data_5X11
# 
_entry.id   5X11 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.288 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5X11         
WWPDB D_1300002765 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5X12 PDB . 
unspecified 5X13 PDB . 
unspecified 5X14 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5X11 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Park, S.C.' 1 ? 
'Kwak, Y.M.' 2 ? 
'Song, W.S.' 3 ? 
'Hong, M.'   4 ? 
'Yoon, S.I.' 5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            45 
_citation.language                  ? 
_citation.page_first                13080 
_citation.page_last                 13093 
_citation.title                     
'Structural basis of effector and operator recognition by the phenolic acid-responsive transcriptional regulator PadR' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkx1055 
_citation.pdbx_database_id_PubMed   29136175 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Park, S.C.' 1 
primary 'Kwak, Y.M.' 2 
primary 'Song, W.S.' 3 
primary 'Hong, M.'   4 
primary 'Yoon, S.I.' 5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   107.94 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5X11 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     341.807 
_cell.length_a_esd                 ? 
_cell.length_b                     61.567 
_cell.length_b_esd                 ? 
_cell.length_c                     120.553 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        32 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5X11 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'DNA (28-MER)'              8636.616  2  ? ? ? ? 
2 polymer syn 'DNA (28-MER)'              8569.551  2  ? ? ? ? 
3 polymer man 'Transcriptional regulator' 21750.912 8  ? ? ? ? 
4 water   nat water                       18.015    17 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DG)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DT)(DA)(DA)(DA)(DT)(DA)(DG)(DT)(DT)(DA)(DC)
(DA)(DT)(DG)(DA)(DT)(DT)(DA)(DC)
;
CGGAACATGTAAATAGTTACATGATTAC I,M             ? 
2 polydeoxyribonucleotide no no 
;(DG)(DT)(DA)(DA)(DT)(DC)(DA)(DT)(DG)(DT)(DA)(DA)(DC)(DT)(DA)(DT)(DT)(DT)(DA)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DC)(DG)
;
GTAATCATGTAACTATTTACATGTTCCG J,N             ? 
3 'polypeptide(L)'        no no 
;GSAKDPMRVLKYAILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDEGFITFRTTIQGTKLEKKMYTLTD
SGKQELHDWLIRHQPIPETVKDEFMLKAYFISSLSRQEASDLFTDQLLKRKAKLSDLQGSYEKLMASAEPMSFSSPDFGH
YLVLTKALEREKNYVSWLESILAMIDED
;
;GSAKDPMRVLKYAILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDEGFITFRTTIQGTKLEKKMYTLTD
SGKQELHDWLIRHQPIPETVKDEFMLKAYFISSLSRQEASDLFTDQLLKRKAKLSDLQGSYEKLMASAEPMSFSSPDFGH
YLVLTKALEREKNYVSWLESILAMIDED
;
A,B,C,D,E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DG  n 
1 3   DG  n 
1 4   DA  n 
1 5   DA  n 
1 6   DC  n 
1 7   DA  n 
1 8   DT  n 
1 9   DG  n 
1 10  DT  n 
1 11  DA  n 
1 12  DA  n 
1 13  DA  n 
1 14  DT  n 
1 15  DA  n 
1 16  DG  n 
1 17  DT  n 
1 18  DT  n 
1 19  DA  n 
1 20  DC  n 
1 21  DA  n 
1 22  DT  n 
1 23  DG  n 
1 24  DA  n 
1 25  DT  n 
1 26  DT  n 
1 27  DA  n 
1 28  DC  n 
2 1   DG  n 
2 2   DT  n 
2 3   DA  n 
2 4   DA  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DT  n 
2 11  DA  n 
2 12  DA  n 
2 13  DC  n 
2 14  DT  n 
2 15  DA  n 
2 16  DT  n 
2 17  DT  n 
2 18  DT  n 
2 19  DA  n 
2 20  DC  n 
2 21  DA  n 
2 22  DT  n 
2 23  DG  n 
2 24  DT  n 
2 25  DT  n 
2 26  DC  n 
2 27  DC  n 
2 28  DG  n 
3 1   GLY n 
3 2   SER n 
3 3   ALA n 
3 4   LYS n 
3 5   ASP n 
3 6   PRO n 
3 7   MET n 
3 8   ARG n 
3 9   VAL n 
3 10  LEU n 
3 11  LYS n 
3 12  TYR n 
3 13  ALA n 
3 14  ILE n 
3 15  LEU n 
3 16  GLY n 
3 17  LEU n 
3 18  LEU n 
3 19  ARG n 
3 20  LYS n 
3 21  GLY n 
3 22  GLU n 
3 23  LEU n 
3 24  SER n 
3 25  GLY n 
3 26  TYR n 
3 27  ASP n 
3 28  ILE n 
3 29  THR n 
3 30  SER n 
3 31  TYR n 
3 32  PHE n 
3 33  LYS n 
3 34  GLU n 
3 35  GLU n 
3 36  LEU n 
3 37  GLY n 
3 38  GLN n 
3 39  PHE n 
3 40  TRP n 
3 41  SER n 
3 42  ALA n 
3 43  LYS n 
3 44  HIS n 
3 45  SER n 
3 46  GLN n 
3 47  ILE n 
3 48  TYR n 
3 49  PRO n 
3 50  GLU n 
3 51  LEU n 
3 52  LYS n 
3 53  LYS n 
3 54  LEU n 
3 55  THR n 
3 56  ASP n 
3 57  GLU n 
3 58  GLY n 
3 59  PHE n 
3 60  ILE n 
3 61  THR n 
3 62  PHE n 
3 63  ARG n 
3 64  THR n 
3 65  THR n 
3 66  ILE n 
3 67  GLN n 
3 68  GLY n 
3 69  THR n 
3 70  LYS n 
3 71  LEU n 
3 72  GLU n 
3 73  LYS n 
3 74  LYS n 
3 75  MET n 
3 76  TYR n 
3 77  THR n 
3 78  LEU n 
3 79  THR n 
3 80  ASP n 
3 81  SER n 
3 82  GLY n 
3 83  LYS n 
3 84  GLN n 
3 85  GLU n 
3 86  LEU n 
3 87  HIS n 
3 88  ASP n 
3 89  TRP n 
3 90  LEU n 
3 91  ILE n 
3 92  ARG n 
3 93  HIS n 
3 94  GLN n 
3 95  PRO n 
3 96  ILE n 
3 97  PRO n 
3 98  GLU n 
3 99  THR n 
3 100 VAL n 
3 101 LYS n 
3 102 ASP n 
3 103 GLU n 
3 104 PHE n 
3 105 MET n 
3 106 LEU n 
3 107 LYS n 
3 108 ALA n 
3 109 TYR n 
3 110 PHE n 
3 111 ILE n 
3 112 SER n 
3 113 SER n 
3 114 LEU n 
3 115 SER n 
3 116 ARG n 
3 117 GLN n 
3 118 GLU n 
3 119 ALA n 
3 120 SER n 
3 121 ASP n 
3 122 LEU n 
3 123 PHE n 
3 124 THR n 
3 125 ASP n 
3 126 GLN n 
3 127 LEU n 
3 128 LEU n 
3 129 LYS n 
3 130 ARG n 
3 131 LYS n 
3 132 ALA n 
3 133 LYS n 
3 134 LEU n 
3 135 SER n 
3 136 ASP n 
3 137 LEU n 
3 138 GLN n 
3 139 GLY n 
3 140 SER n 
3 141 TYR n 
3 142 GLU n 
3 143 LYS n 
3 144 LEU n 
3 145 MET n 
3 146 ALA n 
3 147 SER n 
3 148 ALA n 
3 149 GLU n 
3 150 PRO n 
3 151 MET n 
3 152 SER n 
3 153 PHE n 
3 154 SER n 
3 155 SER n 
3 156 PRO n 
3 157 ASP n 
3 158 PHE n 
3 159 GLY n 
3 160 HIS n 
3 161 TYR n 
3 162 LEU n 
3 163 VAL n 
3 164 LEU n 
3 165 THR n 
3 166 LYS n 
3 167 ALA n 
3 168 LEU n 
3 169 GLU n 
3 170 ARG n 
3 171 GLU n 
3 172 LYS n 
3 173 ASN n 
3 174 TYR n 
3 175 VAL n 
3 176 SER n 
3 177 TRP n 
3 178 LEU n 
3 179 GLU n 
3 180 SER n 
3 181 ILE n 
3 182 LEU n 
3 183 ALA n 
3 184 MET n 
3 185 ILE n 
3 186 ASP n 
3 187 GLU n 
3 188 ASP n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   188 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'padR, BSUW23_04210' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    W23 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis subsp. spizizenii strain W23' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     655816 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 28 'synthetic construct' ? 32630 ? 
2 1 sample 1 28 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5X11         5X11   ? 1 ? 1 
2 PDB 5X11         5X11   ? 2 ? 1 
3 UNP E0TW95_BACPZ E0TW95 ? 3 
;MRVLKYAILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDEGFITFRTTIQGTKLEKKMYTLTDSGKQEL
HDWLIRHQPIPETVKDEFMLKAYFISSLSRQEASDLFTDQLLKRKAKLSDLQGSYEKLMASAEPMSFSSPDFGHYLVLTK
ALEREKNYVSWLESILAMIDED
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5X11 I 1 ? 28  ? 5X11   1 ? 28  ? 1 28  
2  2 5X11 J 1 ? 28  ? 5X11   1 ? 28  ? 1 28  
3  1 5X11 M 1 ? 28  ? 5X11   1 ? 28  ? 1 28  
4  2 5X11 N 1 ? 28  ? 5X11   1 ? 28  ? 1 28  
5  3 5X11 A 7 ? 188 ? E0TW95 1 ? 182 ? 1 182 
6  3 5X11 B 7 ? 188 ? E0TW95 1 ? 182 ? 1 182 
7  3 5X11 C 7 ? 188 ? E0TW95 1 ? 182 ? 1 182 
8  3 5X11 D 7 ? 188 ? E0TW95 1 ? 182 ? 1 182 
9  3 5X11 E 7 ? 188 ? E0TW95 1 ? 182 ? 1 182 
10 3 5X11 F 7 ? 188 ? E0TW95 1 ? 182 ? 1 182 
11 3 5X11 G 7 ? 188 ? E0TW95 1 ? 182 ? 1 182 
12 3 5X11 H 7 ? 188 ? E0TW95 1 ? 182 ? 1 182 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
5  5X11 GLY A 1 ? UNP E0TW95 ? ? 'expression tag' -5 1  
5  5X11 SER A 2 ? UNP E0TW95 ? ? 'expression tag' -4 2  
5  5X11 ALA A 3 ? UNP E0TW95 ? ? 'expression tag' -3 3  
5  5X11 LYS A 4 ? UNP E0TW95 ? ? 'expression tag' -2 4  
5  5X11 ASP A 5 ? UNP E0TW95 ? ? 'expression tag' -1 5  
5  5X11 PRO A 6 ? UNP E0TW95 ? ? 'expression tag' 0  6  
6  5X11 GLY B 1 ? UNP E0TW95 ? ? 'expression tag' -5 7  
6  5X11 SER B 2 ? UNP E0TW95 ? ? 'expression tag' -4 8  
6  5X11 ALA B 3 ? UNP E0TW95 ? ? 'expression tag' -3 9  
6  5X11 LYS B 4 ? UNP E0TW95 ? ? 'expression tag' -2 10 
6  5X11 ASP B 5 ? UNP E0TW95 ? ? 'expression tag' -1 11 
6  5X11 PRO B 6 ? UNP E0TW95 ? ? 'expression tag' 0  12 
7  5X11 GLY C 1 ? UNP E0TW95 ? ? 'expression tag' -5 13 
7  5X11 SER C 2 ? UNP E0TW95 ? ? 'expression tag' -4 14 
7  5X11 ALA C 3 ? UNP E0TW95 ? ? 'expression tag' -3 15 
7  5X11 LYS C 4 ? UNP E0TW95 ? ? 'expression tag' -2 16 
7  5X11 ASP C 5 ? UNP E0TW95 ? ? 'expression tag' -1 17 
7  5X11 PRO C 6 ? UNP E0TW95 ? ? 'expression tag' 0  18 
8  5X11 GLY D 1 ? UNP E0TW95 ? ? 'expression tag' -5 19 
8  5X11 SER D 2 ? UNP E0TW95 ? ? 'expression tag' -4 20 
8  5X11 ALA D 3 ? UNP E0TW95 ? ? 'expression tag' -3 21 
8  5X11 LYS D 4 ? UNP E0TW95 ? ? 'expression tag' -2 22 
8  5X11 ASP D 5 ? UNP E0TW95 ? ? 'expression tag' -1 23 
8  5X11 PRO D 6 ? UNP E0TW95 ? ? 'expression tag' 0  24 
9  5X11 GLY E 1 ? UNP E0TW95 ? ? 'expression tag' -5 25 
9  5X11 SER E 2 ? UNP E0TW95 ? ? 'expression tag' -4 26 
9  5X11 ALA E 3 ? UNP E0TW95 ? ? 'expression tag' -3 27 
9  5X11 LYS E 4 ? UNP E0TW95 ? ? 'expression tag' -2 28 
9  5X11 ASP E 5 ? UNP E0TW95 ? ? 'expression tag' -1 29 
9  5X11 PRO E 6 ? UNP E0TW95 ? ? 'expression tag' 0  30 
10 5X11 GLY F 1 ? UNP E0TW95 ? ? 'expression tag' -5 31 
10 5X11 SER F 2 ? UNP E0TW95 ? ? 'expression tag' -4 32 
10 5X11 ALA F 3 ? UNP E0TW95 ? ? 'expression tag' -3 33 
10 5X11 LYS F 4 ? UNP E0TW95 ? ? 'expression tag' -2 34 
10 5X11 ASP F 5 ? UNP E0TW95 ? ? 'expression tag' -1 35 
10 5X11 PRO F 6 ? UNP E0TW95 ? ? 'expression tag' 0  36 
11 5X11 GLY G 1 ? UNP E0TW95 ? ? 'expression tag' -5 37 
11 5X11 SER G 2 ? UNP E0TW95 ? ? 'expression tag' -4 38 
11 5X11 ALA G 3 ? UNP E0TW95 ? ? 'expression tag' -3 39 
11 5X11 LYS G 4 ? UNP E0TW95 ? ? 'expression tag' -2 40 
11 5X11 ASP G 5 ? UNP E0TW95 ? ? 'expression tag' -1 41 
11 5X11 PRO G 6 ? UNP E0TW95 ? ? 'expression tag' 0  42 
12 5X11 GLY H 1 ? UNP E0TW95 ? ? 'expression tag' -5 43 
12 5X11 SER H 2 ? UNP E0TW95 ? ? 'expression tag' -4 44 
12 5X11 ALA H 3 ? UNP E0TW95 ? ? 'expression tag' -3 45 
12 5X11 LYS H 4 ? UNP E0TW95 ? ? 'expression tag' -2 46 
12 5X11 ASP H 5 ? UNP E0TW95 ? ? 'expression tag' -1 47 
12 5X11 PRO H 6 ? UNP E0TW95 ? ? 'expression tag' 0  48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5X11 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.90 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.51 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.4 M ammonium sulfate, 0.1 M MES, 0.2 M lithium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-04-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00003 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PAL/PLS BEAMLINE 7A (6B, 6C1)' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00003 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   '7A (6B, 6C1)' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5X11 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.65 
_reflns.d_resolution_low                 30 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       69940 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.6 
_reflns.pdbx_Rmerge_I_obs                0.064 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            31.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.65 
_reflns_shell.d_res_low                   2.7 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.521 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -5.09 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -2.00 
_refine.aniso_B[2][2]                            5.69 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -1.83 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.909 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5X11 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.65 
_refine.ls_d_res_low                             30.00 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     66237 
_refine.ls_number_reflns_R_free                  3328 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.33 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.23012 
_refine.ls_R_factor_R_free                       0.26819 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.22817 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5X12 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.637 
_refine.pdbx_overall_ESU_R_Free                  0.326 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             29.664 
_refine.overall_SU_ML                            0.283 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        11121 
_refine_hist.pdbx_number_atoms_nucleic_acid   2284 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             17 
_refine_hist.number_atoms_total               13422 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  0.022  13931 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.274  2.181  19287 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 4.621  5.000  1403  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 32.580 23.506 445   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.631 15.000 1998  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.482 15.000 45    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.071  0.200  2161  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  9470  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 0.241  1.500  7050  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 0.483  2.000  11197 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 0.975  3.000  6881  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? 1.575  4.500  8090  ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 668 0.270 0.500  ? ? ? 
