data_5X0X
# 
_entry.id   5X0X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5X0X         
WWPDB D_1300002737 
EMDB  EMD-6699     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'Complex of Snf2-Nucleosome complex with Snf2 bound to position +6 of the nucleosome' EMD-6699 'associated EM volume' 
PDB  .                                                                                     5X0Y     unspecified            
EMDB .                                                                                     EMD-6700 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5X0X 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Li, M.'   1 ? 
'Liu, X.'  2 ? 
'Xia, X.'  3 ? 
'Chen, Z.' 4 ? 
'Li, X.'   5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            544 
_citation.language                  ? 
_citation.page_first                440 
_citation.page_last                 445 
_citation.title                     'Mechanism of chromatin remodelling revealed by the Snf2-nucleosome structure.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature22036 
_citation.pdbx_database_id_PubMed   28424519 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liu, X.'  1 ? 
primary 'Li, M.'   2 ? 
primary 'Xia, X.'  3 ? 
primary 'Li, X.'   4 ? 
primary 'Chen, Z.' 5 ? 
# 
_cell.angle_alpha                  90.0 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.0 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.0 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5X0X 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5X0X 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone H3.2'                          15421.101 2 ?       ? ?                       ? 
2 polymer man 'Histone H4'                            11394.426 2 ?       ? ?                       ? 
3 polymer man 'Histone H2A'                           14109.436 2 ?       ? ?                       ? 
4 polymer man 'Histone H2B 1.1'                       13848.097 2 ?       ? ?                       ? 
5 polymer syn 'DNA (167-MER)'                         51381.758 1 ?       ? ?                       ? 
6 polymer syn 'DNA (167-MER)'                         51723.949 1 ?       ? ?                       ? 
7 polymer man 'Transcription regulatory protein SNF2' 85802.805 1 3.6.4.- ? 'UNP RESIDUES 666-1400' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4 H2B1.1 
7 
;ATP-dependent helicase SNF2,Regulatory protein GAM1,Regulatory protein SWI2,SWI/SNF complex component SNF2,Transcription factor TYE3
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DG)(DA)(DT)(DA)(DG)(DC)(DT)(DT)(DG)(DT)(DC)(DG)(DA)(DG)(DA)(DA)
(DG)(DT)(DA)(DC)(DG)(DA)(DT)
;
;ATCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCGATAGCTTGTCGAGAA
GTACGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DT)(DA)(DC)(DT)(DT)(DC)(DT)(DC)(DG)(DA)(DC)(DA)(DA)(DG)(DC)(DT)
(DA)(DT)(DC)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DG)(DA)(DT)
;
;ATCGTACTTCTCGACAAGCTATCGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAA
AACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGAT
TCTCGAT
;
J   ? 
7 'polypeptide(L)'        no no 
;AYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYY
NVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPL
STLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSK
LSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHK
VLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVF
EEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSEL
LRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERA
YKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRS
KKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQFEVSDDEKNDKQAR
KQRTKKEDKSEAIDG
;
;AYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYY
NVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPL
STLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSK
LSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHK
VLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVF
EEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSEL
LRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERA
YKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRS
KKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQFEVSDDEKNDKQAR
KQRTKKEDKSEAIDG
;
O   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   THR n 
1 5   LYS n 
1 6   GLN n 
1 7   THR n 
1 8   ALA n 
1 9   ARG n 
1 10  LYS n 
1 11  SER n 
1 12  THR n 
1 13  GLY n 
1 14  GLY n 
1 15  LYS n 
1 16  ALA n 
1 17  PRO n 
1 18  ARG n 
1 19  LYS n 
1 20  GLN n 
1 21  LEU n 
1 22  ALA n 
1 23  THR n 
1 24  LYS n 
1 25  ALA n 
1 26  ALA n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ALA n 
1 31  PRO n 
1 32  ALA n 
1 33  THR n 
1 34  GLY n 
1 35  GLY n 
1 36  VAL n 
1 37  LYS n 
1 38  LYS n 
1 39  PRO n 
1 40  HIS n 
1 41  ARG n 
1 42  TYR n 
1 43  ARG n 
1 44  PRO n 
1 45  GLY n 
1 46  THR n 
1 47  VAL n 
1 48  ALA n 
1 49  LEU n 
1 50  ARG n 
1 51  GLU n 
1 52  ILE n 
1 53  ARG n 
1 54  ARG n 
1 55  TYR n 
1 56  GLN n 
1 57  LYS n 
1 58  SER n 
1 59  THR n 
1 60  GLU n 
1 61  LEU n 
1 62  LEU n 
1 63  ILE n 
1 64  ARG n 
1 65  LYS n 
1 66  LEU n 
1 67  PRO n 
1 68  PHE n 
1 69  GLN n 
1 70  ARG n 
1 71  LEU n 
1 72  VAL n 
1 73  ARG n 
1 74  GLU n 
1 75  ILE n 
1 76  ALA n 
1 77  GLN n 
1 78  ASP n 
1 79  PHE n 
1 80  LYS n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  PHE n 
1 86  GLN n 
1 87  SER n 
1 88  SER n 
1 89  ALA n 
1 90  VAL n 
1 91  MET n 
1 92  ALA n 
1 93  LEU n 
1 94  GLN n 
1 95  GLU n 
1 96  ALA n 
1 97  SER n 
1 98  GLU n 
1 99  ALA n 
1 100 TYR n 
1 101 LEU n 
1 102 VAL n 
1 103 GLY n 
1 104 LEU n 
1 105 PHE n 
1 106 GLU n 
1 107 ASP n 
1 108 THR n 
1 109 ASN n 
1 110 LEU n 
1 111 CYS n 
1 112 ALA n 
1 113 ILE n 
1 114 HIS n 
1 115 ALA n 
1 116 LYS n 
1 117 ARG n 
1 118 VAL n 
1 119 THR n 
1 120 ILE n 
1 121 MET n 
1 122 PRO n 
1 123 LYS n 
1 124 ASP n 
1 125 ILE n 
1 126 GLN n 
1 127 LEU n 
1 128 ALA n 
1 129 ARG n 
1 130 ARG n 
1 131 ILE n 
1 132 ARG n 
1 133 GLY n 
1 134 GLU n 
1 135 ARG n 
1 136 ALA n 
2 1   MET n 
2 2   SER n 
2 3   GLY n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   GLY n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  LEU n 
2 12  GLY n 
2 13  LYS n 
2 14  GLY n 
2 15  GLY n 
2 16  ALA n 
2 17  LYS n 
2 18  ARG n 
2 19  HIS n 
2 20  ARG n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  ARG n 
2 25  ASP n 
2 26  ASN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLY n 
2 30  ILE n 
2 31  THR n 
2 32  LYS n 
2 33  PRO n 
2 34  ALA n 
2 35  ILE n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  ALA n 
2 40  ARG n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  VAL n 
2 45  LYS n 
2 46  ARG n 
2 47  ILE n 
2 48  SER n 
2 49  GLY n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLU n 
2 54  GLU n 
2 55  THR n 
2 56  ARG n 
2 57  GLY n 
2 58  VAL n 
2 59  LEU n 
2 60  LYS n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  GLU n 
2 65  ASN n 
2 66  VAL n 
2 67  ILE n 
2 68  ARG n 
2 69  ASP n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  TYR n 
2 74  THR n 
2 75  GLU n 
2 76  HIS n 
2 77  ALA n 
2 78  LYS n 
2 79  ARG n 
2 80  LYS n 
2 81  THR n 
2 82  VAL n 
2 83  THR n 
2 84  ALA n 
2 85  MET n 
2 86  ASP n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  ARG n 
2 94  GLN n 
2 95  GLY n 
2 96  ARG n 
2 97  THR n 
2 98  LEU n 
2 99  TYR n 
2 100 GLY n 
2 101 PHE n 
2 102 GLY n 
2 103 GLY n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLN n 
3 8   GLY n 
3 9   GLY n 
3 10  LYS n 
3 11  THR n 
3 12  ARG n 
3 13  ALA n 
3 14  LYS n 
3 15  ALA n 
3 16  LYS n 
3 17  THR n 
3 18  ARG n 
3 19  SER n 
3 20  SER n 
3 21  ARG n 
3 22  ALA n 
3 23  GLY n 
3 24  LEU n 
3 25  GLN n 
3 26  PHE n 
3 27  PRO n 
3 28  VAL n 
3 29  GLY n 
3 30  ARG n 
3 31  VAL n 
3 32  HIS n 
3 33  ARG n 
3 34  LEU n 
3 35  LEU n 
3 36  ARG n 
3 37  LYS n 
3 38  GLY n 
3 39  ASN n 
3 40  TYR n 
3 41  ALA n 
3 42  GLU n 
3 43  ARG n 
3 44  VAL n 
3 45  GLY n 
3 46  ALA n 
3 47  GLY n 
3 48  ALA n 
3 49  PRO n 
3 50  VAL n 
3 51  TYR n 
3 52  LEU n 
3 53  ALA n 
3 54  ALA n 
3 55  VAL n 
3 56  LEU n 
3 57  GLU n 
3 58  TYR n 
3 59  LEU n 
3 60  THR n 
3 61  ALA n 
3 62  GLU n 
3 63  ILE n 
3 64  LEU n 
3 65  GLU n 
3 66  LEU n 
3 67  ALA n 
3 68  GLY n 
3 69  ASN n 
3 70  ALA n 
3 71  ALA n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  LYS n 
3 76  LYS n 
3 77  THR n 
3 78  ARG n 
3 79  ILE n 
3 80  ILE n 
3 81  PRO n 
3 82  ARG n 
3 83  HIS n 
3 84  LEU n 
3 85  GLN n 
3 86  LEU n 
3 87  ALA n 
3 88  VAL n 
3 89  ARG n 
3 90  ASN n 
3 91  ASP n 
3 92  GLU n 
3 93  GLU n 
3 94  LEU n 
3 95  ASN n 
3 96  LYS n 
3 97  LEU n 
3 98  LEU n 
3 99  GLY n 
3 100 ARG n 
3 101 VAL n 
3 102 THR n 
3 103 ILE n 
3 104 ALA n 
3 105 GLN n 
3 106 GLY n 
3 107 GLY n 
3 108 VAL n 
3 109 LEU n 
3 110 PRO n 
3 111 ASN n 
3 112 ILE n 
3 113 GLN n 
3 114 SER n 
3 115 VAL n 
3 116 LEU n 
3 117 LEU n 
3 118 PRO n 
3 119 LYS n 
3 120 LYS n 
3 121 THR n 
3 122 GLU n 
3 123 SER n 
3 124 SER n 
3 125 LYS n 
3 126 SER n 
3 127 ALA n 
3 128 LYS n 
3 129 SER n 
3 130 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DG  n 
5 5   DA  n 
5 6   DG  n 
5 7   DA  n 
5 8   DA  n 
5 9   DT  n 
5 10  DC  n 
5 11  DC  n 
5 12  DC  n 
5 13  DG  n 
5 14  DG  n 
5 15  DT  n 
5 16  DG  n 
5 17  DC  n 
5 18  DC  n 
5 19  DG  n 
5 20  DA  n 
5 21  DG  n 
5 22  DG  n 
5 23  DC  n 
5 24  DC  n 
5 25  DG  n 
5 26  DC  n 
5 27  DT  n 
5 28  DC  n 
5 29  DA  n 
5 30  DA  n 
5 31  DT  n 
5 32  DT  n 
5 33  DG  n 
5 34  DG  n 
5 35  DT  n 
5 36  DC  n 
5 37  DG  n 
5 38  DT  n 
5 39  DA  n 
5 40  DG  n 
5 41  DA  n 
5 42  DC  n 
5 43  DA  n 
5 44  DG  n 
5 45  DC  n 
5 46  DT  n 
5 47  DC  n 
5 48  DT  n 
5 49  DA  n 
5 50  DG  n 
5 51  DC  n 
5 52  DA  n 
5 53  DC  n 
5 54  DC  n 
5 55  DG  n 
5 56  DC  n 
5 57  DT  n 
5 58  DT  n 
5 59  DA  n 
5 60  DA  n 
5 61  DA  n 
5 62  DC  n 
5 63  DG  n 
5 64  DC  n 
5 65  DA  n 
5 66  DC  n 
5 67  DG  n 
5 68  DT  n 
5 69  DA  n 
5 70  DC  n 
5 71  DG  n 
5 72  DC  n 
5 73  DG  n 
5 74  DC  n 
5 75  DT  n 
5 76  DG  n 
5 77  DT  n 
5 78  DC  n 
5 79  DC  n 
5 80  DC  n 
5 81  DC  n 
5 82  DC  n 
5 83  DG  n 
5 84  DC  n 
5 85  DG  n 
5 86  DT  n 
5 87  DT  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DA  n 
5 92  DC  n 
5 93  DC  n 
5 94  DG  n 
5 95  DC  n 
5 96  DC  n 
5 97  DA  n 
5 98  DA  n 
5 99  DG  n 
5 100 DG  n 
5 101 DG  n 
5 102 DG  n 
5 103 DA  n 
5 104 DT  n 
5 105 DT  n 
5 106 DA  n 
5 107 DC  n 
5 108 DT  n 
5 109 DC  n 
5 110 DC  n 
5 111 DC  n 
5 112 DT  n 
5 113 DA  n 
5 114 DG  n 
5 115 DT  n 
5 116 DC  n 
5 117 DT  n 
5 118 DC  n 
5 119 DC  n 
5 120 DA  n 
5 121 DG  n 
5 122 DG  n 
5 123 DC  n 
5 124 DA  n 
5 125 DC  n 
5 126 DG  n 
5 127 DT  n 
5 128 DG  n 
5 129 DT  n 
5 130 DC  n 
5 131 DA  n 
5 132 DG  n 
5 133 DA  n 
5 134 DT  n 
5 135 DA  n 
5 136 DT  n 
5 137 DA  n 
5 138 DT  n 
5 139 DA  n 
5 140 DC  n 
5 141 DA  n 
5 142 DT  n 
5 143 DC  n 
5 144 DC  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
5 148 DA  n 
5 149 DG  n 
5 150 DC  n 
5 151 DT  n 
5 152 DT  n 
5 153 DG  n 
5 154 DT  n 
5 155 DC  n 
5 156 DG  n 
5 157 DA  n 
5 158 DG  n 
5 159 DA  n 
5 160 DA  n 
5 161 DG  n 
5 162 DT  n 
5 163 DA  n 
5 164 DC  n 
5 165 DG  n 
5 166 DA  n 
5 167 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DT  n 
6 6   DA  n 
6 7   DC  n 
6 8   DT  n 
6 9   DT  n 
6 10  DC  n 
6 11  DT  n 
6 12  DC  n 
6 13  DG  n 
6 14  DA  n 
6 15  DC  n 
6 16  DA  n 
6 17  DA  n 
6 18  DG  n 
6 19  DC  n 
6 20  DT  n 
6 21  DA  n 
6 22  DT  n 
6 23  DC  n 
6 24  DG  n 
6 25  DG  n 
6 26  DA  n 
6 27  DT  n 
6 28  DG  n 
6 29  DT  n 
6 30  DA  n 
6 31  DT  n 
6 32  DA  n 
6 33  DT  n 
6 34  DA  n 
6 35  DT  n 
6 36  DC  n 
6 37  DT  n 
6 38  DG  n 
6 39  DA  n 
6 40  DC  n 
6 41  DA  n 
6 42  DC  n 
6 43  DG  n 
6 44  DT  n 
6 45  DG  n 
6 46  DC  n 
6 47  DC  n 
6 48  DT  n 
6 49  DG  n 
6 50  DG  n 
6 51  DA  n 
6 52  DG  n 
6 53  DA  n 
6 54  DC  n 
6 55  DT  n 
6 56  DA  n 
6 57  DG  n 
6 58  DG  n 
6 59  DG  n 
6 60  DA  n 
6 61  DG  n 
6 62  DT  n 
6 63  DA  n 
6 64  DA  n 
6 65  DT  n 
6 66  DC  n 
6 67  DC  n 
6 68  DC  n 
6 69  DC  n 
6 70  DT  n 
6 71  DT  n 
6 72  DG  n 
6 73  DG  n 
6 74  DC  n 
6 75  DG  n 
6 76  DG  n 
6 77  DT  n 
6 78  DT  n 
6 79  DA  n 
6 80  DA  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DG  n 
6 85  DC  n 
6 86  DG  n 
6 87  DG  n 
6 88  DG  n 
6 89  DG  n 
6 90  DG  n 
6 91  DA  n 
6 92  DC  n 
6 93  DA  n 
6 94  DG  n 
6 95  DC  n 
6 96  DG  n 
6 97  DC  n 
6 98  DG  n 
6 99  DT  n 
6 100 DA  n 
6 101 DC  n 
6 102 DG  n 
6 103 DT  n 
6 104 DG  n 
6 105 DC  n 
6 106 DG  n 
6 107 DT  n 
6 108 DT  n 
6 109 DT  n 
6 110 DA  n 
6 111 DA  n 
6 112 DG  n 
6 113 DC  n 
6 114 DG  n 
6 115 DG  n 
6 116 DT  n 
6 117 DG  n 
6 118 DC  n 
6 119 DT  n 
6 120 DA  n 
6 121 DG  n 
6 122 DA  n 
6 123 DG  n 
6 124 DC  n 
6 125 DT  n 
6 126 DG  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DA  n 
6 131 DC  n 
6 132 DG  n 
6 133 DA  n 
6 134 DC  n 
6 135 DC  n 
6 136 DA  n 
6 137 DA  n 
6 138 DT  n 
6 139 DT  n 
6 140 DG  n 
6 141 DA  n 
6 142 DG  n 
6 143 DC  n 
6 144 DG  n 
6 145 DG  n 
6 146 DC  n 
6 147 DC  n 
6 148 DT  n 
6 149 DC  n 
6 150 DG  n 
6 151 DG  n 
6 152 DC  n 
6 153 DA  n 
6 154 DC  n 
6 155 DC  n 
6 156 DG  n 
6 157 DG  n 
6 158 DG  n 
6 159 DA  n 
6 160 DT  n 
6 161 DT  n 
6 162 DC  n 
6 163 DT  n 
6 164 DC  n 
6 165 DG  n 
6 166 DA  n 
6 167 DT  n 
7 1   ALA n 
7 2   TYR n 
7 3   ILE n 
7 4   LYS n 
7 5   LEU n 
7 6   LEU n 
7 7   ASP n 
7 8   GLN n 
7 9   THR n 
7 10  LYS n 
7 11  ASP n 
7 12  THR n 
7 13  ARG n 
7 14  ILE n 
7 15  THR n 
7 16  HIS n 
7 17  LEU n 
7 18  LEU n 
7 19  ARG n 
7 20  GLN n 
7 21  THR n 
7 22  ASN n 
7 23  ALA n 
7 24  PHE n 
7 25  LEU n 
7 26  ASP n 
7 27  SER n 
7 28  LEU n 
7 29  THR n 
7 30  ARG n 
7 31  ALA n 
7 32  VAL n 
7 33  LYS n 
7 34  ASP n 
7 35  GLN n 
7 36  GLN n 
7 37  LYS n 
7 38  TYR n 
7 39  THR n 
7 40  LYS n 
7 41  GLU n 
7 42  MET n 
7 43  ILE n 
7 44  ASP n 
7 45  SER n 
7 46  HIS n 
7 47  ILE n 
7 48  LYS n 
7 49  GLU n 
7 50  ALA n 
7 51  SER n 
7 52  GLU n 
7 53  GLU n 
7 54  VAL n 
7 55  ASP n 
7 56  ASP n 
7 57  LEU n 
7 58  SER n 
7 59  MET n 
7 60  VAL n 
7 61  PRO n 
7 62  LYS n 
7 63  MET n 
7 64  LYS n 
7 65  ASP n 
7 66  GLU n 
7 67  GLU n 
7 68  TYR n 
7 69  ASP n 
7 70  ASP n 
7 71  ASP n 
7 72  ASP n 
7 73  ASP n 
7 74  ASN n 
7 75  SER n 
7 76  ASN n 
7 77  VAL n 
7 78  ASP n 
7 79  TYR n 
7 80  TYR n 
7 81  ASN n 
7 82  VAL n 
7 83  ALA n 
7 84  HIS n 
7 85  ARG n 
7 86  ILE n 
7 87  LYS n 
7 88  GLU n 
7 89  ASP n 
7 90  ILE n 
7 91  LYS n 
7 92  LYS n 
7 93  GLN n 
7 94  PRO n 
7 95  SER n 
7 96  ILE n 
7 97  LEU n 
7 98  VAL n 
7 99  GLY n 
7 100 GLY n 
7 101 THR n 
7 102 LEU n 
7 103 LYS n 
7 104 ASP n 
7 105 TYR n 
7 106 GLN n 
7 107 ILE n 
7 108 LYS n 
7 109 GLY n 
7 110 LEU n 
7 111 GLN n 
7 112 TRP n 
7 113 MET n 
7 114 VAL n 
7 115 SER n 
7 116 LEU n 
7 117 PHE n 
7 118 ASN n 
7 119 ASN n 
7 120 HIS n 
7 121 LEU n 
7 122 ASN n 
7 123 GLY n 
7 124 ILE n 
7 125 LEU n 
7 126 ALA n 
7 127 ASP n 
7 128 GLU n 
7 129 MET n 
7 130 GLY n 
7 131 LEU n 
7 132 GLY n 
7 133 LYS n 
7 134 THR n 
7 135 ILE n 
7 136 GLN n 
7 137 THR n 
7 138 ILE n 
7 139 SER n 
7 140 LEU n 
7 141 LEU n 
7 142 THR n 
7 143 TYR n 
7 144 LEU n 
7 145 TYR n 
7 146 GLU n 
7 147 MET n 
7 148 LYS n 
7 149 ASN n 
7 150 ILE n 
7 151 ARG n 
7 152 GLY n 
7 153 PRO n 
7 154 TYR n 
7 155 LEU n 
7 156 VAL n 
7 157 ILE n 
7 158 VAL n 
7 159 PRO n 
7 160 LEU n 
7 161 SER n 
7 162 THR n 
7 163 LEU n 
7 164 SER n 
7 165 ASN n 
7 166 TRP n 
7 167 SER n 
7 168 SER n 
7 169 GLU n 
7 170 PHE n 
7 171 ALA n 
7 172 LYS n 
7 173 TRP n 
7 174 ALA n 
7 175 PRO n 
7 176 THR n 
7 177 LEU n 
7 178 ARG n 
7 179 THR n 
7 180 ILE n 
7 181 SER n 
7 182 PHE n 
7 183 LYS n 
7 184 GLY n 
7 185 SER n 
7 186 PRO n 
7 187 ASN n 
7 188 GLU n 
7 189 ARG n 
7 190 LYS n 
7 191 ALA n 
7 192 LYS n 
7 193 GLN n 
7 194 ALA n 
7 195 LYS n 
7 196 ILE n 
7 197 ARG n 
7 198 ALA n 
7 199 GLY n 
7 200 GLU n 
7 201 PHE n 
7 202 ASP n 
7 203 VAL n 
7 204 VAL n 
7 205 LEU n 
7 206 THR n 
7 207 THR n 
7 208 PHE n 
7 209 GLU n 
7 210 TYR n 
7 211 ILE n 
7 212 ILE n 
7 213 LYS n 
7 214 GLU n 
7 215 ARG n 
7 216 ALA n 
7 217 LEU n 
7 218 LEU n 
7 219 SER n 
7 220 LYS n 
7 221 VAL n 
7 222 LYS n 
7 223 TRP n 
7 224 VAL n 
7 225 HIS n 
7 226 MET n 
7 227 ILE n 
7 228 ILE n 
7 229 ASP n 
7 230 GLU n 
7 231 GLY n 
7 232 HIS n 
7 233 ARG n 
7 234 MET n 
7 235 LYS n 
7 236 ASN n 
7 237 ALA n 
7 238 GLN n 
7 239 SER n 
7 240 LYS n 
7 241 LEU n 
7 242 SER n 
7 243 LEU n 
7 244 THR n 
7 245 LEU n 
7 246 ASN n 
7 247 THR n 
7 248 HIS n 
7 249 TYR n 
7 250 HIS n 
7 251 ALA n 
7 252 ASP n 
7 253 TYR n 
7 254 ARG n 
7 255 LEU n 
7 256 ILE n 
7 257 LEU n 
7 258 THR n 
7 259 GLY n 
7 260 THR n 
7 261 PRO n 
7 262 LEU n 
7 263 GLN n 
7 264 ASN n 
7 265 ASN n 
7 266 LEU n 
7 267 PRO n 
7 268 GLU n 
7 269 LEU n 
7 270 TRP n 
7 271 ALA n 
7 272 LEU n 
7 273 LEU n 
7 274 ASN n 
7 275 PHE n 
7 276 VAL n 
7 277 LEU n 
7 278 PRO n 
7 279 LYS n 
7 280 ILE n 
7 281 PHE n 
7 282 ASN n 
7 283 SER n 
7 284 VAL n 
7 285 LYS n 
7 286 SER n 
7 287 PHE n 
7 288 ASP n 
7 289 GLU n 
7 290 TRP n 
7 291 PHE n 
7 292 ASN n 
7 293 THR n 
7 294 PRO n 
7 295 PHE n 
7 296 ALA n 
7 297 ASN n 
7 298 THR n 
7 299 GLY n 
7 300 GLY n 
7 301 GLN n 
7 302 ASP n 
7 303 LYS n 
7 304 ILE n 
7 305 GLU n 
7 306 LEU n 
7 307 SER n 
7 308 GLU n 
7 309 GLU n 
7 310 GLU n 
7 311 THR n 
7 312 LEU n 
7 313 LEU n 
7 314 VAL n 
7 315 ILE n 
7 316 ARG n 
7 317 ARG n 
7 318 LEU n 
7 319 HIS n 
7 320 LYS n 
7 321 VAL n 
7 322 LEU n 
7 323 ARG n 
7 324 PRO n 
7 325 PHE n 
7 326 LEU n 
7 327 LEU n 
7 328 ARG n 
7 329 ARG n 
7 330 LEU n 
7 331 LYS n 
7 332 LYS n 
7 333 ASP n 
7 334 VAL n 
7 335 GLU n 
7 336 LYS n 
7 337 GLU n 
7 338 LEU n 
7 339 PRO n 
7 340 ASP n 
7 341 LYS n 
7 342 VAL n 
7 343 GLU n 
7 344 LYS n 
7 345 VAL n 
7 346 VAL n 
7 347 LYS n 
7 348 CYS n 
7 349 LYS n 
7 350 MET n 
7 351 SER n 
7 352 ALA n 
7 353 LEU n 
7 354 GLN n 
7 355 GLN n 
7 356 ILE n 
7 357 MET n 
7 358 TYR n 
7 359 GLN n 
7 360 GLN n 
7 361 MET n 
7 362 LEU n 
7 363 LYS n 
7 364 TYR n 
7 365 ARG n 
7 366 ARG n 
7 367 LEU n 
7 368 PHE n 
7 369 ILE n 
7 370 GLY n 
7 371 ASP n 
7 372 GLN n 
7 373 ASN n 
7 374 ASN n 
7 375 LYS n 
7 376 LYS n 
7 377 MET n 
7 378 VAL n 
7 379 GLY n 
7 380 LEU n 
7 381 ARG n 
7 382 GLY n 
7 383 PHE n 
7 384 ASN n 
7 385 ASN n 
7 386 GLN n 
7 387 ILE n 
7 388 MET n 
7 389 GLN n 
7 390 LEU n 
7 391 LYS n 
7 392 LYS n 
7 393 ILE n 
7 394 CYS n 
7 395 ASN n 
7 396 HIS n 
7 397 PRO n 
7 398 PHE n 
7 399 VAL n 
7 400 PHE n 
7 401 GLU n 
7 402 GLU n 
7 403 VAL n 
7 404 GLU n 
7 405 ASP n 
7 406 GLN n 
7 407 ILE n 
7 408 ASN n 
7 409 PRO n 
7 410 THR n 
7 411 ARG n 
7 412 GLU n 
7 413 THR n 
7 414 ASN n 
7 415 ASP n 
7 416 ASP n 
7 417 ILE n 
7 418 TRP n 
7 419 ARG n 
7 420 VAL n 
7 421 ALA n 
7 422 GLY n 
7 423 LYS n 
7 424 PHE n 
7 425 GLU n 
7 426 LEU n 
7 427 LEU n 
7 428 ASP n 
7 429 ARG n 
7 430 ILE n 
7 431 LEU n 
7 432 PRO n 
7 433 LYS n 
7 434 LEU n 
7 435 LYS n 
7 436 ALA n 
7 437 THR n 
7 438 GLY n 
7 439 HIS n 
7 440 ARG n 
7 441 VAL n 
7 442 LEU n 
7 443 ILE n 
7 444 PHE n 
7 445 PHE n 
7 446 GLN n 
7 447 MET n 
7 448 THR n 
7 449 GLN n 
7 450 ILE n 
7 451 MET n 
7 452 ASP n 
7 453 ILE n 
7 454 MET n 
7 455 GLU n 
7 456 ASP n 
7 457 PHE n 
7 458 LEU n 
7 459 ARG n 
7 460 TYR n 
7 461 ILE n 
7 462 ASN n 
7 463 ILE n 
7 464 LYS n 
7 465 TYR n 
7 466 LEU n 
7 467 ARG n 
7 468 LEU n 
7 469 ASP n 
7 470 GLY n 
7 471 HIS n 
7 472 THR n 
7 473 LYS n 
7 474 SER n 
7 475 ASP n 
7 476 GLU n 
7 477 ARG n 
7 478 SER n 
7 479 GLU n 
7 480 LEU n 
7 481 LEU n 
7 482 ARG n 
7 483 LEU n 
7 484 PHE n 
7 485 ASN n 
7 486 ALA n 
7 487 PRO n 
7 488 ASP n 
7 489 SER n 
7 490 GLU n 
7 491 TYR n 
7 492 LEU n 
7 493 CYS n 
7 494 PHE n 
7 495 ILE n 
7 496 LEU n 
7 497 SER n 
7 498 THR n 
7 499 ARG n 
7 500 ALA n 
7 501 GLY n 
7 502 GLY n 
7 503 LEU n 
7 504 GLY n 
7 505 LEU n 
7 506 ASN n 
7 507 LEU n 
7 508 GLN n 
7 509 THR n 
7 510 ALA n 
7 511 ASP n 
7 512 THR n 
7 513 VAL n 
7 514 ILE n 
7 515 ILE n 
7 516 PHE n 
7 517 ASP n 
7 518 THR n 
7 519 ASP n 
7 520 TRP n 
7 521 ASN n 
7 522 PRO n 
7 523 HIS n 
7 524 GLN n 
7 525 ASP n 
7 526 LEU n 
7 527 GLN n 
7 528 ALA n 
7 529 GLN n 
7 530 ASP n 
7 531 ARG n 
7 532 ALA n 
7 533 HIS n 
7 534 ARG n 
7 535 ILE n 
7 536 GLY n 
7 537 GLN n 
7 538 LYS n 
7 539 ASN n 
7 540 GLU n 
7 541 VAL n 
7 542 ARG n 
7 543 ILE n 
7 544 LEU n 
7 545 ARG n 
7 546 LEU n 
7 547 ILE n 
7 548 THR n 
7 549 THR n 
7 550 ASN n 
7 551 SER n 
7 552 VAL n 
7 553 GLU n 
7 554 GLU n 
7 555 VAL n 
7 556 ILE n 
7 557 LEU n 
7 558 GLU n 
7 559 ARG n 
7 560 ALA n 
7 561 TYR n 
7 562 LYS n 
7 563 LYS n 
7 564 LEU n 
7 565 ASP n 
7 566 ILE n 
7 567 ASP n 
7 568 GLY n 
7 569 LYS n 
7 570 VAL n 
7 571 ILE n 
7 572 GLN n 
7 573 ALA n 
7 574 GLY n 
7 575 LYS n 
7 576 PHE n 
7 577 ASP n 
7 578 ASN n 
7 579 LYS n 
7 580 SER n 
7 581 THR n 
7 582 SER n 
7 583 GLU n 
7 584 GLU n 
7 585 GLN n 
7 586 GLU n 
7 587 ALA n 
7 588 LEU n 
7 589 LEU n 
7 590 ARG n 
7 591 SER n 
7 592 LEU n 
7 593 LEU n 
7 594 ASP n 
7 595 ALA n 
7 596 GLU n 
7 597 GLU n 
7 598 GLU n 
7 599 ARG n 
7 600 ARG n 
7 601 LYS n 
7 602 LYS n 
7 603 ARG n 
7 604 GLU n 
7 605 SER n 
7 606 GLY n 
7 607 VAL n 
7 608 GLU n 
7 609 GLU n 
7 610 GLU n 
7 611 GLU n 
7 612 GLU n 
7 613 LEU n 
7 614 LYS n 
7 615 ASP n 
7 616 SER n 
7 617 GLU n 
7 618 ILE n 
7 619 ASN n 
7 620 GLU n 
7 621 ILE n 
7 622 LEU n 
7 623 ALA n 
7 624 ARG n 
7 625 ASN n 
7 626 ASP n 
7 627 GLU n 
7 628 GLU n 
7 629 MET n 
7 630 ALA n 
7 631 VAL n 
7 632 LEU n 
7 633 THR n 
7 634 ARG n 
7 635 MET n 
7 636 ASP n 
7 637 GLU n 
7 638 ASP n 
7 639 ARG n 
7 640 SER n 
7 641 LYS n 
7 642 LYS n 
7 643 GLU n 
7 644 GLU n 
7 645 GLU n 
7 646 LEU n 
7 647 GLY n 
7 648 VAL n 
7 649 LYS n 
7 650 SER n 
7 651 ARG n 
7 652 LEU n 
7 653 LEU n 
7 654 GLU n 
7 655 LYS n 
7 656 SER n 
7 657 GLU n 
7 658 LEU n 
7 659 PRO n 
7 660 ASP n 
7 661 ILE n 
7 662 TYR n 
7 663 SER n 
7 664 ARG n 
7 665 ASP n 
7 666 ILE n 
7 667 GLY n 
7 668 ALA n 
7 669 GLU n 
7 670 LEU n 
7 671 LYS n 
7 672 ARG n 
7 673 GLU n 
7 674 GLU n 
7 675 SER n 
7 676 GLU n 
7 677 SER n 
7 678 ALA n 
7 679 ALA n 
7 680 VAL n 
7 681 TYR n 
7 682 ASN n 
7 683 GLY n 
7 684 ARG n 
7 685 GLY n 
7 686 ALA n 
7 687 ARG n 
7 688 GLU n 
7 689 ARG n 
7 690 LYS n 
7 691 THR n 
7 692 ALA n 
7 693 THR n 
7 694 TYR n 
7 695 ASN n 
7 696 ASP n 
7 697 ASN n 
7 698 MET n 
7 699 SER n 
7 700 GLU n 
7 701 GLU n 
7 702 GLN n 
7 703 TRP n 
7 704 LEU n 
7 705 ARG n 
7 706 GLN n 
7 707 PHE n 
7 708 GLU n 
7 709 VAL n 
7 710 SER n 
7 711 ASP n 
7 712 ASP n 
7 713 GLU n 
7 714 LYS n 
7 715 ASN n 
7 716 ASP n 
7 717 LYS n 
7 718 GLN n 
7 719 ALA n 
7 720 ARG n 
7 721 LYS n 
7 722 GLN n 
7 723 ARG n 
7 724 THR n 
7 725 LYS n 
7 726 LYS n 
7 727 GLU n 
7 728 ASP n 
7 729 LYS n 
7 730 SER n 
7 731 GLU n 
7 732 ALA n 
7 733 ILE n 
7 734 ASP n 
7 735 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 136 'African clawed frog' ? ?                                       ? ?                     ? ? 
? ? 'Xenopus laevis'                                        8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 103 'African clawed frog' ? ?                                       ? ?                     ? ? 
? ? 'Xenopus laevis'                                        8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 130 'African clawed frog' ? 'hist1h2aj, LOC494591'                  ? ?                     ? ? 
? ? 'Xenopus laevis'                                        8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 125 'African clawed frog' ? ?                                       ? ?                     ? ? 
? ? 'Xenopus laevis'                                        8355   ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 735 
;Baker's yeast
;
? 'SNF2, GAM1, RIC1, SWI2, TYE3, YOR290C' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 
559292 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 167 'synthetic construct' ? 32630 ? 
6 1 sample 1 167 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA    P84233 ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1   
2 UNP H4_XENLA     P62799 ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1   
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
1   
4 UNP H2B11_XENLA  P02281 ? 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2   
5 PDB 5X0X         5X0X   ? 5 ? 1   
6 PDB 5X0X         5X0X   ? 6 ? 1   
7 UNP SNF2_YEAST   P22082 ? 7 
;AYIKLLDQTKDTRITHLLRQTNAFLDSLTRAVKDQQKYTKEMIDSHIKEASEEVDDLSMVPKMKDEEYDDDDDNSNVDYY
NVAHRIKEDIKKQPSILVGGTLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPL
STLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSK
LSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHK
VLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVF
EEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSEL
LRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERA
YKKLDIDGKVIQAGKFDNKSTSEEQEALLRSLLDAEEERRKKRESGVEEEEELKDSEINEILARNDEEMAVLTRMDEDRS
KKEEELGVKSRLLEKSELPDIYSRDIGAELKREESESAAVYNGRGARERKTATYNDNMSEEQWLRQFEVSDDEKNDKQAR
KQRTKKEDKSEAIDG
;
666 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5X0X A 1 ? 136 ? P84233 1   ? 136  ? 0   135  
2  2 5X0X B 1 ? 103 ? P62799 1   ? 103  ? 0   102  
3  3 5X0X C 1 ? 130 ? Q6AZJ8 1   ? 130  ? 0   129  
4  4 5X0X D 1 ? 125 ? P02281 2   ? 126  ? -2  122  
5  1 5X0X E 1 ? 136 ? P84233 1   ? 136  ? 0   135  
6  2 5X0X F 1 ? 103 ? P62799 1   ? 103  ? 0   102  
7  3 5X0X G 1 ? 130 ? Q6AZJ8 1   ? 130  ? 0   129  
8  4 5X0X H 1 ? 125 ? P02281 2   ? 126  ? -2  122  
9  5 5X0X I 1 ? 167 ? 5X0X   1   ? 167  ? 1   167  
10 6 5X0X J 1 ? 167 ? 5X0X   -19 ? 147  ? -19 147  
11 7 5X0X O 1 ? 735 ? P22082 666 ? 1400 ? 666 1400 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
4 5X0X THR D 32 ? UNP P02281 SER 33 'see sequence details' 29 1 
8 5X0X THR H 32 ? UNP P02281 SER 33 'see sequence details' 29 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5X0X 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5X0X 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.011  ? 17632 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.926  ? 25051 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 19.078 ? 12287 ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.049  ? 2856  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.005  ? 2163  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     5X0X 
_struct.title                        'Complex of Snf2-Nucleosome complex with Snf2 bound to position +6 of the nucleosome' 
_struct.pdbx_descriptor              
'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1, Transcription regulatory protein SNF2/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5X0X 
_struct_keywords.text            'Snf2, nucleosome, chromatin remodeling, STRUCTURAL PROTEIN-HYDROLASE-DNA complex' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/HYDROLASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 45  ? GLN A 56  ? GLY A 44   GLN A 55   1 ? 12 
HELX_P HELX_P2  AA2 ARG A 64  ? LYS A 80  ? ARG A 63   LYS A 79   1 ? 17 
HELX_P HELX_P3  AA3 GLN A 86  ? ALA A 115 ? GLN A 85   ALA A 114  1 ? 30 
HELX_P HELX_P4  AA4 MET A 121 ? ARG A 132 ? MET A 120  ARG A 131  1 ? 12 
HELX_P HELX_P5  AA5 ASP B 25  ? ILE B 30  ? ASP B 24   ILE B 29   5 ? 6  
HELX_P HELX_P6  AA6 THR B 31  ? GLY B 43  ? THR B 30   GLY B 42   1 ? 13 
HELX_P HELX_P7  AA7 LEU B 50  ? LYS B 78  ? LEU B 49   LYS B 77   1 ? 29 
HELX_P HELX_P8  AA8 THR B 83  ? GLY B 95  ? THR B 82   GLY B 94   1 ? 13 
HELX_P HELX_P9  AA9 THR C 17  ? ALA C 22  ? THR C 16   ALA C 21   1 ? 6  
HELX_P HELX_P10 AB1 PRO C 27  ? GLY C 38  ? PRO C 26   GLY C 37   1 ? 12 
HELX_P HELX_P11 AB2 ALA C 46  ? ASN C 74  ? ALA C 45   ASN C 73   1 ? 29 
HELX_P HELX_P12 AB3 ILE C 80  ? ASP C 91  ? ILE C 79   ASP C 90   1 ? 12 
HELX_P HELX_P13 AB4 GLU C 92  ? GLY C 99  ? GLU C 91   GLY C 98   1 ? 8  
HELX_P HELX_P14 AB5 GLN C 113 ? LEU C 117 ? GLN C 112  LEU C 116  5 ? 5  
HELX_P HELX_P15 AB6 TYR D 37  ? HIS D 49  ? TYR D 34   HIS D 46   1 ? 13 
HELX_P HELX_P16 AB7 SER D 55  ? ASN D 84  ? SER D 52   ASN D 81   1 ? 30 
HELX_P HELX_P17 AB8 THR D 90  ? LEU D 102 ? THR D 87   LEU D 99   1 ? 13 
HELX_P HELX_P18 AB9 PRO D 103 ? ALA D 124 ? PRO D 100  ALA D 121  1 ? 22 
HELX_P HELX_P19 AC1 GLY E 45  ? GLN E 56  ? GLY E 44   GLN E 55   1 ? 12 
HELX_P HELX_P20 AC2 ARG E 64  ? LYS E 80  ? ARG E 63   LYS E 79   1 ? 17 
HELX_P HELX_P21 AC3 GLN E 86  ? ALA E 115 ? GLN E 85   ALA E 114  1 ? 30 
HELX_P HELX_P22 AC4 MET E 121 ? ARG E 132 ? MET E 120  ARG E 131  1 ? 12 
HELX_P HELX_P23 AC5 ASP F 25  ? ILE F 30  ? ASP F 24   ILE F 29   5 ? 6  
HELX_P HELX_P24 AC6 THR F 31  ? GLY F 43  ? THR F 30   GLY F 42   1 ? 13 
HELX_P HELX_P25 AC7 LEU F 50  ? LYS F 78  ? LEU F 49   LYS F 77   1 ? 29 
HELX_P HELX_P26 AC8 THR F 83  ? GLY F 95  ? THR F 82   GLY F 94   1 ? 13 
HELX_P HELX_P27 AC9 THR G 17  ? ALA G 22  ? THR G 16   ALA G 21   1 ? 6  
HELX_P HELX_P28 AD1 PRO G 27  ? GLY G 38  ? PRO G 26   GLY G 37   1 ? 12 
HELX_P HELX_P29 AD2 ALA G 46  ? ASN G 74  ? ALA G 45   ASN G 73   1 ? 29 
HELX_P HELX_P30 AD3 ILE G 80  ? ASP G 91  ? ILE G 79   ASP G 90   1 ? 12 
HELX_P HELX_P31 AD4 GLU G 92  ? GLY G 99  ? GLU G 91   GLY G 98   1 ? 8  
HELX_P HELX_P32 AD5 GLN G 113 ? LEU G 117 ? GLN G 112  LEU G 116  5 ? 5  
HELX_P HELX_P33 AD6 TYR H 37  ? HIS H 49  ? TYR H 34   HIS H 46   1 ? 13 
HELX_P HELX_P34 AD7 SER H 55  ? ASN H 84  ? SER H 52   ASN H 81   1 ? 30 
HELX_P HELX_P35 AD8 THR H 90  ? LEU H 102 ? THR H 87   LEU H 99   1 ? 13 
HELX_P HELX_P36 AD9 PRO H 103 ? ALA H 124 ? PRO H 100  ALA H 121  1 ? 22 
HELX_P HELX_P37 AE1 LEU K 6   ? PHE K 24  ? LEU O 671  PHE O 689  1 ? 19 
HELX_P HELX_P38 AE2 TYR K 79  ? HIS K 84  ? TYR O 744  HIS O 749  1 ? 6  
HELX_P HELX_P39 AE3 LYS K 103 ? ASN K 119 ? LYS O 768  ASN O 784  1 ? 17 
HELX_P HELX_P40 AE4 GLY K 132 ? GLU K 146 ? GLY O 797  GLU O 811  1 ? 15 
HELX_P HELX_P41 AE5 PRO K 159 ? TRP K 173 ? PRO O 824  TRP O 838  1 ? 15 
HELX_P HELX_P42 AE6 GLY K 184 ? ALA K 198 ? GLY O 849  ALA O 863  1 ? 15 
HELX_P HELX_P43 AE7 PHE K 208 ? GLU K 214 ? PHE O 873  GLU O 879  1 ? 7  
HELX_P HELX_P44 AE8 GLU K 214 ? VAL K 221 ? GLU O 879  VAL O 886  1 ? 8  
HELX_P HELX_P45 AE9 GLU K 230 ? ASN K 236 ? GLU O 895  ASN O 901  5 ? 7  
HELX_P HELX_P46 AF1 SER K 239 ? HIS K 248 ? SER O 904  HIS O 913  1 ? 10 
HELX_P HELX_P47 AF2 PRO K 267 ? LEU K 277 ? PRO O 932  LEU O 942  1 ? 11 
HELX_P HELX_P48 AF3 LEU K 277 ? SER K 283 ? LEU O 942  SER O 948  1 ? 7  
HELX_P HELX_P49 AF4 SER K 283 ? THR K 293 ? SER O 948  THR O 958  1 ? 11 
HELX_P HELX_P50 AF5 LYS K 303 ? GLU K 308 ? LYS O 968  GLU O 973  1 ? 6  
HELX_P HELX_P51 AF6 GLU K 310 ? ARG K 323 ? GLU O 975  ARG O 988  1 ? 14 
HELX_P HELX_P52 AF7 SER K 351 ? MET K 357 ? SER O 1016 MET O 1022 1 ? 7  
HELX_P HELX_P53 AF8 GLN K 360 ? ARG K 365 ? GLN O 1025 ARG O 1030 1 ? 6  
HELX_P HELX_P54 AF9 MET K 388 ? ILE K 393 ? MET O 1053 ILE O 1058 1 ? 6  
HELX_P HELX_P55 AG1 GLU K 401 ? ASN K 408 ? GLU O 1066 ASN O 1073 1 ? 8  
HELX_P HELX_P56 AG2 ALA K 421 ? GLY K 438 ? ALA O 1086 GLY O 1103 1 ? 18 
HELX_P HELX_P57 AG3 GLN K 449 ? ASN K 462 ? GLN O 1114 ASN O 1127 1 ? 14 
HELX_P HELX_P58 AG4 LYS K 473 ? ALA K 486 ? LYS O 1138 ALA O 1151 1 ? 14 
HELX_P HELX_P59 AG5 SER K 497 ? GLY K 502 ? SER O 1162 GLY O 1167 1 ? 6  
HELX_P HELX_P60 AG6 PRO K 522 ? ARG K 534 ? PRO O 1187 ARG O 1199 1 ? 13 
HELX_P HELX_P61 AG7 SER K 551 ? SER K 580 ? SER O 1216 SER O 1245 1 ? 30 
HELX_P HELX_P62 AG8 SER K 582 ? GLU K 604 ? SER O 1247 GLU O 1269 1 ? 23 
HELX_P HELX_P63 AG9 LYS K 614 ? LEU K 622 ? LYS O 1279 LEU O 1287 1 ? 9  
HELX_P HELX_P64 AH1 GLU K 627 ? LYS K 642 ? GLU O 1292 LYS O 1307 1 ? 16 
HELX_P HELX_P65 AH2 ARG K 672 ? ARG K 684 ? ARG O 1337 ARG O 1349 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DC 3   N3 ? ? ? 1_555 J DG 165 N1 ? ? I DC 3   J DG 145 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2   hydrog ? ? I DC 3   N4 ? ? ? 1_555 J DG 165 O6 ? ? I DC 3   J DG 145 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3   hydrog ? ? I DC 3   O2 ? ? ? 1_555 J DG 165 N2 ? ? I DC 3   J DG 145 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4   hydrog ? ? I DG 4   N1 ? ? ? 1_555 J DC 164 N3 ? ? I DG 4   J DC 144 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5   hydrog ? ? I DG 4   N2 ? ? ? 1_555 J DC 164 O2 ? ? I DG 4   J DC 144 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6   hydrog ? ? I DG 4   O6 ? ? ? 1_555 J DC 164 N4 ? ? I DG 4   J DC 144 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7   hydrog ? ? I DA 5   N1 ? ? ? 1_555 J DT 163 N3 ? ? I DA 5   J DT 143 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8   hydrog ? ? I DA 5   N6 ? ? ? 1_555 J DT 163 O4 ? ? I DA 5   J DT 143 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog9   hydrog ? ? I DG 6   N1 ? ? ? 1_555 J DC 162 N3 ? ? I DG 6   J DC 142 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10  hydrog ? ? I DG 6   N2 ? ? ? 1_555 J DC 162 O2 ? ? I DG 6   J DC 142 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11  hydrog ? ? I DG 6   O6 ? ? ? 1_555 J DC 162 N4 ? ? I DG 6   J DC 142 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12  hydrog ? ? I DA 7   N1 ? ? ? 1_555 J DT 161 N3 ? ? I DA 7   J DT 141 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13  hydrog ? ? I DA 7   N6 ? ? ? 1_555 J DT 161 O4 ? ? I DA 7   J DT 141 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14  hydrog ? ? I DA 8   N1 ? ? ? 1_555 J DT 160 N3 ? ? I DA 8   J DT 140 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15  hydrog ? ? I DA 8   N6 ? ? ? 1_555 J DT 160 O4 ? ? I DA 8   J DT 140 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16  hydrog ? ? I DT 9   N3 ? ? ? 1_555 J DA 159 N1 ? ? I DT 9   J DA 139 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17  hydrog ? ? I DT 9   O4 ? ? ? 1_555 J DA 159 N6 ? ? I DT 9   J DA 139 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18  hydrog ? ? I DC 10  N3 ? ? ? 1_555 J DG 158 N1 ? ? I DC 10  J DG 138 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19  hydrog ? ? I DC 10  N4 ? ? ? 1_555 J DG 158 O6 ? ? I DC 10  J DG 138 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20  hydrog ? ? I DC 10  O2 ? ? ? 1_555 J DG 158 N2 ? ? I DC 10  J DG 138 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21  hydrog ? ? I DC 11  N3 ? ? ? 1_555 J DG 157 N2 ? ? I DC 11  J DG 137 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog22  hydrog ? ? I DC 11  O2 ? ? ? 1_555 J DG 157 N1 ? ? I DC 11  J DG 137 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog23  hydrog ? ? I DC 12  N3 ? ? ? 1_555 J DG 156 N1 ? ? I DC 12  J DG 136 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24  hydrog ? ? I DC 12  N4 ? ? ? 1_555 J DG 156 O6 ? ? I DC 12  J DG 136 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25  hydrog ? ? I DC 12  O2 ? ? ? 1_555 J DG 156 N2 ? ? I DC 12  J DG 136 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26  hydrog ? ? I DG 13  N1 ? ? ? 1_555 J DC 155 N3 ? ? I DG 13  J DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27  hydrog ? ? I DG 13  N2 ? ? ? 1_555 J DC 155 O2 ? ? I DG 13  J DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28  hydrog ? ? I DG 13  O6 ? ? ? 1_555 J DC 155 N4 ? ? I DG 13  J DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29  hydrog ? ? I DG 14  N1 ? ? ? 1_555 J DC 154 N3 ? ? I DG 14  J DC 134 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30  hydrog ? ? I DG 14  N2 ? ? ? 1_555 J DC 154 O2 ? ? I DG 14  J DC 134 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31  hydrog ? ? I DG 14  O6 ? ? ? 1_555 J DC 154 N4 ? ? I DG 14  J DC 134 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32  hydrog ? ? I DT 15  N3 ? ? ? 1_555 J DA 153 N1 ? ? I DT 15  J DA 133 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33  hydrog ? ? I DT 15  O4 ? ? ? 1_555 J DA 153 N6 ? ? I DT 15  J DA 133 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog34  hydrog ? ? I DG 16  N1 ? ? ? 1_555 J DC 152 N3 ? ? I DG 16  J DC 132 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog35  hydrog ? ? I DG 16  N2 ? ? ? 1_555 J DC 152 O2 ? ? I DG 16  J DC 132 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog36  hydrog ? ? I DG 16  O6 ? ? ? 1_555 J DC 152 N4 ? ? I DG 16  J DC 132 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37  hydrog ? ? I DC 17  N3 ? ? ? 1_555 J DG 151 N1 ? ? I DC 17  J DG 131 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog38  hydrog ? ? I DC 17  N4 ? ? ? 1_555 J DG 151 O6 ? ? I DC 17  J DG 131 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog39  hydrog ? ? I DC 17  O2 ? ? ? 1_555 J DG 151 N2 ? ? I DC 17  J DG 131 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog40  hydrog ? ? I DC 18  N3 ? ? ? 1_555 J DC 149 N4 ? ? I DC 18  J DC 129 1_555 ? ? ? ? ? ? TYPE_14_PAIR            ? ? 
hydrog41  hydrog ? ? I DC 18  N4 ? ? ? 1_555 J DC 149 N3 ? ? I DC 18  J DC 129 1_555 ? ? ? ? ? ? TYPE_14_PAIR            ? ? 
hydrog42  hydrog ? ? I DC 18  N3 ? ? ? 1_555 J DG 150 N1 ? ? I DC 18  J DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43  hydrog ? ? I DC 18  N4 ? ? ? 1_555 J DG 150 O6 ? ? I DC 18  J DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44  hydrog ? ? I DC 18  O2 ? ? ? 1_555 J DG 150 N2 ? ? I DC 18  J DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45  hydrog ? ? I DG 19  N1 ? ? ? 1_555 J DC 149 N3 ? ? I DG 19  J DC 129 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog46  hydrog ? ? I DG 19  N2 ? ? ? 1_555 J DC 149 O2 ? ? I DG 19  J DC 129 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog47  hydrog ? ? I DG 19  O6 ? ? ? 1_555 J DC 149 N4 ? ? I DG 19  J DC 129 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog48  hydrog ? ? I DA 20  N1 ? ? ? 1_555 J DT 148 N3 ? ? I DA 20  J DT 128 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog49  hydrog ? ? I DA 20  N6 ? ? ? 1_555 J DT 148 O4 ? ? I DA 20  J DT 128 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog50  hydrog ? ? I DG 21  N1 ? ? ? 1_555 J DC 147 N3 ? ? I DG 21  J DC 127 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog51  hydrog ? ? I DG 21  N2 ? ? ? 1_555 J DC 147 O2 ? ? I DG 21  J DC 127 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog52  hydrog ? ? I DG 21  O6 ? ? ? 1_555 J DC 147 N4 ? ? I DG 21  J DC 127 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog53  hydrog ? ? I DG 22  N1 ? ? ? 1_555 J DC 146 N3 ? ? I DG 22  J DC 126 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog54  hydrog ? ? I DG 22  N2 ? ? ? 1_555 J DC 146 O2 ? ? I DG 22  J DC 126 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog55  hydrog ? ? I DG 22  O6 ? ? ? 1_555 J DC 146 N4 ? ? I DG 22  J DC 126 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog56  hydrog ? ? I DC 23  N3 ? ? ? 1_555 J DG 145 N1 ? ? I DC 23  J DG 125 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog57  hydrog ? ? I DC 23  N4 ? ? ? 1_555 J DG 145 O6 ? ? I DC 23  J DG 125 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog58  hydrog ? ? I DC 23  O2 ? ? ? 1_555 J DG 145 N2 ? ? I DC 23  J DG 125 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog59  hydrog ? ? I DC 24  N3 ? ? ? 1_555 J DG 144 N1 ? ? I DC 24  J DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog60  hydrog ? ? I DC 24  N4 ? ? ? 1_555 J DG 144 O6 ? ? I DC 24  J DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog61  hydrog ? ? I DC 24  O2 ? ? ? 1_555 J DG 144 N2 ? ? I DC 24  J DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog62  hydrog ? ? I DC 24  N3 ? ? ? 1_555 J DG 145 N1 ? ? I DC 24  J DG 125 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog63  hydrog ? ? I DC 24  N4 ? ? ? 1_555 J DG 145 O6 ? ? I DC 24  J DG 125 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog64  hydrog ? ? I DC 24  O2 ? ? ? 1_555 J DG 145 N2 ? ? I DC 24  J DG 125 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog65  hydrog ? ? I DG 25  N1 ? ? ? 1_555 J DC 143 N3 ? ? I DG 25  J DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog66  hydrog ? ? I DG 25  N2 ? ? ? 1_555 J DC 143 O2 ? ? I DG 25  J DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog67  hydrog ? ? I DG 25  O6 ? ? ? 1_555 J DC 143 N4 ? ? I DG 25  J DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog68  hydrog ? ? I DC 26  N3 ? ? ? 1_555 J DG 142 N1 ? ? I DC 26  J DG 122 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog69  hydrog ? ? I DC 26  N4 ? ? ? 1_555 J DG 142 O6 ? ? I DC 26  J DG 122 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog70  hydrog ? ? I DC 26  O2 ? ? ? 1_555 J DG 142 N2 ? ? I DC 26  J DG 122 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog71  hydrog ? ? I DT 27  N3 ? ? ? 1_555 J DA 141 N1 ? ? I DT 27  J DA 121 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog72  hydrog ? ? I DT 27  O4 ? ? ? 1_555 J DA 141 N6 ? ? I DT 27  J DA 121 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog73  hydrog ? ? I DC 28  N3 ? ? ? 1_555 J DG 140 N2 ? ? I DC 28  J DG 120 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog74  hydrog ? ? I DC 28  O2 ? ? ? 1_555 J DG 140 N1 ? ? I DC 28  J DG 120 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog75  hydrog ? ? I DA 29  N1 ? ? ? 1_555 J DT 138 N3 ? ? I DA 29  J DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog76  hydrog ? ? I DA 29  N6 ? ? ? 1_555 J DT 138 O4 ? ? I DA 29  J DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog77  hydrog ? ? I DA 29  N1 ? ? ? 1_555 J DT 139 N3 ? ? I DA 29  J DT 119 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog78  hydrog ? ? I DA 29  N6 ? ? ? 1_555 J DT 139 O4 ? ? I DA 29  J DT 119 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog79  hydrog ? ? I DA 30  N1 ? ? ? 1_555 J DT 138 N3 ? ? I DA 30  J DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog80  hydrog ? ? I DA 30  N6 ? ? ? 1_555 J DT 138 O4 ? ? I DA 30  J DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog81  hydrog ? ? I DT 31  N3 ? ? ? 1_555 J DA 137 N1 ? ? I DT 31  J DA 117 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog82  hydrog ? ? I DT 31  O4 ? ? ? 1_555 J DA 137 N6 ? ? I DT 31  J DA 117 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog83  hydrog ? ? I DT 32  N3 ? ? ? 1_555 J DA 136 N1 ? ? I DT 32  J DA 116 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog84  hydrog ? ? I DT 32  O4 ? ? ? 1_555 J DA 136 N6 ? ? I DT 32  J DA 116 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog85  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DC 135 N3 ? ? I DG 33  J DC 115 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog86  hydrog ? ? I DG 33  N2 ? ? ? 1_555 J DC 135 O2 ? ? I DG 33  J DC 115 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog87  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DC 135 N4 ? ? I DG 33  J DC 115 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog88  hydrog ? ? I DG 34  N1 ? ? ? 1_555 J DC 134 N3 ? ? I DG 34  J DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog89  hydrog ? ? I DG 34  N2 ? ? ? 1_555 J DC 134 O2 ? ? I DG 34  J DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog90  hydrog ? ? I DG 34  O6 ? ? ? 1_555 J DC 134 N4 ? ? I DG 34  J DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog91  hydrog ? ? I DT 35  N3 ? ? ? 1_555 J DA 133 N1 ? ? I DT 35  J DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog92  hydrog ? ? I DT 35  O4 ? ? ? 1_555 J DA 133 N6 ? ? I DT 35  J DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog93  hydrog ? ? I DC 36  N3 ? ? ? 1_555 J DG 132 N1 ? ? I DC 36  J DG 112 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog94  hydrog ? ? I DC 36  N4 ? ? ? 1_555 J DG 132 O6 ? ? I DC 36  J DG 112 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog95  hydrog ? ? I DC 36  O2 ? ? ? 1_555 J DG 132 N2 ? ? I DC 36  J DG 112 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog96  hydrog ? ? I DG 37  N1 ? ? ? 1_555 J DA 130 N1 ? ? I DG 37  J DA 110 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog97  hydrog ? ? I DG 37  O6 ? ? ? 1_555 J DA 130 N6 ? ? I DG 37  J DA 110 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog98  hydrog ? ? I DG 37  N1 ? ? ? 1_555 J DC 131 N3 ? ? I DG 37  J DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog99  hydrog ? ? I DG 37  N2 ? ? ? 1_555 J DC 131 O2 ? ? I DG 37  J DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog100 hydrog ? ? I DG 37  O6 ? ? ? 1_555 J DC 131 N4 ? ? I DG 37  J DC 111 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog101 hydrog ? ? I DT 38  N3 ? ? ? 1_555 J DA 130 N1 ? ? I DT 38  J DA 110 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog102 hydrog ? ? I DT 38  O4 ? ? ? 1_555 J DA 130 N6 ? ? I DT 38  J DA 110 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog103 hydrog ? ? I DA 39  N1 ? ? ? 1_555 J DT 129 N3 ? ? I DA 39  J DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog104 hydrog ? ? I DA 39  N6 ? ? ? 1_555 J DT 129 O4 ? ? I DA 39  J DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog105 hydrog ? ? I DG 40  N1 ? ? ? 1_555 J DC 128 N3 ? ? I DG 40  J DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog106 hydrog ? ? I DG 40  N2 ? ? ? 1_555 J DC 128 O2 ? ? I DG 40  J DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog107 hydrog ? ? I DG 40  O6 ? ? ? 1_555 J DC 128 N4 ? ? I DG 40  J DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog108 hydrog ? ? I DC 42  N3 ? ? ? 1_555 J DG 126 N1 ? ? I DC 42  J DG 106 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog109 hydrog ? ? I DC 42  N4 ? ? ? 1_555 J DG 126 O6 ? ? I DC 42  J DG 106 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog110 hydrog ? ? I DC 42  O2 ? ? ? 1_555 J DG 126 N2 ? ? I DC 42  J DG 106 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog111 hydrog ? ? I DA 43  N1 ? ? ? 1_555 J DT 125 N3 ? ? I DA 43  J DT 105 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog112 hydrog ? ? I DA 43  N6 ? ? ? 1_555 J DT 125 O4 ? ? I DA 43  J DT 105 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog113 hydrog ? ? I DG 44  N1 ? ? ? 1_555 J DC 124 O2 ? ? I DG 44  J DC 104 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog114 hydrog ? ? I DG 44  N2 ? ? ? 1_555 J DC 124 N3 ? ? I DG 44  J DC 104 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog115 hydrog ? ? I DC 45  N3 ? ? ? 1_555 J DG 123 N1 ? ? I DC 45  J DG 103 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog116 hydrog ? ? I DC 45  N4 ? ? ? 1_555 J DG 123 O6 ? ? I DC 45  J DG 103 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog117 hydrog ? ? I DC 45  O2 ? ? ? 1_555 J DG 123 N2 ? ? I DC 45  J DG 103 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog118 hydrog ? ? I DT 46  N3 ? ? ? 1_555 J DA 122 N1 ? ? I DT 46  J DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog119 hydrog ? ? I DT 46  O4 ? ? ? 1_555 J DA 122 N6 ? ? I DT 46  J DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog120 hydrog ? ? I DC 47  N3 ? ? ? 1_555 J DG 121 N1 ? ? I DC 47  J DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog121 hydrog ? ? I DC 47  N4 ? ? ? 1_555 J DG 121 O6 ? ? I DC 47  J DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog122 hydrog ? ? I DC 47  O2 ? ? ? 1_555 J DG 121 N2 ? ? I DC 47  J DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog123 hydrog ? ? I DT 48  N3 ? ? ? 1_555 J DA 120 N1 ? ? I DT 48  J DA 100 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog124 hydrog ? ? I DT 48  O4 ? ? ? 1_555 J DA 120 N6 ? ? I DT 48  J DA 100 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog125 hydrog ? ? I DA 49  N1 ? ? ? 1_555 J DT 119 N3 ? ? I DA 49  J DT 99  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog126 hydrog ? ? I DA 49  N6 ? ? ? 1_555 J DT 119 O4 ? ? I DA 49  J DT 99  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog127 hydrog ? ? I DG 50  N1 ? ? ? 1_555 J DC 118 N3 ? ? I DG 50  J DC 98  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog128 hydrog ? ? I DG 50  N2 ? ? ? 1_555 J DC 118 O2 ? ? I DG 50  J DC 98  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog129 hydrog ? ? I DG 50  O6 ? ? ? 1_555 J DC 118 N4 ? ? I DG 50  J DC 98  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog130 hydrog ? ? I DC 51  N3 ? ? ? 1_555 J DG 117 N1 ? ? I DC 51  J DG 97  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog131 hydrog ? ? I DC 51  N4 ? ? ? 1_555 J DG 117 O6 ? ? I DC 51  J DG 97  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog132 hydrog ? ? I DC 51  O2 ? ? ? 1_555 J DG 117 N2 ? ? I DC 51  J DG 97  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog133 hydrog ? ? I DA 52  N1 ? ? ? 1_555 J DG 115 N1 ? ? I DA 52  J DG 95  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog134 hydrog ? ? I DA 52  N6 ? ? ? 1_555 J DG 115 O6 ? ? I DA 52  J DG 95  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog135 hydrog ? ? I DA 52  N1 ? ? ? 1_555 J DT 116 N3 ? ? I DA 52  J DT 96  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog136 hydrog ? ? I DA 52  N6 ? ? ? 1_555 J DT 116 O4 ? ? I DA 52  J DT 96  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog137 hydrog ? ? I DC 53  N3 ? ? ? 1_555 J DG 115 N1 ? ? I DC 53  J DG 95  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog138 hydrog ? ? I DC 53  N4 ? ? ? 1_555 J DG 115 O6 ? ? I DC 53  J DG 95  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog139 hydrog ? ? I DC 53  O2 ? ? ? 1_555 J DG 115 N2 ? ? I DC 53  J DG 95  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog140 hydrog ? ? I DC 54  N3 ? ? ? 1_555 J DG 114 N1 ? ? I DC 54  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog141 hydrog ? ? I DC 54  N4 ? ? ? 1_555 J DG 114 O6 ? ? I DC 54  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog142 hydrog ? ? I DC 54  O2 ? ? ? 1_555 J DG 114 N2 ? ? I DC 54  J DG 94  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog143 hydrog ? ? I DG 55  N1 ? ? ? 1_555 J DC 113 N3 ? ? I DG 55  J DC 93  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog144 hydrog ? ? I DG 55  N2 ? ? ? 1_555 J DC 113 O2 ? ? I DG 55  J DC 93  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog145 hydrog ? ? I DG 55  O6 ? ? ? 1_555 J DC 113 N4 ? ? I DG 55  J DC 93  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog146 hydrog ? ? I DC 56  N3 ? ? ? 1_555 J DG 112 N1 ? ? I DC 56  J DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog147 hydrog ? ? I DC 56  N4 ? ? ? 1_555 J DG 112 O6 ? ? I DC 56  J DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog148 hydrog ? ? I DC 56  O2 ? ? ? 1_555 J DG 112 N2 ? ? I DC 56  J DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog149 hydrog ? ? I DT 57  N3 ? ? ? 1_555 J DA 111 N1 ? ? I DT 57  J DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog150 hydrog ? ? I DT 57  O4 ? ? ? 1_555 J DA 111 N6 ? ? I DT 57  J DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog151 hydrog ? ? I DT 58  N3 ? ? ? 1_555 J DA 110 N1 ? ? I DT 58  J DA 90  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog152 hydrog ? ? I DT 58  O4 ? ? ? 1_555 J DA 110 N6 ? ? I DT 58  J DA 90  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog153 hydrog ? ? I DA 59  N1 ? ? ? 1_555 J DT 109 N3 ? ? I DA 59  J DT 89  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog154 hydrog ? ? I DA 59  N6 ? ? ? 1_555 J DT 109 O4 ? ? I DA 59  J DT 89  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog155 hydrog ? ? I DA 61  N1 ? ? ? 1_555 J DT 107 N3 ? ? I DA 61  J DT 87  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog156 hydrog ? ? I DA 61  N6 ? ? ? 1_555 J DT 107 O4 ? ? I DA 61  J DT 87  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog157 hydrog ? ? I DC 62  N3 ? ? ? 1_555 J DG 106 N1 ? ? I DC 62  J DG 86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog158 hydrog ? ? I DC 62  N4 ? ? ? 1_555 J DG 106 O6 ? ? I DC 62  J DG 86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog159 hydrog ? ? I DC 62  O2 ? ? ? 1_555 J DG 106 N2 ? ? I DC 62  J DG 86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog160 hydrog ? ? I DG 63  N1 ? ? ? 1_555 J DC 105 N3 ? ? I DG 63  J DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog161 hydrog ? ? I DG 63  N2 ? ? ? 1_555 J DC 105 O2 ? ? I DG 63  J DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog162 hydrog ? ? I DG 63  O6 ? ? ? 1_555 J DC 105 N4 ? ? I DG 63  J DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog163 hydrog ? ? I DC 64  N3 ? ? ? 1_555 J DG 104 N2 ? ? I DC 64  J DG 84  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog164 hydrog ? ? I DC 64  O2 ? ? ? 1_555 J DG 104 N1 ? ? I DC 64  J DG 84  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog165 hydrog ? ? I DA 65  N1 ? ? ? 1_555 J DT 103 N3 ? ? I DA 65  J DT 83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog166 hydrog ? ? I DA 65  N6 ? ? ? 1_555 J DT 103 O4 ? ? I DA 65  J DT 83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog167 hydrog ? ? I DC 66  N3 ? ? ? 1_555 J DG 102 N1 ? ? I DC 66  J DG 82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog168 hydrog ? ? I DC 66  N4 ? ? ? 1_555 J DG 102 O6 ? ? I DC 66  J DG 82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog169 hydrog ? ? I DC 66  O2 ? ? ? 1_555 J DG 102 N2 ? ? I DC 66  J DG 82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog170 hydrog ? ? I DG 67  N1 ? ? ? 1_555 J DC 101 N3 ? ? I DG 67  J DC 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog171 hydrog ? ? I DG 67  N2 ? ? ? 1_555 J DC 101 O2 ? ? I DG 67  J DC 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog172 hydrog ? ? I DG 67  O6 ? ? ? 1_555 J DC 101 N4 ? ? I DG 67  J DC 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog173 hydrog ? ? I DT 68  N3 ? ? ? 1_555 J DA 100 N1 ? ? I DT 68  J DA 80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog174 hydrog ? ? I DT 68  O4 ? ? ? 1_555 J DA 100 N6 ? ? I DT 68  J DA 80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog175 hydrog ? ? I DA 69  N1 ? ? ? 1_555 J DT 99  N3 ? ? I DA 69  J DT 79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog176 hydrog ? ? I DA 69  N6 ? ? ? 1_555 J DT 99  O4 ? ? I DA 69  J DT 79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog177 hydrog ? ? I DC 70  N3 ? ? ? 1_555 J DG 98  N1 ? ? I DC 70  J DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog178 hydrog ? ? I DC 70  N4 ? ? ? 1_555 J DG 98  O6 ? ? I DC 70  J DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog179 hydrog ? ? I DC 70  O2 ? ? ? 1_555 J DG 98  N2 ? ? I DC 70  J DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog180 hydrog ? ? I DG 71  N1 ? ? ? 1_555 J DC 97  N3 ? ? I DG 71  J DC 77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog181 hydrog ? ? I DG 71  N2 ? ? ? 1_555 J DC 97  O2 ? ? I DG 71  J DC 77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog182 hydrog ? ? I DG 71  O6 ? ? ? 1_555 J DC 97  N4 ? ? I DG 71  J DC 77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog183 hydrog ? ? I DC 72  N3 ? ? ? 1_555 J DG 96  N1 ? ? I DC 72  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog184 hydrog ? ? I DC 72  N4 ? ? ? 1_555 J DG 96  O6 ? ? I DC 72  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog185 hydrog ? ? I DC 72  O2 ? ? ? 1_555 J DG 96  N2 ? ? I DC 72  J DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog186 hydrog ? ? I DG 73  N1 ? ? ? 1_555 J DC 95  O2 ? ? I DG 73  J DC 75  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog187 hydrog ? ? I DG 73  N2 ? ? ? 1_555 J DC 95  N3 ? ? I DG 73  J DC 75  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog188 hydrog ? ? I DC 74  N3 ? ? ? 1_555 J DG 94  N2 ? ? I DC 74  J DG 74  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog189 hydrog ? ? I DC 74  O2 ? ? ? 1_555 J DG 94  N1 ? ? I DC 74  J DG 74  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog190 hydrog ? ? I DT 75  N3 ? ? ? 1_555 J DA 93  N1 ? ? I DT 75  J DA 73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog191 hydrog ? ? I DT 75  O4 ? ? ? 1_555 J DA 93  N6 ? ? I DT 75  J DA 73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog192 hydrog ? ? I DG 76  N1 ? ? ? 1_555 J DC 92  N3 ? ? I DG 76  J DC 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog193 hydrog ? ? I DG 76  N2 ? ? ? 1_555 J DC 92  O2 ? ? I DG 76  J DC 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog194 hydrog ? ? I DG 76  O6 ? ? ? 1_555 J DC 92  N4 ? ? I DG 76  J DC 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog195 hydrog ? ? I DT 77  N3 ? ? ? 1_555 J DA 91  N1 ? ? I DT 77  J DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog196 hydrog ? ? I DT 77  O4 ? ? ? 1_555 J DA 91  N6 ? ? I DT 77  J DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog197 hydrog ? ? I DC 78  N3 ? ? ? 1_555 J DG 90  N1 ? ? I DC 78  J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog198 hydrog ? ? I DC 78  N4 ? ? ? 1_555 J DG 90  O6 ? ? I DC 78  J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog199 hydrog ? ? I DC 78  O2 ? ? ? 1_555 J DG 90  N2 ? ? I DC 78  J DG 70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog200 hydrog ? ? I DC 79  N3 ? ? ? 1_555 J DG 89  N2 ? ? I DC 79  J DG 69  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog201 hydrog ? ? I DC 79  O2 ? ? ? 1_555 J DG 89  N1 ? ? I DC 79  J DG 69  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog202 hydrog ? ? I DC 80  N3 ? ? ? 1_555 J DG 88  N2 ? ? I DC 80  J DG 68  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog203 hydrog ? ? I DC 80  O2 ? ? ? 1_555 J DG 88  N1 ? ? I DC 80  J DG 68  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog204 hydrog ? ? I DC 81  N3 ? ? ? 1_555 J DG 87  N1 ? ? I DC 81  J DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog205 hydrog ? ? I DC 81  N4 ? ? ? 1_555 J DG 87  O6 ? ? I DC 81  J DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog206 hydrog ? ? I DC 81  O2 ? ? ? 1_555 J DG 87  N2 ? ? I DC 81  J DG 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog207 hydrog ? ? I DC 82  N3 ? ? ? 1_555 J DG 86  N1 ? ? I DC 82  J DG 66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog208 hydrog ? ? I DC 82  N4 ? ? ? 1_555 J DG 86  O6 ? ? I DC 82  J DG 66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog209 hydrog ? ? I DC 82  O2 ? ? ? 1_555 J DG 86  N2 ? ? I DC 82  J DG 66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog210 hydrog ? ? I DG 83  N1 ? ? ? 1_555 J DC 85  N3 ? ? I DG 83  J DC 65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog211 hydrog ? ? I DG 83  N2 ? ? ? 1_555 J DC 85  O2 ? ? I DG 83  J DC 65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog212 hydrog ? ? I DG 83  O6 ? ? ? 1_555 J DC 85  N4 ? ? I DG 83  J DC 65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog213 hydrog ? ? I DC 84  N3 ? ? ? 1_555 J DG 84  N1 ? ? I DC 84  J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog214 hydrog ? ? I DC 84  N4 ? ? ? 1_555 J DG 84  O6 ? ? I DC 84  J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog215 hydrog ? ? I DC 84  O2 ? ? ? 1_555 J DG 84  N2 ? ? I DC 84  J DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog216 hydrog ? ? I DG 85  N1 ? ? ? 1_555 J DA 82  N1 ? ? I DG 85  J DA 62  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog217 hydrog ? ? I DG 85  O6 ? ? ? 1_555 J DA 82  N6 ? ? I DG 85  J DA 62  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog218 hydrog ? ? I DG 85  N1 ? ? ? 1_555 J DC 83  N3 ? ? I DG 85  J DC 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog219 hydrog ? ? I DG 85  N2 ? ? ? 1_555 J DC 83  O2 ? ? I DG 85  J DC 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog220 hydrog ? ? I DG 85  O6 ? ? ? 1_555 J DC 83  N4 ? ? I DG 85  J DC 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog221 hydrog ? ? I DT 86  N3 ? ? ? 1_555 J DA 82  N1 ? ? I DT 86  J DA 62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog222 hydrog ? ? I DT 86  O4 ? ? ? 1_555 J DA 82  N6 ? ? I DT 86  J DA 62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog223 hydrog ? ? I DT 87  N3 ? ? ? 1_555 J DA 80  N1 ? ? I DT 87  J DA 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog224 hydrog ? ? I DT 87  O4 ? ? ? 1_555 J DA 80  N6 ? ? I DT 87  J DA 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog225 hydrog ? ? I DT 87  N3 ? ? ? 1_555 J DA 81  N1 ? ? I DT 87  J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog226 hydrog ? ? I DT 87  O4 ? ? ? 1_555 J DA 81  N6 ? ? I DT 87  J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog227 hydrog ? ? I DT 88  N3 ? ? ? 1_555 J DA 80  N1 ? ? I DT 88  J DA 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog228 hydrog ? ? I DT 88  O4 ? ? ? 1_555 J DA 80  N6 ? ? I DT 88  J DA 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog229 hydrog ? ? I DT 89  N3 ? ? ? 1_555 J DA 79  N1 ? ? I DT 89  J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog230 hydrog ? ? I DT 89  O4 ? ? ? 1_555 J DA 79  N6 ? ? I DT 89  J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog231 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 77  N3 ? ? I DA 90  J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog232 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 77  O4 ? ? I DA 90  J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog233 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 78  N3 ? ? I DA 90  J DT 58  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog234 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 78  O4 ? ? I DA 90  J DT 58  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog235 hydrog ? ? I DA 91  N1 ? ? ? 1_555 J DG 76  N1 ? ? I DA 91  J DG 56  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog236 hydrog ? ? I DA 91  N6 ? ? ? 1_555 J DG 76  O6 ? ? I DA 91  J DG 56  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog237 hydrog ? ? I DA 91  N1 ? ? ? 1_555 J DT 77  N3 ? ? I DA 91  J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog238 hydrog ? ? I DA 91  N6 ? ? ? 1_555 J DT 77  O4 ? ? I DA 91  J DT 57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog239 hydrog ? ? I DC 92  N3 ? ? ? 1_555 J DG 76  N1 ? ? I DC 92  J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog240 hydrog ? ? I DC 92  N4 ? ? ? 1_555 J DG 76  O6 ? ? I DC 92  J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog241 hydrog ? ? I DC 92  O2 ? ? ? 1_555 J DG 76  N2 ? ? I DC 92  J DG 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog242 hydrog ? ? I DC 93  N3 ? ? ? 1_555 J DG 75  N1 ? ? I DC 93  J DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog243 hydrog ? ? I DC 93  N4 ? ? ? 1_555 J DG 75  O6 ? ? I DC 93  J DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog244 hydrog ? ? I DC 93  O2 ? ? ? 1_555 J DG 75  N2 ? ? I DC 93  J DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog245 hydrog ? ? I DG 94  N1 ? ? ? 1_555 J DC 74  O2 ? ? I DG 94  J DC 54  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog246 hydrog ? ? I DG 94  N2 ? ? ? 1_555 J DC 74  N3 ? ? I DG 94  J DC 54  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog247 hydrog ? ? I DC 95  N3 ? ? ? 1_555 J DG 73  N1 ? ? I DC 95  J DG 53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog248 hydrog ? ? I DC 95  N4 ? ? ? 1_555 J DG 73  O6 ? ? I DC 95  J DG 53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog249 hydrog ? ? I DC 95  O2 ? ? ? 1_555 J DG 73  N2 ? ? I DC 95  J DG 53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog250 hydrog ? ? I DC 96  N3 ? ? ? 1_555 J DG 72  N1 ? ? I DC 96  J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog251 hydrog ? ? I DC 96  N4 ? ? ? 1_555 J DG 72  O6 ? ? I DC 96  J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog252 hydrog ? ? I DC 96  O2 ? ? ? 1_555 J DG 72  N2 ? ? I DC 96  J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog253 hydrog ? ? I DA 97  N1 ? ? ? 1_555 J DT 71  N3 ? ? I DA 97  J DT 51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog254 hydrog ? ? I DA 97  N6 ? ? ? 1_555 J DT 71  O4 ? ? I DA 97  J DT 51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog255 hydrog ? ? I DA 98  N1 ? ? ? 1_555 J DT 70  N3 ? ? I DA 98  J DT 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog256 hydrog ? ? I DA 98  N6 ? ? ? 1_555 J DT 70  O4 ? ? I DA 98  J DT 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog257 hydrog ? ? I DG 99  N1 ? ? ? 1_555 J DC 69  N3 ? ? I DG 99  J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog258 hydrog ? ? I DG 99  N2 ? ? ? 1_555 J DC 69  O2 ? ? I DG 99  J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog259 hydrog ? ? I DG 99  O6 ? ? ? 1_555 J DC 69  N4 ? ? I DG 99  J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog260 hydrog ? ? I DG 100 N2 ? ? ? 1_555 J DC 68  N3 ? ? I DG 100 J DC 48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog261 hydrog ? ? I DG 101 N1 ? ? ? 1_555 J DC 67  N3 ? ? I DG 101 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog262 hydrog ? ? I DG 101 N2 ? ? ? 1_555 J DC 67  O2 ? ? I DG 101 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog263 hydrog ? ? I DG 101 O6 ? ? ? 1_555 J DC 67  N4 ? ? I DG 101 J DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog264 hydrog ? ? I DG 102 N1 ? ? ? 1_555 J DC 66  N3 ? ? I DG 102 J DC 46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog265 hydrog ? ? I DG 102 N2 ? ? ? 1_555 J DC 66  O2 ? ? I DG 102 J DC 46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog266 hydrog ? ? I DG 102 O6 ? ? ? 1_555 J DC 66  N4 ? ? I DG 102 J DC 46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog267 hydrog ? ? I DA 103 N1 ? ? ? 1_555 J DT 65  N3 ? ? I DA 103 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog268 hydrog ? ? I DA 103 N6 ? ? ? 1_555 J DT 65  O4 ? ? I DA 103 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog269 hydrog ? ? I DT 104 N3 ? ? ? 1_555 J DA 64  N1 ? ? I DT 104 J DA 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog270 hydrog ? ? I DT 104 O4 ? ? ? 1_555 J DA 64  N6 ? ? I DT 104 J DA 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog271 hydrog ? ? I DT 105 N3 ? ? ? 1_555 J DA 63  N1 ? ? I DT 105 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog272 hydrog ? ? I DT 105 O4 ? ? ? 1_555 J DA 63  N6 ? ? I DT 105 J DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog273 hydrog ? ? I DA 106 N1 ? ? ? 1_555 J DG 61  N1 ? ? I DA 106 J DG 41  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog274 hydrog ? ? I DA 106 N6 ? ? ? 1_555 J DG 61  O6 ? ? I DA 106 J DG 41  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog275 hydrog ? ? I DA 106 N1 ? ? ? 1_555 J DT 62  N3 ? ? I DA 106 J DT 42  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog276 hydrog ? ? I DA 106 N6 ? ? ? 1_555 J DT 62  O4 ? ? I DA 106 J DT 42  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog277 hydrog ? ? I DC 107 N3 ? ? ? 1_555 J DG 61  N1 ? ? I DC 107 J DG 41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog278 hydrog ? ? I DC 107 N4 ? ? ? 1_555 J DG 61  O6 ? ? I DC 107 J DG 41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog279 hydrog ? ? I DC 107 O2 ? ? ? 1_555 J DG 61  N2 ? ? I DC 107 J DG 41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog280 hydrog ? ? I DT 108 N3 ? ? ? 1_555 J DA 60  N1 ? ? I DT 108 J DA 40  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog281 hydrog ? ? I DT 108 O4 ? ? ? 1_555 J DA 60  N6 ? ? I DT 108 J DA 40  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog282 hydrog ? ? I DC 109 N3 ? ? ? 1_555 J DG 59  N1 ? ? I DC 109 J DG 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog283 hydrog ? ? I DC 109 N4 ? ? ? 1_555 J DG 59  O6 ? ? I DC 109 J DG 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog284 hydrog ? ? I DC 109 O2 ? ? ? 1_555 J DG 59  N2 ? ? I DC 109 J DG 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog285 hydrog ? ? I DC 110 N3 ? ? ? 1_555 J DG 58  N2 ? ? I DC 110 J DG 38  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog286 hydrog ? ? I DC 110 O2 ? ? ? 1_555 J DG 58  N1 ? ? I DC 110 J DG 38  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog287 hydrog ? ? I DC 111 N3 ? ? ? 1_555 J DG 57  N1 ? ? I DC 111 J DG 37  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog288 hydrog ? ? I DC 111 N4 ? ? ? 1_555 J DG 57  O6 ? ? I DC 111 J DG 37  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog289 hydrog ? ? I DC 111 O2 ? ? ? 1_555 J DG 57  N2 ? ? I DC 111 J DG 37  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog290 hydrog ? ? I DT 112 N3 ? ? ? 1_555 J DA 56  N1 ? ? I DT 112 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog291 hydrog ? ? I DT 112 O4 ? ? ? 1_555 J DA 56  N6 ? ? I DT 112 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog292 hydrog ? ? I DA 113 N1 ? ? ? 1_555 J DT 55  N3 ? ? I DA 113 J DT 35  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog293 hydrog ? ? I DA 113 N6 ? ? ? 1_555 J DT 55  O4 ? ? I DA 113 J DT 35  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog294 hydrog ? ? I DG 114 N1 ? ? ? 1_555 J DC 54  N3 ? ? I DG 114 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog295 hydrog ? ? I DG 114 N2 ? ? ? 1_555 J DC 54  O2 ? ? I DG 114 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog296 hydrog ? ? I DG 114 O6 ? ? ? 1_555 J DC 54  N4 ? ? I DG 114 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog297 hydrog ? ? I DT 115 N3 ? ? ? 1_555 J DA 53  N1 ? ? I DT 115 J DA 33  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog298 hydrog ? ? I DT 115 O4 ? ? ? 1_555 J DA 53  N6 ? ? I DT 115 J DA 33  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog299 hydrog ? ? I DC 116 N3 ? ? ? 1_555 J DG 52  N1 ? ? I DC 116 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog300 hydrog ? ? I DC 116 N4 ? ? ? 1_555 J DG 52  O6 ? ? I DC 116 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog301 hydrog ? ? I DC 116 O2 ? ? ? 1_555 J DG 52  N2 ? ? I DC 116 J DG 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog302 hydrog ? ? I DT 117 N3 ? ? ? 1_555 J DA 51  N1 ? ? I DT 117 J DA 31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog303 hydrog ? ? I DT 117 O4 ? ? ? 1_555 J DA 51  N6 ? ? I DT 117 J DA 31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog304 hydrog ? ? I DC 118 N3 ? ? ? 1_555 J DG 50  N1 ? ? I DC 118 J DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog305 hydrog ? ? I DC 118 N4 ? ? ? 1_555 J DG 50  O6 ? ? I DC 118 J DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog306 hydrog ? ? I DC 118 O2 ? ? ? 1_555 J DG 50  N2 ? ? I DC 118 J DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog307 hydrog ? ? I DC 119 N3 ? ? ? 1_555 J DT 48  N3 ? ? I DC 119 J DT 28  1_555 ? ? ? ? ? ? TYPE_18_PAIR            ? ? 
hydrog308 hydrog ? ? I DC 119 N4 ? ? ? 1_555 J DT 48  O4 ? ? I DC 119 J DT 28  1_555 ? ? ? ? ? ? TYPE_18_PAIR            ? ? 
hydrog309 hydrog ? ? I DC 119 N3 ? ? ? 1_555 J DG 49  N1 ? ? I DC 119 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog310 hydrog ? ? I DC 119 N4 ? ? ? 1_555 J DG 49  O6 ? ? I DC 119 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog311 hydrog ? ? I DC 119 O2 ? ? ? 1_555 J DG 49  N2 ? ? I DC 119 J DG 29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog312 hydrog ? ? I DG 121 N1 ? ? ? 1_555 J DC 47  N3 ? ? I DG 121 J DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog313 hydrog ? ? I DG 121 N2 ? ? ? 1_555 J DC 47  O2 ? ? I DG 121 J DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog314 hydrog ? ? I DG 121 O6 ? ? ? 1_555 J DC 47  N4 ? ? I DG 121 J DC 27  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog315 hydrog ? ? I DG 122 N1 ? ? ? 1_555 J DC 46  N3 ? ? I DG 122 J DC 26  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog316 hydrog ? ? I DG 122 N2 ? ? ? 1_555 J DC 46  O2 ? ? I DG 122 J DC 26  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog317 hydrog ? ? I DG 122 O6 ? ? ? 1_555 J DC 46  N4 ? ? I DG 122 J DC 26  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog318 hydrog ? ? I DC 123 N3 ? ? ? 1_555 J DG 45  N1 ? ? I DC 123 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog319 hydrog ? ? I DC 123 N4 ? ? ? 1_555 J DG 45  O6 ? ? I DC 123 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog320 hydrog ? ? I DC 123 O2 ? ? ? 1_555 J DG 45  N2 ? ? I DC 123 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog321 hydrog ? ? I DC 125 N3 ? ? ? 1_555 J DG 43  N1 ? ? I DC 125 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog322 hydrog ? ? I DC 125 N4 ? ? ? 1_555 J DG 43  O6 ? ? I DC 125 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog323 hydrog ? ? I DC 125 O2 ? ? ? 1_555 J DG 43  N2 ? ? I DC 125 J DG 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog324 hydrog ? ? I DG 126 N1 ? ? ? 1_555 J DC 42  O2 ? ? I DG 126 J DC 22  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog325 hydrog ? ? I DG 126 N2 ? ? ? 1_555 J DC 42  N3 ? ? I DG 126 J DC 22  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog326 hydrog ? ? I DT 127 N3 ? ? ? 1_555 J DA 41  N1 ? ? I DT 127 J DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog327 hydrog ? ? I DT 127 O4 ? ? ? 1_555 J DA 41  N6 ? ? I DT 127 J DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog328 hydrog ? ? I DG 128 N1 ? ? ? 1_555 J DC 40  N3 ? ? I DG 128 J DC 20  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog329 hydrog ? ? I DG 128 N2 ? ? ? 1_555 J DC 40  O2 ? ? I DG 128 J DC 20  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog330 hydrog ? ? I DG 128 O6 ? ? ? 1_555 J DC 40  N4 ? ? I DG 128 J DC 20  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog331 hydrog ? ? I DT 129 N3 ? ? ? 1_555 J DA 39  N1 ? ? I DT 129 J DA 19  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog332 hydrog ? ? I DT 129 O4 ? ? ? 1_555 J DA 39  N6 ? ? I DT 129 J DA 19  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog333 hydrog ? ? I DC 130 N3 ? ? ? 1_555 J DG 38  N1 ? ? I DC 130 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog334 hydrog ? ? I DC 130 N4 ? ? ? 1_555 J DG 38  O6 ? ? I DC 130 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog335 hydrog ? ? I DC 130 O2 ? ? ? 1_555 J DG 38  N2 ? ? I DC 130 J DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog336 hydrog ? ? I DA 131 N1 ? ? ? 1_555 J DT 37  N3 ? ? I DA 131 J DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog337 hydrog ? ? I DA 131 N6 ? ? ? 1_555 J DT 37  O4 ? ? I DA 131 J DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog338 hydrog ? ? I DG 132 N1 ? ? ? 1_555 J DC 36  N3 ? ? I DG 132 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog339 hydrog ? ? I DG 132 N2 ? ? ? 1_555 J DC 36  O2 ? ? I DG 132 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog340 hydrog ? ? I DG 132 O6 ? ? ? 1_555 J DC 36  N4 ? ? I DG 132 J DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog341 hydrog ? ? I DA 133 N1 ? ? ? 1_555 J DT 35  N3 ? ? I DA 133 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog342 hydrog ? ? I DA 133 N6 ? ? ? 1_555 J DT 35  O4 ? ? I DA 133 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog343 hydrog ? ? I DA 135 N1 ? ? ? 1_555 J DT 33  N3 ? ? I DA 135 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog344 hydrog ? ? I DA 135 N6 ? ? ? 1_555 J DT 33  O4 ? ? I DA 135 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog345 hydrog ? ? I DT 136 N3 ? ? ? 1_555 J DA 32  N1 ? ? I DT 136 J DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog346 hydrog ? ? I DT 136 O4 ? ? ? 1_555 J DA 32  N6 ? ? I DT 136 J DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog347 hydrog ? ? I DA 137 N1 ? ? ? 1_555 J DT 31  N3 ? ? I DA 137 J DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog348 hydrog ? ? I DA 137 N6 ? ? ? 1_555 J DT 31  O4 ? ? I DA 137 J DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog349 hydrog ? ? I DT 138 N3 ? ? ? 1_555 J DA 30  N1 ? ? I DT 138 J DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog350 hydrog ? ? I DT 138 O4 ? ? ? 1_555 J DA 30  N6 ? ? I DT 138 J DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog351 hydrog ? ? I DC 140 N3 ? ? ? 1_555 J DG 28  N1 ? ? I DC 140 J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog352 hydrog ? ? I DC 140 N4 ? ? ? 1_555 J DG 28  O6 ? ? I DC 140 J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog353 hydrog ? ? I DC 140 O2 ? ? ? 1_555 J DG 28  N2 ? ? I DC 140 J DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog354 hydrog ? ? I DA 141 N1 ? ? ? 1_555 J DT 27  N3 ? ? I DA 141 J DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog355 hydrog ? ? I DA 141 N6 ? ? ? 1_555 J DT 27  O4 ? ? I DA 141 J DT 7   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog356 hydrog ? ? I DT 142 N3 ? ? ? 1_555 J DA 26  N1 ? ? I DT 142 J DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog357 hydrog ? ? I DT 142 O4 ? ? ? 1_555 J DA 26  N6 ? ? I DT 142 J DA 6   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog358 hydrog ? ? I DC 143 N3 ? ? ? 1_555 J DG 24  N1 ? ? I DC 143 J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog359 hydrog ? ? I DC 143 N4 ? ? ? 1_555 J DG 24  O6 ? ? I DC 143 J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog360 hydrog ? ? I DC 143 O2 ? ? ? 1_555 J DG 24  N2 ? ? I DC 143 J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog361 hydrog ? ? I DC 143 N3 ? ? ? 1_555 J DG 25  N1 ? ? I DC 143 J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog362 hydrog ? ? I DC 143 N4 ? ? ? 1_555 J DG 25  O6 ? ? I DC 143 J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog363 hydrog ? ? I DC 143 O2 ? ? ? 1_555 J DG 25  N2 ? ? I DC 143 J DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog364 hydrog ? ? I DC 144 N3 ? ? ? 1_555 J DG 24  N1 ? ? I DC 144 J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog365 hydrog ? ? I DC 144 N4 ? ? ? 1_555 J DG 24  O6 ? ? I DC 144 J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog366 hydrog ? ? I DC 144 O2 ? ? ? 1_555 J DG 24  N2 ? ? I DC 144 J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog367 hydrog ? ? I DG 145 N1 ? ? ? 1_555 J DC 23  N3 ? ? I DG 145 J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog368 hydrog ? ? I DG 145 N2 ? ? ? 1_555 J DC 23  O2 ? ? I DG 145 J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog369 hydrog ? ? I DG 145 O6 ? ? ? 1_555 J DC 23  N4 ? ? I DG 145 J DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog370 hydrog ? ? I DA 146 N1 ? ? ? 1_555 J DT 22  N3 ? ? I DA 146 J DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog371 hydrog ? ? I DA 146 N6 ? ? ? 1_555 J DT 22  O4 ? ? I DA 146 J DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog372 hydrog ? ? I DT 147 N3 ? ? ? 1_555 J DT 22  O4 ? ? I DT 147 J DT 2   1_555 ? ? ? ? ? ? TYPE_16_PAIR            ? ? 
hydrog373 hydrog ? ? I DT 147 O2 ? ? ? 1_555 J DT 22  N3 ? ? I DT 147 J DT 2   1_555 ? ? ? ? ? ? TYPE_16_PAIR            ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 5 ? 
AB2 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
AB1 2 3 ? parallel 
AB1 3 4 ? parallel 
AB1 4 5 ? parallel 
AB2 1 2 ? parallel 
AB2 2 3 ? parallel 
AB2 3 4 ? parallel 
AB2 4 5 ? parallel 
AB2 5 6 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 84  ? PHE A 85  ? ARG A 83   PHE A 84   
AA1 2 THR B 81  ? VAL B 82  ? THR B 80   VAL B 81   
AA2 1 THR B 97  ? TYR B 99  ? THR B 96   TYR B 98   
AA2 2 VAL G 101 ? ILE G 103 ? VAL G 100  ILE G 102  
AA3 1 ARG C 43  ? VAL C 44  ? ARG C 42   VAL C 43   
AA3 2 THR D 88  ? ILE D 89  ? THR D 85   ILE D 86   
AA4 1 ARG C 78  ? ILE C 79  ? ARG C 77   ILE C 78   
AA4 2 GLY D 53  ? ILE D 54  ? GLY D 50   ILE D 51   
AA5 1 VAL C 101 ? ILE C 103 ? VAL C 100  ILE C 102  
AA5 2 THR F 97  ? TYR F 99  ? THR F 96   TYR F 98   
AA6 1 ARG E 84  ? PHE E 85  ? ARG E 83   PHE E 84   
AA6 2 THR F 81  ? VAL F 82  ? THR F 80   VAL F 81   
AA7 1 ARG G 43  ? VAL G 44  ? ARG G 42   VAL G 43   
AA7 2 THR H 88  ? ILE H 89  ? THR H 85   ILE H 86   
AA8 1 ARG G 78  ? ILE G 79  ? ARG G 77   ILE G 78   
AA8 2 GLY H 53  ? ILE H 54  ? GLY H 50   ILE H 51   
AA9 1 ILE K 124 ? LEU K 125 ? ILE O 789  LEU O 790  
AA9 2 LEU K 326 ? LEU K 327 ? LEU O 991  LEU O 992  
AB1 1 THR K 179 ? ILE K 180 ? THR O 844  ILE O 845  
AB1 2 VAL K 203 ? THR K 207 ? VAL O 868  THR O 872  
AB1 3 TYR K 154 ? VAL K 158 ? TYR O 819  VAL O 823  
AB1 4 TRP K 223 ? ILE K 227 ? TRP O 888  ILE O 892  
AB1 5 ALA K 251 ? LEU K 255 ? ALA O 916  LEU O 920  
AB2 1 LYS K 344 ? VAL K 346 ? LYS O 1009 VAL O 1011 
AB2 2 ARG K 542 ? LEU K 546 ? ARG O 1207 LEU O 1211 
AB2 3 THR K 512 ? PHE K 516 ? THR O 1177 PHE O 1181 
AB2 4 VAL K 441 ? ILE K 443 ? VAL O 1106 ILE O 1108 
AB2 5 CYS K 493 ? ILE K 495 ? CYS O 1158 ILE O 1160 
AB2 6 TYR K 465 ? ARG K 467 ? TYR O 1130 ARG O 1132 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 84  ? N ARG A 83   O VAL B 82  ? O VAL B 81   
AA2 1 2 N TYR B 99  ? N TYR B 98   O THR G 102 ? O THR G 101  
AA3 1 2 N ARG C 43  ? N ARG C 42   O ILE D 89  ? O ILE D 86   
AA4 1 2 N ILE C 79  ? N ILE C 78   O GLY D 53  ? O GLY D 50   
AA5 1 2 N THR C 102 ? N THR C 101  O THR F 97  ? O THR F 96   
AA6 1 2 N ARG E 84  ? N ARG E 83   O VAL F 82  ? O VAL F 81   
AA7 1 2 N ARG G 43  ? N ARG G 42   O ILE H 89  ? O ILE H 86   
AA8 1 2 N ILE G 79  ? N ILE G 78   O GLY H 53  ? O GLY H 50   
AA9 1 2 N ILE K 124 ? N ILE O 789  O LEU K 327 ? O LEU O 992  
AB1 1 2 N ILE K 180 ? N ILE O 845  O LEU K 205 ? O LEU O 870  
AB1 2 3 O VAL K 204 ? O VAL O 869  N VAL K 156 ? N VAL O 821  
AB1 3 4 N LEU K 155 ? N LEU O 820  O ILE K 227 ? O ILE O 892  
AB1 4 5 N MET K 226 ? N MET O 891  O TYR K 253 ? O TYR O 918  
AB2 1 2 N VAL K 346 ? N VAL O 1011 O ARG K 545 ? O ARG O 1210 
AB2 2 3 O ARG K 542 ? O ARG O 1207 N VAL K 513 ? N VAL O 1178 
AB2 3 4 O THR K 512 ? O THR O 1177 N LEU K 442 ? N LEU O 1107 
AB2 4 5 N ILE K 443 ? N ILE O 1108 O PHE K 494 ? O PHE O 1159 
AB2 5 6 O ILE K 495 ? O ILE O 1160 N LEU K 466 ? N LEU O 1131 
# 
_atom_sites.entry_id                    5X0X 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . LYS A 1 38  ? 171.872 234.038 184.383 1.00 141.21 ? 37   LYS A N     1 
ATOM 2     C CA    . LYS A 1 38  ? 171.483 232.852 183.630 1.00 145.33 ? 37   LYS A CA    1 
ATOM 3     C C     . LYS A 1 38  ? 172.535 232.497 182.593 1.00 149.98 ? 37   LYS A C     1 
ATOM 4     O O     . LYS A 1 38  ? 172.410 232.861 181.428 1.00 148.84 ? 37   LYS A O     1 
ATOM 5     C CB    . LYS A 1 38  ? 170.131 233.070 182.950 1.00 142.65 ? 37   LYS A CB    1 
ATOM 6     N N     . PRO A 1 39  ? 173.582 231.796 183.020 1.00 152.43 ? 38   PRO A N     1 
ATOM 7     C CA    . PRO A 1 39  ? 174.619 231.382 182.074 1.00 149.67 ? 38   PRO A CA    1 
ATOM 8     C C     . PRO A 1 39  ? 174.042 230.480 181.000 1.00 150.21 ? 38   PRO A C     1 
ATOM 9     O O     . PRO A 1 39  ? 172.996 229.855 181.183 1.00 151.07 ? 38   PRO A O     1 
ATOM 10    C CB    . PRO A 1 39  ? 175.621 230.637 182.955 1.00 142.73 ? 38   PRO A CB    1 
ATOM 11    C CG    . PRO A 1 39  ? 175.415 231.214 184.311 1.00 145.07 ? 38   PRO A CG    1 
ATOM 12    C CD    . PRO A 1 39  ? 173.939 231.456 184.403 1.00 149.47 ? 38   PRO A CD    1 
ATOM 13    N N     . HIS A 1 40  ? 174.740 230.411 179.875 1.00 147.72 ? 39   HIS A N     1 
ATOM 14    C CA    . HIS A 1 40  ? 174.242 229.647 178.746 1.00 141.62 ? 39   HIS A CA    1 
ATOM 15    C C     . HIS A 1 40  ? 174.726 228.205 178.808 1.00 135.53 ? 39   HIS A C     1 
ATOM 16    O O     . HIS A 1 40  ? 175.885 227.925 179.116 1.00 135.10 ? 39   HIS A O     1 
ATOM 17    C CB    . HIS A 1 40  ? 174.679 230.294 177.439 1.00 138.35 ? 39   HIS A CB    1 
ATOM 18    C CG    . HIS A 1 40  ? 174.086 229.651 176.230 1.00 132.61 ? 39   HIS A CG    1 
ATOM 19    N ND1   . HIS A 1 40  ? 174.657 228.561 175.613 1.00 129.89 ? 39   HIS A ND1   1 
ATOM 20    C CD2   . HIS A 1 40  ? 172.949 229.919 175.548 1.00 128.40 ? 39   HIS A CD2   1 
ATOM 21    C CE1   . HIS A 1 40  ? 173.908 228.200 174.586 1.00 127.86 ? 39   HIS A CE1   1 
ATOM 22    N NE2   . HIS A 1 40  ? 172.865 229.006 174.527 1.00 128.20 ? 39   HIS A NE2   1 
ATOM 23    N N     . ARG A 1 41  ? 173.815 227.284 178.513 1.00 129.01 ? 40   ARG A N     1 
ATOM 24    C CA    . ARG A 1 41  ? 174.110 225.861 178.496 1.00 120.01 ? 40   ARG A CA    1 
ATOM 25    C C     . ARG A 1 41  ? 173.328 225.209 177.373 1.00 114.09 ? 40   ARG A C     1 
ATOM 26    O O     . ARG A 1 41  ? 172.186 225.580 177.103 1.00 108.38 ? 40   ARG A O     1 
ATOM 27    C CB    . ARG A 1 41  ? 173.751 225.211 179.824 1.00 115.31 ? 40   ARG A CB    1 
ATOM 28    C CG    . ARG A 1 41  ? 174.576 225.718 180.971 1.00 118.08 ? 40   ARG A CG    1 
ATOM 29    C CD    . ARG A 1 41  ? 174.093 225.156 182.285 1.00 118.53 ? 40   ARG A CD    1 
ATOM 30    N NE    . ARG A 1 41  ? 174.310 223.723 182.384 1.00 115.75 ? 40   ARG A NE    1 
ATOM 31    C CZ    . ARG A 1 41  ? 175.452 223.183 182.786 1.00 119.77 ? 40   ARG A CZ    1 
ATOM 32    N NH1   . ARG A 1 41  ? 176.469 223.963 183.117 1.00 122.40 ? 40   ARG A NH1   1 
ATOM 33    N NH2   . ARG A 1 41  ? 175.577 221.866 182.855 1.00 117.09 ? 40   ARG A NH2   1 
ATOM 34    N N     . TYR A 1 42  ? 173.948 224.239 176.715 1.00 109.68 ? 41   TYR A N     1 
ATOM 35    C CA    . TYR A 1 42  ? 173.257 223.539 175.650 1.00 88.84  ? 41   TYR A CA    1 
ATOM 36    C C     . TYR A 1 42  ? 172.232 222.569 176.212 1.00 93.10  ? 41   TYR A C     1 
ATOM 37    O O     . TYR A 1 42  ? 172.306 222.149 177.364 1.00 95.61  ? 41   TYR A O     1 
ATOM 38    C CB    . TYR A 1 42  ? 174.240 222.774 174.785 1.00 80.61  ? 41   TYR A CB    1 
ATOM 39    C CG    . TYR A 1 42  ? 175.210 223.642 174.063 1.00 90.18  ? 41   TYR A CG    1 
ATOM 40    C CD1   . TYR A 1 42  ? 174.882 224.206 172.846 1.00 94.89  ? 41   TYR A CD1   1 
ATOM 41    C CD2   . TYR A 1 42  ? 176.464 223.882 174.585 1.00 99.31  ? 41   TYR A CD2   1 
ATOM 42    C CE1   . TYR A 1 42  ? 175.770 224.992 172.171 1.00 100.64 ? 41   TYR A CE1   1 
ATOM 43    C CE2   . TYR A 1 42  ? 177.362 224.667 173.920 1.00 102.27 ? 41   TYR A CE2   1 
ATOM 44    C CZ    . TYR A 1 42  ? 177.010 225.221 172.712 1.00 103.53 ? 41   TYR A CZ    1 
ATOM 45    O OH    . TYR A 1 42  ? 177.906 226.012 172.040 1.00 106.53 ? 41   TYR A OH    1 
ATOM 46    N N     . ARG A 1 43  ? 171.271 222.212 175.379 1.00 96.07  ? 42   ARG A N     1 
ATOM 47    C CA    . ARG A 1 43  ? 170.404 221.106 175.724 1.00 104.10 ? 42   ARG A CA    1 
ATOM 48    C C     . ARG A 1 43  ? 171.242 219.845 175.877 1.00 100.50 ? 42   ARG A C     1 
ATOM 49    O O     . ARG A 1 43  ? 171.931 219.442 174.936 1.00 97.68  ? 42   ARG A O     1 
ATOM 50    C CB    . ARG A 1 43  ? 169.348 220.888 174.655 1.00 110.31 ? 42   ARG A CB    1 
ATOM 51    C CG    . ARG A 1 43  ? 168.441 222.062 174.480 1.00 119.79 ? 42   ARG A CG    1 
ATOM 52    C CD    . ARG A 1 43  ? 167.558 222.256 175.691 1.00 130.93 ? 42   ARG A CD    1 
ATOM 53    N NE    . ARG A 1 43  ? 166.745 223.456 175.538 1.00 140.54 ? 42   ARG A NE    1 
ATOM 54    C CZ    . ARG A 1 43  ? 165.603 223.499 174.864 1.00 149.67 ? 42   ARG A CZ    1 
ATOM 55    N NH1   . ARG A 1 43  ? 165.139 222.404 174.279 1.00 152.00 ? 42   ARG A NH1   1 
ATOM 56    N NH2   . ARG A 1 43  ? 164.932 224.638 174.769 1.00 152.44 ? 42   ARG A NH2   1 
ATOM 57    N N     . PRO A 1 44  ? 171.227 219.216 177.047 1.00 92.72  ? 43   PRO A N     1 
ATOM 58    C CA    . PRO A 1 44  ? 172.003 217.989 177.231 1.00 84.02  ? 43   PRO A CA    1 
ATOM 59    C C     . PRO A 1 44  ? 171.694 216.987 176.134 1.00 81.11  ? 43   PRO A C     1 
ATOM 60    O O     . PRO A 1 44  ? 170.554 216.846 175.695 1.00 83.07  ? 43   PRO A O     1 
ATOM 61    C CB    . PRO A 1 44  ? 171.547 217.484 178.603 1.00 82.19  ? 43   PRO A CB    1 
ATOM 62    C CG    . PRO A 1 44  ? 171.141 218.707 179.307 1.00 87.26  ? 43   PRO A CG    1 
ATOM 63    C CD    . PRO A 1 44  ? 170.515 219.592 178.271 1.00 93.00  ? 43   PRO A CD    1 
ATOM 64    N N     . GLY A 1 45  ? 172.735 216.304 175.678 1.00 74.17  ? 44   GLY A N     1 
ATOM 65    C CA    . GLY A 1 45  ? 172.599 215.485 174.504 1.00 67.98  ? 44   GLY A CA    1 
ATOM 66    C C     . GLY A 1 45  ? 172.956 216.179 173.216 1.00 81.14  ? 44   GLY A C     1 
ATOM 67    O O     . GLY A 1 45  ? 173.100 215.505 172.194 1.00 80.99  ? 44   GLY A O     1 
ATOM 68    N N     . THR A 1 46  ? 173.090 217.500 173.214 1.00 77.48  ? 45   THR A N     1 
ATOM 69    C CA    . THR A 1 46  ? 173.574 218.147 172.006 1.00 75.11  ? 45   THR A CA    1 
ATOM 70    C C     . THR A 1 46  ? 175.084 218.069 171.902 1.00 83.53  ? 45   THR A C     1 
ATOM 71    O O     . THR A 1 46  ? 175.618 217.774 170.827 1.00 76.80  ? 45   THR A O     1 
ATOM 72    C CB    . THR A 1 46  ? 173.142 219.597 171.967 1.00 80.05  ? 45   THR A CB    1 
ATOM 73    O OG1   . THR A 1 46  ? 171.716 219.661 172.016 1.00 90.38  ? 45   THR A OG1   1 
ATOM 74    C CG2   . THR A 1 46  ? 173.621 220.227 170.688 1.00 82.38  ? 45   THR A CG2   1 
ATOM 75    N N     . VAL A 1 47  ? 175.786 218.321 173.006 1.00 80.64  ? 46   VAL A N     1 
ATOM 76    C CA    . VAL A 1 47  ? 177.243 218.313 172.969 1.00 72.86  ? 46   VAL A CA    1 
ATOM 77    C C     . VAL A 1 47  ? 177.751 216.994 172.418 1.00 71.29  ? 46   VAL A C     1 
ATOM 78    O O     . VAL A 1 47  ? 178.709 216.956 171.639 1.00 71.63  ? 46   VAL A O     1 
ATOM 79    C CB    . VAL A 1 47  ? 177.814 218.590 174.364 1.00 74.99  ? 46   VAL A CB    1 
ATOM 80    C CG1   . VAL A 1 47  ? 179.314 218.494 174.335 1.00 63.33  ? 46   VAL A CG1   1 
ATOM 81    C CG2   . VAL A 1 47  ? 177.379 219.940 174.822 1.00 85.34  ? 46   VAL A CG2   1 
ATOM 82    N N     . ALA A 1 48  ? 177.121 215.894 172.813 1.00 78.45  ? 47   ALA A N     1 
ATOM 83    C CA    . ALA A 1 48  ? 177.440 214.603 172.230 1.00 73.02  ? 47   ALA A CA    1 
ATOM 84    C C     . ALA A 1 48  ? 177.340 214.707 170.722 1.00 73.01  ? 47   ALA A C     1 
ATOM 85    O O     . ALA A 1 48  ? 178.344 214.576 170.021 1.00 72.59  ? 47   ALA A O     1 
ATOM 86    C CB    . ALA A 1 48  ? 176.509 213.518 172.755 1.00 70.57  ? 47   ALA A CB    1 
ATOM 87    N N     . LEU A 1 49  ? 176.147 215.008 170.219 1.00 74.52  ? 48   LEU A N     1 
ATOM 88    C CA    . LEU A 1 49  ? 175.950 215.053 168.779 1.00 75.70  ? 48   LEU A CA    1 
ATOM 89    C C     . LEU A 1 49  ? 176.883 216.024 168.092 1.00 77.61  ? 48   LEU A C     1 
ATOM 90    O O     . LEU A 1 49  ? 176.940 216.035 166.861 1.00 90.94  ? 48   LEU A O     1 
ATOM 91    C CB    . LEU A 1 49  ? 174.519 215.421 168.433 1.00 74.29  ? 48   LEU A CB    1 
ATOM 92    C CG    . LEU A 1 49  ? 173.570 214.240 168.315 1.00 81.61  ? 48   LEU A CG    1 
ATOM 93    C CD1   . LEU A 1 49  ? 173.421 213.565 169.645 1.00 83.99  ? 48   LEU A CD1   1 
ATOM 94    C CD2   . LEU A 1 49  ? 172.230 214.705 167.806 1.00 93.31  ? 48   LEU A CD2   1 
ATOM 95    N N     . ARG A 1 50  ? 177.581 216.866 168.837 1.00 68.69  ? 49   ARG A N     1 
ATOM 96    C CA    . ARG A 1 50  ? 178.740 217.492 168.229 1.00 75.20  ? 49   ARG A CA    1 
ATOM 97    C C     . ARG A 1 50  ? 179.950 216.569 168.288 1.00 79.55  ? 49   ARG A C     1 
ATOM 98    O O     . ARG A 1 50  ? 180.698 216.467 167.310 1.00 78.33  ? 49   ARG A O     1 
ATOM 99    C CB    . ARG A 1 50  ? 179.022 218.829 168.896 1.00 81.28  ? 49   ARG A CB    1 
ATOM 100   C CG    . ARG A 1 50  ? 180.118 219.619 168.233 1.00 91.41  ? 49   ARG A CG    1 
ATOM 101   C CD    . ARG A 1 50  ? 180.241 220.996 168.851 1.00 94.39  ? 49   ARG A CD    1 
ATOM 102   N NE    . ARG A 1 50  ? 180.617 220.929 170.253 1.00 86.98  ? 49   ARG A NE    1 
ATOM 103   C CZ    . ARG A 1 50  ? 179.771 221.133 171.253 1.00 89.20  ? 49   ARG A CZ    1 
ATOM 104   N NH1   . ARG A 1 50  ? 178.505 221.420 170.995 1.00 80.65  ? 49   ARG A NH1   1 
ATOM 105   N NH2   . ARG A 1 50  ? 180.189 221.051 172.506 1.00 96.82  ? 49   ARG A NH2   1 
ATOM 106   N N     . GLU A 1 51  ? 180.149 215.869 169.406 1.00 77.33  ? 50   GLU A N     1 
ATOM 107   C CA    . GLU A 1 51  ? 181.304 214.985 169.512 1.00 70.31  ? 50   GLU A CA    1 
ATOM 108   C C     . GLU A 1 51  ? 181.298 213.930 168.422 1.00 70.37  ? 50   GLU A C     1 
ATOM 109   O O     . GLU A 1 51  ? 182.316 213.704 167.770 1.00 74.89  ? 50   GLU A O     1 
ATOM 110   C CB    . GLU A 1 51  ? 181.367 214.315 170.879 1.00 69.23  ? 50   GLU A CB    1 
ATOM 111   C CG    . GLU A 1 51  ? 181.883 215.185 171.984 1.00 84.11  ? 50   GLU A CG    1 
ATOM 112   C CD    . GLU A 1 51  ? 181.924 214.456 173.311 1.00 92.24  ? 50   GLU A CD    1 
ATOM 113   O OE1   . GLU A 1 51  ? 181.302 213.380 173.420 1.00 101.07 ? 50   GLU A OE1   1 
ATOM 114   O OE2   . GLU A 1 51  ? 182.602 214.942 174.238 1.00 85.01  ? 50   GLU A OE2   1 
ATOM 115   N N     . ILE A 1 52  ? 180.169 213.256 168.223 1.00 50.64  ? 51   ILE A N     1 
ATOM 116   C CA    . ILE A 1 52  ? 180.107 212.243 167.177 1.00 51.15  ? 51   ILE A CA    1 
ATOM 117   C C     . ILE A 1 52  ? 180.587 212.819 165.858 1.00 67.22  ? 51   ILE A C     1 
ATOM 118   O O     . ILE A 1 52  ? 181.525 212.305 165.241 1.00 76.84  ? 51   ILE A O     1 
ATOM 119   C CB    . ILE A 1 52  ? 178.688 211.675 167.053 1.00 54.09  ? 51   ILE A CB    1 
ATOM 120   C CG1   . ILE A 1 52  ? 178.394 210.757 168.224 1.00 49.28  ? 51   ILE A CG1   1 
ATOM 121   C CG2   . ILE A 1 52  ? 178.529 210.952 165.752 1.00 41.13  ? 51   ILE A CG2   1 
ATOM 122   C CD1   . ILE A 1 52  ? 176.984 210.272 168.233 1.00 46.15  ? 51   ILE A CD1   1 
ATOM 123   N N     . ARG A 1 53  ? 179.979 213.919 165.425 1.00 65.54  ? 52   ARG A N     1 
ATOM 124   C CA    . ARG A 1 53  ? 180.396 214.513 164.166 1.00 67.97  ? 52   ARG A CA    1 
ATOM 125   C C     . ARG A 1 53  ? 181.860 214.895 164.194 1.00 66.73  ? 52   ARG A C     1 
ATOM 126   O O     . ARG A 1 53  ? 182.485 215.024 163.139 1.00 64.40  ? 52   ARG A O     1 
ATOM 127   C CB    . ARG A 1 53  ? 179.543 215.729 163.848 1.00 75.02  ? 52   ARG A CB    1 
ATOM 128   C CG    . ARG A 1 53  ? 178.116 215.380 163.554 1.00 81.41  ? 52   ARG A CG    1 
ATOM 129   C CD    . ARG A 1 53  ? 177.301 216.616 163.287 1.00 78.40  ? 52   ARG A CD    1 
ATOM 130   N NE    . ARG A 1 53  ? 175.922 216.264 162.998 1.00 85.59  ? 52   ARG A NE    1 
ATOM 131   C CZ    . ARG A 1 53  ? 175.017 216.015 163.934 1.00 97.83  ? 52   ARG A CZ    1 
ATOM 132   N NH1   . ARG A 1 53  ? 175.349 216.080 165.217 1.00 100.65 ? 52   ARG A NH1   1 
ATOM 133   N NH2   . ARG A 1 53  ? 173.780 215.696 163.588 1.00 96.11  ? 52   ARG A NH2   1 
ATOM 134   N N     . ARG A 1 54  ? 182.427 215.088 165.378 1.00 60.79  ? 53   ARG A N     1 
ATOM 135   C CA    . ARG A 1 54  ? 183.861 215.317 165.444 1.00 60.81  ? 53   ARG A CA    1 
ATOM 136   C C     . ARG A 1 54  ? 184.641 214.035 165.199 1.00 70.19  ? 53   ARG A C     1 
ATOM 137   O O     . ARG A 1 54  ? 185.520 213.989 164.336 1.00 75.48  ? 53   ARG A O     1 
ATOM 138   C CB    . ARG A 1 54  ? 184.246 215.907 166.791 1.00 57.18  ? 53   ARG A CB    1 
ATOM 139   C CG    . ARG A 1 54  ? 185.726 216.041 166.948 1.00 59.13  ? 53   ARG A CG    1 
ATOM 140   C CD    . ARG A 1 54  ? 186.065 216.502 168.327 1.00 70.24  ? 53   ARG A CD    1 
ATOM 141   N NE    . ARG A 1 54  ? 187.505 216.541 168.509 1.00 81.55  ? 53   ARG A NE    1 
ATOM 142   C CZ    . ARG A 1 54  ? 188.101 216.985 169.605 1.00 92.59  ? 53   ARG A CZ    1 
ATOM 143   N NH1   . ARG A 1 54  ? 187.375 217.419 170.623 1.00 91.26  ? 53   ARG A NH1   1 
ATOM 144   N NH2   . ARG A 1 54  ? 189.422 216.987 169.685 1.00 104.26 ? 53   ARG A NH2   1 
ATOM 145   N N     . TYR A 1 55  ? 184.335 212.981 165.946 1.00 69.22  ? 54   TYR A N     1 
ATOM 146   C CA    . TYR A 1 55  ? 185.217 211.826 165.960 1.00 66.87  ? 54   TYR A CA    1 
ATOM 147   C C     . TYR A 1 55  ? 185.032 210.953 164.735 1.00 58.55  ? 54   TYR A C     1 
ATOM 148   O O     . TYR A 1 55  ? 186.012 210.440 164.189 1.00 58.68  ? 54   TYR A O     1 
ATOM 149   C CB    . TYR A 1 55  ? 185.005 211.020 167.224 1.00 62.45  ? 54   TYR A CB    1 
ATOM 150   C CG    . TYR A 1 55  ? 185.562 211.694 168.427 1.00 56.83  ? 54   TYR A CG    1 
ATOM 151   C CD1   . TYR A 1 55  ? 186.869 211.496 168.793 1.00 62.12  ? 54   TYR A CD1   1 
ATOM 152   C CD2   . TYR A 1 55  ? 184.790 212.531 169.194 1.00 54.89  ? 54   TYR A CD2   1 
ATOM 153   C CE1   . TYR A 1 55  ? 187.390 212.100 169.890 1.00 63.90  ? 54   TYR A CE1   1 
ATOM 154   C CE2   . TYR A 1 55  ? 185.304 213.144 170.297 1.00 51.50  ? 54   TYR A CE2   1 
ATOM 155   C CZ    . TYR A 1 55  ? 186.608 212.924 170.640 1.00 54.23  ? 54   TYR A CZ    1 
ATOM 156   O OH    . TYR A 1 55  ? 187.143 213.533 171.742 1.00 53.16  ? 54   TYR A OH    1 
ATOM 157   N N     . GLN A 1 56  ? 183.799 210.773 164.275 1.00 54.10  ? 55   GLN A N     1 
ATOM 158   C CA    . GLN A 1 56  ? 183.656 210.020 163.042 1.00 58.44  ? 55   GLN A CA    1 
ATOM 159   C C     . GLN A 1 56  ? 184.385 210.678 161.891 1.00 54.67  ? 55   GLN A C     1 
ATOM 160   O O     . GLN A 1 56  ? 184.528 210.063 160.833 1.00 67.29  ? 55   GLN A O     1 
ATOM 161   C CB    . GLN A 1 56  ? 182.197 209.839 162.660 1.00 57.59  ? 55   GLN A CB    1 
ATOM 162   C CG    . GLN A 1 56  ? 181.430 208.930 163.559 1.00 62.69  ? 55   GLN A CG    1 
ATOM 163   C CD    . GLN A 1 56  ? 180.045 208.694 163.031 1.00 68.14  ? 55   GLN A CD    1 
ATOM 164   O OE1   . GLN A 1 56  ? 179.528 209.491 162.259 1.00 64.93  ? 55   GLN A OE1   1 
ATOM 165   N NE2   . GLN A 1 56  ? 179.441 207.587 163.422 1.00 79.95  ? 55   GLN A NE2   1 
ATOM 166   N N     . LYS A 1 57  ? 184.840 211.910 162.062 1.00 54.62  ? 56   LYS A N     1 
ATOM 167   C CA    . LYS A 1 57  ? 185.667 212.522 161.040 1.00 50.59  ? 56   LYS A CA    1 
ATOM 168   C C     . LYS A 1 57  ? 187.070 211.937 161.057 1.00 63.08  ? 56   LYS A C     1 
ATOM 169   O O     . LYS A 1 57  ? 187.453 211.188 160.154 1.00 65.09  ? 56   LYS A O     1 
ATOM 170   C CB    . LYS A 1 57  ? 185.707 214.030 161.247 1.00 44.41  ? 56   LYS A CB    1 
ATOM 171   C CG    . LYS A 1 57  ? 186.568 214.759 160.261 1.00 68.81  ? 56   LYS A CG    1 
ATOM 172   C CD    . LYS A 1 57  ? 186.549 216.247 160.537 1.00 95.32  ? 56   LYS A CD    1 
ATOM 173   C CE    . LYS A 1 57  ? 187.602 216.961 159.713 1.00 108.27 ? 56   LYS A CE    1 
ATOM 174   N NZ    . LYS A 1 57  ? 187.370 216.791 158.255 1.00 110.83 ? 56   LYS A NZ    1 
ATOM 175   N N     . SER A 1 58  ? 187.840 212.231 162.095 1.00 67.15  ? 57   SER A N     1 
ATOM 176   C CA    . SER A 1 58  ? 189.277 212.035 162.027 1.00 58.71  ? 57   SER A CA    1 
ATOM 177   C C     . SER A 1 58  ? 189.679 210.630 162.452 1.00 63.97  ? 57   SER A C     1 
ATOM 178   O O     . SER A 1 58  ? 188.882 209.848 162.967 1.00 72.24  ? 57   SER A O     1 
ATOM 179   C CB    . SER A 1 58  ? 189.981 213.064 162.902 1.00 62.60  ? 57   SER A CB    1 
ATOM 180   O OG    . SER A 1 58  ? 189.639 212.854 164.256 1.00 73.95  ? 57   SER A OG    1 
ATOM 181   N N     . THR A 1 59  ? 190.956 210.331 162.239 1.00 61.10  ? 58   THR A N     1 
ATOM 182   C CA    . THR A 1 59  ? 191.485 208.981 162.333 1.00 67.59  ? 58   THR A CA    1 
ATOM 183   C C     . THR A 1 59  ? 192.311 208.704 163.576 1.00 68.53  ? 58   THR A C     1 
ATOM 184   O O     . THR A 1 59  ? 192.766 207.575 163.749 1.00 75.04  ? 58   THR A O     1 
ATOM 185   C CB    . THR A 1 59  ? 192.339 208.693 161.113 1.00 69.19  ? 58   THR A CB    1 
ATOM 186   O OG1   . THR A 1 59  ? 193.477 209.557 161.138 1.00 65.06  ? 58   THR A OG1   1 
ATOM 187   C CG2   . THR A 1 59  ? 191.543 208.988 159.863 1.00 64.41  ? 58   THR A CG2   1 
ATOM 188   N N     . GLU A 1 60  ? 192.535 209.686 164.430 1.00 64.38  ? 59   GLU A N     1 
ATOM 189   C CA    . GLU A 1 60  ? 193.573 209.554 165.439 1.00 63.41  ? 59   GLU A CA    1 
ATOM 190   C C     . GLU A 1 60  ? 193.235 208.450 166.432 1.00 62.09  ? 59   GLU A C     1 
ATOM 191   O O     . GLU A 1 60  ? 192.099 207.988 166.529 1.00 68.02  ? 59   GLU A O     1 
ATOM 192   C CB    . GLU A 1 60  ? 193.755 210.870 166.178 1.00 54.03  ? 59   GLU A CB    1 
ATOM 193   C CG    . GLU A 1 60  ? 192.625 211.187 167.129 1.00 66.83  ? 59   GLU A CG    1 
ATOM 194   C CD    . GLU A 1 60  ? 191.346 211.594 166.418 1.00 78.10  ? 59   GLU A CD    1 
ATOM 195   O OE1   . GLU A 1 60  ? 191.288 211.505 165.172 1.00 73.19  ? 59   GLU A OE1   1 
ATOM 196   O OE2   . GLU A 1 60  ? 190.390 212.003 167.108 1.00 86.59  ? 59   GLU A OE2   1 
ATOM 197   N N     . LEU A 1 61  ? 194.253 208.011 167.160 1.00 56.28  ? 60   LEU A N     1 
ATOM 198   C CA    . LEU A 1 61  ? 194.120 206.897 168.086 1.00 59.26  ? 60   LEU A CA    1 
ATOM 199   C C     . LEU A 1 61  ? 193.637 207.403 169.434 1.00 65.13  ? 60   LEU A C     1 
ATOM 200   O O     . LEU A 1 61  ? 194.201 208.349 169.989 1.00 69.75  ? 60   LEU A O     1 
ATOM 201   C CB    . LEU A 1 61  ? 195.448 206.179 168.234 1.00 57.08  ? 60   LEU A CB    1 
ATOM 202   C CG    . LEU A 1 61  ? 195.837 205.737 166.839 1.00 48.82  ? 60   LEU A CG    1 
ATOM 203   C CD1   . LEU A 1 61  ? 197.166 205.035 166.888 1.00 45.91  ? 60   LEU A CD1   1 
ATOM 204   C CD2   . LEU A 1 61  ? 194.741 204.874 166.249 1.00 46.76  ? 60   LEU A CD2   1 
ATOM 205   N N     . LEU A 1 62  ? 192.622 206.750 169.971 1.00 58.13  ? 61   LEU A N     1 
ATOM 206   C CA    . LEU A 1 62  ? 191.841 207.329 171.043 1.00 59.00  ? 61   LEU A CA    1 
ATOM 207   C C     . LEU A 1 62  ? 192.280 206.882 172.422 1.00 62.96  ? 61   LEU A C     1 
ATOM 208   O O     . LEU A 1 62  ? 191.654 207.272 173.407 1.00 66.59  ? 61   LEU A O     1 
ATOM 209   C CB    . LEU A 1 62  ? 190.382 206.979 170.828 1.00 71.02  ? 61   LEU A CB    1 
ATOM 210   C CG    . LEU A 1 62  ? 189.995 207.441 169.432 1.00 68.82  ? 61   LEU A CG    1 
ATOM 211   C CD1   . LEU A 1 62  ? 188.564 207.104 169.147 1.00 69.42  ? 61   LEU A CD1   1 
ATOM 212   C CD2   . LEU A 1 62  ? 190.248 208.910 169.268 1.00 54.96  ? 61   LEU A CD2   1 
ATOM 213   N N     . ILE A 1 63  ? 193.324 206.077 172.530 1.00 60.28  ? 62   ILE A N     1 
ATOM 214   C CA    . ILE A 1 63  ? 193.768 205.557 173.813 1.00 52.91  ? 62   ILE A CA    1 
ATOM 215   C C     . ILE A 1 63  ? 195.184 206.040 174.061 1.00 58.95  ? 62   ILE A C     1 
ATOM 216   O O     . ILE A 1 63  ? 196.026 205.995 173.159 1.00 64.02  ? 62   ILE A O     1 
ATOM 217   C CB    . ILE A 1 63  ? 193.704 204.026 173.848 1.00 54.08  ? 62   ILE A CB    1 
ATOM 218   C CG1   . ILE A 1 63  ? 192.262 203.563 173.742 1.00 59.54  ? 62   ILE A CG1   1 
ATOM 219   C CG2   . ILE A 1 63  ? 194.297 203.512 175.117 1.00 60.06  ? 62   ILE A CG2   1 
ATOM 220   C CD1   . ILE A 1 63  ? 192.138 202.084 173.559 1.00 47.99  ? 62   ILE A CD1   1 
ATOM 221   N N     . ARG A 1 64  ? 195.445 206.506 175.273 1.00 53.76  ? 63   ARG A N     1 
ATOM 222   C CA    . ARG A 1 64  ? 196.779 206.978 175.592 1.00 61.30  ? 63   ARG A CA    1 
ATOM 223   C C     . ARG A 1 64  ? 197.778 205.848 175.455 1.00 64.11  ? 63   ARG A C     1 
ATOM 224   O O     . ARG A 1 64  ? 197.527 204.726 175.895 1.00 66.76  ? 63   ARG A O     1 
ATOM 225   C CB    . ARG A 1 64  ? 196.818 207.537 177.001 1.00 68.53  ? 63   ARG A CB    1 
ATOM 226   C CG    . ARG A 1 64  ? 195.879 208.661 177.189 1.00 63.42  ? 63   ARG A CG    1 
ATOM 227   C CD    . ARG A 1 64  ? 196.336 209.846 176.406 1.00 72.72  ? 63   ARG A CD    1 
ATOM 228   N NE    . ARG A 1 64  ? 195.377 210.915 176.585 1.00 85.13  ? 63   ARG A NE    1 
ATOM 229   C CZ    . ARG A 1 64  ? 194.317 211.073 175.810 1.00 88.28  ? 63   ARG A CZ    1 
ATOM 230   N NH1   . ARG A 1 64  ? 194.108 210.232 174.810 1.00 86.11  ? 63   ARG A NH1   1 
ATOM 231   N NH2   . ARG A 1 64  ? 193.471 212.065 176.033 1.00 89.28  ? 63   ARG A NH2   1 
ATOM 232   N N     . LYS A 1 65  ? 198.914 206.153 174.844 1.00 56.45  ? 64   LYS A N     1 
ATOM 233   C CA    . LYS A 1 65  ? 199.929 205.145 174.611 1.00 63.93  ? 64   LYS A CA    1 
ATOM 234   C C     . LYS A 1 65  ? 200.323 204.470 175.909 1.00 68.26  ? 64   LYS A C     1 
ATOM 235   O O     . LYS A 1 65  ? 199.910 203.340 176.167 1.00 70.78  ? 64   LYS A O     1 
ATOM 236   C CB    . LYS A 1 65  ? 201.155 205.776 173.979 1.00 75.02  ? 64   LYS A CB    1 
ATOM 237   C CG    . LYS A 1 65  ? 200.859 206.576 172.744 1.00 79.89  ? 64   LYS A CG    1 
ATOM 238   C CD    . LYS A 1 65  ? 200.291 205.717 171.646 1.00 79.79  ? 64   LYS A CD    1 
ATOM 239   C CE    . LYS A 1 65  ? 200.139 206.534 170.377 1.00 84.37  ? 64   LYS A CE    1 
ATOM 240   N NZ    . LYS A 1 65  ? 199.603 205.732 169.250 1.00 88.57  ? 64   LYS A NZ    1 
ATOM 241   N N     . LEU A 1 66  ? 201.066 205.175 176.749 1.00 63.53  ? 65   LEU A N     1 
ATOM 242   C CA    . LEU A 1 66  ? 201.701 204.581 177.918 1.00 65.37  ? 65   LEU A CA    1 
ATOM 243   C C     . LEU A 1 66  ? 200.774 203.698 178.741 1.00 67.52  ? 65   LEU A C     1 
ATOM 244   O O     . LEU A 1 66  ? 201.180 202.598 179.135 1.00 69.97  ? 65   LEU A O     1 
ATOM 245   C CB    . LEU A 1 66  ? 202.301 205.662 178.806 1.00 69.45  ? 65   LEU A CB    1 
ATOM 246   C CG    . LEU A 1 66  ? 203.539 206.300 178.203 1.00 77.04  ? 65   LEU A CG    1 
ATOM 247   C CD1   . LEU A 1 66  ? 204.005 207.458 179.054 1.00 79.14  ? 65   LEU A CD1   1 
ATOM 248   C CD2   . LEU A 1 66  ? 204.617 205.249 178.105 1.00 78.56  ? 65   LEU A CD2   1 
ATOM 249   N N     . PRO A 1 67  ? 199.543 204.112 179.027 1.00 64.14  ? 66   PRO A N     1 
ATOM 250   C CA    . PRO A 1 67  ? 198.654 203.191 179.738 1.00 62.72  ? 66   PRO A CA    1 
ATOM 251   C C     . PRO A 1 67  ? 198.419 201.929 178.950 1.00 63.61  ? 66   PRO A C     1 
ATOM 252   O O     . PRO A 1 67  ? 198.563 200.823 179.480 1.00 81.60  ? 66   PRO A O     1 
ATOM 253   C CB    . PRO A 1 67  ? 197.370 204.004 179.896 1.00 56.73  ? 66   PRO A CB    1 
ATOM 254   C CG    . PRO A 1 67  ? 197.803 205.387 179.819 1.00 66.97  ? 66   PRO A CG    1 
ATOM 255   C CD    . PRO A 1 67  ? 198.887 205.404 178.807 1.00 64.45  ? 66   PRO A CD    1 
ATOM 256   N N     . PHE A 1 68  ? 198.103 202.073 177.668 1.00 50.18  ? 67   PHE A N     1 
ATOM 257   C CA    . PHE A 1 68  ? 197.786 200.908 176.863 1.00 53.48  ? 67   PHE A CA    1 
ATOM 258   C C     . PHE A 1 68  ? 198.974 199.977 176.769 1.00 59.49  ? 67   PHE A C     1 
ATOM 259   O O     . PHE A 1 68  ? 198.824 198.753 176.830 1.00 65.47  ? 67   PHE A O     1 
ATOM 260   C CB    . PHE A 1 68  ? 197.346 201.346 175.483 1.00 52.69  ? 67   PHE A CB    1 
ATOM 261   C CG    . PHE A 1 68  ? 197.024 200.224 174.589 1.00 47.75  ? 67   PHE A CG    1 
ATOM 262   C CD1   . PHE A 1 68  ? 195.821 199.583 174.693 1.00 50.86  ? 67   PHE A CD1   1 
ATOM 263   C CD2   . PHE A 1 68  ? 197.911 199.817 173.632 1.00 46.31  ? 67   PHE A CD2   1 
ATOM 264   C CE1   . PHE A 1 68  ? 195.512 198.549 173.867 1.00 41.99  ? 67   PHE A CE1   1 
ATOM 265   C CE2   . PHE A 1 68  ? 197.604 198.785 172.801 1.00 42.01  ? 67   PHE A CE2   1 
ATOM 266   C CZ    . PHE A 1 68  ? 196.404 198.150 172.919 1.00 46.01  ? 67   PHE A CZ    1 
ATOM 267   N N     . GLN A 1 69  ? 200.168 200.535 176.636 1.00 52.99  ? 68   GLN A N     1 
ATOM 268   C CA    . GLN A 1 69  ? 201.352 199.701 176.588 1.00 59.81  ? 68   GLN A CA    1 
ATOM 269   C C     . GLN A 1 69  ? 201.542 198.964 177.899 1.00 68.53  ? 68   GLN A C     1 
ATOM 270   O O     . GLN A 1 69  ? 201.753 197.747 177.918 1.00 67.01  ? 68   GLN A O     1 
ATOM 271   C CB    . GLN A 1 69  ? 202.569 200.542 176.266 1.00 48.89  ? 68   GLN A CB    1 
ATOM 272   C CG    . GLN A 1 69  ? 203.793 199.709 176.128 1.00 64.27  ? 68   GLN A CG    1 
ATOM 273   C CD    . GLN A 1 69  ? 204.945 200.490 175.585 1.00 79.60  ? 68   GLN A CD    1 
ATOM 274   O OE1   . GLN A 1 69  ? 204.799 201.653 175.221 1.00 84.71  ? 68   GLN A OE1   1 
ATOM 275   N NE2   . GLN A 1 69  ? 206.107 199.859 175.518 1.00 81.59  ? 68   GLN A NE2   1 
ATOM 276   N N     . ARG A 1 70  ? 201.471 199.687 179.014 1.00 59.39  ? 69   ARG A N     1 
ATOM 277   C CA    . ARG A 1 70  ? 201.603 199.021 180.301 1.00 66.81  ? 69   ARG A CA    1 
ATOM 278   C C     . ARG A 1 70  ? 200.613 197.879 180.418 1.00 70.65  ? 69   ARG A C     1 
ATOM 279   O O     . ARG A 1 70  ? 200.956 196.792 180.892 1.00 74.26  ? 69   ARG A O     1 
ATOM 280   C CB    . ARG A 1 70  ? 201.411 200.018 181.437 1.00 59.63  ? 69   ARG A CB    1 
ATOM 281   C CG    . ARG A 1 70  ? 202.556 200.986 181.573 1.00 58.15  ? 69   ARG A CG    1 
ATOM 282   C CD    . ARG A 1 70  ? 202.448 201.762 182.853 1.00 62.42  ? 69   ARG A CD    1 
ATOM 283   N NE    . ARG A 1 70  ? 201.243 202.574 182.874 1.00 58.11  ? 69   ARG A NE    1 
ATOM 284   C CZ    . ARG A 1 70  ? 201.162 203.774 182.318 1.00 65.82  ? 69   ARG A CZ    1 
ATOM 285   N NH1   . ARG A 1 70  ? 202.216 204.279 181.698 1.00 65.35  ? 69   ARG A NH1   1 
ATOM 286   N NH2   . ARG A 1 70  ? 200.036 204.466 182.378 1.00 74.35  ? 69   ARG A NH2   1 
ATOM 287   N N     . LEU A 1 71  ? 199.387 198.098 179.953 1.00 65.71  ? 70   LEU A N     1 
ATOM 288   C CA    . LEU A 1 71  ? 198.408 197.024 179.915 1.00 54.66  ? 70   LEU A CA    1 
ATOM 289   C C     . LEU A 1 71  ? 198.933 195.832 179.137 1.00 63.26  ? 70   LEU A C     1 
ATOM 290   O O     . LEU A 1 71  ? 199.019 194.717 179.662 1.00 64.87  ? 70   LEU A O     1 
ATOM 291   C CB    . LEU A 1 71  ? 197.118 197.531 179.296 1.00 43.30  ? 70   LEU A CB    1 
ATOM 292   C CG    . LEU A 1 71  ? 196.119 196.437 178.978 1.00 58.67  ? 70   LEU A CG    1 
ATOM 293   C CD1   . LEU A 1 71  ? 195.773 195.690 180.219 1.00 68.57  ? 70   LEU A CD1   1 
ATOM 294   C CD2   . LEU A 1 71  ? 194.888 197.072 178.414 1.00 53.44  ? 70   LEU A CD2   1 
ATOM 295   N N     . VAL A 1 72  ? 199.298 196.055 177.877 1.00 62.29  ? 71   VAL A N     1 
ATOM 296   C CA    . VAL A 1 72  ? 199.684 194.945 177.016 1.00 58.35  ? 71   VAL A CA    1 
ATOM 297   C C     . VAL A 1 72  ? 200.802 194.145 177.654 1.00 58.61  ? 71   VAL A C     1 
ATOM 298   O O     . VAL A 1 72  ? 200.723 192.919 177.766 1.00 65.83  ? 71   VAL A O     1 
ATOM 299   C CB    . VAL A 1 72  ? 200.085 195.455 175.629 1.00 53.98  ? 71   VAL A CB    1 
ATOM 300   C CG1   . VAL A 1 72  ? 200.633 194.330 174.843 1.00 48.44  ? 71   VAL A CG1   1 
ATOM 301   C CG2   . VAL A 1 72  ? 198.886 196.019 174.935 1.00 45.06  ? 71   VAL A CG2   1 
ATOM 302   N N     . ARG A 1 73  ? 201.850 194.824 178.106 1.00 54.42  ? 72   ARG A N     1 
ATOM 303   C CA    . ARG A 1 73  ? 202.928 194.099 178.762 1.00 61.74  ? 72   ARG A CA    1 
ATOM 304   C C     . ARG A 1 73  ? 202.405 193.307 179.947 1.00 69.48  ? 72   ARG A C     1 
ATOM 305   O O     . ARG A 1 73  ? 202.714 192.118 180.095 1.00 59.04  ? 72   ARG A O     1 
ATOM 306   C CB    . ARG A 1 73  ? 204.021 195.064 179.199 1.00 47.98  ? 72   ARG A CB    1 
ATOM 307   C CG    . ARG A 1 73  ? 204.729 195.733 178.051 1.00 50.76  ? 72   ARG A CG    1 
ATOM 308   C CD    . ARG A 1 73  ? 205.822 196.639 178.546 1.00 66.85  ? 72   ARG A CD    1 
ATOM 309   N NE    . ARG A 1 73  ? 206.462 197.360 177.456 1.00 79.44  ? 72   ARG A NE    1 
ATOM 310   C CZ    . ARG A 1 73  ? 207.447 196.867 176.719 1.00 81.67  ? 72   ARG A CZ    1 
ATOM 311   N NH1   . ARG A 1 73  ? 207.901 195.651 176.957 1.00 72.14  ? 72   ARG A NH1   1 
ATOM 312   N NH2   . ARG A 1 73  ? 207.980 197.587 175.746 1.00 81.90  ? 72   ARG A NH2   1 
ATOM 313   N N     . GLU A 1 74  ? 201.586 193.940 180.785 1.00 64.48  ? 73   GLU A N     1 
ATOM 314   C CA    . GLU A 1 74  ? 201.070 193.255 181.961 1.00 54.41  ? 73   GLU A CA    1 
ATOM 315   C C     . GLU A 1 74  ? 200.401 191.947 181.583 1.00 61.11  ? 73   GLU A C     1 
ATOM 316   O O     . GLU A 1 74  ? 200.623 190.918 182.225 1.00 75.79  ? 73   GLU A O     1 
ATOM 317   C CB    . GLU A 1 74  ? 200.098 194.157 182.710 1.00 53.56  ? 73   GLU A CB    1 
ATOM 318   C CG    . GLU A 1 74  ? 199.517 193.525 183.957 1.00 56.38  ? 73   GLU A CG    1 
ATOM 319   C CD    . GLU A 1 74  ? 198.618 194.477 184.732 1.00 80.64  ? 73   GLU A CD    1 
ATOM 320   O OE1   . GLU A 1 74  ? 198.458 195.631 184.296 1.00 86.15  ? 73   GLU A OE1   1 
ATOM 321   O OE2   . GLU A 1 74  ? 198.061 194.072 185.773 1.00 90.53  ? 73   GLU A OE2   1 
ATOM 322   N N     . ILE A 1 75  ? 199.590 191.960 180.526 1.00 60.11  ? 74   ILE A N     1 
ATOM 323   C CA    . ILE A 1 75  ? 198.998 190.711 180.058 1.00 54.51  ? 74   ILE A CA    1 
ATOM 324   C C     . ILE A 1 75  ? 200.076 189.753 179.594 1.00 59.02  ? 74   ILE A C     1 
ATOM 325   O O     . ILE A 1 75  ? 200.041 188.557 179.899 1.00 67.68  ? 74   ILE A O     1 
ATOM 326   C CB    . ILE A 1 75  ? 197.983 190.976 178.939 1.00 49.29  ? 74   ILE A CB    1 
ATOM 327   C CG1   . ILE A 1 75  ? 196.744 191.643 179.504 1.00 53.00  ? 74   ILE A CG1   1 
ATOM 328   C CG2   . ILE A 1 75  ? 197.621 189.697 178.245 1.00 50.75  ? 74   ILE A CG2   1 
ATOM 329   C CD1   . ILE A 1 75  ? 195.795 192.093 178.447 1.00 58.08  ? 74   ILE A CD1   1 
ATOM 330   N N     . ALA A 1 76  ? 201.052 190.262 178.853 1.00 53.17  ? 75   ALA A N     1 
ATOM 331   C CA    . ALA A 1 76  ? 202.055 189.387 178.274 1.00 56.10  ? 75   ALA A CA    1 
ATOM 332   C C     . ALA A 1 76  ? 202.795 188.597 179.333 1.00 64.47  ? 75   ALA A C     1 
ATOM 333   O O     . ALA A 1 76  ? 203.136 187.433 179.104 1.00 68.14  ? 75   ALA A O     1 
ATOM 334   C CB    . ALA A 1 76  ? 203.044 190.200 177.451 1.00 48.46  ? 75   ALA A CB    1 
ATOM 335   N N     . GLN A 1 77  ? 203.047 189.200 180.497 1.00 66.57  ? 76   GLN A N     1 
ATOM 336   C CA    . GLN A 1 77  ? 203.824 188.513 181.525 1.00 61.69  ? 76   GLN A CA    1 
ATOM 337   C C     . GLN A 1 77  ? 203.318 187.114 181.806 1.00 74.85  ? 76   GLN A C     1 
ATOM 338   O O     . GLN A 1 77  ? 204.125 186.199 181.992 1.00 82.88  ? 76   GLN A O     1 
ATOM 339   C CB    . GLN A 1 77  ? 203.805 189.282 182.833 1.00 56.87  ? 76   GLN A CB    1 
ATOM 340   C CG    . GLN A 1 77  ? 204.552 190.564 182.804 1.00 76.92  ? 76   GLN A CG    1 
ATOM 341   C CD    . GLN A 1 77  ? 204.479 191.246 184.134 1.00 78.89  ? 76   GLN A CD    1 
ATOM 342   O OE1   . GLN A 1 77  ? 203.565 190.989 184.918 1.00 79.99  ? 76   GLN A OE1   1 
ATOM 343   N NE2   . GLN A 1 77  ? 205.439 192.118 184.411 1.00 58.08  ? 76   GLN A NE2   1 
ATOM 344   N N     . ASP A 1 78  ? 202.005 186.933 181.840 1.00 70.19  ? 77   ASP A N     1 
ATOM 345   C CA    . ASP A 1 78  ? 201.454 185.644 182.210 1.00 62.27  ? 77   ASP A CA    1 
ATOM 346   C C     . ASP A 1 78  ? 202.013 184.530 181.349 1.00 68.00  ? 77   ASP A C     1 
ATOM 347   O O     . ASP A 1 78  ? 202.501 183.527 181.875 1.00 90.91  ? 77   ASP A O     1 
ATOM 348   C CB    . ASP A 1 78  ? 199.941 185.688 182.086 1.00 76.62  ? 77   ASP A CB    1 
ATOM 349   C CG    . ASP A 1 78  ? 199.330 186.726 182.980 1.00 95.89  ? 77   ASP A CG    1 
ATOM 350   O OD1   . ASP A 1 78  ? 200.055 187.241 183.854 1.00 96.01  ? 77   ASP A OD1   1 
ATOM 351   O OD2   . ASP A 1 78  ? 198.132 187.027 182.813 1.00 106.82 ? 77   ASP A OD2   1 
ATOM 352   N N     . PHE A 1 79  ? 201.989 184.701 180.033 1.00 63.75  ? 78   PHE A N     1 
ATOM 353   C CA    . PHE A 1 79  ? 202.258 183.608 179.110 1.00 64.19  ? 78   PHE A CA    1 
ATOM 354   C C     . PHE A 1 79  ? 203.742 183.293 179.058 1.00 66.57  ? 78   PHE A C     1 
ATOM 355   O O     . PHE A 1 79  ? 204.158 182.184 179.391 1.00 72.80  ? 78   PHE A O     1 
ATOM 356   C CB    . PHE A 1 79  ? 201.723 183.955 177.727 1.00 60.74  ? 78   PHE A CB    1 
ATOM 357   C CG    . PHE A 1 79  ? 200.273 184.258 177.723 1.00 67.96  ? 78   PHE A CG    1 
ATOM 358   C CD1   . PHE A 1 79  ? 199.482 183.893 178.788 1.00 76.30  ? 78   PHE A CD1   1 
ATOM 359   C CD2   . PHE A 1 79  ? 199.697 184.906 176.664 1.00 65.20  ? 78   PHE A CD2   1 
ATOM 360   C CE1   . PHE A 1 79  ? 198.158 184.177 178.800 1.00 71.82  ? 78   PHE A CE1   1 
ATOM 361   C CE2   . PHE A 1 79  ? 198.368 185.187 176.672 1.00 67.31  ? 78   PHE A CE2   1 
ATOM 362   C CZ    . PHE A 1 79  ? 197.595 184.821 177.740 1.00 61.85  ? 78   PHE A CZ    1 
ATOM 363   N N     . LYS A 1 80  ? 204.545 184.245 178.628 1.00 60.77  ? 79   LYS A N     1 
ATOM 364   C CA    . LYS A 1 80  ? 205.973 184.178 178.848 1.00 60.38  ? 79   LYS A CA    1 
ATOM 365   C C     . LYS A 1 80  ? 206.374 185.438 179.589 1.00 63.12  ? 79   LYS A C     1 
ATOM 366   O O     . LYS A 1 80  ? 205.631 186.418 179.628 1.00 66.41  ? 79   LYS A O     1 
ATOM 367   C CB    . LYS A 1 80  ? 206.746 184.041 177.538 1.00 64.46  ? 79   LYS A CB    1 
ATOM 368   C CG    . LYS A 1 80  ? 208.228 183.795 177.713 1.00 75.52  ? 79   LYS A CG    1 
ATOM 369   C CD    . LYS A 1 80  ? 208.923 183.676 176.381 1.00 83.28  ? 79   LYS A CD    1 
ATOM 370   C CE    . LYS A 1 80  ? 210.421 183.599 176.558 1.00 93.06  ? 79   LYS A CE    1 
ATOM 371   N NZ    . LYS A 1 80  ? 210.818 182.386 177.311 1.00 102.85 ? 79   LYS A NZ    1 
ATOM 372   N N     . THR A 1 81  ? 207.545 185.401 180.198 1.00 77.54  ? 80   THR A N     1 
ATOM 373   C CA    . THR A 1 81  ? 208.065 186.545 180.918 1.00 83.51  ? 80   THR A CA    1 
ATOM 374   C C     . THR A 1 81  ? 209.311 187.064 180.220 1.00 80.76  ? 80   THR A C     1 
ATOM 375   O O     . THR A 1 81  ? 209.976 186.334 179.482 1.00 71.32  ? 80   THR A O     1 
ATOM 376   C CB    . THR A 1 81  ? 208.382 186.183 182.365 1.00 82.75  ? 80   THR A CB    1 
ATOM 377   O OG1   . THR A 1 81  ? 208.789 187.359 183.072 1.00 92.68  ? 80   THR A OG1   1 
ATOM 378   C CG2   . THR A 1 81  ? 209.484 185.156 182.418 1.00 75.18  ? 80   THR A CG2   1 
ATOM 379   N N     . ASP A 1 82  ? 209.607 188.341 180.451 1.00 80.48  ? 81   ASP A N     1 
ATOM 380   C CA    . ASP A 1 82  ? 210.784 188.998 179.896 1.00 80.59  ? 81   ASP A CA    1 
ATOM 381   C C     . ASP A 1 82  ? 210.719 189.022 178.368 1.00 77.67  ? 81   ASP A C     1 
ATOM 382   O O     . ASP A 1 82  ? 211.462 188.334 177.672 1.00 74.23  ? 81   ASP A O     1 
ATOM 383   C CB    . ASP A 1 82  ? 212.051 188.286 180.370 1.00 96.77  ? 81   ASP A CB    1 
ATOM 384   C CG    . ASP A 1 82  ? 212.159 188.255 181.870 1.00 110.28 ? 81   ASP A CG    1 
ATOM 385   O OD1   . ASP A 1 82  ? 211.437 189.031 182.528 1.00 114.32 ? 81   ASP A OD1   1 
ATOM 386   O OD2   . ASP A 1 82  ? 212.945 187.440 182.395 1.00 112.52 ? 81   ASP A OD2   1 
ATOM 387   N N     . LEU A 1 83  ? 209.796 189.833 177.866 1.00 73.55  ? 82   LEU A N     1 
ATOM 388   C CA    . LEU A 1 83  ? 209.542 189.923 176.438 1.00 60.38  ? 82   LEU A CA    1 
ATOM 389   C C     . LEU A 1 83  ? 209.874 191.301 175.897 1.00 64.11  ? 82   LEU A C     1 
ATOM 390   O O     . LEU A 1 83  ? 209.862 192.297 176.619 1.00 53.65  ? 82   LEU A O     1 
ATOM 391   C CB    . LEU A 1 83  ? 208.090 189.605 176.114 1.00 62.49  ? 82   LEU A CB    1 
ATOM 392   C CG    . LEU A 1 83  ? 207.730 188.150 176.345 1.00 73.22  ? 82   LEU A CG    1 
ATOM 393   C CD1   . LEU A 1 83  ? 206.261 187.959 176.130 1.00 67.34  ? 82   LEU A CD1   1 
ATOM 394   C CD2   . LEU A 1 83  ? 208.514 187.289 175.394 1.00 67.94  ? 82   LEU A CD2   1 
ATOM 395   N N     . ARG A 1 84  ? 210.165 191.337 174.607 1.00 72.69  ? 83   ARG A N     1 
ATOM 396   C CA    . ARG A 1 84  ? 210.425 192.565 173.885 1.00 69.47  ? 83   ARG A CA    1 
ATOM 397   C C     . ARG A 1 84  ? 209.308 192.811 172.888 1.00 67.16  ? 83   ARG A C     1 
ATOM 398   O O     . ARG A 1 84  ? 208.863 191.885 172.207 1.00 68.56  ? 83   ARG A O     1 
ATOM 399   C CB    . ARG A 1 84  ? 211.744 192.481 173.133 1.00 69.97  ? 83   ARG A CB    1 
ATOM 400   C CG    . ARG A 1 84  ? 212.957 192.269 173.985 1.00 84.46  ? 83   ARG A CG    1 
ATOM 401   C CD    . ARG A 1 84  ? 213.330 193.523 174.729 1.00 89.89  ? 83   ARG A CD    1 
ATOM 402   N NE    . ARG A 1 84  ? 214.616 193.349 175.383 1.00 88.93  ? 83   ARG A NE    1 
ATOM 403   C CZ    . ARG A 1 84  ? 214.761 192.883 176.613 1.00 105.43 ? 83   ARG A CZ    1 
ATOM 404   N NH1   . ARG A 1 84  ? 213.694 192.555 177.322 1.00 93.57  ? 83   ARG A NH1   1 
ATOM 405   N NH2   . ARG A 1 84  ? 215.969 192.747 177.133 1.00 124.93 ? 83   ARG A NH2   1 
ATOM 406   N N     . PHE A 1 85  ? 208.873 194.058 172.784 1.00 68.50  ? 84   PHE A N     1 
ATOM 407   C CA    . PHE A 1 85  ? 207.907 194.464 171.776 1.00 63.25  ? 84   PHE A CA    1 
ATOM 408   C C     . PHE A 1 85  ? 208.510 195.526 170.882 1.00 59.44  ? 84   PHE A C     1 
ATOM 409   O O     . PHE A 1 85  ? 208.999 196.545 171.373 1.00 61.79  ? 84   PHE A O     1 
ATOM 410   C CB    . PHE A 1 85  ? 206.639 195.005 172.415 1.00 61.03  ? 84   PHE A CB    1 
ATOM 411   C CG    . PHE A 1 85  ? 205.779 193.962 173.007 1.00 56.64  ? 84   PHE A CG    1 
ATOM 412   C CD1   . PHE A 1 85  ? 205.936 192.651 172.657 1.00 51.44  ? 84   PHE A CD1   1 
ATOM 413   C CD2   . PHE A 1 85  ? 204.776 194.296 173.873 1.00 52.14  ? 84   PHE A CD2   1 
ATOM 414   C CE1   . PHE A 1 85  ? 205.127 191.694 173.183 1.00 59.49  ? 84   PHE A CE1   1 
ATOM 415   C CE2   . PHE A 1 85  ? 203.969 193.339 174.400 1.00 51.61  ? 84   PHE A CE2   1 
ATOM 416   C CZ    . PHE A 1 85  ? 204.143 192.038 174.054 1.00 52.27  ? 84   PHE A CZ    1 
ATOM 417   N N     . GLN A 1 86  ? 208.472 195.298 169.580 1.00 57.09  ? 85   GLN A N     1 
ATOM 418   C CA    . GLN A 1 86  ? 208.654 196.410 168.670 1.00 53.73  ? 85   GLN A CA    1 
ATOM 419   C C     . GLN A 1 86  ? 207.518 197.390 168.866 1.00 57.94  ? 85   GLN A C     1 
ATOM 420   O O     . GLN A 1 86  ? 206.356 196.996 168.977 1.00 61.36  ? 85   GLN A O     1 
ATOM 421   C CB    . GLN A 1 86  ? 208.674 195.943 167.228 1.00 53.10  ? 85   GLN A CB    1 
ATOM 422   C CG    . GLN A 1 86  ? 209.878 195.163 166.846 1.00 66.54  ? 85   GLN A CG    1 
ATOM 423   C CD    . GLN A 1 86  ? 209.787 194.675 165.428 1.00 68.31  ? 85   GLN A CD    1 
ATOM 424   O OE1   . GLN A 1 86  ? 208.696 194.476 164.900 1.00 62.67  ? 85   GLN A OE1   1 
ATOM 425   N NE2   . GLN A 1 86  ? 210.932 194.497 164.791 1.00 58.16  ? 85   GLN A NE2   1 
ATOM 426   N N     . SER A 1 87  ? 207.859 198.673 168.922 1.00 65.21  ? 86   SER A N     1 
ATOM 427   C CA    . SER A 1 87  ? 206.839 199.698 169.079 1.00 61.80  ? 86   SER A CA    1 
ATOM 428   C C     . SER A 1 87  ? 205.716 199.488 168.085 1.00 66.48  ? 86   SER A C     1 
ATOM 429   O O     . SER A 1 87  ? 204.533 199.529 168.440 1.00 68.08  ? 86   SER A O     1 
ATOM 430   C CB    . SER A 1 87  ? 207.453 201.070 168.876 1.00 62.24  ? 86   SER A CB    1 
ATOM 431   O OG    . SER A 1 87  ? 207.885 201.181 167.537 1.00 81.02  ? 86   SER A OG    1 
ATOM 432   N N     . SER A 1 88  ? 206.075 199.236 166.829 1.00 59.08  ? 87   SER A N     1 
ATOM 433   C CA    . SER A 1 88  ? 205.063 199.047 165.804 1.00 56.25  ? 87   SER A CA    1 
ATOM 434   C C     . SER A 1 88  ? 204.088 197.946 166.174 1.00 56.99  ? 87   SER A C     1 
ATOM 435   O O     . SER A 1 88  ? 202.903 198.035 165.847 1.00 51.16  ? 87   SER A O     1 
ATOM 436   C CB    . SER A 1 88  ? 205.726 198.730 164.476 1.00 58.80  ? 87   SER A CB    1 
ATOM 437   O OG    . SER A 1 88  ? 206.434 197.516 164.579 1.00 65.48  ? 87   SER A OG    1 
ATOM 438   N N     . ALA A 1 89  ? 204.553 196.907 166.860 1.00 55.33  ? 88   ALA A N     1 
ATOM 439   C CA    . ALA A 1 89  ? 203.637 195.852 167.267 1.00 58.56  ? 88   ALA A CA    1 
ATOM 440   C C     . ALA A 1 89  ? 202.591 196.397 168.223 1.00 48.61  ? 88   ALA A C     1 
ATOM 441   O O     . ALA A 1 89  ? 201.385 196.259 167.995 1.00 50.45  ? 88   ALA A O     1 
ATOM 442   C CB    . ALA A 1 89  ? 204.405 194.703 167.902 1.00 63.45  ? 88   ALA A CB    1 
ATOM 443   N N     . VAL A 1 90  ? 203.037 197.032 169.302 1.00 43.64  ? 89   VAL A N     1 
ATOM 444   C CA    . VAL A 1 90  ? 202.098 197.660 170.221 1.00 48.15  ? 89   VAL A CA    1 
ATOM 445   C C     . VAL A 1 90  ? 201.106 198.508 169.450 1.00 49.84  ? 89   VAL A C     1 
ATOM 446   O O     . VAL A 1 90  ? 199.890 198.429 169.663 1.00 61.41  ? 89   VAL A O     1 
ATOM 447   C CB    . VAL A 1 90  ? 202.849 198.495 171.261 1.00 44.57  ? 89   VAL A CB    1 
ATOM 448   C CG1   . VAL A 1 90  ? 201.874 199.279 172.068 1.00 50.76  ? 89   VAL A CG1   1 
ATOM 449   C CG2   . VAL A 1 90  ? 203.630 197.587 172.144 1.00 42.45  ? 89   VAL A CG2   1 
ATOM 450   N N     . MET A 1 91  ? 201.612 199.311 168.516 1.00 54.51  ? 90   MET A N     1 
ATOM 451   C CA    . MET A 1 91  ? 200.728 200.054 167.632 1.00 56.26  ? 90   MET A CA    1 
ATOM 452   C C     . MET A 1 91  ? 199.698 199.142 167.000 1.00 58.47  ? 90   MET A C     1 
ATOM 453   O O     . MET A 1 91  ? 198.523 199.503 166.893 1.00 68.90  ? 90   MET A O     1 
ATOM 454   C CB    . MET A 1 91  ? 201.534 200.751 166.551 1.00 60.36  ? 90   MET A CB    1 
ATOM 455   C CG    . MET A 1 91  ? 202.436 201.801 167.094 1.00 71.64  ? 90   MET A CG    1 
ATOM 456   S SD    . MET A 1 91  ? 201.439 203.024 167.929 1.00 84.40  ? 90   MET A SD    1 
ATOM 457   C CE    . MET A 1 91  ? 200.537 203.650 166.525 1.00 220.68 ? 90   MET A CE    1 
ATOM 458   N N     . ALA A 1 92  ? 200.107 197.947 166.592 1.00 45.03  ? 91   ALA A N     1 
ATOM 459   C CA    . ALA A 1 92  ? 199.149 197.044 165.980 1.00 47.81  ? 91   ALA A CA    1 
ATOM 460   C C     . ALA A 1 92  ? 198.059 196.675 166.964 1.00 58.18  ? 91   ALA A C     1 
ATOM 461   O O     . ALA A 1 92  ? 196.870 196.848 166.684 1.00 59.43  ? 91   ALA A O     1 
ATOM 462   C CB    . ALA A 1 92  ? 199.847 195.801 165.454 1.00 37.98  ? 91   ALA A CB    1 
ATOM 463   N N     . LEU A 1 93  ? 198.445 196.189 168.140 1.00 55.53  ? 92   LEU A N     1 
ATOM 464   C CA    . LEU A 1 93  ? 197.437 195.798 169.115 1.00 56.94  ? 92   LEU A CA    1 
ATOM 465   C C     . LEU A 1 93  ? 196.458 196.920 169.375 1.00 58.89  ? 92   LEU A C     1 
ATOM 466   O O     . LEU A 1 93  ? 195.247 196.696 169.434 1.00 49.99  ? 92   LEU A O     1 
ATOM 467   C CB    . LEU A 1 93  ? 198.093 195.374 170.412 1.00 46.74  ? 92   LEU A CB    1 
ATOM 468   C CG    . LEU A 1 93  ? 198.846 194.082 170.217 1.00 52.26  ? 92   LEU A CG    1 
ATOM 469   C CD1   . LEU A 1 93  ? 199.525 193.693 171.489 1.00 38.19  ? 92   LEU A CD1   1 
ATOM 470   C CD2   . LEU A 1 93  ? 197.854 193.051 169.812 1.00 36.40  ? 92   LEU A CD2   1 
ATOM 471   N N     . GLN A 1 94  ? 196.958 198.139 169.517 1.00 42.88  ? 93   GLN A N     1 
ATOM 472   C CA    . GLN A 1 94  ? 196.050 199.257 169.706 1.00 39.15  ? 93   GLN A CA    1 
ATOM 473   C C     . GLN A 1 94  ? 195.111 199.402 168.520 1.00 49.31  ? 93   GLN A C     1 
ATOM 474   O O     . GLN A 1 94  ? 193.894 199.521 168.691 1.00 52.18  ? 93   GLN A O     1 
ATOM 475   C CB    . GLN A 1 94  ? 196.840 200.532 169.928 1.00 39.04  ? 93   GLN A CB    1 
ATOM 476   C CG    . GLN A 1 94  ? 195.968 201.698 170.201 1.00 53.84  ? 93   GLN A CG    1 
ATOM 477   C CD    . GLN A 1 94  ? 196.764 202.904 170.568 1.00 67.54  ? 93   GLN A CD    1 
ATOM 478   O OE1   . GLN A 1 94  ? 197.973 202.822 170.752 1.00 71.25  ? 93   GLN A OE1   1 
ATOM 479   N NE2   . GLN A 1 94  ? 196.101 204.046 170.661 1.00 69.51  ? 93   GLN A NE2   1 
ATOM 480   N N     . GLU A 1 95  ? 195.657 199.380 167.308 1.00 40.45  ? 94   GLU A N     1 
ATOM 481   C CA    . GLU A 1 95  ? 194.824 199.519 166.125 1.00 46.02  ? 94   GLU A CA    1 
ATOM 482   C C     . GLU A 1 95  ? 193.696 198.511 166.119 1.00 55.56  ? 94   GLU A C     1 
ATOM 483   O O     . GLU A 1 95  ? 192.525 198.867 165.984 1.00 55.59  ? 94   GLU A O     1 
ATOM 484   C CB    . GLU A 1 95  ? 195.657 199.347 164.872 1.00 58.70  ? 94   GLU A CB    1 
ATOM 485   C CG    . GLU A 1 95  ? 196.604 200.455 164.627 1.00 77.84  ? 94   GLU A CG    1 
ATOM 486   C CD    . GLU A 1 95  ? 195.898 201.774 164.522 1.00 82.74  ? 94   GLU A CD    1 
ATOM 487   O OE1   . GLU A 1 95  ? 194.745 201.791 164.042 1.00 83.02  ? 94   GLU A OE1   1 
ATOM 488   O OE2   . GLU A 1 95  ? 196.511 202.801 164.873 1.00 79.19  ? 94   GLU A OE2   1 
ATOM 489   N N     . ALA A 1 96  ? 194.036 197.235 166.244 1.00 50.07  ? 95   ALA A N     1 
ATOM 490   C CA    . ALA A 1 96  ? 193.002 196.215 166.211 1.00 55.56  ? 95   ALA A CA    1 
ATOM 491   C C     . ALA A 1 96  ? 192.016 196.409 167.344 1.00 60.94  ? 95   ALA A C     1 
ATOM 492   O O     . ALA A 1 96  ? 190.809 196.248 167.157 1.00 68.66  ? 95   ALA A O     1 
ATOM 493   C CB    . ALA A 1 96  ? 193.628 194.832 166.288 1.00 34.07  ? 95   ALA A CB    1 
ATOM 494   N N     . SER A 1 97  ? 192.512 196.760 168.523 1.00 48.72  ? 96   SER A N     1 
ATOM 495   C CA    . SER A 1 97  ? 191.656 196.954 169.679 1.00 48.23  ? 96   SER A CA    1 
ATOM 496   C C     . SER A 1 97  ? 190.601 197.999 169.391 1.00 52.51  ? 96   SER A C     1 
ATOM 497   O O     . SER A 1 97  ? 189.412 197.681 169.290 1.00 61.02  ? 96   SER A O     1 
ATOM 498   C CB    . SER A 1 97  ? 192.483 197.373 170.879 1.00 49.09  ? 96   SER A CB    1 
ATOM 499   O OG    . SER A 1 97  ? 193.402 196.357 171.201 1.00 59.00  ? 96   SER A OG    1 
ATOM 500   N N     . GLU A 1 98  ? 191.032 199.249 169.253 1.00 56.36  ? 97   GLU A N     1 
ATOM 501   C CA    . GLU A 1 98  ? 190.085 200.312 168.961 1.00 60.68  ? 97   GLU A CA    1 
ATOM 502   C C     . GLU A 1 98  ? 189.188 199.922 167.800 1.00 52.11  ? 97   GLU A C     1 
ATOM 503   O O     . GLU A 1 98  ? 187.959 199.970 167.903 1.00 52.37  ? 97   GLU A O     1 
ATOM 504   C CB    . GLU A 1 98  ? 190.831 201.612 168.674 1.00 53.52  ? 97   GLU A CB    1 
ATOM 505   C CG    . GLU A 1 98  ? 191.496 202.207 169.912 1.00 63.79  ? 97   GLU A CG    1 
ATOM 506   C CD    . GLU A 1 98  ? 192.261 203.501 169.634 1.00 84.89  ? 97   GLU A CD    1 
ATOM 507   O OE1   . GLU A 1 98  ? 192.492 203.821 168.449 1.00 86.82  ? 97   GLU A OE1   1 
ATOM 508   O OE2   . GLU A 1 98  ? 192.616 204.213 170.604 1.00 88.88  ? 97   GLU A OE2   1 
ATOM 509   N N     . ALA A 1 99  ? 189.783 199.440 166.718 1.00 40.97  ? 98   ALA A N     1 
ATOM 510   C CA    . ALA A 1 99  ? 188.998 199.069 165.555 1.00 44.17  ? 98   ALA A CA    1 
ATOM 511   C C     . ALA A 1 99  ? 188.057 197.914 165.824 1.00 58.18  ? 98   ALA A C     1 
ATOM 512   O O     . ALA A 1 99  ? 187.245 197.584 164.958 1.00 52.16  ? 98   ALA A O     1 
ATOM 513   C CB    . ALA A 1 99  ? 189.920 198.715 164.404 1.00 33.66  ? 98   ALA A CB    1 
ATOM 514   N N     . TYR A 1 100 ? 188.157 197.283 166.984 1.00 53.73  ? 99   TYR A N     1 
ATOM 515   C CA    . TYR A 1 100 ? 187.220 196.252 167.391 1.00 51.04  ? 99   TYR A CA    1 
ATOM 516   C C     . TYR A 1 100 ? 186.123 196.831 168.269 1.00 48.74  ? 99   TYR A C     1 
ATOM 517   O O     . TYR A 1 100 ? 184.941 196.766 167.915 1.00 53.47  ? 99   TYR A O     1 
ATOM 518   C CB    . TYR A 1 100 ? 187.968 195.124 168.091 1.00 54.74  ? 99   TYR A CB    1 
ATOM 519   C CG    . TYR A 1 100 ? 187.101 194.130 168.790 1.00 42.61  ? 99   TYR A CG    1 
ATOM 520   C CD1   . TYR A 1 100 ? 186.193 193.365 168.092 1.00 35.99  ? 99   TYR A CD1   1 
ATOM 521   C CD2   . TYR A 1 100 ? 187.273 193.877 170.133 1.00 50.88  ? 99   TYR A CD2   1 
ATOM 522   C CE1   . TYR A 1 100 ? 185.422 192.434 168.731 1.00 46.22  ? 99   TYR A CE1   1 
ATOM 523   C CE2   . TYR A 1 100 ? 186.523 192.943 170.778 1.00 47.30  ? 99   TYR A CE2   1 
ATOM 524   C CZ    . TYR A 1 100 ? 185.596 192.223 170.076 1.00 47.75  ? 99   TYR A CZ    1 
ATOM 525   O OH    . TYR A 1 100 ? 184.839 191.287 170.729 1.00 57.71  ? 99   TYR A OH    1 
ATOM 526   N N     . LEU A 1 101 ? 186.500 197.406 169.408 1.00 48.86  ? 100  LEU A N     1 
ATOM 527   C CA    . LEU A 1 101 ? 185.505 198.032 170.261 1.00 53.59  ? 100  LEU A CA    1 
ATOM 528   C C     . LEU A 1 101 ? 184.577 198.925 169.468 1.00 56.82  ? 100  LEU A C     1 
ATOM 529   O O     . LEU A 1 101 ? 183.376 198.960 169.731 1.00 50.85  ? 100  LEU A O     1 
ATOM 530   C CB    . LEU A 1 101 ? 186.173 198.835 171.359 1.00 48.76  ? 100  LEU A CB    1 
ATOM 531   C CG    . LEU A 1 101 ? 186.898 197.933 172.323 1.00 56.95  ? 100  LEU A CG    1 
ATOM 532   C CD1   . LEU A 1 101 ? 187.518 198.758 173.410 1.00 62.84  ? 100  LEU A CD1   1 
ATOM 533   C CD2   . LEU A 1 101 ? 185.901 196.979 172.876 1.00 53.80  ? 100  LEU A CD2   1 
ATOM 534   N N     . VAL A 1 102 ? 185.105 199.646 168.485 1.00 48.99  ? 101  VAL A N     1 
ATOM 535   C CA    . VAL A 1 102 ? 184.246 200.526 167.708 1.00 55.02  ? 101  VAL A CA    1 
ATOM 536   C C     . VAL A 1 102 ? 183.095 199.743 167.106 1.00 53.14  ? 101  VAL A C     1 
ATOM 537   O O     . VAL A 1 102 ? 181.926 200.017 167.388 1.00 52.39  ? 101  VAL A O     1 
ATOM 538   C CB    . VAL A 1 102 ? 185.043 201.249 166.621 1.00 53.72  ? 101  VAL A CB    1 
ATOM 539   C CG1   . VAL A 1 102 ? 184.094 201.947 165.712 1.00 54.55  ? 101  VAL A CG1   1 
ATOM 540   C CG2   . VAL A 1 102 ? 185.944 202.250 167.252 1.00 36.88  ? 101  VAL A CG2   1 
ATOM 541   N N     . GLY A 1 103 ? 183.406 198.738 166.290 1.00 46.50  ? 102  GLY A N     1 
ATOM 542   C CA    . GLY A 1 103 ? 182.344 197.955 165.673 1.00 38.79  ? 102  GLY A CA    1 
ATOM 543   C C     . GLY A 1 103 ? 181.415 197.392 166.728 1.00 45.22  ? 102  GLY A C     1 
ATOM 544   O O     . GLY A 1 103 ? 180.187 197.378 166.554 1.00 47.29  ? 102  GLY A O     1 
ATOM 545   N N     . LEU A 1 104 ? 181.984 196.958 167.848 1.00 45.62  ? 103  LEU A N     1 
ATOM 546   C CA    . LEU A 1 104 ? 181.164 196.454 168.937 1.00 47.63  ? 103  LEU A CA    1 
ATOM 547   C C     . LEU A 1 104 ? 180.114 197.475 169.346 1.00 53.32  ? 103  LEU A C     1 
ATOM 548   O O     . LEU A 1 104 ? 178.924 197.161 169.428 1.00 45.91  ? 103  LEU A O     1 
ATOM 549   C CB    . LEU A 1 104 ? 182.047 196.097 170.121 1.00 49.20  ? 103  LEU A CB    1 
ATOM 550   C CG    . LEU A 1 104 ? 181.243 195.539 171.270 1.00 42.65  ? 103  LEU A CG    1 
ATOM 551   C CD1   . LEU A 1 104 ? 180.599 194.301 170.760 1.00 48.34  ? 103  LEU A CD1   1 
ATOM 552   C CD2   . LEU A 1 104 ? 182.132 195.222 172.433 1.00 38.41  ? 103  LEU A CD2   1 
ATOM 553   N N     . PHE A 1 105 ? 180.535 198.716 169.583 1.00 51.08  ? 104  PHE A N     1 
ATOM 554   C CA    . PHE A 1 105 ? 179.593 199.743 170.001 1.00 49.53  ? 104  PHE A CA    1 
ATOM 555   C C     . PHE A 1 105 ? 178.606 200.086 168.905 1.00 53.72  ? 104  PHE A C     1 
ATOM 556   O O     . PHE A 1 105 ? 177.451 200.401 169.193 1.00 50.18  ? 104  PHE A O     1 
ATOM 557   C CB    . PHE A 1 105 ? 180.335 200.980 170.462 1.00 47.41  ? 104  PHE A CB    1 
ATOM 558   C CG    . PHE A 1 105 ? 180.886 200.848 171.820 1.00 58.15  ? 104  PHE A CG    1 
ATOM 559   C CD1   . PHE A 1 105 ? 180.322 199.968 172.698 1.00 59.89  ? 104  PHE A CD1   1 
ATOM 560   C CD2   . PHE A 1 105 ? 181.962 201.589 172.227 1.00 54.59  ? 104  PHE A CD2   1 
ATOM 561   C CE1   . PHE A 1 105 ? 180.811 199.838 173.958 1.00 53.48  ? 104  PHE A CE1   1 
ATOM 562   C CE2   . PHE A 1 105 ? 182.458 201.457 173.490 1.00 55.70  ? 104  PHE A CE2   1 
ATOM 563   C CZ    . PHE A 1 105 ? 181.882 200.579 174.355 1.00 49.41  ? 104  PHE A CZ    1 
ATOM 564   N N     . GLU A 1 106 ? 179.030 200.053 167.647 1.00 48.87  ? 105  GLU A N     1 
ATOM 565   C CA    . GLU A 1 106 ? 178.056 200.172 166.573 1.00 45.81  ? 105  GLU A CA    1 
ATOM 566   C C     . GLU A 1 106 ? 176.923 199.182 166.769 1.00 55.60  ? 105  GLU A C     1 
ATOM 567   O O     . GLU A 1 106 ? 175.760 199.563 166.959 1.00 60.35  ? 105  GLU A O     1 
ATOM 568   C CB    . GLU A 1 106 ? 178.720 199.948 165.224 1.00 49.24  ? 105  GLU A CB    1 
ATOM 569   C CG    . GLU A 1 106 ? 179.530 201.109 164.728 1.00 74.30  ? 105  GLU A CG    1 
ATOM 570   C CD    . GLU A 1 106 ? 180.278 200.775 163.453 1.00 97.39  ? 105  GLU A CD    1 
ATOM 571   O OE1   . GLU A 1 106 ? 180.432 199.572 163.152 1.00 101.44 ? 105  GLU A OE1   1 
ATOM 572   O OE2   . GLU A 1 106 ? 180.685 201.714 162.735 1.00 99.64  ? 105  GLU A OE2   1 
ATOM 573   N N     . ASP A 1 107 ? 177.251 197.896 166.739 1.00 53.54  ? 106  ASP A N     1 
ATOM 574   C CA    . ASP A 1 107 ? 176.203 196.888 166.795 1.00 56.85  ? 106  ASP A CA    1 
ATOM 575   C C     . ASP A 1 107 ? 175.382 197.020 168.070 1.00 58.00  ? 106  ASP A C     1 
ATOM 576   O O     . ASP A 1 107 ? 174.144 197.044 168.029 1.00 65.56  ? 106  ASP A O     1 
ATOM 577   C CB    . ASP A 1 107 ? 176.825 195.508 166.679 1.00 61.19  ? 106  ASP A CB    1 
ATOM 578   C CG    . ASP A 1 107 ? 177.471 195.288 165.336 1.00 75.73  ? 106  ASP A CG    1 
ATOM 579   O OD1   . ASP A 1 107 ? 177.239 196.119 164.436 1.00 88.07  ? 106  ASP A OD1   1 
ATOM 580   O OD2   . ASP A 1 107 ? 178.191 194.283 165.168 1.00 67.26  ? 106  ASP A OD2   1 
ATOM 581   N N     . THR A 1 108 ? 176.056 197.134 169.212 1.00 53.28  ? 107  THR A N     1 
ATOM 582   C CA    . THR A 1 108 ? 175.351 197.356 170.463 1.00 57.28  ? 107  THR A CA    1 
ATOM 583   C C     . THR A 1 108 ? 174.333 198.462 170.317 1.00 55.40  ? 107  THR A C     1 
ATOM 584   O O     . THR A 1 108 ? 173.155 198.290 170.639 1.00 59.93  ? 107  THR A O     1 
ATOM 585   C CB    . THR A 1 108 ? 176.335 197.719 171.555 1.00 54.98  ? 107  THR A CB    1 
ATOM 586   O OG1   . THR A 1 108 ? 177.188 196.606 171.808 1.00 54.54  ? 107  THR A OG1   1 
ATOM 587   C CG2   . THR A 1 108 ? 175.598 198.070 172.796 1.00 47.59  ? 107  THR A CG2   1 
ATOM 588   N N     . ASN A 1 109 ? 174.772 199.598 169.796 1.00 54.50  ? 108  ASN A N     1 
ATOM 589   C CA    . ASN A 1 109 ? 173.859 200.699 169.565 1.00 56.56  ? 108  ASN A CA    1 
ATOM 590   C C     . ASN A 1 109 ? 172.656 200.251 168.761 1.00 66.72  ? 108  ASN A C     1 
ATOM 591   O O     . ASN A 1 109 ? 171.523 200.630 169.073 1.00 69.72  ? 108  ASN A O     1 
ATOM 592   C CB    . ASN A 1 109 ? 174.580 201.826 168.855 1.00 58.55  ? 108  ASN A CB    1 
ATOM 593   C CG    . ASN A 1 109 ? 173.754 203.056 168.779 1.00 61.75  ? 108  ASN A CG    1 
ATOM 594   O OD1   . ASN A 1 109 ? 172.912 203.290 169.632 1.00 44.13  ? 108  ASN A OD1   1 
ATOM 595   N ND2   . ASN A 1 109 ? 173.982 203.864 167.758 1.00 71.61  ? 108  ASN A ND2   1 
ATOM 596   N N     . LEU A 1 110 ? 172.869 199.428 167.735 1.00 63.28  ? 109  LEU A N     1 
ATOM 597   C CA    . LEU A 1 110 ? 171.719 198.895 167.016 1.00 67.02  ? 109  LEU A CA    1 
ATOM 598   C C     . LEU A 1 110 ? 170.775 198.165 167.950 1.00 71.23  ? 109  LEU A C     1 
ATOM 599   O O     . LEU A 1 110 ? 169.553 198.297 167.840 1.00 78.44  ? 109  LEU A O     1 
ATOM 600   C CB    . LEU A 1 110 ? 172.157 197.976 165.891 1.00 59.49  ? 109  LEU A CB    1 
ATOM 601   C CG    . LEU A 1 110 ? 172.676 198.792 164.735 1.00 54.41  ? 109  LEU A CG    1 
ATOM 602   C CD1   . LEU A 1 110 ? 173.215 197.884 163.681 1.00 46.64  ? 109  LEU A CD1   1 
ATOM 603   C CD2   . LEU A 1 110 ? 171.513 199.581 164.208 1.00 36.80  ? 109  LEU A CD2   1 
ATOM 604   N N     . CYS A 1 111 ? 171.318 197.398 168.890 1.00 61.59  ? 110  CYS A N     1 
ATOM 605   C CA    . CYS A 1 111 ? 170.440 196.692 169.813 1.00 62.37  ? 110  CYS A CA    1 
ATOM 606   C C     . CYS A 1 111 ? 169.660 197.667 170.679 1.00 64.73  ? 110  CYS A C     1 
ATOM 607   O O     . CYS A 1 111 ? 168.428 197.613 170.747 1.00 69.88  ? 110  CYS A O     1 
ATOM 608   C CB    . CYS A 1 111 ? 171.241 195.727 170.672 1.00 57.07  ? 110  CYS A CB    1 
ATOM 609   S SG    . CYS A 1 111 ? 171.897 194.354 169.736 1.00 53.57  ? 110  CYS A SG    1 
ATOM 610   N N     . ALA A 1 112 ? 170.364 198.571 171.351 1.00 56.60  ? 111  ALA A N     1 
ATOM 611   C CA    . ALA A 1 112 ? 169.680 199.503 172.229 1.00 56.30  ? 111  ALA A CA    1 
ATOM 612   C C     . ALA A 1 112 ? 168.574 200.229 171.493 1.00 71.10  ? 111  ALA A C     1 
ATOM 613   O O     . ALA A 1 112 ? 167.464 200.368 172.012 1.00 84.01  ? 111  ALA A O     1 
ATOM 614   C CB    . ALA A 1 112 ? 170.670 200.495 172.815 1.00 52.75  ? 111  ALA A CB    1 
ATOM 615   N N     . ILE A 1 113 ? 168.842 200.675 170.268 1.00 61.12  ? 112  ILE A N     1 
ATOM 616   C CA    . ILE A 1 113 ? 167.785 201.304 169.485 1.00 60.59  ? 112  ILE A CA    1 
ATOM 617   C C     . ILE A 1 113 ? 166.645 200.335 169.257 1.00 65.61  ? 112  ILE A C     1 
ATOM 618   O O     . ILE A 1 113 ? 165.470 200.701 169.351 1.00 68.14  ? 112  ILE A O     1 
ATOM 619   C CB    . ILE A 1 113 ? 168.334 201.832 168.156 1.00 55.93  ? 112  ILE A CB    1 
ATOM 620   C CG1   . ILE A 1 113 ? 169.200 203.050 168.411 1.00 53.54  ? 112  ILE A CG1   1 
ATOM 621   C CG2   . ILE A 1 113 ? 167.207 202.158 167.218 1.00 41.82  ? 112  ILE A CG2   1 
ATOM 622   C CD1   . ILE A 1 113 ? 169.928 203.508 167.208 1.00 52.63  ? 112  ILE A CD1   1 
ATOM 623   N N     . HIS A 1 114 ? 166.965 199.084 168.958 1.00 63.90  ? 113  HIS A N     1 
ATOM 624   C CA    . HIS A 1 114 ? 165.907 198.105 168.811 1.00 60.29  ? 113  HIS A CA    1 
ATOM 625   C C     . HIS A 1 114 ? 165.037 198.022 170.045 1.00 62.96  ? 113  HIS A C     1 
ATOM 626   O O     . HIS A 1 114 ? 163.855 197.698 169.935 1.00 71.40  ? 113  HIS A O     1 
ATOM 627   C CB    . HIS A 1 114 ? 166.488 196.736 168.531 1.00 60.33  ? 113  HIS A CB    1 
ATOM 628   C CG    . HIS A 1 114 ? 165.453 195.684 168.350 1.00 66.94  ? 113  HIS A CG    1 
ATOM 629   N ND1   . HIS A 1 114 ? 164.592 195.672 167.277 1.00 71.63  ? 113  HIS A ND1   1 
ATOM 630   C CD2   . HIS A 1 114 ? 165.108 194.632 169.124 1.00 71.44  ? 113  HIS A CD2   1 
ATOM 631   C CE1   . HIS A 1 114 ? 163.781 194.638 167.381 1.00 72.23  ? 113  HIS A CE1   1 
ATOM 632   N NE2   . HIS A 1 114 ? 164.070 193.993 168.495 1.00 73.60  ? 113  HIS A NE2   1 
ATOM 633   N N     . ALA A 1 115 ? 165.584 198.324 171.211 1.00 59.45  ? 114  ALA A N     1 
ATOM 634   C CA    . ALA A 1 115 ? 164.834 198.236 172.452 1.00 60.34  ? 114  ALA A CA    1 
ATOM 635   C C     . ALA A 1 115 ? 164.075 199.507 172.764 1.00 71.45  ? 114  ALA A C     1 
ATOM 636   O O     . ALA A 1 115 ? 163.526 199.631 173.860 1.00 77.22  ? 114  ALA A O     1 
ATOM 637   C CB    . ALA A 1 115 ? 165.764 197.900 173.616 1.00 66.17  ? 114  ALA A CB    1 
ATOM 638   N N     . LYS A 1 116 ? 164.068 200.466 171.848 1.00 69.83  ? 115  LYS A N     1 
ATOM 639   C CA    . LYS A 1 116 ? 163.412 201.748 172.064 1.00 73.27  ? 115  LYS A CA    1 
ATOM 640   C C     . LYS A 1 116 ? 164.022 202.489 173.241 1.00 80.67  ? 115  LYS A C     1 
ATOM 641   O O     . LYS A 1 116 ? 163.374 203.317 173.874 1.00 81.57  ? 115  LYS A O     1 
ATOM 642   C CB    . LYS A 1 116 ? 161.910 201.576 172.257 1.00 76.11  ? 115  LYS A CB    1 
ATOM 643   C CG    . LYS A 1 116 ? 161.224 201.037 171.035 1.00 87.36  ? 115  LYS A CG    1 
ATOM 644   C CD    . LYS A 1 116 ? 159.746 200.893 171.273 1.00 101.88 ? 115  LYS A CD    1 
ATOM 645   C CE    . LYS A 1 116 ? 159.068 200.321 170.057 1.00 104.56 ? 115  LYS A CE    1 
ATOM 646   N NZ    . LYS A 1 116 ? 159.230 201.233 168.900 1.00 99.81  ? 115  LYS A NZ    1 
ATOM 647   N N     . ARG A 1 117 ? 165.269 202.184 173.546 1.00 80.70  ? 116  ARG A N     1 
ATOM 648   C CA    . ARG A 1 117 ? 166.072 202.996 174.434 1.00 77.30  ? 116  ARG A CA    1 
ATOM 649   C C     . ARG A 1 117 ? 167.165 203.643 173.608 1.00 82.15  ? 116  ARG A C     1 
ATOM 650   O O     . ARG A 1 117 ? 167.585 203.103 172.585 1.00 89.45  ? 116  ARG A O     1 
ATOM 651   C CB    . ARG A 1 117 ? 166.691 202.168 175.545 1.00 74.19  ? 116  ARG A CB    1 
ATOM 652   C CG    . ARG A 1 117 ? 165.680 201.555 176.460 1.00 81.61  ? 116  ARG A CG    1 
ATOM 653   C CD    . ARG A 1 117 ? 166.336 200.813 177.597 1.00 80.86  ? 116  ARG A CD    1 
ATOM 654   N NE    . ARG A 1 117 ? 167.131 199.690 177.131 1.00 84.92  ? 116  ARG A NE    1 
ATOM 655   C CZ    . ARG A 1 117 ? 168.451 199.714 177.052 1.00 80.86  ? 116  ARG A CZ    1 
ATOM 656   N NH1   . ARG A 1 117 ? 169.103 200.800 177.415 1.00 80.71  ? 116  ARG A NH1   1 
ATOM 657   N NH2   . ARG A 1 117 ? 169.115 198.658 176.623 1.00 69.86  ? 116  ARG A NH2   1 
ATOM 658   N N     . VAL A 1 118 ? 167.606 204.820 174.031 1.00 69.56  ? 117  VAL A N     1 
ATOM 659   C CA    . VAL A 1 118 ? 168.713 205.482 173.370 1.00 69.64  ? 117  VAL A CA    1 
ATOM 660   C C     . VAL A 1 118 ? 170.024 205.266 174.103 1.00 72.45  ? 117  VAL A C     1 
ATOM 661   O O     . VAL A 1 118 ? 171.048 205.810 173.696 1.00 72.82  ? 117  VAL A O     1 
ATOM 662   C CB    . VAL A 1 118 ? 168.430 206.969 173.206 1.00 59.47  ? 117  VAL A CB    1 
ATOM 663   C CG1   . VAL A 1 118 ? 167.216 207.145 172.346 1.00 53.73  ? 117  VAL A CG1   1 
ATOM 664   C CG2   . VAL A 1 118 ? 168.217 207.578 174.557 1.00 52.65  ? 117  VAL A CG2   1 
ATOM 665   N N     . THR A 1 119 ? 170.016 204.501 175.183 1.00 68.33  ? 118  THR A N     1 
ATOM 666   C CA    . THR A 1 119 ? 171.186 204.334 176.025 1.00 72.85  ? 118  THR A CA    1 
ATOM 667   C C     . THR A 1 119 ? 171.617 202.881 176.054 1.00 74.46  ? 118  THR A C     1 
ATOM 668   O O     . THR A 1 119 ? 170.870 202.019 176.520 1.00 84.52  ? 118  THR A O     1 
ATOM 669   C CB    . THR A 1 119 ? 170.901 204.788 177.441 1.00 73.71  ? 118  THR A CB    1 
ATOM 670   O OG1   . THR A 1 119 ? 170.596 206.184 177.433 1.00 70.57  ? 118  THR A OG1   1 
ATOM 671   C CG2   . THR A 1 119 ? 172.102 204.527 178.326 1.00 72.24  ? 118  THR A CG2   1 
ATOM 672   N N     . ILE A 1 120 ? 172.820 202.610 175.583 1.00 62.38  ? 119  ILE A N     1 
ATOM 673   C CA    . ILE A 1 120 ? 173.356 201.258 175.601 1.00 68.13  ? 119  ILE A CA    1 
ATOM 674   C C     . ILE A 1 120 ? 173.559 200.850 177.047 1.00 76.11  ? 119  ILE A C     1 
ATOM 675   O O     . ILE A 1 120 ? 173.750 201.703 177.917 1.00 71.50  ? 119  ILE A O     1 
ATOM 676   C CB    . ILE A 1 120 ? 174.668 201.164 174.814 1.00 56.41  ? 119  ILE A CB    1 
ATOM 677   C CG1   . ILE A 1 120 ? 175.739 201.975 175.505 1.00 58.83  ? 119  ILE A CG1   1 
ATOM 678   C CG2   . ILE A 1 120 ? 174.481 201.715 173.440 1.00 48.40  ? 119  ILE A CG2   1 
ATOM 679   C CD1   . ILE A 1 120 ? 177.081 201.768 174.909 1.00 47.31  ? 119  ILE A CD1   1 
ATOM 680   N N     . MET A 1 121 ? 173.501 199.557 177.312 1.00 72.37  ? 120  MET A N     1 
ATOM 681   C CA    . MET A 1 121 ? 173.569 199.009 178.655 1.00 65.29  ? 120  MET A CA    1 
ATOM 682   C C     . MET A 1 121 ? 174.297 197.681 178.631 1.00 63.21  ? 120  MET A C     1 
ATOM 683   O O     . MET A 1 121 ? 174.330 197.004 177.601 1.00 71.89  ? 120  MET A O     1 
ATOM 684   C CB    . MET A 1 121 ? 172.164 198.812 179.229 1.00 74.65  ? 120  MET A CB    1 
ATOM 685   C CG    . MET A 1 121 ? 171.448 200.081 179.543 1.00 77.63  ? 120  MET A CG    1 
ATOM 686   S SD    . MET A 1 121 ? 169.790 199.693 180.095 1.00 102.77 ? 120  MET A SD    1 
ATOM 687   C CE    . MET A 1 121 ? 170.175 198.878 181.636 1.00 79.51  ? 120  MET A CE    1 
ATOM 688   N N     . PRO A 1 122 ? 174.880 197.268 179.754 1.00 62.53  ? 121  PRO A N     1 
ATOM 689   C CA    . PRO A 1 122 ? 175.652 196.022 179.750 1.00 62.34  ? 121  PRO A CA    1 
ATOM 690   C C     . PRO A 1 122 ? 174.910 194.859 179.129 1.00 67.91  ? 121  PRO A C     1 
ATOM 691   O O     . PRO A 1 122 ? 175.491 194.108 178.336 1.00 65.82  ? 121  PRO A O     1 
ATOM 692   C CB    . PRO A 1 122 ? 175.926 195.790 181.235 1.00 46.87  ? 121  PRO A CB    1 
ATOM 693   C CG    . PRO A 1 122 ? 175.933 197.126 181.799 1.00 65.83  ? 121  PRO A CG    1 
ATOM 694   C CD    . PRO A 1 122 ? 174.873 197.885 181.085 1.00 65.68  ? 121  PRO A CD    1 
ATOM 695   N N     . LYS A 1 123 ? 173.624 194.708 179.428 1.00 68.72  ? 122  LYS A N     1 
ATOM 696   C CA    . LYS A 1 123 ? 172.893 193.615 178.812 1.00 71.37  ? 122  LYS A CA    1 
ATOM 697   C C     . LYS A 1 123 ? 172.864 193.756 177.302 1.00 70.78  ? 122  LYS A C     1 
ATOM 698   O O     . LYS A 1 123 ? 172.810 192.750 176.591 1.00 75.41  ? 122  LYS A O     1 
ATOM 699   C CB    . LYS A 1 123 ? 171.480 193.534 179.365 1.00 78.15  ? 122  LYS A CB    1 
ATOM 700   C CG    . LYS A 1 123 ? 170.615 194.723 179.061 1.00 76.69  ? 122  LYS A CG    1 
ATOM 701   C CD    . LYS A 1 123 ? 169.239 194.518 179.658 1.00 84.17  ? 122  LYS A CD    1 
ATOM 702   C CE    . LYS A 1 123 ? 168.332 195.691 179.391 1.00 99.96  ? 122  LYS A CE    1 
ATOM 703   N NZ    . LYS A 1 123 ? 166.985 195.458 179.965 1.00 109.14 ? 122  LYS A NZ    1 
ATOM 704   N N     . ASP A 1 124 ? 172.926 194.982 176.789 1.00 70.35  ? 123  ASP A N     1 
ATOM 705   C CA    . ASP A 1 124 ? 172.963 195.158 175.345 1.00 63.53  ? 123  ASP A CA    1 
ATOM 706   C C     . ASP A 1 124 ? 174.217 194.539 174.764 1.00 69.63  ? 123  ASP A C     1 
ATOM 707   O O     . ASP A 1 124 ? 174.148 193.684 173.874 1.00 66.71  ? 123  ASP A O     1 
ATOM 708   C CB    . ASP A 1 124 ? 172.898 196.633 175.001 1.00 57.46  ? 123  ASP A CB    1 
ATOM 709   C CG    . ASP A 1 124 ? 171.635 197.259 175.475 1.00 69.07  ? 123  ASP A CG    1 
ATOM 710   O OD1   . ASP A 1 124 ? 170.708 196.492 175.784 1.00 81.63  ? 123  ASP A OD1   1 
ATOM 711   O OD2   . ASP A 1 124 ? 171.564 198.500 175.568 1.00 63.15  ? 123  ASP A OD2   1 
ATOM 712   N N     . ILE A 1 125 ? 175.378 194.959 175.258 1.00 70.54  ? 124  ILE A N     1 
ATOM 713   C CA    . ILE A 1 125 ? 176.630 194.374 174.797 1.00 65.13  ? 124  ILE A CA    1 
ATOM 714   C C     . ILE A 1 125 ? 176.570 192.863 174.897 1.00 66.47  ? 124  ILE A C     1 
ATOM 715   O O     . ILE A 1 125 ? 176.829 192.145 173.927 1.00 69.74  ? 124  ILE A O     1 
ATOM 716   C CB    . ILE A 1 125 ? 177.814 194.932 175.593 1.00 58.41  ? 124  ILE A CB    1 
ATOM 717   C CG1   . ILE A 1 125 ? 178.127 196.339 175.132 1.00 60.64  ? 124  ILE A CG1   1 
ATOM 718   C CG2   . ILE A 1 125 ? 179.001 194.049 175.443 1.00 45.28  ? 124  ILE A CG2   1 
ATOM 719   C CD1   . ILE A 1 125 ? 179.178 196.980 175.955 1.00 65.32  ? 124  ILE A CD1   1 
ATOM 720   N N     . GLN A 1 126 ? 176.208 192.361 176.072 1.00 70.93  ? 125  GLN A N     1 
ATOM 721   C CA    . GLN A 1 126 ? 176.134 190.920 176.249 1.00 67.54  ? 125  GLN A CA    1 
ATOM 722   C C     . GLN A 1 126 ? 175.295 190.280 175.161 1.00 65.80  ? 125  GLN A C     1 
ATOM 723   O O     . GLN A 1 126 ? 175.670 189.241 174.607 1.00 64.36  ? 125  GLN A O     1 
ATOM 724   C CB    . GLN A 1 126 ? 175.584 190.615 177.629 1.00 63.24  ? 125  GLN A CB    1 
ATOM 725   C CG    . GLN A 1 126 ? 176.538 191.066 178.695 1.00 71.45  ? 125  GLN A CG    1 
ATOM 726   C CD    . GLN A 1 126 ? 175.954 190.976 180.073 1.00 87.55  ? 125  GLN A CD    1 
ATOM 727   O OE1   . GLN A 1 126 ? 174.737 191.004 180.245 1.00 89.97  ? 125  GLN A OE1   1 
ATOM 728   N NE2   . GLN A 1 126 ? 176.816 190.885 181.074 1.00 87.56  ? 125  GLN A NE2   1 
ATOM 729   N N     . LEU A 1 127 ? 174.188 190.915 174.792 1.00 67.21  ? 126  LEU A N     1 
ATOM 730   C CA    . LEU A 1 127 ? 173.433 190.427 173.650 1.00 59.56  ? 126  LEU A CA    1 
ATOM 731   C C     . LEU A 1 127 ? 174.287 190.419 172.397 1.00 61.46  ? 126  LEU A C     1 
ATOM 732   O O     . LEU A 1 127 ? 174.276 189.451 171.637 1.00 63.65  ? 126  LEU A O     1 
ATOM 733   C CB    . LEU A 1 127 ? 172.193 191.270 173.419 1.00 45.23  ? 126  LEU A CB    1 
ATOM 734   C CG    . LEU A 1 127 ? 171.522 190.836 172.125 1.00 47.14  ? 126  LEU A CG    1 
ATOM 735   C CD1   . LEU A 1 127 ? 171.058 189.420 172.256 1.00 59.87  ? 126  LEU A CD1   1 
ATOM 736   C CD2   . LEU A 1 127 ? 170.368 191.730 171.799 1.00 48.77  ? 126  LEU A CD2   1 
ATOM 737   N N     . ALA A 1 128 ? 175.031 191.492 172.155 1.00 56.45  ? 127  ALA A N     1 
ATOM 738   C CA    . ALA A 1 128 ? 175.810 191.556 170.925 1.00 55.56  ? 127  ALA A CA    1 
ATOM 739   C C     . ALA A 1 128 ? 176.815 190.418 170.853 1.00 59.49  ? 127  ALA A C     1 
ATOM 740   O O     . ALA A 1 128 ? 176.809 189.621 169.907 1.00 59.12  ? 127  ALA A O     1 
ATOM 741   C CB    . ALA A 1 128 ? 176.516 192.897 170.820 1.00 47.29  ? 127  ALA A CB    1 
ATOM 742   N N     . ARG A 1 129 ? 177.671 190.309 171.863 1.00 50.40  ? 128  ARG A N     1 
ATOM 743   C CA    . ARG A 1 129 ? 178.670 189.253 171.853 1.00 53.14  ? 128  ARG A CA    1 
ATOM 744   C C     . ARG A 1 129 ? 178.013 187.884 171.817 1.00 56.31  ? 128  ARG A C     1 
ATOM 745   O O     . ARG A 1 129 ? 178.620 186.905 171.377 1.00 50.52  ? 128  ARG A O     1 
ATOM 746   C CB    . ARG A 1 129 ? 179.579 189.380 173.066 1.00 43.19  ? 128  ARG A CB    1 
ATOM 747   C CG    . ARG A 1 129 ? 180.258 190.705 173.123 1.00 53.84  ? 128  ARG A CG    1 
ATOM 748   C CD    . ARG A 1 129 ? 181.183 190.822 174.307 1.00 68.66  ? 128  ARG A CD    1 
ATOM 749   N NE    . ARG A 1 129 ? 182.365 189.992 174.157 1.00 66.88  ? 128  ARG A NE    1 
ATOM 750   C CZ    . ARG A 1 129 ? 182.635 188.951 174.924 1.00 61.68  ? 128  ARG A CZ    1 
ATOM 751   N NH1   . ARG A 1 129 ? 181.807 188.625 175.899 1.00 54.73  ? 128  ARG A NH1   1 
ATOM 752   N NH2   . ARG A 1 129 ? 183.734 188.244 174.723 1.00 60.09  ? 128  ARG A NH2   1 
ATOM 753   N N     . ARG A 1 130 ? 176.767 187.791 172.268 1.00 55.04  ? 129  ARG A N     1 
ATOM 754   C CA    . ARG A 1 130 ? 176.062 186.527 172.118 1.00 57.43  ? 129  ARG A CA    1 
ATOM 755   C C     . ARG A 1 130 ? 175.653 186.274 170.682 1.00 58.52  ? 129  ARG A C     1 
ATOM 756   O O     . ARG A 1 130 ? 175.830 185.166 170.177 1.00 74.65  ? 129  ARG A O     1 
ATOM 757   C CB    . ARG A 1 130 ? 174.836 186.499 173.011 1.00 61.64  ? 129  ARG A CB    1 
ATOM 758   C CG    . ARG A 1 130 ? 173.911 185.338 172.754 1.00 60.35  ? 129  ARG A CG    1 
ATOM 759   C CD    . ARG A 1 130 ? 174.553 184.004 173.015 1.00 65.52  ? 129  ARG A CD    1 
ATOM 760   N NE    . ARG A 1 130 ? 173.580 182.926 172.850 1.00 87.78  ? 129  ARG A NE    1 
ATOM 761   C CZ    . ARG A 1 130 ? 173.293 182.337 171.693 1.00 84.82  ? 129  ARG A CZ    1 
ATOM 762   N NH1   . ARG A 1 130 ? 173.907 182.714 170.582 1.00 66.73  ? 129  ARG A NH1   1 
ATOM 763   N NH2   . ARG A 1 130 ? 172.388 181.369 171.645 1.00 88.06  ? 129  ARG A NH2   1 
ATOM 764   N N     . ILE A 1 131 ? 175.091 187.271 170.014 1.00 51.69  ? 130  ILE A N     1 
ATOM 765   C CA    . ILE A 1 131 ? 174.644 187.062 168.649 1.00 59.57  ? 130  ILE A CA    1 
ATOM 766   C C     . ILE A 1 131 ? 175.809 186.722 167.752 1.00 57.31  ? 130  ILE A C     1 
ATOM 767   O O     . ILE A 1 131 ? 175.757 185.744 167.005 1.00 59.56  ? 130  ILE A O     1 
ATOM 768   C CB    . ILE A 1 131 ? 173.891 188.288 168.128 1.00 58.92  ? 130  ILE A CB    1 
ATOM 769   C CG1   . ILE A 1 131 ? 172.644 188.510 168.948 1.00 53.54  ? 130  ILE A CG1   1 
ATOM 770   C CG2   . ILE A 1 131 ? 173.489 188.061 166.709 1.00 53.63  ? 130  ILE A CG2   1 
ATOM 771   C CD1   . ILE A 1 131 ? 171.722 187.368 168.849 1.00 55.30  ? 130  ILE A CD1   1 
ATOM 772   N N     . ARG A 1 132 ? 176.875 187.513 167.796 1.00 60.49  ? 131  ARG A N     1 
ATOM 773   C CA    . ARG A 1 132 ? 177.985 187.220 166.904 1.00 62.01  ? 131  ARG A CA    1 
ATOM 774   C C     . ARG A 1 132 ? 178.580 185.855 167.178 1.00 71.77  ? 131  ARG A C     1 
ATOM 775   O O     . ARG A 1 132 ? 179.170 185.245 166.284 1.00 80.75  ? 131  ARG A O     1 
ATOM 776   C CB    . ARG A 1 132 ? 179.069 188.269 167.033 1.00 59.57  ? 131  ARG A CB    1 
ATOM 777   C CG    . ARG A 1 132 ? 178.712 189.592 166.470 1.00 54.97  ? 131  ARG A CG    1 
ATOM 778   C CD    . ARG A 1 132 ? 179.918 190.447 166.572 1.00 59.93  ? 131  ARG A CD    1 
ATOM 779   N NE    . ARG A 1 132 ? 179.706 191.773 166.039 1.00 69.06  ? 131  ARG A NE    1 
ATOM 780   C CZ    . ARG A 1 132 ? 180.615 192.729 166.119 1.00 78.84  ? 131  ARG A CZ    1 
ATOM 781   N NH1   . ARG A 1 132 ? 181.773 192.483 166.711 1.00 84.00  ? 131  ARG A NH1   1 
ATOM 782   N NH2   . ARG A 1 132 ? 180.369 193.925 165.613 1.00 72.72  ? 131  ARG A NH2   1 
ATOM 783   N N     . GLY A 1 133 ? 178.430 185.358 168.395 1.00 61.45  ? 132  GLY A N     1 
ATOM 784   C CA    . GLY A 1 133 ? 179.099 184.143 168.789 1.00 60.26  ? 132  GLY A CA    1 
ATOM 785   C C     . GLY A 1 133 ? 180.527 184.334 169.225 1.00 65.39  ? 132  GLY A C     1 
ATOM 786   O O     . GLY A 1 133 ? 181.327 183.406 169.082 1.00 67.20  ? 132  GLY A O     1 
ATOM 787   N N     . GLU A 1 134 ? 180.880 185.508 169.742 1.00 70.88  ? 133  GLU A N     1 
ATOM 788   C CA    . GLU A 1 134 ? 182.251 185.733 170.172 1.00 71.37  ? 133  GLU A CA    1 
ATOM 789   C C     . GLU A 1 134 ? 182.509 185.072 171.519 1.00 85.85  ? 133  GLU A C     1 
ATOM 790   O O     . GLU A 1 134 ? 183.660 184.824 171.894 1.00 95.93  ? 133  GLU A O     1 
ATOM 791   C CB    . GLU A 1 134 ? 182.548 187.229 170.242 1.00 71.13  ? 133  GLU A CB    1 
ATOM 792   C CG    . GLU A 1 134 ? 182.439 187.960 168.918 1.00 75.67  ? 133  GLU A CG    1 
ATOM 793   C CD    . GLU A 1 134 ? 182.808 189.434 169.034 1.00 81.20  ? 133  GLU A CD    1 
ATOM 794   O OE1   . GLU A 1 134 ? 183.087 189.893 170.162 1.00 83.10  ? 133  GLU A OE1   1 
ATOM 795   O OE2   . GLU A 1 134 ? 182.800 190.141 168.003 1.00 77.43  ? 133  GLU A OE2   1 
ATOM 796   N N     . ARG A 1 135 ? 181.450 184.785 172.263 1.00 95.24  ? 134  ARG A N     1 
ATOM 797   C CA    . ARG A 1 135 ? 181.590 184.125 173.552 1.00 96.06  ? 134  ARG A CA    1 
ATOM 798   C C     . ARG A 1 135 ? 180.233 183.665 174.040 1.00 108.06 ? 134  ARG A C     1 
ATOM 799   O O     . ARG A 1 135 ? 179.214 184.012 173.451 1.00 110.09 ? 134  ARG A O     1 
ATOM 800   C CB    . ARG A 1 135 ? 182.231 185.055 174.578 1.00 75.31  ? 134  ARG A CB    1 
ATOM 801   N N     . LYS B 2 21  ? 209.461 193.364 187.978 1.00 94.87  ? 20   LYS B N     1 
ATOM 802   C CA    . LYS B 2 21  ? 208.341 193.932 187.238 1.00 106.65 ? 20   LYS B CA    1 
ATOM 803   C C     . LYS B 2 21  ? 207.024 193.343 187.728 1.00 113.50 ? 20   LYS B C     1 
ATOM 804   O O     . LYS B 2 21  ? 206.733 192.167 187.496 1.00 104.69 ? 20   LYS B O     1 
ATOM 805   C CB    . LYS B 2 21  ? 208.513 193.686 185.741 1.00 89.41  ? 20   LYS B CB    1 
ATOM 806   N N     . VAL B 2 22  ? 206.229 194.166 188.403 1.00 119.16 ? 21   VAL B N     1 
ATOM 807   C CA    . VAL B 2 22  ? 204.887 193.789 188.827 1.00 112.87 ? 21   VAL B CA    1 
ATOM 808   C C     . VAL B 2 22  ? 203.936 194.902 188.419 1.00 117.70 ? 21   VAL B C     1 
ATOM 809   O O     . VAL B 2 22  ? 204.021 196.020 188.938 1.00 127.71 ? 21   VAL B O     1 
ATOM 810   C CB    . VAL B 2 22  ? 204.802 193.543 190.345 1.00 90.31  ? 21   VAL B CB    1 
ATOM 811   C CG1   . VAL B 2 22  ? 203.358 193.295 190.758 1.00 74.90  ? 21   VAL B CG1   1 
ATOM 812   C CG2   . VAL B 2 22  ? 205.684 192.370 190.742 1.00 80.93  ? 21   VAL B CG2   1 
ATOM 813   N N     . LEU B 2 23  ? 203.023 194.593 187.507 1.00 103.60 ? 22   LEU B N     1 
ATOM 814   C CA    . LEU B 2 23  ? 202.058 195.559 187.012 1.00 93.70  ? 22   LEU B CA    1 
ATOM 815   C C     . LEU B 2 23  ? 200.675 195.146 187.477 1.00 83.89  ? 22   LEU B C     1 
ATOM 816   O O     . LEU B 2 23  ? 200.288 193.984 187.335 1.00 78.49  ? 22   LEU B O     1 
ATOM 817   C CB    . LEU B 2 23  ? 202.100 195.648 185.486 1.00 92.57  ? 22   LEU B CB    1 
ATOM 818   C CG    . LEU B 2 23  ? 203.427 196.107 184.884 1.00 83.95  ? 22   LEU B CG    1 
ATOM 819   C CD1   . LEU B 2 23  ? 203.362 196.076 183.366 1.00 79.18  ? 22   LEU B CD1   1 
ATOM 820   C CD2   . LEU B 2 23  ? 203.798 197.488 185.385 1.00 84.36  ? 22   LEU B CD2   1 
ATOM 821   N N     . ARG B 2 24  ? 199.935 196.092 188.045 1.00 77.60  ? 23   ARG B N     1 
ATOM 822   C CA    . ARG B 2 24  ? 198.623 195.780 188.583 1.00 91.21  ? 23   ARG B CA    1 
ATOM 823   C C     . ARG B 2 24  ? 197.692 196.961 188.369 1.00 88.54  ? 23   ARG B C     1 
ATOM 824   O O     . ARG B 2 24  ? 198.098 198.121 188.473 1.00 80.93  ? 23   ARG B O     1 
ATOM 825   C CB    . ARG B 2 24  ? 198.700 195.421 190.070 1.00 109.25 ? 23   ARG B CB    1 
ATOM 826   C CG    . ARG B 2 24  ? 199.458 194.129 190.353 1.00 124.81 ? 23   ARG B CG    1 
ATOM 827   C CD    . ARG B 2 24  ? 199.568 193.864 191.826 1.00 133.71 ? 23   ARG B CD    1 
ATOM 828   N NE    . ARG B 2 24  ? 198.254 193.687 192.421 1.00 140.14 ? 23   ARG B NE    1 
ATOM 829   C CZ    . ARG B 2 24  ? 198.048 193.540 193.721 1.00 145.44 ? 23   ARG B CZ    1 
ATOM 830   N NH1   . ARG B 2 24  ? 199.076 193.547 194.557 1.00 145.92 ? 23   ARG B NH1   1 
ATOM 831   N NH2   . ARG B 2 24  ? 196.817 193.386 194.186 1.00 145.90 ? 23   ARG B NH2   1 
ATOM 832   N N     . ASP B 2 25  ? 196.439 196.644 188.054 1.00 98.88  ? 24   ASP B N     1 
ATOM 833   C CA    . ASP B 2 25  ? 195.381 197.625 187.857 1.00 106.25 ? 24   ASP B CA    1 
ATOM 834   C C     . ASP B 2 25  ? 195.688 198.587 186.727 1.00 96.66  ? 24   ASP B C     1 
ATOM 835   O O     . ASP B 2 25  ? 195.138 199.687 186.685 1.00 102.33 ? 24   ASP B O     1 
ATOM 836   C CB    . ASP B 2 25  ? 195.116 198.409 189.140 1.00 112.35 ? 24   ASP B CB    1 
ATOM 837   C CG    . ASP B 2 25  ? 194.618 197.529 190.245 1.00 119.05 ? 24   ASP B CG    1 
ATOM 838   O OD1   . ASP B 2 25  ? 194.209 196.393 189.939 1.00 127.60 ? 24   ASP B OD1   1 
ATOM 839   O OD2   . ASP B 2 25  ? 194.645 197.959 191.416 1.00 117.01 ? 24   ASP B OD2   1 
ATOM 840   N N     . ASN B 2 26  ? 196.558 198.201 185.799 1.00 78.99  ? 25   ASN B N     1 
ATOM 841   C CA    . ASN B 2 26  ? 196.758 199.051 184.642 1.00 78.11  ? 25   ASN B CA    1 
ATOM 842   C C     . ASN B 2 26  ? 195.512 199.110 183.795 1.00 77.57  ? 25   ASN B C     1 
ATOM 843   O O     . ASN B 2 26  ? 195.306 200.094 183.084 1.00 77.61  ? 25   ASN B O     1 
ATOM 844   C CB    . ASN B 2 26  ? 197.930 198.558 183.815 1.00 87.94  ? 25   ASN B CB    1 
ATOM 845   C CG    . ASN B 2 26  ? 199.244 198.772 184.509 1.00 88.31  ? 25   ASN B CG    1 
ATOM 846   O OD1   . ASN B 2 26  ? 199.805 199.866 184.480 1.00 88.80  ? 25   ASN B OD1   1 
ATOM 847   N ND2   . ASN B 2 26  ? 199.728 197.738 185.177 1.00 88.69  ? 25   ASN B ND2   1 
ATOM 848   N N     . ILE B 2 27  ? 194.666 198.085 183.880 1.00 72.17  ? 26   ILE B N     1 
ATOM 849   C CA    . ILE B 2 27  ? 193.394 198.112 183.176 1.00 71.98  ? 26   ILE B CA    1 
ATOM 850   C C     . ILE B 2 27  ? 192.606 199.358 183.539 1.00 81.44  ? 26   ILE B C     1 
ATOM 851   O O     . ILE B 2 27  ? 191.780 199.832 182.752 1.00 91.78  ? 26   ILE B O     1 
ATOM 852   C CB    . ILE B 2 27  ? 192.615 196.827 183.479 1.00 64.50  ? 26   ILE B CB    1 
ATOM 853   C CG1   . ILE B 2 27  ? 191.330 196.798 182.676 1.00 62.33  ? 26   ILE B CG1   1 
ATOM 854   C CG2   . ILE B 2 27  ? 192.337 196.731 184.947 1.00 51.52  ? 26   ILE B CG2   1 
ATOM 855   C CD1   . ILE B 2 27  ? 191.571 196.809 181.217 1.00 83.11  ? 26   ILE B CD1   1 
ATOM 856   N N     . GLN B 2 28  ? 192.862 199.929 184.714 1.00 78.49  ? 27   GLN B N     1 
ATOM 857   C CA    . GLN B 2 28  ? 192.339 201.255 184.998 1.00 87.22  ? 27   GLN B CA    1 
ATOM 858   C C     . GLN B 2 28  ? 192.832 202.271 183.989 1.00 87.41  ? 27   GLN B C     1 
ATOM 859   O O     . GLN B 2 28  ? 192.161 203.281 183.764 1.00 73.02  ? 27   GLN B O     1 
ATOM 860   C CB    . GLN B 2 28  ? 192.744 201.693 186.400 1.00 87.69  ? 27   GLN B CB    1 
ATOM 861   C CG    . GLN B 2 28  ? 192.222 200.785 187.471 1.00 103.15 ? 27   GLN B CG    1 
ATOM 862   C CD    . GLN B 2 28  ? 190.727 200.661 187.416 1.00 117.41 ? 27   GLN B CD    1 
ATOM 863   O OE1   . GLN B 2 28  ? 190.023 201.637 187.173 1.00 121.02 ? 27   GLN B OE1   1 
ATOM 864   N NE2   . GLN B 2 28  ? 190.227 199.453 187.627 1.00 119.19 ? 27   GLN B NE2   1 
ATOM 865   N N     . GLY B 2 29  ? 193.987 202.018 183.376 1.00 88.45  ? 28   GLY B N     1 
ATOM 866   C CA    . GLY B 2 29  ? 194.520 202.945 182.398 1.00 83.88  ? 28   GLY B CA    1 
ATOM 867   C C     . GLY B 2 29  ? 193.550 203.245 181.279 1.00 78.23  ? 28   GLY B C     1 
ATOM 868   O O     . GLY B 2 29  ? 193.591 204.323 180.685 1.00 77.88  ? 28   GLY B O     1 
ATOM 869   N N     . ILE B 2 30  ? 192.667 202.308 180.974 1.00 60.69  ? 29   ILE B N     1 
ATOM 870   C CA    . ILE B 2 30  ? 191.548 202.613 180.100 1.00 59.83  ? 29   ILE B CA    1 
ATOM 871   C C     . ILE B 2 30  ? 190.552 203.412 180.919 1.00 69.55  ? 29   ILE B C     1 
ATOM 872   O O     . ILE B 2 30  ? 190.069 202.946 181.955 1.00 75.52  ? 29   ILE B O     1 
ATOM 873   C CB    . ILE B 2 30  ? 190.922 201.336 179.546 1.00 60.29  ? 29   ILE B CB    1 
ATOM 874   C CG1   . ILE B 2 30  ? 192.004 200.529 178.868 1.00 49.02  ? 29   ILE B CG1   1 
ATOM 875   C CG2   . ILE B 2 30  ? 189.897 201.682 178.536 1.00 72.59  ? 29   ILE B CG2   1 
ATOM 876   C CD1   . ILE B 2 30  ? 192.681 201.311 177.802 1.00 48.23  ? 29   ILE B CD1   1 
ATOM 877   N N     . THR B 2 31  ? 190.249 204.616 180.468 1.00 70.22  ? 30   THR B N     1 
ATOM 878   C CA    . THR B 2 31  ? 189.570 205.583 181.305 1.00 71.30  ? 30   THR B CA    1 
ATOM 879   C C     . THR B 2 31  ? 188.217 205.939 180.732 1.00 70.15  ? 30   THR B C     1 
ATOM 880   O O     . THR B 2 31  ? 188.045 206.045 179.517 1.00 65.53  ? 30   THR B O     1 
ATOM 881   C CB    . THR B 2 31  ? 190.373 206.842 181.425 1.00 71.40  ? 30   THR B CB    1 
ATOM 882   O OG1   . THR B 2 31  ? 190.492 207.422 180.125 1.00 78.19  ? 30   THR B OG1   1 
ATOM 883   C CG2   . THR B 2 31  ? 191.741 206.517 181.945 1.00 59.71  ? 30   THR B CG2   1 
ATOM 884   N N     . LYS B 2 32  ? 187.286 206.178 181.632 1.00 66.41  ? 31   LYS B N     1 
ATOM 885   C CA    . LYS B 2 32  ? 185.939 206.602 181.309 1.00 65.47  ? 31   LYS B CA    1 
ATOM 886   C C     . LYS B 2 32  ? 185.925 207.656 180.211 1.00 66.69  ? 31   LYS B C     1 
ATOM 887   O O     . LYS B 2 32  ? 185.088 207.578 179.304 1.00 58.30  ? 31   LYS B O     1 
ATOM 888   C CB    . LYS B 2 32  ? 185.254 207.128 182.562 1.00 62.66  ? 31   LYS B CB    1 
ATOM 889   C CG    . LYS B 2 32  ? 183.877 207.653 182.320 1.00 71.28  ? 31   LYS B CG    1 
ATOM 890   C CD    . LYS B 2 32  ? 183.270 208.111 183.621 1.00 86.16  ? 31   LYS B CD    1 
ATOM 891   C CE    . LYS B 2 32  ? 181.899 208.718 183.410 1.00 93.18  ? 31   LYS B CE    1 
ATOM 892   N NZ    . LYS B 2 32  ? 181.280 209.099 184.703 1.00 91.03  ? 31   LYS B NZ    1 
ATOM 893   N N     . PRO B 2 33  ? 186.815 208.645 180.230 1.00 65.72  ? 32   PRO B N     1 
ATOM 894   C CA    . PRO B 2 33  ? 186.863 209.546 179.080 1.00 67.76  ? 32   PRO B CA    1 
ATOM 895   C C     . PRO B 2 33  ? 187.150 208.811 177.794 1.00 75.32  ? 32   PRO B C     1 
ATOM 896   O O     . PRO B 2 33  ? 186.435 208.997 176.808 1.00 83.66  ? 32   PRO B O     1 
ATOM 897   C CB    . PRO B 2 33  ? 187.989 210.512 179.449 1.00 71.03  ? 32   PRO B CB    1 
ATOM 898   C CG    . PRO B 2 33  ? 187.989 210.522 180.898 1.00 79.34  ? 32   PRO B CG    1 
ATOM 899   C CD    . PRO B 2 33  ? 187.694 209.125 181.304 1.00 72.54  ? 32   PRO B CD    1 
ATOM 900   N N     . ALA B 2 34  ? 188.161 207.949 177.784 1.00 67.74  ? 33   ALA B N     1 
ATOM 901   C CA    . ALA B 2 34  ? 188.539 207.296 176.540 1.00 53.89  ? 33   ALA B CA    1 
ATOM 902   C C     . ALA B 2 34  ? 187.415 206.410 176.037 1.00 60.62  ? 33   ALA B C     1 
ATOM 903   O O     . ALA B 2 34  ? 186.890 206.614 174.939 1.00 65.38  ? 33   ALA B O     1 
ATOM 904   C CB    . ALA B 2 34  ? 189.817 206.491 176.740 1.00 45.64  ? 33   ALA B CB    1 
ATOM 905   N N     . ILE B 2 35  ? 187.011 205.435 176.849 1.00 66.04  ? 34   ILE B N     1 
ATOM 906   C CA    . ILE B 2 35  ? 185.912 204.559 176.466 1.00 55.65  ? 34   ILE B CA    1 
ATOM 907   C C     . ILE B 2 35  ? 184.745 205.382 175.983 1.00 61.56  ? 34   ILE B C     1 
ATOM 908   O O     . ILE B 2 35  ? 184.076 205.038 175.004 1.00 67.32  ? 34   ILE B O     1 
ATOM 909   C CB    . ILE B 2 35  ? 185.500 203.678 177.647 1.00 58.47  ? 34   ILE B CB    1 
ATOM 910   C CG1   . ILE B 2 35  ? 186.627 202.736 178.001 1.00 53.68  ? 34   ILE B CG1   1 
ATOM 911   C CG2   . ILE B 2 35  ? 184.269 202.909 177.295 1.00 57.77  ? 34   ILE B CG2   1 
ATOM 912   C CD1   . ILE B 2 35  ? 186.412 202.031 179.295 1.00 58.38  ? 34   ILE B CD1   1 
ATOM 913   N N     . ARG B 2 36  ? 184.492 206.493 176.654 1.00 69.99  ? 35   ARG B N     1 
ATOM 914   C CA    . ARG B 2 36  ? 183.436 207.369 176.198 1.00 75.36  ? 35   ARG B CA    1 
ATOM 915   C C     . ARG B 2 36  ? 183.712 207.838 174.782 1.00 68.15  ? 35   ARG B C     1 
ATOM 916   O O     . ARG B 2 36  ? 182.820 207.824 173.928 1.00 78.27  ? 35   ARG B O     1 
ATOM 917   C CB    . ARG B 2 36  ? 183.304 208.535 177.164 1.00 71.34  ? 35   ARG B CB    1 
ATOM 918   C CG    . ARG B 2 36  ? 182.162 209.428 176.867 1.00 99.83  ? 35   ARG B CG    1 
ATOM 919   C CD    . ARG B 2 36  ? 181.993 210.396 177.987 1.00 115.53 ? 35   ARG B CD    1 
ATOM 920   N NE    . ARG B 2 36  ? 180.861 211.272 177.748 1.00 120.23 ? 35   ARG B NE    1 
ATOM 921   C CZ    . ARG B 2 36  ? 180.372 212.101 178.657 1.00 121.64 ? 35   ARG B CZ    1 
ATOM 922   N NH1   . ARG B 2 36  ? 180.921 212.153 179.861 1.00 122.85 ? 35   ARG B NH1   1 
ATOM 923   N NH2   . ARG B 2 36  ? 179.338 212.876 178.363 1.00 121.28 ? 35   ARG B NH2   1 
ATOM 924   N N     . ARG B 2 37  ? 184.957 208.206 174.496 1.00 52.73  ? 36   ARG B N     1 
ATOM 925   C CA    . ARG B 2 37  ? 185.284 208.627 173.145 1.00 51.59  ? 36   ARG B CA    1 
ATOM 926   C C     . ARG B 2 37  ? 184.989 207.515 172.154 1.00 63.86  ? 36   ARG B C     1 
ATOM 927   O O     . ARG B 2 37  ? 184.241 207.715 171.193 1.00 76.04  ? 36   ARG B O     1 
ATOM 928   C CB    . ARG B 2 37  ? 186.740 209.078 173.060 1.00 52.55  ? 36   ARG B CB    1 
ATOM 929   C CG    . ARG B 2 37  ? 186.988 210.416 173.730 1.00 57.51  ? 36   ARG B CG    1 
ATOM 930   C CD    . ARG B 2 37  ? 188.326 211.031 173.350 1.00 53.49  ? 36   ARG B CD    1 
ATOM 931   N NE    . ARG B 2 37  ? 189.466 210.289 173.867 1.00 58.71  ? 36   ARG B NE    1 
ATOM 932   C CZ    . ARG B 2 37  ? 190.022 210.515 175.049 1.00 59.98  ? 36   ARG B CZ    1 
ATOM 933   N NH1   . ARG B 2 37  ? 189.549 211.467 175.832 1.00 62.06  ? 36   ARG B NH1   1 
ATOM 934   N NH2   . ARG B 2 37  ? 191.056 209.796 175.448 1.00 48.45  ? 36   ARG B NH2   1 
ATOM 935   N N     . LEU B 2 38  ? 185.536 206.321 172.393 1.00 60.59  ? 37   LEU B N     1 
ATOM 936   C CA    . LEU B 2 38  ? 185.266 205.202 171.498 1.00 57.83  ? 37   LEU B CA    1 
ATOM 937   C C     . LEU B 2 38  ? 183.784 205.074 171.240 1.00 66.49  ? 37   LEU B C     1 
ATOM 938   O O     . LEU B 2 38  ? 183.341 205.028 170.089 1.00 65.36  ? 37   LEU B O     1 
ATOM 939   C CB    . LEU B 2 38  ? 185.794 203.907 172.088 1.00 46.89  ? 37   LEU B CB    1 
ATOM 940   C CG    . LEU B 2 38  ? 187.300 203.868 172.197 1.00 54.01  ? 37   LEU B CG    1 
ATOM 941   C CD1   . LEU B 2 38  ? 187.721 202.603 172.876 1.00 50.48  ? 37   LEU B CD1   1 
ATOM 942   C CD2   . LEU B 2 38  ? 187.867 203.934 170.823 1.00 51.73  ? 37   LEU B CD2   1 
ATOM 943   N N     . ALA B 2 39  ? 182.999 205.057 172.309 1.00 65.42  ? 38   ALA B N     1 
ATOM 944   C CA    . ALA B 2 39  ? 181.558 205.026 172.153 1.00 62.83  ? 38   ALA B CA    1 
ATOM 945   C C     . ALA B 2 39  ? 181.114 206.075 171.159 1.00 61.85  ? 38   ALA B C     1 
ATOM 946   O O     . ALA B 2 39  ? 180.347 205.790 170.234 1.00 48.37  ? 38   ALA B O     1 
ATOM 947   C CB    . ALA B 2 39  ? 180.885 205.248 173.501 1.00 48.90  ? 38   ALA B CB    1 
ATOM 948   N N     . ARG B 2 40  ? 181.622 207.293 171.312 1.00 59.46  ? 39   ARG B N     1 
ATOM 949   C CA    . ARG B 2 40  ? 181.208 208.351 170.409 1.00 62.55  ? 39   ARG B CA    1 
ATOM 950   C C     . ARG B 2 40  ? 181.512 207.967 168.977 1.00 71.01  ? 39   ARG B C     1 
ATOM 951   O O     . ARG B 2 40  ? 180.622 207.964 168.124 1.00 74.39  ? 39   ARG B O     1 
ATOM 952   C CB    . ARG B 2 40  ? 181.886 209.658 170.775 1.00 49.63  ? 39   ARG B CB    1 
ATOM 953   C CG    . ARG B 2 40  ? 181.576 210.061 172.169 1.00 51.92  ? 39   ARG B CG    1 
ATOM 954   C CD    . ARG B 2 40  ? 180.112 210.302 172.331 1.00 59.72  ? 39   ARG B CD    1 
ATOM 955   N NE    . ARG B 2 40  ? 179.813 210.595 173.719 1.00 68.48  ? 39   ARG B NE    1 
ATOM 956   C CZ    . ARG B 2 40  ? 178.590 210.639 174.216 1.00 73.25  ? 39   ARG B CZ    1 
ATOM 957   N NH1   . ARG B 2 40  ? 177.550 210.413 173.431 1.00 74.66  ? 39   ARG B NH1   1 
ATOM 958   N NH2   . ARG B 2 40  ? 178.413 210.900 175.498 1.00 66.55  ? 39   ARG B NH2   1 
ATOM 959   N N     . ARG B 2 41  ? 182.758 207.596 168.703 1.00 57.84  ? 40   ARG B N     1 
ATOM 960   C CA    . ARG B 2 41  ? 183.096 207.236 167.339 1.00 47.64  ? 40   ARG B CA    1 
ATOM 961   C C     . ARG B 2 41  ? 182.156 206.178 166.819 1.00 55.11  ? 40   ARG B C     1 
ATOM 962   O O     . ARG B 2 41  ? 181.763 206.212 165.651 1.00 76.46  ? 40   ARG B O     1 
ATOM 963   C CB    . ARG B 2 41  ? 184.532 206.748 167.243 1.00 45.71  ? 40   ARG B CB    1 
ATOM 964   C CG    . ARG B 2 41  ? 184.891 206.334 165.844 1.00 46.77  ? 40   ARG B CG    1 
ATOM 965   C CD    . ARG B 2 41  ? 186.323 205.923 165.731 1.00 47.84  ? 40   ARG B CD    1 
ATOM 966   N NE    . ARG B 2 41  ? 187.202 207.061 165.917 1.00 45.77  ? 40   ARG B NE    1 
ATOM 967   C CZ    . ARG B 2 41  ? 188.520 206.984 165.869 1.00 52.46  ? 40   ARG B CZ    1 
ATOM 968   N NH1   . ARG B 2 41  ? 189.101 205.823 165.637 1.00 62.57  ? 40   ARG B NH1   1 
ATOM 969   N NH2   . ARG B 2 41  ? 189.256 208.064 166.049 1.00 47.94  ? 40   ARG B NH2   1 
ATOM 970   N N     . GLY B 2 42  ? 181.737 205.263 167.682 1.00 56.53  ? 41   GLY B N     1 
ATOM 971   C CA    . GLY B 2 42  ? 180.818 204.242 167.237 1.00 54.58  ? 41   GLY B CA    1 
ATOM 972   C C     . GLY B 2 42  ? 179.489 204.807 166.811 1.00 60.19  ? 41   GLY B C     1 
ATOM 973   O O     . GLY B 2 42  ? 178.800 204.219 165.977 1.00 73.52  ? 41   GLY B O     1 
ATOM 974   N N     . GLY B 2 43  ? 179.122 205.956 167.342 1.00 58.09  ? 42   GLY B N     1 
ATOM 975   C CA    . GLY B 2 43  ? 177.788 206.456 167.159 1.00 58.97  ? 42   GLY B CA    1 
ATOM 976   C C     . GLY B 2 43  ? 176.903 206.283 168.360 1.00 67.64  ? 42   GLY B C     1 
ATOM 977   O O     . GLY B 2 43  ? 175.696 206.497 168.250 1.00 69.11  ? 42   GLY B O     1 
ATOM 978   N N     . VAL B 2 44  ? 177.459 205.874 169.497 1.00 63.96  ? 43   VAL B N     1 
ATOM 979   C CA    . VAL B 2 44  ? 176.687 205.865 170.724 1.00 64.97  ? 43   VAL B CA    1 
ATOM 980   C C     . VAL B 2 44  ? 176.275 207.285 171.049 1.00 74.40  ? 43   VAL B C     1 
ATOM 981   O O     . VAL B 2 44  ? 177.025 208.236 170.813 1.00 75.33  ? 43   VAL B O     1 
ATOM 982   C CB    . VAL B 2 44  ? 177.517 205.267 171.867 1.00 67.33  ? 43   VAL B CB    1 
ATOM 983   C CG1   . VAL B 2 44  ? 176.728 205.266 173.143 1.00 66.12  ? 43   VAL B CG1   1 
ATOM 984   C CG2   . VAL B 2 44  ? 177.948 203.889 171.517 1.00 71.19  ? 43   VAL B CG2   1 
ATOM 985   N N     . LYS B 2 45  ? 175.075 207.445 171.590 1.00 79.79  ? 44   LYS B N     1 
ATOM 986   C CA    . LYS B 2 45  ? 174.620 208.760 172.007 1.00 71.18  ? 44   LYS B CA    1 
ATOM 987   C C     . LYS B 2 45  ? 174.755 208.940 173.510 1.00 70.71  ? 44   LYS B C     1 
ATOM 988   O O     . LYS B 2 45  ? 175.468 209.833 173.968 1.00 81.28  ? 44   LYS B O     1 
ATOM 989   C CB    . LYS B 2 45  ? 173.182 208.995 171.557 1.00 66.42  ? 44   LYS B CB    1 
ATOM 990   C CG    . LYS B 2 45  ? 172.674 210.380 171.861 1.00 64.42  ? 44   LYS B CG    1 
ATOM 991   C CD    . LYS B 2 45  ? 171.331 210.586 171.202 1.00 71.38  ? 44   LYS B CD    1 
ATOM 992   C CE    . LYS B 2 45  ? 170.762 211.953 171.492 1.00 78.83  ? 44   LYS B CE    1 
ATOM 993   N NZ    . LYS B 2 45  ? 169.466 212.161 170.791 1.00 79.46  ? 44   LYS B NZ    1 
ATOM 994   N N     . ARG B 2 46  ? 174.074 208.114 174.289 1.00 68.08  ? 45   ARG B N     1 
ATOM 995   C CA    . ARG B 2 46  ? 174.065 208.256 175.737 1.00 70.63  ? 45   ARG B CA    1 
ATOM 996   C C     . ARG B 2 46  ? 174.509 206.960 176.394 1.00 72.22  ? 45   ARG B C     1 
ATOM 997   O O     . ARG B 2 46  ? 173.812 205.949 176.318 1.00 73.95  ? 45   ARG B O     1 
ATOM 998   C CB    . ARG B 2 46  ? 172.683 208.655 176.218 1.00 67.14  ? 45   ARG B CB    1 
ATOM 999   C CG    . ARG B 2 46  ? 172.602 208.753 177.693 1.00 74.91  ? 45   ARG B CG    1 
ATOM 1000  C CD    . ARG B 2 46  ? 171.267 209.276 178.110 1.00 77.24  ? 45   ARG B CD    1 
ATOM 1001  N NE    . ARG B 2 46  ? 171.175 209.304 179.556 1.00 85.63  ? 45   ARG B NE    1 
ATOM 1002  C CZ    . ARG B 2 46  ? 170.211 209.915 180.215 1.00 92.59  ? 45   ARG B CZ    1 
ATOM 1003  N NH1   . ARG B 2 46  ? 169.274 210.563 179.552 1.00 87.49  ? 45   ARG B NH1   1 
ATOM 1004  N NH2   . ARG B 2 46  ? 170.195 209.889 181.533 1.00 94.95  ? 45   ARG B NH2   1 
ATOM 1005  N N     . ILE B 2 47  ? 175.655 207.002 177.059 1.00 74.95  ? 46   ILE B N     1 
ATOM 1006  C CA    . ILE B 2 47  ? 176.184 205.828 177.724 1.00 69.83  ? 46   ILE B CA    1 
ATOM 1007  C C     . ILE B 2 47  ? 175.402 205.550 178.999 1.00 72.03  ? 46   ILE B C     1 
ATOM 1008  O O     . ILE B 2 47  ? 174.746 206.427 179.558 1.00 80.89  ? 46   ILE B O     1 
ATOM 1009  C CB    . ILE B 2 47  ? 177.671 206.066 178.015 1.00 57.09  ? 46   ILE B CB    1 
ATOM 1010  C CG1   . ILE B 2 47  ? 178.432 206.167 176.708 1.00 59.42  ? 46   ILE B CG1   1 
ATOM 1011  C CG2   . ILE B 2 47  ? 178.272 204.986 178.855 1.00 53.72  ? 46   ILE B CG2   1 
ATOM 1012  C CD1   . ILE B 2 47  ? 179.842 206.610 176.902 1.00 58.17  ? 46   ILE B CD1   1 
ATOM 1013  N N     . SER B 2 48  ? 175.454 204.304 179.454 1.00 67.61  ? 47   SER B N     1 
ATOM 1014  C CA    . SER B 2 48  ? 175.042 203.958 180.804 1.00 65.39  ? 47   SER B CA    1 
ATOM 1015  C C     . SER B 2 48  ? 176.263 203.752 181.682 1.00 71.00  ? 47   SER B C     1 
ATOM 1016  O O     . SER B 2 48  ? 177.270 203.195 181.250 1.00 77.35  ? 47   SER B O     1 
ATOM 1017  C CB    . SER B 2 48  ? 174.194 202.697 180.838 1.00 71.37  ? 47   SER B CB    1 
ATOM 1018  O OG    . SER B 2 48  ? 173.905 202.346 182.176 1.00 78.18  ? 47   SER B OG    1 
ATOM 1019  N N     . GLY B 2 49  ? 176.150 204.172 182.937 1.00 65.46  ? 48   GLY B N     1 
ATOM 1020  C CA    . GLY B 2 49  ? 177.320 204.231 183.792 1.00 57.72  ? 48   GLY B CA    1 
ATOM 1021  C C     . GLY B 2 49  ? 177.983 202.891 184.022 1.00 75.13  ? 48   GLY B C     1 
ATOM 1022  O O     . GLY B 2 49  ? 179.155 202.831 184.397 1.00 92.15  ? 48   GLY B O     1 
ATOM 1023  N N     . LEU B 2 50  ? 177.260 201.804 183.805 1.00 75.79  ? 49   LEU B N     1 
ATOM 1024  C CA    . LEU B 2 50  ? 177.826 200.508 184.131 1.00 79.18  ? 49   LEU B CA    1 
ATOM 1025  C C     . LEU B 2 50  ? 178.750 199.994 183.042 1.00 79.99  ? 49   LEU B C     1 
ATOM 1026  O O     . LEU B 2 50  ? 179.591 199.130 183.308 1.00 86.79  ? 49   LEU B O     1 
ATOM 1027  C CB    . LEU B 2 50  ? 176.704 199.516 184.379 1.00 86.44  ? 49   LEU B CB    1 
ATOM 1028  C CG    . LEU B 2 50  ? 175.838 199.976 185.540 1.00 83.70  ? 49   LEU B CG    1 
ATOM 1029  C CD1   . LEU B 2 50  ? 174.656 199.055 185.725 1.00 85.01  ? 49   LEU B CD1   1 
ATOM 1030  C CD2   . LEU B 2 50  ? 176.680 200.045 186.791 1.00 71.84  ? 49   LEU B CD2   1 
ATOM 1031  N N     . ILE B 2 51  ? 178.614 200.520 181.824 1.00 72.48  ? 50   ILE B N     1 
ATOM 1032  C CA    . ILE B 2 51  ? 179.375 200.016 180.685 1.00 61.63  ? 50   ILE B CA    1 
ATOM 1033  C C     . ILE B 2 51  ? 180.860 199.998 180.988 1.00 55.67  ? 50   ILE B C     1 
ATOM 1034  O O     . ILE B 2 51  ? 181.573 199.055 180.630 1.00 62.28  ? 50   ILE B O     1 
ATOM 1035  C CB    . ILE B 2 51  ? 179.075 200.866 179.444 1.00 49.34  ? 50   ILE B CB    1 
ATOM 1036  C CG1   . ILE B 2 51  ? 177.595 200.807 179.127 1.00 60.57  ? 50   ILE B CG1   1 
ATOM 1037  C CG2   . ILE B 2 51  ? 179.827 200.354 178.281 1.00 42.90  ? 50   ILE B CG2   1 
ATOM 1038  C CD1   . ILE B 2 51  ? 177.125 199.434 178.871 1.00 44.10  ? 50   ILE B CD1   1 
ATOM 1039  N N     . TYR B 2 52  ? 181.338 201.024 181.683 1.00 56.23  ? 51   TYR B N     1 
ATOM 1040  C CA    . TYR B 2 52  ? 182.768 201.232 181.827 1.00 60.32  ? 51   TYR B CA    1 
ATOM 1041  C C     . TYR B 2 52  ? 183.479 200.012 182.373 1.00 66.61  ? 51   TYR B C     1 
ATOM 1042  O O     . TYR B 2 52  ? 184.675 199.835 182.132 1.00 70.29  ? 51   TYR B O     1 
ATOM 1043  C CB    . TYR B 2 52  ? 183.010 202.428 182.727 1.00 46.41  ? 51   TYR B CB    1 
ATOM 1044  C CG    . TYR B 2 52  ? 182.373 203.653 182.165 1.00 59.38  ? 51   TYR B CG    1 
ATOM 1045  C CD1   . TYR B 2 52  ? 182.426 203.911 180.814 1.00 68.46  ? 51   TYR B CD1   1 
ATOM 1046  C CD2   . TYR B 2 52  ? 181.680 204.527 182.970 1.00 68.90  ? 51   TYR B CD2   1 
ATOM 1047  C CE1   . TYR B 2 52  ? 181.834 205.020 180.285 1.00 77.94  ? 51   TYR B CE1   1 
ATOM 1048  C CE2   . TYR B 2 52  ? 181.083 205.638 182.448 1.00 75.25  ? 51   TYR B CE2   1 
ATOM 1049  C CZ    . TYR B 2 52  ? 181.165 205.880 181.105 1.00 83.79  ? 51   TYR B CZ    1 
ATOM 1050  O OH    . TYR B 2 52  ? 180.568 206.989 180.572 1.00 95.87  ? 51   TYR B OH    1 
ATOM 1051  N N     . GLU B 2 53  ? 182.789 199.177 183.135 1.00 67.55  ? 52   GLU B N     1 
ATOM 1052  C CA    . GLU B 2 53  ? 183.419 197.921 183.507 1.00 67.43  ? 52   GLU B CA    1 
ATOM 1053  C C     . GLU B 2 53  ? 183.275 196.879 182.420 1.00 76.46  ? 52   GLU B C     1 
ATOM 1054  O O     . GLU B 2 53  ? 184.234 196.159 182.111 1.00 81.45  ? 52   GLU B O     1 
ATOM 1055  C CB    . GLU B 2 53  ? 182.851 197.422 184.821 1.00 59.58  ? 52   GLU B CB    1 
ATOM 1056  C CG    . GLU B 2 53  ? 183.309 198.306 185.908 1.00 83.58  ? 52   GLU B CG    1 
ATOM 1057  C CD    . GLU B 2 53  ? 184.810 198.421 185.875 1.00 89.37  ? 52   GLU B CD    1 
ATOM 1058  O OE1   . GLU B 2 53  ? 185.482 197.383 185.702 1.00 85.01  ? 52   GLU B OE1   1 
ATOM 1059  O OE2   . GLU B 2 53  ? 185.321 199.552 185.965 1.00 97.48  ? 52   GLU B OE2   1 
ATOM 1060  N N     . GLU B 2 54  ? 182.085 196.793 181.832 1.00 63.41  ? 53   GLU B N     1 
ATOM 1061  C CA    . GLU B 2 54  ? 181.859 195.827 180.772 1.00 59.77  ? 53   GLU B CA    1 
ATOM 1062  C C     . GLU B 2 54  ? 182.947 195.909 179.722 1.00 68.42  ? 53   GLU B C     1 
ATOM 1063  O O     . GLU B 2 54  ? 183.567 194.897 179.371 1.00 67.18  ? 53   GLU B O     1 
ATOM 1064  C CB    . GLU B 2 54  ? 180.498 196.067 180.134 1.00 60.42  ? 53   GLU B CB    1 
ATOM 1065  C CG    . GLU B 2 54  ? 180.176 195.109 179.022 1.00 64.53  ? 53   GLU B CG    1 
ATOM 1066  C CD    . GLU B 2 54  ? 179.997 193.701 179.515 1.00 80.40  ? 53   GLU B CD    1 
ATOM 1067  O OE1   . GLU B 2 54  ? 179.855 193.511 180.738 1.00 88.16  ? 53   GLU B OE1   1 
ATOM 1068  O OE2   . GLU B 2 54  ? 179.996 192.777 178.680 1.00 75.47  ? 53   GLU B OE2   1 
ATOM 1069  N N     . THR B 2 55  ? 183.218 197.115 179.235 1.00 61.77  ? 54   THR B N     1 
ATOM 1070  C CA    . THR B 2 55  ? 184.216 197.258 178.192 1.00 57.91  ? 54   THR B CA    1 
ATOM 1071  C C     . THR B 2 55  ? 185.564 196.731 178.643 1.00 59.97  ? 54   THR B C     1 
ATOM 1072  O O     . THR B 2 55  ? 186.171 195.913 177.951 1.00 61.51  ? 54   THR B O     1 
ATOM 1073  C CB    . THR B 2 55  ? 184.322 198.704 177.760 1.00 61.39  ? 54   THR B CB    1 
ATOM 1074  O OG1   . THR B 2 55  ? 183.122 199.064 177.078 1.00 69.33  ? 54   THR B OG1   1 
ATOM 1075  C CG2   . THR B 2 55  ? 185.481 198.867 176.840 1.00 53.48  ? 54   THR B CG2   1 
ATOM 1076  N N     . ARG B 2 56  ? 186.044 197.164 179.808 1.00 54.11  ? 55   ARG B N     1 
ATOM 1077  C CA    . ARG B 2 56  ? 187.329 196.657 180.271 1.00 56.70  ? 55   ARG B CA    1 
ATOM 1078  C C     . ARG B 2 56  ? 187.345 195.142 180.260 1.00 60.38  ? 55   ARG B C     1 
ATOM 1079  O O     . ARG B 2 56  ? 188.348 194.526 179.883 1.00 59.03  ? 55   ARG B O     1 
ATOM 1080  C CB    . ARG B 2 56  ? 187.640 197.159 181.669 1.00 49.71  ? 55   ARG B CB    1 
ATOM 1081  C CG    . ARG B 2 56  ? 187.814 198.640 181.770 1.00 50.25  ? 55   ARG B CG    1 
ATOM 1082  C CD    . ARG B 2 56  ? 188.191 198.991 183.182 1.00 61.07  ? 55   ARG B CD    1 
ATOM 1083  N NE    . ARG B 2 56  ? 188.272 200.424 183.373 1.00 66.66  ? 55   ARG B NE    1 
ATOM 1084  C CZ    . ARG B 2 56  ? 187.223 201.174 183.671 1.00 71.48  ? 55   ARG B CZ    1 
ATOM 1085  N NH1   . ARG B 2 56  ? 186.035 200.614 183.815 1.00 67.09  ? 55   ARG B NH1   1 
ATOM 1086  N NH2   . ARG B 2 56  ? 187.364 202.478 183.833 1.00 79.71  ? 55   ARG B NH2   1 
ATOM 1087  N N     . GLY B 2 57  ? 186.234 194.525 180.640 1.00 56.64  ? 56   GLY B N     1 
ATOM 1088  C CA    . GLY B 2 57  ? 186.150 193.084 180.548 1.00 66.92  ? 56   GLY B CA    1 
ATOM 1089  C C     . GLY B 2 57  ? 186.385 192.581 179.141 1.00 64.76  ? 56   GLY B C     1 
ATOM 1090  O O     . GLY B 2 57  ? 187.302 191.786 178.894 1.00 63.05  ? 56   GLY B O     1 
ATOM 1091  N N     . VAL B 2 58  ? 185.579 193.075 178.201 1.00 51.88  ? 57   VAL B N     1 
ATOM 1092  C CA    . VAL B 2 58  ? 185.682 192.614 176.821 1.00 51.51  ? 57   VAL B CA    1 
ATOM 1093  C C     . VAL B 2 58  ? 187.097 192.787 176.307 1.00 56.20  ? 57   VAL B C     1 
ATOM 1094  O O     . VAL B 2 58  ? 187.752 191.831 175.881 1.00 67.57  ? 57   VAL B O     1 
ATOM 1095  C CB    . VAL B 2 58  ? 184.689 193.366 175.931 1.00 56.98  ? 57   VAL B CB    1 
ATOM 1096  C CG1   . VAL B 2 58  ? 184.967 193.046 174.501 1.00 58.23  ? 57   VAL B CG1   1 
ATOM 1097  C CG2   . VAL B 2 58  ? 183.303 192.956 176.289 1.00 55.73  ? 57   VAL B CG2   1 
ATOM 1098  N N     . LEU B 2 59  ? 187.587 194.018 176.357 1.00 50.05  ? 58   LEU B N     1 
ATOM 1099  C CA    . LEU B 2 59  ? 188.921 194.322 175.872 1.00 54.16  ? 58   LEU B CA    1 
ATOM 1100  C C     . LEU B 2 59  ? 189.942 193.367 176.453 1.00 64.47  ? 58   LEU B C     1 
ATOM 1101  O O     . LEU B 2 59  ? 190.657 192.679 175.715 1.00 66.32  ? 58   LEU B O     1 
ATOM 1102  C CB    . LEU B 2 59  ? 189.272 195.752 176.242 1.00 48.25  ? 58   LEU B CB    1 
ATOM 1103  C CG    . LEU B 2 59  ? 190.667 196.162 175.846 1.00 51.50  ? 58   LEU B CG    1 
ATOM 1104  C CD1   . LEU B 2 59  ? 190.738 196.115 174.363 1.00 47.52  ? 58   LEU B CD1   1 
ATOM 1105  C CD2   . LEU B 2 59  ? 190.927 197.550 176.337 1.00 43.88  ? 58   LEU B CD2   1 
ATOM 1106  N N     . LYS B 2 60  ? 190.000 193.288 177.780 1.00 67.91  ? 59   LYS B N     1 
ATOM 1107  C CA    . LYS B 2 60  ? 190.967 192.410 178.420 1.00 63.13  ? 59   LYS B CA    1 
ATOM 1108  C C     . LYS B 2 60  ? 190.904 191.015 177.830 1.00 59.38  ? 59   LYS B C     1 
ATOM 1109  O O     . LYS B 2 60  ? 191.935 190.419 177.508 1.00 55.99  ? 59   LYS B O     1 
ATOM 1110  C CB    . LYS B 2 60  ? 190.719 192.359 179.916 1.00 58.21  ? 59   LYS B CB    1 
ATOM 1111  C CG    . LYS B 2 60  ? 191.691 191.484 180.639 1.00 73.54  ? 59   LYS B CG    1 
ATOM 1112  C CD    . LYS B 2 60  ? 191.379 191.481 182.115 1.00 89.41  ? 59   LYS B CD    1 
ATOM 1113  C CE    . LYS B 2 60  ? 192.321 190.571 182.874 1.00 97.62  ? 59   LYS B CE    1 
ATOM 1114  N NZ    . LYS B 2 60  ? 192.009 190.554 184.325 1.00 88.11  ? 59   LYS B NZ    1 
ATOM 1115  N N     . VAL B 2 61  ? 189.694 190.492 177.642 1.00 42.95  ? 60   VAL B N     1 
ATOM 1116  C CA    . VAL B 2 61  ? 189.564 189.190 176.996 1.00 44.70  ? 60   VAL B CA    1 
ATOM 1117  C C     . VAL B 2 61  ? 190.250 189.200 175.643 1.00 50.22  ? 60   VAL B C     1 
ATOM 1118  O O     . VAL B 2 61  ? 191.152 188.396 175.364 1.00 56.21  ? 60   VAL B O     1 
ATOM 1119  C CB    . VAL B 2 61  ? 188.086 188.809 176.852 1.00 42.52  ? 60   VAL B CB    1 
ATOM 1120  C CG1   . VAL B 2 61  ? 187.956 187.590 175.981 1.00 35.07  ? 60   VAL B CG1   1 
ATOM 1121  C CG2   . VAL B 2 61  ? 187.498 188.552 178.207 1.00 44.87  ? 60   VAL B CG2   1 
ATOM 1122  N N     . PHE B 2 62  ? 189.829 190.119 174.785 1.00 41.22  ? 61   PHE B N     1 
ATOM 1123  C CA    . PHE B 2 62  ? 190.303 190.119 173.414 1.00 48.61  ? 61   PHE B CA    1 
ATOM 1124  C C     . PHE B 2 62  ? 191.820 190.091 173.372 1.00 51.69  ? 61   PHE B C     1 
ATOM 1125  O O     . PHE B 2 62  ? 192.428 189.197 172.767 1.00 50.40  ? 61   PHE B O     1 
ATOM 1126  C CB    . PHE B 2 62  ? 189.748 191.342 172.704 1.00 47.91  ? 61   PHE B CB    1 
ATOM 1127  C CG    . PHE B 2 62  ? 190.105 191.415 171.279 1.00 47.86  ? 61   PHE B CG    1 
ATOM 1128  C CD1   . PHE B 2 62  ? 189.426 190.667 170.359 1.00 44.17  ? 61   PHE B CD1   1 
ATOM 1129  C CD2   . PHE B 2 62  ? 191.099 192.247 170.852 1.00 62.37  ? 61   PHE B CD2   1 
ATOM 1130  C CE1   . PHE B 2 62  ? 189.748 190.732 169.038 1.00 48.31  ? 61   PHE B CE1   1 
ATOM 1131  C CE2   . PHE B 2 62  ? 191.417 192.320 169.533 1.00 55.87  ? 61   PHE B CE2   1 
ATOM 1132  C CZ    . PHE B 2 62  ? 190.743 191.559 168.624 1.00 46.77  ? 61   PHE B CZ    1 
ATOM 1133  N N     . LEU B 2 63  ? 192.453 191.023 174.073 1.00 44.03  ? 62   LEU B N     1 
ATOM 1134  C CA    . LEU B 2 63  ? 193.905 191.043 174.056 1.00 44.08  ? 62   LEU B CA    1 
ATOM 1135  C C     . LEU B 2 63  ? 194.483 189.777 174.653 1.00 54.16  ? 62   LEU B C     1 
ATOM 1136  O O     . LEU B 2 63  ? 195.583 189.363 174.282 1.00 55.79  ? 62   LEU B O     1 
ATOM 1137  C CB    . LEU B 2 63  ? 194.428 192.256 174.794 1.00 44.42  ? 62   LEU B CB    1 
ATOM 1138  C CG    . LEU B 2 63  ? 193.913 193.483 174.085 1.00 48.38  ? 62   LEU B CG    1 
ATOM 1139  C CD1   . LEU B 2 63  ? 194.454 194.723 174.740 1.00 41.40  ? 62   LEU B CD1   1 
ATOM 1140  C CD2   . LEU B 2 63  ? 194.285 193.403 172.643 1.00 47.54  ? 62   LEU B CD2   1 
ATOM 1141  N N     . GLU B 2 64  ? 193.778 189.148 175.591 1.00 53.32  ? 63   GLU B N     1 
ATOM 1142  C CA    . GLU B 2 64  ? 194.271 187.865 176.068 1.00 59.35  ? 63   GLU B CA    1 
ATOM 1143  C C     . GLU B 2 64  ? 194.404 186.897 174.913 1.00 60.11  ? 63   GLU B C     1 
ATOM 1144  O O     . GLU B 2 64  ? 195.466 186.296 174.711 1.00 58.44  ? 63   GLU B O     1 
ATOM 1145  C CB    . GLU B 2 64  ? 193.364 187.294 177.150 1.00 58.85  ? 63   GLU B CB    1 
ATOM 1146  C CG    . GLU B 2 64  ? 193.497 187.992 178.479 1.00 66.62  ? 63   GLU B CG    1 
ATOM 1147  C CD    . GLU B 2 64  ? 192.516 187.477 179.511 1.00 73.49  ? 63   GLU B CD    1 
ATOM 1148  O OE1   . GLU B 2 64  ? 191.582 186.742 179.133 1.00 73.61  ? 63   GLU B OE1   1 
ATOM 1149  O OE2   . GLU B 2 64  ? 192.688 187.799 180.706 1.00 73.56  ? 63   GLU B OE2   1 
ATOM 1150  N N     . ASN B 2 65  ? 193.353 186.766 174.112 1.00 56.27  ? 64   ASN B N     1 
ATOM 1151  C CA    . ASN B 2 65  ? 193.442 185.860 172.977 1.00 57.46  ? 64   ASN B CA    1 
ATOM 1152  C C     . ASN B 2 65  ? 194.593 186.238 172.062 1.00 55.21  ? 64   ASN B C     1 
ATOM 1153  O O     . ASN B 2 65  ? 195.487 185.424 171.789 1.00 58.29  ? 64   ASN B O     1 
ATOM 1154  C CB    . ASN B 2 65  ? 192.139 185.851 172.198 1.00 50.53  ? 64   ASN B CB    1 
ATOM 1155  C CG    . ASN B 2 65  ? 191.065 185.097 172.902 1.00 47.33  ? 64   ASN B CG    1 
ATOM 1156  O OD1   . ASN B 2 65  ? 191.346 184.267 173.757 1.00 50.63  ? 64   ASN B OD1   1 
ATOM 1157  N ND2   . ASN B 2 65  ? 189.821 185.356 172.537 1.00 53.30  ? 64   ASN B ND2   1 
ATOM 1158  N N     . VAL B 2 66  ? 194.596 187.478 171.589 1.00 46.07  ? 65   VAL B N     1 
ATOM 1159  C CA    . VAL B 2 66  ? 195.562 187.844 170.563 1.00 44.08  ? 65   VAL B CA    1 
ATOM 1160  C C     . VAL B 2 66  ? 196.981 187.707 171.085 1.00 42.46  ? 65   VAL B C     1 
ATOM 1161  O O     . VAL B 2 66  ? 197.804 186.993 170.505 1.00 48.94  ? 65   VAL B O     1 
ATOM 1162  C CB    . VAL B 2 66  ? 195.292 189.256 170.045 1.00 38.68  ? 65   VAL B CB    1 
ATOM 1163  C CG1   . VAL B 2 66  ? 196.395 189.655 169.149 1.00 34.37  ? 65   VAL B CG1   1 
ATOM 1164  C CG2   . VAL B 2 66  ? 194.011 189.246 169.290 1.00 46.92  ? 65   VAL B CG2   1 
ATOM 1165  N N     . ILE B 2 67  ? 197.288 188.379 172.192 1.00 48.02  ? 66   ILE B N     1 
ATOM 1166  C CA    . ILE B 2 67  ? 198.630 188.285 172.758 1.00 40.46  ? 66   ILE B CA    1 
ATOM 1167  C C     . ILE B 2 67  ? 199.020 186.833 172.934 1.00 52.96  ? 66   ILE B C     1 
ATOM 1168  O O     . ILE B 2 67  ? 200.174 186.453 172.724 1.00 52.82  ? 66   ILE B O     1 
ATOM 1169  C CB    . ILE B 2 67  ? 198.713 189.036 174.091 1.00 37.61  ? 66   ILE B CB    1 
ATOM 1170  C CG1   . ILE B 2 67  ? 198.537 190.520 173.869 1.00 40.63  ? 66   ILE B CG1   1 
ATOM 1171  C CG2   . ILE B 2 67  ? 200.044 188.814 174.713 1.00 38.36  ? 66   ILE B CG2   1 
ATOM 1172  C CD1   . ILE B 2 67  ? 198.358 191.271 175.147 1.00 49.84  ? 66   ILE B CD1   1 
ATOM 1173  N N     . ARG B 2 68  ? 198.062 185.998 173.311 1.00 53.11  ? 67   ARG B N     1 
ATOM 1174  C CA    . ARG B 2 68  ? 198.344 184.575 173.371 1.00 50.82  ? 67   ARG B CA    1 
ATOM 1175  C C     . ARG B 2 68  ? 198.916 184.087 172.055 1.00 51.84  ? 67   ARG B C     1 
ATOM 1176  O O     . ARG B 2 68  ? 200.067 183.636 172.004 1.00 56.24  ? 67   ARG B O     1 
ATOM 1177  C CB    . ARG B 2 68  ? 197.092 183.796 173.724 1.00 54.48  ? 67   ARG B CB    1 
ATOM 1178  C CG    . ARG B 2 68  ? 197.270 182.313 173.703 1.00 68.33  ? 67   ARG B CG    1 
ATOM 1179  C CD    . ARG B 2 68  ? 195.987 181.690 174.147 1.00 89.17  ? 67   ARG B CD    1 
ATOM 1180  N NE    . ARG B 2 68  ? 195.755 182.029 175.540 1.00 99.55  ? 67   ARG B NE    1 
ATOM 1181  C CZ    . ARG B 2 68  ? 194.634 181.772 176.193 1.00 97.81  ? 67   ARG B CZ    1 
ATOM 1182  N NH1   . ARG B 2 68  ? 193.626 181.188 175.571 1.00 95.06  ? 67   ARG B NH1   1 
ATOM 1183  N NH2   . ARG B 2 68  ? 194.516 182.117 177.463 1.00 89.77  ? 67   ARG B NH2   1 
ATOM 1184  N N     . ASP B 2 69  ? 198.136 184.184 170.983 1.00 52.07  ? 68   ASP B N     1 
ATOM 1185  C CA    . ASP B 2 69  ? 198.615 183.628 169.723 1.00 44.51  ? 68   ASP B CA    1 
ATOM 1186  C C     . ASP B 2 69  ? 199.943 184.237 169.310 1.00 49.31  ? 68   ASP B C     1 
ATOM 1187  O O     . ASP B 2 69  ? 200.859 183.520 168.893 1.00 55.84  ? 68   ASP B O     1 
ATOM 1188  C CB    . ASP B 2 69  ? 197.582 183.825 168.631 1.00 43.77  ? 68   ASP B CB    1 
ATOM 1189  C CG    . ASP B 2 69  ? 196.360 183.002 168.866 1.00 74.85  ? 68   ASP B CG    1 
ATOM 1190  O OD1   . ASP B 2 69  ? 196.418 182.154 169.773 1.00 74.63  ? 68   ASP B OD1   1 
ATOM 1191  O OD2   . ASP B 2 69  ? 195.359 183.176 168.143 1.00 86.17  ? 68   ASP B OD2   1 
ATOM 1192  N N     . ALA B 2 70  ? 200.076 185.553 169.424 1.00 50.58  ? 69   ALA B N     1 
ATOM 1193  C CA    . ALA B 2 70  ? 201.326 186.184 169.031 1.00 48.40  ? 69   ALA B CA    1 
ATOM 1194  C C     . ALA B 2 70  ? 202.492 185.568 169.777 1.00 53.62  ? 69   ALA B C     1 
ATOM 1195  O O     . ALA B 2 70  ? 203.445 185.074 169.169 1.00 50.85  ? 69   ALA B O     1 
ATOM 1196  C CB    . ALA B 2 70  ? 201.262 187.681 169.286 1.00 37.38  ? 69   ALA B CB    1 
ATOM 1197  N N     . VAL B 2 71  ? 202.419 185.571 171.106 1.00 59.75  ? 70   VAL B N     1 
ATOM 1198  C CA    . VAL B 2 71  ? 203.486 184.987 171.906 1.00 62.71  ? 70   VAL B CA    1 
ATOM 1199  C C     . VAL B 2 71  ? 203.806 183.591 171.422 1.00 63.83  ? 70   VAL B C     1 
ATOM 1200  O O     . VAL B 2 71  ? 204.976 183.215 171.302 1.00 52.35  ? 70   VAL B O     1 
ATOM 1201  C CB    . VAL B 2 71  ? 203.098 184.982 173.389 1.00 55.46  ? 70   VAL B CB    1 
ATOM 1202  C CG1   . VAL B 2 71  ? 204.103 184.210 174.164 1.00 54.45  ? 70   VAL B CG1   1 
ATOM 1203  C CG2   . VAL B 2 71  ? 203.052 186.378 173.894 1.00 49.91  ? 70   VAL B CG2   1 
ATOM 1204  N N     . THR B 2 72  ? 202.778 182.806 171.112 1.00 61.31  ? 71   THR B N     1 
ATOM 1205  C CA    . THR B 2 72  ? 203.024 181.452 170.639 1.00 52.61  ? 71   THR B CA    1 
ATOM 1206  C C     . THR B 2 72  ? 203.871 181.451 169.380 1.00 49.11  ? 71   THR B C     1 
ATOM 1207  O O     . THR B 2 72  ? 204.899 180.770 169.313 1.00 56.56  ? 71   THR B O     1 
ATOM 1208  C CB    . THR B 2 72  ? 201.719 180.737 170.384 1.00 45.90  ? 71   THR B CB    1 
ATOM 1209  O OG1   . THR B 2 72  ? 201.027 180.585 171.623 1.00 47.48  ? 71   THR B OG1   1 
ATOM 1210  C CG2   . THR B 2 72  ? 202.007 179.399 169.798 1.00 36.24  ? 71   THR B CG2   1 
ATOM 1211  N N     . TYR B 2 73  ? 203.448 182.200 168.362 1.00 42.91  ? 72   TYR B N     1 
ATOM 1212  C CA    . TYR B 2 73  ? 204.292 182.346 167.183 1.00 51.27  ? 72   TYR B CA    1 
ATOM 1213  C C     . TYR B 2 73  ? 205.715 182.698 167.559 1.00 60.00  ? 72   TYR B C     1 
ATOM 1214  O O     . TYR B 2 73  ? 206.667 182.087 167.064 1.00 48.81  ? 72   TYR B O     1 
ATOM 1215  C CB    . TYR B 2 73  ? 203.752 183.418 166.263 1.00 39.03  ? 72   TYR B CB    1 
ATOM 1216  C CG    . TYR B 2 73  ? 202.661 182.979 165.367 1.00 39.11  ? 72   TYR B CG    1 
ATOM 1217  C CD1   . TYR B 2 73  ? 202.953 182.472 164.132 1.00 36.01  ? 72   TYR B CD1   1 
ATOM 1218  C CD2   . TYR B 2 73  ? 201.348 183.094 165.730 1.00 40.35  ? 72   TYR B CD2   1 
ATOM 1219  C CE1   . TYR B 2 73  ? 201.976 182.087 163.286 1.00 34.26  ? 72   TYR B CE1   1 
ATOM 1220  C CE2   . TYR B 2 73  ? 200.358 182.708 164.886 1.00 38.82  ? 72   TYR B CE2   1 
ATOM 1221  C CZ    . TYR B 2 73  ? 200.678 182.201 163.664 1.00 40.23  ? 72   TYR B CZ    1 
ATOM 1222  O OH    . TYR B 2 73  ? 199.692 181.803 162.802 1.00 53.31  ? 72   TYR B OH    1 
ATOM 1223  N N     . THR B 2 74  ? 205.880 183.685 168.430 1.00 54.02  ? 73   THR B N     1 
ATOM 1224  C CA    . THR B 2 74  ? 207.216 184.101 168.811 1.00 55.64  ? 73   THR B CA    1 
ATOM 1225  C C     . THR B 2 74  ? 208.021 182.932 169.344 1.00 63.07  ? 73   THR B C     1 
ATOM 1226  O O     . THR B 2 74  ? 208.997 182.507 168.719 1.00 58.40  ? 73   THR B O     1 
ATOM 1227  C CB    . THR B 2 74  ? 207.136 185.202 169.844 1.00 54.50  ? 73   THR B CB    1 
ATOM 1228  O OG1   . THR B 2 74  ? 206.474 186.325 169.265 1.00 63.36  ? 73   THR B OG1   1 
ATOM 1229  C CG2   . THR B 2 74  ? 208.509 185.604 170.240 1.00 44.33  ? 73   THR B CG2   1 
ATOM 1230  N N     . GLU B 2 75  ? 207.615 182.382 170.489 1.00 55.34  ? 74   GLU B N     1 
ATOM 1231  C CA    . GLU B 2 75  ? 208.364 181.277 171.068 1.00 58.41  ? 74   GLU B CA    1 
ATOM 1232  C C     . GLU B 2 75  ? 208.673 180.223 170.029 1.00 62.26  ? 74   GLU B C     1 
ATOM 1233  O O     . GLU B 2 75  ? 209.773 179.665 170.012 1.00 70.86  ? 74   GLU B O     1 
ATOM 1234  C CB    . GLU B 2 75  ? 207.602 180.647 172.225 1.00 65.92  ? 74   GLU B CB    1 
ATOM 1235  C CG    . GLU B 2 75  ? 207.535 181.499 173.467 1.00 80.95  ? 74   GLU B CG    1 
ATOM 1236  C CD    . GLU B 2 75  ? 206.784 180.813 174.594 1.00 103.44 ? 74   GLU B CD    1 
ATOM 1237  O OE1   . GLU B 2 75  ? 206.137 179.778 174.333 1.00 104.89 ? 74   GLU B OE1   1 
ATOM 1238  O OE2   . GLU B 2 75  ? 206.854 181.297 175.743 1.00 115.29 ? 74   GLU B OE2   1 
ATOM 1239  N N     . HIS B 2 76  ? 207.731 179.949 169.135 1.00 53.24  ? 75   HIS B N     1 
ATOM 1240  C CA    . HIS B 2 76  ? 208.056 179.022 168.069 1.00 59.19  ? 75   HIS B CA    1 
ATOM 1241  C C     . HIS B 2 76  ? 209.250 179.463 167.253 1.00 71.62  ? 75   HIS B C     1 
ATOM 1242  O O     . HIS B 2 76  ? 210.049 178.617 166.847 1.00 83.99  ? 75   HIS B O     1 
ATOM 1243  C CB    . HIS B 2 76  ? 206.896 178.828 167.127 1.00 55.74  ? 75   HIS B CB    1 
ATOM 1244  C CG    . HIS B 2 76  ? 207.293 178.151 165.864 1.00 55.88  ? 75   HIS B CG    1 
ATOM 1245  N ND1   . HIS B 2 76  ? 207.947 176.943 165.847 1.00 59.74  ? 75   HIS B ND1   1 
ATOM 1246  C CD2   . HIS B 2 76  ? 207.155 178.526 164.574 1.00 58.06  ? 75   HIS B CD2   1 
ATOM 1247  C CE1   . HIS B 2 76  ? 208.191 176.598 164.597 1.00 65.48  ? 75   HIS B CE1   1 
ATOM 1248  N NE2   . HIS B 2 76  ? 207.718 177.541 163.804 1.00 64.52  ? 75   HIS B NE2   1 
ATOM 1249  N N     . ALA B 2 77  ? 209.400 180.749 166.999 1.00 61.50  ? 76   ALA B N     1 
ATOM 1250  C CA    . ALA B 2 77  ? 210.534 181.198 166.213 1.00 57.67  ? 76   ALA B CA    1 
ATOM 1251  C C     . ALA B 2 77  ? 211.779 181.388 167.050 1.00 54.19  ? 76   ALA B C     1 
ATOM 1252  O O     . ALA B 2 77  ? 212.809 181.796 166.512 1.00 54.70  ? 76   ALA B O     1 
ATOM 1253  C CB    . ALA B 2 77  ? 210.201 182.500 165.495 1.00 61.54  ? 76   ALA B CB    1 
ATOM 1254  N N     . LYS B 2 78  ? 211.707 181.107 168.346 1.00 57.97  ? 77   LYS B N     1 
ATOM 1255  C CA    . LYS B 2 78  ? 212.842 181.271 169.240 1.00 60.04  ? 77   LYS B CA    1 
ATOM 1256  C C     . LYS B 2 78  ? 213.364 182.695 169.177 1.00 58.50  ? 77   LYS B C     1 
ATOM 1257  O O     . LYS B 2 78  ? 214.536 182.947 168.909 1.00 64.42  ? 77   LYS B O     1 
ATOM 1258  C CB    . LYS B 2 78  ? 213.938 180.270 168.907 1.00 58.54  ? 77   LYS B CB    1 
ATOM 1259  C CG    . LYS B 2 78  ? 213.520 178.849 169.132 1.00 69.81  ? 77   LYS B CG    1 
ATOM 1260  C CD    . LYS B 2 78  ? 214.576 177.902 168.626 1.00 76.96  ? 77   LYS B CD    1 
ATOM 1261  C CE    . LYS B 2 78  ? 214.182 176.460 168.868 1.00 85.24  ? 77   LYS B CE    1 
ATOM 1262  N NZ    . LYS B 2 78  ? 215.168 175.502 168.293 1.00 89.50  ? 77   LYS B NZ    1 
ATOM 1263  N N     . ARG B 2 79  ? 212.463 183.639 169.390 1.00 63.51  ? 78   ARG B N     1 
ATOM 1264  C CA    . ARG B 2 79  ? 212.816 185.042 169.488 1.00 61.68  ? 78   ARG B CA    1 
ATOM 1265  C C     . ARG B 2 79  ? 212.330 185.561 170.826 1.00 59.09  ? 78   ARG B C     1 
ATOM 1266  O O     . ARG B 2 79  ? 211.331 185.074 171.354 1.00 70.48  ? 78   ARG B O     1 
ATOM 1267  C CB    . ARG B 2 79  ? 212.213 185.843 168.340 1.00 60.26  ? 78   ARG B CB    1 
ATOM 1268  C CG    . ARG B 2 79  ? 212.825 185.473 167.015 1.00 62.55  ? 78   ARG B CG    1 
ATOM 1269  C CD    . ARG B 2 79  ? 212.388 186.371 165.878 1.00 54.78  ? 78   ARG B CD    1 
ATOM 1270  N NE    . ARG B 2 79  ? 210.993 186.211 165.504 1.00 56.55  ? 78   ARG B NE    1 
ATOM 1271  C CZ    . ARG B 2 79  ? 210.027 187.037 165.878 1.00 64.40  ? 78   ARG B CZ    1 
ATOM 1272  N NH1   . ARG B 2 79  ? 210.312 188.064 166.656 1.00 60.08  ? 78   ARG B NH1   1 
ATOM 1273  N NH2   . ARG B 2 79  ? 208.780 186.831 165.486 1.00 40.51  ? 78   ARG B NH2   1 
ATOM 1274  N N     . LYS B 2 80  ? 213.057 186.517 171.391 1.00 63.94  ? 79   LYS B N     1 
ATOM 1275  C CA    . LYS B 2 80  ? 212.599 187.131 172.626 1.00 68.02  ? 79   LYS B CA    1 
ATOM 1276  C C     . LYS B 2 80  ? 211.717 188.332 172.363 1.00 68.99  ? 79   LYS B C     1 
ATOM 1277  O O     . LYS B 2 80  ? 211.244 188.961 173.314 1.00 69.12  ? 79   LYS B O     1 
ATOM 1278  C CB    . LYS B 2 80  ? 213.790 187.552 173.469 1.00 69.59  ? 79   LYS B CB    1 
ATOM 1279  C CG    . LYS B 2 80  ? 214.716 186.421 173.773 1.00 81.13  ? 79   LYS B CG    1 
ATOM 1280  C CD    . LYS B 2 80  ? 214.038 185.396 174.637 1.00 92.12  ? 79   LYS B CD    1 
ATOM 1281  C CE    . LYS B 2 80  ? 214.974 184.241 174.907 1.00 95.69  ? 79   LYS B CE    1 
ATOM 1282  N NZ    . LYS B 2 80  ? 216.170 184.698 175.657 1.00 95.76  ? 79   LYS B NZ    1 
ATOM 1283  N N     . THR B 2 81  ? 211.496 188.662 171.102 1.00 66.65  ? 80   THR B N     1 
ATOM 1284  C CA    . THR B 2 81  ? 210.797 189.865 170.706 1.00 53.85  ? 80   THR B CA    1 
ATOM 1285  C C     . THR B 2 81  ? 209.527 189.474 169.982 1.00 63.12  ? 80   THR B C     1 
ATOM 1286  O O     . THR B 2 81  ? 209.483 188.448 169.306 1.00 81.69  ? 80   THR B O     1 
ATOM 1287  C CB    . THR B 2 81  ? 211.663 190.703 169.782 1.00 55.63  ? 80   THR B CB    1 
ATOM 1288  O OG1   . THR B 2 81  ? 212.907 190.983 170.429 1.00 74.73  ? 80   THR B OG1   1 
ATOM 1289  C CG2   . THR B 2 81  ? 210.982 192.003 169.453 1.00 61.30  ? 80   THR B CG2   1 
ATOM 1290  N N     . VAL B 2 82  ? 208.498 190.290 170.110 1.00 52.53  ? 81   VAL B N     1 
ATOM 1291  C CA    . VAL B 2 82  ? 207.287 190.100 169.335 1.00 50.88  ? 81   VAL B CA    1 
ATOM 1292  C C     . VAL B 2 82  ? 207.259 191.156 168.247 1.00 62.57  ? 81   VAL B C     1 
ATOM 1293  O O     . VAL B 2 82  ? 207.015 192.332 168.517 1.00 62.45  ? 81   VAL B O     1 
ATOM 1294  C CB    . VAL B 2 82  ? 206.045 190.179 170.216 1.00 45.98  ? 81   VAL B CB    1 
ATOM 1295  C CG1   . VAL B 2 82  ? 204.829 190.140 169.359 1.00 41.57  ? 81   VAL B CG1   1 
ATOM 1296  C CG2   . VAL B 2 82  ? 206.049 189.033 171.174 1.00 58.89  ? 81   VAL B CG2   1 
ATOM 1297  N N     . THR B 2 83  ? 207.503 190.743 167.015 1.00 59.20  ? 82   THR B N     1 
ATOM 1298  C CA    . THR B 2 83  ? 207.432 191.665 165.900 1.00 50.97  ? 82   THR B CA    1 
ATOM 1299  C C     . THR B 2 83  ? 205.986 191.935 165.550 1.00 57.12  ? 82   THR B C     1 
ATOM 1300  O O     . THR B 2 83  ? 205.087 191.195 165.940 1.00 57.32  ? 82   THR B O     1 
ATOM 1301  C CB    . THR B 2 83  ? 208.132 191.112 164.672 1.00 54.56  ? 82   THR B CB    1 
ATOM 1302  O OG1   . THR B 2 83  ? 207.441 189.941 164.240 1.00 42.91  ? 82   THR B OG1   1 
ATOM 1303  C CG2   . THR B 2 83  ? 209.547 190.742 165.004 1.00 56.87  ? 82   THR B CG2   1 
ATOM 1304  N N     . ALA B 2 84  ? 205.767 193.013 164.809 1.00 59.81  ? 83   ALA B N     1 
ATOM 1305  C CA    . ALA B 2 84  ? 204.423 193.296 164.335 1.00 52.45  ? 83   ALA B CA    1 
ATOM 1306  C C     . ALA B 2 84  ? 203.895 192.154 163.486 1.00 62.26  ? 83   ALA B C     1 
ATOM 1307  O O     . ALA B 2 84  ? 202.722 191.781 163.597 1.00 60.08  ? 83   ALA B O     1 
ATOM 1308  C CB    . ALA B 2 84  ? 204.409 194.600 163.549 1.00 54.25  ? 83   ALA B CB    1 
ATOM 1309  N N     . MET B 2 85  ? 204.742 191.581 162.635 1.00 63.29  ? 84   MET B N     1 
ATOM 1310  C CA    . MET B 2 85  ? 204.298 190.465 161.818 1.00 66.76  ? 84   MET B CA    1 
ATOM 1311  C C     . MET B 2 85  ? 203.695 189.367 162.667 1.00 67.96  ? 84   MET B C     1 
ATOM 1312  O O     . MET B 2 85  ? 202.726 188.720 162.258 1.00 62.71  ? 84   MET B O     1 
ATOM 1313  C CB    . MET B 2 85  ? 205.458 189.912 161.016 1.00 55.33  ? 84   MET B CB    1 
ATOM 1314  C CG    . MET B 2 85  ? 205.962 190.883 160.021 1.00 64.26  ? 84   MET B CG    1 
ATOM 1315  S SD    . MET B 2 85  ? 204.589 191.365 158.979 1.00 86.68  ? 84   MET B SD    1 
ATOM 1316  C CE    . MET B 2 85  ? 204.193 189.794 158.228 1.00 134.85 ? 84   MET B CE    1 
ATOM 1317  N N     . ASP B 2 86  ? 204.252 189.147 163.850 1.00 59.56  ? 85   ASP B N     1 
ATOM 1318  C CA    . ASP B 2 86  ? 203.668 188.190 164.770 1.00 54.20  ? 85   ASP B CA    1 
ATOM 1319  C C     . ASP B 2 86  ? 202.204 188.505 164.993 1.00 56.68  ? 85   ASP B C     1 
ATOM 1320  O O     . ASP B 2 86  ? 201.327 187.674 164.741 1.00 67.10  ? 85   ASP B O     1 
ATOM 1321  C CB    . ASP B 2 86  ? 204.423 188.255 166.079 1.00 59.32  ? 85   ASP B CB    1 
ATOM 1322  C CG    . ASP B 2 86  ? 205.890 188.067 165.881 1.00 66.35  ? 85   ASP B CG    1 
ATOM 1323  O OD1   . ASP B 2 86  ? 206.267 187.494 164.844 1.00 68.75  ? 85   ASP B OD1   1 
ATOM 1324  O OD2   . ASP B 2 86  ? 206.675 188.563 166.710 1.00 60.41  ? 85   ASP B OD2   1 
ATOM 1325  N N     . VAL B 2 87  ? 201.922 189.731 165.423 1.00 53.58  ? 86   VAL B N     1 
ATOM 1326  C CA    . VAL B 2 87  ? 200.546 190.133 165.667 1.00 54.40  ? 86   VAL B CA    1 
ATOM 1327  C C     . VAL B 2 87  ? 199.709 189.913 164.431 1.00 60.62  ? 86   VAL B C     1 
ATOM 1328  O O     . VAL B 2 87  ? 198.729 189.169 164.458 1.00 68.60  ? 86   VAL B O     1 
ATOM 1329  C CB    . VAL B 2 87  ? 200.481 191.594 166.114 1.00 46.66  ? 86   VAL B CB    1 
ATOM 1330  C CG1   . VAL B 2 87  ? 199.062 192.037 166.103 1.00 52.37  ? 86   VAL B CG1   1 
ATOM 1331  C CG2   . VAL B 2 87  ? 201.049 191.717 167.488 1.00 49.75  ? 86   VAL B CG2   1 
ATOM 1332  N N     . VAL B 2 88  ? 200.101 190.526 163.318 1.00 51.93  ? 87   VAL B N     1 
ATOM 1333  C CA    . VAL B 2 88  ? 199.277 190.439 162.120 1.00 48.57  ? 87   VAL B CA    1 
ATOM 1334  C C     . VAL B 2 88  ? 198.942 188.995 161.805 1.00 53.32  ? 87   VAL B C     1 
ATOM 1335  O O     . VAL B 2 88  ? 197.839 188.685 161.345 1.00 61.64  ? 87   VAL B O     1 
ATOM 1336  C CB    . VAL B 2 88  ? 199.974 191.110 160.938 1.00 46.46  ? 87   VAL B CB    1 
ATOM 1337  C CG1   . VAL B 2 88  ? 199.113 190.989 159.722 1.00 36.11  ? 87   VAL B CG1   1 
ATOM 1338  C CG2   . VAL B 2 88  ? 200.230 192.531 161.258 1.00 34.82  ? 87   VAL B CG2   1 
ATOM 1339  N N     . TYR B 2 89  ? 199.866 188.081 162.075 1.00 46.97  ? 88   TYR B N     1 
ATOM 1340  C CA    . TYR B 2 89  ? 199.519 186.683 161.885 1.00 47.91  ? 88   TYR B CA    1 
ATOM 1341  C C     . TYR B 2 89  ? 198.560 186.199 162.954 1.00 52.08  ? 88   TYR B C     1 
ATOM 1342  O O     . TYR B 2 89  ? 197.755 185.302 162.702 1.00 56.64  ? 88   TYR B O     1 
ATOM 1343  C CB    . TYR B 2 89  ? 200.766 185.824 161.848 1.00 47.71  ? 88   TYR B CB    1 
ATOM 1344  C CG    . TYR B 2 89  ? 201.560 186.083 160.617 1.00 58.77  ? 88   TYR B CG    1 
ATOM 1345  C CD1   . TYR B 2 89  ? 200.925 186.315 159.421 1.00 68.45  ? 88   TYR B CD1   1 
ATOM 1346  C CD2   . TYR B 2 89  ? 202.936 186.095 160.644 1.00 60.59  ? 88   TYR B CD2   1 
ATOM 1347  C CE1   . TYR B 2 89  ? 201.630 186.562 158.284 1.00 78.13  ? 88   TYR B CE1   1 
ATOM 1348  C CE2   . TYR B 2 89  ? 203.654 186.333 159.509 1.00 67.71  ? 88   TYR B CE2   1 
ATOM 1349  C CZ    . TYR B 2 89  ? 202.993 186.569 158.328 1.00 76.79  ? 88   TYR B CZ    1 
ATOM 1350  O OH    . TYR B 2 89  ? 203.695 186.815 157.175 1.00 83.73  ? 88   TYR B OH    1 
ATOM 1351  N N     . ALA B 2 90  ? 198.617 186.766 164.150 1.00 39.95  ? 89   ALA B N     1 
ATOM 1352  C CA    . ALA B 2 90  ? 197.651 186.342 165.149 1.00 33.27  ? 89   ALA B CA    1 
ATOM 1353  C C     . ALA B 2 90  ? 196.256 186.808 164.781 1.00 45.65  ? 89   ALA B C     1 
ATOM 1354  O O     . ALA B 2 90  ? 195.308 186.017 164.773 1.00 57.31  ? 89   ALA B O     1 
ATOM 1355  C CB    . ALA B 2 90  ? 198.044 186.863 166.520 1.00 35.58  ? 89   ALA B CB    1 
ATOM 1356  N N     . LEU B 2 91  ? 196.106 188.086 164.474 1.00 35.46  ? 90   LEU B N     1 
ATOM 1357  C CA    . LEU B 2 91  ? 194.811 188.577 164.048 1.00 41.70  ? 90   LEU B CA    1 
ATOM 1358  C C     . LEU B 2 91  ? 194.323 187.797 162.847 1.00 53.33  ? 90   LEU B C     1 
ATOM 1359  O O     . LEU B 2 91  ? 193.191 187.305 162.832 1.00 47.15  ? 90   LEU B O     1 
ATOM 1360  C CB    . LEU B 2 91  ? 194.901 190.059 163.742 1.00 35.57  ? 90   LEU B CB    1 
ATOM 1361  C CG    . LEU B 2 91  ? 195.263 190.780 165.023 1.00 42.21  ? 90   LEU B CG    1 
ATOM 1362  C CD1   . LEU B 2 91  ? 195.533 192.225 164.773 1.00 40.23  ? 90   LEU B CD1   1 
ATOM 1363  C CD2   . LEU B 2 91  ? 194.123 190.628 165.958 1.00 33.04  ? 90   LEU B CD2   1 
ATOM 1364  N N     . LYS B 2 92  ? 195.175 187.641 161.840 1.00 43.05  ? 91   LYS B N     1 
ATOM 1365  C CA    . LYS B 2 92  ? 194.784 186.830 160.701 1.00 41.89  ? 91   LYS B CA    1 
ATOM 1366  C C     . LYS B 2 92  ? 194.320 185.463 161.144 1.00 45.66  ? 91   LYS B C     1 
ATOM 1367  O O     . LYS B 2 92  ? 193.363 184.919 160.590 1.00 49.28  ? 91   LYS B O     1 
ATOM 1368  C CB    . LYS B 2 92  ? 195.942 186.688 159.733 1.00 31.44  ? 91   LYS B CB    1 
ATOM 1369  C CG    . LYS B 2 92  ? 195.600 185.894 158.510 1.00 48.96  ? 91   LYS B CG    1 
ATOM 1370  C CD    . LYS B 2 92  ? 196.781 185.853 157.583 1.00 74.61  ? 91   LYS B CD    1 
ATOM 1371  C CE    . LYS B 2 92  ? 196.490 185.039 156.355 1.00 92.79  ? 91   LYS B CE    1 
ATOM 1372  N NZ    . LYS B 2 92  ? 197.689 184.994 155.487 1.00 99.34  ? 91   LYS B NZ    1 
ATOM 1373  N N     . ARG B 2 93  ? 194.969 184.905 162.156 1.00 48.29  ? 92   ARG B N     1 
ATOM 1374  C CA    . ARG B 2 93  ? 194.534 183.626 162.686 1.00 43.37  ? 92   ARG B CA    1 
ATOM 1375  C C     . ARG B 2 93  ? 193.117 183.702 163.213 1.00 50.44  ? 92   ARG B C     1 
ATOM 1376  O O     . ARG B 2 93  ? 192.305 182.826 162.913 1.00 52.21  ? 92   ARG B O     1 
ATOM 1377  C CB    . ARG B 2 93  ? 195.487 183.157 163.780 1.00 48.67  ? 92   ARG B CB    1 
ATOM 1378  C CG    . ARG B 2 93  ? 195.014 181.965 164.525 1.00 60.37  ? 92   ARG B CG    1 
ATOM 1379  C CD    . ARG B 2 93  ? 194.866 180.803 163.635 1.00 64.26  ? 92   ARG B CD    1 
ATOM 1380  N NE    . ARG B 2 93  ? 194.180 179.742 164.348 1.00 75.04  ? 92   ARG B NE    1 
ATOM 1381  C CZ    . ARG B 2 93  ? 192.860 179.683 164.455 1.00 89.81  ? 92   ARG B CZ    1 
ATOM 1382  N NH1   . ARG B 2 93  ? 192.123 180.642 163.905 1.00 89.87  ? 92   ARG B NH1   1 
ATOM 1383  N NH2   . ARG B 2 93  ? 192.284 178.685 165.118 1.00 91.04  ? 92   ARG B NH2   1 
ATOM 1384  N N     . GLN B 2 94  ? 192.781 184.744 163.956 1.00 56.21  ? 93   GLN B N     1 
ATOM 1385  C CA    . GLN B 2 94  ? 191.465 184.786 164.563 1.00 51.32  ? 93   GLN B CA    1 
ATOM 1386  C C     . GLN B 2 94  ? 190.403 185.266 163.604 1.00 55.90  ? 93   GLN B C     1 
ATOM 1387  O O     . GLN B 2 94  ? 189.251 185.427 164.007 1.00 49.53  ? 93   GLN B O     1 
ATOM 1388  C CB    . GLN B 2 94  ? 191.463 185.676 165.789 1.00 46.02  ? 93   GLN B CB    1 
ATOM 1389  C CG    . GLN B 2 94  ? 192.386 185.219 166.858 1.00 61.92  ? 93   GLN B CG    1 
ATOM 1390  C CD    . GLN B 2 94  ? 192.273 186.084 168.078 1.00 72.22  ? 93   GLN B CD    1 
ATOM 1391  O OE1   . GLN B 2 94  ? 191.684 187.157 168.028 1.00 79.15  ? 93   GLN B OE1   1 
ATOM 1392  N NE2   . GLN B 2 94  ? 192.880 185.653 169.171 1.00 65.41  ? 93   GLN B NE2   1 
ATOM 1393  N N     . GLY B 2 95  ? 190.760 185.524 162.358 1.00 52.97  ? 94   GLY B N     1 
ATOM 1394  C CA    . GLY B 2 95  ? 189.779 185.929 161.385 1.00 55.26  ? 94   GLY B CA    1 
ATOM 1395  C C     . GLY B 2 95  ? 189.576 187.415 161.284 1.00 48.85  ? 94   GLY B C     1 
ATOM 1396  O O     . GLY B 2 95  ? 188.644 187.851 160.605 1.00 59.67  ? 94   GLY B O     1 
ATOM 1397  N N     . ARG B 2 96  ? 190.418 188.204 161.928 1.00 37.31  ? 95   ARG B N     1 
ATOM 1398  C CA    . ARG B 2 96  ? 190.405 189.647 161.776 1.00 39.50  ? 95   ARG B CA    1 
ATOM 1399  C C     . ARG B 2 96  ? 191.655 190.019 161.009 1.00 56.25  ? 95   ARG B C     1 
ATOM 1400  O O     . ARG B 2 96  ? 192.757 189.981 161.557 1.00 50.43  ? 95   ARG B O     1 
ATOM 1401  C CB    . ARG B 2 96  ? 190.382 190.324 163.135 1.00 40.83  ? 95   ARG B CB    1 
ATOM 1402  C CG    . ARG B 2 96  ? 189.234 189.856 163.947 1.00 49.17  ? 95   ARG B CG    1 
ATOM 1403  C CD    . ARG B 2 96  ? 189.128 190.564 165.257 1.00 57.27  ? 95   ARG B CD    1 
ATOM 1404  N NE    . ARG B 2 96  ? 188.024 189.992 166.002 1.00 64.91  ? 95   ARG B NE    1 
ATOM 1405  C CZ    . ARG B 2 96  ? 186.755 190.291 165.771 1.00 78.55  ? 95   ARG B CZ    1 
ATOM 1406  N NH1   . ARG B 2 96  ? 186.442 191.153 164.815 1.00 86.20  ? 95   ARG B NH1   1 
ATOM 1407  N NH2   . ARG B 2 96  ? 185.800 189.723 166.487 1.00 78.49  ? 95   ARG B NH2   1 
ATOM 1408  N N     . THR B 2 97  ? 191.493 190.386 159.755 1.00 48.04  ? 96   THR B N     1 
ATOM 1409  C CA    . THR B 2 97  ? 192.637 190.678 158.915 1.00 51.05  ? 96   THR B CA    1 
ATOM 1410  C C     . THR B 2 97  ? 192.985 192.143 159.069 1.00 51.69  ? 96   THR B C     1 
ATOM 1411  O O     . THR B 2 97  ? 192.112 193.006 158.951 1.00 61.66  ? 96   THR B O     1 
ATOM 1412  C CB    . THR B 2 97  ? 192.344 190.354 157.460 1.00 52.50  ? 96   THR B CB    1 
ATOM 1413  O OG1   . THR B 2 97  ? 192.010 188.970 157.344 1.00 58.62  ? 96   THR B OG1   1 
ATOM 1414  C CG2   . THR B 2 97  ? 193.564 190.618 156.638 1.00 49.49  ? 96   THR B CG2   1 
ATOM 1415  N N     . LEU B 2 98  ? 194.249 192.423 159.331 1.00 42.56  ? 97   LEU B N     1 
ATOM 1416  C CA    . LEU B 2 98  ? 194.716 193.783 159.508 1.00 39.61  ? 97   LEU B CA    1 
ATOM 1417  C C     . LEU B 2 98  ? 195.666 194.134 158.378 1.00 51.06  ? 97   LEU B C     1 
ATOM 1418  O O     . LEU B 2 98  ? 196.468 193.303 157.960 1.00 48.97  ? 97   LEU B O     1 
ATOM 1419  C CB    . LEU B 2 98  ? 195.424 193.927 160.843 1.00 34.56  ? 97   LEU B CB    1 
ATOM 1420  C CG    . LEU B 2 98  ? 195.927 195.322 161.102 1.00 41.55  ? 97   LEU B CG    1 
ATOM 1421  C CD1   . LEU B 2 98  ? 194.728 196.193 161.169 1.00 50.60  ? 97   LEU B CD1   1 
ATOM 1422  C CD2   . LEU B 2 98  ? 196.674 195.366 162.394 1.00 38.03  ? 97   LEU B CD2   1 
ATOM 1423  N N     . TYR B 2 99  ? 195.577 195.356 157.879 1.00 45.41  ? 98   TYR B N     1 
ATOM 1424  C CA    . TYR B 2 99  ? 196.489 195.800 156.846 1.00 51.91  ? 98   TYR B CA    1 
ATOM 1425  C C     . TYR B 2 99  ? 197.325 196.956 157.348 1.00 50.23  ? 98   TYR B C     1 
ATOM 1426  O O     . TYR B 2 99  ? 196.997 197.609 158.335 1.00 43.70  ? 98   TYR B O     1 
ATOM 1427  C CB    . TYR B 2 99  ? 195.789 196.266 155.589 1.00 62.80  ? 98   TYR B CB    1 
ATOM 1428  C CG    . TYR B 2 99  ? 195.072 195.207 154.846 1.00 56.55  ? 98   TYR B CG    1 
ATOM 1429  C CD1   . TYR B 2 99  ? 195.459 193.903 154.942 1.00 55.05  ? 98   TYR B CD1   1 
ATOM 1430  C CD2   . TYR B 2 99  ? 194.081 195.531 153.947 1.00 52.69  ? 98   TYR B CD2   1 
ATOM 1431  C CE1   . TYR B 2 99  ? 194.817 192.933 154.233 1.00 59.33  ? 98   TYR B CE1   1 
ATOM 1432  C CE2   . TYR B 2 99  ? 193.438 194.576 153.232 1.00 49.26  ? 98   TYR B CE2   1 
ATOM 1433  C CZ    . TYR B 2 99  ? 193.809 193.278 153.378 1.00 56.29  ? 98   TYR B CZ    1 
ATOM 1434  O OH    . TYR B 2 99  ? 193.166 192.312 152.658 1.00 57.58  ? 98   TYR B OH    1 
ATOM 1435  N N     . GLY B 2 100 ? 198.416 197.197 156.652 1.00 47.71  ? 99   GLY B N     1 
ATOM 1436  C CA    . GLY B 2 100 ? 199.223 198.359 156.875 1.00 57.43  ? 99   GLY B CA    1 
ATOM 1437  C C     . GLY B 2 100 ? 200.492 198.098 157.640 1.00 62.42  ? 99   GLY B C     1 
ATOM 1438  O O     . GLY B 2 100 ? 201.405 198.921 157.589 1.00 64.16  ? 99   GLY B O     1 
ATOM 1439  N N     . PHE B 2 101 ? 200.573 196.997 158.359 1.00 72.83  ? 100  PHE B N     1 
ATOM 1440  C CA    . PHE B 2 101 ? 201.775 196.701 159.110 1.00 53.14  ? 100  PHE B CA    1 
ATOM 1441  C C     . PHE B 2 101 ? 202.685 195.701 158.428 1.00 51.84  ? 100  PHE B C     1 
ATOM 1442  O O     . PHE B 2 101 ? 203.740 195.374 158.973 1.00 62.19  ? 100  PHE B O     1 
ATOM 1443  C CB    . PHE B 2 101 ? 201.385 196.246 160.497 1.00 42.03  ? 100  PHE B CB    1 
ATOM 1444  C CG    . PHE B 2 101 ? 200.713 197.317 161.255 1.00 43.69  ? 100  PHE B CG    1 
ATOM 1445  C CD1   . PHE B 2 101 ? 200.973 198.629 160.944 1.00 40.20  ? 100  PHE B CD1   1 
ATOM 1446  C CD2   . PHE B 2 101 ? 199.774 197.038 162.208 1.00 40.68  ? 100  PHE B CD2   1 
ATOM 1447  C CE1   . PHE B 2 101 ? 200.356 199.639 161.609 1.00 49.77  ? 100  PHE B CE1   1 
ATOM 1448  C CE2   . PHE B 2 101 ? 199.146 198.052 162.867 1.00 37.87  ? 100  PHE B CE2   1 
ATOM 1449  C CZ    . PHE B 2 101 ? 199.440 199.354 162.570 1.00 46.06  ? 100  PHE B CZ    1 
ATOM 1450  N N     . GLY B 2 102 ? 202.297 195.196 157.266 1.00 61.19  ? 101  GLY B N     1 
ATOM 1451  C CA    . GLY B 2 102 ? 203.099 194.216 156.561 1.00 48.05  ? 101  GLY B CA    1 
ATOM 1452  C C     . GLY B 2 102 ? 202.322 192.954 156.259 1.00 48.37  ? 101  GLY B C     1 
ATOM 1453  O O     . GLY B 2 102 ? 202.905 191.894 156.042 1.00 50.64  ? 101  GLY B O     1 
ATOM 1454  N N     . ALA C 3 13  ? 215.065 141.247 158.221 1.00 117.74 ? 12   ALA C N     1 
ATOM 1455  C CA    . ALA C 3 13  ? 214.251 141.721 157.112 1.00 126.05 ? 12   ALA C CA    1 
ATOM 1456  C C     . ALA C 3 13  ? 212.787 141.332 157.295 1.00 138.83 ? 12   ALA C C     1 
ATOM 1457  O O     . ALA C 3 13  ? 212.151 140.834 156.368 1.00 138.12 ? 12   ALA C O     1 
ATOM 1458  C CB    . ALA C 3 13  ? 214.783 141.181 155.796 1.00 117.86 ? 12   ALA C CB    1 
ATOM 1459  N N     . LYS C 3 14  ? 212.261 141.553 158.497 1.00 141.39 ? 13   LYS C N     1 
ATOM 1460  C CA    . LYS C 3 14  ? 210.842 141.383 158.781 1.00 130.93 ? 13   LYS C CA    1 
ATOM 1461  C C     . LYS C 3 14  ? 210.262 142.726 159.197 1.00 135.00 ? 13   LYS C C     1 
ATOM 1462  O O     . LYS C 3 14  ? 210.769 143.366 160.124 1.00 136.40 ? 13   LYS C O     1 
ATOM 1463  C CB    . LYS C 3 14  ? 210.607 140.347 159.877 1.00 117.15 ? 13   LYS C CB    1 
ATOM 1464  N N     . ALA C 3 15  ? 209.191 143.137 158.531 1.00 131.40 ? 14   ALA C N     1 
ATOM 1465  C CA    . ALA C 3 15  ? 208.711 144.499 158.661 1.00 116.82 ? 14   ALA C CA    1 
ATOM 1466  C C     . ALA C 3 15  ? 207.765 144.653 159.838 1.00 115.81 ? 14   ALA C C     1 
ATOM 1467  O O     . ALA C 3 15  ? 206.860 143.843 160.054 1.00 113.53 ? 14   ALA C O     1 
ATOM 1468  C CB    . ALA C 3 15  ? 208.004 144.941 157.382 1.00 99.25  ? 14   ALA C CB    1 
ATOM 1469  N N     . LYS C 3 16  ? 207.984 145.717 160.598 1.00 115.03 ? 15   LYS C N     1 
ATOM 1470  C CA    . LYS C 3 16  ? 207.054 146.148 161.623 1.00 111.55 ? 15   LYS C CA    1 
ATOM 1471  C C     . LYS C 3 16  ? 206.500 147.504 161.220 1.00 110.47 ? 15   LYS C C     1 
ATOM 1472  O O     . LYS C 3 16  ? 207.200 148.323 160.620 1.00 109.35 ? 15   LYS C O     1 
ATOM 1473  C CB    . LYS C 3 16  ? 207.720 146.239 162.995 1.00 97.02  ? 15   LYS C CB    1 
ATOM 1474  C CG    . LYS C 3 16  ? 206.752 146.565 164.097 1.00 102.34 ? 15   LYS C CG    1 
ATOM 1475  C CD    . LYS C 3 16  ? 207.466 146.855 165.389 1.00 113.09 ? 15   LYS C CD    1 
ATOM 1476  C CE    . LYS C 3 16  ? 208.129 145.623 165.942 1.00 115.66 ? 15   LYS C CE    1 
ATOM 1477  N NZ    . LYS C 3 16  ? 208.817 145.937 167.217 1.00 115.89 ? 15   LYS C NZ    1 
ATOM 1478  N N     . THR C 3 17  ? 205.234 147.729 161.541 1.00 100.63 ? 16   THR C N     1 
ATOM 1479  C CA    . THR C 3 17  ? 204.585 148.971 161.160 1.00 89.00  ? 16   THR C CA    1 
ATOM 1480  C C     . THR C 3 17  ? 204.932 150.077 162.143 1.00 91.07  ? 16   THR C C     1 
ATOM 1481  O O     . THR C 3 17  ? 205.051 149.843 163.347 1.00 92.99  ? 16   THR C O     1 
ATOM 1482  C CB    . THR C 3 17  ? 203.079 148.774 161.109 1.00 75.21  ? 16   THR C CB    1 
ATOM 1483  O OG1   . THR C 3 17  ? 202.627 148.316 162.388 1.00 68.91  ? 16   THR C OG1   1 
ATOM 1484  C CG2   . THR C 3 17  ? 202.726 147.741 160.063 1.00 68.44  ? 16   THR C CG2   1 
ATOM 1485  N N     . ARG C 3 18  ? 205.106 151.290 161.621 1.00 82.18  ? 17   ARG C N     1 
ATOM 1486  C CA    . ARG C 3 18  ? 205.416 152.404 162.505 1.00 69.16  ? 17   ARG C CA    1 
ATOM 1487  C C     . ARG C 3 18  ? 204.315 152.628 163.523 1.00 69.12  ? 17   ARG C C     1 
ATOM 1488  O O     . ARG C 3 18  ? 204.594 152.829 164.709 1.00 71.46  ? 17   ARG C O     1 
ATOM 1489  C CB    . ARG C 3 18  ? 205.685 153.674 161.705 1.00 61.68  ? 17   ARG C CB    1 
ATOM 1490  C CG    . ARG C 3 18  ? 207.109 153.757 161.238 1.00 65.00  ? 17   ARG C CG    1 
ATOM 1491  C CD    . ARG C 3 18  ? 207.378 154.959 160.381 1.00 66.37  ? 17   ARG C CD    1 
ATOM 1492  N NE    . ARG C 3 18  ? 206.791 154.835 159.059 1.00 63.03  ? 17   ARG C NE    1 
ATOM 1493  C CZ    . ARG C 3 18  ? 206.937 155.745 158.108 1.00 70.85  ? 17   ARG C CZ    1 
ATOM 1494  N NH1   . ARG C 3 18  ? 207.641 156.838 158.348 1.00 64.86  ? 17   ARG C NH1   1 
ATOM 1495  N NH2   . ARG C 3 18  ? 206.385 155.565 156.922 1.00 87.11  ? 17   ARG C NH2   1 
ATOM 1496  N N     . SER C 3 19  ? 203.059 152.563 163.094 1.00 68.96  ? 18   SER C N     1 
ATOM 1497  C CA    . SER C 3 19  ? 201.955 152.798 164.013 1.00 69.81  ? 18   SER C CA    1 
ATOM 1498  C C     . SER C 3 19  ? 202.077 151.907 165.237 1.00 75.16  ? 18   SER C C     1 
ATOM 1499  O O     . SER C 3 19  ? 201.640 152.260 166.337 1.00 70.36  ? 18   SER C O     1 
ATOM 1500  C CB    . SER C 3 19  ? 200.632 152.559 163.296 1.00 64.23  ? 18   SER C CB    1 
ATOM 1501  O OG    . SER C 3 19  ? 200.471 153.495 162.248 1.00 70.26  ? 18   SER C OG    1 
ATOM 1502  N N     . SER C 3 20  ? 202.690 150.743 165.057 1.00 81.61  ? 19   SER C N     1 
ATOM 1503  C CA    . SER C 3 20  ? 202.960 149.870 166.186 1.00 87.29  ? 19   SER C CA    1 
ATOM 1504  C C     . SER C 3 20  ? 204.133 150.387 166.998 1.00 82.42  ? 19   SER C C     1 
ATOM 1505  O O     . SER C 3 20  ? 204.085 150.406 168.231 1.00 76.06  ? 19   SER C O     1 
ATOM 1506  C CB    . SER C 3 20  ? 203.240 148.462 165.684 1.00 87.66  ? 19   SER C CB    1 
ATOM 1507  O OG    . SER C 3 20  ? 204.377 148.468 164.843 1.00 90.31  ? 19   SER C OG    1 
ATOM 1508  N N     . ARG C 3 21  ? 205.199 150.815 166.319 1.00 78.28  ? 20   ARG C N     1 
ATOM 1509  C CA    . ARG C 3 21  ? 206.419 151.187 167.024 1.00 74.74  ? 20   ARG C CA    1 
ATOM 1510  C C     . ARG C 3 21  ? 206.151 152.267 168.051 1.00 86.00  ? 20   ARG C C     1 
ATOM 1511  O O     . ARG C 3 21  ? 206.775 152.295 169.114 1.00 98.50  ? 20   ARG C O     1 
ATOM 1512  C CB    . ARG C 3 21  ? 207.480 151.658 166.038 1.00 76.34  ? 20   ARG C CB    1 
ATOM 1513  C CG    . ARG C 3 21  ? 207.909 150.606 165.056 1.00 82.34  ? 20   ARG C CG    1 
ATOM 1514  C CD    . ARG C 3 21  ? 209.019 151.114 164.170 1.00 89.23  ? 20   ARG C CD    1 
ATOM 1515  N NE    . ARG C 3 21  ? 209.364 150.135 163.149 1.00 104.69 ? 20   ARG C NE    1 
ATOM 1516  C CZ    . ARG C 3 21  ? 210.185 149.113 163.347 1.00 114.30 ? 20   ARG C CZ    1 
ATOM 1517  N NH1   . ARG C 3 21  ? 210.748 148.937 164.530 1.00 114.57 ? 20   ARG C NH1   1 
ATOM 1518  N NH2   . ARG C 3 21  ? 210.444 148.266 162.364 1.00 117.89 ? 20   ARG C NH2   1 
ATOM 1519  N N     . ALA C 3 22  ? 205.227 153.169 167.753 1.00 83.14  ? 21   ALA C N     1 
ATOM 1520  C CA    . ALA C 3 22  ? 204.825 154.134 168.759 1.00 81.18  ? 21   ALA C CA    1 
ATOM 1521  C C     . ALA C 3 22  ? 203.641 153.639 169.565 1.00 81.17  ? 21   ALA C C     1 
ATOM 1522  O O     . ALA C 3 22  ? 203.275 154.258 170.566 1.00 83.84  ? 21   ALA C O     1 
ATOM 1523  C CB    . ALA C 3 22  ? 204.488 155.466 168.103 1.00 68.40  ? 21   ALA C CB    1 
ATOM 1524  N N     . GLY C 3 23  ? 203.042 152.528 169.159 1.00 70.23  ? 22   GLY C N     1 
ATOM 1525  C CA    . GLY C 3 23  ? 201.840 152.067 169.816 1.00 68.38  ? 22   GLY C CA    1 
ATOM 1526  C C     . GLY C 3 23  ? 200.666 152.988 169.573 1.00 67.83  ? 22   GLY C C     1 
ATOM 1527  O O     . GLY C 3 23  ? 200.062 153.501 170.516 1.00 71.29  ? 22   GLY C O     1 
ATOM 1528  N N     . LEU C 3 24  ? 200.343 153.216 168.306 1.00 72.45  ? 23   LEU C N     1 
ATOM 1529  C CA    . LEU C 3 24  ? 199.241 154.082 167.934 1.00 71.51  ? 23   LEU C CA    1 
ATOM 1530  C C     . LEU C 3 24  ? 198.224 153.307 167.123 1.00 68.73  ? 23   LEU C C     1 
ATOM 1531  O O     . LEU C 3 24  ? 198.543 152.310 166.475 1.00 60.12  ? 23   LEU C O     1 
ATOM 1532  C CB    . LEU C 3 24  ? 199.712 155.270 167.121 1.00 65.61  ? 23   LEU C CB    1 
ATOM 1533  C CG    . LEU C 3 24  ? 200.645 156.150 167.922 1.00 54.90  ? 23   LEU C CG    1 
ATOM 1534  C CD1   . LEU C 3 24  ? 201.094 157.308 167.070 1.00 43.28  ? 23   LEU C CD1   1 
ATOM 1535  C CD2   . LEU C 3 24  ? 199.938 156.616 169.169 1.00 42.27  ? 23   LEU C CD2   1 
ATOM 1536  N N     . GLN C 3 25  ? 196.984 153.779 167.172 1.00 72.35  ? 24   GLN C N     1 
ATOM 1537  C CA    . GLN C 3 25  ? 195.931 153.122 166.417 1.00 67.10  ? 24   GLN C CA    1 
ATOM 1538  C C     . GLN C 3 25  ? 195.743 153.739 165.040 1.00 63.55  ? 24   GLN C C     1 
ATOM 1539  O O     . GLN C 3 25  ? 195.078 153.152 164.184 1.00 75.05  ? 24   GLN C O     1 
ATOM 1540  C CB    . GLN C 3 25  ? 194.640 153.169 167.215 1.00 65.70  ? 24   GLN C CB    1 
ATOM 1541  C CG    . GLN C 3 25  ? 194.772 152.424 168.505 1.00 73.58  ? 24   GLN C CG    1 
ATOM 1542  C CD    . GLN C 3 25  ? 195.158 150.993 168.270 1.00 79.52  ? 24   GLN C CD    1 
ATOM 1543  O OE1   . GLN C 3 25  ? 194.653 150.352 167.354 1.00 78.21  ? 24   GLN C OE1   1 
ATOM 1544  N NE2   . GLN C 3 25  ? 196.066 150.481 169.085 1.00 88.80  ? 24   GLN C NE2   1 
ATOM 1545  N N     . PHE C 3 26  ? 196.299 154.893 164.811 1.00 59.46  ? 25   PHE C N     1 
ATOM 1546  C CA    . PHE C 3 26  ? 196.181 155.506 163.500 1.00 67.43  ? 25   PHE C CA    1 
ATOM 1547  C C     . PHE C 3 26  ? 197.365 155.180 162.595 1.00 74.49  ? 25   PHE C C     1 
ATOM 1548  O O     . PHE C 3 26  ? 198.487 154.995 163.062 1.00 81.25  ? 25   PHE C O     1 
ATOM 1549  C CB    . PHE C 3 26  ? 196.010 157.004 163.641 1.00 54.62  ? 25   PHE C CB    1 
ATOM 1550  C CG    . PHE C 3 26  ? 194.635 157.388 164.031 1.00 62.68  ? 25   PHE C CG    1 
ATOM 1551  C CD1   . PHE C 3 26  ? 193.592 156.568 163.710 1.00 61.79  ? 25   PHE C CD1   1 
ATOM 1552  C CD2   . PHE C 3 26  ? 194.384 158.533 164.738 1.00 62.27  ? 25   PHE C CD2   1 
ATOM 1553  C CE1   . PHE C 3 26  ? 192.322 156.890 164.051 1.00 60.80  ? 25   PHE C CE1   1 
ATOM 1554  C CE2   . PHE C 3 26  ? 193.102 158.855 165.093 1.00 64.78  ? 25   PHE C CE2   1 
ATOM 1555  C CZ    . PHE C 3 26  ? 192.075 158.029 164.744 1.00 64.06  ? 25   PHE C CZ    1 
ATOM 1556  N N     . PRO C 3 27  ? 197.129 155.107 161.309 1.00 68.83  ? 26   PRO C N     1 
ATOM 1557  C CA    . PRO C 3 27  ? 198.148 154.608 160.385 1.00 70.03  ? 26   PRO C CA    1 
ATOM 1558  C C     . PRO C 3 27  ? 199.243 155.612 160.079 1.00 70.37  ? 26   PRO C C     1 
ATOM 1559  O O     . PRO C 3 27  ? 199.175 156.298 159.054 1.00 78.67  ? 26   PRO C O     1 
ATOM 1560  C CB    . PRO C 3 27  ? 197.335 154.302 159.131 1.00 67.18  ? 26   PRO C CB    1 
ATOM 1561  C CG    . PRO C 3 27  ? 196.224 155.256 159.195 1.00 64.43  ? 26   PRO C CG    1 
ATOM 1562  C CD    . PRO C 3 27  ? 195.852 155.350 160.628 1.00 67.34  ? 26   PRO C CD    1 
ATOM 1563  N N     . VAL C 3 28  ? 200.265 155.686 160.933 1.00 58.61  ? 27   VAL C N     1 
ATOM 1564  C CA    . VAL C 3 28  ? 201.289 156.715 160.786 1.00 56.57  ? 27   VAL C CA    1 
ATOM 1565  C C     . VAL C 3 28  ? 201.824 156.745 159.369 1.00 56.14  ? 27   VAL C C     1 
ATOM 1566  O O     . VAL C 3 28  ? 202.138 157.809 158.828 1.00 60.97  ? 27   VAL C O     1 
ATOM 1567  C CB    . VAL C 3 28  ? 202.416 156.491 161.800 1.00 62.07  ? 27   VAL C CB    1 
ATOM 1568  C CG1   . VAL C 3 28  ? 203.474 157.541 161.624 1.00 48.86  ? 27   VAL C CG1   1 
ATOM 1569  C CG2   . VAL C 3 28  ? 201.860 156.540 163.182 1.00 74.37  ? 27   VAL C CG2   1 
ATOM 1570  N N     . GLY C 3 29  ? 201.914 155.586 158.735 1.00 59.03  ? 28   GLY C N     1 
ATOM 1571  C CA    . GLY C 3 29  ? 202.308 155.568 157.342 1.00 61.97  ? 28   GLY C CA    1 
ATOM 1572  C C     . GLY C 3 29  ? 201.413 156.434 156.488 1.00 68.68  ? 28   GLY C C     1 
ATOM 1573  O O     . GLY C 3 29  ? 201.877 157.352 155.810 1.00 68.98  ? 28   GLY C O     1 
ATOM 1574  N N     . ARG C 3 30  ? 200.110 156.180 156.543 1.00 67.77  ? 29   ARG C N     1 
ATOM 1575  C CA    . ARG C 3 30  ? 199.189 156.922 155.698 1.00 61.28  ? 29   ARG C CA    1 
ATOM 1576  C C     . ARG C 3 30  ? 199.310 158.421 155.928 1.00 62.24  ? 29   ARG C C     1 
ATOM 1577  O O     . ARG C 3 30  ? 199.309 159.203 154.971 1.00 67.46  ? 29   ARG C O     1 
ATOM 1578  C CB    . ARG C 3 30  ? 197.762 156.454 155.941 1.00 54.00  ? 29   ARG C CB    1 
ATOM 1579  C CG    . ARG C 3 30  ? 196.766 157.200 155.109 1.00 60.92  ? 29   ARG C CG    1 
ATOM 1580  C CD    . ARG C 3 30  ? 195.355 156.703 155.314 1.00 59.56  ? 29   ARG C CD    1 
ATOM 1581  N NE    . ARG C 3 30  ? 195.159 155.370 154.767 1.00 60.90  ? 29   ARG C NE    1 
ATOM 1582  C CZ    . ARG C 3 30  ? 194.002 154.726 154.795 1.00 60.30  ? 29   ARG C CZ    1 
ATOM 1583  N NH1   . ARG C 3 30  ? 192.940 155.300 155.331 1.00 58.49  ? 29   ARG C NH1   1 
ATOM 1584  N NH2   . ARG C 3 30  ? 193.902 153.519 154.271 1.00 51.37  ? 29   ARG C NH2   1 
ATOM 1585  N N     . VAL C 3 31  ? 199.438 158.844 157.184 1.00 58.61  ? 30   VAL C N     1 
ATOM 1586  C CA    . VAL C 3 31  ? 199.680 160.256 157.462 1.00 61.52  ? 30   VAL C CA    1 
ATOM 1587  C C     . VAL C 3 31  ? 200.910 160.729 156.710 1.00 63.80  ? 30   VAL C C     1 
ATOM 1588  O O     . VAL C 3 31  ? 200.845 161.643 155.878 1.00 68.76  ? 30   VAL C O     1 
ATOM 1589  C CB    . VAL C 3 31  ? 199.836 160.491 158.969 1.00 55.38  ? 30   VAL C CB    1 
ATOM 1590  C CG1   . VAL C 3 31  ? 200.370 161.855 159.206 1.00 45.20  ? 30   VAL C CG1   1 
ATOM 1591  C CG2   . VAL C 3 31  ? 198.512 160.354 159.636 1.00 48.48  ? 30   VAL C CG2   1 
ATOM 1592  N N     . HIS C 3 32  ? 202.044 160.079 156.960 1.00 57.01  ? 31   HIS C N     1 
ATOM 1593  C CA    . HIS C 3 32  ? 203.272 160.515 156.320 1.00 59.90  ? 31   HIS C CA    1 
ATOM 1594  C C     . HIS C 3 32  ? 203.148 160.554 154.814 1.00 66.84  ? 31   HIS C C     1 
ATOM 1595  O O     . HIS C 3 32  ? 203.902 161.275 154.160 1.00 69.47  ? 31   HIS C O     1 
ATOM 1596  C CB    . HIS C 3 32  ? 204.434 159.617 156.690 1.00 63.57  ? 31   HIS C CB    1 
ATOM 1597  C CG    . HIS C 3 32  ? 205.713 160.025 156.044 1.00 80.20  ? 31   HIS C CG    1 
ATOM 1598  N ND1   . HIS C 3 32  ? 206.318 161.231 156.305 1.00 79.55  ? 31   HIS C ND1   1 
ATOM 1599  C CD2   . HIS C 3 32  ? 206.475 159.416 155.107 1.00 97.37  ? 31   HIS C CD2   1 
ATOM 1600  C CE1   . HIS C 3 32  ? 207.415 161.337 155.579 1.00 91.58  ? 31   HIS C CE1   1 
ATOM 1601  N NE2   . HIS C 3 32  ? 207.533 160.248 154.842 1.00 102.48 ? 31   HIS C NE2   1 
ATOM 1602  N N     . ARG C 3 33  ? 202.221 159.803 154.239 1.00 62.68  ? 32   ARG C N     1 
ATOM 1603  C CA    . ARG C 3 33  ? 201.967 159.982 152.821 1.00 66.66  ? 32   ARG C CA    1 
ATOM 1604  C C     . ARG C 3 33  ? 201.190 161.260 152.571 1.00 73.84  ? 32   ARG C C     1 
ATOM 1605  O O     . ARG C 3 33  ? 201.567 162.068 151.717 1.00 72.77  ? 32   ARG C O     1 
ATOM 1606  C CB    . ARG C 3 33  ? 201.222 158.785 152.258 1.00 61.38  ? 32   ARG C CB    1 
ATOM 1607  C CG    . ARG C 3 33  ? 200.858 158.941 150.812 1.00 63.39  ? 32   ARG C CG    1 
ATOM 1608  C CD    . ARG C 3 33  ? 200.311 157.647 150.276 1.00 71.09  ? 32   ARG C CD    1 
ATOM 1609  N NE    . ARG C 3 33  ? 199.077 157.252 150.937 1.00 69.64  ? 32   ARG C NE    1 
ATOM 1610  C CZ    . ARG C 3 33  ? 197.873 157.647 150.552 1.00 69.39  ? 32   ARG C CZ    1 
ATOM 1611  N NH1   . ARG C 3 33  ? 197.743 158.438 149.502 1.00 57.74  ? 32   ARG C NH1   1 
ATOM 1612  N NH2   . ARG C 3 33  ? 196.799 157.239 151.205 1.00 67.60  ? 32   ARG C NH2   1 
ATOM 1613  N N     . LEU C 3 34  ? 200.109 161.472 153.317 1.00 65.78  ? 33   LEU C N     1 
ATOM 1614  C CA    . LEU C 3 34  ? 199.260 162.619 153.025 1.00 59.42  ? 33   LEU C CA    1 
ATOM 1615  C C     . LEU C 3 34  ? 200.018 163.924 153.161 1.00 67.86  ? 33   LEU C C     1 
ATOM 1616  O O     . LEU C 3 34  ? 199.793 164.853 152.383 1.00 78.03  ? 33   LEU C O     1 
ATOM 1617  C CB    . LEU C 3 34  ? 198.034 162.626 153.921 1.00 51.87  ? 33   LEU C CB    1 
ATOM 1618  C CG    . LEU C 3 34  ? 197.103 161.496 153.539 1.00 56.24  ? 33   LEU C CG    1 
ATOM 1619  C CD1   . LEU C 3 34  ? 195.898 161.487 154.430 1.00 58.60  ? 33   LEU C CD1   1 
ATOM 1620  C CD2   . LEU C 3 34  ? 196.699 161.674 152.110 1.00 38.22  ? 33   LEU C CD2   1 
ATOM 1621  N N     . LEU C 3 35  ? 200.919 164.024 154.133 1.00 63.82  ? 34   LEU C N     1 
ATOM 1622  C CA    . LEU C 3 35  ? 201.673 165.262 154.251 1.00 64.61  ? 34   LEU C CA    1 
ATOM 1623  C C     . LEU C 3 35  ? 202.409 165.563 152.959 1.00 68.55  ? 34   LEU C C     1 
ATOM 1624  O O     . LEU C 3 35  ? 202.236 166.631 152.367 1.00 63.91  ? 34   LEU C O     1 
ATOM 1625  C CB    . LEU C 3 35  ? 202.640 165.191 155.417 1.00 60.76  ? 34   LEU C CB    1 
ATOM 1626  C CG    . LEU C 3 35  ? 201.887 165.104 156.726 1.00 52.77  ? 34   LEU C CG    1 
ATOM 1627  C CD1   . LEU C 3 35  ? 202.856 165.021 157.858 1.00 49.70  ? 34   LEU C CD1   1 
ATOM 1628  C CD2   . LEU C 3 35  ? 201.009 166.293 156.877 1.00 44.34  ? 34   LEU C CD2   1 
ATOM 1629  N N     . ARG C 3 36  ? 203.215 164.619 152.486 1.00 65.97  ? 35   ARG C N     1 
ATOM 1630  C CA    . ARG C 3 36  ? 203.912 164.824 151.225 1.00 65.29  ? 35   ARG C CA    1 
ATOM 1631  C C     . ARG C 3 36  ? 202.931 165.133 150.108 1.00 72.72  ? 35   ARG C C     1 
ATOM 1632  O O     . ARG C 3 36  ? 202.878 166.256 149.601 1.00 81.65  ? 35   ARG C O     1 
ATOM 1633  C CB    . ARG C 3 36  ? 204.740 163.598 150.873 1.00 65.64  ? 35   ARG C CB    1 
ATOM 1634  C CG    . ARG C 3 36  ? 205.914 163.370 151.774 1.00 87.16  ? 35   ARG C CG    1 
ATOM 1635  C CD    . ARG C 3 36  ? 206.544 162.063 151.412 1.00 101.14 ? 35   ARG C CD    1 
ATOM 1636  N NE    . ARG C 3 36  ? 205.591 160.983 151.619 1.00 117.73 ? 35   ARG C NE    1 
ATOM 1637  C CZ    . ARG C 3 36  ? 205.829 159.710 151.334 1.00 121.80 ? 35   ARG C CZ    1 
ATOM 1638  N NH1   . ARG C 3 36  ? 206.994 159.352 150.814 1.00 121.90 ? 35   ARG C NH1   1 
ATOM 1639  N NH2   . ARG C 3 36  ? 204.895 158.796 151.561 1.00 114.01 ? 35   ARG C NH2   1 
ATOM 1640  N N     . LYS C 3 37  ? 202.110 164.157 149.739 1.00 66.16  ? 36   LYS C N     1 
ATOM 1641  C CA    . LYS C 3 37  ? 201.294 164.314 148.548 1.00 68.14  ? 36   LYS C CA    1 
ATOM 1642  C C     . LYS C 3 37  ? 200.291 165.447 148.662 1.00 70.08  ? 36   LYS C C     1 
ATOM 1643  O O     . LYS C 3 37  ? 199.587 165.721 147.689 1.00 74.51  ? 36   LYS C O     1 
ATOM 1644  C CB    . LYS C 3 37  ? 200.579 163.010 148.228 1.00 65.72  ? 36   LYS C CB    1 
ATOM 1645  N N     . GLY C 3 38  ? 200.188 166.093 149.813 1.00 68.68  ? 37   GLY C N     1 
ATOM 1646  C CA    . GLY C 3 38  ? 199.335 167.247 149.967 1.00 65.25  ? 37   GLY C CA    1 
ATOM 1647  C C     . GLY C 3 38  ? 200.009 168.588 149.792 1.00 75.57  ? 37   GLY C C     1 
ATOM 1648  O O     . GLY C 3 38  ? 199.330 169.617 149.837 1.00 81.74  ? 37   GLY C O     1 
ATOM 1649  N N     . ASN C 3 39  ? 201.322 168.613 149.590 1.00 72.18  ? 38   ASN C N     1 
ATOM 1650  C CA    . ASN C 3 39  ? 202.055 169.859 149.401 1.00 70.38  ? 38   ASN C CA    1 
ATOM 1651  C C     . ASN C 3 39  ? 201.816 170.819 150.554 1.00 68.18  ? 38   ASN C C     1 
ATOM 1652  O O     . ASN C 3 39  ? 201.397 171.958 150.365 1.00 76.16  ? 38   ASN C O     1 
ATOM 1653  C CB    . ASN C 3 39  ? 201.699 170.509 148.072 1.00 76.31  ? 38   ASN C CB    1 
ATOM 1654  C CG    . ASN C 3 39  ? 202.307 169.783 146.907 1.00 80.02  ? 38   ASN C CG    1 
ATOM 1655  O OD1   . ASN C 3 39  ? 203.499 169.915 146.636 1.00 75.11  ? 38   ASN C OD1   1 
ATOM 1656  N ND2   . ASN C 3 39  ? 201.500 168.996 146.214 1.00 73.32  ? 38   ASN C ND2   1 
ATOM 1657  N N     . TYR C 3 40  ? 202.053 170.333 151.761 1.00 67.91  ? 39   TYR C N     1 
ATOM 1658  C CA    . TYR C 3 40  ? 202.028 171.187 152.931 1.00 62.79  ? 39   TYR C CA    1 
ATOM 1659  C C     . TYR C 3 40  ? 203.390 171.732 153.279 1.00 68.58  ? 39   TYR C C     1 
ATOM 1660  O O     . TYR C 3 40  ? 203.480 172.615 154.131 1.00 69.77  ? 39   TYR C O     1 
ATOM 1661  C CB    . TYR C 3 40  ? 201.455 170.429 154.112 1.00 43.63  ? 39   TYR C CB    1 
ATOM 1662  C CG    . TYR C 3 40  ? 200.023 170.097 153.875 1.00 45.06  ? 39   TYR C CG    1 
ATOM 1663  C CD1   . TYR C 3 40  ? 199.025 170.946 154.285 1.00 50.33  ? 39   TYR C CD1   1 
ATOM 1664  C CD2   . TYR C 3 40  ? 199.669 168.969 153.172 1.00 46.17  ? 39   TYR C CD2   1 
ATOM 1665  C CE1   . TYR C 3 40  ? 197.718 170.655 154.045 1.00 50.85  ? 39   TYR C CE1   1 
ATOM 1666  C CE2   . TYR C 3 40  ? 198.369 168.673 152.927 1.00 51.33  ? 39   TYR C CE2   1 
ATOM 1667  C CZ    . TYR C 3 40  ? 197.398 169.517 153.362 1.00 55.49  ? 39   TYR C CZ    1 
ATOM 1668  O OH    . TYR C 3 40  ? 196.091 169.209 153.107 1.00 56.57  ? 39   TYR C OH    1 
ATOM 1669  N N     . ALA C 3 41  ? 204.436 171.231 152.646 1.00 59.12  ? 40   ALA C N     1 
ATOM 1670  C CA    . ALA C 3 41  ? 205.764 171.819 152.737 1.00 58.01  ? 40   ALA C CA    1 
ATOM 1671  C C     . ALA C 3 41  ? 206.649 171.122 151.723 1.00 65.92  ? 40   ALA C C     1 
ATOM 1672  O O     . ALA C 3 41  ? 206.216 170.223 150.998 1.00 69.03  ? 40   ALA C O     1 
ATOM 1673  C CB    . ALA C 3 41  ? 206.365 171.699 154.132 1.00 47.21  ? 40   ALA C CB    1 
ATOM 1674  N N     . GLU C 3 42  ? 207.905 171.537 151.693 1.00 63.96  ? 41   GLU C N     1 
ATOM 1675  C CA    . GLU C 3 42  ? 208.868 170.912 150.806 1.00 60.40  ? 41   GLU C CA    1 
ATOM 1676  C C     . GLU C 3 42  ? 209.253 169.533 151.304 1.00 68.02  ? 41   GLU C C     1 
ATOM 1677  O O     . GLU C 3 42  ? 209.357 168.587 150.522 1.00 78.78  ? 41   GLU C O     1 
ATOM 1678  C CB    . GLU C 3 42  ? 210.100 171.795 150.693 1.00 80.71  ? 41   GLU C CB    1 
ATOM 1679  C CG    . GLU C 3 42  ? 211.164 171.261 149.784 1.00 104.47 ? 41   GLU C CG    1 
ATOM 1680  C CD    . GLU C 3 42  ? 212.338 172.204 149.696 1.00 116.53 ? 41   GLU C CD    1 
ATOM 1681  O OE1   . GLU C 3 42  ? 212.300 173.248 150.377 1.00 111.46 ? 41   GLU C OE1   1 
ATOM 1682  O OE2   . GLU C 3 42  ? 213.297 171.908 148.955 1.00 123.84 ? 41   GLU C OE2   1 
ATOM 1683  N N     . ARG C 3 43  ? 209.465 169.405 152.603 1.00 69.08  ? 42   ARG C N     1 
ATOM 1684  C CA    . ARG C 3 43  ? 210.011 168.196 153.184 1.00 72.50  ? 42   ARG C CA    1 
ATOM 1685  C C     . ARG C 3 43  ? 209.299 167.917 154.490 1.00 69.14  ? 42   ARG C C     1 
ATOM 1686  O O     . ARG C 3 43  ? 208.941 168.847 155.212 1.00 68.42  ? 42   ARG C O     1 
ATOM 1687  C CB    . ARG C 3 43  ? 211.495 168.350 153.442 1.00 73.40  ? 42   ARG C CB    1 
ATOM 1688  C CG    . ARG C 3 43  ? 212.317 168.559 152.206 1.00 79.12  ? 42   ARG C CG    1 
ATOM 1689  C CD    . ARG C 3 43  ? 213.710 168.918 152.615 1.00 88.90  ? 42   ARG C CD    1 
ATOM 1690  N NE    . ARG C 3 43  ? 214.300 167.860 153.413 1.00 95.83  ? 42   ARG C NE    1 
ATOM 1691  C CZ    . ARG C 3 43  ? 215.437 167.990 154.077 1.00 99.49  ? 42   ARG C CZ    1 
ATOM 1692  N NH1   . ARG C 3 43  ? 216.083 169.137 154.046 1.00 97.36  ? 42   ARG C NH1   1 
ATOM 1693  N NH2   . ARG C 3 43  ? 215.920 166.985 154.786 1.00 99.24  ? 42   ARG C NH2   1 
ATOM 1694  N N     . VAL C 3 44  ? 209.116 166.645 154.804 1.00 65.55  ? 43   VAL C N     1 
ATOM 1695  C CA    . VAL C 3 44  ? 208.362 166.236 155.975 1.00 53.75  ? 43   VAL C CA    1 
ATOM 1696  C C     . VAL C 3 44  ? 209.326 165.632 156.974 1.00 59.63  ? 43   VAL C C     1 
ATOM 1697  O O     . VAL C 3 44  ? 209.968 164.616 156.689 1.00 61.22  ? 43   VAL C O     1 
ATOM 1698  C CB    . VAL C 3 44  ? 207.263 165.239 155.623 1.00 49.79  ? 43   VAL C CB    1 
ATOM 1699  C CG1   . VAL C 3 44  ? 206.620 164.762 156.879 1.00 48.52  ? 43   VAL C CG1   1 
ATOM 1700  C CG2   . VAL C 3 44  ? 206.254 165.885 154.714 1.00 46.32  ? 43   VAL C CG2   1 
ATOM 1701  N N     . GLY C 3 45  ? 209.422 166.243 158.148 1.00 61.45  ? 44   GLY C N     1 
ATOM 1702  C CA    . GLY C 3 45  ? 210.240 165.672 159.197 1.00 62.82  ? 44   GLY C CA    1 
ATOM 1703  C C     . GLY C 3 45  ? 209.742 164.299 159.596 1.00 62.98  ? 44   GLY C C     1 
ATOM 1704  O O     . GLY C 3 45  ? 208.605 163.925 159.322 1.00 69.03  ? 44   GLY C O     1 
ATOM 1705  N N     . ALA C 3 46  ? 210.614 163.531 160.242 1.00 65.40  ? 45   ALA C N     1 
ATOM 1706  C CA    . ALA C 3 46  ? 210.239 162.171 160.600 1.00 66.42  ? 45   ALA C CA    1 
ATOM 1707  C C     . ALA C 3 46  ? 209.335 162.122 161.814 1.00 67.59  ? 45   ALA C C     1 
ATOM 1708  O O     . ALA C 3 46  ? 208.365 161.363 161.815 1.00 74.31  ? 45   ALA C O     1 
ATOM 1709  C CB    . ALA C 3 46  ? 211.479 161.327 160.861 1.00 55.38  ? 45   ALA C CB    1 
ATOM 1710  N N     . GLY C 3 47  ? 209.626 162.906 162.844 1.00 69.94  ? 46   GLY C N     1 
ATOM 1711  C CA    . GLY C 3 47  ? 208.801 162.857 164.034 1.00 65.91  ? 46   GLY C CA    1 
ATOM 1712  C C     . GLY C 3 47  ? 207.386 163.329 163.777 1.00 67.72  ? 46   GLY C C     1 
ATOM 1713  O O     . GLY C 3 47  ? 206.448 162.919 164.467 1.00 82.07  ? 46   GLY C O     1 
ATOM 1714  N N     . ALA C 3 48  ? 207.207 164.178 162.768 1.00 58.01  ? 47   ALA C N     1 
ATOM 1715  C CA    . ALA C 3 48  ? 205.913 164.828 162.579 1.00 50.63  ? 47   ALA C CA    1 
ATOM 1716  C C     . ALA C 3 48  ? 204.775 163.837 162.408 1.00 61.69  ? 47   ALA C C     1 
ATOM 1717  O O     . ALA C 3 48  ? 203.879 163.809 163.267 1.00 67.96  ? 47   ALA C O     1 
ATOM 1718  C CB    . ALA C 3 48  ? 206.000 165.809 161.411 1.00 43.46  ? 47   ALA C CB    1 
ATOM 1719  N N     . PRO C 3 49  ? 204.755 162.981 161.386 1.00 61.48  ? 48   PRO C N     1 
ATOM 1720  C CA    . PRO C 3 49  ? 203.566 162.152 161.176 1.00 57.46  ? 48   PRO C CA    1 
ATOM 1721  C C     . PRO C 3 49  ? 203.146 161.422 162.423 1.00 64.84  ? 48   PRO C C     1 
ATOM 1722  O O     . PRO C 3 49  ? 201.953 161.361 162.736 1.00 65.91  ? 48   PRO C O     1 
ATOM 1723  C CB    . PRO C 3 49  ? 204.010 161.186 160.080 1.00 57.24  ? 48   PRO C CB    1 
ATOM 1724  C CG    . PRO C 3 49  ? 205.056 161.893 159.387 1.00 61.09  ? 48   PRO C CG    1 
ATOM 1725  C CD    . PRO C 3 49  ? 205.813 162.608 160.444 1.00 62.73  ? 48   PRO C CD    1 
ATOM 1726  N N     . VAL C 3 50  ? 204.105 160.896 163.166 1.00 57.40  ? 49   VAL C N     1 
ATOM 1727  C CA    . VAL C 3 50  ? 203.831 160.376 164.491 1.00 58.34  ? 49   VAL C CA    1 
ATOM 1728  C C     . VAL C 3 50  ? 203.071 161.422 165.277 1.00 59.47  ? 49   VAL C C     1 
ATOM 1729  O O     . VAL C 3 50  ? 201.883 161.258 165.580 1.00 67.96  ? 49   VAL C O     1 
ATOM 1730  C CB    . VAL C 3 50  ? 205.129 160.017 165.221 1.00 59.47  ? 49   VAL C CB    1 
ATOM 1731  C CG1   . VAL C 3 50  ? 204.826 159.644 166.645 1.00 61.60  ? 49   VAL C CG1   1 
ATOM 1732  C CG2   . VAL C 3 50  ? 205.819 158.888 164.512 1.00 53.78  ? 49   VAL C CG2   1 
ATOM 1733  N N     . TYR C 3 51  ? 203.754 162.521 165.575 1.00 58.99  ? 50   TYR C N     1 
ATOM 1734  C CA    . TYR C 3 51  ? 203.225 163.459 166.546 1.00 60.52  ? 50   TYR C CA    1 
ATOM 1735  C C     . TYR C 3 51  ? 201.829 163.896 166.179 1.00 60.38  ? 50   TYR C C     1 
ATOM 1736  O O     . TYR C 3 51  ? 201.039 164.256 167.051 1.00 58.72  ? 50   TYR C O     1 
ATOM 1737  C CB    . TYR C 3 51  ? 204.123 164.673 166.637 1.00 55.25  ? 50   TYR C CB    1 
ATOM 1738  C CG    . TYR C 3 51  ? 203.773 165.573 167.773 1.00 51.25  ? 50   TYR C CG    1 
ATOM 1739  C CD1   . TYR C 3 51  ? 204.269 165.327 169.032 1.00 52.47  ? 50   TYR C CD1   1 
ATOM 1740  C CD2   . TYR C 3 51  ? 202.932 166.644 167.603 1.00 52.74  ? 50   TYR C CD2   1 
ATOM 1741  C CE1   . TYR C 3 51  ? 203.969 166.138 170.080 1.00 48.80  ? 50   TYR C CE1   1 
ATOM 1742  C CE2   . TYR C 3 51  ? 202.619 167.462 168.650 1.00 51.52  ? 50   TYR C CE2   1 
ATOM 1743  C CZ    . TYR C 3 51  ? 203.139 167.201 169.890 1.00 51.91  ? 50   TYR C CZ    1 
ATOM 1744  O OH    . TYR C 3 51  ? 202.833 168.011 170.957 1.00 59.97  ? 50   TYR C OH    1 
ATOM 1745  N N     . LEU C 3 52  ? 201.510 163.878 164.895 1.00 56.84  ? 51   LEU C N     1 
ATOM 1746  C CA    . LEU C 3 52  ? 200.172 164.233 164.459 1.00 51.48  ? 51   LEU C CA    1 
ATOM 1747  C C     . LEU C 3 52  ? 199.191 163.103 164.721 1.00 51.69  ? 51   LEU C C     1 
ATOM 1748  O O     . LEU C 3 52  ? 198.131 163.311 165.330 1.00 51.87  ? 51   LEU C O     1 
ATOM 1749  C CB    . LEU C 3 52  ? 200.199 164.578 162.982 1.00 54.09  ? 51   LEU C CB    1 
ATOM 1750  C CG    . LEU C 3 52  ? 198.830 164.873 162.439 1.00 53.20  ? 51   LEU C CG    1 
ATOM 1751  C CD1   . LEU C 3 52  ? 198.330 166.060 163.161 1.00 39.55  ? 51   LEU C CD1   1 
ATOM 1752  C CD2   . LEU C 3 52  ? 198.967 165.166 160.998 1.00 53.05  ? 51   LEU C CD2   1 
ATOM 1753  N N     . ALA C 3 53  ? 199.531 161.897 164.274 1.00 55.52  ? 52   ALA C N     1 
ATOM 1754  C CA    . ALA C 3 53  ? 198.627 160.778 164.470 1.00 55.31  ? 52   ALA C CA    1 
ATOM 1755  C C     . ALA C 3 53  ? 198.251 160.651 165.927 1.00 63.31  ? 52   ALA C C     1 
ATOM 1756  O O     . ALA C 3 53  ? 197.089 160.399 166.254 1.00 51.77  ? 52   ALA C O     1 
ATOM 1757  C CB    . ALA C 3 53  ? 199.265 159.491 163.975 1.00 38.56  ? 52   ALA C CB    1 
ATOM 1758  N N     . ALA C 3 54  ? 199.215 160.856 166.820 1.00 57.90  ? 53   ALA C N     1 
ATOM 1759  C CA    . ALA C 3 54  ? 198.897 160.828 168.240 1.00 37.79  ? 53   ALA C CA    1 
ATOM 1760  C C     . ALA C 3 54  ? 197.752 161.771 168.555 1.00 47.65  ? 53   ALA C C     1 
ATOM 1761  O O     . ALA C 3 54  ? 196.749 161.372 169.155 1.00 60.22  ? 53   ALA C O     1 
ATOM 1762  C CB    . ALA C 3 54  ? 200.122 161.197 169.067 1.00 39.48  ? 53   ALA C CB    1 
ATOM 1763  N N     . VAL C 3 55  ? 197.875 163.025 168.136 1.00 55.25  ? 54   VAL C N     1 
ATOM 1764  C CA    . VAL C 3 55  ? 196.850 164.006 168.457 1.00 52.94  ? 54   VAL C CA    1 
ATOM 1765  C C     . VAL C 3 55  ? 195.501 163.550 167.939 1.00 52.96  ? 54   VAL C C     1 
ATOM 1766  O O     . VAL C 3 55  ? 194.506 163.540 168.675 1.00 57.26  ? 54   VAL C O     1 
ATOM 1767  C CB    . VAL C 3 55  ? 197.220 165.375 167.886 1.00 49.45  ? 54   VAL C CB    1 
ATOM 1768  C CG1   . VAL C 3 55  ? 196.104 166.312 168.143 1.00 50.24  ? 54   VAL C CG1   1 
ATOM 1769  C CG2   . VAL C 3 55  ? 198.463 165.865 168.531 1.00 50.29  ? 54   VAL C CG2   1 
ATOM 1770  N N     . LEU C 3 56  ? 195.439 163.170 166.664 1.00 44.43  ? 55   LEU C N     1 
ATOM 1771  C CA    . LEU C 3 56  ? 194.167 162.713 166.123 1.00 41.82  ? 55   LEU C CA    1 
ATOM 1772  C C     . LEU C 3 56  ? 193.577 161.615 166.987 1.00 51.89  ? 55   LEU C C     1 
ATOM 1773  O O     . LEU C 3 56  ? 192.408 161.675 167.384 1.00 45.54  ? 55   LEU C O     1 
ATOM 1774  C CB    . LEU C 3 56  ? 194.349 162.225 164.700 1.00 38.28  ? 55   LEU C CB    1 
ATOM 1775  C CG    . LEU C 3 56  ? 194.742 163.396 163.834 1.00 44.70  ? 55   LEU C CG    1 
ATOM 1776  C CD1   . LEU C 3 56  ? 194.966 162.950 162.423 1.00 44.39  ? 55   LEU C CD1   1 
ATOM 1777  C CD2   . LEU C 3 56  ? 193.645 164.400 163.908 1.00 36.22  ? 55   LEU C CD2   1 
ATOM 1778  N N     . GLU C 3 57  ? 194.389 160.616 167.313 1.00 48.68  ? 56   GLU C N     1 
ATOM 1779  C CA    . GLU C 3 57  ? 193.917 159.529 168.154 1.00 48.94  ? 56   GLU C CA    1 
ATOM 1780  C C     . GLU C 3 57  ? 193.311 160.071 169.430 1.00 51.56  ? 56   GLU C C     1 
ATOM 1781  O O     . GLU C 3 57  ? 192.219 159.670 169.836 1.00 47.92  ? 56   GLU C O     1 
ATOM 1782  C CB    . GLU C 3 57  ? 195.061 158.571 168.453 1.00 49.94  ? 56   GLU C CB    1 
ATOM 1783  C CG    . GLU C 3 57  ? 194.651 157.375 169.272 1.00 58.05  ? 56   GLU C CG    1 
ATOM 1784  C CD    . GLU C 3 57  ? 195.773 156.373 169.422 1.00 82.19  ? 56   GLU C CD    1 
ATOM 1785  O OE1   . GLU C 3 57  ? 196.865 156.632 168.885 1.00 86.71  ? 56   GLU C OE1   1 
ATOM 1786  O OE2   . GLU C 3 57  ? 195.569 155.326 170.070 1.00 89.59  ? 56   GLU C OE2   1 
ATOM 1787  N N     . TYR C 3 58  ? 193.991 161.022 170.050 1.00 47.91  ? 57   TYR C N     1 
ATOM 1788  C CA    . TYR C 3 58  ? 193.474 161.568 171.291 1.00 43.89  ? 57   TYR C CA    1 
ATOM 1789  C C     . TYR C 3 58  ? 192.107 162.198 171.089 1.00 45.26  ? 57   TYR C C     1 
ATOM 1790  O O     . TYR C 3 58  ? 191.158 161.892 171.818 1.00 40.22  ? 57   TYR C O     1 
ATOM 1791  C CB    . TYR C 3 58  ? 194.443 162.583 171.859 1.00 35.67  ? 57   TYR C CB    1 
ATOM 1792  C CG    . TYR C 3 58  ? 193.870 163.260 173.048 1.00 43.74  ? 57   TYR C CG    1 
ATOM 1793  C CD1   . TYR C 3 58  ? 193.821 162.619 174.261 1.00 41.64  ? 57   TYR C CD1   1 
ATOM 1794  C CD2   . TYR C 3 58  ? 193.355 164.530 172.957 1.00 55.47  ? 57   TYR C CD2   1 
ATOM 1795  C CE1   . TYR C 3 58  ? 193.290 163.227 175.352 1.00 49.89  ? 57   TYR C CE1   1 
ATOM 1796  C CE2   . TYR C 3 58  ? 192.823 165.145 174.043 1.00 54.84  ? 57   TYR C CE2   1 
ATOM 1797  C CZ    . TYR C 3 58  ? 192.791 164.491 175.241 1.00 57.22  ? 57   TYR C CZ    1 
ATOM 1798  O OH    . TYR C 3 58  ? 192.255 165.103 176.343 1.00 53.84  ? 57   TYR C OH    1 
ATOM 1799  N N     . LEU C 3 59  ? 191.979 163.081 170.105 1.00 46.38  ? 58   LEU C N     1 
ATOM 1800  C CA    . LEU C 3 59  ? 190.708 163.774 169.935 1.00 47.99  ? 58   LEU C CA    1 
ATOM 1801  C C     . LEU C 3 59  ? 189.585 162.793 169.647 1.00 51.85  ? 58   LEU C C     1 
ATOM 1802  O O     . LEU C 3 59  ? 188.566 162.765 170.354 1.00 47.58  ? 58   LEU C O     1 
ATOM 1803  C CB    . LEU C 3 59  ? 190.817 164.810 168.828 1.00 49.27  ? 58   LEU C CB    1 
ATOM 1804  C CG    . LEU C 3 59  ? 191.795 165.873 169.285 1.00 49.36  ? 58   LEU C CG    1 
ATOM 1805  C CD1   . LEU C 3 59  ? 191.999 166.913 168.224 1.00 47.04  ? 58   LEU C CD1   1 
ATOM 1806  C CD2   . LEU C 3 59  ? 191.264 166.493 170.537 1.00 35.82  ? 58   LEU C CD2   1 
ATOM 1807  N N     . THR C 3 60  ? 189.760 161.965 168.621 1.00 43.89  ? 59   THR C N     1 
ATOM 1808  C CA    . THR C 3 60  ? 188.739 160.978 168.316 1.00 46.68  ? 59   THR C CA    1 
ATOM 1809  C C     . THR C 3 60  ? 188.378 160.175 169.551 1.00 50.91  ? 59   THR C C     1 
ATOM 1810  O O     . THR C 3 60  ? 187.204 159.868 169.785 1.00 52.43  ? 59   THR C O     1 
ATOM 1811  C CB    . THR C 3 60  ? 189.224 160.070 167.204 1.00 53.61  ? 59   THR C CB    1 
ATOM 1812  O OG1   . THR C 3 60  ? 189.451 160.858 166.037 1.00 51.70  ? 59   THR C OG1   1 
ATOM 1813  C CG2   . THR C 3 60  ? 188.188 159.051 166.898 1.00 48.97  ? 59   THR C CG2   1 
ATOM 1814  N N     . ALA C 3 61  ? 189.369 159.869 170.382 1.00 47.88  ? 60   ALA C N     1 
ATOM 1815  C CA    . ALA C 3 61  ? 189.072 159.226 171.652 1.00 47.59  ? 60   ALA C CA    1 
ATOM 1816  C C     . ALA C 3 61  ? 188.117 160.074 172.469 1.00 51.08  ? 60   ALA C C     1 
ATOM 1817  O O     . ALA C 3 61  ? 187.168 159.558 173.066 1.00 45.34  ? 60   ALA C O     1 
ATOM 1818  C CB    . ALA C 3 61  ? 190.357 158.967 172.429 1.00 39.13  ? 60   ALA C CB    1 
ATOM 1819  N N     . GLU C 3 62  ? 188.339 161.383 172.498 1.00 37.64  ? 61   GLU C N     1 
ATOM 1820  C CA    . GLU C 3 62  ? 187.469 162.232 173.298 1.00 41.87  ? 61   GLU C CA    1 
ATOM 1821  C C     . GLU C 3 62  ? 186.038 162.166 172.796 1.00 48.55  ? 61   GLU C C     1 
ATOM 1822  O O     . GLU C 3 62  ? 185.116 161.802 173.541 1.00 52.01  ? 61   GLU C O     1 
ATOM 1823  C CB    . GLU C 3 62  ? 187.979 163.664 173.290 1.00 49.36  ? 61   GLU C CB    1 
ATOM 1824  C CG    . GLU C 3 62  ? 189.329 163.780 173.926 1.00 69.43  ? 61   GLU C CG    1 
ATOM 1825  C CD    . GLU C 3 62  ? 189.338 163.217 175.325 1.00 76.62  ? 61   GLU C CD    1 
ATOM 1826  O OE1   . GLU C 3 62  ? 188.359 163.446 176.066 1.00 80.54  ? 61   GLU C OE1   1 
ATOM 1827  O OE2   . GLU C 3 62  ? 190.315 162.526 175.681 1.00 73.90  ? 61   GLU C OE2   1 
ATOM 1828  N N     . ILE C 3 63  ? 185.835 162.491 171.520 1.00 56.14  ? 62   ILE C N     1 
ATOM 1829  C CA    . ILE C 3 63  ? 184.476 162.501 170.988 1.00 58.31  ? 62   ILE C CA    1 
ATOM 1830  C C     . ILE C 3 63  ? 183.809 161.159 171.224 1.00 51.45  ? 62   ILE C C     1 
ATOM 1831  O O     . ILE C 3 63  ? 182.746 161.071 171.847 1.00 44.56  ? 62   ILE C O     1 
ATOM 1832  C CB    . ILE C 3 63  ? 184.472 162.852 169.498 1.00 56.27  ? 62   ILE C CB    1 
ATOM 1833  C CG1   . ILE C 3 63  ? 184.873 164.296 169.300 1.00 56.80  ? 62   ILE C CG1   1 
ATOM 1834  C CG2   . ILE C 3 63  ? 183.110 162.630 168.928 1.00 78.45  ? 62   ILE C CG2   1 
ATOM 1835  C CD1   . ILE C 3 63  ? 185.061 164.635 167.857 1.00 80.26  ? 62   ILE C CD1   1 
ATOM 1836  N N     . LEU C 3 64  ? 184.438 160.088 170.747 1.00 51.79  ? 63   LEU C N     1 
ATOM 1837  C CA    . LEU C 3 64  ? 183.796 158.788 170.849 1.00 49.24  ? 63   LEU C CA    1 
ATOM 1838  C C     . LEU C 3 64  ? 183.483 158.439 172.289 1.00 51.36  ? 63   LEU C C     1 
ATOM 1839  O O     . LEU C 3 64  ? 182.445 157.838 172.571 1.00 56.35  ? 63   LEU C O     1 
ATOM 1840  C CB    . LEU C 3 64  ? 184.664 157.719 170.218 1.00 36.20  ? 63   LEU C CB    1 
ATOM 1841  C CG    . LEU C 3 64  ? 184.763 157.976 168.731 1.00 49.06  ? 63   LEU C CG    1 
ATOM 1842  C CD1   . LEU C 3 64  ? 185.631 156.933 168.087 1.00 57.29  ? 63   LEU C CD1   1 
ATOM 1843  C CD2   . LEU C 3 64  ? 183.382 157.973 168.151 1.00 36.88  ? 63   LEU C CD2   1 
ATOM 1844  N N     . GLU C 3 65  ? 184.352 158.817 173.219 1.00 48.31  ? 64   GLU C N     1 
ATOM 1845  C CA    . GLU C 3 65  ? 184.027 158.587 174.616 1.00 47.48  ? 64   GLU C CA    1 
ATOM 1846  C C     . GLU C 3 65  ? 182.718 159.261 174.979 1.00 45.07  ? 64   GLU C C     1 
ATOM 1847  O O     . GLU C 3 65  ? 181.773 158.615 175.448 1.00 57.95  ? 64   GLU C O     1 
ATOM 1848  C CB    . GLU C 3 65  ? 185.136 159.096 175.520 1.00 57.97  ? 64   GLU C CB    1 
ATOM 1849  C CG    . GLU C 3 65  ? 184.798 158.876 176.974 1.00 62.51  ? 64   GLU C CG    1 
ATOM 1850  C CD    . GLU C 3 65  ? 185.866 159.379 177.913 1.00 79.17  ? 64   GLU C CD    1 
ATOM 1851  O OE1   . GLU C 3 65  ? 186.874 159.930 177.429 1.00 79.01  ? 64   GLU C OE1   1 
ATOM 1852  O OE2   . GLU C 3 65  ? 185.692 159.232 179.139 1.00 87.98  ? 64   GLU C OE2   1 
ATOM 1853  N N     . LEU C 3 66  ? 182.639 160.567 174.756 1.00 51.07  ? 65   LEU C N     1 
ATOM 1854  C CA    . LEU C 3 66  ? 181.464 161.290 175.218 1.00 48.84  ? 65   LEU C CA    1 
ATOM 1855  C C     . LEU C 3 66  ? 180.202 160.762 174.558 1.00 46.60  ? 65   LEU C C     1 
ATOM 1856  O O     . LEU C 3 66  ? 179.226 160.418 175.237 1.00 42.67  ? 65   LEU C O     1 
ATOM 1857  C CB    . LEU C 3 66  ? 181.647 162.773 174.957 1.00 50.30  ? 65   LEU C CB    1 
ATOM 1858  C CG    . LEU C 3 66  ? 182.839 163.211 175.793 1.00 43.39  ? 65   LEU C CG    1 
ATOM 1859  C CD1   . LEU C 3 66  ? 183.186 164.644 175.527 1.00 48.11  ? 65   LEU C CD1   1 
ATOM 1860  C CD2   . LEU C 3 66  ? 182.519 163.013 177.245 1.00 40.23  ? 65   LEU C CD2   1 
ATOM 1861  N N     . ALA C 3 67  ? 180.213 160.661 173.232 1.00 40.97  ? 66   ALA C N     1 
ATOM 1862  C CA    . ALA C 3 67  ? 179.039 160.162 172.533 1.00 46.52  ? 66   ALA C CA    1 
ATOM 1863  C C     . ALA C 3 67  ? 178.665 158.780 173.020 1.00 53.20  ? 66   ALA C C     1 
ATOM 1864  O O     . ALA C 3 67  ? 177.482 158.446 173.113 1.00 58.78  ? 66   ALA C O     1 
ATOM 1865  C CB    . ALA C 3 67  ? 179.287 160.141 171.035 1.00 50.55  ? 66   ALA C CB    1 
ATOM 1866  N N     . GLY C 3 68  ? 179.660 157.959 173.337 1.00 58.04  ? 67   GLY C N     1 
ATOM 1867  C CA    . GLY C 3 68  ? 179.363 156.674 173.943 1.00 56.59  ? 67   GLY C CA    1 
ATOM 1868  C C     . GLY C 3 68  ? 178.560 156.823 175.213 1.00 57.28  ? 67   GLY C C     1 