2  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' B 668 0.330 0.500  ? ? ? 
3  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' C 668 0.430 0.500  ? ? ? 
4  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' D 668 0.340 0.500  ? ? ? 
5  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' E 668 0.270 0.500  ? ? ? 
6  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' F 668 0.320 0.500  ? ? ? 
7  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' G 668 0.250 0.500  ? ? ? 
8  'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' H 668 0.210 0.500  ? ? ? 
9  'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  A 510 0.340 5.000  ? ? ? 
10 'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  B 510 0.420 5.000  ? ? ? 
11 'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  C 510 0.520 5.000  ? ? ? 
12 'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  D 510 0.480 5.000  ? ? ? 
13 'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  E 510 0.380 5.000  ? ? ? 
14 'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  F 510 0.430 5.000  ? ? ? 
15 'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  G 510 0.370 5.000  ? ? ? 
16 'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL'  H 510 0.500 5.000  ? ? ? 
17 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 668 0.300 2.000  ? ? ? 
18 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    B 668 0.270 2.000  ? ? ? 
19 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    C 668 0.270 2.000  ? ? ? 
20 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    D 668 0.330 2.000  ? ? ? 
21 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    E 668 0.250 2.000  ? ? ? 
22 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    F 668 0.210 2.000  ? ? ? 
23 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    G 668 0.340 2.000  ? ? ? 
24 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    H 668 0.280 2.000  ? ? ? 
25 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     A 510 0.460 10.000 ? ? ? 
26 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     B 510 0.410 10.000 ? ? ? 
27 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     C 510 0.400 10.000 ? ? ? 
28 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     D 510 0.470 10.000 ? ? ? 
29 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     E 510 0.370 10.000 ? ? ? 
30 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     F 510 0.320 10.000 ? ? ? 
31 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     G 510 0.470 10.000 ? ? ? 
32 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'     H 510 0.370 10.000 ? ? ? 
33 'X-RAY DIFFRACTION' 2 1 'LOOSE POSITIONAL'  I 574 0.310 5.000  ? ? ? 
34 'X-RAY DIFFRACTION' 2 1 'LOOSE THERMAL'     M 574 2.760 10.000 ? ? ? 
35 'X-RAY DIFFRACTION' 3 1 'LOOSE POSITIONAL'  J 568 0.260 5.000  ? ? ? 
36 'X-RAY DIFFRACTION' 3 1 'LOOSE THERMAL'     N 568 3.280 10.000 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.650 
_refine_ls_shell.d_res_low                        2.718 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             224 
_refine_ls_shell.number_reflns_R_work             4828 
_refine_ls_shell.percent_reflns_obs               99.45 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.411 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.344 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
1 4 D 
1 5 E 
1 6 F 
1 7 G 
1 8 H 
2 1 I 
2 2 M 
3 1 J 
3 2 N 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 5 A 2   A 139 ? ? ? ? ? ? ? ? ? 
1 2 1 5 B 2   B 139 ? ? ? ? ? ? ? ? ? 
1 3 1 5 C 2   C 139 ? ? ? ? ? ? ? ? ? 
1 4 1 5 D 2   D 139 ? ? ? ? ? ? ? ? ? 
1 5 1 5 E 2   E 139 ? ? ? ? ? ? ? ? ? 
1 6 1 5 F 2   F 139 ? ? ? ? ? ? ? ? ? 
1 7 1 5 G 2   G 139 ? ? ? ? ? ? ? ? ? 
1 8 1 5 H 2   H 139 ? ? ? ? ? ? ? ? ? 
1 1 2 5 A 145 A 176 ? ? ? ? ? ? ? ? ? 
1 2 2 5 B 145 B 176 ? ? ? ? ? ? ? ? ? 
1 3 2 5 C 145 C 176 ? ? ? ? ? ? ? ? ? 
1 4 2 5 D 145 D 176 ? ? ? ? ? ? ? ? ? 
1 5 2 5 E 145 E 176 ? ? ? ? ? ? ? ? ? 
1 6 2 5 F 145 F 176 ? ? ? ? ? ? ? ? ? 
1 7 2 5 G 145 G 176 ? ? ? ? ? ? ? ? ? 
1 8 2 5 H 145 H 176 ? ? ? ? ? ? ? ? ? 
2 1 1 5 I 1   I 28  ? ? ? ? ? ? ? ? ? 
2 2 1 5 M 1   M 28  ? ? ? ? ? ? ? ? ? 
3 1 1 5 J 1   J 28  ? ? ? ? ? ? ? ? ? 
3 2 1 5 N 1   N 28  ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     5X11 
_struct.title                        'Crystal structure of Bacillus subtilis PadR in complex with operator DNA' 
_struct.pdbx_descriptor              'Transcriptional regulator/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5X11 
_struct_keywords.text            'Transcription factor, DNA, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG E 8   ? LEU E 18  ? ARG A 2   LEU A 12  1 ? 11 
HELX_P HELX_P2  AA2 GLY E 25  ? PHE E 32  ? GLY A 19  PHE A 26  1 ? 8  
HELX_P HELX_P3  AA3 LYS E 33  ? PHE E 39  ? LYS A 27  PHE A 33  5 ? 7  
HELX_P HELX_P4  AA4 LYS E 43  ? GLU E 57  ? LYS A 37  GLU A 51  1 ? 15 
HELX_P HELX_P5  AA5 THR E 79  ? ARG E 92  ? THR A 73  ARG A 86  1 ? 14 
HELX_P HELX_P6  AA6 ASP E 102 ? PHE E 110 ? ASP A 96  PHE A 104 1 ? 9  
HELX_P HELX_P7  AA7 GLN E 117 ? SER E 147 ? GLN A 111 SER A 141 1 ? 31 
HELX_P HELX_P8  AA8 ASP E 157 ? ILE E 185 ? ASP A 151 ILE A 179 1 ? 29 
HELX_P HELX_P9  AA9 ARG F 8   ? LEU F 18  ? ARG B 2   LEU B 12  1 ? 11 
HELX_P HELX_P10 AB1 SER F 24  ? PHE F 32  ? SER B 18  PHE B 26  1 ? 9  
HELX_P HELX_P11 AB2 LYS F 33  ? PHE F 39  ? LYS B 27  PHE B 33  5 ? 7  
HELX_P HELX_P12 AB3 LYS F 43  ? GLU F 57  ? LYS B 37  GLU B 51  1 ? 15 
HELX_P HELX_P13 AB4 THR F 79  ? ILE F 91  ? THR B 73  ILE B 85  1 ? 13 
HELX_P HELX_P14 AB5 ASP F 102 ? PHE F 110 ? ASP B 96  PHE B 104 1 ? 9  
HELX_P HELX_P15 AB6 ILE F 111 ? LEU F 114 ? ILE B 105 LEU B 108 5 ? 4  
HELX_P HELX_P16 AB7 SER F 115 ? SER F 147 ? SER B 109 SER B 141 1 ? 33 
HELX_P HELX_P17 AB8 ASP F 157 ? ASP F 186 ? ASP B 151 ASP B 180 1 ? 30 
HELX_P HELX_P18 AB9 VAL G 9   ? LEU G 18  ? VAL C 3   LEU C 12  1 ? 10 
HELX_P HELX_P19 AC1 SER G 24  ? GLU G 34  ? SER C 18  GLU C 28  1 ? 11 
HELX_P HELX_P20 AC2 GLU G 35  ? PHE G 39  ? GLU C 29  PHE C 33  5 ? 5  
HELX_P HELX_P21 AC3 LYS G 43  ? GLU G 57  ? LYS C 37  GLU C 51  1 ? 15 
HELX_P HELX_P22 AC4 THR G 79  ? ARG G 92  ? THR C 73  ARG C 86  1 ? 14 
HELX_P HELX_P23 AC5 ASP G 102 ? PHE G 110 ? ASP C 96  PHE C 104 1 ? 9  
HELX_P HELX_P24 AC6 ILE G 111 ? LEU G 114 ? ILE C 105 LEU C 108 5 ? 4  
HELX_P HELX_P25 AC7 SER G 115 ? MET G 145 ? SER C 109 MET C 139 1 ? 31 
HELX_P HELX_P26 AC8 ASP G 157 ? ASP G 186 ? ASP C 151 ASP C 180 1 ? 30 
HELX_P HELX_P27 AC9 VAL H 9   ? LEU H 18  ? VAL D 3   LEU D 12  1 ? 10 
HELX_P HELX_P28 AD1 GLY H 25  ? GLU H 34  ? GLY D 19  GLU D 28  1 ? 10 
HELX_P HELX_P29 AD2 GLU H 35  ? PHE H 39  ? GLU D 29  PHE D 33  5 ? 5  
HELX_P HELX_P30 AD3 LYS H 43  ? GLU H 57  ? LYS D 37  GLU D 51  1 ? 15 
HELX_P HELX_P31 AD4 THR H 79  ? ARG H 92  ? THR D 73  ARG D 86  1 ? 14 
HELX_P HELX_P32 AD5 ASP H 102 ? PHE H 110 ? ASP D 96  PHE D 104 1 ? 9  
HELX_P HELX_P33 AD6 ILE H 111 ? LEU H 114 ? ILE D 105 LEU D 108 5 ? 4  
HELX_P HELX_P34 AD7 SER H 115 ? SER H 147 ? SER D 109 SER D 141 1 ? 33 
HELX_P HELX_P35 AD8 ASP H 157 ? ASP H 186 ? ASP D 151 ASP D 180 1 ? 30 
HELX_P HELX_P36 AD9 ARG I 8   ? LEU I 18  ? ARG E 2   LEU E 12  1 ? 11 
HELX_P HELX_P37 AE1 SER I 24  ? GLU I 34  ? SER E 18  GLU E 28  1 ? 11 
HELX_P HELX_P38 AE2 GLU I 35  ? PHE I 39  ? GLU E 29  PHE E 33  5 ? 5  
HELX_P HELX_P39 AE3 LYS I 43  ? GLU I 57  ? LYS E 37  GLU E 51  1 ? 15 
HELX_P HELX_P40 AE4 THR I 79  ? ARG I 92  ? THR E 73  ARG E 86  1 ? 14 
HELX_P HELX_P41 AE5 ASP I 102 ? PHE I 110 ? ASP E 96  PHE E 104 1 ? 9  
HELX_P HELX_P42 AE6 ILE I 111 ? LEU I 114 ? ILE E 105 LEU E 108 5 ? 4  
HELX_P HELX_P43 AE7 SER I 115 ? ALA I 146 ? SER E 109 ALA E 140 1 ? 32 
HELX_P HELX_P44 AE8 ASP I 157 ? ALA I 183 ? ASP E 151 ALA E 177 1 ? 27 
HELX_P HELX_P45 AE9 ARG J 8   ? LEU J 18  ? ARG F 2   LEU F 12  1 ? 11 
HELX_P HELX_P46 AF1 SER J 24  ? PHE J 32  ? SER F 18  PHE F 26  1 ? 9  
HELX_P HELX_P47 AF2 LYS J 33  ? PHE J 39  ? LYS F 27  PHE F 33  5 ? 7  
HELX_P HELX_P48 AF3 LYS J 43  ? GLU J 57  ? LYS F 37  GLU F 51  1 ? 15 
HELX_P HELX_P49 AF4 THR J 79  ? ILE J 91  ? THR F 73  ILE F 85  1 ? 13 
HELX_P HELX_P50 AF5 ASP J 102 ? PHE J 110 ? ASP F 96  PHE F 104 1 ? 9  
HELX_P HELX_P51 AF6 ILE J 111 ? LEU J 114 ? ILE F 105 LEU F 108 5 ? 4  
HELX_P HELX_P52 AF7 SER J 115 ? MET J 145 ? SER F 109 MET F 139 1 ? 31 
HELX_P HELX_P53 AF8 ASP J 157 ? ASP J 186 ? ASP F 151 ASP F 180 1 ? 30 
HELX_P HELX_P54 AF9 ARG K 8   ? LEU K 18  ? ARG G 2   LEU G 12  1 ? 11 
HELX_P HELX_P55 AG1 ARG K 19  ? GLY K 21  ? ARG G 13  GLY G 15  5 ? 3  
HELX_P HELX_P56 AG2 SER K 24  ? GLU K 34  ? SER G 18  GLU G 28  1 ? 11 
HELX_P HELX_P57 AG3 GLU K 35  ? PHE K 39  ? GLU G 29  PHE G 33  5 ? 5  
HELX_P HELX_P58 AG4 LYS K 43  ? GLU K 57  ? LYS G 37  GLU G 51  1 ? 15 
HELX_P HELX_P59 AG5 THR K 79  ? ARG K 92  ? THR G 73  ARG G 86  1 ? 14 
HELX_P HELX_P60 AG6 ASP K 102 ? PHE K 110 ? ASP G 96  PHE G 104 1 ? 9  
HELX_P HELX_P61 AG7 ARG K 116 ? ALA K 146 ? ARG G 110 ALA G 140 1 ? 31 
HELX_P HELX_P62 AG8 ASP K 157 ? ALA K 183 ? ASP G 151 ALA G 177 1 ? 27 
HELX_P HELX_P63 AG9 VAL L 9   ? LEU L 18  ? VAL H 3   LEU H 12  1 ? 10 
HELX_P HELX_P64 AH1 GLY L 25  ? GLU L 34  ? GLY H 19  GLU H 28  1 ? 10 
HELX_P HELX_P65 AH2 GLU L 35  ? PHE L 39  ? GLU H 29  PHE H 33  5 ? 5  
HELX_P HELX_P66 AH3 LYS L 43  ? GLU L 57  ? LYS H 37  GLU H 51  1 ? 15 
HELX_P HELX_P67 AH4 THR L 79  ? ARG L 92  ? THR H 73  ARG H 86  1 ? 14 
HELX_P HELX_P68 AH5 ASP L 102 ? PHE L 110 ? ASP H 96  PHE H 104 1 ? 9  
HELX_P HELX_P69 AH6 ILE L 111 ? LEU L 114 ? ILE H 105 LEU H 108 5 ? 4  