ATOM 1869  O O     . GLY C 3 68  ? 177.500 156.213 175.369 1.00 50.81  ? 67   GLY C O     1 
ATOM 1870  N N     . ASN C 3 69  ? 179.036 157.665 176.129 1.00 53.77  ? 68   ASN C N     1 
ATOM 1871  C CA    . ASN C 3 69  ? 178.322 157.852 177.384 1.00 49.99  ? 68   ASN C CA    1 
ATOM 1872  C C     . ASN C 3 69  ? 176.888 158.283 177.134 1.00 59.46  ? 68   ASN C C     1 
ATOM 1873  O O     . ASN C 3 69  ? 175.940 157.618 177.567 1.00 62.59  ? 68   ASN C O     1 
ATOM 1874  C CB    . ASN C 3 69  ? 179.039 158.878 178.250 1.00 63.24  ? 68   ASN C CB    1 
ATOM 1875  C CG    . ASN C 3 69  ? 180.372 158.388 178.723 1.00 72.09  ? 68   ASN C CG    1 
ATOM 1876  O OD1   . ASN C 3 69  ? 180.638 157.190 178.714 1.00 70.82  ? 68   ASN C OD1   1 
ATOM 1877  N ND2   . ASN C 3 69  ? 181.218 159.306 179.163 1.00 68.45  ? 68   ASN C ND2   1 
ATOM 1878  N N     . ALA C 3 70  ? 176.707 159.392 176.420 1.00 58.99  ? 69   ALA C N     1 
ATOM 1879  C CA    . ALA C 3 70  ? 175.355 159.890 176.209 1.00 46.22  ? 69   ALA C CA    1 
ATOM 1880  C C     . ALA C 3 70  ? 174.483 158.834 175.553 1.00 48.92  ? 69   ALA C C     1 
ATOM 1881  O O     . ALA C 3 70  ? 173.327 158.638 175.945 1.00 53.59  ? 69   ALA C O     1 
ATOM 1882  C CB    . ALA C 3 70  ? 175.388 161.155 175.364 1.00 50.00  ? 69   ALA C CB    1 
ATOM 1883  N N     . ALA C 3 71  ? 175.033 158.126 174.571 1.00 37.49  ? 70   ALA C N     1 
ATOM 1884  C CA    . ALA C 3 71  ? 174.284 157.077 173.897 1.00 55.27  ? 70   ALA C CA    1 
ATOM 1885  C C     . ALA C 3 71  ? 173.810 156.033 174.887 1.00 64.37  ? 70   ALA C C     1 
ATOM 1886  O O     . ALA C 3 71  ? 172.675 155.552 174.813 1.00 70.52  ? 70   ALA C O     1 
ATOM 1887  C CB    . ALA C 3 71  ? 175.150 156.431 172.823 1.00 46.74  ? 70   ALA C CB    1 
ATOM 1888  N N     . ARG C 3 72  ? 174.676 155.663 175.826 1.00 57.72  ? 71   ARG C N     1 
ATOM 1889  C CA    . ARG C 3 72  ? 174.254 154.734 176.861 1.00 64.88  ? 71   ARG C CA    1 
ATOM 1890  C C     . ARG C 3 72  ? 173.131 155.331 177.683 1.00 64.46  ? 71   ARG C C     1 
ATOM 1891  O O     . ARG C 3 72  ? 172.197 154.630 178.083 1.00 64.97  ? 71   ARG C O     1 
ATOM 1892  C CB    . ARG C 3 72  ? 175.430 154.378 177.756 1.00 81.00  ? 71   ARG C CB    1 
ATOM 1893  C CG    . ARG C 3 72  ? 175.106 153.341 178.782 1.00 98.99  ? 71   ARG C CG    1 
ATOM 1894  C CD    . ARG C 3 72  ? 176.283 153.148 179.687 1.00 107.50 ? 71   ARG C CD    1 
ATOM 1895  N NE    . ARG C 3 72  ? 176.519 154.350 180.472 1.00 109.22 ? 71   ARG C NE    1 
ATOM 1896  C CZ    . ARG C 3 72  ? 177.648 154.606 181.117 1.00 105.69 ? 71   ARG C CZ    1 
ATOM 1897  N NH1   . ARG C 3 72  ? 178.652 153.746 181.061 1.00 104.40 ? 71   ARG C NH1   1 
ATOM 1898  N NH2   . ARG C 3 72  ? 177.774 155.725 181.812 1.00 100.14 ? 71   ARG C NH2   1 
ATOM 1899  N N     . ASP C 3 73  ? 173.193 156.635 177.928 1.00 50.79  ? 72   ASP C N     1 
ATOM 1900  C CA    . ASP C 3 73  ? 172.158 157.264 178.730 1.00 60.19  ? 72   ASP C CA    1 
ATOM 1901  C C     . ASP C 3 73  ? 170.858 157.444 177.971 1.00 71.74  ? 72   ASP C C     1 
ATOM 1902  O O     . ASP C 3 73  ? 169.854 157.811 178.583 1.00 75.34  ? 72   ASP C O     1 
ATOM 1903  C CB    . ASP C 3 73  ? 172.653 158.601 179.258 1.00 78.75  ? 72   ASP C CB    1 
ATOM 1904  C CG    . ASP C 3 73  ? 173.774 158.436 180.255 1.00 91.60  ? 72   ASP C CG    1 
ATOM 1905  O OD1   . ASP C 3 73  ? 173.982 157.295 180.718 1.00 86.88  ? 72   ASP C OD1   1 
ATOM 1906  O OD2   . ASP C 3 73  ? 174.442 159.437 180.581 1.00 94.96  ? 72   ASP C OD2   1 
ATOM 1907  N N     . ASN C 3 74  ? 170.845 157.208 176.668 1.00 81.67  ? 73   ASN C N     1 
ATOM 1908  C CA    . ASN C 3 74  ? 169.595 157.026 175.952 1.00 75.05  ? 73   ASN C CA    1 
ATOM 1909  C C     . ASN C 3 74  ? 169.193 155.573 175.864 1.00 67.72  ? 73   ASN C C     1 
ATOM 1910  O O     . ASN C 3 74  ? 168.242 155.250 175.149 1.00 75.82  ? 73   ASN C O     1 
ATOM 1911  C CB    . ASN C 3 74  ? 169.678 157.614 174.552 1.00 86.12  ? 73   ASN C CB    1 
ATOM 1912  C CG    . ASN C 3 74  ? 169.570 159.108 174.555 1.00 103.34 ? 73   ASN C CG    1 
ATOM 1913  O OD1   . ASN C 3 74  ? 168.481 159.652 174.704 1.00 112.49 ? 73   ASN C OD1   1 
ATOM 1914  N ND2   . ASN C 3 74  ? 170.695 159.787 174.391 1.00 99.88  ? 73   ASN C ND2   1 
ATOM 1915  N N     . LYS C 3 75  ? 169.914 154.690 176.544 1.00 70.46  ? 74   LYS C N     1 
ATOM 1916  C CA    . LYS C 3 75  ? 169.658 153.260 176.476 1.00 75.48  ? 74   LYS C CA    1 
ATOM 1917  C C     . LYS C 3 75  ? 169.721 152.769 175.037 1.00 65.04  ? 74   LYS C C     1 
ATOM 1918  O O     . LYS C 3 75  ? 168.782 152.160 174.532 1.00 76.42  ? 74   LYS C O     1 
ATOM 1919  C CB    . LYS C 3 75  ? 168.322 152.901 177.124 1.00 86.00  ? 74   LYS C CB    1 
ATOM 1920  C CG    . LYS C 3 75  ? 168.373 153.103 178.622 1.00 94.45  ? 74   LYS C CG    1 
ATOM 1921  C CD    . LYS C 3 75  ? 167.078 152.756 179.322 1.00 112.93 ? 74   LYS C CD    1 
ATOM 1922  C CE    . LYS C 3 75  ? 167.244 152.900 180.833 1.00 122.60 ? 74   LYS C CE    1 
ATOM 1923  N NZ    . LYS C 3 75  ? 165.999 152.608 181.598 1.00 126.16 ? 74   LYS C NZ    1 
ATOM 1924  N N     . LYS C 3 76  ? 170.824 153.072 174.369 1.00 52.29  ? 75   LYS C N     1 
ATOM 1925  C CA    . LYS C 3 76  ? 171.123 152.573 173.039 1.00 57.64  ? 75   LYS C CA    1 
ATOM 1926  C C     . LYS C 3 76  ? 172.540 152.031 173.037 1.00 61.31  ? 75   LYS C C     1 
ATOM 1927  O O     . LYS C 3 76  ? 173.425 152.594 173.686 1.00 69.71  ? 75   LYS C O     1 
ATOM 1928  C CB    . LYS C 3 76  ? 171.006 153.672 172.000 1.00 59.12  ? 75   LYS C CB    1 
ATOM 1929  C CG    . LYS C 3 76  ? 169.636 154.250 171.817 1.00 65.37  ? 75   LYS C CG    1 
ATOM 1930  C CD    . LYS C 3 76  ? 168.714 153.258 171.166 1.00 75.35  ? 75   LYS C CD    1 
ATOM 1931  C CE    . LYS C 3 76  ? 167.400 153.928 170.834 1.00 84.61  ? 75   LYS C CE    1 
ATOM 1932  N NZ    . LYS C 3 76  ? 166.439 153.012 170.186 1.00 89.56  ? 75   LYS C NZ    1 
ATOM 1933  N N     . THR C 3 77  ? 172.758 150.939 172.317 1.00 61.12  ? 76   THR C N     1 
ATOM 1934  C CA    . THR C 3 77  ? 174.090 150.370 172.197 1.00 71.94  ? 76   THR C CA    1 
ATOM 1935  C C     . THR C 3 77  ? 174.850 150.879 170.989 1.00 70.08  ? 76   THR C C     1 
ATOM 1936  O O     . THR C 3 77  ? 176.053 150.632 170.885 1.00 60.89  ? 76   THR C O     1 
ATOM 1937  C CB    . THR C 3 77  ? 174.014 148.852 172.113 1.00 73.03  ? 76   THR C CB    1 
ATOM 1938  O OG1   . THR C 3 77  ? 173.206 148.489 170.989 1.00 70.08  ? 76   THR C OG1   1 
ATOM 1939  C CG2   . THR C 3 77  ? 173.411 148.290 173.372 1.00 65.43  ? 76   THR C CG2   1 
ATOM 1940  N N     . ARG C 3 78  ? 174.191 151.577 170.077 1.00 76.36  ? 77   ARG C N     1 
ATOM 1941  C CA    . ARG C 3 78  ? 174.799 151.944 168.813 1.00 69.16  ? 77   ARG C CA    1 
ATOM 1942  C C     . ARG C 3 78  ? 174.714 153.447 168.604 1.00 63.72  ? 77   ARG C C     1 
ATOM 1943  O O     . ARG C 3 78  ? 173.622 154.010 168.529 1.00 76.76  ? 77   ARG C O     1 
ATOM 1944  C CB    . ARG C 3 78  ? 174.129 151.219 167.668 1.00 66.56  ? 77   ARG C CB    1 
ATOM 1945  C CG    . ARG C 3 78  ? 174.738 151.569 166.365 1.00 85.90  ? 77   ARG C CG    1 
ATOM 1946  C CD    . ARG C 3 78  ? 174.250 150.691 165.250 1.00 91.61  ? 77   ARG C CD    1 
ATOM 1947  N NE    . ARG C 3 78  ? 174.668 149.312 165.427 1.00 91.35  ? 77   ARG C NE    1 
ATOM 1948  C CZ    . ARG C 3 78  ? 173.830 148.313 165.647 1.00 92.23  ? 77   ARG C CZ    1 
ATOM 1949  N NH1   . ARG C 3 78  ? 172.528 148.544 165.681 1.00 79.15  ? 77   ARG C NH1   1 
ATOM 1950  N NH2   . ARG C 3 78  ? 174.291 147.082 165.798 1.00 103.60 ? 77   ARG C NH2   1 
ATOM 1951  N N     . ILE C 3 79  ? 175.874 154.087 168.495 1.00 60.72  ? 78   ILE C N     1 
ATOM 1952  C CA    . ILE C 3 79  ? 175.990 155.538 168.396 1.00 60.87  ? 78   ILE C CA    1 
ATOM 1953  C C     . ILE C 3 79  ? 175.419 156.036 167.082 1.00 55.45  ? 78   ILE C C     1 
ATOM 1954  O O     . ILE C 3 79  ? 175.716 155.495 166.012 1.00 46.82  ? 78   ILE C O     1 
ATOM 1955  C CB    . ILE C 3 79  ? 177.452 155.975 168.552 1.00 50.38  ? 78   ILE C CB    1 
ATOM 1956  C CG1   . ILE C 3 79  ? 177.842 155.922 170.015 1.00 48.86  ? 78   ILE C CG1   1 
ATOM 1957  C CG2   . ILE C 3 79  ? 177.652 157.328 167.984 1.00 37.12  ? 78   ILE C CG2   1 
ATOM 1958  C CD1   . ILE C 3 79  ? 179.268 156.232 170.260 1.00 49.09  ? 78   ILE C CD1   1 
ATOM 1959  N N     . ILE C 3 80  ? 174.613 157.088 167.165 1.00 51.25  ? 79   ILE C N     1 
ATOM 1960  C CA    . ILE C 3 80  ? 173.996 157.726 166.005 1.00 50.80  ? 79   ILE C CA    1 
ATOM 1961  C C     . ILE C 3 80  ? 174.240 159.221 166.074 1.00 61.20  ? 79   ILE C C     1 
ATOM 1962  O O     . ILE C 3 80  ? 174.563 159.761 167.143 1.00 67.72  ? 79   ILE C O     1 
ATOM 1963  C CB    . ILE C 3 80  ? 172.491 157.433 165.938 1.00 40.38  ? 79   ILE C CB    1 
ATOM 1964  C CG1   . ILE C 3 80  ? 171.849 157.714 167.289 1.00 40.08  ? 79   ILE C CG1   1 
ATOM 1965  C CG2   . ILE C 3 80  ? 172.252 156.030 165.477 1.00 37.51  ? 79   ILE C CG2   1 
ATOM 1966  C CD1   . ILE C 3 80  ? 170.359 157.573 167.285 1.00 37.45  ? 79   ILE C CD1   1 
ATOM 1967  N N     . PRO C 3 81  ? 174.090 159.925 164.949 1.00 63.22  ? 80   PRO C N     1 
ATOM 1968  C CA    . PRO C 3 81  ? 174.540 161.322 164.903 1.00 45.27  ? 80   PRO C CA    1 
ATOM 1969  C C     . PRO C 3 81  ? 174.067 162.158 166.065 1.00 46.52  ? 80   PRO C C     1 
ATOM 1970  O O     . PRO C 3 81  ? 174.866 162.868 166.681 1.00 53.08  ? 80   PRO C O     1 
ATOM 1971  C CB    . PRO C 3 81  ? 173.950 161.811 163.585 1.00 50.52  ? 80   PRO C CB    1 
ATOM 1972  C CG    . PRO C 3 81  ? 173.914 160.628 162.754 1.00 54.57  ? 80   PRO C CG    1 
ATOM 1973  C CD    . PRO C 3 81  ? 173.593 159.483 163.639 1.00 60.78  ? 80   PRO C CD    1 
ATOM 1974  N N     . ARG C 3 82  ? 172.788 162.050 166.408 1.00 57.67  ? 81   ARG C N     1 
ATOM 1975  C CA    . ARG C 3 82  ? 172.249 162.792 167.536 1.00 47.74  ? 81   ARG C CA    1 
ATOM 1976  C C     . ARG C 3 82  ? 173.154 162.684 168.745 1.00 50.18  ? 81   ARG C C     1 
ATOM 1977  O O     . ARG C 3 82  ? 173.427 163.679 169.423 1.00 52.24  ? 81   ARG C O     1 
ATOM 1978  C CB    . ARG C 3 82  ? 170.867 162.256 167.872 1.00 46.00  ? 81   ARG C CB    1 
ATOM 1979  C CG    . ARG C 3 82  ? 170.247 162.851 169.093 1.00 38.56  ? 81   ARG C CG    1 
ATOM 1980  C CD    . ARG C 3 82  ? 169.928 164.290 168.915 1.00 45.68  ? 81   ARG C CD    1 
ATOM 1981  N NE    . ARG C 3 82  ? 169.269 164.791 170.104 1.00 54.52  ? 81   ARG C NE    1 
ATOM 1982  C CZ    . ARG C 3 82  ? 169.036 166.070 170.339 1.00 56.79  ? 81   ARG C CZ    1 
ATOM 1983  N NH1   . ARG C 3 82  ? 169.394 166.984 169.453 1.00 67.06  ? 81   ARG C NH1   1 
ATOM 1984  N NH2   . ARG C 3 82  ? 168.429 166.435 171.455 1.00 52.97  ? 81   ARG C NH2   1 
ATOM 1985  N N     . HIS C 3 83  ? 173.655 161.486 169.011 1.00 50.88  ? 82   HIS C N     1 
ATOM 1986  C CA    . HIS C 3 83  ? 174.551 161.315 170.137 1.00 51.45  ? 82   HIS C CA    1 
ATOM 1987  C C     . HIS C 3 83  ? 175.794 162.162 169.974 1.00 56.60  ? 82   HIS C C     1 
ATOM 1988  O O     . HIS C 3 83  ? 176.246 162.798 170.928 1.00 61.30  ? 82   HIS C O     1 
ATOM 1989  C CB    . HIS C 3 83  ? 174.909 159.852 170.276 1.00 38.90  ? 82   HIS C CB    1 
ATOM 1990  C CG    . HIS C 3 83  ? 173.735 158.995 170.589 1.00 49.12  ? 82   HIS C CG    1 
ATOM 1991  N ND1   . HIS C 3 83  ? 173.694 157.653 170.296 1.00 50.51  ? 82   HIS C ND1   1 
ATOM 1992  C CD2   . HIS C 3 83  ? 172.565 159.286 171.197 1.00 52.80  ? 82   HIS C CD2   1 
ATOM 1993  C CE1   . HIS C 3 83  ? 172.536 157.157 170.690 1.00 52.70  ? 82   HIS C CE1   1 
ATOM 1994  N NE2   . HIS C 3 83  ? 171.834 158.128 171.243 1.00 53.49  ? 82   HIS C NE2   1 
ATOM 1995  N N     . LEU C 3 84  ? 176.353 162.202 168.770 1.00 42.32  ? 83   LEU C N     1 
ATOM 1996  C CA    . LEU C 3 84  ? 177.519 163.046 168.551 1.00 52.05  ? 83   LEU C CA    1 
ATOM 1997  C C     . LEU C 3 84  ? 177.188 164.502 168.820 1.00 45.23  ? 83   LEU C C     1 
ATOM 1998  O O     . LEU C 3 84  ? 177.899 165.186 169.561 1.00 46.17  ? 83   LEU C O     1 
ATOM 1999  C CB    . LEU C 3 84  ? 178.033 162.857 167.136 1.00 44.85  ? 83   LEU C CB    1 
ATOM 2000  C CG    . LEU C 3 84  ? 178.630 161.477 166.983 1.00 48.36  ? 83   LEU C CG    1 
ATOM 2001  C CD1   . LEU C 3 84  ? 179.005 161.220 165.562 1.00 48.16  ? 83   LEU C CD1   1 
ATOM 2002  C CD2   . LEU C 3 84  ? 179.840 161.441 167.844 1.00 48.10  ? 83   LEU C CD2   1 
ATOM 2003  N N     . GLN C 3 85  ? 176.092 164.983 168.243 1.00 46.50  ? 84   GLN C N     1 
ATOM 2004  C CA    . GLN C 3 85  ? 175.667 166.352 168.481 1.00 44.06  ? 84   GLN C CA    1 
ATOM 2005  C C     . GLN C 3 85  ? 175.661 166.661 169.961 1.00 42.08  ? 84   GLN C C     1 
ATOM 2006  O O     . GLN C 3 85  ? 176.320 167.600 170.415 1.00 41.77  ? 84   GLN C O     1 
ATOM 2007  C CB    . GLN C 3 85  ? 174.271 166.562 167.919 1.00 46.91  ? 84   GLN C CB    1 
ATOM 2008  C CG    . GLN C 3 85  ? 173.783 167.964 168.031 1.00 46.30  ? 84   GLN C CG    1 
ATOM 2009  C CD    . GLN C 3 85  ? 174.447 168.858 167.041 1.00 54.99  ? 84   GLN C CD    1 
ATOM 2010  O OE1   . GLN C 3 85  ? 174.345 168.634 165.843 1.00 60.50  ? 84   GLN C OE1   1 
ATOM 2011  N NE2   . GLN C 3 85  ? 175.130 169.880 167.521 1.00 57.66  ? 84   GLN C NE2   1 
ATOM 2012  N N     . LEU C 3 86  ? 174.940 165.854 170.736 1.00 41.98  ? 85   LEU C N     1 
ATOM 2013  C CA    . LEU C 3 86  ? 174.806 166.154 172.153 1.00 50.08  ? 85   LEU C CA    1 
ATOM 2014  C C     . LEU C 3 86  ? 176.145 166.061 172.853 1.00 48.38  ? 85   LEU C C     1 
ATOM 2015  O O     . LEU C 3 86  ? 176.436 166.845 173.762 1.00 48.70  ? 85   LEU C O     1 
ATOM 2016  C CB    . LEU C 3 86  ? 173.801 165.215 172.802 1.00 40.49  ? 85   LEU C CB    1 
ATOM 2017  C CG    . LEU C 3 86  ? 172.401 165.333 172.215 1.00 44.22  ? 85   LEU C CG    1 
ATOM 2018  C CD1   . LEU C 3 86  ? 171.469 164.374 172.903 1.00 46.40  ? 85   LEU C CD1   1 
ATOM 2019  C CD2   . LEU C 3 86  ? 171.897 166.742 172.324 1.00 35.46  ? 85   LEU C CD2   1 
ATOM 2020  N N     . ALA C 3 87  ? 176.984 165.125 172.429 1.00 33.94  ? 86   ALA C N     1 
ATOM 2021  C CA    . ALA C 3 87  ? 178.287 164.980 173.056 1.00 42.49  ? 86   ALA C CA    1 
ATOM 2022  C C     . ALA C 3 87  ? 179.111 166.239 172.868 1.00 46.88  ? 86   ALA C C     1 
ATOM 2023  O O     . ALA C 3 87  ? 179.628 166.811 173.831 1.00 59.12  ? 86   ALA C O     1 
ATOM 2024  C CB    . ALA C 3 87  ? 179.009 163.769 172.481 1.00 43.23  ? 86   ALA C CB    1 
ATOM 2025  N N     . VAL C 3 88  ? 179.236 166.690 171.628 1.00 54.46  ? 87   VAL C N     1 
ATOM 2026  C CA    . VAL C 3 88  ? 179.956 167.916 171.333 1.00 52.77  ? 87   VAL C CA    1 
ATOM 2027  C C     . VAL C 3 88  ? 179.350 169.066 172.110 1.00 55.64  ? 87   VAL C C     1 
ATOM 2028  O O     . VAL C 3 88  ? 179.939 169.553 173.079 1.00 55.27  ? 87   VAL C O     1 
ATOM 2029  C CB    . VAL C 3 88  ? 179.924 168.223 169.833 1.00 43.17  ? 87   VAL C CB    1 
ATOM 2030  C CG1   . VAL C 3 88  ? 180.545 169.562 169.577 1.00 45.63  ? 87   VAL C CG1   1 
ATOM 2031  C CG2   . VAL C 3 88  ? 180.648 167.154 169.075 1.00 42.02  ? 87   VAL C CG2   1 
ATOM 2032  N N     . ARG C 3 89  ? 178.153 169.480 171.708 1.00 44.07  ? 88   ARG C N     1 
ATOM 2033  C CA    . ARG C 3 89  ? 177.594 170.718 172.221 1.00 46.94  ? 88   ARG C CA    1 
ATOM 2034  C C     . ARG C 3 89  ? 177.557 170.748 173.736 1.00 51.39  ? 88   ARG C C     1 
ATOM 2035  O O     . ARG C 3 89  ? 177.858 171.780 174.338 1.00 62.63  ? 88   ARG C O     1 
ATOM 2036  C CB    . ARG C 3 89  ? 176.199 170.915 171.669 1.00 40.99  ? 88   ARG C CB    1 
ATOM 2037  C CG    . ARG C 3 89  ? 176.153 170.973 170.182 1.00 37.70  ? 88   ARG C CG    1 
ATOM 2038  C CD    . ARG C 3 89  ? 176.694 172.274 169.656 1.00 32.04  ? 88   ARG C CD    1 
ATOM 2039  N NE    . ARG C 3 89  ? 176.523 172.372 168.211 1.00 50.65  ? 88   ARG C NE    1 
ATOM 2040  C CZ    . ARG C 3 89  ? 177.456 172.064 167.322 1.00 46.85  ? 88   ARG C CZ    1 
ATOM 2041  N NH1   . ARG C 3 89  ? 178.642 171.658 167.725 1.00 36.05  ? 88   ARG C NH1   1 
ATOM 2042  N NH2   . ARG C 3 89  ? 177.205 172.178 166.032 1.00 38.29  ? 88   ARG C NH2   1 
ATOM 2043  N N     . ASN C 3 90  ? 177.197 169.637 174.376 1.00 50.48  ? 89   ASN C N     1 
ATOM 2044  C CA    . ASN C 3 90  ? 177.170 169.654 175.832 1.00 53.22  ? 89   ASN C CA    1 
ATOM 2045  C C     . ASN C 3 90  ? 178.539 169.939 176.410 1.00 57.73  ? 89   ASN C C     1 
ATOM 2046  O O     . ASN C 3 90  ? 178.653 170.717 177.360 1.00 64.32  ? 89   ASN C O     1 
ATOM 2047  C CB    . ASN C 3 90  ? 176.631 168.344 176.382 1.00 60.79  ? 89   ASN C CB    1 
ATOM 2048  C CG    . ASN C 3 90  ? 175.140 168.257 176.268 1.00 59.66  ? 89   ASN C CG    1 
ATOM 2049  O OD1   . ASN C 3 90  ? 174.455 169.274 176.238 1.00 60.17  ? 89   ASN C OD1   1 
ATOM 2050  N ND2   . ASN C 3 90  ? 174.622 167.045 176.197 1.00 50.78  ? 89   ASN C ND2   1 
ATOM 2051  N N     . ASP C 3 91  ? 179.581 169.340 175.857 1.00 58.76  ? 90   ASP C N     1 
ATOM 2052  C CA    . ASP C 3 91  ? 180.910 169.682 176.317 1.00 46.70  ? 90   ASP C CA    1 
ATOM 2053  C C     . ASP C 3 91  ? 181.244 171.111 175.924 1.00 47.69  ? 90   ASP C C     1 
ATOM 2054  O O     . ASP C 3 91  ? 180.624 171.699 175.038 1.00 64.46  ? 90   ASP C O     1 
ATOM 2055  C CB    . ASP C 3 91  ? 181.947 168.735 175.740 1.00 54.20  ? 90   ASP C CB    1 
ATOM 2056  C CG    . ASP C 3 91  ? 183.336 169.081 176.187 1.00 81.07  ? 90   ASP C CG    1 
ATOM 2057  O OD1   . ASP C 3 91  ? 183.625 168.923 177.387 1.00 92.70  ? 90   ASP C OD1   1 
ATOM 2058  O OD2   . ASP C 3 91  ? 184.125 169.557 175.347 1.00 90.22  ? 90   ASP C OD2   1 
ATOM 2059  N N     . GLU C 3 92  ? 182.225 171.681 176.609 1.00 56.39  ? 91   GLU C N     1 
ATOM 2060  C CA    . GLU C 3 92  ? 182.645 173.049 176.313 1.00 53.97  ? 91   GLU C CA    1 
ATOM 2061  C C     . GLU C 3 92  ? 183.724 173.074 175.234 1.00 50.88  ? 91   GLU C C     1 
ATOM 2062  O O     . GLU C 3 92  ? 183.450 173.421 174.086 1.00 51.18  ? 91   GLU C O     1 
ATOM 2063  C CB    . GLU C 3 92  ? 183.142 173.736 177.579 1.00 49.99  ? 91   GLU C CB    1 
ATOM 2064  C CG    . GLU C 3 92  ? 183.567 175.155 177.337 1.00 82.49  ? 91   GLU C CG    1 
ATOM 2065  C CD    . GLU C 3 92  ? 184.022 175.832 178.601 1.00 113.87 ? 91   GLU C CD    1 
ATOM 2066  O OE1   . GLU C 3 92  ? 184.046 175.162 179.654 1.00 119.96 ? 91   GLU C OE1   1 
ATOM 2067  O OE2   . GLU C 3 92  ? 184.351 177.033 178.547 1.00 119.74 ? 91   GLU C OE2   1 
ATOM 2068  N N     . GLU C 3 93  ? 184.945 172.679 175.599 1.00 56.37  ? 92   GLU C N     1 
ATOM 2069  C CA    . GLU C 3 93  ? 186.088 172.962 174.740 1.00 48.08  ? 92   GLU C CA    1 
ATOM 2070  C C     . GLU C 3 93  ? 185.869 172.446 173.331 1.00 50.63  ? 92   GLU C C     1 
ATOM 2071  O O     . GLU C 3 93  ? 186.261 173.098 172.359 1.00 54.57  ? 92   GLU C O     1 
ATOM 2072  C CB    . GLU C 3 93  ? 187.362 172.378 175.335 1.00 56.11  ? 92   GLU C CB    1 
ATOM 2073  C CG    . GLU C 3 93  ? 187.795 173.071 176.609 1.00 81.34  ? 92   GLU C CG    1 
ATOM 2074  C CD    . GLU C 3 93  ? 189.135 172.573 177.128 1.00 97.63  ? 92   GLU C CD    1 
ATOM 2075  O OE1   . GLU C 3 93  ? 189.653 171.561 176.609 1.00 108.77 ? 92   GLU C OE1   1 
ATOM 2076  O OE2   . GLU C 3 93  ? 189.691 173.208 178.049 1.00 94.44  ? 92   GLU C OE2   1 
ATOM 2077  N N     . LEU C 3 94  ? 185.224 171.294 173.190 1.00 49.48  ? 93   LEU C N     1 
ATOM 2078  C CA    . LEU C 3 94  ? 184.858 170.848 171.856 1.00 41.55  ? 93   LEU C CA    1 
ATOM 2079  C C     . LEU C 3 94  ? 183.985 171.874 171.163 1.00 57.24  ? 93   LEU C C     1 
ATOM 2080  O O     . LEU C 3 94  ? 184.281 172.300 170.043 1.00 65.06  ? 93   LEU C O     1 
ATOM 2081  C CB    . LEU C 3 94  ? 184.155 169.505 171.918 1.00 36.77  ? 93   LEU C CB    1 
ATOM 2082  C CG    . LEU C 3 94  ? 185.141 168.402 172.227 1.00 47.19  ? 93   LEU C CG    1 
ATOM 2083  C CD1   . LEU C 3 94  ? 184.408 167.106 172.367 1.00 43.79  ? 93   LEU C CD1   1 
ATOM 2084  C CD2   . LEU C 3 94  ? 186.119 168.328 171.093 1.00 32.39  ? 93   LEU C CD2   1 
ATOM 2085  N N     . ASN C 3 95  ? 182.901 172.282 171.811 1.00 49.27  ? 94   ASN C N     1 
ATOM 2086  C CA    . ASN C 3 95  ? 182.032 173.275 171.205 1.00 46.62  ? 94   ASN C CA    1 
ATOM 2087  C C     . ASN C 3 95  ? 182.824 174.492 170.781 1.00 52.75  ? 94   ASN C C     1 
ATOM 2088  O O     . ASN C 3 95  ? 182.621 175.037 169.694 1.00 61.73  ? 94   ASN C O     1 
ATOM 2089  C CB    . ASN C 3 95  ? 180.939 173.674 172.176 1.00 44.69  ? 94   ASN C CB    1 
ATOM 2090  C CG    . ASN C 3 95  ? 179.950 174.585 171.547 1.00 52.75  ? 94   ASN C CG    1 
ATOM 2091  O OD1   . ASN C 3 95  ? 179.753 174.548 170.337 1.00 56.76  ? 94   ASN C OD1   1 
ATOM 2092  N ND2   . ASN C 3 95  ? 179.312 175.416 172.353 1.00 57.80  ? 94   ASN C ND2   1 
ATOM 2093  N N     . LYS C 3 96  ? 183.745 174.922 171.637 1.00 49.92  ? 95   LYS C N     1 
ATOM 2094  C CA    . LYS C 3 96  ? 184.675 175.979 171.275 1.00 42.90  ? 95   LYS C CA    1 
ATOM 2095  C C     . LYS C 3 96  ? 185.384 175.655 169.975 1.00 50.54  ? 95   LYS C C     1 
ATOM 2096  O O     . LYS C 3 96  ? 185.584 176.529 169.128 1.00 66.33  ? 95   LYS C O     1 
ATOM 2097  C CB    . LYS C 3 96  ? 185.683 176.157 172.406 1.00 50.62  ? 95   LYS C CB    1 
ATOM 2098  C CG    . LYS C 3 96  ? 186.690 177.250 172.220 1.00 66.01  ? 95   LYS C CG    1 
ATOM 2099  C CD    . LYS C 3 96  ? 186.075 178.609 172.359 1.00 97.15  ? 95   LYS C CD    1 
ATOM 2100  C CE    . LYS C 3 96  ? 187.147 179.672 172.263 1.00 112.95 ? 95   LYS C CE    1 
ATOM 2101  N NZ    . LYS C 3 96  ? 188.110 179.559 173.390 1.00 117.35 ? 95   LYS C NZ    1 
ATOM 2102  N N     . LEU C 3 97  ? 185.758 174.392 169.793 1.00 47.07  ? 96   LEU C N     1 
ATOM 2103  C CA    . LEU C 3 97  ? 186.538 174.011 168.625 1.00 38.97  ? 96   LEU C CA    1 
ATOM 2104  C C     . LEU C 3 97  ? 185.664 173.850 167.392 1.00 40.98  ? 96   LEU C C     1 
ATOM 2105  O O     . LEU C 3 97  ? 186.022 174.304 166.303 1.00 47.15  ? 96   LEU C O     1 
ATOM 2106  C CB    . LEU C 3 97  ? 187.291 172.724 168.919 1.00 47.38  ? 96   LEU C CB    1 
ATOM 2107  C CG    . LEU C 3 97  ? 188.013 172.108 167.741 1.00 44.28  ? 96   LEU C CG    1 
ATOM 2108  C CD1   . LEU C 3 97  ? 189.002 173.084 167.216 1.00 36.63  ? 96   LEU C CD1   1 
ATOM 2109  C CD2   . LEU C 3 97  ? 188.716 170.874 168.208 1.00 38.91  ? 96   LEU C CD2   1 
ATOM 2110  N N     . LEU C 3 98  ? 184.517 173.210 167.535 1.00 47.57  ? 97   LEU C N     1 
ATOM 2111  C CA    . LEU C 3 98  ? 183.706 172.852 166.386 1.00 53.35  ? 97   LEU C CA    1 
ATOM 2112  C C     . LEU C 3 98  ? 182.709 173.921 166.012 1.00 49.22  ? 97   LEU C C     1 
ATOM 2113  O O     . LEU C 3 98  ? 181.880 173.688 165.133 1.00 32.70  ? 97   LEU C O     1 
ATOM 2114  C CB    . LEU C 3 98  ? 182.965 171.553 166.650 1.00 47.26  ? 97   LEU C CB    1 
ATOM 2115  C CG    . LEU C 3 98  ? 183.926 170.401 166.848 1.00 45.16  ? 97   LEU C CG    1 
ATOM 2116  C CD1   . LEU C 3 98  ? 183.164 169.156 167.171 1.00 34.86  ? 97   LEU C CD1   1 
ATOM 2117  C CD2   . LEU C 3 98  ? 184.734 170.214 165.608 1.00 46.28  ? 97   LEU C CD2   1 
ATOM 2118  N N     . GLY C 3 99  ? 182.776 175.083 166.642 1.00 39.89  ? 98   GLY C N     1 
ATOM 2119  C CA    . GLY C 3 99  ? 181.652 175.992 166.688 1.00 34.61  ? 98   GLY C CA    1 
ATOM 2120  C C     . GLY C 3 99  ? 180.940 176.241 165.380 1.00 42.42  ? 98   GLY C C     1 
ATOM 2121  O O     . GLY C 3 99  ? 179.729 176.456 165.371 1.00 49.35  ? 98   GLY C O     1 
ATOM 2122  N N     . ARG C 3 100 ? 181.655 176.206 164.268 1.00 44.92  ? 99   ARG C N     1 
ATOM 2123  C CA    . ARG C 3 100 ? 181.025 176.430 162.982 1.00 46.50  ? 99   ARG C CA    1 
ATOM 2124  C C     . ARG C 3 100 ? 180.669 175.149 162.265 1.00 49.65  ? 99   ARG C C     1 
ATOM 2125  O O     . ARG C 3 100 ? 180.192 175.203 161.134 1.00 58.52  ? 99   ARG C O     1 
ATOM 2126  C CB    . ARG C 3 100 ? 181.929 177.272 162.105 1.00 46.26  ? 99   ARG C CB    1 
ATOM 2127  C CG    . ARG C 3 100 ? 182.110 178.630 162.678 1.00 65.80  ? 99   ARG C CG    1 
ATOM 2128  C CD    . ARG C 3 100 ? 182.956 179.494 161.798 1.00 91.52  ? 99   ARG C CD    1 
ATOM 2129  N NE    . ARG C 3 100 ? 183.053 180.827 162.367 1.00 120.41 ? 99   ARG C NE    1 
ATOM 2130  C CZ    . ARG C 3 100 ? 182.123 181.756 162.202 1.00 140.59 ? 99   ARG C CZ    1 
ATOM 2131  N NH1   . ARG C 3 100 ? 181.041 181.485 161.484 1.00 146.73 ? 99   ARG C NH1   1 
ATOM 2132  N NH2   . ARG C 3 100 ? 182.271 182.952 162.752 1.00 144.23 ? 99   ARG C NH2   1 
ATOM 2133  N N     . VAL C 3 101 ? 180.901 174.015 162.872 1.00 41.17  ? 100  VAL C N     1 
ATOM 2134  C CA    . VAL C 3 101 ? 180.578 172.734 162.271 1.00 38.75  ? 100  VAL C CA    1 
ATOM 2135  C C     . VAL C 3 101 ? 179.078 172.536 162.290 1.00 39.85  ? 100  VAL C C     1 
ATOM 2136  O O     . VAL C 3 101 ? 178.403 172.924 163.244 1.00 41.39  ? 100  VAL C O     1 
ATOM 2137  C CB    . VAL C 3 101 ? 181.275 171.595 163.021 1.00 44.43  ? 100  VAL C CB    1 
ATOM 2138  C CG1   . VAL C 3 101 ? 180.722 170.302 162.580 1.00 47.23  ? 100  VAL C CG1   1 
ATOM 2139  C CG2   . VAL C 3 101 ? 182.746 171.632 162.757 1.00 43.35  ? 100  VAL C CG2   1 
ATOM 2140  N N     . THR C 3 102 ? 178.553 171.926 161.244 1.00 41.76  ? 101  THR C N     1 
ATOM 2141  C CA    . THR C 3 102 ? 177.173 171.485 161.235 1.00 38.75  ? 101  THR C CA    1 
ATOM 2142  C C     . THR C 3 102 ? 177.105 169.988 161.005 1.00 47.54  ? 101  THR C C     1 
ATOM 2143  O O     . THR C 3 102 ? 177.665 169.460 160.045 1.00 47.90  ? 101  THR C O     1 
ATOM 2144  C CB    . THR C 3 102 ? 176.383 172.195 160.155 1.00 44.11  ? 101  THR C CB    1 
ATOM 2145  O OG1   . THR C 3 102 ? 176.367 173.594 160.440 1.00 53.22  ? 101  THR C OG1   1 
ATOM 2146  C CG2   . THR C 3 102 ? 174.979 171.665 160.124 1.00 31.47  ? 101  THR C CG2   1 
ATOM 2147  N N     . ILE C 3 103 ? 176.405 169.307 161.896 1.00 46.31  ? 102  ILE C N     1 
ATOM 2148  C CA    . ILE C 3 103 ? 176.311 167.861 161.880 1.00 46.94  ? 102  ILE C CA    1 
ATOM 2149  C C     . ILE C 3 103 ? 174.957 167.490 161.317 1.00 51.17  ? 102  ILE C C     1 
ATOM 2150  O O     . ILE C 3 103 ? 173.933 167.737 161.958 1.00 62.19  ? 102  ILE C O     1 
ATOM 2151  C CB    . ILE C 3 103 ? 176.480 167.284 163.281 1.00 47.62  ? 102  ILE C CB    1 
ATOM 2152  C CG1   . ILE C 3 103 ? 177.876 167.572 163.783 1.00 45.83  ? 102  ILE C CG1   1 
ATOM 2153  C CG2   . ILE C 3 103 ? 176.229 165.833 163.249 1.00 34.15  ? 102  ILE C CG2   1 
ATOM 2154  C CD1   . ILE C 3 103 ? 178.043 167.245 165.209 1.00 42.89  ? 102  ILE C CD1   1 
ATOM 2155  N N     . ALA C 3 104 ? 174.943 166.902 160.129 1.00 39.53  ? 103  ALA C N     1 
ATOM 2156  C CA    . ALA C 3 104 ? 173.679 166.467 159.561 1.00 45.20  ? 103  ALA C CA    1 
ATOM 2157  C C     . ALA C 3 104 ? 172.999 165.505 160.517 1.00 57.86  ? 103  ALA C C     1 
ATOM 2158  O O     . ALA C 3 104 ? 173.654 164.792 161.274 1.00 70.63  ? 103  ALA C O     1 
ATOM 2159  C CB    . ALA C 3 104 ? 173.895 165.798 158.211 1.00 47.62  ? 103  ALA C CB    1 
ATOM 2160  N N     . GLN C 3 105 ? 171.671 165.524 160.515 1.00 54.92  ? 104  GLN C N     1 
ATOM 2161  C CA    . GLN C 3 105 ? 170.880 164.699 161.421 1.00 60.30  ? 104  GLN C CA    1 
ATOM 2162  C C     . GLN C 3 105 ? 171.180 165.037 162.871 1.00 54.80  ? 104  GLN C C     1 
ATOM 2163  O O     . GLN C 3 105 ? 170.982 164.219 163.767 1.00 59.91  ? 104  GLN C O     1 
ATOM 2164  C CB    . GLN C 3 105 ? 171.126 163.212 161.171 1.00 56.15  ? 104  GLN C CB    1 
ATOM 2165  C CG    . GLN C 3 105 ? 170.837 162.792 159.764 1.00 74.72  ? 104  GLN C CG    1 
ATOM 2166  C CD    . GLN C 3 105 ? 169.428 163.115 159.357 1.00 92.27  ? 104  GLN C CD    1 
ATOM 2167  O OE1   . GLN C 3 105 ? 168.496 162.958 160.139 1.00 90.87  ? 104  GLN C OE1   1 
ATOM 2168  N NE2   . GLN C 3 105 ? 169.259 163.584 158.128 1.00 99.19  ? 104  GLN C NE2   1 
ATOM 2169  N N     . GLY C 3 106 ? 171.664 166.244 163.111 1.00 50.56  ? 105  GLY C N     1 
ATOM 2170  C CA    . GLY C 3 106 ? 172.200 166.576 164.409 1.00 46.89  ? 105  GLY C CA    1 
ATOM 2171  C C     . GLY C 3 106 ? 171.165 166.975 165.428 1.00 46.68  ? 105  GLY C C     1 
ATOM 2172  O O     . GLY C 3 106 ? 171.355 166.742 166.619 1.00 52.41  ? 105  GLY C O     1 
ATOM 2173  N N     . GLY C 3 107 ? 170.069 167.566 164.991 1.00 47.20  ? 106  GLY C N     1 
ATOM 2174  C CA    . GLY C 3 107 ? 169.108 168.106 165.927 1.00 39.44  ? 106  GLY C CA    1 
ATOM 2175  C C     . GLY C 3 107 ? 169.701 169.282 166.674 1.00 53.15  ? 106  GLY C C     1 
ATOM 2176  O O     . GLY C 3 107 ? 170.647 169.922 166.234 1.00 49.80  ? 106  GLY C O     1 
ATOM 2177  N N     . VAL C 3 108 ? 169.128 169.564 167.837 1.00 52.94  ? 107  VAL C N     1 
ATOM 2178  C CA    . VAL C 3 108 ? 169.552 170.693 168.649 1.00 51.80  ? 107  VAL C CA    1 
ATOM 2179  C C     . VAL C 3 108 ? 169.610 170.258 170.101 1.00 56.62  ? 107  VAL C C     1 
ATOM 2180  O O     . VAL C 3 108 ? 168.893 169.346 170.517 1.00 66.18  ? 107  VAL C O     1 
ATOM 2181  C CB    . VAL C 3 108 ? 168.595 171.884 168.482 1.00 37.29  ? 107  VAL C CB    1 
ATOM 2182  C CG1   . VAL C 3 108 ? 169.036 173.048 169.325 1.00 34.25  ? 107  VAL C CG1   1 
ATOM 2183  C CG2   . VAL C 3 108 ? 168.521 172.284 167.044 1.00 37.85  ? 107  VAL C CG2   1 
ATOM 2184  N N     . LEU C 3 109 ? 170.486 170.894 170.867 1.00 46.27  ? 108  LEU C N     1 
ATOM 2185  C CA    . LEU C 3 109 ? 170.397 170.769 172.308 1.00 47.89  ? 108  LEU C CA    1 
ATOM 2186  C C     . LEU C 3 109 ? 168.990 171.128 172.759 1.00 53.09  ? 108  LEU C C     1 
ATOM 2187  O O     . LEU C 3 109 ? 168.394 172.071 172.231 1.00 66.37  ? 108  LEU C O     1 
ATOM 2188  C CB    . LEU C 3 109 ? 171.374 171.701 173.006 1.00 35.53  ? 108  LEU C CB    1 
ATOM 2189  C CG    . LEU C 3 109 ? 172.852 171.430 172.871 1.00 40.00  ? 108  LEU C CG    1 
ATOM 2190  C CD1   . LEU C 3 109 ? 173.589 172.523 173.586 1.00 34.41  ? 108  LEU C CD1   1 
ATOM 2191  C CD2   . LEU C 3 109 ? 173.142 170.102 173.493 1.00 51.70  ? 108  LEU C CD2   1 
ATOM 2192  N N     . PRO C 3 110 ? 168.421 170.408 173.717 1.00 61.87  ? 109  PRO C N     1 
ATOM 2193  C CA    . PRO C 3 110 ? 167.182 170.892 174.325 1.00 66.65  ? 109  PRO C CA    1 
ATOM 2194  C C     . PRO C 3 110 ? 167.462 172.207 175.024 1.00 64.81  ? 109  PRO C C     1 
ATOM 2195  O O     . PRO C 3 110 ? 168.335 172.294 175.884 1.00 75.63  ? 109  PRO C O     1 
ATOM 2196  C CB    . PRO C 3 110 ? 166.828 169.787 175.320 1.00 61.98  ? 109  PRO C CB    1 
ATOM 2197  C CG    . PRO C 3 110 ? 167.525 168.589 174.803 1.00 56.24  ? 109  PRO C CG    1 
ATOM 2198  C CD    . PRO C 3 110 ? 168.804 169.093 174.237 1.00 61.48  ? 109  PRO C CD    1 
ATOM 2199  N N     . ASN C 3 111 ? 166.716 173.239 174.650 1.00 62.58  ? 110  ASN C N     1 
ATOM 2200  C CA    . ASN C 3 111 ? 166.883 174.521 175.307 1.00 63.18  ? 110  ASN C CA    1 
ATOM 2201  C C     . ASN C 3 111 ? 165.596 175.315 175.207 1.00 57.12  ? 110  ASN C C     1 
ATOM 2202  O O     . ASN C 3 111 ? 164.934 175.304 174.169 1.00 60.36  ? 110  ASN C O     1 
ATOM 2203  C CB    . ASN C 3 111 ? 168.030 175.314 174.686 1.00 82.52  ? 110  ASN C CB    1 
ATOM 2204  C CG    . ASN C 3 111 ? 168.401 176.528 175.502 1.00 98.06  ? 110  ASN C CG    1 
ATOM 2205  O OD1   . ASN C 3 111 ? 167.642 176.972 176.360 1.00 99.21  ? 110  ASN C OD1   1 
ATOM 2206  N ND2   . ASN C 3 111 ? 169.573 177.082 175.231 1.00 98.98  ? 110  ASN C ND2   1 
ATOM 2207  N N     . ILE C 3 112 ? 165.275 176.030 176.280 1.00 55.13  ? 111  ILE C N     1 
ATOM 2208  C CA    . ILE C 3 112 ? 164.199 177.013 176.294 1.00 52.15  ? 111  ILE C CA    1 
ATOM 2209  C C     . ILE C 3 112 ? 164.637 178.165 177.182 1.00 62.80  ? 111  ILE C C     1 
ATOM 2210  O O     . ILE C 3 112 ? 165.180 177.943 178.267 1.00 59.43  ? 111  ILE C O     1 
ATOM 2211  C CB    . ILE C 3 112 ? 162.876 176.432 176.816 1.00 47.66  ? 111  ILE C CB    1 
ATOM 2212  C CG1   . ILE C 3 112 ? 162.360 175.341 175.896 1.00 51.68  ? 111  ILE C CG1   1 
ATOM 2213  C CG2   . ILE C 3 112 ? 161.843 177.515 176.903 1.00 42.80  ? 111  ILE C CG2   1 
ATOM 2214  C CD1   . ILE C 3 112 ? 161.208 174.581 176.477 1.00 50.07  ? 111  ILE C CD1   1 
ATOM 2215  N N     . GLN C 3 113 ? 164.413 179.390 176.728 1.00 66.97  ? 112  GLN C N     1 
ATOM 2216  C CA    . GLN C 3 113 ? 164.655 180.530 177.592 1.00 59.61  ? 112  GLN C CA    1 
ATOM 2217  C C     . GLN C 3 113 ? 163.660 180.528 178.740 1.00 67.24  ? 112  GLN C C     1 
ATOM 2218  O O     . GLN C 3 113 ? 162.487 180.186 178.574 1.00 74.35  ? 112  GLN C O     1 
ATOM 2219  C CB    . GLN C 3 113 ? 164.555 181.830 176.806 1.00 65.30  ? 112  GLN C CB    1 
ATOM 2220  C CG    . GLN C 3 113 ? 165.680 182.028 175.825 1.00 58.78  ? 112  GLN C CG    1 
ATOM 2221  C CD    . GLN C 3 113 ? 167.016 182.111 176.511 1.00 68.92  ? 112  GLN C CD    1 
ATOM 2222  O OE1   . GLN C 3 113 ? 167.132 182.692 177.584 1.00 67.30  ? 112  GLN C OE1   1 
ATOM 2223  N NE2   . GLN C 3 113 ? 168.036 181.532 175.897 1.00 72.70  ? 112  GLN C NE2   1 
ATOM 2224  N N     . SER C 3 114 ? 164.144 180.912 179.918 1.00 79.45  ? 113  SER C N     1 
ATOM 2225  C CA    . SER C 3 114 ? 163.340 180.799 181.128 1.00 86.05  ? 113  SER C CA    1 
ATOM 2226  C C     . SER C 3 114 ? 162.047 181.590 181.008 1.00 87.39  ? 113  SER C C     1 
ATOM 2227  O O     . SER C 3 114 ? 160.958 181.071 181.271 1.00 93.15  ? 113  SER C O     1 
ATOM 2228  C CB    . SER C 3 114 ? 164.153 181.271 182.329 1.00 80.95  ? 113  SER C CB    1 
ATOM 2229  O OG    . SER C 3 114 ? 165.276 180.434 182.529 1.00 86.48  ? 113  SER C OG    1 
ATOM 2230  N N     . VAL C 3 115 ? 162.147 182.850 180.590 1.00 70.73  ? 114  VAL C N     1 
ATOM 2231  C CA    . VAL C 3 115 ? 160.989 183.725 180.555 1.00 67.00  ? 114  VAL C CA    1 
ATOM 2232  C C     . VAL C 3 115 ? 159.872 183.184 179.684 1.00 72.52  ? 114  VAL C C     1 
ATOM 2233  O O     . VAL C 3 115 ? 158.726 183.608 179.827 1.00 86.04  ? 114  VAL C O     1 
ATOM 2234  C CB    . VAL C 3 115 ? 161.401 185.121 180.065 1.00 72.11  ? 114  VAL C CB    1 
ATOM 2235  C CG1   . VAL C 3 115 ? 162.431 185.712 181.000 1.00 73.94  ? 114  VAL C CG1   1 
ATOM 2236  C CG2   . VAL C 3 115 ? 161.931 185.029 178.663 1.00 79.96  ? 114  VAL C CG2   1 
ATOM 2237  N N     . LEU C 3 116 ? 160.178 182.262 178.777 1.00 68.19  ? 115  LEU C N     1 
ATOM 2238  C CA    . LEU C 3 116 ? 159.123 181.649 177.986 1.00 74.47  ? 115  LEU C CA    1 
ATOM 2239  C C     . LEU C 3 116 ? 158.245 180.749 178.835 1.00 80.31  ? 115  LEU C C     1 
ATOM 2240  O O     . LEU C 3 116 ? 157.070 180.553 178.515 1.00 76.91  ? 115  LEU C O     1 
ATOM 2241  C CB    . LEU C 3 116 ? 159.732 180.857 176.841 1.00 74.20  ? 115  LEU C CB    1 
ATOM 2242  C CG    . LEU C 3 116 ? 160.504 181.746 175.889 1.00 66.34  ? 115  LEU C CG    1 
ATOM 2243  C CD1   . LEU C 3 116 ? 161.228 180.906 174.876 1.00 71.72  ? 115  LEU C CD1   1 
ATOM 2244  C CD2   . LEU C 3 116 ? 159.541 182.680 175.217 1.00 69.46  ? 115  LEU C CD2   1 
ATOM 2245  N N     . LEU C 3 117 ? 158.793 180.194 179.907 1.00 85.55  ? 116  LEU C N     1 
ATOM 2246  C CA    . LEU C 3 117 ? 158.027 179.285 180.731 1.00 82.96  ? 116  LEU C CA    1 
ATOM 2247  C C     . LEU C 3 117 ? 156.869 180.020 181.396 1.00 94.24  ? 116  LEU C C     1 
ATOM 2248  O O     . LEU C 3 117 ? 156.977 181.205 181.718 1.00 88.78  ? 116  LEU C O     1 
ATOM 2249  C CB    . LEU C 3 117 ? 158.915 178.652 181.792 1.00 67.17  ? 116  LEU C CB    1 
ATOM 2250  C CG    . LEU C 3 117 ? 160.006 177.771 181.200 1.00 68.75  ? 116  LEU C CG    1 
ATOM 2251  C CD1   . LEU C 3 117 ? 160.918 177.245 182.285 1.00 61.94  ? 116  LEU C CD1   1 
ATOM 2252  C CD2   . LEU C 3 117 ? 159.369 176.637 180.438 1.00 83.60  ? 116  LEU C CD2   1 
ATOM 2253  N N     . PRO C 3 118 ? 155.746 179.343 181.598 1.00 101.79 ? 117  PRO C N     1 
ATOM 2254  C CA    . PRO C 3 118 ? 154.605 179.987 182.245 1.00 104.08 ? 117  PRO C CA    1 
ATOM 2255  C C     . PRO C 3 118 ? 154.809 180.101 183.743 1.00 113.21 ? 117  PRO C C     1 
ATOM 2256  O O     . PRO C 3 118 ? 155.498 179.294 184.370 1.00 104.17 ? 117  PRO C O     1 
ATOM 2257  C CB    . PRO C 3 118 ? 153.440 179.045 181.920 1.00 89.20  ? 117  PRO C CB    1 
ATOM 2258  C CG    . PRO C 3 118 ? 154.081 177.718 181.789 1.00 84.70  ? 117  PRO C CG    1 
ATOM 2259  C CD    . PRO C 3 118 ? 155.445 177.959 181.202 1.00 91.65  ? 117  PRO C CD    1 
ATOM 2260  N N     . LYS C 3 119 ? 154.193 181.128 184.312 1.00 124.28 ? 118  LYS C N     1 
ATOM 2261  C CA    . LYS C 3 119 ? 154.270 181.363 185.747 1.00 129.17 ? 118  LYS C CA    1 
ATOM 2262  C C     . LYS C 3 119 ? 153.089 182.209 186.187 1.00 129.12 ? 118  LYS C C     1 
ATOM 2263  O O     . LYS C 3 119 ? 152.138 182.393 185.430 1.00 128.80 ? 118  LYS C O     1 
ATOM 2264  C CB    . LYS C 3 119 ? 155.586 182.045 186.116 1.00 127.47 ? 118  LYS C CB    1 
ATOM 2265  N N     . THR D 4 32  ? 188.877 150.752 141.713 1.00 128.30 ? 29   THR D N     1 
ATOM 2266  C CA    . THR D 4 32  ? 188.981 151.982 142.485 1.00 130.25 ? 29   THR D CA    1 
ATOM 2267  C C     . THR D 4 32  ? 188.584 151.752 143.933 1.00 127.23 ? 29   THR D C     1 
ATOM 2268  O O     . THR D 4 32  ? 187.424 151.468 144.224 1.00 125.18 ? 29   THR D O     1 
ATOM 2269  C CB    . THR D 4 32  ? 188.096 153.093 141.899 1.00 127.33 ? 29   THR D CB    1 
ATOM 2270  O OG1   . THR D 4 32  ? 188.525 153.396 140.567 1.00 134.98 ? 29   THR D OG1   1 
ATOM 2271  C CG2   . THR D 4 32  ? 188.185 154.344 142.746 1.00 117.10 ? 29   THR D CG2   1 
ATOM 2272  N N     . ARG D 4 33  ? 189.548 151.871 144.844 1.00 123.26 ? 30   ARG D N     1 
ATOM 2273  C CA    . ARG D 4 33  ? 189.267 151.734 146.266 1.00 114.55 ? 30   ARG D CA    1 
ATOM 2274  C C     . ARG D 4 33  ? 189.394 153.091 146.938 1.00 111.19 ? 30   ARG D C     1 
ATOM 2275  O O     . ARG D 4 33  ? 190.482 153.671 146.986 1.00 112.05 ? 30   ARG D O     1 
ATOM 2276  C CB    . ARG D 4 33  ? 190.189 150.713 146.942 1.00 106.59 ? 30   ARG D CB    1 
ATOM 2277  C CG    . ARG D 4 33  ? 191.678 150.998 146.876 1.00 107.35 ? 30   ARG D CG    1 
ATOM 2278  C CD    . ARG D 4 33  ? 192.427 150.058 147.803 1.00 109.78 ? 30   ARG D CD    1 
ATOM 2279  N NE    . ARG D 4 33  ? 192.281 148.667 147.407 1.00 112.43 ? 30   ARG D NE    1 
ATOM 2280  C CZ    . ARG D 4 33  ? 193.092 148.050 146.559 1.00 110.23 ? 30   ARG D CZ    1 
ATOM 2281  N NH1   . ARG D 4 33  ? 194.122 148.702 146.036 1.00 113.18 ? 30   ARG D NH1   1 
ATOM 2282  N NH2   . ARG D 4 33  ? 192.882 146.778 146.244 1.00 98.31  ? 30   ARG D NH2   1 
ATOM 2283  N N     . LYS D 4 34  ? 188.279 153.598 147.444 1.00 98.65  ? 31   LYS D N     1 
ATOM 2284  C CA    . LYS D 4 34  ? 188.319 154.748 148.327 1.00 87.33  ? 31   LYS D CA    1 
ATOM 2285  C C     . LYS D 4 34  ? 188.995 154.352 149.631 1.00 91.57  ? 31   LYS D C     1 
ATOM 2286  O O     . LYS D 4 34  ? 189.093 153.172 149.967 1.00 99.13  ? 31   LYS D O     1 
ATOM 2287  C CB    . LYS D 4 34  ? 186.902 155.254 148.588 1.00 71.18  ? 31   LYS D CB    1 
ATOM 2288  N N     . GLU D 4 35  ? 189.472 155.342 150.368 1.00 77.60  ? 32   GLU D N     1 
ATOM 2289  C CA    . GLU D 4 35  ? 190.046 155.092 151.678 1.00 64.53  ? 32   GLU D CA    1 
ATOM 2290  C C     . GLU D 4 35  ? 189.292 155.879 152.734 1.00 65.85  ? 32   GLU D C     1 
ATOM 2291  O O     . GLU D 4 35  ? 188.530 156.795 152.425 1.00 67.46  ? 32   GLU D O     1 
ATOM 2292  C CB    . GLU D 4 35  ? 191.504 155.482 151.756 1.00 64.05  ? 32   GLU D CB    1 
ATOM 2293  C CG    . GLU D 4 35  ? 191.713 156.957 151.637 1.00 72.58  ? 32   GLU D CG    1 
ATOM 2294  C CD    . GLU D 4 35  ? 193.156 157.328 151.806 1.00 85.02  ? 32   GLU D CD    1 
ATOM 2295  O OE1   . GLU D 4 35  ? 193.905 156.517 152.390 1.00 76.01  ? 32   GLU D OE1   1 
ATOM 2296  O OE2   . GLU D 4 35  ? 193.547 158.422 151.353 1.00 87.34  ? 32   GLU D OE2   1 
ATOM 2297  N N     . SER D 4 36  ? 189.516 155.507 153.987 1.00 64.44  ? 33   SER D N     1 
ATOM 2298  C CA    . SER D 4 36  ? 188.895 156.173 155.111 1.00 63.15  ? 33   SER D CA    1 
ATOM 2299  C C     . SER D 4 36  ? 189.626 155.765 156.370 1.00 56.01  ? 33   SER D C     1 
ATOM 2300  O O     . SER D 4 36  ? 190.556 154.961 156.340 1.00 63.60  ? 33   SER D O     1 
ATOM 2301  C CB    . SER D 4 36  ? 187.422 155.805 155.237 1.00 57.18  ? 33   SER D CB    1 
ATOM 2302  O OG    . SER D 4 36  ? 187.300 154.435 155.560 1.00 50.24  ? 33   SER D OG    1 
ATOM 2303  N N     . TYR D 4 37  ? 189.205 156.330 157.482 1.00 52.46  ? 34   TYR D N     1 
ATOM 2304  C CA    . TYR D 4 37  ? 189.723 155.936 158.772 1.00 57.44  ? 34   TYR D CA    1 
ATOM 2305  C C     . TYR D 4 37  ? 188.800 154.983 159.500 1.00 62.32  ? 34   TYR D C     1 
ATOM 2306  O O     . TYR D 4 37  ? 189.066 154.649 160.658 1.00 54.78  ? 34   TYR D O     1 
ATOM 2307  C CB    . TYR D 4 37  ? 189.991 157.174 159.603 1.00 48.29  ? 34   TYR D CB    1 
ATOM 2308  C CG    . TYR D 4 37  ? 190.953 158.059 158.894 1.00 59.95  ? 34   TYR D CG    1 
ATOM 2309  C CD1   . TYR D 4 37  ? 192.024 157.526 158.223 1.00 58.73  ? 34   TYR D CD1   1 
ATOM 2310  C CD2   . TYR D 4 37  ? 190.770 159.416 158.852 1.00 54.29  ? 34   TYR D CD2   1 
ATOM 2311  C CE1   . TYR D 4 37  ? 192.901 158.320 157.558 1.00 58.60  ? 34   TYR D CE1   1 
ATOM 2312  C CE2   . TYR D 4 37  ? 191.644 160.219 158.186 1.00 51.69  ? 34   TYR D CE2   1 
ATOM 2313  C CZ    . TYR D 4 37  ? 192.708 159.665 157.542 1.00 63.35  ? 34   TYR D CZ    1 
ATOM 2314  O OH    . TYR D 4 37  ? 193.586 160.467 156.871 1.00 70.65  ? 34   TYR D OH    1 
ATOM 2315  N N     . ALA D 4 38  ? 187.723 154.550 158.846 1.00 61.83  ? 35   ALA D N     1 
ATOM 2316  C CA    . ALA D 4 38  ? 186.653 153.840 159.533 1.00 61.41  ? 35   ALA D CA    1 
ATOM 2317  C C     . ALA D 4 38  ? 187.188 152.739 160.432 1.00 69.85  ? 35   ALA D C     1 
ATOM 2318  O O     . ALA D 4 38  ? 186.831 152.661 161.610 1.00 75.32  ? 35   ALA D O     1 
ATOM 2319  C CB    . ALA D 4 38  ? 185.680 153.265 158.511 1.00 66.02  ? 35   ALA D CB    1 
ATOM 2320  N N     . ILE D 4 39  ? 188.065 151.891 159.903 1.00 70.38  ? 36   ILE D N     1 
ATOM 2321  C CA    . ILE D 4 39  ? 188.593 150.801 160.713 1.00 78.02  ? 36   ILE D CA    1 
ATOM 2322  C C     . ILE D 4 39  ? 189.300 151.351 161.938 1.00 71.29  ? 36   ILE D C     1 
ATOM 2323  O O     . ILE D 4 39  ? 189.094 150.878 163.060 1.00 63.95  ? 36   ILE D O     1 
ATOM 2324  C CB    . ILE D 4 39  ? 189.522 149.916 159.872 1.00 78.16  ? 36   ILE D CB    1 
ATOM 2325  C CG1   . ILE D 4 39  ? 190.717 150.712 159.376 1.00 77.61  ? 36   ILE D CG1   1 
ATOM 2326  C CG2   . ILE D 4 39  ? 188.787 149.399 158.675 1.00 94.51  ? 36   ILE D CG2   1 
ATOM 2327  C CD1   . ILE D 4 39  ? 191.755 149.868 158.715 1.00 83.14  ? 36   ILE D CD1   1 
ATOM 2328  N N     . TYR D 4 40  ? 190.115 152.380 161.746 1.00 58.09  ? 37   TYR D N     1 
ATOM 2329  C CA    . TYR D 4 40  ? 190.873 152.955 162.842 1.00 60.38  ? 37   TYR D CA    1 
ATOM 2330  C C     . TYR D 4 40  ? 189.946 153.485 163.916 1.00 66.73  ? 37   TYR D C     1 
ATOM 2331  O O     . TYR D 4 40  ? 190.035 153.102 165.092 1.00 66.22  ? 37   TYR D O     1 
ATOM 2332  C CB    . TYR D 4 40  ? 191.747 154.057 162.281 1.00 59.60  ? 37   TYR D CB    1 
ATOM 2333  C CG    . TYR D 4 40  ? 192.733 153.509 161.311 1.00 59.52  ? 37   TYR D CG    1 
ATOM 2334  C CD1   . TYR D 4 40  ? 193.640 152.564 161.708 1.00 62.67  ? 37   TYR D CD1   1 
ATOM 2335  C CD2   . TYR D 4 40  ? 192.678 153.844 159.980 1.00 49.42  ? 37   TYR D CD2   1 
ATOM 2336  C CE1   . TYR D 4 40  ? 194.529 152.042 160.841 1.00 62.78  ? 37   TYR D CE1   1 
ATOM 2337  C CE2   . TYR D 4 40  ? 193.558 153.318 159.095 1.00 55.81  ? 37   TYR D CE2   1 
ATOM 2338  C CZ    . TYR D 4 40  ? 194.482 152.408 159.533 1.00 66.52  ? 37   TYR D CZ    1 
ATOM 2339  O OH    . TYR D 4 40  ? 195.381 151.854 158.662 1.00 72.89  ? 37   TYR D OH    1 
ATOM 2340  N N     . VAL D 4 41  ? 189.028 154.360 163.514 1.00 64.28  ? 38   VAL D N     1 
ATOM 2341  C CA    . VAL D 4 41  ? 188.020 154.855 164.437 1.00 59.80  ? 38   VAL D CA    1 
ATOM 2342  C C     . VAL D 4 41  ? 187.426 153.703 165.208 1.00 54.34  ? 38   VAL D C     1 
ATOM 2343  O O     . VAL D 4 41  ? 187.354 153.720 166.440 1.00 64.51  ? 38   VAL D O     1 
ATOM 2344  C CB    . VAL D 4 41  ? 186.927 155.609 163.674 1.00 52.14  ? 38   VAL D CB    1 
ATOM 2345  C CG1   . VAL D 4 41  ? 185.817 155.934 164.611 1.00 44.39  ? 38   VAL D CG1   1 
ATOM 2346  C CG2   . VAL D 4 41  ? 187.498 156.849 163.084 1.00 40.64  ? 38   VAL D CG2   1 
ATOM 2347  N N     . TYR D 4 42  ? 187.039 152.659 164.492 1.00 53.88  ? 39   TYR D N     1 
ATOM 2348  C CA    . TYR D 4 42  ? 186.346 151.569 165.142 1.00 61.00  ? 39   TYR D CA    1 
ATOM 2349  C C     . TYR D 4 42  ? 187.218 150.931 166.209 1.00 63.34  ? 39   TYR D C     1 
ATOM 2350  O O     . TYR D 4 42  ? 186.758 150.676 167.327 1.00 67.43  ? 39   TYR D O     1 
ATOM 2351  C CB    . TYR D 4 42  ? 185.904 150.546 164.114 1.00 59.76  ? 39   TYR D CB    1 
ATOM 2352  C CG    . TYR D 4 42  ? 185.232 149.424 164.792 1.00 72.22  ? 39   TYR D CG    1 
ATOM 2353  C CD1   . TYR D 4 42  ? 183.960 149.570 165.288 1.00 70.05  ? 39   TYR D CD1   1 
ATOM 2354  C CD2   . TYR D 4 42  ? 185.879 148.227 164.980 1.00 88.62  ? 39   TYR D CD2   1 
ATOM 2355  C CE1   . TYR D 4 42  ? 183.339 148.550 165.937 1.00 83.09  ? 39   TYR D CE1   1 
ATOM 2356  C CE2   . TYR D 4 42  ? 185.267 147.196 165.625 1.00 92.80  ? 39   TYR D CE2   1 
ATOM 2357  C CZ    . TYR D 4 42  ? 183.996 147.363 166.105 1.00 94.93  ? 39   TYR D CZ    1 
ATOM 2358  O OH    . TYR D 4 42  ? 183.378 146.327 166.750 1.00 98.85  ? 39   TYR D OH    1 
ATOM 2359  N N     . LYS D 4 43  ? 188.486 150.679 165.892 1.00 62.91  ? 40   LYS D N     1 
ATOM 2360  C CA    . LYS D 4 43  ? 189.384 150.175 166.920 1.00 63.48  ? 40   LYS D CA    1 
ATOM 2361  C C     . LYS D 4 43  ? 189.340 151.059 168.149 1.00 67.50  ? 40   LYS D C     1 
ATOM 2362  O O     . LYS D 4 43  ? 189.119 150.580 169.266 1.00 70.78  ? 40   LYS D O     1 
ATOM 2363  C CB    . LYS D 4 43  ? 190.814 150.082 166.411 1.00 51.67  ? 40   LYS D CB    1 
ATOM 2364  C CG    . LYS D 4 43  ? 191.089 148.957 165.468 1.00 63.91  ? 40   LYS D CG    1 
ATOM 2365  C CD    . LYS D 4 43  ? 192.556 148.976 165.114 1.00 77.34  ? 40   LYS D CD    1 
ATOM 2366  C CE    . LYS D 4 43  ? 192.931 147.820 164.231 1.00 85.61  ? 40   LYS D CE    1 
ATOM 2367  N NZ    . LYS D 4 43  ? 194.376 147.865 163.904 1.00 92.22  ? 40   LYS D NZ    1 
ATOM 2368  N N     . VAL D 4 44  ? 189.530 152.363 167.958 1.00 61.27  ? 41   VAL D N     1 
ATOM 2369  C CA    . VAL D 4 44  ? 189.556 153.264 169.105 1.00 56.23  ? 41   VAL D CA    1 
ATOM 2370  C C     . VAL D 4 44  ? 188.289 153.105 169.926 1.00 61.40  ? 41   VAL D C     1 
ATOM 2371  O O     . VAL D 4 44  ? 188.323 153.012 171.161 1.00 70.68  ? 41   VAL D O     1 
ATOM 2372  C CB    . VAL D 4 44  ? 189.736 154.713 168.638 1.00 52.01  ? 41   VAL D CB    1 
ATOM 2373  C CG1   . VAL D 4 44  ? 189.650 155.636 169.814 1.00 40.01  ? 41   VAL D CG1   1 
ATOM 2374  C CG2   . VAL D 4 44  ? 191.058 154.859 167.955 1.00 41.37  ? 41   VAL D CG2   1 
ATOM 2375  N N     . LEU D 4 45  ? 187.152 153.060 169.243 1.00 54.97  ? 42   LEU D N     1 
ATOM 2376  C CA    . LEU D 4 45  ? 185.891 152.848 169.929 1.00 57.13  ? 42   LEU D CA    1 
ATOM 2377  C C     . LEU D 4 45  ? 185.966 151.625 170.815 1.00 62.44  ? 42   LEU D C     1 
ATOM 2378  O O     . LEU D 4 45  ? 185.712 151.700 172.020 1.00 62.13  ? 42   LEU D O     1 
ATOM 2379  C CB    . LEU D 4 45  ? 184.775 152.701 168.913 1.00 43.32  ? 42   LEU D CB    1 
ATOM 2380  C CG    . LEU D 4 45  ? 183.450 152.360 169.551 1.00 45.09  ? 42   LEU D CG    1 
ATOM 2381  C CD1   . LEU D 4 45  ? 183.109 153.429 170.539 1.00 42.18  ? 42   LEU D CD1   1 
ATOM 2382  C CD2   . LEU D 4 45  ? 182.410 152.301 168.471 1.00 40.17  ? 42   LEU D CD2   1 
ATOM 2383  N N     . LYS D 4 46  ? 186.358 150.492 170.242 1.00 60.82  ? 43   LYS D N     1 
ATOM 2384  C CA    . LYS D 4 46  ? 186.452 149.285 171.047 1.00 66.82  ? 43   LYS D CA    1 
ATOM 2385  C C     . LYS D 4 46  ? 187.500 149.388 172.137 1.00 73.46  ? 43   LYS D C     1 
ATOM 2386  O O     . LYS D 4 46  ? 187.513 148.552 173.043 1.00 74.16  ? 43   LYS D O     1 
ATOM 2387  C CB    . LYS D 4 46  ? 186.710 148.077 170.160 1.00 62.61  ? 43   LYS D CB    1 
ATOM 2388  C CG    . LYS D 4 46  ? 185.499 147.747 169.336 1.00 72.68  ? 43   LYS D CG    1 
ATOM 2389  C CD    . LYS D 4 46  ? 184.359 147.530 170.306 1.00 78.63  ? 43   LYS D CD    1 
ATOM 2390  C CE    . LYS D 4 46  ? 183.079 147.121 169.629 1.00 76.10  ? 43   LYS D CE    1 
ATOM 2391  N NZ    . LYS D 4 46  ? 181.977 146.937 170.615 1.00 73.02  ? 43   LYS D NZ    1 
ATOM 2392  N N     . GLN D 4 47  ? 188.363 150.392 172.093 1.00 70.14  ? 44   GLN D N     1 
ATOM 2393  C CA    . GLN D 4 47  ? 189.232 150.595 173.239 1.00 58.75  ? 44   GLN D CA    1 
ATOM 2394  C C     . GLN D 4 47  ? 188.513 151.355 174.342 1.00 62.81  ? 44   GLN D C     1 
ATOM 2395  O O     . GLN D 4 47  ? 188.696 151.058 175.524 1.00 75.00  ? 44   GLN D O     1 
ATOM 2396  C CB    . GLN D 4 47  ? 190.497 151.317 172.813 1.00 59.18  ? 44   GLN D CB    1 
ATOM 2397  C CG    . GLN D 4 47  ? 191.302 150.502 171.845 1.00 74.99  ? 44   GLN D CG    1 
ATOM 2398  C CD    . GLN D 4 47  ? 192.522 151.228 171.348 1.00 97.34  ? 44   GLN D CD    1 
ATOM 2399  O OE1   . GLN D 4 47  ? 192.606 152.453 171.423 1.00 95.56  ? 44   GLN D OE1   1 
ATOM 2400  N NE2   . GLN D 4 47  ? 193.468 150.478 170.804 1.00 106.25 ? 44   GLN D NE2   1 
ATOM 2401  N N     . VAL D 4 48  ? 187.706 152.350 173.987 1.00 56.89  ? 45   VAL D N     1 
ATOM 2402  C CA    . VAL D 4 48  ? 187.034 153.116 175.031 1.00 56.58  ? 45   VAL D CA    1 
ATOM 2403  C C     . VAL D 4 48  ? 185.783 152.406 175.533 1.00 55.02  ? 45   VAL D C     1 
ATOM 2404  O O     . VAL D 4 48  ? 185.574 152.278 176.742 1.00 51.41  ? 45   VAL D O     1 
ATOM 2405  C CB    . VAL D 4 48  ? 186.716 154.529 174.539 1.00 45.76  ? 45   VAL D CB    1 
ATOM 2406  C CG1   . VAL D 4 48  ? 185.882 155.240 175.568 1.00 40.37  ? 45   VAL D CG1   1 
ATOM 2407  C CG2   . VAL D 4 48  ? 187.999 155.266 174.316 1.00 45.34  ? 45   VAL D CG2   1 
ATOM 2408  N N     . HIS D 4 49  ? 184.923 151.949 174.629 1.00 56.43  ? 46   HIS D N     1 
ATOM 2409  C CA    . HIS D 4 49  ? 183.677 151.285 175.009 1.00 50.52  ? 46   HIS D CA    1 
ATOM 2410  C C     . HIS D 4 49  ? 183.580 149.953 174.291 1.00 63.53  ? 46   HIS D C     1 
ATOM 2411  O O     . HIS D 4 49  ? 183.065 149.876 173.170 1.00 70.30  ? 46   HIS D O     1 
ATOM 2412  C CB    . HIS D 4 49  ? 182.463 152.139 174.689 1.00 43.54  ? 46   HIS D CB    1 
ATOM 2413  C CG    . HIS D 4 49  ? 182.456 153.446 175.395 1.00 52.97  ? 46   HIS D CG    1 
ATOM 2414  N ND1   . HIS D 4 49  ? 182.425 153.542 176.766 1.00 55.86  ? 46   HIS D ND1   1 
ATOM 2415  C CD2   . HIS D 4 49  ? 182.431 154.712 174.925 1.00 67.62  ? 46   HIS D CD2   1 
ATOM 2416  C CE1   . HIS D 4 49  ? 182.412 154.815 177.114 1.00 54.97  ? 46   HIS D CE1   1 
ATOM 2417  N NE2   . HIS D 4 49  ? 182.410 155.546 176.015 1.00 65.38  ? 46   HIS D NE2   1 
ATOM 2418  N N     . PRO D 4 50  ? 184.040 148.881 174.917 1.00 63.84  ? 47   PRO D N     1 
ATOM 2419  C CA    . PRO D 4 50  ? 184.136 147.605 174.196 1.00 59.11  ? 47   PRO D CA    1 
ATOM 2420  C C     . PRO D 4 50  ? 182.822 147.141 173.600 1.00 62.23  ? 47   PRO D C     1 
ATOM 2421  O O     . PRO D 4 50  ? 182.812 146.310 172.689 1.00 69.94  ? 47   PRO D O     1 
ATOM 2422  C CB    . PRO D 4 50  ? 184.633 146.650 175.285 1.00 53.50  ? 47   PRO D CB    1 
ATOM 2423  C CG    . PRO D 4 50  ? 185.317 147.531 176.269 1.00 49.52  ? 47   PRO D CG    1 
ATOM 2424  C CD    . PRO D 4 50  ? 184.494 148.766 176.307 1.00 49.11  ? 47   PRO D CD    1 
ATOM 2425  N N     . ASP D 4 51  ? 181.707 147.638 174.110 1.00 61.00  ? 48   ASP D N     1 
ATOM 2426  C CA    . ASP D 4 51  ? 180.415 147.058 173.802 1.00 83.08  ? 48   ASP D CA    1 
ATOM 2427  C C     . ASP D 4 51  ? 179.629 147.815 172.749 1.00 82.00  ? 48   ASP D C     1 
ATOM 2428  O O     . ASP D 4 51  ? 178.549 147.363 172.365 1.00 89.06  ? 48   ASP D O     1 
ATOM 2429  C CB    . ASP D 4 51  ? 179.604 146.982 175.082 1.00 107.41 ? 48   ASP D CB    1 
ATOM 2430  C CG    . ASP D 4 51  ? 180.319 146.213 176.149 1.00 115.09 ? 48   ASP D CG    1 
ATOM 2431  O OD1   . ASP D 4 51  ? 181.321 145.546 175.817 1.00 109.76 ? 48   ASP D OD1   1 
ATOM 2432  O OD2   . ASP D 4 51  ? 179.893 146.282 177.317 1.00 114.38 ? 48   ASP D OD2   1 
ATOM 2433  N N     . THR D 4 52  ? 180.125 148.944 172.271 1.00 69.10  ? 49   THR D N     1 
ATOM 2434  C CA    . THR D 4 52  ? 179.254 149.896 171.604 1.00 54.62  ? 49   THR D CA    1 
ATOM 2435  C C     . THR D 4 52  ? 179.406 149.820 170.098 1.00 57.90  ? 49   THR D C     1 
ATOM 2436  O O     . THR D 4 52  ? 180.504 149.999 169.570 1.00 65.85  ? 49   THR D O     1 
ATOM 2437  C CB    . THR D 4 52  ? 179.556 151.303 172.081 1.00 57.21  ? 49   THR D CB    1 
ATOM 2438  O OG1   . THR D 4 52  ? 179.287 151.388 173.483 1.00 54.50  ? 49   THR D OG1   1 
ATOM 2439  C CG2   . THR D 4 52  ? 178.691 152.279 171.347 1.00 52.21  ? 49   THR D CG2   1 
ATOM 2440  N N     . GLY D 4 53  ? 178.308 149.571 169.410 1.00 45.06  ? 50   GLY D N     1 
ATOM 2441  C CA    . GLY D 4 53  ? 178.304 149.679 167.972 1.00 51.16  ? 50   GLY D CA    1 
ATOM 2442  C C     . GLY D 4 53  ? 178.249 151.124 167.541 1.00 60.46  ? 50   GLY D C     1 
ATOM 2443  O O     . GLY D 4 53  ? 177.913 152.025 168.307 1.00 70.53  ? 50   GLY D O     1 
ATOM 2444  N N     . ILE D 4 54  ? 178.601 151.358 166.283 1.00 44.24  ? 51   ILE D N     1 
ATOM 2445  C CA    . ILE D 4 54  ? 178.625 152.706 165.739 1.00 50.62  ? 51   ILE D CA    1 
ATOM 2446  C C     . ILE D 4 54  ? 177.986 152.679 164.362 1.00 54.44  ? 51   ILE D C     1 
ATOM 2447  O O     . ILE D 4 54  ? 178.491 152.018 163.451 1.00 56.34  ? 51   ILE D O     1 
ATOM 2448  C CB    . ILE D 4 54  ? 180.055 153.258 165.683 1.00 48.92  ? 51   ILE D CB    1 
ATOM 2449  C CG1   . ILE D 4 54  ? 180.081 154.626 165.036 1.00 54.12  ? 51   ILE D CG1   1 
ATOM 2450  C CG2   . ILE D 4 54  ? 180.986 152.303 165.000 1.00 39.66  ? 51   ILE D CG2   1 
ATOM 2451  C CD1   . ILE D 4 54  ? 181.425 155.284 165.127 1.00 50.57  ? 51   ILE D CD1   1 
ATOM 2452  N N     . SER D 4 55  ? 176.882 153.388 164.205 1.00 56.58  ? 52   SER D N     1 
ATOM 2453  C CA    . SER D 4 55  ? 176.136 153.274 162.969 1.00 45.73  ? 52   SER D CA    1 
ATOM 2454  C C     . SER D 4 55  ? 176.919 153.875 161.816 1.00 50.42  ? 52   SER D C     1 
ATOM 2455  O O     . SER D 4 55  ? 177.747 154.767 161.991 1.00 45.51  ? 52   SER D O     1 
ATOM 2456  C CB    . SER D 4 55  ? 174.786 153.960 163.092 1.00 50.91  ? 52   SER D CB    1 
ATOM 2457  O OG    . SER D 4 55  ? 174.957 155.335 163.344 1.00 50.17  ? 52   SER D OG    1 
ATOM 2458  N N     . SER D 4 56  ? 176.621 153.385 160.615 1.00 46.00  ? 53   SER D N     1 
ATOM 2459  C CA    . SER D 4 56  ? 177.415 153.727 159.442 1.00 52.93  ? 53   SER D CA    1 
ATOM 2460  C C     . SER D 4 56  ? 177.519 155.228 159.253 1.00 57.65  ? 53   SER D C     1 
ATOM 2461  O O     . SER D 4 56  ? 178.618 155.787 159.206 1.00 59.62  ? 53   SER D O     1 
ATOM 2462  C CB    . SER D 4 56  ? 176.800 153.098 158.203 1.00 51.68  ? 53   SER D CB    1 
ATOM 2463  O OG    . SER D 4 56  ? 177.482 153.552 157.055 1.00 72.59  ? 53   SER D OG    1 
ATOM 2464  N N     . LYS D 4 57  ? 176.378 155.896 159.119 1.00 48.51  ? 54   LYS D N     1 
ATOM 2465  C CA    . LYS D 4 57  ? 176.394 157.342 158.976 1.00 46.99  ? 54   LYS D CA    1 
ATOM 2466  C C     . LYS D 4 57  ? 177.244 157.961 160.072 1.00 46.96  ? 54   LYS D C     1 
ATOM 2467  O O     . LYS D 4 57  ? 178.194 158.708 159.803 1.00 59.80  ? 54   LYS D O     1 
ATOM 2468  C CB    . LYS D 4 57  ? 174.965 157.872 159.023 1.00 52.86  ? 54   LYS D CB    1 
ATOM 2469  N N     . ALA D 4 58  ? 176.970 157.586 161.314 1.00 52.04  ? 55   ALA D N     1 
ATOM 2470  C CA    . ALA D 4 58  ? 177.740 158.110 162.423 1.00 49.34  ? 55   ALA D CA    1 
ATOM 2471  C C     . ALA D 4 58  ? 179.206 157.758 162.329 1.00 49.26  ? 55   ALA D C     1 
ATOM 2472  O O     . ALA D 4 58  ? 180.006 158.330 163.069 1.00 59.10  ? 55   ALA D O     1 
ATOM 2473  C CB    . ALA D 4 58  ? 177.180 157.598 163.738 1.00 40.22  ? 55   ALA D CB    1 
ATOM 2474  N N     . MET D 4 59  ? 179.583 156.819 161.473 1.00 49.49  ? 56   MET D N     1 
ATOM 2475  C CA    . MET D 4 59  ? 180.992 156.699 161.143 1.00 53.59  ? 56   MET D CA    1 
ATOM 2476  C C     . MET D 4 59  ? 181.397 157.761 160.145 1.00 51.58  ? 56   MET D C     1 
ATOM 2477  O O     . MET D 4 59  ? 182.418 158.430 160.322 1.00 57.25  ? 56   MET D O     1 
ATOM 2478  C CB    . MET D 4 59  ? 181.305 155.320 160.584 1.00 48.08  ? 56   MET D CB    1 
ATOM 2479  C CG    . MET D 4 59  ? 182.732 155.184 160.150 1.00 39.47  ? 56   MET D CG    1 
ATOM 2480  S SD    . MET D 4 59  ? 183.832 155.354 161.542 1.00 64.69  ? 56   MET D SD    1 
ATOM 2481  C CE    . MET D 4 59  ? 183.525 153.802 162.352 1.00 51.80  ? 56   MET D CE    1 
ATOM 2482  N N     . SER D 4 60  ? 180.598 157.934 159.092 1.00 49.80  ? 57   SER D N     1 
ATOM 2483  C CA    . SER D 4 60  ? 180.936 158.912 158.069 1.00 51.60  ? 57   SER D CA    1 
ATOM 2484  C C     . SER D 4 60  ? 181.233 160.261 158.681 1.00 55.03  ? 57   SER D C     1 
ATOM 2485  O O     . SER D 4 60  ? 182.132 160.977 158.225 1.00 47.42  ? 57   SER D O     1 
ATOM 2486  C CB    . SER D 4 60  ? 179.805 159.041 157.064 1.00 34.87  ? 57   SER D CB    1 
ATOM 2487  O OG    . SER D 4 60  ? 180.101 160.078 156.158 1.00 64.55  ? 57   SER D OG    1 
ATOM 2488  N N     . ILE D 4 61  ? 180.503 160.622 159.726 1.00 39.36  ? 58   ILE D N     1 
ATOM 2489  C CA    . ILE D 4 61  ? 180.856 161.834 160.441 1.00 43.75  ? 58   ILE D CA    1 
ATOM 2490  C C     . ILE D 4 61  ? 182.295 161.740 160.898 1.00 47.11  ? 58   ILE D C     1 
ATOM 2491  O O     . ILE D 4 61  ? 183.156 162.421 160.344 1.00 47.11  ? 58   ILE D O     1 
ATOM 2492  C CB    . ILE D 4 61  ? 179.925 162.102 161.622 1.00 46.10  ? 58   ILE D CB    1 
ATOM 2493  C CG1   . ILE D 4 61  ? 178.577 162.548 161.099 1.00 37.45  ? 58   ILE D CG1   1 
ATOM 2494  C CG2   . ILE D 4 61  ? 180.499 163.159 162.503 1.00 32.65  ? 58   ILE D CG2   1 
ATOM 2495  C CD1   . ILE D 4 61  ? 177.558 162.654 162.162 1.00 49.96  ? 58   ILE D CD1   1 
ATOM 2496  N N     . MET D 4 62  ? 182.578 160.868 161.866 1.00 42.31  ? 59   MET D N     1 
ATOM 2497  C CA    . MET D 4 62  ? 183.911 160.840 162.450 1.00 39.96  ? 59   MET D CA    1 
ATOM 2498  C C     . MET D 4 62  ? 184.989 160.834 161.390 1.00 50.82  ? 59   MET D C     1 
ATOM 2499  O O     . MET D 4 62  ? 186.020 161.493 161.545 1.00 52.69  ? 59   MET D O     1 
ATOM 2500  C CB    . MET D 4 62  ? 184.071 159.634 163.348 1.00 37.21  ? 59   MET D CB    1 
ATOM 2501  C CG    . MET D 4 62  ? 183.225 159.732 164.551 1.00 38.11  ? 59   MET D CG    1 
ATOM 2502  S SD    . MET D 4 62  ? 183.648 161.251 165.372 1.00 53.95  ? 59   MET D SD    1 
ATOM 2503  C CE    . MET D 4 62  ? 185.341 160.896 165.780 1.00 51.56  ? 59   MET D CE    1 
ATOM 2504  N N     . ASN D 4 63  ? 184.762 160.125 160.299 1.00 45.70  ? 60   ASN D N     1 
ATOM 2505  C CA    . ASN D 4 63  ? 185.639 160.240 159.151 1.00 42.06  ? 60   ASN D CA    1 
ATOM 2506  C C     . ASN D 4 63  ? 185.841 161.692 158.751 1.00 53.69  ? 60   ASN D C     1 
ATOM 2507  O O     . ASN D 4 63  ? 186.931 162.250 158.941 1.00 60.95  ? 60   ASN D O     1 
ATOM 2508  C CB    . ASN D 4 63  ? 185.065 159.458 157.987 1.00 38.94  ? 60   ASN D CB    1 
ATOM 2509  C CG    . ASN D 4 63  ? 185.957 159.480 156.807 1.00 59.20  ? 60   ASN D CG    1 
ATOM 2510  O OD1   . ASN D 4 63  ? 187.165 159.607 156.943 1.00 69.10  ? 60   ASN D OD1   1 
ATOM 2511  N ND2   . ASN D 4 63  ? 185.377 159.362 155.626 1.00 51.14  ? 60   ASN D ND2   1 
ATOM 2512  N N     . SER D 4 64  ? 184.789 162.317 158.216 1.00 41.95  ? 61   SER D N     1 
ATOM 2513  C CA    . SER D 4 64  ? 184.940 163.675 157.717 1.00 44.52  ? 61   SER D CA    1 
ATOM 2514  C C     . SER D 4 64  ? 185.543 164.579 158.762 1.00 45.48  ? 61   SER D C     1 
ATOM 2515  O O     . SER D 4 64  ? 186.355 165.447 158.439 1.00 49.65  ? 61   SER D O     1 
ATOM 2516  C CB    . SER D 4 64  ? 183.602 164.231 157.267 1.00 49.66  ? 61   SER D CB    1 
ATOM 2517  O OG    . SER D 4 64  ? 183.133 163.522 156.141 1.00 75.35  ? 61   SER D OG    1 
ATOM 2518  N N     . PHE D 4 65  ? 185.178 164.376 160.019 1.00 42.24  ? 62   PHE D N     1 
ATOM 2519  C CA    . PHE D 4 65  ? 185.802 165.107 161.104 1.00 38.40  ? 62   PHE D CA    1 
ATOM 2520  C C     . PHE D 4 65  ? 187.310 164.978 161.049 1.00 48.39  ? 62   PHE D C     1 
ATOM 2521  O O     . PHE D 4 65  ? 188.029 165.970 160.900 1.00 47.80  ? 62   PHE D O     1 
ATOM 2522  C CB    . PHE D 4 65  ? 185.282 164.602 162.432 1.00 39.55  ? 62   PHE D CB    1 
ATOM 2523  C CG    . PHE D 4 65  ? 185.986 165.175 163.588 1.00 52.45  ? 62   PHE D CG    1 
ATOM 2524  C CD1   . PHE D 4 65  ? 185.680 166.426 164.037 1.00 53.62  ? 62   PHE D CD1   1 
ATOM 2525  C CD2   . PHE D 4 65  ? 186.958 164.461 164.230 1.00 45.05  ? 62   PHE D CD2   1 
ATOM 2526  C CE1   . PHE D 4 65  ? 186.332 166.953 165.109 1.00 56.51  ? 62   PHE D CE1   1 
ATOM 2527  C CE2   . PHE D 4 65  ? 187.610 164.983 165.302 1.00 52.87  ? 62   PHE D CE2   1 
ATOM 2528  C CZ    . PHE D 4 65  ? 187.300 166.230 165.741 1.00 52.85  ? 62   PHE D CZ    1 
ATOM 2529  N N     . VAL D 4 66  ? 187.813 163.756 161.184 1.00 40.58  ? 63   VAL D N     1 
ATOM 2530  C CA    . VAL D 4 66  ? 189.257 163.591 161.247 1.00 42.73  ? 63   VAL D CA    1 
ATOM 2531  C C     . VAL D 4 66  ? 189.924 164.224 160.045 1.00 47.17  ? 63   VAL D C     1 
ATOM 2532  O O     . VAL D 4 66  ? 190.922 164.937 160.184 1.00 58.54  ? 63   VAL D O     1 
ATOM 2533  C CB    . VAL D 4 66  ? 189.632 162.115 161.375 1.00 50.88  ? 63   VAL D CB    1 
ATOM 2534  C CG1   . VAL D 4 66  ? 191.108 161.990 161.269 1.00 41.75  ? 63   VAL D CG1   1 
ATOM 2535  C CG2   . VAL D 4 66  ? 189.190 161.619 162.702 1.00 33.99  ? 63   VAL D CG2   1 
ATOM 2536  N N     . ASN D 4 67  ? 189.381 164.007 158.848 1.00 43.15  ? 64   ASN D N     1 
ATOM 2537  C CA    . ASN D 4 67  ? 189.965 164.703 157.707 1.00 52.00  ? 64   ASN D CA    1 
ATOM 2538  C C     . ASN D 4 67  ? 190.003 166.200 157.944 1.00 53.49  ? 64   ASN D C     1 
ATOM 2539  O O     . ASN D 4 67  ? 190.986 166.864 157.604 1.00 44.42  ? 64   ASN D O     1 
ATOM 2540  C CB    . ASN D 4 67  ? 189.214 164.398 156.421 1.00 46.20  ? 64   ASN D CB    1 
ATOM 2541  C CG    . ASN D 4 67  ? 189.624 163.087 155.820 1.00 66.71  ? 64   ASN D CG    1 
ATOM 2542  O OD1   . ASN D 4 67  ? 190.712 162.969 155.270 1.00 73.87  ? 64   ASN D OD1   1 
ATOM 2543  N ND2   . ASN D 4 67  ? 188.754 162.096 155.899 1.00 74.99  ? 64   ASN D ND2   1 
ATOM 2544  N N     . ASP D 4 68  ? 188.960 166.747 158.556 1.00 48.65  ? 65   ASP D N     1 
ATOM 2545  C CA    . ASP D 4 68  ? 188.948 168.179 158.807 1.00 44.02  ? 65   ASP D CA    1 
ATOM 2546  C C     . ASP D 4 68  ? 190.094 168.577 159.714 1.00 54.76  ? 65   ASP D C     1 
ATOM 2547  O O     . ASP D 4 68  ? 190.967 169.360 159.325 1.00 57.40  ? 65   ASP D O     1 
ATOM 2548  C CB    . ASP D 4 68  ? 187.623 168.591 159.424 1.00 33.97  ? 65   ASP D CB    1 
ATOM 2549  C CG    . ASP D 4 68  ? 187.535 170.067 159.660 1.00 56.66  ? 65   ASP D CG    1 
ATOM 2550  O OD1   . ASP D 4 68  ? 188.451 170.793 159.237 1.00 75.22  ? 65   ASP D OD1   1 
ATOM 2551  O OD2   . ASP D 4 68  ? 186.549 170.512 160.279 1.00 55.93  ? 65   ASP D OD2   1 
ATOM 2552  N N     . VAL D 4 69  ? 190.119 168.033 160.928 1.00 49.36  ? 66   VAL D N     1 
ATOM 2553  C CA    . VAL D 4 69  ? 191.148 168.444 161.874 1.00 50.46  ? 66   VAL D CA    1 
ATOM 2554  C C     . VAL D 4 69  ? 192.519 168.269 161.267 1.00 57.77  ? 66   VAL D C     1 
ATOM 2555  O O     . VAL D 4 69  ? 193.422 169.088 161.481 1.00 50.48  ? 66   VAL D O     1 
ATOM 2556  C CB    . VAL D 4 69  ? 191.014 167.661 163.181 1.00 40.07  ? 66   VAL D CB    1 
ATOM 2557  C CG1   . VAL D 4 69  ? 192.169 167.966 164.074 1.00 34.24  ? 66   VAL D CG1   1 
ATOM 2558  C CG2   . VAL D 4 69  ? 189.743 168.042 163.855 1.00 37.53  ? 66   VAL D CG2   1 
ATOM 2559  N N     . PHE D 4 70  ? 192.689 167.230 160.465 1.00 49.52  ? 67   PHE D N     1 
ATOM 2560  C CA    . PHE D 4 70  ? 193.952 167.047 159.777 1.00 42.89  ? 67   PHE D CA    1 
ATOM 2561  C C     . PHE D 4 70  ? 194.253 168.227 158.873 1.00 51.63  ? 67   PHE D C     1 
ATOM 2562  O O     . PHE D 4 70  ? 195.338 168.808 158.941 1.00 67.29  ? 67   PHE D O     1 
ATOM 2563  C CB    . PHE D 4 70  ? 193.917 165.755 158.985 1.00 39.88  ? 67   PHE D CB    1 
ATOM 2564  C CG    . PHE D 4 70  ? 195.111 165.542 158.153 1.00 52.84  ? 67   PHE D CG    1 
ATOM 2565  C CD1   . PHE D 4 70  ? 196.277 165.109 158.712 1.00 59.60  ? 67   PHE D CD1   1 
ATOM 2566  C CD2   . PHE D 4 70  ? 195.062 165.757 156.803 1.00 47.55  ? 67   PHE D CD2   1 
ATOM 2567  C CE1   . PHE D 4 70  ? 197.376 164.905 157.942 1.00 60.30  ? 67   PHE D CE1   1 
ATOM 2568  C CE2   . PHE D 4 70  ? 196.159 165.549 156.031 1.00 41.02  ? 67   PHE D CE2   1 
ATOM 2569  C CZ    . PHE D 4 70  ? 197.319 165.122 156.601 1.00 49.00  ? 67   PHE D CZ    1 
ATOM 2570  N N     . GLU D 4 71  ? 193.300 168.613 158.028 1.00 41.51  ? 68   GLU D N     1 
ATOM 2571  C CA    . GLU D 4 71  ? 193.565 169.726 157.129 1.00 54.29  ? 68   GLU D CA    1 
ATOM 2572  C C     . GLU D 4 71  ? 193.903 170.987 157.894 1.00 53.22  ? 68   GLU D C     1 
ATOM 2573  O O     . GLU D 4 71  ? 194.773 171.754 157.475 1.00 55.13  ? 68   GLU D O     1 
ATOM 2574  C CB    . GLU D 4 71  ? 192.383 169.973 156.204 1.00 63.52  ? 68   GLU D CB    1 
ATOM 2575  C CG    . GLU D 4 71  ? 192.204 168.891 155.166 1.00 89.45  ? 68   GLU D CG    1 
ATOM 2576  C CD    . GLU D 4 71  ? 191.034 169.153 154.236 1.00 109.26 ? 68   GLU D CD    1 
ATOM 2577  O OE1   . GLU D 4 71  ? 190.254 170.088 154.508 1.00 107.98 ? 68   GLU D OE1   1 
ATOM 2578  O OE2   . GLU D 4 71  ? 190.894 168.428 153.229 1.00 117.04 ? 68   GLU D OE2   1 
ATOM 2579  N N     . ARG D 4 72  ? 193.247 171.222 159.026 1.00 31.86  ? 69   ARG D N     1 
ATOM 2580  C CA    . ARG D 4 72  ? 193.586 172.415 159.788 1.00 35.79  ? 69   ARG D CA    1 
ATOM 2581  C C     . ARG D 4 72  ? 195.009 172.341 160.297 1.00 51.96  ? 69   ARG D C     1 
ATOM 2582  O O     . ARG D 4 72  ? 195.811 173.250 160.067 1.00 56.04  ? 69   ARG D O     1 
ATOM 2583  C CB    . ARG D 4 72  ? 192.638 172.612 160.954 1.00 32.76  ? 69   ARG D CB    1 
ATOM 2584  C CG    . ARG D 4 72  ? 191.247 172.950 160.566 1.00 35.52  ? 69   ARG D CG    1 
ATOM 2585  C CD    . ARG D 4 72  ? 190.462 173.213 161.814 1.00 42.34  ? 69   ARG D CD    1 
ATOM 2586  N NE    . ARG D 4 72  ? 189.042 173.345 161.549 1.00 51.79  ? 69   ARG D NE    1 
ATOM 2587  C CZ    . ARG D 4 72  ? 188.129 173.448 162.502 1.00 53.25  ? 69   ARG D CZ    1 
ATOM 2588  N NH1   . ARG D 4 72  ? 188.503 173.443 163.769 1.00 53.39  ? 69   ARG D NH1   1 
ATOM 2589  N NH2   . ARG D 4 72  ? 186.847 173.553 162.190 1.00 57.76  ? 69   ARG D NH2   1 
ATOM 2590  N N     . ILE D 4 73  ? 195.348 171.261 160.992 1.00 37.64  ? 70   ILE D N     1 
ATOM 2591  C CA    . ILE D 4 73  ? 196.650 171.207 161.643 1.00 47.17  ? 70   ILE D CA    1 
ATOM 2592  C C     . ILE D 4 73  ? 197.760 171.255 160.613 1.00 47.51  ? 70   ILE D C     1 
ATOM 2593  O O     . ILE D 4 73  ? 198.744 171.983 160.769 1.00 55.25  ? 70   ILE D O     1 
ATOM 2594  C CB    . ILE D 4 73  ? 196.763 169.962 162.519 1.00 47.43  ? 70   ILE D CB    1 
ATOM 2595  C CG1   . ILE D 4 73  ? 195.741 170.042 163.627 1.00 44.21  ? 70   ILE D CG1   1 
ATOM 2596  C CG2   . ILE D 4 73  ? 198.114 169.916 163.120 1.00 42.84  ? 70   ILE D CG2   1 
ATOM 2597  C CD1   . ILE D 4 73  ? 195.631 168.786 164.387 1.00 35.34  ? 70   ILE D CD1   1 
ATOM 2598  N N     . ALA D 4 74  ? 197.619 170.487 159.542 1.00 38.57  ? 71   ALA D N     1 
ATOM 2599  C CA    . ALA D 4 74  ? 198.581 170.591 158.460 1.00 48.91  ? 71   ALA D CA    1 
ATOM 2600  C C     . ALA D 4 74  ? 198.686 172.026 157.980 1.00 58.67  ? 71   ALA D C     1 
ATOM 2601  O O     . ALA D 4 74  ? 199.774 172.608 157.970 1.00 62.05  ? 71   ALA D O     1 
ATOM 2602  C CB    . ALA D 4 74  ? 198.189 169.669 157.314 1.00 37.49  ? 71   ALA D CB    1 
ATOM 2603  N N     . GLY D 4 75  ? 197.554 172.627 157.614 1.00 50.72  ? 72   GLY D N     1 
ATOM 2604  C CA    . GLY D 4 75  ? 197.584 173.994 157.127 1.00 33.69  ? 72   GLY D CA    1 
ATOM 2605  C C     . GLY D 4 75  ? 198.377 174.910 158.030 1.00 50.75  ? 72   GLY D C     1 
ATOM 2606  O O     . GLY D 4 75  ? 199.208 175.693 157.567 1.00 51.03  ? 72   GLY D O     1 
ATOM 2607  N N     . GLU D 4 76  ? 198.179 174.786 159.335 1.00 51.66  ? 73   GLU D N     1 
ATOM 2608  C CA    . GLU D 4 76  ? 198.948 175.613 160.249 1.00 43.40  ? 73   GLU D CA    1 
ATOM 2609  C C     . GLU D 4 76  ? 200.422 175.279 160.197 1.00 49.20  ? 73   GLU D C     1 
ATOM 2610  O O     . GLU D 4 76  ? 201.265 176.176 160.266 1.00 64.17  ? 73   GLU D O     1 
ATOM 2611  C CB    . GLU D 4 76  ? 198.429 175.459 161.661 1.00 53.41  ? 73   GLU D CB    1 
ATOM 2612  C CG    . GLU D 4 76  ? 197.098 176.064 161.803 1.00 68.07  ? 73   GLU D CG    1 
ATOM 2613  C CD    . GLU D 4 76  ? 197.137 177.504 161.412 1.00 88.54  ? 73   GLU D CD    1 
ATOM 2614  O OE1   . GLU D 4 76  ? 198.119 178.184 161.767 1.00 84.12  ? 73   GLU D OE1   1 
ATOM 2615  O OE2   . GLU D 4 76  ? 196.197 177.952 160.732 1.00 96.06  ? 73   GLU D OE2   1 
ATOM 2616  N N     . ALA D 4 77  ? 200.763 174.000 160.105 1.00 44.70  ? 74   ALA D N     1 
ATOM 2617  C CA    . ALA D 4 77  ? 202.171 173.657 159.990 1.00 56.39  ? 74   ALA D CA    1 
ATOM 2618  C C     . ALA D 4 77  ? 202.782 174.349 158.789 1.00 60.41  ? 74   ALA D C     1 
ATOM 2619  O O     . ALA D 4 77  ? 203.857 174.947 158.878 1.00 61.91  ? 74   ALA D O     1 
ATOM 2620  C CB    . ALA D 4 77  ? 202.344 172.151 159.881 1.00 58.95  ? 74   ALA D CB    1 
ATOM 2621  N N     . SER D 4 78  ? 202.089 174.303 157.661 1.00 62.57  ? 75   SER D N     1 
ATOM 2622  C CA    . SER D 4 78  ? 202.543 175.008 156.479 1.00 63.09  ? 75   SER D CA    1 
ATOM 2623  C C     . SER D 4 78  ? 202.773 176.472 156.789 1.00 67.54  ? 75   SER D C     1 
ATOM 2624  O O     . SER D 4 78  ? 203.916 176.932 156.814 1.00 71.93  ? 75   SER D O     1 
ATOM 2625  C CB    . SER D 4 78  ? 201.531 174.879 155.357 1.00 54.94  ? 75   SER D CB    1 
ATOM 2626  O OG    . SER D 4 78  ? 201.919 175.692 154.275 1.00 70.31  ? 75   SER D OG    1 
ATOM 2627  N N     . ARG D 4 79  ? 201.704 177.206 157.072 1.00 54.60  ? 76   ARG D N     1 
ATOM 2628  C CA    . ARG D 4 79  ? 201.861 178.646 157.179 1.00 43.04  ? 76   ARG D CA    1 
ATOM 2629  C C     . ARG D 4 79  ? 202.739 179.049 158.347 1.00 57.33  ? 76   ARG D C     1 
ATOM 2630  O O     . ARG D 4 79  ? 203.081 180.223 158.482 1.00 66.51  ? 76   ARG D O     1 
ATOM 2631  C CB    . ARG D 4 79  ? 200.513 179.347 157.265 1.00 43.75  ? 76   ARG D CB    1 
ATOM 2632  C CG    . ARG D 4 79  ? 199.797 179.320 155.942 1.00 49.45  ? 76   ARG D CG    1 
ATOM 2633  C CD    . ARG D 4 79  ? 198.600 180.237 155.903 1.00 53.87  ? 76   ARG D CD    1 
ATOM 2634  N NE    . ARG D 4 79  ? 197.527 179.832 156.793 1.00 75.64  ? 76   ARG D NE    1 
ATOM 2635  C CZ    . ARG D 4 79  ? 197.316 180.373 157.983 1.00 80.51  ? 76   ARG D CZ    1 
ATOM 2636  N NH1   . ARG D 4 79  ? 198.123 181.323 158.428 1.00 77.10  ? 76   ARG D NH1   1 
ATOM 2637  N NH2   . ARG D 4 79  ? 196.305 179.960 158.729 1.00 76.28  ? 76   ARG D NH2   1 
ATOM 2638  N N     . LEU D 4 80  ? 203.118 178.109 159.200 1.00 53.53  ? 77   LEU D N     1 
ATOM 2639  C CA    . LEU D 4 80  ? 204.246 178.388 160.079 1.00 50.48  ? 77   LEU D CA    1 
ATOM 2640  C C     . LEU D 4 80  ? 205.552 178.276 159.318 1.00 58.08  ? 77   LEU D C     1 
ATOM 2641  O O     . LEU D 4 80  ? 206.247 179.272 159.107 1.00 65.22  ? 77   LEU D O     1 
ATOM 2642  C CB    . LEU D 4 80  ? 204.248 177.461 161.285 1.00 60.61  ? 77   LEU D CB    1 
ATOM 2643  C CG    . LEU D 4 80  ? 203.300 178.027 162.297 1.00 59.36  ? 77   LEU D CG    1 
ATOM 2644  C CD1   . LEU D 4 80  ? 203.265 177.149 163.493 1.00 59.10  ? 77   LEU D CD1   1 
ATOM 2645  C CD2   . LEU D 4 80  ? 203.879 179.343 162.650 1.00 51.78  ? 77   LEU D CD2   1 
ATOM 2646  N N     . ALA D 4 81  ? 205.882 177.066 158.878 1.00 54.67  ? 78   ALA D N     1 
ATOM 2647  C CA    . ALA D 4 81  ? 207.180 176.838 158.268 1.00 50.86  ? 78   ALA D CA    1 
ATOM 2648  C C     . ALA D 4 81  ? 207.459 177.842 157.173 1.00 65.22  ? 78   ALA D C     1 
ATOM 2649  O O     . ALA D 4 81  ? 208.617 178.151 156.885 1.00 78.16  ? 78   ALA D O     1 
ATOM 2650  C CB    . ALA D 4 81  ? 207.249 175.426 157.712 1.00 39.09  ? 78   ALA D CB    1 
ATOM 2651  N N     . HIS D 4 82  ? 206.415 178.379 156.564 1.00 57.22  ? 79   HIS D N     1 
ATOM 2652  C CA    . HIS D 4 82  ? 206.625 179.426 155.584 1.00 61.55  ? 79   HIS D CA    1 
ATOM 2653  C C     . HIS D 4 82  ? 207.203 180.678 156.219 1.00 57.04  ? 79   HIS D C     1 
ATOM 2654  O O     . HIS D 4 82  ? 208.133 181.275 155.672 1.00 56.19  ? 79   HIS D O     1 
ATOM 2655  C CB    . HIS D 4 82  ? 205.321 179.750 154.886 1.00 71.23  ? 79   HIS D CB    1 
ATOM 2656  C CG    . HIS D 4 82  ? 205.453 180.826 153.869 1.00 99.51  ? 79   HIS D CG    1 
ATOM 2657  N ND1   . HIS D 4 82  ? 206.211 180.679 152.730 1.00 109.89 ? 79   HIS D ND1   1 
ATOM 2658  C CD2   . HIS D 4 82  ? 204.962 182.085 153.837 1.00 110.06 ? 79   HIS D CD2   1 
ATOM 2659  C CE1   . HIS D 4 82  ? 206.156 181.792 152.024 1.00 117.65 ? 79   HIS D CE1   1 
ATOM 2660  N NE2   . HIS D 4 82  ? 205.406 182.662 152.674 1.00 116.53 ? 79   HIS D NE2   1 
ATOM 2661  N N     . TYR D 4 83  ? 206.663 181.112 157.356 1.00 58.23  ? 80   TYR D N     1 
ATOM 2662  C CA    . TYR D 4 83  ? 207.131 182.367 157.930 1.00 58.07  ? 80   TYR D CA    1 
ATOM 2663  C C     . TYR D 4 83  ? 208.573 182.251 158.372 1.00 58.81  ? 80   TYR D C     1 
ATOM 2664  O O     . TYR D 4 83  ? 209.438 183.003 157.923 1.00 68.13  ? 80   TYR D O     1 
ATOM 2665  C CB    . TYR D 4 83  ? 206.272 182.793 159.111 1.00 64.35  ? 80   TYR D CB    1 
ATOM 2666  C CG    . TYR D 4 83  ? 204.841 183.023 158.756 1.00 75.92  ? 80   TYR D CG    1 
ATOM 2667  C CD1   . TYR D 4 83  ? 204.486 183.407 157.481 1.00 74.47  ? 80   TYR D CD1   1 
ATOM 2668  C CD2   . TYR D 4 83  ? 203.849 182.921 159.710 1.00 75.74  ? 80   TYR D CD2   1 
ATOM 2669  C CE1   . TYR D 4 83  ? 203.176 183.626 157.148 1.00 74.97  ? 80   TYR D CE1   1 
ATOM 2670  C CE2   . TYR D 4 83  ? 202.534 183.143 159.390 1.00 81.80  ? 80   TYR D CE2   1 
ATOM 2671  C CZ    . TYR D 4 83  ? 202.203 183.496 158.107 1.00 84.96  ? 80   TYR D CZ    1 
ATOM 2672  O OH    . TYR D 4 83  ? 200.890 183.725 157.772 1.00 85.01  ? 80   TYR D OH    1 
ATOM 2673  N N     . ASN D 4 84  ? 208.856 181.294 159.238 1.00 57.36  ? 81   ASN D N     1 
ATOM 2674  C CA    . ASN D 4 84  ? 210.203 181.179 159.758 1.00 61.96  ? 81   ASN D CA    1 
ATOM 2675  C C     . ASN D 4 84  ? 211.210 180.813 158.687 1.00 69.06  ? 81   ASN D C     1 
ATOM 2676  O O     . ASN D 4 84  ? 212.402 180.733 158.987 1.00 64.13  ? 81   ASN D O     1 
ATOM 2677  C CB    . ASN D 4 84  ? 210.219 180.149 160.856 1.00 54.30  ? 81   ASN D CB    1 
ATOM 2678  C CG    . ASN D 4 84  ? 209.300 180.513 161.958 1.00 53.59  ? 81   ASN D CG    1 
ATOM 2679  O OD1   . ASN D 4 84  ? 209.584 181.403 162.747 1.00 70.88  ? 81   ASN D OD1   1 
ATOM 2680  N ND2   . ASN D 4 84  ? 208.165 179.846 162.014 1.00 44.21  ? 81   ASN D ND2   1 
ATOM 2681  N N     . LYS D 4 85  ? 210.753 180.553 157.471 1.00 65.92  ? 82   LYS D N     1 
ATOM 2682  C CA    . LYS D 4 85  ? 211.600 180.198 156.345 1.00 67.57  ? 82   LYS D CA    1 
ATOM 2683  C C     . LYS D 4 85  ? 212.292 178.870 156.549 1.00 62.88  ? 82   LYS D C     1 
ATOM 2684  O O     . LYS D 4 85  ? 213.306 178.596 155.916 1.00 66.78  ? 82   LYS D O     1 
ATOM 2685  C CB    . LYS D 4 85  ? 212.627 181.293 156.070 1.00 72.28  ? 82   LYS D CB    1 
ATOM 2686  C CG    . LYS D 4 85  ? 211.995 182.578 155.615 1.00 75.54  ? 82   LYS D CG    1 
ATOM 2687  C CD    . LYS D 4 85  ? 212.957 183.729 155.745 1.00 98.07  ? 82   LYS D CD    1 
ATOM 2688  C CE    . LYS D 4 85  ? 214.180 183.506 154.884 1.00 108.73 ? 82   LYS D CE    1 
ATOM 2689  N NZ    . LYS D 4 85  ? 215.150 184.628 155.010 1.00 97.97  ? 82   LYS D NZ    1 
ATOM 2690  N N     . ARG D 4 86  ? 211.759 178.026 157.416 1.00 61.93  ? 83   ARG D N     1 
ATOM 2691  C CA    . ARG D 4 86  ? 212.088 176.620 157.321 1.00 56.99  ? 83   ARG D CA    1 
ATOM 2692  C C     . ARG D 4 86  ? 211.447 176.057 156.067 1.00 69.43  ? 83   ARG D C     1 
ATOM 2693  O O     . ARG D 4 86  ? 210.424 176.549 155.595 1.00 76.74  ? 83   ARG D O     1 
ATOM 2694  C CB    . ARG D 4 86  ? 211.588 175.862 158.539 1.00 60.01  ? 83   ARG D CB    1 
ATOM 2695  C CG    . ARG D 4 86  ? 212.184 176.319 159.826 1.00 84.52  ? 83   ARG D CG    1 
ATOM 2696  C CD    . ARG D 4 86  ? 213.624 175.921 159.895 1.00 100.50 ? 83   ARG D CD    1 
ATOM 2697  N NE    . ARG D 4 86  ? 214.201 176.259 161.186 1.00 112.49 ? 83   ARG D NE    1 
ATOM 2698  C CZ    . ARG D 4 86  ? 214.778 177.421 161.456 1.00 121.20 ? 83   ARG D CZ    1 
ATOM 2699  N NH1   . ARG D 4 86  ? 214.845 178.358 160.522 1.00 121.32 ? 83   ARG D NH1   1 
ATOM 2700  N NH2   . ARG D 4 86  ? 215.280 177.649 162.659 1.00 120.07 ? 83   ARG D NH2   1 
ATOM 2701  N N     . SER D 4 87  ? 212.078 175.051 155.492 1.00 63.43  ? 84   SER D N     1 
ATOM 2702  C CA    . SER D 4 87  ? 211.490 174.365 154.360 1.00 70.18  ? 84   SER D CA    1 
ATOM 2703  C C     . SER D 4 87  ? 210.821 173.057 154.737 1.00 67.34  ? 84   SER D C     1 
ATOM 2704  O O     . SER D 4 87  ? 210.215 172.422 153.872 1.00 60.32  ? 84   SER D O     1 
ATOM 2705  C CB    . SER D 4 87  ? 212.556 174.106 153.310 1.00 72.41  ? 84   SER D CB    1 
ATOM 2706  O OG    . SER D 4 87  ? 213.560 173.276 153.854 1.00 79.46  ? 84   SER D OG    1 
ATOM 2707  N N     . THR D 4 88  ? 210.904 172.639 155.996 1.00 75.83  ? 85   THR D N     1 
ATOM 2708  C CA    . THR D 4 88  ? 210.538 171.283 156.378 1.00 69.63  ? 85   THR D CA    1 
ATOM 2709  C C     . THR D 4 88  ? 209.658 171.269 157.613 1.00 69.58  ? 85   THR D C     1 
ATOM 2710  O O     . THR D 4 88  ? 210.104 171.654 158.697 1.00 81.67  ? 85   THR D O     1 
ATOM 2711  C CB    . THR D 4 88  ? 211.779 170.453 156.659 1.00 69.02  ? 85   THR D CB    1 
ATOM 2712  O OG1   . THR D 4 88  ? 212.572 170.368 155.475 1.00 89.11  ? 85   THR D OG1   1 
ATOM 2713  C CG2   . THR D 4 88  ? 211.382 169.074 157.095 1.00 68.09  ? 85   THR D CG2   1 
ATOM 2714  N N     . ILE D 4 89  ? 208.430 170.788 157.460 1.00 69.38  ? 86   ILE D N     1 
ATOM 2715  C CA    . ILE D 4 89  ? 207.563 170.536 158.603 1.00 64.78  ? 86   ILE D CA    1 
ATOM 2716  C C     . ILE D 4 89  ? 208.262 169.564 159.533 1.00 65.71  ? 86   ILE D C     1 
ATOM 2717  O O     . ILE D 4 89  ? 208.681 168.485 159.111 1.00 72.41  ? 86   ILE D O     1 
ATOM 2718  C CB    . ILE D 4 89  ? 206.222 169.960 158.157 1.00 56.12  ? 86   ILE D CB    1 
ATOM 2719  C CG1   . ILE D 4 89  ? 205.443 170.989 157.380 1.00 53.60  ? 86   ILE D CG1   1 
ATOM 2720  C CG2   . ILE D 4 89  ? 205.439 169.536 159.345 1.00 48.02  ? 86   ILE D CG2   1 
ATOM 2721  C CD1   . ILE D 4 89  ? 204.256 170.403 156.721 1.00 53.81  ? 86   ILE D CD1   1 
ATOM 2722  N N     . THR D 4 90  ? 208.384 169.926 160.791 1.00 62.40  ? 87   THR D N     1 
ATOM 2723  C CA    . THR D 4 90  ? 208.927 168.987 161.750 1.00 63.00  ? 87   THR D CA    1 
ATOM 2724  C C     . THR D 4 90  ? 207.919 168.813 162.868 1.00 58.30  ? 87   THR D C     1 
ATOM 2725  O O     . THR D 4 90  ? 206.841 169.403 162.855 1.00 62.82  ? 87   THR D O     1 
ATOM 2726  C CB    . THR D 4 90  ? 210.248 169.474 162.310 1.00 61.58  ? 87   THR D CB    1 
ATOM 2727  O OG1   . THR D 4 90  ? 209.998 170.587 163.166 1.00 60.17  ? 87   THR D OG1   1 
ATOM 2728  C CG2   . THR D 4 90  ? 211.137 169.936 161.188 1.00 59.11  ? 87   THR D CG2   1 
ATOM 2729  N N     . SER D 4 91  ? 208.274 168.015 163.863 1.00 55.70  ? 88   SER D N     1 
ATOM 2730  C CA    . SER D 4 91  ? 207.411 167.875 165.021 1.00 60.36  ? 88   SER D CA    1 
ATOM 2731  C C     . SER D 4 91  ? 207.120 169.227 165.643 1.00 60.84  ? 88   SER D C     1 
ATOM 2732  O O     . SER D 4 91  ? 205.957 169.608 165.811 1.00 69.01  ? 88   SER D O     1 
ATOM 2733  C CB    . SER D 4 91  ? 208.075 166.972 166.040 1.00 67.51  ? 88   SER D CB    1 
ATOM 2734  O OG    . SER D 4 91  ? 209.256 167.600 166.488 1.00 85.07  ? 88   SER D OG    1 
ATOM 2735  N N     . ARG D 4 92  ? 208.174 169.976 165.958 1.00 56.02  ? 89   ARG D N     1 
ATOM 2736  C CA    . ARG D 4 92  ? 208.033 171.181 166.762 1.00 55.53  ? 89   ARG D CA    1 
ATOM 2737  C C     . ARG D 4 92  ? 206.932 172.081 166.224 1.00 60.48  ? 89   ARG D C     1 
ATOM 2738  O O     . ARG D 4 92  ? 206.102 172.592 166.990 1.00 73.71  ? 89   ARG D O     1 
ATOM 2739  C CB    . ARG D 4 92  ? 209.373 171.904 166.805 1.00 63.82  ? 89   ARG D CB    1 
ATOM 2740  C CG    . ARG D 4 92  ? 209.444 173.059 167.750 1.00 67.06  ? 89   ARG D CG    1 
ATOM 2741  C CD    . ARG D 4 92  ? 210.872 173.568 167.818 1.00 81.28  ? 89   ARG D CD    1 
ATOM 2742  N NE    . ARG D 4 92  ? 211.018 174.636 168.798 1.00 85.23  ? 89   ARG D NE    1 
ATOM 2743  C CZ    . ARG D 4 92  ? 210.844 175.921 168.527 1.00 74.44  ? 89   ARG D CZ    1 
ATOM 2744  N NH1   . ARG D 4 92  ? 210.529 176.305 167.296 1.00 65.46  ? 89   ARG D NH1   1 
ATOM 2745  N NH2   . ARG D 4 92  ? 210.990 176.823 169.485 1.00 77.63  ? 89   ARG D NH2   1 
ATOM 2746  N N     . GLU D 4 93  ? 206.870 172.241 164.903 1.00 65.73  ? 90   GLU D N     1 
ATOM 2747  C CA    . GLU D 4 93  ? 205.767 172.983 164.314 1.00 65.18  ? 90   GLU D CA    1 
ATOM 2748  C C     . GLU D 4 93  ? 204.440 172.371 164.713 1.00 67.76  ? 90   GLU D C     1 
ATOM 2749  O O     . GLU D 4 93  ? 203.620 173.022 165.360 1.00 66.00  ? 90   GLU D O     1 
ATOM 2750  C CB    . GLU D 4 93  ? 205.890 173.014 162.800 1.00 57.38  ? 90   GLU D CB    1 
ATOM 2751  C CG    . GLU D 4 93  ? 207.093 173.742 162.310 1.00 62.59  ? 90   GLU D CG    1 
ATOM 2752  C CD    . GLU D 4 93  ? 208.320 172.881 162.376 1.00 85.04  ? 90   GLU D CD    1 
ATOM 2753  O OE1   . GLU D 4 93  ? 208.223 171.779 162.952 1.00 80.49  ? 90   GLU D OE1   1 
ATOM 2754  O OE2   . GLU D 4 93  ? 209.372 173.283 161.839 1.00 93.63  ? 90   GLU D OE2   1 
ATOM 2755  N N     . ILE D 4 94  ? 204.232 171.098 164.376 1.00 58.66  ? 91   ILE D N     1 
ATOM 2756  C CA    . ILE D 4 94  ? 202.953 170.464 164.671 1.00 52.19  ? 91   ILE D CA    1 
ATOM 2757  C C     . ILE D 4 94  ? 202.556 170.730 166.104 1.00 50.36  ? 91   ILE D C     1 
ATOM 2758  O O     . ILE D 4 94  ? 201.400 171.049 166.396 1.00 54.81  ? 91   ILE D O     1 
ATOM 2759  C CB    . ILE D 4 94  ? 203.018 168.960 164.392 1.00 52.28  ? 91   ILE D CB    1 
ATOM 2760  C CG1   . ILE D 4 94  ? 203.354 168.719 162.944 1.00 50.94  ? 91   ILE D CG1   1 
ATOM 2761  C CG2   . ILE D 4 94  ? 201.686 168.355 164.646 1.00 47.40  ? 91   ILE D CG2   1 
ATOM 2762  C CD1   . ILE D 4 94  ? 202.319 169.238 162.055 1.00 39.81  ? 91   ILE D CD1   1 
ATOM 2763  N N     . GLN D 4 95  ? 203.517 170.650 167.016 1.00 50.08  ? 92   GLN D N     1 
ATOM 2764  C CA    . GLN D 4 95  ? 203.231 171.022 168.390 1.00 60.47  ? 92   GLN D CA    1 
ATOM 2765  C C     . GLN D 4 95  ? 202.643 172.415 168.452 1.00 64.21  ? 92   GLN D C     1 
ATOM 2766  O O     . GLN D 4 95  ? 201.531 172.609 168.955 1.00 63.73  ? 92   GLN D O     1 
ATOM 2767  C CB    . GLN D 4 95  ? 204.493 170.953 169.231 1.00 60.82  ? 92   GLN D CB    1 
ATOM 2768  C CG    . GLN D 4 95  ? 204.240 171.294 170.662 1.00 63.23  ? 92   GLN D CG    1 
ATOM 2769  C CD    . GLN D 4 95  ? 205.472 171.144 171.497 1.00 68.64  ? 92   GLN D CD    1 
ATOM 2770  O OE1   . GLN D 4 95  ? 206.496 170.661 171.026 1.00 86.18  ? 92   GLN D OE1   1 
ATOM 2771  N NE2   . GLN D 4 95  ? 205.395 171.580 172.744 1.00 66.97  ? 92   GLN D NE2   1 
ATOM 2772  N N     . THR D 4 96  ? 203.360 173.397 167.916 1.00 53.56  ? 93   THR D N     1 
ATOM 2773  C CA    . THR D 4 96  ? 202.852 174.760 167.979 1.00 48.00  ? 93   THR D CA    1 
ATOM 2774  C C     . THR D 4 96  ? 201.453 174.851 167.390 1.00 53.85  ? 93   THR D C     1 
ATOM 2775  O O     . THR D 4 96  ? 200.514 175.299 168.056 1.00 61.84  ? 93   THR D O     1 
ATOM 2776  C CB    . THR D 4 96  ? 203.798 175.706 167.262 1.00 49.83  ? 93   THR D CB    1 
ATOM 2777  O OG1   . THR D 4 96  ? 205.031 175.771 167.982 1.00 50.12  ? 93   THR D OG1   1 
ATOM 2778  C CG2   . THR D 4 96  ? 203.194 177.068 167.190 1.00 50.89  ? 93   THR D CG2   1 
ATOM 2779  N N     . ALA D 4 97  ? 201.290 174.393 166.152 1.00 43.74  ? 94   ALA D N     1 
ATOM 2780  C CA    . ALA D 4 97  ? 199.998 174.460 165.484 1.00 44.65  ? 94   ALA D CA    1 
ATOM 2781  C C     . ALA D 4 97  ? 198.895 173.931 166.376 1.00 54.97  ? 94   ALA D C     1 
ATOM 2782  O O     . ALA D 4 97  ? 197.835 174.552 166.518 1.00 51.41  ? 94   ALA D O     1 
ATOM 2783  C CB    . ALA D 4 97  ? 200.051 173.669 164.185 1.00 39.61  ? 94   ALA D CB    1 
ATOM 2784  N N     . VAL D 4 98  ? 199.137 172.791 167.009 1.00 47.56  ? 95   VAL D N     1 
ATOM 2785  C CA    . VAL D 4 98  ? 198.158 172.285 167.953 1.00 38.10  ? 95   VAL D CA    1 
ATOM 2786  C C     . VAL D 4 98  ? 197.906 173.302 169.045 1.00 44.74  ? 95   VAL D C     1 
ATOM 2787  O O     . VAL D 4 98  ? 196.757 173.594 169.385 1.00 42.48  ? 95   VAL D O     1 
ATOM 2788  C CB    . VAL D 4 98  ? 198.614 170.946 168.532 1.00 41.85  ? 95   VAL D CB    1 
ATOM 2789  C CG1   . VAL D 4 98  ? 197.709 170.566 169.647 1.00 37.24  ? 95   VAL D CG1   1 
ATOM 2790  C CG2   . VAL D 4 98  ? 198.557 169.908 167.464 1.00 38.43  ? 95   VAL D CG2   1 
ATOM 2791  N N     . ARG D 4 99  ? 198.966 173.882 169.595 1.00 47.06  ? 96   ARG D N     1 
ATOM 2792  C CA    . ARG D 4 99  ? 198.746 174.830 170.673 1.00 51.06  ? 96   ARG D CA    1 
ATOM 2793  C C     . ARG D 4 99  ? 197.956 176.031 170.211 1.00 54.52  ? 96   ARG D C     1 
ATOM 2794  O O     . ARG D 4 99  ? 197.387 176.738 171.043 1.00 60.47  ? 96   ARG D O     1 
ATOM 2795  C CB    . ARG D 4 99  ? 200.070 175.267 171.267 1.00 47.05  ? 96   ARG D CB    1 
ATOM 2796  C CG    . ARG D 4 99  ? 200.787 174.105 171.860 1.00 57.24  ? 96   ARG D CG    1 
ATOM 2797  C CD    . ARG D 4 99  ? 202.109 174.484 172.408 1.00 82.65  ? 96   ARG D CD    1 
ATOM 2798  N NE    . ARG D 4 99  ? 201.960 175.373 173.541 1.00 101.75 ? 96   ARG D NE    1 
ATOM 2799  C CZ    . ARG D 4 99  ? 202.986 175.928 174.165 1.00 98.15  ? 96   ARG D CZ    1 
ATOM 2800  N NH1   . ARG D 4 99  ? 204.217 175.673 173.750 1.00 82.07  ? 96   ARG D NH1   1 
ATOM 2801  N NH2   . ARG D 4 99  ? 202.785 176.733 175.197 1.00 97.64  ? 96   ARG D NH2   1 
ATOM 2802  N N     . LEU D 4 100 ? 197.914 176.291 168.912 1.00 44.28  ? 97   LEU D N     1 
ATOM 2803  C CA    . LEU D 4 100 ? 197.028 177.342 168.446 1.00 40.25  ? 97   LEU D CA    1 
ATOM 2804  C C     . LEU D 4 100 ? 195.598 176.856 168.326 1.00 46.03  ? 97   LEU D C     1 
ATOM 2805  O O     . LEU D 4 100 ? 194.677 177.504 168.822 1.00 54.30  ? 97   LEU D O     1 
ATOM 2806  C CB    . LEU D 4 100 ? 197.501 177.889 167.112 1.00 34.79  ? 97   LEU D CB    1 
ATOM 2807  C CG    . LEU D 4 100 ? 198.822 178.612 167.266 1.00 46.66  ? 97   LEU D CG    1 
ATOM 2808  C CD1   . LEU D 4 100 ? 199.283 179.115 165.933 1.00 36.17  ? 97   LEU D CD1   1 
ATOM 2809  C CD2   . LEU D 4 100 ? 198.651 179.742 168.235 1.00 49.08  ? 97   LEU D CD2   1 
ATOM 2810  N N     . LEU D 4 101 ? 195.379 175.720 167.675 1.00 41.27  ? 98   LEU D N     1 
ATOM 2811  C CA    . LEU D 4 101 ? 194.010 175.382 167.315 1.00 47.95  ? 98   LEU D CA    1 
ATOM 2812  C C     . LEU D 4 101 ? 193.229 174.868 168.514 1.00 52.80  ? 98   LEU D C     1 
ATOM 2813  O O     . LEU D 4 101 ? 192.113 175.318 168.780 1.00 59.54  ? 98   LEU D O     1 
ATOM 2814  C CB    . LEU D 4 101 ? 194.001 174.360 166.188 1.00 43.59  ? 98   LEU D CB    1 
ATOM 2815  C CG    . LEU D 4 101 ? 194.755 174.885 164.990 1.00 60.01  ? 98   LEU D CG    1 
ATOM 2816  C CD1   . LEU D 4 101 ? 194.690 173.908 163.852 1.00 76.09  ? 98   LEU D CD1   1 
ATOM 2817  C CD2   . LEU D 4 101 ? 194.147 176.213 164.643 1.00 68.08  ? 98   LEU D CD2   1 
ATOM 2818  N N     . LEU D 4 102 ? 193.788 173.939 169.254 1.00 45.89  ? 99   LEU D N     1 
ATOM 2819  C CA    . LEU D 4 102 ? 193.002 173.310 170.297 1.00 38.19  ? 99   LEU D CA    1 
ATOM 2820  C C     . LEU D 4 102 ? 192.792 174.264 171.457 1.00 50.85  ? 99   LEU D C     1 
ATOM 2821  O O     . LEU D 4 102 ? 193.767 174.743 172.042 1.00 65.08  ? 99   LEU D O     1 
ATOM 2822  C CB    . LEU D 4 102 ? 193.661 172.044 170.786 1.00 35.06  ? 99   LEU D CB    1 
ATOM 2823  C CG    . LEU D 4 102 ? 193.757 171.054 169.639 1.00 38.45  ? 99   LEU D CG    1 
ATOM 2824  C CD1   . LEU D 4 102 ? 194.305 169.751 170.130 1.00 45.42  ? 99   LEU D CD1   1 
ATOM 2825  C CD2   . LEU D 4 102 ? 192.422 170.867 168.988 1.00 38.86  ? 99   LEU D CD2   1 
ATOM 2826  N N     . PRO D 4 103 ? 191.560 174.565 171.821 1.00 48.63  ? 100  PRO D N     1 
ATOM 2827  C CA    . PRO D 4 103 ? 191.323 175.504 172.911 1.00 46.06  ? 100  PRO D CA    1 
ATOM 2828  C C     . PRO D 4 103 ? 191.550 174.849 174.255 1.00 60.60  ? 100  PRO D C     1 
ATOM 2829  O O     . PRO D 4 103 ? 191.465 173.629 174.393 1.00 76.57  ? 100  PRO D O     1 
ATOM 2830  C CB    . PRO D 4 103 ? 189.846 175.866 172.736 1.00 50.08  ? 100  PRO D CB    1 
ATOM 2831  C CG    . PRO D 4 103 ? 189.546 175.505 171.319 1.00 48.46  ? 100  PRO D CG    1 
ATOM 2832  C CD    . PRO D 4 103 ? 190.326 174.272 171.094 1.00 45.13  ? 100  PRO D CD    1 
ATOM 2833  N N     . GLY D 4 104 ? 191.836 175.678 175.250 1.00 63.41  ? 101  GLY D N     1 
ATOM 2834  C CA    . GLY D 4 104 ? 191.739 175.234 176.631 1.00 61.71  ? 101  GLY D CA    1 
ATOM 2835  C C     . GLY D 4 104 ? 192.592 174.026 176.933 1.00 69.16  ? 101  GLY D C     1 
ATOM 2836  O O     . GLY D 4 104 ? 193.784 173.980 176.618 1.00 74.15  ? 101  GLY D O     1 
ATOM 2837  N N     . GLU D 4 105 ? 191.978 173.019 177.547 1.00 50.17  ? 102  GLU D N     1 
ATOM 2838  C CA    . GLU D 4 105 ? 192.754 171.903 178.065 1.00 47.54  ? 102  GLU D CA    1 
ATOM 2839  C C     . GLU D 4 105 ? 193.142 170.932 176.969 1.00 53.02  ? 102  GLU D C     1 
ATOM 2840  O O     . GLU D 4 105 ? 194.158 170.234 177.084 1.00 56.57  ? 102  GLU D O     1 
ATOM 2841  C CB    . GLU D 4 105 ? 191.973 171.193 179.156 1.00 54.84  ? 102  GLU D CB    1 
ATOM 2842  C CG    . GLU D 4 105 ? 191.763 172.081 180.346 1.00 68.01  ? 102  GLU D CG    1 
ATOM 2843  C CD    . GLU D 4 105 ? 193.071 172.610 180.884 1.00 79.26  ? 102  GLU D CD    1 
ATOM 2844  O OE1   . GLU D 4 105 ? 194.054 171.841 180.921 1.00 86.00  ? 102  GLU D OE1   1 
ATOM 2845  O OE2   . GLU D 4 105 ? 193.122 173.797 181.258 1.00 81.58  ? 102  GLU D OE2   1 
ATOM 2846  N N     . LEU D 4 106 ? 192.347 170.862 175.903 1.00 47.66  ? 103  LEU D N     1 
ATOM 2847  C CA    . LEU D 4 106 ? 192.720 170.011 174.784 1.00 54.35  ? 103  LEU D CA    1 
ATOM 2848  C C     . LEU D 4 106 ? 194.142 170.290 174.349 1.00 61.29  ? 103  LEU D C     1 
ATOM 2849  O O     . LEU D 4 106 ? 194.857 169.378 173.922 1.00 64.07  ? 103  LEU D O     1 
ATOM 2850  C CB    . LEU D 4 106 ? 191.761 170.216 173.624 1.00 49.44  ? 103  LEU D CB    1 
ATOM 2851  C CG    . LEU D 4 106 ? 190.353 169.777 173.977 1.00 50.63  ? 103  LEU D CG    1 
ATOM 2852  C CD1   . LEU D 4 106 ? 189.418 170.054 172.837 1.00 58.01  ? 103  LEU D CD1   1 
ATOM 2853  C CD2   . LEU D 4 106 ? 190.367 168.318 174.305 1.00 33.50  ? 103  LEU D CD2   1 
ATOM 2854  N N     . ALA D 4 107 ? 194.573 171.542 174.470 1.00 56.01  ? 104  ALA D N     1 
ATOM 2855  C CA    . ALA D 4 107 ? 195.983 171.857 174.332 1.00 51.30  ? 104  ALA D CA    1 
ATOM 2856  C C     . ALA D 4 107 ? 196.819 170.954 175.218 1.00 57.64  ? 104  ALA D C     1 
ATOM 2857  O O     . ALA D 4 107 ? 197.530 170.073 174.732 1.00 66.22  ? 104  ALA D O     1 
ATOM 2858  C CB    . ALA D 4 107 ? 196.225 173.321 174.686 1.00 56.87  ? 104  ALA D CB    1 
ATOM 2859  N N     . LYS D 4 108 ? 196.711 171.138 176.531 1.00 54.36  ? 105  LYS D N     1 
ATOM 2860  C CA    . LYS D 4 108 ? 197.638 170.490 177.449 1.00 51.26  ? 105  LYS D CA    1 
ATOM 2861  C C     . LYS D 4 108 ? 197.618 168.982 177.283 1.00 55.20  ? 105  LYS D C     1 
ATOM 2862  O O     . LYS D 4 108 ? 198.667 168.346 177.113 1.00 63.38  ? 105  LYS D O     1 
ATOM 2863  C CB    . LYS D 4 108 ? 197.295 170.882 178.879 1.00 52.87  ? 105  LYS D CB    1 
ATOM 2864  C CG    . LYS D 4 108 ? 197.421 172.366 179.095 1.00 71.55  ? 105  LYS D CG    1 
ATOM 2865  C CD    . LYS D 4 108 ? 197.121 172.759 180.517 1.00 86.55  ? 105  LYS D CD    1 
ATOM 2866  C CE    . LYS D 4 108 ? 197.159 174.266 180.661 1.00 88.68  ? 105  LYS D CE    1 
ATOM 2867  N NZ    . LYS D 4 108 ? 198.495 174.813 180.308 1.00 84.70  ? 105  LYS D NZ    1 
ATOM 2868  N N     . HIS D 4 109 ? 196.426 168.394 177.300 1.00 52.06  ? 106  HIS D N     1 
ATOM 2869  C CA    . HIS D 4 109 ? 196.336 166.953 177.132 1.00 44.01  ? 106  HIS D CA    1 
ATOM 2870  C C     . HIS D 4 109 ? 196.945 166.518 175.810 1.00 53.90  ? 106  HIS D C     1 
ATOM 2871  O O     . HIS D 4 109 ? 197.863 165.692 175.783 1.00 58.24  ? 106  HIS D O     1 
ATOM 2872  C CB    . HIS D 4 109 ? 194.887 166.504 177.228 1.00 43.54  ? 106  HIS D CB    1 
ATOM 2873  C CG    . HIS D 4 109 ? 194.257 166.818 178.541 1.00 59.05  ? 106  HIS D CG    1 
ATOM 2874  N ND1   . HIS D 4 109 ? 194.649 166.211 179.713 1.00 46.34  ? 106  HIS D ND1   1 
ATOM 2875  C CD2   . HIS D 4 109 ? 193.265 167.675 178.872 1.00 68.61  ? 106  HIS D CD2   1 
ATOM 2876  C CE1   . HIS D 4 109 ? 193.925 166.682 180.711 1.00 62.87  ? 106  HIS D CE1   1 
ATOM 2877  N NE2   . HIS D 4 109 ? 193.077 167.571 180.228 1.00 66.63  ? 106  HIS D NE2   1 
ATOM 2878  N N     . ALA D 4 110 ? 196.461 167.075 174.702 1.00 56.56  ? 107  ALA D N     1 
ATOM 2879  C CA    . ALA D 4 110 ? 196.920 166.618 173.396 1.00 46.49  ? 107  ALA D CA    1 
ATOM 2880  C C     . ALA D 4 110 ? 198.431 166.725 173.278 1.00 56.25  ? 107  ALA D C     1 
ATOM 2881  O O     . ALA D 4 110 ? 199.102 165.777 172.859 1.00 58.74  ? 107  ALA D O     1 
ATOM 2882  C CB    . ALA D 4 110 ? 196.241 167.420 172.297 1.00 46.45  ? 107  ALA D CB    1 
ATOM 2883  N N     . VAL D 4 111 ? 198.985 167.869 173.658 1.00 55.20  ? 108  VAL D N     1 
ATOM 2884  C CA    . VAL D 4 111 ? 200.430 168.042 173.609 1.00 53.52  ? 108  VAL D CA    1 
ATOM 2885  C C     . VAL D 4 111 ? 201.120 166.954 174.410 1.00 62.74  ? 108  VAL D C     1 
ATOM 2886  O O     . VAL D 4 111 ? 202.081 166.330 173.944 1.00 61.58  ? 108  VAL D O     1 
ATOM 2887  C CB    . VAL D 4 111 ? 200.820 169.434 174.118 1.00 47.32  ? 108  VAL D CB    1 
ATOM 2888  C CG1   . VAL D 4 111 ? 202.313 169.523 174.247 1.00 38.50  ? 108  VAL D CG1   1 
ATOM 2889  C CG2   . VAL D 4 111 ? 200.324 170.474 173.161 1.00 42.97  ? 108  VAL D CG2   1 
ATOM 2890  N N     . SER D 4 112 ? 200.647 166.713 175.631 1.00 70.09  ? 109  SER D N     1 
ATOM 2891  C CA    . SER D 4 112 ? 201.220 165.630 176.416 1.00 70.23  ? 109  SER D CA    1 
ATOM 2892  C C     . SER D 4 112 ? 201.210 164.330 175.627 1.00 71.20  ? 109  SER D C     1 
ATOM 2893  O O     . SER D 4 112 ? 202.236 163.650 175.515 1.00 68.26  ? 109  SER D O     1 
ATOM 2894  C CB    . SER D 4 112 ? 200.459 165.469 177.723 1.00 71.05  ? 109  SER D CB    1 
ATOM 2895  O OG    . SER D 4 112 ? 200.994 164.392 178.459 1.00 81.34  ? 109  SER D OG    1 
ATOM 2896  N N     . GLU D 4 113 ? 200.061 163.991 175.046 1.00 70.58  ? 110  GLU D N     1 
ATOM 2897  C CA    . GLU D 4 113 ? 199.923 162.807 174.213 1.00 66.27  ? 110  GLU D CA    1 
ATOM 2898  C C     . GLU D 4 113 ? 201.029 162.731 173.185 1.00 63.36  ? 110  GLU D C     1 
ATOM 2899  O O     . GLU D 4 113 ? 201.911 161.877 173.283 1.00 70.41  ? 110  GLU D O     1 
ATOM 2900  C CB    . GLU D 4 113 ? 198.584 162.801 173.490 1.00 66.48  ? 110  GLU D CB    1 
ATOM 2901  C CG    . GLU D 4 113 ? 197.409 162.622 174.388 1.00 83.34  ? 110  GLU D CG    1 
ATOM 2902  C CD    . GLU D 4 113 ? 197.461 161.310 175.112 1.00 97.65  ? 110  GLU D CD    1 
ATOM 2903  O OE1   . GLU D 4 113 ? 197.886 160.318 174.488 1.00 105.11 ? 110  GLU D OE1   1 
ATOM 2904  O OE2   . GLU D 4 113 ? 197.078 161.268 176.298 1.00 99.62  ? 110  GLU D OE2   1 
ATOM 2905  N N     . GLY D 4 114 ? 200.992 163.629 172.208 1.00 57.46  ? 111  GLY D N     1 
ATOM 2906  C CA    . GLY D 4 114 ? 201.974 163.572 171.143 1.00 62.97  ? 111  GLY D CA    1 
ATOM 2907  C C     . GLY D 4 114 ? 203.385 163.464 171.671 1.00 63.12  ? 111  GLY D C     1 
ATOM 2908  O O     . GLY D 4 114 ? 204.169 162.625 171.223 1.00 68.97  ? 111  GLY D O     1 
ATOM 2909  N N     . THR D 4 115 ? 203.717 164.296 172.656 1.00 57.03  ? 112  THR D N     1 
ATOM 2910  C CA    . THR D 4 115 ? 205.048 164.260 173.238 1.00 60.68  ? 112  THR D CA    1 
ATOM 2911  C C     . THR D 4 115 ? 205.420 162.845 173.630 1.00 70.74  ? 112  THR D C     1 
ATOM 2912  O O     . THR D 4 115 ? 206.448 162.308 173.200 1.00 69.97  ? 112  THR D O     1 
ATOM 2913  C CB    . THR D 4 115 ? 205.096 165.161 174.460 1.00 73.12  ? 112  THR D CB    1 
ATOM 2914  O OG1   . THR D 4 115 ? 204.738 166.491 174.080 1.00 75.16  ? 112  THR D OG1   1 
ATOM 2915  C CG2   . THR D 4 115 ? 206.484 165.163 175.033 1.00 88.06  ? 112  THR D CG2   1 
ATOM 2916  N N     . LYS D 4 116 ? 204.566 162.220 174.432 1.00 67.68  ? 113  LYS D N     1 
ATOM 2917  C CA    . LYS D 4 116 ? 204.790 160.841 174.830 1.00 59.12  ? 113  LYS D CA    1 
ATOM 2918  C C     . LYS D 4 116 ? 204.969 159.948 173.613 1.00 64.08  ? 113  LYS D C     1 
ATOM 2919  O O     . LYS D 4 116 ? 205.906 159.145 173.547 1.00 72.82  ? 113  LYS D O     1 
ATOM 2920  C CB    . LYS D 4 116 ? 203.620 160.380 175.692 1.00 61.62  ? 113  LYS D CB    1 
ATOM 2921  C CG    . LYS D 4 116 ? 203.696 158.962 176.155 1.00 79.95  ? 113  LYS D CG    1 
ATOM 2922  C CD    . LYS D 4 116 ? 202.558 158.664 177.112 1.00 91.26  ? 113  LYS D CD    1 
ATOM 2923  C CE    . LYS D 4 116 ? 201.232 158.513 176.395 1.00 89.86  ? 113  LYS D CE    1 
ATOM 2924  N NZ    . LYS D 4 116 ? 200.136 158.186 177.351 1.00 88.51  ? 113  LYS D NZ    1 
ATOM 2925  N N     . ALA D 4 117 ? 204.097 160.106 172.620 1.00 55.37  ? 114  ALA D N     1 
ATOM 2926  C CA    . ALA D 4 117 ? 204.138 159.233 171.456 1.00 58.02  ? 114  ALA D CA    1 
ATOM 2927  C C     . ALA D 4 117 ? 205.492 159.288 170.775 1.00 62.43  ? 114  ALA D C     1 
ATOM 2928  O O     . ALA D 4 117 ? 206.169 158.267 170.642 1.00 69.79  ? 114  ALA D O     1 
ATOM 2929  C CB    . ALA D 4 117 ? 203.040 159.614 170.474 1.00 47.89  ? 114  ALA D CB    1 
ATOM 2930  N N     . VAL D 4 118 ? 205.909 160.475 170.343 1.00 56.61  ? 115  VAL D N     1 
ATOM 2931  C CA    . VAL D 4 118 ? 207.200 160.590 169.675 1.00 63.86  ? 115  VAL D CA    1 
ATOM 2932  C C     . VAL D 4 118 ? 208.307 160.071 170.573 1.00 74.31  ? 115  VAL D C     1 
ATOM 2933  O O     . VAL D 4 118 ? 209.226 159.380 170.117 1.00 80.99  ? 115  VAL D O     1 
ATOM 2934  C CB    . VAL D 4 118 ? 207.454 162.044 169.250 1.00 63.27  ? 115  VAL D CB    1 
ATOM 2935  C CG1   . VAL D 4 118 ? 208.866 162.203 168.754 1.00 55.95  ? 115  VAL D CG1   1 
ATOM 2936  C CG2   . VAL D 4 118 ? 206.492 162.421 168.163 1.00 66.89  ? 115  VAL D CG2   1 
ATOM 2937  N N     . THR D 4 119 ? 208.229 160.385 171.863 1.00 73.02  ? 116  THR D N     1 
ATOM 2938  C CA    . THR D 4 119 ? 209.227 159.900 172.803 1.00 79.92  ? 116  THR D CA    1 
ATOM 2939  C C     . THR D 4 119 ? 209.413 158.396 172.671 1.00 79.64  ? 116  THR D C     1 
ATOM 2940  O O     . THR D 4 119 ? 210.491 157.915 172.303 1.00 84.77  ? 116  THR D O     1 
ATOM 2941  C CB    . THR D 4 119 ? 208.808 160.269 174.217 1.00 77.45  ? 116  THR D CB    1 
ATOM 2942  O OG1   . THR D 4 119 ? 208.671 161.691 174.308 1.00 66.35  ? 116  THR D OG1   1 
ATOM 2943  C CG2   . THR D 4 119 ? 209.850 159.797 175.204 1.00 74.60  ? 116  THR D CG2   1 
ATOM 2944  N N     . LYS D 4 120 ? 208.354 157.641 172.959 1.00 72.35  ? 117  LYS D N     1 
ATOM 2945  C CA    . LYS D 4 120 ? 208.422 156.192 172.832 1.00 73.37  ? 117  LYS D CA    1 
ATOM 2946  C C     . LYS D 4 120 ? 208.864 155.784 171.439 1.00 74.72  ? 117  LYS D C     1 
ATOM 2947  O O     . LYS D 4 120 ? 209.570 154.787 171.265 1.00 76.67  ? 117  LYS D O     1 
ATOM 2948  C CB    . LYS D 4 120 ? 207.067 155.577 173.158 1.00 69.68  ? 117  LYS D CB    1 
ATOM 2949  C CG    . LYS D 4 120 ? 207.033 154.073 173.026 1.00 81.65  ? 117  LYS D CG    1 
ATOM 2950  C CD    . LYS D 4 120 ? 205.649 153.530 173.337 1.00 88.94  ? 117  LYS D CD    1 
ATOM 2951  C CE    . LYS D 4 120 ? 205.530 152.046 173.003 1.00 100.43 ? 117  LYS D CE    1 
ATOM 2952  N NZ    . LYS D 4 120 ? 206.429 151.183 173.818 1.00 100.84 ? 117  LYS D NZ    1 
ATOM 2953  N N     . TYR D 4 121 ? 208.463 156.552 170.431 1.00 80.64  ? 118  TYR D N     1 
ATOM 2954  C CA    . TYR D 4 121 ? 208.804 156.195 169.063 1.00 74.90  ? 118  TYR D CA    1 
ATOM 2955  C C     . TYR D 4 121 ? 210.306 156.157 168.872 1.00 86.16  ? 118  TYR D C     1 
ATOM 2956  O O     . TYR D 4 121 ? 210.871 155.128 168.488 1.00 90.22  ? 118  TYR D O     1 
ATOM 2957  C CB    . TYR D 4 121 ? 208.191 157.191 168.093 1.00 61.44  ? 118  TYR D CB    1 
ATOM 2958  C CG    . TYR D 4 121 ? 208.572 156.922 166.670 1.00 63.91  ? 118  TYR D CG    1 
ATOM 2959  C CD1   . TYR D 4 121 ? 207.893 155.987 165.924 1.00 62.67  ? 118  TYR D CD1   1 
ATOM 2960  C CD2   . TYR D 4 121 ? 209.628 157.582 166.081 1.00 58.47  ? 118  TYR D CD2   1 
ATOM 2961  C CE1   . TYR D 4 121 ? 208.233 155.738 164.628 1.00 59.86  ? 118  TYR D CE1   1 
ATOM 2962  C CE2   . TYR D 4 121 ? 209.980 157.331 164.788 1.00 64.37  ? 118  TYR D CE2   1 
ATOM 2963  C CZ    . TYR D 4 121 ? 209.278 156.409 164.066 1.00 69.99  ? 118  TYR D CZ    1 
ATOM 2964  O OH    . TYR D 4 121 ? 209.621 156.152 162.768 1.00 78.04  ? 118  TYR D OH    1 
ATOM 2965  N N     . THR D 4 122 ? 210.969 157.279 169.128 1.00 91.02  ? 119  THR D N     1 
ATOM 2966  C CA    . THR D 4 122 ? 212.417 157.329 169.001 1.00 99.70  ? 119  THR D CA    1 
ATOM 2967  C C     . THR D 4 122 ? 213.073 156.310 169.915 1.00 99.07  ? 119  THR D C     1 
ATOM 2968  O O     . THR D 4 122 ? 213.983 155.580 169.507 1.00 97.05  ? 119  THR D O     1 
ATOM 2969  C CB    . THR D 4 122 ? 212.914 158.727 169.331 1.00 98.99  ? 119  THR D CB    1 
ATOM 2970  O OG1   . THR D 4 122 ? 212.472 159.073 170.648 1.00 107.78 ? 119  THR D OG1   1 
ATOM 2971  C CG2   . THR D 4 122 ? 212.365 159.716 168.341 1.00 85.58  ? 119  THR D CG2   1 
ATOM 2972  N N     . SER D 4 123 ? 212.602 156.231 171.158 1.00 101.81 ? 120  SER D N     1 
ATOM 2973  C CA    . SER D 4 123 ? 213.220 155.335 172.123 1.00 100.28 ? 120  SER D CA    1 
ATOM 2974  C C     . SER D 4 123 ? 213.080 153.871 171.737 1.00 109.38 ? 120  SER D C     1 
ATOM 2975  O O     . SER D 4 123 ? 213.674 153.015 172.397 1.00 113.07 ? 120  SER D O     1 
ATOM 2976  C CB    . SER D 4 123 ? 212.622 155.577 173.504 1.00 90.04  ? 120  SER D CB    1 
ATOM 2977  O OG    . SER D 4 123 ? 212.898 156.896 173.937 1.00 88.72  ? 120  SER D OG    1 
ATOM 2978  N N     . ALA D 4 124 ? 212.309 153.565 170.701 1.00 109.17 ? 121  ALA D N     1 
ATOM 2979  C CA    . ALA D 4 124 ? 212.227 152.210 170.185 1.00 103.50 ? 121  ALA D CA    1 
ATOM 2980  C C     . ALA D 4 124 ? 212.343 152.220 168.666 1.00 108.45 ? 121  ALA D C     1 
ATOM 2981  O O     . ALA D 4 124 ? 212.897 153.154 168.088 1.00 105.15 ? 121  ALA D O     1 
ATOM 2982  C CB    . ALA D 4 124 ? 210.931 151.550 170.618 1.00 89.15  ? 121  ALA D CB    1 
ATOM 2983  N N     . ARG E 1 41  ? 139.580 173.121 176.079 1.00 86.19  ? 40   ARG E N     1 
ATOM 2984  C CA    . ARG E 1 41  ? 140.611 173.755 175.275 1.00 102.29 ? 40   ARG E CA    1 
ATOM 2985  C C     . ARG E 1 41  ? 141.753 174.175 176.179 1.00 100.72 ? 40   ARG E C     1 
ATOM 2986  O O     . ARG E 1 41  ? 141.535 174.608 177.310 1.00 99.10  ? 40   ARG E O     1 
ATOM 2987  C CB    . ARG E 1 41  ? 140.062 174.967 174.536 1.00 112.03 ? 40   ARG E CB    1 
ATOM 2988  C CG    . ARG E 1 41  ? 139.008 174.615 173.527 1.00 120.21 ? 40   ARG E CG    1 
ATOM 2989  C CD    . ARG E 1 41  ? 138.392 175.852 172.923 1.00 119.99 ? 40   ARG E CD    1 
ATOM 2990  N NE    . ARG E 1 41  ? 139.337 176.596 172.108 1.00 112.22 ? 40   ARG E NE    1 
ATOM 2991  C CZ    . ARG E 1 41  ? 139.578 176.321 170.834 1.00 107.92 ? 40   ARG E CZ    1 
ATOM 2992  N NH1   . ARG E 1 41  ? 138.944 175.317 170.245 1.00 103.11 ? 40   ARG E NH1   1 
ATOM 2993  N NH2   . ARG E 1 41  ? 140.451 177.045 170.150 1.00 112.13 ? 40   ARG E NH2   1 
ATOM 2994  N N     . TYR E 1 42  ? 142.975 174.039 175.681 1.00 97.37  ? 41   TYR E N     1 
ATOM 2995  C CA    . TYR E 1 42  ? 144.121 174.452 176.467 1.00 84.23  ? 41   TYR E CA    1 
ATOM 2996  C C     . TYR E 1 42  ? 144.246 175.965 176.493 1.00 80.00  ? 41   TYR E C     1 
ATOM 2997  O O     . TYR E 1 42  ? 143.724 176.670 175.635 1.00 78.73  ? 41   TYR E O     1 
ATOM 2998  C CB    . TYR E 1 42  ? 145.398 173.859 175.904 1.00 77.99  ? 41   TYR E CB    1 
ATOM 2999  C CG    . TYR E 1 42  ? 145.449 172.372 175.961 1.00 78.03  ? 41   TYR E CG    1 
ATOM 3000  C CD1   . TYR E 1 42  ? 145.885 171.724 177.100 1.00 71.99  ? 41   TYR E CD1   1 
ATOM 3001  C CD2   . TYR E 1 42  ? 145.083 171.612 174.869 1.00 76.59  ? 41   TYR E CD2   1 
ATOM 3002  C CE1   . TYR E 1 42  ? 145.946 170.362 177.156 1.00 65.56  ? 41   TYR E CE1   1 
ATOM 3003  C CE2   . TYR E 1 42  ? 145.141 170.248 174.912 1.00 76.58  ? 41   TYR E CE2   1 
ATOM 3004  C CZ    . TYR E 1 42  ? 145.573 169.627 176.060 1.00 73.15  ? 41   TYR E CZ    1 
ATOM 3005  O OH    . TYR E 1 42  ? 145.631 168.258 176.111 1.00 76.73  ? 41   TYR E OH    1 
ATOM 3006  N N     . ARG E 1 43  ? 144.954 176.459 177.494 1.00 78.71  ? 42   ARG E N     1 
ATOM 3007  C CA    . ARG E 1 43  ? 145.350 177.850 177.467 1.00 80.21  ? 42   ARG E CA    1 
ATOM 3008  C C     . ARG E 1 43  ? 146.223 178.097 176.245 1.00 80.08  ? 42   ARG E C     1 
ATOM 3009  O O     . ARG E 1 43  ? 147.265 177.455 176.089 1.00 79.13  ? 42   ARG E O     1 
ATOM 3010  C CB    . ARG E 1 43  ? 146.118 178.222 178.723 1.00 80.25  ? 42   ARG E CB    1 
ATOM 3011  C CG    . ARG E 1 43  ? 145.312 178.064 179.970 1.00 89.87  ? 42   ARG E CG    1 
ATOM 3012  C CD    . ARG E 1 43  ? 144.194 179.079 180.031 1.00 101.23 ? 42   ARG E CD    1 
ATOM 3013  N NE    . ARG E 1 43  ? 143.366 178.852 181.209 1.00 120.64 ? 42   ARG E NE    1 
ATOM 3014  C CZ    . ARG E 1 43  ? 143.661 179.300 182.422 1.00 130.64 ? 42   ARG E CZ    1 
ATOM 3015  N NH1   . ARG E 1 43  ? 144.768 180.004 182.616 1.00 129.15 ? 42   ARG E NH1   1 
ATOM 3016  N NH2   . ARG E 1 43  ? 142.853 179.039 183.440 1.00 132.79 ? 42   ARG E NH2   1 
ATOM 3017  N N     . PRO E 1 44  ? 145.819 178.994 175.352 1.00 78.09  ? 43   PRO E N     1 
ATOM 3018  C CA    . PRO E 1 44  ? 146.637 179.276 174.172 1.00 79.44  ? 43   PRO E CA    1 
ATOM 3019  C C     . PRO E 1 44  ? 148.066 179.594 174.572 1.00 79.77  ? 43   PRO E C     1 
ATOM 3020  O O     . PRO E 1 44  ? 148.320 180.255 175.578 1.00 71.63  ? 43   PRO E O     1 
ATOM 3021  C CB    . PRO E 1 44  ? 145.944 180.487 173.541 1.00 70.84  ? 43   PRO E CB    1 
ATOM 3022  C CG    . PRO E 1 44  ? 144.545 180.348 173.967 1.00 67.63  ? 43   PRO E CG    1 
ATOM 3023  C CD    . PRO E 1 44  ? 144.590 179.792 175.359 1.00 72.79  ? 43   PRO E CD    1 
ATOM 3024  N N     . GLY E 1 45  ? 149.003 179.094 173.779 1.00 76.19  ? 44   GLY E N     1 
ATOM 3025  C CA    . GLY E 1 45  ? 150.385 179.153 174.172 1.00 65.52  ? 44   GLY E CA    1 
ATOM 3026  C C     . GLY E 1 45  ? 150.876 177.934 174.909 1.00 68.96  ? 44   GLY E C     1 
ATOM 3027  O O     . GLY E 1 45  ? 152.087 177.785 175.078 1.00 70.46  ? 44   GLY E O     1 
ATOM 3028  N N     . THR E 1 46  ? 149.987 177.062 175.371 1.00 68.63  ? 45   THR E N     1 
ATOM 3029  C CA    . THR E 1 46  ? 150.470 175.820 175.951 1.00 62.91  ? 45   THR E CA    1 
ATOM 3030  C C     . THR E 1 46  ? 150.805 174.800 174.881 1.00 58.62  ? 45   THR E C     1 
ATOM 3031  O O     . THR E 1 46  ? 151.847 174.140 174.957 1.00 67.09  ? 45   THR E O     1 
ATOM 3032  C CB    . THR E 1 46  ? 149.442 175.238 176.897 1.00 64.86  ? 45   THR E CB    1 
ATOM 3033  O OG1   . THR E 1 46  ? 149.167 176.185 177.930 1.00 74.15  ? 45   THR E OG1   1 
ATOM 3034  C CG2   . THR E 1 46  ? 149.987 173.979 177.513 1.00 55.30  ? 45   THR E CG2   1 
ATOM 3035  N N     . VAL E 1 47  ? 149.940 174.663 173.877 1.00 53.59  ? 46   VAL E N     1 
ATOM 3036  C CA    . VAL E 1 47  ? 150.172 173.667 172.838 1.00 59.68  ? 46   VAL E CA    1 
ATOM 3037  C C     . VAL E 1 47  ? 151.541 173.861 172.214 1.00 64.43  ? 46   VAL E C     1 
ATOM 3038  O O     . VAL E 1 47  ? 152.254 172.893 171.930 1.00 62.91  ? 46   VAL E O     1 
ATOM 3039  C CB    . VAL E 1 47  ? 149.064 173.732 171.781 1.00 54.86  ? 46   VAL E CB    1 
ATOM 3040  C CG1   . VAL E 1 47  ? 149.356 172.762 170.670 1.00 51.34  ? 46   VAL E CG1   1 
ATOM 3041  C CG2   . VAL E 1 47  ? 147.750 173.430 172.415 1.00 57.65  ? 46   VAL E CG2   1 
ATOM 3042  N N     . ALA E 1 48  ? 151.930 175.111 171.992 1.00 65.33  ? 47   ALA E N     1 
ATOM 3043  C CA    . ALA E 1 48  ? 153.277 175.402 171.535 1.00 61.39  ? 47   ALA E CA    1 
ATOM 3044  C C     . ALA E 1 48  ? 154.267 174.744 172.473 1.00 63.72  ? 47   ALA E C     1 
ATOM 3045  O O     . ALA E 1 48  ? 154.994 173.835 172.073 1.00 59.66  ? 47   ALA E O     1 
ATOM 3046  C CB    . ALA E 1 48  ? 153.520 176.904 171.465 1.00 59.90  ? 47   ALA E CB    1 
ATOM 3047  N N     . LEU E 1 49  ? 154.255 175.151 173.739 1.00 64.11  ? 48   LEU E N     1 
ATOM 3048  C CA    . LEU E 1 49  ? 155.224 174.623 174.686 1.00 64.69  ? 48   LEU E CA    1 
ATOM 3049  C C     . LEU E 1 49  ? 155.174 173.116 174.794 1.00 67.39  ? 48   LEU E C     1 
ATOM 3050  O O     . LEU E 1 49  ? 156.052 172.529 175.430 1.00 80.84  ? 48   LEU E O     1 
ATOM 3051  C CB    . LEU E 1 49  ? 155.022 175.221 176.067 1.00 66.49  ? 48   LEU E CB    1 
ATOM 3052  C CG    . LEU E 1 49  ? 155.788 176.508 176.320 1.00 76.55  ? 48   LEU E CG    1 
ATOM 3053  C CD1   . LEU E 1 49  ? 155.283 177.594 175.418 1.00 75.59  ? 48   LEU E CD1   1 
ATOM 3054  C CD2   . LEU E 1 49  ? 155.648 176.914 177.764 1.00 82.51  ? 48   LEU E CD2   1 
ATOM 3055  N N     . ARG E 1 50  ? 154.159 172.475 174.238 1.00 57.15  ? 49   ARG E N     1 
ATOM 3056  C CA    . ARG E 1 50  ? 154.321 171.055 173.994 1.00 63.42  ? 49   ARG E CA    1 
ATOM 3057  C C     . ARG E 1 50  ? 155.079 170.808 172.696 1.00 66.16  ? 49   ARG E C     1 
ATOM 3058  O O     . ARG E 1 50  ? 155.949 169.933 172.645 1.00 62.06  ? 49   ARG E O     1 
ATOM 3059  C CB    . ARG E 1 50  ? 152.964 170.366 173.989 1.00 59.97  ? 49   ARG E CB    1 
ATOM 3060  C CG    . ARG E 1 50  ? 153.044 168.867 173.891 1.00 72.84  ? 49   ARG E CG    1 
ATOM 3061  C CD    . ARG E 1 50  ? 151.674 168.242 174.044 1.00 92.94  ? 49   ARG E CD    1 
ATOM 3062  N NE    . ARG E 1 50  ? 150.771 168.645 172.978 1.00 99.28  ? 49   ARG E NE    1 
ATOM 3063  C CZ    . ARG E 1 50  ? 149.802 169.536 173.132 1.00 95.88  ? 49   ARG E CZ    1 
ATOM 3064  N NH1   . ARG E 1 50  ? 149.615 170.108 174.311 1.00 75.59  ? 49   ARG E NH1   1 
ATOM 3065  N NH2   . ARG E 1 50  ? 149.023 169.854 172.111 1.00 102.51 ? 49   ARG E NH2   1 
ATOM 3066  N N     . GLU E 1 51  ? 154.790 171.580 171.647 1.00 60.29  ? 50   GLU E N     1 
ATOM 3067  C CA    . GLU E 1 51  ? 155.480 171.368 170.379 1.00 57.82  ? 50   GLU E CA    1 
ATOM 3068  C C     . GLU E 1 51  ? 156.982 171.516 170.534 1.00 59.13  ? 50   GLU E C     1 
ATOM 3069  O O     . GLU E 1 51  ? 157.742 170.675 170.057 1.00 56.33  ? 50   GLU E O     1 
ATOM 3070  C CB    . GLU E 1 51  ? 154.976 172.324 169.306 1.00 55.97  ? 50   GLU E CB    1 
ATOM 3071  C CG    . GLU E 1 51  ? 153.660 171.947 168.696 1.00 54.00  ? 50   GLU E CG    1 
ATOM 3072  C CD    . GLU E 1 51  ? 153.220 172.935 167.635 1.00 81.32  ? 50   GLU E CD    1 
ATOM 3073  O OE1   . GLU E 1 51  ? 153.797 174.039 167.572 1.00 83.61  ? 50   GLU E OE1   1 
ATOM 3074  O OE2   . GLU E 1 51  ? 152.317 172.598 166.843 1.00 92.54  ? 50   GLU E OE2   1 
ATOM 3075  N N     . ILE E 1 52  ? 157.433 172.590 171.176 1.00 54.07  ? 51   ILE E N     1 
ATOM 3076  C CA    . ILE E 1 52  ? 158.868 172.770 171.365 1.00 52.27  ? 51   ILE E CA    1 
ATOM 3077  C C     . ILE E 1 52  ? 159.477 171.525 171.979 1.00 51.53  ? 51   ILE E C     1 
ATOM 3078  O O     . ILE E 1 52  ? 160.399 170.923 171.419 1.00 62.17  ? 51   ILE E O     1 
ATOM 3079  C CB    . ILE E 1 52  ? 159.152 174.011 172.221 1.00 51.29  ? 51   ILE E CB    1 
ATOM 3080  C CG1   . ILE E 1 52  ? 158.908 175.268 171.407 1.00 52.61  ? 51   ILE E CG1   1 
ATOM 3081  C CG2   . ILE E 1 52  ? 160.555 173.973 172.741 1.00 43.70  ? 51   ILE E CG2   1 
ATOM 3082  C CD1   . ILE E 1 52  ? 159.042 176.511 172.219 1.00 52.65  ? 51   ILE E CD1   1 
ATOM 3083  N N     . ARG E 1 53  ? 158.947 171.095 173.120 1.00 42.41  ? 52   ARG E N     1 
ATOM 3084  C CA    . ARG E 1 53  ? 159.493 169.907 173.755 1.00 53.23  ? 52   ARG E CA    1 
ATOM 3085  C C     . ARG E 1 53  ? 159.412 168.705 172.840 1.00 59.07  ? 52   ARG E C     1 
ATOM 3086  O O     . ARG E 1 53  ? 160.160 167.741 173.017 1.00 60.37  ? 52   ARG E O     1 
ATOM 3087  C CB    . ARG E 1 53  ? 158.767 169.625 175.059 1.00 43.25  ? 52   ARG E CB    1 
ATOM 3088  C CG    . ARG E 1 53  ? 159.021 170.666 176.106 1.00 55.34  ? 52   ARG E CG    1 
ATOM 3089  C CD    . ARG E 1 53  ? 158.251 170.368 177.363 1.00 64.74  ? 52   ARG E CD    1 
ATOM 3090  N NE    . ARG E 1 53  ? 158.510 171.381 178.371 1.00 75.86  ? 52   ARG E NE    1 
ATOM 3091  C CZ    . ARG E 1 53  ? 157.890 172.552 178.411 1.00 84.67  ? 52   ARG E CZ    1 
ATOM 3092  N NH1   . ARG E 1 53  ? 156.975 172.854 177.498 1.00 77.19  ? 52   ARG E NH1   1 
ATOM 3093  N NH2   . ARG E 1 53  ? 158.187 173.424 179.361 1.00 89.34  ? 52   ARG E NH2   1 
ATOM 3094  N N     . ARG E 1 54  ? 158.512 168.729 171.865 1.00 61.34  ? 53   ARG E N     1 
ATOM 3095  C CA    . ARG E 1 54  ? 158.504 167.653 170.887 1.00 57.76  ? 53   ARG E CA    1 
ATOM 3096  C C     . ARG E 1 54  ? 159.666 167.776 169.915 1.00 62.45  ? 53   ARG E C     1 
ATOM 3097  O O     . ARG E 1 54  ? 160.433 166.829 169.729 1.00 65.01  ? 53   ARG E O     1 
ATOM 3098  C CB    . ARG E 1 54  ? 157.190 167.638 170.122 1.00 56.34  ? 53   ARG E CB    1 
ATOM 3099  C CG    . ARG E 1 54  ? 157.188 166.628 169.021 1.00 63.09  ? 53   ARG E CG    1 
ATOM 3100  C CD    . ARG E 1 54  ? 155.935 166.733 168.217 1.00 65.15  ? 53   ARG E CD    1 
ATOM 3101  N NE    . ARG E 1 54  ? 155.975 165.817 167.091 1.00 76.04  ? 53   ARG E NE    1 
ATOM 3102  C CZ    . ARG E 1 54  ? 154.970 165.634 166.249 1.00 76.99  ? 53   ARG E CZ    1 
ATOM 3103  N NH1   . ARG E 1 54  ? 153.846 166.317 166.403 1.00 70.85  ? 53   ARG E NH1   1 
ATOM 3104  N NH2   . ARG E 1 54  ? 155.092 164.775 165.249 1.00 76.48  ? 53   ARG E NH2   1 
ATOM 3105  N N     . TYR E 1 55  ? 159.817 168.935 169.285 1.00 59.16  ? 54   TYR E N     1 
ATOM 3106  C CA    . TYR E 1 55  ? 160.722 169.028 168.151 1.00 52.87  ? 54   TYR E CA    1 
ATOM 3107  C C     . TYR E 1 55  ? 162.170 169.130 168.586 1.00 58.35  ? 54   TYR E C     1 
ATOM 3108  O O     . TYR E 1 55  ? 163.047 168.531 167.958 1.00 72.92  ? 54   TYR E O     1 
ATOM 3109  C CB    . TYR E 1 55  ? 160.345 170.204 167.276 1.00 49.05  ? 54   TYR E CB    1 
ATOM 3110  C CG    . TYR E 1 55  ? 159.100 169.959 166.500 1.00 44.34  ? 54   TYR E CG    1 
ATOM 3111  C CD1   . TYR E 1 55  ? 159.154 169.354 165.270 1.00 44.34  ? 54   TYR E CD1   1 
ATOM 3112  C CD2   . TYR E 1 55  ? 157.872 170.324 166.994 1.00 41.59  ? 54   TYR E CD2   1 
ATOM 3113  C CE1   . TYR E 1 55  ? 158.027 169.128 164.549 1.00 44.89  ? 54   TYR E CE1   1 
ATOM 3114  C CE2   . TYR E 1 55  ? 156.734 170.099 166.277 1.00 52.44  ? 54   TYR E CE2   1 
ATOM 3115  C CZ    . TYR E 1 55  ? 156.819 169.500 165.054 1.00 53.27  ? 54   TYR E CZ    1 
ATOM 3116  O OH    . TYR E 1 55  ? 155.688 169.263 164.322 1.00 47.76  ? 54   TYR E OH    1 
ATOM 3117  N N     . GLN E 1 56  ? 162.453 169.867 169.653 1.00 48.84  ? 55   GLN E N     1 
ATOM 3118  C CA    . GLN E 1 56  ? 163.830 169.866 170.112 1.00 48.92  ? 55   GLN E CA    1 
ATOM 3119  C C     . GLN E 1 56  ? 164.299 168.478 170.489 1.00 52.54  ? 55   GLN E C     1 
ATOM 3120  O O     . GLN E 1 56  ? 165.495 168.279 170.704 1.00 62.30  ? 55   GLN E O     1 
ATOM 3121  C CB    . GLN E 1 56  ? 164.028 170.791 171.301 1.00 38.35  ? 55   GLN E CB    1 
ATOM 3122  C CG    . GLN E 1 56  ? 163.906 172.242 170.984 1.00 44.28  ? 55   GLN E CG    1 
ATOM 3123  C CD    . GLN E 1 56  ? 164.256 173.084 172.175 1.00 56.73  ? 55   GLN E CD    1 
ATOM 3124  O OE1   . GLN E 1 56  ? 164.187 172.623 173.307 1.00 64.51  ? 55   GLN E OE1   1 
ATOM 3125  N NE2   . GLN E 1 56  ? 164.655 174.320 171.932 1.00 51.27  ? 55   GLN E NE2   1 
ATOM 3126  N N     . LYS E 1 57  ? 163.392 167.517 170.586 1.00 46.11  ? 56   LYS E N     1 
ATOM 3127  C CA    . LYS E 1 57  ? 163.813 166.146 170.803 1.00 50.97  ? 56   LYS E CA    1 
ATOM 3128  C C     . LYS E 1 57  ? 164.395 165.551 169.531 1.00 60.16  ? 56   LYS E C     1 
ATOM 3129  O O     . LYS E 1 57  ? 165.607 165.339 169.430 1.00 59.84  ? 56   LYS E O     1 
ATOM 3130  C CB    . LYS E 1 57  ? 162.634 165.319 171.297 1.00 50.21  ? 56   LYS E CB    1 
ATOM 3131  C CG    . LYS E 1 57  ? 162.954 163.872 171.518 1.00 63.95  ? 56   LYS E CG    1 
ATOM 3132  C CD    . LYS E 1 57  ? 161.731 163.127 172.009 1.00 85.77  ? 56   LYS E CD    1 
ATOM 3133  C CE    . LYS E 1 57  ? 161.972 161.630 171.997 1.00 100.40 ? 56   LYS E CE    1 
ATOM 3134  N NZ    . LYS E 1 57  ? 163.097 161.245 172.888 1.00 106.39 ? 56   LYS E NZ    1 
ATOM 3135  N N     . SER E 1 58  ? 163.558 165.314 168.531 1.00 63.75  ? 57   SER E N     1 
ATOM 3136  C CA    . SER E 1 58  ? 163.939 164.429 167.444 1.00 60.10  ? 57   SER E CA    1 
ATOM 3137  C C     . SER E 1 58  ? 164.656 165.176 166.328 1.00 61.69  ? 57   SER E C     1 
ATOM 3138  O O     . SER E 1 58  ? 164.717 166.403 166.295 1.00 68.93  ? 57   SER E O     1 
ATOM 3139  C CB    . SER E 1 58  ? 162.703 163.731 166.891 1.00 65.53  ? 57   SER E CB    1 
ATOM 3140  O OG    . SER E 1 58  ? 161.835 164.682 166.311 1.00 79.23  ? 57   SER E OG    1 
ATOM 3141  N N     . THR E 1 59  ? 165.189 164.396 165.394 1.00 59.68  ? 58   THR E N     1 
ATOM 3142  C CA    . THR E 1 59  ? 166.122 164.877 164.390 1.00 54.78  ? 58   THR E CA    1 
ATOM 3143  C C     . THR E 1 59  ? 165.539 165.031 162.997 1.00 53.48  ? 58   THR E C     1 
ATOM 3144  O O     . THR E 1 59  ? 166.254 165.466 162.097 1.00 62.20  ? 58   THR E O     1 
ATOM 3145  C CB    . THR E 1 59  ? 167.307 163.934 164.316 1.00 56.32  ? 58   THR E CB    1 
ATOM 3146  O OG1   . THR E 1 59  ? 166.851 162.665 163.842 1.00 57.91  ? 58   THR E OG1   1 
ATOM 3147  C CG2   . THR E 1 59  ? 167.887 163.746 165.699 1.00 49.64  ? 58   THR E CG2   1 
ATOM 3148  N N     . GLU E 1 60  ? 164.285 164.674 162.783 1.00 58.40  ? 59   GLU E N     1 
ATOM 3149  C CA    . GLU E 1 60  ? 163.799 164.496 161.425 1.00 59.47  ? 59   GLU E CA    1 
ATOM 3150  C C     . GLU E 1 60  ? 163.803 165.814 160.663 1.00 60.14  ? 59   GLU E C     1 
ATOM 3151  O O     . GLU E 1 60  ? 163.896 166.897 161.238 1.00 55.53  ? 59   GLU E O     1 
ATOM 3152  C CB    . GLU E 1 60  ? 162.392 163.920 161.444 1.00 49.99  ? 59   GLU E CB    1 
ATOM 3153  C CG    . GLU E 1 60  ? 161.341 164.915 161.879 1.00 65.34  ? 59   GLU E CG    1 
ATOM 3154  C CD    . GLU E 1 60  ? 161.394 165.225 163.364 1.00 82.45  ? 59   GLU E CD    1 
ATOM 3155  O OE1   . GLU E 1 60  ? 162.335 164.769 164.049 1.00 82.07  ? 59   GLU E OE1   1 
ATOM 3156  O OE2   . GLU E 1 60  ? 160.489 165.933 163.852 1.00 90.60  ? 59   GLU E OE2   1 
ATOM 3157  N N     . LEU E 1 61  ? 163.725 165.706 159.343 1.00 60.04  ? 60   LEU E N     1 
ATOM 3158  C CA    . LEU E 1 61  ? 163.813 166.862 158.465 1.00 61.05  ? 60   LEU E CA    1 
ATOM 3159  C C     . LEU E 1 61  ? 162.438 167.483 158.293 1.00 59.19  ? 60   LEU E C     1 
ATOM 3160  O O     . LEU E 1 61  ? 161.469 166.787 157.980 1.00 75.41  ? 60   LEU E O     1 
ATOM 3161  C CB    . LEU E 1 61  ? 164.383 166.455 157.119 1.00 56.38  ? 60   LEU E CB    1 
ATOM 3162  C CG    . LEU E 1 61  ? 165.735 165.839 157.412 1.00 60.76  ? 60   LEU E CG    1 
ATOM 3163  C CD1   . LEU E 1 61  ? 166.364 165.377 156.127 1.00 56.47  ? 60   LEU E CD1   1 
ATOM 3164  C CD2   . LEU E 1 61  ? 166.599 166.830 158.164 1.00 51.29  ? 60   LEU E CD2   1 
ATOM 3165  N N     . LEU E 1 62  ? 162.364 168.791 158.460 1.00 40.55  ? 61   LEU E N     1 
ATOM 3166  C CA    . LEU E 1 62  ? 161.095 169.449 158.684 1.00 48.23  ? 61   LEU E CA    1 
ATOM 3167  C C     . LEU E 1 62  ? 160.479 170.023 157.425 1.00 57.40  ? 61   LEU E C     1 
ATOM 3168  O O     . LEU E 1 62  ? 159.422 170.649 157.506 1.00 58.24  ? 61   LEU E O     1 
ATOM 3169  C CB    . LEU E 1 62  ? 161.289 170.547 159.711 1.00 61.63  ? 61   LEU E CB    1 
ATOM 3170  C CG    . LEU E 1 62  ? 161.915 169.921 160.948 1.00 54.43  ? 61   LEU E CG    1 
ATOM 3171  C CD1   . LEU E 1 62  ? 162.153 170.961 161.997 1.00 48.39  ? 61   LEU E CD1   1 
ATOM 3172  C CD2   . LEU E 1 62  ? 161.056 168.809 161.473 1.00 39.14  ? 61   LEU E CD2   1 
ATOM 3173  N N     . ILE E 1 63  ? 161.098 169.841 156.271 1.00 56.50  ? 62   ILE E N     1 
ATOM 3174  C CA    . ILE E 1 63  ? 160.602 170.413 155.030 1.00 54.82  ? 62   ILE E CA    1 
ATOM 3175  C C     . ILE E 1 63  ? 160.287 169.280 154.074 1.00 61.60  ? 62   ILE E C     1 
ATOM 3176  O O     . ILE E 1 63  ? 161.076 168.341 153.937 1.00 58.86  ? 62   ILE E O     1 
ATOM 3177  C CB    . ILE E 1 63  ? 161.621 171.378 154.412 1.00 51.26  ? 62   ILE E CB    1 
ATOM 3178  C CG1   . ILE E 1 63  ? 161.817 172.579 155.319 1.00 58.79  ? 62   ILE E CG1   1 
ATOM 3179  C CG2   . ILE E 1 63  ? 161.150 171.839 153.074 1.00 50.85  ? 62   ILE E CG2   1 
ATOM 3180  C CD1   . ILE E 1 63  ? 162.948 173.457 154.886 1.00 43.79  ? 62   ILE E CD1   1 
ATOM 3181  N N     . ARG E 1 64  ? 159.138 169.362 153.420 1.00 53.48  ? 63   ARG E N     1 
ATOM 3182  C CA    . ARG E 1 64  ? 158.768 168.322 152.478 1.00 57.77  ? 63   ARG E CA    1 
ATOM 3183  C C     . ARG E 1 64  ? 159.779 168.254 151.352 1.00 61.91  ? 63   ARG E C     1 
ATOM 3184  O O     . ARG E 1 64  ? 160.203 169.282 150.822 1.00 63.08  ? 63   ARG E O     1 
ATOM 3185  C CB    . ARG E 1 64  ? 157.384 168.585 151.917 1.00 70.37  ? 63   ARG E CB    1 
ATOM 3186  C CG    . ARG E 1 64  ? 156.349 168.639 152.968 1.00 52.81  ? 63   ARG E CG    1 
ATOM 3187  C CD    . ARG E 1 64  ? 156.155 167.285 153.564 1.00 49.26  ? 63   ARG E CD    1 
ATOM 3188  N NE    . ARG E 1 64  ? 155.161 167.379 154.612 1.00 73.37  ? 63   ARG E NE    1 
ATOM 3189  C CZ    . ARG E 1 64  ? 155.460 167.661 155.869 1.00 72.99  ? 63   ARG E CZ    1 
ATOM 3190  N NH1   . ARG E 1 64  ? 156.723 167.859 156.211 1.00 67.38  ? 63   ARG E NH1   1 
ATOM 3191  N NH2   . ARG E 1 64  ? 154.503 167.744 156.778 1.00 79.16  ? 63   ARG E NH2   1 
ATOM 3192  N N     . LYS E 1 65  ? 160.161 167.038 150.992 1.00 50.18  ? 64   LYS E N     1 
ATOM 3193  C CA    . LYS E 1 65  ? 161.159 166.846 149.959 1.00 56.69  ? 64   LYS E CA    1 
ATOM 3194  C C     . LYS E 1 65  ? 160.752 167.549 148.680 1.00 65.25  ? 64   LYS E C     1 
ATOM 3195  O O     . LYS E 1 65  ? 161.288 168.611 148.363 1.00 81.41  ? 64   LYS E O     1 
ATOM 3196  C CB    . LYS E 1 65  ? 161.344 165.365 149.682 1.00 56.46  ? 64   LYS E CB    1 
ATOM 3197  C CG    . LYS E 1 65  ? 161.635 164.549 150.907 1.00 79.37  ? 64   LYS E CG    1 
ATOM 3198  C CD    . LYS E 1 65  ? 162.930 164.957 151.555 1.00 101.60 ? 64   LYS E CD    1 
ATOM 3199  C CE    . LYS E 1 65  ? 163.253 164.018 152.702 1.00 98.90  ? 64   LYS E CE    1 
ATOM 3200  N NZ    . LYS E 1 65  ? 164.534 164.358 153.367 1.00 86.09  ? 64   LYS E NZ    1 
ATOM 3201  N N     . LEU E 1 66  ? 159.770 167.001 147.982 1.00 57.43  ? 65   LEU E N     1 
ATOM 3202  C CA    . LEU E 1 66  ? 159.432 167.438 146.634 1.00 54.82  ? 65   LEU E CA    1 
ATOM 3203  C C     . LEU E 1 66  ? 159.325 168.948 146.484 1.00 61.34  ? 65   LEU E C     1 
ATOM 3204  O O     . LEU E 1 66  ? 159.855 169.497 145.511 1.00 73.67  ? 65   LEU E O     1 
ATOM 3205  C CB    . LEU E 1 66  ? 158.137 166.784 146.170 1.00 60.75  ? 65   LEU E CB    1 
ATOM 3206  C CG    . LEU E 1 66  ? 158.298 165.305 145.871 1.00 70.10  ? 65   LEU E CG    1 
ATOM 3207  C CD1   . LEU E 1 66  ? 156.959 164.679 145.558 1.00 63.40  ? 65   LEU E CD1   1 
ATOM 3208  C CD2   . LEU E 1 66  ? 159.239 165.154 144.701 1.00 64.95  ? 65   LEU E CD2   1 
ATOM 3209  N N     . PRO E 1 67  ? 158.667 169.661 147.394 1.00 56.68  ? 66   PRO E N     1 
ATOM 3210  C CA    . PRO E 1 67  ? 158.672 171.120 147.262 1.00 53.75  ? 66   PRO E CA    1 
ATOM 3211  C C     . PRO E 1 67  ? 160.069 171.678 147.330 1.00 55.78  ? 66   PRO E C     1 
ATOM 3212  O O     . PRO E 1 67  ? 160.472 172.468 146.470 1.00 62.31  ? 66   PRO E O     1 
ATOM 3213  C CB    . PRO E 1 67  ? 157.824 171.576 148.448 1.00 44.44  ? 66   PRO E CB    1 
ATOM 3214  C CG    . PRO E 1 67  ? 156.988 170.432 148.759 1.00 55.68  ? 66   PRO E CG    1 
ATOM 3215  C CD    . PRO E 1 67  ? 157.846 169.244 148.534 1.00 60.46  ? 66   PRO E CD    1 
ATOM 3216  N N     . PHE E 1 68  ? 160.841 171.241 148.319 1.00 51.32  ? 67   PHE E N     1 
ATOM 3217  C CA    . PHE E 1 68  ? 162.173 171.790 148.496 1.00 52.30  ? 67   PHE E CA    1 
ATOM 3218  C C     . PHE E 1 68  ? 163.043 171.496 147.294 1.00 53.46  ? 67   PHE E C     1 
ATOM 3219  O O     . PHE E 1 68  ? 163.820 172.348 146.854 1.00 52.04  ? 67   PHE E O     1 
ATOM 3220  C CB    . PHE E 1 68  ? 162.796 171.221 149.752 1.00 56.57  ? 67   PHE E CB    1 
ATOM 3221  C CG    . PHE E 1 68  ? 164.161 171.708 150.000 1.00 41.01  ? 67   PHE E CG    1 
ATOM 3222  C CD1   . PHE E 1 68  ? 164.362 172.946 150.544 1.00 40.39  ? 67   PHE E CD1   1 
ATOM 3223  C CD2   . PHE E 1 68  ? 165.245 170.927 149.708 1.00 46.23  ? 67   PHE E CD2   1 
ATOM 3224  C CE1   . PHE E 1 68  ? 165.620 173.402 150.783 1.00 42.55  ? 67   PHE E CE1   1 
ATOM 3225  C CE2   . PHE E 1 68  ? 166.505 171.380 149.948 1.00 46.09  ? 67   PHE E CE2   1 
ATOM 3226  C CZ    . PHE E 1 68  ? 166.693 172.617 150.486 1.00 43.72  ? 67   PHE E CZ    1 
ATOM 3227  N N     . GLN E 1 69  ? 162.917 170.301 146.737 1.00 44.00  ? 68   GLN E N     1 
ATOM 3228  C CA    . GLN E 1 69  ? 163.687 169.973 145.554 1.00 50.49  ? 68   GLN E CA    1 
ATOM 3229  C C     . GLN E 1 69  ? 163.285 170.857 144.390 1.00 60.49  ? 68   GLN E C     1 
ATOM 3230  O O     . GLN E 1 69  ? 164.137 171.443 143.715 1.00 69.23  ? 68   GLN E O     1 
ATOM 3231  C CB    . GLN E 1 69  ? 163.505 168.511 145.203 1.00 39.12  ? 68   GLN E CB    1 
ATOM 3232  C CG    . GLN E 1 69  ? 164.344 168.117 144.041 1.00 52.43  ? 68   GLN E CG    1 
ATOM 3233  C CD    . GLN E 1 69  ? 164.351 166.636 143.832 1.00 75.30  ? 68   GLN E CD    1 
ATOM 3234  O OE1   . GLN E 1 69  ? 163.792 165.887 144.626 1.00 80.19  ? 68   GLN E OE1   1 
ATOM 3235  N NE2   . GLN E 1 69  ? 164.992 166.195 142.760 1.00 83.02  ? 68   GLN E NE2   1 
ATOM 3236  N N     . ARG E 1 70  ? 161.984 170.969 144.139 1.00 46.69  ? 69   ARG E N     1 
ATOM 3237  C CA    . ARG E 1 70  ? 161.541 171.840 143.060 1.00 50.29  ? 69   ARG E CA    1 
ATOM 3238  C C     . ARG E 1 70  ? 162.108 173.235 143.233 1.00 58.82  ? 69   ARG E C     1 
ATOM 3239  O O     . ARG E 1 70  ? 162.564 173.855 142.267 1.00 71.48  ? 69   ARG E O     1 
ATOM 3240  C CB    . ARG E 1 70  ? 160.020 171.880 143.000 1.00 54.39  ? 69   ARG E CB    1 
ATOM 3241  C CG    . ARG E 1 70  ? 159.414 170.594 142.505 1.00 53.26  ? 69   ARG E CG    1 
ATOM 3242  C CD    . ARG E 1 70  ? 157.952 170.772 142.211 1.00 58.64  ? 69   ARG E CD    1 
ATOM 3243  N NE    . ARG E 1 70  ? 157.214 171.116 143.416 1.00 56.81  ? 69   ARG E NE    1 
ATOM 3244  C CZ    . ARG E 1 70  ? 156.774 170.216 144.283 1.00 53.42  ? 69   ARG E CZ    1 
ATOM 3245  N NH1   . ARG E 1 70  ? 157.014 168.932 144.071 1.00 44.62  ? 69   ARG E NH1   1 
ATOM 3246  N NH2   . ARG E 1 70  ? 156.101 170.594 145.358 1.00 57.45  ? 69   ARG E NH2   1 
ATOM 3247  N N     . LEU E 1 71  ? 162.121 173.730 144.466 1.00 54.57  ? 70   LEU E N     1 
ATOM 3248  C CA    . LEU E 1 71  ? 162.752 175.009 144.743 1.00 49.23  ? 70   LEU E CA    1 
ATOM 3249  C C     . LEU E 1 71  ? 164.198 175.017 144.285 1.00 51.18  ? 70   LEU E C     1 
ATOM 3250  O O     . LEU E 1 71  ? 164.603 175.850 143.466 1.00 60.60  ? 70   LEU E O     1 
ATOM 3251  C CB    . LEU E 1 71  ? 162.668 175.309 146.229 1.00 45.54  ? 70   LEU E CB    1 
ATOM 3252  C CG    . LEU E 1 71  ? 163.511 176.491 146.665 1.00 44.60  ? 70   LEU E CG    1 
ATOM 3253  C CD1   . LEU E 1 71  ? 163.092 177.712 145.923 1.00 39.40  ? 70   LEU E CD1   1 
ATOM 3254  C CD2   . LEU E 1 71  ? 163.308 176.699 148.132 1.00 37.31  ? 70   LEU E CD2   1 
ATOM 3255  N N     . VAL E 1 72  ? 164.993 174.083 144.802 1.00 42.45  ? 71   VAL E N     1 
ATOM 3256  C CA    . VAL E 1 72  ? 166.423 174.100 144.523 1.00 50.36  ? 71   VAL E CA    1 
ATOM 3257  C C     . VAL E 1 72  ? 166.672 174.098 143.028 1.00 50.57  ? 71   VAL E C     1 
ATOM 3258  O O     . VAL E 1 72  ? 167.424 174.926 142.508 1.00 50.95  ? 71   VAL E O     1 
ATOM 3259  C CB    . VAL E 1 72  ? 167.117 172.917 145.205 1.00 45.05  ? 71   VAL E CB    1 
ATOM 3260  C CG1   . VAL E 1 72  ? 168.526 172.866 144.763 1.00 38.58  ? 71   VAL E CG1   1 
ATOM 3261  C CG2   . VAL E 1 72  ? 167.060 173.088 146.689 1.00 50.74  ? 71   VAL E CG2   1 
ATOM 3262  N N     . ARG E 1 73  ? 166.026 173.188 142.309 1.00 41.62  ? 72   ARG E N     1 
ATOM 3263  C CA    . ARG E 1 73  ? 166.204 173.176 140.865 1.00 50.58  ? 72   ARG E CA    1 
ATOM 3264  C C     . ARG E 1 73  ? 165.832 174.520 140.263 1.00 56.67  ? 72   ARG E C     1 
ATOM 3265  O O     . ARG E 1 73  ? 166.586 175.080 139.457 1.00 55.69  ? 72   ARG E O     1 
ATOM 3266  C CB    . ARG E 1 73  ? 165.379 172.060 140.241 1.00 49.68  ? 72   ARG E CB    1 
ATOM 3267  C CG    . ARG E 1 73  ? 165.834 170.681 140.637 1.00 39.12  ? 72   ARG E CG    1 
ATOM 3268  C CD    . ARG E 1 73  ? 165.008 169.624 139.957 1.00 54.17  ? 72   ARG E CD    1 
ATOM 3269  N NE    . ARG E 1 73  ? 165.378 168.286 140.392 1.00 67.15  ? 72   ARG E NE    1 
ATOM 3270  C CZ    . ARG E 1 73  ? 166.377 167.587 139.873 1.00 67.59  ? 72   ARG E CZ    1 
ATOM 3271  N NH1   . ARG E 1 73  ? 167.105 168.104 138.901 1.00 50.95  ? 72   ARG E NH1   1 
ATOM 3272  N NH2   . ARG E 1 73  ? 166.649 166.373 140.322 1.00 79.79  ? 72   ARG E NH2   1 
ATOM 3273  N N     . GLU E 1 74  ? 164.687 175.068 140.666 1.00 48.50  ? 73   GLU E N     1 
ATOM 3274  C CA    . GLU E 1 74  ? 164.248 176.340 140.110 1.00 49.03  ? 73   GLU E CA    1 
ATOM 3275  C C     . GLU E 1 74  ? 165.326 177.399 140.249 1.00 54.38  ? 73   GLU E C     1 
ATOM 3276  O O     . GLU E 1 74  ? 165.606 178.140 139.304 1.00 59.25  ? 73   GLU E O     1 
ATOM 3277  C CB    . GLU E 1 74  ? 162.961 176.793 140.785 1.00 55.83  ? 73   GLU E CB    1 
ATOM 3278  C CG    . GLU E 1 74  ? 162.427 178.108 140.260 1.00 72.03  ? 73   GLU E CG    1 
ATOM 3279  C CD    . GLU E 1 74  ? 161.097 178.494 140.889 1.00 88.97  ? 73   GLU E CD    1 
ATOM 3280  O OE1   . GLU E 1 74  ? 160.592 177.728 141.729 1.00 82.23  ? 73   GLU E OE1   1 
ATOM 3281  O OE2   . GLU E 1 74  ? 160.557 179.568 140.555 1.00 99.08  ? 73   GLU E OE2   1 
ATOM 3282  N N     . ILE E 1 75  ? 165.960 177.474 141.419 1.00 61.29  ? 74   ILE E N     1 
ATOM 3283  C CA    . ILE E 1 75  ? 167.071 178.407 141.576 1.00 50.94  ? 74   ILE E CA    1 
ATOM 3284  C C     . ILE E 1 75  ? 168.208 178.040 140.644 1.00 51.16  ? 74   ILE E C     1 
ATOM 3285  O O     . ILE E 1 75  ? 168.809 178.905 139.999 1.00 54.35  ? 74   ILE E O     1 
ATOM 3286  C CB    . ILE E 1 75  ? 167.549 178.443 143.033 1.00 45.83  ? 74   ILE E CB    1 
ATOM 3287  C CG1   . ILE E 1 75  ? 166.517 179.135 143.904 1.00 48.59  ? 74   ILE E CG1   1 
ATOM 3288  C CG2   . ILE E 1 75  ? 168.873 179.138 143.135 1.00 48.97  ? 74   ILE E CG2   1 
ATOM 3289  C CD1   . ILE E 1 75  ? 166.832 179.044 145.358 1.00 54.96  ? 74   ILE E CD1   1 
ATOM 3290  N N     . ALA E 1 76  ? 168.521 176.753 140.556 1.00 54.09  ? 75   ALA E N     1 
ATOM 3291  C CA    . ALA E 1 76  ? 169.672 176.337 139.777 1.00 56.24  ? 75   ALA E CA    1 
ATOM 3292  C C     . ALA E 1 76  ? 169.562 176.771 138.330 1.00 67.17  ? 75   ALA E C     1 
ATOM 3293  O O     . ALA E 1 76  ? 170.572 177.128 137.717 1.00 73.72  ? 75   ALA E O     1 
ATOM 3294  C CB    . ALA E 1 76  ? 169.836 174.826 139.853 1.00 61.14  ? 75   ALA E CB    1 
ATOM 3295  N N     . GLN E 1 77  ? 168.351 176.756 137.767 1.00 66.02  ? 76   GLN E N     1 
ATOM 3296  C CA    . GLN E 1 77  ? 168.197 177.090 136.354 1.00 61.50  ? 76   GLN E CA    1 
ATOM 3297  C C     . GLN E 1 77  ? 168.889 178.383 135.977 1.00 72.66  ? 76   GLN E C     1 
ATOM 3298  O O     . GLN E 1 77  ? 169.496 178.461 134.905 1.00 88.16  ? 76   GLN E O     1 
ATOM 3299  C CB    . GLN E 1 77  ? 166.733 177.224 135.978 1.00 62.97  ? 76   GLN E CB    1 
ATOM 3300  C CG    . GLN E 1 77  ? 165.974 175.949 135.993 1.00 74.24  ? 76   GLN E CG    1 
ATOM 3301  C CD    . GLN E 1 77  ? 164.546 176.181 135.608 1.00 81.21  ? 76   GLN E CD    1 
ATOM 3302  O OE1   . GLN E 1 77  ? 164.039 177.295 135.734 1.00 78.78  ? 76   GLN E OE1   1 
ATOM 3303  N NE2   . GLN E 1 77  ? 163.881 175.139 135.129 1.00 74.71  ? 76   GLN E NE2   1 
ATOM 3304  N N     . ASP E 1 78  ? 168.809 179.392 136.834 1.00 72.04  ? 77   ASP E N     1 
ATOM 3305  C CA    . ASP E 1 78  ? 169.356 180.690 136.487 1.00 74.58  ? 77   ASP E CA    1 
ATOM 3306  C C     . ASP E 1 78  ? 170.814 180.592 136.082 1.00 70.61  ? 77   ASP E C     1 
ATOM 3307  O O     . ASP E 1 78  ? 171.194 181.086 135.019 1.00 83.54  ? 77   ASP E O     1 
ATOM 3308  C CB    . ASP E 1 78  ? 169.208 181.631 137.669 1.00 81.13  ? 77   ASP E CB    1 
ATOM 3309  C CG    . ASP E 1 78  ? 167.773 181.824 138.061 1.00 92.92  ? 77   ASP E CG    1 
ATOM 3310  O OD1   . ASP E 1 78  ? 166.895 181.414 137.277 1.00 97.15  ? 77   ASP E OD1   1 
ATOM 3311  O OD2   . ASP E 1 78  ? 167.521 182.383 139.147 1.00 97.28  ? 77   ASP E OD2   1 
ATOM 3312  N N     . PHE E 1 79  ? 171.631 179.927 136.889 1.00 60.75  ? 78   PHE E N     1 
ATOM 3313  C CA    . PHE E 1 79  ? 173.077 179.986 136.737 1.00 60.87  ? 78   PHE E CA    1 
ATOM 3314  C C     . PHE E 1 79  ? 173.534 179.146 135.558 1.00 66.09  ? 78   PHE E C     1 
ATOM 3315  O O     . PHE E 1 79  ? 174.116 179.666 134.607 1.00 79.06  ? 78   PHE E O     1 
ATOM 3316  C CB    . PHE E 1 79  ? 173.752 179.532 138.026 1.00 60.56  ? 78   PHE E CB    1 
ATOM 3317  C CG    . PHE E 1 79  ? 173.348 180.332 139.206 1.00 61.72  ? 78   PHE E CG    1 
ATOM 3318  C CD1   . PHE E 1 79  ? 172.731 181.551 139.044 1.00 77.10  ? 78   PHE E CD1   1 
ATOM 3319  C CD2   . PHE E 1 79  ? 173.579 179.871 140.474 1.00 62.91  ? 78   PHE E CD2   1 
ATOM 3320  C CE1   . PHE E 1 79  ? 172.346 182.283 140.115 1.00 69.64  ? 78   PHE E CE1   1 
ATOM 3321  C CE2   . PHE E 1 79  ? 173.197 180.607 141.551 1.00 67.37  ? 78   PHE E CE2   1 
ATOM 3322  C CZ    . PHE E 1 79  ? 172.583 181.816 141.373 1.00 51.98  ? 78   PHE E CZ    1 
ATOM 3323  N N     . LYS E 1 80  ? 173.296 177.851 135.612 1.00 56.20  ? 79   LYS E N     1 
ATOM 3324  C CA    . LYS E 1 80  ? 173.381 177.023 134.430 1.00 68.16  ? 79   LYS E CA    1 
ATOM 3325  C C     . LYS E 1 80  ? 172.041 176.333 134.266 1.00 82.14  ? 79   LYS E C     1 
ATOM 3326  O O     . LYS E 1 80  ? 171.238 176.273 135.197 1.00 92.11  ? 79   LYS E O     1 
ATOM 3327  C CB    . LYS E 1 80  ? 174.515 176.004 134.527 1.00 60.63  ? 79   LYS E CB    1 
ATOM 3328  C CG    . LYS E 1 80  ? 174.762 175.225 133.253 1.00 74.15  ? 79   LYS E CG    1 
ATOM 3329  C CD    . LYS E 1 80  ? 175.889 174.240 133.427 1.00 77.01  ? 79   LYS E CD    1 
ATOM 3330  C CE    . LYS E 1 80  ? 176.021 173.351 132.213 1.00 81.98  ? 79   LYS E CE    1 
ATOM 3331  N NZ    . LYS E 1 80  ? 176.372 174.131 131.003 1.00 85.37  ? 79   LYS E NZ    1 
ATOM 3332  N N     . THR E 1 81  ? 171.792 175.832 133.070 1.00 85.33  ? 80   THR E N     1 
ATOM 3333  C CA    . THR E 1 81  ? 170.564 175.121 132.783 1.00 92.53  ? 80   THR E CA    1 
ATOM 3334  C C     . THR E 1 81  ? 170.875 173.665 132.480 1.00 92.50  ? 80   THR E C     1 
ATOM 3335  O O     . THR E 1 81  ? 171.994 173.322 132.093 1.00 81.97  ? 80   THR E O     1 
ATOM 3336  C CB    . THR E 1 81  ? 169.824 175.758 131.611 1.00 86.75  ? 80   THR E CB    1 
ATOM 3337  O OG1   . THR E 1 81  ? 168.567 175.099 131.427 1.00 95.32  ? 80   THR E OG1   1 
ATOM 3338  C CG2   . THR E 1 81  ? 170.643 175.643 130.352 1.00 71.29  ? 80   THR E CG2   1 
ATOM 3339  N N     . ASP E 1 82  ? 169.872 172.811 132.678 1.00 96.12  ? 81   ASP E N     1 
ATOM 3340  C CA    . ASP E 1 82  ? 169.978 171.383 132.405 1.00 99.42  ? 81   ASP E CA    1 
ATOM 3341  C C     . ASP E 1 82  ? 171.042 170.740 133.296 1.00 86.23  ? 81   ASP E C     1 
ATOM 3342  O O     . ASP E 1 82  ? 172.114 170.339 132.848 1.00 83.34  ? 81   ASP E O     1 
ATOM 3343  C CB    . ASP E 1 82  ? 170.303 171.157 130.929 1.00 113.15 ? 81   ASP E CB    1 
ATOM 3344  C CG    . ASP E 1 82  ? 169.269 171.763 130.019 1.00 120.55 ? 81   ASP E CG    1 
ATOM 3345  O OD1   . ASP E 1 82  ? 168.167 172.082 130.510 1.00 122.50 ? 81   ASP E OD1   1 
ATOM 3346  O OD2   . ASP E 1 82  ? 169.562 171.945 128.820 1.00 119.57 ? 81   ASP E OD2   1 
ATOM 3347  N N     . LEU E 1 83  ? 170.717 170.663 134.581 1.00 71.29  ? 82   LEU E N     1 
ATOM 3348  C CA    . LEU E 1 83  ? 171.638 170.154 135.581 1.00 56.26  ? 82   LEU E CA    1 
ATOM 3349  C C     . LEU E 1 83  ? 171.122 168.876 136.217 1.00 62.31  ? 82   LEU E C     1 
ATOM 3350  O O     . LEU E 1 83  ? 169.920 168.613 136.251 1.00 56.24  ? 82   LEU E O     1 
ATOM 3351  C CB    . LEU E 1 83  ? 171.888 171.180 136.676 1.00 44.11  ? 82   LEU E CB    1 
ATOM 3352  C CG    . LEU E 1 83  ? 172.675 172.385 136.197 1.00 63.32  ? 82   LEU E CG    1 
ATOM 3353  C CD1   . LEU E 1 83  ? 172.759 173.396 137.298 1.00 71.14  ? 82   LEU E CD1   1 
ATOM 3354  C CD2   . LEU E 1 83  ? 174.053 171.945 135.785 1.00 54.28  ? 82   LEU E CD2   1 
ATOM 3355  N N     . ARG E 1 84  ? 172.057 168.090 136.725 1.00 60.22  ? 83   ARG E N     1 
ATOM 3356  C CA    . ARG E 1 84  ? 171.763 166.870 137.448 1.00 60.20  ? 83   ARG E CA    1 
ATOM 3357  C C     . ARG E 1 84  ? 172.152 167.041 138.905 1.00 59.68  ? 83   ARG E C     1 
ATOM 3358  O O     . ARG E 1 84  ? 173.214 167.589 139.208 1.00 55.38  ? 83   ARG E O     1 
ATOM 3359  C CB    . ARG E 1 84  ? 172.538 165.698 136.868 1.00 58.86  ? 83   ARG E CB    1 
ATOM 3360  C CG    . ARG E 1 84  ? 172.241 165.379 135.435 1.00 62.67  ? 83   ARG E CG    1 
ATOM 3361  C CD    . ARG E 1 84  ? 170.900 164.713 135.288 1.00 79.00  ? 83   ARG E CD    1 
ATOM 3362  N NE    . ARG E 1 84  ? 170.730 164.234 133.926 1.00 102.02 ? 83   ARG E NE    1 
ATOM 3363  C CZ    . ARG E 1 84  ? 170.192 164.954 132.954 1.00 111.37 ? 83   ARG E CZ    1 
ATOM 3364  N NH1   . ARG E 1 84  ? 169.767 166.181 133.202 1.00 107.95 ? 83   ARG E NH1   1 
ATOM 3365  N NH2   . ARG E 1 84  ? 170.080 164.447 131.738 1.00 112.21 ? 83   ARG E NH2   1 
ATOM 3366  N N     . PHE E 1 85  ? 171.309 166.552 139.803 1.00 65.21  ? 84   PHE E N     1 
ATOM 3367  C CA    . PHE E 1 85  ? 171.617 166.521 141.223 1.00 55.24  ? 84   PHE E CA    1 
ATOM 3368  C C     . PHE E 1 85  ? 171.607 165.092 141.722 1.00 52.61  ? 84   PHE E C     1 
ATOM 3369  O O     . PHE E 1 85  ? 170.623 164.375 141.530 1.00 59.62  ? 84   PHE E O     1 
ATOM 3370  C CB    . PHE E 1 85  ? 170.616 167.339 142.021 1.00 48.47  ? 84   PHE E CB    1 
ATOM 3371  C CG    . PHE E 1 85  ? 170.793 168.797 141.881 1.00 60.32  ? 84   PHE E CG    1 
ATOM 3372  C CD1   . PHE E 1 85  ? 171.965 169.312 141.406 1.00 62.75  ? 84   PHE E CD1   1 
ATOM 3373  C CD2   . PHE E 1 85  ? 169.808 169.659 142.276 1.00 55.72  ? 84   PHE E CD2   1 
ATOM 3374  C CE1   . PHE E 1 85  ? 172.137 170.657 141.302 1.00 68.07  ? 84   PHE E CE1   1 
ATOM 3375  C CE2   . PHE E 1 85  ? 169.979 171.002 142.170 1.00 51.60  ? 84   PHE E CE2   1 
ATOM 3376  C CZ    . PHE E 1 85  ? 171.145 171.501 141.684 1.00 62.50  ? 84   PHE E CZ    1 
ATOM 3377  N N     . GLN E 1 86  ? 172.687 164.679 142.364 1.00 56.69  ? 85   GLN E N     1 
ATOM 3378  C CA    . GLN E 1 86  ? 172.595 163.498 143.197 1.00 54.00  ? 85   GLN E CA    1 
ATOM 3379  C C     . GLN E 1 86  ? 171.627 163.773 144.326 1.00 62.12  ? 85   GLN E C     1 
ATOM 3380  O O     . GLN E 1 86  ? 171.660 164.840 144.941 1.00 63.74  ? 85   GLN E O     1 
ATOM 3381  C CB    . GLN E 1 86  ? 173.948 163.126 143.772 1.00 48.78  ? 85   GLN E CB    1 
ATOM 3382  C CG    . GLN E 1 86  ? 174.921 162.605 142.780 1.00 51.38  ? 85   GLN E CG    1 
ATOM 3383  C CD    . GLN E 1 86  ? 176.256 162.331 143.414 1.00 64.30  ? 85   GLN E CD    1 
ATOM 3384  O OE1   . GLN E 1 86  ? 176.620 162.953 144.408 1.00 53.42  ? 85   GLN E OE1   1 
ATOM 3385  N NE2   . GLN E 1 86  ? 176.989 161.382 142.857 1.00 65.64  ? 85   GLN E NE2   1 
ATOM 3386  N N     . SER E 1 87  ? 170.751 162.808 144.589 1.00 57.22  ? 86   SER E N     1 
ATOM 3387  C CA    . SER E 1 87  ? 169.795 162.961 145.675 1.00 50.41  ? 86   SER E CA    1 
ATOM 3388  C C     . SER E 1 87  ? 170.495 163.406 146.943 1.00 54.72  ? 86   SER E C     1 
ATOM 3389  O O     . SER E 1 87  ? 170.051 164.337 147.623 1.00 62.69  ? 86   SER E O     1 
ATOM 3390  C CB    . SER E 1 87  ? 169.081 161.646 145.919 1.00 49.65  ? 86   SER E CB    1 
ATOM 3391  O OG    . SER E 1 87  ? 170.018 160.697 146.384 1.00 65.42  ? 86   SER E OG    1 
ATOM 3392  N N     . SER E 1 88  ? 171.613 162.760 147.261 1.00 51.97  ? 87   SER E N     1 
ATOM 3393  C CA    . SER E 1 88  ? 172.335 163.104 148.473 1.00 56.79  ? 87   SER E CA    1 
ATOM 3394  C C     . SER E 1 88  ? 172.695 164.576 148.513 1.00 56.74  ? 87   SER E C     1 
ATOM 3395  O O     . SER E 1 88  ? 172.705 165.181 149.588 1.00 49.63  ? 87   SER E O     1 
ATOM 3396  C CB    . SER E 1 88  ? 173.591 162.258 148.584 1.00 46.25  ? 87   SER E CB    1 
ATOM 3397  O OG    . SER E 1 88  ? 174.449 162.543 147.503 1.00 65.66  ? 87   SER E OG    1 
ATOM 3398  N N     . ALA E 1 89  ? 172.984 165.178 147.364 1.00 50.83  ? 88   ALA E N     1 
ATOM 3399  C CA    . ALA E 1 89  ? 173.293 166.600 147.362 1.00 47.96  ? 88   ALA E CA    1 
ATOM 3400  C C     . ALA E 1 89  ? 172.094 167.406 147.827 1.00 53.54  ? 88   ALA E C     1 
ATOM 3401  O O     . ALA E 1 89  ? 172.186 168.202 148.767 1.00 58.40  ? 88   ALA E O     1 
ATOM 3402  C CB    . ALA E 1 89  ? 173.736 167.041 145.974 1.00 46.79  ? 88   ALA E CB    1 
ATOM 3403  N N     . VAL E 1 90  ? 170.949 167.204 147.183 1.00 47.34  ? 89   VAL E N     1 
ATOM 3404  C CA    . VAL E 1 90  ? 169.733 167.872 147.627 1.00 48.99  ? 89   VAL E CA    1 
ATOM 3405  C C     . VAL E 1 90  ? 169.564 167.702 149.124 1.00 55.93  ? 89   VAL E C     1 
ATOM 3406  O O     . VAL E 1 90  ? 169.300 168.664 149.855 1.00 67.47  ? 89   VAL E O     1 
ATOM 3407  C CB    . VAL E 1 90  ? 168.520 167.328 146.867 1.00 49.44  ? 89   VAL E CB    1 
ATOM 3408  C CG1   . VAL E 1 90  ? 167.272 167.879 147.464 1.00 52.42  ? 89   VAL E CG1   1 
ATOM 3409  C CG2   . VAL E 1 90  ? 168.621 167.727 145.437 1.00 57.35  ? 89   VAL E CG2   1 
ATOM 3410  N N     . MET E 1 91  ? 169.747 166.474 149.605 1.00 43.22  ? 90   MET E N     1 
ATOM 3411  C CA    . MET E 1 91  ? 169.746 166.243 151.041 1.00 51.69  ? 90   MET E CA    1 
ATOM 3412  C C     . MET E 1 91  ? 170.682 167.200 151.747 1.00 56.60  ? 90   MET E C     1 
ATOM 3413  O O     . MET E 1 91  ? 170.350 167.733 152.809 1.00 67.36  ? 90   MET E O     1 
ATOM 3414  C CB    . MET E 1 91  ? 170.148 164.810 151.341 1.00 57.93  ? 90   MET E CB    1 
ATOM 3415  C CG    . MET E 1 91  ? 169.162 163.819 150.834 1.00 66.91  ? 90   MET E CG    1 
ATOM 3416  S SD    . MET E 1 91  ? 167.590 164.137 151.616 1.00 79.24  ? 90   MET E SD    1 
ATOM 3417  C CE    . MET E 1 91  ? 168.037 163.758 153.300 1.00 311.39 ? 90   MET E CE    1 
ATOM 3418  N N     . ALA E 1 92  ? 171.851 167.450 151.169 1.00 45.31  ? 91   ALA E N     1 
ATOM 3419  C CA    . ALA E 1 92  ? 172.777 168.361 151.817 1.00 43.99  ? 91   ALA E CA    1 
ATOM 3420  C C     . ALA E 1 92  ? 172.180 169.750 151.914 1.00 54.36  ? 91   ALA E C     1 
ATOM 3421  O O     . ALA E 1 92  ? 172.098 170.327 153.001 1.00 49.19  ? 91   ALA E O     1 
ATOM 3422  C CB    . ALA E 1 92  ? 174.103 168.393 151.074 1.00 36.59  ? 91   ALA E CB    1 
ATOM 3423  N N     . LEU E 1 93  ? 171.728 170.294 150.788 1.00 59.37  ? 92   LEU E N     1 
ATOM 3424  C CA    . LEU E 1 93  ? 171.164 171.635 150.821 1.00 52.95  ? 92   LEU E CA    1 
ATOM 3425  C C     . LEU E 1 93  ? 170.073 171.748 151.861 1.00 59.23  ? 92   LEU E C     1 
ATOM 3426  O O     . LEU E 1 93  ? 170.019 172.725 152.613 1.00 68.80  ? 92   LEU E O     1 
ATOM 3427  C CB    . LEU E 1 93  ? 170.621 172.014 149.460 1.00 53.78  ? 92   LEU E CB    1 
ATOM 3428  C CG    . LEU E 1 93  ? 171.751 172.183 148.476 1.00 49.96  ? 92   LEU E CG    1 
ATOM 3429  C CD1   . LEU E 1 93  ? 171.204 172.514 147.127 1.00 42.76  ? 92   LEU E CD1   1 
ATOM 3430  C CD2   . LEU E 1 93  ? 172.613 173.285 148.980 1.00 34.15  ? 92   LEU E CD2   1 
ATOM 3431  N N     . GLN E 1 94  ? 169.202 170.752 151.937 1.00 57.51  ? 93   GLN E N     1 
ATOM 3432  C CA    . GLN E 1 94  ? 168.175 170.788 152.962 1.00 49.19  ? 93   GLN E CA    1 
ATOM 3433  C C     . GLN E 1 94  ? 168.792 170.815 154.350 1.00 53.43  ? 93   GLN E C     1 
ATOM 3434  O O     . GLN E 1 94  ? 168.422 171.642 155.189 1.00 53.70  ? 93   GLN E O     1 
ATOM 3435  C CB    . GLN E 1 94  ? 167.247 169.598 152.806 1.00 36.93  ? 93   GLN E CB    1 
ATOM 3436  C CG    . GLN E 1 94  ? 166.132 169.618 153.781 1.00 43.68  ? 93   GLN E CG    1 
ATOM 3437  C CD    . GLN E 1 94  ? 165.150 168.529 153.512 1.00 53.95  ? 93   GLN E CD    1 
ATOM 3438  O OE1   . GLN E 1 94  ? 165.241 167.841 152.502 1.00 54.92  ? 93   GLN E OE1   1 
ATOM 3439  N NE2   . GLN E 1 94  ? 164.208 168.343 154.423 1.00 59.70  ? 93   GLN E NE2   1 
ATOM 3440  N N     . GLU E 1 95  ? 169.746 169.925 154.606 1.00 50.76  ? 94   GLU E N     1 
ATOM 3441  C CA    . GLU E 1 95  ? 170.380 169.885 155.914 1.00 47.60  ? 94   GLU E CA    1 
ATOM 3442  C C     . GLU E 1 95  ? 170.924 171.240 156.309 1.00 50.88  ? 94   GLU E C     1 
ATOM 3443  O O     . GLU E 1 95  ? 170.614 171.762 157.382 1.00 54.49  ? 94   GLU E O     1 
ATOM 3444  C CB    . GLU E 1 95  ? 171.506 168.872 155.922 1.00 52.20  ? 94   GLU E CB    1 
ATOM 3445  C CG    . GLU E 1 95  ? 171.048 167.469 155.836 1.00 62.85  ? 94   GLU E CG    1 
ATOM 3446  C CD    . GLU E 1 95  ? 170.120 167.120 156.961 1.00 72.63  ? 94   GLU E CD    1 
ATOM 3447  O OE1   . GLU E 1 95  ? 170.293 167.678 158.065 1.00 71.98  ? 94   GLU E OE1   1 
ATOM 3448  O OE2   . GLU E 1 95  ? 169.248 166.253 156.758 1.00 62.98  ? 94   GLU E OE2   1 
ATOM 3449  N N     . ALA E 1 96  ? 171.757 171.820 155.457 1.00 40.38  ? 95   ALA E N     1 
ATOM 3450  C CA    . ALA E 1 96  ? 172.341 173.107 155.793 1.00 45.43  ? 95   ALA E CA    1 
ATOM 3451  C C     . ALA E 1 96  ? 171.265 174.158 155.971 1.00 51.35  ? 95   ALA E C     1 
ATOM 3452  O O     . ALA E 1 96  ? 171.344 174.986 156.880 1.00 52.08  ? 95   ALA E O     1 
ATOM 3453  C CB    . ALA E 1 96  ? 173.323 173.536 154.714 1.00 32.92  ? 95   ALA E CB    1 
ATOM 3454  N N     . SER E 1 97  ? 170.251 174.134 155.117 1.00 39.24  ? 96   SER E N     1 
ATOM 3455  C CA    . SER E 1 97  ? 169.176 175.107 155.188 1.00 47.33  ? 96   SER E CA    1 
ATOM 3456  C C     . SER E 1 97  ? 168.518 175.075 156.550 1.00 53.51  ? 96   SER E C     1 
ATOM 3457  O O     . SER E 1 97  ? 168.646 176.022 157.332 1.00 50.17  ? 96   SER E O     1 
ATOM 3458  C CB    . SER E 1 97  ? 168.145 174.828 154.111 1.00 43.58  ? 96   SER E CB    1 
ATOM 3459  O OG    . SER E 1 97  ? 168.740 174.950 152.841 1.00 55.75  ? 96   SER E OG    1 
ATOM 3460  N N     . GLU E 1 98  ? 167.816 173.984 156.840 1.00 52.49  ? 97   GLU E N     1 
ATOM 3461  C CA    . GLU E 1 98  ? 167.164 173.867 158.134 1.00 54.94  ? 97   GLU E CA    1 
ATOM 3462  C C     . GLU E 1 98  ? 168.137 174.192 159.253 1.00 52.52  ? 97   GLU E C     1 
ATOM 3463  O O     . GLU E 1 98  ? 167.862 175.040 160.107 1.00 57.78  ? 97   GLU E O     1 
ATOM 3464  C CB    . GLU E 1 98  ? 166.577 172.468 158.298 1.00 59.21  ? 97   GLU E CB    1 
ATOM 3465  C CG    . GLU E 1 98  ? 165.376 172.211 157.392 1.00 72.26  ? 97   GLU E CG    1 
ATOM 3466  C CD    . GLU E 1 98  ? 164.789 170.807 157.535 1.00 85.46  ? 97   GLU E CD    1 
ATOM 3467  O OE1   . GLU E 1 98  ? 165.446 169.940 158.149 1.00 90.38  ? 97   GLU E OE1   1 
ATOM 3468  O OE2   . GLU E 1 98  ? 163.657 170.574 157.049 1.00 76.25  ? 97   GLU E OE2   1 
ATOM 3469  N N     . ALA E 1 99  ? 169.321 173.599 159.208 1.00 46.25  ? 98   ALA E N     1 
ATOM 3470  C CA    . ALA E 1 99  ? 170.298 173.836 160.255 1.00 40.98  ? 98   ALA E CA    1 
ATOM 3471  C C     . ALA E 1 99  ? 170.772 175.274 160.303 1.00 47.01  ? 98   ALA E C     1 
ATOM 3472  O O     . ALA E 1 99  ? 171.505 175.637 161.224 1.00 47.00  ? 98   ALA E O     1 
ATOM 3473  C CB    . ALA E 1 99  ? 171.490 172.916 160.066 1.00 31.99  ? 98   ALA E CB    1 
ATOM 3474  N N     . TYR E 1 100 ? 170.392 176.090 159.331 1.00 42.86  ? 99   TYR E N     1 
ATOM 3475  C CA    . TYR E 1 100 ? 170.683 177.512 159.354 1.00 39.09  ? 99   TYR E CA    1 
ATOM 3476  C C     . TYR E 1 100 ? 169.509 178.298 159.913 1.00 47.50  ? 99   TYR E C     1 
ATOM 3477  O O     . TYR E 1 100 ? 169.644 178.979 160.935 1.00 43.31  ? 99   TYR E O     1 
ATOM 3478  C CB    . TYR E 1 100 ? 171.061 177.982 157.954 1.00 42.90  ? 99   TYR E CB    1 
ATOM 3479  C CG    . TYR E 1 100 ? 171.127 179.463 157.782 1.00 49.82  ? 99   TYR E CG    1 
ATOM 3480  C CD1   . TYR E 1 100 ? 172.027 180.221 158.497 1.00 38.55  ? 99   TYR E CD1   1 
ATOM 3481  C CD2   . TYR E 1 100 ? 170.368 180.087 156.818 1.00 48.29  ? 99   TYR E CD2   1 
ATOM 3482  C CE1   . TYR E 1 100 ? 172.106 181.575 158.315 1.00 46.37  ? 99   TYR E CE1   1 
ATOM 3483  C CE2   . TYR E 1 100 ? 170.448 181.430 156.615 1.00 49.44  ? 99   TYR E CE2   1 
ATOM 3484  C CZ    . TYR E 1 100 ? 171.315 182.174 157.366 1.00 63.65  ? 99   TYR E CZ    1 
ATOM 3485  O OH    . TYR E 1 100 ? 171.390 183.526 157.164 1.00 75.25  ? 99   TYR E OH    1 
ATOM 3486  N N     . LEU E 1 101 ? 168.352 178.204 159.261 1.00 47.79  ? 100  LEU E N     1 
ATOM 3487  C CA    . LEU E 1 101 ? 167.177 178.882 159.780 1.00 54.51  ? 100  LEU E CA    1 
ATOM 3488  C C     . LEU E 1 101 ? 167.002 178.632 161.261 1.00 49.93  ? 100  LEU E C     1 
ATOM 3489  O O     . LEU E 1 101 ? 166.626 179.539 162.003 1.00 41.21  ? 100  LEU E O     1 
ATOM 3490  C CB    . LEU E 1 101 ? 165.934 178.439 159.036 1.00 55.10  ? 100  LEU E CB    1 
ATOM 3491  C CG    . LEU E 1 101 ? 165.966 178.907 157.605 1.00 52.74  ? 100  LEU E CG    1 
ATOM 3492  C CD1   . LEU E 1 101 ? 164.708 178.479 156.911 1.00 45.95  ? 100  LEU E CD1   1 
ATOM 3493  C CD2   . LEU E 1 101 ? 166.091 180.389 157.622 1.00 49.93  ? 100  LEU E CD2   1 
ATOM 3494  N N     . VAL E 1 102 ? 167.279 177.416 161.719 1.00 46.62  ? 101  VAL E N     1 
ATOM 3495  C CA    . VAL E 1 102 ? 167.111 177.134 163.137 1.00 43.62  ? 101  VAL E CA    1 
ATOM 3496  C C     . VAL E 1 102 ? 167.921 178.110 163.968 1.00 54.43  ? 101  VAL E C     1 
ATOM 3497  O O     . VAL E 1 102 ? 167.371 178.862 164.777 1.00 65.41  ? 101  VAL E O     1 
ATOM 3498  C CB    . VAL E 1 102 ? 167.498 175.689 163.457 1.00 38.27  ? 101  VAL E CB    1 
ATOM 3499  C CG1   . VAL E 1 102 ? 167.537 175.518 164.934 1.00 34.55  ? 101  VAL E CG1   1 
ATOM 3500  C CG2   . VAL E 1 102 ? 166.484 174.767 162.882 1.00 34.89  ? 101  VAL E CG2   1 
ATOM 3501  N N     . GLY E 1 103 ? 169.236 178.135 163.764 1.00 49.80  ? 102  GLY E N     1 
ATOM 3502  C CA    . GLY E 1 103 ? 170.070 179.043 164.541 1.00 41.74  ? 102  GLY E CA    1 
ATOM 3503  C C     . GLY E 1 103 ? 169.577 180.469 164.401 1.00 51.61  ? 102  GLY E C     1 
ATOM 3504  O O     . GLY E 1 103 ? 169.543 181.230 165.379 1.00 46.21  ? 102  GLY E O     1 
ATOM 3505  N N     . LEU E 1 104 ? 169.154 180.834 163.194 1.00 55.00  ? 103  LEU E N     1 
ATOM 3506  C CA    . LEU E 1 104 ? 168.612 182.165 162.982 1.00 42.06  ? 103  LEU E CA    1 
ATOM 3507  C C     . LEU E 1 104 ? 167.475 182.451 163.950 1.00 49.28  ? 103  LEU E C     1 
ATOM 3508  O O     . LEU E 1 104 ? 167.470 183.477 164.634 1.00 54.69  ? 103  LEU E O     1 
ATOM 3509  C CB    . LEU E 1 104 ? 168.135 182.301 161.546 1.00 44.90  ? 103  LEU E CB    1 
ATOM 3510  C CG    . LEU E 1 104 ? 167.589 183.680 161.266 1.00 41.02  ? 103  LEU E CG    1 
ATOM 3511  C CD1   . LEU E 1 104 ? 168.715 184.622 161.489 1.00 39.51  ? 103  LEU E CD1   1 
ATOM 3512  C CD2   . LEU E 1 104 ? 167.098 183.779 159.854 1.00 45.95  ? 103  LEU E CD2   1 
ATOM 3513  N N     . PHE E 1 105 ? 166.510 181.538 164.038 1.00 45.35  ? 104  PHE E N     1 
ATOM 3514  C CA    . PHE E 1 105 ? 165.377 181.751 164.926 1.00 47.63  ? 104  PHE E CA    1 
ATOM 3515  C C     . PHE E 1 105 ? 165.788 181.733 166.383 1.00 51.92  ? 104  PHE E C     1 
ATOM 3516  O O     . PHE E 1 105 ? 165.208 182.453 167.196 1.00 53.76  ? 104  PHE E O     1 
ATOM 3517  C CB    . PHE E 1 105 ? 164.299 180.721 164.658 1.00 44.80  ? 104  PHE E CB    1 
ATOM 3518  C CG    . PHE E 1 105 ? 163.497 181.025 163.463 1.00 55.89  ? 104  PHE E CG    1 
ATOM 3519  C CD1   . PHE E 1 105 ? 163.399 182.313 163.022 1.00 53.02  ? 104  PHE E CD1   1 
ATOM 3520  C CD2   . PHE E 1 105 ? 162.845 180.039 162.774 1.00 54.62  ? 104  PHE E CD2   1 
ATOM 3521  C CE1   . PHE E 1 105 ? 162.657 182.614 161.925 1.00 49.52  ? 104  PHE E CE1   1 
ATOM 3522  C CE2   . PHE E 1 105 ? 162.103 180.338 161.670 1.00 46.01  ? 104  PHE E CE2   1 
ATOM 3523  C CZ    . PHE E 1 105 ? 162.011 181.627 161.245 1.00 42.36  ? 104  PHE E CZ    1 
ATOM 3524  N N     . GLU E 1 106 ? 166.765 180.912 166.748 1.00 48.20  ? 105  GLU E N     1 
ATOM 3525  C CA    . GLU E 1 106 ? 167.316 181.027 168.090 1.00 49.71  ? 105  GLU E CA    1 
ATOM 3526  C C     . GLU E 1 106 ? 167.702 182.464 168.387 1.00 63.07  ? 105  GLU E C     1 
ATOM 3527  O O     . GLU E 1 106 ? 167.146 183.108 169.286 1.00 62.64  ? 105  GLU E O     1 
ATOM 3528  C CB    . GLU E 1 106 ? 168.523 180.117 168.251 1.00 46.52  ? 105  GLU E CB    1 
ATOM 3529  C CG    . GLU E 1 106 ? 168.190 178.665 168.424 1.00 64.91  ? 105  GLU E CG    1 
ATOM 3530  C CD    . GLU E 1 106 ? 169.431 177.795 168.437 1.00 80.97  ? 105  GLU E CD    1 
ATOM 3531  O OE1   . GLU E 1 106 ? 170.494 178.270 167.983 1.00 85.84  ? 105  GLU E OE1   1 
ATOM 3532  O OE2   . GLU E 1 106 ? 169.353 176.649 168.930 1.00 82.53  ? 105  GLU E OE2   1 
ATOM 3533  N N     . ASP E 1 107 ? 168.653 182.989 167.623 1.00 63.12  ? 106  ASP E N     1 
ATOM 3534  C CA    . ASP E 1 107 ? 169.162 184.318 167.927 1.00 55.89  ? 106  ASP E CA    1 
ATOM 3535  C C     . ASP E 1 107 ? 168.050 185.356 167.882 1.00 61.56  ? 106  ASP E C     1 
ATOM 3536  O O     . ASP E 1 107 ? 167.893 186.160 168.811 1.00 69.86  ? 106  ASP E O     1 
ATOM 3537  C CB    . ASP E 1 107 ? 170.279 184.663 166.958 1.00 51.86  ? 106  ASP E CB    1 
ATOM 3538  C CG    . ASP E 1 107 ? 171.476 183.766 167.129 1.00 75.01  ? 106  ASP E CG    1 
ATOM 3539  O OD1   . ASP E 1 107 ? 171.515 183.034 168.139 1.00 84.51  ? 106  ASP E OD1   1 
ATOM 3540  O OD2   . ASP E 1 107 ? 172.386 183.799 166.276 1.00 74.52  ? 106  ASP E OD2   1 
ATOM 3541  N N     . THR E 1 108 ? 167.250 185.336 166.818 1.00 55.77  ? 107  THR E N     1 
ATOM 3542  C CA    . THR E 1 108 ? 166.108 186.233 166.740 1.00 52.12  ? 107  THR E CA    1 
ATOM 3543  C C     . THR E 1 108 ? 165.313 186.202 168.023 1.00 59.72  ? 107  THR E C     1 
ATOM 3544  O O     . THR E 1 108 ? 165.040 187.241 168.629 1.00 51.91  ? 107  THR E O     1 
ATOM 3545  C CB    . THR E 1 108 ? 165.215 185.834 165.584 1.00 54.28  ? 107  THR E CB    1 
ATOM 3546  O OG1   . THR E 1 108 ? 165.916 186.027 164.359 1.00 62.55  ? 107  THR E OG1   1 
ATOM 3547  C CG2   . THR E 1 108 ? 163.988 186.670 165.589 1.00 59.23  ? 107  THR E CG2   1 
ATOM 3548  N N     . ASN E 1 109 ? 164.963 185.005 168.468 1.00 61.40  ? 108  ASN E N     1 
ATOM 3549  C CA    . ASN E 1 109 ? 164.246 184.869 169.720 1.00 52.16  ? 108  ASN E CA    1 
ATOM 3550  C C     . ASN E 1 109 ? 164.962 185.593 170.841 1.00 59.97  ? 108  ASN E C     1 
ATOM 3551  O O     . ASN E 1 109 ? 164.324 186.272 171.651 1.00 59.47  ? 108  ASN E O     1 
ATOM 3552  C CB    . ASN E 1 109 ? 164.076 183.402 170.061 1.00 49.36  ? 108  ASN E CB    1 
ATOM 3553  C CG    . ASN E 1 109 ? 163.172 183.200 171.219 1.00 61.50  ? 108  ASN E CG    1 
ATOM 3554  O OD1   . ASN E 1 109 ? 162.288 184.006 171.462 1.00 59.58  ? 108  ASN E OD1   1 
ATOM 3555  N ND2   . ASN E 1 109 ? 163.375 182.119 171.951 1.00 72.28  ? 108  ASN E ND2   1 
ATOM 3556  N N     . LEU E 1 110 ? 166.289 185.484 170.900 1.00 56.37  ? 109  LEU E N     1 
ATOM 3557  C CA    . LEU E 1 110 ? 167.012 186.259 171.900 1.00 59.22  ? 109  LEU E CA    1 
ATOM 3558  C C     . LEU E 1 110 ? 166.718 187.739 171.766 1.00 73.49  ? 109  LEU E C     1 
ATOM 3559  O O     . LEU E 1 110 ? 166.538 188.439 172.767 1.00 74.93  ? 109  LEU E O     1 
ATOM 3560  C CB    . LEU E 1 110 ? 168.505 186.011 171.809 1.00 55.00  ? 109  LEU E CB    1 
ATOM 3561  C CG    . LEU E 1 110 ? 168.840 184.669 172.408 1.00 60.66  ? 109  LEU E CG    1 
ATOM 3562  C CD1   . LEU E 1 110 ? 170.290 184.377 172.210 1.00 49.35  ? 109  LEU E CD1   1 
ATOM 3563  C CD2   . LEU E 1 110 ? 168.514 184.756 173.871 1.00 37.71  ? 109  LEU E CD2   1 
ATOM 3564  N N     . CYS E 1 111 ? 166.649 188.240 170.537 1.00 71.12  ? 110  CYS E N     1 
ATOM 3565  C CA    . CYS E 1 111 ? 166.356 189.657 170.372 1.00 62.68  ? 110  CYS E CA    1 
ATOM 3566  C C     . CYS E 1 111 ? 164.962 189.989 170.876 1.00 66.47  ? 110  CYS E C     1 
ATOM 3567  O O     . CYS E 1 111 ? 164.781 190.884 171.708 1.00 66.08  ? 110  CYS E O     1 
ATOM 3568  C CB    . CYS E 1 111 ? 166.516 190.065 168.916 1.00 53.06  ? 110  CYS E CB    1 
ATOM 3569  S SG    . CYS E 1 111 ? 168.218 190.021 168.372 1.00 61.02  ? 110  CYS E SG    1 
ATOM 3570  N N     . ALA E 1 112 ? 163.957 189.274 170.380 1.00 58.44  ? 111  ALA E N     1 
ATOM 3571  C CA    . ALA E 1 112 ? 162.596 189.572 170.789 1.00 57.87  ? 111  ALA E CA    1 
ATOM 3572  C C     . ALA E 1 112 ? 162.471 189.567 172.299 1.00 62.56  ? 111  ALA E C     1 
ATOM 3573  O O     . ALA E 1 112 ? 161.853 190.463 172.878 1.00 64.87  ? 111  ALA E O     1 
ATOM 3574  C CB    . ALA E 1 112 ? 161.631 188.575 170.171 1.00 49.39  ? 111  ALA E CB    1 
ATOM 3575  N N     . ILE E 1 113 ? 163.074 188.582 172.960 1.00 61.25  ? 112  ILE E N     1 
ATOM 3576  C CA    . ILE E 1 113 ? 163.055 188.580 174.418 1.00 62.50  ? 112  ILE E CA    1 
ATOM 3577  C C     . ILE E 1 113 ? 163.728 189.824 174.960 1.00 65.61  ? 112  ILE E C     1 
ATOM 3578  O O     . ILE E 1 113 ? 163.248 190.442 175.914 1.00 72.27  ? 112  ILE E O     1 
ATOM 3579  C CB    . ILE E 1 113 ? 163.715 187.312 174.968 1.00 56.94  ? 112  ILE E CB    1 
ATOM 3580  C CG1   . ILE E 1 113 ? 162.815 186.119 174.715 1.00 49.64  ? 112  ILE E CG1   1 
ATOM 3581  C CG2   . ILE E 1 113 ? 164.006 187.467 176.434 1.00 42.79  ? 112  ILE E CG2   1 
ATOM 3582  C CD1   . ILE E 1 113 ? 163.457 184.826 175.037 1.00 50.22  ? 112  ILE E CD1   1 
ATOM 3583  N N     . HIS E 1 114 ? 164.846 190.215 174.363 1.00 64.25  ? 113  HIS E N     1 
ATOM 3584  C CA    . HIS E 1 114 ? 165.479 191.444 174.798 1.00 62.21  ? 113  HIS E CA    1 
ATOM 3585  C C     . HIS E 1 114 ? 164.536 192.624 174.720 1.00 66.96  ? 113  HIS E C     1 
ATOM 3586  O O     . HIS E 1 114 ? 164.676 193.566 175.499 1.00 74.90  ? 113  HIS E O     1 
ATOM 3587  C CB    . HIS E 1 114 ? 166.699 191.737 173.952 1.00 60.74  ? 113  HIS E CB    1 
ATOM 3588  C CG    . HIS E 1 114 ? 167.410 192.979 174.357 1.00 70.19  ? 113  HIS E CG    1 
ATOM 3589  N ND1   . HIS E 1 114 ? 168.065 193.095 175.561 1.00 71.78  ? 113  HIS E ND1   1 
ATOM 3590  C CD2   . HIS E 1 114 ? 167.534 194.175 173.741 1.00 76.61  ? 113  HIS E CD2   1 
ATOM 3591  C CE1   . HIS E 1 114 ? 168.591 194.301 175.656 1.00 78.18  ? 113  HIS E CE1   1 
ATOM 3592  N NE2   . HIS E 1 114 ? 168.280 194.977 174.566 1.00 79.21  ? 113  HIS E NE2   1 
ATOM 3593  N N     . ALA E 1 115 ? 163.572 192.589 173.815 1.00 66.26  ? 114  ALA E N     1 
ATOM 3594  C CA    . ALA E 1 115 ? 162.645 193.695 173.643 1.00 59.80  ? 114  ALA E CA    1 
ATOM 3595  C C     . ALA E 1 115 ? 161.444 193.594 174.559 1.00 71.94  ? 114  ALA E C     1 
ATOM 3596  O O     . ALA E 1 115 ? 160.503 194.374 174.411 1.00 62.56  ? 114  ALA E O     1 
ATOM 3597  C CB    . ALA E 1 115 ? 162.173 193.777 172.193 1.00 61.13  ? 114  ALA E CB    1 
ATOM 3598  N N     . LYS E 1 116 ? 161.438 192.628 175.468 1.00 82.11  ? 115  LYS E N     1 
ATOM 3599  C CA    . LYS E 1 116 ? 160.313 192.408 176.366 1.00 74.41  ? 115  LYS E CA    1 
ATOM 3600  C C     . LYS E 1 116 ? 159.047 192.076 175.595 1.00 69.37  ? 115  LYS E C     1 
ATOM 3601  O O     . LYS E 1 116 ? 157.938 192.303 176.068 1.00 62.59  ? 115  LYS E O     1 
ATOM 3602  C CB    . LYS E 1 116 ? 160.088 193.610 177.277 1.00 75.10  ? 115  LYS E CB    1 
ATOM 3603  C CG    . LYS E 1 116 ? 161.236 193.853 178.213 1.00 91.73  ? 115  LYS E CG    1 
ATOM 3604  C CD    . LYS E 1 116 ? 160.963 195.043 179.092 1.00 109.68 ? 115  LYS E CD    1 
ATOM 3605  C CE    . LYS E 1 116 ? 162.130 195.303 180.005 1.00 111.42 ? 115  LYS E CE    1 
ATOM 3606  N NZ    . LYS E 1 116 ? 162.351 194.145 180.904 1.00 101.78 ? 115  LYS E NZ    1 
ATOM 3607  N N     . ARG E 1 117 ? 159.210 191.548 174.397 1.00 69.73  ? 116  ARG E N     1 
ATOM 3608  C CA    . ARG E 1 117 ? 158.128 190.916 173.673 1.00 64.36  ? 116  ARG E CA    1 
ATOM 3609  C C     . ARG E 1 117 ? 158.423 189.432 173.605 1.00 64.82  ? 116  ARG E C     1 
ATOM 3610  O O     . ARG E 1 117 ? 159.581 189.017 173.630 1.00 78.48  ? 116  ARG E O     1 
ATOM 3611  C CB    . ARG E 1 117 ? 157.990 191.477 172.269 1.00 61.53  ? 116  ARG E CB    1 
ATOM 3612  C CG    . ARG E 1 117 ? 157.621 192.925 172.244 1.00 72.91  ? 116  ARG E CG    1 
ATOM 3613  C CD    . ARG E 1 117 ? 157.410 193.421 170.835 1.00 71.90  ? 116  ARG E CD    1 
ATOM 3614  N NE    . ARG E 1 117 ? 158.624 193.343 170.040 1.00 74.63  ? 116  ARG E NE    1 
ATOM 3615  C CZ    . ARG E 1 117 ? 158.844 192.402 169.138 1.00 78.03  ? 116  ARG E CZ    1 
ATOM 3616  N NH1   . ARG E 1 117 ? 157.928 191.478 168.925 1.00 78.99  ? 116  ARG E NH1   1 
ATOM 3617  N NH2   . ARG E 1 117 ? 159.967 192.388 168.445 1.00 72.02  ? 116  ARG E NH2   1 
ATOM 3618  N N     . VAL E 1 118 ? 157.371 188.624 173.551 1.00 55.77  ? 117  VAL E N     1 
ATOM 3619  C CA    . VAL E 1 118 ? 157.539 187.193 173.388 1.00 64.23  ? 117  VAL E CA    1 
ATOM 3620  C C     . VAL E 1 118 ? 157.345 186.758 171.948 1.00 64.12  ? 117  VAL E C     1 
ATOM 3621  O O     . VAL E 1 118 ? 157.401 185.566 171.657 1.00 65.07  ? 117  VAL E O     1 
ATOM 3622  C CB    . VAL E 1 118 ? 156.595 186.434 174.310 1.00 56.88  ? 117  VAL E CB    1 
ATOM 3623  C CG1   . VAL E 1 118 ? 156.922 186.771 175.732 1.00 55.04  ? 117  VAL E CG1   1 
ATOM 3624  C CG2   . VAL E 1 118 ? 155.184 186.812 173.984 1.00 66.75  ? 117  VAL E CG2   1 
ATOM 3625  N N     . THR E 1 119 ? 157.099 187.691 171.043 1.00 54.52  ? 118  THR E N     1 
ATOM 3626  C CA    . THR E 1 119 ? 156.774 187.370 169.664 1.00 56.37  ? 118  THR E CA    1 
ATOM 3627  C C     . THR E 1 119 ? 157.811 187.951 168.724 1.00 59.75  ? 118  THR E C     1 
ATOM 3628  O O     . THR E 1 119 ? 157.969 189.170 168.647 1.00 65.11  ? 118  THR E O     1 
ATOM 3629  C CB    . THR E 1 119 ? 155.413 187.917 169.290 1.00 60.29  ? 118  THR E CB    1 
ATOM 3630  O OG1   . THR E 1 119 ? 154.417 187.294 170.104 1.00 64.75  ? 118  THR E OG1   1 
ATOM 3631  C CG2   . THR E 1 119 ? 155.126 187.650 167.828 1.00 67.50  ? 118  THR E CG2   1 
ATOM 3632  N N     . ILE E 1 120 ? 158.499 187.090 167.995 1.00 55.56  ? 119  ILE E N     1 
ATOM 3633  C CA    . ILE E 1 120 ? 159.489 187.536 167.027 1.00 57.16  ? 119  ILE E CA    1 
ATOM 3634  C C     . ILE E 1 120 ? 158.765 188.276 165.919 1.00 61.53  ? 119  ILE E C     1 
ATOM 3635  O O     . ILE E 1 120 ? 157.585 188.026 165.666 1.00 65.50  ? 119  ILE E O     1 
ATOM 3636  C CB    . ILE E 1 120 ? 160.294 186.359 166.466 1.00 51.59  ? 119  ILE E CB    1 
ATOM 3637  C CG1   . ILE E 1 120 ? 159.390 185.459 165.656 1.00 58.62  ? 119  ILE E CG1   1 
ATOM 3638  C CG2   . ILE E 1 120 ? 160.869 185.554 167.584 1.00 46.82  ? 119  ILE E CG2   1 
ATOM 3639  C CD1   . ILE E 1 120 ? 160.141 184.412 164.922 1.00 47.21  ? 119  ILE E CD1   1 
ATOM 3640  N N     . MET E 1 121 ? 159.457 189.196 165.272 1.00 67.73  ? 120  MET E N     1 
ATOM 3641  C CA    . MET E 1 121 ? 158.886 190.066 164.258 1.00 65.01  ? 120  MET E CA    1 
ATOM 3642  C C     . MET E 1 121 ? 159.915 190.348 163.184 1.00 68.89  ? 120  MET E C     1 
ATOM 3643  O O     . MET E 1 121 ? 161.121 190.273 163.437 1.00 61.52  ? 120  MET E O     1 
ATOM 3644  C CB    . MET E 1 121 ? 158.420 191.385 164.881 1.00 66.29  ? 120  MET E CB    1 
ATOM 3645  C CG    . MET E 1 121 ? 157.225 191.257 165.763 1.00 60.22  ? 120  MET E CG    1 
ATOM 3646  S SD    . MET E 1 121 ? 156.872 192.849 166.499 1.00 99.54  ? 120  MET E SD    1 
ATOM 3647  C CE    . MET E 1 121 ? 156.386 193.749 165.036 1.00 104.73 ? 120  MET E CE    1 
ATOM 3648  N N     . PRO E 1 122 ? 159.478 190.693 161.976 1.00 69.93  ? 121  PRO E N     1 
ATOM 3649  C CA    . PRO E 1 122 ? 160.444 190.906 160.894 1.00 62.69  ? 121  PRO E CA    1 
ATOM 3650  C C     . PRO E 1 122 ? 161.585 191.822 161.280 1.00 62.29  ? 121  PRO E C     1 
ATOM 3651  O O     . PRO E 1 122 ? 162.746 191.524 160.974 1.00 62.20  ? 121  PRO E O     1 
ATOM 3652  C CB    . PRO E 1 122 ? 159.582 191.512 159.787 1.00 54.52  ? 121  PRO E CB    1 
ATOM 3653  C CG    . PRO E 1 122 ? 158.262 190.966 160.038 1.00 59.74  ? 121  PRO E CG    1 
ATOM 3654  C CD    . PRO E 1 122 ? 158.104 190.919 161.515 1.00 65.45  ? 121  PRO E CD    1 
ATOM 3655  N N     . LYS E 1 123 ? 161.299 192.912 161.984 1.00 53.25  ? 122  LYS E N     1 
ATOM 3656  C CA    . LYS E 1 123 ? 162.390 193.781 162.389 1.00 61.57  ? 122  LYS E CA    1 
ATOM 3657  C C     . LYS E 1 123 ? 163.366 193.052 163.293 1.00 66.97  ? 122  LYS E C     1 
ATOM 3658  O O     . LYS E 1 123 ? 164.557 193.371 163.296 1.00 63.75  ? 122  LYS E O     1 
ATOM 3659  C CB    . LYS E 1 123 ? 161.857 195.027 163.076 1.00 60.88  ? 122  LYS E CB    1 
ATOM 3660  C CG    . LYS E 1 123 ? 161.139 194.775 164.370 1.00 83.71  ? 122  LYS E CG    1 
ATOM 3661  C CD    . LYS E 1 123 ? 160.666 196.089 164.954 1.00 87.87  ? 122  LYS E CD    1 
ATOM 3662  C CE    . LYS E 1 123 ? 159.925 195.891 166.251 1.00 84.83  ? 122  LYS E CE    1 
ATOM 3663  N NZ    . LYS E 1 123 ? 159.492 197.191 166.816 1.00 89.21  ? 122  LYS E NZ    1 
ATOM 3664  N N     . ASP E 1 124 ? 162.897 192.060 164.044 1.00 60.33  ? 123  ASP E N     1 
ATOM 3665  C CA    . ASP E 1 124 ? 163.810 191.295 164.880 1.00 53.83  ? 123  ASP E CA    1 
ATOM 3666  C C     . ASP E 1 124 ? 164.823 190.558 164.028 1.00 58.13  ? 123  ASP E C     1 
ATOM 3667  O O     . ASP E 1 124 ? 166.035 190.718 164.203 1.00 59.67  ? 123  ASP E O     1 
ATOM 3668  C CB    . ASP E 1 124 ? 163.033 190.315 165.737 1.00 55.12  ? 123  ASP E CB    1 
ATOM 3669  C CG    . ASP E 1 124 ? 162.092 191.007 166.657 1.00 69.52  ? 123  ASP E CG    1 
ATOM 3670  O OD1   . ASP E 1 124 ? 162.272 192.224 166.836 1.00 77.97  ? 123  ASP E OD1   1 
ATOM 3671  O OD2   . ASP E 1 124 ? 161.163 190.362 167.180 1.00 68.70  ? 123  ASP E OD2   1 
ATOM 3672  N N     . ILE E 1 125 ? 164.341 189.742 163.094 1.00 57.59  ? 124  ILE E N     1 
ATOM 3673  C CA    . ILE E 1 125 ? 165.243 189.039 162.192 1.00 52.50  ? 124  ILE E CA    1 
ATOM 3674  C C     . ILE E 1 125 ? 166.202 190.017 161.544 1.00 56.85  ? 124  ILE E C     1 
ATOM 3675  O O     . ILE E 1 125 ? 167.423 189.839 161.583 1.00 62.16  ? 124  ILE E O     1 
ATOM 3676  C CB    . ILE E 1 125 ? 164.453 188.260 161.136 1.00 53.89  ? 124  ILE E CB    1 
ATOM 3677  C CG1   . ILE E 1 125 ? 163.858 187.013 161.753 1.00 50.23  ? 124  ILE E CG1   1 
ATOM 3678  C CG2   . ILE E 1 125 ? 165.331 187.914 159.985 1.00 45.55  ? 124  ILE E CG2   1 
ATOM 3679  C CD1   . ILE E 1 125 ? 162.974 186.287 160.814 1.00 56.33  ? 124  ILE E CD1   1 
ATOM 3680  N N     . GLN E 1 126 ? 165.660 191.076 160.954 1.00 67.26  ? 125  GLN E N     1 
ATOM 3681  C CA    . GLN E 1 126 ? 166.514 192.056 160.303 1.00 60.82  ? 125  GLN E CA    1 
ATOM 3682  C C     . GLN E 1 126 ? 167.616 192.522 161.234 1.00 60.10  ? 125  GLN E C     1 
ATOM 3683  O O     . GLN E 1 126 ? 168.776 192.639 160.827 1.00 63.60  ? 125  GLN E O     1 
ATOM 3684  C CB    . GLN E 1 126 ? 165.665 193.215 159.821 1.00 59.48  ? 125  GLN E CB    1 
ATOM 3685  C CG    . GLN E 1 126 ? 164.725 192.773 158.737 1.00 68.82  ? 125  GLN E CG    1 
ATOM 3686  C CD    . GLN E 1 126 ? 163.724 193.828 158.371 1.00 83.69  ? 125  GLN E CD    1 
ATOM 3687  O OE1   . GLN E 1 126 ? 163.416 194.709 159.170 1.00 95.41  ? 125  GLN E OE1   1 
ATOM 3688  N NE2   . GLN E 1 126 ? 163.191 193.740 157.162 1.00 72.73  ? 125  GLN E NE2   1 
ATOM 3689  N N     . LEU E 1 127 ? 167.290 192.732 162.505 1.00 57.48  ? 126  LEU E N     1 
ATOM 3690  C CA    . LEU E 1 127 ? 168.337 193.028 163.469 1.00 53.11  ? 126  LEU E CA    1 
ATOM 3691  C C     . LEU E 1 127 ? 169.353 191.904 163.531 1.00 58.21  ? 126  LEU E C     1 
ATOM 3692  O O     . LEU E 1 127 ? 170.559 192.149 163.546 1.00 68.69  ? 126  LEU E O     1 
ATOM 3693  C CB    . LEU E 1 127 ? 167.752 193.266 164.849 1.00 42.26  ? 126  LEU E CB    1 
ATOM 3694  C CG    . LEU E 1 127 ? 168.882 193.406 165.857 1.00 45.70  ? 126  LEU E CG    1 
ATOM 3695  C CD1   . LEU E 1 127 ? 169.698 194.614 165.526 1.00 39.42  ? 126  LEU E CD1   1 
ATOM 3696  C CD2   . LEU E 1 127 ? 168.341 193.514 167.248 1.00 48.61  ? 126  LEU E CD2   1 
ATOM 3697  N N     . ALA E 1 128 ? 168.890 190.660 163.577 1.00 51.20  ? 127  ALA E N     1 
ATOM 3698  C CA    . ALA E 1 128 ? 169.830 189.555 163.710 1.00 51.07  ? 127  ALA E CA    1 
ATOM 3699  C C     . ALA E 1 128 ? 170.800 189.517 162.542 1.00 59.28  ? 127  ALA E C     1 
ATOM 3700  O O     . ALA E 1 128 ? 172.023 189.575 162.726 1.00 65.30  ? 127  ALA E O     1 
ATOM 3701  C CB    . ALA E 1 128 ? 169.079 188.238 163.822 1.00 52.28  ? 127  ALA E CB    1 
ATOM 3702  N N     . ARG E 1 129 ? 170.272 189.447 161.325 1.00 53.22  ? 128  ARG E N     1 
ATOM 3703  C CA    . ARG E 1 129 ? 171.142 189.392 160.161 1.00 53.00  ? 128  ARG E CA    1 
ATOM 3704  C C     . ARG E 1 129 ? 172.020 190.629 160.080 1.00 57.81  ? 128  ARG E C     1 
ATOM 3705  O O     . ARG E 1 129 ? 173.089 190.605 159.467 1.00 49.03  ? 128  ARG E O     1 
ATOM 3706  C CB    . ARG E 1 129 ? 170.315 189.237 158.895 1.00 34.23  ? 128  ARG E CB    1 
ATOM 3707  C CG    . ARG E 1 129 ? 169.456 188.020 158.930 1.00 45.90  ? 128  ARG E CG    1 
ATOM 3708  C CD    . ARG E 1 129 ? 168.658 187.847 157.663 1.00 61.40  ? 128  ARG E CD    1 
ATOM 3709  N NE    . ARG E 1 129 ? 169.497 187.473 156.539 1.00 64.69  ? 128  ARG E NE    1 
ATOM 3710  C CZ    . ARG E 1 129 ? 169.703 188.244 155.487 1.00 68.00  ? 128  ARG E CZ    1 
ATOM 3711  N NH1   . ARG E 1 129 ? 169.118 189.425 155.417 1.00 77.45  ? 128  ARG E NH1   1 
ATOM 3712  N NH2   . ARG E 1 129 ? 170.483 187.830 154.503 1.00 65.17  ? 128  ARG E NH2   1 
ATOM 3713  N N     . ARG E 1 130 ? 171.591 191.725 160.697 1.00 50.77  ? 129  ARG E N     1 
ATOM 3714  C CA    . ARG E 1 130 ? 172.470 192.883 160.757 1.00 43.95  ? 129  ARG E CA    1 
ATOM 3715  C C     . ARG E 1 130 ? 173.613 192.677 161.729 1.00 49.28  ? 129  ARG E C     1 
ATOM 3716  O O     . ARG E 1 130 ? 174.759 192.990 161.409 1.00 56.65  ? 129  ARG E O     1 
ATOM 3717  C CB    . ARG E 1 130 ? 171.685 194.121 161.145 1.00 49.49  ? 129  ARG E CB    1 
ATOM 3718  C CG    . ARG E 1 130 ? 172.540 195.319 161.466 1.00 52.96  ? 129  ARG E CG    1 
ATOM 3719  C CD    . ARG E 1 130 ? 173.360 195.789 160.296 1.00 67.24  ? 129  ARG E CD    1 
ATOM 3720  N NE    . ARG E 1 130 ? 174.085 197.011 160.637 1.00 81.76  ? 129  ARG E NE    1 
ATOM 3721  C CZ    . ARG E 1 130 ? 175.276 197.044 161.228 1.00 77.41  ? 129  ARG E CZ    1 
ATOM 3722  N NH1   . ARG E 1 130 ? 175.893 195.917 161.548 1.00 57.81  ? 129  ARG E NH1   1 
ATOM 3723  N NH2   . ARG E 1 130 ? 175.851 198.206 161.501 1.00 85.97  ? 129  ARG E NH2   1 
ATOM 3724  N N     . ILE E 1 131 ? 173.326 192.172 162.921 1.00 52.08  ? 130  ILE E N     1 
ATOM 3725  C CA    . ILE E 1 131 ? 174.383 191.997 163.902 1.00 63.04  ? 130  ILE E CA    1 
ATOM 3726  C C     . ILE E 1 131 ? 175.415 191.017 163.404 1.00 65.84  ? 130  ILE E C     1 
ATOM 3727  O O     . ILE E 1 131 ? 176.613 191.300 163.437 1.00 67.09  ? 130  ILE E O     1 
ATOM 3728  C CB    . ILE E 1 131 ? 173.808 191.552 165.248 1.00 63.05  ? 130  ILE E CB    1 
ATOM 3729  C CG1   . ILE E 1 131 ? 172.900 192.624 165.797 1.00 61.77  ? 130  ILE E CG1   1 
ATOM 3730  C CG2   . ILE E 1 131 ? 174.922 191.333 166.218 1.00 67.71  ? 130  ILE E CG2   1 
ATOM 3731  C CD1   . ILE E 1 131 ? 173.629 193.879 166.038 1.00 68.21  ? 130  ILE E CD1   1 
ATOM 3732  N N     . ARG E 1 132 ? 174.986 189.848 162.941 1.00 71.19  ? 131  ARG E N     1 
ATOM 3733  C CA    . ARG E 1 132 ? 175.976 188.878 162.500 1.00 61.95  ? 131  ARG E CA    1 
ATOM 3734  C C     . ARG E 1 132 ? 176.800 189.404 161.344 1.00 64.50  ? 131  ARG E C     1 
ATOM 3735  O O     . ARG E 1 132 ? 177.938 188.972 161.147 1.00 67.14  ? 131  ARG E O     1 
ATOM 3736  C CB    . ARG E 1 132 ? 175.311 187.582 162.087 1.00 61.36  ? 131  ARG E CB    1 
ATOM 3737  C CG    . ARG E 1 132 ? 174.754 186.793 163.210 1.00 52.56  ? 131  ARG E CG    1 
ATOM 3738  C CD    . ARG E 1 132 ? 174.258 185.518 162.641 1.00 57.63  ? 131  ARG E CD    1 
ATOM 3739  N NE    . ARG E 1 132 ? 173.698 184.643 163.645 1.00 58.64  ? 131  ARG E NE    1 
ATOM 3740  C CZ    . ARG E 1 132 ? 173.108 183.498 163.347 1.00 69.86  ? 131  ARG E CZ    1 
ATOM 3741  N NH1   . ARG E 1 132 ? 173.013 183.121 162.080 1.00 76.06  ? 131  ARG E NH1   1 
ATOM 3742  N NH2   . ARG E 1 132 ? 172.613 182.735 164.304 1.00 75.42  ? 131  ARG E NH2   1 
ATOM 3743  N N     . GLY E 1 133 ? 176.254 190.334 160.579 1.00 63.10  ? 132  GLY E N     1 
ATOM 3744  C CA    . GLY E 1 133 ? 176.899 190.774 159.368 1.00 64.86  ? 132  GLY E CA    1 
ATOM 3745  C C     . GLY E 1 133 ? 176.653 189.888 158.176 1.00 70.87  ? 132  GLY E C     1 
ATOM 3746  O O     . GLY E 1 133 ? 177.502 189.833 157.284 1.00 63.85  ? 132  GLY E O     1 
ATOM 3747  N N     . GLU E 1 134 ? 175.525 189.183 158.134 1.00 74.01  ? 133  GLU E N     1 
ATOM 3748  C CA    . GLU E 1 134 ? 175.252 188.313 157.000 1.00 77.88  ? 133  GLU E CA    1 
ATOM 3749  C C     . GLU E 1 134 ? 174.781 189.122 155.800 1.00 93.40  ? 133  GLU E C     1 
ATOM 3750  O O     . GLU E 1 134 ? 174.841 188.657 154.657 1.00 99.84  ? 133  GLU E O     1 
ATOM 3751  C CB    . GLU E 1 134 ? 174.214 187.259 157.378 1.00 78.83  ? 133  GLU E CB    1 
ATOM 3752  C CG    . GLU E 1 134 ? 174.641 186.317 158.487 1.00 82.66  ? 133  GLU E CG    1 
ATOM 3753  C CD    . GLU E 1 134 ? 173.594 185.248 158.778 1.00 84.51  ? 133  GLU E CD    1 
ATOM 3754  O OE1   . GLU E 1 134 ? 172.513 185.285 158.155 1.00 81.87  ? 133  GLU E OE1   1 
ATOM 3755  O OE2   . GLU E 1 134 ? 173.842 184.381 159.645 1.00 82.79  ? 133  GLU E OE2   1 
ATOM 3756  N N     . ARG E 1 135 ? 174.302 190.335 156.040 1.00 105.31 ? 134  ARG E N     1 
ATOM 3757  C CA    . ARG E 1 135 ? 173.857 191.198 154.957 1.00 112.77 ? 134  ARG E CA    1 
ATOM 3758  C C     . ARG E 1 135 ? 173.639 192.603 155.480 1.00 116.40 ? 134  ARG E C     1 
ATOM 3759  O O     . ARG E 1 135 ? 173.681 192.826 156.686 1.00 113.09 ? 134  ARG E O     1 
ATOM 3760  C CB    . ARG E 1 135 ? 172.573 190.667 154.326 1.00 101.62 ? 134  ARG E CB    1 
ATOM 3761  N N     . ARG F 2 18  ? 162.684 165.512 127.087 1.00 132.40 ? 17   ARG F N     1 
ATOM 3762  C CA    . ARG F 2 18  ? 163.166 166.880 126.949 1.00 137.34 ? 17   ARG F CA    1 
ATOM 3763  C C     . ARG F 2 18  ? 162.051 167.874 127.235 1.00 149.73 ? 17   ARG F C     1 
ATOM 3764  O O     . ARG F 2 18  ? 161.694 168.682 126.380 1.00 154.71 ? 17   ARG F O     1 
ATOM 3765  C CB    . ARG F 2 18  ? 163.735 167.113 125.548 1.00 121.88 ? 17   ARG F CB    1 
ATOM 3766  N N     . HIS F 2 19  ? 161.501 167.803 128.443 1.00 146.72 ? 18   HIS F N     1 
ATOM 3767  C CA    . HIS F 2 19  ? 160.464 168.732 128.859 1.00 142.42 ? 18   HIS F CA    1 
ATOM 3768  C C     . HIS F 2 19  ? 160.947 170.176 128.768 1.00 156.70 ? 18   HIS F C     1 
ATOM 3769  O O     . HIS F 2 19  ? 162.120 170.487 128.995 1.00 161.94 ? 18   HIS F O     1 
ATOM 3770  C CB    . HIS F 2 19  ? 160.033 168.455 130.299 1.00 130.23 ? 18   HIS F CB    1 
ATOM 3771  C CG    . HIS F 2 19  ? 159.444 167.097 130.516 1.00 133.83 ? 18   HIS F CG    1 
ATOM 3772  N ND1   . HIS F 2 19  ? 158.218 166.730 130.006 1.00 132.77 ? 18   HIS F ND1   1 
ATOM 3773  C CD2   . HIS F 2 19  ? 159.897 166.030 131.215 1.00 135.03 ? 18   HIS F CD2   1 
ATOM 3774  C CE1   . HIS F 2 19  ? 157.948 165.490 130.368 1.00 129.73 ? 18   HIS F CE1   1 
ATOM 3775  N NE2   . HIS F 2 19  ? 158.951 165.042 131.103 1.00 132.30 ? 18   HIS F NE2   1 
ATOM 3776  N N     . ARG F 2 20  ? 160.019 171.067 128.438 1.00 161.05 ? 19   ARG F N     1 
ATOM 3777  C CA    . ARG F 2 20  ? 160.234 172.498 128.613 1.00 153.43 ? 19   ARG F CA    1 
ATOM 3778  C C     . ARG F 2 20  ? 159.992 172.801 130.086 1.00 145.26 ? 19   ARG F C     1 
ATOM 3779  O O     . ARG F 2 20  ? 158.894 172.571 130.602 1.00 135.90 ? 19   ARG F O     1 
ATOM 3780  C CB    . ARG F 2 20  ? 159.304 173.309 127.713 1.00 148.05 ? 19   ARG F CB    1 
ATOM 3781  N N     . LYS F 2 21  ? 161.014 173.307 130.766 1.00 140.22 ? 20   LYS F N     1 
ATOM 3782  C CA    . LYS F 2 21  ? 161.003 173.394 132.221 1.00 123.36 ? 20   LYS F CA    1 
ATOM 3783  C C     . LYS F 2 21  ? 160.889 174.846 132.667 1.00 108.04 ? 20   LYS F C     1 
ATOM 3784  O O     . LYS F 2 21  ? 161.828 175.630 132.511 1.00 90.48  ? 20   LYS F O     1 
ATOM 3785  C CB    . LYS F 2 21  ? 162.260 172.752 132.802 1.00 110.60 ? 20   LYS F CB    1 
ATOM 3786  N N     . VAL F 2 22  ? 159.737 175.199 133.227 1.00 111.28 ? 21   VAL F N     1 
ATOM 3787  C CA    . VAL F 2 22  ? 159.521 176.513 133.817 1.00 115.02 ? 21   VAL F CA    1 
ATOM 3788  C C     . VAL F 2 22  ? 158.918 176.315 135.197 1.00 126.25 ? 21   VAL F C     1 
ATOM 3789  O O     . VAL F 2 22  ? 157.789 175.831 135.324 1.00 137.64 ? 21   VAL F O     1 
ATOM 3790  C CB    . VAL F 2 22  ? 158.600 177.396 132.954 1.00 103.54 ? 21   VAL F CB    1 
ATOM 3791  C CG1   . VAL F 2 22  ? 158.289 178.698 133.678 1.00 97.08  ? 21   VAL F CG1   1 
ATOM 3792  C CG2   . VAL F 2 22  ? 159.241 177.672 131.604 1.00 102.91 ? 21   VAL F CG2   1 
ATOM 3793  N N     . LEU F 2 23  ? 159.661 176.701 136.227 1.00 110.79 ? 22   LEU F N     1 
ATOM 3794  C CA    . LEU F 2 23  ? 159.221 176.559 137.604 1.00 91.70  ? 22   LEU F CA    1 
ATOM 3795  C C     . LEU F 2 23  ? 158.995 177.941 138.186 1.00 74.69  ? 22   LEU F C     1 
ATOM 3796  O O     . LEU F 2 23  ? 159.847 178.822 138.057 1.00 61.56  ? 22   LEU F O     1 
ATOM 3797  C CB    . LEU F 2 23  ? 160.250 175.795 138.436 1.00 91.29  ? 22   LEU F CB    1 
ATOM 3798  C CG    . LEU F 2 23  ? 160.535 174.362 137.988 1.00 83.88  ? 22   LEU F CG    1 
ATOM 3799  C CD1   . LEU F 2 23  ? 161.627 173.744 138.844 1.00 76.32  ? 22   LEU F CD1   1 
ATOM 3800  C CD2   . LEU F 2 23  ? 159.272 173.524 138.026 1.00 84.13  ? 22   LEU F CD2   1 
ATOM 3801  N N     . ARG F 2 24  ? 157.840 178.136 138.815 1.00 68.89  ? 23   ARG F N     1 
ATOM 3802  C CA    . ARG F 2 24  ? 157.502 179.444 139.349 1.00 77.26  ? 23   ARG F CA    1 
ATOM 3803  C C     . ARG F 2 24  ? 156.718 179.278 140.639 1.00 86.54  ? 23   ARG F C     1 
ATOM 3804  O O     . ARG F 2 24  ? 155.896 178.368 140.774 1.00 79.60  ? 23   ARG F O     1 
ATOM 3805  C CB    . ARG F 2 24  ? 156.702 180.270 138.336 1.00 73.50  ? 23   ARG F CB    1 
ATOM 3806  N N     . ASP F 2 25  ? 156.997 180.166 141.589 1.00 89.84  ? 24   ASP F N     1 
ATOM 3807  C CA    . ASP F 2 25  ? 156.322 180.212 142.878 1.00 92.87  ? 24   ASP F CA    1 
ATOM 3808  C C     . ASP F 2 25  ? 156.501 178.933 143.670 1.00 86.93  ? 24   ASP F C     1 
ATOM 3809  O O     . ASP F 2 25  ? 155.700 178.635 144.555 1.00 89.91  ? 24   ASP F O     1 
ATOM 3810  C CB    . ASP F 2 25  ? 154.834 180.504 142.706 1.00 104.97 ? 24   ASP F CB    1 
ATOM 3811  C CG    . ASP F 2 25  ? 154.590 181.852 142.101 1.00 115.61 ? 24   ASP F CG    1 
ATOM 3812  O OD1   . ASP F 2 25  ? 155.539 182.659 142.088 1.00 119.01 ? 24   ASP F OD1   1 
ATOM 3813  O OD2   . ASP F 2 25  ? 153.464 182.105 141.628 1.00 116.04 ? 24   ASP F OD2   1 
ATOM 3814  N N     . ASN F 2 26  ? 157.542 178.158 143.376 1.00 77.17  ? 25   ASN F N     1 
ATOM 3815  C CA    . ASN F 2 26  ? 157.804 177.005 144.214 1.00 68.02  ? 25   ASN F CA    1 
ATOM 3816  C C     . ASN F 2 26  ? 158.204 177.428 145.605 1.00 72.43  ? 25   ASN F C     1 
ATOM 3817  O O     . ASN F 2 26  ? 158.002 176.668 146.552 1.00 72.20  ? 25   ASN F O     1 
ATOM 3818  C CB    . ASN F 2 26  ? 158.886 176.136 143.601 1.00 69.24  ? 25   ASN F CB    1 
ATOM 3819  C CG    . ASN F 2 26  ? 158.415 175.438 142.357 1.00 68.63  ? 25   ASN F CG    1 
ATOM 3820  O OD1   . ASN F 2 26  ? 157.754 174.403 142.423 1.00 74.46  ? 25   ASN F OD1   1 
ATOM 3821  N ND2   . ASN F 2 26  ? 158.717 176.020 141.209 1.00 73.41  ? 25   ASN F ND2   1 
ATOM 3822  N N     . ILE F 2 27  ? 158.740 178.639 145.745 1.00 68.18  ? 26   ILE F N     1 
ATOM 3823  C CA    . ILE F 2 27  ? 159.057 179.163 147.063 1.00 61.98  ? 26   ILE F CA    1 
ATOM 3824  C C     . ILE F 2 27  ? 157.835 179.122 147.965 1.00 64.65  ? 26   ILE F C     1 
ATOM 3825  O O     . ILE F 2 27  ? 157.960 179.045 149.191 1.00 70.85  ? 26   ILE F O     1 
ATOM 3826  C CB    . ILE F 2 27  ? 159.627 180.579 146.927 1.00 55.21  ? 26   ILE F CB    1 
ATOM 3827  C CG1   . ILE F 2 27  ? 160.051 181.100 148.287 1.00 57.16  ? 26   ILE F CG1   1 
ATOM 3828  C CG2   . ILE F 2 27  ? 158.613 181.480 146.295 1.00 55.06  ? 26   ILE F CG2   1 
ATOM 3829  C CD1   . ILE F 2 27  ? 161.112 180.277 148.905 1.00 51.32  ? 26   ILE F CD1   1 
ATOM 3830  N N     . GLN F 2 28  ? 156.638 179.140 147.382 1.00 73.06  ? 27   GLN F N     1 
ATOM 3831  C CA    . GLN F 2 28  ? 155.452 178.839 148.166 1.00 85.11  ? 27   GLN F CA    1 
ATOM 3832  C C     . GLN F 2 28  ? 155.533 177.456 148.779 1.00 75.07  ? 27   GLN F C     1 
ATOM 3833  O O     . GLN F 2 28  ? 154.908 177.212 149.815 1.00 65.05  ? 27   GLN F O     1 
ATOM 3834  C CB    . GLN F 2 28  ? 154.206 178.937 147.297 1.00 95.62  ? 27   GLN F CB    1 
ATOM 3835  C CG    . GLN F 2 28  ? 154.002 180.302 146.716 1.00 103.83 ? 27   GLN F CG    1 
ATOM 3836  C CD    . GLN F 2 28  ? 153.933 181.356 147.783 1.00 111.96 ? 27   GLN F CD    1 
ATOM 3837  O OE1   . GLN F 2 28  ? 153.340 181.146 148.837 1.00 117.97 ? 27   GLN F OE1   1 
ATOM 3838  N NE2   . GLN F 2 28  ? 154.551 182.498 147.525 1.00 102.54 ? 27   GLN F NE2   1 
ATOM 3839  N N     . GLY F 2 29  ? 156.294 176.553 148.164 1.00 74.11  ? 28   GLY F N     1 
ATOM 3840  C CA    . GLY F 2 29  ? 156.420 175.210 148.694 1.00 76.02  ? 28   GLY F CA    1 
ATOM 3841  C C     . GLY F 2 29  ? 156.881 175.185 150.132 1.00 75.47  ? 28   GLY F C     1 
ATOM 3842  O O     . GLY F 2 29  ? 156.565 174.256 150.876 1.00 76.72  ? 28   GLY F O     1 
ATOM 3843  N N     . ILE F 2 30  ? 157.631 176.193 150.547 1.00 61.33  ? 29   ILE F N     1 
ATOM 3844  C CA    . ILE F 2 30  ? 157.896 176.375 151.963 1.00 48.05  ? 29   ILE F CA    1 
ATOM 3845  C C     . ILE F 2 30  ? 156.631 176.941 152.581 1.00 60.12  ? 29   ILE F C     1 
ATOM 3846  O O     . ILE F 2 30  ? 156.153 178.004 152.177 1.00 55.23  ? 29   ILE F O     1 
ATOM 3847  C CB    . ILE F 2 30  ? 159.090 177.299 152.183 1.00 53.95  ? 29   ILE F CB    1 
ATOM 3848  C CG1   . ILE F 2 30  ? 160.271 176.742 151.422 1.00 51.65  ? 29   ILE F CG1   1 
ATOM 3849  C CG2   . ILE F 2 30  ? 159.437 177.332 153.622 1.00 54.16  ? 29   ILE F CG2   1 
ATOM 3850  C CD1   . ILE F 2 30  ? 160.577 175.349 151.835 1.00 46.13  ? 29   ILE F CD1   1 
ATOM 3851  N N     . THR F 2 31  ? 156.081 176.233 153.552 1.00 60.74  ? 30   THR F N     1 
ATOM 3852  C CA    . THR F 2 31  ? 154.730 176.496 153.999 1.00 59.68  ? 30   THR F CA    1 
ATOM 3853  C C     . THR F 2 31  ? 154.715 176.939 155.445 1.00 59.43  ? 30   THR F C     1 
ATOM 3854  O O     . THR F 2 31  ? 155.484 176.447 156.272 1.00 63.87  ? 30   THR F O     1 
ATOM 3855  C CB    . THR F 2 31  ? 153.880 175.268 153.878 1.00 67.82  ? 30   THR F CB    1 
ATOM 3856  O OG1   . THR F 2 31  ? 154.419 174.263 154.739 1.00 72.14  ? 30   THR F OG1   1 
ATOM 3857  C CG2   . THR F 2 31  ? 153.913 174.773 152.464 1.00 56.31  ? 30   THR F CG2   1 
ATOM 3858  N N     . LYS F 2 32  ? 153.789 177.827 155.736 1.00 61.12  ? 31   LYS F N     1 
ATOM 3859  C CA    . LYS F 2 32  ? 153.550 178.339 157.071 1.00 61.61  ? 31   LYS F CA    1 
ATOM 3860  C C     . LYS F 2 32  ? 153.601 177.236 158.118 1.00 74.20  ? 31   LYS F C     1 
ATOM 3861  O O     . LYS F 2 32  ? 154.191 177.437 159.185 1.00 72.20  ? 31   LYS F O     1 
ATOM 3862  C CB    . LYS F 2 32  ? 152.206 179.052 157.113 1.00 50.02  ? 31   LYS F CB    1 
ATOM 3863  C CG    . LYS F 2 32  ? 151.836 179.560 158.467 1.00 57.85  ? 31   LYS F CG    1 
ATOM 3864  C CD    . LYS F 2 32  ? 150.515 180.282 158.398 1.00 72.28  ? 31   LYS F CD    1 
ATOM 3865  C CE    . LYS F 2 32  ? 150.067 180.752 159.766 1.00 85.31  ? 31   LYS F CE    1 
ATOM 3866  N NZ    . LYS F 2 32  ? 148.803 181.523 159.676 1.00 82.84  ? 31   LYS F NZ    1 
ATOM 3867  N N     . PRO F 2 33  ? 153.021 176.063 157.874 1.00 65.67  ? 32   PRO F N     1 
ATOM 3868  C CA    . PRO F 2 33  ? 153.223 174.984 158.840 1.00 63.53  ? 32   PRO F CA    1 
ATOM 3869  C C     . PRO F 2 33  ? 154.682 174.648 159.018 1.00 68.57  ? 32   PRO F C     1 
ATOM 3870  O O     . PRO F 2 33  ? 155.162 174.577 160.151 1.00 78.13  ? 32   PRO F O     1 
ATOM 3871  C CB    . PRO F 2 33  ? 152.440 173.824 158.226 1.00 59.13  ? 32   PRO F CB    1 
ATOM 3872  C CG    . PRO F 2 33  ? 151.402 174.468 157.445 1.00 57.34  ? 32   PRO F CG    1 
ATOM 3873  C CD    . PRO F 2 33  ? 152.040 175.671 156.854 1.00 47.31  ? 32   PRO F CD    1 
ATOM 3874  N N     . ALA F 2 34  ? 155.417 174.471 157.925 1.00 57.29  ? 33   ALA F N     1 
ATOM 3875  C CA    . ALA F 2 34  ? 156.802 174.044 158.049 1.00 45.14  ? 33   ALA F CA    1 
ATOM 3876  C C     . ALA F 2 34  ? 157.626 175.096 158.768 1.00 53.61  ? 33   ALA F C     1 
ATOM 3877  O O     . ALA F 2 34  ? 158.197 174.836 159.831 1.00 64.44  ? 33   ALA F O     1 
ATOM 3878  C CB    . ALA F 2 34  ? 157.382 173.748 156.671 1.00 42.11  ? 33   ALA F CB    1 
ATOM 3879  N N     . ILE F 2 35  ? 157.669 176.306 158.213 1.00 51.75  ? 34   ILE F N     1 
ATOM 3880  C CA    . ILE F 2 35  ? 158.402 177.389 158.853 1.00 53.69  ? 34   ILE F CA    1 
ATOM 3881  C C     . ILE F 2 35  ? 158.026 177.473 160.310 1.00 57.24  ? 34   ILE F C     1 
ATOM 3882  O O     . ILE F 2 35  ? 158.872 177.686 161.183 1.00 70.39  ? 34   ILE F O     1 
ATOM 3883  C CB    . ILE F 2 35  ? 158.117 178.715 158.144 1.00 52.39  ? 34   ILE F CB    1 
ATOM 3884  C CG1   . ILE F 2 35  ? 158.663 178.670 156.735 1.00 53.58  ? 34   ILE F CG1   1 
ATOM 3885  C CG2   . ILE F 2 35  ? 158.738 179.837 158.909 1.00 39.30  ? 34   ILE F CG2   1 
ATOM 3886  C CD1   . ILE F 2 35  ? 158.201 179.810 155.896 1.00 59.91  ? 34   ILE F CD1   1 
ATOM 3887  N N     . ARG F 2 36  ? 156.748 177.289 160.598 1.00 58.47  ? 35   ARG F N     1 
ATOM 3888  C CA    . ARG F 2 36  ? 156.329 177.279 161.982 1.00 59.65  ? 35   ARG F CA    1 
ATOM 3889  C C     . ARG F 2 36  ? 157.049 176.182 162.744 1.00 57.42  ? 35   ARG F C     1 
ATOM 3890  O O     . ARG F 2 36  ? 157.550 176.407 163.850 1.00 66.98  ? 35   ARG F O     1 
ATOM 3891  C CB    . ARG F 2 36  ? 154.820 177.114 162.045 1.00 63.74  ? 35   ARG F CB    1 
ATOM 3892  C CG    . ARG F 2 36  ? 154.266 177.224 163.413 1.00 80.48  ? 35   ARG F CG    1 
ATOM 3893  C CD    . ARG F 2 36  ? 152.779 177.268 163.336 1.00 98.27  ? 35   ARG F CD    1 
ATOM 3894  N NE    . ARG F 2 36  ? 152.196 177.408 164.658 1.00 96.78  ? 35   ARG F NE    1 
ATOM 3895  C CZ    . ARG F 2 36  ? 150.913 177.655 164.871 1.00 99.63  ? 35   ARG F CZ    1 
ATOM 3896  N NH1   . ARG F 2 36  ? 150.092 177.795 163.841 1.00 103.59 ? 35   ARG F NH1   1 
ATOM 3897  N NH2   . ARG F 2 36  ? 150.452 177.762 166.109 1.00 105.02 ? 35   ARG F NH2   1 
ATOM 3898  N N     . ARG F 2 37  ? 157.161 175.000 162.146 1.00 45.78  ? 36   ARG F N     1 
ATOM 3899  C CA    . ARG F 2 37  ? 157.874 173.927 162.816 1.00 55.25  ? 36   ARG F CA    1 
ATOM 3900  C C     . ARG F 2 37  ? 159.308 174.336 163.100 1.00 53.68  ? 36   ARG F C     1 
ATOM 3901  O O     . ARG F 2 37  ? 159.757 174.289 164.249 1.00 51.39  ? 36   ARG F O     1 
ATOM 3902  C CB    . ARG F 2 37  ? 157.813 172.644 161.991 1.00 55.33  ? 36   ARG F CB    1 
ATOM 3903  C CG    . ARG F 2 37  ? 156.444 171.990 162.010 1.00 63.84  ? 36   ARG F CG    1 
ATOM 3904  C CD    . ARG F 2 37  ? 156.465 170.557 161.499 1.00 60.58  ? 36   ARG F CD    1 
ATOM 3905  N NE    . ARG F 2 37  ? 156.758 170.459 160.077 1.00 60.61  ? 36   ARG F NE    1 
ATOM 3906  C CZ    . ARG F 2 37  ? 155.833 170.483 159.127 1.00 62.16  ? 36   ARG F CZ    1 
ATOM 3907  N NH1   . ARG F 2 37  ? 154.557 170.591 159.448 1.00 56.88  ? 36   ARG F NH1   1 
ATOM 3908  N NH2   . ARG F 2 37  ? 156.181 170.389 157.856 1.00 61.80  ? 36   ARG F NH2   1 
ATOM 3909  N N     . LEU F 2 38  ? 160.034 174.778 162.072 1.00 57.58  ? 37   LEU F N     1 
ATOM 3910  C CA    . LEU F 2 38  ? 161.408 175.217 162.282 1.00 58.08  ? 37   LEU F CA    1 
ATOM 3911  C C     . LEU F 2 38  ? 161.487 176.174 163.448 1.00 59.25  ? 37   LEU F C     1 
ATOM 3912  O O     . LEU F 2 38  ? 162.280 175.983 164.374 1.00 59.21  ? 37   LEU F O     1 
ATOM 3913  C CB    . LEU F 2 38  ? 161.952 175.889 161.034 1.00 50.36  ? 37   LEU F CB    1 
ATOM 3914  C CG    . LEU F 2 38  ? 162.098 174.949 159.862 1.00 48.32  ? 37   LEU F CG    1 
ATOM 3915  C CD1   . LEU F 2 38  ? 162.543 175.715 158.657 1.00 40.69  ? 37   LEU F CD1   1 
ATOM 3916  C CD2   . LEU F 2 38  ? 163.103 173.913 160.220 1.00 42.73  ? 37   LEU F CD2   1 
ATOM 3917  N N     . ALA F 2 39  ? 160.636 177.191 163.434 1.00 49.15  ? 38   ALA F N     1 
ATOM 3918  C CA    . ALA F 2 39  ? 160.581 178.108 164.555 1.00 55.16  ? 38   ALA F CA    1 
ATOM 3919  C C     . ALA F 2 39  ? 160.505 177.343 165.857 1.00 59.25  ? 38   ALA F C     1 
ATOM 3920  O O     . ALA F 2 39  ? 161.260 177.612 166.797 1.00 48.47  ? 38   ALA F O     1 
ATOM 3921  C CB    . ALA F 2 39  ? 159.380 179.034 164.409 1.00 52.69  ? 38   ALA F CB    1 
ATOM 3922  N N     . ARG F 2 40  ? 159.622 176.353 165.916 1.00 55.05  ? 39   ARG F N     1 
ATOM 3923  C CA    . ARG F 2 40  ? 159.480 175.604 167.151 1.00 54.65  ? 39   ARG F CA    1 
ATOM 3924  C C     . ARG F 2 40  ? 160.803 174.984 167.543 1.00 57.20  ? 39   ARG F C     1 
ATOM 3925  O O     . ARG F 2 40  ? 161.296 175.201 168.651 1.00 71.48  ? 39   ARG F O     1 
ATOM 3926  C CB    . ARG F 2 40  ? 158.405 174.542 167.007 1.00 54.56  ? 39   ARG F CB    1 
ATOM 3927  C CG    . ARG F 2 40  ? 157.094 175.138 166.648 1.00 56.61  ? 39   ARG F CG    1 
ATOM 3928  C CD    . ARG F 2 40  ? 156.621 176.054 167.728 1.00 60.87  ? 39   ARG F CD    1 
ATOM 3929  N NE    . ARG F 2 40  ? 155.393 176.704 167.318 1.00 69.14  ? 39   ARG F NE    1 
ATOM 3930  C CZ    . ARG F 2 40  ? 154.850 177.724 167.959 1.00 70.72  ? 39   ARG F CZ    1 
ATOM 3931  N NH1   . ARG F 2 40  ? 155.429 178.204 169.047 1.00 64.35  ? 39   ARG F NH1   1 
ATOM 3932  N NH2   . ARG F 2 40  ? 153.735 178.264 167.503 1.00 68.12  ? 39   ARG F NH2   1 
ATOM 3933  N N     . ARG F 2 41  ? 161.417 174.241 166.627 1.00 41.00  ? 40   ARG F N     1 
ATOM 3934  C CA    . ARG F 2 41  ? 162.680 173.614 166.968 1.00 42.41  ? 40   ARG F CA    1 
ATOM 3935  C C     . ARG F 2 41  ? 163.658 174.636 167.490 1.00 49.66  ? 40   ARG F C     1 
ATOM 3936  O O     . ARG F 2 41  ? 164.414 174.357 168.423 1.00 65.78  ? 40   ARG F O     1 
ATOM 3937  C CB    . ARG F 2 41  ? 163.273 172.893 165.769 1.00 38.44  ? 40   ARG F CB    1 
ATOM 3938  C CG    . ARG F 2 41  ? 164.600 172.269 166.091 1.00 46.17  ? 40   ARG F CG    1 
ATOM 3939  C CD    . ARG F 2 41  ? 165.151 171.496 164.936 1.00 41.97  ? 40   ARG F CD    1 
ATOM 3940  N NE    . ARG F 2 41  ? 164.348 170.319 164.673 1.00 43.01  ? 40   ARG F NE    1 
ATOM 3941  C CZ    . ARG F 2 41  ? 164.607 169.456 163.706 1.00 55.45  ? 40   ARG F CZ    1 
ATOM 3942  N NH1   . ARG F 2 41  ? 165.650 169.645 162.921 1.00 56.27  ? 40   ARG F NH1   1 
ATOM 3943  N NH2   . ARG F 2 41  ? 163.829 168.406 163.526 1.00 56.49  ? 40   ARG F NH2   1 
ATOM 3944  N N     . GLY F 2 42  ? 163.621 175.844 166.945 1.00 51.05  ? 41   GLY F N     1 
ATOM 3945  C CA    . GLY F 2 42  ? 164.523 176.864 167.425 1.00 42.07  ? 41   GLY F CA    1 
ATOM 3946  C C     . GLY F 2 42  ? 164.263 177.233 168.862 1.00 46.75  ? 41   GLY F C     1 
ATOM 3947  O O     . GLY F 2 42  ? 165.171 177.669 169.568 1.00 58.61  ? 41   GLY F O     1 
ATOM 3948  N N     . GLY F 2 43  ? 163.044 177.042 169.324 1.00 43.91  ? 42   GLY F N     1 
ATOM 3949  C CA    . GLY F 2 43  ? 162.654 177.562 170.605 1.00 39.04  ? 42   GLY F CA    1 
ATOM 3950  C C     . GLY F 2 43  ? 161.804 178.798 170.527 1.00 49.43  ? 42   GLY F C     1 
ATOM 3951  O O     . GLY F 2 43  ? 161.577 179.434 171.556 1.00 55.85  ? 42   GLY F O     1 
ATOM 3952  N N     . VAL F 2 44  ? 161.350 179.174 169.336 1.00 53.24  ? 43   VAL F N     1 
ATOM 3953  C CA    . VAL F 2 44  ? 160.382 180.250 169.230 1.00 50.00  ? 43   VAL F CA    1 
ATOM 3954  C C     . VAL F 2 44  ? 159.117 179.836 169.951 1.00 59.83  ? 43   VAL F C     1 
ATOM 3955  O O     . VAL F 2 44  ? 158.726 178.665 169.931 1.00 59.23  ? 43   VAL F O     1 
ATOM 3956  C CB    . VAL F 2 44  ? 160.091 180.556 167.756 1.00 50.46  ? 43   VAL F CB    1 
ATOM 3957  C CG1   . VAL F 2 44  ? 159.081 181.658 167.639 1.00 54.62  ? 43   VAL F CG1   1 
ATOM 3958  C CG2   . VAL F 2 44  ? 161.347 180.920 167.052 1.00 47.60  ? 43   VAL F CG2   1 
ATOM 3959  N N     . LYS F 2 45  ? 158.466 180.791 170.599 1.00 66.25  ? 44   LYS F N     1 
ATOM 3960  C CA    . LYS F 2 45  ? 157.201 180.509 171.257 1.00 65.66  ? 44   LYS F CA    1 
ATOM 3961  C C     . LYS F 2 45  ? 156.025 180.986 170.421 1.00 71.19  ? 44   LYS F C     1 
ATOM 3962  O O     . LYS F 2 45  ? 155.176 180.186 170.029 1.00 75.13  ? 44   LYS F O     1 
ATOM 3963  C CB    . LYS F 2 45  ? 157.171 181.136 172.648 1.00 60.79  ? 44   LYS F CB    1 
ATOM 3964  C CG    . LYS F 2 45  ? 155.932 180.798 173.434 1.00 63.91  ? 44   LYS F CG    1 
ATOM 3965  C CD    . LYS F 2 45  ? 156.083 181.285 174.856 1.00 67.19  ? 44   LYS F CD    1 
ATOM 3966  C CE    . LYS F 2 45  ? 154.859 180.992 175.688 1.00 73.78  ? 44   LYS F CE    1 
ATOM 3967  N NZ    . LYS F 2 45  ? 155.045 181.427 177.099 1.00 68.85  ? 44   LYS F NZ    1 
ATOM 3968  N N     . ARG F 2 46  ? 155.952 182.280 170.149 1.00 72.92  ? 45   ARG F N     1 
ATOM 3969  C CA    . ARG F 2 46  ? 154.822 182.852 169.432 1.00 69.23  ? 45   ARG F CA    1 
ATOM 3970  C C     . ARG F 2 46  ? 155.309 183.611 168.208 1.00 68.20  ? 45   ARG F C     1 
ATOM 3971  O O     . ARG F 2 46  ? 155.970 184.641 168.332 1.00 74.89  ? 45   ARG F O     1 
ATOM 3972  C CB    . ARG F 2 46  ? 154.025 183.762 170.345 1.00 74.36  ? 45   ARG F CB    1 
ATOM 3973  C CG    . ARG F 2 46  ? 152.898 184.420 169.647 1.00 81.95  ? 45   ARG F CG    1 
ATOM 3974  C CD    . ARG F 2 46  ? 152.065 185.197 170.614 1.00 83.93  ? 45   ARG F CD    1 
ATOM 3975  N NE    . ARG F 2 46  ? 151.006 185.890 169.910 1.00 88.92  ? 45   ARG F NE    1 
ATOM 3976  C CZ    . ARG F 2 46  ? 149.989 186.474 170.512 1.00 91.23  ? 45   ARG F CZ    1 
ATOM 3977  N NH1   . ARG F 2 46  ? 149.891 186.425 171.826 1.00 73.03  ? 45   ARG F NH1   1 
ATOM 3978  N NH2   . ARG F 2 46  ? 149.067 187.091 169.800 1.00 97.30  ? 45   ARG F NH2   1 
ATOM 3979  N N     . ILE F 2 47  ? 154.956 183.114 167.031 1.00 58.61  ? 46   ILE F N     1 
ATOM 3980  C CA    . ILE F 2 47  ? 155.362 183.747 165.792 1.00 57.44  ? 46   ILE F CA    1 
ATOM 3981  C C     . ILE F 2 47  ? 154.545 185.009 165.556 1.00 63.29  ? 46   ILE F C     1 
ATOM 3982  O O     . ILE F 2 47  ? 153.457 185.184 166.099 1.00 59.41  ? 46   ILE F O     1 
ATOM 3983  C CB    . ILE F 2 47  ? 155.185 182.738 164.652 1.00 55.17  ? 46   ILE F CB    1 
ATOM 3984  C CG1   . ILE F 2 47  ? 156.144 181.581 164.846 1.00 50.06  ? 46   ILE F CG1   1 
ATOM 3985  C CG2   . ILE F 2 47  ? 155.411 183.347 163.306 1.00 51.74  ? 46   ILE F CG2   1 
ATOM 3986  C CD1   . ILE F 2 47  ? 155.884 180.459 163.901 1.00 51.61  ? 46   ILE F CD1   1 
ATOM 3987  N N     . SER F 2 48  ? 155.089 185.912 164.749 1.00 63.84  ? 47   SER F N     1 
ATOM 3988  C CA    . SER F 2 48  ? 154.313 186.997 164.173 1.00 69.03  ? 47   SER F CA    1 
ATOM 3989  C C     . SER F 2 48  ? 153.990 186.691 162.721 1.00 69.22  ? 47   SER F C     1 
ATOM 3990  O O     . SER F 2 48  ? 154.814 186.148 161.988 1.00 74.82  ? 47   SER F O     1 
ATOM 3991  C CB    . SER F 2 48  ? 155.050 188.326 164.243 1.00 73.53  ? 47   SER F CB    1 
ATOM 3992  O OG    . SER F 2 48  ? 154.303 189.326 163.581 1.00 81.80  ? 47   SER F OG    1 
ATOM 3993  N N     . GLY F 2 49  ? 152.793 187.083 162.301 1.00 55.32  ? 48   GLY F N     1 
ATOM 3994  C CA    . GLY F 2 49  ? 152.297 186.645 161.010 1.00 63.40  ? 48   GLY F CA    1 
ATOM 3995  C C     . GLY F 2 49  ? 153.145 187.091 159.840 1.00 71.86  ? 48   GLY F C     1 
ATOM 3996  O O     . GLY F 2 49  ? 153.072 186.507 158.758 1.00 73.99  ? 48   GLY F O     1 
ATOM 3997  N N     . LEU F 2 50  ? 153.956 188.119 160.028 1.00 62.18  ? 49   LEU F N     1 
ATOM 3998  C CA    . LEU F 2 50  ? 154.693 188.649 158.895 1.00 65.77  ? 49   LEU F CA    1 
ATOM 3999  C C     . LEU F 2 50  ? 155.943 187.841 158.596 1.00 65.99  ? 49   LEU F C     1 
ATOM 4000  O O     . LEU F 2 50  ? 156.459 187.904 157.476 1.00 65.86  ? 49   LEU F O     1 
ATOM 4001  C CB    . LEU F 2 50  ? 155.054 190.099 159.162 1.00 76.34  ? 49   LEU F CB    1 
ATOM 4002  C CG    . LEU F 2 50  ? 153.798 190.931 159.357 1.00 67.29  ? 49   LEU F CG    1 
ATOM 4003  C CD1   . LEU F 2 50  ? 154.149 192.351 159.732 1.00 66.98  ? 49   LEU F CD1   1 
ATOM 4004  C CD2   . LEU F 2 50  ? 152.970 190.885 158.096 1.00 55.82  ? 49   LEU F CD2   1 
ATOM 4005  N N     . ILE F 2 51  ? 156.428 187.077 159.574 1.00 58.66  ? 50   ILE F N     1 
ATOM 4006  C CA    . ILE F 2 51  ? 157.685 186.352 159.425 1.00 57.06  ? 50   ILE F CA    1 
ATOM 4007  C C     . ILE F 2 51  ? 157.676 185.499 158.172 1.00 58.76  ? 50   ILE F C     1 
ATOM 4008  O O     . ILE F 2 51  ? 158.675 185.415 157.449 1.00 57.08  ? 50   ILE F O     1 
ATOM 4009  C CB    . ILE F 2 51  ? 157.942 185.496 160.672 1.00 57.33  ? 50   ILE F CB    1 
ATOM 4010  C CG1   . ILE F 2 51  ? 158.016 186.384 161.897 1.00 64.87  ? 50   ILE F CG1   1 
ATOM 4011  C CG2   . ILE F 2 51  ? 159.222 184.771 160.538 1.00 51.93  ? 50   ILE F CG2   1 
ATOM 4012  C CD1   . ILE F 2 51  ? 159.085 187.394 161.801 1.00 61.21  ? 50   ILE F CD1   1 
ATOM 4013  N N     . TYR F 2 52  ? 156.536 184.886 157.878 1.00 59.36  ? 51   TYR F N     1 
ATOM 4014  C CA    . TYR F 2 52  ? 156.476 183.866 156.845 1.00 61.37  ? 51   TYR F CA    1 
ATOM 4015  C C     . TYR F 2 52  ? 157.023 184.351 155.519 1.00 69.28  ? 51   TYR F C     1 
ATOM 4016  O O     . TYR F 2 52  ? 157.472 183.543 154.704 1.00 76.36  ? 51   TYR F O     1 
ATOM 4017  C CB    . TYR F 2 52  ? 155.042 183.402 156.684 1.00 58.21  ? 51   TYR F CB    1 
ATOM 4018  C CG    . TYR F 2 52  ? 154.513 182.858 157.967 1.00 68.83  ? 51   TYR F CG    1 
ATOM 4019  C CD1   . TYR F 2 52  ? 155.302 182.064 158.768 1.00 73.24  ? 51   TYR F CD1   1 
ATOM 4020  C CD2   . TYR F 2 52  ? 153.245 183.170 158.403 1.00 73.95  ? 51   TYR F CD2   1 
ATOM 4021  C CE1   . TYR F 2 52  ? 154.835 181.572 159.950 1.00 85.75  ? 51   TYR F CE1   1 
ATOM 4022  C CE2   . TYR F 2 52  ? 152.772 182.683 159.587 1.00 81.19  ? 51   TYR F CE2   1 
ATOM 4023  C CZ    . TYR F 2 52  ? 153.571 181.883 160.356 1.00 89.38  ? 51   TYR F CZ    1 
ATOM 4024  O OH    . TYR F 2 52  ? 153.107 181.392 161.545 1.00 89.57  ? 51   TYR F OH    1 
ATOM 4025  N N     . GLU F 2 53  ? 156.967 185.649 155.259 1.00 60.53  ? 52   GLU F N     1 
ATOM 4026  C CA    . GLU F 2 53  ? 157.652 186.131 154.071 1.00 65.83  ? 52   GLU F CA    1 
ATOM 4027  C C     . GLU F 2 53  ? 159.126 186.354 154.328 1.00 67.19  ? 52   GLU F C     1 
ATOM 4028  O O     . GLU F 2 53  ? 159.968 185.994 153.493 1.00 65.76  ? 52   GLU F O     1 
ATOM 4029  C CB    . GLU F 2 53  ? 156.988 187.396 153.564 1.00 76.60  ? 52   GLU F CB    1 
ATOM 4030  C CG    . GLU F 2 53  ? 155.664 187.055 153.014 1.00 85.24  ? 52   GLU F CG    1 
ATOM 4031  C CD    . GLU F 2 53  ? 155.804 185.963 151.987 1.00 85.28  ? 52   GLU F CD    1 
ATOM 4032  O OE1   . GLU F 2 53  ? 156.731 186.044 151.155 1.00 89.30  ? 52   GLU F OE1   1 
ATOM 4033  O OE2   . GLU F 2 53  ? 155.025 184.994 152.040 1.00 72.56  ? 52   GLU F OE2   1 
ATOM 4034  N N     . GLU F 2 54  ? 159.448 186.941 155.476 1.00 63.16  ? 53   GLU F N     1 
ATOM 4035  C CA    . GLU F 2 54  ? 160.840 187.187 155.809 1.00 56.71  ? 53   GLU F CA    1 
ATOM 4036  C C     . GLU F 2 54  ? 161.672 185.937 155.619 1.00 60.40  ? 53   GLU F C     1 
ATOM 4037  O O     . GLU F 2 54  ? 162.702 185.958 154.933 1.00 59.23  ? 53   GLU F O     1 
ATOM 4038  C CB    . GLU F 2 54  ? 160.951 187.675 157.246 1.00 58.75  ? 53   GLU F CB    1 
ATOM 4039  C CG    . GLU F 2 54  ? 162.362 187.957 157.680 1.00 66.64  ? 53   GLU F CG    1 
ATOM 4040  C CD    . GLU F 2 54  ? 162.960 189.128 156.953 1.00 86.73  ? 53   GLU F CD    1 
ATOM 4041  O OE1   . GLU F 2 54  ? 162.203 189.883 156.314 1.00 94.62  ? 53   GLU F OE1   1 
ATOM 4042  O OE2   . GLU F 2 54  ? 164.192 189.298 157.017 1.00 90.33  ? 53   GLU F OE2   1 
ATOM 4043  N N     . THR F 2 55  ? 161.222 184.826 156.191 1.00 66.14  ? 54   THR F N     1 
ATOM 4044  C CA    . THR F 2 55  ? 161.995 183.602 156.088 1.00 58.12  ? 54   THR F CA    1 
ATOM 4045  C C     . THR F 2 55  ? 162.214 183.209 154.641 1.00 52.83  ? 54   THR F C     1 
ATOM 4046  O O     . THR F 2 55  ? 163.350 182.972 154.230 1.00 49.08  ? 54   THR F O     1 
ATOM 4047  C CB    . THR F 2 55  ? 161.318 182.486 156.852 1.00 55.73  ? 54   THR F CB    1 
ATOM 4048  O OG1   . THR F 2 55  ? 161.397 182.775 158.247 1.00 60.75  ? 54   THR F OG1   1 
ATOM 4049  C CG2   . THR F 2 55  ? 162.011 181.198 156.574 1.00 44.52  ? 54   THR F CG2   1 
ATOM 4050  N N     . ARG F 2 56  ? 161.149 183.153 153.843 1.00 54.81  ? 55   ARG F N     1 
ATOM 4051  C CA    . ARG F 2 56  ? 161.337 182.796 152.443 1.00 58.81  ? 55   ARG F CA    1 
ATOM 4052  C C     . ARG F 2 56  ? 162.393 183.672 151.802 1.00 53.47  ? 55   ARG F C     1 
ATOM 4053  O O     . ARG F 2 56  ? 163.218 183.191 151.016 1.00 59.07  ? 55   ARG F O     1 
ATOM 4054  C CB    . ARG F 2 56  ? 160.036 182.918 151.671 1.00 51.27  ? 55   ARG F CB    1 
ATOM 4055  C CG    . ARG F 2 56  ? 158.965 181.974 152.112 1.00 46.61  ? 55   ARG F CG    1 
ATOM 4056  C CD    . ARG F 2 56  ? 157.767 182.146 151.221 1.00 50.15  ? 55   ARG F CD    1 
ATOM 4057  N NE    . ARG F 2 56  ? 156.651 181.334 151.660 1.00 54.16  ? 55   ARG F NE    1 
ATOM 4058  C CZ    . ARG F 2 56  ? 155.785 181.730 152.577 1.00 57.43  ? 55   ARG F CZ    1 
ATOM 4059  N NH1   . ARG F 2 56  ? 155.915 182.924 153.130 1.00 53.73  ? 55   ARG F NH1   1 
ATOM 4060  N NH2   . ARG F 2 56  ? 154.788 180.941 152.935 1.00 69.23  ? 55   ARG F NH2   1 
ATOM 4061  N N     . GLY F 2 57  ? 162.404 184.953 152.146 1.00 40.34  ? 56   GLY F N     1 
ATOM 4062  C CA    . GLY F 2 57  ? 163.453 185.816 151.652 1.00 39.49  ? 56   GLY F CA    1 
ATOM 4063  C C     . GLY F 2 57  ? 164.832 185.324 152.031 1.00 53.99  ? 56   GLY F C     1 
ATOM 4064  O O     . GLY F 2 57  ? 165.677 185.064 151.163 1.00 61.60  ? 56   GLY F O     1 
ATOM 4065  N N     . VAL F 2 58  ? 165.055 185.153 153.334 1.00 50.28  ? 57   VAL F N     1 
ATOM 4066  C CA    . VAL F 2 58  ? 166.369 184.737 153.813 1.00 43.44  ? 57   VAL F CA    1 
ATOM 4067  C C     . VAL F 2 58  ? 166.799 183.453 153.132 1.00 52.21  ? 57   VAL F C     1 
ATOM 4068  O O     . VAL F 2 58  ? 167.849 183.385 152.485 1.00 67.70  ? 57   VAL F O     1 
ATOM 4069  C CB    . VAL F 2 58  ? 166.353 184.562 155.334 1.00 48.41  ? 57   VAL F CB    1 
ATOM 4070  C CG1   . VAL F 2 58  ? 167.628 183.923 155.770 1.00 48.92  ? 57   VAL F CG1   1 
ATOM 4071  C CG2   . VAL F 2 58  ? 166.200 185.897 155.978 1.00 40.97  ? 57   VAL F CG2   1 
ATOM 4072  N N     . LEU F 2 59  ? 165.978 182.421 153.266 1.00 44.91  ? 58   LEU F N     1 
ATOM 4073  C CA    . LEU F 2 59  ? 166.287 181.128 152.684 1.00 54.07  ? 58   LEU F CA    1 
ATOM 4074  C C     . LEU F 2 59  ? 166.666 181.263 151.224 1.00 54.32  ? 58   LEU F C     1 
ATOM 4075  O O     . LEU F 2 59  ? 167.759 180.857 150.814 1.00 57.48  ? 58   LEU F O     1 
ATOM 4076  C CB    . LEU F 2 59  ? 165.082 180.216 152.828 1.00 50.16  ? 58   LEU F CB    1 
ATOM 4077  C CG    . LEU F 2 59  ? 165.262 178.858 152.199 1.00 49.74  ? 58   LEU F CG    1 
ATOM 4078  C CD1   . LEU F 2 59  ? 166.359 178.174 152.930 1.00 44.91  ? 58   LEU F CD1   1 
ATOM 4079  C CD2   . LEU F 2 59  ? 163.989 178.087 152.326 1.00 54.63  ? 58   LEU F CD2   1 
ATOM 4080  N N     . LYS F 2 60  ? 165.784 181.866 150.431 1.00 47.49  ? 59   LYS F N     1 
ATOM 4081  C CA    . LYS F 2 60  ? 166.061 182.021 149.011 1.00 50.53  ? 59   LYS F CA    1 
ATOM 4082  C C     . LYS F 2 60  ? 167.436 182.619 148.791 1.00 50.21  ? 59   LYS F C     1 
ATOM 4083  O O     . LYS F 2 60  ? 168.211 182.133 147.964 1.00 47.02  ? 59   LYS F O     1 
ATOM 4084  C CB    . LYS F 2 60  ? 164.999 182.888 148.361 1.00 53.85  ? 59   LYS F CB    1 
ATOM 4085  C CG    . LYS F 2 60  ? 165.217 183.074 146.894 1.00 67.48  ? 59   LYS F CG    1 
ATOM 4086  C CD    . LYS F 2 60  ? 164.128 183.947 146.321 1.00 94.61  ? 59   LYS F CD    1 
ATOM 4087  C CE    . LYS F 2 60  ? 164.339 184.189 144.841 1.00 105.27 ? 59   LYS F CE    1 
ATOM 4088  N NZ    . LYS F 2 60  ? 163.278 185.060 144.277 1.00 106.59 ? 59   LYS F NZ    1 
ATOM 4089  N N     . VAL F 2 61  ? 167.773 183.657 149.554 1.00 38.88  ? 60   VAL F N     1 
ATOM 4090  C CA    . VAL F 2 61  ? 169.115 184.221 149.451 1.00 45.78  ? 60   VAL F CA    1 
ATOM 4091  C C     . VAL F 2 61  ? 170.160 183.147 149.688 1.00 54.44  ? 60   VAL F C     1 
ATOM 4092  O O     . VAL F 2 61  ? 171.031 182.889 148.845 1.00 55.24  ? 60   VAL F O     1 
ATOM 4093  C CB    . VAL F 2 61  ? 169.288 185.375 150.447 1.00 43.51  ? 60   VAL F CB    1 
ATOM 4094  C CG1   . VAL F 2 61  ? 170.732 185.790 150.501 1.00 34.94  ? 60   VAL F CG1   1 
ATOM 4095  C CG2   . VAL F 2 61  ? 168.425 186.529 150.033 1.00 47.97  ? 60   VAL F CG2   1 
ATOM 4096  N N     . PHE F 2 62  ? 170.081 182.505 150.845 1.00 42.85  ? 61   PHE F N     1 
ATOM 4097  C CA    . PHE F 2 62  ? 171.118 181.572 151.242 1.00 41.68  ? 61   PHE F CA    1 
ATOM 4098  C C     . PHE F 2 62  ? 171.365 180.549 150.148 1.00 45.39  ? 61   PHE F C     1 
ATOM 4099  O O     . PHE F 2 62  ? 172.492 180.395 149.657 1.00 44.39  ? 61   PHE F O     1 
ATOM 4100  C CB    . PHE F 2 62  ? 170.706 180.906 152.544 1.00 42.46  ? 61   PHE F CB    1 
ATOM 4101  C CG    . PHE F 2 62  ? 171.716 179.984 153.086 1.00 41.36  ? 61   PHE F CG    1 
ATOM 4102  C CD1   . PHE F 2 62  ? 172.799 180.469 153.764 1.00 40.64  ? 61   PHE F CD1   1 
ATOM 4103  C CD2   . PHE F 2 62  ? 171.575 178.635 152.942 1.00 51.90  ? 61   PHE F CD2   1 
ATOM 4104  C CE1   . PHE F 2 62  ? 173.736 179.621 154.272 1.00 47.07  ? 61   PHE F CE1   1 
ATOM 4105  C CE2   . PHE F 2 62  ? 172.505 177.786 153.455 1.00 59.58  ? 61   PHE F CE2   1 
ATOM 4106  C CZ    . PHE F 2 62  ? 173.589 178.279 154.118 1.00 53.37  ? 61   PHE F CZ    1 
ATOM 4107  N N     . LEU F 2 63  ? 170.306 179.889 149.698 1.00 37.11  ? 62   LEU F N     1 
ATOM 4108  C CA    . LEU F 2 63  ? 170.493 178.893 148.659 1.00 45.48  ? 62   LEU F CA    1 
ATOM 4109  C C     . LEU F 2 63  ? 171.018 179.518 147.382 1.00 60.57  ? 62   LEU F C     1 
ATOM 4110  O O     . LEU F 2 63  ? 171.711 178.855 146.608 1.00 62.22  ? 62   LEU F O     1 
ATOM 4111  C CB    . LEU F 2 63  ? 169.198 178.157 148.387 1.00 32.77  ? 62   LEU F CB    1 
ATOM 4112  C CG    . LEU F 2 63  ? 168.788 177.464 149.662 1.00 39.43  ? 62   LEU F CG    1 
ATOM 4113  C CD1   . LEU F 2 63  ? 167.537 176.663 149.434 1.00 38.34  ? 62   LEU F CD1   1 
ATOM 4114  C CD2   . LEU F 2 63  ? 169.918 176.615 150.137 1.00 35.90  ? 62   LEU F CD2   1 
ATOM 4115  N N     . GLU F 2 64  ? 170.693 180.782 147.125 1.00 57.12  ? 63   GLU F N     1 
ATOM 4116  C CA    . GLU F 2 64  ? 171.303 181.420 145.969 1.00 65.05  ? 63   GLU F CA    1 
ATOM 4117  C C     . GLU F 2 64  ? 172.812 181.383 146.090 1.00 62.04  ? 63   GLU F C     1 
ATOM 4118  O O     . GLU F 2 64  ? 173.509 180.932 145.174 1.00 60.12  ? 63   GLU F O     1 
ATOM 4119  C CB    . GLU F 2 64  ? 170.810 182.852 145.803 1.00 69.51  ? 63   GLU F CB    1 
ATOM 4120  C CG    . GLU F 2 64  ? 169.400 182.947 145.281 1.00 72.36  ? 63   GLU F CG    1 
ATOM 4121  C CD    . GLU F 2 64  ? 168.893 184.372 145.220 1.00 80.55  ? 63   GLU F CD    1 
ATOM 4122  O OE1   . GLU F 2 64  ? 169.548 185.264 145.797 1.00 78.37  ? 63   GLU F OE1   1 
ATOM 4123  O OE2   . GLU F 2 64  ? 167.844 184.603 144.584 1.00 82.41  ? 63   GLU F OE2   1 
ATOM 4124  N N     . ASN F 2 65  ? 173.335 181.808 147.234 1.00 51.90  ? 64   ASN F N     1 
ATOM 4125  C CA    . ASN F 2 65  ? 174.780 181.772 147.403 1.00 49.68  ? 64   ASN F CA    1 
ATOM 4126  C C     . ASN F 2 65  ? 175.319 180.366 147.218 1.00 43.85  ? 64   ASN F C     1 
ATOM 4127  O O     . ASN F 2 65  ? 176.192 180.121 146.373 1.00 60.07  ? 64   ASN F O     1 
ATOM 4128  C CB    . ASN F 2 65  ? 175.170 182.304 148.770 1.00 40.50  ? 64   ASN F CB    1 
ATOM 4129  C CG    . ASN F 2 65  ? 175.049 183.786 148.855 1.00 53.41  ? 64   ASN F CG    1 
ATOM 4130  O OD1   . ASN F 2 65  ? 175.051 184.470 147.839 1.00 68.55  ? 64   ASN F OD1   1 
ATOM 4131  N ND2   . ASN F 2 65  ? 174.969 184.307 150.067 1.00 44.82  ? 64   ASN F ND2   1 
ATOM 4132  N N     . VAL F 2 66  ? 174.799 179.422 147.993 1.00 40.72  ? 65   VAL F N     1 
ATOM 4133  C CA    . VAL F 2 66  ? 175.403 178.096 147.999 1.00 45.60  ? 65   VAL F CA    1 
ATOM 4134  C C     . VAL F 2 66  ? 175.312 177.457 146.624 1.00 51.66  ? 65   VAL F C     1 
ATOM 4135  O O     . VAL F 2 66  ? 176.324 177.064 146.039 1.00 54.04  ? 65   VAL F O     1 
ATOM 4136  C CB    . VAL F 2 66  ? 174.761 177.214 149.068 1.00 37.89  ? 65   VAL F CB    1 
ATOM 4137  C CG1   . VAL F 2 66  ? 175.267 175.835 148.917 1.00 31.21  ? 65   VAL F CG1   1 
ATOM 4138  C CG2   . VAL F 2 66  ? 175.138 177.743 150.405 1.00 47.65  ? 65   VAL F CG2   1 
ATOM 4139  N N     . ILE F 2 67  ? 174.100 177.351 146.084 1.00 46.80  ? 66   ILE F N     1 
ATOM 4140  C CA    . ILE F 2 67  ? 173.937 176.758 144.760 1.00 41.47  ? 66   ILE F CA    1 
ATOM 4141  C C     . ILE F 2 67  ? 174.865 177.429 143.771 1.00 60.71  ? 66   ILE F C     1 
ATOM 4142  O O     . ILE F 2 67  ? 175.427 176.783 142.884 1.00 63.27  ? 66   ILE F O     1 
ATOM 4143  C CB    . ILE F 2 67  ? 172.481 176.857 144.294 1.00 43.74  ? 66   ILE F CB    1 
ATOM 4144  C CG1   . ILE F 2 67  ? 171.592 176.002 145.165 1.00 38.92  ? 66   ILE F CG1   1 
ATOM 4145  C CG2   . ILE F 2 67  ? 172.365 176.372 142.894 1.00 40.44  ? 66   ILE F CG2   1 
ATOM 4146  C CD1   . ILE F 2 67  ? 170.140 176.253 144.919 1.00 49.51  ? 66   ILE F CD1   1 
ATOM 4147  N N     . ARG F 2 68  ? 175.050 178.735 143.915 1.00 55.40  ? 67   ARG F N     1 
ATOM 4148  C CA    . ARG F 2 68  ? 176.025 179.409 143.079 1.00 47.51  ? 67   ARG F CA    1 
ATOM 4149  C C     . ARG F 2 68  ? 177.373 178.722 143.169 1.00 52.90  ? 67   ARG F C     1 
ATOM 4150  O O     . ARG F 2 68  ? 177.871 178.191 142.169 1.00 60.78  ? 67   ARG F O     1 
ATOM 4151  C CB    . ARG F 2 68  ? 176.149 180.868 143.472 1.00 56.15  ? 67   ARG F CB    1 
ATOM 4152  C CG    . ARG F 2 68  ? 177.212 181.612 142.732 1.00 67.73  ? 67   ARG F CG    1 
ATOM 4153  C CD    . ARG F 2 68  ? 177.158 183.041 143.165 1.00 83.33  ? 67   ARG F CD    1 
ATOM 4154  N NE    . ARG F 2 68  ? 175.903 183.623 142.722 1.00 94.75  ? 67   ARG F NE    1 
ATOM 4155  C CZ    . ARG F 2 68  ? 175.470 184.820 143.078 1.00 97.57  ? 67   ARG F CZ    1 
ATOM 4156  N NH1   . ARG F 2 68  ? 176.184 185.563 143.903 1.00 99.47  ? 67   ARG F NH1   1 
ATOM 4157  N NH2   . ARG F 2 68  ? 174.313 185.265 142.621 1.00 92.20  ? 67   ARG F NH2   1 
ATOM 4158  N N     . ASP F 2 69  ? 177.968 178.709 144.359 1.00 41.52  ? 68   ASP F N     1 
ATOM 4159  C CA    . ASP F 2 69  ? 179.310 178.149 144.458 1.00 40.48  ? 68   ASP F CA    1 
ATOM 4160  C C     . ASP F 2 69  ? 179.356 176.712 143.969 1.00 44.56  ? 68   ASP F C     1 
ATOM 4161  O O     . ASP F 2 69  ? 180.268 176.332 143.227 1.00 42.33  ? 68   ASP F O     1 
ATOM 4162  C CB    . ASP F 2 69  ? 179.816 178.238 145.884 1.00 37.34  ? 68   ASP F CB    1 
ATOM 4163  C CG    . ASP F 2 69  ? 180.058 179.650 146.301 1.00 62.98  ? 68   ASP F CG    1 
ATOM 4164  O OD1   . ASP F 2 69  ? 180.006 180.517 145.412 1.00 82.94  ? 68   ASP F OD1   1 
ATOM 4165  O OD2   . ASP F 2 69  ? 180.322 179.897 147.495 1.00 69.60  ? 68   ASP F OD2   1 
ATOM 4166  N N     . ALA F 2 70  ? 178.384 175.899 144.363 1.00 48.58  ? 69   ALA F N     1 
ATOM 4167  C CA    . ALA F 2 70  ? 178.391 174.511 143.931 1.00 52.44  ? 69   ALA F CA    1 
ATOM 4168  C C     . ALA F 2 70  ? 178.438 174.425 142.419 1.00 48.24  ? 69   ALA F C     1 
ATOM 4169  O O     . ALA F 2 70  ? 179.336 173.802 141.846 1.00 49.70  ? 69   ALA F O     1 
ATOM 4170  C CB    . ALA F 2 70  ? 177.168 173.786 144.468 1.00 39.30  ? 69   ALA F CB    1 
ATOM 4171  N N     . VAL F 2 71  ? 177.481 175.067 141.754 1.00 39.77  ? 70   VAL F N     1 
ATOM 4172  C CA    . VAL F 2 71  ? 177.454 175.053 140.298 1.00 50.05  ? 70   VAL F CA    1 
ATOM 4173  C C     . VAL F 2 71  ? 178.804 175.442 139.741 1.00 52.11  ? 70   VAL F C     1 
ATOM 4174  O O     . VAL F 2 71  ? 179.302 174.823 138.796 1.00 42.82  ? 70   VAL F O     1 
ATOM 4175  C CB    . VAL F 2 71  ? 176.352 175.981 139.777 1.00 50.01  ? 70   VAL F CB    1 
ATOM 4176  C CG1   . VAL F 2 71  ? 176.465 176.107 138.301 1.00 50.13  ? 70   VAL F CG1   1 
ATOM 4177  C CG2   . VAL F 2 71  ? 175.023 175.416 140.123 1.00 41.05  ? 70   VAL F CG2   1 
ATOM 4178  N N     . THR F 2 72  ? 179.432 176.457 140.328 1.00 46.25  ? 71   THR F N     1 
ATOM 4179  C CA    . THR F 2 72  ? 180.736 176.876 139.836 1.00 44.36  ? 71   THR F CA    1 
ATOM 4180  C C     . THR F 2 72  ? 181.743 175.743 139.900 1.00 53.93  ? 71   THR F C     1 
ATOM 4181  O O     . THR F 2 72  ? 182.396 175.423 138.902 1.00 66.78  ? 71   THR F O     1 
ATOM 4182  C CB    . THR F 2 72  ? 181.241 178.061 140.625 1.00 51.31  ? 71   THR F CB    1 
ATOM 4183  O OG1   . THR F 2 72  ? 180.375 179.171 140.394 1.00 49.27  ? 71   THR F OG1   1 
ATOM 4184  C CG2   . THR F 2 72  ? 182.620 178.392 140.171 1.00 44.09  ? 71   THR F CG2   1 
ATOM 4185  N N     . TYR F 2 73  ? 181.895 175.130 141.074 1.00 51.23  ? 72   TYR F N     1 
ATOM 4186  C CA    . TYR F 2 73  ? 182.743 173.948 141.158 1.00 50.32  ? 72   TYR F CA    1 
ATOM 4187  C C     . TYR F 2 73  ? 182.418 172.952 140.066 1.00 57.95  ? 72   TYR F C     1 
ATOM 4188  O O     . TYR F 2 73  ? 183.316 172.450 139.383 1.00 68.09  ? 72   TYR F O     1 
ATOM 4189  C CB    . TYR F 2 73  ? 182.586 173.267 142.500 1.00 35.04  ? 72   TYR F CB    1 
ATOM 4190  C CG    . TYR F 2 73  ? 183.386 173.858 143.595 1.00 37.94  ? 72   TYR F CG    1 
ATOM 4191  C CD1   . TYR F 2 73  ? 184.652 173.406 143.838 1.00 38.19  ? 72   TYR F CD1   1 
ATOM 4192  C CD2   . TYR F 2 73  ? 182.876 174.836 144.404 1.00 39.00  ? 72   TYR F CD2   1 
ATOM 4193  C CE1   . TYR F 2 73  ? 185.392 173.911 144.846 1.00 35.73  ? 72   TYR F CE1   1 
ATOM 4194  C CE2   . TYR F 2 73  ? 183.614 175.351 145.419 1.00 37.90  ? 72   TYR F CE2   1 
ATOM 4195  C CZ    . TYR F 2 73  ? 184.875 174.886 145.635 1.00 38.97  ? 72   TYR F CZ    1 
ATOM 4196  O OH    . TYR F 2 73  ? 185.634 175.397 146.652 1.00 46.81  ? 72   TYR F OH    1 
ATOM 4197  N N     . THR F 2 74  ? 181.138 172.651 139.889 1.00 48.75  ? 73   THR F N     1 
ATOM 4198  C CA    . THR F 2 74  ? 180.754 171.678 138.884 1.00 59.33  ? 73   THR F CA    1 
ATOM 4199  C C     . THR F 2 74  ? 181.287 172.064 137.518 1.00 65.93  ? 73   THR F C     1 
ATOM 4200  O O     . THR F 2 74  ? 182.152 171.378 136.967 1.00 70.59  ? 73   THR F O     1 
ATOM 4201  C CB    . THR F 2 74  ? 179.249 171.547 138.846 1.00 54.59  ? 73   THR F CB    1 
ATOM 4202  O OG1   . THR F 2 74  ? 178.798 171.071 140.112 1.00 47.82  ? 73   THR F OG1   1 
ATOM 4203  C CG2   . THR F 2 74  ? 178.868 170.564 137.800 1.00 44.60  ? 73   THR F CG2   1 
ATOM 4204  N N     . GLU F 2 75  ? 180.800 173.174 136.964 1.00 54.72  ? 74   GLU F N     1 
ATOM 4205  C CA    . GLU F 2 75  ? 181.248 173.581 135.640 1.00 62.40  ? 74   GLU F CA    1 
ATOM 4206  C C     . GLU F 2 75  ? 182.756 173.528 135.535 1.00 60.11  ? 74   GLU F C     1 
ATOM 4207  O O     . GLU F 2 75  ? 183.296 173.109 134.508 1.00 62.75  ? 74   GLU F O     1 
ATOM 4208  C CB    . GLU F 2 75  ? 180.761 174.983 135.305 1.00 68.48  ? 74   GLU F CB    1 
ATOM 4209  C CG    . GLU F 2 75  ? 179.280 175.083 135.039 1.00 90.14  ? 74   GLU F CG    1 
ATOM 4210  C CD    . GLU F 2 75  ? 178.855 176.497 134.688 1.00 103.58 ? 74   GLU F CD    1 
ATOM 4211  O OE1   . GLU F 2 75  ? 179.670 177.426 134.866 1.00 107.53 ? 74   GLU F OE1   1 
ATOM 4212  O OE2   . GLU F 2 75  ? 177.712 176.681 134.219 1.00 103.87 ? 74   GLU F OE2   1 
ATOM 4213  N N     . HIS F 2 76  ? 183.458 173.922 136.590 1.00 52.63  ? 75   HIS F N     1 
ATOM 4214  C CA    . HIS F 2 76  ? 184.899 173.771 136.540 1.00 47.23  ? 75   HIS F CA    1 
ATOM 4215  C C     . HIS F 2 76  ? 185.331 172.343 136.297 1.00 53.54  ? 75   HIS F C     1 
ATOM 4216  O O     . HIS F 2 76  ? 186.308 172.122 135.580 1.00 69.30  ? 75   HIS F O     1 
ATOM 4217  C CB    . HIS F 2 76  ? 185.552 174.244 137.814 1.00 47.52  ? 75   HIS F CB    1 
ATOM 4218  C CG    . HIS F 2 76  ? 186.970 173.809 137.924 1.00 58.45  ? 75   HIS F CG    1 
ATOM 4219  N ND1   . HIS F 2 76  ? 187.902 174.073 136.949 1.00 58.65  ? 75   HIS F ND1   1 
ATOM 4220  C CD2   . HIS F 2 76  ? 187.610 173.102 138.880 1.00 71.60  ? 75   HIS F CD2   1 
ATOM 4221  C CE1   . HIS F 2 76  ? 189.061 173.551 137.304 1.00 71.33  ? 75   HIS F CE1   1 
ATOM 4222  N NE2   . HIS F 2 76  ? 188.911 172.959 138.473 1.00 73.09  ? 75   HIS F NE2   1 
ATOM 4223  N N     . ALA F 2 77  ? 184.643 171.371 136.866 1.00 59.87  ? 76   ALA F N     1 
ATOM 4224  C CA    . ALA F 2 77  ? 185.040 169.991 136.654 1.00 66.14  ? 76   ALA F CA    1 
ATOM 4225  C C     . ALA F 2 77  ? 184.476 169.418 135.373 1.00 65.87  ? 76   ALA F C     1 
ATOM 4226  O O     . ALA F 2 77  ? 184.711 168.244 135.085 1.00 74.14  ? 76   ALA F O     1 
ATOM 4227  C CB    . ALA F 2 77  ? 184.608 169.127 137.831 1.00 66.07  ? 76   ALA F CB    1 
ATOM 4228  N N     . LYS F 2 78  ? 183.738 170.212 134.606 1.00 50.27  ? 77   LYS F N     1 
ATOM 4229  C CA    . LYS F 2 78  ? 183.137 169.754 133.365 1.00 58.78  ? 77   LYS F CA    1 
ATOM 4230  C C     . LYS F 2 78  ? 182.266 168.536 133.617 1.00 62.97  ? 77   LYS F C     1 
ATOM 4231  O O     . LYS F 2 78  ? 182.437 167.479 133.014 1.00 62.97  ? 77   LYS F O     1 
ATOM 4232  C CB    . LYS F 2 78  ? 184.208 169.457 132.326 1.00 66.71  ? 77   LYS F CB    1 
ATOM 4233  C CG    . LYS F 2 78  ? 184.975 170.676 131.912 1.00 72.30  ? 77   LYS F CG    1 
ATOM 4234  C CD    . LYS F 2 78  ? 186.126 170.296 131.019 1.00 81.24  ? 77   LYS F CD    1 
ATOM 4235  C CE    . LYS F 2 78  ? 186.899 171.519 130.569 1.00 94.43  ? 77   LYS F CE    1 
ATOM 4236  N NZ    . LYS F 2 78  ? 188.098 171.162 129.760 1.00 101.43 ? 77   LYS F NZ    1 
ATOM 4237  N N     . ARG F 2 79  ? 181.345 168.681 134.554 1.00 58.68  ? 78   ARG F N     1 
ATOM 4238  C CA    . ARG F 2 79  ? 180.353 167.662 134.833 1.00 61.02  ? 78   ARG F CA    1 
ATOM 4239  C C     . ARG F 2 79  ? 178.980 168.282 134.681 1.00 62.03  ? 78   ARG F C     1 
ATOM 4240  O O     . ARG F 2 79  ? 178.810 169.478 134.919 1.00 66.17  ? 78   ARG F O     1 
ATOM 4241  C CB    . ARG F 2 79  ? 180.538 167.081 136.230 1.00 65.45  ? 78   ARG F CB    1 
ATOM 4242  C CG    . ARG F 2 79  ? 181.816 166.293 136.346 1.00 70.09  ? 78   ARG F CG    1 
ATOM 4243  C CD    . ARG F 2 79  ? 181.947 165.549 137.657 1.00 58.37  ? 78   ARG F CD    1 
ATOM 4244  N NE    . ARG F 2 79  ? 182.142 166.413 138.808 1.00 65.64  ? 78   ARG F NE    1 
ATOM 4245  C CZ    . ARG F 2 79  ? 181.180 166.744 139.656 1.00 63.93  ? 78   ARG F CZ    1 
ATOM 4246  N NH1   . ARG F 2 79  ? 179.954 166.296 139.459 1.00 63.54  ? 78   ARG F NH1   1 
ATOM 4247  N NH2   . ARG F 2 79  ? 181.439 167.528 140.690 1.00 42.48  ? 78   ARG F NH2   1 
ATOM 4248  N N     . LYS F 2 80  ? 178.012 167.484 134.247 1.00 65.61  ? 79   LYS F N     1 
ATOM 4249  C CA    . LYS F 2 80  ? 176.650 167.984 134.170 1.00 65.80  ? 79   LYS F CA    1 
ATOM 4250  C C     . LYS F 2 80  ? 175.892 167.752 135.459 1.00 69.05  ? 79   LYS F C     1 
ATOM 4251  O O     . LYS F 2 80  ? 174.720 168.126 135.553 1.00 73.68  ? 79   LYS F O     1 
ATOM 4252  C CB    . LYS F 2 80  ? 175.914 167.313 133.023 1.00 60.95  ? 79   LYS F CB    1 
ATOM 4253  C CG    . LYS F 2 80  ? 176.600 167.492 131.709 1.00 76.88  ? 79   LYS F CG    1 
ATOM 4254  C CD    . LYS F 2 80  ? 176.605 168.940 131.304 1.00 90.53  ? 79   LYS F CD    1 
ATOM 4255  C CE    . LYS F 2 80  ? 177.333 169.112 129.992 1.00 94.92  ? 79   LYS F CE    1 
ATOM 4256  N NZ    . LYS F 2 80  ? 176.640 168.375 128.906 1.00 99.65  ? 79   LYS F NZ    1 
ATOM 4257  N N     . THR F 2 81  ? 176.533 167.141 136.441 1.00 57.71  ? 80   THR F N     1 
ATOM 4258  C CA    . THR F 2 81  ? 175.893 166.725 137.670 1.00 52.83  ? 80   THR F CA    1 
ATOM 4259  C C     . THR F 2 81  ? 176.513 167.485 138.823 1.00 58.34  ? 80   THR F C     1 
ATOM 4260  O O     . THR F 2 81  ? 177.696 167.815 138.790 1.00 72.88  ? 80   THR F O     1 
ATOM 4261  C CB    . THR F 2 81  ? 176.085 165.235 137.891 1.00 60.02  ? 80   THR F CB    1 
ATOM 4262  O OG1   . THR F 2 81  ? 175.593 164.524 136.752 1.00 72.11  ? 80   THR F OG1   1 
ATOM 4263  C CG2   . THR F 2 81  ? 175.332 164.780 139.111 1.00 61.98  ? 80   THR F CG2   1 
ATOM 4264  N N     . VAL F 2 82  ? 175.723 167.754 139.846 1.00 50.63  ? 81   VAL F N     1 
ATOM 4265  C CA    . VAL F 2 82  ? 176.248 168.333 141.068 1.00 51.72  ? 81   VAL F CA    1 
ATOM 4266  C C     . VAL F 2 82  ? 176.289 167.242 142.120 1.00 53.53  ? 81   VAL F C     1 
ATOM 4267  O O     . VAL F 2 82  ? 175.253 166.834 142.647 1.00 55.25  ? 81   VAL F O     1 
ATOM 4268  C CB    . VAL F 2 82  ? 175.405 169.516 141.529 1.00 47.47  ? 81   VAL F CB    1 
ATOM 4269  C CG1   . VAL F 2 82  ? 175.883 169.973 142.863 1.00 35.92  ? 81   VAL F CG1   1 
ATOM 4270  C CG2   . VAL F 2 82  ? 175.515 170.618 140.527 1.00 49.28  ? 81   VAL F CG2   1 
ATOM 4271  N N     . THR F 2 83  ? 177.483 166.768 142.436 1.00 53.21  ? 82   THR F N     1 
ATOM 4272  C CA    . THR F 2 83  ? 177.630 165.773 143.478 1.00 59.37  ? 82   THR F CA    1 
ATOM 4273  C C     . THR F 2 83  ? 177.504 166.430 144.834 1.00 60.15  ? 82   THR F C     1 
ATOM 4274  O O     . THR F 2 83  ? 177.620 167.645 144.967 1.00 53.49  ? 82   THR F O     1 
ATOM 4275  C CB    . THR F 2 83  ? 178.977 165.078 143.400 1.00 62.23  ? 82   THR F CB    1 
ATOM 4276  O OG1   . THR F 2 83  ? 180.002 166.038 143.646 1.00 49.20  ? 82   THR F OG1   1 
ATOM 4277  C CG2   . THR F 2 83  ? 179.181 164.493 142.034 1.00 55.18  ? 82   THR F CG2   1 
ATOM 4278  N N     . ALA F 2 84  ? 177.258 165.610 145.848 1.00 64.56  ? 83   ALA F N     1 
ATOM 4279  C CA    . ALA F 2 84  ? 177.224 166.135 147.202 1.00 59.04  ? 83   ALA F CA    1 
ATOM 4280  C C     . ALA F 2 84  ? 178.548 166.782 147.567 1.00 49.20  ? 83   ALA F C     1 
ATOM 4281  O O     . ALA F 2 84  ? 178.574 167.840 148.205 1.00 53.53  ? 83   ALA F O     1 
ATOM 4282  C CB    . ALA F 2 84  ? 176.881 165.024 148.186 1.00 55.81  ? 83   ALA F CB    1 
ATOM 4283  N N     . MET F 2 85  ? 179.659 166.168 147.169 1.00 41.06  ? 84   MET F N     1 
ATOM 4284  C CA    . MET F 2 85  ? 180.954 166.758 147.466 1.00 50.11  ? 84   MET F CA    1 
ATOM 4285  C C     . MET F 2 85  ? 181.030 168.190 146.985 1.00 59.60  ? 84   MET F C     1 
ATOM 4286  O O     . MET F 2 85  ? 181.641 169.040 147.641 1.00 59.44  ? 84   MET F O     1 
ATOM 4287  C CB    . MET F 2 85  ? 182.058 165.944 146.824 1.00 46.24  ? 84   MET F CB    1 
ATOM 4288  C CG    . MET F 2 85  ? 182.161 164.587 147.403 1.00 57.40  ? 84   MET F CG    1 
ATOM 4289  S SD    . MET F 2 85  ? 182.390 164.759 149.169 1.00 73.02  ? 84   MET F SD    1 
ATOM 4290  C CE    . MET F 2 85  ? 183.958 165.614 149.204 1.00 61.73  ? 84   MET F CE    1 
ATOM 4291  N N     . ASP F 2 86  ? 180.413 168.475 145.847 1.00 48.88  ? 85   ASP F N     1 
ATOM 4292  C CA    . ASP F 2 86  ? 180.342 169.844 145.373 1.00 44.15  ? 85   ASP F CA    1 
ATOM 4293  C C     . ASP F 2 86  ? 179.775 170.743 146.451 1.00 49.08  ? 85   ASP F C     1 
ATOM 4294  O O     . ASP F 2 86  ? 180.415 171.709 146.877 1.00 48.42  ? 85   ASP F O     1 
ATOM 4295  C CB    . ASP F 2 86  ? 179.465 169.885 144.142 1.00 50.58  ? 85   ASP F CB    1 
ATOM 4296  C CG    . ASP F 2 86  ? 179.927 168.921 143.101 1.00 63.31  ? 85   ASP F CG    1 
ATOM 4297  O OD1   . ASP F 2 86  ? 181.110 168.539 143.147 1.00 68.05  ? 85   ASP F OD1   1 
ATOM 4298  O OD2   . ASP F 2 86  ? 179.097 168.472 142.289 1.00 44.30  ? 85   ASP F OD2   1 
ATOM 4299  N N     . VAL F 2 87  ? 178.586 170.404 146.938 1.00 45.40  ? 86   VAL F N     1 
ATOM 4300  C CA    . VAL F 2 87  ? 177.956 171.201 147.978 1.00 45.58  ? 86   VAL F CA    1 
ATOM 4301  C C     . VAL F 2 87  ? 178.878 171.340 149.164 1.00 47.08  ? 86   VAL F C     1 
ATOM 4302  O O     . VAL F 2 87  ? 179.245 172.449 149.551 1.00 44.95  ? 86   VAL F O     1 
ATOM 4303  C CB    . VAL F 2 87  ? 176.620 170.585 148.397 1.00 37.77  ? 86   VAL F CB    1 
ATOM 4304  C CG1   . VAL F 2 87  ? 176.137 171.273 149.623 1.00 33.93  ? 86   VAL F CG1   1 
ATOM 4305  C CG2   . VAL F 2 87  ? 175.631 170.747 147.291 1.00 44.28  ? 86   VAL F CG2   1 
ATOM 4306  N N     . VAL F 2 88  ? 179.297 170.217 149.738 1.00 31.62  ? 87   VAL F N     1 
ATOM 4307  C CA    . VAL F 2 88  ? 180.102 170.285 150.950 1.00 43.60  ? 87   VAL F CA    1 
ATOM 4308  C C     . VAL F 2 88  ? 181.280 171.219 150.759 1.00 47.45  ? 87   VAL F C     1 
ATOM 4309  O O     . VAL F 2 88  ? 181.677 171.937 151.681 1.00 42.91  ? 87   VAL F O     1 
ATOM 4310  C CB    . VAL F 2 88  ? 180.571 168.890 151.364 1.00 31.86  ? 87   VAL F CB    1 
ATOM 4311  C CG1   . VAL F 2 88  ? 181.407 168.996 152.599 1.00 31.42  ? 87   VAL F CG1   1 
ATOM 4312  C CG2   . VAL F 2 88  ? 179.395 168.025 151.601 1.00 32.45  ? 87   VAL F CG2   1 
ATOM 4313  N N     . TYR F 2 89  ? 181.840 171.257 149.556 1.00 37.45  ? 88   TYR F N     1 
ATOM 4314  C CA    . TYR F 2 89  ? 182.895 172.228 149.324 1.00 37.88  ? 88   TYR F CA    1 
ATOM 4315  C C     . TYR F 2 89  ? 182.344 173.638 149.241 1.00 46.25  ? 88   TYR F C     1 
ATOM 4316  O O     . TYR F 2 89  ? 183.037 174.594 149.587 1.00 45.21  ? 88   TYR F O     1 
ATOM 4317  C CB    . TYR F 2 89  ? 183.677 171.879 148.075 1.00 35.26  ? 88   TYR F CB    1 
ATOM 4318  C CG    . TYR F 2 89  ? 184.477 170.641 148.271 1.00 43.93  ? 88   TYR F CG    1 
ATOM 4319  C CD1   . TYR F 2 89  ? 185.085 170.395 149.478 1.00 52.30  ? 88   TYR F CD1   1 
ATOM 4320  C CD2   . TYR F 2 89  ? 184.629 169.720 147.260 1.00 52.75  ? 88   TYR F CD2   1 
ATOM 4321  C CE1   . TYR F 2 89  ? 185.815 169.266 149.684 1.00 58.59  ? 88   TYR F CE1   1 
ATOM 4322  C CE2   . TYR F 2 89  ? 185.366 168.589 147.451 1.00 62.94  ? 88   TYR F CE2   1 
ATOM 4323  C CZ    . TYR F 2 89  ? 185.957 168.365 148.670 1.00 65.79  ? 88   TYR F CZ    1 
ATOM 4324  O OH    . TYR F 2 89  ? 186.699 167.230 148.886 1.00 75.33  ? 88   TYR F OH    1 
ATOM 4325  N N     . ALA F 2 90  ? 181.109 173.801 148.790 1.00 40.65  ? 89   ALA F N     1 
ATOM 4326  C CA    . ALA F 2 90  ? 180.565 175.149 148.776 1.00 37.02  ? 89   ALA F CA    1 
ATOM 4327  C C     . ALA F 2 90  ? 180.323 175.648 150.187 1.00 45.76  ? 89   ALA F C     1 
ATOM 4328  O O     . ALA F 2 90  ? 180.751 176.747 150.549 1.00 59.17  ? 89   ALA F O     1 
ATOM 4329  C CB    . ALA F 2 90  ? 179.281 175.192 147.966 1.00 40.06  ? 89   ALA F CB    1 
ATOM 4330  N N     . LEU F 2 91  ? 179.639 174.857 150.999 1.00 38.84  ? 90   LEU F N     1 
ATOM 4331  C CA    . LEU F 2 91  ? 179.434 175.249 152.379 1.00 33.65  ? 90   LEU F CA    1 
ATOM 4332  C C     . LEU F 2 91  ? 180.763 175.498 153.057 1.00 54.43  ? 90   LEU F C     1 
ATOM 4333  O O     . LEU F 2 91  ? 180.966 176.542 153.683 1.00 57.51  ? 90   LEU F O     1 
ATOM 4334  C CB    . LEU F 2 91  ? 178.640 174.178 153.101 1.00 30.07  ? 90   LEU F CB    1 
ATOM 4335  C CG    . LEU F 2 91  ? 177.279 174.085 152.447 1.00 41.81  ? 90   LEU F CG    1 
ATOM 4336  C CD1   . LEU F 2 91  ? 176.493 172.940 152.993 1.00 43.57  ? 90   LEU F CD1   1 
ATOM 4337  C CD2   . LEU F 2 91  ? 176.570 175.360 152.708 1.00 30.33  ? 90   LEU F CD2   1 
ATOM 4338  N N     . LYS F 2 92  ? 181.699 174.565 152.915 1.00 45.11  ? 91   LYS F N     1 
ATOM 4339  C CA    . LYS F 2 92  ? 183.018 174.794 153.476 1.00 40.88  ? 91   LYS F CA    1 
ATOM 4340  C C     . LYS F 2 92  ? 183.586 176.111 153.001 1.00 53.85  ? 91   LYS F C     1 
ATOM 4341  O O     . LYS F 2 92  ? 184.231 176.827 153.769 1.00 52.28  ? 91   LYS F O     1 
ATOM 4342  C CB    . LYS F 2 92  ? 183.956 173.666 153.097 1.00 31.56  ? 91   LYS F CB    1 
ATOM 4343  C CG    . LYS F 2 92  ? 185.330 173.816 153.674 1.00 40.61  ? 91   LYS F CG    1 
ATOM 4344  C CD    . LYS F 2 92  ? 186.171 172.630 153.298 1.00 65.90  ? 91   LYS F CD    1 
ATOM 4345  C CE    . LYS F 2 92  ? 187.569 172.754 153.833 1.00 80.38  ? 91   LYS F CE    1 
ATOM 4346  N NZ    . LYS F 2 92  ? 188.374 171.585 153.411 1.00 94.50  ? 91   LYS F NZ    1 
ATOM 4347  N N     . ARG F 2 93  ? 183.336 176.456 151.745 1.00 57.33  ? 92   ARG F N     1 
ATOM 4348  C CA    . ARG F 2 93  ? 183.786 177.740 151.239 1.00 37.48  ? 92   ARG F CA    1 
ATOM 4349  C C     . ARG F 2 93  ? 183.173 178.884 152.018 1.00 43.50  ? 92   ARG F C     1 
ATOM 4350  O O     . ARG F 2 93  ? 183.886 179.812 152.403 1.00 61.72  ? 92   ARG F O     1 
ATOM 4351  C CB    . ARG F 2 93  ? 183.456 177.866 149.755 1.00 49.86  ? 92   ARG F CB    1 
ATOM 4352  C CG    . ARG F 2 93  ? 183.687 179.220 149.196 1.00 61.63  ? 92   ARG F CG    1 
ATOM 4353  C CD    . ARG F 2 93  ? 185.104 179.605 149.297 1.00 75.84  ? 92   ARG F CD    1 
ATOM 4354  N NE    . ARG F 2 93  ? 185.239 181.010 148.966 1.00 77.98  ? 92   ARG F NE    1 
ATOM 4355  C CZ    . ARG F 2 93  ? 185.032 181.981 149.845 1.00 89.95  ? 92   ARG F CZ    1 
ATOM 4356  N NH1   . ARG F 2 93  ? 184.665 181.665 151.083 1.00 95.44  ? 92   ARG F NH1   1 
ATOM 4357  N NH2   . ARG F 2 93  ? 185.174 183.253 149.487 1.00 89.20  ? 92   ARG F NH2   1 
ATOM 4358  N N     . GLN F 2 94  ? 181.881 178.830 152.298 1.00 42.19  ? 93   GLN F N     1 
ATOM 4359  C CA    . GLN F 2 94  ? 181.249 179.962 152.946 1.00 44.92  ? 93   GLN F CA    1 
ATOM 4360  C C     . GLN F 2 94  ? 181.461 179.963 154.440 1.00 53.38  ? 93   GLN F C     1 
ATOM 4361  O O     . GLN F 2 94  ? 180.913 180.824 155.129 1.00 44.60  ? 93   GLN F O     1 
ATOM 4362  C CB    . GLN F 2 94  ? 179.762 179.989 152.657 1.00 47.67  ? 93   GLN F CB    1 
ATOM 4363  C CG    . GLN F 2 94  ? 179.438 180.117 151.215 1.00 63.59  ? 93   GLN F CG    1 
ATOM 4364  C CD    . GLN F 2 94  ? 177.958 180.230 151.000 1.00 72.67  ? 93   GLN F CD    1 
ATOM 4365  O OE1   . GLN F 2 94  ? 177.175 179.972 151.907 1.00 80.28  ? 93   GLN F OE1   1 
ATOM 4366  N NE2   . GLN F 2 94  ? 177.556 180.566 149.785 1.00 69.38  ? 93   GLN F NE2   1 
ATOM 4367  N N     . GLY F 2 95  ? 182.217 179.013 154.963 1.00 48.58  ? 94   GLY F N     1 
ATOM 4368  C CA    . GLY F 2 95  ? 182.501 178.998 156.375 1.00 33.07  ? 94   GLY F CA    1 
ATOM 4369  C C     . GLY F 2 95  ? 181.520 178.214 157.200 1.00 48.90  ? 94   GLY F C     1 
ATOM 4370  O O     . GLY F 2 95  ? 181.581 178.279 158.430 1.00 50.00  ? 94   GLY F O     1 
ATOM 4371  N N     . ARG F 2 96  ? 180.626 177.472 156.570 1.00 45.51  ? 95   ARG F N     1 
ATOM 4372  C CA    . ARG F 2 96  ? 179.737 176.563 157.268 1.00 44.39  ? 95   ARG F CA    1 
ATOM 4373  C C     . ARG F 2 96  ? 180.188 175.159 156.928 1.00 53.64  ? 95   ARG F C     1 
ATOM 4374  O O     . ARG F 2 96  ? 179.968 174.686 155.813 1.00 53.87  ? 95   ARG F O     1 
ATOM 4375  C CB    . ARG F 2 96  ? 178.300 176.789 156.833 1.00 40.21  ? 95   ARG F CB    1 
ATOM 4376  C CG    . ARG F 2 96  ? 177.896 178.201 157.034 1.00 42.70  ? 95   ARG F CG    1 
ATOM 4377  C CD    . ARG F 2 96  ? 176.461 178.442 156.699 1.00 52.69  ? 95   ARG F CD    1 
ATOM 4378  N NE    . ARG F 2 96  ? 176.181 179.856 156.860 1.00 73.62  ? 95   ARG F NE    1 
ATOM 4379  C CZ    . ARG F 2 96  ? 175.973 180.430 158.035 1.00 80.28  ? 95   ARG F CZ    1 
ATOM 4380  N NH1   . ARG F 2 96  ? 176.018 179.704 159.142 1.00 78.87  ? 95   ARG F NH1   1 
ATOM 4381  N NH2   . ARG F 2 96  ? 175.732 181.728 158.105 1.00 70.17  ? 95   ARG F NH2   1 
ATOM 4382  N N     . THR F 2 97  ? 180.806 174.490 157.879 1.00 50.41  ? 96   THR F N     1 
ATOM 4383  C CA    . THR F 2 97  ? 181.352 173.172 157.623 1.00 41.63  ? 96   THR F CA    1 
ATOM 4384  C C     . THR F 2 97  ? 180.275 172.144 157.901 1.00 51.64  ? 96   THR F C     1 
ATOM 4385  O O     . THR F 2 97  ? 179.649 172.170 158.963 1.00 63.09  ? 96   THR F O     1 
ATOM 4386  C CB    . THR F 2 97  ? 182.572 172.908 158.488 1.00 46.86  ? 96   THR F CB    1 
ATOM 4387  O OG1   . THR F 2 97  ? 183.567 173.895 158.212 1.00 49.20  ? 96   THR F OG1   1 
ATOM 4388  C CG2   . THR F 2 97  ? 183.133 171.563 158.155 1.00 48.10  ? 96   THR F CG2   1 
ATOM 4389  N N     . LEU F 2 98  ? 180.061 171.247 156.956 1.00 44.88  ? 97   LEU F N     1 
ATOM 4390  C CA    . LEU F 2 98  ? 179.056 170.211 157.091 1.00 34.75  ? 97   LEU F CA    1 
ATOM 4391  C C     . LEU F 2 98  ? 179.742 168.860 157.158 1.00 47.50  ? 97   LEU F C     1 
ATOM 4392  O O     . LEU F 2 98  ? 180.718 168.622 156.451 1.00 54.03  ? 97   LEU F O     1 
ATOM 4393  C CB    . LEU F 2 98  ? 178.099 170.249 155.913 1.00 31.30  ? 97   LEU F CB    1 
ATOM 4394  C CG    . LEU F 2 98  ? 177.017 169.205 155.993 1.00 36.94  ? 97   LEU F CG    1 
ATOM 4395  C CD1   . LEU F 2 98  ? 176.212 169.529 157.196 1.00 35.91  ? 97   LEU F CD1   1 
ATOM 4396  C CD2   . LEU F 2 98  ? 176.166 169.257 154.768 1.00 38.58  ? 97   LEU F CD2   1 
ATOM 4397  N N     . TYR F 2 99  ? 179.241 167.976 158.006 1.00 43.78  ? 98   TYR F N     1 
ATOM 4398  C CA    . TYR F 2 99  ? 179.788 166.638 158.087 1.00 38.80  ? 98   TYR F CA    1 
ATOM 4399  C C     . TYR F 2 99  ? 178.742 165.620 157.691 1.00 43.54  ? 98   TYR F C     1 
ATOM 4400  O O     . TYR F 2 99  ? 177.546 165.898 157.671 1.00 39.12  ? 98   TYR F O     1 
ATOM 4401  C CB    . TYR F 2 99  ? 180.270 166.271 159.473 1.00 52.67  ? 98   TYR F CB    1 
ATOM 4402  C CG    . TYR F 2 99  ? 181.436 167.043 159.953 1.00 54.01  ? 98   TYR F CG    1 
ATOM 4403  C CD1   . TYR F 2 99  ? 182.319 167.594 159.071 1.00 53.07  ? 98   TYR F CD1   1 
ATOM 4404  C CD2   . TYR F 2 99  ? 181.723 167.116 161.297 1.00 47.45  ? 98   TYR F CD2   1 
ATOM 4405  C CE1   . TYR F 2 99  ? 183.409 168.279 159.516 1.00 56.60  ? 98   TYR F CE1   1 
ATOM 4406  C CE2   . TYR F 2 99  ? 182.807 167.790 161.752 1.00 49.51  ? 98   TYR F CE2   1 
ATOM 4407  C CZ    . TYR F 2 99  ? 183.648 168.371 160.857 1.00 53.98  ? 98   TYR F CZ    1 
ATOM 4408  O OH    . TYR F 2 99  ? 184.743 169.048 161.310 1.00 52.48  ? 98   TYR F OH    1 
ATOM 4409  N N     . GLY F 2 100 ? 179.213 164.432 157.375 1.00 50.02  ? 99   GLY F N     1 
ATOM 4410  C CA    . GLY F 2 100 ? 178.357 163.306 157.154 1.00 46.41  ? 99   GLY F CA    1 
ATOM 4411  C C     . GLY F 2 100 ? 178.159 162.949 155.706 1.00 57.58  ? 99   GLY F C     1 
ATOM 4412  O O     . GLY F 2 100 ? 177.746 161.827 155.414 1.00 74.24  ? 99   GLY F O     1 
ATOM 4413  N N     . PHE F 2 101 ? 178.419 163.865 154.796 1.00 62.64  ? 100  PHE F N     1 
ATOM 4414  C CA    . PHE F 2 101 ? 178.245 163.568 153.389 1.00 45.01  ? 100  PHE F CA    1 
ATOM 4415  C C     . PHE F 2 101 ? 179.540 163.239 152.675 1.00 52.57  ? 100  PHE F C     1 
ATOM 4416  O O     . PHE F 2 101 ? 179.515 162.966 151.475 1.00 70.31  ? 100  PHE F O     1 
ATOM 4417  C CB    . PHE F 2 101 ? 177.521 164.720 152.732 1.00 42.97  ? 100  PHE F CB    1 
ATOM 4418  C CG    . PHE F 2 101 ? 176.155 164.882 153.261 1.00 40.92  ? 100  PHE F CG    1 
ATOM 4419  C CD1   . PHE F 2 101 ? 175.504 163.794 153.791 1.00 53.70  ? 100  PHE F CD1   1 
ATOM 4420  C CD2   . PHE F 2 101 ? 175.547 166.104 153.312 1.00 35.37  ? 100  PHE F CD2   1 
ATOM 4421  C CE1   . PHE F 2 101 ? 174.254 163.912 154.305 1.00 54.45  ? 100  PHE F CE1   1 
ATOM 4422  C CE2   . PHE F 2 101 ? 174.296 166.225 153.839 1.00 34.43  ? 100  PHE F CE2   1 
ATOM 4423  C CZ    . PHE F 2 101 ? 173.647 165.128 154.332 1.00 36.09  ? 100  PHE F CZ    1 
ATOM 4424  N N     . GLY F 2 102 ? 180.645 163.201 153.380 1.00 55.82  ? 101  GLY F N     1 
ATOM 4425  C CA    . GLY F 2 102 ? 181.831 162.651 152.765 1.00 47.30  ? 101  GLY F CA    1 
ATOM 4426  C C     . GLY F 2 102 ? 182.849 163.723 152.448 1.00 66.05  ? 101  GLY F C     1 
ATOM 4427  O O     . GLY F 2 102 ? 182.518 164.894 152.232 1.00 69.38  ? 101  GLY F O     1 
ATOM 4428  N N     . GLY F 2 103 ? 184.111 163.314 152.411 1.00 75.95  ? 102  GLY F N     1 
ATOM 4429  C CA    . GLY F 2 103 ? 185.215 164.231 152.207 1.00 82.33  ? 102  GLY F CA    1 
ATOM 4430  C C     . GLY F 2 103 ? 186.574 163.569 152.349 1.00 96.86  ? 102  GLY F C     1 
ATOM 4431  O O     . GLY F 2 103 ? 187.591 164.101 151.908 1.00 98.88  ? 102  GLY F O     1 
ATOM 4432  O OXT   . GLY F 2 103 ? 186.699 162.479 152.907 1.00 104.00 ? 102  GLY F OXT   1 
ATOM 4433  N N     . ALA G 3 13  ? 218.550 187.224 120.417 1.00 133.67 ? 12   ALA G N     1 
ATOM 4434  C CA    . ALA G 3 13  ? 218.931 187.042 121.810 1.00 139.05 ? 12   ALA G CA    1 
ATOM 4435  C C     . ALA G 3 13  ? 218.854 188.356 122.580 1.00 141.85 ? 12   ALA G C     1 
ATOM 4436  O O     . ALA G 3 13  ? 219.776 188.706 123.315 1.00 141.74 ? 12   ALA G O     1 
ATOM 4437  C CB    . ALA G 3 13  ? 220.327 186.452 121.904 1.00 135.61 ? 12   ALA G CB    1 
ATOM 4438  N N     . LYS G 3 14  ? 217.755 189.085 122.401 1.00 137.32 ? 13   LYS G N     1 
ATOM 4439  C CA    . LYS G 3 14  ? 217.464 190.281 123.183 1.00 129.36 ? 13   LYS G CA    1 
ATOM 4440  C C     . LYS G 3 14  ? 216.182 190.051 123.968 1.00 131.23 ? 13   LYS G C     1 
ATOM 4441  O O     . LYS G 3 14  ? 215.148 189.705 123.389 1.00 138.07 ? 13   LYS G O     1 
ATOM 4442  C CB    . LYS G 3 14  ? 217.323 191.513 122.296 1.00 118.32 ? 13   LYS G CB    1 
ATOM 4443  C CG    . LYS G 3 14  ? 217.015 192.752 123.107 1.00 114.51 ? 13   LYS G CG    1 
ATOM 4444  C CD    . LYS G 3 14  ? 216.932 193.981 122.247 1.00 111.11 ? 13   LYS G CD    1 
ATOM 4445  C CE    . LYS G 3 14  ? 216.639 195.189 123.103 1.00 104.73 ? 13   LYS G CE    1 
ATOM 4446  N NZ    . LYS G 3 14  ? 216.596 196.428 122.289 1.00 93.10  ? 13   LYS G NZ    1 
ATOM 4447  N N     . ALA G 3 15  ? 216.245 190.266 125.275 1.00 121.01 ? 14   ALA G N     1 
ATOM 4448  C CA    . ALA G 3 15  ? 215.173 189.838 126.153 1.00 108.33 ? 14   ALA G CA    1 
ATOM 4449  C C     . ALA G 3 15  ? 214.078 190.886 126.257 1.00 103.52 ? 14   ALA G C     1 
ATOM 4450  O O     . ALA G 3 15  ? 214.336 192.080 126.424 1.00 97.10  ? 14   ALA G O     1 
ATOM 4451  C CB    . ALA G 3 15  ? 215.713 189.531 127.547 1.00 100.25 ? 14   ALA G CB    1 
ATOM 4452  N N     . LYS G 3 16  ? 212.842 190.415 126.162 1.00 107.68 ? 15   LYS G N     1 
ATOM 4453  C CA    . LYS G 3 16  ? 211.676 191.223 126.460 1.00 110.08 ? 15   LYS G CA    1 
ATOM 4454  C C     . LYS G 3 16  ? 210.987 190.629 127.677 1.00 104.35 ? 15   LYS G C     1 
ATOM 4455  O O     . LYS G 3 16  ? 210.975 189.411 127.868 1.00 96.45  ? 15   LYS G O     1 
ATOM 4456  C CB    . LYS G 3 16  ? 210.705 191.280 125.282 1.00 115.02 ? 15   LYS G CB    1 
ATOM 4457  C CG    . LYS G 3 16  ? 209.548 192.208 125.519 1.00 122.93 ? 15   LYS G CG    1 
ATOM 4458  C CD    . LYS G 3 16  ? 208.509 192.080 124.438 1.00 124.24 ? 15   LYS G CD    1 
ATOM 4459  C CE    . LYS G 3 16  ? 209.022 192.588 123.118 1.00 126.67 ? 15   LYS G CE    1 
ATOM 4460  N NZ    . LYS G 3 16  ? 207.974 192.457 122.075 1.00 126.63 ? 15   LYS G NZ    1 
ATOM 4461  N N     . THR G 3 17  ? 210.426 191.499 128.505 1.00 94.04  ? 16   THR G N     1 
ATOM 4462  C CA    . THR G 3 17  ? 209.784 191.047 129.727 1.00 83.78  ? 16   THR G CA    1 
ATOM 4463  C C     . THR G 3 17  ? 208.375 190.557 129.438 1.00 92.07  ? 16   THR G C     1 
ATOM 4464  O O     . THR G 3 17  ? 207.668 191.114 128.596 1.00 92.91  ? 16   THR G O     1 
ATOM 4465  C CB    . THR G 3 17  ? 209.744 192.179 130.740 1.00 71.72  ? 16   THR G CB    1 
ATOM 4466  O OG1   . THR G 3 17  ? 209.053 193.293 130.165 1.00 58.74  ? 16   THR G OG1   1 
ATOM 4467  C CG2   . THR G 3 17  ? 211.150 192.603 131.100 1.00 63.25  ? 16   THR G CG2   1 
ATOM 4468  N N     . ARG G 3 18  ? 207.969 189.498 130.137 1.00 86.56  ? 17   ARG G N     1 
ATOM 4469  C CA    . ARG G 3 18  ? 206.622 188.987 129.932 1.00 71.71  ? 17   ARG G CA    1 
ATOM 4470  C C     . ARG G 3 18  ? 205.575 190.034 130.264 1.00 68.38  ? 17   ARG G C     1 
ATOM 4471  O O     . ARG G 3 18  ? 204.613 190.213 129.511 1.00 70.80  ? 17   ARG G O     1 
ATOM 4472  C CB    . ARG G 3 18  ? 206.395 187.714 130.739 1.00 66.19  ? 17   ARG G CB    1 
ATOM 4473  C CG    . ARG G 3 18  ? 206.878 186.491 130.014 1.00 72.14  ? 17   ARG G CG    1 
ATOM 4474  C CD    . ARG G 3 18  ? 206.737 185.235 130.823 1.00 76.73  ? 17   ARG G CD    1 
ATOM 4475  N NE    . ARG G 3 18  ? 207.705 185.165 131.903 1.00 85.03  ? 17   ARG G NE    1 
ATOM 4476  C CZ    . ARG G 3 18  ? 207.811 184.127 132.720 1.00 82.77  ? 17   ARG G CZ    1 
ATOM 4477  N NH1   . ARG G 3 18  ? 207.003 183.091 132.574 1.00 80.59  ? 17   ARG G NH1   1 
ATOM 4478  N NH2   . ARG G 3 18  ? 208.722 184.122 133.677 1.00 83.31  ? 17   ARG G NH2   1 
ATOM 4479  N N     . SER G 3 19  ? 205.758 190.758 131.364 1.00 62.25  ? 18   SER G N     1 
ATOM 4480  C CA    . SER G 3 19  ? 204.776 191.759 131.756 1.00 69.72  ? 18   SER G CA    1 
ATOM 4481  C C     . SER G 3 19  ? 204.494 192.713 130.608 1.00 79.44  ? 18   SER G C     1 
ATOM 4482  O O     . SER G 3 19  ? 203.394 193.259 130.480 1.00 76.27  ? 18   SER G O     1 
ATOM 4483  C CB    . SER G 3 19  ? 205.276 192.513 132.981 1.00 66.74  ? 18   SER G CB    1 
ATOM 4484  O OG    . SER G 3 19  ? 205.393 191.631 134.080 1.00 73.89  ? 18   SER G OG    1 
ATOM 4485  N N     . SER G 3 20  ? 205.489 192.910 129.751 1.00 81.89  ? 19   SER G N     1 
ATOM 4486  C CA    . SER G 3 20  ? 205.286 193.712 128.558 1.00 80.32  ? 19   SER G CA    1 
ATOM 4487  C C     . SER G 3 20  ? 204.509 192.935 127.511 1.00 78.40  ? 19   SER G C     1 
ATOM 4488  O O     . SER G 3 20  ? 203.589 193.468 126.885 1.00 68.88  ? 19   SER G O     1 
ATOM 4489  C CB    . SER G 3 20  ? 206.633 194.152 128.004 1.00 81.18  ? 19   SER G CB    1 
ATOM 4490  O OG    . SER G 3 20  ? 207.401 193.017 127.654 1.00 91.80  ? 19   SER G OG    1 
ATOM 4491  N N     . ARG G 3 21  ? 204.867 191.665 127.311 1.00 74.14  ? 20   ARG G N     1 
ATOM 4492  C CA    . ARG G 3 21  ? 204.274 190.897 126.224 1.00 72.09  ? 20   ARG G CA    1 
ATOM 4493  C C     . ARG G 3 21  ? 202.763 190.863 126.339 1.00 87.51  ? 20   ARG G C     1 
ATOM 4494  O O     . ARG G 3 21  ? 202.055 190.858 125.330 1.00 99.72  ? 20   ARG G O     1 
ATOM 4495  C CB    . ARG G 3 21  ? 204.826 189.478 126.213 1.00 72.34  ? 20   ARG G CB    1 
ATOM 4496  C CG    . ARG G 3 21  ? 206.306 189.403 125.972 1.00 84.72  ? 20   ARG G CG    1 
ATOM 4497  C CD    . ARG G 3 21  ? 206.768 187.969 125.888 1.00 96.42  ? 20   ARG G CD    1 
ATOM 4498  N NE    . ARG G 3 21  ? 208.216 187.892 125.760 1.00 109.72 ? 20   ARG G NE    1 
ATOM 4499  C CZ    . ARG G 3 21  ? 208.869 188.018 124.613 1.00 112.60 ? 20   ARG G CZ    1 
ATOM 4500  N NH1   . ARG G 3 21  ? 208.201 188.226 123.492 1.00 114.84 ? 20   ARG G NH1   1 
ATOM 4501  N NH2   . ARG G 3 21  ? 210.190 187.937 124.585 1.00 106.47 ? 20   ARG G NH2   1 
ATOM 4502  N N     . ALA G 3 22  ? 202.250 190.837 127.560 1.00 81.66  ? 21   ALA G N     1 
ATOM 4503  C CA    . ALA G 3 22  ? 200.814 190.956 127.730 1.00 80.80  ? 21   ALA G CA    1 
ATOM 4504  C C     . ALA G 3 22  ? 200.392 192.400 127.916 1.00 78.18  ? 21   ALA G C     1 
ATOM 4505  O O     . ALA G 3 22  ? 199.195 192.697 127.909 1.00 80.12  ? 21   ALA G O     1 
ATOM 4506  C CB    . ALA G 3 22  ? 200.356 190.122 128.919 1.00 82.79  ? 21   ALA G CB    1 
ATOM 4507  N N     . GLY G 3 23  ? 201.347 193.305 128.069 1.00 67.17  ? 22   GLY G N     1 
ATOM 4508  C CA    . GLY G 3 23  ? 201.009 194.679 128.364 1.00 65.28  ? 22   GLY G CA    1 
ATOM 4509  C C     . GLY G 3 23  ? 200.409 194.837 129.742 1.00 69.55  ? 22   GLY G C     1 
ATOM 4510  O O     . GLY G 3 23  ? 199.293 195.338 129.889 1.00 74.87  ? 22   GLY G O     1 
ATOM 4511  N N     . LEU G 3 24  ? 201.136 194.398 130.761 1.00 69.36  ? 23   LEU G N     1 
ATOM 4512  C CA    . LEU G 3 24  ? 200.676 194.484 132.133 1.00 63.63  ? 23   LEU G CA    1 
ATOM 4513  C C     . LEU G 3 24  ? 201.646 195.310 132.953 1.00 68.23  ? 23   LEU G C     1 
ATOM 4514  O O     . LEU G 3 24  ? 202.830 195.416 132.634 1.00 57.97  ? 23   LEU G O     1 
ATOM 4515  C CB    . LEU G 3 24  ? 200.541 193.116 132.767 1.00 62.42  ? 23   LEU G CB    1 
ATOM 4516  C CG    . LEU G 3 24  ? 199.498 192.282 132.060 1.00 58.67  ? 23   LEU G CG    1 
ATOM 4517  C CD1   . LEU G 3 24  ? 199.408 190.930 132.716 1.00 68.37  ? 23   LEU G CD1   1 
ATOM 4518  C CD2   . LEU G 3 24  ? 198.177 193.008 132.094 1.00 54.70  ? 23   LEU G CD2   1 
ATOM 4519  N N     . GLN G 3 25  ? 201.122 195.902 134.021 1.00 79.45  ? 24   GLN G N     1 
ATOM 4520  C CA    . GLN G 3 25  ? 201.967 196.704 134.888 1.00 77.26  ? 24   GLN G CA    1 
ATOM 4521  C C     . GLN G 3 25  ? 202.534 195.895 136.043 1.00 72.08  ? 24   GLN G C     1 
ATOM 4522  O O     . GLN G 3 25  ? 203.459 196.347 136.721 1.00 77.45  ? 24   GLN G O     1 
ATOM 4523  C CB    . GLN G 3 25  ? 201.173 197.895 135.396 1.00 77.43  ? 24   GLN G CB    1 
ATOM 4524  C CG    . GLN G 3 25  ? 200.746 198.783 134.271 1.00 72.34  ? 24   GLN G CG    1 
ATOM 4525  C CD    . GLN G 3 25  ? 201.929 199.273 133.487 1.00 76.75  ? 24   GLN G CD    1 
ATOM 4526  O OE1   . GLN G 3 25  ? 202.956 199.622 134.058 1.00 82.51  ? 24   GLN G OE1   1 
ATOM 4527  N NE2   . GLN G 3 25  ? 201.802 199.291 132.170 1.00 74.64  ? 24   GLN G NE2   1 
ATOM 4528  N N     . PHE G 3 26  ? 202.007 194.730 136.285 1.00 63.52  ? 25   PHE G N     1 
ATOM 4529  C CA    . PHE G 3 26  ? 202.539 193.902 137.353 1.00 64.55  ? 25   PHE G CA    1 
ATOM 4530  C C     . PHE G 3 26  ? 203.582 192.907 136.855 1.00 68.32  ? 25   PHE G C     1 
ATOM 4531  O O     . PHE G 3 26  ? 203.520 192.439 135.720 1.00 62.72  ? 25   PHE G O     1 
ATOM 4532  C CB    . PHE G 3 26  ? 201.411 193.185 138.065 1.00 55.35  ? 25   PHE G CB    1 
ATOM 4533  C CG    . PHE G 3 26  ? 200.678 194.063 139.004 1.00 58.14  ? 25   PHE G CG    1 
ATOM 4534  C CD1   . PHE G 3 26  ? 201.315 195.137 139.557 1.00 59.41  ? 25   PHE G CD1   1 
ATOM 4535  C CD2   . PHE G 3 26  ? 199.361 193.847 139.309 1.00 56.03  ? 25   PHE G CD2   1 
ATOM 4536  C CE1   . PHE G 3 26  ? 200.675 195.960 140.419 1.00 65.89  ? 25   PHE G CE1   1 
ATOM 4537  C CE2   . PHE G 3 26  ? 198.709 194.684 140.173 1.00 52.76  ? 25   PHE G CE2   1 
ATOM 4538  C CZ    . PHE G 3 26  ? 199.373 195.738 140.726 1.00 62.93  ? 25   PHE G CZ    1 
ATOM 4539  N N     . PRO G 3 27  ? 204.538 192.580 137.689 1.00 62.78  ? 26   PRO G N     1 
ATOM 4540  C CA    . PRO G 3 27  ? 205.687 191.793 137.241 1.00 66.90  ? 26   PRO G CA    1 
ATOM 4541  C C     . PRO G 3 27  ? 205.392 190.315 137.074 1.00 65.56  ? 26   PRO G C     1 
ATOM 4542  O O     . PRO G 3 27  ? 205.673 189.528 137.984 1.00 74.24  ? 26   PRO G O     1 
ATOM 4543  C CB    . PRO G 3 27  ? 206.695 192.015 138.365 1.00 65.46  ? 26   PRO G CB    1 
ATOM 4544  C CG    . PRO G 3 27  ? 205.857 192.236 139.547 1.00 61.78  ? 26   PRO G CG    1 
ATOM 4545  C CD    . PRO G 3 27  ? 204.695 193.030 139.076 1.00 54.33  ? 26   PRO G CD    1 
ATOM 4546  N N     . VAL G 3 28  ? 204.861 189.921 135.916 1.00 56.59  ? 27   VAL G N     1 
ATOM 4547  C CA    . VAL G 3 28  ? 204.423 188.543 135.723 1.00 53.95  ? 27   VAL G CA    1 
ATOM 4548  C C     . VAL G 3 28  ? 205.512 187.570 136.124 1.00 60.87  ? 27   VAL G C     1 
ATOM 4549  O O     . VAL G 3 28  ? 205.239 186.495 136.667 1.00 73.37  ? 27   VAL G O     1 
ATOM 4550  C CB    . VAL G 3 28  ? 203.988 188.323 134.270 1.00 53.83  ? 27   VAL G CB    1 
ATOM 4551  C CG1   . VAL G 3 28  ? 203.561 186.897 134.079 1.00 53.18  ? 27   VAL G CG1   1 
ATOM 4552  C CG2   . VAL G 3 28  ? 202.868 189.249 133.939 1.00 54.88  ? 27   VAL G CG2   1 
ATOM 4553  N N     . GLY G 3 29  ? 206.762 187.936 135.888 1.00 67.71  ? 28   GLY G N     1 
ATOM 4554  C CA    . GLY G 3 29  ? 207.847 187.098 136.355 1.00 74.92  ? 28   GLY G CA    1 
ATOM 4555  C C     . GLY G 3 29  ? 207.768 186.844 137.841 1.00 70.69  ? 28   GLY G C     1 
ATOM 4556  O O     . GLY G 3 29  ? 207.714 185.696 138.287 1.00 54.23  ? 28   GLY G O     1 
ATOM 4557  N N     . ARG G 3 30  ? 207.716 187.914 138.627 1.00 75.33  ? 29   ARG G N     1 
ATOM 4558  C CA    . ARG G 3 30  ? 207.709 187.755 140.072 1.00 73.12  ? 29   ARG G CA    1 
ATOM 4559  C C     . ARG G 3 30  ? 206.557 186.873 140.528 1.00 71.12  ? 29   ARG G C     1 
ATOM 4560  O O     . ARG G 3 30  ? 206.733 186.011 141.395 1.00 61.64  ? 29   ARG G O     1 
ATOM 4561  C CB    . ARG G 3 30  ? 207.647 189.116 140.749 1.00 66.49  ? 29   ARG G CB    1 
ATOM 4562  C CG    . ARG G 3 30  ? 207.618 189.011 142.241 1.00 65.61  ? 29   ARG G CG    1 
ATOM 4563  C CD    . ARG G 3 30  ? 207.604 190.363 142.915 1.00 56.56  ? 29   ARG G CD    1 
ATOM 4564  N NE    . ARG G 3 30  ? 208.868 191.064 142.759 1.00 61.18  ? 29   ARG G NE    1 
ATOM 4565  C CZ    . ARG G 3 30  ? 209.117 192.255 143.281 1.00 68.05  ? 29   ARG G CZ    1 
ATOM 4566  N NH1   . ARG G 3 30  ? 208.195 192.867 144.002 1.00 59.90  ? 29   ARG G NH1   1 
ATOM 4567  N NH2   . ARG G 3 30  ? 210.293 192.827 143.100 1.00 74.39  ? 29   ARG G NH2   1 
ATOM 4568  N N     . VAL G 3 31  ? 205.374 187.054 139.943 1.00 65.13  ? 30   VAL G N     1 
ATOM 4569  C CA    . VAL G 3 31  ? 204.260 186.161 140.248 1.00 54.86  ? 30   VAL G CA    1 
ATOM 4570  C C     . VAL G 3 31  ? 204.664 184.722 139.990 1.00 54.60  ? 30   VAL G C     1 
ATOM 4571  O O     . VAL G 3 31  ? 204.651 183.877 140.894 1.00 69.98  ? 30   VAL G O     1 
ATOM 4572  C CB    . VAL G 3 31  ? 203.024 186.539 139.424 1.00 54.75  ? 30   VAL G CB    1 
ATOM 4573  C CG1   . VAL G 3 31  ? 202.013 185.457 139.521 1.00 54.73  ? 30   VAL G CG1   1 
ATOM 4574  C CG2   . VAL G 3 31  ? 202.444 187.808 139.944 1.00 57.56  ? 30   VAL G CG2   1 
ATOM 4575  N N     . HIS G 3 32  ? 205.073 184.433 138.757 1.00 60.32  ? 31   HIS G N     1 
ATOM 4576  C CA    . HIS G 3 32  ? 205.420 183.064 138.423 1.00 68.44  ? 31   HIS G CA    1 
ATOM 4577  C C     . HIS G 3 32  ? 206.477 182.501 139.346 1.00 74.47  ? 31   HIS G C     1 
ATOM 4578  O O     . HIS G 3 32  ? 206.577 181.281 139.484 1.00 81.88  ? 31   HIS G O     1 
ATOM 4579  C CB    . HIS G 3 32  ? 205.911 182.953 136.995 1.00 68.67  ? 31   HIS G CB    1 
ATOM 4580  C CG    . HIS G 3 32  ? 206.288 181.563 136.616 1.00 82.99  ? 31   HIS G CG    1 
ATOM 4581  N ND1   . HIS G 3 32  ? 205.375 180.536 136.579 1.00 93.80  ? 31   HIS G ND1   1 
ATOM 4582  C CD2   . HIS G 3 32  ? 207.485 181.013 136.310 1.00 87.00  ? 31   HIS G CD2   1 
ATOM 4583  C CE1   . HIS G 3 32  ? 205.987 179.418 136.239 1.00 94.81  ? 31   HIS G CE1   1 
ATOM 4584  N NE2   . HIS G 3 32  ? 207.269 179.680 136.070 1.00 89.20  ? 31   HIS G NE2   1 
ATOM 4585  N N     . ARG G 3 33  ? 207.270 183.348 139.985 1.00 70.04  ? 32   ARG G N     1 
ATOM 4586  C CA    . ARG G 3 33  ? 208.151 182.828 141.015 1.00 69.61  ? 32   ARG G CA    1 
ATOM 4587  C C     . ARG G 3 33  ? 207.372 182.497 142.272 1.00 70.75  ? 32   ARG G C     1 
ATOM 4588  O O     . ARG G 3 33  ? 207.507 181.402 142.826 1.00 76.05  ? 32   ARG G O     1 
ATOM 4589  C CB    . ARG G 3 33  ? 209.259 183.820 141.318 1.00 60.49  ? 32   ARG G CB    1 
ATOM 4590  C CG    . ARG G 3 33  ? 210.161 183.378 142.431 1.00 56.01  ? 32   ARG G CG    1 
ATOM 4591  C CD    . ARG G 3 33  ? 211.342 184.302 142.536 1.00 73.26  ? 32   ARG G CD    1 
ATOM 4592  N NE    . ARG G 3 33  ? 210.952 185.661 142.882 1.00 80.51  ? 32   ARG G NE    1 
ATOM 4593  C CZ    . ARG G 3 33  ? 210.802 186.094 144.125 1.00 87.63  ? 32   ARG G CZ    1 
ATOM 4594  N NH1   . ARG G 3 33  ? 211.022 185.276 145.139 1.00 98.67  ? 32   ARG G NH1   1 
ATOM 4595  N NH2   . ARG G 3 33  ? 210.448 187.346 144.354 1.00 84.54  ? 32   ARG G NH2   1 
ATOM 4596  N N     . LEU G 3 34  ? 206.535 183.423 142.732 1.00 55.68  ? 33   LEU G N     1 
ATOM 4597  C CA    . LEU G 3 34  ? 205.864 183.202 144.005 1.00 50.78  ? 33   LEU G CA    1 
ATOM 4598  C C     . LEU G 3 34  ? 204.997 181.960 143.972 1.00 62.20  ? 33   LEU G C     1 
ATOM 4599  O O     . LEU G 3 34  ? 204.912 181.238 144.968 1.00 65.79  ? 33   LEU G O     1 
ATOM 4600  C CB    . LEU G 3 34  ? 205.034 184.412 144.396 1.00 41.70  ? 33   LEU G CB    1 
ATOM 4601  C CG    . LEU G 3 34  ? 205.939 185.568 144.765 1.00 61.41  ? 33   LEU G CG    1 
ATOM 4602  C CD1   . LEU G 3 34  ? 205.127 186.771 145.136 1.00 63.13  ? 33   LEU G CD1   1 
ATOM 4603  C CD2   . LEU G 3 34  ? 206.808 185.147 145.907 1.00 47.13  ? 33   LEU G CD2   1 
ATOM 4604  N N     . LEU G 3 35  ? 204.345 181.683 142.848 1.00 60.63  ? 34   LEU G N     1 
ATOM 4605  C CA    . LEU G 3 35  ? 203.536 180.476 142.797 1.00 63.53  ? 34   LEU G CA    1 
ATOM 4606  C C     . LEU G 3 35  ? 204.381 179.255 143.107 1.00 69.13  ? 34   LEU G C     1 
ATOM 4607  O O     . LEU G 3 35  ? 204.076 178.492 144.027 1.00 66.77  ? 34   LEU G O     1 
ATOM 4608  C CB    . LEU G 3 35  ? 202.865 180.337 141.443 1.00 54.34  ? 34   LEU G CB    1 
ATOM 4609  C CG    . LEU G 3 35  ? 201.863 181.450 141.231 1.00 52.87  ? 34   LEU G CG    1 
ATOM 4610  C CD1   . LEU G 3 35  ? 201.226 181.301 139.890 1.00 43.46  ? 34   LEU G CD1   1 
ATOM 4611  C CD2   . LEU G 3 35  ? 200.836 181.407 142.304 1.00 52.14  ? 34   LEU G CD2   1 
ATOM 4612  N N     . ARG G 3 36  ? 205.469 179.067 142.369 1.00 69.97  ? 35   ARG G N     1 
ATOM 4613  C CA    . ARG G 3 36  ? 206.350 177.943 142.648 1.00 71.15  ? 35   ARG G CA    1 
ATOM 4614  C C     . ARG G 3 36  ? 206.824 177.970 144.090 1.00 73.12  ? 35   ARG G C     1 