HELX_P HELX_P70 AH7 SER L 115 ? MET L 145 ? SER H 109 MET H 139 1 ? 31 
HELX_P HELX_P71 AH8 ASP L 157 ? ASP L 186 ? ASP H 151 ASP H 180 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DC 1  N3 ? ? ? 1_555 B DG 28 N1 ? ? I DC 1  J DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? A DC 1  N4 ? ? ? 1_555 B DG 28 O6 ? ? I DC 1  J DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? A DC 1  O2 ? ? ? 1_555 B DG 28 N2 ? ? I DC 1  J DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 27 N3 ? ? I DG 2  J DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 27 O2 ? ? I DG 2  J DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 27 N4 ? ? I DG 2  J DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 26 N3 ? ? I DG 3  J DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 26 O2 ? ? I DG 3  J DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 26 N4 ? ? I DG 3  J DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 25 N3 ? ? I DA 4  J DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 25 O4 ? ? I DA 4  J DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 24 N3 ? ? I DA 5  J DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 24 O4 ? ? I DA 5  J DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG 23 N1 ? ? I DC 6  J DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG 23 O6 ? ? I DC 6  J DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG 23 N2 ? ? I DC 6  J DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 22 N3 ? ? I DA 7  J DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 22 O4 ? ? I DA 7  J DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 21 N1 ? ? I DT 8  J DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 21 N6 ? ? I DT 8  J DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? A DG 9  N1 ? ? ? 1_555 B DC 20 N3 ? ? I DG 9  J DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC 20 O2 ? ? I DG 9  J DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? A DG 9  O6 ? ? ? 1_555 B DC 20 N4 ? ? I DG 9  J DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 19 N1 ? ? I DT 10 J DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 19 N6 ? ? I DT 10 J DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 18 N3 ? ? I DA 11 J DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 18 O4 ? ? I DA 11 J DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 17 N3 ? ? I DA 12 J DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 17 O4 ? ? I DA 12 J DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 16 N3 ? ? I DA 13 J DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 16 O4 ? ? I DA 13 J DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 15 N1 ? ? I DT 14 J DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 15 N6 ? ? I DT 14 J DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 14 N3 ? ? I DA 15 J DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 14 O4 ? ? I DA 15 J DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? A DG 16 N1 ? ? ? 1_555 B DC 13 N3 ? ? I DG 16 J DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? A DG 16 N2 ? ? ? 1_555 B DC 13 O2 ? ? I DG 16 J DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? A DG 16 O6 ? ? ? 1_555 B DC 13 N4 ? ? I DG 16 J DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? A DT 17 N3 ? ? ? 1_555 B DA 12 N1 ? ? I DT 17 J DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? A DT 17 O4 ? ? ? 1_555 B DA 12 N6 ? ? I DT 17 J DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? A DT 18 N3 ? ? ? 1_555 B DA 11 N1 ? ? I DT 18 J DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? A DT 18 O4 ? ? ? 1_555 B DA 11 N6 ? ? I DT 18 J DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? A DA 19 N1 ? ? ? 1_555 B DT 10 N3 ? ? I DA 19 J DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? A DA 19 N6 ? ? ? 1_555 B DT 10 O4 ? ? I DA 19 J DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? A DC 20 N3 ? ? ? 1_555 B DG 9  N1 ? ? I DC 20 J DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? A DC 20 N4 ? ? ? 1_555 B DG 9  O6 ? ? I DC 20 J DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? A DC 20 O2 ? ? ? 1_555 B DG 9  N2 ? ? I DC 20 J DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? A DA 21 N1 ? ? ? 1_555 B DT 8  N3 ? ? I DA 21 J DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? A DA 21 N6 ? ? ? 1_555 B DT 8  O4 ? ? I DA 21 J DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? A DT 22 N3 ? ? ? 1_555 B DA 7  N1 ? ? I DT 22 J DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? A DT 22 O4 ? ? ? 1_555 B DA 7  N6 ? ? I DT 22 J DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? A DG 23 N1 ? ? ? 1_555 B DC 6  N3 ? ? I DG 23 J DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? A DG 23 N2 ? ? ? 1_555 B DC 6  O2 ? ? I DG 23 J DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? A DG 23 O6 ? ? ? 1_555 B DC 6  N4 ? ? I DG 23 J DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? A DA 24 N1 ? ? ? 1_555 B DT 5  N3 ? ? I DA 24 J DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? A DA 24 N6 ? ? ? 1_555 B DT 5  O4 ? ? I DA 24 J DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? A DT 25 N3 ? ? ? 1_555 B DA 4  N1 ? ? I DT 25 J DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? A DT 25 O4 ? ? ? 1_555 B DA 4  N6 ? ? I DT 25 J DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? A DT 26 N3 ? ? ? 1_555 B DA 3  N1 ? ? I DT 26 J DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? A DT 26 O4 ? ? ? 1_555 B DA 3  N6 ? ? I DT 26 J DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? A DA 27 N1 ? ? ? 1_555 B DT 2  N3 ? ? I DA 27 J DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? A DA 27 N6 ? ? ? 1_555 B DT 2  O4 ? ? I DA 27 J DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? A DC 28 N3 ? ? ? 1_555 B DG 1  N1 ? ? I DC 28 J DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? A DC 28 N4 ? ? ? 1_555 B DG 1  O6 ? ? I DC 28 J DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? A DC 28 O2 ? ? ? 1_555 B DG 1  N2 ? ? I DC 28 J DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? C DC 1  N3 ? ? ? 1_555 D DG 28 N1 ? ? M DC 1  N DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? C DC 1  N4 ? ? ? 1_555 D DG 28 O6 ? ? M DC 1  N DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? C DC 1  O2 ? ? ? 1_555 D DG 28 N2 ? ? M DC 1  N DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? C DG 2  N1 ? ? ? 1_555 D DC 27 N3 ? ? M DG 2  N DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? C DG 2  N2 ? ? ? 1_555 D DC 27 O2 ? ? M DG 2  N DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? C DG 2  O6 ? ? ? 1_555 D DC 27 N4 ? ? M DG 2  N DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? C DG 3  N1 ? ? ? 1_555 D DC 26 N3 ? ? M DG 3  N DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? C DG 3  N2 ? ? ? 1_555 D DC 26 O2 ? ? M DG 3  N DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? C DG 3  O6 ? ? ? 1_555 D DC 26 N4 ? ? M DG 3  N DC 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 25 N3 ? ? M DA 4  N DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 25 O4 ? ? M DA 4  N DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT 24 N3 ? ? M DA 5  N DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT 24 O4 ? ? M DA 5  N DT 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? C DC 6  N3 ? ? ? 1_555 D DG 23 N1 ? ? M DC 6  N DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? C DC 6  N4 ? ? ? 1_555 D DG 23 O6 ? ? M DC 6  N DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? C DC 6  O2 ? ? ? 1_555 D DG 23 N2 ? ? M DC 6  N DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 22 N3 ? ? M DA 7  N DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 22 O4 ? ? M DA 7  N DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? C DT 8  N3 ? ? ? 1_555 D DA 21 N1 ? ? M DT 8  N DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA 21 N6 ? ? M DT 8  N DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? C DG 9  N1 ? ? ? 1_555 D DC 20 N3 ? ? M DG 9  N DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? C DG 9  N2 ? ? ? 1_555 D DC 20 O2 ? ? M DG 9  N DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? C DG 9  O6 ? ? ? 1_555 D DC 20 N4 ? ? M DG 9  N DC 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? C DT 10 N3 ? ? ? 1_555 D DA 19 N1 ? ? M DT 10 N DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? C DT 10 O4 ? ? ? 1_555 D DA 19 N6 ? ? M DT 10 N DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 18 N3 ? ? M DA 11 N DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 18 O4 ? ? M DA 11 N DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? C DA 12 N1 ? ? ? 1_555 D DT 17 N3 ? ? M DA 12 N DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DT 17 O4 ? ? M DA 12 N DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? C DA 13 N1 ? ? ? 1_555 D DT 16 N3 ? ? M DA 13 N DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? C DA 13 N6 ? ? ? 1_555 D DT 16 O4 ? ? M DA 13 N DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA 15 N1 ? ? M DT 14 N DA 15 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? 
hydrog98  hydrog ? ? C DA 15 N1 ? ? ? 1_555 D DT 14 N3 ? ? M DA 15 N DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? C DA 15 N6 ? ? ? 1_555 D DT 14 O4 ? ? M DA 15 N DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? C DG 16 N1 ? ? ? 1_555 D DC 13 N3 ? ? M DG 16 N DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? C DG 16 N2 ? ? ? 1_555 D DC 13 O2 ? ? M DG 16 N DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? C DG 16 O6 ? ? ? 1_555 D DC 13 N4 ? ? M DG 16 N DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA 12 N1 ? ? M DT 17 N DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA 12 N6 ? ? M DT 17 N DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? C DT 18 N3 ? ? ? 1_555 D DA 11 N1 ? ? M DT 18 N DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? C DT 18 O4 ? ? ? 1_555 D DA 11 N6 ? ? M DT 18 N DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? C DA 19 N1 ? ? ? 1_555 D DT 10 N3 ? ? M DA 19 N DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? C DA 19 N6 ? ? ? 1_555 D DT 10 O4 ? ? M DA 19 N DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? C DC 20 N3 ? ? ? 1_555 D DG 9  N1 ? ? M DC 20 N DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? C DC 20 N4 ? ? ? 1_555 D DG 9  O6 ? ? M DC 20 N DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? C DC 20 O2 ? ? ? 1_555 D DG 9  N2 ? ? M DC 20 N DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? C DA 21 N1 ? ? ? 1_555 D DT 8  N3 ? ? M DA 21 N DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? C DA 21 N6 ? ? ? 1_555 D DT 8  O4 ? ? M DA 21 N DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? C DT 22 N3 ? ? ? 1_555 D DA 7  N1 ? ? M DT 22 N DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? C DT 22 O4 ? ? ? 1_555 D DA 7  N6 ? ? M DT 22 N DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? C DG 23 N1 ? ? ? 1_555 D DC 6  N3 ? ? M DG 23 N DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? C DG 23 N2 ? ? ? 1_555 D DC 6  O2 ? ? M DG 23 N DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? C DG 23 O6 ? ? ? 1_555 D DC 6  N4 ? ? M DG 23 N DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? C DA 24 N1 ? ? ? 1_555 D DT 5  N3 ? ? M DA 24 N DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? C DA 24 N6 ? ? ? 1_555 D DT 5  O4 ? ? M DA 24 N DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? C DT 25 N3 ? ? ? 1_555 D DA 4  N1 ? ? M DT 25 N DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? C DT 25 O4 ? ? ? 1_555 D DA 4  N6 ? ? M DT 25 N DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? C DT 26 N3 ? ? ? 1_555 D DA 3  N1 ? ? M DT 26 N DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? C DT 26 O4 ? ? ? 1_555 D DA 3  N6 ? ? M DT 26 N DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? C DA 27 N1 ? ? ? 1_555 D DT 2  N3 ? ? M DA 27 N DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? C DA 27 N6 ? ? ? 1_555 D DT 2  O4 ? ? M DA 27 N DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? C DC 28 N3 ? ? ? 1_555 D DG 1  N1 ? ? M DC 28 N DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? C DC 28 N4 ? ? ? 1_555 D DG 1  O6 ? ? M DC 28 N DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? C DC 28 O2 ? ? ? 1_555 D DG 1  N2 ? ? M DC 28 N DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU E 23 ? SER E 24 ? LEU A 17 SER A 18 
AA1 2 LEU E 71 ? LEU E 78 ? LEU A 65 LEU A 72 
AA1 3 ILE E 60 ? GLN E 67 ? ILE A 54 GLN A 61 
AA2 1 ILE F 60 ? GLN F 67 ? ILE B 54 GLN B 61 
AA2 2 LEU F 71 ? LEU F 78 ? LEU B 65 LEU B 72 
AA3 1 ILE G 60 ? GLN G 67 ? ILE C 54 GLN C 61 
AA3 2 LEU G 71 ? LEU G 78 ? LEU C 65 LEU C 72 
AA4 1 LEU H 23 ? SER H 24 ? LEU D 17 SER D 18 
AA4 2 LEU H 71 ? LEU H 78 ? LEU D 65 LEU D 72 
AA4 3 ILE H 60 ? GLN H 67 ? ILE D 54 GLN D 61 
AA5 1 ILE I 60 ? ILE I 66 ? ILE E 54 ILE E 60 
AA5 2 GLU I 72 ? LEU I 78 ? GLU E 66 LEU E 72 
AA6 1 ILE J 60 ? GLN J 67 ? ILE F 54 GLN F 61 
AA6 2 LEU J 71 ? LEU J 78 ? LEU F 65 LEU F 72 
AA7 1 ILE K 60 ? GLN K 67 ? ILE G 54 GLN G 61 
AA7 2 LEU K 71 ? LEU K 78 ? LEU G 65 LEU G 72 
AA8 1 LEU L 23 ? SER L 24 ? LEU H 17 SER H 18 
AA8 2 LEU L 71 ? LEU L 78 ? LEU H 65 LEU H 72 
AA8 3 ILE L 60 ? GLN L 67 ? ILE H 54 GLN H 61 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU E 23 ? N LEU A 17 O TYR E 76 ? O TYR A 70 
AA1 2 3 O THR E 77 ? O THR A 71 N THR E 61 ? N THR A 55 
AA2 1 2 N THR F 61 ? N THR B 55 O THR F 77 ? O THR B 71 
AA3 1 2 N THR G 65 ? N THR C 59 O LYS G 73 ? O LYS C 67 
AA4 1 2 N LEU H 23 ? N LEU D 17 O TYR H 76 ? O TYR D 70 
AA4 2 3 O LEU H 71 ? O LEU D 65 N GLN H 67 ? N GLN D 61 
AA5 1 2 N THR I 61 ? N THR E 55 O THR I 77 ? O THR E 71 
AA6 1 2 N THR J 65 ? N THR F 59 O LYS J 73 ? O LYS F 67 
AA7 1 2 N ARG K 63 ? N ARG G 57 O MET K 75 ? O MET G 69 
AA8 1 2 N LEU L 23 ? N LEU H 17 O TYR L 76 ? O TYR H 70 
AA8 2 3 O LEU L 71 ? O LEU H 65 N GLN L 67 ? N GLN H 61 
# 
_atom_sites.entry_id                    5X11 
_atom_sites.fract_transf_matrix[1][1]   0.002926 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000947 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016242 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008719 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O "O5'" . DC  A 1 1   ? -71.445 -5.260  34.526 1.00 79.97  ? 1   DC  I "O5'" 1 
ATOM   2     C "C5'" . DC  A 1 1   ? -70.050 -5.011  34.641 1.00 76.06  ? 1   DC  I "C5'" 1 
ATOM   3     C "C4'" . DC  A 1 1   ? -69.379 -5.089  33.283 1.00 75.11  ? 1   DC  I "C4'" 1 
ATOM   4     O "O4'" . DC  A 1 1   ? -69.436 -3.815  32.592 1.00 74.15  ? 1   DC  I "O4'" 1 
ATOM   5     C "C3'" . DC  A 1 1   ? -67.911 -5.443  33.376 1.00 72.61  ? 1   DC  I "C3'" 1 
ATOM   6     O "O3'" . DC  A 1 1   ? -67.773 -6.667  32.680 1.00 74.24  ? 1   DC  I "O3'" 1 
ATOM   7     C "C2'" . DC  A 1 1   ? -67.162 -4.257  32.752 1.00 70.10  ? 1   DC  I "C2'" 1 
ATOM   8     C "C1'" . DC  A 1 1   ? -68.232 -3.604  31.888 1.00 71.32  ? 1   DC  I "C1'" 1 
ATOM   9     N N1    . DC  A 1 1   ? -68.142 -2.124  31.628 1.00 68.87  ? 1   DC  I N1    1 
ATOM   10    C C2    . DC  A 1 1   ? -67.809 -1.643  30.340 1.00 69.84  ? 1   DC  I C2    1 
ATOM   11    O O2    . DC  A 1 1   ? -67.563 -2.427  29.410 1.00 71.34  ? 1   DC  I O2    1 
ATOM   12    N N3    . DC  A 1 1   ? -67.750 -0.300  30.128 1.00 68.47  ? 1   DC  I N3    1 
ATOM   13    C C4    . DC  A 1 1   ? -68.013 0.547   31.127 1.00 67.10  ? 1   DC  I C4    1 
ATOM   14    N N4    . DC  A 1 1   ? -67.950 1.854   30.857 1.00 66.18  ? 1   DC  I N4    1 
ATOM   15    C C5    . DC  A 1 1   ? -68.354 0.087   32.442 1.00 66.31  ? 1   DC  I C5    1 
ATOM   16    C C6    . DC  A 1 1   ? -68.413 -1.240  32.641 1.00 66.93  ? 1   DC  I C6    1 
ATOM   17    P P     . DG  A 1 2   ? -66.527 -7.617  33.004 1.00 73.10  ? 2   DG  I P     1 
ATOM   18    O OP1   . DG  A 1 2   ? -66.848 -9.004  32.596 1.00 75.80  ? 2   DG  I OP1   1 
ATOM   19    O OP2   . DG  A 1 2   ? -66.076 -7.353  34.384 1.00 70.99  ? 2   DG  I OP2   1 
ATOM   20    O "O5'" . DG  A 1 2   ? -65.433 -6.986  32.022 1.00 71.75  ? 2   DG  I "O5'" 1 
ATOM   21    C "C5'" . DG  A 1 2   ? -65.640 -6.982  30.616 1.00 74.23  ? 2   DG  I "C5'" 1 
ATOM   22    C "C4'" . DG  A 1 2   ? -64.571 -6.162  29.923 1.00 73.25  ? 2   DG  I "C4'" 1 
ATOM   23    O "O4'" . DG  A 1 2   ? -64.881 -4.763  30.089 1.00 71.52  ? 2   DG  I "O4'" 1 
ATOM   24    C "C3'" . DG  A 1 2   ? -63.147 -6.345  30.437 1.00 72.06  ? 2   DG  I "C3'" 1 
ATOM   25    O "O3'" . DG  A 1 2   ? -62.369 -6.797  29.355 1.00 74.72  ? 2   DG  I "O3'" 1 
ATOM   26    C "C2'" . DG  A 1 2   ? -62.717 -4.958  30.924 1.00 67.89  ? 2   DG  I "C2'" 1 
ATOM   27    C "C1'" . DG  A 1 2   ? -63.687 -4.031  30.209 1.00 68.58  ? 2   DG  I "C1'" 1 
ATOM   28    N N9    . DG  A 1 2   ? -64.045 -2.827  30.946 1.00 66.73  ? 2   DG  I N9    1 
ATOM   29    C C8    . DG  A 1 2   ? -64.364 -2.691  32.282 1.00 65.75  ? 2   DG  I C8    1 
ATOM   30    N N7    . DG  A 1 2   ? -64.651 -1.467  32.642 1.00 64.50  ? 2   DG  I N7    1 
ATOM   31    C C5    . DG  A 1 2   ? -64.513 -0.750  31.457 1.00 65.35  ? 2   DG  I C5    1 
ATOM   32    C C6    . DG  A 1 2   ? -64.692 0.631   31.201 1.00 65.24  ? 2   DG  I C6    1 
ATOM   33    O O6    . DG  A 1 2   ? -65.019 1.517   32.001 1.00 65.08  ? 2   DG  I O6    1 
ATOM   34    N N1    . DG  A 1 2   ? -64.453 0.951   29.858 1.00 66.74  ? 2   DG  I N1    1 
ATOM   35    C C2    . DG  A 1 2   ? -64.082 0.038   28.884 1.00 68.17  ? 2   DG  I C2    1 
ATOM   36    N N2    . DG  A 1 2   ? -63.890 0.523   27.649 1.00 68.78  ? 2   DG  I N2    1 
ATOM   37    N N3    . DG  A 1 2   ? -63.917 -1.266  29.106 1.00 67.76  ? 2   DG  I N3    1 
ATOM   38    C C4    . DG  A 1 2   ? -64.147 -1.576  30.408 1.00 66.52  ? 2   DG  I C4    1 
ATOM   39    P P     . DG  A 1 3   ? -60.833 -7.167  29.548 1.00 75.47  ? 3   DG  I P     1 
ATOM   40    O OP1   . DG  A 1 3   ? -60.830 -8.551  30.062 1.00 79.38  ? 3   DG  I OP1   1 
ATOM   41    O OP2   . DG  A 1 3   ? -60.131 -6.106  30.295 1.00 71.14  ? 3   DG  I OP2   1 
ATOM   42    O "O5'" . DG  A 1 3   ? -60.223 -7.149  28.065 1.00 78.05  ? 3   DG  I "O5'" 1 
ATOM   43    C "C5'" . DG  A 1 3   ? -60.778 -6.349  27.019 1.00 79.14  ? 3   DG  I "C5'" 1 
ATOM   44    C "C4'" . DG  A 1 3   ? -60.017 -5.051  26.784 1.00 76.18  ? 3   DG  I "C4'" 1 
ATOM   45    O "O4'" . DG  A 1 3   ? -60.584 -3.977  27.569 1.00 72.43  ? 3   DG  I "O4'" 1 
ATOM   46    C "C3'" . DG  A 1 3   ? -58.521 -5.044  27.092 1.00 74.76  ? 3   DG  I "C3'" 1 
ATOM   47    O "O3'" . DG  A 1 3   ? -57.886 -4.515  25.945 1.00 77.05  ? 3   DG  I "O3'" 1 
ATOM   48    C "C2'" . DG  A 1 3   ? -58.386 -4.092  28.278 1.00 69.87  ? 3   DG  I "C2'" 1 
ATOM   49    C "C1'" . DG  A 1 3   ? -59.534 -3.138  27.981 1.00 69.23  ? 3   DG  I "C1'" 1 
ATOM   50    N N9    . DG  A 1 3   ? -60.010 -2.340  29.105 1.00 66.22  ? 3   DG  I N9    1 
ATOM   51    C C8    . DG  A 1 3   ? -60.249 -2.738  30.397 1.00 65.04  ? 3   DG  I C8    1 
ATOM   52    N N7    . DG  A 1 3   ? -60.689 -1.792  31.178 1.00 63.60  ? 3   DG  I N7    1 
ATOM   53    C C5    . DG  A 1 3   ? -60.741 -0.684  30.345 1.00 64.38  ? 3   DG  I C5    1 