ATOM 4615  O O     . ARG G 3 36  ? 206.435 177.127 144.902 1.00 70.82  ? 35   ARG G O     1 
ATOM 4616  C CB    . ARG G 3 36  ? 207.542 177.958 141.703 1.00 64.55  ? 35   ARG G CB    1 
ATOM 4617  C CG    . ARG G 3 36  ? 207.199 177.660 140.277 1.00 72.65  ? 35   ARG G CG    1 
ATOM 4618  C CD    . ARG G 3 36  ? 208.425 177.856 139.442 1.00 86.14  ? 35   ARG G CD    1 
ATOM 4619  N NE    . ARG G 3 36  ? 208.863 179.240 139.529 1.00 102.79 ? 35   ARG G NE    1 
ATOM 4620  C CZ    . ARG G 3 36  ? 209.956 179.717 138.948 1.00 114.19 ? 35   ARG G CZ    1 
ATOM 4621  N NH1   . ARG G 3 36  ? 210.737 178.914 138.241 1.00 115.21 ? 35   ARG G NH1   1 
ATOM 4622  N NH2   . ARG G 3 36  ? 210.271 180.998 139.084 1.00 115.41 ? 35   ARG G NH2   1 
ATOM 4623  N N     . LYS G 3 37  ? 207.631 178.963 144.442 1.00 75.40  ? 36   LYS G N     1 
ATOM 4624  C CA    . LYS G 3 37  ? 208.284 178.937 145.740 1.00 79.84  ? 36   LYS G CA    1 
ATOM 4625  C C     . LYS G 3 37  ? 207.304 178.999 146.897 1.00 74.21  ? 36   LYS G C     1 
ATOM 4626  O O     . LYS G 3 37  ? 207.733 178.916 148.047 1.00 78.44  ? 36   LYS G O     1 
ATOM 4627  C CB    . LYS G 3 37  ? 209.290 180.073 145.842 1.00 73.73  ? 36   LYS G CB    1 
ATOM 4628  C CG    . LYS G 3 37  ? 210.431 179.888 144.871 1.00 77.73  ? 36   LYS G CG    1 
ATOM 4629  C CD    . LYS G 3 37  ? 211.485 180.969 144.998 1.00 90.66  ? 36   LYS G CD    1 
ATOM 4630  C CE    . LYS G 3 37  ? 212.565 180.798 143.934 1.00 96.23  ? 36   LYS G CE    1 
ATOM 4631  N NZ    . LYS G 3 37  ? 213.267 179.491 144.046 1.00 99.84  ? 36   LYS G NZ    1 
ATOM 4632  N N     . GLY G 3 38  ? 206.017 179.162 146.632 1.00 66.35  ? 37   GLY G N     1 
ATOM 4633  C CA    . GLY G 3 38  ? 205.015 179.125 147.670 1.00 72.52  ? 37   GLY G CA    1 
ATOM 4634  C C     . GLY G 3 38  ? 204.339 177.789 147.881 1.00 71.83  ? 37   GLY G C     1 
ATOM 4635  O O     . GLY G 3 38  ? 203.523 177.661 148.798 1.00 68.71  ? 37   GLY G O     1 
ATOM 4636  N N     . ASN G 3 39  ? 204.652 176.788 147.066 1.00 66.90  ? 38   ASN G N     1 
ATOM 4637  C CA    . ASN G 3 39  ? 204.059 175.463 147.200 1.00 68.95  ? 38   ASN G CA    1 
ATOM 4638  C C     . ASN G 3 39  ? 202.542 175.533 147.172 1.00 67.77  ? 38   ASN G C     1 
ATOM 4639  O O     . ASN G 3 39  ? 201.860 175.064 148.080 1.00 76.86  ? 38   ASN G O     1 
ATOM 4640  C CB    . ASN G 3 39  ? 204.546 174.769 148.465 1.00 69.44  ? 38   ASN G CB    1 
ATOM 4641  C CG    . ASN G 3 39  ? 205.967 174.300 148.340 1.00 82.08  ? 38   ASN G CG    1 
ATOM 4642  O OD1   . ASN G 3 39  ? 206.242 173.290 147.696 1.00 94.09  ? 38   ASN G OD1   1 
ATOM 4643  N ND2   . ASN G 3 39  ? 206.887 175.037 148.941 1.00 74.99  ? 38   ASN G ND2   1 
ATOM 4644  N N     . TYR G 3 40  ? 202.017 176.160 146.132 1.00 61.52  ? 39   TYR G N     1 
ATOM 4645  C CA    . TYR G 3 40  ? 200.589 176.154 145.896 1.00 62.90  ? 39   TYR G CA    1 
ATOM 4646  C C     . TYR G 3 40  ? 200.159 175.037 144.978 1.00 71.40  ? 39   TYR G C     1 
ATOM 4647  O O     . TYR G 3 40  ? 198.958 174.802 144.845 1.00 73.08  ? 39   TYR G O     1 
ATOM 4648  C CB    . TYR G 3 40  ? 200.152 177.489 145.326 1.00 42.76  ? 39   TYR G CB    1 
ATOM 4649  C CG    . TYR G 3 40  ? 200.349 178.574 146.328 1.00 41.64  ? 39   TYR G CG    1 
ATOM 4650  C CD1   . TYR G 3 40  ? 199.343 178.924 147.193 1.00 49.61  ? 39   TYR G CD1   1 
ATOM 4651  C CD2   . TYR G 3 40  ? 201.567 179.197 146.459 1.00 41.35  ? 39   TYR G CD2   1 
ATOM 4652  C CE1   . TYR G 3 40  ? 199.532 179.896 148.126 1.00 53.04  ? 39   TYR G CE1   1 
ATOM 4653  C CE2   . TYR G 3 40  ? 201.764 180.166 147.387 1.00 48.45  ? 39   TYR G CE2   1 
ATOM 4654  C CZ    . TYR G 3 40  ? 200.747 180.512 148.219 1.00 55.63  ? 39   TYR G CZ    1 
ATOM 4655  O OH    . TYR G 3 40  ? 200.957 181.488 149.151 1.00 61.04  ? 39   TYR G OH    1 
ATOM 4656  N N     . ALA G 3 41  ? 201.102 174.353 144.354 1.00 74.97  ? 40   ALA G N     1 
ATOM 4657  C CA    . ALA G 3 41  ? 200.826 173.127 143.620 1.00 71.36  ? 40   ALA G CA    1 
ATOM 4658  C C     . ALA G 3 41  ? 202.156 172.514 143.229 1.00 76.56  ? 40   ALA G C     1 
ATOM 4659  O O     . ALA G 3 41  ? 203.227 173.046 143.530 1.00 79.69  ? 40   ALA G O     1 
ATOM 4660  C CB    . ALA G 3 41  ? 199.971 173.364 142.381 1.00 61.04  ? 40   ALA G CB    1 
ATOM 4661  N N     . GLU G 3 42  ? 202.075 171.390 142.535 1.00 72.43  ? 41   GLU G N     1 
ATOM 4662  C CA    . GLU G 3 42  ? 203.275 170.733 142.052 1.00 71.57  ? 41   GLU G CA    1 
ATOM 4663  C C     . GLU G 3 42  ? 203.886 171.496 140.894 1.00 71.32  ? 41   GLU G C     1 
ATOM 4664  O O     . GLU G 3 42  ? 205.104 171.664 140.823 1.00 86.94  ? 41   GLU G O     1 
ATOM 4665  C CB    . GLU G 3 42  ? 202.938 169.312 141.628 1.00 73.76  ? 41   GLU G CB    1 
ATOM 4666  C CG    . GLU G 3 42  ? 204.107 168.522 141.125 1.00 90.03  ? 41   GLU G CG    1 
ATOM 4667  C CD    . GLU G 3 42  ? 203.703 167.116 140.756 1.00 100.98 ? 41   GLU G CD    1 
ATOM 4668  O OE1   . GLU G 3 42  ? 202.503 166.802 140.878 1.00 104.67 ? 41   GLU G OE1   1 
ATOM 4669  O OE2   . GLU G 3 42  ? 204.576 166.325 140.342 1.00 103.02 ? 41   GLU G OE2   1 
ATOM 4670  N N     . ARG G 3 43  ? 203.052 171.965 139.981 1.00 67.83  ? 42   ARG G N     1 
ATOM 4671  C CA    . ARG G 3 43  ? 203.512 172.551 138.738 1.00 66.63  ? 42   ARG G CA    1 
ATOM 4672  C C     . ARG G 3 43  ? 202.645 173.748 138.414 1.00 65.69  ? 42   ARG G C     1 
ATOM 4673  O O     . ARG G 3 43  ? 201.446 173.740 138.690 1.00 64.07  ? 42   ARG G O     1 
ATOM 4674  C CB    . ARG G 3 43  ? 203.426 171.546 137.610 1.00 68.45  ? 42   ARG G CB    1 
ATOM 4675  C CG    . ARG G 3 43  ? 204.304 170.344 137.788 1.00 76.08  ? 42   ARG G CG    1 
ATOM 4676  C CD    . ARG G 3 43  ? 203.958 169.342 136.733 1.00 86.94  ? 42   ARG G CD    1 
ATOM 4677  N NE    . ARG G 3 43  ? 204.165 169.897 135.408 1.00 93.72  ? 42   ARG G NE    1 
ATOM 4678  C CZ    . ARG G 3 43  ? 203.750 169.313 134.296 1.00 102.94 ? 42   ARG G CZ    1 
ATOM 4679  N NH1   . ARG G 3 43  ? 203.095 168.172 134.362 1.00 97.33  ? 42   ARG G NH1   1 
ATOM 4680  N NH2   . ARG G 3 43  ? 203.971 169.874 133.120 1.00 110.07 ? 42   ARG G NH2   1 
ATOM 4681  N N     . VAL G 3 44  ? 203.241 174.762 137.808 1.00 65.19  ? 43   VAL G N     1 
ATOM 4682  C CA    . VAL G 3 44  ? 202.554 176.011 137.528 1.00 62.34  ? 43   VAL G CA    1 
ATOM 4683  C C     . VAL G 3 44  ? 202.362 176.122 136.030 1.00 66.39  ? 43   VAL G C     1 
ATOM 4684  O O     . VAL G 3 44  ? 203.338 176.168 135.276 1.00 72.08  ? 43   VAL G O     1 
ATOM 4685  C CB    . VAL G 3 44  ? 203.325 177.214 138.058 1.00 61.63  ? 43   VAL G CB    1 
ATOM 4686  C CG1   . VAL G 3 44  ? 202.637 178.462 137.624 1.00 63.77  ? 43   VAL G CG1   1 
ATOM 4687  C CG2   . VAL G 3 44  ? 203.417 177.147 139.558 1.00 51.74  ? 43   VAL G CG2   1 
ATOM 4688  N N     . GLY G 3 45  ? 201.109 176.178 135.597 1.00 66.55  ? 44   GLY G N     1 
ATOM 4689  C CA    . GLY G 3 45  ? 200.838 176.391 134.191 1.00 69.32  ? 44   GLY G CA    1 
ATOM 4690  C C     . GLY G 3 45  ? 201.395 177.718 133.719 1.00 64.03  ? 44   GLY G C     1 
ATOM 4691  O O     . GLY G 3 45  ? 201.688 178.609 134.511 1.00 55.60  ? 44   GLY G O     1 
ATOM 4692  N N     . ALA G 3 46  ? 201.558 177.843 132.405 1.00 66.77  ? 45   ALA G N     1 
ATOM 4693  C CA    . ALA G 3 46  ? 202.153 179.060 131.873 1.00 73.89  ? 45   ALA G CA    1 
ATOM 4694  C C     . ALA G 3 46  ? 201.174 180.215 131.837 1.00 78.30  ? 45   ALA G C     1 
ATOM 4695  O O     . ALA G 3 46  ? 201.546 181.334 132.190 1.00 73.95  ? 45   ALA G O     1 
ATOM 4696  C CB    . ALA G 3 46  ? 202.699 178.818 130.472 1.00 70.09  ? 45   ALA G CB    1 
ATOM 4697  N N     . GLY G 3 47  ? 199.937 179.974 131.420 1.00 73.08  ? 46   GLY G N     1 
ATOM 4698  C CA    . GLY G 3 47  ? 198.987 181.064 131.340 1.00 63.85  ? 46   GLY G CA    1 
ATOM 4699  C C     . GLY G 3 47  ? 198.662 181.650 132.698 1.00 68.36  ? 46   GLY G C     1 
ATOM 4700  O O     . GLY G 3 47  ? 198.302 182.825 132.810 1.00 63.76  ? 46   GLY G O     1 
ATOM 4701  N N     . ALA G 3 48  ? 198.807 180.848 133.750 1.00 66.85  ? 47   ALA G N     1 
ATOM 4702  C CA    . ALA G 3 48  ? 198.331 181.272 135.064 1.00 56.03  ? 47   ALA G CA    1 
ATOM 4703  C C     . ALA G 3 48  ? 198.960 182.574 135.527 1.00 62.27  ? 47   ALA G C     1 
ATOM 4704  O O     . ALA G 3 48  ? 198.227 183.563 135.687 1.00 64.09  ? 47   ALA G O     1 
ATOM 4705  C CB    . ALA G 3 48  ? 198.540 180.144 136.072 1.00 53.81  ? 47   ALA G CB    1 
ATOM 4706  N N     . PRO G 3 49  ? 200.276 182.674 135.715 1.00 59.09  ? 48   PRO G N     1 
ATOM 4707  C CA    . PRO G 3 49  ? 200.819 183.900 136.307 1.00 57.14  ? 48   PRO G CA    1 
ATOM 4708  C C     . PRO G 3 49  ? 200.337 185.141 135.606 1.00 65.92  ? 48   PRO G C     1 
ATOM 4709  O O     . PRO G 3 49  ? 199.984 186.127 136.259 1.00 64.57  ? 48   PRO G O     1 
ATOM 4710  C CB    . PRO G 3 49  ? 202.327 183.715 136.156 1.00 55.30  ? 48   PRO G CB    1 
ATOM 4711  C CG    . PRO G 3 49  ? 202.506 182.287 136.101 1.00 60.99  ? 48   PRO G CG    1 
ATOM 4712  C CD    . PRO G 3 49  ? 201.361 181.779 135.307 1.00 57.14  ? 48   PRO G CD    1 
ATOM 4713  N N     . VAL G 3 50  ? 200.280 185.102 134.285 1.00 67.77  ? 49   VAL G N     1 
ATOM 4714  C CA    . VAL G 3 50  ? 199.621 186.150 133.530 1.00 63.91  ? 49   VAL G CA    1 
ATOM 4715  C C     . VAL G 3 50  ? 198.242 186.375 134.111 1.00 61.03  ? 49   VAL G C     1 
ATOM 4716  O O     . VAL G 3 50  ? 197.966 187.416 134.720 1.00 63.52  ? 49   VAL G O     1 
ATOM 4717  C CB    . VAL G 3 50  ? 199.508 185.775 132.050 1.00 60.17  ? 49   VAL G CB    1 
ATOM 4718  C CG1   . VAL G 3 50  ? 198.675 186.796 131.327 1.00 49.26  ? 49   VAL G CG1   1 
ATOM 4719  C CG2   . VAL G 3 50  ? 200.877 185.678 131.440 1.00 58.80  ? 49   VAL G CG2   1 
ATOM 4720  N N     . TYR G 3 51  ? 197.384 185.374 133.952 1.00 48.44  ? 50   TYR G N     1 
ATOM 4721  C CA    . TYR G 3 51  ? 195.974 185.581 134.218 1.00 47.58  ? 50   TYR G CA    1 
ATOM 4722  C C     . TYR G 3 51  ? 195.757 186.129 135.607 1.00 51.81  ? 50   TYR G C     1 
ATOM 4723  O O     . TYR G 3 51  ? 194.768 186.819 135.857 1.00 53.55  ? 50   TYR G O     1 
ATOM 4724  C CB    . TYR G 3 51  ? 195.221 184.278 134.069 1.00 52.21  ? 50   TYR G CB    1 
ATOM 4725  C CG    . TYR G 3 51  ? 193.741 184.454 134.102 1.00 49.44  ? 50   TYR G CG    1 
ATOM 4726  C CD1   . TYR G 3 51  ? 193.054 184.781 132.957 1.00 43.14  ? 50   TYR G CD1   1 
ATOM 4727  C CD2   . TYR G 3 51  ? 193.032 184.323 135.271 1.00 50.02  ? 50   TYR G CD2   1 
ATOM 4728  C CE1   . TYR G 3 51  ? 191.705 184.939 132.963 1.00 52.10  ? 50   TYR G CE1   1 
ATOM 4729  C CE2   . TYR G 3 51  ? 191.677 184.485 135.290 1.00 53.63  ? 50   TYR G CE2   1 
ATOM 4730  C CZ    . TYR G 3 51  ? 191.017 184.797 134.131 1.00 55.73  ? 50   TYR G CZ    1 
ATOM 4731  O OH    . TYR G 3 51  ? 189.654 184.967 134.130 1.00 59.27  ? 50   TYR G OH    1 
ATOM 4732  N N     . LEU G 3 52  ? 196.662 185.827 136.523 1.00 51.35  ? 51   LEU G N     1 
ATOM 4733  C CA    . LEU G 3 52  ? 196.558 186.355 137.870 1.00 51.73  ? 51   LEU G CA    1 
ATOM 4734  C C     . LEU G 3 52  ? 196.986 187.811 137.925 1.00 60.75  ? 51   LEU G C     1 
ATOM 4735  O O     . LEU G 3 52  ? 196.255 188.669 138.442 1.00 60.75  ? 51   LEU G O     1 
ATOM 4736  C CB    . LEU G 3 52  ? 197.410 185.518 138.806 1.00 51.09  ? 51   LEU G CB    1 
ATOM 4737  C CG    . LEU G 3 52  ? 197.420 186.058 140.208 1.00 45.91  ? 51   LEU G CG    1 
ATOM 4738  C CD1   . LEU G 3 52  ? 196.029 185.994 140.700 1.00 41.61  ? 51   LEU G CD1   1 
ATOM 4739  C CD2   . LEU G 3 52  ? 198.295 185.192 141.022 1.00 47.20  ? 51   LEU G CD2   1 
ATOM 4740  N N     . ALA G 3 53  ? 198.165 188.111 137.388 1.00 57.91  ? 52   ALA G N     1 
ATOM 4741  C CA    . ALA G 3 53  ? 198.645 189.480 137.429 1.00 57.24  ? 52   ALA G CA    1 
ATOM 4742  C C     . ALA G 3 53  ? 197.614 190.419 136.850 1.00 67.09  ? 52   ALA G C     1 
ATOM 4743  O O     . ALA G 3 53  ? 197.381 191.503 137.388 1.00 61.97  ? 52   ALA G O     1 
ATOM 4744  C CB    . ALA G 3 53  ? 199.955 189.603 136.670 1.00 47.61  ? 52   ALA G CB    1 
ATOM 4745  N N     . ALA G 3 54  ? 196.957 190.004 135.770 1.00 64.20  ? 53   ALA G N     1 
ATOM 4746  C CA    . ALA G 3 54  ? 195.895 190.829 135.213 1.00 59.11  ? 53   ALA G CA    1 
ATOM 4747  C C     . ALA G 3 54  ? 194.875 191.185 136.278 1.00 62.29  ? 53   ALA G C     1 
ATOM 4748  O O     . ALA G 3 54  ? 194.564 192.361 136.490 1.00 63.31  ? 53   ALA G O     1 
ATOM 4749  C CB    . ALA G 3 54  ? 195.214 190.109 134.056 1.00 57.52  ? 53   ALA G CB    1 
ATOM 4750  N N     . VAL G 3 55  ? 194.360 190.179 136.975 1.00 59.58  ? 54   VAL G N     1 
ATOM 4751  C CA    . VAL G 3 55  ? 193.328 190.432 137.968 1.00 54.74  ? 54   VAL G CA    1 
ATOM 4752  C C     . VAL G 3 55  ? 193.823 191.417 139.008 1.00 51.91  ? 54   VAL G C     1 
ATOM 4753  O O     . VAL G 3 55  ? 193.154 192.412 139.313 1.00 56.15  ? 54   VAL G O     1 
ATOM 4754  C CB    . VAL G 3 55  ? 192.881 189.124 138.623 1.00 44.26  ? 54   VAL G CB    1 
ATOM 4755  C CG1   . VAL G 3 55  ? 191.912 189.441 139.696 1.00 39.99  ? 54   VAL G CG1   1 
ATOM 4756  C CG2   . VAL G 3 55  ? 192.255 188.246 137.606 1.00 36.55  ? 54   VAL G CG2   1 
ATOM 4757  N N     . LEU G 3 56  ? 195.001 191.157 139.574 1.00 40.73  ? 55   LEU G N     1 
ATOM 4758  C CA    . LEU G 3 56  ? 195.524 192.080 140.571 1.00 51.64  ? 55   LEU G CA    1 
ATOM 4759  C C     . LEU G 3 56  ? 195.545 193.498 140.035 1.00 60.72  ? 55   LEU G C     1 
ATOM 4760  O O     . LEU G 3 56  ? 195.053 194.431 140.679 1.00 52.69  ? 55   LEU G O     1 
ATOM 4761  C CB    . LEU G 3 56  ? 196.915 191.655 140.996 1.00 47.35  ? 55   LEU G CB    1 
ATOM 4762  C CG    . LEU G 3 56  ? 196.820 190.328 141.707 1.00 52.26  ? 55   LEU G CG    1 
ATOM 4763  C CD1   . LEU G 3 56  ? 198.180 189.855 142.114 1.00 52.62  ? 55   LEU G CD1   1 
ATOM 4764  C CD2   . LEU G 3 56  ? 195.943 190.515 142.895 1.00 36.03  ? 55   LEU G CD2   1 
ATOM 4765  N N     . GLU G 3 57  ? 196.088 193.671 138.834 1.00 59.66  ? 56   GLU G N     1 
ATOM 4766  C CA    . GLU G 3 57  ? 196.134 194.991 138.231 1.00 45.55  ? 56   GLU G CA    1 
ATOM 4767  C C     . GLU G 3 57  ? 194.756 195.614 138.212 1.00 52.92  ? 56   GLU G C     1 
ATOM 4768  O O     . GLU G 3 57  ? 194.575 196.773 138.591 1.00 51.16  ? 56   GLU G O     1 
ATOM 4769  C CB    . GLU G 3 57  ? 196.716 194.899 136.828 1.00 48.89  ? 56   GLU G CB    1 
ATOM 4770  C CG    . GLU G 3 57  ? 196.859 196.234 136.144 1.00 53.52  ? 56   GLU G CG    1 
ATOM 4771  C CD    . GLU G 3 57  ? 197.576 196.122 134.817 1.00 78.23  ? 56   GLU G CD    1 
ATOM 4772  O OE1   . GLU G 3 57  ? 197.946 194.993 134.445 1.00 89.47  ? 56   GLU G OE1   1 
ATOM 4773  O OE2   . GLU G 3 57  ? 197.774 197.155 134.145 1.00 79.49  ? 56   GLU G OE2   1 
ATOM 4774  N N     . TYR G 3 58  ? 193.761 194.837 137.813 1.00 49.23  ? 57   TYR G N     1 
ATOM 4775  C CA    . TYR G 3 58  ? 192.418 195.381 137.752 1.00 42.31  ? 57   TYR G CA    1 
ATOM 4776  C C     . TYR G 3 58  ? 191.954 195.863 139.116 1.00 50.69  ? 57   TYR G C     1 
ATOM 4777  O O     . TYR G 3 58  ? 191.495 197.000 139.261 1.00 49.06  ? 57   TYR G O     1 
ATOM 4778  C CB    . TYR G 3 58  ? 191.459 194.346 137.205 1.00 32.95  ? 57   TYR G CB    1 
ATOM 4779  C CG    . TYR G 3 58  ? 190.058 194.830 137.269 1.00 44.61  ? 57   TYR G CG    1 
ATOM 4780  C CD1   . TYR G 3 58  ? 189.594 195.748 136.361 1.00 43.66  ? 57   TYR G CD1   1 
ATOM 4781  C CD2   . TYR G 3 58  ? 189.204 194.390 138.250 1.00 53.67  ? 57   TYR G CD2   1 
ATOM 4782  C CE1   . TYR G 3 58  ? 188.316 196.203 136.418 1.00 46.75  ? 57   TYR G CE1   1 
ATOM 4783  C CE2   . TYR G 3 58  ? 187.925 194.839 138.314 1.00 51.57  ? 57   TYR G CE2   1 
ATOM 4784  C CZ    . TYR G 3 58  ? 187.483 195.747 137.396 1.00 55.82  ? 57   TYR G CZ    1 
ATOM 4785  O OH    . TYR G 3 58  ? 186.194 196.208 137.453 1.00 66.81  ? 57   TYR G OH    1 
ATOM 4786  N N     . LEU G 3 59  ? 192.066 195.016 140.134 1.00 54.38  ? 58   LEU G N     1 
ATOM 4787  C CA    . LEU G 3 59  ? 191.550 195.407 141.440 1.00 52.26  ? 58   LEU G CA    1 
ATOM 4788  C C     . LEU G 3 59  ? 192.260 196.644 141.960 1.00 59.62  ? 58   LEU G C     1 
ATOM 4789  O O     . LEU G 3 59  ? 191.621 197.654 142.290 1.00 49.44  ? 58   LEU G O     1 
ATOM 4790  C CB    . LEU G 3 59  ? 191.681 194.256 142.424 1.00 43.35  ? 58   LEU G CB    1 
ATOM 4791  C CG    . LEU G 3 59  ? 190.772 193.139 141.952 1.00 43.54  ? 58   LEU G CG    1 
ATOM 4792  C CD1   . LEU G 3 59  ? 190.881 191.939 142.844 1.00 46.51  ? 58   LEU G CD1   1 
ATOM 4793  C CD2   . LEU G 3 59  ? 189.369 193.653 141.926 1.00 43.51  ? 58   LEU G CD2   1 
ATOM 4794  N N     . THR G 3 60  ? 193.588 196.592 142.024 1.00 46.23  ? 59   THR G N     1 
ATOM 4795  C CA    . THR G 3 60  ? 194.329 197.756 142.478 1.00 44.64  ? 59   THR G CA    1 
ATOM 4796  C C     . THR G 3 60  ? 193.912 198.995 141.708 1.00 52.45  ? 59   THR G C     1 
ATOM 4797  O O     . THR G 3 60  ? 193.784 200.082 142.281 1.00 54.10  ? 59   THR G O     1 
ATOM 4798  C CB    . THR G 3 60  ? 195.816 197.502 142.332 1.00 59.01  ? 59   THR G CB    1 
ATOM 4799  O OG1   . THR G 3 60  ? 196.173 196.392 143.154 1.00 58.83  ? 59   THR G OG1   1 
ATOM 4800  C CG2   . THR G 3 60  ? 196.576 198.696 142.782 1.00 65.60  ? 59   THR G CG2   1 
ATOM 4801  N N     . ALA G 3 61  ? 193.648 198.840 140.414 1.00 52.65  ? 60   ALA G N     1 
ATOM 4802  C CA    . ALA G 3 61  ? 193.109 199.953 139.651 1.00 47.58  ? 60   ALA G CA    1 
ATOM 4803  C C     . ALA G 3 61  ? 191.812 200.444 140.265 1.00 50.09  ? 60   ALA G C     1 
ATOM 4804  O O     . ALA G 3 61  ? 191.589 201.652 140.389 1.00 57.76  ? 60   ALA G O     1 
ATOM 4805  C CB    . ALA G 3 61  ? 192.892 199.547 138.198 1.00 39.51  ? 60   ALA G CB    1 
ATOM 4806  N N     . GLU G 3 62  ? 190.946 199.523 140.674 1.00 44.73  ? 61   GLU G N     1 
ATOM 4807  C CA    . GLU G 3 62  ? 189.674 199.948 141.238 1.00 44.90  ? 61   GLU G CA    1 
ATOM 4808  C C     . GLU G 3 62  ? 189.886 200.762 142.501 1.00 57.17  ? 61   GLU G C     1 
ATOM 4809  O O     . GLU G 3 62  ? 189.457 201.923 142.592 1.00 58.52  ? 61   GLU G O     1 
ATOM 4810  C CB    . GLU G 3 62  ? 188.794 198.741 141.516 1.00 45.02  ? 61   GLU G CB    1 
ATOM 4811  C CG    . GLU G 3 62  ? 188.438 198.006 140.260 1.00 65.89  ? 61   GLU G CG    1 
ATOM 4812  C CD    . GLU G 3 62  ? 187.794 198.916 139.244 1.00 78.27  ? 61   GLU G CD    1 
ATOM 4813  O OE1   . GLU G 3 62  ? 186.964 199.760 139.642 1.00 70.74  ? 61   GLU G OE1   1 
ATOM 4814  O OE2   . GLU G 3 62  ? 188.132 198.803 138.048 1.00 89.42  ? 61   GLU G OE2   1 
ATOM 4815  N N     . ILE G 3 63  ? 190.573 200.180 143.482 1.00 65.76  ? 62   ILE G N     1 
ATOM 4816  C CA    . ILE G 3 63  ? 190.766 200.888 144.744 1.00 60.49  ? 62   ILE G CA    1 
ATOM 4817  C C     . ILE G 3 63  ? 191.399 202.244 144.494 1.00 60.21  ? 62   ILE G C     1 
ATOM 4818  O O     . ILE G 3 63  ? 190.855 203.286 144.874 1.00 50.25  ? 62   ILE G O     1 
ATOM 4819  C CB    . ILE G 3 63  ? 191.620 200.063 145.711 1.00 54.00  ? 62   ILE G CB    1 
ATOM 4820  C CG1   . ILE G 3 63  ? 190.854 198.845 146.175 1.00 67.02  ? 62   ILE G CG1   1 
ATOM 4821  C CG2   . ILE G 3 63  ? 191.996 200.896 146.892 1.00 44.37  ? 62   ILE G CG2   1 
ATOM 4822  C CD1   . ILE G 3 63  ? 191.708 197.916 146.974 1.00 78.43  ? 62   ILE G CD1   1 
ATOM 4823  N N     . LEU G 3 64  ? 192.550 202.252 143.828 1.00 61.54  ? 63   LEU G N     1 
ATOM 4824  C CA    . LEU G 3 64  ? 193.256 203.511 143.652 1.00 55.79  ? 63   LEU G CA    1 
ATOM 4825  C C     . LEU G 3 64  ? 192.394 204.530 142.938 1.00 59.92  ? 63   LEU G C     1 
ATOM 4826  O O     . LEU G 3 64  ? 192.445 205.720 143.258 1.00 61.16  ? 63   LEU G O     1 
ATOM 4827  C CB    . LEU G 3 64  ? 194.552 203.289 142.900 1.00 53.72  ? 63   LEU G CB    1 
ATOM 4828  C CG    . LEU G 3 64  ? 195.480 202.451 143.750 1.00 56.83  ? 63   LEU G CG    1 
ATOM 4829  C CD1   . LEU G 3 64  ? 196.768 202.209 143.017 1.00 66.88  ? 63   LEU G CD1   1 
ATOM 4830  C CD2   . LEU G 3 64  ? 195.714 203.162 145.048 1.00 44.37  ? 63   LEU G CD2   1 
ATOM 4831  N N     . GLU G 3 65  ? 191.582 204.093 141.983 1.00 61.79  ? 64   GLU G N     1 
ATOM 4832  C CA    . GLU G 3 65  ? 190.670 205.033 141.354 1.00 49.94  ? 64   GLU G CA    1 
ATOM 4833  C C     . GLU G 3 65  ? 189.773 205.682 142.390 1.00 56.23  ? 64   GLU G C     1 
ATOM 4834  O O     . GLU G 3 65  ? 189.730 206.911 142.522 1.00 65.53  ? 64   GLU G O     1 
ATOM 4835  C CB    . GLU G 3 65  ? 189.823 204.343 140.300 1.00 58.78  ? 64   GLU G CB    1 
ATOM 4836  C CG    . GLU G 3 65  ? 188.861 205.309 139.654 1.00 72.20  ? 64   GLU G CG    1 
ATOM 4837  C CD    . GLU G 3 65  ? 187.987 204.664 138.608 1.00 83.35  ? 64   GLU G CD    1 
ATOM 4838  O OE1   . GLU G 3 65  ? 188.112 203.442 138.397 1.00 88.51  ? 64   GLU G OE1   1 
ATOM 4839  O OE2   . GLU G 3 65  ? 187.165 205.379 138.001 1.00 77.53  ? 64   GLU G OE2   1 
ATOM 4840  N N     . LEU G 3 66  ? 189.051 204.866 143.148 1.00 52.66  ? 65   LEU G N     1 
ATOM 4841  C CA    . LEU G 3 66  ? 188.067 205.434 144.056 1.00 53.60  ? 65   LEU G CA    1 
ATOM 4842  C C     . LEU G 3 66  ? 188.727 206.343 145.079 1.00 58.21  ? 65   LEU G C     1 
ATOM 4843  O O     . LEU G 3 66  ? 188.325 207.501 145.253 1.00 53.25  ? 65   LEU G O     1 
ATOM 4844  C CB    . LEU G 3 66  ? 187.292 204.317 144.727 1.00 52.24  ? 65   LEU G CB    1 
ATOM 4845  C CG    . LEU G 3 66  ? 186.553 203.583 143.619 1.00 61.57  ? 65   LEU G CG    1 
ATOM 4846  C CD1   . LEU G 3 66  ? 185.838 202.380 144.154 1.00 69.59  ? 65   LEU G CD1   1 
ATOM 4847  C CD2   . LEU G 3 66  ? 185.581 204.523 142.971 1.00 45.82  ? 65   LEU G CD2   1 
ATOM 4848  N N     . ALA G 3 67  ? 189.765 205.846 145.746 1.00 56.08  ? 66   ALA G N     1 
ATOM 4849  C CA    . ALA G 3 67  ? 190.446 206.661 146.739 1.00 65.33  ? 66   ALA G CA    1 
ATOM 4850  C C     . ALA G 3 67  ? 190.963 207.944 146.127 1.00 73.53  ? 66   ALA G C     1 
ATOM 4851  O O     . ALA G 3 67  ? 190.953 208.995 146.771 1.00 62.37  ? 66   ALA G O     1 
ATOM 4852  C CB    . ALA G 3 67  ? 191.589 205.882 147.366 1.00 57.31  ? 66   ALA G CB    1 
ATOM 4853  N N     . GLY G 3 68  ? 191.418 207.881 144.881 1.00 71.36  ? 67   GLY G N     1 
ATOM 4854  C CA    . GLY G 3 68  ? 191.793 209.101 144.192 1.00 60.05  ? 67   GLY G CA    1 
ATOM 4855  C C     . GLY G 3 68  ? 190.654 210.092 144.141 1.00 59.98  ? 67   GLY G C     1 
ATOM 4856  O O     . GLY G 3 68  ? 190.801 211.249 144.541 1.00 59.99  ? 67   GLY G O     1 
ATOM 4857  N N     . ASN G 3 69  ? 189.488 209.642 143.680 1.00 59.73  ? 68   ASN G N     1 
ATOM 4858  C CA    . ASN G 3 69  ? 188.347 210.542 143.591 1.00 57.61  ? 68   ASN G CA    1 
ATOM 4859  C C     . ASN G 3 69  ? 188.042 211.168 144.940 1.00 65.38  ? 68   ASN G C     1 
ATOM 4860  O O     . ASN G 3 69  ? 188.039 212.396 145.085 1.00 73.63  ? 68   ASN G O     1 
ATOM 4861  C CB    . ASN G 3 69  ? 187.128 209.797 143.067 1.00 68.11  ? 68   ASN G CB    1 
ATOM 4862  C CG    . ASN G 3 69  ? 187.295 209.369 141.643 1.00 73.66  ? 68   ASN G CG    1 
ATOM 4863  O OD1   . ASN G 3 69  ? 188.140 209.896 140.925 1.00 71.16  ? 68   ASN G OD1   1 
ATOM 4864  N ND2   . ASN G 3 69  ? 186.477 208.422 141.209 1.00 71.36  ? 68   ASN G ND2   1 
ATOM 4865  N N     . ALA G 3 70  ? 187.797 210.335 145.950 1.00 66.55  ? 69   ALA G N     1 
ATOM 4866  C CA    . ALA G 3 70  ? 187.431 210.880 147.249 1.00 54.42  ? 69   ALA G CA    1 
ATOM 4867  C C     . ALA G 3 70  ? 188.495 211.838 147.757 1.00 54.11  ? 69   ALA G C     1 
ATOM 4868  O O     . ALA G 3 70  ? 188.179 212.912 148.281 1.00 50.32  ? 69   ALA G O     1 
ATOM 4869  C CB    . ALA G 3 70  ? 187.208 209.754 148.247 1.00 44.14  ? 69   ALA G CB    1 
ATOM 4870  N N     . ALA G 3 71  ? 189.762 211.474 147.583 1.00 52.38  ? 70   ALA G N     1 
ATOM 4871  C CA    . ALA G 3 71  ? 190.852 212.335 148.016 1.00 51.29  ? 70   ALA G CA    1 
ATOM 4872  C C     . ALA G 3 71  ? 190.761 213.694 147.352 1.00 71.56  ? 70   ALA G C     1 
ATOM 4873  O O     . ALA G 3 71  ? 190.979 214.730 147.987 1.00 76.93  ? 70   ALA G O     1 
ATOM 4874  C CB    . ALA G 3 71  ? 192.188 211.679 147.694 1.00 36.29  ? 70   ALA G CB    1 
ATOM 4875  N N     . ARG G 3 72  ? 190.442 213.708 146.061 1.00 75.02  ? 71   ARG G N     1 
ATOM 4876  C CA    . ARG G 3 72  ? 190.249 214.981 145.387 1.00 75.96  ? 71   ARG G CA    1 
ATOM 4877  C C     . ARG G 3 72  ? 189.093 215.738 146.007 1.00 68.89  ? 71   ARG G C     1 
ATOM 4878  O O     . ARG G 3 72  ? 189.140 216.964 146.143 1.00 71.22  ? 71   ARG G O     1 
ATOM 4879  C CB    . ARG G 3 72  ? 189.996 214.756 143.905 1.00 83.68  ? 71   ARG G CB    1 
ATOM 4880  C CG    . ARG G 3 72  ? 189.896 216.022 143.118 1.00 92.76  ? 71   ARG G CG    1 
ATOM 4881  C CD    . ARG G 3 72  ? 189.526 215.703 141.702 1.00 97.26  ? 71   ARG G CD    1 
ATOM 4882  N NE    . ARG G 3 72  ? 188.182 215.150 141.643 1.00 106.27 ? 71   ARG G NE    1 
ATOM 4883  C CZ    . ARG G 3 72  ? 187.696 214.488 140.603 1.00 98.13  ? 71   ARG G CZ    1 
ATOM 4884  N NH1   . ARG G 3 72  ? 188.451 214.288 139.535 1.00 106.46 ? 71   ARG G NH1   1 
ATOM 4885  N NH2   . ARG G 3 72  ? 186.458 214.023 140.633 1.00 68.70  ? 71   ARG G NH2   1 
ATOM 4886  N N     . ASP G 3 73  ? 188.050 215.020 146.410 1.00 58.99  ? 72   ASP G N     1 
ATOM 4887  C CA    . ASP G 3 73  ? 186.901 215.689 146.992 1.00 69.92  ? 72   ASP G CA    1 
ATOM 4888  C C     . ASP G 3 73  ? 187.155 216.161 148.410 1.00 86.30  ? 72   ASP G C     1 
ATOM 4889  O O     . ASP G 3 73  ? 186.323 216.887 148.957 1.00 95.00  ? 72   ASP G O     1 
ATOM 4890  C CB    . ASP G 3 73  ? 185.690 214.771 146.947 1.00 83.10  ? 72   ASP G CB    1 
ATOM 4891  C CG    . ASP G 3 73  ? 185.227 214.513 145.534 1.00 105.71 ? 72   ASP G CG    1 
ATOM 4892  O OD1   . ASP G 3 73  ? 185.681 215.241 144.627 1.00 116.87 ? 72   ASP G OD1   1 
ATOM 4893  O OD2   . ASP G 3 73  ? 184.413 213.592 145.327 1.00 100.68 ? 72   ASP G OD2   1 
ATOM 4894  N N     . ASN G 3 74  ? 188.262 215.771 149.021 1.00 87.58  ? 73   ASN G N     1 
ATOM 4895  C CA    . ASN G 3 74  ? 188.734 216.442 150.220 1.00 89.06  ? 73   ASN G CA    1 
ATOM 4896  C C     . ASN G 3 74  ? 189.714 217.548 149.908 1.00 78.67  ? 73   ASN G C     1 
ATOM 4897  O O     . ASN G 3 74  ? 190.320 218.098 150.830 1.00 81.63  ? 73   ASN G O     1 
ATOM 4898  C CB    . ASN G 3 74  ? 189.375 215.454 151.181 1.00 98.25  ? 73   ASN G CB    1 
ATOM 4899  C CG    . ASN G 3 74  ? 188.359 214.639 151.921 1.00 107.34 ? 73   ASN G CG    1 
ATOM 4900  O OD1   . ASN G 3 74  ? 187.735 215.125 152.858 1.00 107.56 ? 73   ASN G OD1   1 
ATOM 4901  N ND2   . ASN G 3 74  ? 188.181 213.393 151.511 1.00 104.99 ? 73   ASN G ND2   1 
ATOM 4902  N N     . LYS G 3 75  ? 189.907 217.860 148.631 1.00 71.51  ? 74   LYS G N     1 
ATOM 4903  C CA    . LYS G 3 75  ? 190.877 218.861 148.215 1.00 70.56  ? 74   LYS G CA    1 
ATOM 4904  C C     . LYS G 3 75  ? 192.266 218.513 148.732 1.00 75.44  ? 74   LYS G C     1 
ATOM 4905  O O     . LYS G 3 75  ? 192.911 219.312 149.405 1.00 88.21  ? 74   LYS G O     1 
ATOM 4906  C CB    . LYS G 3 75  ? 190.459 220.262 148.656 1.00 69.76  ? 74   LYS G CB    1 
ATOM 4907  N N     . LYS G 3 76  ? 192.704 217.297 148.444 1.00 56.64  ? 75   LYS G N     1 
ATOM 4908  C CA    . LYS G 3 76  ? 194.051 216.837 148.730 1.00 61.52  ? 75   LYS G CA    1 
ATOM 4909  C C     . LYS G 3 76  ? 194.611 216.185 147.480 1.00 60.13  ? 75   LYS G C     1 
ATOM 4910  O O     . LYS G 3 76  ? 193.884 215.510 146.748 1.00 71.99  ? 75   LYS G O     1 
ATOM 4911  C CB    . LYS G 3 76  ? 194.059 215.832 149.866 1.00 71.08  ? 75   LYS G CB    1 
ATOM 4912  C CG    . LYS G 3 76  ? 193.617 216.354 151.199 1.00 75.96  ? 75   LYS G CG    1 
ATOM 4913  C CD    . LYS G 3 76  ? 194.627 217.309 151.768 1.00 88.43  ? 75   LYS G CD    1 
ATOM 4914  C CE    . LYS G 3 76  ? 194.239 217.676 153.182 1.00 96.68  ? 75   LYS G CE    1 
ATOM 4915  N NZ    . LYS G 3 76  ? 195.191 218.614 153.811 1.00 99.82  ? 75   LYS G NZ    1 
ATOM 4916  N N     . THR G 3 77  ? 195.898 216.388 147.230 1.00 55.18  ? 76   THR G N     1 
ATOM 4917  C CA    . THR G 3 77  ? 196.551 215.761 146.092 1.00 74.03  ? 76   THR G CA    1 
ATOM 4918  C C     . THR G 3 77  ? 197.199 214.434 146.433 1.00 76.29  ? 76   THR G C     1 
ATOM 4919  O O     . THR G 3 77  ? 197.607 213.710 145.522 1.00 78.21  ? 76   THR G O     1 
ATOM 4920  C CB    . THR G 3 77  ? 197.617 216.683 145.517 1.00 79.42  ? 76   THR G CB    1 
ATOM 4921  O OG1   . THR G 3 77  ? 198.569 216.989 146.541 1.00 64.71  ? 76   THR G OG1   1 
ATOM 4922  C CG2   . THR G 3 77  ? 196.989 217.955 145.014 1.00 91.08  ? 76   THR G CG2   1 
ATOM 4923  N N     . ARG G 3 78  ? 197.307 214.093 147.707 1.00 78.98  ? 77   ARG G N     1 
ATOM 4924  C CA    . ARG G 3 78  ? 198.069 212.932 148.124 1.00 71.67  ? 77   ARG G CA    1 
ATOM 4925  C C     . ARG G 3 78  ? 197.205 212.008 148.966 1.00 65.31  ? 77   ARG G C     1 
ATOM 4926  O O     . ARG G 3 78  ? 196.733 212.393 150.036 1.00 75.59  ? 77   ARG G O     1 
ATOM 4927  C CB    . ARG G 3 78  ? 199.298 213.350 148.899 1.00 73.26  ? 77   ARG G CB    1 
ATOM 4928  C CG    . ARG G 3 78  ? 200.100 212.182 149.329 1.00 91.20  ? 77   ARG G CG    1 
ATOM 4929  C CD    . ARG G 3 78  ? 201.434 212.578 149.890 1.00 97.84  ? 77   ARG G CD    1 
ATOM 4930  N NE    . ARG G 3 78  ? 202.284 213.187 148.883 1.00 97.75  ? 77   ARG G NE    1 
ATOM 4931  C CZ    . ARG G 3 78  ? 202.675 214.449 148.916 1.00 99.18  ? 77   ARG G CZ    1 
ATOM 4932  N NH1   . ARG G 3 78  ? 202.315 215.221 149.929 1.00 94.09  ? 77   ARG G NH1   1 
ATOM 4933  N NH2   . ARG G 3 78  ? 203.452 214.928 147.958 1.00 100.74 ? 77   ARG G NH2   1 
ATOM 4934  N N     . ILE G 3 79  ? 197.018 210.784 148.484 1.00 54.11  ? 78   ILE G N     1 
ATOM 4935  C CA    . ILE G 3 79  ? 196.137 209.798 149.099 1.00 63.25  ? 78   ILE G CA    1 
ATOM 4936  C C     . ILE G 3 79  ? 196.685 209.349 150.441 1.00 63.25  ? 78   ILE G C     1 
ATOM 4937  O O     . ILE G 3 79  ? 197.869 209.023 150.570 1.00 59.33  ? 78   ILE G O     1 
ATOM 4938  C CB    . ILE G 3 79  ? 195.934 208.597 148.168 1.00 54.06  ? 78   ILE G CB    1 
ATOM 4939  C CG1   . ILE G 3 79  ? 194.955 208.967 147.072 1.00 56.66  ? 78   ILE G CG1   1 
ATOM 4940  C CG2   . ILE G 3 79  ? 195.472 207.418 148.935 1.00 37.49  ? 78   ILE G CG2   1 
ATOM 4941  C CD1   . ILE G 3 79  ? 194.766 207.903 146.061 1.00 44.02  ? 78   ILE G CD1   1 
ATOM 4942  N N     . ILE G 3 80  ? 195.809 209.311 151.439 1.00 57.28  ? 79   ILE G N     1 
ATOM 4943  C CA    . ILE G 3 80  ? 196.144 208.874 152.791 1.00 56.05  ? 79   ILE G CA    1 
ATOM 4944  C C     . ILE G 3 80  ? 195.128 207.844 153.244 1.00 61.41  ? 79   ILE G C     1 
ATOM 4945  O O     . ILE G 3 80  ? 194.030 207.743 152.675 1.00 58.86  ? 79   ILE G O     1 
ATOM 4946  C CB    . ILE G 3 80  ? 196.180 210.056 153.769 1.00 52.68  ? 79   ILE G CB    1 
ATOM 4947  C CG1   . ILE G 3 80  ? 194.916 210.890 153.619 1.00 48.17  ? 79   ILE G CG1   1 
ATOM 4948  C CG2   . ILE G 3 80  ? 197.421 210.865 153.566 1.00 55.95  ? 79   ILE G CG2   1 
ATOM 4949  C CD1   . ILE G 3 80  ? 194.806 211.997 154.620 1.00 38.03  ? 79   ILE G CD1   1 
ATOM 4950  N N     . PRO G 3 81  ? 195.458 207.061 154.275 1.00 64.81  ? 80   PRO G N     1 
ATOM 4951  C CA    . PRO G 3 81  ? 194.621 205.900 154.601 1.00 56.73  ? 80   PRO G CA    1 
ATOM 4952  C C     . PRO G 3 81  ? 193.147 206.209 154.680 1.00 52.10  ? 80   PRO G C     1 
ATOM 4953  O O     . PRO G 3 81  ? 192.333 205.492 154.091 1.00 41.23  ? 80   PRO G O     1 
ATOM 4954  C CB    . PRO G 3 81  ? 195.175 205.467 155.953 1.00 52.89  ? 80   PRO G CB    1 
ATOM 4955  C CG    . PRO G 3 81  ? 196.568 205.853 155.904 1.00 53.66  ? 80   PRO G CG    1 
ATOM 4956  C CD    . PRO G 3 81  ? 196.642 207.123 155.143 1.00 48.40  ? 80   PRO G CD    1 
ATOM 4957  N N     . ARG G 3 82  ? 192.791 207.294 155.356 1.00 59.46  ? 81   ARG G N     1 
ATOM 4958  C CA    . ARG G 3 82  ? 191.396 207.691 155.459 1.00 44.75  ? 81   ARG G CA    1 
ATOM 4959  C C     . ARG G 3 82  ? 190.711 207.634 154.110 1.00 45.91  ? 81   ARG G C     1 
ATOM 4960  O O     . ARG G 3 82  ? 189.587 207.135 153.990 1.00 42.62  ? 81   ARG G O     1 
ATOM 4961  C CB    . ARG G 3 82  ? 191.317 209.100 156.023 1.00 50.33  ? 81   ARG G CB    1 
ATOM 4962  C CG    . ARG G 3 82  ? 189.941 209.678 156.067 1.00 36.02  ? 81   ARG G CG    1 
ATOM 4963  C CD    . ARG G 3 82  ? 189.065 208.966 157.031 1.00 42.43  ? 81   ARG G CD    1 
ATOM 4964  N NE    . ARG G 3 82  ? 187.770 209.614 157.078 1.00 57.91  ? 81   ARG G NE    1 
ATOM 4965  C CZ    . ARG G 3 82  ? 186.710 209.109 157.686 1.00 51.92  ? 81   ARG G CZ    1 
ATOM 4966  N NH1   . ARG G 3 82  ? 186.796 207.951 158.318 1.00 47.37  ? 81   ARG G NH1   1 
ATOM 4967  N NH2   . ARG G 3 82  ? 185.567 209.772 157.676 1.00 51.23  ? 81   ARG G NH2   1 
ATOM 4968  N N     . HIS G 3 83  ? 191.387 208.114 153.076 1.00 47.47  ? 82   HIS G N     1 
ATOM 4969  C CA    . HIS G 3 83  ? 190.803 208.067 151.750 1.00 51.13  ? 82   HIS G CA    1 
ATOM 4970  C C     . HIS G 3 83  ? 190.528 206.640 151.330 1.00 53.16  ? 82   HIS G C     1 
ATOM 4971  O O     . HIS G 3 83  ? 189.469 206.346 150.773 1.00 65.91  ? 82   HIS G O     1 
ATOM 4972  C CB    . HIS G 3 83  ? 191.729 208.750 150.769 1.00 47.27  ? 82   HIS G CB    1 
ATOM 4973  C CG    . HIS G 3 83  ? 191.910 210.197 151.055 1.00 53.80  ? 82   HIS G CG    1 
ATOM 4974  N ND1   . HIS G 3 83  ? 193.016 210.905 150.646 1.00 61.19  ? 82   HIS G ND1   1 
ATOM 4975  C CD2   . HIS G 3 83  ? 191.109 211.081 151.688 1.00 52.63  ? 82   HIS G CD2   1 
ATOM 4976  C CE1   . HIS G 3 83  ? 192.899 212.159 151.037 1.00 51.50  ? 82   HIS G CE1   1 
ATOM 4977  N NE2   . HIS G 3 83  ? 191.749 212.293 151.669 1.00 54.79  ? 82   HIS G NE2   1 
ATOM 4978  N N     . LEU G 3 84  ? 191.459 205.732 151.602 1.00 47.07  ? 83   LEU G N     1 
ATOM 4979  C CA    . LEU G 3 84  ? 191.216 204.337 151.266 1.00 46.01  ? 83   LEU G CA    1 
ATOM 4980  C C     . LEU G 3 84  ? 190.001 203.808 152.003 1.00 47.64  ? 83   LEU G C     1 
ATOM 4981  O O     . LEU G 3 84  ? 189.101 203.218 151.399 1.00 44.27  ? 83   LEU G O     1 
ATOM 4982  C CB    . LEU G 3 84  ? 192.448 203.509 151.584 1.00 32.92  ? 83   LEU G CB    1 
ATOM 4983  C CG    . LEU G 3 84  ? 193.564 203.857 150.627 1.00 39.33  ? 83   LEU G CG    1 
ATOM 4984  C CD1   . LEU G 3 84  ? 194.827 203.163 151.016 1.00 47.59  ? 83   LEU G CD1   1 
ATOM 4985  C CD2   . LEU G 3 84  ? 193.128 203.404 149.281 1.00 47.34  ? 83   LEU G CD2   1 
ATOM 4986  N N     . GLN G 3 85  ? 189.948 204.036 153.312 1.00 50.35  ? 84   GLN G N     1 
ATOM 4987  C CA    . GLN G 3 85  ? 188.800 203.611 154.095 1.00 52.40  ? 84   GLN G CA    1 
ATOM 4988  C C     . GLN G 3 85  ? 187.512 204.045 153.433 1.00 51.25  ? 84   GLN G C     1 
ATOM 4989  O O     . GLN G 3 85  ? 186.643 203.220 153.134 1.00 54.92  ? 84   GLN G O     1 
ATOM 4990  C CB    . GLN G 3 85  ? 188.877 204.213 155.487 1.00 50.38  ? 84   GLN G CB    1 
ATOM 4991  C CG    . GLN G 3 85  ? 187.790 203.759 156.398 1.00 56.98  ? 84   GLN G CG    1 
ATOM 4992  C CD    . GLN G 3 85  ? 188.007 202.360 156.859 1.00 55.22  ? 84   GLN G CD    1 
ATOM 4993  O OE1   . GLN G 3 85  ? 189.019 202.066 157.482 1.00 56.19  ? 84   GLN G OE1   1 
ATOM 4994  N NE2   . GLN G 3 85  ? 187.068 201.479 156.566 1.00 50.25  ? 84   GLN G NE2   1 
ATOM 4995  N N     . LEU G 3 86  ? 187.384 205.343 153.167 1.00 43.81  ? 85   LEU G N     1 
ATOM 4996  C CA    . LEU G 3 86  ? 186.130 205.844 152.628 1.00 48.36  ? 85   LEU G CA    1 
ATOM 4997  C C     . LEU G 3 86  ? 185.867 205.268 151.252 1.00 54.59  ? 85   LEU G C     1 
ATOM 4998  O O     . LEU G 3 86  ? 184.719 204.978 150.901 1.00 59.75  ? 85   LEU G O     1 
ATOM 4999  C CB    . LEU G 3 86  ? 186.144 207.363 152.574 1.00 54.85  ? 85   LEU G CB    1 
ATOM 5000  C CG    . LEU G 3 86  ? 186.300 208.013 153.942 1.00 59.03  ? 85   LEU G CG    1 
ATOM 5001  C CD1   . LEU G 3 86  ? 186.309 209.511 153.806 1.00 57.02  ? 85   LEU G CD1   1 
ATOM 5002  C CD2   . LEU G 3 86  ? 185.208 207.564 154.869 1.00 51.96  ? 85   LEU G CD2   1 
ATOM 5003  N N     . ALA G 3 87  ? 186.919 205.073 150.468 1.00 45.40  ? 86   ALA G N     1 
ATOM 5004  C CA    . ALA G 3 87  ? 186.739 204.524 149.135 1.00 49.58  ? 86   ALA G CA    1 
ATOM 5005  C C     . ALA G 3 87  ? 186.149 203.129 149.210 1.00 62.78  ? 86   ALA G C     1 
ATOM 5006  O O     . ALA G 3 87  ? 185.134 202.831 148.573 1.00 73.66  ? 86   ALA G O     1 
ATOM 5007  C CB    . ALA G 3 87  ? 188.069 204.511 148.393 1.00 44.03  ? 86   ALA G CB    1 
ATOM 5008  N N     . VAL G 3 88  ? 186.770 202.260 149.994 1.00 62.17  ? 87   VAL G N     1 
ATOM 5009  C CA    . VAL G 3 88  ? 186.266 200.912 150.186 1.00 58.15  ? 87   VAL G CA    1 
ATOM 5010  C C     . VAL G 3 88  ? 184.845 200.965 150.708 1.00 48.31  ? 87   VAL G C     1 
ATOM 5011  O O     . VAL G 3 88  ? 183.894 200.672 149.979 1.00 62.31  ? 87   VAL G O     1 
ATOM 5012  C CB    . VAL G 3 88  ? 187.153 200.129 151.159 1.00 47.98  ? 87   VAL G CB    1 
ATOM 5013  C CG1   . VAL G 3 88  ? 186.531 198.798 151.451 1.00 45.66  ? 87   VAL G CG1   1 
ATOM 5014  C CG2   . VAL G 3 88  ? 188.522 199.954 150.579 1.00 31.28  ? 87   VAL G CG2   1 
ATOM 5015  N N     . ARG G 3 89  ? 184.696 201.375 151.964 1.00 42.30  ? 88   ARG G N     1 
ATOM 5016  C CA    . ARG G 3 89  ? 183.416 201.234 152.634 1.00 45.63  ? 88   ARG G CA    1 
ATOM 5017  C C     . ARG G 3 89  ? 182.285 201.870 151.852 1.00 53.41  ? 88   ARG G C     1 
ATOM 5018  O O     . ARG G 3 89  ? 181.196 201.298 151.770 1.00 66.72  ? 88   ARG G O     1 
ATOM 5019  C CB    . ARG G 3 89  ? 183.494 201.847 154.015 1.00 50.05  ? 88   ARG G CB    1 
ATOM 5020  C CG    . ARG G 3 89  ? 184.535 201.228 154.880 1.00 54.94  ? 88   ARG G CG    1 
ATOM 5021  C CD    . ARG G 3 89  ? 184.125 199.862 155.359 1.00 54.11  ? 88   ARG G CD    1 
ATOM 5022  N NE    . ARG G 3 89  ? 185.091 199.322 156.308 1.00 60.67  ? 88   ARG G NE    1 
ATOM 5023  C CZ    . ARG G 3 89  ? 186.076 198.497 155.988 1.00 54.80  ? 88   ARG G CZ    1 
ATOM 5024  N NH1   . ARG G 3 89  ? 186.218 198.089 154.744 1.00 51.38  ? 88   ARG G NH1   1 
ATOM 5025  N NH2   . ARG G 3 89  ? 186.908 198.066 156.918 1.00 51.33  ? 88   ARG G NH2   1 
ATOM 5026  N N     . ASN G 3 90  ? 182.510 203.045 151.267 1.00 57.68  ? 89   ASN G N     1 
ATOM 5027  C CA    . ASN G 3 90  ? 181.431 203.658 150.504 1.00 53.50  ? 89   ASN G CA    1 
ATOM 5028  C C     . ASN G 3 90  ? 181.008 202.787 149.341 1.00 55.58  ? 89   ASN G C     1 
ATOM 5029  O O     . ASN G 3 90  ? 179.810 202.638 149.091 1.00 69.66  ? 89   ASN G O     1 
ATOM 5030  C CB    . ASN G 3 90  ? 181.830 205.037 150.007 1.00 54.04  ? 89   ASN G CB    1 
ATOM 5031  C CG    . ASN G 3 90  ? 181.764 206.067 151.092 1.00 62.58  ? 89   ASN G CG    1 
ATOM 5032  O OD1   . ASN G 3 90  ? 181.011 205.920 152.050 1.00 61.91  ? 89   ASN G OD1   1 
ATOM 5033  N ND2   . ASN G 3 90  ? 182.554 207.116 150.961 1.00 58.34  ? 89   ASN G ND2   1 
ATOM 5034  N N     . ASP G 3 91  ? 181.958 202.197 148.632 1.00 55.47  ? 90   ASP G N     1 
ATOM 5035  C CA    . ASP G 3 91  ? 181.577 201.270 147.588 1.00 44.72  ? 90   ASP G CA    1 
ATOM 5036  C C     . ASP G 3 91  ? 180.954 200.026 148.199 1.00 50.73  ? 90   ASP G C     1 
ATOM 5037  O O     . ASP G 3 91  ? 181.123 199.735 149.383 1.00 70.79  ? 90   ASP G O     1 
ATOM 5038  C CB    . ASP G 3 91  ? 182.775 200.881 146.741 1.00 51.66  ? 90   ASP G CB    1 
ATOM 5039  C CG    . ASP G 3 91  ? 182.411 199.906 145.662 1.00 71.90  ? 90   ASP G CG    1 
ATOM 5040  O OD1   . ASP G 3 91  ? 181.679 200.299 144.735 1.00 94.72  ? 90   ASP G OD1   1 
ATOM 5041  O OD2   . ASP G 3 91  ? 182.815 198.731 145.768 1.00 70.48  ? 90   ASP G OD2   1 
ATOM 5042  N N     . GLU G 3 92  ? 180.209 199.296 147.382 1.00 59.85  ? 91   GLU G N     1 
ATOM 5043  C CA    . GLU G 3 92  ? 179.569 198.069 147.851 1.00 59.57  ? 91   GLU G CA    1 
ATOM 5044  C C     . GLU G 3 92  ? 180.491 196.865 147.679 1.00 56.38  ? 91   GLU G C     1 
ATOM 5045  O O     . GLU G 3 92  ? 181.060 196.369 148.651 1.00 56.80  ? 91   GLU G O     1 
ATOM 5046  C CB    . GLU G 3 92  ? 178.254 197.842 147.116 1.00 59.46  ? 91   GLU G CB    1 
ATOM 5047  C CG    . GLU G 3 92  ? 177.541 196.604 147.575 1.00 94.58  ? 91   GLU G CG    1 
ATOM 5048  C CD    . GLU G 3 92  ? 176.228 196.413 146.867 1.00 117.60 ? 91   GLU G CD    1 
ATOM 5049  O OE1   . GLU G 3 92  ? 175.910 197.232 145.981 1.00 128.22 ? 91   GLU G OE1   1 
ATOM 5050  O OE2   . GLU G 3 92  ? 175.511 195.447 147.196 1.00 113.39 ? 91   GLU G OE2   1 
ATOM 5051  N N     . GLU G 3 93  ? 180.659 196.412 146.435 1.00 54.90  ? 92   GLU G N     1 
ATOM 5052  C CA    . GLU G 3 93  ? 181.255 195.101 146.213 1.00 56.98  ? 92   GLU G CA    1 
ATOM 5053  C C     . GLU G 3 93  ? 182.599 194.974 146.904 1.00 55.23  ? 92   GLU G C     1 
ATOM 5054  O O     . GLU G 3 93  ? 182.928 193.913 147.442 1.00 65.70  ? 92   GLU G O     1 
ATOM 5055  C CB    . GLU G 3 93  ? 181.388 194.820 144.722 1.00 61.05  ? 92   GLU G CB    1 
ATOM 5056  C CG    . GLU G 3 93  ? 180.053 194.636 144.030 1.00 75.75  ? 92   GLU G CG    1 
ATOM 5057  C CD    . GLU G 3 93  ? 180.193 194.228 142.573 1.00 97.41  ? 92   GLU G CD    1 
ATOM 5058  O OE1   . GLU G 3 93  ? 181.321 194.258 142.035 1.00 107.03 ? 92   GLU G OE1   1 
ATOM 5059  O OE2   . GLU G 3 93  ? 179.174 193.848 141.959 1.00 96.75  ? 92   GLU G OE2   1 
ATOM 5060  N N     . LEU G 3 94  ? 183.383 196.046 146.927 1.00 58.19  ? 93   LEU G N     1 
ATOM 5061  C CA    . LEU G 3 94  ? 184.605 196.011 147.713 1.00 54.76  ? 93   LEU G CA    1 
ATOM 5062  C C     . LEU G 3 94  ? 184.304 195.712 149.168 1.00 57.66  ? 93   LEU G C     1 
ATOM 5063  O O     . LEU G 3 94  ? 184.878 194.790 149.754 1.00 59.76  ? 93   LEU G O     1 
ATOM 5064  C CB    . LEU G 3 94  ? 185.360 197.320 147.583 1.00 50.05  ? 93   LEU G CB    1 
ATOM 5065  C CG    . LEU G 3 94  ? 186.008 197.428 146.222 1.00 47.13  ? 93   LEU G CG    1 
ATOM 5066  C CD1   . LEU G 3 94  ? 186.671 198.761 146.092 1.00 44.83  ? 93   LEU G CD1   1 
ATOM 5067  C CD2   . LEU G 3 94  ? 187.022 196.329 146.107 1.00 32.28  ? 93   LEU G CD2   1 
ATOM 5068  N N     . ASN G 3 95  ? 183.407 196.483 149.770 1.00 49.96  ? 94   ASN G N     1 
ATOM 5069  C CA    . ASN G 3 95  ? 183.065 196.238 151.160 1.00 49.89  ? 94   ASN G CA    1 
ATOM 5070  C C     . ASN G 3 95  ? 182.672 194.792 151.366 1.00 53.78  ? 94   ASN G C     1 
ATOM 5071  O O     . ASN G 3 95  ? 183.073 194.156 152.344 1.00 58.63  ? 94   ASN G O     1 
ATOM 5072  C CB    . ASN G 3 95  ? 181.938 197.154 151.590 1.00 46.81  ? 94   ASN G CB    1 
ATOM 5073  C CG    . ASN G 3 95  ? 181.650 197.031 153.041 1.00 52.25  ? 94   ASN G CG    1 
ATOM 5074  O OD1   . ASN G 3 95  ? 182.532 196.686 153.821 1.00 50.75  ? 94   ASN G OD1   1 
ATOM 5075  N ND2   . ASN G 3 95  ? 180.418 197.308 153.428 1.00 53.38  ? 94   ASN G ND2   1 
ATOM 5076  N N     . LYS G 3 96  ? 181.886 194.257 150.438 1.00 53.01  ? 95   LYS G N     1 
ATOM 5077  C CA    . LYS G 3 96  ? 181.573 192.837 150.441 1.00 54.23  ? 95   LYS G CA    1 
ATOM 5078  C C     . LYS G 3 96  ? 182.839 192.004 150.497 1.00 53.23  ? 95   LYS G C     1 
ATOM 5079  O O     . LYS G 3 96  ? 182.900 190.995 151.203 1.00 57.64  ? 95   LYS G O     1 
ATOM 5080  C CB    . LYS G 3 96  ? 180.768 192.507 149.188 1.00 53.88  ? 95   LYS G CB    1 
ATOM 5081  C CG    . LYS G 3 96  ? 180.312 191.086 149.058 1.00 63.87  ? 95   LYS G CG    1 
ATOM 5082  C CD    . LYS G 3 96  ? 179.218 190.757 150.026 1.00 88.61  ? 95   LYS G CD    1 
ATOM 5083  C CE    . LYS G 3 96  ? 178.725 189.346 149.786 1.00 100.69 ? 95   LYS G CE    1 
ATOM 5084  N NZ    . LYS G 3 96  ? 178.111 189.219 148.438 1.00 95.15  ? 95   LYS G NZ    1 
ATOM 5085  N N     . LEU G 3 97  ? 183.867 192.424 149.768 1.00 47.08  ? 96   LEU G N     1 
ATOM 5086  C CA    . LEU G 3 97  ? 185.083 191.630 149.676 1.00 38.03  ? 96   LEU G CA    1 
ATOM 5087  C C     . LEU G 3 97  ? 185.971 191.816 150.897 1.00 41.77  ? 96   LEU G C     1 
ATOM 5088  O O     . LEU G 3 97  ? 186.513 190.848 151.434 1.00 44.63  ? 96   LEU G O     1 
ATOM 5089  C CB    . LEU G 3 97  ? 185.834 192.001 148.407 1.00 41.94  ? 96   LEU G CB    1 
ATOM 5090  C CG    . LEU G 3 97  ? 187.207 191.384 148.258 1.00 45.67  ? 96   LEU G CG    1 
ATOM 5091  C CD1   . LEU G 3 97  ? 187.075 189.904 148.272 1.00 37.65  ? 96   LEU G CD1   1 
ATOM 5092  C CD2   . LEU G 3 97  ? 187.788 191.829 146.955 1.00 40.59  ? 96   LEU G CD2   1 
ATOM 5093  N N     . LEU G 3 98  ? 186.134 193.046 151.351 1.00 41.88  ? 97   LEU G N     1 
ATOM 5094  C CA    . LEU G 3 98  ? 187.101 193.341 152.393 1.00 53.31  ? 97   LEU G CA    1 
ATOM 5095  C C     . LEU G 3 98  ? 186.521 193.234 153.782 1.00 59.18  ? 97   LEU G C     1 
ATOM 5096  O O     . LEU G 3 98  ? 187.204 193.578 154.746 1.00 48.41  ? 97   LEU G O     1 
ATOM 5097  C CB    . LEU G 3 98  ? 187.674 194.733 152.200 1.00 49.17  ? 97   LEU G CB    1 
ATOM 5098  C CG    . LEU G 3 98  ? 188.433 194.841 150.896 1.00 49.91  ? 97   LEU G CG    1 
ATOM 5099  C CD1   . LEU G 3 98  ? 188.923 196.241 150.709 1.00 40.98  ? 97   LEU G CD1   1 
ATOM 5100  C CD2   . LEU G 3 98  ? 189.576 193.882 150.909 1.00 60.15  ? 97   LEU G CD2   1 
ATOM 5101  N N     . GLY G 3 99  ? 185.294 192.757 153.909 1.00 51.49  ? 98   GLY G N     1 
ATOM 5102  C CA    . GLY G 3 99  ? 184.496 193.006 155.090 1.00 39.31  ? 98   GLY G CA    1 
ATOM 5103  C C     . GLY G 3 99  ? 185.187 192.805 156.418 1.00 50.89  ? 98   GLY G C     1 
ATOM 5104  O O     . GLY G 3 99  ? 184.881 193.506 157.381 1.00 52.88  ? 98   GLY G O     1 
ATOM 5105  N N     . ARG G 3 100 ? 186.121 191.874 156.496 1.00 58.94  ? 99   ARG G N     1 
ATOM 5106  C CA    . ARG G 3 100 ? 186.824 191.639 157.742 1.00 61.47  ? 99   ARG G CA    1 
ATOM 5107  C C     . ARG G 3 100 ? 188.154 192.351 157.815 1.00 60.67  ? 99   ARG G C     1 
ATOM 5108  O O     . ARG G 3 100 ? 188.878 192.178 158.793 1.00 68.75  ? 99   ARG G O     1 
ATOM 5109  C CB    . ARG G 3 100 ? 187.027 190.153 157.948 1.00 63.58  ? 99   ARG G CB    1 
ATOM 5110  C CG    . ARG G 3 100 ? 185.726 189.457 158.112 1.00 69.97  ? 99   ARG G CG    1 
ATOM 5111  C CD    . ARG G 3 100 ? 185.908 187.995 158.371 1.00 90.83  ? 99   ARG G CD    1 
ATOM 5112  N NE    . ARG G 3 100 ? 184.615 187.370 158.587 1.00 115.63 ? 99   ARG G NE    1 
ATOM 5113  C CZ    . ARG G 3 100 ? 183.985 187.387 159.752 1.00 120.61 ? 99   ARG G CZ    1 
ATOM 5114  N NH1   . ARG G 3 100 ? 184.541 187.995 160.792 1.00 116.90 ? 99   ARG G NH1   1 
ATOM 5115  N NH2   . ARG G 3 100 ? 182.805 186.801 159.880 1.00 118.76 ? 99   ARG G NH2   1 
ATOM 5116  N N     . VAL G 3 101 ? 188.501 193.119 156.816 1.00 49.58  ? 100  VAL G N     1 
ATOM 5117  C CA    . VAL G 3 101 ? 189.752 193.855 156.802 1.00 40.21  ? 100  VAL G CA    1 
ATOM 5118  C C     . VAL G 3 101 ? 189.663 195.013 157.773 1.00 46.18  ? 100  VAL G C     1 
ATOM 5119  O O     . VAL G 3 101 ? 188.612 195.641 157.909 1.00 41.63  ? 100  VAL G O     1 
ATOM 5120  C CB    . VAL G 3 101 ? 190.062 194.365 155.392 1.00 33.48  ? 100  VAL G CB    1 
ATOM 5121  C CG1   . VAL G 3 101 ? 191.173 195.334 155.450 1.00 44.56  ? 100  VAL G CG1   1 
ATOM 5122  C CG2   . VAL G 3 101 ? 190.435 193.222 154.504 1.00 31.33  ? 100  VAL G CG2   1 
ATOM 5123  N N     . THR G 3 102 ? 190.761 195.304 158.443 1.00 41.79  ? 101  THR G N     1 
ATOM 5124  C CA    . THR G 3 102 ? 190.871 196.511 159.235 1.00 48.05  ? 101  THR G CA    1 
ATOM 5125  C C     . THR G 3 102 ? 192.030 197.355 158.742 1.00 60.35  ? 101  THR G C     1 
ATOM 5126  O O     . THR G 3 102 ? 193.163 196.887 158.630 1.00 64.15  ? 101  THR G O     1 
ATOM 5127  C CB    . THR G 3 102 ? 191.076 196.183 160.700 1.00 54.58  ? 101  THR G CB    1 
ATOM 5128  O OG1   . THR G 3 102 ? 189.930 195.479 161.179 1.00 53.82  ? 101  THR G OG1   1 
ATOM 5129  C CG2   . THR G 3 102 ? 191.258 197.453 161.482 1.00 37.68  ? 101  THR G CG2   1 
ATOM 5130  N N     . ILE G 3 103 ? 191.737 198.612 158.455 1.00 57.06  ? 102  ILE G N     1 
ATOM 5131  C CA    . ILE G 3 103 ? 192.703 199.532 157.888 1.00 49.72  ? 102  ILE G CA    1 
ATOM 5132  C C     . ILE G 3 103 ? 193.175 200.450 158.992 1.00 51.48  ? 102  ILE G C     1 
ATOM 5133  O O     . ILE G 3 103 ? 192.399 201.273 159.485 1.00 55.98  ? 102  ILE G O     1 
ATOM 5134  C CB    . ILE G 3 103 ? 192.089 200.340 156.750 1.00 47.96  ? 102  ILE G CB    1 
ATOM 5135  C CG1   . ILE G 3 103 ? 191.723 199.416 155.612 1.00 42.65  ? 102  ILE G CG1   1 
ATOM 5136  C CG2   . ILE G 3 103 ? 193.047 201.364 156.301 1.00 37.54  ? 102  ILE G CG2   1 
ATOM 5137  C CD1   . ILE G 3 103 ? 190.923 200.088 154.573 1.00 44.89  ? 102  ILE G CD1   1 
ATOM 5138  N N     . ALA G 3 104 ? 194.433 200.318 159.386 1.00 45.90  ? 103  ALA G N     1 
ATOM 5139  C CA    . ALA G 3 104 ? 194.963 201.211 160.401 1.00 51.97  ? 103  ALA G CA    1 
ATOM 5140  C C     . ALA G 3 104 ? 194.814 202.648 159.939 1.00 69.98  ? 103  ALA G C     1 
ATOM 5141  O O     . ALA G 3 104 ? 194.829 202.936 158.744 1.00 77.77  ? 103  ALA G O     1 
ATOM 5142  C CB    . ALA G 3 104 ? 196.427 200.901 160.682 1.00 46.82  ? 103  ALA G CB    1 
ATOM 5143  N N     . GLN G 3 105 ? 194.618 203.549 160.895 1.00 67.30  ? 104  GLN G N     1 
ATOM 5144  C CA    . GLN G 3 105 ? 194.398 204.960 160.600 1.00 61.65  ? 104  GLN G CA    1 
ATOM 5145  C C     . GLN G 3 105 ? 193.154 205.153 159.750 1.00 70.45  ? 104  GLN G C     1 
ATOM 5146  O O     . GLN G 3 105 ? 193.019 206.149 159.041 1.00 88.20  ? 104  GLN G O     1 
ATOM 5147  C CB    . GLN G 3 105 ? 195.609 205.574 159.899 1.00 58.29  ? 104  GLN G CB    1 
ATOM 5148  C CG    . GLN G 3 105 ? 196.877 205.439 160.681 1.00 77.56  ? 104  GLN G CG    1 
ATOM 5149  C CD    . GLN G 3 105 ? 196.764 206.047 162.050 1.00 101.67 ? 104  GLN G CD    1 
ATOM 5150  O OE1   . GLN G 3 105 ? 196.168 207.106 162.219 1.00 113.44 ? 104  GLN G OE1   1 
ATOM 5151  N NE2   . GLN G 3 105 ? 197.324 205.374 163.046 1.00 96.65  ? 104  GLN G NE2   1 
ATOM 5152  N N     . GLY G 3 106 ? 192.239 204.202 159.812 1.00 62.67  ? 105  GLY G N     1 
ATOM 5153  C CA    . GLY G 3 106 ? 191.144 204.173 158.874 1.00 58.78  ? 105  GLY G CA    1 
ATOM 5154  C C     . GLY G 3 106 ? 189.989 205.069 159.235 1.00 54.77  ? 105  GLY G C     1 
ATOM 5155  O O     . GLY G 3 106 ? 189.300 205.572 158.350 1.00 64.62  ? 105  GLY G O     1 
ATOM 5156  N N     . GLY G 3 107 ? 189.761 205.290 160.516 1.00 55.62  ? 106  GLY G N     1 
ATOM 5157  C CA    . GLY G 3 107 ? 188.582 206.017 160.934 1.00 55.56  ? 106  GLY G CA    1 
ATOM 5158  C C     . GLY G 3 107 ? 187.333 205.218 160.629 1.00 65.21  ? 106  GLY G C     1 
ATOM 5159  O O     . GLY G 3 107 ? 187.358 204.004 160.478 1.00 64.46  ? 106  GLY G O     1 
ATOM 5160  N N     . VAL G 3 108 ? 186.215 205.926 160.532 1.00 73.23  ? 107  VAL G N     1 
ATOM 5161  C CA    . VAL G 3 108 ? 184.926 205.298 160.292 1.00 61.95  ? 107  VAL G CA    1 
ATOM 5162  C C     . VAL G 3 108 ? 184.164 206.119 159.269 1.00 69.36  ? 107  VAL G C     1 
ATOM 5163  O O     . VAL G 3 108 ? 184.370 207.329 159.149 1.00 83.75  ? 107  VAL G O     1 
ATOM 5164  C CB    . VAL G 3 108 ? 184.119 205.178 161.594 1.00 53.23  ? 107  VAL G CB    1 
ATOM 5165  C CG1   . VAL G 3 108 ? 182.786 204.530 161.340 1.00 76.70  ? 107  VAL G CG1   1 
ATOM 5166  C CG2   . VAL G 3 108 ? 184.892 204.394 162.604 1.00 46.92  ? 107  VAL G CG2   1 
ATOM 5167  N N     . LEU G 3 109 ? 183.301 205.456 158.512 1.00 66.84  ? 108  LEU G N     1 
ATOM 5168  C CA    . LEU G 3 109 ? 182.320 206.190 157.738 1.00 60.22  ? 108  LEU G CA    1 
ATOM 5169  C C     . LEU G 3 109 ? 181.554 207.130 158.656 1.00 62.79  ? 108  LEU G C     1 
ATOM 5170  O O     . LEU G 3 109 ? 181.226 206.759 159.786 1.00 75.76  ? 108  LEU G O     1 
ATOM 5171  C CB    . LEU G 3 109 ? 181.322 205.251 157.078 1.00 50.01  ? 108  LEU G CB    1 
ATOM 5172  C CG    . LEU G 3 109 ? 181.807 204.341 155.977 1.00 43.62  ? 108  LEU G CG    1 
ATOM 5173  C CD1   . LEU G 3 109 ? 180.656 203.479 155.550 1.00 43.19  ? 108  LEU G CD1   1 
ATOM 5174  C CD2   . LEU G 3 109 ? 182.280 205.190 154.842 1.00 52.24  ? 108  LEU G CD2   1 
ATOM 5175  N N     . PRO G 3 110 ? 181.257 208.348 158.221 1.00 70.51  ? 109  PRO G N     1 
ATOM 5176  C CA    . PRO G 3 110 ? 180.317 209.163 158.989 1.00 75.63  ? 109  PRO G CA    1 
ATOM 5177  C C     . PRO G 3 110 ? 178.966 208.477 158.996 1.00 74.97  ? 109  PRO G C     1 
ATOM 5178  O O     . PRO G 3 110 ? 178.401 208.181 157.946 1.00 66.65  ? 109  PRO G O     1 
ATOM 5179  C CB    . PRO G 3 110 ? 180.280 210.478 158.211 1.00 78.85  ? 109  PRO G CB    1 
ATOM 5180  C CG    . PRO G 3 110 ? 181.555 210.498 157.462 1.00 83.88  ? 109  PRO G CG    1 
ATOM 5181  C CD    . PRO G 3 110 ? 181.810 209.084 157.081 1.00 81.72  ? 109  PRO G CD    1 
ATOM 5182  N N     . ASN G 3 111 ? 178.446 208.220 160.189 1.00 71.45  ? 110  ASN G N     1 
ATOM 5183  C CA    . ASN G 3 111 ? 177.132 207.613 160.284 1.00 69.28  ? 110  ASN G CA    1 
ATOM 5184  C C     . ASN G 3 111 ? 176.495 207.984 161.609 1.00 65.75  ? 110  ASN G C     1 
ATOM 5185  O O     . ASN G 3 111 ? 177.169 208.016 162.639 1.00 62.83  ? 110  ASN G O     1 
ATOM 5186  C CB    . ASN G 3 111 ? 177.214 206.095 160.156 1.00 78.99  ? 110  ASN G CB    1 
ATOM 5187  C CG    . ASN G 3 111 ? 175.858 205.454 159.989 1.00 96.01  ? 110  ASN G CG    1 
ATOM 5188  O OD1   . ASN G 3 111 ? 174.830 206.067 160.262 1.00 102.56 ? 110  ASN G OD1   1 
ATOM 5189  N ND2   . ASN G 3 111 ? 175.848 204.206 159.548 1.00 98.72  ? 110  ASN G ND2   1 
ATOM 5190  N N     . ILE G 3 112 ? 175.188 208.224 161.574 1.00 68.69  ? 111  ILE G N     1 
ATOM 5191  C CA    . ILE G 3 112 ? 174.372 208.383 162.770 1.00 64.69  ? 111  ILE G CA    1 
ATOM 5192  C C     . ILE G 3 112 ? 173.014 207.764 162.489 1.00 63.11  ? 111  ILE G C     1 
ATOM 5193  O O     . ILE G 3 112 ? 172.445 207.973 161.414 1.00 67.78  ? 111  ILE G O     1 
ATOM 5194  C CB    . ILE G 3 112 ? 174.196 209.856 163.172 1.00 63.23  ? 111  ILE G CB    1 
ATOM 5195  C CG1   . ILE G 3 112 ? 175.526 210.480 163.553 1.00 68.73  ? 111  ILE G CG1   1 
ATOM 5196  C CG2   . ILE G 3 112 ? 173.265 209.957 164.342 1.00 57.62  ? 111  ILE G CG2   1 
ATOM 5197  C CD1   . ILE G 3 112 ? 175.449 211.965 163.720 1.00 72.60  ? 111  ILE G CD1   1 
ATOM 5198  N N     . GLN G 3 113 ? 172.496 206.999 163.439 1.00 68.93  ? 112  GLN G N     1 
ATOM 5199  C CA    . GLN G 3 113 ? 171.136 206.512 163.305 1.00 64.42  ? 112  GLN G CA    1 
ATOM 5200  C C     . GLN G 3 113 ? 170.160 207.674 163.391 1.00 72.34  ? 112  GLN G C     1 
ATOM 5201  O O     . GLN G 3 113 ? 170.347 208.615 164.165 1.00 82.23  ? 112  GLN G O     1 
ATOM 5202  C CB    . GLN G 3 113 ? 170.828 205.480 164.381 1.00 65.67  ? 112  GLN G CB    1 
ATOM 5203  C CG    . GLN G 3 113 ? 171.567 204.182 164.200 1.00 52.21  ? 112  GLN G CG    1 
ATOM 5204  C CD    . GLN G 3 113 ? 171.196 203.499 162.912 1.00 63.07  ? 112  GLN G CD    1 
ATOM 5205  O OE1   . GLN G 3 113 ? 170.040 203.517 162.506 1.00 69.00  ? 112  GLN G OE1   1 
ATOM 5206  N NE2   . GLN G 3 113 ? 172.173 202.887 162.261 1.00 58.95  ? 112  GLN G NE2   1 
ATOM 5207  N N     . SER G 3 114 ? 169.110 207.600 162.577 1.00 78.76  ? 113  SER G N     1 
ATOM 5208  C CA    . SER G 3 114 ? 168.190 208.722 162.444 1.00 78.71  ? 113  SER G CA    1 
ATOM 5209  C C     . SER G 3 114 ? 167.569 209.090 163.782 1.00 80.22  ? 113  SER G C     1 
ATOM 5210  O O     . SER G 3 114 ? 167.573 210.257 164.185 1.00 93.60  ? 113  SER G O     1 
ATOM 5211  C CB    . SER G 3 114 ? 167.110 208.380 161.423 1.00 76.09  ? 113  SER G CB    1 
ATOM 5212  O OG    . SER G 3 114 ? 167.679 208.189 160.141 1.00 76.74  ? 113  SER G OG    1 
ATOM 5213  N N     . VAL G 3 115 ? 167.046 208.097 164.498 1.00 71.65  ? 114  VAL G N     1 
ATOM 5214  C CA    . VAL G 3 115 ? 166.326 208.358 165.731 1.00 74.60  ? 114  VAL G CA    1 
ATOM 5215  C C     . VAL G 3 115 ? 167.169 209.087 166.759 1.00 83.05  ? 114  VAL G C     1 
ATOM 5216  O O     . VAL G 3 115 ? 166.621 209.682 167.687 1.00 93.28  ? 114  VAL G O     1 
ATOM 5217  C CB    . VAL G 3 115 ? 165.808 207.039 166.325 1.00 73.96  ? 114  VAL G CB    1 
ATOM 5218  C CG1   . VAL G 3 115 ? 164.873 206.367 165.346 1.00 72.10  ? 114  VAL G CG1   1 
ATOM 5219  C CG2   . VAL G 3 115 ? 166.967 206.149 166.667 1.00 75.63  ? 114  VAL G CG2   1 
ATOM 5220  N N     . LEU G 3 116 ? 168.490 209.050 166.624 1.00 82.29  ? 115  LEU G N     1 
ATOM 5221  C CA    . LEU G 3 116 ? 169.331 209.813 167.532 1.00 86.32  ? 115  LEU G CA    1 
ATOM 5222  C C     . LEU G 3 116 ? 169.191 211.305 167.296 1.00 88.21  ? 115  LEU G C     1 
ATOM 5223  O O     . LEU G 3 116 ? 169.393 212.098 168.220 1.00 85.27  ? 115  LEU G O     1 
ATOM 5224  C CB    . LEU G 3 116 ? 170.782 209.391 167.367 1.00 77.36  ? 115  LEU G CB    1 
ATOM 5225  C CG    . LEU G 3 116 ? 170.990 207.936 167.729 1.00 68.52  ? 115  LEU G CG    1 
ATOM 5226  C CD1   . LEU G 3 116 ? 172.393 207.518 167.388 1.00 74.77  ? 115  LEU G CD1   1 
ATOM 5227  C CD2   . LEU G 3 116 ? 170.724 207.763 169.194 1.00 62.00  ? 115  LEU G CD2   1 
ATOM 5228  N N     . LEU G 3 117 ? 168.855 211.703 166.078 1.00 88.28  ? 116  LEU G N     1 
ATOM 5229  C CA    . LEU G 3 117 ? 168.754 213.114 165.771 1.00 89.42  ? 116  LEU G CA    1 
ATOM 5230  C C     . LEU G 3 117 ? 167.616 213.748 166.563 1.00 104.20 ? 116  LEU G C     1 
ATOM 5231  O O     . LEU G 3 117 ? 166.604 213.101 166.839 1.00 99.93  ? 116  LEU G O     1 
ATOM 5232  C CB    . LEU G 3 117 ? 168.526 213.320 164.282 1.00 75.85  ? 116  LEU G CB    1 
ATOM 5233  C CG    . LEU G 3 117 ? 169.699 212.849 163.434 1.00 76.85  ? 116  LEU G CG    1 
ATOM 5234  C CD1   . LEU G 3 117 ? 169.384 212.985 161.961 1.00 75.37  ? 116  LEU G CD1   1 
ATOM 5235  C CD2   . LEU G 3 117 ? 170.925 213.648 163.796 1.00 83.24  ? 116  LEU G CD2   1 
ATOM 5236  N N     . PRO G 3 118 ? 167.766 215.007 166.953 1.00 115.48 ? 117  PRO G N     1 
ATOM 5237  C CA    . PRO G 3 118 ? 166.704 215.676 167.701 1.00 117.51 ? 117  PRO G CA    1 
ATOM 5238  C C     . PRO G 3 118 ? 165.562 216.089 166.794 1.00 119.79 ? 117  PRO G C     1 
ATOM 5239  O O     . PRO G 3 118 ? 165.739 216.356 165.604 1.00 111.35 ? 117  PRO G O     1 
ATOM 5240  C CB    . PRO G 3 118 ? 167.409 216.904 168.288 1.00 109.67 ? 117  PRO G CB    1 
ATOM 5241  C CG    . PRO G 3 118 ? 168.481 217.200 167.313 1.00 107.25 ? 117  PRO G CG    1 
ATOM 5242  C CD    . PRO G 3 118 ? 168.938 215.875 166.766 1.00 110.30 ? 117  PRO G CD    1 
ATOM 5243  N N     . LYS G 3 119 ? 164.373 216.136 167.381 1.00 119.34 ? 118  LYS G N     1 
ATOM 5244  C CA    . LYS G 3 119 ? 163.179 216.539 166.653 1.00 115.85 ? 118  LYS G CA    1 
ATOM 5245  C C     . LYS G 3 119 ? 162.128 217.029 167.632 1.00 121.48 ? 118  LYS G C     1 
ATOM 5246  O O     . LYS G 3 119 ? 162.426 217.260 168.802 1.00 125.95 ? 118  LYS G O     1 
ATOM 5247  C CB    . LYS G 3 119 ? 162.636 215.380 165.818 1.00 108.88 ? 118  LYS G CB    1 
ATOM 5248  N N     . THR H 4 32  ? 220.434 192.560 152.613 1.00 101.32 ? 29   THR H N     1 
ATOM 5249  C CA    . THR H 4 32  ? 219.059 192.082 152.642 1.00 116.19 ? 29   THR H CA    1 
ATOM 5250  C C     . THR H 4 32  ? 218.115 193.100 152.026 1.00 125.63 ? 29   THR H C     1 
ATOM 5251  O O     . THR H 4 32  ? 217.927 194.186 152.571 1.00 125.63 ? 29   THR H O     1 
ATOM 5252  C CB    . THR H 4 32  ? 218.596 191.780 154.076 1.00 114.29 ? 29   THR H CB    1 
ATOM 5253  O OG1   . THR H 4 32  ? 219.412 190.746 154.637 1.00 122.09 ? 29   THR H OG1   1 
ATOM 5254  C CG2   . THR H 4 32  ? 217.151 191.332 154.083 1.00 100.82 ? 29   THR H CG2   1 
ATOM 5255  N N     . ARG H 4 33  ? 217.521 192.752 150.886 1.00 123.75 ? 30   ARG H N     1 
ATOM 5256  C CA    . ARG H 4 33  ? 216.550 193.624 150.242 1.00 108.90 ? 30   ARG H CA    1 
ATOM 5257  C C     . ARG H 4 33  ? 215.164 193.013 150.364 1.00 99.15  ? 30   ARG H C     1 
ATOM 5258  O O     . ARG H 4 33  ? 214.896 191.943 149.811 1.00 96.24  ? 30   ARG H O     1 
ATOM 5259  C CB    . ARG H 4 33  ? 216.892 193.885 148.770 1.00 105.95 ? 30   ARG H CB    1 
ATOM 5260  C CG    . ARG H 4 33  ? 216.967 192.668 147.868 1.00 112.99 ? 30   ARG H CG    1 
ATOM 5261  C CD    . ARG H 4 33  ? 217.048 193.104 146.415 1.00 123.00 ? 30   ARG H CD    1 
ATOM 5262  N NE    . ARG H 4 33  ? 218.255 193.866 146.140 1.00 129.09 ? 30   ARG H NE    1 
ATOM 5263  C CZ    . ARG H 4 33  ? 219.404 193.320 145.764 1.00 131.78 ? 30   ARG H CZ    1 
ATOM 5264  N NH1   . ARG H 4 33  ? 219.490 192.007 145.599 1.00 137.62 ? 30   ARG H NH1   1 
ATOM 5265  N NH2   . ARG H 4 33  ? 220.462 194.088 145.540 1.00 129.09 ? 30   ARG H NH2   1 
ATOM 5266  N N     . LYS H 4 34  ? 214.291 193.688 151.099 1.00 91.05  ? 31   LYS H N     1 
ATOM 5267  C CA    . LYS H 4 34  ? 212.881 193.348 151.077 1.00 91.87  ? 31   LYS H CA    1 
ATOM 5268  C C     . LYS H 4 34  ? 212.311 193.669 149.704 1.00 93.63  ? 31   LYS H C     1 
ATOM 5269  O O     . LYS H 4 34  ? 212.885 194.445 148.940 1.00 95.97  ? 31   LYS H O     1 
ATOM 5270  C CB    . LYS H 4 34  ? 212.141 194.127 152.162 1.00 95.17  ? 31   LYS H CB    1 
ATOM 5271  C CG    . LYS H 4 34  ? 210.639 193.938 152.259 1.00 107.57 ? 31   LYS H CG    1 
ATOM 5272  C CD    . LYS H 4 34  ? 210.257 192.541 152.685 1.00 107.82 ? 31   LYS H CD    1 
ATOM 5273  C CE    . LYS H 4 34  ? 208.764 192.473 152.976 1.00 100.43 ? 31   LYS H CE    1 
ATOM 5274  N NZ    . LYS H 4 34  ? 208.286 191.087 153.228 1.00 101.35 ? 31   LYS H NZ    1 
ATOM 5275  N N     . GLU H 4 35  ? 211.179 193.064 149.382 1.00 82.00  ? 32   GLU H N     1 
ATOM 5276  C CA    . GLU H 4 35  ? 210.492 193.371 148.142 1.00 76.65  ? 32   GLU H CA    1 
ATOM 5277  C C     . GLU H 4 35  ? 209.087 193.863 148.434 1.00 68.31  ? 32   GLU H C     1 
ATOM 5278  O O     . GLU H 4 35  ? 208.575 193.710 149.544 1.00 69.49  ? 32   GLU H O     1 
ATOM 5279  C CB    . GLU H 4 35  ? 210.386 192.172 147.226 1.00 86.97  ? 32   GLU H CB    1 
ATOM 5280  C CG    . GLU H 4 35  ? 209.502 191.102 147.777 1.00 97.36  ? 32   GLU H CG    1 
ATOM 5281  C CD    . GLU H 4 35  ? 209.341 189.964 146.814 1.00 98.24  ? 32   GLU H CD    1 
ATOM 5282  O OE1   . GLU H 4 35  ? 209.582 190.179 145.608 1.00 94.97  ? 32   GLU H OE1   1 
ATOM 5283  O OE2   . GLU H 4 35  ? 208.982 188.855 147.257 1.00 86.71  ? 32   GLU H OE2   1 
ATOM 5284  N N     . SER H 4 36  ? 208.471 194.458 147.422 1.00 58.67  ? 33   SER H N     1 
ATOM 5285  C CA    . SER H 4 36  ? 207.118 194.960 147.531 1.00 47.08  ? 33   SER H CA    1 
ATOM 5286  C C     . SER H 4 36  ? 206.598 195.232 146.138 1.00 60.38  ? 33   SER H C     1 
ATOM 5287  O O     . SER H 4 36  ? 207.302 195.061 145.144 1.00 73.80  ? 33   SER H O     1 
ATOM 5288  C CB    . SER H 4 36  ? 207.061 196.241 148.354 1.00 45.90  ? 33   SER H CB    1 
ATOM 5289  O OG    . SER H 4 36  ? 207.740 197.276 147.673 1.00 58.60  ? 33   SER H OG    1 
ATOM 5290  N N     . TYR H 4 37  ? 205.352 195.652 146.067 1.00 56.82  ? 34   TYR H N     1 
ATOM 5291  C CA    . TYR H 4 37  ? 204.768 196.075 144.814 1.00 56.63  ? 34   TYR H CA    1 
ATOM 5292  C C     . TYR H 4 37  ? 204.755 197.580 144.661 1.00 63.31  ? 34   TYR H C     1 
ATOM 5293  O O     . TYR H 4 37  ? 204.187 198.084 143.688 1.00 69.54  ? 34   TYR H O     1 
ATOM 5294  C CB    . TYR H 4 37  ? 203.370 195.504 144.698 1.00 62.46  ? 34   TYR H CB    1 
ATOM 5295  C CG    . TYR H 4 37  ? 203.421 194.020 144.784 1.00 64.40  ? 34   TYR H CG    1 
ATOM 5296  C CD1   . TYR H 4 37  ? 204.423 193.321 144.161 1.00 62.79  ? 34   TYR H CD1   1 
ATOM 5297  C CD2   . TYR H 4 37  ? 202.503 193.320 145.522 1.00 61.41  ? 34   TYR H CD2   1 
ATOM 5298  C CE1   . TYR H 4 37  ? 204.493 191.969 144.245 1.00 67.76  ? 34   TYR H CE1   1 
ATOM 5299  C CE2   . TYR H 4 37  ? 202.566 191.964 145.612 1.00 55.42  ? 34   TYR H CE2   1 
ATOM 5300  C CZ    . TYR H 4 37  ? 203.562 191.295 144.971 1.00 60.81  ? 34   TYR H CZ    1 
ATOM 5301  O OH    . TYR H 4 37  ? 203.631 189.934 145.060 1.00 64.07  ? 34   TYR H OH    1 
ATOM 5302  N N     . ALA H 4 38  ? 205.360 198.300 145.604 1.00 64.24  ? 35   ALA H N     1 
ATOM 5303  C CA    . ALA H 4 38  ? 205.190 199.744 145.683 1.00 64.38  ? 35   ALA H CA    1 
ATOM 5304  C C     . ALA H 4 38  ? 205.369 200.411 144.330 1.00 72.37  ? 35   ALA H C     1 
ATOM 5305  O O     . ALA H 4 38  ? 204.522 201.198 143.900 1.00 76.35  ? 35   ALA H O     1 
ATOM 5306  C CB    . ALA H 4 38  ? 206.171 200.323 146.694 1.00 57.20  ? 35   ALA H CB    1 
ATOM 5307  N N     . ILE H 4 39  ? 206.455 200.092 143.631 1.00 68.53  ? 36   ILE H N     1 
ATOM 5308  C CA    . ILE H 4 39  ? 206.690 200.720 142.338 1.00 66.72  ? 36   ILE H CA    1 
ATOM 5309  C C     . ILE H 4 39  ? 205.540 200.424 141.393 1.00 68.09  ? 36   ILE H C     1 
ATOM 5310  O O     . ILE H 4 39  ? 205.023 201.318 140.716 1.00 81.12  ? 36   ILE H O     1 
ATOM 5311  C CB    . ILE H 4 39  ? 208.033 200.256 141.758 1.00 65.61  ? 36   ILE H CB    1 
ATOM 5312  C CG1   . ILE H 4 39  ? 208.026 198.756 141.522 1.00 69.99  ? 36   ILE H CG1   1 
ATOM 5313  C CG2   . ILE H 4 39  ? 209.136 200.564 142.722 1.00 76.44  ? 36   ILE H CG2   1 
ATOM 5314  C CD1   . ILE H 4 39  ? 209.227 198.269 140.783 1.00 67.26  ? 36   ILE H CD1   1 
ATOM 5315  N N     . TYR H 4 40  ? 205.099 199.173 141.360 1.00 50.25  ? 37   TYR H N     1 
ATOM 5316  C CA    . TYR H 4 40  ? 204.032 198.773 140.461 1.00 53.48  ? 37   TYR H CA    1 
ATOM 5317  C C     . TYR H 4 40  ? 202.763 199.545 140.758 1.00 56.64  ? 37   TYR H C     1 
ATOM 5318  O O     . TYR H 4 40  ? 202.191 200.206 139.879 1.00 55.97  ? 37   TYR H O     1 
ATOM 5319  C CB    . TYR H 4 40  ? 203.817 197.283 140.622 1.00 54.18  ? 37   TYR H CB    1 
ATOM 5320  C CG    . TYR H 4 40  ? 205.032 196.526 140.219 1.00 64.56  ? 37   TYR H CG    1 
ATOM 5321  C CD1   . TYR H 4 40  ? 205.522 196.633 138.945 1.00 70.07  ? 37   TYR H CD1   1 
ATOM 5322  C CD2   . TYR H 4 40  ? 205.755 195.803 141.138 1.00 74.42  ? 37   TYR H CD2   1 
ATOM 5323  C CE1   . TYR H 4 40  ? 206.631 195.970 138.565 1.00 76.14  ? 37   TYR H CE1   1 
ATOM 5324  C CE2   . TYR H 4 40  ? 206.879 195.142 140.773 1.00 75.46  ? 37   TYR H CE2   1 
ATOM 5325  C CZ    . TYR H 4 40  ? 207.317 195.234 139.480 1.00 74.04  ? 37   TYR H CZ    1 
ATOM 5326  O OH    . TYR H 4 40  ? 208.453 194.582 139.080 1.00 74.95  ? 37   TYR H OH    1 
ATOM 5327  N N     . VAL H 4 41  ? 202.323 199.483 142.012 1.00 61.16  ? 38   VAL H N     1 
ATOM 5328  C CA    . VAL H 4 41  ? 201.175 200.268 142.435 1.00 58.92  ? 38   VAL H CA    1 
ATOM 5329  C C     . VAL H 4 41  ? 201.314 201.684 141.935 1.00 53.08  ? 38   VAL H C     1 
ATOM 5330  O O     . VAL H 4 41  ? 200.406 202.241 141.314 1.00 64.19  ? 38   VAL H O     1 
ATOM 5331  C CB    . VAL H 4 41  ? 201.050 200.247 143.960 1.00 62.38  ? 38   VAL H CB    1 
ATOM 5332  C CG1   . VAL H 4 41  ? 199.992 201.208 144.375 1.00 60.25  ? 38   VAL H CG1   1 
ATOM 5333  C CG2   . VAL H 4 41  ? 200.718 198.870 144.413 1.00 65.74  ? 38   VAL H CG2   1 
ATOM 5334  N N     . TYR H 4 42  ? 202.481 202.269 142.158 1.00 61.67  ? 39   TYR H N     1 
ATOM 5335  C CA    . TYR H 4 42  ? 202.651 203.666 141.824 1.00 68.65  ? 39   TYR H CA    1 
ATOM 5336  C C     . TYR H 4 42  ? 202.445 203.897 140.338 1.00 66.23  ? 39   TYR H C     1 
ATOM 5337  O O     . TYR H 4 42  ? 201.745 204.834 139.938 1.00 62.33  ? 39   TYR H O     1 
ATOM 5338  C CB    . TYR H 4 42  ? 204.019 204.145 142.267 1.00 73.77  ? 39   TYR H CB    1 
ATOM 5339  C CG    . TYR H 4 42  ? 204.194 205.557 141.889 1.00 83.69  ? 39   TYR H CG    1 
ATOM 5340  C CD1   . TYR H 4 42  ? 203.550 206.550 142.586 1.00 75.12  ? 39   TYR H CD1   1 
ATOM 5341  C CD2   . TYR H 4 42  ? 204.966 205.905 140.808 1.00 100.23 ? 39   TYR H CD2   1 
ATOM 5342  C CE1   . TYR H 4 42  ? 203.684 207.856 142.231 1.00 88.68  ? 39   TYR H CE1   1 
ATOM 5343  C CE2   . TYR H 4 42  ? 205.112 207.209 140.444 1.00 106.22 ? 39   TYR H CE2   1 
ATOM 5344  C CZ    . TYR H 4 42  ? 204.466 208.182 141.158 1.00 105.21 ? 39   TYR H CZ    1 
ATOM 5345  O OH    . TYR H 4 42  ? 204.614 209.493 140.796 1.00 110.17 ? 39   TYR H OH    1 
ATOM 5346  N N     . LYS H 4 43  ? 203.031 203.045 139.499 1.00 57.79  ? 40   LYS H N     1 
ATOM 5347  C CA    . LYS H 4 43  ? 202.766 203.162 138.073 1.00 50.78  ? 40   LYS H CA    1 
ATOM 5348  C C     . LYS H 4 43  ? 201.275 203.184 137.807 1.00 53.77  ? 40   LYS H C     1 
ATOM 5349  O O     . LYS H 4 43  ? 200.764 204.090 137.140 1.00 68.23  ? 40   LYS H O     1 
ATOM 5350  C CB    . LYS H 4 43  ? 203.406 202.024 137.294 1.00 50.39  ? 40   LYS H CB    1 
ATOM 5351  C CG    . LYS H 4 43  ? 204.889 202.108 137.134 1.00 62.65  ? 40   LYS H CG    1 
ATOM 5352  C CD    . LYS H 4 43  ? 205.347 200.944 136.291 1.00 78.01  ? 40   LYS H CD    1 
ATOM 5353  C CE    . LYS H 4 43  ? 206.822 201.003 136.014 1.00 86.01  ? 40   LYS H CE    1 
ATOM 5354  N NZ    . LYS H 4 43  ? 207.240 199.849 135.183 1.00 91.12  ? 40   LYS H NZ    1 
ATOM 5355  N N     . VAL H 4 44  ? 200.556 202.198 138.338 1.00 47.67  ? 41   VAL H N     1 
ATOM 5356  C CA    . VAL H 4 44  ? 199.123 202.126 138.074 1.00 57.25  ? 41   VAL H CA    1 
ATOM 5357  C C     . VAL H 4 44  ? 198.453 203.434 138.455 1.00 62.46  ? 41   VAL H C     1 
ATOM 5358  O O     . VAL H 4 44  ? 197.632 203.986 137.709 1.00 66.32  ? 41   VAL H O     1 
ATOM 5359  C CB    . VAL H 4 44  ? 198.502 200.944 138.827 1.00 45.19  ? 41   VAL H CB    1 
ATOM 5360  C CG1   . VAL H 4 44  ? 197.016 200.949 138.636 1.00 34.26  ? 41   VAL H CG1   1 
ATOM 5361  C CG2   . VAL H 4 44  ? 199.090 199.665 138.324 1.00 38.81  ? 41   VAL H CG2   1 
ATOM 5362  N N     . LEU H 4 45  ? 198.807 203.952 139.625 1.00 58.18  ? 42   LEU H N     1 
ATOM 5363  C CA    . LEU H 4 45  ? 198.272 205.230 140.054 1.00 64.80  ? 42   LEU H CA    1 
ATOM 5364  C C     . LEU H 4 45  ? 198.475 206.280 138.984 1.00 66.96  ? 42   LEU H C     1 
ATOM 5365  O O     . LEU H 4 45  ? 197.520 206.916 138.531 1.00 68.63  ? 42   LEU H O     1 
ATOM 5366  C CB    . LEU H 4 45  ? 198.938 205.654 141.349 1.00 54.74  ? 42   LEU H CB    1 
ATOM 5367  C CG    . LEU H 4 45  ? 198.515 207.033 141.794 1.00 52.59  ? 42   LEU H CG    1 
ATOM 5368  C CD1   . LEU H 4 45  ? 197.028 207.046 141.953 1.00 39.94  ? 42   LEU H CD1   1 
ATOM 5369  C CD2   . LEU H 4 45  ? 199.178 207.326 143.109 1.00 50.69  ? 42   LEU H CD2   1 
ATOM 5370  N N     . LYS H 4 46  ? 199.714 206.444 138.534 1.00 67.19  ? 43   LYS H N     1 
ATOM 5371  C CA    . LYS H 4 46  ? 199.968 207.437 137.502 1.00 70.57  ? 43   LYS H CA    1 
ATOM 5372  C C     . LYS H 4 46  ? 199.269 207.116 136.196 1.00 70.44  ? 43   LYS H C     1 
ATOM 5373  O O     . LYS H 4 46  ? 199.186 207.986 135.326 1.00 80.45  ? 43   LYS H O     1 
ATOM 5374  C CB    . LYS H 4 46  ? 201.465 207.605 137.288 1.00 59.82  ? 43   LYS H CB    1 
ATOM 5375  C CG    . LYS H 4 46  ? 202.102 208.284 138.465 1.00 69.37  ? 43   LYS H CG    1 
ATOM 5376  C CD    . LYS H 4 46  ? 201.384 209.602 138.649 1.00 85.76  ? 43   LYS H CD    1 
ATOM 5377  C CE    . LYS H 4 46  ? 201.959 210.437 139.760 1.00 83.40  ? 43   LYS H CE    1 
ATOM 5378  N NZ    . LYS H 4 46  ? 201.212 211.716 139.923 1.00 73.61  ? 43   LYS H NZ    1 
ATOM 5379  N N     . GLN H 4 47  ? 198.746 205.909 136.037 1.00 59.26  ? 44   GLN H N     1 
ATOM 5380  C CA    . GLN H 4 47  ? 197.912 205.676 134.871 1.00 54.91  ? 44   GLN H CA    1 
ATOM 5381  C C     . GLN H 4 47  ? 196.497 206.180 135.101 1.00 50.58  ? 44   GLN H C     1 
ATOM 5382  O O     . GLN H 4 47  ? 195.875 206.728 134.190 1.00 71.67  ? 44   GLN H O     1 
ATOM 5383  C CB    . GLN H 4 47  ? 197.915 204.200 134.515 1.00 55.60  ? 44   GLN H CB    1 
ATOM 5384  C CG    . GLN H 4 47  ? 199.284 203.727 134.124 1.00 72.64  ? 44   GLN H CG    1 
ATOM 5385  C CD    . GLN H 4 47  ? 199.329 202.250 133.841 1.00 99.40  ? 44   GLN H CD    1 
ATOM 5386  O OE1   . GLN H 4 47  ? 198.456 201.495 134.266 1.00 102.28 ? 44   GLN H OE1   1 
ATOM 5387  N NE2   . GLN H 4 47  ? 200.368 201.819 133.143 1.00 106.61 ? 44   GLN H NE2   1 
ATOM 5388  N N     . VAL H 4 48  ? 195.958 205.991 136.302 1.00 50.01  ? 45   VAL H N     1 
ATOM 5389  C CA    . VAL H 4 48  ? 194.588 206.436 136.535 1.00 54.35  ? 45   VAL H CA    1 
ATOM 5390  C C     . VAL H 4 48  ? 194.524 207.925 136.844 1.00 47.09  ? 45   VAL H C     1 
ATOM 5391  O O     . VAL H 4 48  ? 193.710 208.653 136.270 1.00 54.88  ? 45   VAL H O     1 
ATOM 5392  C CB    . VAL H 4 48  ? 193.936 205.606 137.642 1.00 49.30  ? 45   VAL H CB    1 
ATOM 5393  C CG1   . VAL H 4 48  ? 192.589 206.186 137.975 1.00 49.11  ? 45   VAL H CG1   1 
ATOM 5394  C CG2   . VAL H 4 48  ? 193.785 204.194 137.167 1.00 44.31  ? 45   VAL H CG2   1 
ATOM 5395  N N     . HIS H 4 49  ? 195.357 208.406 137.761 1.00 58.48  ? 46   HIS H N     1 
ATOM 5396  C CA    . HIS H 4 49  ? 195.351 209.814 138.154 1.00 66.75  ? 46   HIS H CA    1 
ATOM 5397  C C     . HIS H 4 49  ? 196.757 210.371 138.046 1.00 73.46  ? 46   HIS H C     1 
ATOM 5398  O O     . HIS H 4 49  ? 197.540 210.298 139.000 1.00 79.88  ? 46   HIS H O     1 
ATOM 5399  C CB    . HIS H 4 49  ? 194.822 210.003 139.565 1.00 61.00  ? 46   HIS H CB    1 
ATOM 5400  C CG    . HIS H 4 49  ? 193.427 209.527 139.743 1.00 67.47  ? 46   HIS H CG    1 
ATOM 5401  N ND1   . HIS H 4 49  ? 192.370 210.068 139.048 1.00 83.80  ? 46   HIS H ND1   1 
ATOM 5402  C CD2   . HIS H 4 49  ? 192.902 208.593 140.565 1.00 62.83  ? 46   HIS H CD2   1 
ATOM 5403  C CE1   . HIS H 4 49  ? 191.254 209.467 139.414 1.00 76.30  ? 46   HIS H CE1   1 
ATOM 5404  N NE2   . HIS H 4 49  ? 191.549 208.570 140.337 1.00 70.41  ? 46   HIS H NE2   1 
ATOM 5405  N N     . PRO H 4 50  ? 197.103 210.957 136.910 1.00 73.34  ? 47   PRO H N     1 
ATOM 5406  C CA    . PRO H 4 50  ? 198.501 211.347 136.691 1.00 68.80  ? 47   PRO H CA    1 
ATOM 5407  C C     . PRO H 4 50  ? 199.050 212.272 137.758 1.00 66.53  ? 47   PRO H C     1 
ATOM 5408  O O     . PRO H 4 50  ? 200.269 212.390 137.911 1.00 68.30  ? 47   PRO H O     1 
ATOM 5409  C CB    . PRO H 4 50  ? 198.439 212.033 135.324 1.00 68.34  ? 47   PRO H CB    1 
ATOM 5410  C CG    . PRO H 4 50  ? 197.234 211.454 134.671 1.00 61.03  ? 47   PRO H CG    1 
ATOM 5411  C CD    . PRO H 4 50  ? 196.247 211.300 135.769 1.00 65.99  ? 47   PRO H CD    1 
ATOM 5412  N N     . ASP H 4 51  ? 198.182 212.954 138.486 1.00 67.84  ? 48   ASP H N     1 
ATOM 5413  C CA    . ASP H 4 51  ? 198.607 214.055 139.329 1.00 83.49  ? 48   ASP H CA    1 
ATOM 5414  C C     . ASP H 4 51  ? 198.734 213.700 140.798 1.00 79.45  ? 48   ASP H C     1 
ATOM 5415  O O     . ASP H 4 51  ? 199.158 214.547 141.585 1.00 71.34  ? 48   ASP H O     1 
ATOM 5416  C CB    . ASP H 4 51  ? 197.618 215.195 139.167 1.00 106.52 ? 48   ASP H CB    1 
ATOM 5417  C CG    . ASP H 4 51  ? 197.478 215.611 137.736 1.00 113.72 ? 48   ASP H CG    1 
ATOM 5418  O OD1   . ASP H 4 51  ? 198.317 215.182 136.917 1.00 109.67 ? 48   ASP H OD1   1 
ATOM 5419  O OD2   . ASP H 4 51  ? 196.527 216.353 137.425 1.00 113.11 ? 48   ASP H OD2   1 
ATOM 5420  N N     . THR H 4 52  ? 198.385 212.487 141.193 1.00 86.51  ? 49   THR H N     1 
ATOM 5421  C CA    . THR H 4 52  ? 198.091 212.237 142.594 1.00 66.43  ? 49   THR H CA    1 
ATOM 5422  C C     . THR H 4 52  ? 199.248 211.544 143.284 1.00 68.20  ? 49   THR H C     1 
ATOM 5423  O O     . THR H 4 52  ? 199.669 210.464 142.870 1.00 72.32  ? 49   THR H O     1 
ATOM 5424  C CB    . THR H 4 52  ? 196.837 211.394 142.720 1.00 65.73  ? 49   THR H CB    1 
ATOM 5425  O OG1   . THR H 4 52  ? 195.731 212.117 142.174 1.00 67.33  ? 49   THR H OG1   1 
ATOM 5426  C CG2   . THR H 4 52  ? 196.575 211.097 144.163 1.00 70.66  ? 49   THR H CG2   1 
ATOM 5427  N N     . GLY H 4 53  ? 199.750 212.155 144.341 1.00 61.24  ? 50   GLY H N     1 
ATOM 5428  C CA    . GLY H 4 53  ? 200.711 211.488 145.185 1.00 60.40  ? 50   GLY H CA    1 
ATOM 5429  C C     . GLY H 4 53  ? 200.031 210.485 146.085 1.00 68.71  ? 50   GLY H C     1 
ATOM 5430  O O     . GLY H 4 53  ? 198.820 210.501 146.289 1.00 74.86  ? 50   GLY H O     1 
ATOM 5431  N N     . ILE H 4 54  ? 200.830 209.576 146.630 1.00 57.94  ? 51   ILE H N     1 
ATOM 5432  C CA    . ILE H 4 54  ? 200.310 208.528 147.494 1.00 49.53  ? 51   ILE H CA    1 
ATOM 5433  C C     . ILE H 4 54  ? 201.225 208.402 148.699 1.00 49.09  ? 51   ILE H C     1 
ATOM 5434  O O     . ILE H 4 54  ? 202.403 208.067 148.557 1.00 52.81  ? 51   ILE H O     1 
ATOM 5435  C CB    . ILE H 4 54  ? 200.186 207.197 146.741 1.00 58.64  ? 51   ILE H CB    1 
ATOM 5436  C CG1   . ILE H 4 54  ? 199.728 206.093 147.670 1.00 55.77  ? 51   ILE H CG1   1 
ATOM 5437  C CG2   . ILE H 4 54  ? 201.464 206.840 146.043 1.00 37.67  ? 51   ILE H CG2   1 
ATOM 5438  C CD1   . ILE H 4 54  ? 199.414 204.820 146.944 1.00 48.35  ? 51   ILE H CD1   1 
ATOM 5439  N N     . SER H 4 55  ? 200.693 208.670 149.879 1.00 59.02  ? 52   SER H N     1 
ATOM 5440  C CA    . SER H 4 55  ? 201.550 208.729 151.045 1.00 60.51  ? 52   SER H CA    1 
ATOM 5441  C C     . SER H 4 55  ? 202.087 207.350 151.382 1.00 59.70  ? 52   SER H C     1 
ATOM 5442  O O     . SER H 4 55  ? 201.478 206.326 151.078 1.00 60.49  ? 52   SER H O     1 
ATOM 5443  C CB    . SER H 4 55  ? 200.797 209.298 152.236 1.00 61.88  ? 52   SER H CB    1 
ATOM 5444  O OG    . SER H 4 55  ? 199.708 208.468 152.566 1.00 60.20  ? 52   SER H OG    1 
ATOM 5445  N N     . SER H 4 56  ? 203.240 207.341 152.048 1.00 49.38  ? 53   SER H N     1 
ATOM 5446  C CA    . SER H 4 56  ? 203.969 206.100 152.277 1.00 48.35  ? 53   SER H CA    1 
ATOM 5447  C C     . SER H 4 56  ? 203.101 205.056 152.953 1.00 55.83  ? 53   SER H C     1 
ATOM 5448  O O     . SER H 4 56  ? 202.918 203.951 152.435 1.00 54.93  ? 53   SER H O     1 
ATOM 5449  C CB    . SER H 4 56  ? 205.196 206.374 153.129 1.00 60.06  ? 53   SER H CB    1 
ATOM 5450  O OG    . SER H 4 56  ? 205.815 205.154 153.472 1.00 73.03  ? 53   SER H OG    1 
ATOM 5451  N N     . LYS H 4 57  ? 202.576 205.384 154.129 1.00 64.12  ? 54   LYS H N     1 
ATOM 5452  C CA    . LYS H 4 57  ? 201.700 204.452 154.819 1.00 61.43  ? 54   LYS H CA    1 
ATOM 5453  C C     . LYS H 4 57  ? 200.617 203.963 153.874 1.00 64.53  ? 54   LYS H C     1 
ATOM 5454  O O     . LYS H 4 57  ? 200.443 202.755 153.666 1.00 65.47  ? 54   LYS H O     1 
ATOM 5455  C CB    . LYS H 4 57  ? 201.096 205.136 156.041 1.00 72.77  ? 54   LYS H CB    1 
ATOM 5456  C CG    . LYS H 4 57  ? 200.483 204.222 157.047 1.00 89.12  ? 54   LYS H CG    1 
ATOM 5457  C CD    . LYS H 4 57  ? 201.580 203.462 157.749 1.00 94.54  ? 54   LYS H CD    1 
ATOM 5458  C CE    . LYS H 4 57  ? 201.032 202.637 158.888 1.00 93.33  ? 54   LYS H CE    1 
ATOM 5459  N NZ    . LYS H 4 57  ? 200.464 203.511 159.950 1.00 82.93  ? 54   LYS H NZ    1 
ATOM 5460  N N     . ALA H 4 58  ? 199.937 204.897 153.221 1.00 56.13  ? 55   ALA H N     1 
ATOM 5461  C CA    . ALA H 4 58  ? 198.897 204.524 152.285 1.00 44.17  ? 55   ALA H CA    1 
ATOM 5462  C C     . ALA H 4 58  ? 199.420 203.689 151.138 1.00 48.70  ? 55   ALA H C     1 
ATOM 5463  O O     . ALA H 4 58  ? 198.617 203.113 150.405 1.00 55.95  ? 55   ALA H O     1 
ATOM 5464  C CB    . ALA H 4 58  ? 198.216 205.765 151.737 1.00 43.51  ? 55   ALA H CB    1 
ATOM 5465  N N     . MET H 4 59  ? 200.729 203.631 150.938 1.00 44.37  ? 56   MET H N     1 
ATOM 5466  C CA    . MET H 4 59  ? 201.256 202.598 150.063 1.00 49.05  ? 56   MET H CA    1 
ATOM 5467  C C     . MET H 4 59  ? 201.313 201.268 150.784 1.00 50.96  ? 56   MET H C     1 
ATOM 5468  O O     . MET H 4 59  ? 200.882 200.246 150.246 1.00 60.40  ? 56   MET H O     1 
ATOM 5469  C CB    . MET H 4 59  ? 202.640 202.968 149.555 1.00 39.54  ? 56   MET H CB    1 
ATOM 5470  C CG    . MET H 4 59  ? 203.255 201.890 148.718 1.00 37.51  ? 56   MET H CG    1 
ATOM 5471  S SD    . MET H 4 59  ? 202.301 201.620 147.238 1.00 74.37  ? 56   MET H SD    1 
ATOM 5472  C CE    . MET H 4 59  ? 202.726 203.095 146.341 1.00 46.55  ? 56   MET H CE    1 
ATOM 5473  N N     . SER H 4 60  ? 201.835 201.270 152.010 1.00 56.95  ? 57   SER H N     1 
ATOM 5474  C CA    . SER H 4 60  ? 201.957 200.027 152.755 1.00 64.30  ? 57   SER H CA    1 
ATOM 5475  C C     . SER H 4 60  ? 200.645 199.278 152.786 1.00 64.51  ? 57   SER H C     1 
ATOM 5476  O O     . SER H 4 60  ? 200.620 198.045 152.705 1.00 51.46  ? 57   SER H O     1 
ATOM 5477  C CB    . SER H 4 60  ? 202.426 200.301 154.173 1.00 52.48  ? 57   SER H CB    1 
ATOM 5478  O OG    . SER H 4 60  ? 202.418 199.100 154.909 1.00 70.65  ? 57   SER H OG    1 
ATOM 5479  N N     . ILE H 4 61  ? 199.541 200.003 152.885 1.00 58.82  ? 58   ILE H N     1 
ATOM 5480  C CA    . ILE H 4 61  ? 198.255 199.340 152.760 1.00 49.24  ? 58   ILE H CA    1 
ATOM 5481  C C     . ILE H 4 61  ? 198.203 198.603 151.440 1.00 58.95  ? 58   ILE H C     1 
ATOM 5482  O O     . ILE H 4 61  ? 198.266 197.375 151.425 1.00 67.81  ? 58   ILE H O     1 
ATOM 5483  C CB    . ILE H 4 61  ? 197.086 200.315 152.887 1.00 43.08  ? 58   ILE H CB    1 
ATOM 5484  C CG1   . ILE H 4 61  ? 196.961 200.753 154.329 1.00 43.78  ? 58   ILE H CG1   1 
ATOM 5485  C CG2   . ILE H 4 61  ? 195.820 199.664 152.446 1.00 50.19  ? 58   ILE H CG2   1 
ATOM 5486  C CD1   . ILE H 4 61  ? 195.974 201.835 154.515 1.00 57.12  ? 58   ILE H CD1   1 
ATOM 5487  N N     . MET H 4 62  ? 198.140 199.335 150.328 1.00 59.58  ? 59   MET H N     1 
ATOM 5488  C CA    . MET H 4 62  ? 197.935 198.685 149.041 1.00 57.75  ? 59   MET H CA    1 
ATOM 5489  C C     . MET H 4 62  ? 198.861 197.504 148.856 1.00 57.05  ? 59   MET H C     1 
ATOM 5490  O O     . MET H 4 62  ? 198.455 196.472 148.318 1.00 53.46  ? 59   MET H O     1 
ATOM 5491  C CB    . MET H 4 62  ? 198.131 199.671 147.912 1.00 53.91  ? 59   MET H CB    1 
ATOM 5492  C CG    . MET H 4 62  ? 197.075 200.698 147.893 1.00 52.71  ? 59   MET H CG    1 
ATOM 5493  S SD    . MET H 4 62  ? 195.516 199.850 147.791 1.00 58.00  ? 59   MET H SD    1 
ATOM 5494  C CE    . MET H 4 62  ? 195.713 199.074 146.205 1.00 46.14  ? 59   MET H CE    1 
ATOM 5495  N N     . ASN H 4 63  ? 200.094 197.623 149.315 1.00 48.34  ? 60   ASN H N     1 
ATOM 5496  C CA    . ASN H 4 63  ? 200.971 196.470 149.373 1.00 43.37  ? 60   ASN H CA    1 
ATOM 5497  C C     . ASN H 4 63  ? 200.303 195.301 150.075 1.00 55.82  ? 60   ASN H C     1 
ATOM 5498  O O     . ASN H 4 63  ? 199.949 194.301 149.433 1.00 59.00  ? 60   ASN H O     1 
ATOM 5499  C CB    . ASN H 4 63  ? 202.255 196.839 150.089 1.00 35.49  ? 60   ASN H CB    1 
ATOM 5500  C CG    . ASN H 4 63  ? 203.221 195.719 150.114 1.00 49.08  ? 60   ASN H CG    1 
ATOM 5501  O OD1   . ASN H 4 63  ? 203.215 194.873 149.232 1.00 51.80  ? 60   ASN H OD1   1 
ATOM 5502  N ND2   . ASN H 4 63  ? 204.064 195.689 151.130 1.00 63.01  ? 60   ASN H ND2   1 
ATOM 5503  N N     . SER H 4 64  ? 200.109 195.424 151.391 1.00 59.48  ? 61   SER H N     1 
ATOM 5504  C CA    . SER H 4 64  ? 199.568 194.302 152.144 1.00 52.04  ? 61   SER H CA    1 
ATOM 5505  C C     . SER H 4 64  ? 198.292 193.791 151.525 1.00 59.01  ? 61   SER H C     1 
ATOM 5506  O O     . SER H 4 64  ? 198.055 192.583 151.498 1.00 65.56  ? 61   SER H O     1 
ATOM 5507  C CB    . SER H 4 64  ? 199.318 194.698 153.586 1.00 47.82  ? 61   SER H CB    1 
ATOM 5508  O OG    . SER H 4 64  ? 200.539 194.968 154.238 1.00 74.47  ? 61   SER H OG    1 
ATOM 5509  N N     . PHE H 4 65  ? 197.472 194.691 151.004 1.00 62.58  ? 62   PHE H N     1 
ATOM 5510  C CA    . PHE H 4 65  ? 196.287 194.285 150.274 1.00 53.71  ? 62   PHE H CA    1 
ATOM 5511  C C     . PHE H 4 65  ? 196.637 193.306 149.172 1.00 53.06  ? 62   PHE H C     1 
ATOM 5512  O O     . PHE H 4 65  ? 196.176 192.161 149.169 1.00 59.76  ? 62   PHE H O     1 
ATOM 5513  C CB    . PHE H 4 65  ? 195.598 195.500 149.694 1.00 44.79  ? 62   PHE H CB    1 
ATOM 5514  C CG    . PHE H 4 65  ? 194.481 195.163 148.799 1.00 48.63  ? 62   PHE H CG    1 
ATOM 5515  C CD1   . PHE H 4 65  ? 193.264 194.818 149.307 1.00 50.63  ? 62   PHE H CD1   1 
ATOM 5516  C CD2   . PHE H 4 65  ? 194.647 195.193 147.442 1.00 45.50  ? 62   PHE H CD2   1 
ATOM 5517  C CE1   . PHE H 4 65  ? 192.231 194.510 148.477 1.00 49.93  ? 62   PHE H CE1   1 
ATOM 5518  C CE2   . PHE H 4 65  ? 193.618 194.887 146.610 1.00 40.91  ? 62   PHE H CE2   1 
ATOM 5519  C CZ    . PHE H 4 65  ? 192.410 194.543 147.126 1.00 48.98  ? 62   PHE H CZ    1 
ATOM 5520  N N     . VAL H 4 66  ? 197.443 193.745 148.212 1.00 50.29  ? 63   VAL H N     1 
ATOM 5521  C CA    . VAL H 4 66  ? 197.723 192.881 147.076 1.00 57.61  ? 63   VAL H CA    1 
ATOM 5522  C C     . VAL H 4 66  ? 198.257 191.542 147.537 1.00 60.22  ? 63   VAL H C     1 
ATOM 5523  O O     . VAL H 4 66  ? 197.820 190.493 147.055 1.00 67.32  ? 63   VAL H O     1 
ATOM 5524  C CB    . VAL H 4 66  ? 198.688 193.556 146.102 1.00 48.87  ? 63   VAL H CB    1 
ATOM 5525  C CG1   . VAL H 4 66  ? 199.067 192.575 145.053 1.00 43.93  ? 63   VAL H CG1   1 
ATOM 5526  C CG2   . VAL H 4 66  ? 198.004 194.713 145.471 1.00 44.42  ? 63   VAL H CG2   1 
ATOM 5527  N N     . ASN H 4 67  ? 199.185 191.539 148.493 1.00 49.33  ? 64   ASN H N     1 
ATOM 5528  C CA    . ASN H 4 67  ? 199.619 190.245 149.006 1.00 52.07  ? 64   ASN H CA    1 
ATOM 5529  C C     . ASN H 4 67  ? 198.439 189.428 149.493 1.00 50.13  ? 64   ASN H C     1 
ATOM 5530  O O     . ASN H 4 67  ? 198.378 188.217 149.265 1.00 57.25  ? 64   ASN H O     1 
ATOM 5531  C CB    . ASN H 4 67  ? 200.641 190.400 150.121 1.00 42.35  ? 64   ASN H CB    1 
ATOM 5532  C CG    . ASN H 4 67  ? 202.023 190.646 149.596 1.00 65.73  ? 64   ASN H CG    1 
ATOM 5533  O OD1   . ASN H 4 67  ? 202.660 189.740 149.073 1.00 73.38  ? 64   ASN H OD1   1 
ATOM 5534  N ND2   . ASN H 4 67  ? 202.511 191.865 149.746 1.00 70.18  ? 64   ASN H ND2   1 
ATOM 5535  N N     . ASP H 4 68  ? 197.473 190.074 150.134 1.00 41.80  ? 65   ASP H N     1 
ATOM 5536  C CA    . ASP H 4 68  ? 196.319 189.336 150.621 1.00 48.91  ? 65   ASP H CA    1 
ATOM 5537  C C     . ASP H 4 68  ? 195.565 188.696 149.472 1.00 61.11  ? 65   ASP H C     1 
ATOM 5538  O O     . ASP H 4 68  ? 195.442 187.469 149.402 1.00 67.36  ? 65   ASP H O     1 
ATOM 5539  C CB    . ASP H 4 68  ? 195.400 190.258 151.403 1.00 41.24  ? 65   ASP H CB    1 
ATOM 5540  C CG    . ASP H 4 68  ? 194.215 189.540 151.971 1.00 61.71  ? 65   ASP H CG    1 
ATOM 5541  O OD1   . ASP H 4 68  ? 194.162 188.303 151.863 1.00 80.60  ? 65   ASP H OD1   1 
ATOM 5542  O OD2   . ASP H 4 68  ? 193.323 190.211 152.523 1.00 52.56  ? 65   ASP H OD2   1 
ATOM 5543  N N     . VAL H 4 69  ? 195.065 189.514 148.550 1.00 47.15  ? 66   VAL H N     1 
ATOM 5544  C CA    . VAL H 4 69  ? 194.257 188.963 147.470 1.00 45.73  ? 66   VAL H CA    1 
ATOM 5545  C C     . VAL H 4 69  ? 195.015 187.873 146.751 1.00 47.11  ? 66   VAL H C     1 
ATOM 5546  O O     . VAL H 4 69  ? 194.439 186.857 146.342 1.00 49.96  ? 66   VAL H O     1 
ATOM 5547  C CB    . VAL H 4 69  ? 193.829 190.070 146.506 1.00 48.45  ? 66   VAL H CB    1 
ATOM 5548  C CG1   . VAL H 4 69  ? 193.149 189.473 145.320 1.00 39.31  ? 66   VAL H CG1   1 
ATOM 5549  C CG2   . VAL H 4 69  ? 192.897 190.998 147.204 1.00 39.03  ? 66   VAL H CG2   1 
ATOM 5550  N N     . PHE H 4 70  ? 196.322 188.037 146.627 1.00 39.76  ? 67   PHE H N     1 
ATOM 5551  C CA    . PHE H 4 70  ? 197.128 186.991 146.027 1.00 44.14  ? 67   PHE H CA    1 
ATOM 5552  C C     . PHE H 4 70  ? 197.022 185.702 146.819 1.00 56.86  ? 67   PHE H C     1 
ATOM 5553  O O     . PHE H 4 70  ? 196.739 184.642 146.257 1.00 62.66  ? 67   PHE H O     1 
ATOM 5554  C CB    . PHE H 4 70  ? 198.569 187.450 145.933 1.00 41.55  ? 67   PHE H CB    1 
ATOM 5555  C CG    . PHE H 4 70  ? 199.488 186.409 145.449 1.00 53.09  ? 67   PHE H CG    1 
ATOM 5556  C CD1   . PHE H 4 70  ? 199.552 186.104 144.121 1.00 46.84  ? 67   PHE H CD1   1 
ATOM 5557  C CD2   . PHE H 4 70  ? 200.306 185.747 146.322 1.00 61.92  ? 67   PHE H CD2   1 
ATOM 5558  C CE1   . PHE H 4 70  ? 200.407 185.149 143.675 1.00 53.26  ? 67   PHE H CE1   1 
ATOM 5559  C CE2   . PHE H 4 70  ? 201.166 184.794 145.876 1.00 51.48  ? 67   PHE H CE2   1 
ATOM 5560  C CZ    . PHE H 4 70  ? 201.216 184.494 144.550 1.00 52.62  ? 67   PHE H CZ    1 
ATOM 5561  N N     . GLU H 4 71  ? 197.227 185.770 148.132 1.00 57.51  ? 68   GLU H N     1 
ATOM 5562  C CA    . GLU H 4 71  ? 197.158 184.548 148.920 1.00 59.41  ? 68   GLU H CA    1 
ATOM 5563  C C     . GLU H 4 71  ? 195.801 183.888 148.798 1.00 50.19  ? 68   GLU H C     1 
ATOM 5564  O O     . GLU H 4 71  ? 195.711 182.660 148.740 1.00 51.25  ? 68   GLU H O     1 
ATOM 5565  C CB    . GLU H 4 71  ? 197.480 184.821 150.381 1.00 56.95  ? 68   GLU H CB    1 
ATOM 5566  C CG    . GLU H 4 71  ? 198.936 185.151 150.615 1.00 84.15  ? 68   GLU H CG    1 
ATOM 5567  C CD    . GLU H 4 71  ? 199.254 185.405 152.078 1.00 105.20 ? 68   GLU H CD    1 
ATOM 5568  O OE1   . GLU H 4 71  ? 198.309 185.497 152.886 1.00 115.31 ? 68   GLU H OE1   1 
ATOM 5569  O OE2   . GLU H 4 71  ? 200.450 185.509 152.422 1.00 101.09 ? 68   GLU H OE2   1 
ATOM 5570  N N     . ARG H 4 72  ? 194.730 184.674 148.742 1.00 33.78  ? 69   ARG H N     1 
ATOM 5571  C CA    . ARG H 4 72  ? 193.422 184.053 148.593 1.00 38.73  ? 69   ARG H CA    1 
ATOM 5572  C C     . ARG H 4 72  ? 193.317 183.336 147.264 1.00 48.09  ? 69   ARG H C     1 
ATOM 5573  O O     . ARG H 4 72  ? 192.984 182.150 147.211 1.00 49.98  ? 69   ARG H O     1 
ATOM 5574  C CB    . ARG H 4 72  ? 192.310 185.075 148.710 1.00 38.82  ? 69   ARG H CB    1 
ATOM 5575  C CG    . ARG H 4 72  ? 192.155 185.663 150.063 1.00 49.56  ? 69   ARG H CG    1 
ATOM 5576  C CD    . ARG H 4 72  ? 190.962 186.570 150.046 1.00 55.19  ? 69   ARG H CD    1 
ATOM 5577  N NE    . ARG H 4 72  ? 190.854 187.353 151.263 1.00 57.54  ? 69   ARG H NE    1 
ATOM 5578  C CZ    . ARG H 4 72  ? 189.964 188.317 151.432 1.00 67.08  ? 69   ARG H CZ    1 
ATOM 5579  N NH1   . ARG H 4 72  ? 189.111 188.597 150.463 1.00 65.17  ? 69   ARG H NH1   1 
ATOM 5580  N NH2   . ARG H 4 72  ? 189.928 189.001 152.564 1.00 63.92  ? 69   ARG H NH2   1 
ATOM 5581  N N     . ILE H 4 73  ? 193.600 184.040 146.173 1.00 48.05  ? 70   ILE H N     1 
ATOM 5582  C CA    . ILE H 4 73  ? 193.360 183.454 144.862 1.00 55.54  ? 70   ILE H CA    1 
ATOM 5583  C C     . ILE H 4 73  ? 194.232 182.232 144.659 1.00 52.30  ? 70   ILE H C     1 
ATOM 5584  O O     . ILE H 4 73  ? 193.771 181.190 144.184 1.00 53.55  ? 70   ILE H O     1 
ATOM 5585  C CB    . ILE H 4 73  ? 193.591 184.485 143.760 1.00 49.16  ? 70   ILE H CB    1 
ATOM 5586  C CG1   . ILE H 4 73  ? 192.589 185.604 143.912 1.00 46.51  ? 70   ILE H CG1   1 
ATOM 5587  C CG2   . ILE H 4 73  ? 193.390 183.841 142.445 1.00 42.20  ? 70   ILE H CG2   1 
ATOM 5588  C CD1   . ILE H 4 73  ? 192.879 186.746 143.030 1.00 36.84  ? 70   ILE H CD1   1 
ATOM 5589  N N     . ALA H 4 74  ? 195.503 182.335 145.021 1.00 40.60  ? 71   ALA H N     1 
ATOM 5590  C CA    . ALA H 4 74  ? 196.353 181.158 144.977 1.00 42.16  ? 71   ALA H CA    1 
ATOM 5591  C C     . ALA H 4 74  ? 195.740 180.031 145.785 1.00 54.29  ? 71   ALA H C     1 
ATOM 5592  O O     . ALA H 4 74  ? 195.512 178.935 145.265 1.00 49.01  ? 71   ALA H O     1 
ATOM 5593  C CB    . ALA H 4 74  ? 197.745 181.493 145.493 1.00 33.52  ? 71   ALA H CB    1 
ATOM 5594  N N     . GLY H 4 75  ? 195.428 180.295 147.054 1.00 58.00  ? 72   GLY H N     1 
ATOM 5595  C CA    . GLY H 4 75  ? 194.856 179.256 147.891 1.00 52.20  ? 72   GLY H CA    1 
ATOM 5596  C C     . GLY H 4 75  ? 193.701 178.548 147.220 1.00 53.46  ? 72   GLY H C     1 
ATOM 5597  O O     . GLY H 4 75  ? 193.626 177.318 147.220 1.00 50.16  ? 72   GLY H O     1 
ATOM 5598  N N     . GLU H 4 76  ? 192.817 179.306 146.586 1.00 50.32  ? 73   GLU H N     1 
ATOM 5599  C CA    . GLU H 4 76  ? 191.712 178.672 145.890 1.00 48.67  ? 73   GLU H CA    1 
ATOM 5600  C C     . GLU H 4 76  ? 192.193 177.839 144.722 1.00 55.25  ? 73   GLU H C     1 
ATOM 5601  O O     . GLU H 4 76  ? 191.659 176.757 144.469 1.00 73.07  ? 73   GLU H O     1 
ATOM 5602  C CB    . GLU H 4 76  ? 190.724 179.713 145.413 1.00 44.18  ? 73   GLU H CB    1 
ATOM 5603  C CG    . GLU H 4 76  ? 190.014 180.324 146.544 1.00 68.08  ? 73   GLU H CG    1 
ATOM 5604  C CD    . GLU H 4 76  ? 189.324 179.277 147.353 1.00 80.43  ? 73   GLU H CD    1 
ATOM 5605  O OE1   . GLU H 4 76  ? 188.752 178.349 146.748 1.00 61.13  ? 73   GLU H OE1   1 
ATOM 5606  O OE2   . GLU H 4 76  ? 189.370 179.368 148.593 1.00 88.09  ? 73   GLU H OE2   1 
ATOM 5607  N N     . ALA H 4 77  ? 193.178 178.329 143.979 1.00 40.98  ? 74   ALA H N     1 
ATOM 5608  C CA    . ALA H 4 77  ? 193.701 177.519 142.890 1.00 49.07  ? 74   ALA H CA    1 
ATOM 5609  C C     . ALA H 4 77  ? 194.186 176.184 143.416 1.00 53.83  ? 74   ALA H C     1 
ATOM 5610  O O     . ALA H 4 77  ? 193.874 175.129 142.857 1.00 59.55  ? 74   ALA H O     1 
ATOM 5611  C CB    . ALA H 4 77  ? 194.827 178.251 142.178 1.00 48.12  ? 74   ALA H CB    1 
ATOM 5612  N N     . SER H 4 78  ? 194.926 176.211 144.514 1.00 55.54  ? 75   SER H N     1 
ATOM 5613  C CA    . SER H 4 78  ? 195.364 174.984 145.147 1.00 65.60  ? 75   SER H CA    1 
ATOM 5614  C C     . SER H 4 78  ? 194.182 174.086 145.442 1.00 61.37  ? 75   SER H C     1 
ATOM 5615  O O     . SER H 4 78  ? 194.020 173.040 144.810 1.00 48.93  ? 75   SER H O     1 
ATOM 5616  C CB    . SER H 4 78  ? 196.111 175.281 146.433 1.00 66.54  ? 75   SER H CB    1 
ATOM 5617  O OG    . SER H 4 78  ? 196.394 174.077 147.104 1.00 68.69  ? 75   SER H OG    1 
ATOM 5618  N N     . ARG H 4 79  ? 193.323 174.500 146.364 1.00 54.09  ? 76   ARG H N     1 
ATOM 5619  C CA    . ARG H 4 79  ? 192.292 173.580 146.813 1.00 51.24  ? 76   ARG H CA    1 
ATOM 5620  C C     . ARG H 4 79  ? 191.307 173.231 145.714 1.00 53.76  ? 76   ARG H C     1 
ATOM 5621  O O     . ARG H 4 79  ? 190.464 172.356 145.901 1.00 50.21  ? 76   ARG H O     1 
ATOM 5622  C CB    . ARG H 4 79  ? 191.555 174.123 148.029 1.00 56.90  ? 76   ARG H CB    1 
ATOM 5623  C CG    . ARG H 4 79  ? 192.419 174.073 149.260 1.00 67.45  ? 76   ARG H CG    1 
ATOM 5624  C CD    . ARG H 4 79  ? 191.649 174.331 150.530 1.00 63.88  ? 76   ARG H CD    1 
ATOM 5625  N NE    . ARG H 4 79  ? 191.125 175.681 150.630 1.00 78.43  ? 76   ARG H NE    1 
ATOM 5626  C CZ    . ARG H 4 79  ? 189.870 176.005 150.356 1.00 84.08  ? 76   ARG H CZ    1 
ATOM 5627  N NH1   . ARG H 4 79  ? 189.024 175.074 149.943 1.00 73.68  ? 76   ARG H NH1   1 
ATOM 5628  N NH2   . ARG H 4 79  ? 189.465 177.256 150.486 1.00 94.31  ? 76   ARG H NH2   1 
ATOM 5629  N N     . LEU H 4 80  ? 191.387 173.890 144.568 1.00 57.00  ? 77   LEU H N     1 
ATOM 5630  C CA    . LEU H 4 80  ? 190.732 173.321 143.398 1.00 52.07  ? 77   LEU H CA    1 
ATOM 5631  C C     . LEU H 4 80  ? 191.549 172.173 142.838 1.00 62.63  ? 77   LEU H C     1 
ATOM 5632  O O     . LEU H 4 80  ? 191.127 171.016 142.887 1.00 65.51  ? 77   LEU H O     1 
ATOM 5633  C CB    . LEU H 4 80  ? 190.494 174.379 142.330 1.00 47.96  ? 77   LEU H CB    1 
ATOM 5634  C CG    . LEU H 4 80  ? 189.242 175.117 142.692 1.00 55.45  ? 77   LEU H CG    1 
ATOM 5635  C CD1   . LEU H 4 80  ? 188.973 176.167 141.677 1.00 52.81  ? 77   LEU H CD1   1 
ATOM 5636  C CD2   . LEU H 4 80  ? 188.181 174.086 142.650 1.00 45.74  ? 77   LEU H CD2   1 
ATOM 5637  N N     . ALA H 4 81  ? 192.735 172.482 142.324 1.00 53.21  ? 78   ALA H N     1 
ATOM 5638  C CA    . ALA H 4 81  ? 193.520 171.472 141.637 1.00 56.41  ? 78   ALA H CA    1 
ATOM 5639  C C     . ALA H 4 81  ? 193.667 170.223 142.476 1.00 64.77  ? 78   ALA H C     1 
ATOM 5640  O O     . ALA H 4 81  ? 193.836 169.125 141.941 1.00 65.74  ? 78   ALA H O     1 
ATOM 5641  C CB    . ALA H 4 81  ? 194.889 172.031 141.287 1.00 59.03  ? 78   ALA H CB    1 
ATOM 5642  N N     . HIS H 4 82  ? 193.587 170.362 143.788 1.00 70.10  ? 79   HIS H N     1 
ATOM 5643  C CA    . HIS H 4 82  ? 193.613 169.183 144.631 1.00 62.65  ? 79   HIS H CA    1 
ATOM 5644  C C     . HIS H 4 82  ? 192.391 168.309 144.406 1.00 63.73  ? 79   HIS H C     1 
ATOM 5645  O O     . HIS H 4 82  ? 192.517 167.088 144.302 1.00 60.69  ? 79   HIS H O     1 
ATOM 5646  C CB    . HIS H 4 82  ? 193.702 169.590 146.087 1.00 56.82  ? 79   HIS H CB    1 
ATOM 5647  C CG    . HIS H 4 82  ? 193.723 168.431 147.018 1.00 83.90  ? 79   HIS H CG    1 
ATOM 5648  N ND1   . HIS H 4 82  ? 194.755 167.521 147.042 1.00 91.26  ? 79   HIS H ND1   1 
ATOM 5649  C CD2   . HIS H 4 82  ? 192.820 168.005 147.928 1.00 89.80  ? 79   HIS H CD2   1 
ATOM 5650  C CE1   . HIS H 4 82  ? 194.499 166.598 147.952 1.00 87.40  ? 79   HIS H CE1   1 
ATOM 5651  N NE2   . HIS H 4 82  ? 193.330 166.868 148.502 1.00 85.48  ? 79   HIS H NE2   1 
ATOM 5652  N N     . TYR H 4 83  ? 191.199 168.899 144.351 1.00 68.19  ? 80   TYR H N     1 
ATOM 5653  C CA    . TYR H 4 83  ? 190.004 168.074 144.239 1.00 66.59  ? 80   TYR H CA    1 
ATOM 5654  C C     . TYR H 4 83  ? 189.977 167.342 142.916 1.00 67.95  ? 80   TYR H C     1 
ATOM 5655  O O     . TYR H 4 83  ? 189.917 166.112 142.871 1.00 71.03  ? 80   TYR H O     1 
ATOM 5656  C CB    . TYR H 4 83  ? 188.738 168.906 144.383 1.00 56.61  ? 80   TYR H CB    1 
ATOM 5657  C CG    . TYR H 4 83  ? 188.626 169.599 145.700 1.00 74.19  ? 80   TYR H CG    1 
ATOM 5658  C CD1   . TYR H 4 83  ? 189.231 169.078 146.823 1.00 77.42  ? 80   TYR H CD1   1 
ATOM 5659  C CD2   . TYR H 4 83  ? 187.862 170.742 145.836 1.00 72.22  ? 80   TYR H CD2   1 
ATOM 5660  C CE1   . TYR H 4 83  ? 189.128 169.705 148.036 1.00 72.97  ? 80   TYR H CE1   1 
ATOM 5661  C CE2   . TYR H 4 83  ? 187.748 171.374 147.047 1.00 73.68  ? 80   TYR H CE2   1 
ATOM 5662  C CZ    . TYR H 4 83  ? 188.383 170.851 148.145 1.00 76.78  ? 80   TYR H CZ    1 
ATOM 5663  O OH    . TYR H 4 83  ? 188.275 171.474 149.365 1.00 83.00  ? 80   TYR H OH    1 
ATOM 5664  N N     . ASN H 4 84  ? 190.045 168.081 141.824 1.00 70.31  ? 81   ASN H N     1 
ATOM 5665  C CA    . ASN H 4 84  ? 189.948 167.446 140.526 1.00 67.29  ? 81   ASN H CA    1 
ATOM 5666  C C     . ASN H 4 84  ? 191.115 166.524 140.241 1.00 74.91  ? 81   ASN H C     1 
ATOM 5667  O O     . ASN H 4 84  ? 191.130 165.881 139.190 1.00 74.02  ? 81   ASN H O     1 
ATOM 5668  C CB    . ASN H 4 84  ? 189.860 168.510 139.464 1.00 50.53  ? 81   ASN H CB    1 
ATOM 5669  C CG    . ASN H 4 84  ? 188.684 169.387 139.668 1.00 61.01  ? 81   ASN H CG    1 
ATOM 5670  O OD1   . ASN H 4 84  ? 187.555 168.994 139.412 1.00 74.44  ? 81   ASN H OD1   1 
ATOM 5671  N ND2   . ASN H 4 84  ? 188.929 170.584 140.160 1.00 52.74  ? 81   ASN H ND2   1 
ATOM 5672  N N     . LYS H 4 85  ? 192.100 166.480 141.128 1.00 73.25  ? 82   LYS H N     1 
ATOM 5673  C CA    . LYS H 4 85  ? 193.275 165.637 140.993 1.00 72.25  ? 82   LYS H CA    1 
ATOM 5674  C C     . LYS H 4 85  ? 194.132 166.039 139.814 1.00 68.88  ? 82   LYS H C     1 
ATOM 5675  O O     . LYS H 4 85  ? 194.924 165.241 139.322 1.00 65.51  ? 82   LYS H O     1 
ATOM 5676  C CB    . LYS H 4 85  ? 192.882 164.166 140.883 1.00 73.04  ? 82   LYS H CB    1 
ATOM 5677  C CG    . LYS H 4 85  ? 192.243 163.643 142.139 1.00 83.96  ? 82   LYS H CG    1 
ATOM 5678  C CD    . LYS H 4 85  ? 191.511 162.355 141.876 1.00 102.73 ? 82   LYS H CD    1 
ATOM 5679  C CE    . LYS H 4 85  ? 192.462 161.288 141.383 1.00 117.00 ? 82   LYS H CE    1 
ATOM 5680  N NZ    . LYS H 4 85  ? 191.753 160.009 141.105 1.00 120.82 ? 82   LYS H NZ    1 
ATOM 5681  N N     . ARG H 4 86  ? 194.003 167.271 139.352 1.00 65.88  ? 83   ARG H N     1 
ATOM 5682  C CA    . ARG H 4 86  ? 195.074 167.842 138.564 1.00 65.13  ? 83   ARG H CA    1 
ATOM 5683  C C     . ARG H 4 86  ? 196.264 168.088 139.472 1.00 73.22  ? 83   ARG H C     1 
ATOM 5684  O O     . ARG H 4 86  ? 196.118 168.297 140.675 1.00 78.56  ? 83   ARG H O     1 
ATOM 5685  C CB    . ARG H 4 86  ? 194.638 169.148 137.921 1.00 65.26  ? 83   ARG H CB    1 
ATOM 5686  C CG    . ARG H 4 86  ? 193.490 169.009 136.982 1.00 67.91  ? 83   ARG H CG    1 
ATOM 5687  C CD    . ARG H 4 86  ? 193.923 168.289 135.745 1.00 86.44  ? 83   ARG H CD    1 
ATOM 5688  N NE    . ARG H 4 86  ? 192.850 168.236 134.765 1.00 107.23 ? 83   ARG H NE    1 
ATOM 5689  C CZ    . ARG H 4 86  ? 191.952 167.263 134.705 1.00 114.45 ? 83   ARG H CZ    1 
ATOM 5690  N NH1   . ARG H 4 86  ? 191.999 166.266 135.576 1.00 117.08 ? 83   ARG H NH1   1 
ATOM 5691  N NH2   . ARG H 4 86  ? 191.006 167.290 133.780 1.00 105.13 ? 83   ARG H NH2   1 
ATOM 5692  N N     . SER H 4 87  ? 197.453 168.012 138.906 1.00 71.51  ? 84   SER H N     1 
ATOM 5693  C CA    . SER H 4 87  ? 198.646 168.347 139.656 1.00 75.28  ? 84   SER H CA    1 
ATOM 5694  C C     . SER H 4 87  ? 199.164 169.742 139.362 1.00 74.09  ? 84   SER H C     1 
ATOM 5695  O O     . SER H 4 87  ? 200.128 170.171 139.999 1.00 68.94  ? 84   SER H O     1 
ATOM 5696  C CB    . SER H 4 87  ? 199.735 167.330 139.364 1.00 74.85  ? 84   SER H CB    1 
ATOM 5697  O OG    . SER H 4 87  ? 200.055 167.364 137.990 1.00 86.42  ? 84   SER H OG    1 
ATOM 5698  N N     . THR H 4 88  ? 198.554 170.463 138.427 1.00 77.04  ? 85   THR H N     1 
ATOM 5699  C CA    . THR H 4 88  ? 199.146 171.682 137.893 1.00 62.57  ? 85   THR H CA    1 
ATOM 5700  C C     . THR H 4 88  ? 198.137 172.813 137.832 1.00 56.85  ? 85   THR H C     1 
ATOM 5701  O O     . THR H 4 88  ? 197.161 172.734 137.082 1.00 79.62  ? 85   THR H O     1 
ATOM 5702  C CB    . THR H 4 88  ? 199.690 171.445 136.495 1.00 64.85  ? 85   THR H CB    1 
ATOM 5703  O OG1   . THR H 4 88  ? 200.716 170.453 136.547 1.00 81.48  ? 85   THR H OG1   1 
ATOM 5704  C CG2   . THR H 4 88  ? 200.253 172.720 135.943 1.00 56.88  ? 85   THR H CG2   1 
ATOM 5705  N N     . ILE H 4 89  ? 198.392 173.875 138.586 1.00 57.72  ? 86   ILE H N     1 
ATOM 5706  C CA    . ILE H 4 89  ? 197.613 175.100 138.465 1.00 64.66  ? 86   ILE H CA    1 
ATOM 5707  C C     . ILE H 4 89  ? 197.707 175.591 137.034 1.00 64.35  ? 86   ILE H C     1 
ATOM 5708  O O     . ILE H 4 89  ? 198.805 175.768 136.503 1.00 64.96  ? 86   ILE H O     1 
ATOM 5709  C CB    . ILE H 4 89  ? 198.126 176.174 139.420 1.00 67.16  ? 86   ILE H CB    1 
ATOM 5710  C CG1   . ILE H 4 89  ? 197.872 175.768 140.848 1.00 69.63  ? 86   ILE H CG1   1 
ATOM 5711  C CG2   . ILE H 4 89  ? 197.444 177.462 139.140 1.00 55.66  ? 86   ILE H CG2   1 
ATOM 5712  C CD1   . ILE H 4 89  ? 198.569 176.652 141.807 1.00 63.23  ? 86   ILE H CD1   1 
ATOM 5713  N N     . THR H 4 90  ? 196.574 175.821 136.407 1.00 60.29  ? 87   THR H N     1 
ATOM 5714  C CA    . THR H 4 90  ? 196.602 176.411 135.086 1.00 68.39  ? 87   THR H CA    1 
ATOM 5715  C C     . THR H 4 90  ? 195.766 177.675 135.112 1.00 62.93  ? 87   THR H C     1 
ATOM 5716  O O     . THR H 4 90  ? 195.216 178.057 136.143 1.00 57.62  ? 87   THR H O     1 
ATOM 5717  C CB    . THR H 4 90  ? 196.063 175.452 134.043 1.00 75.89  ? 87   THR H CB    1 
ATOM 5718  O OG1   . THR H 4 90  ? 194.654 175.322 134.228 1.00 73.17  ? 87   THR H OG1   1 
ATOM 5719  C CG2   . THR H 4 90  ? 196.688 174.097 134.228 1.00 71.69  ? 87   THR H CG2   1 
ATOM 5720  N N     . SER H 4 91  ? 195.645 178.326 133.966 1.00 66.29  ? 88   SER H N     1 
ATOM 5721  C CA    . SER H 4 91  ? 194.779 179.488 133.881 1.00 69.34  ? 88   SER H CA    1 
ATOM 5722  C C     . SER H 4 91  ? 193.371 179.144 134.327 1.00 64.75  ? 88   SER H C     1 
ATOM 5723  O O     . SER H 4 91  ? 192.820 179.785 135.228 1.00 64.45  ? 88   SER H O     1 
ATOM 5724  C CB    . SER H 4 91  ? 194.757 179.999 132.455 1.00 78.60  ? 88   SER H CB    1 
ATOM 5725  O OG    . SER H 4 91  ? 194.182 179.005 131.635 1.00 92.26  ? 88   SER H OG    1 
ATOM 5726  N N     . ARG H 4 92  ? 192.792 178.110 133.724 1.00 57.35  ? 89   ARG H N     1 
ATOM 5727  C CA    . ARG H 4 92  ? 191.374 177.827 133.899 1.00 58.16  ? 89   ARG H CA    1 
ATOM 5728  C C     . ARG H 4 92  ? 190.988 177.819 135.369 1.00 70.00  ? 89   ARG H C     1 
ATOM 5729  O O     . ARG H 4 92  ? 189.968 178.406 135.758 1.00 74.46  ? 89   ARG H O     1 
ATOM 5730  C CB    . ARG H 4 92  ? 191.051 176.498 133.230 1.00 63.75  ? 89   ARG H CB    1 
ATOM 5731  C CG    . ARG H 4 92  ? 189.597 176.159 133.154 1.00 66.79  ? 89   ARG H CG    1 
ATOM 5732  C CD    . ARG H 4 92  ? 189.414 174.908 132.317 1.00 70.03  ? 89   ARG H CD    1 
ATOM 5733  N NE    . ARG H 4 92  ? 188.006 174.584 132.131 1.00 73.50  ? 89   ARG H NE    1 
ATOM 5734  C CZ    . ARG H 4 92  ? 187.303 173.825 132.959 1.00 78.54  ? 89   ARG H CZ    1 
ATOM 5735  N NH1   . ARG H 4 92  ? 187.881 173.294 134.028 1.00 79.97  ? 89   ARG H NH1   1 
ATOM 5736  N NH2   . ARG H 4 92  ? 186.023 173.592 132.713 1.00 91.54  ? 89   ARG H NH2   1 
ATOM 5737  N N     . GLU H 4 93  ? 191.821 177.210 136.212 1.00 57.67  ? 90   GLU H N     1 
ATOM 5738  C CA    . GLU H 4 93  ? 191.578 177.277 137.645 1.00 52.54  ? 90   GLU H CA    1 
ATOM 5739  C C     . GLU H 4 93  ? 191.511 178.718 138.107 1.00 60.31  ? 90   GLU H C     1 
ATOM 5740  O O     . GLU H 4 93  ? 190.483 179.165 138.615 1.00 60.95  ? 90   GLU H O     1 
ATOM 5741  C CB    . GLU H 4 93  ? 192.664 176.537 138.407 1.00 55.19  ? 90   GLU H CB    1 
ATOM 5742  C CG    . GLU H 4 93  ? 192.700 175.074 138.133 1.00 68.70  ? 90   GLU H CG    1 
ATOM 5743  C CD    . GLU H 4 93  ? 193.419 174.774 136.850 1.00 82.87  ? 90   GLU H CD    1 
ATOM 5744  O OE1   . GLU H 4 93  ? 193.738 175.739 136.126 1.00 81.12  ? 90   GLU H OE1   1 
ATOM 5745  O OE2   . GLU H 4 93  ? 193.687 173.589 136.569 1.00 93.97  ? 90   GLU H OE2   1 
ATOM 5746  N N     . ILE H 4 94  ? 192.587 179.476 137.894 1.00 53.96  ? 91   ILE H N     1 
ATOM 5747  C CA    . ILE H 4 94  ? 192.616 180.853 138.370 1.00 46.88  ? 91   ILE H CA    1 
ATOM 5748  C C     . ILE H 4 94  ? 191.346 181.570 137.976 1.00 54.45  ? 91   ILE H C     1 
ATOM 5749  O O     . ILE H 4 94  ? 190.748 182.294 138.777 1.00 56.44  ? 91   ILE H O     1 
ATOM 5750  C CB    . ILE H 4 94  ? 193.847 181.586 137.830 1.00 45.70  ? 91   ILE H CB    1 
ATOM 5751  C CG1   . ILE H 4 94  ? 195.102 180.890 138.287 1.00 45.91  ? 91   ILE H CG1   1 
ATOM 5752  C CG2   . ILE H 4 94  ? 193.878 182.964 138.380 1.00 39.00  ? 91   ILE H CG2   1 
ATOM 5753  C CD1   . ILE H 4 94  ? 195.236 180.916 139.741 1.00 35.01  ? 91   ILE H CD1   1 
ATOM 5754  N N     . GLN H 4 95  ? 190.886 181.343 136.752 1.00 56.60  ? 92   GLN H N     1 
ATOM 5755  C CA    . GLN H 4 95  ? 189.603 181.896 136.357 1.00 57.48  ? 92   GLN H CA    1 
ATOM 5756  C C     . GLN H 4 95  ? 188.526 181.496 137.342 1.00 60.09  ? 92   GLN H C     1 
ATOM 5757  O O     . GLN H 4 95  ? 187.868 182.353 137.941 1.00 62.22  ? 92   GLN H O     1 
ATOM 5758  C CB    . GLN H 4 95  ? 189.231 181.426 134.962 1.00 58.03  ? 92   GLN H CB    1 
ATOM 5759  C CG    . GLN H 4 95  ? 187.933 181.998 134.499 1.00 53.70  ? 92   GLN H CG    1 
ATOM 5760  C CD    . GLN H 4 95  ? 187.615 181.596 133.093 1.00 57.88  ? 92   GLN H CD    1 
ATOM 5761  O OE1   . GLN H 4 95  ? 188.433 180.984 132.415 1.00 70.94  ? 92   GLN H OE1   1 
ATOM 5762  N NE2   . GLN H 4 95  ? 186.411 181.914 132.647 1.00 58.57  ? 92   GLN H NE2   1 
ATOM 5763  N N     . THR H 4 96  ? 188.351 180.195 137.550 1.00 55.70  ? 93   THR H N     1 
ATOM 5764  C CA    . THR H 4 96  ? 187.306 179.758 138.465 1.00 53.76  ? 93   THR H CA    1 
ATOM 5765  C C     . THR H 4 96  ? 187.461 180.414 139.828 1.00 54.55  ? 93   THR H C     1 
ATOM 5766  O O     . THR H 4 96  ? 186.539 181.072 140.322 1.00 55.58  ? 93   THR H O     1 
ATOM 5767  C CB    . THR H 4 96  ? 187.319 178.246 138.593 1.00 56.16  ? 93   THR H CB    1 
ATOM 5768  O OG1   . THR H 4 96  ? 186.939 177.665 137.343 1.00 69.18  ? 93   THR H OG1   1 
ATOM 5769  C CG2   . THR H 4 96  ? 186.357 177.819 139.650 1.00 52.03  ? 93   THR H CG2   1 
ATOM 5770  N N     . ALA H 4 97  ? 188.638 180.278 140.431 1.00 44.25  ? 94   ALA H N     1 
ATOM 5771  C CA    . ALA H 4 97  ? 188.883 180.841 141.750 1.00 39.31  ? 94   ALA H CA    1 
ATOM 5772  C C     . ALA H 4 97  ? 188.437 182.287 141.817 1.00 47.35  ? 94   ALA H C     1 
ATOM 5773  O O     . ALA H 4 97  ? 187.757 182.704 142.762 1.00 42.70  ? 94   ALA H O     1 
ATOM 5774  C CB    . ALA H 4 97  ? 190.362 180.729 142.090 1.00 41.55  ? 94   ALA H CB    1 
ATOM 5775  N N     . VAL H 4 98  ? 188.792 183.066 140.804 1.00 49.62  ? 95   VAL H N     1 
ATOM 5776  C CA    . VAL H 4 98  ? 188.311 184.434 140.763 1.00 46.70  ? 95   VAL H CA    1 
ATOM 5777  C C     . VAL H 4 98  ? 186.798 184.461 140.776 1.00 48.06  ? 95   VAL H C     1 
ATOM 5778  O O     . VAL H 4 98  ? 186.186 185.218 141.535 1.00 48.14  ? 95   VAL H O     1 
ATOM 5779  C CB    . VAL H 4 98  ? 188.871 185.163 139.541 1.00 51.45  ? 95   VAL H CB    1 
ATOM 5780  C CG1   . VAL H 4 98  ? 188.193 186.477 139.407 1.00 52.36  ? 95   VAL H CG1   1 
ATOM 5781  C CG2   . VAL H 4 98  ? 190.335 185.370 139.725 1.00 55.91  ? 95   VAL H CG2   1 
ATOM 5782  N N     . ARG H 4 99  ? 186.165 183.622 139.966 1.00 39.88  ? 96   ARG H N     1 
ATOM 5783  C CA    . ARG H 4 99  ? 184.714 183.662 139.935 1.00 45.42  ? 96   ARG H CA    1 
ATOM 5784  C C     . ARG H 4 99  ? 184.115 183.294 141.272 1.00 50.55  ? 96   ARG H C     1 
ATOM 5785  O O     . ARG H 4 99  ? 182.952 183.613 141.523 1.00 53.83  ? 96   ARG H O     1 
ATOM 5786  C CB    . ARG H 4 99  ? 184.185 182.746 138.851 1.00 41.05  ? 96   ARG H CB    1 
ATOM 5787  C CG    . ARG H 4 99  ? 184.653 183.195 137.511 1.00 46.18  ? 96   ARG H CG    1 
ATOM 5788  C CD    . ARG H 4 99  ? 184.197 182.294 136.428 1.00 58.33  ? 96   ARG H CD    1 
ATOM 5789  N NE    . ARG H 4 99  ? 182.757 182.345 136.291 1.00 81.47  ? 96   ARG H NE    1 
ATOM 5790  C CZ    . ARG H 4 99  ? 182.083 181.575 135.453 1.00 86.60  ? 96   ARG H CZ    1 
ATOM 5791  N NH1   . ARG H 4 99  ? 182.736 180.708 134.694 1.00 85.94  ? 96   ARG H NH1   1 
ATOM 5792  N NH2   . ARG H 4 99  ? 180.764 181.668 135.373 1.00 75.61  ? 96   ARG H NH2   1 
ATOM 5793  N N     . LEU H 4 100 ? 184.867 182.621 142.132 1.00 42.10  ? 97   LEU H N     1 
ATOM 5794  C CA    . LEU H 4 100 ? 184.358 182.407 143.474 1.00 44.12  ? 97   LEU H CA    1 
ATOM 5795  C C     . LEU H 4 100 ? 184.563 183.625 144.352 1.00 45.13  ? 97   LEU H C     1 
ATOM 5796  O O     . LEU H 4 100 ? 183.631 184.079 145.013 1.00 56.07  ? 97   LEU H O     1 
ATOM 5797  C CB    . LEU H 4 100 ? 185.016 181.196 144.109 1.00 38.55  ? 97   LEU H CB    1 
ATOM 5798  C CG    . LEU H 4 100 ? 184.609 179.926 143.393 1.00 38.69  ? 97   LEU H CG    1 
ATOM 5799  C CD1   . LEU H 4 100 ? 185.295 178.751 144.017 1.00 32.73  ? 97   LEU H CD1   1 
ATOM 5800  C CD2   . LEU H 4 100 ? 183.120 179.779 143.465 1.00 33.36  ? 97   LEU H CD2   1 
ATOM 5801  N N     . LEU H 4 101 ? 185.769 184.177 144.378 1.00 35.27  ? 98   LEU H N     1 
ATOM 5802  C CA    . LEU H 4 101 ? 186.056 185.164 145.409 1.00 50.54  ? 98   LEU H CA    1 
ATOM 5803  C C     . LEU H 4 101 ? 185.427 186.510 145.082 1.00 51.26  ? 98   LEU H C     1 
ATOM 5804  O O     . LEU H 4 101 ? 184.765 187.118 145.925 1.00 66.13  ? 98   LEU H O     1 
ATOM 5805  C CB    . LEU H 4 101 ? 187.559 185.305 145.598 1.00 50.88  ? 98   LEU H CB    1 
ATOM 5806  C CG    . LEU H 4 101 ? 188.176 183.972 145.947 1.00 57.19  ? 98   LEU H CG    1 
ATOM 5807  C CD1   . LEU H 4 101 ? 189.648 184.119 146.202 1.00 71.64  ? 98   LEU H CD1   1 
ATOM 5808  C CD2   . LEU H 4 101 ? 187.434 183.452 147.145 1.00 60.91  ? 98   LEU H CD2   1 
ATOM 5809  N N     . LEU H 4 102 ? 185.608 186.991 143.874 1.00 53.93  ? 99   LEU H N     1 
ATOM 5810  C CA    . LEU H 4 102 ? 185.169 188.342 143.588 1.00 42.98  ? 99   LEU H CA    1 
ATOM 5811  C C     . LEU H 4 102 ? 183.655 188.406 143.507 1.00 54.13  ? 99   LEU H C     1 
ATOM 5812  O O     . LEU H 4 102 ? 183.053 187.700 142.694 1.00 64.20  ? 99   LEU H O     1 
ATOM 5813  C CB    . LEU H 4 102 ? 185.773 188.850 142.302 1.00 38.66  ? 99   LEU H CB    1 
ATOM 5814  C CG    . LEU H 4 102 ? 187.284 188.891 142.441 1.00 42.04  ? 99   LEU H CG    1 
ATOM 5815  C CD1   . LEU H 4 102 ? 187.896 189.497 141.218 1.00 45.40  ? 99   LEU H CD1   1 
ATOM 5816  C CD2   . LEU H 4 102 ? 187.683 189.642 143.673 1.00 45.57  ? 99   LEU H CD2   1 
ATOM 5817  N N     . PRO H 4 103 ? 183.008 189.225 144.315 1.00 43.03  ? 100  PRO H N     1 
ATOM 5818  C CA    . PRO H 4 103 ? 181.551 189.287 144.286 1.00 47.56  ? 100  PRO H CA    1 
ATOM 5819  C C     . PRO H 4 103 ? 181.061 190.086 143.100 1.00 61.95  ? 100  PRO H C     1 
ATOM 5820  O O     . PRO H 4 103 ? 181.778 190.928 142.558 1.00 70.18  ? 100  PRO H O     1 
ATOM 5821  C CB    . PRO H 4 103 ? 181.213 190.009 145.593 1.00 37.57  ? 100  PRO H CB    1 
ATOM 5822  C CG    . PRO H 4 103 ? 182.433 189.833 146.434 1.00 36.18  ? 100  PRO H CG    1 
ATOM 5823  C CD    . PRO H 4 103 ? 183.547 189.937 145.471 1.00 37.95  ? 100  PRO H CD    1 
ATOM 5824  N N     . GLY H 4 104 ? 179.826 189.816 142.703 1.00 61.54  ? 101  GLY H N     1 
ATOM 5825  C CA    . GLY H 4 104 ? 179.119 190.727 141.817 1.00 49.42  ? 101  GLY H CA    1 
ATOM 5826  C C     . GLY H 4 104 ? 179.848 190.989 140.521 1.00 63.77  ? 101  GLY H C     1 
ATOM 5827  O O     . GLY H 4 104 ? 180.281 190.068 139.826 1.00 75.65  ? 101  GLY H O     1 
ATOM 5828  N N     . GLU H 4 105 ? 179.999 192.267 140.187 1.00 51.28  ? 102  GLU H N     1 
ATOM 5829  C CA    . GLU H 4 105 ? 180.498 192.617 138.867 1.00 50.04  ? 102  GLU H CA    1 
ATOM 5830  C C     . GLU H 4 105 ? 182.003 192.468 138.777 1.00 58.08  ? 102  GLU H C     1 
ATOM 5831  O O     . GLU H 4 105 ? 182.544 192.236 137.688 1.00 65.92  ? 102  GLU H O     1 
ATOM 5832  C CB    . GLU H 4 105 ? 180.080 194.034 138.515 1.00 68.52  ? 102  GLU H CB    1 
ATOM 5833  C CG    . GLU H 4 105 ? 178.590 194.150 138.389 1.00 67.38  ? 102  GLU H CG    1 
ATOM 5834  C CD    . GLU H 4 105 ? 178.037 193.166 137.387 1.00 80.52  ? 102  GLU H CD    1 
ATOM 5835  O OE1   . GLU H 4 105 ? 178.677 192.966 136.334 1.00 84.17  ? 102  GLU H OE1   1 
ATOM 5836  O OE2   . GLU H 4 105 ? 176.969 192.582 137.654 1.00 93.89  ? 102  GLU H OE2   1 
ATOM 5837  N N     . LEU H 4 106 ? 182.700 192.606 139.904 1.00 53.27  ? 103  LEU H N     1 
ATOM 5838  C CA    . LEU H 4 106 ? 184.138 192.386 139.889 1.00 52.79  ? 103  LEU H CA    1 
ATOM 5839  C C     . LEU H 4 106 ? 184.471 191.062 139.235 1.00 57.73  ? 103  LEU H C     1 
ATOM 5840  O O     . LEU H 4 106 ? 185.503 190.936 138.568 1.00 52.93  ? 103  LEU H O     1 
ATOM 5841  C CB    . LEU H 4 106 ? 184.691 192.433 141.302 1.00 59.02  ? 103  LEU H CB    1 
ATOM 5842  C CG    . LEU H 4 106 ? 184.528 193.807 141.923 1.00 60.90  ? 103  LEU H CG    1 
ATOM 5843  C CD1   . LEU H 4 106 ? 185.022 193.802 143.339 1.00 63.91  ? 103  LEU H CD1   1 
ATOM 5844  C CD2   . LEU H 4 106 ? 185.284 194.803 141.104 1.00 56.98  ? 103  LEU H CD2   1 
ATOM 5845  N N     . ALA H 4 107 ? 183.598 190.074 139.399 1.00 49.68  ? 104  ALA H N     1 
ATOM 5846  C CA    . ALA H 4 107 ? 183.691 188.863 138.605 1.00 48.54  ? 104  ALA H CA    1 
ATOM 5847  C C     . ALA H 4 107 ? 183.791 189.200 137.130 1.00 50.89  ? 104  ALA H C     1 
ATOM 5848  O O     . ALA H 4 107 ? 184.843 189.033 136.512 1.00 46.95  ? 104  ALA H O     1 
ATOM 5849  C CB    . ALA H 4 107 ? 182.479 187.975 138.867 1.00 50.44  ? 104  ALA H CB    1 
ATOM 5850  N N     . LYS H 4 108 ? 182.705 189.717 136.561 1.00 52.29  ? 105  LYS H N     1 
ATOM 5851  C CA    . LYS H 4 108 ? 182.621 189.854 135.113 1.00 52.45  ? 105  LYS H CA    1 
ATOM 5852  C C     . LYS H 4 108 ? 183.761 190.695 134.570 1.00 52.86  ? 105  LYS H C     1 
ATOM 5853  O O     . LYS H 4 108 ? 184.470 190.283 133.642 1.00 42.40  ? 105  LYS H O     1 
ATOM 5854  C CB    . LYS H 4 108 ? 181.276 190.458 134.737 1.00 57.69  ? 105  LYS H CB    1 
ATOM 5855  C CG    . LYS H 4 108 ? 180.131 189.579 135.166 1.00 74.35  ? 105  LYS H CG    1 
ATOM 5856  C CD    . LYS H 4 108 ? 178.798 190.149 134.763 1.00 89.50  ? 105  LYS H CD    1 
ATOM 5857  C CE    . LYS H 4 108 ? 177.677 189.288 135.306 1.00 98.82  ? 105  LYS H CE    1 
ATOM 5858  N NZ    . LYS H 4 108 ? 177.756 187.898 134.783 1.00 103.87 ? 105  LYS H NZ    1 
ATOM 5859  N N     . HIS H 4 109 ? 183.972 191.868 135.157 1.00 51.93  ? 106  HIS H N     1 
ATOM 5860  C CA    . HIS H 4 109 ? 185.058 192.717 134.694 1.00 53.84  ? 106  HIS H CA    1 
ATOM 5861  C C     . HIS H 4 109 ? 186.394 192.002 134.803 1.00 53.71  ? 106  HIS H C     1 
ATOM 5862  O O     . HIS H 4 109 ? 187.110 191.854 133.807 1.00 54.25  ? 106  HIS H O     1 
ATOM 5863  C CB    . HIS H 4 109 ? 185.080 194.017 135.482 1.00 52.14  ? 106  HIS H CB    1 
ATOM 5864  C CG    . HIS H 4 109 ? 183.829 194.813 135.341 1.00 72.04  ? 106  HIS H CG    1 
ATOM 5865  N ND1   . HIS H 4 109 ? 183.456 195.399 134.153 1.00 69.55  ? 106  HIS H ND1   1 
ATOM 5866  C CD2   . HIS H 4 109 ? 182.863 195.122 136.235 1.00 81.66  ? 106  HIS H CD2   1 
ATOM 5867  C CE1   . HIS H 4 109 ? 182.311 196.035 134.320 1.00 71.75  ? 106  HIS H CE1   1 
ATOM 5868  N NE2   . HIS H 4 109 ? 181.930 195.884 135.575 1.00 73.09  ? 106  HIS H NE2   1 
ATOM 5869  N N     . ALA H 4 110 ? 186.742 191.536 136.001 1.00 46.68  ? 107  ALA H N     1 
ATOM 5870  C CA    . ALA H 4 110 ? 188.058 190.944 136.198 1.00 43.40  ? 107  ALA H CA    1 
ATOM 5871  C C     . ALA H 4 110 ? 188.294 189.796 135.231 1.00 48.03  ? 107  ALA H C     1 
ATOM 5872  O O     . ALA H 4 110 ? 189.338 189.724 134.575 1.00 48.12  ? 107  ALA H O     1 
ATOM 5873  C CB    . ALA H 4 110 ? 188.205 190.470 137.635 1.00 55.61  ? 107  ALA H CB    1 
ATOM 5874  N N     . VAL H 4 111 ? 187.326 188.896 135.118 1.00 48.77  ? 108  VAL H N     1 
ATOM 5875  C CA    . VAL H 4 111 ? 187.457 187.783 134.188 1.00 55.49  ? 108  VAL H CA    1 
ATOM 5876  C C     . VAL H 4 111 ? 187.721 188.294 132.785 1.00 64.79  ? 108  VAL H C     1 
ATOM 5877  O O     . VAL H 4 111 ? 188.622 187.811 132.089 1.00 58.80  ? 108  VAL H O     1 
ATOM 5878  C CB    . VAL H 4 111 ? 186.203 186.902 134.229 1.00 56.65  ? 108  VAL H CB    1 
ATOM 5879  C CG1   . VAL H 4 111 ? 186.271 185.881 133.130 1.00 55.00  ? 108  VAL H CG1   1 
ATOM 5880  C CG2   . VAL H 4 111 ? 186.113 186.220 135.559 1.00 56.19  ? 108  VAL H CG2   1 
ATOM 5881  N N     . SER H 4 112 ? 186.937 189.276 132.344 1.00 58.87  ? 109  SER H N     1 
ATOM 5882  C CA    . SER H 4 112 ? 187.192 189.858 131.035 1.00 48.37  ? 109  SER H CA    1 
ATOM 5883  C C     . SER H 4 112 ? 188.639 190.306 130.918 1.00 59.76  ? 109  SER H C     1 
ATOM 5884  O O     . SER H 4 112 ? 189.334 189.961 129.955 1.00 66.53  ? 109  SER H O     1 
ATOM 5885  C CB    . SER H 4 112 ? 186.248 191.024 130.787 1.00 54.05  ? 109  SER H CB    1 
ATOM 5886  O OG    . SER H 4 112 ? 186.529 191.609 129.534 1.00 80.94  ? 109  SER H OG    1 
ATOM 5887  N N     . GLU H 4 113 ? 189.118 191.050 131.914 1.00 55.67  ? 110  GLU H N     1 
ATOM 5888  C CA    . GLU H 4 113 ? 190.501 191.498 131.963 1.00 57.27  ? 110  GLU H CA    1 
ATOM 5889  C C     . GLU H 4 113 ? 191.455 190.354 131.708 1.00 59.76  ? 110  GLU H C     1 
ATOM 5890  O O     . GLU H 4 113 ? 192.095 190.299 130.657 1.00 65.52  ? 110  GLU H O     1 
ATOM 5891  C CB    . GLU H 4 113 ? 190.828 192.115 133.314 1.00 57.78  ? 110  GLU H CB    1 
ATOM 5892  C CG    . GLU H 4 113 ? 190.130 193.404 133.580 1.00 72.88  ? 110  GLU H CG    1 
ATOM 5893  C CD    . GLU H 4 113 ? 190.507 194.453 132.578 1.00 96.75  ? 110  GLU H CD    1 
ATOM 5894  O OE1   . GLU H 4 113 ? 191.692 194.490 132.193 1.00 106.35 ? 110  GLU H OE1   1 
ATOM 5895  O OE2   . GLU H 4 113 ? 189.625 195.240 132.178 1.00 98.85  ? 110  GLU H OE2   1 
ATOM 5896  N N     . GLY H 4 114 ? 191.543 189.434 132.661 1.00 49.59  ? 111  GLY H N     1 
ATOM 5897  C CA    . GLY H 4 114 ? 192.493 188.347 132.525 1.00 51.49  ? 111  GLY H CA    1 
ATOM 5898  C C     . GLY H 4 114 ? 192.394 187.667 131.179 1.00 53.95  ? 111  GLY H C     1 
ATOM 5899  O O     . GLY H 4 114 ? 193.402 187.441 130.506 1.00 58.39  ? 111  GLY H O     1 
ATOM 5900  N N     . THR H 4 115 ? 191.170 187.359 130.757 1.00 54.71  ? 112  THR H N     1 
ATOM 5901  C CA    . THR H 4 115 ? 190.973 186.714 129.469 1.00 57.77  ? 112  THR H CA    1 
ATOM 5902  C C     . THR H 4 115 ? 191.706 187.466 128.378 1.00 66.59  ? 112  THR H C     1 
ATOM 5903  O O     . THR H 4 115 ? 192.531 186.900 127.651 1.00 67.18  ? 112  THR H O     1 
ATOM 5904  C CB    . THR H 4 115 ? 189.489 186.659 129.148 1.00 66.12  ? 112  THR H CB    1 
ATOM 5905  O OG1   . THR H 4 115 ? 188.807 185.953 130.186 1.00 64.75  ? 112  THR H OG1   1 
ATOM 5906  C CG2   . THR H 4 115 ? 189.280 185.949 127.842 1.00 71.90  ? 112  THR H CG2   1 
ATOM 5907  N N     . LYS H 4 116 ? 191.427 188.760 128.275 1.00 72.93  ? 113  LYS H N     1 
ATOM 5908  C CA    . LYS H 4 116 ? 192.110 189.595 127.302 1.00 68.28  ? 113  LYS H CA    1 
ATOM 5909  C C     . LYS H 4 116 ? 193.618 189.492 127.462 1.00 65.07  ? 113  LYS H C     1 
ATOM 5910  O O     . LYS H 4 116 ? 194.348 189.299 126.485 1.00 58.45  ? 113  LYS H O     1 
ATOM 5911  C CB    . LYS H 4 116 ? 191.630 191.033 127.462 1.00 74.87  ? 113  LYS H CB    1 
ATOM 5912  C CG    . LYS H 4 116 ? 192.270 192.019 126.541 1.00 91.17  ? 113  LYS H CG    1 
ATOM 5913  C CD    . LYS H 4 116 ? 191.616 193.379 126.696 1.00 106.29 ? 113  LYS H CD    1 
ATOM 5914  C CE    . LYS H 4 116 ? 192.038 194.075 127.974 1.00 117.19 ? 113  LYS H CE    1 
ATOM 5915  N NZ    . LYS H 4 116 ? 191.411 195.422 128.087 1.00 118.55 ? 113  LYS H NZ    1 
ATOM 5916  N N     . ALA H 4 117 ? 194.096 189.576 128.701 1.00 62.22  ? 114  ALA H N     1 
ATOM 5917  C CA    . ALA H 4 117 ? 195.532 189.578 128.939 1.00 55.09  ? 114  ALA H CA    1 
ATOM 5918  C C     . ALA H 4 117 ? 196.184 188.332 128.373 1.00 61.11  ? 114  ALA H C     1 
ATOM 5919  O O     . ALA H 4 117 ? 197.073 188.419 127.524 1.00 68.97  ? 114  ALA H O     1 
ATOM 5920  C CB    . ALA H 4 117 ? 195.818 189.690 130.429 1.00 48.81  ? 114  ALA H CB    1 
ATOM 5921  N N     . VAL H 4 118 ? 195.751 187.158 128.825 1.00 60.97  ? 115  VAL H N     1 
ATOM 5922  C CA    . VAL H 4 118 ? 196.344 185.924 128.323 1.00 71.76  ? 115  VAL H CA    1 
ATOM 5923  C C     . VAL H 4 118 ? 196.214 185.853 126.813 1.00 80.87  ? 115  VAL H C     1 
ATOM 5924  O O     . VAL H 4 118 ? 197.146 185.443 126.111 1.00 77.49  ? 115  VAL H O     1 
ATOM 5925  C CB    . VAL H 4 118 ? 195.701 184.707 129.003 1.00 66.49  ? 115  VAL H CB    1 
ATOM 5926  C CG1   . VAL H 4 118 ? 196.158 183.436 128.337 1.00 47.83  ? 115  VAL H CG1   1 
ATOM 5927  C CG2   . VAL H 4 118 ? 196.085 184.684 130.452 1.00 75.23  ? 115  VAL H CG2   1 
ATOM 5928  N N     . THR H 4 119 ? 195.061 186.262 126.291 1.00 85.35  ? 116  THR H N     1 
ATOM 5929  C CA    . THR H 4 119 ? 194.861 186.263 124.851 1.00 82.37  ? 116  THR H CA    1 
ATOM 5930  C C     . THR H 4 119 ? 196.004 186.974 124.143 1.00 87.51  ? 116  THR H C     1 
ATOM 5931  O O     . THR H 4 119 ? 196.755 186.368 123.370 1.00 92.67  ? 116  THR H O     1 
ATOM 5932  C CB    . THR H 4 119 ? 193.531 186.925 124.527 1.00 80.05  ? 116  THR H CB    1 
ATOM 5933  O OG1   . THR H 4 119 ? 192.481 186.212 125.187 1.00 80.52  ? 116  THR H OG1   1 
ATOM 5934  C CG2   . THR H 4 119 ? 193.296 186.907 123.035 1.00 88.42  ? 116  THR H CG2   1 
ATOM 5935  N N     . LYS H 4 120 ? 196.153 188.270 124.414 1.00 85.28  ? 117  LYS H N     1 
ATOM 5936  C CA    . LYS H 4 120 ? 197.238 189.032 123.812 1.00 69.80  ? 117  LYS H CA    1 
ATOM 5937  C C     . LYS H 4 120 ? 198.583 188.386 124.091 1.00 75.22  ? 117  LYS H C     1 
ATOM 5938  O O     . LYS H 4 120 ? 199.488 188.422 123.255 1.00 87.58  ? 117  LYS H O     1 
ATOM 5939  C CB    . LYS H 4 120 ? 197.221 190.463 124.334 1.00 48.50  ? 117  LYS H CB    1 
ATOM 5940  C CG    . LYS H 4 120 ? 198.332 191.326 123.784 1.00 56.61  ? 117  LYS H CG    1 
ATOM 5941  C CD    . LYS H 4 120 ? 198.272 192.727 124.366 1.00 69.19  ? 117  LYS H CD    1 
ATOM 5942  C CE    . LYS H 4 120 ? 199.502 193.551 123.996 1.00 86.71  ? 117  LYS H CE    1 
ATOM 5943  N NZ    . LYS H 4 120 ? 199.634 193.792 122.533 1.00 87.64  ? 117  LYS H NZ    1 
ATOM 5944  N N     . TYR H 4 121 ? 198.728 187.780 125.265 1.00 75.16  ? 118  TYR H N     1 
ATOM 5945  C CA    . TYR H 4 121 ? 200.004 187.183 125.624 1.00 75.63  ? 118  TYR H CA    1 
ATOM 5946  C C     . TYR H 4 121 ? 200.389 186.096 124.641 1.00 84.40  ? 118  TYR H C     1 
ATOM 5947  O O     . TYR H 4 121 ? 201.447 186.160 124.007 1.00 91.46  ? 118  TYR H O     1 
ATOM 5948  C CB    . TYR H 4 121 ? 199.935 186.602 127.026 1.00 67.39  ? 118  TYR H CB    1 
ATOM 5949  C CG    . TYR H 4 121 ? 201.198 185.902 127.425 1.00 64.19  ? 118  TYR H CG    1 
ATOM 5950  C CD1   . TYR H 4 121 ? 202.269 186.610 127.919 1.00 62.07  ? 118  TYR H CD1   1 
ATOM 5951  C CD2   . TYR H 4 121 ? 201.330 184.538 127.281 1.00 58.47  ? 118  TYR H CD2   1 
ATOM 5952  C CE1   . TYR H 4 121 ? 203.421 185.979 128.285 1.00 69.69  ? 118  TYR H CE1   1 
ATOM 5953  C CE2   . TYR H 4 121 ? 202.482 183.903 127.636 1.00 65.94  ? 118  TYR H CE2   1 
ATOM 5954  C CZ    . TYR H 4 121 ? 203.523 184.629 128.139 1.00 79.97  ? 118  TYR H CZ    1 
ATOM 5955  O OH    . TYR H 4 121 ? 204.683 184.000 128.501 1.00 83.72  ? 118  TYR H OH    1 
ATOM 5956  N N     . THR H 4 122 ? 199.541 185.083 124.509 1.00 91.80  ? 119  THR H N     1 
ATOM 5957  C CA    . THR H 4 122 ? 199.812 184.008 123.568 1.00 96.78  ? 119  THR H CA    1 
ATOM 5958  C C     . THR H 4 122 ? 199.943 184.549 122.156 1.00 100.11 ? 119  THR H C     1 
ATOM 5959  O O     . THR H 4 122 ? 200.866 184.189 121.418 1.00 105.40 ? 119  THR H O     1 
ATOM 5960  C CB    . THR H 4 122 ? 198.699 182.975 123.633 1.00 91.55  ? 119  THR H CB    1 
ATOM 5961  O OG1   . THR H 4 122 ? 197.451 183.626 123.370 1.00 83.97  ? 119  THR H OG1   1 
ATOM 5962  C CG2   . THR H 4 122 ? 198.660 182.346 124.998 1.00 91.02  ? 119  THR H CG2   1 
ATOM 5963  N N     . SER H 4 123 ? 199.033 185.442 121.771 1.00 97.20  ? 120  SER H N     1 
ATOM 5964  C CA    . SER H 4 123 ? 199.038 185.958 120.411 1.00 103.53 ? 120  SER H CA    1 
ATOM 5965  C C     . SER H 4 123 ? 200.288 186.762 120.095 1.00 114.29 ? 120  SER H C     1 
ATOM 5966  O O     . SER H 4 123 ? 200.483 187.142 118.937 1.00 117.54 ? 120  SER H O     1 
ATOM 5967  C CB    . SER H 4 123 ? 197.792 186.805 120.179 1.00 101.22 ? 120  SER H CB    1 
ATOM 5968  O OG    . SER H 4 123 ? 196.626 186.013 120.311 1.00 104.41 ? 120  SER H OG    1 
ATOM 5969  N N     . ALA H 4 124 ? 201.127 187.036 121.085 1.00 116.07 ? 121  ALA H N     1 
ATOM 5970  C CA    . ALA H 4 124 ? 202.407 187.682 120.845 1.00 111.23 ? 121  ALA H CA    1 
ATOM 5971  C C     . ALA H 4 124 ? 203.510 186.957 121.606 1.00 117.73 ? 121  ALA H C     1 
ATOM 5972  O O     . ALA H 4 124 ? 203.374 185.779 121.933 1.00 116.28 ? 121  ALA H O     1 
ATOM 5973  C CB    . ALA H 4 124 ? 202.352 189.144 121.247 1.00 94.26  ? 121  ALA H CB    1 
ATOM 5974  P P     . DT  I 5 2   ? 156.573 231.435 163.236 1.00 155.63 ? 2    DT  I P     1 
ATOM 5975  O OP1   . DT  I 5 2   ? 156.044 230.377 162.346 1.00 151.07 ? 2    DT  I OP1   1 
ATOM 5976  O OP2   . DT  I 5 2   ? 156.942 231.114 164.634 1.00 152.55 ? 2    DT  I OP2   1 
ATOM 5977  O "O5'" . DT  I 5 2   ? 157.826 232.121 162.518 1.00 178.19 ? 2    DT  I "O5'" 1 
ATOM 5978  C "C5'" . DT  I 5 2   ? 159.052 232.280 163.218 1.00 182.22 ? 2    DT  I "C5'" 1 
ATOM 5979  C "C4'" . DT  I 5 2   ? 159.056 233.578 163.996 1.00 192.07 ? 2    DT  I "C4'" 1 
ATOM 5980  O "O4'" . DT  I 5 2   ? 158.525 233.348 165.329 1.00 195.41 ? 2    DT  I "O4'" 1 
ATOM 5981  C "C3'" . DT  I 5 2   ? 160.433 234.203 164.200 1.00 196.92 ? 2    DT  I "C3'" 1 
ATOM 5982  O "O3'" . DT  I 5 2   ? 160.316 235.612 164.159 1.00 200.63 ? 2    DT  I "O3'" 1 
ATOM 5983  C "C2'" . DT  I 5 2   ? 160.805 233.725 165.595 1.00 195.98 ? 2    DT  I "C2'" 1 
ATOM 5984  C "C1'" . DT  I 5 2   ? 159.454 233.811 166.280 1.00 194.85 ? 2    DT  I "C1'" 1 
ATOM 5985  N N1    . DT  I 5 2   ? 159.347 232.985 167.517 1.00 189.09 ? 2    DT  I N1    1 
ATOM 5986  C C2    . DT  I 5 2   ? 159.250 231.618 167.421 1.00 180.33 ? 2    DT  I C2    1 
ATOM 5987  O O2    . DT  I 5 2   ? 159.248 231.015 166.364 1.00 173.87 ? 2    DT  I O2    1 
ATOM 5988  N N3    . DT  I 5 2   ? 159.160 230.970 168.621 1.00 179.63 ? 2    DT  I N3    1 
ATOM 5989  C C4    . DT  I 5 2   ? 159.156 231.538 169.881 1.00 184.11 ? 2    DT  I C4    1 
ATOM 5990  O O4    . DT  I 5 2   ? 159.069 230.868 170.905 1.00 187.09 ? 2    DT  I O4    1 
ATOM 5991  C C5    . DT  I 5 2   ? 159.259 232.972 169.908 1.00 184.49 ? 2    DT  I C5    1 
ATOM 5992  C C7    . DT  I 5 2   ? 159.260 233.703 171.216 1.00 180.06 ? 2    DT  I C7    1 
ATOM 5993  C C6    . DT  I 5 2   ? 159.346 233.617 168.739 1.00 188.37 ? 2    DT  I C6    1 
ATOM 5994  P P     . DC  I 5 3   ? 160.979 236.442 162.957 1.00 240.87 ? 3    DC  I P     1 
ATOM 5995  O OP1   . DC  I 5 3   ? 160.204 237.687 162.770 1.00 238.23 ? 3    DC  I OP1   1 
ATOM 5996  O OP2   . DC  I 5 3   ? 161.151 235.511 161.821 1.00 240.00 ? 3    DC  I OP2   1 
ATOM 5997  O "O5'" . DC  I 5 3   ? 162.423 236.828 163.519 1.00 195.75 ? 3    DC  I "O5'" 1 
ATOM 5998  C "C5'" . DC  I 5 3   ? 162.895 238.156 163.384 1.00 195.71 ? 3    DC  I "C5'" 1 
ATOM 5999  C "C4'" . DC  I 5 3   ? 163.500 238.642 164.683 1.00 197.38 ? 3    DC  I "C4'" 1 
ATOM 6000  O "O4'" . DC  I 5 3   ? 163.367 237.605 165.694 1.00 196.92 ? 3    DC  I "O4'" 1 
ATOM 6001  C "C3'" . DC  I 5 3   ? 164.984 238.964 164.608 1.00 197.81 ? 3    DC  I "C3'" 1 
ATOM 6002  O "O3'" . DC  I 5 3   ? 165.287 240.062 165.470 1.00 201.35 ? 3    DC  I "O3'" 1 
ATOM 6003  C "C2'" . DC  I 5 3   ? 165.621 237.665 165.082 1.00 195.90 ? 3    DC  I "C2'" 1 
ATOM 6004  C "C1'" . DC  I 5 3   ? 164.643 237.220 166.153 1.00 194.12 ? 3    DC  I "C1'" 1 
ATOM 6005  N N1    . DC  I 5 3   ? 164.641 235.752 166.365 1.00 184.43 ? 3    DC  I N1    1 
ATOM 6006  C C2    . DC  I 5 3   ? 164.904 235.234 167.636 1.00 179.93 ? 3    DC  I C2    1 
ATOM 6007  O O2    . DC  I 5 3   ? 165.126 236.009 168.569 1.00 179.02 ? 3    DC  I O2    1 
ATOM 6008  N N3    . DC  I 5 3   ? 164.902 233.895 167.809 1.00 175.23 ? 3    DC  I N3    1 
ATOM 6009  C C4    . DC  I 5 3   ? 164.652 233.091 166.782 1.00 171.26 ? 3    DC  I C4    1 
ATOM 6010  N N4    . DC  I 5 3   ? 164.661 231.776 167.007 1.00 164.59 ? 3    DC  I N4    1 
ATOM 6011  C C5    . DC  I 5 3   ? 164.391 233.597 165.477 1.00 173.08 ? 3    DC  I C5    1 
ATOM 6012  C C6    . DC  I 5 3   ? 164.396 234.922 165.316 1.00 176.34 ? 3    DC  I C6    1 
ATOM 6013  P P     . DG  I 5 4   ? 166.789 240.323 165.984 1.00 191.06 ? 4    DG  I P     1 
ATOM 6014  O OP1   . DG  I 5 4   ? 166.876 241.725 166.436 1.00 186.91 ? 4    DG  I OP1   1 
ATOM 6015  O OP2   . DG  I 5 4   ? 167.766 239.829 164.993 1.00 187.74 ? 4    DG  I OP2   1 
ATOM 6016  O "O5'" . DG  I 5 4   ? 166.893 239.414 167.280 1.00 193.04 ? 4    DG  I "O5'" 1 
ATOM 6017  C "C5'" . DG  I 5 4   ? 166.688 239.990 168.541 1.00 191.15 ? 4    DG  I "C5'" 1 
ATOM 6018  C "C4'" . DG  I 5 4   ? 167.871 239.726 169.445 1.00 192.10 ? 4    DG  I "C4'" 1 
ATOM 6019  O "O4'" . DG  I 5 4   ? 168.031 238.303 169.625 1.00 194.33 ? 4    DG  I "O4'" 1 
ATOM 6020  C "C3'" . DG  I 5 4   ? 169.212 240.220 168.932 1.00 191.25 ? 4    DG  I "C3'" 1 
ATOM 6021  O "O3'" . DG  I 5 4   ? 170.045 240.542 170.055 1.00 193.12 ? 4    DG  I "O3'" 1 
ATOM 6022  C "C2'" . DG  I 5 4   ? 169.725 239.019 168.133 1.00 191.51 ? 4    DG  I "C2'" 1 
ATOM 6023  C "C1'" . DG  I 5 4   ? 169.174 237.846 168.931 1.00 191.04 ? 4    DG  I "C1'" 1 
ATOM 6024  N N9    . DG  I 5 4   ? 168.769 236.712 168.129 1.00 180.71 ? 4    DG  I N9    1 
ATOM 6025  C C8    . DG  I 5 4   ? 168.372 236.704 166.820 1.00 176.02 ? 4    DG  I C8    1 
ATOM 6026  N N7    . DG  I 5 4   ? 168.041 235.518 166.393 1.00 166.88 ? 4    DG  I N7    1 
ATOM 6027  C C5    . DG  I 5 4   ? 168.224 234.703 167.498 1.00 162.95 ? 4    DG  I C5    1 
ATOM 6028  C C6    . DG  I 5 4   ? 168.028 233.317 167.655 1.00 154.08 ? 4    DG  I C6    1 
ATOM 6029  O O6    . DG  I 5 4   ? 167.649 232.491 166.821 1.00 147.18 ? 4    DG  I O6    1 
ATOM 6030  N N1    . DG  I 5 4   ? 168.345 232.898 168.941 1.00 151.24 ? 4    DG  I N1    1 
ATOM 6031  C C2    . DG  I 5 4   ? 168.776 233.725 169.947 1.00 150.54 ? 4    DG  I C2    1 
ATOM 6032  N N2    . DG  I 5 4   ? 169.026 233.151 171.130 1.00 143.86 ? 4    DG  I N2    1 
ATOM 6033  N N3    . DG  I 5 4   ? 168.960 235.017 169.808 1.00 159.40 ? 4    DG  I N3    1 
ATOM 6034  C C4    . DG  I 5 4   ? 168.665 235.433 168.567 1.00 167.83 ? 4    DG  I C4    1 
ATOM 6035  P P     . DA  I 5 5   ? 171.647 240.438 169.992 1.00 165.26 ? 5    DA  I P     1 
ATOM 6036  O OP1   . DA  I 5 5   ? 172.155 241.235 171.125 1.00 166.03 ? 5    DA  I OP1   1 
ATOM 6037  O OP2   . DA  I 5 5   ? 172.126 240.729 168.624 1.00 161.67 ? 5    DA  I OP2   1 
ATOM 6038  O "O5'" . DA  I 5 5   ? 171.937 238.914 170.340 1.00 172.81 ? 5    DA  I "O5'" 1 
ATOM 6039  C "C5'" . DA  I 5 5   ? 171.379 238.351 171.510 1.00 171.21 ? 5    DA  I "C5'" 1 
ATOM 6040  C "C4'" . DA  I 5 5   ? 172.448 237.802 172.432 1.00 164.64 ? 5    DA  I "C4'" 1 
ATOM 6041  O "O4'" . DA  I 5 5   ? 172.652 236.404 172.171 1.00 162.41 ? 5    DA  I "O4'" 1 
ATOM 6042  C "C3'" . DA  I 5 5   ? 173.816 238.421 172.297 1.00 162.66 ? 5    DA  I "C3'" 1 
ATOM 6043  O "O3'" . DA  I 5 5   ? 174.488 238.296 173.538 1.00 164.81 ? 5    DA  I "O3'" 1 
ATOM 6044  C "C2'" . DA  I 5 5   ? 174.466 237.578 171.194 1.00 159.91 ? 5    DA  I "C2'" 1 
ATOM 6045  C "C1'" . DA  I 5 5   ? 173.720 236.244 171.269 1.00 160.06 ? 5    DA  I "C1'" 1 
ATOM 6046  N N9    . DA  I 5 5   ? 173.156 235.811 170.000 1.00 154.89 ? 5    DA  I N9    1 
ATOM 6047  C C8    . DA  I 5 5   ? 172.876 236.577 168.912 1.00 151.27 ? 5    DA  I C8    1 
ATOM 6048  N N7    . DA  I 5 5   ? 172.346 235.910 167.919 1.00 147.50 ? 5    DA  I N7    1 
ATOM 6049  C C5    . DA  I 5 5   ? 172.270 234.621 168.397 1.00 144.91 ? 5    DA  I C5    1 
ATOM 6050  C C6    . DA  I 5 5   ? 171.800 233.430 167.830 1.00 138.43 ? 5    DA  I C6    1 
ATOM 6051  N N6    . DA  I 5 5   ? 171.299 233.351 166.597 1.00 131.86 ? 5    DA  I N6    1 
ATOM 6052  N N1    . DA  I 5 5   ? 171.869 232.315 168.580 1.00 140.48 ? 5    DA  I N1    1 
ATOM 6053  C C2    . DA  I 5 5   ? 172.367 232.406 169.814 1.00 141.37 ? 5    DA  I C2    1 
ATOM 6054  N N3    . DA  I 5 5   ? 172.841 233.467 170.449 1.00 144.65 ? 5    DA  I N3    1 
ATOM 6055  C C4    . DA  I 5 5   ? 172.760 234.549 169.680 1.00 148.97 ? 5    DA  I C4    1 
ATOM 6056  P P     . DG  I 5 6   ? 176.088 238.334 173.628 1.00 160.96 ? 6    DG  I P     1 
ATOM 6057  O OP1   . DG  I 5 6   ? 176.438 238.678 175.023 1.00 155.84 ? 6    DG  I OP1   1 
ATOM 6058  O OP2   . DG  I 5 6   ? 176.613 239.159 172.520 1.00 159.55 ? 6    DG  I OP2   1 
ATOM 6059  O "O5'" . DG  I 5 6   ? 176.505 236.814 173.404 1.00 164.80 ? 6    DG  I "O5'" 1 
ATOM 6060  C "C5'" . DG  I 5 6   ? 176.024 235.823 174.290 1.00 157.60 ? 6    DG  I "C5'" 1 
ATOM 6061  C "C4'" . DG  I 5 6   ? 176.649 234.476 173.992 1.00 144.55 ? 6    DG  I "C4'" 1 
ATOM 6062  O "O4'" . DG  I 5 6   ? 176.108 233.952 172.758 1.00 134.73 ? 6    DG  I "O4'" 1 
ATOM 6063  C "C3'" . DG  I 5 6   ? 178.158 234.489 173.804 1.00 139.58 ? 6    DG  I "C3'" 1 
ATOM 6064  O "O3'" . DG  I 5 6   ? 178.681 233.271 174.247 1.00 138.94 ? 6    DG  I "O3'" 1 
ATOM 6065  C "C2'" . DG  I 5 6   ? 178.299 234.626 172.295 1.00 131.70 ? 6    DG  I "C2'" 1 
ATOM 6066  C "C1'" . DG  I 5 6   ? 177.145 233.765 171.824 1.00 132.72 ? 6    DG  I "C1'" 1 
ATOM 6067  N N9    . DG  I 5 6   ? 176.637 234.133 170.518 1.00 133.27 ? 6    DG  I N9    1 
ATOM 6068  C C8    . DG  I 5 6   ? 176.583 235.383 169.966 1.00 141.04 ? 6    DG  I C8    1 
ATOM 6069  N N7    . DG  I 5 6   ? 176.048 235.401 168.782 1.00 143.04 ? 6    DG  I N7    1 
ATOM 6070  C C5    . DG  I 5 6   ? 175.738 234.076 168.537 1.00 138.78 ? 6    DG  I C5    1 
ATOM 6071  C C6    . DG  I 5 6   ? 175.145 233.476 167.415 1.00 138.83 ? 6    DG  I C6    1 
ATOM 6072  O O6    . DG  I 5 6   ? 174.764 234.008 166.371 1.00 140.37 ? 6    DG  I O6    1 
ATOM 6073  N N1    . DG  I 5 6   ? 175.014 232.107 167.577 1.00 130.92 ? 6    DG  I N1    1 
ATOM 6074  C C2    . DG  I 5 6   ? 175.403 231.409 168.688 1.00 127.99 ? 6    DG  I C2    1 
ATOM 6075  N N2    . DG  I 5 6   ? 175.191 230.091 168.668 1.00 134.08 ? 6    DG  I N2    1 
ATOM 6076  N N3    . DG  I 5 6   ? 175.958 231.960 169.745 1.00 122.01 ? 6    DG  I N3    1 
ATOM 6077  C C4    . DG  I 5 6   ? 176.091 233.290 169.600 1.00 129.34 ? 6    DG  I C4    1 
ATOM 6078  P P     . DA  I 5 7   ? 180.240 233.140 174.589 1.00 137.88 ? 7    DA  I P     1 
ATOM 6079  O OP1   . DA  I 5 7   ? 180.367 233.197 176.059 1.00 134.79 ? 7    DA  I OP1   1 
ATOM 6080  O OP2   . DA  I 5 7   ? 180.974 234.101 173.737 1.00 134.60 ? 7    DA  I OP2   1 
ATOM 6081  O "O5'" . DA  I 5 7   ? 180.601 231.665 174.102 1.00 133.56 ? 7    DA  I "O5'" 1 
ATOM 6082  C "C5'" . DA  I 5 7   ? 179.802 230.584 174.522 1.00 125.63 ? 7    DA  I "C5'" 1 
ATOM 6083  C "C4'" . DA  I 5 7   ? 179.723 229.527 173.447 1.00 117.12 ? 7    DA  I "C4'" 1 
ATOM 6084  O "O4'" . DA  I 5 7   ? 179.006 230.043 172.301 1.00 116.66 ? 7    DA  I "O4'" 1 
ATOM 6085  C "C3'" . DA  I 5 7   ? 181.067 229.044 172.931 1.00 116.28 ? 7    DA  I "C3'" 1 
ATOM 6086  O "O3'" . DA  I 5 7   ? 181.044 227.639 172.847 1.00 121.23 ? 7    DA  I "O3'" 1 
ATOM 6087  C "C2'" . DA  I 5 7   ? 181.183 229.705 171.556 1.00 111.09 ? 7    DA  I "C2'" 1 
ATOM 6088  C "C1'" . DA  I 5 7   ? 179.732 229.788 171.124 1.00 120.75 ? 7    DA  I "C1'" 1 
ATOM 6089  N N9    . DA  I 5 7   ? 179.461 230.878 170.199 1.00 139.17 ? 7    DA  I N9    1 
ATOM 6090  C C8    . DA  I 5 7   ? 179.699 232.196 170.419 1.00 145.04 ? 7    DA  I C8    1 
ATOM 6091  N N7    . DA  I 5 7   ? 179.337 232.971 169.431 1.00 142.70 ? 7    DA  I N7    1 
ATOM 6092  C C5    . DA  I 5 7   ? 178.828 232.099 168.492 1.00 143.00 ? 7    DA  I C5    1 
ATOM 6093  C C6    . DA  I 5 7   ? 178.280 232.307 167.219 1.00 144.19 ? 7    DA  I C6    1 
ATOM 6094  N N6    . DA  I 5 7   ? 178.162 233.510 166.668 1.00 142.03 ? 7    DA  I N6    1 
ATOM 6095  N N1    . DA  I 5 7   ? 177.860 231.236 166.534 1.00 146.72 ? 7    DA  I N1    1 
ATOM 6096  C C2    . DA  I 5 7   ? 177.982 230.033 167.095 1.00 148.14 ? 7    DA  I C2    1 
ATOM 6097  N N3    . DA  I 5 7   ? 178.476 229.712 168.292 1.00 148.39 ? 7    DA  I N3    1 
ATOM 6098  C C4    . DA  I 5 7   ? 178.886 230.805 168.946 1.00 144.97 ? 7    DA  I C4    1 
ATOM 6099  P P     . DA  I 5 8   ? 182.282 226.839 172.220 1.00 135.93 ? 8    DA  I P     1 
ATOM 6100  O OP1   . DA  I 5 8   ? 182.261 225.477 172.784 1.00 127.96 ? 8    DA  I OP1   1 
ATOM 6101  O OP2   . DA  I 5 8   ? 183.496 227.667 172.359 1.00 134.50 ? 8    DA  I OP2   1 
ATOM 6102  O "O5'" . DA  I 5 8   ? 181.896 226.742 170.684 1.00 111.97 ? 8    DA  I "O5'" 1 
ATOM 6103  C "C5'" . DA  I 5 8   ? 180.575 226.433 170.333 1.00 111.97 ? 8    DA  I "C5'" 1 
ATOM 6104  C "C4'" . DA  I 5 8   ? 180.540 225.602 169.082 1.00 117.22 ? 8    DA  I "C4'" 1 
ATOM 6105  O "O4'" . DA  I 5 8   ? 180.178 226.443 167.975 1.00 117.46 ? 8    DA  I "O4'" 1 
ATOM 6106  C "C3'" . DA  I 5 8   ? 181.864 224.978 168.707 1.00 122.10 ? 8    DA  I "C3'" 1 
ATOM 6107  O "O3'" . DA  I 5 8   ? 181.654 223.777 167.985 1.00 126.08 ? 8    DA  I "O3'" 1 
ATOM 6108  C "C2'" . DA  I 5 8   ? 182.512 226.053 167.844 1.00 125.47 ? 8    DA  I "C2'" 1 
ATOM 6109  C "C1'" . DA  I 5 8   ? 181.318 226.761 167.214 1.00 123.61 ? 8    DA  I "C1'" 1 
ATOM 6110  N N9    . DA  I 5 8   ? 181.461 228.206 167.192 1.00 127.85 ? 8    DA  I N9    1 
ATOM 6111  C C8    . DA  I 5 8   ? 181.921 229.000 168.196 1.00 128.10 ? 8    DA  I C8    1 
ATOM 6112  N N7    . DA  I 5 8   ? 181.942 230.273 167.891 1.00 128.42 ? 8    DA  I N7    1 
ATOM 6113  C C5    . DA  I 5 8   ? 181.454 230.310 166.601 1.00 130.61 ? 8    DA  I C5    1 
ATOM 6114  C C6    . DA  I 5 8   ? 181.222 231.364 165.708 1.00 134.80 ? 8    DA  I C6    1 
ATOM 6115  N N6    . DA  I 5 8   ? 181.470 232.640 166.001 1.00 139.45 ? 8    DA  I N6    1 
ATOM 6116  N N1    . DA  I 5 8   ? 180.728 231.059 164.494 1.00 132.22 ? 8    DA  I N1    1 
ATOM 6117  C C2    . DA  I 5 8   ? 180.484 229.783 164.206 1.00 126.32 ? 8    DA  I C2    1 
ATOM 6118  N N3    . DA  I 5 8   ? 180.664 228.709 164.961 1.00 123.79 ? 8    DA  I N3    1 
ATOM 6119  C C4    . DA  I 5 8   ? 181.155 229.045 166.156 1.00 128.46 ? 8    DA  I C4    1 
ATOM 6120  P P     . DT  I 5 9   ? 182.897 223.025 167.303 1.00 141.49 ? 9    DT  I P     1 
ATOM 6121  O OP1   . DT  I 5 9   ? 182.573 221.605 167.100 1.00 142.69 ? 9    DT  I OP1   1 
ATOM 6122  O OP2   . DT  I 5 9   ? 184.119 223.403 168.035 1.00 128.64 ? 9    DT  I OP2   1 
ATOM 6123  O "O5'" . DT  I 5 9   ? 182.960 223.665 165.858 1.00 107.35 ? 9    DT  I "O5'" 1 
ATOM 6124  C "C5'" . DT  I 5 9   ? 181.791 223.734 165.092 1.00 110.56 ? 9    DT  I "C5'" 1 
ATOM 6125  C "C4'" . DT  I 5 9   ? 182.081 224.402 163.779 1.00 126.12 ? 9    DT  I "C4'" 1 
ATOM 6126  O "O4'" . DT  I 5 9   ? 182.157 225.837 163.974 1.00 126.84 ? 9    DT  I "O4'" 1 
ATOM 6127  C "C3'" . DT  I 5 9   ? 183.412 223.995 163.150 1.00 133.39 ? 9    DT  I "C3'" 1 
ATOM 6128  O "O3'" . DT  I 5 9   ? 183.236 223.815 161.768 1.00 139.12 ? 9    DT  I "O3'" 1 
ATOM 6129  C "C2'" . DT  I 5 9   ? 184.298 225.197 163.439 1.00 129.40 ? 9    DT  I "C2'" 1 
ATOM 6130  C "C1'" . DT  I 5 9   ? 183.287 226.308 163.300 1.00 126.98 ? 9    DT  I "C1'" 1 
ATOM 6131  N N1    . DT  I 5 9   ? 183.715 227.587 163.892 1.00 124.88 ? 9    DT  I N1    1 
ATOM 6132  C C2    . DT  I 5 9   ? 183.657 228.715 163.126 1.00 127.26 ? 9    DT  I C2    1 
ATOM 6133  O O2    . DT  I 5 9   ? 183.262 228.719 161.978 1.00 138.19 ? 9    DT  I O2    1 
ATOM 6134  N N3    . DT  I 5 9   ? 184.077 229.846 163.745 1.00 116.60 ? 9    DT  I N3    1 
ATOM 6135  C C4    . DT  I 5 9   ? 184.542 229.966 165.029 1.00 118.36 ? 9    DT  I C4    1 
ATOM 6136  O O4    . DT  I 5 9   ? 184.900 231.041 165.492 1.00 122.54 ? 9    DT  I O4    1 
ATOM 6137  C C5    . DT  I 5 9   ? 184.582 228.746 165.784 1.00 121.67 ? 9    DT  I C5    1 
ATOM 6138  C C7    . DT  I 5 9   ? 185.077 228.753 167.194 1.00 120.49 ? 9    DT  I C7    1 
ATOM 6139  C C6    . DT  I 5 9   ? 184.173 227.624 165.185 1.00 121.57 ? 9    DT  I C6    1 
ATOM 6140  P P     . DC  I 5 10  ? 184.296 222.968 160.913 1.00 130.97 ? 10   DC  I P     1 
ATOM 6141  O OP1   . DC  I 5 10  ? 183.670 221.663 160.617 1.00 134.60 ? 10   DC  I OP1   1 
ATOM 6142  O OP2   . DC  I 5 10  ? 185.603 223.018 161.598 1.00 121.13 ? 10   DC  I OP2   1 
ATOM 6143  O "O5'" . DC  I 5 10  ? 184.429 223.804 159.561 1.00 119.99 ? 10   DC  I "O5'" 1 
ATOM 6144  C "C5'" . DC  I 5 10  ? 183.262 224.269 158.907 1.00 116.88 ? 10   DC  I "C5'" 1 
ATOM 6145  C "C4'" . DC  I 5 10  ? 183.536 225.566 158.171 1.00 122.76 ? 10   DC  I "C4'" 1 
ATOM 6146  O "O4'" . DC  I 5 10  ? 183.823 226.618 159.121 1.00 123.99 ? 10   DC  I "O4'" 1 
ATOM 6147  C "C3'" . DC  I 5 10  ? 184.720 225.528 157.211 1.00 132.26 ? 10   DC  I "C3'" 1 
ATOM 6148  O "O3'" . DC  I 5 10  ? 184.358 226.150 156.002 1.00 145.34 ? 10   DC  I "O3'" 1 
ATOM 6149  C "C2'" . DC  I 5 10  ? 185.799 226.316 157.947 1.00 129.54 ? 10   DC  I "C2'" 1 
ATOM 6150  C "C1'" . DC  I 5 10  ? 184.967 227.318 158.711 1.00 128.87 ? 10   DC  I "C1'" 1 
ATOM 6151  N N1    . DC  I 5 10  ? 185.628 227.831 159.911 1.00 131.55 ? 10   DC  I N1    1 
ATOM 6152  C C2    . DC  I 5 10  ? 186.005 229.162 159.963 1.00 129.31 ? 10   DC  I C2    1 
ATOM 6153  O O2    . DC  I 5 10  ? 185.782 229.876 158.987 1.00 137.59 ? 10   DC  I O2    1 
ATOM 6154  N N3    . DC  I 5 10  ? 186.608 229.629 161.074 1.00 111.82 ? 10   DC  I N3    1 
ATOM 6155  C C4    . DC  I 5 10  ? 186.825 228.813 162.099 1.00 112.81 ? 10   DC  I C4    1 
ATOM 6156  N N4    . DC  I 5 10  ? 187.422 229.311 163.180 1.00 116.86 ? 10   DC  I N4    1 
ATOM 6157  C C5    . DC  I 5 10  ? 186.446 227.449 162.061 1.00 118.59 ? 10   DC  I C5    1 
ATOM 6158  C C6    . DC  I 5 10  ? 185.852 227.006 160.958 1.00 125.12 ? 10   DC  I C6    1 
ATOM 6159  P P     . DC  I 5 11  ? 185.452 226.378 154.856 1.00 135.56 ? 11   DC  I P     1 
ATOM 6160  O OP1   . DC  I 5 11  ? 184.746 226.423 153.558 1.00 122.80 ? 11   DC  I OP1   1 
ATOM 6161  O OP2   . DC  I 5 11  ? 186.547 225.410 155.061 1.00 130.87 ? 11   DC  I OP2   1 
ATOM 6162  O "O5'" . DC  I 5 11  ? 186.017 227.828 155.178 1.00 154.59 ? 11   DC  I "O5'" 1 
ATOM 6163  C "C5'" . DC  I 5 11  ? 185.356 228.960 154.664 1.00 154.48 ? 11   DC  I "C5'" 1 
ATOM 6164  C "C4'" . DC  I 5 11  ? 186.352 230.031 154.274 1.00 158.80 ? 11   DC  I "C4'" 1 
ATOM 6165  O "O4'" . DC  I 5 11  ? 187.012 230.517 155.463 1.00 160.88 ? 11   DC  I "O4'" 1 
ATOM 6166  C "C3'" . DC  I 5 11  ? 187.472 229.574 153.352 1.00 160.32 ? 11   DC  I "C3'" 1 
ATOM 6167  O "O3'" . DC  I 5 11  ? 187.922 230.670 152.605 1.00 163.00 ? 11   DC  I "O3'" 1 
ATOM 6168  C "C2'" . DC  I 5 11  ? 188.526 229.134 154.344 1.00 158.98 ? 11   DC  I "C2'" 1 
ATOM 6169  C "C1'" . DC  I 5 11  ? 188.385 230.216 155.393 1.00 157.24 ? 11   DC  I "C1'" 1 
ATOM 6170  N N1    . DC  I 5 11  ? 188.828 229.784 156.710 1.00 146.78 ? 11   DC  I N1    1 
ATOM 6171  C C2    . DC  I 5 11  ? 189.464 230.690 157.549 1.00 141.47 ? 11   DC  I C2    1 
ATOM 6172  O O2    . DC  I 5 11  ? 189.631 231.846 157.167 1.00 137.95 ? 11   DC  I O2    1 
ATOM 6173  N N3    . DC  I 5 11  ? 189.867 230.281 158.758 1.00 141.28 ? 11   DC  I N3    1 
ATOM 6174  C C4    . DC  I 5 11  ? 189.661 229.025 159.133 1.00 137.83 ? 11   DC  I C4    1 
ATOM 6175  N N4    . DC  I 5 11  ? 190.113 228.665 160.326 1.00 133.01 ? 11   DC  I N4    1 
ATOM 6176  C C5    . DC  I 5 11  ? 189.029 228.077 158.287 1.00 137.84 ? 11   DC  I C5    1 
ATOM 6177  C C6    . DC  I 5 11  ? 188.627 228.499 157.093 1.00 140.46 ? 11   DC  I C6    1 
ATOM 6178  P P     . DC  I 5 12  ? 189.001 230.492 151.430 1.00 126.93 ? 12   DC  I P     1 
ATOM 6179  O OP1   . DC  I 5 12  ? 188.295 229.974 150.242 1.00 122.08 ? 12   DC  I OP1   1 
ATOM 6180  O OP2   . DC  I 5 12  ? 190.189 229.779 151.934 1.00 125.11 ? 12   DC  I OP2   1 
ATOM 6181  O "O5'" . DC  I 5 12  ? 189.443 231.991 151.151 1.00 148.38 ? 12   DC  I "O5'" 1 
ATOM 6182  C "C5'" . DC  I 5 12  ? 189.285 232.955 152.179 1.00 153.46 ? 12   DC  I "C5'" 1 
ATOM 6183  C "C4'" . DC  I 5 12  ? 190.631 233.380 152.703 1.00 160.14 ? 12   DC  I "C4'" 1 
ATOM 6184  O "O4'" . DC  I 5 12  ? 190.860 232.793 154.014 1.00 157.66 ? 12   DC  I "O4'" 1 
ATOM 6185  C "C3'" . DC  I 5 12  ? 191.798 232.927 151.831 1.00 166.41 ? 12   DC  I "C3'" 1 
ATOM 6186  O "O3'" . DC  I 5 12  ? 192.720 233.966 151.694 1.00 176.01 ? 12   DC  I "O3'" 1 
ATOM 6187  C "C2'" . DC  I 5 12  ? 192.386 231.780 152.630 1.00 160.96 ? 12   DC  I "C2'" 1 
ATOM 6188  C "C1'" . DC  I 5 12  ? 192.166 232.286 154.036 1.00 157.63 ? 12   DC  I "C1'" 1 
ATOM 6189  N N1    . DC  I 5 12  ? 192.275 231.224 155.058 1.00 152.32 ? 12   DC  I N1    1 
ATOM 6190  C C2    . DC  I 5 12  ? 192.925 231.483 156.260 1.00 151.59 ? 12   DC  I C2    1 
ATOM 6191  O O2    . DC  I 5 12  ? 193.362 232.606 156.483 1.00 153.72 ? 12   DC  I O2    1 
ATOM 6192  N N3    . DC  I 5 12  ? 193.022 230.504 157.178 1.00 145.95 ? 12   DC  I N3    1 
ATOM 6193  C C4    . DC  I 5 12  ? 192.528 229.305 156.922 1.00 143.15 ? 12   DC  I C4    1 
ATOM 6194  N N4    . DC  I 5 12  ? 192.659 228.366 157.858 1.00 144.08 ? 12   DC  I N4    1 
ATOM 6195  C C5    . DC  I 5 12  ? 191.877 229.012 155.694 1.00 143.13 ? 12   DC  I C5    1 
ATOM 6196  C C6    . DC  I 5 12  ? 191.784 229.990 154.796 1.00 145.66 ? 12   DC  I C6    1 
ATOM 6197  P P     . DG  I 5 13  ? 193.892 233.862 150.606 1.00 151.51 ? 13   DG  I P     1 
ATOM 6198  O OP1   . DG  I 5 13  ? 193.264 233.749 149.276 1.00 140.16 ? 13   DG  I OP1   1 
ATOM 6199  O OP2   . DG  I 5 13  ? 194.857 232.839 151.047 1.00 148.96 ? 13   DG  I OP2   1 
ATOM 6200  O "O5'" . DG  I 5 13  ? 194.608 235.270 150.736 1.00 123.42 ? 13   DG  I "O5'" 1 
ATOM 6201  C "C5'" . DG  I 5 13  ? 194.530 235.955 151.963 1.00 129.62 ? 13   DG  I "C5'" 1 
ATOM 6202  C "C4'" . DG  I 5 13  ? 195.631 235.494 152.888 1.00 144.62 ? 13   DG  I "C4'" 1 
ATOM 6203  O "O4'" . DG  I 5 13  ? 195.206 234.343 153.644 1.00 149.24 ? 13   DG  I "O4'" 1 
ATOM 6204  C "C3'" . DG  I 5 13  ? 196.910 235.064 152.175 1.00 152.28 ? 13   DG  I "C3'" 1 
ATOM 6205  O "O3'" . DG  I 5 13  ? 197.924 236.008 152.410 1.00 157.84 ? 13   DG  I "O3'" 1 
ATOM 6206  C "C2'" . DG  I 5 13  ? 197.254 233.704 152.795 1.00 155.23 ? 13   DG  I "C2'" 1 
ATOM 6207  C "C1'" . DG  I 5 13  ? 196.363 233.661 154.025 1.00 151.87 ? 13   DG  I "C1'" 1 
ATOM 6208  N N9    . DG  I 5 13  ? 196.008 232.312 154.439 1.00 148.46 ? 13   DG  I N9    1 
ATOM 6209  C C8    . DG  I 5 13  ? 195.300 231.395 153.722 1.00 149.07 ? 13   DG  I C8    1 
ATOM 6210  N N7    . DG  I 5 13  ? 195.124 230.271 154.344 1.00 144.84 ? 13   DG  I N7    1 
ATOM 6211  C C5    . DG  I 5 13  ? 195.785 230.446 155.544 1.00 142.34 ? 13   DG  I C5    1 
ATOM 6212  C C6    . DG  I 5 13  ? 195.941 229.564 156.629 1.00 140.97 ? 13   DG  I C6    1 
ATOM 6213  O O6    . DG  I 5 13  ? 195.525 228.407 156.744 1.00 136.11 ? 13   DG  I O6    1 
ATOM 6214  N N1    . DG  I 5 13  ? 196.680 230.135 157.652 1.00 141.39 ? 13   DG  I N1    1 
ATOM 6215  C C2    . DG  I 5 13  ? 197.189 231.402 157.635 1.00 137.08 ? 13   DG  I C2    1 
ATOM 6216  N N2    . DG  I 5 13  ? 197.867 231.776 158.723 1.00 137.80 ? 13   DG  I N2    1 
ATOM 6217  N N3    . DG  I 5 13  ? 197.048 232.242 156.625 1.00 132.61 ? 13   DG  I N3    1 
ATOM 6218  C C4    . DG  I 5 13  ? 196.330 231.700 155.621 1.00 140.56 ? 13   DG  I C4    1 
ATOM 6219  P P     . DG  I 5 14  ? 199.281 235.957 151.558 1.00 172.56 ? 14   DG  I P     1 
ATOM 6220  O OP1   . DG  I 5 14  ? 199.548 237.327 151.077 1.00 174.14 ? 14   DG  I OP1   1 
ATOM 6221  O OP2   . DG  I 5 14  ? 199.181 234.839 150.598 1.00 169.41 ? 14   DG  I OP2   1 
ATOM 6222  O "O5'" . DG  I 5 14  ? 200.379 235.567 152.639 1.00 115.61 ? 14   DG  I "O5'" 1 
ATOM 6223  C "C5'" . DG  I 5 14  ? 200.410 236.250 153.865 1.00 129.51 ? 14   DG  I "C5'" 1 
ATOM 6224  C "C4'" . DG  I 5 14  ? 200.911 235.341 154.955 1.00 147.62 ? 14   DG  I "C4'" 1 
ATOM 6225  O "O4'" . DG  I 5 14  ? 199.976 234.274 155.142 1.00 153.50 ? 14   DG  I "O4'" 1 
ATOM 6226  C "C3'" . DG  I 5 14  ? 202.231 234.659 154.639 1.00 156.74 ? 14   DG  I "C3'" 1 
ATOM 6227  O "O3'" . DG  I 5 14  ? 203.287 235.348 155.275 1.00 162.90 ? 14   DG  I "O3'" 1 
ATOM 6228  C "C2'" . DG  I 5 14  ? 202.074 233.237 155.196 1.00 156.46 ? 14   DG  I "C2'" 1 
ATOM 6229  C "C1'" . DG  I 5 14  ? 200.648 233.198 155.731 1.00 154.02 ? 14   DG  I "C1'" 1 
ATOM 6230  N N9    . DG  I 5 14  ? 199.938 231.986 155.377 1.00 145.59 ? 14   DG  I N9    1 
ATOM 6231  C C8    . DG  I 5 14  ? 199.252 231.756 154.222 1.00 137.71 ? 14   DG  I C8    1 
ATOM 6232  N N7    . DG  I 5 14  ? 198.703 230.584 154.168 1.00 134.62 ? 14   DG  I N7    1 
ATOM 6233  C C5    . DG  I 5 14  ? 199.056 229.997 155.367 1.00 139.12 ? 14   DG  I C5    1 
ATOM 6234  C C6    . DG  I 5 14  ? 198.756 228.721 155.863 1.00 141.34 ? 14   DG  I C6    1 
ATOM 6235  O O6    . DG  I 5 14  ? 198.085 227.829 155.327 1.00 142.00 ? 14   DG  I O6    1 
ATOM 6236  N N1    . DG  I 5 14  ? 199.305 228.520 157.114 1.00 144.49 ? 14   DG  I N1    1 
ATOM 6237  C C2    . DG  I 5 14  ? 200.055 229.436 157.797 1.00 147.59 ? 14   DG  I C2    1 
ATOM 6238  N N2    . DG  I 5 14  ? 200.504 229.054 158.991 1.00 149.34 ? 14   DG  I N2    1 
ATOM 6239  N N3    . DG  I 5 14  ? 200.352 230.637 157.339 1.00 148.41 ? 14   DG  I N3    1 
ATOM 6240  C C4    . DG  I 5 14  ? 199.821 230.846 156.121 1.00 144.43 ? 14   DG  I C4    1 
ATOM 6241  P P     . DT  I 5 15  ? 204.807 234.941 154.967 1.00 162.77 ? 15   DT  I P     1 
ATOM 6242  O OP1   . DT  I 5 15  ? 205.674 236.073 155.351 1.00 158.23 ? 15   DT  I OP1   1 
ATOM 6243  O OP2   . DT  I 5 15  ? 204.845 234.394 153.595 1.00 160.09 ? 15   DT  I OP2   1 
ATOM 6244  O "O5'" . DT  I 5 15  ? 205.089 233.734 155.965 1.00 166.02 ? 15   DT  I "O5'" 1 
ATOM 6245  C "C5'" . DT  I 5 15  ? 204.797 233.871 157.340 1.00 167.52 ? 15   DT  I "C5'" 1 
ATOM 6246  C "C4'" . DT  I 5 15  ? 204.952 232.538 158.030 1.00 171.01 ? 15   DT  I "C4'" 1 
ATOM 6247  O "O4'" . DT  I 5 15  ? 203.861 231.675 157.647 1.00 172.97 ? 15   DT  I "O4'" 1 
ATOM 6248  C "C3'" . DT  I 5 15  ? 206.233 231.793 157.663 1.00 170.96 ? 15   DT  I "C3'" 1 
ATOM 6249  O "O3'" . DT  I 5 15  ? 207.016 231.596 158.812 1.00 172.23 ? 15   DT  I "O3'" 1 
ATOM 6250  C "C2'" . DT  I 5 15  ? 205.757 230.465 157.061 1.00 170.23 ? 15   DT  I "C2'" 1 
ATOM 6251  C "C1'" . DT  I 5 15  ? 204.330 230.360 157.568 1.00 166.51 ? 15   DT  I "C1'" 1 
ATOM 6252  N N1    . DT  I 5 15  ? 203.454 229.620 156.660 1.00 151.06 ? 15   DT  I N1    1 
ATOM 6253  C C2    . DT  I 5 15  ? 202.945 228.421 157.054 1.00 139.41 ? 15   DT  I C2    1 
ATOM 6254  O O2    . DT  I 5 15  ? 203.173 227.927 158.133 1.00 129.55 ? 15   DT  I O2    1 
ATOM 6255  N N3    . DT  I 5 15  ? 202.150 227.815 156.140 1.00 140.32 ? 15   DT  I N3    1 
ATOM 6256  C C4    . DT  I 5 15  ? 201.823 228.282 154.889 1.00 143.13 ? 15   DT  I C4    1 
ATOM 6257  O O4    . DT  I 5 15  ? 201.096 227.664 154.127 1.00 139.31 ? 15   DT  I O4    1 
ATOM 6258  C C5    . DT  I 5 15  ? 202.391 229.545 154.540 1.00 148.06 ? 15   DT  I C5    1 
ATOM 6259  C C7    . DT  I 5 15  ? 202.102 230.149 153.205 1.00 147.64 ? 15   DT  I C7    1 
ATOM 6260  C C6    . DT  I 5 15  ? 203.175 230.145 155.431 1.00 148.43 ? 15   DT  I C6    1 
ATOM 6261  P P     . DG  I 5 16  ? 208.564 231.211 158.659 1.00 129.59 ? 16   DG  I P     1 
ATOM 6262  O OP1   . DG  I 5 16  ? 209.285 231.754 159.827 1.00 123.44 ? 16   DG  I OP1   1 
ATOM 6263  O OP2   . DG  I 5 16  ? 208.975 231.592 157.293 1.00 112.84 ? 16   DG  I OP2   1 
ATOM 6264  O "O5'" . DG  I 5 16  ? 208.566 229.619 158.754 1.00 170.91 ? 16   DG  I "O5'" 1 
ATOM 6265  C "C5'" . DG  I 5 16  ? 207.946 228.984 159.856 1.00 164.34 ? 16   DG  I "C5'" 1 
ATOM 6266  C "C4'" . DG  I 5 16  ? 208.209 227.492 159.840 1.00 154.33 ? 16   DG  I "C4'" 1 
ATOM 6267  O "O4'" . DG  I 5 16  ? 207.284 226.842 158.937 1.00 152.16 ? 16   DG  I "O4'" 1 
ATOM 6268  C "C3'" . DG  I 5 16  ? 209.605 227.083 159.389 1.00 146.89 ? 16   DG  I "C3'" 1 
ATOM 6269  O "O3'" . DG  I 5 16  ? 210.046 225.987 160.171 1.00 145.56 ? 16   DG  I "O3'" 1 
ATOM 6270  C "C2'" . DG  I 5 16  ? 209.394 226.694 157.929 1.00 143.52 ? 16   DG  I "C2'" 1 
ATOM 6271  C "C1'" . DG  I 5 16  ? 207.987 226.126 157.948 1.00 146.50 ? 16   DG  I "C1'" 1 
ATOM 6272  N N9    . DG  I 5 16  ? 207.285 226.323 156.700 1.00 142.74 ? 16   DG  I N9    1 
ATOM 6273  C C8    . DG  I 5 16  ? 207.427 227.378 155.848 1.00 143.39 ? 16   DG  I C8    1 
ATOM 6274  N N7    . DG  I 5 16  ? 206.648 227.314 154.814 1.00 139.49 ? 16   DG  I N7    1 
ATOM 6275  C C5    . DG  I 5 16  ? 205.937 226.145 154.999 1.00 139.38 ? 16   DG  I C5    1 
ATOM 6276  C C6    . DG  I 5 16  ? 204.945 225.559 154.195 1.00 144.67 ? 16   DG  I C6    1 
ATOM 6277  O O6    . DG  I 5 16  ? 204.486 225.974 153.131 1.00 147.60 ? 16   DG  I O6    1 
ATOM 6278  N N1    . DG  I 5 16  ? 204.474 224.375 154.735 1.00 147.76 ? 16   DG  I N1    1 
ATOM 6279  C C2    . DG  I 5 16  ? 204.910 223.828 155.910 1.00 146.99 ? 16   DG  I C2    1 
ATOM 6280  N N2    . DG  I 5 16  ? 204.336 222.674 156.275 1.00 141.07 ? 16   DG  I N2    1 
ATOM 6281  N N3    . DG  I 5 16  ? 205.849 224.370 156.676 1.00 145.94 ? 16   DG  I N3    1 
ATOM 6282  C C4    . DG  I 5 16  ? 206.313 225.524 156.157 1.00 142.17 ? 16   DG  I C4    1 
ATOM 6283  P P     . DC  I 5 17  ? 211.536 225.409 160.034 1.00 135.20 ? 17   DC  I P     1 
ATOM 6284  O OP1   . DC  I 5 17  ? 212.168 225.512 161.360 1.00 133.45 ? 17   DC  I OP1   1 
ATOM 6285  O OP2   . DC  I 5 17  ? 212.202 226.002 158.861 1.00 122.57 ? 17   DC  I OP2   1 
ATOM 6286  O "O5'" . DC  I 5 17  ? 211.284 223.870 159.752 1.00 153.64 ? 17   DC  I "O5'" 1 
ATOM 6287  C "C5'" . DC  I 5 17  ? 210.299 223.203 160.503 1.00 147.67 ? 17   DC  I "C5'" 1 
ATOM 6288  C "C4'" . DC  I 5 17  ? 209.589 222.163 159.669 1.00 136.76 ? 17   DC  I "C4'" 1 
ATOM 6289  O "O4'" . DC  I 5 17  ? 208.896 222.794 158.562 1.00 134.69 ? 17   DC  I "O4'" 1 
ATOM 6290  C "C3'" . DC  I 5 17  ? 210.499 221.107 159.042 1.00 122.52 ? 17   DC  I "C3'" 1 
ATOM 6291  O "O3'" . DC  I 5 17  ? 209.939 219.841 159.252 1.00 109.26 ? 17   DC  I "O3'" 1 
ATOM 6292  C "C2'" . DC  I 5 17  ? 210.473 221.472 157.564 1.00 120.80 ? 17   DC  I "C2'" 1 
ATOM 6293  C "C1'" . DC  I 5 17  ? 209.060 221.976 157.442 1.00 125.62 ? 17   DC  I "C1'" 1 
ATOM 6294  N N1    . DC  I 5 17  ? 208.815 222.758 156.239 1.00 116.31 ? 17   DC  I N1    1 
ATOM 6295  C C2    . DC  I 5 17  ? 207.853 222.324 155.343 1.00 111.78 ? 17   DC  I C2    1 
ATOM 6296  O O2    . DC  I 5 17  ? 207.231 221.291 155.594 1.00 114.91 ? 17   DC  I O2    1 
ATOM 6297  N N3    . DC  I 5 17  ? 207.622 223.046 154.225 1.00 105.64 ? 17   DC  I N3    1 
ATOM 6298  C C4    . DC  I 5 17  ? 208.318 224.152 153.998 1.00 106.38 ? 17   DC  I C4    1 
ATOM 6299  N N4    . DC  I 5 17  ? 208.057 224.835 152.882 1.00 95.02  ? 17   DC  I N4    1 
ATOM 6300  C C5    . DC  I 5 17  ? 209.310 224.611 154.907 1.00 117.38 ? 17   DC  I C5    1 
ATOM 6301  C C6    . DC  I 5 17  ? 209.528 223.882 156.002 1.00 116.29 ? 17   DC  I C6    1 
ATOM 6302  P P     . DC  I 5 18  ? 210.619 218.821 160.280 1.00 120.73 ? 18   DC  I P     1 
ATOM 6303  O OP1   . DC  I 5 18  ? 209.778 218.787 161.493 1.00 120.06 ? 18   DC  I OP1   1 
ATOM 6304  O OP2   . DC  I 5 18  ? 212.046 219.184 160.376 1.00 116.11 ? 18   DC  I OP2   1 
ATOM 6305  O "O5'" . DC  I 5 18  ? 210.485 217.419 159.538 1.00 114.71 ? 18   DC  I "O5'" 1 
ATOM 6306  C "C5'" . DC  I 5 18  ? 209.202 216.919 159.240 1.00 104.31 ? 18   DC  I "C5'" 1 
ATOM 6307  C "C4'" . DC  I 5 18  ? 209.187 216.206 157.906 1.00 90.00  ? 18   DC  I "C4'" 1 
ATOM 6308  O "O4'" . DC  I 5 18  ? 209.279 217.170 156.826 1.00 90.50  ? 18   DC  I "O4'" 1 
ATOM 6309  C "C3'" . DC  I 5 18  ? 210.333 215.225 157.680 1.00 87.55  ? 18   DC  I "C3'" 1 
ATOM 6310  O "O3'" . DC  I 5 18  ? 209.849 214.107 156.956 1.00 95.96  ? 18   DC  I "O3'" 1 
ATOM 6311  C "C2'" . DC  I 5 18  ? 211.290 216.047 156.824 1.00 86.02  ? 18   DC  I "C2'" 1 
ATOM 6312  C "C1'" . DC  I 5 18  ? 210.287 216.753 155.941 1.00 94.59  ? 18   DC  I "C1'" 1 
ATOM 6313  N N1    . DC  I 5 18  ? 210.810 217.931 155.250 1.00 95.28  ? 18   DC  I N1    1 
ATOM 6314  C C2    . DC  I 5 18  ? 210.355 218.228 153.967 1.00 99.24  ? 18   DC  I C2    1 
ATOM 6315  O O2    . DC  I 5 18  ? 209.534 217.481 153.433 1.00 98.38  ? 18   DC  I O2    1 
ATOM 6316  N N3    . DC  I 5 18  ? 210.832 219.324 153.344 1.00 100.62 ? 18   DC  I N3    1 
ATOM 6317  C C4    . DC  I 5 18  ? 211.720 220.102 153.958 1.00 109.44 ? 18   DC  I C4    1 
ATOM 6318  N N4    . DC  I 5 18  ? 212.162 221.177 153.306 1.00 115.97 ? 18   DC  I N4    1 
ATOM 6319  C C5    . DC  I 5 18  ? 212.194 219.813 155.265 1.00 109.38 ? 18   DC  I C5    1 
ATOM 6320  C C6    . DC  I 5 18  ? 211.712 218.730 155.871 1.00 95.74  ? 18   DC  I C6    1 
ATOM 6321  P P     . DG  I 5 19  ? 209.142 212.880 157.711 1.00 94.41  ? 19   DG  I P     1 
ATOM 6322  O OP1   . DG  I 5 19  ? 208.072 213.411 158.579 1.00 102.54 ? 19   DG  I OP1   1 
ATOM 6323  O OP2   . DG  I 5 19  ? 210.205 212.023 158.266 1.00 84.90  ? 19   DG  I OP2   1 
ATOM 6324  O "O5'" . DG  I 5 19  ? 208.434 212.074 156.539 1.00 108.38 ? 19   DG  I "O5'" 1 
ATOM 6325  C "C5'" . DG  I 5 19  ? 207.230 212.558 156.002 1.00 93.97  ? 19   DG  I "C5'" 1 
ATOM 6326  C "C4'" . DG  I 5 19  ? 207.245 212.526 154.488 1.00 83.43  ? 19   DG  I "C4'" 1 
ATOM 6327  O "O4'" . DG  I 5 19  ? 208.082 213.589 153.974 1.00 86.59  ? 19   DG  I "O4'" 1 
ATOM 6328  C "C3'" . DG  I 5 19  ? 207.803 211.262 153.867 1.00 83.99  ? 19   DG  I "C3'" 1 
ATOM 6329  O "O3'" . DG  I 5 19  ? 207.224 211.114 152.611 1.00 103.44 ? 19   DG  I "O3'" 1 
ATOM 6330  C "C2'" . DG  I 5 19  ? 209.267 211.629 153.717 1.00 78.93  ? 19   DG  I "C2'" 1 
ATOM 6331  C "C1'" . DG  I 5 19  ? 209.087 213.020 153.168 1.00 88.84  ? 19   DG  I "C1'" 1 
ATOM 6332  N N9    . DG  I 5 19  ? 210.258 213.861 153.249 1.00 96.34  ? 19   DG  I N9    1 
ATOM 6333  C C8    . DG  I 5 19  ? 211.244 213.832 154.194 1.00 101.42 ? 19   DG  I C8    1 
ATOM 6334  N N7    . DG  I 5 19  ? 212.155 214.740 154.009 1.00 109.95 ? 19   DG  I N7    1 
ATOM 6335  C C5    . DG  I 5 19  ? 211.731 215.412 152.878 1.00 117.74 ? 19   DG  I C5    1 
ATOM 6336  C C6    . DG  I 5 19  ? 212.309 216.493 152.195 1.00 119.79 ? 19   DG  I C6    1 
ATOM 6337  O O6    . DG  I 5 19  ? 213.347 217.103 152.462 1.00 118.13 ? 19   DG  I O6    1 
ATOM 6338  N N1    . DG  I 5 19  ? 211.558 216.863 151.098 1.00 123.66 ? 19   DG  I N1    1 
ATOM 6339  C C2    . DG  I 5 19  ? 210.394 216.263 150.711 1.00 127.02 ? 19   DG  I C2    1 
ATOM 6340  N N2    . DG  I 5 19  ? 209.806 216.755 149.622 1.00 135.07 ? 19   DG  I N2    1 
ATOM 6341  N N3    . DG  I 5 19  ? 209.846 215.248 151.339 1.00 121.47 ? 19   DG  I N3    1 
ATOM 6342  C C4    . DG  I 5 19  ? 210.566 214.880 152.408 1.00 113.16 ? 19   DG  I C4    1 
ATOM 6343  P P     . DA  I 5 20  ? 206.075 210.034 152.367 1.00 84.77  ? 20   DA  I P     1 
ATOM 6344  O OP1   . DA  I 5 20  ? 205.082 210.170 153.449 1.00 66.71  ? 20   DA  I OP1   1 
ATOM 6345  O OP2   . DA  I 5 20  ? 206.762 208.752 152.135 1.00 78.34  ? 20   DA  I OP2   1 
ATOM 6346  O "O5'" . DA  I 5 20  ? 205.434 210.506 150.993 1.00 91.45  ? 20   DA  I "O5'" 1 
ATOM 6347  C "C5'" . DA  I 5 20  ? 205.542 211.853 150.630 1.00 91.14  ? 20   DA  I "C5'" 1 
ATOM 6348  C "C4'" . DA  I 5 20  ? 205.264 212.060 149.159 1.00 82.81  ? 20   DA  I "C4'" 1 
ATOM 6349  O "O4'" . DA  I 5 20  ? 206.413 212.632 148.530 1.00 86.39  ? 20   DA  I "O4'" 1 
ATOM 6350  C "C3'" . DA  I 5 20  ? 205.029 210.824 148.354 1.00 79.14  ? 20   DA  I "C3'" 1 
ATOM 6351  O "O3'" . DA  I 5 20  ? 204.466 211.220 147.125 1.00 75.64  ? 20   DA  I "O3'" 1 
ATOM 6352  C "C2'" . DA  I 5 20  ? 206.451 210.304 148.184 1.00 84.26  ? 20   DA  I "C2'" 1 
ATOM 6353  C "C1'" . DA  I 5 20  ? 207.259 211.594 148.099 1.00 93.44  ? 20   DA  I "C1'" 1 
ATOM 6354  N N9    . DA  I 5 20  ? 208.408 211.610 148.971 1.00 112.24 ? 20   DA  I N9    1 
ATOM 6355  C C8    . DA  I 5 20  ? 208.616 210.835 150.060 1.00 121.65 ? 20   DA  I C8    1 
ATOM 6356  N N7    . DA  I 5 20  ? 209.739 211.089 150.676 1.00 125.18 ? 20   DA  I N7    1 
ATOM 6357  C C5    . DA  I 5 20  ? 210.291 212.113 149.946 1.00 120.01 ? 20   DA  I C5    1 
ATOM 6358  C C6    . DA  I 5 20  ? 211.479 212.830 150.085 1.00 122.22 ? 20   DA  I C6    1 
ATOM 6359  N N6    . DA  I 5 20  ? 212.359 212.609 151.058 1.00 120.78 ? 20   DA  I N6    1 
ATOM 6360  N N1    . DA  I 5 20  ? 211.737 213.782 149.179 1.00 125.21 ? 20   DA  I N1    1 
ATOM 6361  C C2    . DA  I 5 20  ? 210.853 213.996 148.208 1.00 113.23 ? 20   DA  I C2    1 
ATOM 6362  N N3    . DA  I 5 20  ? 209.704 213.384 147.977 1.00 100.95 ? 20   DA  I N3    1 
ATOM 6363  C C4    . DA  I 5 20  ? 209.481 212.448 148.893 1.00 111.93 ? 20   DA  I C4    1 
ATOM 6364  P P     . DG  I 5 21  ? 204.574 210.290 145.829 1.00 97.79  ? 21   DG  I P     1 
ATOM 6365  O OP1   . DG  I 5 21  ? 203.584 210.780 144.854 1.00 101.81 ? 21   DG  I OP1   1 
ATOM 6366  O OP2   . DG  I 5 21  ? 204.572 208.881 146.261 1.00 79.86  ? 21   DG  I OP2   1 
ATOM 6367  O "O5'" . DG  I 5 21  ? 205.995 210.649 145.227 1.00 87.26  ? 21   DG  I "O5'" 1 
ATOM 6368  C "C5'" . DG  I 5 21  ? 206.195 211.918 144.676 1.00 80.01  ? 21   DG  I "C5'" 1 
ATOM 6369  C "C4'" . DG  I 5 21  ? 207.571 212.025 144.073 1.00 84.71  ? 21   DG  I "C4'" 1 
ATOM 6370  O "O4'" . DG  I 5 21  ? 208.560 212.096 145.127 1.00 90.89  ? 21   DG  I "O4'" 1 
ATOM 6371  C "C3'" . DG  I 5 21  ? 207.989 210.840 143.207 1.00 91.74  ? 21   DG  I "C3'" 1 
ATOM 6372  O "O3'" . DG  I 5 21  ? 208.766 211.314 142.164 1.00 107.78 ? 21   DG  I "O3'" 1 
ATOM 6373  C "C2'" . DG  I 5 21  ? 208.849 210.045 144.162 1.00 82.53  ? 21   DG  I "C2'" 1 
ATOM 6374  C "C1'" . DG  I 5 21  ? 209.571 211.192 144.808 1.00 96.54  ? 21   DG  I "C1'" 1 
ATOM 6375  N N9    . DG  I 5 21  ? 210.300 210.839 145.997 1.00 111.18 ? 21   DG  I N9    1 
ATOM 6376  C C8    . DG  I 5 21  ? 209.937 209.951 146.963 1.00 109.21 ? 21   DG  I C8    1 
ATOM 6377  N N7    . DG  I 5 21  ? 210.811 209.843 147.915 1.00 111.92 ? 21   DG  I N7    1 
ATOM 6378  C C5    . DG  I 5 21  ? 211.819 210.709 147.539 1.00 118.07 ? 21   DG  I C5    1 
ATOM 6379  C C6    . DG  I 5 21  ? 213.032 211.019 148.171 1.00 118.21 ? 21   DG  I C6    1 
ATOM 6380  O O6    . DG  I 5 21  ? 213.484 210.573 149.225 1.00 119.11 ? 21   DG  I O6    1 
ATOM 6381  N N1    . DG  I 5 21  ? 213.760 211.947 147.452 1.00 126.96 ? 21   DG  I N1    1 
ATOM 6382  C C2    . DG  I 5 21  ? 213.365 212.505 146.267 1.00 139.54 ? 21   DG  I C2    1 
ATOM 6383  N N2    . DG  I 5 21  ? 214.204 213.389 145.713 1.00 154.13 ? 21   DG  I N2    1 
ATOM 6384  N N3    . DG  I 5 21  ? 212.229 212.223 145.666 1.00 130.52 ? 21   DG  I N3    1 
ATOM 6385  C C4    . DG  I 5 21  ? 211.511 211.324 146.360 1.00 120.83 ? 21   DG  I C4    1 
ATOM 6386  P P     . DG  I 5 22  ? 208.362 211.001 140.651 1.00 111.64 ? 22   DG  I P     1 
ATOM 6387  O OP1   . DG  I 5 22  ? 207.073 211.670 140.385 1.00 100.91 ? 22   DG  I OP1   1 
ATOM 6388  O OP2   . DG  I 5 22  ? 208.516 209.545 140.457 1.00 100.88 ? 22   DG  I OP2   1 
ATOM 6389  O "O5'" . DG  I 5 22  ? 209.496 211.740 139.812 1.00 109.61 ? 22   DG  I "O5'" 1 
ATOM 6390  C "C5'" . DG  I 5 22  ? 210.035 212.959 140.290 1.00 110.21 ? 22   DG  I "C5'" 1 
ATOM 6391  C "C4'" . DG  I 5 22  ? 211.544 212.936 140.198 1.00 119.74 ? 22   DG  I "C4'" 1 
ATOM 6392  O "O4'" . DG  I 5 22  ? 212.109 212.603 141.491 1.00 119.98 ? 22   DG  I "O4'" 1 
ATOM 6393  C "C3'" . DG  I 5 22  ? 212.097 211.909 139.221 1.00 127.86 ? 22   DG  I "C3'" 1 
ATOM 6394  O "O3'" . DG  I 5 22  ? 213.170 212.478 138.497 1.00 135.09 ? 22   DG  I "O3'" 1 
ATOM 6395  C "C2'" . DG  I 5 22  ? 212.564 210.784 140.137 1.00 125.69 ? 22   DG  I "C2'" 1 
ATOM 6396  C "C1'" . DG  I 5 22  ? 213.043 211.569 141.337 1.00 124.35 ? 22   DG  I "C1'" 1 
ATOM 6397  N N9    . DG  I 5 22  ? 213.050 210.785 142.551 1.00 132.37 ? 22   DG  I N9    1 
ATOM 6398  C C8    . DG  I 5 22  ? 212.022 210.038 143.036 1.00 136.56 ? 22   DG  I C8    1 
ATOM 6399  N N7    . DG  I 5 22  ? 212.301 209.431 144.148 1.00 137.84 ? 22   DG  I N7    1 
ATOM 6400  C C5    . DG  I 5 22  ? 213.605 209.795 144.411 1.00 136.63 ? 22   DG  I C5    1 
ATOM 6401  C C6    . DG  I 5 22  ? 214.440 209.442 145.483 1.00 140.84 ? 22   DG  I C6    1 
ATOM 6402  O O6    . DG  I 5 22  ? 214.191 208.706 146.436 1.00 139.85 ? 22   DG  I O6    1 
ATOM 6403  N N1    . DG  I 5 22  ? 215.686 210.024 145.375 1.00 146.20 ? 22   DG  I N1    1 
ATOM 6404  C C2    . DG  I 5 22  ? 216.077 210.849 144.358 1.00 141.03 ? 22   DG  I C2    1 
ATOM 6405  N N2    . DG  I 5 22  ? 217.328 211.321 144.430 1.00 126.05 ? 22   DG  I N2    1 
ATOM 6406  N N3    . DG  I 5 22  ? 215.300 211.195 143.343 1.00 141.83 ? 22   DG  I N3    1 
ATOM 6407  C C4    . DG  I 5 22  ? 214.080 210.635 143.441 1.00 136.24 ? 22   DG  I C4    1 
ATOM 6408  P P     . DC  I 5 23  ? 213.453 212.030 136.981 1.00 140.25 ? 23   DC  I P     1 
ATOM 6409  O OP1   . DC  I 5 23  ? 213.491 213.237 136.131 1.00 144.87 ? 23   DC  I OP1   1 
ATOM 6410  O OP2   . DC  I 5 23  ? 212.507 210.942 136.659 1.00 125.71 ? 23   DC  I OP2   1 
ATOM 6411  O "O5'" . DC  I 5 23  ? 214.925 211.426 137.056 1.00 121.21 ? 23   DC  I "O5'" 1 
ATOM 6412  C "C5'" . DC  I 5 23  ? 215.379 210.886 138.274 1.00 117.34 ? 23   DC  I "C5'" 1 
ATOM 6413  C "C4'" . DC  I 5 23  ? 216.792 211.310 138.566 1.00 116.21 ? 23   DC  I "C4'" 1 
ATOM 6414  O "O4'" . DC  I 5 23  ? 217.043 211.111 139.974 1.00 118.18 ? 23   DC  I "O4'" 1 
ATOM 6415  C "C3'" . DC  I 5 23  ? 217.823 210.454 137.878 1.00 125.00 ? 23   DC  I "C3'" 1 
ATOM 6416  O "O3'" . DC  I 5 23  ? 219.086 211.091 137.881 1.00 136.19 ? 23   DC  I "O3'" 1 
ATOM 6417  C "C2'" . DC  I 5 23  ? 217.818 209.238 138.779 1.00 125.93 ? 23   DC  I "C2'" 1 
ATOM 6418  C "C1'" . DC  I 5 23  ? 217.730 209.888 140.155 1.00 125.98 ? 23   DC  I "C1'" 1 
ATOM 6419  N N1    . DC  I 5 23  ? 216.992 209.068 141.139 1.00 120.56 ? 23   DC  I N1    1 
ATOM 6420  C C2    . DC  I 5 23  ? 217.662 208.545 142.241 1.00 114.43 ? 23   DC  I C2    1 
ATOM 6421  O O2    . DC  I 5 23  ? 218.859 208.782 142.380 1.00 119.50 ? 23   DC  I O2    1 
ATOM 6422  N N3    . DC  I 5 23  ? 216.980 207.795 143.129 1.00 106.31 ? 23   DC  I N3    1 
ATOM 6423  C C4    . DC  I 5 23  ? 215.691 207.561 142.946 1.00 104.31 ? 23   DC  I C4    1 
ATOM 6424  N N4    . DC  I 5 23  ? 215.061 206.811 143.852 1.00 92.17  ? 23   DC  I N4    1 
ATOM 6425  C C5    . DC  I 5 23  ? 214.988 208.078 141.822 1.00 107.96 ? 23   DC  I C5    1 
ATOM 6426  C C6    . DC  I 5 23  ? 215.672 208.822 140.954 1.00 111.15 ? 23   DC  I C6    1 
ATOM 6427  P P     . DC  I 5 24  ? 220.266 210.518 136.952 1.00 146.77 ? 24   DC  I P     1 
ATOM 6428  O OP1   . DC  I 5 24  ? 221.220 211.610 136.682 1.00 147.05 ? 24   DC  I OP1   1 
ATOM 6429  O OP2   . DC  I 5 24  ? 219.639 209.802 135.825 1.00 142.49 ? 24   DC  I OP2   1 
ATOM 6430  O "O5'" . DC  I 5 24  ? 220.977 209.418 137.861 1.00 101.94 ? 24   DC  I "O5'" 1 
ATOM 6431  C "C5'" . DC  I 5 24  ? 221.287 209.715 139.202 1.00 105.59 ? 24   DC  I "C5'" 1 
ATOM 6432  C "C4'" . DC  I 5 24  ? 222.556 209.012 139.630 1.00 118.08 ? 24   DC  I "C4'" 1 
ATOM 6433  O "O4'" . DC  I 5 24  ? 222.270 208.126 140.733 1.00 124.76 ? 24   DC  I "O4'" 1 
ATOM 6434  C "C3'" . DC  I 5 24  ? 223.194 208.124 138.585 1.00 123.54 ? 24   DC  I "C3'" 1 
ATOM 6435  O "O3'" . DC  I 5 24  ? 224.567 207.965 138.904 1.00 123.78 ? 24   DC  I "O3'" 1 
ATOM 6436  C "C2'" . DC  I 5 24  ? 222.414 206.821 138.759 1.00 128.75 ? 24   DC  I "C2'" 1 
ATOM 6437  C "C1'" . DC  I 5 24  ? 222.151 206.795 140.265 1.00 126.02 ? 24   DC  I "C1'" 1 
ATOM 6438  N N1    . DC  I 5 24  ? 220.802 206.323 140.618 1.00 115.20 ? 24   DC  I N1    1 
ATOM 6439  C C2    . DC  I 5 24  ? 220.615 205.565 141.770 1.00 113.70 ? 24   DC  I C2    1 
ATOM 6440  O O2    . DC  I 5 24  ? 221.587 205.283 142.475 1.00 108.68 ? 24   DC  I O2    1 
ATOM 6441  N N3    . DC  I 5 24  ? 219.368 205.163 142.086 1.00 113.34 ? 24   DC  I N3    1 
ATOM 6442  C C4    . DC  I 5 24  ? 218.345 205.490 141.309 1.00 104.46 ? 24   DC  I C4    1 
ATOM 6443  N N4    . DC  I 5 24  ? 217.138 205.056 141.660 1.00 99.76  ? 24   DC  I N4    1 
ATOM 6444  C C5    . DC  I 5 24  ? 218.516 206.256 140.132 1.00 98.27  ? 24   DC  I C5    1 
ATOM 6445  C C6    . DC  I 5 24  ? 219.750 206.655 139.831 1.00 102.24 ? 24   DC  I C6    1 
ATOM 6446  P P     . DG  I 5 25  ? 225.470 206.865 138.167 1.00 171.36 ? 25   DG  I P     1 
ATOM 6447  O OP1   . DG  I 5 25  ? 226.833 207.413 138.090 1.00 175.80 ? 25   DG  I OP1   1 
ATOM 6448  O OP2   . DG  I 5 25  ? 224.798 206.439 136.924 1.00 174.37 ? 25   DG  I OP2   1 
ATOM 6449  O "O5'" . DG  I 5 25  ? 225.492 205.643 139.191 1.00 130.43 ? 25   DG  I "O5'" 1 
ATOM 6450  C "C5'" . DG  I 5 25  ? 226.364 204.549 138.965 1.00 129.58 ? 25   DG  I "C5'" 1 
ATOM 6451  C "C4'" . DG  I 5 25  ? 226.595 203.775 140.244 1.00 122.56 ? 25   DG  I "C4'" 1 
ATOM 6452  O "O4'" . DG  I 5 25  ? 225.354 203.693 140.977 1.00 123.51 ? 25   DG  I "O4'" 1 
ATOM 6453  C "C3'" . DG  I 5 25  ? 226.996 202.334 140.049 1.00 126.78 ? 25   DG  I "C3'" 1 
ATOM 6454  O "O3'" . DG  I 5 25  ? 227.537 201.840 141.265 1.00 127.88 ? 25   DG  I "O3'" 1 
ATOM 6455  C "C2'" . DG  I 5 25  ? 225.643 201.703 139.745 1.00 137.01 ? 25   DG  I "C2'" 1 
ATOM 6456  C "C1'" . DG  I 5 25  ? 224.751 202.428 140.748 1.00 131.45 ? 25   DG  I "C1'" 1 
ATOM 6457  N N9    . DG  I 5 25  ? 223.374 202.660 140.304 1.00 121.03 ? 25   DG  I N9    1 
ATOM 6458  C C8    . DG  I 5 25  ? 222.963 203.351 139.192 1.00 114.54 ? 25   DG  I C8    1 
ATOM 6459  N N7    . DG  I 5 25  ? 221.667 203.429 139.081 1.00 108.05 ? 25   DG  I N7    1 
ATOM 6460  C C5    . DG  I 5 25  ? 221.191 202.763 140.196 1.00 109.53 ? 25   DG  I C5    1 
ATOM 6461  C C6    . DG  I 5 25  ? 219.869 202.518 140.610 1.00 103.66 ? 25   DG  I C6    1 
ATOM 6462  O O6    . DG  I 5 25  ? 218.820 202.848 140.060 1.00 99.54  ? 25   DG  I O6    1 
ATOM 6463  N N1    . DG  I 5 25  ? 219.822 201.797 141.792 1.00 99.11  ? 25   DG  I N1    1 
ATOM 6464  C C2    . DG  I 5 25  ? 220.916 201.377 142.492 1.00 105.16 ? 25   DG  I C2    1 
ATOM 6465  N N2    . DG  I 5 25  ? 220.669 200.696 143.618 1.00 106.53 ? 25   DG  I N2    1 
ATOM 6466  N N3    . DG  I 5 25  ? 222.165 201.596 142.116 1.00 106.44 ? 25   DG  I N3    1 
ATOM 6467  C C4    . DG  I 5 25  ? 222.226 202.293 140.962 1.00 111.51 ? 25   DG  I C4    1 
ATOM 6468  P P     . DC  I 5 26  ? 228.485 200.543 141.278 1.00 127.68 ? 26   DC  I P     1 
ATOM 6469  O OP1   . DC  I 5 26  ? 229.824 200.940 141.760 1.00 125.65 ? 26   DC  I OP1   1 
ATOM 6470  O OP2   . DC  I 5 26  ? 228.353 199.895 139.958 1.00 131.03 ? 26   DC  I OP2   1 
ATOM 6471  O "O5'" . DC  I 5 26  ? 227.835 199.609 142.403 1.00 129.70 ? 26   DC  I "O5'" 1 
ATOM 6472  C "C5'" . DC  I 5 26  ? 226.429 199.653 142.645 1.00 131.52 ? 26   DC  I "C5'" 1 
ATOM 6473  C "C4'" . DC  I 5 26  ? 225.797 198.326 142.296 1.00 127.44 ? 26   DC  I "C4'" 1 
ATOM 6474  O "O4'" . DC  I 5 26  ? 224.460 198.549 141.773 1.00 130.36 ? 26   DC  I "O4'" 1 
ATOM 6475  C "C3'" . DC  I 5 26  ? 226.525 197.565 141.203 1.00 121.62 ? 26   DC  I "C3'" 1 
ATOM 6476  O "O3'" . DC  I 5 26  ? 226.338 196.184 141.387 1.00 114.85 ? 26   DC  I "O3'" 1 
ATOM 6477  C "C2'" . DC  I 5 26  ? 225.803 198.063 139.966 1.00 124.00 ? 26   DC  I "C2'" 1 
ATOM 6478  C "C1'" . DC  I 5 26  ? 224.385 198.013 140.471 1.00 125.34 ? 26   DC  I "C1'" 1 
ATOM 6479  N N1    . DC  I 5 26  ? 223.451 198.820 139.674 1.00 114.08 ? 26   DC  I N1    1 
ATOM 6480  C C2    . DC  I 5 26  ? 222.178 199.105 140.172 1.00 112.28 ? 26   DC  I C2    1 
ATOM 6481  O O2    . DC  I 5 26  ? 221.848 198.675 141.280 1.00 113.76 ? 26   DC  I O2    1 
ATOM 6482  N N3    . DC  I 5 26  ? 221.337 199.842 139.427 1.00 104.91 ? 26   DC  I N3    1 
ATOM 6483  C C4    . DC  I 5 26  ? 221.723 200.288 138.244 1.00 102.88 ? 26   DC  I C4    1 
ATOM 6484  N N4    . DC  I 5 26  ? 220.852 201.015 137.548 1.00 103.66 ? 26   DC  I N4    1 
ATOM 6485  C C5    . DC  I 5 26  ? 223.011 200.006 137.716 1.00 100.00 ? 26   DC  I C5    1 
ATOM 6486  C C6    . DC  I 5 26  ? 223.831 199.268 138.456 1.00 104.07 ? 26   DC  I C6    1 
ATOM 6487  P P     . DT  I 5 27  ? 227.522 195.297 142.003 1.00 133.38 ? 27   DT  I P     1 
ATOM 6488  O OP1   . DT  I 5 27  ? 228.124 196.093 143.088 1.00 115.20 ? 27   DT  I OP1   1 
ATOM 6489  O OP2   . DT  I 5 27  ? 228.362 194.806 140.894 1.00 141.40 ? 27   DT  I OP2   1 
ATOM 6490  O "O5'" . DT  I 5 27  ? 226.773 194.047 142.648 1.00 114.32 ? 27   DT  I "O5'" 1 
ATOM 6491  C "C5'" . DT  I 5 27  ? 226.175 194.170 143.919 1.00 116.98 ? 27   DT  I "C5'" 1 
ATOM 6492  C "C4'" . DT  I 5 27  ? 224.880 193.383 143.999 1.00 111.13 ? 27   DT  I "C4'" 1 
ATOM 6493  O "O4'" . DT  I 5 27  ? 223.927 193.887 143.025 1.00 107.77 ? 27   DT  I "O4'" 1 
ATOM 6494  C "C3'" . DT  I 5 27  ? 224.989 191.895 143.713 1.00 97.92  ? 27   DT  I "C3'" 1 
ATOM 6495  O "O3'" . DT  I 5 27  ? 223.983 191.234 144.458 1.00 101.49 ? 27   DT  I "O3'" 1 
ATOM 6496  C "C2'" . DT  I 5 27  ? 224.701 191.849 142.215 1.00 86.36  ? 27   DT  I "C2'" 1 
ATOM 6497  C "C1'" . DT  I 5 27  ? 223.578 192.858 142.119 1.00 93.77  ? 27   DT  I "C1'" 1 
ATOM 6498  N N1    . DT  I 5 27  ? 223.419 193.482 140.804 1.00 99.77  ? 27   DT  I N1    1 
ATOM 6499  C C2    . DT  I 5 27  ? 222.174 193.565 140.255 1.00 111.17 ? 27   DT  I C2    1 
ATOM 6500  O O2    . DT  I 5 27  ? 221.192 193.091 140.777 1.00 117.87 ? 27   DT  I O2    1 
ATOM 6501  N N3    . DT  I 5 27  ? 222.124 194.199 139.045 1.00 118.73 ? 27   DT  I N3    1 
ATOM 6502  C C4    . DT  I 5 27  ? 223.173 194.765 138.369 1.00 121.27 ? 27   DT  I C4    1 
ATOM 6503  O O4    . DT  I 5 27  ? 223.035 195.328 137.298 1.00 120.37 ? 27   DT  I O4    1 
ATOM 6504  C C5    . DT  I 5 27  ? 224.444 194.662 139.015 1.00 119.53 ? 27   DT  I C5    1 
ATOM 6505  C C7    . DT  I 5 27  ? 225.655 195.229 138.357 1.00 113.76 ? 27   DT  I C7    1 
ATOM 6506  C C6    . DT  I 5 27  ? 224.506 194.039 140.192 1.00 114.22 ? 27   DT  I C6    1 
ATOM 6507  P P     . DC  I 5 28  ? 223.822 189.638 144.439 1.00 112.30 ? 28   DC  I P     1 
ATOM 6508  O OP1   . DC  I 5 28  ? 224.240 189.165 145.770 1.00 114.13 ? 28   DC  I OP1   1 
ATOM 6509  O OP2   . DC  I 5 28  ? 224.434 189.054 143.230 1.00 85.42  ? 28   DC  I OP2   1 
ATOM 6510  O "O5'" . DC  I 5 28  ? 222.250 189.445 144.293 1.00 129.93 ? 28   DC  I "O5'" 1 
ATOM 6511  C "C5'" . DC  I 5 28  ? 221.528 190.286 143.417 1.00 126.47 ? 28   DC  I "C5'" 1 
ATOM 6512  C "C4'" . DC  I 5 28  ? 220.395 189.526 142.783 1.00 124.16 ? 28   DC  I "C4'" 1 
ATOM 6513  O "O4'" . DC  I 5 28  ? 220.186 190.005 141.437 1.00 123.67 ? 28   DC  I "O4'" 1 
ATOM 6514  C "C3'" . DC  I 5 28  ? 220.659 188.053 142.624 1.00 121.32 ? 28   DC  I "C3'" 1 
ATOM 6515  O "O3'" . DC  I 5 28  ? 219.443 187.382 142.487 1.00 118.64 ? 28   DC  I "O3'" 1 
ATOM 6516  C "C2'" . DC  I 5 28  ? 221.460 188.024 141.332 1.00 119.76 ? 28   DC  I "C2'" 1 
ATOM 6517  C "C1'" . DC  I 5 28  ? 220.758 189.102 140.511 1.00 119.41 ? 28   DC  I "C1'" 1 
ATOM 6518  N N1    . DC  I 5 28  ? 221.672 189.867 139.658 1.00 114.13 ? 28   DC  I N1    1 
ATOM 6519  C C2    . DC  I 5 28  ? 221.184 190.507 138.523 1.00 115.56 ? 28   DC  I C2    1 
ATOM 6520  O O2    . DC  I 5 28  ? 219.992 190.412 138.244 1.00 107.99 ? 28   DC  I O2    1 
ATOM 6521  N N3    . DC  I 5 28  ? 222.035 191.216 137.760 1.00 125.73 ? 28   DC  I N3    1 
ATOM 6522  C C4    . DC  I 5 28  ? 223.317 191.296 138.099 1.00 128.23 ? 28   DC  I C4    1 
ATOM 6523  N N4    . DC  I 5 28  ? 224.126 192.004 137.315 1.00 127.76 ? 28   DC  I N4    1 
ATOM 6524  C C5    . DC  I 5 28  ? 223.831 190.648 139.250 1.00 125.66 ? 28   DC  I C5    1 
ATOM 6525  C C6    . DC  I 5 28  ? 222.980 189.955 139.996 1.00 115.84 ? 28   DC  I C6    1 
ATOM 6526  P P     . DA  I 5 29  ? 218.673 186.861 143.790 1.00 107.49 ? 29   DA  I P     1 
ATOM 6527  O OP1   . DA  I 5 29  ? 218.585 187.982 144.747 1.00 102.46 ? 29   DA  I OP1   1 
ATOM 6528  O OP2   . DA  I 5 29  ? 219.305 185.592 144.189 1.00 96.61  ? 29   DA  I OP2   1 
ATOM 6529  O "O5'" . DA  I 5 29  ? 217.205 186.545 143.271 1.00 81.66  ? 29   DA  I "O5'" 1 
ATOM 6530  C "C5'" . DA  I 5 29  ? 216.233 187.543 143.333 1.00 67.01  ? 29   DA  I "C5'" 1 
ATOM 6531  C "C4'" . DA  I 5 29  ? 215.979 188.124 141.966 1.00 71.36  ? 29   DA  I "C4'" 1 
ATOM 6532  O "O4'" . DA  I 5 29  ? 217.222 188.189 141.214 1.00 76.44  ? 29   DA  I "O4'" 1 
ATOM 6533  C "C3'" . DA  I 5 29  ? 215.015 187.318 141.100 1.00 77.41  ? 29   DA  I "C3'" 1 
ATOM 6534  O "O3'" . DA  I 5 29  ? 214.185 188.191 140.416 1.00 78.66  ? 29   DA  I "O3'" 1 
ATOM 6535  C "C2'" . DA  I 5 29  ? 215.948 186.615 140.139 1.00 81.04  ? 29   DA  I "C2'" 1 
ATOM 6536  C "C1'" . DA  I 5 29  ? 216.967 187.708 139.923 1.00 85.22  ? 29   DA  I "C1'" 1 
ATOM 6537  N N9    . DA  I 5 29  ? 218.195 187.226 139.317 1.00 96.25  ? 29   DA  I N9    1 
ATOM 6538  C C8    . DA  I 5 29  ? 219.056 186.314 139.832 1.00 92.36  ? 29   DA  I C8    1 
ATOM 6539  N N7    . DA  I 5 29  ? 220.069 186.052 139.055 1.00 89.06  ? 29   DA  I N7    1 
ATOM 6540  C C5    . DA  I 5 29  ? 219.842 186.832 137.942 1.00 93.66  ? 29   DA  I C5    1 
ATOM 6541  C C6    . DA  I 5 29  ? 220.559 187.004 136.751 1.00 92.23  ? 29   DA  I C6    1 
ATOM 6542  N N6    . DA  I 5 29  ? 221.694 186.358 136.484 1.00 93.63  ? 29   DA  I N6    1 
ATOM 6543  N N1    . DA  I 5 29  ? 220.072 187.864 135.843 1.00 95.81  ? 29   DA  I N1    1 
ATOM 6544  C C2    . DA  I 5 29  ? 218.935 188.496 136.123 1.00 94.04  ? 29   DA  I C2    1 
ATOM 6545  N N3    . DA  I 5 29  ? 218.174 188.409 137.207 1.00 101.55 ? 29   DA  I N3    1 
ATOM 6546  C C4    . DA  I 5 29  ? 218.695 187.561 138.088 1.00 100.59 ? 29   DA  I C4    1 
ATOM 6547  P P     . DA  I 5 30  ? 212.863 187.646 139.706 1.00 86.67  ? 30   DA  I P     1 
ATOM 6548  O OP1   . DA  I 5 30  ? 212.121 188.826 139.235 1.00 80.01  ? 30   DA  I OP1   1 
ATOM 6549  O OP2   . DA  I 5 30  ? 212.233 186.685 140.627 1.00 84.75  ? 30   DA  I OP2   1 
ATOM 6550  O "O5'" . DA  I 5 30  ? 213.400 186.829 138.452 1.00 71.86  ? 30   DA  I "O5'" 1 
ATOM 6551  C "C5'" . DA  I 5 30  ? 212.534 186.544 137.371 1.00 78.42  ? 30   DA  I "C5'" 1 
ATOM 6552  C "C4'" . DA  I 5 30  ? 212.569 187.668 136.360 1.00 84.55  ? 30   DA  I "C4'" 1 
ATOM 6553  O "O4'" . DA  I 5 30  ? 213.832 188.345 136.464 1.00 92.58  ? 30   DA  I "O4'" 1 
ATOM 6554  C "C3'" . DA  I 5 30  ? 212.398 187.237 134.906 1.00 81.74  ? 30   DA  I "C3'" 1 
ATOM 6555  O "O3'" . DA  I 5 30  ? 211.300 187.922 134.326 1.00 88.62  ? 30   DA  I "O3'" 1 
ATOM 6556  C "C2'" . DA  I 5 30  ? 213.707 187.620 134.219 1.00 76.88  ? 30   DA  I "C2'" 1 
ATOM 6557  C "C1'" . DA  I 5 30  ? 214.621 188.071 135.344 1.00 85.51  ? 30   DA  I "C1'" 1 
ATOM 6558  N N9    . DA  I 5 30  ? 215.659 187.112 135.703 1.00 87.23  ? 30   DA  I N9    1 
ATOM 6559  C C8    . DA  I 5 30  ? 215.833 186.487 136.894 1.00 87.83  ? 30   DA  I C8    1 
ATOM 6560  N N7    . DA  I 5 30  ? 216.870 185.695 136.926 1.00 93.89  ? 30   DA  I N7    1 
ATOM 6561  C C5    . DA  I 5 30  ? 217.411 185.821 135.671 1.00 93.28  ? 30   DA  I C5    1 
ATOM 6562  C C6    . DA  I 5 30  ? 218.529 185.248 135.072 1.00 92.51  ? 30   DA  I C6    1 
ATOM 6563  N N6    . DA  I 5 30  ? 219.326 184.397 135.700 1.00 99.36  ? 30   DA  I N6    1 
ATOM 6564  N N1    . DA  I 5 30  ? 218.808 185.594 133.803 1.00 92.31  ? 30   DA  I N1    1 
ATOM 6565  C C2    . DA  I 5 30  ? 217.994 186.443 133.193 1.00 89.50  ? 30   DA  I C2    1 
ATOM 6566  N N3    . DA  I 5 30  ? 216.918 187.048 133.658 1.00 95.98  ? 30   DA  I N3    1 
ATOM 6567  C C4    . DA  I 5 30  ? 216.682 186.692 134.912 1.00 95.24  ? 30   DA  I C4    1 
ATOM 6568  P P     . DT  I 5 31  ? 210.488 187.262 133.111 1.00 87.48  ? 31   DT  I P     1 
ATOM 6569  O OP1   . DT  I 5 31  ? 209.520 188.245 132.591 1.00 66.26  ? 31   DT  I OP1   1 
ATOM 6570  O OP2   . DT  I 5 31  ? 210.032 185.939 133.558 1.00 71.99  ? 31   DT  I OP2   1 
ATOM 6571  O "O5'" . DT  I 5 31  ? 211.583 187.072 131.978 1.00 119.85 ? 31   DT  I "O5'" 1 
ATOM 6572  C "C5'" . DT  I 5 31  ? 212.041 188.202 131.273 1.00 102.88 ? 31   DT  I "C5'" 1 
ATOM 6573  C "C4'" . DT  I 5 31  ? 213.074 187.813 130.240 1.00 84.75  ? 31   DT  I "C4'" 1 
ATOM 6574  O "O4'" . DT  I 5 31  ? 214.252 187.270 130.891 1.00 89.59  ? 31   DT  I "O4'" 1 
ATOM 6575  C "C3'" . DT  I 5 31  ? 212.612 186.758 129.254 1.00 77.55  ? 31   DT  I "C3'" 1 
ATOM 6576  O "O3'" . DT  I 5 31  ? 213.024 187.120 127.973 1.00 88.17  ? 31   DT  I "O3'" 1 
ATOM 6577  C "C2'" . DT  I 5 31  ? 213.328 185.508 129.732 1.00 77.19  ? 31   DT  I "C2'" 1 
ATOM 6578  C "C1'" . DT  I 5 31  ? 214.626 186.083 130.250 1.00 83.81  ? 31   DT  I "C1'" 1 
ATOM 6579  N N1    . DT  I 5 31  ? 215.288 185.220 131.246 1.00 81.73  ? 31   DT  I N1    1 
ATOM 6580  C C2    . DT  I 5 31  ? 216.475 184.607 130.944 1.00 91.24  ? 31   DT  I C2    1 
ATOM 6581  O O2    . DT  I 5 31  ? 217.033 184.730 129.876 1.00 87.91  ? 31   DT  I O2    1 
ATOM 6582  N N3    . DT  I 5 31  ? 216.987 183.833 131.946 1.00 105.20 ? 31   DT  I N3    1 
ATOM 6583  C C4    . DT  I 5 31  ? 216.444 183.629 133.185 1.00 118.10 ? 31   DT  I C4    1 
ATOM 6584  O O4    . DT  I 5 31  ? 216.970 182.921 134.023 1.00 123.56 ? 31   DT  I O4    1 
ATOM 6585  C C5    . DT  I 5 31  ? 215.207 184.297 133.428 1.00 116.10 ? 31   DT  I C5    1 
ATOM 6586  C C7    . DT  I 5 31  ? 214.518 184.139 134.742 1.00 120.86 ? 31   DT  I C7    1 
ATOM 6587  C C6    . DT  I 5 31  ? 214.695 185.047 132.458 1.00 97.63  ? 31   DT  I C6    1 
ATOM 6588  P P     . DT  I 5 32  ? 212.235 186.575 126.692 1.00 114.83 ? 32   DT  I P     1 
ATOM 6589  O OP1   . DT  I 5 32  ? 211.818 187.754 125.915 1.00 117.79 ? 32   DT  I OP1   1 
ATOM 6590  O OP2   . DT  I 5 32  ? 211.247 185.584 127.155 1.00 111.59 ? 32   DT  I OP2   1 
ATOM 6591  O "O5'" . DT  I 5 32  ? 213.355 185.797 125.876 1.00 102.13 ? 32   DT  I "O5'" 1 
ATOM 6592  C "C5'" . DT  I 5 32  ? 214.511 185.367 126.549 1.00 100.54 ? 32   DT  I "C5'" 1 
ATOM 6593  C "C4'" . DT  I 5 32  ? 215.593 185.004 125.576 1.00 105.46 ? 32   DT  I "C4'" 1 
ATOM 6594  O "O4'" . DT  I 5 32  ? 216.613 184.258 126.268 1.00 105.98 ? 32   DT  I "O4'" 1 
ATOM 6595  C "C3'" . DT  I 5 32  ? 215.142 184.088 124.473 1.00 116.25 ? 32   DT  I "C3'" 1 
ATOM 6596  O "O3'" . DT  I 5 32  ? 216.064 184.153 123.415 1.00 136.91 ? 32   DT  I "O3'" 1 
ATOM 6597  C "C2'" . DT  I 5 32  ? 215.181 182.740 125.170 1.00 107.52 ? 32   DT  I "C2'" 1 
ATOM 6598  C "C1'" . DT  I 5 32  ? 216.413 182.878 126.057 1.00 104.25 ? 32   DT  I "C1'" 1 
ATOM 6599  N N1    . DT  I 5 32  ? 216.263 182.232 127.374 1.00 102.57 ? 32   DT  I N1    1 
ATOM 6600  C C2    . DT  I 5 32  ? 217.253 181.405 127.834 1.00 104.66 ? 32   DT  I C2    1 
ATOM 6601  O O2    . DT  I 5 32  ? 218.260 181.160 127.206 1.00 105.90 ? 32   DT  I O2    1 
ATOM 6602  N N3    . DT  I 5 32  ? 217.016 180.860 129.058 1.00 105.05 ? 32   DT  I N3    1 
ATOM 6603  C C4    . DT  I 5 32  ? 215.924 181.063 129.852 1.00 106.42 ? 32   DT  I C4    1 
ATOM 6604  O O4    . DT  I 5 32  ? 215.798 180.531 130.936 1.00 107.58 ? 32   DT  I O4    1 
ATOM 6605  C C5    . DT  I 5 32  ? 214.930 181.936 129.319 1.00 101.43 ? 32   DT  I C5    1 
ATOM 6606  C C7    . DT  I 5 32  ? 213.697 182.212 130.110 1.00 101.07 ? 32   DT  I C7    1 
ATOM 6607  C C6    . DT  I 5 32  ? 215.139 182.474 128.117 1.00 99.36  ? 32   DT  I C6    1 
ATOM 6608  P P     . DG  I 5 33  ? 215.786 183.366 122.047 1.00 145.59 ? 33   DG  I P     1 
ATOM 6609  O OP1   . DG  I 5 33  ? 216.529 184.066 120.979 1.00 142.19 ? 33   DG  I OP1   1 
ATOM 6610  O OP2   . DG  I 5 33  ? 214.330 183.157 121.926 1.00 144.24 ? 33   DG  I OP2   1 
ATOM 6611  O "O5'" . DG  I 5 33  ? 216.471 181.952 122.295 1.00 111.35 ? 33   DG  I "O5'" 1 
ATOM 6612  C "C5'" . DG  I 5 33  ? 217.824 181.901 122.692 1.00 124.67 ? 33   DG  I "C5'" 1 
ATOM 6613  C "C4'" . DG  I 5 33  ? 218.193 180.510 123.142 1.00 139.47 ? 33   DG  I "C4'" 1 
ATOM 6614  O "O4'" . DG  I 5 33  ? 217.808 180.335 124.521 1.00 141.80 ? 33   DG  I "O4'" 1 
ATOM 6615  C "C3'" . DG  I 5 33  ? 217.508 179.385 122.360 1.00 150.41 ? 33   DG  I "C3'" 1 
ATOM 6616  O "O3'" . DG  I 5 33  ? 218.479 178.483 121.854 1.00 163.62 ? 33   DG  I "O3'" 1 
ATOM 6617  C "C2'" . DG  I 5 33  ? 216.612 178.717 123.399 1.00 143.48 ? 33   DG  I "C2'" 1 
ATOM 6618  C "C1'" . DG  I 5 33  ? 217.356 179.027 124.679 1.00 141.74 ? 33   DG  I "C1'" 1 
ATOM 6619  N N9    . DG  I 5 33  ? 216.516 178.955 125.855 1.00 136.05 ? 33   DG  I N9    1 
ATOM 6620  C C8    . DG  I 5 33  ? 215.327 179.597 126.063 1.00 136.88 ? 33   DG  I C8    1 
ATOM 6621  N N7    . DG  I 5 33  ? 214.792 179.330 127.215 1.00 134.45 ? 33   DG  I N7    1 
ATOM 6622  C C5    . DG  I 5 33  ? 215.678 178.441 127.795 1.00 130.04 ? 33   DG  I C5    1 
ATOM 6623  C C6    . DG  I 5 33  ? 215.626 177.798 129.040 1.00 132.12 ? 33   DG  I C6    1 
ATOM 6624  O O6    . DG  I 5 33  ? 214.760 177.883 129.909 1.00 141.38 ? 33   DG  I O6    1 
ATOM 6625  N N1    . DG  I 5 33  ? 216.720 176.976 129.236 1.00 117.56 ? 33   DG  I N1    1 
ATOM 6626  C C2    . DG  I 5 33  ? 217.740 176.807 128.346 1.00 106.84 ? 33   DG  I C2    1 
ATOM 6627  N N2    . DG  I 5 33  ? 218.712 175.973 128.717 1.00 109.98 ? 33   DG  I N2    1 
ATOM 6628  N N3    . DG  I 5 33  ? 217.801 177.401 127.172 1.00 108.55 ? 33   DG  I N3    1 
ATOM 6629  C C4    . DG  I 5 33  ? 216.746 178.211 126.973 1.00 122.69 ? 33   DG  I C4    1 
ATOM 6630  P P     . DG  I 5 34  ? 218.337 177.898 120.366 1.00 146.84 ? 34   DG  I P     1 
ATOM 6631  O OP1   . DG  I 5 34  ? 219.469 178.396 119.560 1.00 145.93 ? 34   DG  I OP1   1 
ATOM 6632  O OP2   . DG  I 5 34  ? 216.955 178.151 119.923 1.00 139.83 ? 34   DG  I OP2   1 
ATOM 6633  O "O5'" . DG  I 5 34  ? 218.479 176.323 120.557 1.00 130.26 ? 34   DG  I "O5'" 1 
ATOM 6634  C "C5'" . DG  I 5 34  ? 217.482 175.610 121.262 1.00 128.72 ? 34   DG  I "C5'" 1 
ATOM 6635  C "C4'" . DG  I 5 34  ? 218.074 174.933 122.476 1.00 130.81 ? 34   DG  I "C4'" 1 
ATOM 6636  O "O4'" . DG  I 5 34  ? 217.719 175.668 123.655 1.00 136.12 ? 34   DG  I "O4'" 1 
ATOM 6637  C "C3'" . DG  I 5 34  ? 217.561 173.537 122.724 1.00 134.05 ? 34   DG  I "C3'" 1 
ATOM 6638  O "O3'" . DG  I 5 34  ? 218.371 172.625 122.028 1.00 134.96 ? 34   DG  I "O3'" 1 
ATOM 6639  C "C2'" . DG  I 5 34  ? 217.710 173.366 124.240 1.00 139.01 ? 34   DG  I "C2'" 1 
ATOM 6640  C "C1'" . DG  I 5 34  ? 217.726 174.803 124.770 1.00 140.67 ? 34   DG  I "C1'" 1 
ATOM 6641  N N9    . DG  I 5 34  ? 216.581 175.139 125.598 1.00 142.14 ? 34   DG  I N9    1 
ATOM 6642  C C8    . DG  I 5 34  ? 215.624 176.071 125.315 1.00 135.50 ? 34   DG  I C8    1 
ATOM 6643  N N7    . DG  I 5 34  ? 214.715 176.173 126.231 1.00 131.89 ? 34   DG  I N7    1 
ATOM 6644  C C5    . DG  I 5 34  ? 215.088 175.245 127.182 1.00 141.41 ? 34   DG  I C5    1 
ATOM 6645  C C6    . DG  I 5 34  ? 214.469 174.907 128.394 1.00 146.18 ? 34   DG  I C6    1 
ATOM 6646  O O6    . DG  I 5 34  ? 213.443 175.385 128.881 1.00 141.66 ? 34   DG  I O6    1 
ATOM 6647  N N1    . DG  I 5 34  ? 215.159 173.914 129.062 1.00 149.05 ? 34   DG  I N1    1 
ATOM 6648  C C2    . DG  I 5 34  ? 216.307 173.316 128.611 1.00 146.70 ? 34   DG  I C2    1 
ATOM 6649  N N2    . DG  I 5 34  ? 216.828 172.374 129.402 1.00 142.20 ? 34   DG  I N2    1 
ATOM 6650  N N3    . DG  I 5 34  ? 216.901 173.622 127.469 1.00 147.44 ? 34   DG  I N3    1 
ATOM 6651  C C4    . DG  I 5 34  ? 216.233 174.593 126.808 1.00 144.71 ? 34   DG  I C4    1 
ATOM 6652  P P     . DT  I 5 35  ? 217.743 171.258 121.481 1.00 156.52 ? 35   DT  I P     1 
ATOM 6653  O OP1   . DT  I 5 35  ? 218.812 170.472 120.833 1.00 153.88 ? 35   DT  I OP1   1 
ATOM 6654  O OP2   . DT  I 5 35  ? 216.532 171.625 120.724 1.00 156.23 ? 35   DT  I OP2   1 
ATOM 6655  O "O5'" . DT  I 5 35  ? 217.293 170.500 122.809 1.00 160.84 ? 35   DT  I "O5'" 1 
ATOM 6656  C "C5'" . DT  I 5 35  ? 217.195 169.100 122.812 1.00 158.80 ? 35   DT  I "C5'" 1 
ATOM 6657  C "C4'" . DT  I 5 35  ? 217.536 168.549 124.175 1.00 152.24 ? 35   DT  I "C4'" 1 
ATOM 6658  O "O4'" . DT  I 5 35  ? 217.026 169.449 125.193 1.00 151.42 ? 35   DT  I "O4'" 1 
ATOM 6659  C "C3'" . DT  I 5 35  ? 216.892 167.216 124.480 1.00 151.37 ? 35   DT  I "C3'" 1 
ATOM 6660  O "O3'" . DT  I 5 35  ? 217.618 166.558 125.495 1.00 152.52 ? 35   DT  I "O3'" 1 
ATOM 6661  C "C2'" . DT  I 5 35  ? 215.534 167.663 124.984 1.00 153.38 ? 35   DT  I "C2'" 1 
ATOM 6662  C "C1'" . DT  I 5 35  ? 215.950 168.827 125.864 1.00 152.21 ? 35   DT  I "C1'" 1 
ATOM 6663  N N1    . DT  I 5 35  ? 214.896 169.821 126.070 1.00 148.40 ? 35   DT  I N1    1 
ATOM 6664  C C2    . DT  I 5 35  ? 213.916 169.577 126.992 1.00 145.31 ? 35   DT  I C2    1 
ATOM 6665  O O2    . DT  I 5 35  ? 213.861 168.563 127.656 1.00 144.06 ? 35   DT  I O2    1 
ATOM 6666  N N3    . DT  I 5 35  ? 212.995 170.567 127.115 1.00 143.06 ? 35   DT  I N3    1 
ATOM 6667  C C4    . DT  I 5 35  ? 212.961 171.754 126.424 1.00 142.67 ? 35   DT  I C4    1 
ATOM 6668  O O4    . DT  I 5 35  ? 212.090 172.590 126.604 1.00 141.78 ? 35   DT  I O4    1 
ATOM 6669  C C5    . DT  I 5 35  ? 214.019 171.944 125.476 1.00 141.68 ? 35   DT  I C5    1 
ATOM 6670  C C7    . DT  I 5 35  ? 214.079 173.194 124.661 1.00 141.05 ? 35   DT  I C7    1 
ATOM 6671  C C6    . DT  I 5 35  ? 214.926 170.980 125.347 1.00 144.20 ? 35   DT  I C6    1 
ATOM 6672  P P     . DC  I 5 36  ? 217.390 164.991 125.748 1.00 151.86 ? 36   DC  I P     1 
ATOM 6673  O OP1   . DC  I 5 36  ? 218.554 164.493 126.510 1.00 148.77 ? 36   DC  I OP1   1 
ATOM 6674  O OP2   . DC  I 5 36  ? 217.030 164.393 124.448 1.00 146.57 ? 36   DC  I OP2   1 
ATOM 6675  O "O5'" . DC  I 5 36  ? 216.087 164.922 126.672 1.00 169.10 ? 36   DC  I "O5'" 1 
ATOM 6676  C "C5'" . DC  I 5 36  ? 216.159 165.316 128.034 1.00 163.19 ? 36   DC  I "C5'" 1 
ATOM 6677  C "C4'" . DC  I 5 36  ? 214.948 164.837 128.814 1.00 153.43 ? 36   DC  I "C4'" 1 
ATOM 6678  O "O4'" . DC  I 5 36  ? 213.898 165.828 128.736 1.00 148.02 ? 36   DC  I "O4'" 1 
ATOM 6679  C "C3'" . DC  I 5 36  ? 214.313 163.547 128.315 1.00 148.01 ? 36   DC  I "C3'" 1 
ATOM 6680  O "O3'" . DC  I 5 36  ? 213.683 162.896 129.396 1.00 150.58 ? 36   DC  I "O3'" 1 
ATOM 6681  C "C2'" . DC  I 5 36  ? 213.277 164.074 127.344 1.00 139.52 ? 36   DC  I "C2'" 1 
ATOM 6682  C "C1'" . DC  I 5 36  ? 212.760 165.247 128.145 1.00 138.59 ? 36   DC  I "C1'" 1 
ATOM 6683  N N1    . DC  I 5 36  ? 212.112 166.263 127.349 1.00 134.12 ? 36   DC  I N1    1 
ATOM 6684  C C2    . DC  I 5 36  ? 211.132 167.039 127.932 1.00 129.85 ? 36   DC  I C2    1 
ATOM 6685  O O2    . DC  I 5 36  ? 210.830 166.833 129.106 1.00 127.84 ? 36   DC  I O2    1 
ATOM 6686  N N3    . DC  I 5 36  ? 210.540 168.000 127.204 1.00 131.80 ? 36   DC  I N3    1 
ATOM 6687  C C4    . DC  I 5 36  ? 210.900 168.188 125.937 1.00 137.34 ? 36   DC  I C4    1 
ATOM 6688  N N4    . DC  I 5 36  ? 210.283 169.148 125.254 1.00 140.96 ? 36   DC  I N4    1 
ATOM 6689  C C5    . DC  I 5 36  ? 211.907 167.402 125.321 1.00 136.26 ? 36   DC  I C5    1 
ATOM 6690  C C6    . DC  I 5 36  ? 212.481 166.456 126.060 1.00 136.64 ? 36   DC  I C6    1 
ATOM 6691  P P     . DG  I 5 37  ? 214.200 161.462 129.892 1.00 143.83 ? 37   DG  I P     1 
ATOM 6692  O OP1   . DG  I 5 37  ? 215.514 161.654 130.533 1.00 143.63 ? 37   DG  I OP1   1 
ATOM 6693  O OP2   . DG  I 5 37  ? 214.016 160.505 128.781 1.00 137.81 ? 37   DG  I OP2   1 
ATOM 6694  O "O5'" . DG  I 5 37  ? 213.190 161.081 131.053 1.00 143.94 ? 37   DG  I "O5'" 1 
ATOM 6695  C "C5'" . DG  I 5 37  ? 213.075 161.928 132.165 1.00 136.35 ? 37   DG  I "C5'" 1 
ATOM 6696  C "C4'" . DG  I 5 37  ? 211.644 162.372 132.335 1.00 126.79 ? 37   DG  I "C4'" 1 
ATOM 6697  O "O4'" . DG  I 5 37  ? 211.286 163.225 131.242 1.00 123.40 ? 37   DG  I "O4'" 1 
ATOM 6698  C "C3'" . DG  I 5 37  ? 210.631 161.234 132.334 1.00 123.32 ? 37   DG  I "C3'" 1 
ATOM 6699  O "O3'" . DG  I 5 37  ? 210.072 161.108 133.623 1.00 124.49 ? 37   DG  I "O3'" 1 
ATOM 6700  C "C2'" . DG  I 5 37  ? 209.584 161.634 131.286 1.00 120.70 ? 37   DG  I "C2'" 1 
ATOM 6701  C "C1'" . DG  I 5 37  ? 209.926 163.079 130.972 1.00 123.54 ? 37   DG  I "C1'" 1 
ATOM 6702  N N9    . DG  I 5 37  ? 209.732 163.430 129.582 1.00 131.43 ? 37   DG  I N9    1 
ATOM 6703  C C8    . DG  I 5 37  ? 210.369 162.889 128.504 1.00 135.26 ? 37   DG  I C8    1 
ATOM 6704  N N7    . DG  I 5 37  ? 210.010 163.418 127.375 1.00 138.94 ? 37   DG  I N7    1 
ATOM 6705  C C5    . DG  I 5 37  ? 209.088 164.383 127.734 1.00 139.40 ? 37   DG  I C5    1 
ATOM 6706  C C6    . DG  I 5 37  ? 208.354 165.280 126.937 1.00 139.59 ? 37   DG  I C6    1 
ATOM 6707  O O6    . DG  I 5 37  ? 208.376 165.412 125.713 1.00 149.44 ? 37   DG  I O6    1 
ATOM 6708  N N1    . DG  I 5 37  ? 207.531 166.088 127.695 1.00 126.96 ? 37   DG  I N1    1 
ATOM 6709  C C2    . DG  I 5 37  ? 207.426 166.032 129.051 1.00 121.37 ? 37   DG  I C2    1 
ATOM 6710  N N2    . DG  I 5 37  ? 206.580 166.898 129.610 1.00 112.94 ? 37   DG  I N2    1 
ATOM 6711  N N3    . DG  I 5 37  ? 208.105 165.195 129.813 1.00 128.21 ? 37   DG  I N3    1 
ATOM 6712  C C4    . DG  I 5 37  ? 208.912 164.404 129.088 1.00 134.77 ? 37   DG  I C4    1 
ATOM 6713  P P     . DT  I 5 38  ? 208.917 160.035 133.912 1.00 114.30 ? 38   DT  I P     1 
ATOM 6714  O OP1   . DT  I 5 38  ? 209.046 159.617 135.320 1.00 112.02 ? 38   DT  I OP1   1 
ATOM 6715  O OP2   . DT  I 5 38  ? 208.901 159.033 132.831 1.00 109.97 ? 38   DT  I OP2   1 
ATOM 6716  O "O5'" . DT  I 5 38  ? 207.598 160.897 133.792 1.00 121.24 ? 38   DT  I "O5'" 1 
ATOM 6717  C "C5'" . DT  I 5 38  ? 207.592 162.204 134.299 1.00 111.73 ? 38   DT  I "C5'" 1 
ATOM 6718  C "C4'" . DT  I 5 38  ? 206.329 162.919 133.901 1.00 109.59 ? 38   DT  I "C4'" 1 
ATOM 6719  O "O4'" . DT  I 5 38  ? 206.433 163.392 132.531 1.00 114.36 ? 38   DT  I "O4'" 1 
ATOM 6720  C "C3'" . DT  I 5 38  ? 205.086 162.054 133.924 1.00 107.66 ? 38   DT  I "C3'" 1 
ATOM 6721  O "O3'" . DT  I 5 38  ? 204.013 162.860 134.257 1.00 103.26 ? 38   DT  I "O3'" 1 
ATOM 6722  C "C2'" . DT  I 5 38  ? 204.992 161.624 132.470 1.00 111.76 ? 38   DT  I "C2'" 1 
ATOM 6723  C "C1'" . DT  I 5 38  ? 205.300 162.950 131.835 1.00 112.73 ? 38   DT  I "C1'" 1 
ATOM 6724  N N1    . DT  I 5 38  ? 205.617 162.877 130.430 1.00 117.20 ? 38   DT  I N1    1 
ATOM 6725  C C2    . DT  I 5 38  ? 205.003 163.740 129.567 1.00 119.89 ? 38   DT  I C2    1 
ATOM 6726  O O2    . DT  I 5 38  ? 204.191 164.563 129.923 1.00 118.39 ? 38   DT  I O2    1 
ATOM 6727  N N3    . DT  I 5 38  ? 205.374 163.606 128.264 1.00 124.65 ? 38   DT  I N3    1 
ATOM 6728  C C4    . DT  I 5 38  ? 206.281 162.710 127.761 1.00 128.31 ? 38   DT  I C4    1 
ATOM 6729  O O4    . DT  I 5 38  ? 206.544 162.652 126.572 1.00 129.55 ? 38   DT  I O4    1 
ATOM 6730  C C5    . DT  I 5 38  ? 206.884 161.831 128.728 1.00 124.91 ? 38   DT  I C5    1 
ATOM 6731  C C7    . DT  I 5 38  ? 207.878 160.805 128.294 1.00 116.68 ? 38   DT  I C7    1 
ATOM 6732  C C6    . DT  I 5 38  ? 206.526 161.959 130.000 1.00 122.43 ? 38   DT  I C6    1 
ATOM 6733  P P     . DA  I 5 39  ? 203.404 162.843 135.734 1.00 107.43 ? 39   DA  I P     1 
ATOM 6734  O OP1   . DA  I 5 39  ? 204.330 163.593 136.598 1.00 103.10 ? 39   DA  I OP1   1 
ATOM 6735  O OP2   . DA  I 5 39  ? 203.050 161.452 136.062 1.00 108.12 ? 39   DA  I OP2   1 
ATOM 6736  O "O5'" . DA  I 5 39  ? 202.055 163.671 135.582 1.00 94.85  ? 39   DA  I "O5'" 1 
ATOM 6737  C "C5'" . DA  I 5 39  ? 201.951 164.934 136.167 1.00 94.80  ? 39   DA  I "C5'" 1 
ATOM 6738  C "C4'" . DA  I 5 39  ? 201.142 165.882 135.308 1.00 92.97  ? 39   DA  I "C4'" 1 
ATOM 6739  O "O4'" . DA  I 5 39  ? 201.485 165.714 133.916 1.00 89.54  ? 39   DA  I "O4'" 1 
ATOM 6740  C "C3'" . DA  I 5 39  ? 199.652 165.699 135.347 1.00 92.69  ? 39   DA  I "C3'" 1 
ATOM 6741  O "O3'" . DA  I 5 39  ? 199.076 166.895 134.926 1.00 94.91  ? 39   DA  I "O3'" 1 
ATOM 6742  C "C2'" . DA  I 5 39  ? 199.470 164.613 134.306 1.00 91.87  ? 39   DA  I "C2'" 1 
ATOM 6743  C "C1'" . DA  I 5 39  ? 200.409 165.108 133.224 1.00 91.10  ? 39   DA  I "C1'" 1 
ATOM 6744  N N9    . DA  I 5 39  ? 200.991 164.064 132.404 1.00 97.01  ? 39   DA  I N9    1 
ATOM 6745  C C8    . DA  I 5 39  ? 201.714 163.016 132.846 1.00 93.48  ? 39   DA  I C8    1 
ATOM 6746  N N7    . DA  I 5 39  ? 202.174 162.253 131.904 1.00 95.79  ? 39   DA  I N7    1 
ATOM 6747  C C5    . DA  I 5 39  ? 201.748 162.852 130.758 1.00 102.40 ? 39   DA  I C5    1 
ATOM 6748  C C6    . DA  I 5 39  ? 201.935 162.522 129.428 1.00 112.41 ? 39   DA  I C6    1 
ATOM 6749  N N6    . DA  I 5 39  ? 202.599 161.441 129.049 1.00 114.97 ? 39   DA  I N6    1 
ATOM 6750  N N1    . DA  I 5 39  ? 201.364 163.298 128.505 1.00 109.63 ? 39   DA  I N1    1 
ATOM 6751  C C2    . DA  I 5 39  ? 200.677 164.365 128.913 1.00 99.29  ? 39   DA  I C2    1 
ATOM 6752  N N3    . DA  I 5 39  ? 200.446 164.787 130.152 1.00 99.28  ? 39   DA  I N3    1 
ATOM 6753  C C4    . DA  I 5 39  ? 201.022 163.979 131.034 1.00 101.09 ? 39   DA  I C4    1 
ATOM 6754  P P     . DG  I 5 40  ? 197.527 167.190 135.166 1.00 83.87  ? 40   DG  I P     1 
ATOM 6755  O OP1   . DG  I 5 40  ? 197.438 168.210 136.228 1.00 72.45  ? 40   DG  I OP1   1 
ATOM 6756  O OP2   . DG  I 5 40  ? 196.833 165.901 135.308 1.00 88.26  ? 40   DG  I OP2   1 
ATOM 6757  O "O5'" . DG  I 5 40  ? 197.065 167.807 133.781 1.00 84.88  ? 40   DG  I "O5'" 1 
ATOM 6758  C "C5'" . DG  I 5 40  ? 197.545 167.242 132.591 1.00 97.20  ? 40   DG  I "C5'" 1 
ATOM 6759  C "C4'" . DG  I 5 40  ? 196.464 167.215 131.541 1.00 103.80 ? 40   DG  I "C4'" 1 
ATOM 6760  O "O4'" . DG  I 5 40  ? 196.785 166.207 130.562 1.00 101.77 ? 40   DG  I "O4'" 1 
ATOM 6761  C "C3'" . DG  I 5 40  ? 195.123 166.777 132.050 1.00 108.69 ? 40   DG  I "C3'" 1 
ATOM 6762  O "O3'" . DG  I 5 40  ? 194.160 166.978 131.040 1.00 107.08 ? 40   DG  I "O3'" 1 
ATOM 6763  C "C2'" . DG  I 5 40  ? 195.400 165.295 132.214 1.00 103.90 ? 40   DG  I "C2'" 1 
ATOM 6764  C "C1'" . DG  I 5 40  ? 196.092 165.019 130.885 1.00 104.93 ? 40   DG  I "C1'" 1 
ATOM 6765  N N9    . DG  I 5 40  ? 197.060 163.943 130.914 1.00 111.36 ? 40   DG  I N9    1 
ATOM 6766  C C8    . DG  I 5 40  ? 197.670 163.411 132.003 1.00 118.88 ? 40   DG  I C8    1 
ATOM 6767  N N7    . DG  I 5 40  ? 198.522 162.479 131.715 1.00 121.81 ? 40   DG  I N7    1 
ATOM 6768  C C5    . DG  I 5 40  ? 198.465 162.391 130.346 1.00 118.08 ? 40   DG  I C5    1 
ATOM 6769  C C6    . DG  I 5 40  ? 199.153 161.547 129.478 1.00 118.52 ? 40   DG  I C6    1 
ATOM 6770  O O6    . DG  I 5 40  ? 199.983 160.693 129.756 1.00 120.13 ? 40   DG  I O6    1 
ATOM 6771  N N1    . DG  I 5 40  ? 198.817 161.776 128.155 1.00 118.15 ? 40   DG  I N1    1 
ATOM 6772  C C2    . DG  I 5 40  ? 197.906 162.712 127.741 1.00 115.60 ? 40   DG  I C2    1 
ATOM 6773  N N2    . DG  I 5 40  ? 197.698 162.799 126.427 1.00 112.71 ? 40   DG  I N2    1 
ATOM 6774  N N3    . DG  I 5 40  ? 197.247 163.509 128.555 1.00 117.04 ? 40   DG  I N3    1 
ATOM 6775  C C4    . DG  I 5 40  ? 197.576 163.288 129.838 1.00 114.04 ? 40   DG  I C4    1 
ATOM 6776  P P     . DA  I 5 41  ? 193.647 168.447 130.643 1.00 117.61 ? 41   DA  I P     1 
ATOM 6777  O OP1   . DA  I 5 41  ? 194.627 169.483 131.016 1.00 108.15 ? 41   DA  I OP1   1 
ATOM 6778  O OP2   . DA  I 5 41  ? 192.282 168.542 131.182 1.00 115.59 ? 41   DA  I OP2   1 
ATOM 6779  O "O5'" . DA  I 5 41  ? 193.544 168.379 129.048 1.00 122.23 ? 41   DA  I "O5'" 1 
ATOM 6780  C "C5'" . DA  I 5 41  ? 194.320 167.420 128.334 1.00 119.52 ? 41   DA  I "C5'" 1 
ATOM 6781  C "C4'" . DA  I 5 41  ? 193.976 167.422 126.859 1.00 115.22 ? 41   DA  I "C4'" 1 
ATOM 6782  O "O4'" . DA  I 5 41  ? 194.352 166.162 126.266 1.00 111.31 ? 41   DA  I "O4'" 1 
ATOM 6783  C "C3'" . DA  I 5 41  ? 192.515 167.514 126.549 1.00 122.52 ? 41   DA  I "C3'" 1 
ATOM 6784  O "O3'" . DA  I 5 41  ? 192.377 167.859 125.183 1.00 136.61 ? 41   DA  I "O3'" 1 
ATOM 6785  C "C2'" . DA  I 5 41  ? 192.064 166.080 126.827 1.00 113.92 ? 41   DA  I "C2'" 1 
ATOM 6786  C "C1'" . DA  I 5 41  ? 193.270 165.255 126.367 1.00 106.22 ? 41   DA  I "C1'" 1 
ATOM 6787  N N9    . DA  I 5 41  ? 193.692 164.230 127.304 1.00 96.51  ? 41   DA  I N9    1 
ATOM 6788  C C8    . DA  I 5 41  ? 193.661 164.305 128.655 1.00 99.45  ? 41   DA  I C8    1 
ATOM 6789  N N7    . DA  I 5 41  ? 194.160 163.261 129.252 1.00 105.33 ? 41   DA  I N7    1 
ATOM 6790  C C5    . DA  I 5 41  ? 194.568 162.454 128.226 1.00 107.13 ? 41   DA  I C5    1 
ATOM 6791  C C6    . DA  I 5 41  ? 195.185 161.202 128.217 1.00 115.09 ? 41   DA  I C6    1 
ATOM 6792  N N6    . DA  I 5 41  ? 195.500 160.544 129.329 1.00 119.60 ? 41   DA  I N6    1 
ATOM 6793  N N1    . DA  I 5 41  ? 195.462 160.646 127.026 1.00 113.60 ? 41   DA  I N1    1 
ATOM 6794  C C2    . DA  I 5 41  ? 195.142 161.334 125.926 1.00 113.32 ? 41   DA  I C2    1 
ATOM 6795  N N3    . DA  I 5 41  ? 194.563 162.528 125.817 1.00 112.81 ? 41   DA  I N3    1 
ATOM 6796  C C4    . DA  I 5 41  ? 194.302 163.036 127.016 1.00 103.30 ? 41   DA  I C4    1 
ATOM 6797  P P     . DC  I 5 42  ? 190.938 167.917 124.476 1.00 143.32 ? 42   DC  I P     1 
ATOM 6798  O OP1   . DC  I 5 42  ? 191.037 168.833 123.321 1.00 135.64 ? 42   DC  I OP1   1 
ATOM 6799  O OP2   . DC  I 5 42  ? 189.916 168.144 125.513 1.00 139.76 ? 42   DC  I OP2   1 
ATOM 6800  O "O5'" . DC  I 5 42  ? 190.737 166.439 123.925 1.00 131.39 ? 42   DC  I "O5'" 1 
ATOM 6801  C "C5'" . DC  I 5 42  ? 191.789 165.794 123.228 1.00 131.16 ? 42   DC  I "C5'" 1 
ATOM 6802  C "C4'" . DC  I 5 42  ? 191.342 164.430 122.769 1.00 134.81 ? 42   DC  I "C4'" 1 
ATOM 6803  O "O4'" . DC  I 5 42  ? 191.821 163.419 123.688 1.00 131.51 ? 42   DC  I "O4'" 1 
ATOM 6804  C "C3'" . DC  I 5 42  ? 189.836 164.264 122.731 1.00 139.26 ? 42   DC  I "C3'" 1 
ATOM 6805  O "O3'" . DC  I 5 42  ? 189.491 163.444 121.674 1.00 153.27 ? 42   DC  I "O3'" 1 
ATOM 6806  C "C2'" . DC  I 5 42  ? 189.541 163.592 124.059 1.00 128.57 ? 42   DC  I "C2'" 1 
ATOM 6807  C "C1'" . DC  I 5 42  ? 190.726 162.663 124.150 1.00 126.27 ? 42   DC  I "C1'" 1 
ATOM 6808  N N1    . DC  I 5 42  ? 191.021 162.215 125.513 1.00 122.81 ? 42   DC  I N1    1 
ATOM 6809  C C2    . DC  I 5 42  ? 191.548 160.952 125.710 1.00 117.28 ? 42   DC  I C2    1 
ATOM 6810  O O2    . DC  I 5 42  ? 191.748 160.237 124.730 1.00 116.79 ? 42   DC  I O2    1 
ATOM 6811  N N3    . DC  I 5 42  ? 191.833 160.551 126.961 1.00 116.06 ? 42   DC  I N3    1 
ATOM 6812  C C4    . DC  I 5 42  ? 191.604 161.361 127.982 1.00 117.30 ? 42   DC  I C4    1 
ATOM 6813  N N4    . DC  I 5 42  ? 191.897 160.921 129.202 1.00 120.58 ? 42   DC  I N4    1 
ATOM 6814  C C5    . DC  I 5 42  ? 191.058 162.654 127.802 1.00 118.64 ? 42   DC  I C5    1 
ATOM 6815  C C6    . DC  I 5 42  ? 190.781 163.034 126.560 1.00 123.14 ? 42   DC  I C6    1 
ATOM 6816  P P     . DA  I 5 43  ? 188.164 163.771 120.850 1.00 160.26 ? 43   DA  I P     1 
ATOM 6817  O OP1   . DA  I 5 43  ? 188.417 164.997 120.066 1.00 155.23 ? 43   DA  I OP1   1 
ATOM 6818  O OP2   . DA  I 5 43  ? 187.059 163.733 121.829 1.00 156.18 ? 43   DA  I OP2   1 
ATOM 6819  O "O5'" . DA  I 5 43  ? 188.004 162.522 119.878 1.00 120.25 ? 43   DA  I "O5'" 1 
ATOM 6820  C "C5'" . DA  I 5 43  ? 187.313 161.382 120.325 1.00 122.09 ? 43   DA  I "C5'" 1 
ATOM 6821  C "C4'" . DA  I 5 43  ? 188.124 160.135 120.079 1.00 128.35 ? 43   DA  I "C4'" 1 
ATOM 6822  O "O4'" . DA  I 5 43  ? 188.961 159.883 121.227 1.00 130.59 ? 43   DA  I "O4'" 1 
ATOM 6823  C "C3'" . DA  I 5 43  ? 187.304 158.881 119.961 1.00 134.92 ? 43   DA  I "C3'" 1 
ATOM 6824  O "O3'" . DA  I 5 43  ? 188.117 157.869 119.423 1.00 141.01 ? 43   DA  I "O3'" 1 
ATOM 6825  C "C2'" . DA  I 5 43  ? 186.993 158.618 121.424 1.00 134.86 ? 43   DA  I "C2'" 1 
ATOM 6826  C "C1'" . DA  I 5 43  ? 188.363 158.875 122.025 1.00 134.81 ? 43   DA  I "C1'" 1 
ATOM 6827  N N9    . DA  I 5 43  ? 188.330 159.355 123.390 1.00 135.67 ? 43   DA  I N9    1 
ATOM 6828  C C8    . DA  I 5 43  ? 187.982 160.599 123.810 1.00 132.90 ? 43   DA  I C8    1 
ATOM 6829  N N7    . DA  I 5 43  ? 188.075 160.761 125.103 1.00 132.27 ? 43   DA  I N7    1 
ATOM 6830  C C5    . DA  I 5 43  ? 188.522 159.542 125.552 1.00 132.41 ? 43   DA  I C5    1 
ATOM 6831  C C6    . DA  I 5 43  ? 188.817 159.070 126.824 1.00 127.18 ? 43   DA  I C6    1 
ATOM 6832  N N6    . DA  I 5 43  ? 188.697 159.811 127.915 1.00 127.49 ? 43   DA  I N6    1 
ATOM 6833  N N1    . DA  I 5 43  ? 189.236 157.804 126.940 1.00 119.69 ? 43   DA  I N1    1 
ATOM 6834  C C2    . DA  I 5 43  ? 189.343 157.066 125.841 1.00 119.86 ? 43   DA  I C2    1 
ATOM 6835  N N3    . DA  I 5 43  ? 189.108 157.406 124.584 1.00 130.14 ? 43   DA  I N3    1 
ATOM 6836  C C4    . DA  I 5 43  ? 188.693 158.668 124.510 1.00 134.49 ? 43   DA  I C4    1 
ATOM 6837  P P     . DG  I 5 44  ? 187.461 156.607 118.687 1.00 154.78 ? 44   DG  I P     1 
ATOM 6838  O OP1   . DG  I 5 44  ? 188.500 155.980 117.847 1.00 157.65 ? 44   DG  I OP1   1 
ATOM 6839  O OP2   . DG  I 5 44  ? 186.181 157.040 118.094 1.00 147.13 ? 44   DG  I OP2   1 
ATOM 6840  O "O5'" . DG  I 5 44  ? 187.128 155.619 119.882 1.00 144.69 ? 44   DG  I "O5'" 1 
ATOM 6841  C "C5'" . DG  I 5 44  ? 188.069 155.432 120.916 1.00 150.62 ? 44   DG  I "C5'" 1 
ATOM 6842  C "C4'" . DG  I 5 44  ? 187.406 154.754 122.082 1.00 155.74 ? 44   DG  I "C4'" 1 
ATOM 6843  O "O4'" . DG  I 5 44  ? 187.493 155.584 123.265 1.00 157.23 ? 44   DG  I "O4'" 1 
ATOM 6844  C "C3'" . DG  I 5 44  ? 185.914 154.480 121.879 1.00 155.86 ? 44   DG  I "C3'" 1 
ATOM 6845  O "O3'" . DG  I 5 44  ? 185.654 153.155 122.200 1.00 155.94 ? 44   DG  I "O3'" 1 
ATOM 6846  C "C2'" . DG  I 5 44  ? 185.250 155.422 122.874 1.00 157.64 ? 44   DG  I "C2'" 1 
ATOM 6847  C "C1'" . DG  I 5 44  ? 186.296 155.411 123.959 1.00 156.58 ? 44   DG  I "C1'" 1 
ATOM 6848  N N9    . DG  I 5 44  ? 186.142 156.446 124.969 1.00 149.62 ? 44   DG  I N9    1 
ATOM 6849  C C8    . DG  I 5 44  ? 185.763 157.746 124.783 1.00 143.94 ? 44   DG  I C8    1 
ATOM 6850  N N7    . DG  I 5 44  ? 185.705 158.422 125.891 1.00 140.46 ? 44   DG  I N7    1 
ATOM 6851  C C5    . DG  I 5 44  ? 186.055 157.505 126.864 1.00 139.47 ? 44   DG  I C5    1 
ATOM 6852  C C6    . DG  I 5 44  ? 186.163 157.656 128.254 1.00 125.53 ? 44   DG  I C6    1 
ATOM 6853  O O6    . DG  I 5 44  ? 185.962 158.666 128.929 1.00 110.75 ? 44   DG  I O6    1 
ATOM 6854  N N1    . DG  I 5 44  ? 186.545 156.481 128.872 1.00 126.75 ? 44   DG  I N1    1 
ATOM 6855  C C2    . DG  I 5 44  ? 186.791 155.310 128.226 1.00 130.84 ? 44   DG  I C2    1 
ATOM 6856  N N2    . DG  I 5 44  ? 187.151 154.280 128.991 1.00 131.04 ? 44   DG  I N2    1 
ATOM 6857  N N3    . DG  I 5 44  ? 186.691 155.153 126.925 1.00 136.94 ? 44   DG  I N3    1 
ATOM 6858  C C4    . DG  I 5 44  ? 186.317 156.289 126.313 1.00 143.45 ? 44   DG  I C4    1 
ATOM 6859  P P     . DC  I 5 45  ? 184.583 152.320 121.356 1.00 149.20 ? 45   DC  I P     1 
ATOM 6860  O OP1   . DC  I 5 45  ? 185.334 151.511 120.375 1.00 150.02 ? 45   DC  I OP1   1 
ATOM 6861  O OP2   . DC  I 5 45  ? 183.537 153.260 120.903 1.00 143.56 ? 45   DC  I OP2   1 
ATOM 6862  O "O5'" . DC  I 5 45  ? 183.960 151.336 122.443 1.00 147.34 ? 45   DC  I "O5'" 1 
ATOM 6863  C "C5'" . DC  I 5 45  ? 184.824 150.550 123.250 1.00 143.11 ? 45   DC  I "C5'" 1 
ATOM 6864  C "C4'" . DC  I 5 45  ? 184.442 150.669 124.707 1.00 139.16 ? 45   DC  I "C4'" 1 
ATOM 6865  O "O4'" . DC  I 5 45  ? 184.710 151.996 125.161 1.00 138.24 ? 45   DC  I "O4'" 1 
ATOM 6866  C "C3'" . DC  I 5 45  ? 182.968 150.482 124.992 1.00 137.79 ? 45   DC  I "C3'" 1 
ATOM 6867  O "O3'" . DC  I 5 45  ? 182.697 149.131 125.239 1.00 140.06 ? 45   DC  I "O3'" 1 
ATOM 6868  C "C2'" . DC  I 5 45  ? 182.739 151.324 126.248 1.00 138.18 ? 45   DC  I "C2'" 1 
ATOM 6869  C "C1'" . DC  I 5 45  ? 183.998 152.181 126.349 1.00 133.46 ? 45   DC  I "C1'" 1 
ATOM 6870  N N1    . DC  I 5 45  ? 183.708 153.606 126.521 1.00 125.78 ? 45   DC  I N1    1 
ATOM 6871  C C2    . DC  I 5 45  ? 183.745 154.139 127.792 1.00 113.55 ? 45   DC  I C2    1 
ATOM 6872  O O2    . DC  I 5 45  ? 184.036 153.398 128.727 1.00 112.18 ? 45   DC  I O2    1 
ATOM 6873  N N3    . DC  I 5 45  ? 183.475 155.442 127.967 1.00 110.40 ? 45   DC  I N3    1 
ATOM 6874  C C4    . DC  I 5 45  ? 183.167 156.195 126.922 1.00 121.04 ? 45   DC  I C4    1 
ATOM 6875  N N4    . DC  I 5 45  ? 182.904 157.479 127.144 1.00 126.82 ? 45   DC  I N4    1 
ATOM 6876  C C5    . DC  I 5 45  ? 183.114 155.668 125.607 1.00 125.06 ? 45   DC  I C5    1 
ATOM 6877  C C6    . DC  I 5 45  ? 183.382 154.373 125.454 1.00 129.33 ? 45   DC  I C6    1 
ATOM 6878  P P     . DT  I 5 46  ? 181.188 148.663 125.502 1.00 128.33 ? 46   DT  I P     1 
ATOM 6879  O OP1   . DT  I 5 46  ? 181.076 147.235 125.147 1.00 128.10 ? 46   DT  I OP1   1 
ATOM 6880  O OP2   . DT  I 5 46  ? 180.313 149.669 124.866 1.00 120.30 ? 46   DT  I OP2   1 
ATOM 6881  O "O5'" . DT  I 5 46  ? 181.011 148.803 127.078 1.00 138.30 ? 46   DT  I "O5'" 1 
ATOM 6882  C "C5'" . DT  I 5 46  ? 181.950 148.206 127.944 1.00 132.62 ? 46   DT  I "C5'" 1 
ATOM 6883  C "C4'" . DT  I 5 46  ? 181.679 148.603 129.379 1.00 123.49 ? 46   DT  I "C4'" 1 
ATOM 6884  O "O4'" . DT  I 5 46  ? 181.710 150.049 129.502 1.00 122.97 ? 46   DT  I "O4'" 1 
ATOM 6885  C "C3'" . DT  I 5 46  ? 180.319 148.181 129.912 1.00 118.83 ? 46   DT  I "C3'" 1 
ATOM 6886  O "O3'" . DT  I 5 46  ? 180.431 147.899 131.285 1.00 121.18 ? 46   DT  I "O3'" 1 
ATOM 6887  C "C2'" . DT  I 5 46  ? 179.483 149.426 129.674 1.00 120.48 ? 46   DT  I "C2'" 1 
ATOM 6888  C "C1'" . DT  I 5 46  ? 180.489 150.494 130.040 1.00 119.56 ? 46   DT  I "C1'" 1 
ATOM 6889  N N1    . DT  I 5 46  ? 180.194 151.823 129.480 1.00 116.06 ? 46   DT  I N1    1 
ATOM 6890  C C2    . DT  I 5 46  ? 180.110 152.886 130.323 1.00 114.58 ? 46   DT  I C2    1 
ATOM 6891  O O2    . DT  I 5 46  ? 180.250 152.788 131.520 1.00 118.39 ? 46   DT  I O2    1 
ATOM 6892  N N3    . DT  I 5 46  ? 179.851 154.080 129.718 1.00 115.89 ? 46   DT  I N3    1 
ATOM 6893  C C4    . DT  I 5 46  ? 179.672 154.304 128.376 1.00 121.59 ? 46   DT  I C4    1 
ATOM 6894  O O4    . DT  I 5 46  ? 179.437 155.413 127.921 1.00 118.41 ? 46   DT  I O4    1 
ATOM 6895  C C5    . DT  I 5 46  ? 179.777 153.143 127.545 1.00 126.52 ? 46   DT  I C5    1 
ATOM 6896  C C7    . DT  I 5 46  ? 179.601 153.266 126.066 1.00 132.76 ? 46   DT  I C7    1 
ATOM 6897  C C6    . DT  I 5 46  ? 180.031 151.969 128.130 1.00 120.43 ? 46   DT  I C6    1 
ATOM 6898  P P     . DC  I 5 47  ? 179.424 146.858 131.967 1.00 132.61 ? 47   DC  I P     1 
ATOM 6899  O OP1   . DC  I 5 47  ? 180.231 145.932 132.790 1.00 127.40 ? 47   DC  I OP1   1 
ATOM 6900  O OP2   . DC  I 5 47  ? 178.561 146.341 130.884 1.00 125.02 ? 47   DC  I OP2   1 
ATOM 6901  O "O5'" . DC  I 5 47  ? 178.516 147.768 132.917 1.00 115.13 ? 47   DC  I "O5'" 1 
ATOM 6902  C "C5'" . DC  I 5 47  ? 179.055 148.315 134.104 1.00 106.88 ? 47   DC  I "C5'" 1 
ATOM 6903  C "C4'" . DC  I 5 47  ? 178.171 149.420 134.638 1.00 102.82 ? 47   DC  I "C4'" 1 
ATOM 6904  O "O4'" . DC  I 5 47  ? 178.102 150.492 133.668 1.00 109.58 ? 47   DC  I "O4'" 1 
ATOM 6905  C "C3'" . DC  I 5 47  ? 176.722 149.020 134.911 1.00 96.67  ? 47   DC  I "C3'" 1 
ATOM 6906  O "O3'" . DC  I 5 47  ? 176.224 149.750 136.015 1.00 94.88  ? 47   DC  I "O3'" 1 
ATOM 6907  C "C2'" . DC  I 5 47  ? 176.034 149.483 133.640 1.00 104.89 ? 47   DC  I "C2'" 1 
ATOM 6908  C "C1'" . DC  I 5 47  ? 176.755 150.796 133.443 1.00 107.25 ? 47   DC  I "C1'" 1 
ATOM 6909  N N1    . DC  I 5 47  ? 176.625 151.365 132.105 1.00 102.48 ? 47   DC  I N1    1 
ATOM 6910  C C2    . DC  I 5 47  ? 176.483 152.736 131.969 1.00 111.56 ? 47   DC  I C2    1 
ATOM 6911  O O2    . DC  I 5 47  ? 176.468 153.434 132.981 1.00 121.65 ? 47   DC  I O2    1 
ATOM 6912  N N3    . DC  I 5 47  ? 176.367 153.266 130.735 1.00 107.88 ? 47   DC  I N3    1 
ATOM 6913  C C4    . DC  I 5 47  ? 176.388 152.473 129.672 1.00 103.70 ? 47   DC  I C4    1 
ATOM 6914  N N4    . DC  I 5 47  ? 176.267 153.040 128.467 1.00 103.97 ? 47   DC  I N4    1 
ATOM 6915  C C5    . DC  I 5 47  ? 176.530 151.064 129.793 1.00 100.41 ? 47   DC  I C5    1 
ATOM 6916  C C6    . DC  I 5 47  ? 176.645 150.560 131.021 1.00 97.64  ? 47   DC  I C6    1 
ATOM 6917  P P     . DT  I 5 48  ? 176.724 149.459 137.514 1.00 94.91  ? 48   DT  I P     1 
ATOM 6918  O OP1   . DT  I 5 48  ? 177.856 148.513 137.491 1.00 95.47  ? 48   DT  I OP1   1 
ATOM 6919  O OP2   . DT  I 5 48  ? 175.530 149.127 138.312 1.00 89.82  ? 48   DT  I OP2   1 
ATOM 6920  O "O5'" . DT  I 5 48  ? 177.235 150.886 138.015 1.00 84.69  ? 48   DT  I "O5'" 1 
ATOM 6921  C "C5'" . DT  I 5 48  ? 177.010 152.033 137.210 1.00 74.10  ? 48   DT  I "C5'" 1 
ATOM 6922  C "C4'" . DT  I 5 48  ? 176.214 153.061 137.965 1.00 70.54  ? 48   DT  I "C4'" 1 
ATOM 6923  O "O4'" . DT  I 5 48  ? 175.483 153.877 137.023 1.00 80.01  ? 48   DT  I "O4'" 1 
ATOM 6924  C "C3'" . DT  I 5 48  ? 175.142 152.478 138.843 1.00 69.28  ? 48   DT  I "C3'" 1 
ATOM 6925  O "O3'" . DT  I 5 48  ? 174.669 153.478 139.716 1.00 79.89  ? 48   DT  I "O3'" 1 
ATOM 6926  C "C2'" . DT  I 5 48  ? 174.094 152.189 137.791 1.00 73.32  ? 48   DT  I "C2'" 1 
ATOM 6927  C "C1'" . DT  I 5 48  ? 174.118 153.527 137.085 1.00 82.92  ? 48   DT  I "C1'" 1 
ATOM 6928  N N1    . DT  I 5 48  ? 173.604 153.503 135.735 1.00 90.71  ? 48   DT  I N1    1 
ATOM 6929  C C2    . DT  I 5 48  ? 173.399 154.687 135.094 1.00 95.61  ? 48   DT  I C2    1 
ATOM 6930  O O2    . DT  I 5 48  ? 173.609 155.762 135.611 1.00 102.72 ? 48   DT  I O2    1 
ATOM 6931  N N3    . DT  I 5 48  ? 172.933 154.576 133.823 1.00 100.71 ? 48   DT  I N3    1 
ATOM 6932  C C4    . DT  I 5 48  ? 172.661 153.417 133.149 1.00 101.98 ? 48   DT  I C4    1 
ATOM 6933  O O4    . DT  I 5 48  ? 172.255 153.419 132.001 1.00 100.78 ? 48   DT  I O4    1 
ATOM 6934  C C5    . DT  I 5 48  ? 172.912 152.205 133.879 1.00 98.29  ? 48   DT  I C5    1 
ATOM 6935  C C7    . DT  I 5 48  ? 172.657 150.880 133.242 1.00 104.92 ? 48   DT  I C7    1 
ATOM 6936  C C6    . DT  I 5 48  ? 173.366 152.306 135.125 1.00 97.04  ? 48   DT  I C6    1 
ATOM 6937  P P     . DA  I 5 49  ? 175.478 153.918 141.032 1.00 87.36  ? 49   DA  I P     1 
ATOM 6938  O OP1   . DA  I 5 49  ? 176.914 154.033 140.735 1.00 73.38  ? 49   DA  I OP1   1 
ATOM 6939  O OP2   . DA  I 5 49  ? 175.070 153.068 142.159 1.00 82.21  ? 49   DA  I OP2   1 
ATOM 6940  O "O5'" . DA  I 5 49  ? 174.900 155.373 141.302 1.00 82.94  ? 49   DA  I "O5'" 1 
ATOM 6941  C "C5'" . DA  I 5 49  ? 175.281 156.425 140.448 1.00 64.05  ? 49   DA  I "C5'" 1 
ATOM 6942  C "C4'" . DA  I 5 49  ? 174.084 157.148 139.851 1.00 70.88  ? 49   DA  I "C4'" 1 
ATOM 6943  O "O4'" . DA  I 5 49  ? 173.480 156.370 138.793 1.00 78.28  ? 49   DA  I "O4'" 1 
ATOM 6944  C "C3'" . DA  I 5 49  ? 172.953 157.485 140.812 1.00 62.71  ? 49   DA  I "C3'" 1 
ATOM 6945  O "O3'" . DA  I 5 49  ? 172.579 158.801 140.568 1.00 58.54  ? 49   DA  I "O3'" 1 
ATOM 6946  C "C2'" . DA  I 5 49  ? 171.851 156.524 140.376 1.00 66.04  ? 49   DA  I "C2'" 1 
ATOM 6947  C "C1'" . DA  I 5 49  ? 172.095 156.526 138.894 1.00 73.90  ? 49   DA  I "C1'" 1 
ATOM 6948  N N9    . DA  I 5 49  ? 171.473 155.441 138.177 1.00 78.65  ? 49   DA  I N9    1 
ATOM 6949  C C8    . DA  I 5 49  ? 171.319 154.165 138.597 1.00 77.24  ? 49   DA  I C8    1 
ATOM 6950  N N7    . DA  I 5 49  ? 170.742 153.395 137.714 1.00 76.98  ? 49   DA  I N7    1 
ATOM 6951  C C5    . DA  I 5 49  ? 170.505 154.232 136.650 1.00 92.72  ? 49   DA  I C5    1 
ATOM 6952  C C6    . DA  I 5 49  ? 169.912 154.024 135.405 1.00 100.04 ? 49   DA  I C6    1 
ATOM 6953  N N6    . DA  I 5 49  ? 169.427 152.855 135.020 1.00 82.63  ? 49   DA  I N6    1 
ATOM 6954  N N1    . DA  I 5 49  ? 169.826 155.065 134.573 1.00 107.56 ? 49   DA  I N1    1 
ATOM 6955  C C2    . DA  I 5 49  ? 170.309 156.232 134.971 1.00 92.73  ? 49   DA  I C2    1 
ATOM 6956  N N3    . DA  I 5 49  ? 170.883 156.547 136.121 1.00 89.82  ? 49   DA  I N3    1 
ATOM 6957  C C4    . DA  I 5 49  ? 170.949 155.491 136.920 1.00 90.71  ? 49   DA  I C4    1 
ATOM 6958  P P     . DG  I 5 50  ? 171.722 159.629 141.632 1.00 68.06  ? 50   DG  I P     1 
ATOM 6959  O OP1   . DG  I 5 50  ? 172.662 160.419 142.446 1.00 68.11  ? 50   DG  I OP1   1 
ATOM 6960  O OP2   . DG  I 5 50  ? 170.768 158.726 142.292 1.00 76.57  ? 50   DG  I OP2   1 
ATOM 6961  O "O5'" . DG  I 5 50  ? 170.907 160.623 140.707 1.00 78.14  ? 50   DG  I "O5'" 1 
ATOM 6962  C "C5'" . DG  I 5 50  ? 171.580 161.286 139.676 1.00 73.63  ? 50   DG  I "C5'" 1 
ATOM 6963  C "C4'" . DG  I 5 50  ? 170.660 161.522 138.513 1.00 65.79  ? 50   DG  I "C4'" 1 
ATOM 6964  O "O4'" . DG  I 5 50  ? 170.380 160.258 137.871 1.00 66.36  ? 50   DG  I "O4'" 1 
ATOM 6965  C "C3'" . DG  I 5 50  ? 169.311 162.099 138.896 1.00 60.54  ? 50   DG  I "C3'" 1 
ATOM 6966  O "O3'" . DG  I 5 50  ? 168.904 163.011 137.931 1.00 65.38  ? 50   DG  I "O3'" 1 
ATOM 6967  C "C2'" . DG  I 5 50  ? 168.422 160.877 138.893 1.00 66.92  ? 50   DG  I "C2'" 1 
ATOM 6968  C "C1'" . DG  I 5 50  ? 168.999 160.132 137.716 1.00 74.00  ? 50   DG  I "C1'" 1 
ATOM 6969  N N9    . DG  I 5 50  ? 168.649 158.721 137.691 1.00 82.28  ? 50   DG  I N9    1 
ATOM 6970  C C8    . DG  I 5 50  ? 168.817 157.817 138.695 1.00 94.93  ? 50   DG  I C8    1 
ATOM 6971  N N7    . DG  I 5 50  ? 168.403 156.627 138.389 1.00 100.99 ? 50   DG  I N7    1 
ATOM 6972  C C5    . DG  I 5 50  ? 167.928 156.754 137.102 1.00 96.59  ? 50   DG  I C5    1 
ATOM 6973  C C6    . DG  I 5 50  ? 167.356 155.794 136.250 1.00 103.94 ? 50   DG  I C6    1 
ATOM 6974  O O6    . DG  I 5 50  ? 167.148 154.600 136.471 1.00 99.99  ? 50   DG  I O6    1 
ATOM 6975  N N1    . DG  I 5 50  ? 167.012 156.334 135.026 1.00 116.73 ? 50   DG  I N1    1 
ATOM 6976  C C2    . DG  I 5 50  ? 167.195 157.636 134.675 1.00 104.40 ? 50   DG  I C2    1 
ATOM 6977  N N2    . DG  I 5 50  ? 166.800 157.977 133.447 1.00 103.07 ? 50   DG  I N2    1 
ATOM 6978  N N3    . DG  I 5 50  ? 167.729 158.546 135.465 1.00 82.86  ? 50   DG  I N3    1 
ATOM 6979  C C4    . DG  I 5 50  ? 168.072 158.033 136.658 1.00 84.80  ? 50   DG  I C4    1 
ATOM 6980  P P     . DC  I 5 51  ? 168.056 164.294 138.371 1.00 87.07  ? 51   DC  I P     1 
ATOM 6981  O OP1   . DC  I 5 51  ? 168.745 165.486 137.851 1.00 79.14  ? 51   DC  I OP1   1 
ATOM 6982  O OP2   . DC  I 5 51  ? 167.742 164.180 139.802 1.00 93.22  ? 51   DC  I OP2   1 
ATOM 6983  O "O5'" . DC  I 5 51  ? 166.705 164.144 137.567 1.00 63.35  ? 51   DC  I "O5'" 1 
ATOM 6984  C "C5'" . DC  I 5 51  ? 166.693 164.485 136.227 1.00 75.68  ? 51   DC  I "C5'" 1 
ATOM 6985  C "C4'" . DC  I 5 51  ? 165.905 163.483 135.431 1.00 83.77  ? 51   DC  I "C4'" 1 
ATOM 6986  O "O4'" . DC  I 5 51  ? 166.152 162.166 135.918 1.00 84.19  ? 51   DC  I "O4'" 1 
ATOM 6987  C "C3'" . DC  I 5 51  ? 164.413 163.635 135.541 1.00 82.84  ? 51   DC  I "C3'" 1 
ATOM 6988  O "O3'" . DC  I 5 51  ? 163.965 164.461 134.520 1.00 100.36 ? 51   DC  I "O3'" 1 
ATOM 6989  C "C2'" . DC  I 5 51  ? 163.889 162.204 135.368 1.00 82.63  ? 51   DC  I "C2'" 1 
ATOM 6990  C "C1'" . DC  I 5 51  ? 165.151 161.351 135.389 1.00 81.33  ? 51   DC  I "C1'" 1 
ATOM 6991  N N1    . DC  I 5 51  ? 165.029 160.153 136.221 1.00 82.99  ? 51   DC  I N1    1 
ATOM 6992  C C2    . DC  I 5 51  ? 164.433 159.016 135.702 1.00 83.34  ? 51   DC  I C2    1 
ATOM 6993  O O2    . DC  I 5 51  ? 164.028 159.025 134.544 1.00 81.41  ? 51   DC  I O2    1 
ATOM 6994  N N3    . DC  I 5 51  ? 164.333 157.919 136.471 1.00 81.63  ? 51   DC  I N3    1 
ATOM 6995  C C4    . DC  I 5 51  ? 164.789 157.943 137.709 1.00 81.98  ? 51   DC  I C4    1 
ATOM 6996  N N4    . DC  I 5 51  ? 164.666 156.837 138.437 1.00 86.32  ? 51   DC  I N4    1 
ATOM 6997  C C5    . DC  I 5 51  ? 165.398 159.094 138.258 1.00 83.81  ? 51   DC  I C5    1 
ATOM 6998  C C6    . DC  I 5 51  ? 165.490 160.169 137.485 1.00 88.89  ? 51   DC  I C6    1 
ATOM 6999  P P     . DA  I 5 52  ? 162.529 165.150 134.641 1.00 92.27  ? 52   DA  I P     1 
ATOM 7000  O OP1   . DA  I 5 52  ? 162.487 166.261 133.669 1.00 78.41  ? 52   DA  I OP1   1 
ATOM 7001  O OP2   . DA  I 5 52  ? 162.291 165.394 136.079 1.00 78.95  ? 52   DA  I OP2   1 
ATOM 7002  O "O5'" . DA  I 5 52  ? 161.520 164.010 134.164 1.00 87.79  ? 52   DA  I "O5'" 1 
ATOM 7003  C "C5'" . DA  I 5 52  ? 161.615 163.492 132.853 1.00 88.03  ? 52   DA  I "C5'" 1 
ATOM 7004  C "C4'" . DA  I 5 52  ? 160.681 162.321 132.691 1.00 93.90  ? 52   DA  I "C4'" 1 
ATOM 7005  O "O4'" . DA  I 5 52  ? 161.178 161.222 133.463 1.00 97.18  ? 52   DA  I "O4'" 1 
ATOM 7006  C "C3'" . DA  I 5 52  ? 159.267 162.580 133.190 1.00 98.07  ? 52   DA  I "C3'" 1 
ATOM 7007  O "O3'" . DA  I 5 52  ? 158.361 162.595 132.095 1.00 103.59 ? 52   DA  I "O3'" 1 
ATOM 7008  C "C2'" . DA  I 5 52  ? 158.976 161.432 134.157 1.00 100.98 ? 52   DA  I "C2'" 1 
ATOM 7009  C "C1'" . DA  I 5 52  ? 160.105 160.458 133.904 1.00 99.67  ? 52   DA  I "C1'" 1 
ATOM 7010  N N9    . DA  I 5 52  ? 160.518 159.786 135.107 1.00 90.73  ? 52   DA  I N9    1 
ATOM 7011  C C8    . DA  I 5 52  ? 161.363 160.262 136.055 1.00 89.11  ? 52   DA  I C8    1 
ATOM 7012  N N7    . DA  I 5 52  ? 161.555 159.441 137.051 1.00 96.51  ? 52   DA  I N7    1 
ATOM 7013  C C5    . DA  I 5 52  ? 160.768 158.360 136.732 1.00 100.69 ? 52   DA  I C5    1 
ATOM 7014  C C6    . DA  I 5 52  ? 160.531 157.153 137.385 1.00 102.10 ? 52   DA  I C6    1 
ATOM 7015  N N6    . DA  I 5 52  ? 161.090 156.835 138.548 1.00 108.02 ? 52   DA  I N6    1 
ATOM 7016  N N1    . DA  I 5 52  ? 159.696 156.282 136.799 1.00 102.69 ? 52   DA  I N1    1 
ATOM 7017  C C2    . DA  I 5 52  ? 159.137 156.619 135.635 1.00 88.32  ? 52   DA  I C2    1 
ATOM 7018  N N3    . DA  I 5 52  ? 159.288 157.727 134.926 1.00 86.41  ? 52   DA  I N3    1 
ATOM 7019  C C4    . DA  I 5 52  ? 160.124 158.561 135.536 1.00 93.79  ? 52   DA  I C4    1 
ATOM 7020  P P     . DC  I 5 53  ? 156.837 163.057 132.306 1.00 90.22  ? 53   DC  I P     1 
ATOM 7021  O OP1   . DC  I 5 53  ? 156.227 163.298 130.985 1.00 90.77  ? 53   DC  I OP1   1 
ATOM 7022  O OP2   . DC  I 5 53  ? 156.804 164.100 133.349 1.00 68.77  ? 53   DC  I OP2   1 
ATOM 7023  O "O5'" . DC  I 5 53  ? 156.145 161.757 132.872 1.00 100.28 ? 53   DC  I "O5'" 1 
ATOM 7024  C "C5'" . DC  I 5 53  ? 156.261 160.566 132.154 1.00 98.78  ? 53   DC  I "C5'" 1 
ATOM 7025  C "C4'" . DC  I 5 53  ? 155.479 159.495 132.845 1.00 92.99  ? 53   DC  I "C4'" 1 
ATOM 7026  O "O4'" . DC  I 5 53  ? 156.285 158.923 133.900 1.00 102.65 ? 53   DC  I "O4'" 1 
ATOM 7027  C "C3'" . DC  I 5 53  ? 154.210 160.011 133.505 1.00 82.18  ? 53   DC  I "C3'" 1 
ATOM 7028  O "O3'" . DC  I 5 53  ? 153.120 159.223 133.097 1.00 85.97  ? 53   DC  I "O3'" 1 
ATOM 7029  C "C2'" . DC  I 5 53  ? 154.501 159.885 135.001 1.00 94.95  ? 53   DC  I "C2'" 1 
ATOM 7030  C "C1'" . DC  I 5 53  ? 155.485 158.738 135.025 1.00 106.18 ? 53   DC  I "C1'" 1 
ATOM 7031  N N1    . DC  I 5 53  ? 156.345 158.736 136.212 1.00 102.21 ? 53   DC  I N1    1 
ATOM 7032  C C2    . DC  I 5 53  ? 156.343 157.631 137.051 1.00 107.08 ? 53   DC  I C2    1 
ATOM 7033  O O2    . DC  I 5 53  ? 155.636 156.664 136.771 1.00 117.40 ? 53   DC  I O2    1 
ATOM 7034  N N3    . DC  I 5 53  ? 157.136 157.631 138.139 1.00 103.42 ? 53   DC  I N3    1 
ATOM 7035  C C4    . DC  I 5 53  ? 157.892 158.688 138.404 1.00 108.54 ? 53   DC  I C4    1 
ATOM 7036  N N4    . DC  I 5 53  ? 158.654 158.644 139.496 1.00 99.79  ? 53   DC  I N4    1 
ATOM 7037  C C5    . DC  I 5 53  ? 157.902 159.835 137.564 1.00 111.59 ? 53   DC  I C5    1 
ATOM 7038  C C6    . DC  I 5 53  ? 157.118 159.815 136.489 1.00 97.07  ? 53   DC  I C6    1 
ATOM 7039  P P     . DC  I 5 54  ? 151.698 159.380 133.813 1.00 84.56  ? 54   DC  I P     1 
ATOM 7040  O OP1   . DC  I 5 54  ? 150.678 158.782 132.931 1.00 81.68  ? 54   DC  I OP1   1 
ATOM 7041  O OP2   . DC  I 5 54  ? 151.559 160.781 134.247 1.00 75.60  ? 54   DC  I OP2   1 
ATOM 7042  O "O5'" . DC  I 5 54  ? 151.848 158.451 135.090 1.00 81.71  ? 54   DC  I "O5'" 1 
ATOM 7043  C "C5'" . DC  I 5 54  ? 152.339 157.146 134.923 1.00 85.56  ? 54   DC  I "C5'" 1 
ATOM 7044  C "C4'" . DC  I 5 54  ? 151.305 156.153 135.356 1.00 86.63  ? 54   DC  I "C4'" 1 
ATOM 7045  O "O4'" . DC  I 5 54  ? 151.781 155.465 136.523 1.00 85.91  ? 54   DC  I "O4'" 1 
ATOM 7046  C "C3'" . DC  I 5 54  ? 149.994 156.783 135.761 1.00 78.14  ? 54   DC  I "C3'" 1 
ATOM 7047  O "O3'" . DC  I 5 54  ? 148.939 155.894 135.528 1.00 72.27  ? 54   DC  I "O3'" 1 
ATOM 7048  C "C2'" . DC  I 5 54  ? 150.182 157.062 137.248 1.00 71.76  ? 54   DC  I "C2'" 1 
ATOM 7049  C "C1'" . DC  I 5 54  ? 151.254 156.064 137.680 1.00 85.48  ? 54   DC  I "C1'" 1 
ATOM 7050  N N1    . DC  I 5 54  ? 152.357 156.702 138.435 1.00 94.47  ? 54   DC  I N1    1 
ATOM 7051  C C2    . DC  I 5 54  ? 152.933 156.037 139.512 1.00 89.29  ? 54   DC  I C2    1 
ATOM 7052  O O2    . DC  I 5 54  ? 152.529 154.920 139.805 1.00 95.71  ? 54   DC  I O2    1 
ATOM 7053  N N3    . DC  I 5 54  ? 153.920 156.637 140.200 1.00 88.01  ? 54   DC  I N3    1 
ATOM 7054  C C4    . DC  I 5 54  ? 154.328 157.848 139.851 1.00 84.74  ? 54   DC  I C4    1 
ATOM 7055  N N4    . DC  I 5 54  ? 155.309 158.405 140.559 1.00 79.44  ? 54   DC  I N4    1 
ATOM 7056  C C5    . DC  I 5 54  ? 153.747 158.549 138.762 1.00 89.34  ? 54   DC  I C5    1 
ATOM 7057  C C6    . DC  I 5 54  ? 152.770 157.946 138.093 1.00 99.03  ? 54   DC  I C6    1 
ATOM 7058  P P     . DG  I 5 55  ? 147.459 156.255 136.031 1.00 96.34  ? 55   DG  I P     1 
ATOM 7059  O OP1   . DG  I 5 55  ? 146.514 155.570 135.130 1.00 79.26  ? 55   DG  I OP1   1 
ATOM 7060  O OP2   . DG  I 5 55  ? 147.357 157.716 136.233 1.00 92.02  ? 55   DG  I OP2   1 
ATOM 7061  O "O5'" . DG  I 5 55  ? 147.381 155.545 137.448 1.00 111.34 ? 55   DG  I "O5'" 1 
ATOM 7062  C "C5'" . DG  I 5 55  ? 147.791 154.204 137.559 1.00 105.94 ? 55   DG  I "C5'" 1 
ATOM 7063  C "C4'" . DG  I 5 55  ? 147.840 153.802 139.004 1.00 93.83  ? 55   DG  I "C4'" 1 
ATOM 7064  O "O4'" . DG  I 5 55  ? 149.053 154.322 139.590 1.00 96.92  ? 55   DG  I "O4'" 1 
ATOM 7065  C "C3'" . DG  I 5 55  ? 146.686 154.361 139.824 1.00 81.27  ? 55   DG  I "C3'" 1 
ATOM 7066  O "O3'" . DG  I 5 55  ? 146.050 153.341 140.549 1.00 88.52  ? 55   DG  I "O3'" 1 
ATOM 7067  C "C2'" . DG  I 5 55  ? 147.340 155.374 140.745 1.00 78.18  ? 55   DG  I "C2'" 1 
ATOM 7068  C "C1'" . DG  I 5 55  ? 148.764 154.865 140.842 1.00 91.33  ? 55   DG  I "C1'" 1 
ATOM 7069  N N9    . DG  I 5 55  ? 149.697 155.941 141.108 1.00 88.66  ? 55   DG  I N9    1 
ATOM 7070  C C8    . DG  I 5 55  ? 149.771 157.130 140.447 1.00 88.35  ? 55   DG  I C8    1 
ATOM 7071  N N7    . DG  I 5 55  ? 150.682 157.921 140.908 1.00 88.63  ? 55   DG  I N7    1 
ATOM 7072  C C5    . DG  I 5 55  ? 151.231 157.222 141.960 1.00 87.67  ? 55   DG  I C5    1 
ATOM 7073  C C6    . DG  I 5 55  ? 152.256 157.586 142.834 1.00 81.01  ? 55   DG  I C6    1 
ATOM 7074  O O6    . DG  I 5 55  ? 152.898 158.635 142.851 1.00 76.34  ? 55   DG  I O6    1 
ATOM 7075  N N1    . DG  I 5 55  ? 152.514 156.598 143.759 1.00 80.85  ? 55   DG  I N1    1 
ATOM 7076  C C2    . DG  I 5 55  ? 151.862 155.401 143.824 1.00 86.79  ? 55   DG  I C2    1 
ATOM 7077  N N2    . DG  I 5 55  ? 152.255 154.568 144.786 1.00 86.48  ? 55   DG  I N2    1 
ATOM 7078  N N3    . DG  I 5 55  ? 150.890 155.045 143.008 1.00 92.12  ? 55   DG  I N3    1 
ATOM 7079  C C4    . DG  I 5 55  ? 150.635 156.001 142.100 1.00 90.03  ? 55   DG  I C4    1 
ATOM 7080  P P     . DC  I 5 56  ? 144.663 153.654 141.291 1.00 108.24 ? 56   DC  I P     1 
ATOM 7081  O OP1   . DC  I 5 56  ? 143.772 152.495 141.089 1.00 85.03  ? 56   DC  I OP1   1 
ATOM 7082  O OP2   . DC  I 5 56  ? 144.232 155.010 140.894 1.00 101.31 ? 56   DC  I OP2   1 
ATOM 7083  O "O5'" . DC  I 5 56  ? 145.063 153.708 142.825 1.00 128.21 ? 56   DC  I "O5'" 1 
ATOM 7084  C "C5'" . DC  I 5 56  ? 145.679 152.595 143.398 1.00 111.96 ? 56   DC  I "C5'" 1 
ATOM 7085  C "C4'" . DC  I 5 56  ? 146.685 153.017 144.436 1.00 95.47  ? 56   DC  I "C4'" 1 
ATOM 7086  O "O4'" . DC  I 5 56  ? 147.429 154.148 143.969 1.00 95.63  ? 56   DC  I "O4'" 1 
ATOM 7087  C "C3'" . DC  I 5 56  ? 146.085 153.479 145.748 1.00 97.30  ? 56   DC  I "C3'" 1 
ATOM 7088  O "O3'" . DC  I 5 56  ? 146.055 152.409 146.646 1.00 114.87 ? 56   DC  I "O3'" 1 
ATOM 7089  C "C2'" . DC  I 5 56  ? 147.046 154.577 146.228 1.00 90.85  ? 56   DC  I "C2'" 1 
ATOM 7090  C "C1'" . DC  I 5 56  ? 148.053 154.694 145.091 1.00 87.75  ? 56   DC  I "C1'" 1 
ATOM 7091  N N1    . DC  I 5 56  ? 148.464 156.073 144.800 1.00 81.34  ? 56   DC  I N1    1 
ATOM 7092  C C2    . DC  I 5 56  ? 149.339 156.708 145.660 1.00 100.38 ? 56   DC  I C2    1 
ATOM 7093  O O2    . DC  I 5 56  ? 149.751 156.105 146.641 1.00 117.58 ? 56   DC  I O2    1 
ATOM 7094  N N3    . DC  I 5 56  ? 149.729 157.964 145.395 1.00 88.12  ? 56   DC  I N3    1 
ATOM 7095  C C4    . DC  I 5 56  ? 149.268 158.584 144.325 1.00 84.36  ? 56   DC  I C4    1 
ATOM 7096  N N4    . DC  I 5 56  ? 149.681 159.833 144.109 1.00 67.75  ? 56   DC  I N4    1 
ATOM 7097  C C5    . DC  I 5 56  ? 148.365 157.955 143.428 1.00 80.19  ? 56   DC  I C5    1 
ATOM 7098  C C6    . DC  I 5 56  ? 147.989 156.708 143.709 1.00 74.54  ? 56   DC  I C6    1 
ATOM 7099  P P     . DT  I 5 57  ? 144.835 152.269 147.670 1.00 89.16  ? 57   DT  I P     1 
ATOM 7100  O OP1   . DT  I 5 57  ? 145.129 151.142 148.576 1.00 83.23  ? 57   DT  I OP1   1 
ATOM 7101  O OP2   . DT  I 5 57  ? 143.596 152.306 146.871 1.00 84.33  ? 57   DT  I OP2   1 
ATOM 7102  O "O5'" . DT  I 5 57  ? 144.888 153.615 148.512 1.00 88.09  ? 57   DT  I "O5'" 1 
ATOM 7103  C "C5'" . DT  I 5 57  ? 144.599 153.583 149.884 1.00 86.52  ? 57   DT  I "C5'" 1 
ATOM 7104  C "C4'" . DT  I 5 57  ? 145.875 153.591 150.689 1.00 80.07  ? 57   DT  I "C4'" 1 
ATOM 7105  O "O4'" . DT  I 5 57  ? 146.826 154.469 150.044 1.00 80.51  ? 57   DT  I "O4'" 1 
ATOM 7106  C "C3'" . DT  I 5 57  ? 145.729 154.169 152.074 1.00 88.24  ? 57   DT  I "C3'" 1 
ATOM 7107  O "O3'" . DT  I 5 57  ? 146.855 153.827 152.836 1.00 114.05 ? 57   DT  I "O3'" 1 
ATOM 7108  C "C2'" . DT  I 5 57  ? 145.735 155.647 151.749 1.00 85.69  ? 57   DT  I "C2'" 1 
ATOM 7109  C "C1'" . DT  I 5 57  ? 146.889 155.685 150.765 1.00 87.84  ? 57   DT  I "C1'" 1 
ATOM 7110  N N1    . DT  I 5 57  ? 146.842 156.802 149.805 1.00 88.36  ? 57   DT  I N1    1 
ATOM 7111  C C2    . DT  I 5 57  ? 147.576 157.912 150.061 1.00 89.30  ? 57   DT  I C2    1 
ATOM 7112  O O2    . DT  I 5 57  ? 148.245 158.038 151.058 1.00 101.39 ? 57   DT  I O2    1 
ATOM 7113  N N3    . DT  I 5 57  ? 147.500 158.882 149.114 1.00 86.19  ? 57   DT  I N3    1 
ATOM 7114  C C4    . DT  I 5 57  ? 146.780 158.843 147.952 1.00 85.38  ? 57   DT  I C4    1 
ATOM 7115  O O4    . DT  I 5 57  ? 146.772 159.766 147.157 1.00 83.63  ? 57   DT  I O4    1 
ATOM 7116  C C5    . DT  I 5 57  ? 146.031 157.647 147.737 1.00 74.89  ? 57   DT  I C5    1 
ATOM 7117  C C7    . DT  I 5 57  ? 145.202 157.503 146.504 1.00 61.66  ? 57   DT  I C7    1 
ATOM 7118  C C6    . DT  I 5 57  ? 146.100 156.687 148.662 1.00 79.41  ? 57   DT  I C6    1 
ATOM 7119  P P     . DT  I 5 58  ? 146.836 154.035 154.423 1.00 91.84  ? 58   DT  I P     1 
ATOM 7120  O OP1   . DT  I 5 58  ? 148.047 153.388 154.959 1.00 76.94  ? 58   DT  I OP1   1 
ATOM 7121  O OP2   . DT  I 5 58  ? 145.504 153.627 154.904 1.00 74.34  ? 58   DT  I OP2   1 
ATOM 7122  O "O5'" . DT  I 5 58  ? 146.964 155.615 154.617 1.00 101.14 ? 58   DT  I "O5'" 1 
ATOM 7123  C "C5'" . DT  I 5 58  ? 148.152 156.281 154.232 1.00 77.94  ? 58   DT  I "C5'" 1 
ATOM 7124  C "C4'" . DT  I 5 58  ? 148.180 157.692 154.776 1.00 82.67  ? 58   DT  I "C4'" 1 
ATOM 7125  O "O4'" . DT  I 5 58  ? 148.007 158.635 153.694 1.00 89.09  ? 58   DT  I "O4'" 1 
ATOM 7126  C "C3'" . DT  I 5 58  ? 147.083 158.017 155.775 1.00 79.29  ? 58   DT  I "C3'" 1 
ATOM 7127  O "O3'" . DT  I 5 58  ? 147.573 158.935 156.706 1.00 90.13  ? 58   DT  I "O3'" 1 
ATOM 7128  C "C2'" . DT  I 5 58  ? 146.027 158.656 154.892 1.00 67.25  ? 58   DT  I "C2'" 1 
ATOM 7129  C "C1'" . DT  I 5 58  ? 146.908 159.465 153.972 1.00 81.31  ? 58   DT  I "C1'" 1 
ATOM 7130  N N1    . DT  I 5 58  ? 146.275 159.801 152.713 1.00 85.38  ? 58   DT  I N1    1 
ATOM 7131  C C2    . DT  I 5 58  ? 146.641 160.949 152.072 1.00 89.54  ? 58   DT  I C2    1 
ATOM 7132  O O2    . DT  I 5 58  ? 147.474 161.713 152.504 1.00 91.09  ? 58   DT  I O2    1 
ATOM 7133  N N3    . DT  I 5 58  ? 146.006 161.171 150.894 1.00 92.72  ? 58   DT  I N3    1 
ATOM 7134  C C4    . DT  I 5 58  ? 145.048 160.371 150.315 1.00 96.51  ? 58   DT  I C4    1 
ATOM 7135  O O4    . DT  I 5 58  ? 144.519 160.651 149.249 1.00 93.83  ? 58   DT  I O4    1 
ATOM 7136  C C5    . DT  I 5 58  ? 144.714 159.183 151.044 1.00 82.47  ? 58   DT  I C5    1 
ATOM 7137  C C7    . DT  I 5 58  ? 143.685 158.245 150.508 1.00 74.68  ? 58   DT  I C7    1 
ATOM 7138  C C6    . DT  I 5 58  ? 145.336 158.959 152.197 1.00 83.03  ? 58   DT  I C6    1 
ATOM 7139  P P     . DA  I 5 59  ? 148.206 158.410 158.078 1.00 80.06  ? 59   DA  I P     1 
ATOM 7140  O OP1   . DA  I 5 59  ? 148.944 157.169 157.779 1.00 63.71  ? 59   DA  I OP1   1 
ATOM 7141  O OP2   . DA  I 5 59  ? 147.137 158.410 159.092 1.00 75.45  ? 59   DA  I OP2   1 
ATOM 7142  O "O5'" . DA  I 5 59  ? 149.247 159.543 158.471 1.00 77.14  ? 59   DA  I "O5'" 1 
ATOM 7143  C "C5'" . DA  I 5 59  ? 150.468 159.631 157.784 1.00 77.52  ? 59   DA  I "C5'" 1 
ATOM 7144  C "C4'" . DA  I 5 59  ? 150.758 161.060 157.387 1.00 73.34  ? 59   DA  I "C4'" 1 
ATOM 7145  O "O4'" . DA  I 5 59  ? 149.839 161.465 156.345 1.00 84.99  ? 59   DA  I "O4'" 1 
ATOM 7146  C "C3'" . DA  I 5 59  ? 150.599 162.086 158.501 1.00 72.95  ? 59   DA  I "C3'" 1 
ATOM 7147  O "O3'" . DA  I 5 59  ? 151.578 163.100 158.347 1.00 80.09  ? 59   DA  I "O3'" 1 
ATOM 7148  C "C2'" . DA  I 5 59  ? 149.197 162.627 158.248 1.00 69.79  ? 59   DA  I "C2'" 1 
ATOM 7149  C "C1'" . DA  I 5 59  ? 149.184 162.645 156.735 1.00 77.25  ? 59   DA  I "C1'" 1 
ATOM 7150  N N9    . DA  I 5 59  ? 147.862 162.628 156.150 1.00 79.95  ? 59   DA  I N9    1 
ATOM 7151  C C8    . DA  I 5 59  ? 146.802 161.875 156.535 1.00 89.97  ? 59   DA  I C8    1 
ATOM 7152  N N7    . DA  I 5 59  ? 145.741 162.050 155.795 1.00 86.65  ? 59   DA  I N7    1 
ATOM 7153  C C5    . DA  I 5 59  ? 146.144 162.975 154.857 1.00 74.54  ? 59   DA  I C5    1 
ATOM 7154  C C6    . DA  I 5 59  ? 145.482 163.581 153.780 1.00 73.14  ? 59   DA  I C6    1 
ATOM 7155  N N6    . DA  I 5 59  ? 144.218 163.329 153.460 1.00 69.44  ? 59   DA  I N6    1 
ATOM 7156  N N1    . DA  I 5 59  ? 146.173 164.458 153.040 1.00 63.36  ? 59   DA  I N1    1 
ATOM 7157  C C2    . DA  I 5 59  ? 147.442 164.692 153.355 1.00 69.22  ? 59   DA  I C2    1 
ATOM 7158  N N3    . DA  I 5 59  ? 148.163 164.192 154.348 1.00 70.28  ? 59   DA  I N3    1 
ATOM 7159  C C4    . DA  I 5 59  ? 147.448 163.331 155.061 1.00 72.24  ? 59   DA  I C4    1 
ATOM 7160  P P     . DA  I 5 60  ? 152.160 163.860 159.634 1.00 77.94  ? 60   DA  I P     1 
ATOM 7161  O OP1   . DA  I 5 60  ? 153.597 164.111 159.408 1.00 49.96  ? 60   DA  I OP1   1 
ATOM 7162  O OP2   . DA  I 5 60  ? 151.700 163.127 160.829 1.00 79.54  ? 60   DA  I OP2   1 
ATOM 7163  O "O5'" . DA  I 5 60  ? 151.405 165.258 159.624 1.00 74.16  ? 60   DA  I "O5'" 1 
ATOM 7164  C "C5'" . DA  I 5 60  ? 152.006 166.366 159.006 1.00 67.41  ? 60   DA  I "C5'" 1 
ATOM 7165  C "C4'" . DA  I 5 60  ? 151.498 166.534 157.596 1.00 67.10  ? 60   DA  I "C4'" 1 
ATOM 7166  O "O4'" . DA  I 5 60  ? 150.243 165.861 157.461 1.00 80.00  ? 60   DA  I "O4'" 1 
ATOM 7167  C "C3'" . DA  I 5 60  ? 151.201 167.970 157.209 1.00 55.95  ? 60   DA  I "C3'" 1 
ATOM 7168  O "O3'" . DA  I 5 60  ? 152.311 168.540 156.570 1.00 66.15  ? 60   DA  I "O3'" 1 
ATOM 7169  C "C2'" . DA  I 5 60  ? 150.008 167.860 156.255 1.00 58.87  ? 60   DA  I "C2'" 1 
ATOM 7170  C "C1'" . DA  I 5 60  ? 149.603 166.392 156.340 1.00 71.35  ? 60   DA  I "C1'" 1 
ATOM 7171  N N9    . DA  I 5 60  ? 148.169 166.169 156.454 1.00 68.21  ? 60   DA  I N9    1 
ATOM 7172  C C8    . DA  I 5 60  ? 147.531 165.408 157.374 1.00 62.24  ? 60   DA  I C8    1 
ATOM 7173  N N7    . DA  I 5 60  ? 146.239 165.364 157.212 1.00 62.62  ? 60   DA  I N7    1 
ATOM 7174  C C5    . DA  I 5 60  ? 146.018 166.163 156.118 1.00 73.13  ? 60   DA  I C5    1 
ATOM 7175  C C6    . DA  I 5 60  ? 144.852 166.529 155.440 1.00 77.30  ? 60   DA  I C6    1 
ATOM 7176  N N6    . DA  I 5 60  ? 143.640 166.125 155.798 1.00 82.93  ? 60   DA  I N6    1 
ATOM 7177  N N1    . DA  I 5 60  ? 144.972 167.339 154.387 1.00 78.53  ? 60   DA  I N1    1 
ATOM 7178  C C2    . DA  I 5 60  ? 146.186 167.739 154.030 1.00 65.68  ? 60   DA  I C2    1 
ATOM 7179  N N3    . DA  I 5 60  ? 147.352 167.469 154.594 1.00 68.95  ? 60   DA  I N3    1 
ATOM 7180  C C4    . DA  I 5 60  ? 147.193 166.673 155.646 1.00 76.32  ? 60   DA  I C4    1 
ATOM 7181  P P     . DA  I 5 61  ? 152.633 170.094 156.783 1.00 78.49  ? 61   DA  I P     1 
ATOM 7182  O OP1   . DA  I 5 61  ? 153.950 170.329 156.173 1.00 78.16  ? 61   DA  I OP1   1 
ATOM 7183  O OP2   . DA  I 5 61  ? 152.415 170.413 158.203 1.00 67.88  ? 61   DA  I OP2   1 
ATOM 7184  O "O5'" . DA  I 5 61  ? 151.515 170.840 155.933 1.00 75.92  ? 61   DA  I "O5'" 1 
ATOM 7185  C "C5'" . DA  I 5 61  ? 151.606 170.842 154.539 1.00 77.58  ? 61   DA  I "C5'" 1 
ATOM 7186  C "C4'" . DA  I 5 61  ? 150.386 171.479 153.919 1.00 68.70  ? 61   DA  I "C4'" 1 
ATOM 7187  O "O4'" . DA  I 5 61  ? 149.220 170.675 154.205 1.00 61.97  ? 61   DA  I "O4'" 1 
ATOM 7188  C "C3'" . DA  I 5 61  ? 150.066 172.882 154.409 1.00 68.48  ? 61   DA  I "C3'" 1 
ATOM 7189  O "O3'" . DA  I 5 61  ? 149.719 173.676 153.303 1.00 77.80  ? 61   DA  I "O3'" 1 
ATOM 7190  C "C2'" . DA  I 5 61  ? 148.878 172.660 155.334 1.00 56.13  ? 61   DA  I "C2'" 1 
ATOM 7191  C "C1'" . DA  I 5 61  ? 148.183 171.504 154.648 1.00 60.38  ? 61   DA  I "C1'" 1 
ATOM 7192  N N9    . DA  I 5 61  ? 147.326 170.718 155.528 1.00 64.35  ? 61   DA  I N9    1 
ATOM 7193  C C8    . DA  I 5 61  ? 147.710 170.025 156.628 1.00 64.61  ? 61   DA  I C8    1 
ATOM 7194  N N7    . DA  I 5 61  ? 146.740 169.391 157.223 1.00 71.04  ? 61   DA  I N7    1 
ATOM 7195  C C5    . DA  I 5 61  ? 145.639 169.692 156.463 1.00 79.78  ? 61   DA  I C5    1 
ATOM 7196  C C6    . DA  I 5 61  ? 144.302 169.328 156.582 1.00 84.36  ? 61   DA  I C6    1 
ATOM 7197  N N6    . DA  I 5 61  ? 143.856 168.544 157.555 1.00 70.86  ? 61   DA  I N6    1 
ATOM 7198  N N1    . DA  I 5 61  ? 143.439 169.785 155.662 1.00 85.65  ? 61   DA  I N1    1 
ATOM 7199  C C2    . DA  I 5 61  ? 143.901 170.571 154.686 1.00 75.10  ? 61   DA  I C2    1 
ATOM 7200  N N3    . DA  I 5 61  ? 145.147 170.990 154.475 1.00 73.52  ? 61   DA  I N3    1 
ATOM 7201  C C4    . DA  I 5 61  ? 145.975 170.505 155.409 1.00 74.75  ? 61   DA  I C4    1 
ATOM 7202  P P     . DC  I 5 62  ? 149.549 175.261 153.454 1.00 82.33  ? 62   DC  I P     1 
ATOM 7203  O OP1   . DC  I 5 62  ? 150.206 175.922 152.310 1.00 75.59  ? 62   DC  I OP1   1 
ATOM 7204  O OP2   . DC  I 5 62  ? 149.889 175.628 154.833 1.00 68.65  ? 62   DC  I OP2   1 
ATOM 7205  O "O5'" . DC  I 5 62  ? 147.986 175.474 153.323 1.00 75.09  ? 62   DC  I "O5'" 1 
ATOM 7206  C "C5'" . DC  I 5 62  ? 147.234 174.610 152.515 1.00 78.23  ? 62   DC  I "C5'" 1 
ATOM 7207  C "C4'" . DC  I 5 62  ? 145.764 174.876 152.708 1.00 82.84  ? 62   DC  I "C4'" 1 
ATOM 7208  O "O4'" . DC  I 5 62  ? 145.215 173.922 153.649 1.00 90.26  ? 62   DC  I "O4'" 1 
ATOM 7209  C "C3'" . DC  I 5 62  ? 145.443 176.251 153.280 1.00 86.48  ? 62   DC  I "C3'" 1 
ATOM 7210  O "O3'" . DC  I 5 62  ? 144.270 176.731 152.676 1.00 103.83 ? 62   DC  I "O3'" 1 
ATOM 7211  C "C2'" . DC  I 5 62  ? 145.221 175.945 154.757 1.00 85.07  ? 62   DC  I "C2'" 1 
ATOM 7212  C "C1'" . DC  I 5 62  ? 144.513 174.620 154.641 1.00 88.57  ? 62   DC  I "C1'" 1 
ATOM 7213  N N1    . DC  I 5 62  ? 144.534 173.818 155.848 1.00 81.79  ? 62   DC  I N1    1 
ATOM 7214  C C2    . DC  I 5 62  ? 143.346 173.300 156.330 1.00 91.90  ? 62   DC  I C2    1 
ATOM 7215  O O2    . DC  I 5 62  ? 142.304 173.566 155.735 1.00 105.01 ? 62   DC  I O2    1 
ATOM 7216  N N3    . DC  I 5 62  ? 143.365 172.540 157.437 1.00 79.98  ? 62   DC  I N3    1 
ATOM 7217  C C4    . DC  I 5 62  ? 144.519 172.290 158.044 1.00 77.44  ? 62   DC  I C4    1 
ATOM 7218  N N4    . DC  I 5 62  ? 144.494 171.533 159.140 1.00 85.42  ? 62   DC  I N4    1 
ATOM 7219  C C5    . DC  I 5 62  ? 145.746 172.807 157.560 1.00 67.41  ? 62   DC  I C5    1 
ATOM 7220  C C6    . DC  I 5 62  ? 145.706 173.556 156.461 1.00 69.44  ? 62   DC  I C6    1 
ATOM 7221  P P     . DG  I 5 63  ? 144.033 178.304 152.483 1.00 98.91  ? 63   DG  I P     1 
ATOM 7222  O OP1   . DG  I 5 63  ? 144.395 178.627 151.089 1.00 106.01 ? 63   DG  I OP1   1 
ATOM 7223  O OP2   . DG  I 5 63  ? 144.674 179.014 153.606 1.00 94.00  ? 63   DG  I OP2   1 
ATOM 7224  O "O5'" . DG  I 5 63  ? 142.461 178.450 152.669 1.00 81.03  ? 63   DG  I "O5'" 1 
ATOM 7225  C "C5'" . DG  I 5 63  ? 141.678 177.284 152.729 1.00 89.79  ? 63   DG  I "C5'" 1 
ATOM 7226  C "C4'" . DG  I 5 63  ? 140.350 177.556 153.389 1.00 105.39 ? 63   DG  I "C4'" 1 
ATOM 7227  O "O4'" . DG  I 5 63  ? 140.204 176.708 154.549 1.00 101.03 ? 63   DG  I "O4'" 1 
ATOM 7228  C "C3'" . DG  I 5 63  ? 140.166 178.958 153.915 1.00 118.59 ? 63   DG  I "C3'" 1 
ATOM 7229  O "O3'" . DG  I 5 63  ? 138.789 179.207 154.013 1.00 131.68 ? 63   DG  I "O3'" 1 
ATOM 7230  C "C2'" . DG  I 5 63  ? 140.804 178.848 155.290 1.00 109.74 ? 63   DG  I "C2'" 1 
ATOM 7231  C "C1'" . DG  I 5 63  ? 140.307 177.483 155.726 1.00 107.76 ? 63   DG  I "C1'" 1 
ATOM 7232  N N9    . DG  I 5 63  ? 141.213 176.797 156.614 1.00 115.87 ? 63   DG  I N9    1 
ATOM 7233  C C8    . DG  I 5 63  ? 142.575 176.852 156.599 1.00 117.52 ? 63   DG  I C8    1 
ATOM 7234  N N7    . DG  I 5 63  ? 143.130 176.101 157.500 1.00 119.93 ? 63   DG  I N7    1 
ATOM 7235  C C5    . DG  I 5 63  ? 142.063 175.502 158.140 1.00 124.61 ? 63   DG  I C5    1 
ATOM 7236  C C6    . DG  I 5 63  ? 142.046 174.590 159.207 1.00 133.31 ? 63   DG  I C6    1 
ATOM 7237  O O6    . DG  I 5 63  ? 142.999 174.112 159.818 1.00 133.76 ? 63   DG  I O6    1 
ATOM 7238  N N1    . DG  I 5 63  ? 140.756 174.237 159.561 1.00 138.75 ? 63   DG  I N1    1 
ATOM 7239  C C2    . DG  I 5 63  ? 139.625 174.705 158.950 1.00 131.23 ? 63   DG  I C2    1 
ATOM 7240  N N2    . DG  I 5 63  ? 138.458 174.250 159.428 1.00 128.14 ? 63   DG  I N2    1 
ATOM 7241  N N3    . DG  I 5 63  ? 139.630 175.568 157.951 1.00 121.71 ? 63   DG  I N3    1 
ATOM 7242  C C4    . DG  I 5 63  ? 140.879 175.919 157.603 1.00 120.33 ? 63   DG  I C4    1 
ATOM 7243  P P     . DC  I 5 64  ? 138.229 180.681 154.295 1.00 120.67 ? 64   DC  I P     1 
ATOM 7244  O OP1   . DC  I 5 64  ? 137.380 181.034 153.141 1.00 119.22 ? 64   DC  I OP1   1 
ATOM 7245  O OP2   . DC  I 5 64  ? 139.350 181.562 154.683 1.00 108.44 ? 64   DC  I OP2   1 
ATOM 7246  O "O5'" . DC  I 5 64  ? 137.295 180.472 155.569 1.00 125.95 ? 64   DC  I "O5'" 1 
ATOM 7247  C "C5'" . DC  I 5 64  ? 136.781 179.179 155.857 1.00 126.44 ? 64   DC  I "C5'" 1 
ATOM 7248  C "C4'" . DC  I 5 64  ? 136.621 178.998 157.349 1.00 127.90 ? 64   DC  I "C4'" 1 
ATOM 7249  O "O4'" . DC  I 5 64  ? 137.739 178.242 157.876 1.00 130.30 ? 64   DC  I "O4'" 1 
ATOM 7250  C "C3'" . DC  I 5 64  ? 136.591 180.307 158.147 1.00 132.66 ? 64   DC  I "C3'" 1 
ATOM 7251  O "O3'" . DC  I 5 64  ? 135.477 180.319 159.014 1.00 145.11 ? 64   DC  I "O3'" 1 
ATOM 7252  C "C2'" . DC  I 5 64  ? 137.897 180.271 158.931 1.00 126.33 ? 64   DC  I "C2'" 1 
ATOM 7253  C "C1'" . DC  I 5 64  ? 138.058 178.786 159.121 1.00 133.14 ? 64   DC  I "C1'" 1 
ATOM 7254  N N1    . DC  I 5 64  ? 139.408 178.397 159.488 1.00 133.62 ? 64   DC  I N1    1 
ATOM 7255  C C2    . DC  I 5 64  ? 139.590 177.495 160.529 1.00 134.04 ? 64   DC  I C2    1 
ATOM 7256  O O2    . DC  I 5 64  ? 138.601 177.027 161.089 1.00 137.88 ? 64   DC  I O2    1 
ATOM 7257  N N3    . DC  I 5 64  ? 140.837 177.144 160.883 1.00 129.27 ? 64   DC  I N3    1 
ATOM 7258  C C4    . DC  I 5 64  ? 141.872 177.676 160.251 1.00 129.32 ? 64   DC  I C4    1 
ATOM 7259  N N4    . DC  I 5 64  ? 143.091 177.298 160.637 1.00 130.11 ? 64   DC  I N4    1 
ATOM 7260  C C5    . DC  I 5 64  ? 141.708 178.611 159.187 1.00 129.36 ? 64   DC  I C5    1 
ATOM 7261  C C6    . DC  I 5 64  ? 140.466 178.944 158.847 1.00 128.28 ? 64   DC  I C6    1 
ATOM 7262  P P     . DA  I 5 65  ? 134.401 181.506 158.917 1.00 125.90 ? 65   DA  I P     1 
ATOM 7263  O OP1   . DA  I 5 65  ? 133.368 181.092 157.943 1.00 128.36 ? 65   DA  I OP1   1 
ATOM 7264  O OP2   . DA  I 5 65  ? 135.144 182.767 158.709 1.00 115.08 ? 65   DA  I OP2   1 
ATOM 7265  O "O5'" . DA  I 5 65  ? 133.758 181.550 160.376 1.00 113.81 ? 65   DA  I "O5'" 1 
ATOM 7266  C "C5'" . DA  I 5 65  ? 133.170 180.384 160.919 1.00 117.65 ? 65   DA  I "C5'" 1 
ATOM 7267  C "C4'" . DA  I 5 65  ? 133.542 180.226 162.375 1.00 127.84 ? 65   DA  I "C4'" 1 
ATOM 7268  O "O4'" . DA  I 5 65  ? 134.934 179.836 162.475 1.00 122.45 ? 65   DA  I "O4'" 1 
ATOM 7269  C "C3'" . DA  I 5 65  ? 133.412 181.496 163.216 1.00 139.67 ? 65   DA  I "C3'" 1 
ATOM 7270  O "O3'" . DA  I 5 65  ? 132.994 181.156 164.518 1.00 155.42 ? 65   DA  I "O3'" 1 
ATOM 7271  C "C2'" . DA  I 5 65  ? 134.835 182.006 163.229 1.00 128.95 ? 65   DA  I "C2'" 1 
ATOM 7272  C "C1'" . DA  I 5 65  ? 135.568 180.699 163.379 1.00 124.20 ? 65   DA  I "C1'" 1 
ATOM 7273  N N9    . DA  I 5 65  ? 136.967 180.791 163.039 1.00 125.07 ? 65   DA  I N9    1 
ATOM 7274  C C8    . DA  I 5 65  ? 137.507 181.443 161.981 1.00 125.79 ? 65   DA  I C8    1 
ATOM 7275  N N7    . DA  I 5 65  ? 138.808 181.363 161.925 1.00 119.39 ? 65   DA  I N7    1 
ATOM 7276  C C5    . DA  I 5 65  ? 139.135 180.613 163.028 1.00 119.45 ? 65   DA  I C5    1 
ATOM 7277  C C6    . DA  I 5 65  ? 140.354 180.178 163.529 1.00 124.19 ? 65   DA  I C6    1 
ATOM 7278  N N6    . DA  I 5 65  ? 141.513 180.450 162.949 1.00 125.61 ? 65   DA  I N6    1 
ATOM 7279  N N1    . DA  I 5 65  ? 140.340 179.443 164.643 1.00 126.38 ? 65   DA  I N1    1 
ATOM 7280  C C2    . DA  I 5 65  ? 139.174 179.177 165.224 1.00 122.23 ? 65   DA  I C2    1 
ATOM 7281  N N3    . DA  I 5 65  ? 137.959 179.533 164.843 1.00 121.40 ? 65   DA  I N3    1 
ATOM 7282  C C4    . DA  I 5 65  ? 138.013 180.255 163.726 1.00 121.80 ? 65   DA  I C4    1 
ATOM 7283  P P     . DC  I 5 66  ? 132.698 182.296 165.610 1.00 149.00 ? 66   DC  I P     1 
ATOM 7284  O OP1   . DC  I 5 66  ? 131.453 182.976 165.215 1.00 144.25 ? 66   DC  I OP1   1 
ATOM 7285  O OP2   . DC  I 5 66  ? 133.918 183.083 165.868 1.00 141.87 ? 66   DC  I OP2   1 
ATOM 7286  O "O5'" . DC  I 5 66  ? 132.404 181.465 166.931 1.00 139.23 ? 66   DC  I "O5'" 1 
ATOM 7287  C "C5'" . DC  I 5 66  ? 133.155 180.301 167.201 1.00 131.31 ? 66   DC  I "C5'" 1 
ATOM 7288  C "C4'" . DC  I 5 66  ? 134.369 180.638 168.033 1.00 130.69 ? 66   DC  I "C4'" 1 
ATOM 7289  O "O4'" . DC  I 5 66  ? 135.516 180.810 167.181 1.00 132.67 ? 66   DC  I "O4'" 1 
ATOM 7290  C "C3'" . DC  I 5 66  ? 134.248 181.934 168.826 1.00 132.34 ? 66   DC  I "C3'" 1 
ATOM 7291  O "O3'" . DC  I 5 66  ? 134.183 181.641 170.195 1.00 136.43 ? 66   DC  I "O3'" 1 
ATOM 7292  C "C2'" . DC  I 5 66  ? 135.520 182.727 168.468 1.00 133.32 ? 66   DC  I "C2'" 1 
ATOM 7293  C "C1'" . DC  I 5 66  ? 136.401 181.661 167.845 1.00 132.97 ? 66   DC  I "C1'" 1 
ATOM 7294  N N1    . DC  I 5 66  ? 137.411 182.166 166.867 1.00 132.75 ? 66   DC  I N1    1 
ATOM 7295  C C2    . DC  I 5 66  ? 138.761 181.980 167.136 1.00 127.57 ? 66   DC  I C2    1 
ATOM 7296  O O2    . DC  I 5 66  ? 139.087 181.420 168.181 1.00 115.98 ? 66   DC  I O2    1 
ATOM 7297  N N3    . DC  I 5 66  ? 139.674 182.418 166.252 1.00 131.36 ? 66   DC  I N3    1 
ATOM 7298  C C4    . DC  I 5 66  ? 139.283 183.016 165.137 1.00 133.67 ? 66   DC  I C4    1 
ATOM 7299  N N4    . DC  I 5 66  ? 140.230 183.433 164.301 1.00 127.18 ? 66   DC  I N4    1 
ATOM 7300  C C5    . DC  I 5 66  ? 137.910 183.219 164.836 1.00 136.31 ? 66   DC  I C5    1 
ATOM 7301  C C6    . DC  I 5 66  ? 137.015 182.777 165.721 1.00 136.59 ? 66   DC  I C6    1 
ATOM 7302  P P     . DG  I 5 67  ? 133.647 182.752 171.216 1.00 113.69 ? 67   DG  I P     1 
ATOM 7303  O OP1   . DG  I 5 67  ? 132.657 182.118 172.109 1.00 101.81 ? 67   DG  I OP1   1 
ATOM 7304  O OP2   . DG  I 5 67  ? 133.274 183.933 170.413 1.00 111.53 ? 67   DG  I OP2   1 
ATOM 7305  O "O5'" . DG  I 5 67  ? 134.935 183.123 172.070 1.00 142.93 ? 67   DG  I "O5'" 1 
ATOM 7306  C "C5'" . DG  I 5 67  ? 135.613 182.109 172.769 1.00 137.89 ? 67   DG  I "C5'" 1 
ATOM 7307  C "C4'" . DG  I 5 67  ? 137.019 182.538 173.125 1.00 131.35 ? 67   DG  I "C4'" 1 
ATOM 7308  O "O4'" . DG  I 5 67  ? 137.776 182.784 171.912 1.00 132.48 ? 67   DG  I "O4'" 1 
ATOM 7309  C "C3'" . DG  I 5 67  ? 137.125 183.826 173.923 1.00 127.27 ? 67   DG  I "C3'" 1 
ATOM 7310  O "O3'" . DG  I 5 67  ? 138.300 183.774 174.697 1.00 122.05 ? 67   DG  I "O3'" 1 
ATOM 7311  C "C2'" . DG  I 5 67  ? 137.279 184.841 172.809 1.00 130.72 ? 67   DG  I "C2'" 1 
ATOM 7312  C "C1'" . DG  I 5 67  ? 138.274 184.100 171.953 1.00 127.24 ? 67   DG  I "C1'" 1 
ATOM 7313  N N9    . DG  I 5 67  ? 138.401 184.577 170.586 1.00 117.50 ? 67   DG  I N9    1 
ATOM 7314  C C8    . DG  I 5 67  ? 137.401 184.992 169.757 1.00 115.13 ? 67   DG  I C8    1 
ATOM 7315  N N7    . DG  I 5 67  ? 137.818 185.324 168.569 1.00 113.23 ? 67   DG  I N7    1 
ATOM 7316  C C5    . DG  I 5 67  ? 139.180 185.109 168.620 1.00 114.96 ? 67   DG  I C5    1 
ATOM 7317  C C6    . DG  I 5 67  ? 140.164 185.295 167.633 1.00 107.25 ? 67   DG  I C6    1 
ATOM 7318  O O6    . DG  I 5 67  ? 140.023 185.705 166.478 1.00 102.28 ? 67   DG  I O6    1 
ATOM 7319  N N1    . DG  I 5 67  ? 141.429 184.960 168.097 1.00 107.10 ? 67   DG  I N1    1 
ATOM 7320  C C2    . DG  I 5 67  ? 141.698 184.494 169.358 1.00 106.75 ? 67   DG  I C2    1 
ATOM 7321  N N2    . DG  I 5 67  ? 142.980 184.218 169.627 1.00 101.04 ? 67   DG  I N2    1 
ATOM 7322  N N3    . DG  I 5 67  ? 140.783 184.319 170.291 1.00 116.35 ? 67   DG  I N3    1 
ATOM 7323  C C4    . DG  I 5 67  ? 139.552 184.645 169.852 1.00 117.14 ? 67   DG  I C4    1 
ATOM 7324  P P     . DT  I 5 68  ? 138.264 183.978 176.287 1.00 109.49 ? 68   DT  I P     1 
ATOM 7325  O OP1   . DT  I 5 68  ? 137.508 182.862 176.886 1.00 105.54 ? 68   DT  I OP1   1 
ATOM 7326  O OP2   . DT  I 5 68  ? 137.881 185.377 176.553 1.00 111.17 ? 68   DT  I OP2   1 
ATOM 7327  O "O5'" . DT  I 5 68  ? 139.792 183.829 176.702 1.00 143.95 ? 68   DT  I "O5'" 1 
ATOM 7328  C "C5'" . DT  I 5 68  ? 140.749 183.522 175.712 1.00 129.31 ? 68   DT  I "C5'" 1 
ATOM 7329  C "C4'" . DT  I 5 68  ? 142.006 184.318 175.932 1.00 111.52 ? 68   DT  I "C4'" 1 
ATOM 7330  O "O4'" . DT  I 5 68  ? 142.335 185.038 174.726 1.00 105.14 ? 68   DT  I "O4'" 1 
ATOM 7331  C "C3'" . DT  I 5 68  ? 141.890 185.378 176.998 1.00 108.71 ? 68   DT  I "C3'" 1 
ATOM 7332  O "O3'" . DT  I 5 68  ? 143.174 185.710 177.470 1.00 106.12 ? 68   DT  I "O3'" 1 
ATOM 7333  C "C2'" . DT  I 5 68  ? 141.294 186.525 176.199 1.00 109.42 ? 68   DT  I "C2'" 1 
ATOM 7334  C "C1'" . DT  I 5 68  ? 142.095 186.414 174.913 1.00 112.94 ? 68   DT  I "C1'" 1 
ATOM 7335  N N1    . DT  I 5 68  ? 141.389 186.914 173.719 1.00 123.59 ? 68   DT  I N1    1 
ATOM 7336  C C2    . DT  I 5 68  ? 142.071 187.022 172.538 1.00 120.07 ? 68   DT  I C2    1 
ATOM 7337  O O2    . DT  I 5 68  ? 143.241 186.736 172.422 1.00 110.84 ? 68   DT  I O2    1 
ATOM 7338  N N3    . DT  I 5 68  ? 141.331 187.479 171.488 1.00 123.12 ? 68   DT  I N3    1 
ATOM 7339  C C4    . DT  I 5 68  ? 140.009 187.833 171.510 1.00 135.73 ? 68   DT  I C4    1 
ATOM 7340  O O4    . DT  I 5 68  ? 139.423 188.238 170.521 1.00 141.29 ? 68   DT  I O4    1 
ATOM 7341  C C5    . DT  I 5 68  ? 139.356 187.695 172.777 1.00 135.79 ? 68   DT  I C5    1 
ATOM 7342  C C7    . DT  I 5 68  ? 137.918 188.065 172.916 1.00 137.68 ? 68   DT  I C7    1 
ATOM 7343  C C6    . DT  I 5 68  ? 140.067 187.243 173.809 1.00 129.76 ? 68   DT  I C6    1 
ATOM 7344  P P     . DA  I 5 69  ? 144.028 184.683 178.363 1.00 123.60 ? 69   DA  I P     1 
ATOM 7345  O OP1   . DA  I 5 69  ? 143.470 183.319 178.286 1.00 119.42 ? 69   DA  I OP1   1 
ATOM 7346  O OP2   . DA  I 5 69  ? 144.199 185.314 179.685 1.00 123.71 ? 69   DA  I OP2   1 
ATOM 7347  O "O5'" . DA  I 5 69  ? 145.452 184.686 177.648 1.00 152.25 ? 69   DA  I "O5'" 1 
ATOM 7348  C "C5'" . DA  I 5 69  ? 145.533 184.978 176.267 1.00 139.83 ? 69   DA  I "C5'" 1 
ATOM 7349  C "C4'" . DA  I 5 69  ? 146.963 185.229 175.849 1.00 121.14 ? 69   DA  I "C4'" 1 
ATOM 7350  O "O4'" . DA  I 5 69  ? 147.008 186.335 174.935 1.00 114.08 ? 69   DA  I "O4'" 1 
ATOM 7351  C "C3'" . DA  I 5 69  ? 147.887 185.643 176.960 1.00 113.93 ? 69   DA  I "C3'" 1 
ATOM 7352  O "O3'" . DA  I 5 69  ? 149.223 185.346 176.580 1.00 110.01 ? 69   DA  I "O3'" 1 
ATOM 7353  C "C2'" . DA  I 5 69  ? 147.624 187.150 177.063 1.00 111.43 ? 69   DA  I "C2'" 1 
ATOM 7354  C "C1'" . DA  I 5 69  ? 147.131 187.530 175.666 1.00 115.14 ? 69   DA  I "C1'" 1 
ATOM 7355  N N9    . DA  I 5 69  ? 145.826 188.162 175.676 1.00 128.34 ? 69   DA  I N9    1 
ATOM 7356  C C8    . DA  I 5 69  ? 144.952 188.212 176.712 1.00 133.05 ? 69   DA  I C8    1 
ATOM 7357  N N7    . DA  I 5 69  ? 143.832 188.817 176.423 1.00 136.23 ? 69   DA  I N7    1 
ATOM 7358  C C5    . DA  I 5 69  ? 143.985 189.184 175.109 1.00 133.44 ? 69   DA  I C5    1 
ATOM 7359  C C6    . DA  I 5 69  ? 143.145 189.855 174.223 1.00 133.35 ? 69   DA  I C6    1 