ATOM   54    C C6    . DG  A 1 3   ? -61.136 0.650   30.619 1.00 63.21  ? 3   DG  I C6    1 
ATOM   55    O O6    . DG  A 1 3   ? -61.524 1.128   31.694 1.00 61.04  ? 3   DG  I O6    1 
ATOM   56    N N1    . DG  A 1 3   ? -61.035 1.459   29.486 1.00 64.56  ? 3   DG  I N1    1 
ATOM   57    C C2    . DG  A 1 3   ? -60.612 1.031   28.242 1.00 67.41  ? 3   DG  I C2    1 
ATOM   58    N N2    . DG  A 1 3   ? -60.577 1.944   27.257 1.00 69.71  ? 3   DG  I N2    1 
ATOM   59    N N3    . DG  A 1 3   ? -60.237 -0.215  27.972 1.00 67.96  ? 3   DG  I N3    1 
ATOM   60    C C4    . DG  A 1 3   ? -60.326 -1.011  29.067 1.00 66.06  ? 3   DG  I C4    1 
ATOM   61    P P     . DA  A 1 4   ? -56.334 -4.723  25.653 1.00 77.62  ? 4   DA  I P     1 
ATOM   62    O OP1   . DA  A 1 4   ? -56.308 -5.800  24.637 1.00 81.36  ? 4   DA  I OP1   1 
ATOM   63    O OP2   . DA  A 1 4   ? -55.586 -4.831  26.933 1.00 74.68  ? 4   DA  I OP2   1 
ATOM   64    O "O5'" . DA  A 1 4   ? -55.859 -3.329  25.013 1.00 75.57  ? 4   DA  I "O5'" 1 
ATOM   65    C "C5'" . DA  A 1 4   ? -56.803 -2.449  24.383 1.00 74.86  ? 4   DA  I "C5'" 1 
ATOM   66    C "C4'" . DA  A 1 4   ? -56.427 -0.976  24.531 1.00 70.58  ? 4   DA  I "C4'" 1 
ATOM   67    O "O4'" . DA  A 1 4   ? -57.022 -0.391  25.716 1.00 66.26  ? 4   DA  I "O4'" 1 
ATOM   68    C "C3'" . DA  A 1 4   ? -54.946 -0.644  24.609 1.00 67.72  ? 4   DA  I "C3'" 1 
ATOM   69    O "O3'" . DA  A 1 4   ? -54.743 0.455   23.735 1.00 69.49  ? 4   DA  I "O3'" 1 
ATOM   70    C "C2'" . DA  A 1 4   ? -54.739 -0.287  26.082 1.00 63.23  ? 4   DA  I "C2'" 1 
ATOM   71    C "C1'" . DA  A 1 4   ? -56.069 0.347   26.456 1.00 61.75  ? 4   DA  I "C1'" 1 
ATOM   72    N N9    . DA  A 1 4   ? -56.497 0.224   27.850 1.00 57.95  ? 4   DA  I N9    1 
ATOM   73    C C8    . DA  A 1 4   ? -56.421 -0.891  28.635 1.00 56.77  ? 4   DA  I C8    1 
ATOM   74    N N7    . DA  A 1 4   ? -56.911 -0.743  29.841 1.00 55.75  ? 4   DA  I N7    1 
ATOM   75    C C5    . DA  A 1 4   ? -57.354 0.565   29.851 1.00 55.61  ? 4   DA  I C5    1 
ATOM   76    C C6    . DA  A 1 4   ? -57.973 1.352   30.852 1.00 54.57  ? 4   DA  I C6    1 
ATOM   77    N N6    . DA  A 1 4   ? -58.255 0.882   32.067 1.00 52.26  ? 4   DA  I N6    1 
ATOM   78    N N1    . DA  A 1 4   ? -58.278 2.645   30.557 1.00 55.28  ? 4   DA  I N1    1 
ATOM   79    C C2    . DA  A 1 4   ? -57.992 3.110   29.327 1.00 56.38  ? 4   DA  I C2    1 
ATOM   80    N N3    . DA  A 1 4   ? -57.415 2.458   28.305 1.00 57.69  ? 4   DA  I N3    1 
ATOM   81    C C4    . DA  A 1 4   ? -57.113 1.178   28.629 1.00 56.97  ? 4   DA  I C4    1 
ATOM   82    P P     . DA  A 1 5   ? -53.287 1.021   23.360 1.00 70.66  ? 5   DA  I P     1 
ATOM   83    O OP1   . DA  A 1 5   ? -53.405 1.488   21.958 1.00 75.06  ? 5   DA  I OP1   1 
ATOM   84    O OP2   . DA  A 1 5   ? -52.217 0.073   23.743 1.00 66.66  ? 5   DA  I OP2   1 
ATOM   85    O "O5'" . DA  A 1 5   ? -53.202 2.301   24.309 1.00 67.53  ? 5   DA  I "O5'" 1 
ATOM   86    C "C5'" . DA  A 1 5   ? -54.202 3.322   24.148 1.00 68.71  ? 5   DA  I "C5'" 1 
ATOM   87    C "C4'" . DA  A 1 5   ? -54.183 4.291   25.317 1.00 65.93  ? 5   DA  I "C4'" 1 
ATOM   88    O "O4'" . DA  A 1 5   ? -54.657 3.616   26.511 1.00 63.25  ? 5   DA  I "O4'" 1 
ATOM   89    C "C3'" . DA  A 1 5   ? -52.805 4.857   25.665 1.00 63.92  ? 5   DA  I "C3'" 1 
ATOM   90    O "O3'" . DA  A 1 5   ? -52.857 6.279   25.581 1.00 65.83  ? 5   DA  I "O3'" 1 
ATOM   91    C "C2'" . DA  A 1 5   ? -52.545 4.362   27.084 1.00 59.56  ? 5   DA  I "C2'" 1 
ATOM   92    C "C1'" . DA  A 1 5   ? -53.957 4.150   27.608 1.00 59.08  ? 5   DA  I "C1'" 1 
ATOM   93    N N9    . DA  A 1 5   ? -54.030 3.195   28.700 1.00 56.16  ? 5   DA  I N9    1 
ATOM   94    C C8    . DA  A 1 5   ? -53.520 1.921   28.720 1.00 55.39  ? 5   DA  I C8    1 
ATOM   95    N N7    . DA  A 1 5   ? -53.725 1.284   29.848 1.00 53.66  ? 5   DA  I N7    1 
ATOM   96    C C5    . DA  A 1 5   ? -54.411 2.206   30.611 1.00 52.43  ? 5   DA  I C5    1 
ATOM   97    C C6    . DA  A 1 5   ? -54.918 2.137   31.914 1.00 51.56  ? 5   DA  I C6    1 
ATOM   98    N N6    . DA  A 1 5   ? -54.789 1.040   32.664 1.00 49.49  ? 5   DA  I N6    1 
ATOM   99    N N1    . DA  A 1 5   ? -55.555 3.238   32.400 1.00 53.40  ? 5   DA  I N1    1 
ATOM   100   C C2    . DA  A 1 5   ? -55.673 4.330   31.614 1.00 54.24  ? 5   DA  I C2    1 
ATOM   101   N N3    . DA  A 1 5   ? -55.228 4.503   30.362 1.00 54.33  ? 5   DA  I N3    1 
ATOM   102   C C4    . DA  A 1 5   ? -54.608 3.394   29.923 1.00 54.16  ? 5   DA  I C4    1 
ATOM   103   P P     . DC  A 1 6   ? -51.616 7.221   25.983 1.00 66.32  ? 6   DC  I P     1 
ATOM   104   O OP1   . DC  A 1 6   ? -51.744 8.435   25.139 1.00 68.88  ? 6   DC  I OP1   1 
ATOM   105   O OP2   . DC  A 1 6   ? -50.341 6.459   26.035 1.00 62.40  ? 6   DC  I OP2   1 
ATOM   106   O "O5'" . DC  A 1 6   ? -52.014 7.621   27.482 1.00 63.24  ? 6   DC  I "O5'" 1 
ATOM   107   C "C5'" . DC  A 1 6   ? -53.315 8.185   27.730 1.00 61.85  ? 6   DC  I "C5'" 1 
ATOM   108   C "C4'" . DC  A 1 6   ? -53.450 8.509   29.204 1.00 57.58  ? 6   DC  I "C4'" 1 
ATOM   109   O "O4'" . DC  A 1 6   ? -53.509 7.272   29.959 1.00 54.64  ? 6   DC  I "O4'" 1 
ATOM   110   C "C3'" . DC  A 1 6   ? -52.274 9.297   29.762 1.00 55.26  ? 6   DC  I "C3'" 1 
ATOM   111   O "O3'" . DC  A 1 6   ? -52.762 10.511  30.323 1.00 54.50  ? 6   DC  I "O3'" 1 
ATOM   112   C "C2'" . DC  A 1 6   ? -51.630 8.354   30.787 1.00 51.80  ? 6   DC  I "C2'" 1 
ATOM   113   C "C1'" . DC  A 1 6   ? -52.784 7.438   31.150 1.00 51.73  ? 6   DC  I "C1'" 1 
ATOM   114   N N1    . DC  A 1 6   ? -52.420 6.067   31.582 1.00 50.89  ? 6   DC  I N1    1 
ATOM   115   C C2    . DC  A 1 6   ? -52.848 5.627   32.841 1.00 49.73  ? 6   DC  I C2    1 
ATOM   116   O O2    . DC  A 1 6   ? -53.502 6.393   33.559 1.00 51.19  ? 6   DC  I O2    1 
ATOM   117   N N3    . DC  A 1 6   ? -52.531 4.371   33.237 1.00 47.91  ? 6   DC  I N3    1 
ATOM   118   C C4    . DC  A 1 6   ? -51.833 3.568   32.434 1.00 47.91  ? 6   DC  I C4    1 
ATOM   119   N N4    . DC  A 1 6   ? -51.557 2.335   32.885 1.00 47.17  ? 6   DC  I N4    1 
ATOM   120   C C5    . DC  A 1 6   ? -51.385 3.995   31.144 1.00 48.12  ? 6   DC  I C5    1 
ATOM   121   C C6    . DC  A 1 6   ? -51.696 5.237   30.761 1.00 49.64  ? 6   DC  I C6    1 
ATOM   122   P P     . DA  A 1 7   ? -51.754 11.656  30.792 1.00 55.16  ? 7   DA  I P     1 
ATOM   123   O OP1   . DA  A 1 7   ? -52.640 12.731  31.256 1.00 58.65  ? 7   DA  I OP1   1 
ATOM   124   O OP2   . DA  A 1 7   ? -50.752 11.921  29.733 1.00 55.27  ? 7   DA  I OP2   1 
ATOM   125   O "O5'" . DA  A 1 7   ? -50.921 11.029  32.026 1.00 53.24  ? 7   DA  I "O5'" 1 
ATOM   126   C "C5'" . DA  A 1 7   ? -51.197 11.365  33.379 1.00 51.24  ? 7   DA  I "C5'" 1 
ATOM   127   C "C4'" . DA  A 1 7   ? -50.531 10.465  34.414 1.00 47.40  ? 7   DA  I "C4'" 1 
ATOM   128   O "O4'" . DA  A 1 7   ? -50.823 9.065   34.217 1.00 45.28  ? 7   DA  I "O4'" 1 
ATOM   129   C "C3'" . DA  A 1 7   ? -49.022 10.419  34.457 1.00 46.22  ? 7   DA  I "C3'" 1 
ATOM   130   O "O3'" . DA  A 1 7   ? -48.499 11.591  35.080 1.00 48.29  ? 7   DA  I "O3'" 1 
ATOM   131   C "C2'" . DA  A 1 7   ? -48.802 9.205   35.339 1.00 41.93  ? 7   DA  I "C2'" 1 
ATOM   132   C "C1'" . DA  A 1 7   ? -50.106 8.438   35.250 1.00 41.33  ? 7   DA  I "C1'" 1 
ATOM   133   N N9    . DA  A 1 7   ? -49.865 7.024   34.981 1.00 38.59  ? 7   DA  I N9    1 
ATOM   134   C C8    . DA  A 1 7   ? -49.559 6.420   33.800 1.00 38.16  ? 7   DA  I C8    1 
ATOM   135   N N7    . DA  A 1 7   ? -49.389 5.118   33.898 1.00 38.20  ? 7   DA  I N7    1 
ATOM   136   C C5    . DA  A 1 7   ? -49.586 4.858   35.240 1.00 36.75  ? 7   DA  I C5    1 
ATOM   137   C C6    . DA  A 1 7   ? -49.551 3.673   36.006 1.00 36.35  ? 7   DA  I C6    1 
ATOM   138   N N6    . DA  A 1 7   ? -49.285 2.453   35.515 1.00 33.93  ? 7   DA  I N6    1 
ATOM   139   N N1    . DA  A 1 7   ? -49.795 3.800   37.332 1.00 37.03  ? 7   DA  I N1    1 
ATOM   140   C C2    . DA  A 1 7   ? -50.066 4.990   37.848 1.00 36.05  ? 7   DA  I C2    1 
ATOM   141   N N3    . DA  A 1 7   ? -50.128 6.161   37.228 1.00 37.54  ? 7   DA  I N3    1 
ATOM   142   C C4    . DA  A 1 7   ? -49.872 6.022   35.919 1.00 37.24  ? 7   DA  I C4    1 
ATOM   143   P P     . DT  A 1 8   ? -46.983 11.635  35.563 1.00 45.71  ? 8   DT  I P     1 
ATOM   144   O OP1   . DT  A 1 8   ? -46.819 13.017  36.071 1.00 49.81  ? 8   DT  I OP1   1 
ATOM   145   O OP2   . DT  A 1 8   ? -46.089 11.130  34.496 1.00 45.02  ? 8   DT  I OP2   1 
ATOM   146   O "O5'" . DT  A 1 8   ? -46.877 10.580  36.746 1.00 42.34  ? 8   DT  I "O5'" 1 
ATOM   147   C "C5'" . DT  A 1 8   ? -47.536 10.780  37.987 1.00 44.28  ? 8   DT  I "C5'" 1 
ATOM   148   C "C4'" . DT  A 1 8   ? -47.008 9.774   38.981 1.00 43.24  ? 8   DT  I "C4'" 1 
ATOM   149   O "O4'" . DT  A 1 8   ? -47.286 8.444   38.469 1.00 42.20  ? 8   DT  I "O4'" 1 
ATOM   150   C "C3'" . DT  A 1 8   ? -45.498 9.848   39.156 1.00 43.50  ? 8   DT  I "C3'" 1 
ATOM   151   O "O3'" . DT  A 1 8   ? -45.193 10.332  40.454 1.00 45.87  ? 8   DT  I "O3'" 1 
ATOM   152   C "C2'" . DT  A 1 8   ? -44.996 8.409   38.937 1.00 40.94  ? 8   DT  I "C2'" 1 
ATOM   153   C "C1'" . DT  A 1 8   ? -46.284 7.594   38.945 1.00 40.49  ? 8   DT  I "C1'" 1 
ATOM   154   N N1    . DT  A 1 8   ? -46.197 6.388   38.107 1.00 40.10  ? 8   DT  I N1    1 
ATOM   155   C C2    . DT  A 1 8   ? -46.227 5.172   38.762 1.00 40.19  ? 8   DT  I C2    1 
ATOM   156   O O2    . DT  A 1 8   ? -46.341 5.076   39.969 1.00 42.18  ? 8   DT  I O2    1 
ATOM   157   N N3    . DT  A 1 8   ? -46.106 4.061   37.961 1.00 39.34  ? 8   DT  I N3    1 
ATOM   158   C C4    . DT  A 1 8   ? -45.979 4.050   36.585 1.00 39.40  ? 8   DT  I C4    1 
ATOM   159   O O4    . DT  A 1 8   ? -45.885 2.992   35.965 1.00 40.27  ? 8   DT  I O4    1 
ATOM   160   C C5    . DT  A 1 8   ? -45.946 5.353   35.946 1.00 39.49  ? 8   DT  I C5    1 
ATOM   161   C C7    . DT  A 1 8   ? -45.799 5.443   34.457 1.00 37.88  ? 8   DT  I C7    1 
ATOM   162   C C6    . DT  A 1 8   ? -46.051 6.459   36.725 1.00 40.05  ? 8   DT  I C6    1 
ATOM   163   P P     . DG  A 1 9   ? -43.718 10.840  40.793 1.00 46.75  ? 9   DG  I P     1 
ATOM   164   O OP1   . DG  A 1 9   ? -43.714 11.420  42.139 1.00 52.37  ? 9   DG  I OP1   1 
ATOM   165   O OP2   . DG  A 1 9   ? -43.206 11.670  39.694 1.00 52.06  ? 9   DG  I OP2   1 
ATOM   166   O "O5'" . DG  A 1 9   ? -42.833 9.556   40.782 1.00 44.71  ? 9   DG  I "O5'" 1 
ATOM   167   C "C5'" . DG  A 1 9   ? -42.332 9.187   42.021 1.00 44.86  ? 9   DG  I "C5'" 1 
ATOM   168   C "C4'" . DG  A 1 9   ? -42.723 7.770   42.382 1.00 43.74  ? 9   DG  I "C4'" 1 
ATOM   169   O "O4'" . DG  A 1 9   ? -43.367 6.999   41.320 1.00 40.98  ? 9   DG  I "O4'" 1 
ATOM   170   C "C3'" . DG  A 1 9   ? -41.497 6.937   42.656 1.00 40.31  ? 9   DG  I "C3'" 1 
ATOM   171   O "O3'" . DG  A 1 9   ? -40.988 7.313   43.911 1.00 38.81  ? 9   DG  I "O3'" 1 
ATOM   172   C "C2'" . DG  A 1 9   ? -42.164 5.577   42.737 1.00 39.84  ? 9   DG  I "C2'" 1 
ATOM   173   C "C1'" . DG  A 1 9   ? -43.279 5.664   41.715 1.00 37.84  ? 9   DG  I "C1'" 1 
ATOM   174   N N9    . DG  A 1 9   ? -43.119 4.792   40.548 1.00 37.21  ? 9   DG  I N9    1 
ATOM   175   C C8    . DG  A 1 9   ? -43.024 5.173   39.236 1.00 35.52  ? 9   DG  I C8    1 
ATOM   176   N N7    . DG  A 1 9   ? -42.942 4.187   38.406 1.00 32.36  ? 9   DG  I N7    1 
ATOM   177   C C5    . DG  A 1 9   ? -42.977 3.058   39.220 1.00 34.22  ? 9   DG  I C5    1 
ATOM   178   C C6    . DG  A 1 9   ? -42.919 1.677   38.875 1.00 33.92  ? 9   DG  I C6    1 
ATOM   179   O O6    . DG  A 1 9   ? -42.818 1.183   37.744 1.00 33.72  ? 9   DG  I O6    1 
ATOM   180   N N1    . DG  A 1 9   ? -42.989 0.841   39.981 1.00 35.38  ? 9   DG  I N1    1 
ATOM   181   C C2    . DG  A 1 9   ? -43.091 1.287   41.284 1.00 37.17  ? 9   DG  I C2    1 
ATOM   182   N N2    . DG  A 1 9   ? -43.136 0.329   42.239 1.00 36.66  ? 9   DG  I N2    1 
ATOM   183   N N3    . DG  A 1 9   ? -43.141 2.579   41.615 1.00 35.66  ? 9   DG  I N3    1 
ATOM   184   C C4    . DG  A 1 9   ? -43.082 3.405   40.539 1.00 34.82  ? 9   DG  I C4    1 
ATOM   185   P P     . DT  A 1 10  ? -39.614 6.704   44.413 1.00 40.05  ? 10  DT  I P     1 
ATOM   186   O OP1   . DT  A 1 10  ? -39.359 7.312   45.741 1.00 44.01  ? 10  DT  I OP1   1 
ATOM   187   O OP2   . DT  A 1 10  ? -38.575 6.770   43.365 1.00 36.55  ? 10  DT  I OP2   1 
ATOM   188   O "O5'" . DT  A 1 10  ? -39.972 5.153   44.567 1.00 38.86  ? 10  DT  I "O5'" 1 
ATOM   189   C "C5'" . DT  A 1 10  ? -40.837 4.676   45.580 1.00 39.68  ? 10  DT  I "C5'" 1 
ATOM   190   C "C4'" . DT  A 1 10  ? -40.566 3.198   45.702 1.00 40.14  ? 10  DT  I "C4'" 1 
ATOM   191   O "O4'" . DT  A 1 10  ? -40.766 2.563   44.423 1.00 38.51  ? 10  DT  I "O4'" 1 
ATOM   192   C "C3'" . DT  A 1 10  ? -39.134 2.874   46.104 1.00 40.84  ? 10  DT  I "C3'" 1 
ATOM   193   O "O3'" . DT  A 1 10  ? -39.245 1.880   47.111 1.00 41.21  ? 10  DT  I "O3'" 1 
ATOM   194   C "C2'" . DT  A 1 10  ? -38.434 2.460   44.796 1.00 38.31  ? 10  DT  I "C2'" 1 
ATOM   195   C "C1'" . DT  A 1 10  ? -39.599 1.885   44.010 1.00 38.67  ? 10  DT  I "C1'" 1 
ATOM   196   N N1    . DT  A 1 10  ? -39.597 1.940   42.501 1.00 38.50  ? 10  DT  I N1    1 
ATOM   197   C C2    . DT  A 1 10  ? -39.741 0.725   41.857 1.00 37.83  ? 10  DT  I C2    1 
ATOM   198   O O2    . DT  A 1 10  ? -39.830 -0.338  42.433 1.00 41.76  ? 10  DT  I O2    1 
ATOM   199   N N3    . DT  A 1 10  ? -39.756 0.778   40.502 1.00 35.19  ? 10  DT  I N3    1 
ATOM   200   C C4    . DT  A 1 10  ? -39.671 1.904   39.725 1.00 33.83  ? 10  DT  I C4    1 
ATOM   201   O O4    . DT  A 1 10  ? -39.723 1.776   38.506 1.00 32.93  ? 10  DT  I O4    1 
ATOM   202   C C5    . DT  A 1 10  ? -39.521 3.164   40.440 1.00 33.70  ? 10  DT  I C5    1 
ATOM   203   C C7    . DT  A 1 10  ? -39.403 4.467   39.709 1.00 31.07  ? 10  DT  I C7    1 
ATOM   204   C C6    . DT  A 1 10  ? -39.505 3.130   41.786 1.00 36.18  ? 10  DT  I C6    1 
ATOM   205   P P     . DA  A 1 11  ? -37.961 1.148   47.658 1.00 43.36  ? 11  DA  I P     1 
ATOM   206   O OP1   . DA  A 1 11  ? -38.255 0.658   49.022 1.00 46.63  ? 11  DA  I OP1   1 
ATOM   207   O OP2   . DA  A 1 11  ? -36.787 1.985   47.362 1.00 43.63  ? 11  DA  I OP2   1 
ATOM   208   O "O5'" . DA  A 1 11  ? -37.818 -0.110  46.687 1.00 43.06  ? 11  DA  I "O5'" 1 
ATOM   209   C "C5'" . DA  A 1 11  ? -38.775 -1.167  46.704 1.00 43.29  ? 11  DA  I "C5'" 1 
ATOM   210   C "C4'" . DA  A 1 11  ? -38.140 -2.442  46.189 1.00 42.58  ? 11  DA  I "C4'" 1 
ATOM   211   O "O4'" . DA  A 1 11  ? -37.997 -2.365  44.749 1.00 38.97  ? 11  DA  I "O4'" 1 
ATOM   212   C "C3'" . DA  A 1 11  ? -36.751 -2.771  46.723 1.00 44.08  ? 11  DA  I "C3'" 1 
ATOM   213   O "O3'" . DA  A 1 11  ? -36.765 -4.188  46.935 1.00 47.59  ? 11  DA  I "O3'" 1 
ATOM   214   C "C2'" . DA  A 1 11  ? -35.804 -2.299  45.609 1.00 39.29  ? 11  DA  I "C2'" 1 
ATOM   215   C "C1'" . DA  A 1 11  ? -36.648 -2.546  44.363 1.00 38.04  ? 11  DA  I "C1'" 1 
ATOM   216   N N9    . DA  A 1 11  ? -36.523 -1.651  43.213 1.00 35.91  ? 11  DA  I N9    1 
ATOM   217   C C8    . DA  A 1 11  ? -36.422 -0.296  43.197 1.00 33.97  ? 11  DA  I C8    1 
ATOM   218   N N7    . DA  A 1 11  ? -36.354 0.217   41.998 1.00 31.45  ? 11  DA  I N7    1 
ATOM   219   C C5    . DA  A 1 11  ? -36.438 -0.861  41.154 1.00 33.26  ? 11  DA  I C5    1 
ATOM   220   C C6    . DA  A 1 11  ? -36.431 -1.003  39.741 1.00 32.45  ? 11  DA  I C6    1 
ATOM   221   N N6    . DA  A 1 11  ? -36.335 0.010   38.887 1.00 27.63  ? 11  DA  I N6    1 
ATOM   222   N N1    . DA  A 1 11  ? -36.526 -2.261  39.229 1.00 33.50  ? 11  DA  I N1    1 
ATOM   223   C C2    . DA  A 1 11  ? -36.628 -3.289  40.070 1.00 33.69  ? 11  DA  I C2    1 
ATOM   224   N N3    . DA  A 1 11  ? -36.637 -3.275  41.403 1.00 34.74  ? 11  DA  I N3    1 
ATOM   225   C C4    . DA  A 1 11  ? -36.544 -2.027  41.890 1.00 34.78  ? 11  DA  I C4    1 
ATOM   226   P P     . DA  A 1 12  ? -35.548 -5.007  47.562 1.00 51.70  ? 12  DA  I P     1 
ATOM   227   O OP1   . DA  A 1 12  ? -36.154 -5.960  48.531 1.00 54.59  ? 12  DA  I OP1   1 
ATOM   228   O OP2   . DA  A 1 12  ? -34.452 -4.101  47.976 1.00 49.63  ? 12  DA  I OP2   1 
ATOM   229   O "O5'" . DA  A 1 12  ? -34.953 -5.790  46.289 1.00 52.40  ? 12  DA  I "O5'" 1 
ATOM   230   C "C5'" . DA  A 1 12  ? -35.750 -6.508  45.334 1.00 53.72  ? 12  DA  I "C5'" 1 
ATOM   231   C "C4'" . DA  A 1 12  ? -34.899 -6.869  44.120 1.00 53.51  ? 12  DA  I "C4'" 1 
ATOM   232   O "O4'" . DA  A 1 12  ? -34.831 -5.758  43.173 1.00 49.85  ? 12  DA  I "O4'" 1 
ATOM   233   C "C3'" . DA  A 1 12  ? -33.450 -7.229  44.444 1.00 54.83  ? 12  DA  I "C3'" 1 
ATOM   234   O "O3'" . DA  A 1 12  ? -33.154 -8.430  43.749 1.00 60.27  ? 12  DA  I "O3'" 1 
ATOM   235   C "C2'" . DA  A 1 12  ? -32.640 -6.047  43.913 1.00 50.29  ? 12  DA  I "C2'" 1 
ATOM   236   C "C1'" . DA  A 1 12  ? -33.499 -5.624  42.720 1.00 46.63  ? 12  DA  I "C1'" 1 
ATOM   237   N N9    . DA  A 1 12  ? -33.327 -4.254  42.240 1.00 42.22  ? 12  DA  I N9    1 
ATOM   238   C C8    . DA  A 1 12  ? -33.067 -3.127  42.973 1.00 40.07  ? 12  DA  I C8    1 
ATOM   239   N N7    . DA  A 1 12  ? -32.973 -2.037  42.241 1.00 38.26  ? 12  DA  I N7    1 
ATOM   240   C C5    . DA  A 1 12  ? -33.162 -2.472  40.935 1.00 37.00  ? 12  DA  I C5    1 
ATOM   241   C C6    . DA  A 1 12  ? -33.186 -1.812  39.669 1.00 36.03  ? 12  DA  I C6    1 
ATOM   242   N N6    . DA  A 1 12  ? -33.003 -0.491  39.508 1.00 30.70  ? 12  DA  I N6    1 
ATOM   243   N N1    . DA  A 1 12  ? -33.402 -2.566  38.550 1.00 35.33  ? 12  DA  I N1    1 
ATOM   244   C C2    . DA  A 1 12  ? -33.601 -3.873  38.702 1.00 37.21  ? 12  DA  I C2    1 
ATOM   245   N N3    . DA  A 1 12  ? -33.602 -4.592  39.835 1.00 39.88  ? 12  DA  I N3    1 
ATOM   246   C C4    . DA  A 1 12  ? -33.384 -3.835  40.924 1.00 39.34  ? 12  DA  I C4    1 
ATOM   247   P P     . DA  A 1 13  ? -31.887 -9.362  44.087 1.00 65.48  ? 13  DA  I P     1 
ATOM   248   O OP1   . DA  A 1 13  ? -32.457 -10.719 44.197 1.00 67.59  ? 13  DA  I OP1   1 
ATOM   249   O OP2   . DA  A 1 13  ? -31.021 -8.780  45.150 1.00 64.02  ? 13  DA  I OP2   1 
ATOM   250   O "O5'" . DA  A 1 13  ? -31.025 -9.240  42.736 1.00 64.82  ? 13  DA  I "O5'" 1 
ATOM   251   C "C5'" . DA  A 1 13  ? -31.655 -9.580  41.483 1.00 65.78  ? 13  DA  I "C5'" 1 
ATOM   252   C "C4'" . DA  A 1 13  ? -31.062 -8.777  40.339 1.00 63.22  ? 13  DA  I "C4'" 1 
ATOM   253   O "O4'" . DA  A 1 13  ? -31.226 -7.349  40.548 1.00 60.89  ? 13  DA  I "O4'" 1 
ATOM   254   C "C3'" . DA  A 1 13  ? -29.564 -8.915  40.148 1.00 62.44  ? 13  DA  I "C3'" 1 
ATOM   255   O "O3'" . DA  A 1 13  ? -29.352 -9.992  39.236 1.00 66.17  ? 13  DA  I "O3'" 1 
ATOM   256   C "C2'" . DA  A 1 13  ? -29.163 -7.574  39.538 1.00 58.37  ? 13  DA  I "C2'" 1 
ATOM   257   C "C1'" . DA  A 1 13  ? -30.464 -6.772  39.525 1.00 57.06  ? 13  DA  I "C1'" 1 
ATOM   258   N N9    . DA  A 1 13  ? -30.270 -5.365  39.824 1.00 53.34  ? 13  DA  I N9    1 
ATOM   259   C C8    . DA  A 1 13  ? -30.003 -4.810  41.047 1.00 51.43  ? 13  DA  I C8    1 
ATOM   260   N N7    . DA  A 1 13  ? -29.866 -3.507  40.992 1.00 51.06  ? 13  DA  I N7    1 