ATOM 7360  N N6    . DA  I 5 69  ? 141.940 190.294 174.561 1.00 137.91 ? 69   DA  I N6    1 
ATOM 7361  N N1    . DA  I 5 69  ? 143.589 190.067 172.978 1.00 128.51 ? 69   DA  I N1    1 
ATOM 7362  C C2    . DA  I 5 69  ? 144.796 189.619 172.652 1.00 122.43 ? 69   DA  I C2    1 
ATOM 7363  N N3    . DA  I 5 69  ? 145.677 188.970 173.402 1.00 122.42 ? 69   DA  I N3    1 
ATOM 7364  C C4    . DA  I 5 69  ? 145.201 188.781 174.629 1.00 129.55 ? 69   DA  I C4    1 
ATOM 7365  P P     . DC  I 5 70  ? 150.469 186.201 177.124 1.00 101.30 ? 70   DC  I P     1 
ATOM 7366  O OP1   . DC  I 5 70  ? 151.661 185.369 176.893 1.00 97.68  ? 70   DC  I OP1   1 
ATOM 7367  O OP2   . DC  I 5 70  ? 150.216 186.702 178.487 1.00 95.00  ? 70   DC  I OP2   1 
ATOM 7368  O "O5'" . DC  I 5 70  ? 150.567 187.414 176.099 1.00 105.11 ? 70   DC  I "O5'" 1 
ATOM 7369  C "C5'" . DC  I 5 70  ? 150.945 187.140 174.779 1.00 102.87 ? 70   DC  I "C5'" 1 
ATOM 7370  C "C4'" . DC  I 5 70  ? 150.971 188.392 173.939 1.00 99.88  ? 70   DC  I "C4'" 1 
ATOM 7371  O "O4'" . DC  I 5 70  ? 149.662 189.011 173.934 1.00 104.56 ? 70   DC  I "O4'" 1 
ATOM 7372  C "C3'" . DC  I 5 70  ? 151.943 189.462 174.396 1.00 93.72  ? 70   DC  I "C3'" 1 
ATOM 7373  O "O3'" . DC  I 5 70  ? 152.469 190.093 173.256 1.00 83.87  ? 70   DC  I "O3'" 1 
ATOM 7374  C "C2'" . DC  I 5 70  ? 151.032 190.398 175.177 1.00 99.72  ? 70   DC  I "C2'" 1 
ATOM 7375  C "C1'" . DC  I 5 70  ? 149.786 190.356 174.316 1.00 105.37 ? 70   DC  I "C1'" 1 
ATOM 7376  N N1    . DC  I 5 70  ? 148.557 190.727 175.026 1.00 111.66 ? 70   DC  I N1    1 
ATOM 7377  C C2    . DC  I 5 70  ? 147.517 191.353 174.338 1.00 111.66 ? 70   DC  I C2    1 
ATOM 7378  O O2    . DC  I 5 70  ? 147.651 191.620 173.144 1.00 105.64 ? 70   DC  I O2    1 
ATOM 7379  N N3    . DC  I 5 70  ? 146.389 191.667 175.003 1.00 115.17 ? 70   DC  I N3    1 
ATOM 7380  C C4    . DC  I 5 70  ? 146.280 191.372 176.289 1.00 120.44 ? 70   DC  I C4    1 
ATOM 7381  N N4    . DC  I 5 70  ? 145.148 191.694 176.905 1.00 123.35 ? 70   DC  I N4    1 
ATOM 7382  C C5    . DC  I 5 70  ? 147.324 190.730 177.005 1.00 119.09 ? 70   DC  I C5    1 
ATOM 7383  C C6    . DC  I 5 70  ? 148.436 190.434 176.340 1.00 114.48 ? 70   DC  I C6    1 
ATOM 7384  P P     . DG  I 5 71  ? 153.849 190.901 173.315 1.00 86.72  ? 71   DG  I P     1 
ATOM 7385  O OP1   . DG  I 5 71  ? 154.951 189.951 173.063 1.00 85.15  ? 71   DG  I OP1   1 
ATOM 7386  O OP2   . DG  I 5 71  ? 153.842 191.694 174.555 1.00 84.16  ? 71   DG  I OP2   1 
ATOM 7387  O "O5'" . DG  I 5 71  ? 153.722 191.904 172.080 1.00 75.99  ? 71   DG  I "O5'" 1 
ATOM 7388  C "C5'" . DG  I 5 71  ? 152.602 191.788 171.211 1.00 82.60  ? 71   DG  I "C5'" 1 
ATOM 7389  C "C4'" . DG  I 5 71  ? 152.454 192.993 170.297 1.00 93.52  ? 71   DG  I "C4'" 1 
ATOM 7390  O "O4'" . DG  I 5 71  ? 151.272 193.721 170.654 1.00 99.45  ? 71   DG  I "O4'" 1 
ATOM 7391  C "C3'" . DG  I 5 71  ? 153.545 194.025 170.387 1.00 97.12  ? 71   DG  I "C3'" 1 
ATOM 7392  O "O3'" . DG  I 5 71  ? 153.482 194.856 169.246 1.00 99.61  ? 71   DG  I "O3'" 1 
ATOM 7393  C "C2'" . DG  I 5 71  ? 153.142 194.787 171.642 1.00 94.80  ? 71   DG  I "C2'" 1 
ATOM 7394  C "C1'" . DG  I 5 71  ? 151.617 194.741 171.569 1.00 98.71  ? 71   DG  I "C1'" 1 
ATOM 7395  N N9    . DG  I 5 71  ? 150.988 194.415 172.830 1.00 99.03  ? 71   DG  I N9    1 
ATOM 7396  C C8    . DG  I 5 71  ? 151.489 193.626 173.829 1.00 95.83  ? 71   DG  I C8    1 
ATOM 7397  N N7    . DG  I 5 71  ? 150.679 193.500 174.838 1.00 96.88  ? 71   DG  I N7    1 
ATOM 7398  C C5    . DG  I 5 71  ? 149.570 194.229 174.469 1.00 101.05 ? 71   DG  I C5    1 
ATOM 7399  C C6    . DG  I 5 71  ? 148.372 194.456 175.156 1.00 105.69 ? 71   DG  I C6    1 
ATOM 7400  O O6    . DG  I 5 71  ? 148.033 194.038 176.266 1.00 105.34 ? 71   DG  I O6    1 
ATOM 7401  N N1    . DG  I 5 71  ? 147.515 195.266 174.427 1.00 111.94 ? 71   DG  I N1    1 
ATOM 7402  C C2    . DG  I 5 71  ? 147.795 195.796 173.194 1.00 112.21 ? 71   DG  I C2    1 
ATOM 7403  N N2    . DG  I 5 71  ? 146.845 196.547 172.634 1.00 122.04 ? 71   DG  I N2    1 
ATOM 7404  N N3    . DG  I 5 71  ? 148.912 195.582 172.541 1.00 101.32 ? 71   DG  I N3    1 
ATOM 7405  C C4    . DG  I 5 71  ? 149.750 194.799 173.238 1.00 100.28 ? 71   DG  I C4    1 
ATOM 7406  P P     . DC  I 5 72  ? 154.426 196.146 169.124 1.00 87.88  ? 72   DC  I P     1 
ATOM 7407  O OP1   . DC  I 5 72  ? 154.554 196.443 167.685 1.00 75.13  ? 72   DC  I OP1   1 
ATOM 7408  O OP2   . DC  I 5 72  ? 155.627 195.913 169.951 1.00 84.01  ? 72   DC  I OP2   1 
ATOM 7409  O "O5'" . DC  I 5 72  ? 153.581 197.315 169.808 1.00 117.36 ? 72   DC  I "O5'" 1 
ATOM 7410  C "C5'" . DC  I 5 72  ? 152.400 197.777 169.189 1.00 108.60 ? 72   DC  I "C5'" 1 
ATOM 7411  C "C4'" . DC  I 5 72  ? 151.631 198.709 170.105 1.00 107.18 ? 72   DC  I "C4'" 1 
ATOM 7412  O "O4'" . DC  I 5 72  ? 151.076 197.969 171.221 1.00 112.40 ? 72   DC  I "O4'" 1 
ATOM 7413  C "C3'" . DC  I 5 72  ? 152.450 199.849 170.729 1.00 112.19 ? 72   DC  I "C3'" 1 
ATOM 7414  O "O3'" . DC  I 5 72  ? 151.767 201.059 170.558 1.00 123.28 ? 72   DC  I "O3'" 1 
ATOM 7415  C "C2'" . DC  I 5 72  ? 152.483 199.473 172.201 1.00 108.21 ? 72   DC  I "C2'" 1 
ATOM 7416  C "C1'" . DC  I 5 72  ? 151.134 198.815 172.321 1.00 110.94 ? 72   DC  I "C1'" 1 
ATOM 7417  N N1    . DC  I 5 72  ? 150.955 198.065 173.550 1.00 114.84 ? 72   DC  I N1    1 
ATOM 7418  C C2    . DC  I 5 72  ? 149.791 198.244 174.264 1.00 115.70 ? 72   DC  I C2    1 
ATOM 7419  O O2    . DC  I 5 72  ? 148.940 198.997 173.807 1.00 112.40 ? 72   DC  I O2    1 
ATOM 7420  N N3    . DC  I 5 72  ? 149.617 197.584 175.418 1.00 117.54 ? 72   DC  I N3    1 
ATOM 7421  C C4    . DC  I 5 72  ? 150.571 196.784 175.865 1.00 115.91 ? 72   DC  I C4    1 
ATOM 7422  N N4    . DC  I 5 72  ? 150.354 196.148 177.012 1.00 113.31 ? 72   DC  I N4    1 
ATOM 7423  C C5    . DC  I 5 72  ? 151.787 196.595 175.154 1.00 117.33 ? 72   DC  I C5    1 
ATOM 7424  C C6    . DC  I 5 72  ? 151.937 197.258 174.011 1.00 118.45 ? 72   DC  I C6    1 
ATOM 7425  P P     . DG  I 5 73  ? 152.215 202.087 169.415 1.00 117.01 ? 73   DG  I P     1 
ATOM 7426  O OP1   . DG  I 5 73  ? 151.689 201.577 168.132 1.00 92.57  ? 73   DG  I OP1   1 
ATOM 7427  O OP2   . DG  I 5 73  ? 153.664 202.310 169.576 1.00 116.64 ? 73   DG  I OP2   1 
ATOM 7428  O "O5'" . DG  I 5 73  ? 151.454 203.438 169.802 1.00 148.59 ? 73   DG  I "O5'" 1 
ATOM 7429  C "C5'" . DG  I 5 73  ? 150.043 203.438 169.956 1.00 146.50 ? 73   DG  I "C5'" 1 
ATOM 7430  C "C4'" . DG  I 5 73  ? 149.646 204.068 171.277 1.00 147.97 ? 73   DG  I "C4'" 1 
ATOM 7431  O "O4'" . DG  I 5 73  ? 149.835 203.117 172.339 1.00 147.39 ? 73   DG  I "O4'" 1 
ATOM 7432  C "C3'" . DG  I 5 73  ? 150.458 205.297 171.665 1.00 152.84 ? 73   DG  I "C3'" 1 
ATOM 7433  O "O3'" . DG  I 5 73  ? 149.655 206.446 171.575 1.00 164.12 ? 73   DG  I "O3'" 1 
ATOM 7434  C "C2'" . DG  I 5 73  ? 150.901 205.040 173.110 1.00 147.21 ? 73   DG  I "C2'" 1 
ATOM 7435  C "C1'" . DG  I 5 73  ? 150.120 203.805 173.521 1.00 147.41 ? 73   DG  I "C1'" 1 
ATOM 7436  N N9    . DG  I 5 73  ? 150.905 202.929 174.356 1.00 143.99 ? 73   DG  I N9    1 
ATOM 7437  C C8    . DG  I 5 73  ? 152.118 202.390 174.044 1.00 143.87 ? 73   DG  I C8    1 
ATOM 7438  N N7    . DG  I 5 73  ? 152.608 201.644 174.981 1.00 145.31 ? 73   DG  I N7    1 
ATOM 7439  C C5    . DG  I 5 73  ? 151.656 201.689 175.977 1.00 143.82 ? 73   DG  I C5    1 
ATOM 7440  C C6    . DG  I 5 73  ? 151.647 201.076 177.235 1.00 145.32 ? 73   DG  I C6    1 
ATOM 7441  O O6    . DG  I 5 73  ? 152.503 200.339 177.732 1.00 145.08 ? 73   DG  I O6    1 
ATOM 7442  N N1    . DG  I 5 73  ? 150.503 201.379 177.943 1.00 149.81 ? 73   DG  I N1    1 
ATOM 7443  C C2    . DG  I 5 73  ? 149.499 202.177 177.491 1.00 154.45 ? 73   DG  I C2    1 
ATOM 7444  N N2    . DG  I 5 73  ? 148.476 202.350 178.325 1.00 164.81 ? 73   DG  I N2    1 
ATOM 7445  N N3    . DG  I 5 73  ? 149.495 202.770 176.310 1.00 145.55 ? 73   DG  I N3    1 
ATOM 7446  C C4    . DG  I 5 73  ? 150.602 202.481 175.611 1.00 141.74 ? 73   DG  I C4    1 
ATOM 7447  P P     . DC  I 5 74  ? 150.235 207.865 172.043 1.00 143.54 ? 74   DC  I P     1 
ATOM 7448  O OP1   . DC  I 5 74  ? 149.404 208.908 171.408 1.00 135.09 ? 74   DC  I OP1   1 
ATOM 7449  O OP2   . DC  I 5 74  ? 151.697 207.843 171.837 1.00 142.30 ? 74   DC  I OP2   1 
ATOM 7450  O "O5'" . DC  I 5 74  ? 149.955 207.896 173.611 1.00 132.55 ? 74   DC  I "O5'" 1 
ATOM 7451  C "C5'" . DC  I 5 74  ? 148.632 207.793 174.073 1.00 135.52 ? 74   DC  I "C5'" 1 
ATOM 7452  C "C4'" . DC  I 5 74  ? 148.601 207.622 175.571 1.00 144.56 ? 74   DC  I "C4'" 1 
ATOM 7453  O "O4'" . DC  I 5 74  ? 149.332 206.433 175.938 1.00 149.50 ? 74   DC  I "O4'" 1 
ATOM 7454  C "C3'" . DC  I 5 74  ? 149.235 208.768 176.361 1.00 154.50 ? 74   DC  I "C3'" 1 
ATOM 7455  O "O3'" . DC  I 5 74  ? 148.294 209.277 177.282 1.00 161.38 ? 74   DC  I "O3'" 1 
ATOM 7456  C "C2'" . DC  I 5 74  ? 150.414 208.104 177.072 1.00 155.33 ? 74   DC  I "C2'" 1 
ATOM 7457  C "C1'" . DC  I 5 74  ? 149.945 206.673 177.164 1.00 155.51 ? 74   DC  I "C1'" 1 
ATOM 7458  N N1    . DC  I 5 74  ? 151.028 205.723 177.321 1.00 156.22 ? 74   DC  I N1    1 
ATOM 7459  C C2    . DC  I 5 74  ? 151.189 205.057 178.531 1.00 157.77 ? 74   DC  I C2    1 
ATOM 7460  O O2    . DC  I 5 74  ? 150.406 205.282 179.450 1.00 159.79 ? 74   DC  I O2    1 
ATOM 7461  N N3    . DC  I 5 74  ? 152.197 204.180 178.664 1.00 154.25 ? 74   DC  I N3    1 
ATOM 7462  C C4    . DC  I 5 74  ? 153.021 203.965 177.651 1.00 152.78 ? 74   DC  I C4    1 
ATOM 7463  N N4    . DC  I 5 74  ? 154.005 203.086 177.829 1.00 154.84 ? 74   DC  I N4    1 
ATOM 7464  C C5    . DC  I 5 74  ? 152.873 204.637 176.406 1.00 150.42 ? 74   DC  I C5    1 
ATOM 7465  C C6    . DC  I 5 74  ? 151.868 205.498 176.288 1.00 151.42 ? 74   DC  I C6    1 
ATOM 7466  P P     . DT  I 5 75  ? 148.528 210.695 177.993 1.00 149.52 ? 75   DT  I P     1 
ATOM 7467  O OP1   . DT  I 5 75  ? 147.391 211.559 177.629 1.00 151.10 ? 75   DT  I OP1   1 
ATOM 7468  O OP2   . DT  I 5 75  ? 149.903 211.144 177.711 1.00 141.17 ? 75   DT  I OP2   1 
ATOM 7469  O "O5'" . DT  I 5 75  ? 148.442 210.350 179.549 1.00 141.71 ? 75   DT  I "O5'" 1 
ATOM 7470  C "C5'" . DT  I 5 75  ? 148.976 209.123 180.032 1.00 147.76 ? 75   DT  I "C5'" 1 
ATOM 7471  C "C4'" . DT  I 5 75  ? 149.338 209.232 181.495 1.00 158.89 ? 75   DT  I "C4'" 1 
ATOM 7472  O "O4'" . DT  I 5 75  ? 150.319 208.222 181.817 1.00 158.42 ? 75   DT  I "O4'" 1 
ATOM 7473  C "C3'" . DT  I 5 75  ? 150.019 210.522 181.873 1.00 166.48 ? 75   DT  I "C3'" 1 
ATOM 7474  O "O3'" . DT  I 5 75  ? 150.005 210.652 183.264 1.00 172.93 ? 75   DT  I "O3'" 1 
ATOM 7475  C "C2'" . DT  I 5 75  ? 151.418 210.244 181.384 1.00 163.89 ? 75   DT  I "C2'" 1 
ATOM 7476  C "C1'" . DT  I 5 75  ? 151.593 208.829 181.908 1.00 158.79 ? 75   DT  I "C1'" 1 
ATOM 7477  N N1    . DT  I 5 75  ? 152.530 208.032 181.125 1.00 153.71 ? 75   DT  I N1    1 
ATOM 7478  C C2    . DT  I 5 75  ? 153.156 206.974 181.713 1.00 153.21 ? 75   DT  I C2    1 
ATOM 7479  O O2    . DT  I 5 75  ? 152.986 206.661 182.870 1.00 153.80 ? 75   DT  I O2    1 
ATOM 7480  N N3    . DT  I 5 75  ? 153.990 206.286 180.901 1.00 150.82 ? 75   DT  I N3    1 
ATOM 7481  C C4    . DT  I 5 75  ? 154.260 206.541 179.588 1.00 146.39 ? 75   DT  I C4    1 
ATOM 7482  O O4    . DT  I 5 75  ? 155.035 205.858 178.940 1.00 137.48 ? 75   DT  I O4    1 
ATOM 7483  C C5    . DT  I 5 75  ? 153.573 207.665 179.027 1.00 148.29 ? 75   DT  I C5    1 
ATOM 7484  C C7    . DT  I 5 75  ? 153.796 208.042 177.600 1.00 139.76 ? 75   DT  I C7    1 
ATOM 7485  C C6    . DT  I 5 75  ? 152.747 208.350 179.814 1.00 151.79 ? 75   DT  I C6    1 
ATOM 7486  P P     . DG  I 5 76  ? 150.083 212.107 183.922 1.00 185.42 ? 76   DG  I P     1 
ATOM 7487  O OP1   . DG  I 5 76  ? 148.976 212.904 183.354 1.00 187.87 ? 76   DG  I OP1   1 
ATOM 7488  O OP2   . DG  I 5 76  ? 151.474 212.572 183.781 1.00 179.69 ? 76   DG  I OP2   1 
ATOM 7489  O "O5'" . DG  I 5 76  ? 149.802 211.844 185.468 1.00 107.78 ? 76   DG  I "O5'" 1 
ATOM 7490  C "C5'" . DG  I 5 76  ? 149.986 210.555 186.007 1.00 117.43 ? 76   DG  I "C5'" 1 
ATOM 7491  C "C4'" . DG  I 5 76  ? 151.397 210.384 186.516 1.00 130.73 ? 76   DG  I "C4'" 1 
ATOM 7492  O "O4'" . DG  I 5 76  ? 152.185 209.713 185.519 1.00 138.56 ? 76   DG  I "O4'" 1 
ATOM 7493  C "C3'" . DG  I 5 76  ? 152.132 211.688 186.828 1.00 138.45 ? 76   DG  I "C3'" 1 
ATOM 7494  O "O3'" . DG  I 5 76  ? 152.350 211.805 188.255 1.00 141.26 ? 76   DG  I "O3'" 1 
ATOM 7495  C "C2'" . DG  I 5 76  ? 153.430 211.600 186.011 1.00 139.97 ? 76   DG  I "C2'" 1 
ATOM 7496  C "C1'" . DG  I 5 76  ? 153.509 210.126 185.660 1.00 143.29 ? 76   DG  I "C1'" 1 
ATOM 7497  N N9    . DG  I 5 76  ? 154.197 209.866 184.409 1.00 148.75 ? 76   DG  I N9    1 
ATOM 7498  C C8    . DG  I 5 76  ? 154.069 210.563 183.245 1.00 146.95 ? 76   DG  I C8    1 
ATOM 7499  N N7    . DG  I 5 76  ? 154.797 210.093 182.279 1.00 140.61 ? 76   DG  I N7    1 
ATOM 7500  C C5    . DG  I 5 76  ? 155.455 209.027 182.846 1.00 136.96 ? 76   DG  I C5    1 
ATOM 7501  C C6    . DG  I 5 76  ? 156.381 208.148 182.283 1.00 131.13 ? 76   DG  I C6    1 
ATOM 7502  O O6    . DG  I 5 76  ? 156.818 208.142 181.131 1.00 133.38 ? 76   DG  I O6    1 
ATOM 7503  N N1    . DG  I 5 76  ? 156.813 207.206 183.196 1.00 132.51 ? 76   DG  I N1    1 
ATOM 7504  C C2    . DG  I 5 76  ? 156.398 207.134 184.495 1.00 138.22 ? 76   DG  I C2    1 
ATOM 7505  N N2    . DG  I 5 76  ? 156.920 206.155 185.232 1.00 137.11 ? 76   DG  I N2    1 
ATOM 7506  N N3    . DG  I 5 76  ? 155.521 207.950 185.034 1.00 144.73 ? 76   DG  I N3    1 
ATOM 7507  C C4    . DG  I 5 76  ? 155.097 208.871 184.155 1.00 145.49 ? 76   DG  I C4    1 
ATOM 7508  P P     . DT  I 5 77  ? 153.821 211.893 188.908 1.00 167.54 ? 77   DT  I P     1 
ATOM 7509  O OP1   . DT  I 5 77  ? 153.628 211.898 190.371 1.00 166.67 ? 77   DT  I OP1   1 
ATOM 7510  O OP2   . DT  I 5 77  ? 154.613 212.988 188.313 1.00 166.12 ? 77   DT  I OP2   1 
ATOM 7511  O "O5'" . DT  I 5 77  ? 154.482 210.490 188.561 1.00 156.41 ? 77   DT  I "O5'" 1 
ATOM 7512  C "C5'" . DT  I 5 77  ? 154.164 209.370 189.335 1.00 155.96 ? 77   DT  I "C5'" 1 
ATOM 7513  C "C4'" . DT  I 5 77  ? 155.388 208.870 190.066 1.00 158.43 ? 77   DT  I "C4'" 1 
ATOM 7514  O "O4'" . DT  I 5 77  ? 156.418 208.533 189.106 1.00 160.81 ? 77   DT  I "O4'" 1 
ATOM 7515  C "C3'" . DT  I 5 77  ? 156.032 209.855 191.023 1.00 164.02 ? 77   DT  I "C3'" 1 
ATOM 7516  O "O3'" . DT  I 5 77  ? 156.633 209.125 192.086 1.00 166.13 ? 77   DT  I "O3'" 1 
ATOM 7517  C "C2'" . DT  I 5 77  ? 157.062 210.554 190.136 1.00 164.87 ? 77   DT  I "C2'" 1 
ATOM 7518  C "C1'" . DT  I 5 77  ? 157.511 209.421 189.221 1.00 162.18 ? 77   DT  I "C1'" 1 
ATOM 7519  N N1    . DT  I 5 77  ? 157.866 209.859 187.859 1.00 157.03 ? 77   DT  I N1    1 
ATOM 7520  C C2    . DT  I 5 77  ? 158.810 209.164 187.161 1.00 155.67 ? 77   DT  I C2    1 
ATOM 7521  O O2    . DT  I 5 77  ? 159.399 208.211 187.616 1.00 151.71 ? 77   DT  I O2    1 
ATOM 7522  N N3    . DT  I 5 77  ? 159.055 209.639 185.909 1.00 153.93 ? 77   DT  I N3    1 
ATOM 7523  C C4    . DT  I 5 77  ? 158.447 210.701 185.296 1.00 148.65 ? 77   DT  I C4    1 
ATOM 7524  O O4    . DT  I 5 77  ? 158.734 211.055 184.165 1.00 145.80 ? 77   DT  I O4    1 
ATOM 7525  C C5    . DT  I 5 77  ? 157.463 211.381 186.081 1.00 147.72 ? 77   DT  I C5    1 
ATOM 7526  C C7    . DT  I 5 77  ? 156.742 212.558 185.513 1.00 148.14 ? 77   DT  I C7    1 
ATOM 7527  C C6    . DT  I 5 77  ? 157.215 210.928 187.308 1.00 151.95 ? 77   DT  I C6    1 
ATOM 7528  P P     . DC  I 5 78  ? 157.821 209.744 192.968 1.00 136.03 ? 78   DC  I P     1 
ATOM 7529  O OP1   . DC  I 5 78  ? 157.879 208.965 194.217 1.00 136.75 ? 78   DC  I OP1   1 
ATOM 7530  O OP2   . DC  I 5 78  ? 157.696 211.214 193.010 1.00 128.25 ? 78   DC  I OP2   1 
ATOM 7531  O "O5'" . DC  I 5 78  ? 159.122 209.355 192.156 1.00 158.19 ? 78   DC  I "O5'" 1 
ATOM 7532  C "C5'" . DC  I 5 78  ? 159.380 208.009 191.906 1.00 146.87 ? 78   DC  I "C5'" 1 
ATOM 7533  C "C4'" . DC  I 5 78  ? 160.756 207.841 191.326 1.00 137.22 ? 78   DC  I "C4'" 1 
ATOM 7534  O "O4'" . DC  I 5 78  ? 160.780 208.356 189.979 1.00 133.41 ? 78   DC  I "O4'" 1 
ATOM 7535  C "C3'" . DC  I 5 78  ? 161.856 208.566 192.082 1.00 136.65 ? 78   DC  I "C3'" 1 
ATOM 7536  O "O3'" . DC  I 5 78  ? 162.945 207.693 192.218 1.00 138.65 ? 78   DC  I "O3'" 1 
ATOM 7537  C "C2'" . DC  I 5 78  ? 162.175 209.760 191.180 1.00 134.10 ? 78   DC  I "C2'" 1 
ATOM 7538  C "C1'" . DC  I 5 78  ? 161.896 209.186 189.812 1.00 136.19 ? 78   DC  I "C1'" 1 
ATOM 7539  N N1    . DC  I 5 78  ? 161.538 210.187 188.799 1.00 141.61 ? 78   DC  I N1    1 
ATOM 7540  C C2    . DC  I 5 78  ? 162.157 210.157 187.552 1.00 147.51 ? 78   DC  I C2    1 
ATOM 7541  O O2    . DC  I 5 78  ? 163.029 209.312 187.334 1.00 153.12 ? 78   DC  I O2    1 
ATOM 7542  N N3    . DC  I 5 78  ? 161.799 211.063 186.618 1.00 141.85 ? 78   DC  I N3    1 
ATOM 7543  C C4    . DC  I 5 78  ? 160.861 211.957 186.896 1.00 142.03 ? 78   DC  I C4    1 
ATOM 7544  N N4    . DC  I 5 78  ? 160.539 212.833 185.947 1.00 142.68 ? 78   DC  I N4    1 
ATOM 7545  C C5    . DC  I 5 78  ? 160.212 211.996 188.157 1.00 141.15 ? 78   DC  I C5    1 
ATOM 7546  C C6    . DC  I 5 78  ? 160.574 211.096 189.068 1.00 138.46 ? 78   DC  I C6    1 
ATOM 7547  P P     . DC  I 5 79  ? 164.239 208.093 193.074 1.00 132.75 ? 79   DC  I P     1 
ATOM 7548  O OP1   . DC  I 5 79  ? 164.419 207.048 194.099 1.00 133.80 ? 79   DC  I OP1   1 
ATOM 7549  O OP2   . DC  I 5 79  ? 164.175 209.512 193.471 1.00 135.72 ? 79   DC  I OP2   1 
ATOM 7550  O "O5'" . DC  I 5 79  ? 165.395 207.945 192.004 1.00 145.07 ? 79   DC  I "O5'" 1 
ATOM 7551  C "C5'" . DC  I 5 79  ? 165.070 207.425 190.736 1.00 145.81 ? 79   DC  I "C5'" 1 
ATOM 7552  C "C4'" . DC  I 5 79  ? 166.237 207.551 189.799 1.00 146.83 ? 79   DC  I "C4'" 1 
ATOM 7553  O "O4'" . DC  I 5 79  ? 165.885 208.419 188.700 1.00 141.19 ? 79   DC  I "O4'" 1 
ATOM 7554  C "C3'" . DC  I 5 79  ? 167.471 208.159 190.421 1.00 150.90 ? 79   DC  I "C3'" 1 
ATOM 7555  O "O3'" . DC  I 5 79  ? 168.609 207.654 189.768 1.00 150.74 ? 79   DC  I "O3'" 1 
ATOM 7556  C "C2'" . DC  I 5 79  ? 167.268 209.643 190.147 1.00 148.51 ? 79   DC  I "C2'" 1 
ATOM 7557  C "C1'" . DC  I 5 79  ? 166.628 209.613 188.769 1.00 139.04 ? 79   DC  I "C1'" 1 
ATOM 7558  N N1    . DC  I 5 79  ? 165.698 210.710 188.537 1.00 131.67 ? 79   DC  I N1    1 
ATOM 7559  C C2    . DC  I 5 79  ? 165.660 211.329 187.291 1.00 131.58 ? 79   DC  I C2    1 
ATOM 7560  O O2    . DC  I 5 79  ? 166.431 210.953 186.407 1.00 128.79 ? 79   DC  I O2    1 
ATOM 7561  N N3    . DC  I 5 79  ? 164.782 212.332 187.087 1.00 137.43 ? 79   DC  I N3    1 
ATOM 7562  C C4    . DC  I 5 79  ? 163.971 212.713 188.070 1.00 141.96 ? 79   DC  I C4    1 
ATOM 7563  N N4    . DC  I 5 79  ? 163.121 213.710 187.828 1.00 144.24 ? 79   DC  I N4    1 
ATOM 7564  C C5    . DC  I 5 79  ? 163.994 212.087 189.346 1.00 140.64 ? 79   DC  I C5    1 
ATOM 7565  C C6    . DC  I 5 79  ? 164.862 211.095 189.529 1.00 135.85 ? 79   DC  I C6    1 
ATOM 7566  P P     . DC  I 5 80  ? 169.218 206.233 190.206 1.00 144.13 ? 80   DC  I P     1 
ATOM 7567  O OP1   . DC  I 5 80  ? 168.131 205.233 190.266 1.00 137.63 ? 80   DC  I OP1   1 
ATOM 7568  O OP2   . DC  I 5 80  ? 170.049 206.473 191.400 1.00 143.32 ? 80   DC  I OP2   1 
ATOM 7569  O "O5'" . DC  I 5 80  ? 170.188 205.849 189.002 1.00 113.71 ? 80   DC  I "O5'" 1 
ATOM 7570  C "C5'" . DC  I 5 80  ? 169.644 205.555 187.742 1.00 107.81 ? 80   DC  I "C5'" 1 
ATOM 7571  C "C4'" . DC  I 5 80  ? 170.196 206.488 186.689 1.00 104.77 ? 80   DC  I "C4'" 1 
ATOM 7572  O "O4'" . DC  I 5 80  ? 169.643 207.816 186.866 1.00 106.92 ? 80   DC  I "O4'" 1 
ATOM 7573  C "C3'" . DC  I 5 80  ? 171.714 206.652 186.703 1.00 100.47 ? 80   DC  I "C3'" 1 
ATOM 7574  O "O3'" . DC  I 5 80  ? 172.203 206.545 185.377 1.00 100.86 ? 80   DC  I "O3'" 1 
ATOM 7575  C "C2'" . DC  I 5 80  ? 171.899 208.060 187.261 1.00 102.54 ? 80   DC  I "C2'" 1 
ATOM 7576  C "C1'" . DC  I 5 80  ? 170.673 208.752 186.712 1.00 107.66 ? 80   DC  I "C1'" 1 
ATOM 7577  N N1    . DC  I 5 80  ? 170.308 209.979 187.445 1.00 118.68 ? 80   DC  I N1    1 
ATOM 7578  C C2    . DC  I 5 80  ? 169.761 211.060 186.756 1.00 122.69 ? 80   DC  I C2    1 
ATOM 7579  O O2    . DC  I 5 80  ? 169.587 210.977 185.546 1.00 116.39 ? 80   DC  I O2    1 
ATOM 7580  N N3    . DC  I 5 80  ? 169.431 212.170 187.435 1.00 126.95 ? 80   DC  I N3    1 
ATOM 7581  C C4    . DC  I 5 80  ? 169.632 212.228 188.742 1.00 130.68 ? 80   DC  I C4    1 
ATOM 7582  N N4    . DC  I 5 80  ? 169.293 213.348 189.371 1.00 128.81 ? 80   DC  I N4    1 
ATOM 7583  C C5    . DC  I 5 80  ? 170.193 211.142 189.465 1.00 130.07 ? 80   DC  I C5    1 
ATOM 7584  C C6    . DC  I 5 80  ? 170.511 210.046 188.782 1.00 121.06 ? 80   DC  I C6    1 
ATOM 7585  P P     . DC  I 5 81  ? 173.775 206.435 185.069 1.00 109.16 ? 81   DC  I P     1 
ATOM 7586  O OP1   . DC  I 5 81  ? 174.013 205.119 184.458 1.00 95.53  ? 81   DC  I OP1   1 
ATOM 7587  O OP2   . DC  I 5 81  ? 174.559 206.825 186.252 1.00 90.59  ? 81   DC  I OP2   1 
ATOM 7588  O "O5'" . DC  I 5 81  ? 173.993 207.531 183.940 1.00 104.08 ? 81   DC  I "O5'" 1 
ATOM 7589  C "C5'" . DC  I 5 81  ? 173.203 207.481 182.776 1.00 88.29  ? 81   DC  I "C5'" 1 
ATOM 7590  C "C4'" . DC  I 5 81  ? 173.204 208.810 182.061 1.00 78.09  ? 81   DC  I "C4'" 1 
ATOM 7591  O "O4'" . DC  I 5 81  ? 172.653 209.822 182.932 1.00 82.52  ? 81   DC  I "O4'" 1 
ATOM 7592  C "C3'" . DC  I 5 81  ? 174.569 209.323 181.643 1.00 74.96  ? 81   DC  I "C3'" 1 
ATOM 7593  O "O3'" . DC  I 5 81  ? 174.439 210.066 180.464 1.00 71.88  ? 81   DC  I "O3'" 1 
ATOM 7594  C "C2'" . DC  I 5 81  ? 174.949 210.214 182.808 1.00 83.27  ? 81   DC  I "C2'" 1 
ATOM 7595  C "C1'" . DC  I 5 81  ? 173.608 210.829 183.159 1.00 85.24  ? 81   DC  I "C1'" 1 
ATOM 7596  N N1    . DC  I 5 81  ? 173.519 211.237 184.567 1.00 84.13  ? 81   DC  I N1    1 
ATOM 7597  C C2    . DC  I 5 81  ? 172.971 212.468 184.900 1.00 87.39  ? 81   DC  I C2    1 
ATOM 7598  O O2    . DC  I 5 81  ? 172.557 213.201 184.011 1.00 87.82  ? 81   DC  I O2    1 
ATOM 7599  N N3    . DC  I 5 81  ? 172.901 212.821 186.193 1.00 88.37  ? 81   DC  I N3    1 
ATOM 7600  C C4    . DC  I 5 81  ? 173.354 212.000 187.127 1.00 86.91  ? 81   DC  I C4    1 
ATOM 7601  N N4    . DC  I 5 81  ? 173.268 212.390 188.399 1.00 89.31  ? 81   DC  I N4    1 
ATOM 7602  C C5    . DC  I 5 81  ? 173.924 210.744 186.807 1.00 86.28  ? 81   DC  I C5    1 
ATOM 7603  C C6    . DC  I 5 81  ? 173.984 210.407 185.526 1.00 82.31  ? 81   DC  I C6    1 
ATOM 7604  P P     . DC  I 5 82  ? 175.732 210.475 179.613 1.00 93.76  ? 82   DC  I P     1 
ATOM 7605  O OP1   . DC  I 5 82  ? 175.629 209.801 178.312 1.00 96.16  ? 82   DC  I OP1   1 
ATOM 7606  O OP2   . DC  I 5 82  ? 176.936 210.298 180.439 1.00 78.97  ? 82   DC  I OP2   1 
ATOM 7607  O "O5'" . DC  I 5 82  ? 175.516 212.021 179.358 1.00 115.35 ? 82   DC  I "O5'" 1 
ATOM 7608  C "C5'" . DC  I 5 82  ? 174.252 212.472 178.955 1.00 105.24 ? 82   DC  I "C5'" 1 
ATOM 7609  C "C4'" . DC  I 5 82  ? 174.210 213.982 178.863 1.00 89.14  ? 82   DC  I "C4'" 1 
ATOM 7610  O "O4'" . DC  I 5 82  ? 174.095 214.555 180.184 1.00 90.26  ? 82   DC  I "O4'" 1 
ATOM 7611  C "C3'" . DC  I 5 82  ? 175.426 214.624 178.241 1.00 82.61  ? 82   DC  I "C3'" 1 
ATOM 7612  O "O3'" . DC  I 5 82  ? 175.026 215.774 177.558 1.00 82.54  ? 82   DC  I "O3'" 1 
ATOM 7613  C "C2'" . DC  I 5 82  ? 176.289 214.957 179.455 1.00 88.64  ? 82   DC  I "C2'" 1 
ATOM 7614  C "C1'" . DC  I 5 82  ? 175.245 215.310 180.496 1.00 90.39  ? 82   DC  I "C1'" 1 
ATOM 7615  N N1    . DC  I 5 82  ? 175.624 214.959 181.865 1.00 90.02  ? 82   DC  I N1    1 
ATOM 7616  C C2    . DC  I 5 82  ? 175.369 215.851 182.894 1.00 97.67  ? 82   DC  I C2    1 
ATOM 7617  O O2    . DC  I 5 82  ? 174.866 216.941 182.630 1.00 97.65  ? 82   DC  I O2    1 
ATOM 7618  N N3    . DC  I 5 82  ? 175.687 215.505 184.151 1.00 101.61 ? 82   DC  I N3    1 
ATOM 7619  C C4    . DC  I 5 82  ? 176.226 214.325 184.394 1.00 103.59 ? 82   DC  I C4    1 
ATOM 7620  N N4    . DC  I 5 82  ? 176.525 214.029 185.654 1.00 103.87 ? 82   DC  I N4    1 
ATOM 7621  C C5    . DC  I 5 82  ? 176.488 213.396 183.359 1.00 98.86  ? 82   DC  I C5    1 
ATOM 7622  C C6    . DC  I 5 82  ? 176.167 213.750 182.121 1.00 92.71  ? 82   DC  I C6    1 
ATOM 7623  P P     . DG  I 5 83  ? 176.061 216.554 176.624 1.00 92.21  ? 83   DG  I P     1 
ATOM 7624  O OP1   . DG  I 5 83  ? 175.406 216.773 175.322 1.00 76.08  ? 83   DG  I OP1   1 
ATOM 7625  O OP2   . DG  I 5 83  ? 177.363 215.872 176.695 1.00 76.41  ? 83   DG  I OP2   1 
ATOM 7626  O "O5'" . DG  I 5 83  ? 176.222 217.944 177.365 1.00 77.32  ? 83   DG  I "O5'" 1 
ATOM 7627  C "C5'" . DG  I 5 83  ? 175.437 218.204 178.497 1.00 85.22  ? 83   DG  I "C5'" 1 
ATOM 7628  C "C4'" . DG  I 5 83  ? 175.438 219.669 178.817 1.00 90.55  ? 83   DG  I "C4'" 1 
ATOM 7629  O "O4'" . DG  I 5 83  ? 175.705 219.845 180.215 1.00 92.71  ? 83   DG  I "O4'" 1 
ATOM 7630  C "C3'" . DG  I 5 83  ? 176.527 220.444 178.138 1.00 92.62  ? 83   DG  I "C3'" 1 
ATOM 7631  O "O3'" . DG  I 5 83  ? 176.185 221.804 178.128 1.00 97.92  ? 83   DG  I "O3'" 1 
ATOM 7632  C "C2'" . DG  I 5 83  ? 177.724 220.154 179.033 1.00 89.31  ? 83   DG  I "C2'" 1 
ATOM 7633  C "C1'" . DG  I 5 83  ? 177.086 220.039 180.409 1.00 94.40  ? 83   DG  I "C1'" 1 
ATOM 7634  N N9    . DG  I 5 83  ? 177.586 218.917 181.168 1.00 106.66 ? 83   DG  I N9    1 
ATOM 7635  C C8    . DG  I 5 83  ? 178.060 217.743 180.672 1.00 113.74 ? 83   DG  I C8    1 
ATOM 7636  N N7    . DG  I 5 83  ? 178.436 216.911 181.592 1.00 114.71 ? 83   DG  I N7    1 
ATOM 7637  C C5    . DG  I 5 83  ? 178.186 217.579 182.770 1.00 116.82 ? 83   DG  I C5    1 
ATOM 7638  C C6    . DG  I 5 83  ? 178.392 217.177 184.099 1.00 126.16 ? 83   DG  I C6    1 
ATOM 7639  O O6    . DG  I 5 83  ? 178.859 216.115 184.517 1.00 131.77 ? 83   DG  I O6    1 
ATOM 7640  N N1    . DG  I 5 83  ? 178.024 218.158 184.989 1.00 130.09 ? 83   DG  I N1    1 
ATOM 7641  C C2    . DG  I 5 83  ? 177.505 219.371 184.646 1.00 131.60 ? 83   DG  I C2    1 
ATOM 7642  N N2    . DG  I 5 83  ? 177.179 220.174 185.659 1.00 132.45 ? 83   DG  I N2    1 
ATOM 7643  N N3    . DG  I 5 83  ? 177.298 219.758 183.405 1.00 124.59 ? 83   DG  I N3    1 
ATOM 7644  C C4    . DG  I 5 83  ? 177.666 218.815 182.524 1.00 113.41 ? 83   DG  I C4    1 
ATOM 7645  P P     . DC  I 5 84  ? 177.307 222.933 177.959 1.00 106.64 ? 84   DC  I P     1 
ATOM 7646  O OP1   . DC  I 5 84  ? 176.595 224.152 177.537 1.00 110.05 ? 84   DC  I OP1   1 
ATOM 7647  O OP2   . DC  I 5 84  ? 178.411 222.427 177.127 1.00 101.26 ? 84   DC  I OP2   1 
ATOM 7648  O "O5'" . DC  I 5 84  ? 177.864 223.126 179.439 1.00 93.58  ? 84   DC  I "O5'" 1 
ATOM 7649  C "C5'" . DC  I 5 84  ? 179.192 223.518 179.640 1.00 97.30  ? 84   DC  I "C5'" 1 
ATOM 7650  C "C4'" . DC  I 5 84  ? 179.360 224.099 181.019 1.00 108.80 ? 84   DC  I "C4'" 1 
ATOM 7651  O "O4'" . DC  I 5 84  ? 179.200 223.043 181.995 1.00 104.56 ? 84   DC  I "O4'" 1 
ATOM 7652  C "C3'" . DC  I 5 84  ? 180.734 224.673 181.288 1.00 118.46 ? 84   DC  I "C3'" 1 
ATOM 7653  O "O3'" . DC  I 5 84  ? 180.660 225.640 182.315 1.00 131.08 ? 84   DC  I "O3'" 1 
ATOM 7654  C "C2'" . DC  I 5 84  ? 181.472 223.443 181.755 1.00 113.45 ? 84   DC  I "C2'" 1 
ATOM 7655  C "C1'" . DC  I 5 84  ? 180.425 222.833 182.656 1.00 109.44 ? 84   DC  I "C1'" 1 
ATOM 7656  N N1    . DC  I 5 84  ? 180.613 221.403 182.846 1.00 112.20 ? 84   DC  I N1    1 
ATOM 7657  C C2    . DC  I 5 84  ? 180.743 220.890 184.130 1.00 118.52 ? 84   DC  I C2    1 
ATOM 7658  O O2    . DC  I 5 84  ? 180.690 221.659 185.085 1.00 118.36 ? 84   DC  I O2    1 
ATOM 7659  N N3    . DC  I 5 84  ? 180.924 219.564 184.289 1.00 122.84 ? 84   DC  I N3    1 
ATOM 7660  C C4    . DC  I 5 84  ? 180.982 218.775 183.226 1.00 124.74 ? 84   DC  I C4    1 
ATOM 7661  N N4    . DC  I 5 84  ? 181.167 217.471 183.425 1.00 133.61 ? 84   DC  I N4    1 
ATOM 7662  C C5    . DC  I 5 84  ? 180.847 219.281 181.909 1.00 115.74 ? 84   DC  I C5    1 
ATOM 7663  C C6    . DC  I 5 84  ? 180.670 220.591 181.767 1.00 111.36 ? 84   DC  I C6    1 
ATOM 7664  P P     . DG  I 5 85  ? 181.889 226.644 182.569 1.00 124.47 ? 85   DG  I P     1 
ATOM 7665  O OP1   . DG  I 5 85  ? 181.491 227.599 183.622 1.00 117.81 ? 85   DG  I OP1   1 
ATOM 7666  O OP2   . DG  I 5 85  ? 182.332 227.152 181.258 1.00 121.87 ? 85   DG  I OP2   1 
ATOM 7667  O "O5'" . DG  I 5 85  ? 183.051 225.698 183.113 1.00 92.66  ? 85   DG  I "O5'" 1 
ATOM 7668  C "C5'" . DG  I 5 85  ? 184.109 226.238 183.867 1.00 104.10 ? 85   DG  I "C5'" 1 
ATOM 7669  C "C4'" . DG  I 5 85  ? 183.697 226.375 185.312 1.00 118.27 ? 85   DG  I "C4'" 1 
ATOM 7670  O "O4'" . DG  I 5 85  ? 182.728 225.365 185.622 1.00 121.72 ? 85   DG  I "O4'" 1 
ATOM 7671  C "C3'" . DG  I 5 85  ? 184.826 226.244 186.322 1.00 129.52 ? 85   DG  I "C3'" 1 
ATOM 7672  O "O3'" . DG  I 5 85  ? 184.841 227.375 187.144 1.00 134.56 ? 85   DG  I "O3'" 1 
ATOM 7673  C "C2'" . DG  I 5 85  ? 184.514 224.988 187.132 1.00 133.31 ? 85   DG  I "C2'" 1 
ATOM 7674  C "C1'" . DG  I 5 85  ? 183.286 224.398 186.467 1.00 132.42 ? 85   DG  I "C1'" 1 
ATOM 7675  N N9    . DG  I 5 85  ? 183.529 223.175 185.710 1.00 134.30 ? 85   DG  I N9    1 
ATOM 7676  C C8    . DG  I 5 85  ? 183.272 222.951 184.386 1.00 138.35 ? 85   DG  I C8    1 
ATOM 7677  N N7    . DG  I 5 85  ? 183.557 221.743 183.998 1.00 137.68 ? 85   DG  I N7    1 
ATOM 7678  C C5    . DG  I 5 85  ? 184.026 221.130 185.144 1.00 136.48 ? 85   DG  I C5    1 
ATOM 7679  C C6    . DG  I 5 85  ? 184.490 219.819 185.348 1.00 144.63 ? 85   DG  I C6    1 
ATOM 7680  O O6    . DG  I 5 85  ? 184.582 218.897 184.535 1.00 150.67 ? 85   DG  I O6    1 
ATOM 7681  N N1    . DG  I 5 85  ? 184.873 219.615 186.660 1.00 141.43 ? 85   DG  I N1    1 
ATOM 7682  C C2    . DG  I 5 85  ? 184.816 220.559 187.645 1.00 134.70 ? 85   DG  I C2    1 
ATOM 7683  N N2    . DG  I 5 85  ? 185.229 220.177 188.852 1.00 144.69 ? 85   DG  I N2    1 
ATOM 7684  N N3    . DG  I 5 85  ? 184.383 221.785 187.470 1.00 123.60 ? 85   DG  I N3    1 
ATOM 7685  C C4    . DG  I 5 85  ? 184.010 222.001 186.201 1.00 128.00 ? 85   DG  I C4    1 
ATOM 7686  P P     . DT  I 5 86  ? 186.200 228.201 187.324 1.00 127.97 ? 86   DT  I P     1 
ATOM 7687  O OP1   . DT  I 5 86  ? 185.849 229.467 188.002 1.00 125.87 ? 86   DT  I OP1   1 
ATOM 7688  O OP2   . DT  I 5 86  ? 186.876 228.220 186.009 1.00 115.92 ? 86   DT  I OP2   1 
ATOM 7689  O "O5'" . DT  I 5 86  ? 187.065 227.290 188.308 1.00 116.10 ? 86   DT  I "O5'" 1 
ATOM 7690  C "C5'" . DT  I 5 86  ? 186.546 226.950 189.569 1.00 120.08 ? 86   DT  I "C5'" 1 
ATOM 7691  C "C4'" . DT  I 5 86  ? 187.270 225.756 190.145 1.00 126.95 ? 86   DT  I "C4'" 1 
ATOM 7692  O "O4'" . DT  I 5 86  ? 186.940 224.564 189.384 1.00 133.30 ? 86   DT  I "O4'" 1 
ATOM 7693  C "C3'" . DT  I 5 86  ? 188.793 225.858 190.139 1.00 124.17 ? 86   DT  I "C3'" 1 
ATOM 7694  O "O3'" . DT  I 5 86  ? 189.297 225.483 191.418 1.00 117.50 ? 86   DT  I "O3'" 1 
ATOM 7695  C "C2'" . DT  I 5 86  ? 189.200 224.868 189.052 1.00 130.40 ? 86   DT  I "C2'" 1 
ATOM 7696  C "C1'" . DT  I 5 86  ? 188.113 223.823 189.180 1.00 131.14 ? 86   DT  I "C1'" 1 
ATOM 7697  N N1    . DT  I 5 86  ? 187.946 222.990 187.966 1.00 122.95 ? 86   DT  I N1    1 
ATOM 7698  C C2    . DT  I 5 86  ? 188.321 221.673 187.991 1.00 120.95 ? 86   DT  I C2    1 
ATOM 7699  O O2    . DT  I 5 86  ? 188.787 221.133 188.967 1.00 126.88 ? 86   DT  I O2    1 
ATOM 7700  N N3    . DT  I 5 86  ? 188.125 221.005 186.823 1.00 114.29 ? 86   DT  I N3    1 
ATOM 7701  C C4    . DT  I 5 86  ? 187.599 221.518 185.658 1.00 118.05 ? 86   DT  I C4    1 
ATOM 7702  O O4    . DT  I 5 86  ? 187.457 220.847 184.654 1.00 111.91 ? 86   DT  I O4    1 
ATOM 7703  C C5    . DT  I 5 86  ? 187.228 222.899 185.701 1.00 120.41 ? 86   DT  I C5    1 
ATOM 7704  C C7    . DT  I 5 86  ? 186.648 223.559 184.489 1.00 107.43 ? 86   DT  I C7    1 
ATOM 7705  C C6    . DT  I 5 86  ? 187.425 223.561 186.836 1.00 122.35 ? 86   DT  I C6    1 
ATOM 7706  P P     . DT  I 5 87  ? 190.826 225.030 191.612 1.00 146.25 ? 87   DT  I P     1 
ATOM 7707  O OP1   . DT  I 5 87  ? 191.122 225.088 193.055 1.00 140.24 ? 87   DT  I OP1   1 
ATOM 7708  O OP2   . DT  I 5 87  ? 191.680 225.766 190.663 1.00 144.65 ? 87   DT  I OP2   1 
ATOM 7709  O "O5'" . DT  I 5 87  ? 190.815 223.496 191.201 1.00 132.74 ? 87   DT  I "O5'" 1 
ATOM 7710  C "C5'" . DT  I 5 87  ? 189.993 222.598 191.909 1.00 123.49 ? 87   DT  I "C5'" 1 
ATOM 7711  C "C4'" . DT  I 5 87  ? 190.782 221.396 192.368 1.00 114.60 ? 87   DT  I "C4'" 1 
ATOM 7712  O "O4'" . DT  I 5 87  ? 190.794 220.405 191.319 1.00 109.94 ? 87   DT  I "O4'" 1 
ATOM 7713  C "C3'" . DT  I 5 87  ? 192.236 221.672 192.690 1.00 119.82 ? 87   DT  I "C3'" 1 
ATOM 7714  O "O3'" . DT  I 5 87  ? 192.683 220.773 193.685 1.00 133.83 ? 87   DT  I "O3'" 1 
ATOM 7715  C "C2'" . DT  I 5 87  ? 192.924 221.425 191.357 1.00 107.91 ? 87   DT  I "C2'" 1 
ATOM 7716  C "C1'" . DT  I 5 87  ? 192.079 220.317 190.743 1.00 110.48 ? 87   DT  I "C1'" 1 
ATOM 7717  N N1    . DT  I 5 87  ? 191.933 220.435 189.270 1.00 111.39 ? 87   DT  I N1    1 
ATOM 7718  C C2    . DT  I 5 87  ? 192.080 219.319 188.493 1.00 103.99 ? 87   DT  I C2    1 
ATOM 7719  O O2    . DT  I 5 87  ? 192.341 218.223 188.944 1.00 95.39  ? 87   DT  I O2    1 
ATOM 7720  N N3    . DT  I 5 87  ? 191.924 219.533 187.159 1.00 101.70 ? 87   DT  I N3    1 
ATOM 7721  C C4    . DT  I 5 87  ? 191.629 220.718 186.541 1.00 107.60 ? 87   DT  I C4    1 
ATOM 7722  O O4    . DT  I 5 87  ? 191.504 220.810 185.337 1.00 107.41 ? 87   DT  I O4    1 
ATOM 7723  C C5    . DT  I 5 87  ? 191.482 221.842 187.403 1.00 111.83 ? 87   DT  I C5    1 
ATOM 7724  C C7    . DT  I 5 87  ? 191.169 223.176 186.820 1.00 114.58 ? 87   DT  I C7    1 
ATOM 7725  C C6    . DT  I 5 87  ? 191.637 221.657 188.715 1.00 111.16 ? 87   DT  I C6    1 
ATOM 7726  P P     . DT  I 5 88  ? 194.251 220.576 193.964 1.00 120.61 ? 88   DT  I P     1 
ATOM 7727  O OP1   . DT  I 5 88  ? 194.398 220.141 195.363 1.00 112.40 ? 88   DT  I OP1   1 
ATOM 7728  O OP2   . DT  I 5 88  ? 194.997 221.762 193.495 1.00 115.32 ? 88   DT  I OP2   1 
ATOM 7729  O "O5'" . DT  I 5 88  ? 194.623 219.328 193.056 1.00 118.61 ? 88   DT  I "O5'" 1 
ATOM 7730  C "C5'" . DT  I 5 88  ? 193.902 218.129 193.217 1.00 108.42 ? 88   DT  I "C5'" 1 
ATOM 7731  C "C4'" . DT  I 5 88  ? 194.430 217.048 192.299 1.00 102.67 ? 88   DT  I "C4'" 1 
ATOM 7732  O "O4'" . DT  I 5 88  ? 194.137 217.391 190.922 1.00 105.24 ? 88   DT  I "O4'" 1 
ATOM 7733  C "C3'" . DT  I 5 88  ? 195.937 216.825 192.357 1.00 102.58 ? 88   DT  I "C3'" 1 
ATOM 7734  O "O3'" . DT  I 5 88  ? 196.204 215.457 192.172 1.00 111.54 ? 88   DT  I "O3'" 1 
ATOM 7735  C "C2'" . DT  I 5 88  ? 196.422 217.641 191.172 1.00 96.34  ? 88   DT  I "C2'" 1 
ATOM 7736  C "C1'" . DT  I 5 88  ? 195.327 217.344 190.177 1.00 97.46  ? 88   DT  I "C1'" 1 
ATOM 7737  N N1    . DT  I 5 88  ? 195.212 218.310 189.079 1.00 98.24  ? 88   DT  I N1    1 
ATOM 7738  C C2    . DT  I 5 88  ? 195.154 217.839 187.799 1.00 97.44  ? 88   DT  I C2    1 
ATOM 7739  O O2    . DT  I 5 88  ? 195.222 216.659 187.524 1.00 95.15  ? 88   DT  I O2    1 
ATOM 7740  N N3    . DT  I 5 88  ? 195.021 218.796 186.842 1.00 85.86  ? 88   DT  I N3    1 
ATOM 7741  C C4    . DT  I 5 88  ? 194.941 220.153 187.036 1.00 94.74  ? 88   DT  I C4    1 
ATOM 7742  O O4    . DT  I 5 88  ? 194.824 220.938 186.111 1.00 100.67 ? 88   DT  I O4    1 
ATOM 7743  C C5    . DT  I 5 88  ? 194.999 220.585 188.401 1.00 92.69  ? 88   DT  I C5    1 
ATOM 7744  C C7    . DT  I 5 88  ? 194.929 222.043 188.720 1.00 84.38  ? 88   DT  I C7    1 
ATOM 7745  C C6    . DT  I 5 88  ? 195.130 219.653 189.353 1.00 94.85  ? 88   DT  I C6    1 
ATOM 7746  P P     . DT  I 5 89  ? 197.671 214.870 192.432 1.00 106.36 ? 89   DT  I P     1 
ATOM 7747  O OP1   . DT  I 5 89  ? 197.538 213.833 193.475 1.00 107.29 ? 89   DT  I OP1   1 
ATOM 7748  O OP2   . DT  I 5 89  ? 198.600 215.997 192.631 1.00 94.30  ? 89   DT  I OP2   1 
ATOM 7749  O "O5'" . DT  I 5 89  ? 198.053 214.179 191.045 1.00 88.51  ? 89   DT  I "O5'" 1 
ATOM 7750  C "C5'" . DT  I 5 89  ? 197.083 214.081 190.009 1.00 83.56  ? 89   DT  I "C5'" 1 
ATOM 7751  C "C4'" . DT  I 5 89  ? 197.534 213.114 188.932 1.00 84.92  ? 89   DT  I "C4'" 1 
ATOM 7752  O "O4'" . DT  I 5 89  ? 197.429 213.765 187.654 1.00 91.21  ? 89   DT  I "O4'" 1 
ATOM 7753  C "C3'" . DT  I 5 89  ? 198.992 212.724 189.001 1.00 82.14  ? 89   DT  I "C3'" 1 
ATOM 7754  O "O3'" . DT  I 5 89  ? 199.237 211.657 188.097 1.00 90.65  ? 89   DT  I "O3'" 1 
ATOM 7755  C "C2'" . DT  I 5 89  ? 199.621 213.998 188.478 1.00 71.73  ? 89   DT  I "C2'" 1 
ATOM 7756  C "C1'" . DT  I 5 89  ? 198.706 214.261 187.289 1.00 88.40  ? 89   DT  I "C1'" 1 
ATOM 7757  N N1    . DT  I 5 89  ? 198.551 215.659 186.958 1.00 87.12  ? 89   DT  I N1    1 
ATOM 7758  C C2    . DT  I 5 89  ? 198.387 216.002 185.651 1.00 90.80  ? 89   DT  I C2    1 
ATOM 7759  O O2    . DT  I 5 89  ? 198.389 215.192 184.748 1.00 114.28 ? 89   DT  I O2    1 
ATOM 7760  N N3    . DT  I 5 89  ? 198.226 217.327 185.429 1.00 83.04  ? 89   DT  I N3    1 
ATOM 7761  C C4    . DT  I 5 89  ? 198.208 218.325 186.370 1.00 102.98 ? 89   DT  I C4    1 
ATOM 7762  O O4    . DT  I 5 89  ? 198.059 219.497 186.074 1.00 108.13 ? 89   DT  I O4    1 
ATOM 7763  C C5    . DT  I 5 89  ? 198.379 217.901 187.723 1.00 99.38  ? 89   DT  I C5    1 
ATOM 7764  C C7    . DT  I 5 89  ? 198.387 218.917 188.817 1.00 92.02  ? 89   DT  I C7    1 
ATOM 7765  C C6    . DT  I 5 89  ? 198.536 216.598 187.957 1.00 92.44  ? 89   DT  I C6    1 
ATOM 7766  P P     . DA  I 5 90  ? 198.865 210.142 188.474 1.00 89.77  ? 90   DA  I P     1 
ATOM 7767  O OP1   . DA  I 5 90  ? 197.801 210.123 189.496 1.00 90.49  ? 90   DA  I OP1   1 
ATOM 7768  O OP2   . DA  I 5 90  ? 200.127 209.414 188.690 1.00 73.95  ? 90   DA  I OP2   1 
ATOM 7769  O "O5'" . DA  I 5 90  ? 198.252 209.579 187.128 1.00 72.76  ? 90   DA  I "O5'" 1 
ATOM 7770  C "C5'" . DA  I 5 90  ? 197.505 210.431 186.316 1.00 71.65  ? 90   DA  I "C5'" 1 
ATOM 7771  C "C4'" . DA  I 5 90  ? 198.241 210.708 185.029 1.00 85.84  ? 90   DA  I "C4'" 1 
ATOM 7772  O "O4'" . DA  I 5 90  ? 198.846 212.021 185.077 1.00 92.71  ? 90   DA  I "O4'" 1 
ATOM 7773  C "C3'" . DA  I 5 90  ? 199.375 209.730 184.709 1.00 64.49  ? 90   DA  I "C3'" 1 
ATOM 7774  O "O3'" . DA  I 5 90  ? 199.225 209.263 183.384 1.00 63.15  ? 90   DA  I "O3'" 1 
ATOM 7775  C "C2'" . DA  I 5 90  ? 200.620 210.594 184.851 1.00 66.52  ? 90   DA  I "C2'" 1 
ATOM 7776  C "C1'" . DA  I 5 90  ? 200.078 211.938 184.434 1.00 75.79  ? 90   DA  I "C1'" 1 
ATOM 7777  N N9    . DA  I 5 90  ? 200.918 213.032 184.859 1.00 84.30  ? 90   DA  I N9    1 
ATOM 7778  C C8    . DA  I 5 90  ? 201.641 213.097 186.005 1.00 85.86  ? 90   DA  I C8    1 
ATOM 7779  N N7    . DA  I 5 90  ? 202.331 214.195 186.127 1.00 83.50  ? 90   DA  I N7    1 
ATOM 7780  C C5    . DA  I 5 90  ? 202.052 214.888 184.970 1.00 80.17  ? 90   DA  I C5    1 
ATOM 7781  C C6    . DA  I 5 90  ? 202.485 216.128 184.501 1.00 84.88  ? 90   DA  I C6    1 
ATOM 7782  N N6    . DA  I 5 90  ? 203.316 216.900 185.191 1.00 80.73  ? 90   DA  I N6    1 
ATOM 7783  N N1    . DA  I 5 90  ? 202.020 216.554 183.304 1.00 90.55  ? 90   DA  I N1    1 
ATOM 7784  C C2    . DA  I 5 90  ? 201.194 215.748 182.631 1.00 82.93  ? 90   DA  I C2    1 
ATOM 7785  N N3    . DA  I 5 90  ? 200.710 214.559 182.984 1.00 91.86  ? 90   DA  I N3    1 
ATOM 7786  C C4    . DA  I 5 90  ? 201.189 214.185 184.174 1.00 88.09  ? 90   DA  I C4    1 
ATOM 7787  P P     . DA  I 5 91  ? 200.133 208.069 182.809 1.00 79.69  ? 91   DA  I P     1 
ATOM 7788  O OP1   . DA  I 5 91  ? 199.319 206.840 182.859 1.00 72.37  ? 91   DA  I OP1   1 
ATOM 7789  O OP2   . DA  I 5 91  ? 201.471 208.087 183.430 1.00 81.77  ? 91   DA  I OP2   1 
ATOM 7790  O "O5'" . DA  I 5 91  ? 200.308 208.469 181.282 1.00 89.07  ? 91   DA  I "O5'" 1 
ATOM 7791  C "C5'" . DA  I 5 91  ? 199.163 208.660 180.495 1.00 83.24  ? 91   DA  I "C5'" 1 
ATOM 7792  C "C4'" . DA  I 5 91  ? 199.318 209.868 179.609 1.00 75.90  ? 91   DA  I "C4'" 1 
ATOM 7793  O "O4'" . DA  I 5 91  ? 199.850 210.968 180.386 1.00 73.71  ? 91   DA  I "O4'" 1 
ATOM 7794  C "C3'" . DA  I 5 91  ? 200.274 209.685 178.447 1.00 63.62  ? 91   DA  I "C3'" 1 
ATOM 7795  O "O3'" . DA  I 5 91  ? 199.805 210.420 177.356 1.00 57.96  ? 91   DA  I "O3'" 1 
ATOM 7796  C "C2'" . DA  I 5 91  ? 201.557 210.279 178.997 1.00 57.55  ? 91   DA  I "C2'" 1 
ATOM 7797  C "C1'" . DA  I 5 91  ? 200.998 211.463 179.751 1.00 67.72  ? 91   DA  I "C1'" 1 
ATOM 7798  N N9    . DA  I 5 91  ? 201.897 211.996 180.765 1.00 77.65  ? 91   DA  I N9    1 
ATOM 7799  C C8    . DA  I 5 91  ? 202.211 211.428 181.957 1.00 81.81  ? 91   DA  I C8    1 
ATOM 7800  N N7    . DA  I 5 91  ? 203.039 212.136 182.676 1.00 77.19  ? 91   DA  I N7    1 
ATOM 7801  C C5    . DA  I 5 91  ? 203.289 213.244 181.898 1.00 79.53  ? 91   DA  I C5    1 
ATOM 7802  C C6    . DA  I 5 91  ? 204.094 214.371 182.100 1.00 79.46  ? 91   DA  I C6    1 
ATOM 7803  N N6    . DA  I 5 91  ? 204.816 214.562 183.201 1.00 61.61  ? 91   DA  I N6    1 
ATOM 7804  N N1    . DA  I 5 91  ? 204.122 215.300 181.132 1.00 73.55  ? 91   DA  I N1    1 
ATOM 7805  C C2    . DA  I 5 91  ? 203.391 215.094 180.035 1.00 70.71  ? 91   DA  I C2    1 
ATOM 7806  N N3    . DA  I 5 91  ? 202.599 214.074 179.735 1.00 77.16  ? 91   DA  I N3    1 
ATOM 7807  C C4    . DA  I 5 91  ? 202.584 213.182 180.724 1.00 79.15  ? 91   DA  I C4    1 
ATOM 7808  P P     . DC  I 5 92  ? 200.313 210.076 175.879 1.00 70.85  ? 92   DC  I P     1 
ATOM 7809  O OP1   . DC  I 5 92  ? 199.149 209.650 175.087 1.00 70.53  ? 92   DC  I OP1   1 
ATOM 7810  O OP2   . DC  I 5 92  ? 201.496 209.208 176.004 1.00 53.36  ? 92   DC  I OP2   1 
ATOM 7811  O "O5'" . DC  I 5 92  ? 200.810 211.475 175.323 1.00 75.76  ? 92   DC  I "O5'" 1 
ATOM 7812  C "C5'" . DC  I 5 92  ? 201.432 212.368 176.198 1.00 67.62  ? 92   DC  I "C5'" 1 
ATOM 7813  C "C4'" . DC  I 5 92  ? 202.286 213.352 175.445 1.00 68.68  ? 92   DC  I "C4'" 1 
ATOM 7814  O "O4'" . DC  I 5 92  ? 203.167 214.008 176.381 1.00 79.28  ? 92   DC  I "O4'" 1 
ATOM 7815  C "C3'" . DC  I 5 92  ? 203.223 212.730 174.447 1.00 67.00  ? 92   DC  I "C3'" 1 
ATOM 7816  O "O3'" . DC  I 5 92  ? 203.711 213.732 173.608 1.00 69.30  ? 92   DC  I "O3'" 1 
ATOM 7817  C "C2'" . DC  I 5 92  ? 204.310 212.234 175.368 1.00 66.25  ? 92   DC  I "C2'" 1 
ATOM 7818  C "C1'" . DC  I 5 92  ? 204.452 213.439 176.280 1.00 72.35  ? 92   DC  I "C1'" 1 
ATOM 7819  N N1    . DC  I 5 92  ? 204.904 213.098 177.617 1.00 71.74  ? 92   DC  I N1    1 
ATOM 7820  C C2    . DC  I 5 92  ? 205.805 213.923 178.258 1.00 85.47  ? 92   DC  I C2    1 
ATOM 7821  O O2    . DC  I 5 92  ? 206.198 214.936 177.690 1.00 103.93 ? 92   DC  I O2    1 
ATOM 7822  N N3    . DC  I 5 92  ? 206.215 213.610 179.499 1.00 84.17  ? 92   DC  I N3    1 
ATOM 7823  C C4    . DC  I 5 92  ? 205.769 212.507 180.081 1.00 88.34  ? 92   DC  I C4    1 
ATOM 7824  N N4    . DC  I 5 92  ? 206.206 212.235 181.312 1.00 95.04  ? 92   DC  I N4    1 
ATOM 7825  C C5    . DC  I 5 92  ? 204.853 211.640 179.436 1.00 71.76  ? 92   DC  I C5    1 
ATOM 7826  C C6    . DC  I 5 92  ? 204.448 211.977 178.214 1.00 67.22  ? 92   DC  I C6    1 
ATOM 7827  P P     . DC  I 5 93  ? 204.372 213.360 172.198 1.00 88.65  ? 93   DC  I P     1 
ATOM 7828  O OP1   . DC  I 5 93  ? 203.279 213.280 171.209 1.00 69.56  ? 93   DC  I OP1   1 
ATOM 7829  O OP2   . DC  I 5 93  ? 205.269 212.205 172.394 1.00 93.73  ? 93   DC  I OP2   1 
ATOM 7830  O "O5'" . DC  I 5 93  ? 205.283 214.627 171.878 1.00 82.32  ? 93   DC  I "O5'" 1 
ATOM 7831  C "C5'" . DC  I 5 93  ? 205.378 215.678 172.826 1.00 76.17  ? 93   DC  I "C5'" 1 
ATOM 7832  C "C4'" . DC  I 5 93  ? 206.820 216.073 173.033 1.00 85.10  ? 93   DC  I "C4'" 1 
ATOM 7833  O "O4'" . DC  I 5 93  ? 207.216 215.757 174.396 1.00 83.30  ? 93   DC  I "O4'" 1 
ATOM 7834  C "C3'" . DC  I 5 93  ? 207.801 215.329 172.138 1.00 94.07  ? 93   DC  I "C3'" 1 
ATOM 7835  O "O3'" . DC  I 5 93  ? 208.876 216.173 171.800 1.00 109.02 ? 93   DC  I "O3'" 1 
ATOM 7836  C "C2'" . DC  I 5 93  ? 208.257 214.204 173.045 1.00 87.28  ? 93   DC  I "C2'" 1 
ATOM 7837  C "C1'" . DC  I 5 93  ? 208.363 214.952 174.351 1.00 91.34  ? 93   DC  I "C1'" 1 
ATOM 7838  N N1    . DC  I 5 93  ? 208.392 214.066 175.521 1.00 97.06  ? 93   DC  I N1    1 
ATOM 7839  C C2    . DC  I 5 93  ? 209.206 214.379 176.596 1.00 95.93  ? 93   DC  I C2    1 
ATOM 7840  O O2    . DC  I 5 93  ? 209.877 215.405 176.555 1.00 89.73  ? 93   DC  I O2    1 
ATOM 7841  N N3    . DC  I 5 93  ? 209.241 213.548 177.659 1.00 100.76 ? 93   DC  I N3    1 
ATOM 7842  C C4    . DC  I 5 93  ? 208.507 212.445 177.660 1.00 97.01  ? 93   DC  I C4    1 
ATOM 7843  N N4    . DC  I 5 93  ? 208.566 211.660 178.732 1.00 99.13  ? 93   DC  I N4    1 
ATOM 7844  C C5    . DC  I 5 93  ? 207.675 212.102 176.565 1.00 80.95  ? 93   DC  I C5    1 
ATOM 7845  C C6    . DC  I 5 93  ? 207.655 212.933 175.523 1.00 88.49  ? 93   DC  I C6    1 
ATOM 7846  P P     . DG  I 5 94  ? 210.050 215.647 170.835 1.00 112.67 ? 94   DG  I P     1 
ATOM 7847  O OP1   . DG  I 5 94  ? 209.445 215.351 169.521 1.00 111.61 ? 94   DG  I OP1   1 
ATOM 7848  O OP2   . DG  I 5 94  ? 210.835 214.603 171.531 1.00 95.86  ? 94   DG  I OP2   1 
ATOM 7849  O "O5'" . DG  I 5 94  ? 210.997 216.918 170.689 1.00 116.27 ? 94   DG  I "O5'" 1 
ATOM 7850  C "C5'" . DG  I 5 94  ? 211.166 217.791 171.790 1.00 111.30 ? 94   DG  I "C5'" 1 
ATOM 7851  C "C4'" . DG  I 5 94  ? 212.212 217.258 172.745 1.00 112.14 ? 94   DG  I "C4'" 1 
ATOM 7852  O "O4'" . DG  I 5 94  ? 211.617 216.338 173.669 1.00 118.93 ? 94   DG  I "O4'" 1 
ATOM 7853  C "C3'" . DG  I 5 94  ? 213.326 216.459 172.093 1.00 113.41 ? 94   DG  I "C3'" 1 
ATOM 7854  O "O3'" . DG  I 5 94  ? 214.423 217.296 171.825 1.00 123.61 ? 94   DG  I "O3'" 1 
ATOM 7855  C "C2'" . DG  I 5 94  ? 213.677 215.389 173.141 1.00 111.93 ? 94   DG  I "C2'" 1 
ATOM 7856  C "C1'" . DG  I 5 94  ? 212.668 215.633 174.257 1.00 115.81 ? 94   DG  I "C1'" 1 
ATOM 7857  N N9    . DG  I 5 94  ? 212.155 214.410 174.843 1.00 106.46 ? 94   DG  I N9    1 
ATOM 7858  C C8    . DG  I 5 94  ? 211.236 213.559 174.302 1.00 103.12 ? 94   DG  I C8    1 
ATOM 7859  N N7    . DG  I 5 94  ? 210.971 212.535 175.057 1.00 94.94  ? 94   DG  I N7    1 
ATOM 7860  C C5    . DG  I 5 94  ? 211.786 212.713 176.161 1.00 105.13 ? 94   DG  I C5    1 
ATOM 7861  C C6    . DG  I 5 94  ? 211.940 211.919 177.307 1.00 107.94 ? 94   DG  I C6    1 
ATOM 7862  O O6    . DG  I 5 94  ? 211.370 210.865 177.586 1.00 116.81 ? 94   DG  I O6    1 
ATOM 7863  N N1    . DG  I 5 94  ? 212.868 212.456 178.183 1.00 94.45  ? 94   DG  I N1    1 
ATOM 7864  C C2    . DG  I 5 94  ? 213.555 213.616 177.975 1.00 90.52  ? 94   DG  I C2    1 
ATOM 7865  N N2    . DG  I 5 94  ? 214.408 213.973 178.933 1.00 75.72  ? 94   DG  I N2    1 
ATOM 7866  N N3    . DG  I 5 94  ? 213.423 214.371 176.902 1.00 99.57  ? 94   DG  I N3    1 
ATOM 7867  C C4    . DG  I 5 94  ? 212.519 213.862 176.043 1.00 103.61 ? 94   DG  I C4    1 
ATOM 7868  P P     . DC  I 5 95  ? 215.662 216.735 170.977 1.00 124.07 ? 95   DC  I P     1 
ATOM 7869  O OP1   . DC  I 5 95  ? 216.434 217.894 170.491 1.00 110.69 ? 95   DC  I OP1   1 
ATOM 7870  O OP2   . DC  I 5 95  ? 215.135 215.737 170.024 1.00 120.13 ? 95   DC  I OP2   1 
ATOM 7871  O "O5'" . DC  I 5 95  ? 216.552 215.987 172.064 1.00 133.55 ? 95   DC  I "O5'" 1 
ATOM 7872  C "C5'" . DC  I 5 95  ? 216.975 216.694 173.204 1.00 132.56 ? 95   DC  I "C5'" 1 
ATOM 7873  C "C4'" . DC  I 5 95  ? 217.490 215.752 174.268 1.00 127.43 ? 95   DC  I "C4'" 1 
ATOM 7874  O "O4'" . DC  I 5 95  ? 216.398 215.075 174.907 1.00 122.69 ? 95   DC  I "O4'" 1 
ATOM 7875  C "C3'" . DC  I 5 95  ? 218.334 214.610 173.767 1.00 132.10 ? 95   DC  I "C3'" 1 
ATOM 7876  O "O3'" . DC  I 5 95  ? 219.646 215.039 173.513 1.00 140.88 ? 95   DC  I "O3'" 1 
ATOM 7877  C "C2'" . DC  I 5 95  ? 218.291 213.664 174.958 1.00 129.01 ? 95   DC  I "C2'" 1 
ATOM 7878  C "C1'" . DC  I 5 95  ? 216.946 213.982 175.609 1.00 125.19 ? 95   DC  I "C1'" 1 
ATOM 7879  N N1    . DC  I 5 95  ? 216.012 212.849 175.581 1.00 120.89 ? 95   DC  I N1    1 
ATOM 7880  C C2    . DC  I 5 95  ? 216.049 211.930 176.619 1.00 119.38 ? 95   DC  I C2    1 
ATOM 7881  O O2    . DC  I 5 95  ? 216.846 212.102 177.542 1.00 124.78 ? 95   DC  I O2    1 
ATOM 7882  N N3    . DC  I 5 95  ? 215.197 210.889 176.607 1.00 111.98 ? 95   DC  I N3    1 
ATOM 7883  C C4    . DC  I 5 95  ? 214.353 210.740 175.595 1.00 113.74 ? 95   DC  I C4    1 
ATOM 7884  N N4    . DC  I 5 95  ? 213.531 209.692 175.627 1.00 112.52 ? 95   DC  I N4    1 
ATOM 7885  C C5    . DC  I 5 95  ? 214.308 211.661 174.511 1.00 119.64 ? 95   DC  I C5    1 
ATOM 7886  C C6    . DC  I 5 95  ? 215.152 212.692 174.545 1.00 116.84 ? 95   DC  I C6    1 
ATOM 7887  P P     . DC  I 5 96  ? 220.660 214.069 172.736 1.00 142.49 ? 96   DC  I P     1 
ATOM 7888  O OP1   . DC  I 5 96  ? 221.831 214.867 172.329 1.00 139.92 ? 96   DC  I OP1   1 
ATOM 7889  O OP2   . DC  I 5 96  ? 219.880 213.339 171.720 1.00 128.41 ? 96   DC  I OP2   1 
ATOM 7890  O "O5'" . DC  I 5 96  ? 221.118 213.017 173.845 1.00 132.76 ? 96   DC  I "O5'" 1 
ATOM 7891  C "C5'" . DC  I 5 96  ? 221.763 213.469 175.016 1.00 128.01 ? 96   DC  I "C5'" 1 
ATOM 7892  C "C4'" . DC  I 5 96  ? 221.745 212.394 176.077 1.00 115.72 ? 96   DC  I "C4'" 1 
ATOM 7893  O "O4'" . DC  I 5 96  ? 220.393 211.990 176.318 1.00 116.84 ? 96   DC  I "O4'" 1 
ATOM 7894  C "C3'" . DC  I 5 96  ? 222.459 211.124 175.686 1.00 112.55 ? 96   DC  I "C3'" 1 
ATOM 7895  O "O3'" . DC  I 5 96  ? 223.807 211.221 176.068 1.00 118.17 ? 96   DC  I "O3'" 1 
ATOM 7896  C "C2'" . DC  I 5 96  ? 221.729 210.038 176.483 1.00 108.36 ? 96   DC  I "C2'" 1 
ATOM 7897  C "C1'" . DC  I 5 96  ? 220.382 210.680 176.827 1.00 115.62 ? 96   DC  I "C1'" 1 
ATOM 7898  N N1    . DC  I 5 96  ? 219.197 209.974 176.264 1.00 112.41 ? 96   DC  I N1    1 
ATOM 7899  C C2    . DC  I 5 96  ? 218.644 208.901 176.950 1.00 108.81 ? 96   DC  I C2    1 
ATOM 7900  O O2    . DC  I 5 96  ? 219.158 208.537 178.004 1.00 107.71 ? 96   DC  I O2    1 
ATOM 7901  N N3    . DC  I 5 96  ? 217.561 208.283 176.436 1.00 104.40 ? 96   DC  I N3    1 
ATOM 7902  C C4    . DC  I 5 96  ? 217.035 208.707 175.295 1.00 100.55 ? 96   DC  I C4    1 
ATOM 7903  N N4    . DC  I 5 96  ? 215.964 208.067 174.826 1.00 101.29 ? 96   DC  I N4    1 
ATOM 7904  C C5    . DC  I 5 96  ? 217.578 209.806 174.584 1.00 93.72  ? 96   DC  I C5    1 
ATOM 7905  C C6    . DC  I 5 96  ? 218.650 210.403 175.100 1.00 100.53 ? 96   DC  I C6    1 
ATOM 7906  P P     . DA  I 5 97  ? 224.913 210.316 175.346 1.00 124.09 ? 97   DA  I P     1 
ATOM 7907  O OP1   . DA  I 5 97  ? 226.226 210.955 175.563 1.00 121.80 ? 97   DA  I OP1   1 
ATOM 7908  O OP2   . DA  I 5 97  ? 224.447 210.046 173.971 1.00 123.47 ? 97   DA  I OP2   1 
ATOM 7909  O "O5'" . DA  I 5 97  ? 224.873 208.955 176.172 1.00 143.40 ? 97   DA  I "O5'" 1 
ATOM 7910  C "C5'" . DA  I 5 97  ? 225.095 208.988 177.561 1.00 137.31 ? 97   DA  I "C5'" 1 
ATOM 7911  C "C4'" . DA  I 5 97  ? 224.645 207.699 178.192 1.00 126.18 ? 97   DA  I "C4'" 1 
ATOM 7912  O "O4'" . DA  I 5 97  ? 223.249 207.484 177.876 1.00 119.46 ? 97   DA  I "O4'" 1 
ATOM 7913  C "C3'" . DA  I 5 97  ? 225.393 206.459 177.705 1.00 114.66 ? 97   DA  I "C3'" 1 
ATOM 7914  O "O3'" . DA  I 5 97  ? 225.740 205.641 178.811 1.00 119.51 ? 97   DA  I "O3'" 1 
ATOM 7915  C "C2'" . DA  I 5 97  ? 224.382 205.774 176.792 1.00 102.46 ? 97   DA  I "C2'" 1 
ATOM 7916  C "C1'" . DA  I 5 97  ? 223.068 206.166 177.438 1.00 104.12 ? 97   DA  I "C1'" 1 
ATOM 7917  N N9    . DA  I 5 97  ? 221.960 206.149 176.506 1.00 98.95  ? 97   DA  I N9    1 
ATOM 7918  C C8    . DA  I 5 97  ? 221.818 206.930 175.401 1.00 101.80 ? 97   DA  I C8    1 
ATOM 7919  N N7    . DA  I 5 97  ? 220.719 206.705 174.733 1.00 97.50  ? 97   DA  I N7    1 
ATOM 7920  C C5    . DA  I 5 97  ? 220.101 205.700 175.445 1.00 94.85  ? 97   DA  I C5    1 
ATOM 7921  C C6    . DA  I 5 97  ? 218.900 205.020 175.247 1.00 98.90  ? 97   DA  I C6    1 
ATOM 7922  N N6    . DA  I 5 97  ? 218.086 205.274 174.224 1.00 101.74 ? 97   DA  I N6    1 
ATOM 7923  N N1    . DA  I 5 97  ? 218.565 204.069 176.134 1.00 95.96  ? 97   DA  I N1    1 
ATOM 7924  C C2    . DA  I 5 97  ? 219.387 203.825 177.157 1.00 79.89  ? 97   DA  I C2    1 
ATOM 7925  N N3    . DA  I 5 97  ? 220.551 204.402 177.448 1.00 89.61  ? 97   DA  I N3    1 
ATOM 7926  C C4    . DA  I 5 97  ? 220.851 205.340 176.542 1.00 97.93  ? 97   DA  I C4    1 
ATOM 7927  P P     . DA  I 5 98  ? 226.900 204.539 178.679 1.00 108.74 ? 98   DA  I P     1 
ATOM 7928  O OP1   . DA  I 5 98  ? 228.109 205.093 179.316 1.00 114.07 ? 98   DA  I OP1   1 
ATOM 7929  O OP2   . DA  I 5 98  ? 226.955 204.065 177.282 1.00 93.84  ? 98   DA  I OP2   1 
ATOM 7930  O "O5'" . DA  I 5 98  ? 226.359 203.333 179.565 1.00 103.70 ? 98   DA  I "O5'" 1 
ATOM 7931  C "C5'" . DA  I 5 98  ? 224.969 203.194 179.767 1.00 106.17 ? 98   DA  I "C5'" 1 
ATOM 7932  C "C4'" . DA  I 5 98  ? 224.508 201.803 179.394 1.00 102.43 ? 98   DA  I "C4'" 1 
ATOM 7933  O "O4'" . DA  I 5 98  ? 223.467 201.883 178.382 1.00 91.12  ? 98   DA  I "O4'" 1 
ATOM 7934  C "C3'" . DA  I 5 98  ? 225.584 200.907 178.796 1.00 97.30  ? 98   DA  I "C3'" 1 
ATOM 7935  O "O3'" . DA  I 5 98  ? 225.330 199.580 179.185 1.00 92.77  ? 98   DA  I "O3'" 1 
ATOM 7936  C "C2'" . DA  I 5 98  ? 225.345 201.088 177.309 1.00 97.95  ? 98   DA  I "C2'" 1 
ATOM 7937  C "C1'" . DA  I 5 98  ? 223.836 201.067 177.301 1.00 99.24  ? 98   DA  I "C1'" 1 
ATOM 7938  N N9    . DA  I 5 98  ? 223.249 201.598 176.092 1.00 108.30 ? 98   DA  I N9    1 
ATOM 7939  C C8    . DA  I 5 98  ? 223.804 202.486 175.228 1.00 110.28 ? 98   DA  I C8    1 
ATOM 7940  N N7    . DA  I 5 98  ? 223.033 202.781 174.216 1.00 109.73 ? 98   DA  I N7    1 
ATOM 7941  C C5    . DA  I 5 98  ? 221.899 202.031 174.436 1.00 111.45 ? 98   DA  I C5    1 
ATOM 7942  C C6    . DA  I 5 98  ? 220.703 201.895 173.720 1.00 123.70 ? 98   DA  I C6    1 
ATOM 7943  N N6    . DA  I 5 98  ? 220.452 202.545 172.588 1.00 123.57 ? 98   DA  I N6    1 
ATOM 7944  N N1    . DA  I 5 98  ? 219.770 201.064 174.215 1.00 137.81 ? 98   DA  I N1    1 
ATOM 7945  C C2    . DA  I 5 98  ? 220.029 200.424 175.351 1.00 134.30 ? 98   DA  I C2    1 
ATOM 7946  N N3    . DA  I 5 98  ? 221.119 200.466 176.105 1.00 120.42 ? 98   DA  I N3    1 
ATOM 7947  C C4    . DA  I 5 98  ? 222.020 201.299 175.586 1.00 112.01 ? 98   DA  I C4    1 
ATOM 7948  P P     . DG  I 5 99  ? 226.318 198.391 178.757 1.00 100.23 ? 99   DG  I P     1 
ATOM 7949  O OP1   . DG  I 5 99  ? 227.632 198.671 179.371 1.00 108.90 ? 99   DG  I OP1   1 
ATOM 7950  O OP2   . DG  I 5 99  ? 226.201 198.159 177.304 1.00 100.04 ? 99   DG  I OP2   1 
ATOM 7951  O "O5'" . DG  I 5 99  ? 225.670 197.120 179.457 1.00 121.94 ? 99   DG  I "O5'" 1 
ATOM 7952  C "C5'" . DG  I 5 99  ? 224.280 197.103 179.708 1.00 112.49 ? 99   DG  I "C5'" 1 
ATOM 7953  C "C4'" . DG  I 5 99  ? 223.516 196.572 178.511 1.00 102.59 ? 99   DG  I "C4'" 1 
ATOM 7954  O "O4'" . DG  I 5 99  ? 223.488 197.550 177.453 1.00 90.81  ? 99   DG  I "O4'" 1 
ATOM 7955  C "C3'" . DG  I 5 99  ? 224.094 195.304 177.879 1.00 97.73  ? 99   DG  I "C3'" 1 
ATOM 7956  O "O3'" . DG  I 5 99  ? 223.226 194.221 178.106 1.00 98.28  ? 99   DG  I "O3'" 1 
ATOM 7957  C "C2'" . DG  I 5 99  ? 224.185 195.638 176.384 1.00 92.01  ? 99   DG  I "C2'" 1 
ATOM 7958  C "C1'" . DG  I 5 99  ? 223.275 196.839 176.276 1.00 91.54  ? 99   DG  I "C1'" 1 
ATOM 7959  N N9    . DG  I 5 99  ? 223.560 197.681 175.134 1.00 94.05  ? 99   DG  I N9    1 
ATOM 7960  C C8    . DG  I 5 99  ? 224.770 198.193 174.755 1.00 100.70 ? 99   DG  I C8    1 
ATOM 7961  N N7    . DG  I 5 99  ? 224.709 198.902 173.668 1.00 97.59  ? 99   DG  I N7    1 
ATOM 7962  C C5    . DG  I 5 99  ? 223.375 198.844 173.306 1.00 103.55 ? 99   DG  I C5    1 
ATOM 7963  C C6    . DG  I 5 99  ? 222.701 199.426 172.217 1.00 119.28 ? 99   DG  I C6    1 
ATOM 7964  O O6    . DG  I 5 99  ? 223.168 200.122 171.314 1.00 129.21 ? 99   DG  I O6    1 
ATOM 7965  N N1    . DG  I 5 99  ? 221.350 199.117 172.217 1.00 119.92 ? 99   DG  I N1    1 
ATOM 7966  C C2    . DG  I 5 99  ? 220.729 198.342 173.157 1.00 114.36 ? 99   DG  I C2    1 
ATOM 7967  N N2    . DG  I 5 99  ? 219.411 198.156 173.013 1.00 111.66 ? 99   DG  I N2    1 
ATOM 7968  N N3    . DG  I 5 99  ? 221.350 197.801 174.190 1.00 99.22  ? 99   DG  I N3    1 
ATOM 7969  C C4    . DG  I 5 99  ? 222.663 198.092 174.197 1.00 94.13  ? 99   DG  I C4    1 
ATOM 7970  P P     . DG  I 5 100 ? 223.795 192.724 178.091 1.00 90.26  ? 100  DG  I P     1 
ATOM 7971  O OP1   . DG  I 5 100 ? 223.999 192.316 179.493 1.00 81.85  ? 100  DG  I OP1   1 
ATOM 7972  O OP2   . DG  I 5 100 ? 224.910 192.665 177.127 1.00 86.92  ? 100  DG  I OP2   1 
ATOM 7973  O "O5'" . DG  I 5 100 ? 222.601 191.873 177.481 1.00 89.71  ? 100  DG  I "O5'" 1 
ATOM 7974  C "C5'" . DG  I 5 100 ? 221.296 192.084 177.945 1.00 89.21  ? 100  DG  I "C5'" 1 
ATOM 7975  C "C4'" . DG  I 5 100 ? 220.345 192.210 176.783 1.00 91.39  ? 100  DG  I "C4'" 1 
ATOM 7976  O "O4'" . DG  I 5 100 ? 220.896 193.136 175.818 1.00 95.45  ? 100  DG  I "O4'" 1 
ATOM 7977  C "C3'" . DG  I 5 100 ? 220.091 190.916 176.025 1.00 92.62  ? 100  DG  I "C3'" 1 
ATOM 7978  O "O3'" . DG  I 5 100 ? 218.746 190.858 175.642 1.00 92.60  ? 100  DG  I "O3'" 1 
ATOM 7979  C "C2'" . DG  I 5 100 ? 221.008 191.035 174.817 1.00 88.81  ? 100  DG  I "C2'" 1 
ATOM 7980  C "C1'" . DG  I 5 100 ? 220.965 192.525 174.556 1.00 89.78  ? 100  DG  I "C1'" 1 
ATOM 7981  N N9    . DG  I 5 100 ? 222.148 193.024 173.887 1.00 89.02  ? 100  DG  I N9    1 
ATOM 7982  C C8    . DG  I 5 100 ? 223.448 192.749 174.205 1.00 88.17  ? 100  DG  I C8    1 
ATOM 7983  N N7    . DG  I 5 100 ? 224.303 193.345 173.432 1.00 101.91 ? 100  DG  I N7    1 
ATOM 7984  C C5    . DG  I 5 100 ? 223.517 194.065 172.551 1.00 101.76 ? 100  DG  I C5    1 
ATOM 7985  C C6    . DG  I 5 100 ? 223.887 194.904 171.489 1.00 96.96  ? 100  DG  I C6    1 
ATOM 7986  O O6    . DG  I 5 100 ? 225.021 195.189 171.099 1.00 87.63  ? 100  DG  I O6    1 
ATOM 7987  N N1    . DG  I 5 100 ? 222.783 195.439 170.850 1.00 105.16 ? 100  DG  I N1    1 
ATOM 7988  C C2    . DG  I 5 100 ? 221.487 195.191 171.195 1.00 115.91 ? 100  DG  I C2    1 
ATOM 7989  N N2    . DG  I 5 100 ? 220.556 195.801 170.459 1.00 128.43 ? 100  DG  I N2    1 
ATOM 7990  N N3    . DG  I 5 100 ? 221.124 194.405 172.189 1.00 104.74 ? 100  DG  I N3    1 
ATOM 7991  C C4    . DG  I 5 100 ? 222.190 193.878 172.821 1.00 99.40  ? 100  DG  I C4    1 
ATOM 7992  P P     . DG  I 5 101 ? 217.982 189.451 175.595 1.00 81.56  ? 101  DG  I P     1 
ATOM 7993  O OP1   . DG  I 5 101 ? 216.827 189.518 176.513 1.00 85.89  ? 101  DG  I OP1   1 
ATOM 7994  O OP2   . DG  I 5 101 ? 218.985 188.379 175.724 1.00 79.02  ? 101  DG  I OP2   1 
ATOM 7995  O "O5'" . DG  I 5 101 ? 217.428 189.405 174.119 1.00 77.87  ? 101  DG  I "O5'" 1 
ATOM 7996  C "C5'" . DG  I 5 101 ? 216.938 190.580 173.559 1.00 60.69  ? 101  DG  I "C5'" 1 
ATOM 7997  C "C4'" . DG  I 5 101 ? 217.186 190.576 172.084 1.00 56.86  ? 101  DG  I "C4'" 1 
ATOM 7998  O "O4'" . DG  I 5 101 ? 218.551 190.958 171.830 1.00 62.80  ? 101  DG  I "O4'" 1 
ATOM 7999  C "C3'" . DG  I 5 101 ? 217.003 189.210 171.432 1.00 60.82  ? 101  DG  I "C3'" 1 
ATOM 8000  O "O3'" . DG  I 5 101 ? 216.106 189.321 170.361 1.00 62.79  ? 101  DG  I "O3'" 1 
ATOM 8001  C "C2'" . DG  I 5 101 ? 218.407 188.845 170.959 1.00 56.97  ? 101  DG  I "C2'" 1 
ATOM 8002  C "C1'" . DG  I 5 101 ? 219.006 190.213 170.749 1.00 65.43  ? 101  DG  I "C1'" 1 
ATOM 8003  N N9    . DG  I 5 101 ? 220.449 190.220 170.764 1.00 84.25  ? 101  DG  I N9    1 
ATOM 8004  C C8    . DG  I 5 101 ? 221.263 189.500 171.585 1.00 84.50  ? 101  DG  I C8    1 
ATOM 8005  N N7    . DG  I 5 101 ? 222.525 189.710 171.370 1.00 85.57  ? 101  DG  I N7    1 
ATOM 8006  C C5    . DG  I 5 101 ? 222.541 190.632 170.340 1.00 85.32  ? 101  DG  I C5    1 
ATOM 8007  C C6    . DG  I 5 101 ? 223.627 191.237 169.684 1.00 93.50  ? 101  DG  I C6    1 
ATOM 8008  O O6    . DG  I 5 101 ? 224.833 191.076 169.885 1.00 109.53 ? 101  DG  I O6    1 
ATOM 8009  N N1    . DG  I 5 101 ? 223.209 192.109 168.700 1.00 86.64  ? 101  DG  I N1    1 
ATOM 8010  C C2    . DG  I 5 101 ? 221.907 192.360 168.388 1.00 80.53  ? 101  DG  I C2    1 
ATOM 8011  N N2    . DG  I 5 101 ? 221.705 193.244 167.411 1.00 74.52  ? 101  DG  I N2    1 
ATOM 8012  N N3    . DG  I 5 101 ? 220.879 191.805 168.997 1.00 81.62  ? 101  DG  I N3    1 
ATOM 8013  C C4    . DG  I 5 101 ? 221.272 190.955 169.959 1.00 85.00  ? 101  DG  I C4    1 
ATOM 8014  P P     . DG  I 5 102 ? 215.408 188.013 169.756 1.00 66.20  ? 102  DG  I P     1 
ATOM 8015  O OP1   . DG  I 5 102 ? 213.949 188.150 169.928 1.00 59.74  ? 102  DG  I OP1   1 
ATOM 8016  O OP2   . DG  I 5 102 ? 216.092 186.828 170.300 1.00 71.97  ? 102  DG  I OP2   1 
ATOM 8017  O "O5'" . DG  I 5 102 ? 215.735 188.125 168.211 1.00 67.96  ? 102  DG  I "O5'" 1 
ATOM 8018  C "C5'" . DG  I 5 102 ? 215.269 189.233 167.512 1.00 65.37  ? 102  DG  I "C5'" 1 
ATOM 8019  C "C4'" . DG  I 5 102 ? 216.370 189.860 166.700 1.00 69.41  ? 102  DG  I "C4'" 1 
ATOM 8020  O "O4'" . DG  I 5 102 ? 217.618 189.746 167.388 1.00 83.78  ? 102  DG  I "O4'" 1 
ATOM 8021  C "C3'" . DG  I 5 102 ? 216.606 189.221 165.343 1.00 67.93  ? 102  DG  I "C3'" 1 
ATOM 8022  O "O3'" . DG  I 5 102 ? 216.078 190.059 164.353 1.00 74.09  ? 102  DG  I "O3'" 1 
ATOM 8023  C "C2'" . DG  I 5 102 ? 218.138 189.108 165.230 1.00 61.36  ? 102  DG  I "C2'" 1 
ATOM 8024  C "C1'" . DG  I 5 102 ? 218.622 189.898 166.431 1.00 75.22  ? 102  DG  I "C1'" 1 
ATOM 8025  N N9    . DG  I 5 102 ? 219.865 189.415 167.002 1.00 86.15  ? 102  DG  I N9    1 
ATOM 8026  C C8    . DG  I 5 102 ? 219.995 188.532 168.033 1.00 92.58  ? 102  DG  I C8    1 
ATOM 8027  N N7    . DG  I 5 102 ? 221.225 188.291 168.358 1.00 95.34  ? 102  DG  I N7    1 
ATOM 8028  C C5    . DG  I 5 102 ? 221.963 189.065 167.486 1.00 93.09  ? 102  DG  I C5    1 
ATOM 8029  C C6    . DG  I 5 102 ? 223.356 189.203 167.366 1.00 97.04  ? 102  DG  I C6    1 
ATOM 8030  O O6    . DG  I 5 102 ? 224.239 188.651 168.027 1.00 97.43  ? 102  DG  I O6    1 
ATOM 8031  N N1    . DG  I 5 102 ? 223.695 190.082 166.362 1.00 104.42 ? 102  DG  I N1    1 
ATOM 8032  C C2    . DG  I 5 102 ? 222.801 190.746 165.569 1.00 109.24 ? 102  DG  I C2    1 
ATOM 8033  N N2    . DG  I 5 102 ? 223.330 191.558 164.653 1.00 117.04 ? 102  DG  I N2    1 
ATOM 8034  N N3    . DG  I 5 102 ? 221.487 190.626 165.667 1.00 97.69  ? 102  DG  I N3    1 
ATOM 8035  C C4    . DG  I 5 102 ? 221.142 189.769 166.645 1.00 89.16  ? 102  DG  I C4    1 
ATOM 8036  P P     . DA  I 5 103 ? 215.619 189.450 162.948 1.00 81.24  ? 103  DA  I P     1 
ATOM 8037  O OP1   . DA  I 5 103 ? 214.610 190.365 162.385 1.00 72.09  ? 103  DA  I OP1   1 
ATOM 8038  O OP2   . DA  I 5 103 ? 215.292 188.029 163.165 1.00 72.18  ? 103  DA  I OP2   1 
ATOM 8039  O "O5'" . DA  I 5 103 ? 216.939 189.530 162.064 1.00 73.08  ? 103  DA  I "O5'" 1 
ATOM 8040  C "C5'" . DA  I 5 103 ? 217.580 190.770 161.903 1.00 74.31  ? 103  DA  I "C5'" 1 
ATOM 8041  C "C4'" . DA  I 5 103 ? 218.990 190.580 161.404 1.00 84.35  ? 103  DA  I "C4'" 1 
ATOM 8042  O "O4'" . DA  I 5 103 ? 219.827 190.159 162.489 1.00 91.57  ? 103  DA  I "O4'" 1 
ATOM 8043  C "C3'" . DA  I 5 103 ? 219.145 189.513 160.327 1.00 89.61  ? 103  DA  I "C3'" 1 
ATOM 8044  O "O3'" . DA  I 5 103 ? 219.476 190.119 159.101 1.00 99.27  ? 103  DA  I "O3'" 1 
ATOM 8045  C "C2'" . DA  I 5 103 ? 220.281 188.620 160.834 1.00 78.10  ? 103  DA  I "C2'" 1 
ATOM 8046  C "C1'" . DA  I 5 103 ? 220.891 189.443 161.949 1.00 86.87  ? 103  DA  I "C1'" 1 
ATOM 8047  N N9    . DA  I 5 103 ? 221.473 188.643 163.006 1.00 82.62  ? 103  DA  I N9    1 
ATOM 8048  C C8    . DA  I 5 103 ? 220.808 187.881 163.907 1.00 72.26  ? 103  DA  I C8    1 
ATOM 8049  N N7    . DA  I 5 103 ? 221.585 187.274 164.758 1.00 72.27  ? 103  DA  I N7    1 
ATOM 8050  C C5    . DA  I 5 103 ? 222.849 187.676 164.392 1.00 83.59  ? 103  DA  I C5    1 
ATOM 8051  C C6    . DA  I 5 103 ? 224.111 187.377 164.907 1.00 85.19  ? 103  DA  I C6    1 
ATOM 8052  N N6    . DA  I 5 103 ? 224.298 186.573 165.946 1.00 91.55  ? 103  DA  I N6    1 
ATOM 8053  N N1    . DA  I 5 103 ? 225.174 187.938 164.322 1.00 88.63  ? 103  DA  I N1    1 
ATOM 8054  C C2    . DA  I 5 103 ? 224.976 188.749 163.284 1.00 89.63  ? 103  DA  I C2    1 
ATOM 8055  N N3    . DA  I 5 103 ? 223.833 189.098 162.705 1.00 92.17  ? 103  DA  I N3    1 
ATOM 8056  C C4    . DA  I 5 103 ? 222.799 188.520 163.316 1.00 90.07  ? 103  DA  I C4    1 
ATOM 8057  P P     . DT  I 5 104 ? 219.819 189.218 157.818 1.00 112.40 ? 104  DT  I P     1 
ATOM 8058  O OP1   . DT  I 5 104 ? 219.521 190.023 156.620 1.00 111.48 ? 104  DT  I OP1   1 
ATOM 8059  O OP2   . DT  I 5 104 ? 219.189 187.896 157.978 1.00 101.23 ? 104  DT  I OP2   1 
ATOM 8060  O "O5'" . DT  I 5 104 ? 221.392 189.014 157.917 1.00 108.96 ? 104  DT  I "O5'" 1 
ATOM 8061  C "C5'" . DT  I 5 104 ? 222.215 190.130 158.123 1.00 112.23 ? 104  DT  I "C5'" 1 
ATOM 8062  C "C4'" . DT  I 5 104 ? 223.662 189.717 158.177 1.00 123.02 ? 104  DT  I "C4'" 1 
ATOM 8063  O "O4'" . DT  I 5 104 ? 223.930 189.079 159.443 1.00 122.10 ? 104  DT  I "O4'" 1 
ATOM 8064  C "C3'" . DT  I 5 104 ? 224.084 188.728 157.099 1.00 133.17 ? 104  DT  I "C3'" 1 
ATOM 8065  O "O3'" . DT  I 5 104 ? 225.306 189.134 156.558 1.00 150.71 ? 104  DT  I "O3'" 1 
ATOM 8066  C "C2'" . DT  I 5 104 ? 224.218 187.412 157.854 1.00 123.58 ? 104  DT  I "C2'" 1 
ATOM 8067  C "C1'" . DT  I 5 104 ? 224.644 187.896 159.224 1.00 116.86 ? 104  DT  I "C1'" 1 
ATOM 8068  N N1    . DT  I 5 104 ? 224.311 186.963 160.313 1.00 110.38 ? 104  DT  I N1    1 
ATOM 8069  C C2    . DT  I 5 104 ? 225.315 186.456 161.077 1.00 113.71 ? 104  DT  I C2    1 
ATOM 8070  O O2    . DT  I 5 104 ? 226.483 186.727 160.907 1.00 120.55 ? 104  DT  I O2    1 
ATOM 8071  N N3    . DT  I 5 104 ? 224.911 185.618 162.059 1.00 110.11 ? 104  DT  I N3    1 
ATOM 8072  C C4    . DT  I 5 104 ? 223.633 185.242 162.353 1.00 110.39 ? 104  DT  I C4    1 
ATOM 8073  O O4    . DT  I 5 104 ? 223.375 184.475 163.261 1.00 115.94 ? 104  DT  I O4    1 
ATOM 8074  C C5    . DT  I 5 104 ? 222.622 185.808 161.520 1.00 107.29 ? 104  DT  I C5    1 
ATOM 8075  C C7    . DT  I 5 104 ? 221.190 185.455 161.748 1.00 112.72 ? 104  DT  I C7    1 
ATOM 8076  C C6    . DT  I 5 104 ? 223.001 186.643 160.553 1.00 105.17 ? 104  DT  I C6    1 
ATOM 8077  P P     . DT  I 5 105 ? 225.715 188.688 155.076 1.00 156.83 ? 105  DT  I P     1 
ATOM 8078  O OP1   . DT  I 5 105 ? 226.239 189.881 154.378 1.00 154.84 ? 105  DT  I OP1   1 
ATOM 8079  O OP2   . DT  I 5 105 ? 224.574 187.943 154.506 1.00 147.25 ? 105  DT  I OP2   1 
ATOM 8080  O "O5'" . DT  I 5 105 ? 226.906 187.658 155.318 1.00 102.90 ? 105  DT  I "O5'" 1 
ATOM 8081  C "C5'" . DT  I 5 105 ? 227.979 188.022 156.162 1.00 112.47 ? 105  DT  I "C5'" 1 
ATOM 8082  C "C4'" . DT  I 5 105 ? 228.674 186.792 156.693 1.00 126.26 ? 105  DT  I "C4'" 1 
ATOM 8083  O "O4'" . DT  I 5 105 ? 228.056 186.377 157.919 1.00 122.75 ? 105  DT  I "O4'" 1 
ATOM 8084  C "C3'" . DT  I 5 105 ? 228.555 185.575 155.807 1.00 135.11 ? 105  DT  I "C3'" 1 
ATOM 8085  O "O3'" . DT  I 5 105 ? 229.585 185.572 154.849 1.00 140.66 ? 105  DT  I "O3'" 1 
ATOM 8086  C "C2'" . DT  I 5 105 ? 228.709 184.411 156.791 1.00 133.21 ? 105  DT  I "C2'" 1 
ATOM 8087  C "C1'" . DT  I 5 105 ? 228.435 185.042 158.157 1.00 126.17 ? 105  DT  I "C1'" 1 
ATOM 8088  N N1    . DT  I 5 105 ? 227.362 184.348 158.925 1.00 122.71 ? 105  DT  I N1    1 
ATOM 8089  C C2    . DT  I 5 105 ? 227.709 183.588 160.010 1.00 119.38 ? 105  DT  I C2    1 
ATOM 8090  O O2    . DT  I 5 105 ? 228.853 183.459 160.392 1.00 117.05 ? 105  DT  I O2    1 
ATOM 8091  N N3    . DT  I 5 105 ? 226.669 182.988 160.643 1.00 111.62 ? 105  DT  I N3    1 
ATOM 8092  C C4    . DT  I 5 105 ? 225.342 183.065 160.310 1.00 108.53 ? 105  DT  I C4    1 
ATOM 8093  O O4    . DT  I 5 105 ? 224.479 182.488 160.951 1.00 103.84 ? 105  DT  I O4    1 
ATOM 8094  C C5    . DT  I 5 105 ? 225.040 183.871 159.158 1.00 115.21 ? 105  DT  I C5    1 
ATOM 8095  C C7    . DT  I 5 105 ? 223.629 184.017 158.695 1.00 118.14 ? 105  DT  I C7    1 
ATOM 8096  C C6    . DT  I 5 105 ? 226.054 184.465 158.523 1.00 118.78 ? 105  DT  I C6    1 
ATOM 8097  P P     . DA  I 5 106 ? 229.695 184.363 153.799 1.00 166.94 ? 106  DA  I P     1 
ATOM 8098  O OP1   . DA  I 5 106 ? 230.447 184.860 152.627 1.00 158.84 ? 106  DA  I OP1   1 
ATOM 8099  O OP2   . DA  I 5 106 ? 228.335 183.820 153.609 1.00 167.87 ? 106  DA  I OP2   1 
ATOM 8100  O "O5'" . DA  I 5 106 ? 230.563 183.261 154.573 1.00 172.13 ? 106  DA  I "O5'" 1 
ATOM 8101  C "C5'" . DA  I 5 106 ? 231.746 183.650 155.253 1.00 169.48 ? 106  DA  I "C5'" 1 
ATOM 8102  C "C4'" . DA  I 5 106 ? 232.140 182.622 156.292 1.00 167.39 ? 106  DA  I "C4'" 1 
ATOM 8103  O "O4'" . DA  I 5 106 ? 231.007 182.328 157.150 1.00 159.54 ? 106  DA  I "O4'" 1 
ATOM 8104  C "C3'" . DA  I 5 106 ? 232.584 181.277 155.733 1.00 169.71 ? 106  DA  I "C3'" 1 
ATOM 8105  O "O3'" . DA  I 5 106 ? 233.583 180.732 156.575 1.00 177.09 ? 106  DA  I "O3'" 1 
ATOM 8106  C "C2'" . DA  I 5 106 ? 231.303 180.465 155.812 1.00 159.67 ? 106  DA  I "C2'" 1 
ATOM 8107  C "C1'" . DA  I 5 106 ? 230.783 180.937 157.151 1.00 155.17 ? 106  DA  I "C1'" 1 
ATOM 8108  N N9    . DA  I 5 106 ? 229.361 180.691 157.359 1.00 145.67 ? 106  DA  I N9    1 
ATOM 8109  C C8    . DA  I 5 106 ? 228.329 181.160 156.605 1.00 134.15 ? 106  DA  I C8    1 
ATOM 8110  N N7    . DA  I 5 106 ? 227.153 180.794 157.038 1.00 122.13 ? 106  DA  I N7    1 
ATOM 8111  C C5    . DA  I 5 106 ? 227.433 180.032 158.152 1.00 124.29 ? 106  DA  I C5    1 
ATOM 8112  C C6    . DA  I 5 106 ? 226.609 179.350 159.050 1.00 115.72 ? 106  DA  I C6    1 
ATOM 8113  N N6    . DA  I 5 106 ? 225.287 179.337 158.947 1.00 106.11 ? 106  DA  I N6    1 
ATOM 8114  N N1    . DA  I 5 106 ? 227.193 178.679 160.056 1.00 118.28 ? 106  DA  I N1    1 
ATOM 8115  C C2    . DA  I 5 106 ? 228.522 178.699 160.145 1.00 116.87 ? 106  DA  I C2    1 
ATOM 8116  N N3    . DA  I 5 106 ? 229.404 179.298 159.351 1.00 126.84 ? 106  DA  I N3    1 
ATOM 8117  C C4    . DA  I 5 106 ? 228.785 179.957 158.367 1.00 135.55 ? 106  DA  I C4    1 
ATOM 8118  P P     . DC  I 5 107 ? 234.586 179.605 156.026 1.00 167.38 ? 107  DC  I P     1 
ATOM 8119  O OP1   . DC  I 5 107 ? 235.917 180.231 155.900 1.00 163.28 ? 107  DC  I OP1   1 
ATOM 8120  O OP2   . DC  I 5 107 ? 233.966 178.963 154.847 1.00 161.72 ? 107  DC  I OP2   1 
ATOM 8121  O "O5'" . DC  I 5 107 ? 234.631 178.531 157.208 1.00 146.45 ? 107  DC  I "O5'" 1 
ATOM 8122  C "C5'" . DC  I 5 107 ? 234.537 177.150 156.909 1.00 141.49 ? 107  DC  I "C5'" 1 
ATOM 8123  C "C4'" . DC  I 5 107 ? 233.551 176.466 157.834 1.00 144.97 ? 107  DC  I "C4'" 1 
ATOM 8124  O "O4'" . DC  I 5 107 ? 232.306 177.170 157.809 1.00 147.26 ? 107  DC  I "O4'" 1 
ATOM 8125  C "C3'" . DC  I 5 107 ? 233.184 175.055 157.434 1.00 155.93 ? 107  DC  I "C3'" 1 
ATOM 8126  O "O3'" . DC  I 5 107 ? 234.075 174.154 158.023 1.00 168.46 ? 107  DC  I "O3'" 1 
ATOM 8127  C "C2'" . DC  I 5 107 ? 231.768 174.878 157.993 1.00 154.77 ? 107  DC  I "C2'" 1 
ATOM 8128  C "C1'" . DC  I 5 107 ? 231.307 176.307 158.286 1.00 152.56 ? 107  DC  I "C1'" 1 
ATOM 8129  N N1    . DC  I 5 107 ? 230.043 176.669 157.638 1.00 153.39 ? 107  DC  I N1    1 
ATOM 8130  C C2    . DC  I 5 107 ? 228.842 176.207 158.163 1.00 148.00 ? 107  DC  I C2    1 
ATOM 8131  O O2    . DC  I 5 107 ? 228.859 175.490 159.165 1.00 143.09 ? 107  DC  I O2    1 
ATOM 8132  N N3    . DC  I 5 107 ? 227.689 176.561 157.565 1.00 144.55 ? 107  DC  I N3    1 
ATOM 8133  C C4    . DC  I 5 107 ? 227.714 177.335 156.488 1.00 142.07 ? 107  DC  I C4    1 
ATOM 8134  N N4    . DC  I 5 107 ? 226.547 177.657 155.926 1.00 138.40 ? 107  DC  I N4    1 
ATOM 8135  C C5    . DC  I 5 107 ? 228.932 177.816 155.939 1.00 146.94 ? 107  DC  I C5    1 
ATOM 8136  C C6    . DC  I 5 107 ? 230.060 177.461 156.543 1.00 153.08 ? 107  DC  I C6    1 
ATOM 8137  P P     . DT  I 5 108 ? 234.132 172.645 157.491 1.00 140.98 ? 108  DT  I P     1 
ATOM 8138  O OP1   . DT  I 5 108 ? 235.431 172.080 157.907 1.00 136.15 ? 108  DT  I OP1   1 
ATOM 8139  O OP2   . DT  I 5 108 ? 233.729 172.667 156.068 1.00 142.99 ? 108  DT  I OP2   1 
ATOM 8140  O "O5'" . DT  I 5 108 ? 232.992 171.906 158.319 1.00 154.56 ? 108  DT  I "O5'" 1 
ATOM 8141  C "C5'" . DT  I 5 108 ? 233.191 171.645 159.691 1.00 153.24 ? 108  DT  I "C5'" 1 
ATOM 8142  C "C4'" . DT  I 5 108 ? 232.029 170.863 160.260 1.00 151.30 ? 108  DT  I "C4'" 1 
ATOM 8143  O "O4'" . DT  I 5 108 ? 230.786 171.539 159.929 1.00 148.09 ? 108  DT  I "O4'" 1 
ATOM 8144  C "C3'" . DT  I 5 108 ? 231.884 169.442 159.724 1.00 151.63 ? 108  DT  I "C3'" 1 
ATOM 8145  O "O3'" . DT  I 5 108 ? 231.413 168.597 160.760 1.00 155.69 ? 108  DT  I "O3'" 1 
ATOM 8146  C "C2'" . DT  I 5 108 ? 230.840 169.616 158.632 1.00 146.55 ? 108  DT  I "C2'" 1 
ATOM 8147  C "C1'" . DT  I 5 108 ? 229.929 170.641 159.273 1.00 146.08 ? 108  DT  I "C1'" 1 
ATOM 8148  N N1    . DT  I 5 108 ? 229.131 171.391 158.303 1.00 146.64 ? 108  DT  I N1    1 
ATOM 8149  C C2    . DT  I 5 108 ? 227.769 171.324 158.369 1.00 148.79 ? 108  DT  I C2    1 
ATOM 8150  O O2    . DT  I 5 108 ? 227.179 170.661 159.195 1.00 153.72 ? 108  DT  I O2    1 
ATOM 8151  N N3    . DT  I 5 108 ? 227.115 172.056 157.423 1.00 142.19 ? 108  DT  I N3    1 
ATOM 8152  C C4    . DT  I 5 108 ? 227.688 172.828 156.440 1.00 139.98 ? 108  DT  I C4    1 
ATOM 8153  O O4    . DT  I 5 108 ? 227.031 173.450 155.628 1.00 132.90 ? 108  DT  I O4    1 
ATOM 8154  C C5    . DT  I 5 108 ? 229.116 172.854 156.431 1.00 145.80 ? 108  DT  I C5    1 
ATOM 8155  C C7    . DT  I 5 108 ? 229.834 173.665 155.406 1.00 146.86 ? 108  DT  I C7    1 
ATOM 8156  C C6    . DT  I 5 108 ? 229.766 172.142 157.352 1.00 146.96 ? 108  DT  I C6    1 
ATOM 8157  P P     . DC  I 5 109 ? 231.418 167.000 160.596 1.00 141.15 ? 109  DC  I P     1 
ATOM 8158  O OP1   . DC  I 5 109 ? 232.525 166.482 161.419 1.00 146.80 ? 109  DC  I OP1   1 
ATOM 8159  O OP2   . DC  I 5 109 ? 231.337 166.649 159.165 1.00 130.50 ? 109  DC  I OP2   1 
ATOM 8160  O "O5'" . DC  I 5 109 ? 230.045 166.566 161.272 1.00 144.11 ? 109  DC  I "O5'" 1 
ATOM 8161  C "C5'" . DC  I 5 109 ? 228.966 167.486 161.298 1.00 137.49 ? 109  DC  I "C5'" 1 
ATOM 8162  C "C4'" . DC  I 5 109 ? 227.651 166.780 161.062 1.00 129.18 ? 109  DC  I "C4'" 1 
ATOM 8163  O "O4'" . DC  I 5 109 ? 226.875 167.538 160.104 1.00 129.52 ? 109  DC  I "O4'" 1 
ATOM 8164  C "C3'" . DC  I 5 109 ? 227.783 165.410 160.431 1.00 115.37 ? 109  DC  I "C3'" 1 
ATOM 8165  O "O3'" . DC  I 5 109 ? 226.568 164.704 160.593 1.00 98.05  ? 109  DC  I "O3'" 1 
ATOM 8166  C "C2'" . DC  I 5 109 ? 227.967 165.814 158.986 1.00 120.08 ? 109  DC  I "C2'" 1 
ATOM 8167  C "C1'" . DC  I 5 109 ? 226.839 166.823 158.890 1.00 123.18 ? 109  DC  I "C1'" 1 
ATOM 8168  N N1    . DC  I 5 109 ? 226.964 167.773 157.785 1.00 120.92 ? 109  DC  I N1    1 
ATOM 8169  C C2    . DC  I 5 109 ? 225.812 168.303 157.230 1.00 125.80 ? 109  DC  I C2    1 
ATOM 8170  O O2    . DC  I 5 109 ? 224.720 167.963 157.689 1.00 122.01 ? 109  DC  I O2    1 
ATOM 8171  N N3    . DC  I 5 109 ? 225.914 169.191 156.224 1.00 132.10 ? 109  DC  I N3    1 
ATOM 8172  C C4    . DC  I 5 109 ? 227.113 169.527 155.758 1.00 132.28 ? 109  DC  I C4    1 
ATOM 8173  N N4    . DC  I 5 109 ? 227.162 170.402 154.756 1.00 133.25 ? 109  DC  I N4    1 
ATOM 8174  C C5    . DC  I 5 109 ? 228.310 168.990 156.309 1.00 126.23 ? 109  DC  I C5    1 
ATOM 8175  C C6    . DC  I 5 109 ? 228.187 168.122 157.316 1.00 119.55 ? 109  DC  I C6    1 
ATOM 8176  P P     . DC  I 5 110 ? 226.245 163.926 161.958 1.00 124.10 ? 110  DC  I P     1 
ATOM 8177  O OP1   . DC  I 5 110 ? 226.584 164.780 163.110 1.00 123.96 ? 110  DC  I OP1   1 
ATOM 8178  O OP2   . DC  I 5 110 ? 226.836 162.582 161.828 1.00 122.09 ? 110  DC  I OP2   1 
ATOM 8179  O "O5'" . DC  I 5 110 ? 224.660 163.779 161.934 1.00 137.98 ? 110  DC  I "O5'" 1 
ATOM 8180  C "C5'" . DC  I 5 110 ? 223.876 164.841 161.432 1.00 130.43 ? 110  DC  I "C5'" 1 
ATOM 8181  C "C4'" . DC  I 5 110 ? 222.585 164.331 160.826 1.00 119.50 ? 110  DC  I "C4'" 1 
ATOM 8182  O "O4'" . DC  I 5 110 ? 222.518 164.721 159.439 1.00 111.24 ? 110  DC  I "O4'" 1 
ATOM 8183  C "C3'" . DC  I 5 110 ? 222.445 162.833 160.780 1.00 121.40 ? 110  DC  I "C3'" 1 
ATOM 8184  O "O3'" . DC  I 5 110 ? 221.102 162.520 160.524 1.00 124.68 ? 110  DC  I "O3'" 1 
ATOM 8185  C "C2'" . DC  I 5 110 ? 223.299 162.516 159.566 1.00 114.59 ? 110  DC  I "C2'" 1 
ATOM 8186  C "C1'" . DC  I 5 110 ? 222.826 163.609 158.626 1.00 111.97 ? 110  DC  I "C1'" 1 
ATOM 8187  N N1    . DC  I 5 110 ? 223.820 164.036 157.678 1.00 109.81 ? 110  DC  I N1    1 
ATOM 8188  C C2    . DC  I 5 110 ? 223.424 164.822 156.608 1.00 107.68 ? 110  DC  I C2    1 
ATOM 8189  O O2    . DC  I 5 110 ? 222.237 165.104 156.491 1.00 107.46 ? 110  DC  I O2    1 
ATOM 8190  N N3    . DC  I 5 110 ? 224.345 165.249 155.727 1.00 108.31 ? 110  DC  I N3    1 
ATOM 8191  C C4    . DC  I 5 110 ? 225.618 164.918 155.898 1.00 114.17 ? 110  DC  I C4    1 
ATOM 8192  N N4    . DC  I 5 110 ? 226.498 165.361 155.000 1.00 117.37 ? 110  DC  I N4    1 
ATOM 8193  C C5    . DC  I 5 110 ? 226.045 164.106 156.990 1.00 112.79 ? 110  DC  I C5    1 
ATOM 8194  C C6    . DC  I 5 110 ? 225.120 163.703 157.858 1.00 112.62 ? 110  DC  I C6    1 
ATOM 8195  P P     . DC  I 5 111 ? 220.026 162.470 161.709 1.00 109.45 ? 111  DC  I P     1 
ATOM 8196  O OP1   . DC  I 5 111 ? 220.549 163.216 162.869 1.00 108.18 ? 111  DC  I OP1   1 
ATOM 8197  O OP2   . DC  I 5 111 ? 219.615 161.066 161.852 1.00 100.92 ? 111  DC  I OP2   1 
ATOM 8198  O "O5'" . DC  I 5 111 ? 218.781 163.255 161.117 1.00 100.04 ? 111  DC  I "O5'" 1 
ATOM 8199  C "C5'" . DC  I 5 111 ? 218.992 164.304 160.211 1.00 93.38  ? 111  DC  I "C5'" 1 
ATOM 8200  C "C4'" . DC  I 5 111 ? 217.710 164.656 159.494 1.00 93.32  ? 111  DC  I "C4'" 1 
ATOM 8201  O "O4'" . DC  I 5 111 ? 217.896 164.517 158.078 1.00 91.63  ? 111  DC  I "O4'" 1 
ATOM 8202  C "C3'" . DC  I 5 111 ? 216.553 163.746 159.776 1.00 96.79  ? 111  DC  I "C3'" 1 
ATOM 8203  O "O3'" . DC  I 5 111 ? 215.371 164.393 159.376 1.00 99.83  ? 111  DC  I "O3'" 1 
ATOM 8204  C "C2'" . DC  I 5 111 ? 216.878 162.555 158.882 1.00 95.88  ? 111  DC  I "C2'" 1 
ATOM 8205  C "C1'" . DC  I 5 111 ? 217.601 163.192 157.703 1.00 90.24  ? 111  DC  I "C1'" 1 
ATOM 8206  N N1    . DC  I 5 111 ? 218.870 162.558 157.407 1.00 95.54  ? 111  DC  I N1    1 
ATOM 8207  C C2    . DC  I 5 111 ? 219.559 162.936 156.278 1.00 88.13  ? 111  DC  I C2    1 
ATOM 8208  O O2    . DC  I 5 111 ? 219.056 163.757 155.523 1.00 69.87  ? 111  DC  I O2    1 
ATOM 8209  N N3    . DC  I 5 111 ? 220.754 162.376 156.023 1.00 101.44 ? 111  DC  I N3    1 
ATOM 8210  C C4    . DC  I 5 111 ? 221.257 161.482 156.848 1.00 116.16 ? 111  DC  I C4    1 
ATOM 8211  N N4    . DC  I 5 111 ? 222.448 160.966 156.554 1.00 127.09 ? 111  DC  I N4    1 
ATOM 8212  C C5    . DC  I 5 111 ? 220.574 161.090 158.024 1.00 109.74 ? 111  DC  I C5    1 
ATOM 8213  C C6    . DC  I 5 111 ? 219.396 161.658 158.267 1.00 100.57 ? 111  DC  I C6    1 
ATOM 8214  P P     . DT  I 5 112 ? 214.060 163.568 158.969 1.00 96.57  ? 112  DT  I P     1 
ATOM 8215  O OP1   . DT  I 5 112 ? 212.947 164.418 159.405 1.00 91.31  ? 112  DT  I OP1   1 
ATOM 8216  O OP2   . DT  I 5 112 ? 214.102 162.177 159.453 1.00 87.64  ? 112  DT  I OP2   1 
ATOM 8217  O "O5'" . DT  I 5 112 ? 214.078 163.593 157.379 1.00 90.05  ? 112  DT  I "O5'" 1 
ATOM 8218  C "C5'" . DT  I 5 112 ? 213.802 164.796 156.727 1.00 80.87  ? 112  DT  I "C5'" 1 
ATOM 8219  C "C4'" . DT  I 5 112 ? 213.753 164.609 155.234 1.00 86.54  ? 112  DT  I "C4'" 1 
ATOM 8220  O "O4'" . DT  I 5 112 ? 215.036 164.156 154.762 1.00 90.17  ? 112  DT  I "O4'" 1 
ATOM 8221  C "C3'" . DT  I 5 112 ? 212.727 163.612 154.748 1.00 78.34  ? 112  DT  I "C3'" 1 
ATOM 8222  O "O3'" . DT  I 5 112 ? 211.996 164.187 153.700 1.00 65.64  ? 112  DT  I "O3'" 1 
ATOM 8223  C "C2'" . DT  I 5 112 ? 213.559 162.422 154.294 1.00 81.83  ? 112  DT  I "C2'" 1 
ATOM 8224  C "C1'" . DT  I 5 112 ? 214.886 163.046 153.924 1.00 85.53  ? 112  DT  I "C1'" 1 
ATOM 8225  N N1    . DT  I 5 112 ? 216.038 162.152 154.181 1.00 89.61  ? 112  DT  I N1    1 
ATOM 8226  C C2    . DT  I 5 112 ? 217.074 162.098 153.290 1.00 102.85 ? 112  DT  I C2    1 
ATOM 8227  O O2    . DT  I 5 112 ? 217.102 162.740 152.268 1.00 108.75 ? 112  DT  I O2    1 
ATOM 8228  N N3    . DT  I 5 112 ? 218.085 161.256 153.643 1.00 100.74 ? 112  DT  I N3    1 
ATOM 8229  C C4    . DT  I 5 112 ? 218.156 160.486 154.771 1.00 100.78 ? 112  DT  I C4    1 
ATOM 8230  O O4    . DT  I 5 112 ? 219.102 159.759 155.010 1.00 97.85  ? 112  DT  I O4    1 
ATOM 8231  C C5    . DT  I 5 112 ? 217.044 160.592 155.656 1.00 97.17  ? 112  DT  I C5    1 
ATOM 8232  C C7    . DT  I 5 112 ? 217.014 159.781 156.908 1.00 100.35 ? 112  DT  I C7    1 
ATOM 8233  C C6    . DT  I 5 112 ? 216.051 161.409 155.325 1.00 86.28  ? 112  DT  I C6    1 
ATOM 8234  P P     . DA  I 5 113 ? 211.120 163.290 152.704 1.00 93.13  ? 113  DA  I P     1 
ATOM 8235  O OP1   . DA  I 5 113 ? 210.035 164.134 152.180 1.00 89.79  ? 113  DA  I OP1   1 
ATOM 8236  O OP2   . DA  I 5 113 ? 210.763 162.019 153.355 1.00 87.82  ? 113  DA  I OP2   1 
ATOM 8237  O "O5'" . DA  I 5 113 ? 212.119 163.034 151.503 1.00 80.85  ? 113  DA  I "O5'" 1 
ATOM 8238  C "C5'" . DA  I 5 113 ? 212.961 164.082 151.084 1.00 87.55  ? 113  DA  I "C5'" 1 
ATOM 8239  C "C4'" . DA  I 5 113 ? 213.312 163.966 149.614 1.00 88.21  ? 113  DA  I "C4'" 1 
ATOM 8240  O "O4'" . DA  I 5 113 ? 214.528 163.218 149.462 1.00 80.34  ? 113  DA  I "O4'" 1 
ATOM 8241  C "C3'" . DA  I 5 113 ? 212.304 163.249 148.746 1.00 97.73  ? 113  DA  I "C3'" 1 
ATOM 8242  O "O3'" . DA  I 5 113 ? 212.443 163.693 147.413 1.00 100.96 ? 113  DA  I "O3'" 1 
ATOM 8243  C "C2'" . DA  I 5 113 ? 212.724 161.792 148.889 1.00 95.19  ? 113  DA  I "C2'" 1 
ATOM 8244  C "C1'" . DA  I 5 113 ? 214.232 161.885 149.118 1.00 92.71  ? 113  DA  I "C1'" 1 
ATOM 8245  N N9    . DA  I 5 113 ? 214.699 161.053 150.205 1.00 98.32  ? 113  DA  I N9    1 
ATOM 8246  C C8    . DA  I 5 113 ? 214.161 160.958 151.443 1.00 101.10 ? 113  DA  I C8    1 
ATOM 8247  N N7    . DA  I 5 113 ? 214.802 160.152 152.240 1.00 100.84 ? 113  DA  I N7    1 
ATOM 8248  C C5    . DA  I 5 113 ? 215.831 159.690 151.468 1.00 102.15 ? 113  DA  I C5    1 
ATOM 8249  C C6    . DA  I 5 113 ? 216.862 158.808 151.734 1.00 101.87 ? 113  DA  I C6    1 
ATOM 8250  N N6    . DA  I 5 113 ? 217.015 158.208 152.908 1.00 97.79  ? 113  DA  I N6    1 
ATOM 8251  N N1    . DA  I 5 113 ? 217.728 158.550 150.749 1.00 99.93  ? 113  DA  I N1    1 
ATOM 8252  C C2    . DA  I 5 113 ? 217.559 159.150 149.574 1.00 93.41  ? 113  DA  I C2    1 
ATOM 8253  N N3    . DA  I 5 113 ? 216.627 160.012 149.209 1.00 96.82  ? 113  DA  I N3    1 
ATOM 8254  C C4    . DA  I 5 113 ? 215.791 160.244 150.214 1.00 99.58  ? 113  DA  I C4    1 
ATOM 8255  P P     . DG  I 5 114 ? 211.626 162.987 146.228 1.00 114.39 ? 114  DG  I P     1 
ATOM 8256  O OP1   . DG  I 5 114 ? 211.544 163.955 145.119 1.00 103.18 ? 114  DG  I OP1   1 
ATOM 8257  O OP2   . DG  I 5 114 ? 210.392 162.422 146.803 1.00 113.37 ? 114  DG  I OP2   1 
ATOM 8258  O "O5'" . DG  I 5 114 ? 212.565 161.778 145.779 1.00 138.40 ? 114  DG  I "O5'" 1 
ATOM 8259  C "C5'" . DG  I 5 114 ? 213.913 162.027 145.443 1.00 137.53 ? 114  DG  I "C5'" 1 
ATOM 8260  C "C4'" . DG  I 5 114 ? 214.557 160.807 144.817 1.00 135.98 ? 114  DG  I "C4'" 1 
ATOM 8261  O "O4'" . DG  I 5 114 ? 215.205 160.018 145.840 1.00 132.19 ? 114  DG  I "O4'" 1 
ATOM 8262  C "C3'" . DG  I 5 114 ? 213.606 159.864 144.104 1.00 136.10 ? 114  DG  I "C3'" 1 
ATOM 8263  O "O3'" . DG  I 5 114 ? 214.263 159.289 142.995 1.00 141.77 ? 114  DG  I "O3'" 1 
ATOM 8264  C "C2'" . DG  I 5 114 ? 213.321 158.824 145.172 1.00 132.88 ? 114  DG  I "C2'" 1 
ATOM 8265  C "C1'" . DG  I 5 114 ? 214.672 158.718 145.850 1.00 129.02 ? 114  DG  I "C1'" 1 
ATOM 8266  N N9    . DG  I 5 114 ? 214.587 158.295 147.231 1.00 123.85 ? 114  DG  I N9    1 
ATOM 8267  C C8    . DG  I 5 114 ? 213.734 158.774 148.178 1.00 124.68 ? 114  DG  I C8    1 
ATOM 8268  N N7    . DG  I 5 114 ? 213.878 158.216 149.339 1.00 120.29 ? 114  DG  I N7    1 
ATOM 8269  C C5    . DG  I 5 114 ? 214.907 157.323 149.151 1.00 115.36 ? 114  DG  I C5    1 
ATOM 8270  C C6    . DG  I 5 114 ? 215.508 156.444 150.059 1.00 120.27 ? 114  DG  I C6    1 
ATOM 8271  O O6    . DG  I 5 114 ? 215.241 156.271 151.248 1.00 121.25 ? 114  DG  I O6    1 
ATOM 8272  N N1    . DG  I 5 114 ? 216.516 155.711 149.470 1.00 129.30 ? 114  DG  I N1    1 
ATOM 8273  C C2    . DG  I 5 114 ? 216.896 155.816 148.163 1.00 128.95 ? 114  DG  I C2    1 
ATOM 8274  N N2    . DG  I 5 114 ? 217.898 155.021 147.774 1.00 128.67 ? 114  DG  I N2    1 
ATOM 8275  N N3    . DG  I 5 114 ? 216.340 156.641 147.296 1.00 119.80 ? 114  DG  I N3    1 
ATOM 8276  C C4    . DG  I 5 114 ? 215.356 157.360 147.860 1.00 117.21 ? 114  DG  I C4    1 
ATOM 8277  P P     . DT  I 5 115 ? 213.449 158.946 141.655 1.00 120.42 ? 115  DT  I P     1 
ATOM 8278  O OP1   . DT  I 5 115 ? 214.077 159.661 140.527 1.00 113.17 ? 115  DT  I OP1   1 
ATOM 8279  O OP2   . DT  I 5 115 ? 212.018 159.147 141.952 1.00 106.77 ? 115  DT  I OP2   1 
ATOM 8280  O "O5'" . DT  I 5 115 ? 213.708 157.388 141.455 1.00 120.18 ? 115  DT  I "O5'" 1 
ATOM 8281  C "C5'" . DT  I 5 115 ? 213.676 156.540 142.575 1.00 117.83 ? 115  DT  I "C5'" 1 
ATOM 8282  C "C4'" . DT  I 5 115 ? 214.702 155.445 142.450 1.00 124.80 ? 115  DT  I "C4'" 1 
ATOM 8283  O "O4'" . DT  I 5 115 ? 215.279 155.188 143.754 1.00 124.30 ? 115  DT  I "O4'" 1 
ATOM 8284  C "C3'" . DT  I 5 115 ? 214.126 154.124 142.001 1.00 136.01 ? 115  DT  I "C3'" 1 
ATOM 8285  O "O3'" . DT  I 5 115 ? 215.122 153.333 141.397 1.00 147.45 ? 115  DT  I "O3'" 1 
ATOM 8286  C "C2'" . DT  I 5 115 ? 213.674 153.529 143.315 1.00 133.30 ? 115  DT  I "C2'" 1 
ATOM 8287  C "C1'" . DT  I 5 115 ? 214.794 153.962 144.255 1.00 126.99 ? 115  DT  I "C1'" 1 
ATOM 8288  N N1    . DT  I 5 115 ? 214.320 154.169 145.636 1.00 121.94 ? 115  DT  I N1    1 
ATOM 8289  C C2    . DT  I 5 115 ? 214.801 153.378 146.645 1.00 120.80 ? 115  DT  I C2    1 
ATOM 8290  O O2    . DT  I 5 115 ? 215.631 152.513 146.473 1.00 121.97 ? 115  DT  I O2    1 
ATOM 8291  N N3    . DT  I 5 115 ? 214.279 153.648 147.876 1.00 120.21 ? 115  DT  I N3    1 
ATOM 8292  C C4    . DT  I 5 115 ? 213.340 154.600 148.187 1.00 123.58 ? 115  DT  I C4    1 
ATOM 8293  O O4    . DT  I 5 115 ? 212.928 154.767 149.326 1.00 125.52 ? 115  DT  I O4    1 
ATOM 8294  C C5    . DT  I 5 115 ? 212.872 155.384 147.081 1.00 126.24 ? 115  DT  I C5    1 
ATOM 8295  C C7    . DT  I 5 115 ? 211.837 156.436 147.295 1.00 128.26 ? 115  DT  I C7    1 
ATOM 8296  C C6    . DT  I 5 115 ? 213.375 155.132 145.874 1.00 123.64 ? 115  DT  I C6    1 
ATOM 8297  P P     . DC  I 5 116 ? 214.696 152.107 140.453 1.00 147.54 ? 116  DC  I P     1 
ATOM 8298  O OP1   . DC  I 5 116 ? 215.746 151.923 139.433 1.00 138.03 ? 116  DC  I OP1   1 
ATOM 8299  O OP2   . DC  I 5 116 ? 213.295 152.332 140.047 1.00 142.42 ? 116  DC  I OP2   1 
ATOM 8300  O "O5'" . DC  I 5 116 ? 214.717 150.848 141.426 1.00 124.41 ? 116  DC  I "O5'" 1 
ATOM 8301  C "C5'" . DC  I 5 116 ? 215.947 150.368 141.924 1.00 121.04 ? 116  DC  I "C5'" 1 
ATOM 8302  C "C4'" . DC  I 5 116 ? 215.711 149.237 142.898 1.00 131.14 ? 116  DC  I "C4'" 1 
ATOM 8303  O "O4'" . DC  I 5 116 ? 215.333 149.784 144.187 1.00 132.95 ? 116  DC  I "O4'" 1 
ATOM 8304  C "C3'" . DC  I 5 116 ? 214.583 148.288 142.492 1.00 143.37 ? 116  DC  I "C3'" 1 
ATOM 8305  O "O3'" . DC  I 5 116 ? 214.990 146.949 142.650 1.00 152.66 ? 116  DC  I "O3'" 1 
ATOM 8306  C "C2'" . DC  I 5 116 ? 213.460 148.642 143.453 1.00 142.05 ? 116  DC  I "C2'" 1 
ATOM 8307  C "C1'" . DC  I 5 116 ? 214.245 149.057 144.679 1.00 138.11 ? 116  DC  I "C1'" 1 
ATOM 8308  N N1    . DC  I 5 116 ? 213.465 149.902 145.591 1.00 134.47 ? 116  DC  I N1    1 
ATOM 8309  C C2    . DC  I 5 116 ? 213.412 149.579 146.933 1.00 126.46 ? 116  DC  I C2    1 
ATOM 8310  O O2    . DC  I 5 116 ? 214.051 148.610 147.336 1.00 123.11 ? 116  DC  I O2    1 
ATOM 8311  N N3    . DC  I 5 116 ? 212.675 150.340 147.759 1.00 123.36 ? 116  DC  I N3    1 
ATOM 8312  C C4    . DC  I 5 116 ? 212.006 151.373 147.283 1.00 126.18 ? 116  DC  I C4    1 
ATOM 8313  N N4    . DC  I 5 116 ? 211.292 152.093 148.140 1.00 124.10 ? 116  DC  I N4    1 
ATOM 8314  C C5    . DC  I 5 116 ? 212.034 151.714 145.909 1.00 131.29 ? 116  DC  I C5    1 
ATOM 8315  C C6    . DC  I 5 116 ? 212.764 150.950 145.105 1.00 134.97 ? 116  DC  I C6    1 
ATOM 8316  P P     . DT  I 5 117 ? 214.666 145.888 141.493 1.00 186.19 ? 117  DT  I P     1 
ATOM 8317  O OP1   . DT  I 5 117 ? 215.946 145.282 141.070 1.00 188.22 ? 117  DT  I OP1   1 
ATOM 8318  O OP2   . DT  I 5 117 ? 213.808 146.581 140.512 1.00 179.31 ? 117  DT  I OP2   1 
ATOM 8319  O "O5'" . DT  I 5 117 ? 213.770 144.779 142.210 1.00 134.50 ? 117  DT  I "O5'" 1 
ATOM 8320  C "C5'" . DT  I 5 117 ? 212.912 145.140 143.268 1.00 135.50 ? 117  DT  I "C5'" 1 
ATOM 8321  C "C4'" . DT  I 5 117 ? 213.273 144.374 144.522 1.00 139.75 ? 117  DT  I "C4'" 1 
ATOM 8322  O "O4'" . DT  I 5 117 ? 212.974 145.180 145.685 1.00 143.90 ? 117  DT  I "O4'" 1 
ATOM 8323  C "C3'" . DT  I 5 117 ? 212.483 143.109 144.736 1.00 140.04 ? 117  DT  I "C3'" 1 
ATOM 8324  O "O3'" . DT  I 5 117 ? 213.166 142.300 145.663 1.00 142.55 ? 117  DT  I "O3'" 1 
ATOM 8325  C "C2'" . DT  I 5 117 ? 211.206 143.673 145.337 1.00 140.49 ? 117  DT  I "C2'" 1 
ATOM 8326  C "C1'" . DT  I 5 117 ? 211.782 144.713 146.290 1.00 141.71 ? 117  DT  I "C1'" 1 
ATOM 8327  N N1    . DT  I 5 117 ? 210.915 145.871 146.503 1.00 139.43 ? 117  DT  I N1    1 
ATOM 8328  C C2    . DT  I 5 117 ? 210.480 146.159 147.762 1.00 133.91 ? 117  DT  I C2    1 
ATOM 8329  O O2    . DT  I 5 117 ? 210.754 145.482 148.728 1.00 132.05 ? 117  DT  I O2    1 
ATOM 8330  N N3    . DT  I 5 117 ? 209.698 147.269 147.852 1.00 130.41 ? 117  DT  I N3    1 
ATOM 8331  C C4    . DT  I 5 117 ? 209.331 148.102 146.826 1.00 133.27 ? 117  DT  I C4    1 
ATOM 8332  O O4    . DT  I 5 117 ? 208.622 149.079 147.000 1.00 133.48 ? 117  DT  I O4    1 
ATOM 8333  C C5    . DT  I 5 117 ? 209.833 147.743 145.532 1.00 133.91 ? 117  DT  I C5    1 
ATOM 8334  C C7    . DT  I 5 117 ? 209.495 148.575 144.336 1.00 129.44 ? 117  DT  I C7    1 
ATOM 8335  C C6    . DT  I 5 117 ? 210.595 146.661 145.437 1.00 138.71 ? 117  DT  I C6    1 
ATOM 8336  P P     . DC  I 5 118 ? 212.613 140.840 146.022 1.00 141.77 ? 118  DC  I P     1 
ATOM 8337  O OP1   . DC  I 5 118 ? 213.707 140.101 146.686 1.00 145.76 ? 118  DC  I OP1   1 
ATOM 8338  O OP2   . DC  I 5 118 ? 211.957 140.312 144.808 1.00 128.28 ? 118  DC  I OP2   1 
ATOM 8339  O "O5'" . DC  I 5 118 ? 211.486 141.113 147.115 1.00 171.23 ? 118  DC  I "O5'" 1 
ATOM 8340  C "C5'" . DC  I 5 118 ? 211.831 141.728 148.343 1.00 166.96 ? 118  DC  I "C5'" 1 
ATOM 8341  C "C4'" . DC  I 5 118 ? 210.714 141.573 149.353 1.00 160.22 ? 118  DC  I "C4'" 1 
ATOM 8342  O "O4'" . DC  I 5 118 ? 209.864 142.744 149.329 1.00 154.23 ? 118  DC  I "O4'" 1 
ATOM 8343  C "C3'" . DC  I 5 118 ? 209.784 140.399 149.106 1.00 156.78 ? 118  DC  I "C3'" 1 
ATOM 8344  O "O3'" . DC  I 5 118 ? 209.278 139.956 150.336 1.00 157.63 ? 118  DC  I "O3'" 1 
ATOM 8345  C "C2'" . DC  I 5 118 ? 208.690 141.036 148.266 1.00 150.78 ? 118  DC  I "C2'" 1 
ATOM 8346  C "C1'" . DC  I 5 118 ? 208.551 142.356 148.992 1.00 148.39 ? 118  DC  I "C1'" 1 
ATOM 8347  N N1    . DC  I 5 118 ? 207.956 143.437 148.199 1.00 140.23 ? 118  DC  I N1    1 
ATOM 8348  C C2    . DC  I 5 118 ? 207.371 144.493 148.869 1.00 134.65 ? 118  DC  I C2    1 
ATOM 8349  O O2    . DC  I 5 118 ? 207.350 144.466 150.099 1.00 133.86 ? 118  DC  I O2    1 
ATOM 8350  N N3    . DC  I 5 118 ? 206.836 145.506 148.164 1.00 128.81 ? 118  DC  I N3    1 
ATOM 8351  C C4    . DC  I 5 118 ? 206.881 145.481 146.837 1.00 125.30 ? 118  DC  I C4    1 
ATOM 8352  N N4    . DC  I 5 118 ? 206.338 146.507 146.185 1.00 121.25 ? 118  DC  I N4    1 
ATOM 8353  C C5    . DC  I 5 118 ? 207.484 144.407 146.124 1.00 126.72 ? 118  DC  I C5    1 
ATOM 8354  C C6    . DC  I 5 118 ? 208.010 143.413 146.841 1.00 133.56 ? 118  DC  I C6    1 
ATOM 8355  P P     . DC  I 5 119 ? 208.850 138.426 150.512 1.00 130.23 ? 119  DC  I P     1 
ATOM 8356  O OP1   . DC  I 5 119 ? 209.053 138.049 151.926 1.00 127.36 ? 119  DC  I OP1   1 
ATOM 8357  O OP2   . DC  I 5 119 ? 209.556 137.687 149.448 1.00 123.92 ? 119  DC  I OP2   1 
ATOM 8358  O "O5'" . DC  I 5 119 ? 207.298 138.421 150.129 1.00 163.40 ? 119  DC  I "O5'" 1 
ATOM 8359  C "C5'" . DC  I 5 119 ? 206.314 138.204 151.126 1.00 151.77 ? 119  DC  I "C5'" 1 
ATOM 8360  C "C4'" . DC  I 5 119 ? 206.230 139.381 152.073 1.00 138.29 ? 119  DC  I "C4'" 1 
ATOM 8361  O "O4'" . DC  I 5 119 ? 206.437 140.607 151.338 1.00 135.62 ? 119  DC  I "O4'" 1 
ATOM 8362  C "C3'" . DC  I 5 119 ? 204.894 139.537 152.763 1.00 131.48 ? 119  DC  I "C3'" 1 
ATOM 8363  O "O3'" . DC  I 5 119 ? 205.076 140.122 154.024 1.00 128.01 ? 119  DC  I "O3'" 1 
ATOM 8364  C "C2'" . DC  I 5 119 ? 204.144 140.459 151.820 1.00 130.73 ? 119  DC  I "C2'" 1 
ATOM 8365  C "C1'" . DC  I 5 119 ? 205.252 141.369 151.325 1.00 131.58 ? 119  DC  I "C1'" 1 
ATOM 8366  N N1    . DC  I 5 119 ? 205.038 141.825 149.960 1.00 126.60 ? 119  DC  I N1    1 
ATOM 8367  C C2    . DC  I 5 119 ? 204.472 143.070 149.729 1.00 122.28 ? 119  DC  I C2    1 
ATOM 8368  O O2    . DC  I 5 119 ? 204.163 143.776 150.688 1.00 116.39 ? 119  DC  I O2    1 
ATOM 8369  N N3    . DC  I 5 119 ? 204.281 143.475 148.459 1.00 118.42 ? 119  DC  I N3    1 
ATOM 8370  C C4    . DC  I 5 119 ? 204.631 142.685 147.456 1.00 115.16 ? 119  DC  I C4    1 
ATOM 8371  N N4    . DC  I 5 119 ? 204.424 143.126 146.218 1.00 102.31 ? 119  DC  I N4    1 
ATOM 8372  C C5    . DC  I 5 119 ? 205.204 141.408 147.674 1.00 119.43 ? 119  DC  I C5    1 
ATOM 8373  C C6    . DC  I 5 119 ? 205.382 141.021 148.932 1.00 122.25 ? 119  DC  I C6    1 
ATOM 8374  P P     . DA  I 5 120 ? 204.675 139.293 155.334 1.00 117.54 ? 120  DA  I P     1 
ATOM 8375  O OP1   . DA  I 5 120 ? 205.672 139.585 156.379 1.00 115.92 ? 120  DA  I OP1   1 
ATOM 8376  O OP2   . DA  I 5 120 ? 204.451 137.901 154.906 1.00 110.08 ? 120  DA  I OP2   1 
ATOM 8377  O "O5'" . DA  I 5 120 ? 203.261 139.899 155.761 1.00 122.04 ? 120  DA  I "O5'" 1 
ATOM 8378  C "C5'" . DA  I 5 120 ? 203.205 140.955 156.699 1.00 104.01 ? 120  DA  I "C5'" 1 
ATOM 8379  C "C4'" . DA  I 5 120 ? 201.942 141.771 156.528 1.00 89.80  ? 120  DA  I "C4'" 1 
ATOM 8380  O "O4'" . DA  I 5 120 ? 201.724 142.051 155.126 1.00 87.64  ? 120  DA  I "O4'" 1 
ATOM 8381  C "C3'" . DA  I 5 120 ? 200.666 141.096 156.991 1.00 95.00  ? 120  DA  I "C3'" 1 
ATOM 8382  O "O3'" . DA  I 5 120 ? 199.754 142.083 157.354 1.00 91.23  ? 120  DA  I "O3'" 1 
ATOM 8383  C "C2'" . DA  I 5 120 ? 200.210 140.421 155.716 1.00 96.86  ? 120  DA  I "C2'" 1 
ATOM 8384  C "C1'" . DA  I 5 120 ? 200.463 141.555 154.759 1.00 95.32  ? 120  DA  I "C1'" 1 
ATOM 8385  N N9    . DA  I 5 120 ? 200.525 141.164 153.377 1.00 96.56  ? 120  DA  I N9    1 
ATOM 8386  C C8    . DA  I 5 120 ? 201.046 140.021 152.870 1.00 90.74  ? 120  DA  I C8    1 
ATOM 8387  N N7    . DA  I 5 120 ? 200.980 139.950 151.568 1.00 92.36  ? 120  DA  I N7    1 
ATOM 8388  C C5    . DA  I 5 120 ? 200.381 141.134 151.208 1.00 100.89 ? 120  DA  I C5    1 
ATOM 8389  C C6    . DA  I 5 120 ? 200.028 141.670 149.967 1.00 102.89 ? 120  DA  I C6    1 
ATOM 8390  N N6    . DA  I 5 120 ? 200.241 141.044 148.814 1.00 103.27 ? 120  DA  I N6    1 
ATOM 8391  N N1    . DA  I 5 120 ? 199.445 142.878 149.953 1.00 100.34 ? 120  DA  I N1    1 
ATOM 8392  C C2    . DA  I 5 120 ? 199.234 143.498 151.112 1.00 93.32  ? 120  DA  I C2    1 
ATOM 8393  N N3    . DA  I 5 120 ? 199.522 143.090 152.341 1.00 95.90  ? 120  DA  I N3    1 
ATOM 8394  C C4    . DA  I 5 120 ? 200.099 141.891 152.314 1.00 100.71 ? 120  DA  I C4    1 
ATOM 8395  P P     . DG  I 5 121 ? 199.740 142.681 158.837 1.00 91.25  ? 121  DG  I P     1 
ATOM 8396  O OP1   . DG  I 5 121 ? 201.131 142.834 159.301 1.00 88.15  ? 121  DG  I OP1   1 
ATOM 8397  O OP2   . DG  I 5 121 ? 198.769 141.891 159.615 1.00 90.96  ? 121  DG  I OP2   1 
ATOM 8398  O "O5'" . DG  I 5 121 ? 199.132 144.134 158.643 1.00 102.73 ? 121  DG  I "O5'" 1 
ATOM 8399  C "C5'" . DG  I 5 121 ? 199.877 145.101 157.958 1.00 99.03  ? 121  DG  I "C5'" 1 
ATOM 8400  C "C4'" . DG  I 5 121 ? 198.984 146.166 157.359 1.00 89.56  ? 121  DG  I "C4'" 1 
ATOM 8401  O "O4'" . DG  I 5 121 ? 198.610 145.791 156.018 1.00 76.32  ? 121  DG  I "O4'" 1 
ATOM 8402  C "C3'" . DG  I 5 121 ? 197.682 146.412 158.082 1.00 86.34  ? 121  DG  I "C3'" 1 
ATOM 8403  O "O3'" . DG  I 5 121 ? 197.279 147.742 157.853 1.00 78.52  ? 121  DG  I "O3'" 1 
ATOM 8404  C "C2'" . DG  I 5 121 ? 196.746 145.419 157.408 1.00 83.92  ? 121  DG  I "C2'" 1 
ATOM 8405  C "C1'" . DG  I 5 121 ? 197.250 145.426 155.973 1.00 78.78  ? 121  DG  I "C1'" 1 
ATOM 8406  N N9    . DG  I 5 121 ? 197.182 144.132 155.339 1.00 84.82  ? 121  DG  I N9    1 
ATOM 8407  C C8    . DG  I 5 121 ? 197.498 142.939 155.902 1.00 96.15  ? 121  DG  I C8    1 
ATOM 8408  N N7    . DG  I 5 121 ? 197.372 141.938 155.092 1.00 102.49 ? 121  DG  I N7    1 
ATOM 8409  C C5    . DG  I 5 121 ? 196.957 142.512 153.912 1.00 96.56  ? 121  DG  I C5    1 
ATOM 8410  C C6    . DG  I 5 121 ? 196.659 141.919 152.679 1.00 98.65  ? 121  DG  I C6    1 
ATOM 8411  O O6    . DG  I 5 121 ? 196.707 140.732 152.369 1.00 106.59 ? 121  DG  I O6    1 
ATOM 8412  N N1    . DG  I 5 121 ? 196.267 142.850 151.750 1.00 96.48  ? 121  DG  I N1    1 
ATOM 8413  C C2    . DG  I 5 121 ? 196.180 144.184 151.978 1.00 98.99  ? 121  DG  I C2    1 
ATOM 8414  N N2    . DG  I 5 121 ? 195.792 144.922 150.945 1.00 112.07 ? 121  DG  I N2    1 
ATOM 8415  N N3    . DG  I 5 121 ? 196.460 144.760 153.128 1.00 88.06  ? 121  DG  I N3    1 
ATOM 8416  C C4    . DG  I 5 121 ? 196.843 143.862 154.046 1.00 87.57  ? 121  DG  I C4    1 
ATOM 8417  P P     . DG  I 5 122 ? 195.934 148.317 158.504 1.00 95.88  ? 122  DG  I P     1 
ATOM 8418  O OP1   . DG  I 5 122 ? 196.245 149.652 159.036 1.00 92.14  ? 122  DG  I OP1   1 
ATOM 8419  O OP2   . DG  I 5 122 ? 195.346 147.300 159.389 1.00 90.53  ? 122  DG  I OP2   1 
ATOM 8420  O "O5'" . DG  I 5 122 ? 194.980 148.519 157.254 1.00 75.91  ? 122  DG  I "O5'" 1 
ATOM 8421  C "C5'" . DG  I 5 122 ? 195.326 149.468 156.285 1.00 73.27  ? 122  DG  I "C5'" 1 
ATOM 8422  C "C4'" . DG  I 5 122 ? 194.484 149.300 155.048 1.00 78.10  ? 122  DG  I "C4'" 1 
ATOM 8423  O "O4'" . DG  I 5 122 ? 194.704 147.984 154.495 1.00 81.54  ? 122  DG  I "O4'" 1 
ATOM 8424  C "C3'" . DG  I 5 122 ? 192.986 149.410 155.280 1.00 72.75  ? 122  DG  I "C3'" 1 
ATOM 8425  O "O3'" . DG  I 5 122 ? 192.397 150.069 154.199 1.00 66.98  ? 122  DG  I "O3'" 1 
ATOM 8426  C "C2'" . DG  I 5 122 ? 192.555 147.960 155.332 1.00 75.56  ? 122  DG  I "C2'" 1 
ATOM 8427  C "C1'" . DG  I 5 122 ? 193.471 147.355 154.302 1.00 80.17  ? 122  DG  I "C1'" 1 
ATOM 8428  N N9    . DG  I 5 122 ? 193.658 145.936 154.490 1.00 87.36  ? 122  DG  I N9    1 
ATOM 8429  C C8    . DG  I 5 122 ? 194.042 145.311 155.636 1.00 94.64  ? 122  DG  I C8    1 
ATOM 8430  N N7    . DG  I 5 122 ? 194.138 144.024 155.516 1.00 98.01  ? 122  DG  I N7    1 
ATOM 8431  C C5    . DG  I 5 122 ? 193.767 143.783 154.208 1.00 90.90  ? 122  DG  I C5    1 
ATOM 8432  C C6    . DG  I 5 122 ? 193.671 142.575 153.507 1.00 91.11  ? 122  DG  I C6    1 
ATOM 8433  O O6    . DG  I 5 122 ? 193.895 141.436 153.915 1.00 94.59  ? 122  DG  I O6    1 
ATOM 8434  N N1    . DG  I 5 122 ? 193.264 142.773 152.206 1.00 85.88  ? 122  DG  I N1    1 
ATOM 8435  C C2    . DG  I 5 122 ? 192.989 143.988 151.650 1.00 82.85  ? 122  DG  I C2    1 
ATOM 8436  N N2    . DG  I 5 122 ? 192.614 143.979 150.376 1.00 74.73  ? 122  DG  I N2    1 
ATOM 8437  N N3    . DG  I 5 122 ? 193.075 145.128 152.293 1.00 86.96  ? 122  DG  I N3    1 
ATOM 8438  C C4    . DG  I 5 122 ? 193.481 144.950 153.561 1.00 87.79  ? 122  DG  I C4    1 
ATOM 8439  P P     . DC  I 5 123 ? 190.890 150.604 154.293 1.00 78.67  ? 123  DC  I P     1 
ATOM 8440  O OP1   . DC  I 5 123 ? 190.945 152.073 154.363 1.00 68.34  ? 123  DC  I OP1   1 
ATOM 8441  O OP2   . DC  I 5 123 ? 190.169 149.842 155.328 1.00 77.75  ? 123  DC  I OP2   1 
ATOM 8442  O "O5'" . DC  I 5 123 ? 190.296 150.194 152.888 1.00 76.24  ? 123  DC  I "O5'" 1 
ATOM 8443  C "C5'" . DC  I 5 123 ? 191.163 149.664 151.949 1.00 73.36  ? 123  DC  I "C5'" 1 
ATOM 8444  C "C4'" . DC  I 5 123 ? 190.416 149.191 150.740 1.00 78.67  ? 123  DC  I "C4'" 1 
ATOM 8445  O "O4'" . DC  I 5 123 ? 190.626 147.771 150.581 1.00 73.63  ? 123  DC  I "O4'" 1 
ATOM 8446  C "C3'" . DC  I 5 123 ? 188.922 149.373 150.804 1.00 81.10  ? 123  DC  I "C3'" 1 
ATOM 8447  O "O3'" . DC  I 5 123 ? 188.419 149.442 149.503 1.00 77.12  ? 123  DC  I "O3'" 1 
ATOM 8448  C "C2'" . DC  I 5 123 ? 188.485 148.098 151.498 1.00 77.51  ? 123  DC  I "C2'" 1 
ATOM 8449  C "C1'" . DC  I 5 123 ? 189.460 147.071 150.935 1.00 74.63  ? 123  DC  I "C1'" 1 
ATOM 8450  N N1    . DC  I 5 123 ? 189.833 146.035 151.913 1.00 86.23  ? 123  DC  I N1    1 
ATOM 8451  C C2    . DC  I 5 123 ? 189.774 144.692 151.560 1.00 95.92  ? 123  DC  I C2    1 
ATOM 8452  O O2    . DC  I 5 123 ? 189.402 144.386 150.429 1.00 100.93 ? 123  DC  I O2    1 
ATOM 8453  N N3    . DC  I 5 123 ? 190.113 143.760 152.475 1.00 95.44  ? 123  DC  I N3    1 
ATOM 8454  C C4    . DC  I 5 123 ? 190.502 144.133 153.683 1.00 96.32  ? 123  DC  I C4    1 
ATOM 8455  N N4    . DC  I 5 123 ? 190.831 143.184 154.556 1.00 96.98  ? 123  DC  I N4    1 
ATOM 8456  C C5    . DC  I 5 123 ? 190.557 145.495 154.061 1.00 99.39  ? 123  DC  I C5    1 
ATOM 8457  C C6    . DC  I 5 123 ? 190.232 146.404 153.148 1.00 93.96  ? 123  DC  I C6    1 
ATOM 8458  P P     . DA  I 5 124 ? 186.882 149.791 149.242 1.00 95.70  ? 124  DA  I P     1 
ATOM 8459  O OP1   . DA  I 5 124 ? 186.836 150.832 148.202 1.00 85.27  ? 124  DA  I OP1   1 
ATOM 8460  O OP2   . DA  I 5 124 ? 186.249 150.035 150.546 1.00 91.28  ? 124  DA  I OP2   1 
ATOM 8461  O "O5'" . DA  I 5 124 ? 186.297 148.441 148.641 1.00 96.07  ? 124  DA  I "O5'" 1 
ATOM 8462  C "C5'" . DA  I 5 124 ? 187.178 147.504 148.068 1.00 93.50  ? 124  DA  I "C5'" 1 
ATOM 8463  C "C4'" . DA  I 5 124 ? 186.441 146.537 147.168 1.00 86.83  ? 124  DA  I "C4'" 1 
ATOM 8464  O "O4'" . DA  I 5 124 ? 186.608 145.204 147.672 1.00 86.24  ? 124  DA  I "O4'" 1 
ATOM 8465  C "C3'" . DA  I 5 124 ? 184.947 146.715 147.111 1.00 93.42  ? 124  DA  I "C3'" 1 
ATOM 8466  O "O3'" . DA  I 5 124 ? 184.445 146.051 145.975 1.00 111.24 ? 124  DA  I "O3'" 1 
ATOM 8467  C "C2'" . DA  I 5 124 ? 184.507 146.017 148.385 1.00 84.32  ? 124  DA  I "C2'" 1 
ATOM 8468  C "C1'" . DA  I 5 124 ? 185.515 144.877 148.500 1.00 80.12  ? 124  DA  I "C1'" 1 
ATOM 8469  N N9    . DA  I 5 124 ? 186.026 144.709 149.844 1.00 79.27  ? 124  DA  I N9    1 
ATOM 8470  C C8    . DA  I 5 124 ? 186.372 145.694 150.711 1.00 78.79  ? 124  DA  I C8    1 
ATOM 8471  N N7    . DA  I 5 124 ? 186.819 145.257 151.857 1.00 81.56  ? 124  DA  I N7    1 
ATOM 8472  C C5    . DA  I 5 124 ? 186.758 143.894 151.729 1.00 81.92  ? 124  DA  I C5    1 
ATOM 8473  C C6    . DA  I 5 124 ? 187.093 142.865 152.600 1.00 81.08  ? 124  DA  I C6    1 
ATOM 8474  N N6    . DA  I 5 124 ? 187.572 143.076 153.821 1.00 72.60  ? 124  DA  I N6    1 
ATOM 8475  N N1    . DA  I 5 124 ? 186.923 141.605 152.170 1.00 84.81  ? 124  DA  I N1    1 
ATOM 8476  C C2    . DA  I 5 124 ? 186.443 141.406 150.942 1.00 89.88  ? 124  DA  I C2    1 
ATOM 8477  N N3    . DA  I 5 124 ? 186.089 142.303 150.031 1.00 91.40  ? 124  DA  I N3    1 
ATOM 8478  C C4    . DA  I 5 124 ? 186.278 143.537 150.492 1.00 85.95  ? 124  DA  I C4    1 
ATOM 8479  P P     . DC  I 5 125 ? 182.863 145.963 145.718 1.00 118.17 ? 125  DC  I P     1 
ATOM 8480  O OP1   . DC  I 5 125 ? 182.649 145.910 144.258 1.00 114.51 ? 125  DC  I OP1   1 
ATOM 8481  O OP2   . DC  I 5 125 ? 182.221 147.026 146.515 1.00 112.98 ? 125  DC  I OP2   1 
ATOM 8482  O "O5'" . DC  I 5 125 ? 182.446 144.548 146.331 1.00 92.20  ? 125  DC  I "O5'" 1 
ATOM 8483  C "C5'" . DC  I 5 125 ? 181.976 143.526 145.471 1.00 97.25  ? 125  DC  I "C5'" 1 
ATOM 8484  C "C4'" . DC  I 5 125 ? 181.897 142.201 146.197 1.00 106.06 ? 125  DC  I "C4'" 1 
ATOM 8485  O "O4'" . DC  I 5 125 ? 182.711 142.252 147.402 1.00 105.63 ? 125  DC  I "O4'" 1 
ATOM 8486  C "C3'" . DC  I 5 125 ? 180.505 141.812 146.683 1.00 117.41 ? 125  DC  I "C3'" 1 
ATOM 8487  O "O3'" . DC  I 5 125 ? 180.409 140.402 146.695 1.00 136.20 ? 125  DC  I "O3'" 1 
ATOM 8488  C "C2'" . DC  I 5 125 ? 180.524 142.357 148.098 1.00 106.98 ? 125  DC  I "C2'" 1 
ATOM 8489  C "C1'" . DC  I 5 125 ? 181.898 141.877 148.487 1.00 105.55 ? 125  DC  I "C1'" 1 
ATOM 8490  N N1    . DC  I 5 125 ? 182.431 142.455 149.718 1.00 102.68 ? 125  DC  I N1    1 
ATOM 8491  C C2    . DC  I 5 125 ? 182.909 141.609 150.708 1.00 96.65  ? 125  DC  I C2    1 
ATOM 8492  O O2    . DC  I 5 125 ? 182.826 140.390 150.559 1.00 89.85  ? 125  DC  I O2    1 
ATOM 8493  N N3    . DC  I 5 125 ? 183.388 142.135 151.843 1.00 96.13  ? 125  DC  I N3    1 
ATOM 8494  C C4    . DC  I 5 125 ? 183.448 143.447 151.982 1.00 109.29 ? 125  DC  I C4    1 
ATOM 8495  N N4    . DC  I 5 125 ? 183.944 143.919 153.120 1.00 113.86 ? 125  DC  I N4    1 
ATOM 8496  C C5    . DC  I 5 125 ? 182.973 144.332 150.980 1.00 109.08 ? 125  DC  I C5    1 
ATOM 8497  C C6    . DC  I 5 125 ? 182.477 143.793 149.872 1.00 104.42 ? 125  DC  I C6    1 
ATOM 8498  P P     . DG  I 5 126 ? 179.090 139.675 147.245 1.00 135.55 ? 126  DG  I P     1 
ATOM 8499  O OP1   . DG  I 5 126 ? 179.180 138.248 146.876 1.00 127.23 ? 126  DG  I OP1   1 
ATOM 8500  O OP2   . DG  I 5 126 ? 177.936 140.489 146.822 1.00 126.27 ? 126  DG  I OP2   1 
ATOM 8501  O "O5'" . DG  I 5 126 ? 179.202 139.785 148.835 1.00 110.38 ? 126  DG  I "O5'" 1 
ATOM 8502  C "C5'" . DG  I 5 126 ? 180.226 139.089 149.528 1.00 112.31 ? 126  DG  I "C5'" 1 
ATOM 8503  C "C4'" . DG  I 5 126 ? 179.711 137.787 150.083 1.00 111.56 ? 126  DG  I "C4'" 1 
ATOM 8504  O "O4'" . DG  I 5 126 ? 179.843 137.793 151.520 1.00 103.54 ? 126  DG  I "O4'" 1 
ATOM 8505  C "C3'" . DG  I 5 126 ? 178.243 137.543 149.835 1.00 122.35 ? 126  DG  I "C3'" 1 
ATOM 8506  O "O3'" . DG  I 5 126 ? 177.977 136.165 149.894 1.00 124.26 ? 126  DG  I "O3'" 1 
ATOM 8507  C "C2'" . DG  I 5 126 ? 177.589 138.302 150.986 1.00 116.14 ? 126  DG  I "C2'" 1 
ATOM 8508  C "C1'" . DG  I 5 126 ? 178.616 138.179 152.113 1.00 113.40 ? 126  DG  I "C1'" 1 
ATOM 8509  N N9    . DG  I 5 126 ? 178.846 139.427 152.826 1.00 129.50 ? 126  DG  I N9    1 
ATOM 8510  C C8    . DG  I 5 126 ? 178.584 140.691 152.378 1.00 136.50 ? 126  DG  I C8    1 
ATOM 8511  N N7    . DG  I 5 126 ? 178.920 141.616 153.225 1.00 128.92 ? 126  DG  I N7    1 
ATOM 8512  C C5    . DG  I 5 126 ? 179.442 140.920 154.296 1.00 126.07 ? 126  DG  I C5    1 
ATOM 8513  C C6    . DG  I 5 126 ? 179.963 141.392 155.509 1.00 130.51 ? 126  DG  I C6    1 
ATOM 8514  O O6    . DG  I 5 126 ? 180.074 142.556 155.886 1.00 127.72 ? 126  DG  I O6    1 
ATOM 8515  N N1    . DG  I 5 126 ? 180.389 140.358 156.327 1.00 132.94 ? 126  DG  I N1    1 
ATOM 8516  C C2    . DG  I 5 126 ? 180.313 139.036 156.007 1.00 128.05 ? 126  DG  I C2    1 
ATOM 8517  N N2    . DG  I 5 126 ? 180.777 138.181 156.919 1.00 114.97 ? 126  DG  I N2    1 
ATOM 8518  N N3    . DG  I 5 126 ? 179.822 138.578 154.869 1.00 128.65 ? 126  DG  I N3    1 
ATOM 8519  C C4    . DG  I 5 126 ? 179.402 139.576 154.068 1.00 126.31 ? 126  DG  I C4    1 
ATOM 8520  P P     . DT  I 5 127 ? 176.520 135.606 149.533 1.00 139.99 ? 127  DT  I P     1 
ATOM 8521  O OP1   . DT  I 5 127 ? 176.711 134.452 148.631 1.00 137.87 ? 127  DT  I OP1   1 
ATOM 8522  O OP2   . DT  I 5 127 ? 175.672 136.741 149.116 1.00 141.77 ? 127  DT  I OP2   1 
ATOM 8523  O "O5'" . DT  I 5 127 ? 175.990 135.064 150.929 1.00 131.71 ? 127  DT  I "O5'" 1 
ATOM 8524  C "C5'" . DT  I 5 127 ? 176.791 134.158 151.655 1.00 136.26 ? 127  DT  I "C5'" 1 
ATOM 8525  C "C4'" . DT  I 5 127 ? 176.558 134.306 153.140 1.00 137.49 ? 127  DT  I "C4'" 1 
ATOM 8526  O "O4'" . DT  I 5 127 ? 176.933 135.644 153.563 1.00 137.92 ? 127  DT  I "O4'" 1 
ATOM 8527  C "C3'" . DT  I 5 127 ? 175.105 134.116 153.580 1.00 139.20 ? 127  DT  I "C3'" 1 
ATOM 8528  O "O3'" . DT  I 5 127 ? 175.051 133.272 154.716 1.00 140.42 ? 127  DT  I "O3'" 1 
ATOM 8529  C "C2'" . DT  I 5 127 ? 174.665 135.532 153.922 1.00 137.74 ? 127  DT  I "C2'" 1 
ATOM 8530  C "C1'" . DT  I 5 127 ? 175.960 136.104 154.455 1.00 133.85 ? 127  DT  I "C1'" 1 
ATOM 8531  N N1    . DT  I 5 127 ? 175.986 137.569 154.482 1.00 122.51 ? 127  DT  I N1    1 
ATOM 8532  C C2    . DT  I 5 127 ? 176.533 138.208 155.558 1.00 112.12 ? 127  DT  I C2    1 
ATOM 8533  O O2    . DT  I 5 127 ? 177.018 137.622 156.500 1.00 111.36 ? 127  DT  I O2    1 
ATOM 8534  N N3    . DT  I 5 127 ? 176.499 139.569 155.489 1.00 103.27 ? 127  DT  I N3    1 
ATOM 8535  C C4    . DT  I 5 127 ? 175.975 140.330 154.476 1.00 112.36 ? 127  DT  I C4    1 
ATOM 8536  O O4    . DT  I 5 127 ? 175.986 141.552 154.498 1.00 108.28 ? 127  DT  I O4    1 
ATOM 8537  C C5    . DT  I 5 127 ? 175.411 139.595 153.386 1.00 121.61 ? 127  DT  I C5    1 
ATOM 8538  C C7    . DT  I 5 127 ? 174.812 140.327 152.227 1.00 127.66 ? 127  DT  I C7    1 
ATOM 8539  C C6    . DT  I 5 127 ? 175.432 138.264 153.448 1.00 117.67 ? 127  DT  I C6    1 
ATOM 8540  P P     . DG  I 5 128 ? 173.701 132.475 155.055 1.00 137.11 ? 128  DG  I P     1 
ATOM 8541  O OP1   . DG  I 5 128 ? 174.063 131.074 155.332 1.00 143.30 ? 128  DG  I OP1   1 
ATOM 8542  O OP2   . DG  I 5 128 ? 172.721 132.793 154.001 1.00 118.61 ? 128  DG  I OP2   1 
ATOM 8543  O "O5'" . DG  I 5 128 ? 173.192 133.127 156.417 1.00 129.15 ? 128  DG  I "O5'" 1 
ATOM 8544  C "C5'" . DG  I 5 128 ? 173.707 132.668 157.651 1.00 126.84 ? 128  DG  I "C5'" 1 
ATOM 8545  C "C4'" . DG  I 5 128 ? 174.400 133.794 158.381 1.00 123.79 ? 128  DG  I "C4'" 1 
ATOM 8546  O "O4'" . DG  I 5 128 ? 174.455 134.937 157.526 1.00 121.60 ? 128  DG  I "O4'" 1 
ATOM 8547  C "C3'" . DG  I 5 128 ? 173.684 134.285 159.631 1.00 114.97 ? 128  DG  I "C3'" 1 
ATOM 8548  O "O3'" . DG  I 5 128 ? 174.238 133.669 160.775 1.00 104.79 ? 128  DG  I "O3'" 1 
ATOM 8549  C "C2'" . DG  I 5 128 ? 173.935 135.801 159.639 1.00 116.23 ? 128  DG  I "C2'" 1 
ATOM 8550  C "C1'" . DG  I 5 128 ? 174.671 136.056 158.330 1.00 117.48 ? 128  DG  I "C1'" 1 
ATOM 8551  N N9    . DG  I 5 128 ? 174.217 137.240 157.617 1.00 118.94 ? 128  DG  I N9    1 
ATOM 8552  C C8    . DG  I 5 128 ? 173.585 137.290 156.402 1.00 131.36 ? 128  DG  I C8    1 
ATOM 8553  N N7    . DG  I 5 128 ? 173.321 138.500 156.004 1.00 132.64 ? 128  DG  I N7    1 
ATOM 8554  C C5    . DG  I 5 128 ? 173.792 139.299 157.031 1.00 125.14 ? 128  DG  I C5    1 
ATOM 8555  C C6    . DG  I 5 128 ? 173.777 140.696 157.169 1.00 122.83 ? 128  DG  I C6    1 
ATOM 8556  O O6    . DG  I 5 128 ? 173.325 141.538 156.390 1.00 125.36 ? 128  DG  I O6    1 
ATOM 8557  N N1    . DG  I 5 128 ? 174.363 141.098 158.361 1.00 115.15 ? 128  DG  I N1    1 
ATOM 8558  C C2    . DG  I 5 128 ? 174.894 140.251 159.297 1.00 107.14 ? 128  DG  I C2    1 
ATOM 8559  N N2    . DG  I 5 128 ? 175.419 140.817 160.388 1.00 106.24 ? 128  DG  I N2    1 
ATOM 8560  N N3    . DG  I 5 128 ? 174.915 138.941 159.178 1.00 111.22 ? 128  DG  I N3    1 
ATOM 8561  C C4    . DG  I 5 128 ? 174.350 138.537 158.026 1.00 118.58 ? 128  DG  I C4    1 
ATOM 8562  P P     . DT  I 5 129 ? 173.287 133.211 161.982 1.00 139.80 ? 129  DT  I P     1 
ATOM 8563  O OP1   . DT  I 5 129 ? 174.007 132.192 162.770 1.00 147.73 ? 129  DT  I OP1   1 
ATOM 8564  O OP2   . DT  I 5 129 ? 171.953 132.931 161.416 1.00 122.13 ? 129  DT  I OP2   1 
ATOM 8565  O "O5'" . DT  I 5 129 ? 173.160 134.510 162.888 1.00 129.20 ? 129  DT  I "O5'" 1 
ATOM 8566  C "C5'" . DT  I 5 129 ? 173.842 134.566 164.116 1.00 117.80 ? 129  DT  I "C5'" 1 
ATOM 8567  C "C4'" . DT  I 5 129 ? 173.897 135.986 164.630 1.00 108.47 ? 129  DT  I "C4'" 1 
ATOM 8568  O "O4'" . DT  I 5 129 ? 173.683 136.908 163.525 1.00 110.31 ? 129  DT  I "O4'" 1 
ATOM 8569  C "C3'" . DT  I 5 129 ? 172.815 136.346 165.627 1.00 101.01 ? 129  DT  I "C3'" 1 
ATOM 8570  O "O3'" . DT  I 5 129 ? 173.243 137.475 166.343 1.00 101.52 ? 129  DT  I "O3'" 1 
ATOM 8571  C "C2'" . DT  I 5 129 ? 171.701 136.729 164.682 1.00 105.61 ? 129  DT  I "C2'" 1 
ATOM 8572  C "C1'" . DT  I 5 129 ? 172.501 137.635 163.777 1.00 109.02 ? 129  DT  I "C1'" 1 
ATOM 8573  N N1    . DT  I 5 129 ? 171.862 137.980 162.490 1.00 111.64 ? 129  DT  I N1    1 
ATOM 8574  C C2    . DT  I 5 129 ? 171.712 139.296 162.166 1.00 117.19 ? 129  DT  I C2    1 
ATOM 8575  O O2    . DT  I 5 129 ? 172.051 140.193 162.900 1.00 118.55 ? 129  DT  I O2    1 
ATOM 8576  N N3    . DT  I 5 129 ? 171.134 139.530 160.952 1.00 114.30 ? 129  DT  I N3    1 
ATOM 8577  C C4    . DT  I 5 129 ? 170.706 138.587 160.052 1.00 109.67 ? 129  DT  I C4    1 
ATOM 8578  O O4    . DT  I 5 129 ? 170.198 138.883 158.983 1.00 102.52 ? 129  DT  I O4    1 
ATOM 8579  C C5    . DT  I 5 129 ? 170.903 137.225 160.448 1.00 116.52 ? 129  DT  I C5    1 
ATOM 8580  C C7    . DT  I 5 129 ? 170.475 136.118 159.539 1.00 126.24 ? 129  DT  I C7    1 
ATOM 8581  C C6    . DT  I 5 129 ? 171.468 136.987 161.636 1.00 111.90 ? 129  DT  I C6    1 
ATOM 8582  P P     . DC  I 5 130 ? 173.299 137.466 167.942 1.00 113.86 ? 130  DC  I P     1 
ATOM 8583  O OP1   . DC  I 5 130 ? 174.717 137.331 168.320 1.00 111.90 ? 130  DC  I OP1   1 
ATOM 8584  O OP2   . DC  I 5 130 ? 172.323 136.473 168.425 1.00 101.44 ? 130  DC  I OP2   1 
ATOM 8585  O "O5'" . DC  I 5 130 ? 172.793 138.928 168.335 1.00 131.19 ? 130  DC  I "O5'" 1 
ATOM 8586  C "C5'" . DC  I 5 130 ? 173.443 140.055 167.786 1.00 115.66 ? 130  DC  I "C5'" 1 
ATOM 8587  C "C4'" . DC  I 5 130 ? 172.528 141.256 167.741 1.00 103.09 ? 130  DC  I "C4'" 1 
ATOM 8588  O "O4'" . DC  I 5 130 ? 171.898 141.339 166.441 1.00 104.73 ? 130  DC  I "O4'" 1 
ATOM 8589  C "C3'" . DC  I 5 130 ? 171.392 141.240 168.743 1.00 96.85  ? 130  DC  I "C3'" 1 
ATOM 8590  O "O3'" . DC  I 5 130 ? 171.080 142.562 169.109 1.00 90.84  ? 130  DC  I "O3'" 1 
ATOM 8591  C "C2'" . DC  I 5 130 ? 170.270 140.649 167.911 1.00 92.89  ? 130  DC  I "C2'" 1 
ATOM 8592  C "C1'" . DC  I 5 130 ? 170.509 141.382 166.614 1.00 94.35  ? 130  DC  I "C1'" 1 
ATOM 8593  N N1    . DC  I 5 130 ? 169.875 140.754 165.451 1.00 91.98  ? 130  DC  I N1    1 
ATOM 8594  C C2    . DC  I 5 130 ? 169.354 141.548 164.432 1.00 94.90  ? 130  DC  I C2    1 
ATOM 8595  O O2    . DC  I 5 130 ? 169.431 142.770 164.517 1.00 96.24  ? 130  DC  I O2    1 
ATOM 8596  N N3    . DC  I 5 130 ? 168.783 140.957 163.368 1.00 91.93  ? 130  DC  I N3    1 
ATOM 8597  C C4    . DC  I 5 130 ? 168.727 139.640 163.299 1.00 95.81  ? 130  DC  I C4    1 
ATOM 8598  N N4    . DC  I 5 130 ? 168.149 139.097 162.228 1.00 97.91  ? 130  DC  I N4    1 
ATOM 8599  C C5    . DC  I 5 130 ? 169.244 138.817 164.327 1.00 98.04  ? 130  DC  I C5    1 
ATOM 8600  C C6    . DC  I 5 130 ? 169.810 139.411 165.373 1.00 96.05  ? 130  DC  I C6    1 
ATOM 8601  P P     . DA  I 5 131 ? 171.826 143.298 170.327 1.00 90.15  ? 131  DA  I P     1 
ATOM 8602  O OP1   . DA  I 5 131 ? 173.189 142.755 170.462 1.00 81.16  ? 131  DA  I OP1   1 
ATOM 8603  O OP2   . DA  I 5 131 ? 170.920 143.303 171.489 1.00 87.56  ? 131  DA  I OP2   1 
ATOM 8604  O "O5'" . DA  I 5 131 ? 171.913 144.799 169.819 1.00 82.79  ? 131  DA  I "O5'" 1 
ATOM 8605  C "C5'" . DA  I 5 131 ? 171.768 145.050 168.445 1.00 67.44  ? 131  DA  I "C5'" 1 
ATOM 8606  C "C4'" . DA  I 5 131 ? 171.392 146.487 168.181 1.00 73.33  ? 131  DA  I "C4'" 1 
ATOM 8607  O "O4'" . DA  I 5 131 ? 170.293 146.529 167.262 1.00 83.53  ? 131  DA  I "O4'" 1 
ATOM 8608  C "C3'" . DA  I 5 131 ? 170.860 147.248 169.355 1.00 71.23  ? 131  DA  I "C3'" 1 
ATOM 8609  O "O3'" . DA  I 5 131 ? 170.840 148.608 168.986 1.00 71.66  ? 131  DA  I "O3'" 1 
ATOM 8610  C "C2'" . DA  I 5 131 ? 169.453 146.663 169.456 1.00 64.68  ? 131  DA  I "C2'" 1 
ATOM 8611  C "C1'" . DA  I 5 131 ? 169.091 146.434 167.990 1.00 79.09  ? 131  DA  I "C1'" 1 
ATOM 8612  N N9    . DA  I 5 131 ? 168.556 145.125 167.723 1.00 90.42  ? 131  DA  I N9    1 
ATOM 8613  C C8    . DA  I 5 131 ? 168.732 144.007 168.462 1.00 100.89 ? 131  DA  I C8    1 
ATOM 8614  N N7    . DA  I 5 131 ? 168.171 142.950 167.954 1.00 101.87 ? 131  DA  I N7    1 
ATOM 8615  C C5    . DA  I 5 131 ? 167.601 143.408 166.793 1.00 91.53  ? 131  DA  I C5    1 
ATOM 8616  C C6    . DA  I 5 131 ? 166.856 142.774 165.803 1.00 94.28  ? 131  DA  I C6    1 
ATOM 8617  N N6    . DA  I 5 131 ? 166.565 141.478 165.830 1.00 83.83  ? 131  DA  I N6    1 
ATOM 8618  N N1    . DA  I 5 131 ? 166.430 143.516 164.775 1.00 99.05  ? 131  DA  I N1    1 
ATOM 8619  C C2    . DA  I 5 131 ? 166.739 144.807 164.749 1.00 84.50  ? 131  DA  I C2    1 
ATOM 8620  N N3    . DA  I 5 131 ? 167.423 145.515 165.631 1.00 89.45  ? 131  DA  I N3    1 
ATOM 8621  C C4    . DA  I 5 131 ? 167.835 144.745 166.632 1.00 87.32  ? 131  DA  I C4    1 
ATOM 8622  P P     . DG  I 5 132 ? 170.374 149.766 169.987 1.00 69.17  ? 132  DG  I P     1 
ATOM 8623  O OP1   . DG  I 5 132 ? 171.525 150.651 170.247 1.00 79.96  ? 132  DG  I OP1   1 
ATOM 8624  O OP2   . DG  I 5 132 ? 169.711 149.154 171.143 1.00 77.45  ? 132  DG  I OP2   1 
ATOM 8625  O "O5'" . DG  I 5 132 ? 169.267 150.515 169.119 1.00 75.54  ? 132  DG  I "O5'" 1 
ATOM 8626  C "C5'" . DG  I 5 132 ? 168.309 149.726 168.449 1.00 77.85  ? 132  DG  I "C5'" 1 
ATOM 8627  C "C4'" . DG  I 5 132 ? 167.654 150.441 167.293 1.00 85.40  ? 132  DG  I "C4'" 1 
ATOM 8628  O "O4'" . DG  I 5 132 ? 166.980 149.460 166.492 1.00 87.20  ? 132  DG  I "O4'" 1 
ATOM 8629  C "C3'" . DG  I 5 132 ? 166.529 151.341 167.699 1.00 88.70  ? 132  DG  I "C3'" 1 
ATOM 8630  O "O3'" . DG  I 5 132 ? 166.078 152.075 166.592 1.00 104.20 ? 132  DG  I "O3'" 1 
ATOM 8631  C "C2'" . DG  I 5 132 ? 165.500 150.312 168.116 1.00 87.20  ? 132  DG  I "C2'" 1 
ATOM 8632  C "C1'" . DG  I 5 132 ? 165.671 149.278 167.008 1.00 92.63  ? 132  DG  I "C1'" 1 
ATOM 8633  N N9    . DG  I 5 132 ? 165.552 147.893 167.455 1.00 92.83  ? 132  DG  I N9    1 
ATOM 8634  C C8    . DG  I 5 132 ? 166.062 147.340 168.598 1.00 91.80  ? 132  DG  I C8    1 
ATOM 8635  N N7    . DG  I 5 132 ? 165.828 146.066 168.706 1.00 92.14  ? 132  DG  I N7    1 
ATOM 8636  C C5    . DG  I 5 132 ? 165.107 145.763 167.570 1.00 101.51 ? 132  DG  I C5    1 
ATOM 8637  C C6    . DG  I 5 132 ? 164.578 144.541 167.142 1.00 121.03 ? 132  DG  I C6    1 
ATOM 8638  O O6    . DG  I 5 132 ? 164.627 143.446 167.702 1.00 119.20 ? 132  DG  I O6    1 
ATOM 8639  N N1    . DG  I 5 132 ? 163.922 144.665 165.936 1.00 129.82 ? 132  DG  I N1    1 
ATOM 8640  C C2    . DG  I 5 132 ? 163.808 145.827 165.226 1.00 115.40 ? 132  DG  I C2    1 
ATOM 8641  N N2    . DG  I 5 132 ? 163.130 145.755 164.076 1.00 110.38 ? 132  DG  I N2    1 
ATOM 8642  N N3    . DG  I 5 132 ? 164.303 146.979 165.617 1.00 99.07  ? 132  DG  I N3    1 
ATOM 8643  C C4    . DG  I 5 132 ? 164.941 146.871 166.788 1.00 91.77  ? 132  DG  I C4    1 
ATOM 8644  P P     . DA  I 5 133 ? 165.071 153.306 166.809 1.00 99.88  ? 133  DA  I P     1 
ATOM 8645  O OP1   . DA  I 5 133 ? 165.358 154.306 165.762 1.00 108.76 ? 133  DA  I OP1   1 
ATOM 8646  O OP2   . DA  I 5 133 ? 165.131 153.688 168.234 1.00 85.51  ? 133  DA  I OP2   1 
ATOM 8647  O "O5'" . DA  I 5 133 ? 163.632 152.682 166.517 1.00 112.62 ? 133  DA  I "O5'" 1 
ATOM 8648  C "C5'" . DA  I 5 133 ? 163.122 152.696 165.198 1.00 116.72 ? 133  DA  I "C5'" 1 
ATOM 8649  C "C4'" . DA  I 5 133 ? 162.159 151.553 164.980 1.00 119.94 ? 133  DA  I "C4'" 1 
ATOM 8650  O "O4'" . DA  I 5 133 ? 162.687 150.372 165.581 1.00 107.66 ? 133  DA  I "O4'" 1 
ATOM 8651  C "C3'" . DA  I 5 133 ? 160.810 151.725 165.636 1.00 127.01 ? 133  DA  I "C3'" 1 
ATOM 8652  O "O3'" . DA  I 5 133 ? 159.925 152.324 164.733 1.00 140.80 ? 133  DA  I "O3'" 1 
ATOM 8653  C "C2'" . DA  I 5 133 ? 160.378 150.291 165.965 1.00 114.50 ? 133  DA  I "C2'" 1 
ATOM 8654  C "C1'" . DA  I 5 133 ? 161.638 149.464 165.722 1.00 105.63 ? 133  DA  I "C1'" 1 
ATOM 8655  N N9    . DA  I 5 133 ? 161.951 148.575 166.815 1.00 96.65  ? 133  DA  I N9    1 
ATOM 8656  C C8    . DA  I 5 133 ? 162.609 148.885 167.956 1.00 95.41  ? 133  DA  I C8    1 
ATOM 8657  N N7    . DA  I 5 133 ? 162.757 147.878 168.770 1.00 90.99  ? 133  DA  I N7    1 
ATOM 8658  C C5    . DA  I 5 133 ? 162.137 146.842 168.117 1.00 91.69  ? 133  DA  I C5    1 
ATOM 8659  C C6    . DA  I 5 133 ? 161.931 145.506 168.463 1.00 93.71  ? 133  DA  I C6    1 
ATOM 8660  N N6    . DA  I 5 133 ? 162.362 144.973 169.601 1.00 99.77  ? 133  DA  I N6    1 
ATOM 8661  N N1    . DA  I 5 133 ? 161.268 144.732 167.589 1.00 90.70  ? 133  DA  I N1    1 
ATOM 8662  C C2    . DA  I 5 133 ? 160.836 145.277 166.451 1.00 95.60  ? 133  DA  I C2    1 
ATOM 8663  N N3    . DA  I 5 133 ? 160.966 146.526 166.022 1.00 101.87 ? 133  DA  I N3    1 
ATOM 8664  C C4    . DA  I 5 133 ? 161.628 147.260 166.914 1.00 98.57  ? 133  DA  I C4    1 
ATOM 8665  P P     . DT  I 5 134 ? 158.669 153.152 165.285 1.00 132.56 ? 134  DT  I P     1 
ATOM 8666  O OP1   . DT  I 5 134 ? 158.102 153.901 164.147 1.00 128.49 ? 134  DT  I OP1   1 
ATOM 8667  O OP2   . DT  I 5 134 ? 159.090 153.847 166.518 1.00 120.91 ? 134  DT  I OP2   1 
ATOM 8668  O "O5'" . DT  I 5 134 ? 157.621 152.028 165.699 1.00 117.18 ? 134  DT  I "O5'" 1 
ATOM 8669  C "C5'" . DT  I 5 134 ? 156.996 151.267 164.698 1.00 119.69 ? 134  DT  I "C5'" 1 
ATOM 8670  C "C4'" . DT  I 5 134 ? 156.221 150.115 165.298 1.00 123.67 ? 134  DT  I "C4'" 1 
ATOM 8671  O "O4'" . DT  I 5 134 ? 157.126 149.210 165.976 1.00 120.59 ? 134  DT  I "O4'" 1 
ATOM 8672  C "C3'" . DT  I 5 134 ? 155.176 150.507 166.337 1.00 131.71 ? 134  DT  I "C3'" 1 
ATOM 8673  O "O3'" . DT  I 5 134 ? 154.020 149.743 166.119 1.00 145.80 ? 134  DT  I "O3'" 1 
ATOM 8674  C "C2'" . DT  I 5 134 ? 155.850 150.117 167.649 1.00 121.24 ? 134  DT  I "C2'" 1 
ATOM 8675  C "C1'" . DT  I 5 134 ? 156.556 148.865 167.201 1.00 117.11 ? 134  DT  I "C1'" 1 
ATOM 8676  N N1    . DT  I 5 134 ? 157.609 148.402 168.096 1.00 109.28 ? 134  DT  I N1    1 
ATOM 8677  C C2    . DT  I 5 134 ? 158.299 147.281 167.761 1.00 104.47 ? 134  DT  I C2    1 
ATOM 8678  O O2    . DT  I 5 134 ? 158.086 146.655 166.746 1.00 94.97  ? 134  DT  I O2    1 
ATOM 8679  N N3    . DT  I 5 134 ? 159.246 146.902 168.657 1.00 109.36 ? 134  DT  I N3    1 
ATOM 8680  C C4    . DT  I 5 134 ? 159.575 147.528 169.829 1.00 108.44 ? 134  DT  I C4    1 
ATOM 8681  O O4    . DT  I 5 134 ? 160.455 147.113 170.571 1.00 99.81  ? 134  DT  I O4    1 
ATOM 8682  C C5    . DT  I 5 134 ? 158.810 148.703 170.124 1.00 116.26 ? 134  DT  I C5    1 
ATOM 8683  C C7    . DT  I 5 134 ? 159.075 149.470 171.379 1.00 122.31 ? 134  DT  I C7    1 
ATOM 8684  C C6    . DT  I 5 134 ? 157.875 149.084 169.248 1.00 109.87 ? 134  DT  I C6    1 
ATOM 8685  P P     . DA  I 5 135 ? 152.580 150.442 166.127 1.00 140.16 ? 135  DA  I P     1 
ATOM 8686  O OP1   . DA  I 5 135 ? 152.043 150.393 164.753 1.00 131.95 ? 135  DA  I OP1   1 
ATOM 8687  O OP2   . DA  I 5 135 ? 152.732 151.744 166.796 1.00 128.19 ? 135  DA  I OP2   1 
ATOM 8688  O "O5'" . DA  I 5 135 ? 151.719 149.503 167.083 1.00 115.82 ? 135  DA  I "O5'" 1 
ATOM 8689  C "C5'" . DA  I 5 135 ? 151.485 148.167 166.711 1.00 121.22 ? 135  DA  I "C5'" 1 
ATOM 8690  C "C4'" . DA  I 5 135 ? 151.430 147.262 167.922 1.00 132.56 ? 135  DA  I "C4'" 1 
ATOM 8691  O "O4'" . DA  I 5 135 ? 152.752 147.087 168.462 1.00 134.18 ? 135  DA  I "O4'" 1 
ATOM 8692  C "C3'" . DA  I 5 135 ? 150.569 147.768 169.080 1.00 141.56 ? 135  DA  I "C3'" 1 
ATOM 8693  O "O3'" . DA  I 5 135 ? 149.506 146.875 169.299 1.00 153.60 ? 135  DA  I "O3'" 1 
ATOM 8694  C "C2'" . DA  I 5 135 ? 151.530 147.794 170.271 1.00 135.96 ? 135  DA  I "C2'" 1 
ATOM 8695  C "C1'" . DA  I 5 135 ? 152.614 146.843 169.821 1.00 131.07 ? 135  DA  I "C1'" 1 
ATOM 8696  N N9    . DA  I 5 135 ? 153.877 147.093 170.467 1.00 125.13 ? 135  DA  I N9    1 
ATOM 8697  C C8    . DA  I 5 135 ? 154.699 148.150 170.273 1.00 123.61 ? 135  DA  I C8    1 
ATOM 8698  N N7    . DA  I 5 135 ? 155.770 148.121 171.019 1.00 122.35 ? 135  DA  I N7    1 
ATOM 8699  C C5    . DA  I 5 135 ? 155.638 146.961 171.740 1.00 124.87 ? 135  DA  I C5    1 
ATOM 8700  C C6    . DA  I 5 135 ? 156.442 146.357 172.712 1.00 128.25 ? 135  DA  I C6    1 
ATOM 8701  N N6    . DA  I 5 135 ? 157.599 146.864 173.128 1.00 125.17 ? 135  DA  I N6    1 
ATOM 8702  N N1    . DA  I 5 135 ? 156.015 145.209 173.242 1.00 127.67 ? 135  DA  I N1    1 
ATOM 8703  C C2    . DA  I 5 135 ? 154.860 144.708 172.820 1.00 119.73 ? 135  DA  I C2    1 
ATOM 8704  N N3    . DA  I 5 135 ? 154.017 145.187 171.920 1.00 119.41 ? 135  DA  I N3    1 
ATOM 8705  C C4    . DA  I 5 135 ? 154.471 146.324 171.416 1.00 123.03 ? 135  DA  I C4    1 
ATOM 8706  P P     . DT  I 5 136 ? 148.495 147.100 170.521 1.00 129.47 ? 136  DT  I P     1 
ATOM 8707  O OP1   . DT  I 5 136 ? 147.226 146.456 170.135 1.00 120.29 ? 136  DT  I OP1   1 
ATOM 8708  O OP2   . DT  I 5 136 ? 148.504 148.523 170.899 1.00 133.03 ? 136  DT  I OP2   1 
ATOM 8709  O "O5'" . DT  I 5 136 ? 149.165 146.292 171.717 1.00 133.44 ? 136  DT  I "O5'" 1 
ATOM 8710  C "C5'" . DT  I 5 136 ? 149.747 145.045 171.457 1.00 135.05 ? 136  DT  I "C5'" 1 
ATOM 8711  C "C4'" . DT  I 5 136 ? 150.004 144.295 172.740 1.00 140.64 ? 136  DT  I "C4'" 1 
ATOM 8712  O "O4'" . DT  I 5 136 ? 151.375 144.492 173.159 1.00 144.17 ? 136  DT  I "O4'" 1 
ATOM 8713  C "C3'" . DT  I 5 136 ? 149.139 144.720 173.919 1.00 143.90 ? 136  DT  I "C3'" 1 
ATOM 8714  O "O3'" . DT  I 5 136 ? 148.739 143.581 174.630 1.00 146.47 ? 136  DT  I "O3'" 1 
ATOM 8715  C "C2'" . DT  I 5 136 ? 150.093 145.566 174.741 1.00 146.47 ? 136  DT  I "C2'" 1 
ATOM 8716  C "C1'" . DT  I 5 136 ? 151.385 144.817 174.518 1.00 145.94 ? 136  DT  I "C1'" 1 
ATOM 8717  N N1    . DT  I 5 136 ? 152.554 145.629 174.784 1.00 142.36 ? 136  DT  I N1    1 
ATOM 8718  C C2    . DT  I 5 136 ? 153.489 145.183 175.667 1.00 136.81 ? 136  DT  I C2    1 
ATOM 8719  O O2    . DT  I 5 136 ? 153.393 144.133 176.257 1.00 131.94 ? 136  DT  I O2    1 
ATOM 8720  N N3    . DT  I 5 136 ? 154.531 146.025 175.860 1.00 139.82 ? 136  DT  I N3    1 
ATOM 8721  C C4    . DT  I 5 136 ? 154.736 147.231 175.260 1.00 146.54 ? 136  DT  I C4    1 
ATOM 8722  O O4    . DT  I 5 136 ? 155.715 147.912 175.493 1.00 152.21 ? 136  DT  I O4    1 
ATOM 8723  C C5    . DT  I 5 136 ? 153.721 147.639 174.336 1.00 145.20 ? 136  DT  I C5    1 
ATOM 8724  C C7    . DT  I 5 136 ? 153.835 148.946 173.622 1.00 142.35 ? 136  DT  I C7    1 
ATOM 8725  C C6    . DT  I 5 136 ? 152.686 146.830 174.150 1.00 145.40 ? 136  DT  I C6    1 
ATOM 8726  P P     . DA  I 5 137 ? 147.570 143.674 175.720 1.00 138.68 ? 137  DA  I P     1 
ATOM 8727  O OP1   . DA  I 5 137 ? 146.487 142.776 175.267 1.00 131.10 ? 137  DA  I OP1   1 
ATOM 8728  O OP2   . DA  I 5 137 ? 147.323 145.100 176.018 1.00 140.87 ? 137  DA  I OP2   1 
ATOM 8729  O "O5'" . DA  I 5 137 ? 148.221 143.045 177.026 1.00 158.18 ? 137  DA  I "O5'" 1 
ATOM 8730  C "C5'" . DA  I 5 137 ? 149.503 143.455 177.429 1.00 163.01 ? 137  DA  I "C5'" 1 
ATOM 8731  C "C4'" . DA  I 5 137 ? 149.868 142.823 178.748 1.00 166.73 ? 137  DA  I "C4'" 1 
ATOM 8732  O "O4'" . DA  I 5 137 ? 151.194 143.239 179.114 1.00 162.72 ? 137  DA  I "O4'" 1 