ATOM   261   C C5    . DA  A 1 13  ? -30.031 -3.216  39.650 1.00 49.35  ? 13  DA  I C5    1 
ATOM   262   C C6    . DA  A 1 13  ? -29.989 -2.007  38.939 1.00 48.84  ? 13  DA  I C6    1 
ATOM   263   N N6    . DA  A 1 13  ? -29.760 -0.873  39.585 1.00 47.15  ? 13  DA  I N6    1 
ATOM   264   N N1    . DA  A 1 13  ? -30.194 -2.022  37.584 1.00 48.72  ? 13  DA  I N1    1 
ATOM   265   C C2    . DA  A 1 13  ? -30.430 -3.207  36.974 1.00 49.17  ? 13  DA  I C2    1 
ATOM   266   N N3    . DA  A 1 13  ? -30.482 -4.414  37.559 1.00 51.00  ? 13  DA  I N3    1 
ATOM   267   C C4    . DA  A 1 13  ? -30.275 -4.345  38.902 1.00 50.70  ? 13  DA  I C4    1 
ATOM   268   P P     . DT  A 1 14  ? -27.877 -10.379 38.717 1.00 66.50  ? 14  DT  I P     1 
ATOM   269   O OP1   . DT  A 1 14  ? -28.001 -11.792 38.292 1.00 69.90  ? 14  DT  I OP1   1 
ATOM   270   O OP2   . DT  A 1 14  ? -26.826 -9.902  39.659 1.00 63.26  ? 14  DT  I OP2   1 
ATOM   271   O "O5'" . DT  A 1 14  ? -27.723 -9.458  37.419 1.00 62.40  ? 14  DT  I "O5'" 1 
ATOM   272   C "C5'" . DT  A 1 14  ? -28.724 -9.470  36.382 1.00 58.50  ? 14  DT  I "C5'" 1 
ATOM   273   C "C4'" . DT  A 1 14  ? -28.307 -8.439  35.348 1.00 53.16  ? 14  DT  I "C4'" 1 
ATOM   274   O "O4'" . DT  A 1 14  ? -28.357 -7.091  35.905 1.00 49.04  ? 14  DT  I "O4'" 1 
ATOM   275   C "C3'" . DT  A 1 14  ? -26.890 -8.625  34.809 1.00 50.99  ? 14  DT  I "C3'" 1 
ATOM   276   O "O3'" . DT  A 1 14  ? -27.026 -8.495  33.401 1.00 50.89  ? 14  DT  I "O3'" 1 
ATOM   277   C "C2'" . DT  A 1 14  ? -26.089 -7.516  35.496 1.00 47.79  ? 14  DT  I "C2'" 1 
ATOM   278   C "C1'" . DT  A 1 14  ? -27.148 -6.418  35.624 1.00 45.55  ? 14  DT  I "C1'" 1 
ATOM   279   N N1    . DT  A 1 14  ? -27.004 -5.366  36.691 1.00 41.60  ? 14  DT  I N1    1 
ATOM   280   C C2    . DT  A 1 14  ? -27.116 -4.046  36.319 1.00 39.20  ? 14  DT  I C2    1 
ATOM   281   O O2    . DT  A 1 14  ? -27.294 -3.700  35.167 1.00 40.83  ? 14  DT  I O2    1 
ATOM   282   N N3    . DT  A 1 14  ? -26.996 -3.138  37.337 1.00 35.79  ? 14  DT  I N3    1 
ATOM   283   C C4    . DT  A 1 14  ? -26.794 -3.394  38.678 1.00 36.40  ? 14  DT  I C4    1 
ATOM   284   O O4    . DT  A 1 14  ? -26.702 -2.460  39.494 1.00 36.26  ? 14  DT  I O4    1 
ATOM   285   C C5    . DT  A 1 14  ? -26.678 -4.810  39.004 1.00 37.30  ? 14  DT  I C5    1 
ATOM   286   C C7    . DT  A 1 14  ? -26.441 -5.298  40.401 1.00 36.11  ? 14  DT  I C7    1 
ATOM   287   C C6    . DT  A 1 14  ? -26.795 -5.699  38.012 1.00 40.12  ? 14  DT  I C6    1 
ATOM   288   P P     . DA  A 1 15  ? -25.838 -8.640  32.345 1.00 52.08  ? 15  DA  I P     1 
ATOM   289   O OP1   . DA  A 1 15  ? -26.406 -9.114  31.061 1.00 52.79  ? 15  DA  I OP1   1 
ATOM   290   O OP2   . DA  A 1 15  ? -24.688 -9.378  32.942 1.00 51.91  ? 15  DA  I OP2   1 
ATOM   291   O "O5'" . DA  A 1 15  ? -25.431 -7.097  32.215 1.00 45.61  ? 15  DA  I "O5'" 1 
ATOM   292   C "C5'" . DA  A 1 15  ? -26.321 -6.123  31.718 1.00 42.24  ? 15  DA  I "C5'" 1 
ATOM   293   C "C4'" . DA  A 1 15  ? -25.514 -4.865  31.454 1.00 40.85  ? 15  DA  I "C4'" 1 
ATOM   294   O "O4'" . DA  A 1 15  ? -25.391 -4.042  32.661 1.00 36.84  ? 15  DA  I "O4'" 1 
ATOM   295   C "C3'" . DA  A 1 15  ? -24.090 -5.141  30.963 1.00 41.04  ? 15  DA  I "C3'" 1 
ATOM   296   O "O3'" . DA  A 1 15  ? -23.913 -4.376  29.746 1.00 40.69  ? 15  DA  I "O3'" 1 
ATOM   297   C "C2'" . DA  A 1 15  ? -23.179 -4.775  32.162 1.00 37.44  ? 15  DA  I "C2'" 1 
ATOM   298   C "C1'" . DA  A 1 15  ? -24.013 -3.717  32.888 1.00 36.67  ? 15  DA  I "C1'" 1 
ATOM   299   N N9    . DA  A 1 15  ? -23.866 -3.524  34.345 1.00 36.00  ? 15  DA  I N9    1 
ATOM   300   C C8    . DA  A 1 15  ? -23.901 -4.466  35.345 1.00 37.38  ? 15  DA  I C8    1 
ATOM   301   N N7    . DA  A 1 15  ? -23.794 -3.980  36.565 1.00 36.01  ? 15  DA  I N7    1 
ATOM   302   C C5    . DA  A 1 15  ? -23.697 -2.624  36.345 1.00 32.80  ? 15  DA  I C5    1 
ATOM   303   C C6    . DA  A 1 15  ? -23.563 -1.553  37.223 1.00 32.50  ? 15  DA  I C6    1 
ATOM   304   N N6    . DA  A 1 15  ? -23.511 -1.733  38.544 1.00 32.43  ? 15  DA  I N6    1 
ATOM   305   N N1    . DA  A 1 15  ? -23.500 -0.295  36.707 1.00 33.27  ? 15  DA  I N1    1 
ATOM   306   C C2    . DA  A 1 15  ? -23.569 -0.136  35.387 1.00 32.99  ? 15  DA  I C2    1 
ATOM   307   N N3    . DA  A 1 15  ? -23.702 -1.095  34.459 1.00 34.30  ? 15  DA  I N3    1 
ATOM   308   C C4    . DA  A 1 15  ? -23.762 -2.320  35.007 1.00 33.45  ? 15  DA  I C4    1 
ATOM   309   P P     . DG  A 1 16  ? -22.507 -4.212  28.988 1.00 40.33  ? 16  DG  I P     1 
ATOM   310   O OP1   . DG  A 1 16  ? -22.818 -3.928  27.577 1.00 43.54  ? 16  DG  I OP1   1 
ATOM   311   O OP2   . DG  A 1 16  ? -21.589 -5.305  29.330 1.00 41.89  ? 16  DG  I OP2   1 
ATOM   312   O "O5'" . DG  A 1 16  ? -21.897 -2.914  29.678 1.00 38.62  ? 16  DG  I "O5'" 1 
ATOM   313   C "C5'" . DG  A 1 16  ? -22.601 -1.678  29.745 1.00 36.43  ? 16  DG  I "C5'" 1 
ATOM   314   C "C4'" . DG  A 1 16  ? -21.687 -0.631  30.379 1.00 35.57  ? 16  DG  I "C4'" 1 
ATOM   315   O "O4'" . DG  A 1 16  ? -21.738 -0.784  31.814 1.00 34.06  ? 16  DG  I "O4'" 1 
ATOM   316   C "C3'" . DG  A 1 16  ? -20.206 -0.701  30.009 1.00 36.86  ? 16  DG  I "C3'" 1 
ATOM   317   O "O3'" . DG  A 1 16  ? -19.842 0.534   29.470 1.00 37.44  ? 16  DG  I "O3'" 1 
ATOM   318   C "C2'" . DG  A 1 16  ? -19.460 -0.929  31.312 1.00 36.41  ? 16  DG  I "C2'" 1 
ATOM   319   C "C1'" . DG  A 1 16  ? -20.481 -0.473  32.341 1.00 36.81  ? 16  DG  I "C1'" 1 
ATOM   320   N N9    . DG  A 1 16  ? -20.406 -1.218  33.582 1.00 39.23  ? 16  DG  I N9    1 
ATOM   321   C C8    . DG  A 1 16  ? -20.408 -2.611  33.746 1.00 41.53  ? 16  DG  I C8    1 
ATOM   322   N N7    . DG  A 1 16  ? -20.339 -2.976  35.002 1.00 41.46  ? 16  DG  I N7    1 
ATOM   323   C C5    . DG  A 1 16  ? -20.269 -1.732  35.670 1.00 37.81  ? 16  DG  I C5    1 
ATOM   324   C C6    . DG  A 1 16  ? -20.186 -1.477  37.035 1.00 38.46  ? 16  DG  I C6    1 
ATOM   325   O O6    . DG  A 1 16  ? -20.146 -2.348  37.901 1.00 42.51  ? 16  DG  I O6    1 
ATOM   326   N N1    . DG  A 1 16  ? -20.162 -0.111  37.361 1.00 40.28  ? 16  DG  I N1    1 
ATOM   327   C C2    . DG  A 1 16  ? -20.203 0.898   36.398 1.00 40.73  ? 16  DG  I C2    1 
ATOM   328   N N2    . DG  A 1 16  ? -20.156 2.163   36.846 1.00 36.45  ? 16  DG  I N2    1 
ATOM   329   N N3    . DG  A 1 16  ? -20.278 0.659   35.071 1.00 38.74  ? 16  DG  I N3    1 
ATOM   330   C C4    . DG  A 1 16  ? -20.315 -0.663  34.817 1.00 36.58  ? 16  DG  I C4    1 
ATOM   331   P P     . DT  A 1 17  ? -18.383 0.940   28.968 1.00 39.04  ? 17  DT  I P     1 
ATOM   332   O OP1   . DT  A 1 17  ? -18.672 1.634   27.708 1.00 44.19  ? 17  DT  I OP1   1 
ATOM   333   O OP2   . DT  A 1 17  ? -17.382 -0.132  28.982 1.00 40.92  ? 17  DT  I OP2   1 
ATOM   334   O "O5'" . DT  A 1 17  ? -17.863 2.021   30.028 1.00 39.08  ? 17  DT  I "O5'" 1 
ATOM   335   C "C5'" . DT  A 1 17  ? -18.630 3.153   30.406 1.00 37.30  ? 17  DT  I "C5'" 1 
ATOM   336   C "C4'" . DT  A 1 17  ? -17.978 3.895   31.565 1.00 37.49  ? 17  DT  I "C4'" 1 
ATOM   337   O "O4'" . DT  A 1 17  ? -18.060 3.120   32.787 1.00 35.22  ? 17  DT  I "O4'" 1 
ATOM   338   C "C3'" . DT  A 1 17  ? -16.506 4.284   31.422 1.00 38.80  ? 17  DT  I "C3'" 1 
ATOM   339   O "O3'" . DT  A 1 17  ? -16.421 5.699   31.636 1.00 40.86  ? 17  DT  I "O3'" 1 
ATOM   340   C "C2'" . DT  A 1 17  ? -15.786 3.476   32.510 1.00 36.36  ? 17  DT  I "C2'" 1 
ATOM   341   C "C1'" . DT  A 1 17  ? -16.880 3.238   33.550 1.00 34.08  ? 17  DT  I "C1'" 1 
ATOM   342   N N1    . DT  A 1 17  ? -16.871 1.980   34.432 1.00 34.20  ? 17  DT  I N1    1 
ATOM   343   C C2    . DT  A 1 17  ? -16.959 2.144   35.808 1.00 32.26  ? 17  DT  I C2    1 
ATOM   344   O O2    . DT  A 1 17  ? -16.990 3.221   36.362 1.00 35.19  ? 17  DT  I O2    1 
ATOM   345   N N3    . DT  A 1 17  ? -16.971 1.003   36.543 1.00 29.67  ? 17  DT  I N3    1 
ATOM   346   C C4    . DT  A 1 17  ? -16.910 -0.280  36.053 1.00 30.86  ? 17  DT  I C4    1 
ATOM   347   O O4    . DT  A 1 17  ? -16.946 -1.232  36.809 1.00 31.57  ? 17  DT  I O4    1 
ATOM   348   C C5    . DT  A 1 17  ? -16.827 -0.425  34.614 1.00 31.79  ? 17  DT  I C5    1 
ATOM   349   C C7    . DT  A 1 17  ? -16.777 -1.801  34.002 1.00 28.49  ? 17  DT  I C7    1 
ATOM   350   C C6    . DT  A 1 17  ? -16.808 0.705   33.875 1.00 32.30  ? 17  DT  I C6    1 
ATOM   351   P P     . DT  A 1 18  ? -15.030 6.479   31.506 1.00 43.58  ? 18  DT  I P     1 
ATOM   352   O OP1   . DT  A 1 18  ? -15.345 7.821   30.935 1.00 45.95  ? 18  DT  I OP1   1 
ATOM   353   O OP2   . DT  A 1 18  ? -14.041 5.580   30.880 1.00 44.02  ? 18  DT  I OP2   1 
ATOM   354   O "O5'" . DT  A 1 18  ? -14.562 6.666   33.007 1.00 39.98  ? 18  DT  I "O5'" 1 
ATOM   355   C "C5'" . DT  A 1 18  ? -15.452 7.190   33.956 1.00 38.68  ? 18  DT  I "C5'" 1 
ATOM   356   C "C4'" . DT  A 1 18  ? -14.760 7.229   35.309 1.00 38.13  ? 18  DT  I "C4'" 1 
ATOM   357   O "O4'" . DT  A 1 18  ? -14.877 5.945   35.961 1.00 36.68  ? 18  DT  I "O4'" 1 
ATOM   358   C "C3'" . DT  A 1 18  ? -13.274 7.575   35.323 1.00 38.85  ? 18  DT  I "C3'" 1 
ATOM   359   O "O3'" . DT  A 1 18  ? -13.138 8.546   36.353 1.00 41.85  ? 18  DT  I "O3'" 1 
ATOM   360   C "C2'" . DT  A 1 18  ? -12.565 6.246   35.617 1.00 36.99  ? 18  DT  I "C2'" 1 
ATOM   361   C "C1'" . DT  A 1 18  ? -13.613 5.502   36.429 1.00 35.40  ? 18  DT  I "C1'" 1 
ATOM   362   N N1    . DT  A 1 18  ? -13.622 3.996   36.388 1.00 33.69  ? 18  DT  I N1    1 
ATOM   363   C C2    . DT  A 1 18  ? -13.906 3.347   37.565 1.00 33.34  ? 18  DT  I C2    1 