ATOM 8733  C "C3'" . DA  I 5 137 ? 149.040 143.292 179.904 1.00 167.57 ? 137  DA  I "C3'" 1 
ATOM 8734  O "O3'" . DA  I 5 137 ? 149.329 142.478 181.014 1.00 169.22 ? 137  DA  I "O3'" 1 
ATOM 8735  C "C2'" . DA  I 5 137 ? 149.613 144.689 180.086 1.00 160.73 ? 137  DA  I "C2'" 1 
ATOM 8736  C "C1'" . DA  I 5 137 ? 151.103 144.411 179.901 1.00 157.26 ? 137  DA  I "C1'" 1 
ATOM 8737  N N9    . DA  I 5 137 ? 151.841 145.453 179.207 1.00 149.79 ? 137  DA  I N9    1 
ATOM 8738  C C8    . DA  I 5 137 ? 151.557 146.003 177.992 1.00 145.66 ? 137  DA  I C8    1 
ATOM 8739  N N7    . DA  I 5 137 ? 152.425 146.906 177.608 1.00 139.28 ? 137  DA  I N7    1 
ATOM 8740  C C5    . DA  I 5 137 ? 153.353 146.917 178.623 1.00 139.03 ? 137  DA  I C5    1 
ATOM 8741  C C6    . DA  I 5 137 ? 154.524 147.649 178.814 1.00 138.20 ? 137  DA  I C6    1 
ATOM 8742  N N6    . DA  I 5 137 ? 154.973 148.546 177.941 1.00 133.20 ? 137  DA  I N6    1 
ATOM 8743  N N1    . DA  I 5 137 ? 155.218 147.434 179.942 1.00 137.60 ? 137  DA  I N1    1 
ATOM 8744  C C2    . DA  I 5 137 ? 154.761 146.537 180.812 1.00 133.60 ? 137  DA  I C2    1 
ATOM 8745  N N3    . DA  I 5 137 ? 153.672 145.788 180.741 1.00 134.39 ? 137  DA  I N3    1 
ATOM 8746  C C4    . DA  I 5 137 ? 153.010 146.027 179.612 1.00 141.12 ? 137  DA  I C4    1 
ATOM 8747  P P     . DT  I 5 138 ? 148.153 141.938 181.954 1.00 177.56 ? 138  DT  I P     1 
ATOM 8748  O OP1   . DT  I 5 138 ? 148.346 140.497 182.203 1.00 177.54 ? 138  DT  I OP1   1 
ATOM 8749  O OP2   . DT  I 5 138 ? 146.891 142.426 181.377 1.00 175.31 ? 138  DT  I OP2   1 
ATOM 8750  O "O5'" . DT  I 5 138 ? 148.393 142.726 183.307 1.00 131.35 ? 138  DT  I "O5'" 1 
ATOM 8751  C "C5'" . DT  I 5 138 ? 148.263 144.117 183.311 1.00 134.39 ? 138  DT  I "C5'" 1 
ATOM 8752  C "C4'" . DT  I 5 138 ? 149.043 144.724 184.446 1.00 140.94 ? 138  DT  I "C4'" 1 
ATOM 8753  O "O4'" . DT  I 5 138 ? 150.374 145.014 183.999 1.00 144.20 ? 138  DT  I "O4'" 1 
ATOM 8754  C "C3'" . DT  I 5 138 ? 148.481 146.035 184.938 1.00 139.53 ? 138  DT  I "C3'" 1 
ATOM 8755  O "O3'" . DT  I 5 138 ? 147.579 145.771 185.988 1.00 139.45 ? 138  DT  I "O3'" 1 
ATOM 8756  C "C2'" . DT  I 5 138 ? 149.711 146.792 185.428 1.00 135.71 ? 138  DT  I "C2'" 1 
ATOM 8757  C "C1'" . DT  I 5 138 ? 150.849 146.192 184.605 1.00 134.84 ? 138  DT  I "C1'" 1 
ATOM 8758  N N1    . DT  I 5 138 ? 151.384 147.078 183.534 1.00 121.33 ? 138  DT  I N1    1 
ATOM 8759  C C2    . DT  I 5 138 ? 152.585 147.697 183.727 1.00 110.67 ? 138  DT  I C2    1 
ATOM 8760  O O2    . DT  I 5 138 ? 153.229 147.587 184.747 1.00 99.19  ? 138  DT  I O2    1 
ATOM 8761  N N3    . DT  I 5 138 ? 153.008 148.466 182.686 1.00 115.09 ? 138  DT  I N3    1 
ATOM 8762  C C4    . DT  I 5 138 ? 152.372 148.665 181.489 1.00 115.72 ? 138  DT  I C4    1 
ATOM 8763  O O4    . DT  I 5 138 ? 152.837 149.376 180.616 1.00 109.70 ? 138  DT  I O4    1 
ATOM 8764  C C5    . DT  I 5 138 ? 151.124 147.982 181.338 1.00 120.96 ? 138  DT  I C5    1 
ATOM 8765  C C7    . DT  I 5 138 ? 150.342 148.141 180.077 1.00 126.24 ? 138  DT  I C7    1 
ATOM 8766  C C6    . DT  I 5 138 ? 150.692 147.222 182.354 1.00 119.33 ? 138  DT  I C6    1 
ATOM 8767  P P     . DA  I 5 139 ? 146.837 146.968 186.746 1.00 155.85 ? 139  DA  I P     1 
ATOM 8768  O OP1   . DA  I 5 139 ? 145.551 146.442 187.228 1.00 157.83 ? 139  DA  I OP1   1 
ATOM 8769  O OP2   . DA  I 5 139 ? 146.860 148.161 185.884 1.00 148.24 ? 139  DA  I OP2   1 
ATOM 8770  O "O5'" . DA  I 5 139 ? 147.763 147.243 188.006 1.00 147.62 ? 139  DA  I "O5'" 1 
ATOM 8771  C "C5'" . DA  I 5 139 ? 147.850 148.537 188.530 1.00 142.89 ? 139  DA  I "C5'" 1 
ATOM 8772  C "C4'" . DA  I 5 139 ? 149.246 148.803 189.027 1.00 139.14 ? 139  DA  I "C4'" 1 
ATOM 8773  O "O4'" . DA  I 5 139 ? 150.167 148.763 187.916 1.00 136.87 ? 139  DA  I "O4'" 1 
ATOM 8774  C "C3'" . DA  I 5 139 ? 149.441 150.151 189.688 1.00 146.58 ? 139  DA  I "C3'" 1 
ATOM 8775  O "O3'" . DA  I 5 139 ? 150.406 150.052 190.724 1.00 153.65 ? 139  DA  I "O3'" 1 
ATOM 8776  C "C2'" . DA  I 5 139 ? 149.953 151.004 188.548 1.00 144.82 ? 139  DA  I "C2'" 1 
ATOM 8777  C "C1'" . DA  I 5 139 ? 150.806 150.007 187.785 1.00 137.74 ? 139  DA  I "C1'" 1 
ATOM 8778  N N9    . DA  I 5 139 ? 150.887 150.322 186.378 1.00 135.85 ? 139  DA  I N9    1 
ATOM 8779  C C8    . DA  I 5 139 ? 149.904 150.171 185.449 1.00 139.39 ? 139  DA  I C8    1 
ATOM 8780  N N7    . DA  I 5 139 ? 150.251 150.550 184.247 1.00 133.47 ? 139  DA  I N7    1 
ATOM 8781  C C5    . DA  I 5 139 ? 151.548 150.986 184.405 1.00 124.80 ? 139  DA  I C5    1 
ATOM 8782  C C6    . DA  I 5 139 ? 152.478 151.511 183.504 1.00 120.00 ? 139  DA  I C6    1 
ATOM 8783  N N6    . DA  I 5 139 ? 152.217 151.689 182.209 1.00 112.93 ? 139  DA  I N6    1 
ATOM 8784  N N1    . DA  I 5 139 ? 153.690 151.851 183.982 1.00 119.93 ? 139  DA  I N1    1 
ATOM 8785  C C2    . DA  I 5 139 ? 153.941 151.670 185.282 1.00 120.86 ? 139  DA  I C2    1 
ATOM 8786  N N3    . DA  I 5 139 ? 153.144 151.183 186.226 1.00 124.96 ? 139  DA  I N3    1 
ATOM 8787  C C4    . DA  I 5 139 ? 151.953 150.857 185.715 1.00 127.61 ? 139  DA  I C4    1 
ATOM 8788  P P     . DC  I 5 140 ? 149.972 150.219 192.263 1.00 185.57 ? 140  DC  I P     1 
ATOM 8789  O OP1   . DC  I 5 140 ? 150.897 149.410 193.082 1.00 187.93 ? 140  DC  I OP1   1 
ATOM 8790  O OP2   . DC  I 5 140 ? 148.518 149.987 192.344 1.00 182.68 ? 140  DC  I OP2   1 
ATOM 8791  O "O5'" . DC  I 5 140 ? 150.243 151.758 192.588 1.00 128.06 ? 140  DC  I "O5'" 1 
ATOM 8792  C "C5'" . DC  I 5 140 ? 149.692 152.767 191.766 1.00 132.12 ? 140  DC  I "C5'" 1 
ATOM 8793  C "C4'" . DC  I 5 140 ? 150.770 153.720 191.309 1.00 141.42 ? 140  DC  I "C4'" 1 
ATOM 8794  O "O4'" . DC  I 5 140 ? 150.836 153.732 189.863 1.00 144.57 ? 140  DC  I "O4'" 1 
ATOM 8795  C "C3'" . DC  I 5 140 ? 150.546 155.172 191.731 1.00 151.77 ? 140  DC  I "C3'" 1 
ATOM 8796  O "O3'" . DC  I 5 140 ? 151.757 155.738 192.172 1.00 157.37 ? 140  DC  I "O3'" 1 
ATOM 8797  C "C2'" . DC  I 5 140 ? 150.068 155.828 190.448 1.00 151.30 ? 140  DC  I "C2'" 1 
ATOM 8798  C "C1'" . DC  I 5 140 ? 150.890 155.066 189.439 1.00 141.80 ? 140  DC  I "C1'" 1 
ATOM 8799  N N1    . DC  I 5 140 ? 150.381 155.160 188.074 1.00 126.00 ? 140  DC  I N1    1 
ATOM 8800  C C2    . DC  I 5 140 ? 151.221 155.631 187.078 1.00 113.48 ? 140  DC  I C2    1 
ATOM 8801  O O2    . DC  I 5 140 ? 152.371 155.952 187.373 1.00 103.21 ? 140  DC  I O2    1 
ATOM 8802  N N3    . DC  I 5 140 ? 150.757 155.731 185.818 1.00 114.98 ? 140  DC  I N3    1 
ATOM 8803  C C4    . DC  I 5 140 ? 149.504 155.372 185.543 1.00 118.73 ? 140  DC  I C4    1 
ATOM 8804  N N4    . DC  I 5 140 ? 149.091 155.491 184.283 1.00 117.08 ? 140  DC  I N4    1 
ATOM 8805  C C5    . DC  I 5 140 ? 148.621 154.891 186.549 1.00 123.84 ? 140  DC  I C5    1 
ATOM 8806  C C6    . DC  I 5 140 ? 149.099 154.804 187.794 1.00 126.12 ? 140  DC  I C6    1 
ATOM 8807  P P     . DA  I 5 141 ? 151.729 157.000 193.161 1.00 127.98 ? 141  DA  I P     1 
ATOM 8808  O OP1   . DA  I 5 141 ? 152.711 156.737 194.231 1.00 123.89 ? 141  DA  I OP1   1 
ATOM 8809  O OP2   . DA  I 5 141 ? 150.319 157.283 193.503 1.00 111.43 ? 141  DA  I OP2   1 
ATOM 8810  O "O5'" . DA  I 5 141 ? 152.249 158.203 192.255 1.00 134.35 ? 141  DA  I "O5'" 1 
ATOM 8811  C "C5'" . DA  I 5 141 ? 153.547 158.159 191.697 1.00 128.00 ? 141  DA  I "C5'" 1 
ATOM 8812  C "C4'" . DA  I 5 141 ? 153.751 159.324 190.755 1.00 124.99 ? 141  DA  I "C4'" 1 
ATOM 8813  O "O4'" . DA  I 5 141 ? 153.193 158.998 189.456 1.00 128.42 ? 141  DA  I "O4'" 1 
ATOM 8814  C "C3'" . DA  I 5 141 ? 153.073 160.619 191.194 1.00 119.23 ? 141  DA  I "C3'" 1 
ATOM 8815  O "O3'" . DA  I 5 141 ? 153.938 161.717 190.978 1.00 112.10 ? 141  DA  I "O3'" 1 
ATOM 8816  C "C2'" . DA  I 5 141 ? 151.842 160.682 190.302 1.00 123.88 ? 141  DA  I "C2'" 1 
ATOM 8817  C "C1'" . DA  I 5 141 ? 152.357 160.040 189.034 1.00 127.55 ? 141  DA  I "C1'" 1 
ATOM 8818  N N9    . DA  I 5 141 ? 151.301 159.481 188.217 1.00 125.86 ? 141  DA  I N9    1 
ATOM 8819  C C8    . DA  I 5 141 ? 150.389 158.542 188.584 1.00 121.65 ? 141  DA  I C8    1 
ATOM 8820  N N7    . DA  I 5 141 ? 149.541 158.231 187.639 1.00 116.59 ? 141  DA  I N7    1 
ATOM 8821  C C5    . DA  I 5 141 ? 149.925 159.026 186.580 1.00 117.94 ? 141  DA  I C5    1 
ATOM 8822  C C6    . DA  I 5 141 ? 149.427 159.175 185.273 1.00 113.09 ? 141  DA  I C6    1 
ATOM 8823  N N6    . DA  I 5 141 ? 148.385 158.489 184.794 1.00 103.86 ? 141  DA  I N6    1 
ATOM 8824  N N1    . DA  I 5 141 ? 150.044 160.059 184.471 1.00 116.20 ? 141  DA  I N1    1 
ATOM 8825  C C2    . DA  I 5 141 ? 151.086 160.743 184.947 1.00 116.26 ? 141  DA  I C2    1 
ATOM 8826  N N3    . DA  I 5 141 ? 151.643 160.688 186.152 1.00 116.78 ? 141  DA  I N3    1 
ATOM 8827  C C4    . DA  I 5 141 ? 151.011 159.801 186.924 1.00 121.88 ? 141  DA  I C4    1 
ATOM 8828  P P     . DT  I 5 142 ? 153.357 163.212 190.926 1.00 118.27 ? 142  DT  I P     1 
ATOM 8829  O OP1   . DT  I 5 142 ? 154.482 164.134 191.172 1.00 124.24 ? 142  DT  I OP1   1 
ATOM 8830  O OP2   . DT  I 5 142 ? 152.139 163.296 191.754 1.00 110.83 ? 142  DT  I OP2   1 
ATOM 8831  O "O5'" . DT  I 5 142 ? 152.940 163.386 189.408 1.00 134.36 ? 142  DT  I "O5'" 1 
ATOM 8832  C "C5'" . DT  I 5 142 ? 153.909 163.190 188.411 1.00 118.28 ? 142  DT  I "C5'" 1 
ATOM 8833  C "C4'" . DT  I 5 142 ? 153.867 164.298 187.384 1.00 97.29  ? 142  DT  I "C4'" 1 
ATOM 8834  O "O4'" . DT  I 5 142 ? 152.912 163.963 186.356 1.00 100.10 ? 142  DT  I "O4'" 1 
ATOM 8835  C "C3'" . DT  I 5 142 ? 153.445 165.656 187.907 1.00 91.34  ? 142  DT  I "C3'" 1 
ATOM 8836  O "O3'" . DT  I 5 142 ? 154.101 166.674 187.133 1.00 102.48 ? 142  DT  I "O3'" 1 
ATOM 8837  C "C2'" . DT  I 5 142 ? 151.929 165.624 187.721 1.00 92.75  ? 142  DT  I "C2'" 1 
ATOM 8838  C "C1'" . DT  I 5 142 ? 151.774 164.789 186.457 1.00 99.44  ? 142  DT  I "C1'" 1 
ATOM 8839  N N1    . DT  I 5 142 ? 150.583 163.921 186.438 1.00 104.51 ? 142  DT  I N1    1 
ATOM 8840  C C2    . DT  I 5 142 ? 149.844 163.852 185.296 1.00 108.02 ? 142  DT  I C2    1 
ATOM 8841  O O2    . DT  I 5 142 ? 150.106 164.484 184.299 1.00 115.07 ? 142  DT  I O2    1 
ATOM 8842  N N3    . DT  I 5 142 ? 148.778 163.019 185.352 1.00 106.62 ? 142  DT  I N3    1 
ATOM 8843  C C4    . DT  I 5 142 ? 148.382 162.251 186.413 1.00 103.61 ? 142  DT  I C4    1 
ATOM 8844  O O4    . DT  I 5 142 ? 147.396 161.528 186.359 1.00 92.01  ? 142  DT  I O4    1 
ATOM 8845  C C5    . DT  I 5 142 ? 149.200 162.364 187.592 1.00 107.73 ? 142  DT  I C5    1 
ATOM 8846  C C7    . DT  I 5 142 ? 148.859 161.578 188.818 1.00 111.73 ? 142  DT  I C7    1 
ATOM 8847  C C6    . DT  I 5 142 ? 150.257 163.182 187.548 1.00 106.33 ? 142  DT  I C6    1 
ATOM 8848  P P     . DC  I 5 143 ? 153.343 167.986 186.597 1.00 105.66 ? 143  DC  I P     1 
ATOM 8849  O OP1   . DC  I 5 143 ? 154.402 168.878 186.096 1.00 92.92  ? 143  DC  I OP1   1 
ATOM 8850  O OP2   . DC  I 5 143 ? 152.406 168.506 187.614 1.00 102.48 ? 143  DC  I OP2   1 
ATOM 8851  O "O5'" . DC  I 5 143 ? 152.545 167.465 185.323 1.00 99.43  ? 143  DC  I "O5'" 1 
ATOM 8852  C "C5'" . DC  I 5 143 ? 152.706 168.102 184.077 1.00 84.37  ? 143  DC  I "C5'" 1 
ATOM 8853  C "C4'" . DC  I 5 143 ? 151.397 168.702 183.617 1.00 79.80  ? 143  DC  I "C4'" 1 
ATOM 8854  O "O4'" . DC  I 5 143 ? 150.327 167.728 183.791 1.00 77.18  ? 143  DC  I "O4'" 1 
ATOM 8855  C "C3'" . DC  I 5 143 ? 150.942 169.918 184.414 1.00 78.08  ? 143  DC  I "C3'" 1 
ATOM 8856  O "O3'" . DC  I 5 143 ? 150.120 170.699 183.616 1.00 73.86  ? 143  DC  I "O3'" 1 
ATOM 8857  C "C2'" . DC  I 5 143 ? 150.113 169.266 185.491 1.00 71.87  ? 143  DC  I "C2'" 1 
ATOM 8858  C "C1'" . DC  I 5 143 ? 149.344 168.302 184.621 1.00 73.92  ? 143  DC  I "C1'" 1 
ATOM 8859  N N1    . DC  I 5 143 ? 148.653 167.256 185.376 1.00 80.41  ? 143  DC  I N1    1 
ATOM 8860  C C2    . DC  I 5 143 ? 147.558 166.614 184.816 1.00 83.54  ? 143  DC  I C2    1 
ATOM 8861  O O2    . DC  I 5 143 ? 147.159 166.922 183.695 1.00 81.13  ? 143  DC  I O2    1 
ATOM 8862  N N3    . DC  I 5 143 ? 146.926 165.665 185.522 1.00 91.56  ? 143  DC  I N3    1 
ATOM 8863  C C4    . DC  I 5 143 ? 147.350 165.347 186.737 1.00 87.62  ? 143  DC  I C4    1 
ATOM 8864  N N4    . DC  I 5 143 ? 146.668 164.415 187.387 1.00 79.30  ? 143  DC  I N4    1 
ATOM 8865  C C5    . DC  I 5 143 ? 148.452 166.001 187.342 1.00 81.77  ? 143  DC  I C5    1 
ATOM 8866  C C6    . DC  I 5 143 ? 149.069 166.944 186.630 1.00 85.04  ? 143  DC  I C6    1 
ATOM 8867  P P     . DC  I 5 144 ? 150.544 172.188 183.230 1.00 73.38  ? 144  DC  I P     1 
ATOM 8868  O OP1   . DC  I 5 144 ? 152.012 172.181 183.050 1.00 77.33  ? 144  DC  I OP1   1 
ATOM 8869  O OP2   . DC  I 5 144 ? 149.924 173.114 184.201 1.00 77.33  ? 144  DC  I OP2   1 
ATOM 8870  O "O5'" . DC  I 5 144 ? 149.816 172.384 181.830 1.00 92.77  ? 144  DC  I "O5'" 1 
ATOM 8871  C "C5'" . DC  I 5 144 ? 149.107 171.292 181.266 1.00 87.84  ? 144  DC  I "C5'" 1 
ATOM 8872  C "C4'" . DC  I 5 144 ? 147.635 171.400 181.585 1.00 90.25  ? 144  DC  I "C4'" 1 
ATOM 8873  O "O4'" . DC  I 5 144 ? 147.239 170.354 182.516 1.00 95.53  ? 144  DC  I "O4'" 1 
ATOM 8874  C "C3'" . DC  I 5 144 ? 147.229 172.719 182.241 1.00 95.84  ? 144  DC  I "C3'" 1 
ATOM 8875  O "O3'" . DC  I 5 144 ? 146.116 173.236 181.589 1.00 102.69 ? 144  DC  I "O3'" 1 
ATOM 8876  C "C2'" . DC  I 5 144 ? 146.882 172.302 183.667 1.00 94.91  ? 144  DC  I "C2'" 1 
ATOM 8877  C "C1'" . DC  I 5 144 ? 146.326 170.919 183.419 1.00 95.21  ? 144  DC  I "C1'" 1 
ATOM 8878  N N1    . DC  I 5 144 ? 146.231 170.072 184.643 1.00 97.50  ? 144  DC  I N1    1 
ATOM 8879  C C2    . DC  I 5 144 ? 145.287 169.049 184.701 1.00 102.58 ? 144  DC  I C2    1 
ATOM 8880  O O2    . DC  I 5 144 ? 144.575 168.826 183.724 1.00 105.51 ? 144  DC  I O2    1 
ATOM 8881  N N3    . DC  I 5 144 ? 145.205 168.290 185.813 1.00 99.23  ? 144  DC  I N3    1 
ATOM 8882  C C4    . DC  I 5 144 ? 145.997 168.539 186.846 1.00 95.53  ? 144  DC  I C4    1 
ATOM 8883  N N4    . DC  I 5 144 ? 145.866 167.763 187.927 1.00 99.55  ? 144  DC  I N4    1 
ATOM 8884  C C5    . DC  I 5 144 ? 146.954 169.593 186.820 1.00 90.24  ? 144  DC  I C5    1 
ATOM 8885  C C6    . DC  I 5 144 ? 147.023 170.338 185.714 1.00 92.29  ? 144  DC  I C6    1 
ATOM 8886  P P     . DG  I 5 145 ? 146.302 174.271 180.384 1.00 104.89 ? 145  DG  I P     1 
ATOM 8887  O OP1   . DG  I 5 145 ? 147.060 173.588 179.319 1.00 98.78  ? 145  DG  I OP1   1 
ATOM 8888  O OP2   . DG  I 5 145 ? 146.822 175.529 180.950 1.00 101.73 ? 145  DG  I OP2   1 
ATOM 8889  O "O5'" . DG  I 5 145 ? 144.808 174.505 179.887 1.00 108.74 ? 145  DG  I "O5'" 1 
ATOM 8890  C "C5'" . DG  I 5 145 ? 143.965 173.381 179.693 1.00 105.66 ? 145  DG  I "C5'" 1 
ATOM 8891  C "C4'" . DG  I 5 145 ? 142.747 173.442 180.590 1.00 94.90  ? 145  DG  I "C4'" 1 
ATOM 8892  O "O4'" . DG  I 5 145 ? 142.977 172.658 181.786 1.00 88.31  ? 145  DG  I "O4'" 1 
ATOM 8893  C "C3'" . DG  I 5 145 ? 142.351 174.843 181.071 1.00 91.39  ? 145  DG  I "C3'" 1 
ATOM 8894  O "O3'" . DG  I 5 145 ? 140.963 175.041 180.841 1.00 95.47  ? 145  DG  I "O3'" 1 
ATOM 8895  C "C2'" . DG  I 5 145 ? 142.674 174.800 182.563 1.00 92.90  ? 145  DG  I "C2'" 1 
ATOM 8896  C "C1'" . DG  I 5 145 ? 142.407 173.344 182.861 1.00 95.89  ? 145  DG  I "C1'" 1 
ATOM 8897  N N9    . DG  I 5 145 ? 143.007 172.873 184.094 1.00 90.37  ? 145  DG  I N9    1 
ATOM 8898  C C8    . DG  I 5 145 ? 144.054 173.432 184.775 1.00 88.91  ? 145  DG  I C8    1 
ATOM 8899  N N7    . DG  I 5 145 ? 144.373 172.782 185.856 1.00 88.46  ? 145  DG  I N7    1 
ATOM 8900  C C5    . DG  I 5 145 ? 143.471 171.734 185.894 1.00 82.08  ? 145  DG  I C5    1 
ATOM 8901  C C6    . DG  I 5 145 ? 143.327 170.692 186.831 1.00 88.12  ? 145  DG  I C6    1 
ATOM 8902  O O6    . DG  I 5 145 ? 143.979 170.490 187.859 1.00 90.96  ? 145  DG  I O6    1 
ATOM 8903  N N1    . DG  I 5 145 ? 142.277 169.839 186.499 1.00 93.38  ? 145  DG  I N1    1 
ATOM 8904  C C2    . DG  I 5 145 ? 141.482 169.971 185.386 1.00 90.58  ? 145  DG  I C2    1 
ATOM 8905  N N2    . DG  I 5 145 ? 140.522 169.047 185.221 1.00 75.42  ? 145  DG  I N2    1 
ATOM 8906  N N3    . DG  I 5 145 ? 141.612 170.943 184.499 1.00 87.19  ? 145  DG  I N3    1 
ATOM 8907  C C4    . DG  I 5 145 ? 142.627 171.778 184.813 1.00 78.59  ? 145  DG  I C4    1 
ATOM 8908  P P     . DA  I 5 146 ? 140.185 176.283 181.501 1.00 88.53  ? 146  DA  I P     1 
ATOM 8909  O OP1   . DA  I 5 146 ? 139.073 176.631 180.593 1.00 90.72  ? 146  DA  I OP1   1 
ATOM 8910  O OP2   . DA  I 5 146 ? 141.177 177.317 181.862 1.00 86.50  ? 146  DA  I OP2   1 
ATOM 8911  O "O5'" . DA  I 5 146 ? 139.565 175.681 182.850 1.00 84.37  ? 146  DA  I "O5'" 1 
ATOM 8912  C "C5'" . DA  I 5 146 ? 138.222 175.995 183.230 1.00 81.94  ? 146  DA  I "C5'" 1 
ATOM 8913  C "C4'" . DA  I 5 146 ? 137.380 174.735 183.289 1.00 83.05  ? 146  DA  I "C4'" 1 
ATOM 8914  O "O4'" . DA  I 5 146 ? 138.253 173.585 183.198 1.00 81.21  ? 146  DA  I "O4'" 1 
ATOM 8915  C "C3'" . DA  I 5 146 ? 136.576 174.553 184.573 1.00 85.19  ? 146  DA  I "C3'" 1 
ATOM 8916  O "O3'" . DA  I 5 146 ? 135.247 174.985 184.378 1.00 87.30  ? 146  DA  I "O3'" 1 
ATOM 8917  C "C2'" . DA  I 5 146 ? 136.633 173.052 184.805 1.00 92.09  ? 146  DA  I "C2'" 1 
ATOM 8918  C "C1'" . DA  I 5 146 ? 138.012 172.715 184.275 1.00 91.46  ? 146  DA  I "C1'" 1 
ATOM 8919  N N9    . DA  I 5 146 ? 139.077 172.883 185.256 1.00 90.27  ? 146  DA  I N9    1 
ATOM 8920  C C8    . DA  I 5 146 ? 140.087 173.802 185.241 1.00 83.05  ? 146  DA  I C8    1 
ATOM 8921  N N7    . DA  I 5 146 ? 140.908 173.702 186.260 1.00 86.03  ? 146  DA  I N7    1 
ATOM 8922  C C5    . DA  I 5 146 ? 140.401 172.639 186.985 1.00 83.38  ? 146  DA  I C5    1 
ATOM 8923  C C6    . DA  I 5 146 ? 140.812 172.015 188.181 1.00 82.06  ? 146  DA  I C6    1 
ATOM 8924  N N6    . DA  I 5 146 ? 141.880 172.397 188.888 1.00 73.97  ? 146  DA  I N6    1 
ATOM 8925  N N1    . DA  I 5 146 ? 140.071 170.983 188.627 1.00 86.02  ? 146  DA  I N1    1 
ATOM 8926  C C2    . DA  I 5 146 ? 139.007 170.602 187.921 1.00 90.19  ? 146  DA  I C2    1 
ATOM 8927  N N3    . DA  I 5 146 ? 138.524 171.107 186.797 1.00 95.70  ? 146  DA  I N3    1 
ATOM 8928  C C4    . DA  I 5 146 ? 139.273 172.129 186.377 1.00 87.84  ? 146  DA  I C4    1 
ATOM 8929  P P     . DT  I 5 147 ? 134.536 175.915 185.475 1.00 91.92  ? 147  DT  I P     1 
ATOM 8930  O OP1   . DT  I 5 147 ? 133.186 176.238 184.969 1.00 92.35  ? 147  DT  I OP1   1 
ATOM 8931  O OP2   . DT  I 5 147 ? 135.483 176.985 185.843 1.00 96.94  ? 147  DT  I OP2   1 
ATOM 8932  O "O5'" . DT  I 5 147 ? 134.367 174.969 186.745 1.00 109.77 ? 147  DT  I "O5'" 1 
ATOM 8933  C "C5'" . DT  I 5 147 ? 133.197 174.196 186.885 1.00 89.58  ? 147  DT  I "C5'" 1 
ATOM 8934  C "C4'" . DT  I 5 147 ? 133.389 173.124 187.935 1.00 89.13  ? 147  DT  I "C4'" 1 
ATOM 8935  O "O4'" . DT  I 5 147 ? 134.660 172.462 187.720 1.00 92.50  ? 147  DT  I "O4'" 1 
ATOM 8936  C "C3'" . DT  I 5 147 ? 133.466 173.625 189.361 1.00 100.79 ? 147  DT  I "C3'" 1 
ATOM 8937  O "O3'" . DT  I 5 147 ? 132.162 173.812 189.890 1.00 109.03 ? 147  DT  I "O3'" 1 
ATOM 8938  C "C2'" . DT  I 5 147 ? 134.185 172.466 190.034 1.00 99.50  ? 147  DT  I "C2'" 1 
ATOM 8939  C "C1'" . DT  I 5 147 ? 135.216 172.093 188.969 1.00 97.12  ? 147  DT  I "C1'" 1 
ATOM 8940  N N1    . DT  I 5 147 ? 136.505 172.801 189.139 1.00 88.41  ? 147  DT  I N1    1 
ATOM 8941  C C2    . DT  I 5 147 ? 137.331 172.432 190.163 1.00 88.57  ? 147  DT  I C2    1 
ATOM 8942  O O2    . DT  I 5 147 ? 137.062 171.546 190.945 1.00 93.74  ? 147  DT  I O2    1 
ATOM 8943  N N3    . DT  I 5 147 ? 138.491 173.144 190.248 1.00 80.42  ? 147  DT  I N3    1 
ATOM 8944  C C4    . DT  I 5 147 ? 138.897 174.173 189.427 1.00 80.07  ? 147  DT  I C4    1 
ATOM 8945  O O4    . DT  I 5 147 ? 139.962 174.752 189.582 1.00 79.29  ? 147  DT  I O4    1 
ATOM 8946  C C5    . DT  I 5 147 ? 137.988 174.514 188.371 1.00 94.26  ? 147  DT  I C5    1 
ATOM 8947  C C7    . DT  I 5 147 ? 138.332 175.617 187.422 1.00 81.89  ? 147  DT  I C7    1 
ATOM 8948  C C6    . DT  I 5 147 ? 136.844 173.821 188.276 1.00 84.69  ? 147  DT  I C6    1 
ATOM 8949  P P     . DA  J 6 21  ? 142.030 174.981 196.024 1.00 144.73 ? 1    DA  J P     1 
ATOM 8950  O OP1   . DA  J 6 21  ? 141.995 176.274 196.744 1.00 145.15 ? 1    DA  J OP1   1 
ATOM 8951  O OP2   . DA  J 6 21  ? 143.213 174.100 196.130 1.00 138.36 ? 1    DA  J OP2   1 
ATOM 8952  O "O5'" . DA  J 6 21  ? 140.747 174.124 196.437 1.00 137.34 ? 1    DA  J "O5'" 1 
ATOM 8953  C "C5'" . DA  J 6 21  ? 140.668 172.753 196.086 1.00 139.70 ? 1    DA  J "C5'" 1 
ATOM 8954  C "C4'" . DA  J 6 21  ? 139.413 172.123 196.664 1.00 145.05 ? 1    DA  J "C4'" 1 
ATOM 8955  O "O4'" . DA  J 6 21  ? 138.258 172.903 196.281 1.00 143.46 ? 1    DA  J "O4'" 1 
ATOM 8956  C "C3'" . DA  J 6 21  ? 139.122 170.720 196.175 1.00 148.13 ? 1    DA  J "C3'" 1 
ATOM 8957  O "O3'" . DA  J 6 21  ? 138.393 170.011 197.147 1.00 150.35 ? 1    DA  J "O3'" 1 
ATOM 8958  C "C2'" . DA  J 6 21  ? 138.290 170.957 194.916 1.00 145.64 ? 1    DA  J "C2'" 1 
ATOM 8959  C "C1'" . DA  J 6 21  ? 137.576 172.274 195.211 1.00 140.63 ? 1    DA  J "C1'" 1 
ATOM 8960  N N9    . DA  J 6 21  ? 137.575 173.186 194.073 1.00 130.68 ? 1    DA  J N9    1 
ATOM 8961  C C8    . DA  J 6 21  ? 138.665 173.646 193.390 1.00 127.90 ? 1    DA  J C8    1 
ATOM 8962  N N7    . DA  J 6 21  ? 138.367 174.458 192.409 1.00 123.22 ? 1    DA  J N7    1 
ATOM 8963  C C5    . DA  J 6 21  ? 136.987 174.538 192.452 1.00 122.88 ? 1    DA  J C5    1 
ATOM 8964  C C6    . DA  J 6 21  ? 136.058 175.236 191.664 1.00 114.79 ? 1    DA  J C6    1 
ATOM 8965  N N6    . DA  J 6 21  ? 136.407 176.025 190.646 1.00 98.71  ? 1    DA  J N6    1 
ATOM 8966  N N1    . DA  J 6 21  ? 134.751 175.099 191.969 1.00 120.84 ? 1    DA  J N1    1 
ATOM 8967  C C2    . DA  J 6 21  ? 134.409 174.307 192.989 1.00 122.40 ? 1    DA  J C2    1 
ATOM 8968  N N3    . DA  J 6 21  ? 135.193 173.595 193.795 1.00 126.93 ? 1    DA  J N3    1 
ATOM 8969  C C4    . DA  J 6 21  ? 136.483 173.756 193.468 1.00 126.54 ? 1    DA  J C4    1 
ATOM 8970  P P     . DT  J 6 22  ? 138.662 168.443 197.342 1.00 127.33 ? 2    DT  J P     1 
ATOM 8971  O OP1   . DT  J 6 22  ? 137.455 167.845 197.953 1.00 129.89 ? 2    DT  J OP1   1 
ATOM 8972  O OP2   . DT  J 6 22  ? 139.980 168.320 198.002 1.00 109.69 ? 2    DT  J OP2   1 
ATOM 8973  O "O5'" . DT  J 6 22  ? 138.810 167.896 195.844 1.00 147.09 ? 2    DT  J "O5'" 1 
ATOM 8974  C "C5'" . DT  J 6 22  ? 138.605 166.514 195.556 1.00 135.34 ? 2    DT  J "C5'" 1 
ATOM 8975  C "C4'" . DT  J 6 22  ? 137.490 166.341 194.543 1.00 118.03 ? 2    DT  J "C4'" 1 
ATOM 8976  O "O4'" . DT  J 6 22  ? 137.421 167.517 193.707 1.00 111.16 ? 2    DT  J "O4'" 1 
ATOM 8977  C "C3'" . DT  J 6 22  ? 137.704 165.233 193.547 1.00 105.12 ? 2    DT  J "C3'" 1 
ATOM 8978  O "O3'" . DT  J 6 22  ? 136.489 165.041 192.833 1.00 109.05 ? 2    DT  J "O3'" 1 
ATOM 8979  C "C2'" . DT  J 6 22  ? 138.755 165.886 192.662 1.00 94.98  ? 2    DT  J "C2'" 1 
ATOM 8980  C "C1'" . DT  J 6 22  ? 138.126 167.265 192.501 1.00 105.60 ? 2    DT  J "C1'" 1 
ATOM 8981  N N1    . DT  J 6 22  ? 139.071 168.391 192.295 1.00 100.48 ? 2    DT  J N1    1 
ATOM 8982  C C2    . DT  J 6 22  ? 138.866 169.218 191.233 1.00 98.11  ? 2    DT  J C2    1 
ATOM 8983  O O2    . DT  J 6 22  ? 137.983 169.041 190.417 1.00 92.56  ? 2    DT  J O2    1 
ATOM 8984  N N3    . DT  J 6 22  ? 139.743 170.255 191.132 1.00 98.02  ? 2    DT  J N3    1 
ATOM 8985  C C4    . DT  J 6 22  ? 140.776 170.561 191.989 1.00 97.12  ? 2    DT  J C4    1 
ATOM 8986  O O4    . DT  J 6 22  ? 141.512 171.522 191.801 1.00 93.45  ? 2    DT  J O4    1 
ATOM 8987  C C5    . DT  J 6 22  ? 140.936 169.661 193.104 1.00 101.57 ? 2    DT  J C5    1 
ATOM 8988  C C7    . DT  J 6 22  ? 142.030 169.883 194.102 1.00 97.42  ? 2    DT  J C7    1 
ATOM 8989  C C6    . DT  J 6 22  ? 140.078 168.631 193.208 1.00 99.63  ? 2    DT  J C6    1 
ATOM 8990  P P     . DC  J 6 23  ? 136.066 163.595 192.277 1.00 105.81 ? 3    DC  J P     1 
ATOM 8991  O OP1   . DC  J 6 23  ? 134.932 163.113 193.093 1.00 97.68  ? 3    DC  J OP1   1 
ATOM 8992  O OP2   . DC  J 6 23  ? 137.282 162.767 192.150 1.00 103.41 ? 3    DC  J OP2   1 
ATOM 8993  O "O5'" . DC  J 6 23  ? 135.544 163.912 190.803 1.00 136.39 ? 3    DC  J "O5'" 1 
ATOM 8994  C "C5'" . DC  J 6 23  ? 136.014 165.070 190.131 1.00 125.39 ? 3    DC  J "C5'" 1 
ATOM 8995  C "C4'" . DC  J 6 23  ? 136.881 164.685 188.955 1.00 105.81 ? 3    DC  J "C4'" 1 
ATOM 8996  O "O4'" . DC  J 6 23  ? 137.840 165.742 188.685 1.00 99.54  ? 3    DC  J "O4'" 1 
ATOM 8997  C "C3'" . DC  J 6 23  ? 137.698 163.407 189.153 1.00 94.98  ? 3    DC  J "C3'" 1 
ATOM 8998  O "O3'" . DC  J 6 23  ? 137.698 162.627 187.962 1.00 103.29 ? 3    DC  J "O3'" 1 
ATOM 8999  C "C2'" . DC  J 6 23  ? 139.094 163.944 189.464 1.00 79.27  ? 3    DC  J "C2'" 1 
ATOM 9000  C "C1'" . DC  J 6 23  ? 139.127 165.182 188.584 1.00 84.12  ? 3    DC  J "C1'" 1 
ATOM 9001  N N1    . DC  J 6 23  ? 140.123 166.203 189.006 1.00 89.91  ? 3    DC  J N1    1 
ATOM 9002  C C2    . DC  J 6 23  ? 140.226 167.402 188.302 1.00 98.35  ? 3    DC  J C2    1 
ATOM 9003  O O2    . DC  J 6 23  ? 139.504 167.597 187.328 1.00 95.91  ? 3    DC  J O2    1 
ATOM 9004  N N3    . DC  J 6 23  ? 141.140 168.311 188.685 1.00 94.61  ? 3    DC  J N3    1 
ATOM 9005  C C4    . DC  J 6 23  ? 141.915 168.071 189.734 1.00 91.06  ? 3    DC  J C4    1 
ATOM 9006  N N4    . DC  J 6 23  ? 142.800 169.007 190.075 1.00 90.57  ? 3    DC  J N4    1 
ATOM 9007  C C5    . DC  J 6 23  ? 141.829 166.857 190.469 1.00 88.03  ? 3    DC  J C5    1 
ATOM 9008  C C6    . DC  J 6 23  ? 140.928 165.959 190.072 1.00 91.40  ? 3    DC  J C6    1 
ATOM 9009  P P     . DG  J 6 24  ? 136.328 162.246 187.210 1.00 100.13 ? 4    DG  J P     1 
ATOM 9010  O OP1   . DG  J 6 24  ? 135.197 162.341 188.155 1.00 96.32  ? 4    DG  J OP1   1 
ATOM 9011  O OP2   . DG  J 6 24  ? 136.560 160.960 186.520 1.00 88.01  ? 4    DG  J OP2   1 
ATOM 9012  O "O5'" . DG  J 6 24  ? 136.188 163.379 186.090 1.00 119.37 ? 4    DG  J "O5'" 1 
ATOM 9013  C "C5'" . DG  J 6 24  ? 137.353 164.034 185.602 1.00 112.74 ? 4    DG  J "C5'" 1 
ATOM 9014  C "C4'" . DG  J 6 24  ? 137.578 163.728 184.141 1.00 103.26 ? 4    DG  J "C4'" 1 
ATOM 9015  O "O4'" . DG  J 6 24  ? 138.862 164.237 183.744 1.00 99.98  ? 4    DG  J "O4'" 1 
ATOM 9016  C "C3'" . DG  J 6 24  ? 137.619 162.258 183.787 1.00 109.65 ? 4    DG  J "C3'" 1 
ATOM 9017  O "O3'" . DG  J 6 24  ? 137.196 162.091 182.432 1.00 128.73 ? 4    DG  J "O3'" 1 
ATOM 9018  C "C2'" . DG  J 6 24  ? 139.087 161.888 184.006 1.00 100.28 ? 4    DG  J "C2'" 1 
ATOM 9019  C "C1'" . DG  J 6 24  ? 139.826 163.209 183.806 1.00 103.09 ? 4    DG  J "C1'" 1 
ATOM 9020  N N9    . DG  J 6 24  ? 140.735 163.503 184.892 1.00 107.07 ? 4    DG  J N9    1 
ATOM 9021  C C8    . DG  J 6 24  ? 140.656 163.013 186.166 1.00 113.50 ? 4    DG  J C8    1 
ATOM 9022  N N7    . DG  J 6 24  ? 141.598 163.442 186.945 1.00 115.72 ? 4    DG  J N7    1 
ATOM 9023  C C5    . DG  J 6 24  ? 142.355 164.269 186.136 1.00 105.33 ? 4    DG  J C5    1 
ATOM 9024  C C6    . DG  J 6 24  ? 143.501 165.016 186.440 1.00 101.00 ? 4    DG  J C6    1 
ATOM 9025  O O6    . DG  J 6 24  ? 144.110 165.091 187.499 1.00 104.96 ? 4    DG  J O6    1 
ATOM 9026  N N1    . DG  J 6 24  ? 143.968 165.722 185.346 1.00 91.60  ? 4    DG  J N1    1 
ATOM 9027  C C2    . DG  J 6 24  ? 143.399 165.718 184.109 1.00 83.17  ? 4    DG  J C2    1 
ATOM 9028  N N2    . DG  J 6 24  ? 144.031 166.479 183.197 1.00 76.01  ? 4    DG  J N2    1 
ATOM 9029  N N3    . DG  J 6 24  ? 142.307 165.026 183.796 1.00 90.88  ? 4    DG  J N3    1 
ATOM 9030  C C4    . DG  J 6 24  ? 141.840 164.325 184.866 1.00 99.47  ? 4    DG  J C4    1 
ATOM 9031  P P     . DG  J 6 25  ? 137.845 160.985 181.462 1.00 114.72 ? 5    DG  J P     1 
ATOM 9032  O OP1   . DG  J 6 25  ? 136.936 160.894 180.300 1.00 103.95 ? 5    DG  J OP1   1 
ATOM 9033  O OP2   . DG  J 6 25  ? 138.145 159.746 182.209 1.00 104.33 ? 5    DG  J OP2   1 
ATOM 9034  O "O5'" . DG  J 6 25  ? 139.195 161.674 180.961 1.00 89.19  ? 5    DG  J "O5'" 1 
ATOM 9035  C "C5'" . DG  J 6 25  ? 139.140 162.983 180.416 1.00 98.19  ? 5    DG  J "C5'" 1 
ATOM 9036  C "C4'" . DG  J 6 25  ? 140.272 163.228 179.441 1.00 101.73 ? 5    DG  J "C4'" 1 
ATOM 9037  O "O4'" . DG  J 6 25  ? 141.453 163.646 180.154 1.00 96.01  ? 5    DG  J "O4'" 1 
ATOM 9038  C "C3'" . DG  J 6 25  ? 140.695 162.033 178.611 1.00 101.88 ? 5    DG  J "C3'" 1 
ATOM 9039  O "O3'" . DG  J 6 25  ? 141.155 162.503 177.353 1.00 102.64 ? 5    DG  J "O3'" 1 
ATOM 9040  C "C2'" . DG  J 6 25  ? 141.809 161.412 179.454 1.00 96.76  ? 5    DG  J "C2'" 1 
ATOM 9041  C "C1'" . DG  J 6 25  ? 142.426 162.623 180.136 1.00 92.70  ? 5    DG  J "C1'" 1 
ATOM 9042  N N9    . DG  J 6 25  ? 142.822 162.382 181.511 1.00 93.23  ? 5    DG  J N9    1 
ATOM 9043  C C8    . DG  J 6 25  ? 142.220 161.559 182.422 1.00 100.22 ? 5    DG  J C8    1 
ATOM 9044  N N7    . DG  J 6 25  ? 142.793 161.582 183.595 1.00 95.47  ? 5    DG  J N7    1 
ATOM 9045  C C5    . DG  J 6 25  ? 143.845 162.471 183.436 1.00 90.86  ? 5    DG  J C5    1 
ATOM 9046  C C6    . DG  J 6 25  ? 144.820 162.914 184.357 1.00 88.44  ? 5    DG  J C6    1 
ATOM 9047  O O6    . DG  J 6 25  ? 144.981 162.595 185.541 1.00 98.91  ? 5    DG  J O6    1 
ATOM 9048  N N1    . DG  J 6 25  ? 145.680 163.820 183.775 1.00 81.25  ? 5    DG  J N1    1 
ATOM 9049  C C2    . DG  J 6 25  ? 145.607 164.248 182.477 1.00 82.35  ? 5    DG  J C2    1 
ATOM 9050  N N2    . DG  J 6 25  ? 146.520 165.134 182.100 1.00 91.65  ? 5    DG  J N2    1 
ATOM 9051  N N3    . DG  J 6 25  ? 144.701 163.856 181.620 1.00 80.17  ? 5    DG  J N3    1 
ATOM 9052  C C4    . DG  J 6 25  ? 143.856 162.977 182.163 1.00 88.71  ? 5    DG  J C4    1 
ATOM 9053  P P     . DA  J 6 26  ? 142.164 161.651 176.443 1.00 95.17  ? 6    DA  J P     1 
ATOM 9054  O OP1   . DA  J 6 26  ? 141.859 162.060 175.055 1.00 97.93  ? 6    DA  J OP1   1 
ATOM 9055  O OP2   . DA  J 6 26  ? 142.142 160.214 176.798 1.00 89.16  ? 6    DA  J OP2   1 
ATOM 9056  O "O5'" . DA  J 6 26  ? 143.589 162.266 176.799 1.00 91.34  ? 6    DA  J "O5'" 1 
ATOM 9057  C "C5'" . DA  J 6 26  ? 143.928 163.541 176.290 1.00 94.08  ? 6    DA  J "C5'" 1 
ATOM 9058  C "C4'" . DA  J 6 26  ? 145.401 163.824 176.470 1.00 97.48  ? 6    DA  J "C4'" 1 
ATOM 9059  O "O4'" . DA  J 6 26  ? 145.730 163.735 177.874 1.00 106.48 ? 6    DA  J "O4'" 1 
ATOM 9060  C "C3'" . DA  J 6 26  ? 146.339 162.859 175.762 1.00 102.71 ? 6    DA  J "C3'" 1 
ATOM 9061  O "O3'" . DA  J 6 26  ? 147.493 163.562 175.331 1.00 110.28 ? 6    DA  J "O3'" 1 
ATOM 9062  C "C2'" . DA  J 6 26  ? 146.660 161.852 176.859 1.00 99.97  ? 6    DA  J "C2'" 1 
ATOM 9063  C "C1'" . DA  J 6 26  ? 146.715 162.751 178.073 1.00 104.96 ? 6    DA  J "C1'" 1 
ATOM 9064  N N9    . DA  J 6 26  ? 146.415 162.071 179.317 1.00 100.31 ? 6    DA  J N9    1 
ATOM 9065  C C8    . DA  J 6 26  ? 145.404 161.193 179.555 1.00 95.86  ? 6    DA  J C8    1 
ATOM 9066  N N7    . DA  J 6 26  ? 145.374 160.750 180.786 1.00 86.34  ? 6    DA  J N7    1 
ATOM 9067  C C5    . DA  J 6 26  ? 146.435 161.391 181.390 1.00 87.23  ? 6    DA  J C5    1 
ATOM 9068  C C6    . DA  J 6 26  ? 146.945 161.356 182.695 1.00 87.63  ? 6    DA  J C6    1 
ATOM 9069  N N6    . DA  J 6 26  ? 146.427 160.609 183.671 1.00 86.38  ? 6    DA  J N6    1 
ATOM 9070  N N1    . DA  J 6 26  ? 148.010 162.127 182.965 1.00 87.49  ? 6    DA  J N1    1 
ATOM 9071  C C2    . DA  J 6 26  ? 148.529 162.870 181.989 1.00 83.94  ? 6    DA  J C2    1 
ATOM 9072  N N3    . DA  J 6 26  ? 148.140 162.983 180.731 1.00 89.10  ? 6    DA  J N3    1 
ATOM 9073  C C4    . DA  J 6 26  ? 147.079 162.212 180.496 1.00 91.69  ? 6    DA  J C4    1 
ATOM 9074  P P     . DT  J 6 27  ? 148.861 162.793 174.985 1.00 98.33  ? 7    DT  J P     1 
ATOM 9075  O OP1   . DT  J 6 27  ? 149.591 163.657 174.038 1.00 91.96  ? 7    DT  J OP1   1 
ATOM 9076  O OP2   . DT  J 6 27  ? 148.589 161.390 174.615 1.00 85.66  ? 7    DT  J OP2   1 
ATOM 9077  O "O5'" . DT  J 6 27  ? 149.669 162.819 176.358 1.00 83.36  ? 7    DT  J "O5'" 1 
ATOM 9078  C "C5'" . DT  J 6 27  ? 150.197 164.043 176.822 1.00 71.25  ? 7    DT  J "C5'" 1 
ATOM 9079  C "C4'" . DT  J 6 27  ? 151.340 163.816 177.791 1.00 75.18  ? 7    DT  J "C4'" 1 
ATOM 9080  O "O4'" . DT  J 6 27  ? 150.835 163.214 179.006 1.00 87.86  ? 7    DT  J "O4'" 1 
ATOM 9081  C "C3'" . DT  J 6 27  ? 152.445 162.887 177.296 1.00 76.97  ? 7    DT  J "C3'" 1 
ATOM 9082  O "O3'" . DT  J 6 27  ? 153.682 163.344 177.782 1.00 86.37  ? 7    DT  J "O3'" 1 
ATOM 9083  C "C2'" . DT  J 6 27  ? 152.069 161.563 177.936 1.00 78.19  ? 7    DT  J "C2'" 1 
ATOM 9084  C "C1'" . DT  J 6 27  ? 151.566 162.045 179.279 1.00 85.61  ? 7    DT  J "C1'" 1 
ATOM 9085  N N1    . DT  J 6 27  ? 150.672 161.106 179.939 1.00 84.80  ? 7    DT  J N1    1 
ATOM 9086  C C2    . DT  J 6 27  ? 150.818 160.885 181.275 1.00 91.14  ? 7    DT  J C2    1 
ATOM 9087  O O2    . DT  J 6 27  ? 151.667 161.423 181.953 1.00 100.44 ? 7    DT  J O2    1 
ATOM 9088  N N3    . DT  J 6 27  ? 149.941 160.005 181.803 1.00 79.15  ? 7    DT  J N3    1 
ATOM 9089  C C4    . DT  J 6 27  ? 148.944 159.329 181.140 1.00 79.67  ? 7    DT  J C4    1 
ATOM 9090  O O4    . DT  J 6 27  ? 148.201 158.551 181.717 1.00 85.91  ? 7    DT  J O4    1 
ATOM 9091  C C5    . DT  J 6 27  ? 148.839 159.606 179.734 1.00 81.16  ? 7    DT  J C5    1 
ATOM 9092  C C7    . DT  J 6 27  ? 147.795 158.930 178.908 1.00 74.75  ? 7    DT  J C7    1 
ATOM 9093  C C6    . DT  J 6 27  ? 149.697 160.476 179.206 1.00 62.21  ? 7    DT  J C6    1 
ATOM 9094  P P     . DG  J 6 28  ? 155.043 162.892 177.069 1.00 106.94 ? 8    DG  J P     1 
ATOM 9095  O OP1   . DG  J 6 28  ? 155.603 164.057 176.355 1.00 102.55 ? 8    DG  J OP1   1 
ATOM 9096  O OP2   . DG  J 6 28  ? 154.762 161.641 176.339 1.00 113.73 ? 8    DG  J OP2   1 
ATOM 9097  O "O5'" . DG  J 6 28  ? 155.995 162.516 178.287 1.00 81.55  ? 8    DG  J "O5'" 1 
ATOM 9098  C "C5'" . DG  J 6 28  ? 155.715 161.373 179.052 1.00 98.88  ? 8    DG  J "C5'" 1 
ATOM 9099  C "C4'" . DG  J 6 28  ? 156.649 161.275 180.234 1.00 108.23 ? 8    DG  J "C4'" 1 
ATOM 9100  O "O4'" . DG  J 6 28  ? 155.869 160.938 181.394 1.00 99.28  ? 8    DG  J "O4'" 1 
ATOM 9101  C "C3'" . DG  J 6 28  ? 157.639 160.143 180.158 1.00 117.79 ? 8    DG  J "C3'" 1 
ATOM 9102  O "O3'" . DG  J 6 28  ? 158.567 160.278 181.228 1.00 121.54 ? 8    DG  J "O3'" 1 
ATOM 9103  C "C2'" . DG  J 6 28  ? 156.697 158.975 180.392 1.00 116.45 ? 8    DG  J "C2'" 1 
ATOM 9104  C "C1'" . DG  J 6 28  ? 155.859 159.529 181.535 1.00 103.44 ? 8    DG  J "C1'" 1 
ATOM 9105  N N9    . DG  J 6 28  ? 154.483 159.090 181.529 1.00 94.19  ? 8    DG  J N9    1 
ATOM 9106  C C8    . DG  J 6 28  ? 153.621 159.075 180.471 1.00 92.61  ? 8    DG  J C8    1 
ATOM 9107  N N7    . DG  J 6 28  ? 152.443 158.630 180.779 1.00 95.62  ? 8    DG  J N7    1 
ATOM 9108  C C5    . DG  J 6 28  ? 152.526 158.373 182.133 1.00 97.31  ? 8    DG  J C5    1 
ATOM 9109  C C6    . DG  J 6 28  ? 151.563 157.873 183.020 1.00 105.03 ? 8    DG  J C6    1 
ATOM 9110  O O6    . DG  J 6 28  ? 150.398 157.563 182.787 1.00 101.00 ? 8    DG  J O6    1 
ATOM 9111  N N1    . DG  J 6 28  ? 152.063 157.745 184.304 1.00 112.15 ? 8    DG  J N1    1 
ATOM 9112  C C2    . DG  J 6 28  ? 153.340 158.058 184.683 1.00 117.80 ? 8    DG  J C2    1 
ATOM 9113  N N2    . DG  J 6 28  ? 153.639 157.864 185.971 1.00 129.36 ? 8    DG  J N2    1 
ATOM 9114  N N3    . DG  J 6 28  ? 154.258 158.516 183.857 1.00 103.43 ? 8    DG  J N3    1 
ATOM 9115  C C4    . DG  J 6 28  ? 153.778 158.647 182.602 1.00 91.21  ? 8    DG  J C4    1 
ATOM 9116  P P     . DT  J 6 29  ? 159.768 159.230 181.438 1.00 119.74 ? 9    DT  J P     1 
ATOM 9117  O OP1   . DT  J 6 29  ? 161.010 159.934 181.074 1.00 97.02  ? 9    DT  J OP1   1 
ATOM 9118  O OP2   . DT  J 6 29  ? 159.461 157.944 180.788 1.00 126.33 ? 9    DT  J OP2   1 
ATOM 9119  O "O5'" . DT  J 6 29  ? 159.769 158.969 183.016 1.00 69.82  ? 9    DT  J "O5'" 1 
ATOM 9120  C "C5'" . DT  J 6 29  ? 158.540 158.759 183.701 1.00 88.67  ? 9    DT  J "C5'" 1 
ATOM 9121  C "C4'" . DT  J 6 29  ? 158.536 157.417 184.399 1.00 110.07 ? 9    DT  J "C4'" 1 
ATOM 9122  O "O4'" . DT  J 6 29  ? 157.177 156.911 184.467 1.00 109.17 ? 9    DT  J "O4'" 1 
ATOM 9123  C "C3'" . DT  J 6 29  ? 159.338 156.340 183.691 1.00 118.13 ? 9    DT  J "C3'" 1 
ATOM 9124  O "O3'" . DT  J 6 29  ? 159.880 155.461 184.635 1.00 129.47 ? 9    DT  J "O3'" 1 
ATOM 9125  C "C2'" . DT  J 6 29  ? 158.282 155.657 182.843 1.00 111.85 ? 9    DT  J "C2'" 1 
ATOM 9126  C "C1'" . DT  J 6 29  ? 157.099 155.676 183.790 1.00 105.55 ? 9    DT  J "C1'" 1 
ATOM 9127  N N1    . DT  J 6 29  ? 155.811 155.613 183.096 1.00 95.51  ? 9    DT  J N1    1 
ATOM 9128  C C2    . DT  J 6 29  ? 154.681 155.300 183.800 1.00 102.59 ? 9    DT  J C2    1 
ATOM 9129  O O2    . DT  J 6 29  ? 154.679 155.070 184.989 1.00 104.02 ? 9    DT  J O2    1 
ATOM 9130  N N3    . DT  J 6 29  ? 153.540 155.272 183.060 1.00 105.48 ? 9    DT  J N3    1 
ATOM 9131  C C4    . DT  J 6 29  ? 153.424 155.510 181.711 1.00 101.62 ? 9    DT  J C4    1 
ATOM 9132  O O4    . DT  J 6 29  ? 152.349 155.464 181.130 1.00 97.43  ? 9    DT  J O4    1 
ATOM 9133  C C5    . DT  J 6 29  ? 154.650 155.838 181.037 1.00 95.92  ? 9    DT  J C5    1 
ATOM 9134  C C7    . DT  J 6 29  ? 154.651 156.118 179.569 1.00 92.03  ? 9    DT  J C7    1 
ATOM 9135  C C6    . DT  J 6 29  ? 155.770 155.869 181.753 1.00 92.81  ? 9    DT  J C6    1 
ATOM 9136  P P     . DA  J 6 30  ? 161.367 155.705 185.175 1.00 123.89 ? 10   DA  J P     1 
ATOM 9137  O OP1   . DA  J 6 30  ? 161.494 157.130 185.534 1.00 120.50 ? 10   DA  J OP1   1 
ATOM 9138  O OP2   . DA  J 6 30  ? 162.288 155.121 184.180 1.00 116.37 ? 10   DA  J OP2   1 
ATOM 9139  O "O5'" . DA  J 6 30  ? 161.439 154.827 186.505 1.00 87.66  ? 10   DA  J "O5'" 1 
ATOM 9140  C "C5'" . DA  J 6 30  ? 162.123 153.588 186.493 1.00 93.63  ? 10   DA  J "C5'" 1 
ATOM 9141  C "C4'" . DA  J 6 30  ? 161.155 152.427 186.610 1.00 113.24 ? 10   DA  J "C4'" 1 
ATOM 9142  O "O4'" . DA  J 6 30  ? 159.975 152.695 185.846 1.00 122.76 ? 10   DA  J "O4'" 1 
ATOM 9143  C "C3'" . DA  J 6 30  ? 161.668 151.120 186.044 1.00 128.00 ? 10   DA  J "C3'" 1 
ATOM 9144  O "O3'" . DA  J 6 30  ? 162.357 150.411 187.037 1.00 140.63 ? 10   DA  J "O3'" 1 
ATOM 9145  C "C2'" . DA  J 6 30  ? 160.395 150.384 185.608 1.00 128.78 ? 10   DA  J "C2'" 1 
ATOM 9146  C "C1'" . DA  J 6 30  ? 159.321 151.471 185.638 1.00 127.69 ? 10   DA  J "C1'" 1 
ATOM 9147  N N9    . DA  J 6 30  ? 158.529 151.564 184.423 1.00 126.51 ? 10   DA  J N9    1 
ATOM 9148  C C8    . DA  J 6 30  ? 158.604 152.519 183.459 1.00 126.92 ? 10   DA  J C8    1 
ATOM 9149  N N7    . DA  J 6 30  ? 157.742 152.355 182.488 1.00 121.15 ? 10   DA  J N7    1 
ATOM 9150  C C5    . DA  J 6 30  ? 157.058 151.210 182.845 1.00 120.31 ? 10   DA  J C5    1 
ATOM 9151  C C6    . DA  J 6 30  ? 156.011 150.498 182.237 1.00 118.99 ? 10   DA  J C6    1 
ATOM 9152  N N6    . DA  J 6 30  ? 155.452 150.854 181.081 1.00 120.89 ? 10   DA  J N6    1 
ATOM 9153  N N1    . DA  J 6 30  ? 155.561 149.396 182.863 1.00 113.85 ? 10   DA  J N1    1 
ATOM 9154  C C2    . DA  J 6 30  ? 156.123 149.045 184.015 1.00 114.28 ? 10   DA  J C2    1 
ATOM 9155  N N3    . DA  J 6 30  ? 157.107 149.631 184.680 1.00 116.15 ? 10   DA  J N3    1 
ATOM 9156  C C4    . DA  J 6 30  ? 157.531 150.717 184.036 1.00 120.33 ? 10   DA  J C4    1 
ATOM 9157  P P     . DT  J 6 31  ? 163.650 149.562 186.632 1.00 139.38 ? 11   DT  J P     1 
ATOM 9158  O OP1   . DT  J 6 31  ? 164.066 148.736 187.783 1.00 138.70 ? 11   DT  J OP1   1 
ATOM 9159  O OP2   . DT  J 6 31  ? 164.598 150.505 186.013 1.00 125.80 ? 11   DT  J OP2   1 
ATOM 9160  O "O5'" . DT  J 6 31  ? 163.106 148.610 185.479 1.00 102.81 ? 11   DT  J "O5'" 1 
ATOM 9161  C "C5'" . DT  J 6 31  ? 163.275 147.217 185.585 1.00 108.82 ? 11   DT  J "C5'" 1 
ATOM 9162  C "C4'" . DT  J 6 31  ? 161.934 146.520 185.653 1.00 126.32 ? 11   DT  J "C4'" 1 
ATOM 9163  O "O4'" . DT  J 6 31  ? 160.913 147.394 185.157 1.00 130.54 ? 11   DT  J "O4'" 1 
ATOM 9164  C "C3'" . DT  J 6 31  ? 161.817 145.302 184.777 1.00 137.42 ? 11   DT  J "C3'" 1 
ATOM 9165  O "O3'" . DT  J 6 31  ? 162.346 144.177 185.438 1.00 149.47 ? 11   DT  J "O3'" 1 
ATOM 9166  C "C2'" . DT  J 6 31  ? 160.310 145.177 184.590 1.00 131.07 ? 11   DT  J "C2'" 1 
ATOM 9167  C "C1'" . DT  J 6 31  ? 159.808 146.611 184.778 1.00 132.37 ? 11   DT  J "C1'" 1 
ATOM 9168  N N1    . DT  J 6 31  ? 159.212 147.198 183.569 1.00 138.84 ? 11   DT  J N1    1 
ATOM 9169  C C2    . DT  J 6 31  ? 158.072 146.650 183.041 1.00 137.98 ? 11   DT  J C2    1 
ATOM 9170  O O2    . DT  J 6 31  ? 157.524 145.675 183.504 1.00 139.11 ? 11   DT  J O2    1 
ATOM 9171  N N3    . DT  J 6 31  ? 157.600 147.275 181.930 1.00 137.16 ? 11   DT  J N3    1 
ATOM 9172  C C4    . DT  J 6 31  ? 158.130 148.381 181.315 1.00 138.63 ? 11   DT  J C4    1 
ATOM 9173  O O4    . DT  J 6 31  ? 157.629 148.875 180.314 1.00 134.65 ? 11   DT  J O4    1 
ATOM 9174  C C5    . DT  J 6 31  ? 159.320 148.911 181.925 1.00 143.14 ? 11   DT  J C5    1 
ATOM 9175  C C7    . DT  J 6 31  ? 159.992 150.113 181.343 1.00 147.60 ? 11   DT  J C7    1 
ATOM 9176  C C6    . DT  J 6 31  ? 159.796 148.299 183.010 1.00 140.45 ? 11   DT  J C6    1 
ATOM 9177  P P     . DA  J 6 32  ? 163.316 143.176 184.646 1.00 129.64 ? 12   DA  J P     1 
ATOM 9178  O OP1   . DA  J 6 32  ? 164.107 142.412 185.635 1.00 114.04 ? 12   DA  J OP1   1 
ATOM 9179  O OP2   . DA  J 6 32  ? 163.981 143.979 183.604 1.00 131.61 ? 12   DA  J OP2   1 
ATOM 9180  O "O5'" . DA  J 6 32  ? 162.322 142.177 183.900 1.00 125.35 ? 12   DA  J "O5'" 1 
ATOM 9181  C "C5'" . DA  J 6 32  ? 161.790 142.525 182.644 1.00 125.77 ? 12   DA  J "C5'" 1 
ATOM 9182  C "C4'" . DA  J 6 32  ? 160.396 141.969 182.484 1.00 134.40 ? 12   DA  J "C4'" 1 
ATOM 9183  O "O4'" . DA  J 6 32  ? 159.433 143.028 182.660 1.00 135.27 ? 12   DA  J "O4'" 1 
ATOM 9184  C "C3'" . DA  J 6 32  ? 160.108 141.396 181.120 1.00 142.13 ? 12   DA  J "C3'" 1 
ATOM 9185  O "O3'" . DA  J 6 32  ? 160.444 140.041 181.114 1.00 152.90 ? 12   DA  J "O3'" 1 
ATOM 9186  C "C2'" . DA  J 6 32  ? 158.609 141.588 180.987 1.00 138.93 ? 12   DA  J "C2'" 1 
ATOM 9187  C "C1'" . DA  J 6 32  ? 158.395 142.903 181.717 1.00 135.36 ? 12   DA  J "C1'" 1 
ATOM 9188  N N9    . DA  J 6 32  ? 158.447 144.051 180.847 1.00 134.30 ? 12   DA  J N9    1 
ATOM 9189  C C8    . DA  J 6 32  ? 159.362 145.049 180.871 1.00 130.06 ? 12   DA  J C8    1 
ATOM 9190  N N7    . DA  J 6 32  ? 159.161 145.965 179.965 1.00 125.74 ? 12   DA  J N7    1 
ATOM 9191  C C5    . DA  J 6 32  ? 158.034 145.529 179.303 1.00 126.18 ? 12   DA  J C5    1 
ATOM 9192  C C6    . DA  J 6 32  ? 157.319 146.044 178.213 1.00 126.17 ? 12   DA  J C6    1 
ATOM 9193  N N6    . DA  J 6 32  ? 157.641 147.178 177.599 1.00 122.97 ? 12   DA  J N6    1 
ATOM 9194  N N1    . DA  J 6 32  ? 156.251 145.355 177.787 1.00 130.62 ? 12   DA  J N1    1 
ATOM 9195  C C2    . DA  J 6 32  ? 155.934 144.228 178.408 1.00 128.50 ? 12   DA  J C2    1 
ATOM 9196  N N3    . DA  J 6 32  ? 156.538 143.638 179.429 1.00 126.25 ? 12   DA  J N3    1 
ATOM 9197  C C4    . DA  J 6 32  ? 157.592 144.345 179.828 1.00 129.52 ? 12   DA  J C4    1 
ATOM 9198  P P     . DT  J 6 33  ? 160.699 139.306 179.719 1.00 129.23 ? 13   DT  J P     1 
ATOM 9199  O OP1   . DT  J 6 33  ? 161.425 138.045 179.961 1.00 128.80 ? 13   DT  J OP1   1 
ATOM 9200  O OP2   . DT  J 6 33  ? 161.244 140.316 178.796 1.00 114.41 ? 13   DT  J OP2   1 
ATOM 9201  O "O5'" . DT  J 6 33  ? 159.243 138.996 179.190 1.00 141.96 ? 13   DT  J "O5'" 1 
ATOM 9202  C "C5'" . DT  J 6 33  ? 159.064 138.681 177.857 1.00 141.25 ? 13   DT  J "C5'" 1 
ATOM 9203  C "C4'" . DT  J 6 33  ? 157.608 138.735 177.519 1.00 142.87 ? 13   DT  J "C4'" 1 
ATOM 9204  O "O4'" . DT  J 6 33  ? 157.108 140.037 177.851 1.00 138.09 ? 13   DT  J "O4'" 1 
ATOM 9205  C "C3'" . DT  J 6 33  ? 157.300 138.494 176.063 1.00 148.76 ? 13   DT  J "C3'" 1 
ATOM 9206  O "O3'" . DT  J 6 33  ? 156.868 137.178 175.913 1.00 162.24 ? 13   DT  J "O3'" 1 
ATOM 9207  C "C2'" . DT  J 6 33  ? 156.168 139.453 175.770 1.00 140.45 ? 13   DT  J "C2'" 1 
ATOM 9208  C "C1'" . DT  J 6 33  ? 156.370 140.566 176.788 1.00 136.27 ? 13   DT  J "C1'" 1 
ATOM 9209  N N1    . DT  J 6 33  ? 157.090 141.753 176.285 1.00 127.59 ? 13   DT  J N1    1 
ATOM 9210  C C2    . DT  J 6 33  ? 156.677 142.367 175.138 1.00 119.49 ? 13   DT  J C2    1 
ATOM 9211  O O2    . DT  J 6 33  ? 155.759 141.973 174.455 1.00 114.26 ? 13   DT  J O2    1 
ATOM 9212  N N3    . DT  J 6 33  ? 157.405 143.452 174.777 1.00 118.96 ? 13   DT  J N3    1 
ATOM 9213  C C4    . DT  J 6 33  ? 158.459 144.001 175.449 1.00 130.04 ? 13   DT  J C4    1 
ATOM 9214  O O4    . DT  J 6 33  ? 159.038 144.995 175.044 1.00 133.94 ? 13   DT  J O4    1 
ATOM 9215  C C5    . DT  J 6 33  ? 158.830 143.329 176.662 1.00 128.50 ? 13   DT  J C5    1 
ATOM 9216  C C7    . DT  J 6 33  ? 159.979 143.830 177.478 1.00 119.23 ? 13   DT  J C7    1 
ATOM 9217  C C6    . DT  J 6 33  ? 158.134 142.250 177.018 1.00 127.66 ? 13   DT  J C6    1 
ATOM 9218  P P     . DA  J 6 34  ? 157.597 136.209 174.872 1.00 134.45 ? 14   DA  J P     1 
ATOM 9219  O OP1   . DA  J 6 34  ? 157.309 134.821 175.270 1.00 126.06 ? 14   DA  J OP1   1 
ATOM 9220  O OP2   . DA  J 6 34  ? 158.992 136.664 174.752 1.00 127.75 ? 14   DA  J OP2   1 
ATOM 9221  O "O5'" . DA  J 6 34  ? 156.849 136.508 173.511 1.00 111.12 ? 14   DA  J "O5'" 1 
ATOM 9222  C "C5'" . DA  J 6 34  ? 155.464 136.711 173.516 1.00 119.03 ? 14   DA  J "C5'" 1 
ATOM 9223  C "C4'" . DA  J 6 34  ? 155.062 137.461 172.277 1.00 127.94 ? 14   DA  J "C4'" 1 
ATOM 9224  O "O4'" . DA  J 6 34  ? 155.376 138.861 172.445 1.00 125.77 ? 14   DA  J "O4'" 1 
ATOM 9225  C "C3'" . DA  J 6 34  ? 155.793 137.013 171.025 1.00 133.99 ? 14   DA  J "C3'" 1 
ATOM 9226  O "O3'" . DA  J 6 34  ? 154.898 136.898 169.981 1.00 141.14 ? 14   DA  J "O3'" 1 
ATOM 9227  C "C2'" . DA  J 6 34  ? 156.798 138.124 170.772 1.00 128.80 ? 14   DA  J "C2'" 1 
ATOM 9228  C "C1'" . DA  J 6 34  ? 156.062 139.322 171.315 1.00 127.58 ? 14   DA  J "C1'" 1 
ATOM 9229  N N9    . DA  J 6 34  ? 156.944 140.394 171.728 1.00 127.90 ? 14   DA  J N9    1 
ATOM 9230  C C8    . DA  J 6 34  ? 157.608 140.504 172.907 1.00 126.28 ? 14   DA  J C8    1 
ATOM 9231  N N7    . DA  J 6 34  ? 158.330 141.588 173.003 1.00 118.63 ? 14   DA  J N7    1 
ATOM 9232  C C5    . DA  J 6 34  ? 158.118 142.224 171.806 1.00 119.09 ? 14   DA  J C5    1 
ATOM 9233  C C6    . DA  J 6 34  ? 158.605 143.420 171.281 1.00 113.21 ? 14   DA  J C6    1 
ATOM 9234  N N6    . DA  J 6 34  ? 159.433 144.226 171.940 1.00 111.18 ? 14   DA  J N6    1 
ATOM 9235  N N1    . DA  J 6 34  ? 158.209 143.765 170.046 1.00 106.35 ? 14   DA  J N1    1 
ATOM 9236  C C2    . DA  J 6 34  ? 157.381 142.954 169.388 1.00 107.23 ? 14   DA  J C2    1 
ATOM 9237  N N3    . DA  J 6 34  ? 156.860 141.803 169.780 1.00 113.52 ? 14   DA  J N3    1 
ATOM 9238  C C4    . DA  J 6 34  ? 157.273 141.496 171.008 1.00 121.03 ? 14   DA  J C4    1 
ATOM 9239  P P     . DT  J 6 35  ? 154.894 135.553 169.123 1.00 147.61 ? 15   DT  J P     1 
ATOM 9240  O OP1   . DT  J 6 35  ? 153.498 135.113 168.937 1.00 139.68 ? 15   DT  J OP1   1 
ATOM 9241  O OP2   . DT  J 6 35  ? 155.886 134.666 169.763 1.00 143.55 ? 15   DT  J OP2   1 
ATOM 9242  O "O5'" . DT  J 6 35  ? 155.504 136.005 167.732 1.00 121.76 ? 15   DT  J "O5'" 1 
ATOM 9243  C "C5'" . DT  J 6 35  ? 156.824 136.466 167.679 1.00 115.72 ? 15   DT  J "C5'" 1 
ATOM 9244  C "C4'" . DT  J 6 35  ? 156.931 137.652 166.756 1.00 120.36 ? 15   DT  J "C4'" 1 
ATOM 9245  O "O4'" . DT  J 6 35  ? 157.290 138.810 167.527 1.00 123.79 ? 15   DT  J "O4'" 1 
ATOM 9246  C "C3'" . DT  J 6 35  ? 157.998 137.508 165.681 1.00 123.00 ? 15   DT  J "C3'" 1 
ATOM 9247  O "O3'" . DT  J 6 35  ? 157.406 137.357 164.374 1.00 121.63 ? 15   DT  J "O3'" 1 
ATOM 9248  C "C2'" . DT  J 6 35  ? 158.862 138.762 165.806 1.00 127.41 ? 15   DT  J "C2'" 1 
ATOM 9249  C "C1'" . DT  J 6 35  ? 158.084 139.655 166.754 1.00 122.96 ? 15   DT  J "C1'" 1 
ATOM 9250  N N1    . DT  J 6 35  ? 158.949 140.380 167.657 1.00 115.49 ? 15   DT  J N1    1 
ATOM 9251  C C2    . DT  J 6 35  ? 159.495 141.563 167.259 1.00 110.19 ? 15   DT  J C2    1 
ATOM 9252  O O2    . DT  J 6 35  ? 159.284 142.062 166.176 1.00 109.16 ? 15   DT  J O2    1 
ATOM 9253  N N3    . DT  J 6 35  ? 160.301 142.152 168.181 1.00 106.86 ? 15   DT  J N3    1 
ATOM 9254  C C4    . DT  J 6 35  ? 160.607 141.677 169.432 1.00 106.02 ? 15   DT  J C4    1 
ATOM 9255  O O4    . DT  J 6 35  ? 161.343 142.276 170.199 1.00 107.80 ? 15   DT  J O4    1 
ATOM 9256  C C5    . DT  J 6 35  ? 160.004 140.426 169.777 1.00 106.56 ? 15   DT  J C5    1 
ATOM 9257  C C7    . DT  J 6 35  ? 160.273 139.809 171.108 1.00 107.74 ? 15   DT  J C7    1 
ATOM 9258  C C6    . DT  J 6 35  ? 159.217 139.843 168.882 1.00 111.03 ? 15   DT  J C6    1 
ATOM 9259  P P     . DC  J 6 36  ? 156.654 138.564 163.622 1.00 130.69 ? 16   DC  J P     1 
ATOM 9260  O OP1   . DC  J 6 36  ? 155.856 139.345 164.579 1.00 133.38 ? 16   DC  J OP1   1 
ATOM 9261  O OP2   . DC  J 6 36  ? 155.999 137.987 162.433 1.00 132.76 ? 16   DC  J OP2   1 
ATOM 9262  O "O5'" . DC  J 6 36  ? 157.826 139.488 163.077 1.00 112.65 ? 16   DC  J "O5'" 1 
ATOM 9263  C "C5'" . DC  J 6 36  ? 157.814 140.860 163.376 1.00 118.92 ? 16   DC  J "C5'" 1 
ATOM 9264  C "C4'" . DC  J 6 36  ? 157.998 141.681 162.133 1.00 125.86 ? 16   DC  J "C4'" 1 
ATOM 9265  O "O4'" . DC  J 6 36  ? 159.057 142.613 162.353 1.00 126.83 ? 16   DC  J "O4'" 1 
ATOM 9266  C "C3'" . DC  J 6 36  ? 158.453 140.906 160.931 1.00 130.21 ? 16   DC  J "C3'" 1 
ATOM 9267  O "O3'" . DC  J 6 36  ? 158.197 141.677 159.780 1.00 138.88 ? 16   DC  J "O3'" 1 
ATOM 9268  C "C2'" . DC  J 6 36  ? 159.949 140.753 161.202 1.00 124.12 ? 16   DC  J "C2'" 1 
ATOM 9269  C "C1'" . DC  J 6 36  ? 160.278 141.997 162.028 1.00 117.97 ? 16   DC  J "C1'" 1 
ATOM 9270  N N1    . DC  J 6 36  ? 160.999 141.713 163.292 1.00 105.33 ? 16   DC  J N1    1 
ATOM 9271  C C2    . DC  J 6 36  ? 161.355 142.766 164.116 1.00 110.91 ? 16   DC  J C2    1 
ATOM 9272  O O2    . DC  J 6 36  ? 161.106 143.913 163.767 1.00 106.88 ? 16   DC  J O2    1 
ATOM 9273  N N3    . DC  J 6 36  ? 162.026 142.520 165.252 1.00 112.86 ? 16   DC  J N3    1 
ATOM 9274  C C4    . DC  J 6 36  ? 162.306 141.276 165.596 1.00 111.97 ? 16   DC  J C4    1 
ATOM 9275  N N4    . DC  J 6 36  ? 162.960 141.089 166.741 1.00 114.46 ? 16   DC  J N4    1 
ATOM 9276  C C5    . DC  J 6 36  ? 161.945 140.175 164.778 1.00 101.96 ? 16   DC  J C5    1 
ATOM 9277  C C6    . DC  J 6 36  ? 161.293 140.437 163.643 1.00 96.51  ? 16   DC  J C6    1 
ATOM 9278  P P     . DT  J 6 37  ? 158.804 141.272 158.353 1.00 113.56 ? 17   DT  J P     1 
ATOM 9279  O OP1   . DT  J 6 37  ? 157.847 141.770 157.350 1.00 111.07 ? 17   DT  J OP1   1 
ATOM 9280  O OP2   . DT  J 6 37  ? 159.201 139.853 158.342 1.00 104.01 ? 17   DT  J OP2   1 
ATOM 9281  O "O5'" . DT  J 6 37  ? 160.110 142.162 158.258 1.00 120.49 ? 17   DT  J "O5'" 1 
ATOM 9282  C "C5'" . DT  J 6 37  ? 160.033 143.502 158.657 1.00 117.56 ? 17   DT  J "C5'" 1 
ATOM 9283  C "C4'" . DT  J 6 37  ? 161.404 144.131 158.724 1.00 111.69 ? 17   DT  J "C4'" 1 
ATOM 9284  O "O4'" . DT  J 6 37  ? 162.117 143.665 159.896 1.00 113.02 ? 17   DT  J "O4'" 1 
ATOM 9285  C "C3'" . DT  J 6 37  ? 162.309 143.828 157.535 1.00 102.20 ? 17   DT  J "C3'" 1 
ATOM 9286  O "O3'" . DT  J 6 37  ? 162.778 145.031 157.011 1.00 101.85 ? 17   DT  J "O3'" 1 
ATOM 9287  C "C2'" . DT  J 6 37  ? 163.449 143.010 158.152 1.00 100.93 ? 17   DT  J "C2'" 1 
ATOM 9288  C "C1'" . DT  J 6 37  ? 163.466 143.565 159.555 1.00 107.66 ? 17   DT  J "C1'" 1 
ATOM 9289  N N1    . DT  J 6 37  ? 164.130 142.711 160.525 1.00 102.94 ? 17   DT  J N1    1 
ATOM 9290  C C2    . DT  J 6 37  ? 164.685 143.283 161.623 1.00 100.21 ? 17   DT  J C2    1 
ATOM 9291  O O2    . DT  J 6 37  ? 164.647 144.470 161.833 1.00 100.89 ? 17   DT  J O2    1 
ATOM 9292  N N3    . DT  J 6 37  ? 165.288 142.420 162.474 1.00 96.43  ? 17   DT  J N3    1 
ATOM 9293  C C4    . DT  J 6 37  ? 165.389 141.065 162.336 1.00 97.72  ? 17   DT  J C4    1 
ATOM 9294  O O4    . DT  J 6 37  ? 165.950 140.368 163.163 1.00 93.02  ? 17   DT  J O4    1 
ATOM 9295  C C5    . DT  J 6 37  ? 164.784 140.523 161.157 1.00 103.62 ? 17   DT  J C5    1 
ATOM 9296  C C7    . DT  J 6 37  ? 164.832 139.051 160.902 1.00 107.71 ? 17   DT  J C7    1 
ATOM 9297  C C6    . DT  J 6 37  ? 164.187 141.366 160.313 1.00 100.65 ? 17   DT  J C6    1 
ATOM 9298  P P     . DG  J 6 38  ? 163.263 145.108 155.489 1.00 112.55 ? 18   DG  J P     1 
ATOM 9299  O OP1   . DG  J 6 38  ? 162.150 145.691 154.716 1.00 109.75 ? 18   DG  J OP1   1 
ATOM 9300  O OP2   . DG  J 6 38  ? 163.813 143.792 155.110 1.00 103.17 ? 18   DG  J OP2   1 
ATOM 9301  O "O5'" . DG  J 6 38  ? 164.467 146.146 155.549 1.00 114.83 ? 18   DG  J "O5'" 1 
ATOM 9302  C "C5'" . DG  J 6 38  ? 164.335 147.307 156.336 1.00 100.27 ? 18   DG  J "C5'" 1 
ATOM 9303  C "C4'" . DG  J 6 38  ? 165.590 147.559 157.135 1.00 89.28  ? 18   DG  J "C4'" 1 
ATOM 9304  O "O4'" . DG  J 6 38  ? 165.876 146.399 157.956 1.00 95.95  ? 18   DG  J "O4'" 1 
ATOM 9305  C "C3'" . DG  J 6 38  ? 166.844 147.788 156.298 1.00 80.89  ? 18   DG  J "C3'" 1 
ATOM 9306  O "O3'" . DG  J 6 38  ? 167.673 148.741 156.935 1.00 81.29  ? 18   DG  J "O3'" 1 
ATOM 9307  C "C2'" . DG  J 6 38  ? 167.488 146.416 156.316 1.00 82.70  ? 18   DG  J "C2'" 1 
ATOM 9308  C "C1'" . DG  J 6 38  ? 167.210 146.028 157.745 1.00 90.63  ? 18   DG  J "C1'" 1 
ATOM 9309  N N9    . DG  J 6 38  ? 167.347 144.616 157.991 1.00 90.60  ? 18   DG  J N9    1 
ATOM 9310  C C8    . DG  J 6 38  ? 166.946 143.602 157.176 1.00 97.49  ? 18   DG  J C8    1 
ATOM 9311  N N7    . DG  J 6 38  ? 167.203 142.427 157.658 1.00 97.27  ? 18   DG  J N7    1 
ATOM 9312  C C5    . DG  J 6 38  ? 167.817 142.687 158.868 1.00 102.41 ? 18   DG  J C5    1 
ATOM 9313  C C6    . DG  J 6 38  ? 168.319 141.801 159.836 1.00 116.38 ? 18   DG  J C6    1 
ATOM 9314  O O6    . DG  J 6 38  ? 168.316 140.570 159.821 1.00 122.72 ? 18   DG  J O6    1 
ATOM 9315  N N1    . DG  J 6 38  ? 168.861 142.472 160.917 1.00 117.68 ? 18   DG  J N1    1 
ATOM 9316  C C2    . DG  J 6 38  ? 168.915 143.828 161.042 1.00 108.99 ? 18   DG  J C2    1 
ATOM 9317  N N2    . DG  J 6 38  ? 169.475 144.291 162.163 1.00 94.26  ? 18   DG  J N2    1 
ATOM 9318  N N3    . DG  J 6 38  ? 168.446 144.672 160.141 1.00 101.96 ? 18   DG  J N3    1 
ATOM 9319  C C4    . DG  J 6 38  ? 167.914 144.029 159.083 1.00 97.59  ? 18   DG  J C4    1 
ATOM 9320  P P     . DA  J 6 39  ? 168.978 149.303 156.189 1.00 92.24  ? 19   DA  J P     1 
ATOM 9321  O OP1   . DA  J 6 39  ? 168.498 150.099 155.046 1.00 88.00  ? 19   DA  J OP1   1 
ATOM 9322  O OP2   . DA  J 6 39  ? 169.918 148.194 155.957 1.00 77.76  ? 19   DA  J OP2   1 
ATOM 9323  O "O5'" . DA  J 6 39  ? 169.646 150.279 157.256 1.00 84.66  ? 19   DA  J "O5'" 1 
ATOM 9324  C "C5'" . DA  J 6 39  ? 169.343 150.139 158.617 1.00 82.50  ? 19   DA  J "C5'" 1 
ATOM 9325  C "C4'" . DA  J 6 39  ? 170.402 149.328 159.329 1.00 89.99  ? 19   DA  J "C4'" 1 
ATOM 9326  O "O4'" . DA  J 6 39  ? 170.147 147.910 159.165 1.00 91.32  ? 19   DA  J "O4'" 1 
ATOM 9327  C "C3'" . DA  J 6 39  ? 171.831 149.546 158.842 1.00 91.94  ? 19   DA  J "C3'" 1 
ATOM 9328  O "O3'" . DA  J 6 39  ? 172.669 149.717 159.949 1.00 92.58  ? 19   DA  J "O3'" 1 
ATOM 9329  C "C2'" . DA  J 6 39  ? 172.141 148.241 158.121 1.00 82.37  ? 19   DA  J "C2'" 1 
ATOM 9330  C "C1'" . DA  J 6 39  ? 171.381 147.275 158.988 1.00 85.60  ? 19   DA  J "C1'" 1 
ATOM 9331  N N9    . DA  J 6 39  ? 171.168 145.958 158.394 1.00 85.56  ? 19   DA  J N9    1 
ATOM 9332  C C8    . DA  J 6 39  ? 170.638 145.680 157.172 1.00 81.73  ? 19   DA  J C8    1 
ATOM 9333  N N7    . DA  J 6 39  ? 170.552 144.400 156.911 1.00 87.61  ? 19   DA  J N7    1 
ATOM 9334  C C5    . DA  J 6 39  ? 171.061 143.795 158.043 1.00 89.64  ? 19   DA  J C5    1 
ATOM 9335  C C6    . DA  J 6 39  ? 171.249 142.444 158.393 1.00 85.92  ? 19   DA  J C6    1 
ATOM 9336  N N6    . DA  J 6 39  ? 170.929 141.430 157.592 1.00 78.22  ? 19   DA  J N6    1 
ATOM 9337  N N1    . DA  J 6 39  ? 171.778 142.175 159.601 1.00 90.47  ? 19   DA  J N1    1 
ATOM 9338  C C2    . DA  J 6 39  ? 172.101 143.200 160.394 1.00 78.89  ? 19   DA  J C2    1 
ATOM 9339  N N3    . DA  J 6 39  ? 171.974 144.507 160.172 1.00 89.96  ? 19   DA  J N3    1 
ATOM 9340  C C4    . DA  J 6 39  ? 171.444 144.738 158.967 1.00 91.48  ? 19   DA  J C4    1 
ATOM 9341  P P     . DC  J 6 40  ? 174.170 150.234 159.752 1.00 82.54  ? 20   DC  J P     1 
ATOM 9342  O OP1   . DC  J 6 40  ? 174.263 151.546 160.416 1.00 74.96  ? 20   DC  J OP1   1 
ATOM 9343  O OP2   . DC  J 6 40  ? 174.554 150.097 158.339 1.00 72.34  ? 20   DC  J OP2   1 
ATOM 9344  O "O5'" . DC  J 6 40  ? 175.028 149.199 160.590 1.00 80.91  ? 20   DC  J "O5'" 1 
ATOM 9345  C "C5'" . DC  J 6 40  ? 174.987 149.270 161.979 1.00 76.82  ? 20   DC  J "C5'" 1 
ATOM 9346  C "C4'" . DC  J 6 40  ? 175.536 148.015 162.607 1.00 72.46  ? 20   DC  J "C4'" 1 
ATOM 9347  O "O4'" . DC  J 6 40  ? 174.967 146.863 161.957 1.00 80.05  ? 20   DC  J "O4'" 1 
ATOM 9348  C "C3'" . DC  J 6 40  ? 177.034 147.850 162.518 1.00 68.35  ? 20   DC  J "C3'" 1 
ATOM 9349  O "O3'" . DC  J 6 40  ? 177.468 147.182 163.655 1.00 80.99  ? 20   DC  J "O3'" 1 
ATOM 9350  C "C2'" . DC  J 6 40  ? 177.192 146.994 161.278 1.00 69.38  ? 20   DC  J "C2'" 1 
ATOM 9351  C "C1'" . DC  J 6 40  ? 175.981 146.087 161.383 1.00 72.84  ? 20   DC  J "C1'" 1 
ATOM 9352  N N1    . DC  J 6 40  ? 175.489 145.621 160.083 1.00 84.03  ? 20   DC  J N1    1 
ATOM 9353  C C2    . DC  J 6 40  ? 175.553 144.273 159.762 1.00 90.35  ? 20   DC  J C2    1 
ATOM 9354  O O2    . DC  J 6 40  ? 176.029 143.486 160.576 1.00 83.31  ? 20   DC  J O2    1 
ATOM 9355  N N3    . DC  J 6 40  ? 175.100 143.864 158.559 1.00 95.82  ? 20   DC  J N3    1 
ATOM 9356  C C4    . DC  J 6 40  ? 174.589 144.745 157.708 1.00 94.79  ? 20   DC  J C4    1 
ATOM 9357  N N4    . DC  J 6 40  ? 174.147 144.303 156.531 1.00 101.08 ? 20   DC  J N4    1 
ATOM 9358  C C5    . DC  J 6 40  ? 174.516 146.120 158.020 1.00 81.38  ? 20   DC  J C5    1 
ATOM 9359  C C6    . DC  J 6 40  ? 174.962 146.511 159.210 1.00 78.11  ? 20   DC  J C6    1 
ATOM 9360  P P     . DA  J 6 41  ? 178.991 147.292 164.123 1.00 86.71  ? 21   DA  J P     1 
ATOM 9361  O OP1   . DA  J 6 41  ? 179.013 147.837 165.488 1.00 95.54  ? 21   DA  J OP1   1 
ATOM 9362  O OP2   . DA  J 6 41  ? 179.736 147.957 163.043 1.00 84.43  ? 21   DA  J OP2   1 
ATOM 9363  O "O5'" . DA  J 6 41  ? 179.439 145.777 164.194 1.00 86.42  ? 21   DA  J "O5'" 1 
ATOM 9364  C "C5'" . DA  J 6 41  ? 178.519 144.788 163.814 1.00 77.29  ? 21   DA  J "C5'" 1 
ATOM 9365  C "C4'" . DA  J 6 41  ? 179.037 143.423 164.158 1.00 78.13  ? 21   DA  J "C4'" 1 
ATOM 9366  O "O4'" . DA  J 6 41  ? 178.668 142.516 163.106 1.00 83.26  ? 21   DA  J "O4'" 1 
ATOM 9367  C "C3'" . DA  J 6 41  ? 180.533 143.335 164.190 1.00 82.68  ? 21   DA  J "C3'" 1 
ATOM 9368  O "O3'" . DA  J 6 41  ? 180.911 142.110 164.779 1.00 99.03  ? 21   DA  J "O3'" 1 
ATOM 9369  C "C2'" . DA  J 6 41  ? 180.831 143.354 162.703 1.00 72.49  ? 21   DA  J "C2'" 1 
ATOM 9370  C "C1'" . DA  J 6 41  ? 179.709 142.469 162.159 1.00 85.65  ? 21   DA  J "C1'" 1 
ATOM 9371  N N9    . DA  J 6 41  ? 179.168 142.917 160.890 1.00 90.34  ? 21   DA  J N9    1 
ATOM 9372  C C8    . DA  J 6 41  ? 179.018 144.197 160.471 1.00 90.37  ? 21   DA  J C8    1 
ATOM 9373  N N7    . DA  J 6 41  ? 178.485 144.304 159.282 1.00 83.81  ? 21   DA  J N7    1 
ATOM 9374  C C5    . DA  J 6 41  ? 178.263 143.001 158.903 1.00 85.16  ? 21   DA  J C5    1 
ATOM 9375  C C6    . DA  J 6 41  ? 177.711 142.439 157.749 1.00 87.90  ? 21   DA  J C6    1 
ATOM 9376  N N6    . DA  J 6 41  ? 177.274 143.166 156.729 1.00 99.27  ? 21   DA  J N6    1 
ATOM 9377  N N1    . DA  J 6 41  ? 177.629 141.100 157.678 1.00 79.65  ? 21   DA  J N1    1 
ATOM 9378  C C2    . DA  J 6 41  ? 178.073 140.384 158.705 1.00 81.55  ? 21   DA  J C2    1 
ATOM 9379  N N3    . DA  J 6 41  ? 178.608 140.803 159.847 1.00 86.53  ? 21   DA  J N3    1 
ATOM 9380  C C4    . DA  J 6 41  ? 178.667 142.135 159.885 1.00 87.90  ? 21   DA  J C4    1 
ATOM 9381  P P     . DC  J 6 42  ? 182.400 141.888 165.334 1.00 117.65 ? 22   DC  J P     1 
ATOM 9382  O OP1   . DC  J 6 42  ? 182.287 141.570 166.770 1.00 113.86 ? 22   DC  J OP1   1 
ATOM 9383  O OP2   . DC  J 6 42  ? 183.227 143.037 164.919 1.00 112.86 ? 22   DC  J OP2   1 
ATOM 9384  O "O5'" . DC  J 6 42  ? 182.901 140.588 164.543 1.00 91.92  ? 22   DC  J "O5'" 1 
ATOM 9385  C "C5'" . DC  J 6 42  ? 182.170 139.377 164.658 1.00 79.14  ? 22   DC  J "C5'" 1 
ATOM 9386  C "C4'" . DC  J 6 42  ? 182.412 138.454 163.475 1.00 87.89  ? 22   DC  J "C4'" 1 
ATOM 9387  O "O4'" . DC  J 6 42  ? 181.737 138.955 162.293 1.00 96.10  ? 22   DC  J "O4'" 1 
ATOM 9388  C "C3'" . DC  J 6 42  ? 183.871 138.254 163.075 1.00 101.55 ? 22   DC  J "C3'" 1 
ATOM 9389  O "O3'" . DC  J 6 42  ? 184.074 136.877 162.764 1.00 121.05 ? 22   DC  J "O3'" 1 
ATOM 9390  C "C2'" . DC  J 6 42  ? 184.002 139.140 161.838 1.00 99.43  ? 22   DC  J "C2'" 1 
ATOM 9391  C "C1'" . DC  J 6 42  ? 182.637 138.954 161.210 1.00 98.53  ? 22   DC  J "C1'" 1 
ATOM 9392  N N1    . DC  J 6 42  ? 182.242 140.039 160.315 1.00 101.61 ? 22   DC  J N1    1 
ATOM 9393  C C2    . DC  J 6 42  ? 181.546 139.752 159.146 1.00 116.73 ? 22   DC  J C2    1 
ATOM 9394  O O2    . DC  J 6 42  ? 181.298 138.584 158.869 1.00 125.43 ? 22   DC  J O2    1 
ATOM 9395  N N3    . DC  J 6 42  ? 181.167 140.764 158.345 1.00 114.92 ? 22   DC  J N3    1 
ATOM 9396  C C4    . DC  J 6 42  ? 181.457 142.014 158.681 1.00 112.75 ? 22   DC  J C4    1 
ATOM 9397  N N4    . DC  J 6 42  ? 181.060 142.990 157.864 1.00 114.93 ? 22   DC  J N4    1 
ATOM 9398  C C5    . DC  J 6 42  ? 182.163 142.324 159.869 1.00 101.12 ? 22   DC  J C5    1 
ATOM 9399  C C6    . DC  J 6 42  ? 182.530 141.313 160.651 1.00 95.76  ? 22   DC  J C6    1 
ATOM 9400  P P     . DG  J 6 43  ? 185.427 136.369 162.065 1.00 138.71 ? 23   DG  J P     1 
ATOM 9401  O OP1   . DG  J 6 43  ? 185.567 134.937 162.398 1.00 134.76 ? 23   DG  J OP1   1 
ATOM 9402  O OP2   . DG  J 6 43  ? 186.511 137.310 162.409 1.00 127.87 ? 23   DG  J OP2   1 
ATOM 9403  O "O5'" . DG  J 6 43  ? 185.123 136.489 160.500 1.00 99.17  ? 23   DG  J "O5'" 1 
ATOM 9404  C "C5'" . DG  J 6 43  ? 184.007 135.815 159.946 1.00 98.25  ? 23   DG  J "C5'" 1 
ATOM 9405  C "C4'" . DG  J 6 43  ? 184.293 135.370 158.527 1.00 116.68 ? 23   DG  J "C4'" 1 
ATOM 9406  O "O4'" . DG  J 6 43  ? 183.784 136.349 157.588 1.00 122.11 ? 23   DG  J "O4'" 1 
ATOM 9407  C "C3'" . DG  J 6 43  ? 185.762 135.209 158.187 1.00 127.87 ? 23   DG  J "C3'" 1 
ATOM 9408  O "O3'" . DG  J 6 43  ? 185.902 134.192 157.227 1.00 136.56 ? 23   DG  J "O3'" 1 
ATOM 9409  C "C2'" . DG  J 6 43  ? 186.112 136.568 157.599 1.00 127.20 ? 23   DG  J "C2'" 1 
ATOM 9410  C "C1'" . DG  J 6 43  ? 184.845 136.887 156.829 1.00 126.09 ? 23   DG  J "C1'" 1 
ATOM 9411  N N9    . DG  J 6 43  ? 184.603 138.300 156.709 1.00 126.83 ? 23   DG  J N9    1 
ATOM 9412  C C8    . DG  J 6 43  ? 185.025 139.272 157.566 1.00 123.24 ? 23   DG  J C8    1 
ATOM 9413  N N7    . DG  J 6 43  ? 184.629 140.460 157.232 1.00 117.60 ? 23   DG  J N7    1 
ATOM 9414  C C5    . DG  J 6 43  ? 183.890 140.255 156.082 1.00 114.96 ? 23   DG  J C5    1 
ATOM 9415  C C6    . DG  J 6 43  ? 183.204 141.177 155.275 1.00 122.18 ? 23   DG  J C6    1 
ATOM 9416  O O6    . DG  J 6 43  ? 183.138 142.398 155.395 1.00 122.70 ? 23   DG  J O6    1 
ATOM 9417  N N1    . DG  J 6 43  ? 182.598 140.566 154.197 1.00 124.98 ? 23   DG  J N1    1 
ATOM 9418  C C2    . DG  J 6 43  ? 182.601 139.224 153.960 1.00 114.46 ? 23   DG  J C2    1 
ATOM 9419  N N2    . DG  J 6 43  ? 181.962 138.844 152.852 1.00 106.84 ? 23   DG  J N2    1 
ATOM 9420  N N3    . DG  J 6 43  ? 183.244 138.339 154.706 1.00 105.85 ? 23   DG  J N3    1 
ATOM 9421  C C4    . DG  J 6 43  ? 183.857 138.929 155.753 1.00 115.10 ? 23   DG  J C4    1 
ATOM 9422  P P     . DT  J 6 44  ? 187.287 133.399 157.080 1.00 139.39 ? 24   DT  J P     1 
ATOM 9423  O OP1   . DT  J 6 44  ? 187.536 132.679 158.346 1.00 137.94 ? 24   DT  J OP1   1 
ATOM 9424  O OP2   . DT  J 6 44  ? 188.295 134.344 156.561 1.00 136.69 ? 24   DT  J OP2   1 
ATOM 9425  O "O5'" . DT  J 6 44  ? 186.971 132.336 155.938 1.00 111.45 ? 24   DT  J "O5'" 1 
ATOM 9426  C "C5'" . DT  J 6 44  ? 185.851 132.531 155.090 1.00 113.79 ? 24   DT  J "C5'" 1 
ATOM 9427  C "C4'" . DT  J 6 44  ? 186.305 132.865 153.689 1.00 118.12 ? 24   DT  J "C4'" 1 
ATOM 9428  O "O4'" . DT  J 6 44  ? 185.917 134.223 153.365 1.00 126.65 ? 24   DT  J "O4'" 1 
ATOM 9429  C "C3'" . DT  J 6 44  ? 187.811 132.784 153.478 1.00 123.06 ? 24   DT  J "C3'" 1 
ATOM 9430  O "O3'" . DT  J 6 44  ? 188.091 132.127 152.260 1.00 132.93 ? 24   DT  J "O3'" 1 
ATOM 9431  C "C2'" . DT  J 6 44  ? 188.249 134.247 153.452 1.00 123.07 ? 24   DT  J "C2'" 1 
ATOM 9432  C "C1'" . DT  J 6 44  ? 187.029 134.939 152.880 1.00 128.79 ? 24   DT  J "C1'" 1 
ATOM 9433  N N1    . DT  J 6 44  ? 186.902 136.341 153.330 1.00 135.34 ? 24   DT  J N1    1 
ATOM 9434  C C2    . DT  J 6 44  ? 185.776 137.048 153.009 1.00 136.07 ? 24   DT  J C2    1 
ATOM 9435  O O2    . DT  J 6 44  ? 184.864 136.585 152.358 1.00 140.84 ? 24   DT  J O2    1 
ATOM 9436  N N3    . DT  J 6 44  ? 185.752 138.325 153.477 1.00 122.64 ? 24   DT  J N3    1 
ATOM 9437  C C4    . DT  J 6 44  ? 186.720 138.952 154.218 1.00 119.65 ? 24   DT  J C4    1 
ATOM 9438  O O4    . DT  J 6 44  ? 186.604 140.106 154.593 1.00 120.25 ? 24   DT  J O4    1 
ATOM 9439  C C5    . DT  J 6 44  ? 187.878 138.155 154.523 1.00 129.54 ? 24   DT  J C5    1 
ATOM 9440  C C7    . DT  J 6 44  ? 188.998 138.730 155.324 1.00 134.66 ? 24   DT  J C7    1 
ATOM 9441  C C6    . DT  J 6 44  ? 187.913 136.903 154.071 1.00 133.07 ? 24   DT  J C6    1 
ATOM 9442  P P     . DG  J 6 45  ? 189.570 132.165 151.638 1.00 133.04 ? 25   DG  J P     1 
ATOM 9443  O OP1   . DG  J 6 45  ? 189.732 130.950 150.819 1.00 124.22 ? 25   DG  J OP1   1 
ATOM 9444  O OP2   . DG  J 6 45  ? 190.537 132.403 152.729 1.00 129.05 ? 25   DG  J OP2   1 
ATOM 9445  O "O5'" . DG  J 6 45  ? 189.535 133.434 150.665 1.00 135.53 ? 25   DG  J "O5'" 1 
ATOM 9446  C "C5'" . DG  J 6 45  ? 188.596 133.476 149.598 1.00 136.58 ? 25   DG  J "C5'" 1 
ATOM 9447  C "C4'" . DG  J 6 45  ? 188.827 134.684 148.712 1.00 134.73 ? 25   DG  J "C4'" 1 
ATOM 9448  O "O4'" . DG  J 6 45  ? 188.859 135.882 149.525 1.00 132.03 ? 25   DG  J "O4'" 1 
ATOM 9449  C "C3'" . DG  J 6 45  ? 190.145 134.692 147.946 1.00 130.85 ? 25   DG  J "C3'" 1 
ATOM 9450  O "O3'" . DG  J 6 45  ? 189.973 135.420 146.738 1.00 126.41 ? 25   DG  J "O3'" 1 
ATOM 9451  C "C2'" . DG  J 6 45  ? 191.046 135.450 148.904 1.00 131.91 ? 25   DG  J "C2'" 1 
ATOM 9452  C "C1'" . DG  J 6 45  ? 190.085 136.539 149.312 1.00 131.61 ? 25   DG  J "C1'" 1 
ATOM 9453  N N9    . DG  J 6 45  ? 190.441 137.244 150.522 1.00 123.77 ? 25   DG  J N9    1 
ATOM 9454  C C8    . DG  J 6 45  ? 190.852 136.706 151.716 1.00 120.88 ? 25   DG  J C8    1 
ATOM 9455  N N7    . DG  J 6 45  ? 191.075 137.603 152.632 1.00 111.69 ? 25   DG  J N7    1 
ATOM 9456  C C5    . DG  J 6 45  ? 190.785 138.805 152.002 1.00 107.82 ? 25   DG  J C5    1 
ATOM 9457  C C6    . DG  J 6 45  ? 190.842 140.122 152.490 1.00 99.72  ? 25   DG  J C6    1 
ATOM 9458  O O6    . DG  J 6 45  ? 191.172 140.506 153.617 1.00 99.65  ? 25   DG  J O6    1 
ATOM 9459  N N1    . DG  J 6 45  ? 190.466 141.043 151.521 1.00 94.14  ? 25   DG  J N1    1 
ATOM 9460  C C2    . DG  J 6 45  ? 190.080 140.726 150.242 1.00 95.81  ? 25   DG  J C2    1 
ATOM 9461  N N2    . DG  J 6 45  ? 189.750 141.748 149.450 1.00 96.46  ? 25   DG  J N2    1 
ATOM 9462  N N3    . DG  J 6 45  ? 190.027 139.498 149.774 1.00 96.93  ? 25   DG  J N3    1 
ATOM 9463  C C4    . DG  J 6 45  ? 190.390 138.594 150.707 1.00 108.36 ? 25   DG  J C4    1 
ATOM 9464  P P     . DC  J 6 46  ? 191.009 135.248 145.524 1.00 132.08 ? 26   DC  J P     1 
ATOM 9465  O OP1   . DC  J 6 46  ? 190.218 135.104 144.285 1.00 129.50 ? 26   DC  J OP1   1 
ATOM 9466  O OP2   . DC  J 6 46  ? 191.974 134.202 145.910 1.00 132.87 ? 26   DC  J OP2   1 
ATOM 9467  O "O5'" . DC  J 6 46  ? 191.803 136.636 145.482 1.00 149.78 ? 26   DC  J "O5'" 1 
ATOM 9468  C "C5'" . DC  J 6 46  ? 191.411 137.699 146.326 1.00 143.42 ? 26   DC  J "C5'" 1 
ATOM 9469  C "C4'" . DC  J 6 46  ? 191.730 139.034 145.702 1.00 133.50 ? 26   DC  J "C4'" 1 
ATOM 9470  O "O4'" . DC  J 6 46  ? 192.040 139.966 146.751 1.00 130.38 ? 26   DC  J "O4'" 1 
ATOM 9471  C "C3'" . DC  J 6 46  ? 192.970 139.048 144.852 1.00 131.28 ? 26   DC  J "C3'" 1 
ATOM 9472  O "O3'" . DC  J 6 46  ? 193.021 140.259 144.152 1.00 133.56 ? 26   DC  J "O3'" 1 
ATOM 9473  C "C2'" . DC  J 6 46  ? 194.026 139.020 145.929 1.00 129.11 ? 26   DC  J "C2'" 1 
ATOM 9474  C "C1'" . DC  J 6 46  ? 193.442 140.045 146.888 1.00 126.09 ? 26   DC  J "C1'" 1 
ATOM 9475  N N1    . DC  J 6 46  ? 193.753 139.795 148.271 1.00 116.48 ? 26   DC  J N1    1 
ATOM 9476  C C2    . DC  J 6 46  ? 193.652 140.838 149.164 1.00 114.07 ? 26   DC  J C2    1 
ATOM 9477  O O2    . DC  J 6 46  ? 193.320 141.945 148.734 1.00 115.55 ? 26   DC  J O2    1 
ATOM 9478  N N3    . DC  J 6 46  ? 193.929 140.620 150.462 1.00 107.44 ? 26   DC  J N3    1 
ATOM 9479  C C4    . DC  J 6 46  ? 194.285 139.407 150.864 1.00 104.68 ? 26   DC  J C4    1 
ATOM 9480  N N4    . DC  J 6 46  ? 194.548 139.235 152.155 1.00 94.48  ? 26   DC  J N4    1 
ATOM 9481  C C5    . DC  J 6 46  ? 194.386 138.317 149.960 1.00 114.74 ? 26   DC  J C5    1 
ATOM 9482  C C6    . DC  J 6 46  ? 194.107 138.556 148.680 1.00 114.71 ? 26   DC  J C6    1 
ATOM 9483  P P     . DC  J 6 47  ? 193.692 140.310 142.702 1.00 125.04 ? 27   DC  J P     1 
ATOM 9484  O OP1   . DC  J 6 47  ? 192.597 140.486 141.728 1.00 112.24 ? 27   DC  J OP1   1 
ATOM 9485  O OP2   . DC  J 6 47  ? 194.606 139.155 142.611 1.00 124.24 ? 27   DC  J OP2   1 
ATOM 9486  O "O5'" . DC  J 6 47  ? 194.577 141.633 142.731 1.00 142.52 ? 27   DC  J "O5'" 1 
ATOM 9487  C "C5'" . DC  J 6 47  ? 193.957 142.880 142.897 1.00 126.04 ? 27   DC  J "C5'" 1 
ATOM 9488  C "C4'" . DC  J 6 47  ? 194.696 143.704 143.924 1.00 110.33 ? 27   DC  J "C4'" 1 
ATOM 9489  O "O4'" . DC  J 6 47  ? 194.802 142.963 145.153 1.00 107.02 ? 27   DC  J "O4'" 1 
ATOM 9490  C "C3'" . DC  J 6 47  ? 196.131 144.076 143.544 1.00 109.13 ? 27   DC  J "C3'" 1 
ATOM 9491  O "O3'" . DC  J 6 47  ? 196.233 145.462 143.401 1.00 111.57 ? 27   DC  J "O3'" 1 
ATOM 9492  C "C2'" . DC  J 6 47  ? 196.975 143.580 144.722 1.00 106.16 ? 27   DC  J "C2'" 1 
ATOM 9493  C "C1'" . DC  J 6 47  ? 195.937 143.425 145.811 1.00 103.20 ? 27   DC  J "C1'" 1 
ATOM 9494  N N1    . DC  J 6 47  ? 196.330 142.466 146.846 1.00 95.13  ? 27   DC  J N1    1 
ATOM 9495  C C2    . DC  J 6 47  ? 196.441 142.901 148.158 1.00 100.65 ? 27   DC  J C2    1 
ATOM 9496  O O2    . DC  J 6 47  ? 196.179 144.075 148.416 1.00 105.46 ? 27   DC  J O2    1 
ATOM 9497  N N3    . DC  J 6 47  ? 196.821 142.031 149.106 1.00 98.86  ? 27   DC  J N3    1 
ATOM 9498  C C4    . DC  J 6 47  ? 197.094 140.780 148.777 1.00 107.33 ? 27   DC  J C4    1 
ATOM 9499  N N4    . DC  J 6 47  ? 197.466 139.956 149.751 1.00 112.20 ? 27   DC  J N4    1 
ATOM 9500  C C5    . DC  J 6 47  ? 196.996 140.315 147.439 1.00 101.94 ? 27   DC  J C5    1 
ATOM 9501  C C6    . DC  J 6 47  ? 196.624 141.190 146.511 1.00 94.79  ? 27   DC  J C6    1 
ATOM 9502  P P     . DT  J 6 48  ? 197.468 146.106 142.608 1.00 115.82 ? 28   DT  J P     1 
ATOM 9503  O OP1   . DT  J 6 48  ? 197.095 146.173 141.183 1.00 115.77 ? 28   DT  J OP1   1 
ATOM 9504  O OP2   . DT  J 6 48  ? 198.707 145.420 143.015 1.00 105.30 ? 28   DT  J OP2   1 
ATOM 9505  O "O5'" . DT  J 6 48  ? 197.529 147.586 143.178 1.00 127.48 ? 28   DT  J "O5'" 1 
ATOM 9506  C "C5'" . DT  J 6 48  ? 196.734 147.929 144.289 1.00 120.12 ? 28   DT  J "C5'" 1 
ATOM 9507  C "C4'" . DT  J 6 48  ? 197.588 148.464 145.408 1.00 110.65 ? 28   DT  J "C4'" 1 
ATOM 9508  O "O4'" . DT  J 6 48  ? 198.082 147.368 146.218 1.00 111.64 ? 28   DT  J "O4'" 1 
ATOM 9509  C "C3'" . DT  J 6 48  ? 198.828 149.217 144.952 1.00 97.68  ? 28   DT  J "C3'" 1 
ATOM 9510  O "O3'" . DT  J 6 48  ? 199.080 150.262 145.856 1.00 91.91  ? 28   DT  J "O3'" 1 
ATOM 9511  C "C2'" . DT  J 6 48  ? 199.900 148.142 145.056 1.00 96.45  ? 28   DT  J "C2'" 1 
ATOM 9512  C "C1'" . DT  J 6 48  ? 199.472 147.514 146.356 1.00 104.30 ? 28   DT  J "C1'" 1 
ATOM 9513  N N1    . DT  J 6 48  ? 200.055 146.199 146.626 1.00 100.94 ? 28   DT  J N1    1 
ATOM 9514  C C2    . DT  J 6 48  ? 200.517 145.927 147.882 1.00 92.33  ? 28   DT  J C2    1 
ATOM 9515  O O2    . DT  J 6 48  ? 200.470 146.724 148.784 1.00 88.28  ? 28   DT  J O2    1 
ATOM 9516  N N3    . DT  J 6 48  ? 201.030 144.680 148.051 1.00 99.60  ? 28   DT  J N3    1 
ATOM 9517  C C4    . DT  J 6 48  ? 201.122 143.692 147.105 1.00 105.08 ? 28   DT  J C4    1 
ATOM 9518  O O4    . DT  J 6 48  ? 201.605 142.594 147.353 1.00 107.06 ? 28   DT  J O4    1 
ATOM 9519  C C5    . DT  J 6 48  ? 200.610 144.041 145.801 1.00 109.76 ? 28   DT  J C5    1 
ATOM 9520  C C7    . DT  J 6 48  ? 200.655 143.051 144.683 1.00 116.73 ? 28   DT  J C7    1 
ATOM 9521  C C6    . DT  J 6 48  ? 200.105 145.264 145.630 1.00 107.22 ? 28   DT  J C6    1 
ATOM 9522  P P     . DG  J 6 49  ? 198.360 151.684 145.680 1.00 99.61  ? 29   DG  J P     1 
ATOM 9523  O OP1   . DG  J 6 49  ? 196.900 151.467 145.694 1.00 92.77  ? 29   DG  J OP1   1 
ATOM 9524  O OP2   . DG  J 6 49  ? 198.991 152.374 144.540 1.00 93.60  ? 29   DG  J OP2   1 
ATOM 9525  O "O5'" . DG  J 6 49  ? 198.751 152.470 147.007 1.00 88.97  ? 29   DG  J "O5'" 1 
ATOM 9526  C "C5'" . DG  J 6 49  ? 197.931 152.362 148.140 1.00 81.72  ? 29   DG  J "C5'" 1 
ATOM 9527  C "C4'" . DG  J 6 49  ? 198.728 151.916 149.343 1.00 72.91  ? 29   DG  J "C4'" 1 
ATOM 9528  O "O4'" . DG  J 6 49  ? 199.413 150.677 149.047 1.00 77.91  ? 29   DG  J "O4'" 1 
ATOM 9529  C "C3'" . DG  J 6 49  ? 199.805 152.882 149.793 1.00 76.09  ? 29   DG  J "C3'" 1 
ATOM 9530  O "O3'" . DG  J 6 49  ? 199.860 152.866 151.183 1.00 89.48  ? 29   DG  J "O3'" 1 
ATOM 9531  C "C2'" . DG  J 6 49  ? 201.061 152.279 149.184 1.00 72.54  ? 29   DG  J "C2'" 1 
ATOM 9532  C "C1'" . DG  J 6 49  ? 200.771 150.814 149.365 1.00 77.64  ? 29   DG  J "C1'" 1 
ATOM 9533  N N9    . DG  J 6 49  ? 201.518 149.952 148.476 1.00 84.33  ? 29   DG  J N9    1 
ATOM 9534  C C8    . DG  J 6 49  ? 201.628 150.068 147.128 1.00 90.20  ? 29   DG  J C8    1 
ATOM 9535  N N7    . DG  J 6 49  ? 202.346 149.135 146.588 1.00 87.46  ? 29   DG  J N7    1 
ATOM 9536  C C5    . DG  J 6 49  ? 202.728 148.350 147.648 1.00 88.07  ? 29   DG  J C5    1 
ATOM 9537  C C6    . DG  J 6 49  ? 203.511 147.188 147.670 1.00 102.13 ? 29   DG  J C6    1 
ATOM 9538  O O6    . DG  J 6 49  ? 204.050 146.616 146.724 1.00 110.92 ? 29   DG  J O6    1 
ATOM 9539  N N1    . DG  J 6 49  ? 203.669 146.700 148.952 1.00 93.91  ? 29   DG  J N1    1 
ATOM 9540  C C2    . DG  J 6 49  ? 203.122 147.258 150.067 1.00 88.98  ? 29   DG  J C2    1 
ATOM 9541  N N2    . DG  J 6 49  ? 203.380 146.643 151.222 1.00 101.95 ? 29   DG  J N2    1 
ATOM 9542  N N3    . DG  J 6 49  ? 202.381 148.350 150.059 1.00 79.02  ? 29   DG  J N3    1 
ATOM 9543  C C4    . DG  J 6 49  ? 202.228 148.839 148.816 1.00 80.90  ? 29   DG  J C4    1 
ATOM 9544  P P     . DG  J 6 50  ? 200.663 154.003 151.970 1.00 93.37  ? 30   DG  J P     1 
ATOM 9545  O OP1   . DG  J 6 50  ? 199.694 154.738 152.803 1.00 84.23  ? 30   DG  J OP1   1 
ATOM 9546  O OP2   . DG  J 6 50  ? 201.491 154.739 151.000 1.00 84.34  ? 30   DG  J OP2   1 
ATOM 9547  O "O5'" . DG  J 6 50  ? 201.623 153.170 152.924 1.00 63.27  ? 30   DG  J "O5'" 1 
ATOM 9548  C "C5'" . DG  J 6 50  ? 201.057 152.301 153.868 1.00 70.28  ? 30   DG  J "C5'" 1 
ATOM 9549  C "C4'" . DG  J 6 50  ? 202.094 151.360 154.428 1.00 77.91  ? 30   DG  J "C4'" 1 
ATOM 9550  O "O4'" . DG  J 6 50  ? 202.544 150.471 153.384 1.00 85.66  ? 30   DG  J "O4'" 1 
ATOM 9551  C "C3'" . DG  J 6 50  ? 203.337 152.032 154.970 1.00 80.07  ? 30   DG  J "C3'" 1 
ATOM 9552  O "O3'" . DG  J 6 50  ? 203.802 151.314 156.074 1.00 83.84  ? 30   DG  J "O3'" 1 
ATOM 9553  C "C2'" . DG  J 6 50  ? 204.299 151.936 153.799 1.00 86.31  ? 30   DG  J "C2'" 1 
ATOM 9554  C "C1'" . DG  J 6 50  ? 203.931 150.584 153.230 1.00 94.06  ? 30   DG  J "C1'" 1 
ATOM 9555  N N9    . DG  J 6 50  ? 204.230 150.441 151.817 1.00 100.46 ? 30   DG  J N9    1 
ATOM 9556  C C8    . DG  J 6 50  ? 203.798 151.240 150.800 1.00 105.73 ? 30   DG  J C8    1 
ATOM 9557  N N7    . DG  J 6 50  ? 204.215 150.859 149.630 1.00 104.58 ? 30   DG  J N7    1 
ATOM 9558  C C5    . DG  J 6 50  ? 204.973 149.738 149.896 1.00 103.36 ? 30   DG  J C5    1 
ATOM 9559  C C6    . DG  J 6 50  ? 205.671 148.892 149.025 1.00 102.89 ? 30   DG  J C6    1 
ATOM 9560  O O6    . DG  J 6 50  ? 205.771 148.962 147.801 1.00 104.54 ? 30   DG  J O6    1 
ATOM 9561  N N1    . DG  J 6 50  ? 206.287 147.862 149.701 1.00 92.01  ? 30   DG  J N1    1 
ATOM 9562  C C2    . DG  J 6 50  ? 206.234 147.677 151.047 1.00 90.37  ? 30   DG  J C2    1 
ATOM 9563  N N2    . DG  J 6 50  ? 206.907 146.638 151.525 1.00 97.98  ? 30   DG  J N2    1 
ATOM 9564  N N3    . DG  J 6 50  ? 205.585 148.461 151.875 1.00 91.91  ? 30   DG  J N3    1 
ATOM 9565  C C4    . DG  J 6 50  ? 204.977 149.463 151.233 1.00 97.76  ? 30   DG  J C4    1 
ATOM 9566  P P     . DA  J 6 51  ? 204.812 151.998 157.110 1.00 83.60  ? 31   DA  J P     1 
ATOM 9567  O OP1   . DA  J 6 51  ? 204.156 152.034 158.429 1.00 71.26  ? 31   DA  J OP1   1 
ATOM 9568  O OP2   . DA  J 6 51  ? 205.325 153.243 156.516 1.00 84.04  ? 31   DA  J OP2   1 
ATOM 9569  O "O5'" . DA  J 6 51  ? 206.008 150.960 157.177 1.00 97.55  ? 31   DA  J "O5'" 1 
ATOM 9570  C "C5'" . DA  J 6 51  ? 205.739 149.652 157.600 1.00 99.45  ? 31   DA  J "C5'" 1 
ATOM 9571  C "C4'" . DA  J 6 51  ? 206.879 148.730 157.263 1.00 92.33  ? 31   DA  J "C4'" 1 
ATOM 9572  O "O4'" . DA  J 6 51  ? 206.912 148.506 155.840 1.00 91.42  ? 31   DA  J "O4'" 1 
ATOM 9573  C "C3'" . DA  J 6 51  ? 208.243 149.249 157.650 1.00 88.09  ? 31   DA  J "C3'" 1 
ATOM 9574  O "O3'" . DA  J 6 51  ? 208.974 148.213 158.199 1.00 104.93 ? 31   DA  J "O3'" 1 
ATOM 9575  C "C2'" . DA  J 6 51  ? 208.834 149.710 156.329 1.00 76.82  ? 31   DA  J "C2'" 1 
ATOM 9576  C "C1'" . DA  J 6 51  ? 208.193 148.755 155.347 1.00 84.94  ? 31   DA  J "C1'" 1 
ATOM 9577  N N9    . DA  J 6 51  ? 208.040 149.334 154.032 1.00 95.66  ? 31   DA  J N9    1 
ATOM 9578  C C8    . DA  J 6 51  ? 207.267 150.392 153.703 1.00 104.75 ? 31   DA  J C8    1 
ATOM 9579  N N7    . DA  J 6 51  ? 207.319 150.707 152.441 1.00 100.81 ? 31   DA  J N7    1 
ATOM 9580  C C5    . DA  J 6 51  ? 208.191 149.792 151.912 1.00 98.56  ? 31   DA  J C5    1 
ATOM 9581  C C6    . DA  J 6 51  ? 208.653 149.588 150.618 1.00 100.34 ? 31   DA  J C6    1 
ATOM 9582  N N6    . DA  J 6 51  ? 208.290 150.345 149.596 1.00 92.34  ? 31   DA  J N6    1 
ATOM 9583  N N1    . DA  J 6 51  ? 209.511 148.579 150.409 1.00 106.20 ? 31   DA  J N1    1 
ATOM 9584  C C2    . DA  J 6 51  ? 209.861 147.822 151.443 1.00 95.09  ? 31   DA  J C2    1 
ATOM 9585  N N3    . DA  J 6 51  ? 209.486 147.919 152.711 1.00 81.43  ? 31   DA  J N3    1 
ATOM 9586  C C4    . DA  J 6 51  ? 208.632 148.927 152.873 1.00 91.17  ? 31   DA  J C4    1 
ATOM 9587  P P     . DG  J 6 52  ? 210.324 148.526 158.994 1.00 106.19 ? 32   DG  J P     1 
ATOM 9588  O OP1   . DG  J 6 52  ? 210.328 147.690 160.209 1.00 99.79  ? 32   DG  J OP1   1 
ATOM 9589  O OP2   . DG  J 6 52  ? 210.450 149.993 159.086 1.00 85.27  ? 32   DG  J OP2   1 
ATOM 9590  O "O5'" . DG  J 6 52  ? 211.446 147.984 158.014 1.00 101.68 ? 32   DG  J "O5'" 1 
ATOM 9591  C "C5'" . DG  J 6 52  ? 211.119 146.960 157.113 1.00 98.18  ? 32   DG  J "C5'" 1 
ATOM 9592  C "C4'" . DG  J 6 52  ? 212.351 146.217 156.666 1.00 105.00 ? 32   DG  J "C4'" 1 
ATOM 9593  O "O4'" . DG  J 6 52  ? 212.474 146.338 155.242 1.00 106.02 ? 32   DG  J "O4'" 1 
ATOM 9594  C "C3'" . DG  J 6 52  ? 213.652 146.761 157.203 1.00 118.79 ? 32   DG  J "C3'" 1 
ATOM 9595  O "O3'" . DG  J 6 52  ? 214.657 145.761 157.103 1.00 130.91 ? 32   DG  J "O3'" 1 
ATOM 9596  C "C2'" . DG  J 6 52  ? 213.914 147.920 156.252 1.00 116.20 ? 32   DG  J "C2'" 1 
ATOM 9597  C "C1'" . DG  J 6 52  ? 213.366 147.381 154.934 1.00 106.71 ? 32   DG  J "C1'" 1 
ATOM 9598  N N9    . DG  J 6 52  ? 212.640 148.368 154.183 1.00 99.56  ? 32   DG  J N9    1 
ATOM 9599  C C8    . DG  J 6 52  ? 211.604 149.133 154.623 1.00 101.43 ? 32   DG  J C8    1 
ATOM 9600  N N7    . DG  J 6 52  ? 211.144 149.940 153.720 1.00 100.77 ? 32   DG  J N7    1 
ATOM 9601  C C5    . DG  J 6 52  ? 211.928 149.684 152.613 1.00 103.71 ? 32   DG  J C5    1 
ATOM 9602  C C6    . DG  J 6 52  ? 211.883 150.235 151.327 1.00 114.94 ? 32   DG  J C6    1 
ATOM 9603  O O6    . DG  J 6 52  ? 211.132 151.107 150.895 1.00 122.53 ? 32   DG  J O6    1 
ATOM 9604  N N1    . DG  J 6 52  ? 212.847 149.694 150.505 1.00 119.70 ? 32   DG  J N1    1 
ATOM 9605  C C2    . DG  J 6 52  ? 213.730 148.727 150.873 1.00 123.51 ? 32   DG  J C2    1 
ATOM 9606  N N2    . DG  J 6 52  ? 214.597 148.336 149.942 1.00 124.52 ? 32   DG  J N2    1 
ATOM 9607  N N3    . DG  J 6 52  ? 213.780 148.195 152.074 1.00 116.55 ? 32   DG  J N3    1 
ATOM 9608  C C4    . DG  J 6 52  ? 212.835 148.704 152.880 1.00 104.39 ? 32   DG  J C4    1 
ATOM 9609  P P     . DA  J 6 53  ? 216.156 146.051 157.599 1.00 128.86 ? 33   DA  J P     1 
ATOM 9610  O OP1   . DA  J 6 53  ? 216.793 144.745 157.841 1.00 127.12 ? 33   DA  J OP1   1 
ATOM 9611  O OP2   . DA  J 6 53  ? 216.125 147.059 158.673 1.00 123.23 ? 33   DA  J OP2   1 
ATOM 9612  O "O5'" . DA  J 6 53  ? 216.851 146.697 156.325 1.00 92.89  ? 33   DA  J "O5'" 1 
ATOM 9613  C "C5'" . DA  J 6 53  ? 216.670 146.092 155.072 1.00 103.76 ? 33   DA  J "C5'" 1 
ATOM 9614  C "C4'" . DA  J 6 53  ? 217.656 146.625 154.066 1.00 123.59 ? 33   DA  J "C4'" 1 
ATOM 9615  O "O4'" . DA  J 6 53  ? 216.983 147.496 153.131 1.00 124.28 ? 33   DA  J "O4'" 1 
ATOM 9616  C "C3'" . DA  J 6 53  ? 218.783 147.451 154.643 1.00 139.83 ? 33   DA  J "C3'" 1 
ATOM 9617  O "O3'" . DA  J 6 53  ? 219.902 147.310 153.800 1.00 153.21 ? 33   DA  J "O3'" 1 
ATOM 9618  C "C2'" . DA  J 6 53  ? 218.207 148.858 154.571 1.00 136.47 ? 33   DA  J "C2'" 1 
ATOM 9619  C "C1'" . DA  J 6 53  ? 217.514 148.797 153.228 1.00 129.09 ? 33   DA  J "C1'" 1 
ATOM 9620  N N9    . DA  J 6 53  ? 216.412 149.724 153.081 1.00 122.10 ? 33   DA  J N9    1 
ATOM 9621  C C8    . DA  J 6 53  ? 215.440 150.004 153.993 1.00 112.77 ? 33   DA  J C8    1 
ATOM 9622  N N7    . DA  J 6 53  ? 214.555 150.869 153.564 1.00 110.60 ? 33   DA  J N7    1 
ATOM 9623  C C5    . DA  J 6 53  ? 214.971 151.154 152.280 1.00 117.90 ? 33   DA  J C5    1 
ATOM 9624  C C6    . DA  J 6 53  ? 214.460 151.998 151.289 1.00 120.31 ? 33   DA  J C6    1 
ATOM 9625  N N6    . DA  J 6 53  ? 213.368 152.738 151.450 1.00 117.51 ? 33   DA  J N6    1 
ATOM 9626  N N1    . DA  J 6 53  ? 215.119 152.057 150.121 1.00 120.70 ? 33   DA  J N1    1 
ATOM 9627  C C2    . DA  J 6 53  ? 216.214 151.316 149.966 1.00 121.54 ? 33   DA  J C2    1 
ATOM 9628  N N3    . DA  J 6 53  ? 216.787 150.488 150.825 1.00 120.95 ? 33   DA  J N3    1 
ATOM 9629  C C4    . DA  J 6 53  ? 216.109 150.453 151.970 1.00 120.35 ? 33   DA  J C4    1 
ATOM 9630  P P     . DC  J 6 54  ? 221.385 147.574 154.343 1.00 141.64 ? 34   DC  J P     1 
ATOM 9631  O OP1   . DC  J 6 54  ? 222.175 146.357 154.065 1.00 136.88 ? 34   DC  J OP1   1 
ATOM 9632  O OP2   . DC  J 6 54  ? 221.298 148.100 155.720 1.00 134.02 ? 34   DC  J OP2   1 
ATOM 9633  O "O5'" . DC  J 6 54  ? 221.901 148.741 153.392 1.00 134.01 ? 34   DC  J "O5'" 1 
ATOM 9634  C "C5'" . DC  J 6 54  ? 221.048 149.226 152.371 1.00 135.66 ? 34   DC  J "C5'" 1 
ATOM 9635  C "C4'" . DC  J 6 54  ? 221.845 149.925 151.301 1.00 141.05 ? 34   DC  J "C4'" 1 
ATOM 9636  O "O4'" . DC  J 6 54  ? 220.981 150.839 150.593 1.00 140.77 ? 34   DC  J "O4'" 1 
ATOM 9637  C "C3'" . DC  J 6 54  ? 222.945 150.804 151.829 1.00 149.28 ? 34   DC  J "C3'" 1 
ATOM 9638  O "O3'" . DC  J 6 54  ? 223.838 151.105 150.783 1.00 160.27 ? 34   DC  J "O3'" 1 
ATOM 9639  C "C2'" . DC  J 6 54  ? 222.152 152.022 152.254 1.00 146.20 ? 34   DC  J "C2'" 1 
ATOM 9640  C "C1'" . DC  J 6 54  ? 221.139 152.141 151.124 1.00 141.06 ? 34   DC  J "C1'" 1 
ATOM 9641  N N1    . DC  J 6 54  ? 219.809 152.609 151.564 1.00 137.65 ? 34   DC  J N1    1 
ATOM 9642  C C2    . DC  J 6 54  ? 219.024 153.360 150.696 1.00 136.49 ? 34   DC  J C2    1 
ATOM 9643  O O2    . DC  J 6 54  ? 219.462 153.638 149.580 1.00 135.10 ? 34   DC  J O2    1 
ATOM 9644  N N3    . DC  J 6 54  ? 217.809 153.768 151.100 1.00 130.61 ? 34   DC  J N3    1 
ATOM 9645  C C4    . DC  J 6 54  ? 217.372 153.449 152.305 1.00 128.32 ? 34   DC  J C4    1 
ATOM 9646  N N4    . DC  J 6 54  ? 216.169 153.889 152.656 1.00 129.14 ? 34   DC  J N4    1 
ATOM 9647  C C5    . DC  J 6 54  ? 218.152 152.681 153.209 1.00 127.47 ? 34   DC  J C5    1 
ATOM 9648  C C6    . DC  J 6 54  ? 219.353 152.281 152.799 1.00 132.37 ? 34   DC  J C6    1 
ATOM 9649  P P     . DT  J 6 55  ? 225.011 152.180 150.986 1.00 154.96 ? 35   DT  J P     1 
ATOM 9650  O OP1   . DT  J 6 55  ? 226.196 151.652 150.284 1.00 157.45 ? 35   DT  J OP1   1 
ATOM 9651  O OP2   . DT  J 6 55  ? 225.112 152.557 152.411 1.00 146.36 ? 35   DT  J OP2   1 
ATOM 9652  O "O5'" . DT  J 6 55  ? 224.498 153.435 150.160 1.00 129.40 ? 35   DT  J "O5'" 1 
ATOM 9653  C "C5'" . DT  J 6 55  ? 224.176 153.270 148.797 1.00 135.17 ? 35   DT  J "C5'" 1 
ATOM 9654  C "C4'" . DT  J 6 55  ? 224.066 154.603 148.088 1.00 149.51 ? 35   DT  J "C4'" 1 
ATOM 9655  O "O4'" . DT  J 6 55  ? 222.772 155.190 148.343 1.00 155.12 ? 35   DT  J "O4'" 1 
ATOM 9656  C "C3'" . DT  J 6 55  ? 225.073 155.655 148.503 1.00 159.05 ? 35   DT  J "C3'" 1 
ATOM 9657  O "O3'" . DT  J 6 55  ? 225.287 156.514 147.409 1.00 164.79 ? 35   DT  J "O3'" 1 
ATOM 9658  C "C2'" . DT  J 6 55  ? 224.341 156.369 149.638 1.00 158.22 ? 35   DT  J "C2'" 1 
ATOM 9659  C "C1'" . DT  J 6 55  ? 222.916 156.369 149.111 1.00 156.68 ? 35   DT  J "C1'" 1 
ATOM 9660  N N1    . DT  J 6 55  ? 221.885 156.320 150.141 1.00 151.75 ? 35   DT  J N1    1 
ATOM 9661  C C2    . DT  J 6 55  ? 220.660 156.828 149.847 1.00 140.52 ? 35   DT  J C2    1 
ATOM 9662  O O2    . DT  J 6 55  ? 220.402 157.360 148.788 1.00 138.86 ? 35   DT  J O2    1 
ATOM 9663  N N3    . DT  J 6 55  ? 219.740 156.710 150.835 1.00 132.25 ? 35   DT  J N3    1 
ATOM 9664  C C4    . DT  J 6 55  ? 219.916 156.131 152.064 1.00 132.00 ? 35   DT  J C4    1 
ATOM 9665  O O4    . DT  J 6 55  ? 219.022 156.073 152.890 1.00 123.46 ? 35   DT  J O4    1 
ATOM 9666  C C5    . DT  J 6 55  ? 221.220 155.600 152.311 1.00 142.23 ? 35   DT  J C5    1 
ATOM 9667  C C7    . DT  J 6 55  ? 221.518 154.960 153.627 1.00 138.96 ? 35   DT  J C7    1 
ATOM 9668  C C6    . DT  J 6 55  ? 222.138 155.708 151.342 1.00 151.28 ? 35   DT  J C6    1 
ATOM 9669  P P     . DA  J 6 56  ? 226.576 157.464 147.355 1.00 147.05 ? 36   DA  J P     1 
ATOM 9670  O OP1   . DA  J 6 56  ? 227.255 157.203 146.070 1.00 144.67 ? 36   DA  J OP1   1 
ATOM 9671  O OP2   . DA  J 6 56  ? 227.306 157.297 148.628 1.00 143.43 ? 36   DA  J OP2   1 
ATOM 9672  O "O5'" . DA  J 6 56  ? 225.951 158.933 147.307 1.00 163.92 ? 36   DA  J "O5'" 1 
ATOM 9673  C "C5'" . DA  J 6 56  ? 224.543 159.091 147.212 1.00 162.93 ? 36   DA  J "C5'" 1 
ATOM 9674  C "C4'" . DA  J 6 56  ? 224.184 160.417 146.577 1.00 156.53 ? 36   DA  J "C4'" 1 
ATOM 9675  O "O4'" . DA  J 6 56  ? 223.094 160.996 147.303 1.00 151.79 ? 36   DA  J "O4'" 1 
ATOM 9676  C "C3'" . DA  J 6 56  ? 225.244 161.476 146.684 1.00 151.26 ? 36   DA  J "C3'" 1 
ATOM 9677  O "O3'" . DA  J 6 56  ? 224.887 162.556 145.840 1.00 139.08 ? 36   DA  J "O3'" 1 
ATOM 9678  C "C2'" . DA  J 6 56  ? 225.128 161.852 148.159 1.00 153.52 ? 36   DA  J "C2'" 1 
ATOM 9679  C "C1'" . DA  J 6 56  ? 223.623 161.711 148.402 1.00 149.13 ? 36   DA  J "C1'" 1 
ATOM 9680  N N9    . DA  J 6 56  ? 223.291 160.963 149.596 1.00 143.73 ? 36   DA  J N9    1 
ATOM 9681  C C8    . DA  J 6 56  ? 224.128 160.217 150.369 1.00 147.11 ? 36   DA  J C8    1 
ATOM 9682  N N7    . DA  J 6 56  ? 223.525 159.630 151.373 1.00 145.44 ? 36   DA  J N7    1 
ATOM 9683  C C5    . DA  J 6 56  ? 222.206 160.016 151.236 1.00 146.40 ? 36   DA  J C5    1 
ATOM 9684  C C6    . DA  J 6 56  ? 221.052 159.731 151.981 1.00 155.56 ? 36   DA  J C6    1 
ATOM 9685  N N6    . DA  J 6 56  ? 221.056 158.956 153.058 1.00 161.31 ? 36   DA  J N6    1 
ATOM 9686  N N1    . DA  J 6 56  ? 219.890 160.285 151.577 1.00 154.95 ? 36   DA  J N1    1 
ATOM 9687  C C2    . DA  J 6 56  ? 219.901 161.056 150.489 1.00 150.41 ? 36   DA  J C2    1 
ATOM 9688  N N3    . DA  J 6 56  ? 220.918 161.389 149.709 1.00 143.93 ? 36   DA  J N3    1 
ATOM 9689  C C4    . DA  J 6 56  ? 222.050 160.831 150.143 1.00 141.59 ? 36   DA  J C4    1 
ATOM 9690  P P     . DG  J 6 57  ? 225.663 163.958 145.922 1.00 175.76 ? 37   DG  J P     1 
ATOM 9691  O OP1   . DG  J 6 57  ? 225.459 164.620 144.619 1.00 181.18 ? 37   DG  J OP1   1 
ATOM 9692  O OP2   . DG  J 6 57  ? 227.030 163.719 146.426 1.00 175.37 ? 37   DG  J OP2   1 
ATOM 9693  O "O5'" . DG  J 6 57  ? 224.868 164.775 147.037 1.00 126.61 ? 37   DG  J "O5'" 1 
ATOM 9694  C "C5'" . DG  J 6 57  ? 223.497 165.047 146.858 1.00 130.67 ? 37   DG  J "C5'" 1 
ATOM 9695  C "C4'" . DG  J 6 57  ? 223.026 166.100 147.830 1.00 132.96 ? 37   DG  J "C4'" 1 
ATOM 9696  O "O4'" . DG  J 6 57  ? 222.834 165.505 149.130 1.00 133.30 ? 37   DG  J "O4'" 1 
ATOM 9697  C "C3'" . DG  J 6 57  ? 223.994 167.254 148.048 1.00 126.85 ? 37   DG  J "C3'" 1 
ATOM 9698  O "O3'" . DG  J 6 57  ? 223.265 168.425 148.319 1.00 119.82 ? 37   DG  J "O3'" 1 
ATOM 9699  C "C2'" . DG  J 6 57  ? 224.747 166.801 149.281 1.00 126.07 ? 37   DG  J "C2'" 1 
ATOM 9700  C "C1'" . DG  J 6 57  ? 223.604 166.207 150.066 1.00 126.43 ? 37   DG  J "C1'" 1 
ATOM 9701  N N9    . DG  J 6 57  ? 224.014 165.281 151.089 1.00 125.88 ? 37   DG  J N9    1 
ATOM 9702  C C8    . DG  J 6 57  ? 225.282 164.875 151.389 1.00 126.28 ? 37   DG  J C8    1 
ATOM 9703  N N7    . DG  J 6 57  ? 225.327 164.024 152.371 1.00 127.94 ? 37   DG  J N7    1 
ATOM 9704  C C5    . DG  J 6 57  ? 224.005 163.862 152.731 1.00 127.10 ? 37   DG  J C5    1 
ATOM 9705  C C6    . DG  J 6 57  ? 223.426 163.063 153.729 1.00 122.31 ? 37   DG  J C6    1 
ATOM 9706  O O6    . DG  J 6 57  ? 223.976 162.312 154.530 1.00 117.55 ? 37   DG  J O6    1 
ATOM 9707  N N1    . DG  J 6 57  ? 222.057 163.199 153.754 1.00 126.39 ? 37   DG  J N1    1 
ATOM 9708  C C2    . DG  J 6 57  ? 221.334 164.000 152.922 1.00 130.33 ? 37   DG  J C2    1 
ATOM 9709  N N2    . DG  J 6 57  ? 220.012 163.996 153.105 1.00 128.09 ? 37   DG  J N2    1 
ATOM 9710  N N3    . DG  J 6 57  ? 221.861 164.751 151.983 1.00 133.44 ? 37   DG  J N3    1 
ATOM 9711  C C4    . DG  J 6 57  ? 223.194 164.631 151.948 1.00 130.57 ? 37   DG  J C4    1 
ATOM 9712  P P     . DG  J 6 58  ? 222.836 169.405 147.124 1.00 128.30 ? 38   DG  J P     1 
ATOM 9713  O OP1   . DG  J 6 58  ? 222.311 168.582 146.013 1.00 128.79 ? 38   DG  J OP1   1 
ATOM 9714  O OP2   . DG  J 6 58  ? 223.966 170.326 146.887 1.00 118.23 ? 38   DG  J OP2   1 
ATOM 9715  O "O5'" . DG  J 6 58  ? 221.633 170.250 147.743 1.00 132.81 ? 38   DG  J "O5'" 1 
ATOM 9716  C "C5'" . DG  J 6 58  ? 220.422 169.606 148.076 1.00 125.05 ? 38   DG  J "C5'" 1 
ATOM 9717  C "C4'" . DG  J 6 58  ? 220.027 169.928 149.496 1.00 113.40 ? 38   DG  J "C4'" 1 
ATOM 9718  O "O4'" . DG  J 6 58  ? 220.893 169.208 150.408 1.00 106.34 ? 38   DG  J "O4'" 1 
ATOM 9719  C "C3'" . DG  J 6 58  ? 220.164 171.399 149.867 1.00 107.40 ? 38   DG  J "C3'" 1 
ATOM 9720  O "O3'" . DG  J 6 58  ? 219.073 171.810 150.666 1.00 99.20  ? 38   DG  J "O3'" 1 
ATOM 9721  C "C2'" . DG  J 6 58  ? 221.467 171.431 150.648 1.00 113.41 ? 38   DG  J "C2'" 1 
ATOM 9722  C "C1'" . DG  J 6 58  ? 221.389 170.104 151.364 1.00 107.36 ? 38   DG  J "C1'" 1 
ATOM 9723  N N9    . DG  J 6 58  ? 222.672 169.622 151.819 1.00 112.60 ? 38   DG  J N9    1 
ATOM 9724  C C8    . DG  J 6 58  ? 223.895 169.940 151.313 1.00 117.22 ? 38   DG  J C8    1 
ATOM 9725  N N7    . DG  J 6 58  ? 224.874 169.351 151.928 1.00 117.94 ? 38   DG  J N7    1 
ATOM 9726  C C5    . DG  J 6 58  ? 224.253 168.593 152.900 1.00 120.54 ? 38   DG  J C5    1 
ATOM 9727  C C6    . DG  J 6 58  ? 224.803 167.736 153.869 1.00 127.40 ? 38   DG  J C6    1 
ATOM 9728  O O6    . DG  J 6 58  ? 225.990 167.468 154.071 1.00 130.46 ? 38   DG  J O6    1 
ATOM 9729  N N1    . DG  J 6 58  ? 223.826 167.163 154.656 1.00 130.04 ? 38   DG  J N1    1 
ATOM 9730  C C2    . DG  J 6 58  ? 222.490 167.391 154.518 1.00 121.55 ? 38   DG  J C2    1 
ATOM 9731  N N2    . DG  J 6 58  ? 221.696 166.745 155.368 1.00 120.53 ? 38   DG  J N2    1 
ATOM 9732  N N3    . DG  J 6 58  ? 221.962 168.189 153.613 1.00 109.89 ? 38   DG  J N3    1 
ATOM 9733  C C4    . DG  J 6 58  ? 222.900 168.752 152.843 1.00 114.07 ? 38   DG  J C4    1 
ATOM 9734  P P     . DG  J 6 59  ? 218.551 173.317 150.535 1.00 96.22  ? 39   DG  J P     1 
ATOM 9735  O OP1   . DG  J 6 59  ? 217.970 173.452 149.186 1.00 100.40 ? 39   DG  J OP1   1 
ATOM 9736  O OP2   . DG  J 6 59  ? 219.661 174.183 150.976 1.00 89.05  ? 39   DG  J OP2   1 
ATOM 9737  O "O5'" . DG  J 6 59  ? 217.386 173.448 151.606 1.00 92.39  ? 39   DG  J "O5'" 1 
ATOM 9738  C "C5'" . DG  J 6 59  ? 216.635 172.336 151.952 1.00 90.09  ? 39   DG  J "C5'" 1 
ATOM 9739  C "C4'" . DG  J 6 59  ? 216.938 171.944 153.371 1.00 95.10  ? 39   DG  J "C4'" 1 
ATOM 9740  O "O4'" . DG  J 6 59  ? 218.316 171.552 153.459 1.00 94.33  ? 39   DG  J "O4'" 1 
ATOM 9741  C "C3'" . DG  J 6 59  ? 216.731 173.049 154.396 1.00 101.33 ? 39   DG  J "C3'" 1 
ATOM 9742  O "O3'" . DG  J 6 59  ? 215.775 172.655 155.340 1.00 100.99 ? 39   DG  J "O3'" 1 
ATOM 9743  C "C2'" . DG  J 6 59  ? 218.101 173.252 155.040 1.00 101.45 ? 39   DG  J "C2'" 1 
ATOM 9744  C "C1'" . DG  J 6 59  ? 218.862 171.992 154.668 1.00 96.46  ? 39   DG  J "C1'" 1 
ATOM 9745  N N9    . DG  J 6 59  ? 220.274 172.225 154.430 1.00 104.19 ? 39   DG  J N9    1 
ATOM 9746  C C8    . DG  J 6 59  ? 220.809 173.004 153.449 1.00 99.95  ? 39   DG  J C8    1 
ATOM 9747  N N7    . DG  J 6 59  ? 222.104 173.019 153.449 1.00 106.37 ? 39   DG  J N7    1 
ATOM 9748  C C5    . DG  J 6 59  ? 222.451 172.192 154.497 1.00 114.83 ? 39   DG  J C5    1 
ATOM 9749  C C6    . DG  J 6 59  ? 223.720 171.830 154.976 1.00 120.44 ? 39   DG  J C6    1 
ATOM 9750  O O6    . DG  J 6 59  ? 224.826 172.175 154.557 1.00 123.12 ? 39   DG  J O6    1 
ATOM 9751  N N1    . DG  J 6 59  ? 223.637 170.979 156.051 1.00 119.36 ? 39   DG  J N1    1 
ATOM 9752  C C2    . DG  J 6 59  ? 222.475 170.532 156.597 1.00 120.29 ? 39   DG  J C2    1 
ATOM 9753  N N2    . DG  J 6 59  ? 222.607 169.707 157.632 1.00 123.41 ? 39   DG  J N2    1 
ATOM 9754  N N3    . DG  J 6 59  ? 221.272 170.859 156.161 1.00 118.38 ? 39   DG  J N3    1 
ATOM 9755  C C4    . DG  J 6 59  ? 221.338 171.689 155.108 1.00 113.99 ? 39   DG  J C4    1 
ATOM 9756  P P     . DA  J 6 60  ? 215.181 173.737 156.357 1.00 91.75  ? 40   DA  J P     1 
ATOM 9757  O OP1   . DA  J 6 60  ? 213.752 173.432 156.563 1.00 87.29  ? 40   DA  J OP1   1 
ATOM 9758  O OP2   . DA  J 6 60  ? 215.595 175.063 155.878 1.00 89.90  ? 40   DA  J OP2   1 
ATOM 9759  O "O5'" . DA  J 6 60  ? 215.993 173.474 157.687 1.00 75.22  ? 40   DA  J "O5'" 1 
ATOM 9760  C "C5'" . DA  J 6 60  ? 216.146 172.171 158.133 1.00 91.98  ? 40   DA  J "C5'" 1 
ATOM 9761  C "C4'" . DA  J 6 60  ? 217.397 172.043 158.954 1.00 100.75 ? 40   DA  J "C4'" 1 
ATOM 9762  O "O4'" . DA  J 6 60  ? 218.541 172.249 158.122 1.00 100.36 ? 40   DA  J "O4'" 1 
ATOM 9763  C "C3'" . DA  J 6 60  ? 217.532 173.070 160.064 1.00 97.01  ? 40   DA  J "C3'" 1 
ATOM 9764  O "O3'" . DA  J 6 60  ? 217.210 172.474 161.288 1.00 89.68  ? 40   DA  J "O3'" 1 
ATOM 9765  C "C2'" . DA  J 6 60  ? 219.010 173.496 160.015 1.00 92.35  ? 40   DA  J "C2'" 1 
ATOM 9766  C "C1'" . DA  J 6 60  ? 219.603 172.576 158.961 1.00 95.69  ? 40   DA  J "C1'" 1 
ATOM 9767  N N9    . DA  J 6 60  ? 220.643 173.198 158.165 1.00 97.99  ? 40   DA  J N9    1 
ATOM 9768  C C8    . DA  J 6 60  ? 220.475 173.981 157.075 1.00 93.11  ? 40   DA  J C8    1 
ATOM 9769  N N7    . DA  J 6 60  ? 221.590 174.395 156.550 1.00 90.57  ? 40   DA  J N7    1 
ATOM 9770  C C5    . DA  J 6 60  ? 222.553 173.848 157.361 1.00 102.72 ? 40   DA  J C5    1 
ATOM 9771  C C6    . DA  J 6 60  ? 223.944 173.924 157.339 1.00 112.56 ? 40   DA  J C6    1 
ATOM 9772  N N6    . DA  J 6 60  ? 224.614 174.615 156.424 1.00 114.34 ? 40   DA  J N6    1 
ATOM 9773  N N1    . DA  J 6 60  ? 224.624 173.261 158.285 1.00 109.03 ? 40   DA  J N1    1 
ATOM 9774  C C2    . DA  J 6 60  ? 223.936 172.576 159.193 1.00 93.55  ? 40   DA  J C2    1 
ATOM 9775  N N3    . DA  J 6 60  ? 222.623 172.440 159.317 1.00 87.21  ? 40   DA  J N3    1 
ATOM 9776  C C4    . DA  J 6 60  ? 221.988 173.107 158.357 1.00 98.17  ? 40   DA  J C4    1 
ATOM 9777  P P     . DG  J 6 61  ? 217.201 173.352 162.626 1.00 117.00 ? 41   DG  J P     1 
ATOM 9778  O OP1   . DG  J 6 61  ? 216.342 172.653 163.601 1.00 108.58 ? 41   DG  J OP1   1 
ATOM 9779  O OP2   . DG  J 6 61  ? 216.919 174.747 162.239 1.00 115.99 ? 41   DG  J OP2   1 
ATOM 9780  O "O5'" . DG  J 6 61  ? 218.706 173.268 163.137 1.00 107.45 ? 41   DG  J "O5'" 1 
ATOM 9781  C "C5'" . DG  J 6 61  ? 219.326 172.007 163.243 1.00 109.81 ? 41   DG  J "C5'" 1 
ATOM 9782  C "C4'" . DG  J 6 61  ? 220.762 172.153 163.679 1.00 108.93 ? 41   DG  J "C4'" 1 
ATOM 9783  O "O4'" . DG  J 6 61  ? 221.564 172.576 162.554 1.00 103.98 ? 41   DG  J "O4'" 1 
ATOM 9784  C "C3'" . DG  J 6 61  ? 220.982 173.182 164.780 1.00 112.05 ? 41   DG  J "C3'" 1 
ATOM 9785  O "O3'" . DG  J 6 61  ? 221.773 172.632 165.801 1.00 121.93 ? 41   DG  J "O3'" 1 
ATOM 9786  C "C2'" . DG  J 6 61  ? 221.699 174.321 164.073 1.00 103.59 ? 41   DG  J "C2'" 1 
ATOM 9787  C "C1'" . DG  J 6 61  ? 222.428 173.595 162.964 1.00 97.89  ? 41   DG  J "C1'" 1 
ATOM 9788  N N9    . DG  J 6 61  ? 222.716 174.434 161.812 1.00 97.98  ? 41   DG  J N9    1 
ATOM 9789  C C8    . DG  J 6 61  ? 221.823 174.926 160.902 1.00 111.93 ? 41   DG  J C8    1 
ATOM 9790  N N7    . DG  J 6 61  ? 222.376 175.644 159.972 1.00 115.27 ? 41   DG  J N7    1 
ATOM 9791  C C5    . DG  J 6 61  ? 223.719 175.623 160.289 1.00 109.77 ? 41   DG  J C5    1 
ATOM 9792  C C6    . DG  J 6 61  ? 224.810 176.223 159.641 1.00 114.65 ? 41   DG  J C6    1 
ATOM 9793  O O6    . DG  J 6 61  ? 224.808 176.920 158.627 1.00 123.50 ? 41   DG  J O6    1 
ATOM 9794  N N1    . DG  J 6 61  ? 226.001 175.951 160.286 1.00 112.21 ? 41   DG  J N1    1 
ATOM 9795  C C2    . DG  J 6 61  ? 226.120 175.189 161.413 1.00 108.73 ? 41   DG  J C2    1 
ATOM 9796  N N2    . DG  J 6 61  ? 227.355 175.036 161.895 1.00 113.24 ? 41   DG  J N2    1 
ATOM 9797  N N3    . DG  J 6 61  ? 225.105 174.625 162.034 1.00 102.27 ? 41   DG  J N3    1 
ATOM 9798  C C4    . DG  J 6 61  ? 223.941 174.882 161.417 1.00 100.43 ? 41   DG  J C4    1 
ATOM 9799  P P     . DT  J 6 62  ? 221.890 173.388 167.210 1.00 135.76 ? 42   DT  J P     1 
ATOM 9800  O OP1   . DT  J 6 62  ? 221.876 172.370 168.278 1.00 125.23 ? 42   DT  J OP1   1 
ATOM 9801  O OP2   . DT  J 6 62  ? 220.897 174.477 167.206 1.00 134.03 ? 42   DT  J OP2   1 
ATOM 9802  O "O5'" . DT  J 6 62  ? 223.336 174.049 167.169 1.00 146.30 ? 42   DT  J "O5'" 1 
ATOM 9803  C "C5'" . DT  J 6 62  ? 224.461 173.238 166.932 1.00 146.36 ? 42   DT  J "C5'" 1 
ATOM 9804  C "C4'" . DT  J 6 62  ? 225.680 174.090 166.691 1.00 144.48 ? 42   DT  J "C4'" 1 
ATOM 9805  O "O4'" . DT  J 6 62  ? 225.613 174.688 165.366 1.00 133.16 ? 42   DT  J "O4'" 1 
ATOM 9806  C "C3'" . DT  J 6 62  ? 225.833 175.256 167.662 1.00 154.00 ? 42   DT  J "C3'" 1 
ATOM 9807  O "O3'" . DT  J 6 62  ? 227.178 175.352 168.072 1.00 168.04 ? 42   DT  J "O3'" 1 
ATOM 9808  C "C2'" . DT  J 6 62  ? 225.427 176.458 166.816 1.00 142.99 ? 42   DT  J "C2'" 1 
ATOM 9809  C "C1'" . DT  J 6 62  ? 225.979 176.037 165.477 1.00 130.24 ? 42   DT  J "C1'" 1 
ATOM 9810  N N1    . DT  J 6 62  ? 225.422 176.788 164.345 1.00 123.29 ? 42   DT  J N1    1 
ATOM 9811  C C2    . DT  J 6 62  ? 226.274 177.460 163.509 1.00 117.16 ? 42   DT  J C2    1 
ATOM 9812  O O2    . DT  J 6 62  ? 227.478 177.465 163.654 1.00 110.76 ? 42   DT  J O2    1 
ATOM 9813  N N3    . DT  J 6 62  ? 225.663 178.133 162.494 1.00 120.04 ? 42   DT  J N3    1 
ATOM 9814  C C4    . DT  J 6 62  ? 224.315 178.193 162.241 1.00 129.91 ? 42   DT  J C4    1 
ATOM 9815  O O4    . DT  J 6 62  ? 223.850 178.822 161.308 1.00 136.14 ? 42   DT  J O4    1 
ATOM 9816  C C5    . DT  J 6 62  ? 223.481 177.473 163.154 1.00 128.96 ? 42   DT  J C5    1 
ATOM 9817  C C7    . DT  J 6 62  ? 221.998 177.491 162.966 1.00 124.90 ? 42   DT  J C7    1 
ATOM 9818  C C6    . DT  J 6 62  ? 224.066 176.812 164.156 1.00 126.82 ? 42   DT  J C6    1 
ATOM 9819  P P     . DA  J 6 63  ? 227.578 176.289 169.312 1.00 132.75 ? 43   DA  J P     1 
ATOM 9820  O OP1   . DA  J 6 63  ? 228.290 175.440 170.285 1.00 130.50 ? 43   DA  J OP1   1 
ATOM 9821  O OP2   . DA  J 6 63  ? 226.400 177.075 169.728 1.00 123.79 ? 43   DA  J OP2   1 
ATOM 9822  O "O5'" . DA  J 6 63  ? 228.633 177.303 168.699 1.00 119.59 ? 43   DA  J "O5'" 1 
ATOM 9823  C "C5'" . DA  J 6 63  ? 229.948 177.285 169.182 1.00 122.41 ? 43   DA  J "C5'" 1 
ATOM 9824  C "C4'" . DA  J 6 63  ? 230.894 177.826 168.148 1.00 125.95 ? 43   DA  J "C4'" 1 
ATOM 9825  O "O4'" . DA  J 6 63  ? 230.186 177.955 166.893 1.00 120.22 ? 43   DA  J "O4'" 1 
ATOM 9826  C "C3'" . DA  J 6 63  ? 231.424 179.211 168.453 1.00 130.72 ? 43   DA  J "C3'" 1 
ATOM 9827  O "O3'" . DA  J 6 63  ? 232.665 179.384 167.823 1.00 140.43 ? 43   DA  J "O3'" 1 
ATOM 9828  C "C2'" . DA  J 6 63  ? 230.357 180.089 167.828 1.00 121.58 ? 43   DA  J "C2'" 1 
ATOM 9829  C "C1'" . DA  J 6 63  ? 230.075 179.318 166.554 1.00 115.44 ? 43   DA  J "C1'" 1 
ATOM 9830  N N9    . DA  J 6 63  ? 228.750 179.550 166.006 1.00 113.94 ? 43   DA  J N9    1 
ATOM 9831  C C8    . DA  J 6 63  ? 227.581 178.980 166.408 1.00 103.69 ? 43   DA  J C8    1 
ATOM 9832  N N7    . DA  J 6 63  ? 226.539 179.376 165.721 1.00 97.86  ? 43   DA  J N7    1 
ATOM 9833  C C5    . DA  J 6 63  ? 227.068 180.262 164.805 1.00 111.86 ? 43   DA  J C5    1 
ATOM 9834  C C6    . DA  J 6 63  ? 226.486 181.027 163.784 1.00 113.56 ? 43   DA  J C6    1 
ATOM 9835  N N6    . DA  J 6 63  ? 225.182 181.016 163.510 1.00 113.45 ? 43   DA  J N6    1 
ATOM 9836  N N1    . DA  J 6 63  ? 227.299 181.809 163.053 1.00 116.73 ? 43   DA  J N1    1 
ATOM 9837  C C2    . DA  J 6 63  ? 228.602 181.815 163.330 1.00 119.91 ? 43   DA  J C2    1 
ATOM 9838  N N3    . DA  J 6 63  ? 229.260 181.145 164.263 1.00 122.99 ? 43   DA  J N3    1 
ATOM 9839  C C4    . DA  J 6 63  ? 228.428 180.378 164.968 1.00 120.51 ? 43   DA  J C4    1 
ATOM 9840  P P     . DA  J 6 64  ? 233.631 180.584 168.267 1.00 124.50 ? 44   DA  J P     1 
ATOM 9841  O OP1   . DA  J 6 64  ? 234.814 179.992 168.922 1.00 125.85 ? 44   DA  J OP1   1 
ATOM 9842  O OP2   . DA  J 6 64  ? 232.814 181.589 168.978 1.00 115.55 ? 44   DA  J OP2   1 
ATOM 9843  O "O5'" . DA  J 6 64  ? 234.086 181.227 166.883 1.00 129.77 ? 44   DA  J "O5'" 1 
ATOM 9844  C "C5'" . DA  J 6 64  ? 233.118 181.531 165.905 1.00 130.57 ? 44   DA  J "C5'" 1 
ATOM 9845  C "C4'" . DA  J 6 64  ? 233.218 182.980 165.494 1.00 128.90 ? 44   DA  J "C4'" 1 
ATOM 9846  O "O4'" . DA  J 6 64  ? 231.944 183.399 164.951 1.00 127.46 ? 44   DA  J "O4'" 1 
ATOM 9847  C "C3'" . DA  J 6 64  ? 233.472 183.941 166.636 1.00 129.58 ? 44   DA  J "C3'" 1 
ATOM 9848  O "O3'" . DA  J 6 64  ? 233.962 185.157 166.114 1.00 122.10 ? 44   DA  J "O3'" 1 
ATOM 9849  C "C2'" . DA  J 6 64  ? 232.070 184.114 167.168 1.00 129.93 ? 44   DA  J "C2'" 1 
ATOM 9850  C "C1'" . DA  J 6 64  ? 231.332 184.289 165.857 1.00 129.26 ? 44   DA  J "C1'" 1 
ATOM 9851  N N9    . DA  J 6 64  ? 229.926 183.972 165.934 1.00 126.81 ? 44   DA  J N9    1 
ATOM 9852  C C8    . DA  J 6 64  ? 229.322 183.099 166.782 1.00 126.18 ? 44   DA  J C8    1 
ATOM 9853  N N7    . DA  J 6 64  ? 228.030 183.024 166.619 1.00 115.70 ? 44   DA  J N7    1 
ATOM 9854  C C5    . DA  J 6 64  ? 227.780 183.910 165.598 1.00 114.59 ? 44   DA  J C5    1 
ATOM 9855  C C6    . DA  J 6 64  ? 226.608 184.286 164.951 1.00 108.11 ? 44   DA  J C6    1 
ATOM 9856  N N6    . DA  J 6 64  ? 225.413 183.795 165.264 1.00 101.47 ? 44   DA  J N6    1 
ATOM 9857  N N1    . DA  J 6 64  ? 226.705 185.192 163.968 1.00 105.60 ? 44   DA  J N1    1 
ATOM 9858  C C2    . DA  J 6 64  ? 227.904 185.672 163.654 1.00 107.34 ? 44   DA  J C2    1 
ATOM 9859  N N3    . DA  J 6 64  ? 229.074 185.397 164.196 1.00 113.81 ? 44   DA  J N3    1 
ATOM 9860  C C4    . DA  J 6 64  ? 228.940 184.496 165.165 1.00 117.76 ? 44   DA  J C4    1 
ATOM 9861  P P     . DT  J 6 65  ? 234.250 186.403 167.084 1.00 140.58 ? 45   DT  J P     1 
ATOM 9862  O OP1   . DT  J 6 65  ? 235.225 185.965 168.103 1.00 149.25 ? 45   DT  J OP1   1 
ATOM 9863  O OP2   . DT  J 6 65  ? 232.962 187.006 167.478 1.00 133.07 ? 45   DT  J OP2   1 
ATOM 9864  O "O5'" . DT  J 6 65  ? 234.946 187.459 166.124 1.00 118.36 ? 45   DT  J "O5'" 1 
ATOM 9865  C "C5'" . DT  J 6 65  ? 234.540 187.534 164.778 1.00 116.76 ? 45   DT  J "C5'" 1 
ATOM 9866  C "C4'" . DT  J 6 65  ? 233.406 188.526 164.598 1.00 121.91 ? 45   DT  J "C4'" 1 
ATOM 9867  O "O4'" . DT  J 6 65  ? 232.133 187.885 164.783 1.00 124.07 ? 45   DT  J "O4'" 1 
ATOM 9868  C "C3'" . DT  J 6 65  ? 233.407 189.716 165.557 1.00 124.59 ? 45   DT  J "C3'" 1 
ATOM 9869  O "O3'" . DT  J 6 65  ? 233.777 190.881 164.837 1.00 122.63 ? 45   DT  J "O3'" 1 
ATOM 9870  C "C2'" . DT  J 6 65  ? 231.955 189.783 166.075 1.00 126.39 ? 45   DT  J "C2'" 1 
ATOM 9871  C "C1'" . DT  J 6 65  ? 231.218 188.891 165.094 1.00 118.54 ? 45   DT  J "C1'" 1 
ATOM 9872  N N1    . DT  J 6 65  ? 230.007 188.270 165.649 1.00 109.33 ? 45   DT  J N1    1 
ATOM 9873  C C2    . DT  J 6 65  ? 228.798 188.506 165.053 1.00 111.74 ? 45   DT  J C2    1 
ATOM 9874  O O2    . DT  J 6 65  ? 228.668 189.221 164.082 1.00 102.13 ? 45   DT  J O2    1 
ATOM 9875  N N3    . DT  J 6 65  ? 227.737 187.889 165.653 1.00 112.02 ? 45   DT  J N3    1 
ATOM 9876  C C4    . DT  J 6 65  ? 227.776 187.063 166.748 1.00 99.14  ? 45   DT  J C4    1 
ATOM 9877  O O4    . DT  J 6 65  ? 226.776 186.545 167.214 1.00 87.64  ? 45   DT  J O4    1 
ATOM 9878  C C5    . DT  J 6 65  ? 229.077 186.857 167.317 1.00 101.48 ? 45   DT  J C5    1 
ATOM 9879  C C7    . DT  J 6 65  ? 229.242 185.984 168.519 1.00 103.82 ? 45   DT  J C7    1 
ATOM 9880  C C6    . DT  J 6 65  ? 230.115 187.464 166.747 1.00 105.20 ? 45   DT  J C6    1 
ATOM 9881  P P     . DC  J 6 66  ? 233.414 192.348 165.375 1.00 131.50 ? 46   DC  J P     1 
ATOM 9882  O OP1   . DC  J 6 66  ? 234.283 193.287 164.638 1.00 141.97 ? 46   DC  J OP1   1 
ATOM 9883  O OP2   . DC  J 6 66  ? 233.419 192.342 166.850 1.00 113.03 ? 46   DC  J OP2   1 
ATOM 9884  O "O5'" . DC  J 6 66  ? 231.918 192.577 164.877 1.00 116.51 ? 46   DC  J "O5'" 1 
ATOM 9885  C "C5'" . DC  J 6 66  ? 231.590 192.343 163.522 1.00 114.99 ? 46   DC  J "C5'" 1 
ATOM 9886  C "C4'" . DC  J 6 66  ? 230.355 193.121 163.117 1.00 114.34 ? 46   DC  J "C4'" 1 
ATOM 9887  O "O4'" . DC  J 6 66  ? 229.170 192.416 163.554 1.00 106.97 ? 46   DC  J "O4'" 1 
ATOM 9888  C "C3'" . DC  J 6 66  ? 230.248 194.516 163.708 1.00 119.50 ? 46   DC  J "C3'" 1 
ATOM 9889  O "O3'" . DC  J 6 66  ? 229.582 195.360 162.799 1.00 130.93 ? 46   DC  J "O3'" 1 
ATOM 9890  C "C2'" . DC  J 6 66  ? 229.414 194.282 164.959 1.00 110.57 ? 46   DC  J "C2'" 1 
ATOM 9891  C "C1'" . DC  J 6 66  ? 228.463 193.192 164.494 1.00 106.17 ? 46   DC  J "C1'" 1 
ATOM 9892  N N1    . DC  J 6 66  ? 228.039 192.296 165.564 1.00 109.39 ? 46   DC  J N1    1 
ATOM 9893  C C2    . DC  J 6 66  ? 226.686 192.131 165.821 1.00 106.16 ? 46   DC  J C2    1 
ATOM 9894  O O2    . DC  J 6 66  ? 225.864 192.746 165.139 1.00 111.53 ? 46   DC  J O2    1 
ATOM 9895  N N3    . DC  J 6 66  ? 226.303 191.283 166.797 1.00 99.44  ? 46   DC  J N3    1 
ATOM 9896  C C4    . DC  J 6 66  ? 227.221 190.631 167.506 1.00 101.37 ? 46   DC  J C4    1 
ATOM 9897  N N4    . DC  J 6 66  ? 226.796 189.809 168.461 1.00 96.83  ? 46   DC  J N4    1 
ATOM 9898  C C5    . DC  J 6 66  ? 228.612 190.787 167.260 1.00 102.68 ? 46   DC  J C5    1 
ATOM 9899  C C6    . DC  J 6 66  ? 228.972 191.619 166.283 1.00 107.52 ? 46   DC  J C6    1 
ATOM 9900  P P     . DC  J 6 67  ? 229.557 196.943 163.046 1.00 125.31 ? 47   DC  J P     1 
ATOM 9901  O OP1   . DC  J 6 67  ? 229.763 197.600 161.741 1.00 113.48 ? 47   DC  J OP1   1 
ATOM 9902  O OP2   . DC  J 6 67  ? 230.474 197.228 164.167 1.00 101.77 ? 47   DC  J OP2   1 
ATOM 9903  O "O5'" . DC  J 6 67  ? 228.065 197.229 163.534 1.00 128.79 ? 47   DC  J "O5'" 1 
ATOM 9904  C "C5'" . DC  J 6 67  ? 226.975 196.993 162.657 1.00 105.25 ? 47   DC  J "C5'" 1 
ATOM 9905  C "C4'" . DC  J 6 67  ? 225.660 197.288 163.349 1.00 99.16  ? 47   DC  J "C4'" 1 
ATOM 9906  O "O4'" . DC  J 6 67  ? 225.374 196.255 164.323 1.00 98.59  ? 47   DC  J "O4'" 1 
ATOM 9907  C "C3'" . DC  J 6 67  ? 225.619 198.601 164.119 1.00 100.77 ? 47   DC  J "C3'" 1 
ATOM 9908  O "O3'" . DC  J 6 67  ? 224.329 199.165 164.009 1.00 102.97 ? 47   DC  J "O3'" 1 
ATOM 9909  C "C2'" . DC  J 6 67  ? 225.905 198.151 165.549 1.00 97.14  ? 47   DC  J "C2'" 1 
ATOM 9910  C "C1'" . DC  J 6 67  ? 225.140 196.847 165.579 1.00 96.38  ? 47   DC  J "C1'" 1 
ATOM 9911  N N1    . DC  J 6 67  ? 225.595 195.904 166.605 1.00 92.71  ? 47   DC  J N1    1 
ATOM 9912  C C2    . DC  J 6 67  ? 224.656 195.223 167.369 1.00 91.63  ? 47   DC  J C2    1 
ATOM 9913  O O2    . DC  J 6 67  ? 223.457 195.423 167.174 1.00 95.17  ? 47   DC  J O2    1 
ATOM 9914  N N3    . DC  J 6 67  ? 225.077 194.328 168.287 1.00 85.72  ? 47   DC  J N3    1 
ATOM 9915  C C4    . DC  J 6 67  ? 226.378 194.124 168.464 1.00 86.21  ? 47   DC  J C4    1 
ATOM 9916  N N4    . DC  J 6 67  ? 226.745 193.238 169.390 1.00 81.02  ? 47   DC  J N4    1 
ATOM 9917  C C5    . DC  J 6 67  ? 227.355 194.810 167.692 1.00 91.41  ? 47   DC  J C5    1 
ATOM 9918  C C6    . DC  J 6 67  ? 226.920 195.682 166.779 1.00 90.74  ? 47   DC  J C6    1 
ATOM 9919  P P     . DC  J 6 68  ? 223.939 200.073 162.744 1.00 110.45 ? 48   DC  J P     1 
ATOM 9920  O OP1   . DC  J 6 68  ? 224.569 199.506 161.534 1.00 110.94 ? 48   DC  J OP1   1 
ATOM 9921  O OP2   . DC  J 6 68  ? 224.177 201.480 163.108 1.00 98.13  ? 48   DC  J OP2   1 
ATOM 9922  O "O5'" . DC  J 6 68  ? 222.369 199.867 162.611 1.00 95.00  ? 48   DC  J "O5'" 1 
ATOM 9923  C "C5'" . DC  J 6 68  ? 221.872 198.617 162.206 1.00 88.22  ? 48   DC  J "C5'" 1 
ATOM 9924  C "C4'" . DC  J 6 68  ? 220.665 198.228 163.028 1.00 84.46  ? 48   DC  J "C4'" 1 
ATOM 9925  O "O4'" . DC  J 6 68  ? 221.093 197.738 164.320 1.00 93.48  ? 48   DC  J "O4'" 1 
ATOM 9926  C "C3'" . DC  J 6 68  ? 219.687 199.358 163.314 1.00 81.32  ? 48   DC  J "C3'" 1 
ATOM 9927  O "O3'" . DC  J 6 68  ? 218.373 198.856 163.258 1.00 88.24  ? 48   DC  J "O3'" 1 
ATOM 9928  C "C2'" . DC  J 6 68  ? 220.063 199.768 164.726 1.00 89.76  ? 48   DC  J "C2'" 1 
ATOM 9929  C "C1'" . DC  J 6 68  ? 220.404 198.426 165.328 1.00 90.00  ? 48   DC  J "C1'" 1 
ATOM 9930  N N1    . DC  J 6 68  ? 221.287 198.527 166.473 1.00 88.10  ? 48   DC  J N1    1 
ATOM 9931  C C2    . DC  J 6 68  ? 220.908 197.978 167.694 1.00 94.88  ? 48   DC  J C2    1 
ATOM 9932  O O2    . DC  J 6 68  ? 219.814 197.424 167.787 1.00 93.03  ? 48   DC  J O2    1 
ATOM 9933  N N3    . DC  J 6 68  ? 221.745 198.087 168.746 1.00 102.75 ? 48   DC  J N3    1 
ATOM 9934  C C4    . DC  J 6 68  ? 222.913 198.701 168.596 1.00 100.33 ? 48   DC  J C4    1 
ATOM 9935  N N4    . DC  J 6 68  ? 223.719 198.779 169.650 1.00 103.14 ? 48   DC  J N4    1 
ATOM 9936  C C5    . DC  J 6 68  ? 223.311 199.261 167.357 1.00 96.26  ? 48   DC  J C5    1 
ATOM 9937  C C6    . DC  J 6 68  ? 222.475 199.149 166.332 1.00 93.22  ? 48   DC  J C6    1 
ATOM 9938  P P     . DC  J 6 69  ? 217.132 199.769 163.698 1.00 87.59  ? 49   DC  J P     1 
ATOM 9939  O OP1   . DC  J 6 69  ? 216.002 199.406 162.821 1.00 75.40  ? 49   DC  J OP1   1 
ATOM 9940  O OP2   . DC  J 6 69  ? 217.579 201.173 163.772 1.00 84.79  ? 49   DC  J OP2   1 
ATOM 9941  O "O5'" . DC  J 6 69  ? 216.795 199.260 165.171 1.00 92.08  ? 49   DC  J "O5'" 1 
ATOM 9942  C "C5'" . DC  J 6 69  ? 216.191 197.992 165.346 1.00 84.03  ? 49   DC  J "C5'" 1 
ATOM 9943  C "C4'" . DC  J 6 69  ? 215.756 197.776 166.781 1.00 77.08  ? 49   DC  J "C4'" 1 
ATOM 9944  O "O4'" . DC  J 6 69  ? 216.892 197.923 167.666 1.00 81.43  ? 49   DC  J "O4'" 1 
ATOM 9945  C "C3'" . DC  J 6 69  ? 214.723 198.753 167.299 1.00 72.55  ? 49   DC  J "C3'" 1 
ATOM 9946  O "O3'" . DC  J 6 69  ? 213.985 198.124 168.306 1.00 81.30  ? 49   DC  J "O3'" 1 
ATOM 9947  C "C2'" . DC  J 6 69  ? 215.604 199.843 167.878 1.00 73.18  ? 49   DC  J "C2'" 1 
ATOM 9948  C "C1'" . DC  J 6 69  ? 216.661 198.995 168.550 1.00 80.91  ? 49   DC  J "C1'" 1 
ATOM 9949  N N1    . DC  J 6 69  ? 217.947 199.682 168.767 1.00 80.22  ? 49   DC  J N1    1 
ATOM 9950  C C2    . DC  J 6 69  ? 218.528 199.681 170.037 1.00 91.98  ? 49   DC  J C2    1 
ATOM 9951  O O2    . DC  J 6 69  ? 217.953 199.122 170.964 1.00 100.49 ? 49   DC  J O2    1 
ATOM 9952  N N3    . DC  J 6 69  ? 219.715 200.286 170.218 1.00 94.86  ? 49   DC  J N3    1 
ATOM 9953  C C4    . DC  J 6 69  ? 220.316 200.876 169.199 1.00 102.83 ? 49   DC  J C4    1 
ATOM 9954  N N4    . DC  J 6 69  ? 221.487 201.464 169.432 1.00 113.63 ? 49   DC  J N4    1 
ATOM 9955  C C5    . DC  J 6 69  ? 219.745 200.892 167.895 1.00 93.46  ? 49   DC  J C5    1 
ATOM 9956  C C6    . DC  J 6 69  ? 218.571 200.281 167.726 1.00 75.83  ? 49   DC  J C6    1 
ATOM 9957  P P     . DT  J 6 70  ? 212.498 198.606 168.654 1.00 76.47  ? 50   DT  J P     1 
ATOM 9958  O OP1   . DT  J 6 70  ? 211.553 197.849 167.812 1.00 73.78  ? 50   DT  J OP1   1 
ATOM 9959  O OP2   . DT  J 6 70  ? 212.487 200.081 168.653 1.00 79.46  ? 50   DT  J OP2   1 
ATOM 9960  O "O5'" . DT  J 6 70  ? 212.305 198.105 170.146 1.00 86.34  ? 50   DT  J "O5'" 1 
ATOM 9961  C "C5'" . DT  J 6 70  ? 212.827 196.856 170.515 1.00 77.51  ? 50   DT  J "C5'" 1 
ATOM 9962  C "C4'" . DT  J 6 70  ? 213.327 196.900 171.934 1.00 60.95  ? 50   DT  J "C4'" 1 
ATOM 9963  O "O4'" . DT  J 6 70  ? 214.545 197.661 171.982 1.00 67.89  ? 50   DT  J "O4'" 1 
ATOM 9964  C "C3'" . DT  J 6 70  ? 212.365 197.559 172.911 1.00 63.09  ? 50   DT  J "C3'" 1 
ATOM 9965  O "O3'" . DT  J 6 70  ? 212.015 196.653 173.907 1.00 78.41  ? 50   DT  J "O3'" 1 
ATOM 9966  C "C2'" . DT  J 6 70  ? 213.143 198.741 173.478 1.00 79.33  ? 50   DT  J "C2'" 1 
ATOM 9967  C "C1'" . DT  J 6 70  ? 214.582 198.386 173.170 1.00 82.73  ? 50   DT  J "C1'" 1 
ATOM 9968  N N1    . DT  J 6 70  ? 215.417 199.563 172.941 1.00 81.52  ? 50   DT  J N1    1 
ATOM 9969  C C2    . DT  J 6 70  ? 216.381 199.892 173.850 1.00 93.82  ? 50   DT  J C2    1 
ATOM 9970  O O2    . DT  J 6 70  ? 216.580 199.262 174.864 1.00 100.87 ? 50   DT  J O2    1 
ATOM 9971  N N3    . DT  J 6 70  ? 217.092 201.006 173.542 1.00 94.78  ? 50   DT  J N3    1 
ATOM 9972  C C4    . DT  J 6 70  ? 216.953 201.795 172.435 1.00 96.84  ? 50   DT  J C4    1 
ATOM 9973  O O4    . DT  J 6 70  ? 217.651 202.773 172.244 1.00 98.05  ? 50   DT  J O4    1 
ATOM 9974  C C5    . DT  J 6 70  ? 215.934 201.394 171.519 1.00 84.77  ? 50   DT  J C5    1 
ATOM 9975  C C7    . DT  J 6 70  ? 215.695 202.192 170.282 1.00 85.79  ? 50   DT  J C7    1 
ATOM 9976  C C6    . DT  J 6 70  ? 215.225 200.303 171.806 1.00 64.23  ? 50   DT  J C6    1 
ATOM 9977  P P     . DT  J 6 71  ? 210.988 197.092 175.049 1.00 80.52  ? 51   DT  J P     1 
ATOM 9978  O OP1   . DT  J 6 71  ? 210.345 195.876 175.573 1.00 78.16  ? 51   DT  J OP1   1 
ATOM 9979  O OP2   . DT  J 6 71  ? 210.177 198.193 174.506 1.00 83.20  ? 51   DT  J OP2   1 
ATOM 9980  O "O5'" . DT  J 6 71  ? 211.928 197.679 176.183 1.00 78.52  ? 51   DT  J "O5'" 1 
ATOM 9981  C "C5'" . DT  J 6 71  ? 213.036 196.925 176.613 1.00 90.05  ? 51   DT  J "C5'" 1 
ATOM 9982  C "C4'" . DT  J 6 71  ? 213.859 197.707 177.609 1.00 96.92  ? 51   DT  J "C4'" 1 
ATOM 9983  O "O4'" . DT  J 6 71  ? 214.634 198.708 176.913 1.00 94.73  ? 51   DT  J "O4'" 1 
ATOM 9984  C "C3'" . DT  J 6 71  ? 213.045 198.454 178.661 1.00 94.40  ? 51   DT  J "C3'" 1 
ATOM 9985  O "O3'" . DT  J 6 71  ? 213.582 198.207 179.937 1.00 93.59  ? 51   DT  J "O3'" 1 
ATOM 9986  C "C2'" . DT  J 6 71  ? 213.210 199.913 178.259 1.00 89.00  ? 51   DT  J "C2'" 1 
ATOM 9987  C "C1'" . DT  J 6 71  ? 214.592 199.889 177.652 1.00 92.70  ? 51   DT  J "C1'" 1 
ATOM 9988  N N1    . DT  J 6 71  ? 214.845 201.001 176.749 1.00 95.85  ? 51   DT  J N1    1 
ATOM 9989  C C2    . DT  J 6 71  ? 215.868 201.864 177.028 1.00 87.07  ? 51   DT  J C2    1 
ATOM 9990  O O2    . DT  J 6 71  ? 216.573 201.768 178.012 1.00 83.69  ? 51   DT  J O2    1 
ATOM 9991  N N3    . DT  J 6 71  ? 216.017 202.876 176.134 1.00 88.52  ? 51   DT  J N3    1 
ATOM 9992  C C4    . DT  J 6 71  ? 215.271 203.090 174.998 1.00 94.98  ? 51   DT  J C4    1 
ATOM 9993  O O4    . DT  J 6 71  ? 215.481 204.022 174.243 1.00 104.70 ? 51   DT  J O4    1 
ATOM 9994  C C5    . DT  J 6 71  ? 214.229 202.143 174.760 1.00 99.04  ? 51   DT  J C5    1 
ATOM 9995  C C7    . DT  J 6 71  ? 213.355 202.293 173.563 1.00 103.02 ? 51   DT  J C7    1 
ATOM 9996  C C6    . DT  J 6 71  ? 214.061 201.156 175.641 1.00 100.29 ? 51   DT  J C6    1 
ATOM 9997  P P     . DG  J 6 72  ? 212.711 198.506 181.249 1.00 92.60  ? 52   DG  J P     1 
ATOM 9998  O OP1   . DG  J 6 72  ? 212.804 197.321 182.121 1.00 82.70  ? 52   DG  J OP1   1 
ATOM 9999  O OP2   . DG  J 6 72  ? 211.396 199.024 180.823 1.00 84.74  ? 52   DG  J OP2   1 
ATOM 10000 O "O5'" . DG  J 6 72  ? 213.500 199.687 181.964 1.00 86.42  ? 52   DG  J "O5'" 1 
ATOM 10001 C "C5'" . DG  J 6 72  ? 214.829 199.470 182.393 1.00 85.55  ? 52   DG  J "C5'" 1 
ATOM 10002 C "C4'" . DG  J 6 72  ? 215.551 200.784 182.596 1.00 94.54  ? 52   DG  J "C4'" 1 
ATOM 10003 O "O4'" . DG  J 6 72  ? 215.753 201.437 181.312 1.00 91.17  ? 52   DG  J "O4'" 1 
ATOM 10004 C "C3'" . DG  J 6 72  ? 214.803 201.793 183.467 1.00 109.81 ? 52   DG  J "C3'" 1 
ATOM 10005 O "O3'" . DG  J 6 72  ? 215.697 202.381 184.386 1.00 124.84 ? 52   DG  J "O3'" 1 
ATOM 10006 C "C2'" . DG  J 6 72  ? 214.310 202.814 182.453 1.00 109.40 ? 52   DG  J "C2'" 1 
ATOM 10007 C "C1'" . DG  J 6 72  ? 215.448 202.793 181.464 1.00 102.24 ? 52   DG  J "C1'" 1 
ATOM 10008 N N9    . DG  J 6 72  ? 215.078 203.356 180.189 1.00 96.41  ? 52   DG  J N9    1 
ATOM 10009 C C8    . DG  J 6 72  ? 214.128 202.896 179.326 1.00 100.04 ? 52   DG  J C8    1 
ATOM 10010 N N7    . DG  J 6 72  ? 213.994 203.637 178.267 1.00 103.42 ? 52   DG  J N7    1 
ATOM 10011 C C5    . DG  J 6 72  ? 214.905 204.659 178.459 1.00 99.35  ? 52   DG  J C5    1 
ATOM 10012 C C6    . DG  J 6 72  ? 215.209 205.765 177.650 1.00 101.45 ? 52   DG  J C6    1 
ATOM 10013 O O6    . DG  J 6 72  ? 214.723 206.073 176.561 1.00 115.22 ? 52   DG  J O6    1 
ATOM 10014 N N1    . DG  J 6 72  ? 216.186 206.562 178.219 1.00 93.30  ? 52   DG  J N1    1 
ATOM 10015 C C2    . DG  J 6 72  ? 216.795 206.315 179.418 1.00 93.75  ? 52   DG  J C2    1 
ATOM 10016 N N2    . DG  J 6 72  ? 217.714 207.199 179.807 1.00 99.36  ? 52   DG  J N2    1 
ATOM 10017 N N3    . DG  J 6 72  ? 216.521 205.282 180.184 1.00 93.46  ? 52   DG  J N3    1 
ATOM 10018 C C4    . DG  J 6 72  ? 215.574 204.497 179.638 1.00 93.88  ? 52   DG  J C4    1 
ATOM 10019 P P     . DG  J 6 73  ? 215.146 203.287 185.591 1.00 108.71 ? 53   DG  J P     1 
ATOM 10020 O OP1   . DG  J 6 73  ? 214.785 202.358 186.681 1.00 101.19 ? 53   DG  J OP1   1 
ATOM 10021 O OP2   . DG  J 6 73  ? 214.144 204.250 185.080 1.00 84.41  ? 53   DG  J OP2   1 
ATOM 10022 O "O5'" . DG  J 6 73  ? 216.422 204.140 186.017 1.00 113.69 ? 53   DG  J "O5'" 1 
ATOM 10023 C "C5'" . DG  J 6 73  ? 217.386 204.472 185.042 1.00 111.67 ? 53   DG  J "C5'" 1 
ATOM 10024 C "C4'" . DG  J 6 73  ? 217.383 205.962 184.758 1.00 114.21 ? 53   DG  J "C4'" 1 
ATOM 10025 O "O4'" . DG  J 6 73  ? 216.946 206.210 183.397 1.00 110.16 ? 53   DG  J "O4'" 1 
ATOM 10026 C "C3'" . DG  J 6 73  ? 216.470 206.809 185.654 1.00 109.78 ? 53   DG  J "C3'" 1 
ATOM 10027 O "O3'" . DG  J 6 73  ? 217.197 207.952 186.121 1.00 113.61 ? 53   DG  J "O3'" 1 
ATOM 10028 C "C2'" . DG  J 6 73  ? 215.341 207.201 184.706 1.00 109.61 ? 53   DG  J "C2'" 1 
ATOM 10029 C "C1'" . DG  J 6 73  ? 216.110 207.330 183.415 1.00 114.78 ? 53   DG  J "C1'" 1 
ATOM 10030 N N9    . DG  J 6 73  ? 215.280 207.304 182.240 1.00 122.36 ? 53   DG  J N9    1 
ATOM 10031 C C8    . DG  J 6 73  ? 214.418 206.314 181.863 1.00 122.90 ? 53   DG  J C8    1 
ATOM 10032 N N7    . DG  J 6 73  ? 213.802 206.567 180.743 1.00 123.36 ? 53   DG  J N7    1 
ATOM 10033 C C5    . DG  J 6 73  ? 214.280 207.813 180.367 1.00 122.25 ? 53   DG  J C5    1 
ATOM 10034 C C6    . DG  J 6 73  ? 213.973 208.608 179.240 1.00 128.33 ? 53   DG  J C6    1 
ATOM 10035 O O6    . DG  J 6 73  ? 213.194 208.367 178.312 1.00 127.42 ? 53   DG  J O6    1 
ATOM 10036 N N1    . DG  J 6 73  ? 214.683 209.797 179.246 1.00 132.30 ? 53   DG  J N1    1 
ATOM 10037 C C2    . DG  J 6 73  ? 215.571 210.173 180.218 1.00 121.65 ? 53   DG  J C2    1 
ATOM 10038 N N2    . DG  J 6 73  ? 216.158 211.357 180.044 1.00 101.72 ? 53   DG  J N2    1 
ATOM 10039 N N3    . DG  J 6 73  ? 215.873 209.437 181.275 1.00 126.32 ? 53   DG  J N3    1 
ATOM 10040 C C4    . DG  J 6 73  ? 215.190 208.276 181.283 1.00 124.00 ? 53   DG  J C4    1 
ATOM 10041 P P     . DC  J 6 74  ? 216.441 209.277 186.631 1.00 98.88  ? 54   DC  J P     1 
ATOM 10042 O OP1   . DC  J 6 74  ? 217.445 210.073 187.359 1.00 96.26  ? 54   DC  J OP1   1 
ATOM 10043 O OP2   . DC  J 6 74  ? 215.173 208.914 187.291 1.00 93.73  ? 54   DC  J OP2   1 
ATOM 10044 O "O5'" . DC  J 6 74  ? 216.081 210.063 185.292 1.00 97.34  ? 54   DC  J "O5'" 1 
ATOM 10045 C "C5'" . DC  J 6 74  ? 217.106 210.668 184.530 1.00 97.21  ? 54   DC  J "C5'" 1 
ATOM 10046 C "C4'" . DC  J 6 74  ? 216.728 212.087 184.171 1.00 90.88  ? 54   DC  J "C4'" 1 
ATOM 10047 O "O4'" . DC  J 6 74  ? 216.002 212.090 182.915 1.00 95.27  ? 54   DC  J "O4'" 1 
ATOM 10048 C "C3'" . DC  J 6 74  ? 215.814 212.769 185.180 1.00 85.92  ? 54   DC  J "C3'" 1 
ATOM 10049 O "O3'" . DC  J 6 74  ? 216.124 214.140 185.257 1.00 93.84  ? 54   DC  J "O3'" 1 
ATOM 10050 C "C2'" . DC  J 6 74  ? 214.440 212.555 184.572 1.00 81.00  ? 54   DC  J "C2'" 1 
ATOM 10051 C "C1'" . DC  J 6 74  ? 214.754 212.714 183.100 1.00 86.73  ? 54   DC  J "C1'" 1 
ATOM 10052 N N1    . DC  J 6 74  ? 213.785 212.051 182.234 1.00 87.21  ? 54   DC  J N1    1 
ATOM 10053 C C2    . DC  J 6 74  ? 213.281 212.719 181.119 1.00 90.11  ? 54   DC  J C2    1 
ATOM 10054 O O2    . DC  J 6 74  ? 213.659 213.866 180.877 1.00 86.13  ? 54   DC  J O2    1 
ATOM 10055 N N3    . DC  J 6 74  ? 212.390 212.089 180.335 1.00 87.79  ? 54   DC  J N3    1 
ATOM 10056 C C4    . DC  J 6 74  ? 212.003 210.851 180.631 1.00 80.94  ? 54   DC  J C4    1 
ATOM 10057 N N4    . DC  J 6 74  ? 211.119 210.268 179.823 1.00 70.49  ? 54   DC  J N4    1 
ATOM 10058 C C5    . DC  J 6 74  ? 212.503 210.157 181.766 1.00 97.20  ? 54   DC  J C5    1 
ATOM 10059 C C6    . DC  J 6 74  ? 213.381 210.791 182.533 1.00 93.67  ? 54   DC  J C6    1 
ATOM 10060 P P     . DG  J 6 75  ? 215.554 215.021 186.469 1.00 106.98 ? 55   DG  J P     1 
ATOM 10061 O OP1   . DG  J 6 75  ? 216.189 214.524 187.705 1.00 89.42  ? 55   DG  J OP1   1 
ATOM 10062 O OP2   . DG  J 6 75  ? 214.083 215.067 186.358 1.00 96.17  ? 55   DG  J OP2   1 
ATOM 10063 O "O5'" . DG  J 6 75  ? 216.106 216.482 186.165 1.00 111.97 ? 55   DG  J "O5'" 1 
ATOM 10064 C "C5'" . DG  J 6 75  ? 216.451 216.839 184.845 1.00 107.59 ? 55   DG  J "C5'" 1 
ATOM 10065 C "C4'" . DG  J 6 75  ? 215.271 217.462 184.128 1.00 109.89 ? 55   DG  J "C4'" 1 
ATOM 10066 O "O4'" . DG  J 6 75  ? 214.491 216.437 183.477 1.00 110.40 ? 55   DG  J "O4'" 1 
ATOM 10067 C "C3'" . DG  J 6 75  ? 214.286 218.227 185.026 1.00 116.40 ? 55   DG  J "C3'" 1 
ATOM 10068 O "O3'" . DG  J 6 75  ? 214.212 219.579 184.627 1.00 130.67 ? 55   DG  J "O3'" 1 
ATOM 10069 C "C2'" . DG  J 6 75  ? 212.951 217.519 184.799 1.00 107.71 ? 55   DG  J "C2'" 1 
ATOM 10070 C "C1'" . DG  J 6 75  ? 213.175 216.889 183.441 1.00 107.21 ? 55   DG  J "C1'" 1 
ATOM 10071 N N9    . DG  J 6 75  ? 212.287 215.774 183.167 1.00 99.56  ? 55   DG  J N9    1 
ATOM 10072 C C8    . DG  J 6 75  ? 211.985 214.729 183.996 1.00 104.76 ? 55   DG  J C8    1 
ATOM 10073 N N7    . DG  J 6 75  ? 211.138 213.889 183.479 1.00 103.51 ? 55   DG  J N7    1 
ATOM 10074 C C5    . DG  J 6 75  ? 210.855 214.425 182.238 1.00 97.56  ? 55   DG  J C5    1 
ATOM 10075 C C6    . DG  J 6 75  ? 210.002 213.960 181.228 1.00 102.22 ? 55   DG  J C6    1 
ATOM 10076 O O6    . DG  J 6 75  ? 209.302 212.946 181.223 1.00 107.62 ? 55   DG  J O6    1 
ATOM 10077 N N1    . DG  J 6 75  ? 210.007 214.800 180.128 1.00 101.73 ? 55   DG  J N1    1 
ATOM 10078 C C2    . DG  J 6 75  ? 210.747 215.945 180.023 1.00 96.80  ? 55   DG  J C2    1 
ATOM 10079 N N2    . DG  J 6 75  ? 210.621 216.629 178.885 1.00 90.00  ? 55   DG  J N2    1 
ATOM 10080 N N3    . DG  J 6 75  ? 211.549 216.391 180.963 1.00 97.02  ? 55   DG  J N3    1 
ATOM 10081 C C4    . DG  J 6 75  ? 211.556 215.582 182.035 1.00 94.92  ? 55   DG  J C4    1 
ATOM 10082 P P     . DG  J 6 76  ? 213.564 220.659 185.619 1.00 101.75 ? 56   DG  J P     1 
ATOM 10083 O OP1   . DG  J 6 76  ? 214.345 221.910 185.500 1.00 95.85  ? 56   DG  J OP1   1 
ATOM 10084 O OP2   . DG  J 6 76  ? 213.398 219.985 186.924 1.00 93.23  ? 56   DG  J OP2   1 
ATOM 10085 O "O5'" . DG  J 6 76  ? 212.102 220.903 185.032 1.00 117.29 ? 56   DG  J "O5'" 1 
ATOM 10086 C "C5'" . DG  J 6 76  ? 211.886 221.932 184.088 1.00 110.18 ? 56   DG  J "C5'" 1 
ATOM 10087 C "C4'" . DG  J 6 76  ? 211.360 221.350 182.801 1.00 98.74  ? 56   DG  J "C4'" 1 
ATOM 10088 O "O4'" . DG  J 6 76  ? 211.251 219.934 182.954 1.00 98.37  ? 56   DG  J "O4'" 1 
ATOM 10089 C "C3'" . DG  J 6 76  ? 209.956 221.792 182.423 1.00 98.76  ? 56   DG  J "C3'" 1 
ATOM 10090 O "O3'" . DG  J 6 76  ? 210.007 222.961 181.631 1.00 110.77 ? 56   DG  J "O3'" 1 
ATOM 10091 C "C2'" . DG  J 6 76  ? 209.420 220.609 181.615 1.00 94.35  ? 56   DG  J "C2'" 1 
ATOM 10092 C "C1'" . DG  J 6 76  ? 210.364 219.463 181.979 1.00 98.68  ? 56   DG  J "C1'" 1 
ATOM 10093 N N9    . DG  J 6 76  ? 209.702 218.272 182.480 1.00 103.98 ? 56   DG  J N9    1 
ATOM 10094 C C8    . DG  J 6 76  ? 209.947 217.621 183.656 1.00 114.86 ? 56   DG  J C8    1 
ATOM 10095 N N7    . DG  J 6 76  ? 209.219 216.558 183.819 1.00 116.66 ? 56   DG  J N7    1 
ATOM 10096 C C5    . DG  J 6 76  ? 208.431 216.515 182.683 1.00 110.76 ? 56   DG  J C5    1 
ATOM 10097 C C6    . DG  J 6 76  ? 207.438 215.599 182.302 1.00 128.60 ? 56   DG  J C6    1 
ATOM 10098 O O6    . DG  J 6 76  ? 207.044 214.596 182.898 1.00 138.21 ? 56   DG  J O6    1 
ATOM 10099 N N1    . DG  J 6 76  ? 206.892 215.917 181.074 1.00 133.94 ? 56   DG  J N1    1 
ATOM 10100 C C2    . DG  J 6 76  ? 207.247 216.996 180.322 1.00 131.58 ? 56   DG  J C2    1 
ATOM 10101 N N2    . DG  J 6 76  ? 206.610 217.131 179.163 1.00 135.50 ? 56   DG  J N2    1 
ATOM 10102 N N3    . DG  J 6 76  ? 208.176 217.859 180.660 1.00 119.57 ? 56   DG  J N3    1 
ATOM 10103 C C4    . DG  J 6 76  ? 208.722 217.560 181.851 1.00 105.64 ? 56   DG  J C4    1 
ATOM 10104 P P     . DT  J 6 77  ? 208.717 223.912 181.526 1.00 103.97 ? 57   DT  J P     1 
ATOM 10105 O OP1   . DT  J 6 77  ? 209.073 225.081 180.696 1.00 98.0