ATOM   364   O O2    . DT  A 1 18  ? -14.130 3.898   38.630 1.00 36.00  ? 18  DT  I O2    1 
ATOM   365   N N3    . DT  A 1 18  ? -13.898 1.993   37.487 1.00 32.10  ? 18  DT  I N3    1 
ATOM   366   C C4    . DT  A 1 18  ? -13.662 1.200   36.403 1.00 31.09  ? 18  DT  I C4    1 
ATOM   367   O O4    . DT  A 1 18  ? -13.721 -0.020  36.521 1.00 31.55  ? 18  DT  I O4    1 
ATOM   368   C C5    . DT  A 1 18  ? -13.374 1.915   35.184 1.00 32.12  ? 18  DT  I C5    1 
ATOM   369   C C7    . DT  A 1 18  ? -13.098 1.161   33.903 1.00 30.09  ? 18  DT  I C7    1 
ATOM   370   C C6    . DT  A 1 18  ? -13.372 3.272   35.234 1.00 32.89  ? 18  DT  I C6    1 
ATOM   371   P P     . DA  A 1 19  ? -11.758 9.280   36.703 1.00 47.50  ? 19  DA  I P     1 
ATOM   372   O OP1   . DA  A 1 19  ? -12.164 10.673  37.031 1.00 50.81  ? 19  DA  I OP1   1 
ATOM   373   O OP2   . DA  A 1 19  ? -10.740 9.055   35.646 1.00 45.76  ? 19  DA  I OP2   1 
ATOM   374   O "O5'" . DA  A 1 19  ? -11.291 8.542   38.060 1.00 43.46  ? 19  DA  I "O5'" 1 
ATOM   375   C "C5'" . DA  A 1 19  ? -12.229 8.342   39.124 1.00 41.19  ? 19  DA  I "C5'" 1 
ATOM   376   C "C4'" . DA  A 1 19  ? -11.637 7.450   40.205 1.00 42.76  ? 19  DA  I "C4'" 1 
ATOM   377   O "O4'" . DA  A 1 19  ? -11.857 6.015   39.915 1.00 41.05  ? 19  DA  I "O4'" 1 
ATOM   378   C "C3'" . DA  A 1 19  ? -10.132 7.633   40.446 1.00 43.42  ? 19  DA  I "C3'" 1 
ATOM   379   O "O3'" . DA  A 1 19  ? -9.919  7.712   41.872 1.00 45.77  ? 19  DA  I "O3'" 1 
ATOM   380   C "C2'" . DA  A 1 19  ? -9.524  6.372   39.824 1.00 39.76  ? 19  DA  I "C2'" 1 
ATOM   381   C "C1'" . DA  A 1 19  ? -10.624 5.341   40.053 1.00 37.36  ? 19  DA  I "C1'" 1 
ATOM   382   N N9    . DA  A 1 19  ? -10.520 4.200   39.138 1.00 34.74  ? 19  DA  I N9    1 
ATOM   383   C C8    . DA  A 1 19  ? -10.277 4.211   37.787 1.00 33.08  ? 19  DA  I C8    1 
ATOM   384   N N7    . DA  A 1 19  ? -10.212 3.009   37.261 1.00 31.31  ? 19  DA  I N7    1 
ATOM   385   C C5    . DA  A 1 19  ? -10.417 2.156   38.341 1.00 29.95  ? 19  DA  I C5    1 
ATOM   386   C C6    . DA  A 1 19  ? -10.456 0.747   38.460 1.00 29.21  ? 19  DA  I C6    1 
ATOM   387   N N6    . DA  A 1 19  ? -10.287 -0.057  37.419 1.00 26.59  ? 19  DA  I N6    1 
ATOM   388   N N1    . DA  A 1 19  ? -10.673 0.195   39.680 1.00 30.06  ? 19  DA  I N1    1 
ATOM   389   C C2    . DA  A 1 19  ? -10.833 1.029   40.717 1.00 31.30  ? 19  DA  I C2    1 
ATOM   390   N N3    . DA  A 1 19  ? -10.814 2.373   40.727 1.00 30.67  ? 19  DA  I N3    1 
ATOM   391   C C4    . DA  A 1 19  ? -10.601 2.870   39.501 1.00 30.81  ? 19  DA  I C4    1 
ATOM   392   P P     . DC  A 1 20  ? -8.495  7.979   42.578 1.00 47.44  ? 20  DC  I P     1 
ATOM   393   O OP1   . DC  A 1 20  ? -8.822  8.862   43.714 1.00 48.16  ? 20  DC  I OP1   1 
ATOM   394   O OP2   . DC  A 1 20  ? -7.440  8.302   41.575 1.00 45.06  ? 20  DC  I OP2   1 
ATOM   395   O "O5'" . DC  A 1 20  ? -8.133  6.529   43.178 1.00 46.02  ? 20  DC  I "O5'" 1 
ATOM   396   C "C5'" . DC  A 1 20  ? -9.079  5.886   44.048 1.00 42.28  ? 20  DC  I "C5'" 1 
ATOM   397   C "C4'" . DC  A 1 20  ? -8.642  4.472   44.322 1.00 40.98  ? 20  DC  I "C4'" 1 
ATOM   398   O "O4'" . DC  A 1 20  ? -8.711  3.659   43.112 1.00 39.14  ? 20  DC  I "O4'" 1 
ATOM   399   C "C3'" . DC  A 1 20  ? -7.208  4.346   44.814 1.00 42.16  ? 20  DC  I "C3'" 1 
ATOM   400   O "O3'" . DC  A 1 20  ? -7.274  3.633   46.045 1.00 42.93  ? 20  DC  I "O3'" 1 
ATOM   401   C "C2'" . DC  A 1 20  ? -6.496  3.543   43.711 1.00 39.95  ? 20  DC  I "C2'" 1 
ATOM   402   C "C1'" . DC  A 1 20  ? -7.656  2.738   43.136 1.00 37.65  ? 20  DC  I "C1'" 1 
ATOM   403   N N1    . DC  A 1 20  ? -7.510  2.260   41.742 1.00 37.30  ? 20  DC  I N1    1 
ATOM   404   C C2    . DC  A 1 20  ? -7.605  0.878   41.486 1.00 36.40  ? 20  DC  I C2    1 
ATOM   405   O O2    . DC  A 1 20  ? -7.813  0.099   42.424 1.00 39.40  ? 20  DC  I O2    1 
ATOM   406   N N3    . DC  A 1 20  ? -7.492  0.442   40.218 1.00 33.95  ? 20  DC  I N3    1 
ATOM   407   C C4    . DC  A 1 20  ? -7.284  1.325   39.225 1.00 34.91  ? 20  DC  I C4    1 
ATOM   408   N N4    . DC  A 1 20  ? -7.159  0.855   37.974 1.00 32.81  ? 20  DC  I N4    1 
ATOM   409   C C5    . DC  A 1 20  ? -7.174  2.732   39.463 1.00 34.37  ? 20  DC  I C5    1 
ATOM   410   C C6    . DC  A 1 20  ? -7.304  3.154   40.722 1.00 35.78  ? 20  DC  I C6    1 
ATOM   411   P P     . DA  A 1 21  ? -6.060  3.656   47.053 1.00 44.96  ? 21  DA  I P     1 
ATOM   412   O OP1   . DA  A 1 21  ? -6.581  3.528   48.430 1.00 49.80  ? 21  DA  I OP1   1 
ATOM   413   O OP2   . DA  A 1 21  ? -5.171  4.770   46.693 1.00 47.52  ? 21  DA  I OP2   1 
ATOM   414   O "O5'" . DA  A 1 21  ? -5.350  2.285   46.740 1.00 44.84  ? 21  DA  I "O5'" 1 
ATOM   415   C "C5'" . DA  A 1 21  ? -4.442  2.211   45.725 1.00 42.28  ? 21  DA  I "C5'" 1 
ATOM   416   C "C4'" . DA  A 1 21  ? -4.082  0.772   45.476 1.00 40.18  ? 21  DA  I "C4'" 1 
ATOM   417   O "O4'" . DA  A 1 21  ? -4.734  0.356   44.265 1.00 38.15  ? 21  DA  I "O4'" 1 
ATOM   418   C "C3'" . DA  A 1 21  ? -2.597  0.753   45.180 1.00 40.74  ? 21  DA  I "C3'" 1 
ATOM   419   O "O3'" . DA  A 1 21  ? -1.813  0.176   46.226 1.00 39.26  ? 21  DA  I "O3'" 1 
ATOM   420   C "C2'" . DA  A 1 21  ? -2.454  0.046   43.840 1.00 39.94  ? 21  DA  I "C2'" 1 
ATOM   421   C "C1'" . DA  A 1 21  ? -3.856  -0.403  43.475 1.00 38.62  ? 21  DA  I "C1'" 1 
ATOM   422   N N9    . DA  A 1 21  ? -3.988  -0.211  42.026 1.00 38.80  ? 21  DA  I N9    1 
ATOM   423   C C8    . DA  A 1 21  ? -4.092  0.967   41.340 1.00 37.74  ? 21  DA  I C8    1 
ATOM   424   N N7    . DA  A 1 21  ? -4.140  0.800   40.035 1.00 36.73  ? 21  DA  I N7    1 
ATOM   425   C C5    . DA  A 1 21  ? -4.037  -0.551  39.839 1.00 35.45  ? 21  DA  I C5    1 
ATOM   426   C C6    . DA  A 1 21  ? -4.029  -1.353  38.672 1.00 37.06  ? 21  DA  I C6    1 
ATOM   427   N N6    . DA  A 1 21  ? -4.136  -0.856  37.433 1.00 33.31  ? 21  DA  I N6    1 
ATOM   428   N N1    . DA  A 1 21  ? -3.911  -2.710  38.845 1.00 38.25  ? 21  DA  I N1    1 
ATOM   429   C C2    . DA  A 1 21  ? -3.809  -3.201  40.094 1.00 36.75  ? 21  DA  I C2    1 
ATOM   430   N N3    . DA  A 1 21  ? -3.811  -2.534  41.250 1.00 36.07  ? 21  DA  I N3    1 
ATOM   431   C C4    . DA  A 1 21  ? -3.934  -1.204  41.057 1.00 37.14  ? 21  DA  I C4    1 
ATOM   432   P P     . DT  A 1 22  ? -0.255  0.453   46.129 1.00 39.09  ? 22  DT  I P     1 
ATOM   433   O OP1   . DT  A 1 22  ? 0.374   0.202   47.446 1.00 42.12  ? 22  DT  I OP1   1 
ATOM   434   O OP2   . DT  A 1 22  ? -0.031  1.744   45.441 1.00 40.47  ? 22  DT  I OP2   1 
ATOM   435   O "O5'" . DT  A 1 22  ? 0.160   -0.704  45.120 1.00 36.57  ? 22  DT  I "O5'" 1 
ATOM   436   C "C5'" . DT  A 1 22  ? -0.170  -2.038  45.435 1.00 36.02  ? 22  DT  I "C5'" 1 
ATOM   437   C "C4'" . DT  A 1 22  ? 0.388   -2.926  44.363 1.00 35.89  ? 22  DT  I "C4'" 1 
ATOM   438   O "O4'" . DT  A 1 22  ? -0.300  -2.598  43.143 1.00 34.57  ? 22  DT  I "O4'" 1 
ATOM   439   C "C3'" . DT  A 1 22  ? 1.877   -2.742  44.068 1.00 37.03  ? 22  DT  I "C3'" 1 
ATOM   440   O "O3'" . DT  A 1 22  ? 2.599   -3.825  44.615 1.00 38.06  ? 22  DT  I "O3'" 1 
ATOM   441   C "C2'" . DT  A 1 22  ? 1.966   -2.637  42.535 1.00 35.77  ? 22  DT  I "C2'" 1 
ATOM   442   C "C1'" . DT  A 1 22  ? 0.553   -3.001  42.090 1.00 34.04  ? 22  DT  I "C1'" 1 
ATOM   443   N N1    . DT  A 1 22  ? 0.121   -2.335  40.833 1.00 32.41  ? 22  DT  I N1    1 
ATOM   444   C C2    . DT  A 1 22  ? 0.015   -3.121  39.699 1.00 33.03  ? 22  DT  I C2    1 
ATOM   445   O O2    . DT  A 1 22  ? 0.264   -4.308  39.643 1.00 34.99  ? 22  DT  I O2    1 
ATOM   446   N N3    . DT  A 1 22  ? -0.375  -2.470  38.570 1.00 32.68  ? 22  DT  I N3    1 
ATOM   447   C C4    . DT  A 1 22  ? -0.663  -1.135  38.456 1.00 33.03  ? 22  DT  I C4    1 
ATOM   448   O O4    . DT  A 1 22  ? -1.017  -0.678  37.387 1.00 35.88  ? 22  DT  I O4    1 
ATOM   449   C C5    . DT  A 1 22  ? -0.552  -0.341  39.665 1.00 32.72  ? 22  DT  I C5    1 
ATOM   450   C C7    . DT  A 1 22  ? -0.881  1.124   39.592 1.00 30.07  ? 22  DT  I C7    1 
ATOM   451   C C6    . DT  A 1 22  ? -0.164  -0.973  40.803 1.00 31.60  ? 22  DT  I C6    1 
ATOM   452   P P     . DG  A 1 23  ? 4.169   -3.739  44.893 1.00 43.31  ? 23  DG  I P     1 
ATOM   453   O OP1   . DG  A 1 23  ? 4.549   -4.820  45.843 1.00 45.15  ? 23  DG  I OP1   1 
ATOM   454   O OP2   . DG  A 1 23  ? 4.608   -2.359  45.183 1.00 42.82  ? 23  DG  I OP2   1 
ATOM   455   O "O5'" . DG  A 1 23  ? 4.694   -4.144  43.447 1.00 44.12  ? 23  DG  I "O5'" 1 
ATOM   456   C "C5'" . DG  A 1 23  ? 4.392   -5.479  43.071 1.00 46.13  ? 23  DG  I "C5'" 1 
ATOM   457   C "C4'" . DG  A 1 23  ? 4.663   -5.695  41.604 1.00 46.08  ? 23  DG  I "C4'" 1 
ATOM   458   O "O4'" . DG  A 1 23  ? 3.700   -4.984  40.800 1.00 43.54  ? 23  DG  I "O4'" 1 
ATOM   459   C "C3'" . DG  A 1 23  ? 6.045   -5.222  41.193 1.00 46.72  ? 23  DG  I "C3'" 1 
ATOM   460   O "O3'" . DG  A 1 23  ? 6.748   -6.395  40.921 1.00 49.90  ? 23  DG  I "O3'" 1 
ATOM   461   C "C2'" . DG  A 1 23  ? 5.799   -4.393  39.953 1.00 45.00  ? 23  DG  I "C2'" 1 
ATOM   462   C "C1'" . DG  A 1 23  ? 4.367   -4.762  39.588 1.00 44.05  ? 23  DG  I "C1'" 1 
ATOM   463   N N9    . DG  A 1 23  ? 3.756   -3.703  38.801 1.00 42.15  ? 23  DG  I N9    1 
ATOM   464   C C8    . DG  A 1 23  ? 3.426   -2.427  39.172 1.00 40.10  ? 23  DG  I C8    1 
ATOM   465   N N7    . DG  A 1 23  ? 2.915   -1.735  38.187 1.00 40.98  ? 23  DG  I N7    1 
ATOM   466   C C5    . DG  A 1 23  ? 2.920   -2.609  37.094 1.00 42.86  ? 23  DG  I C5    1 
ATOM   467   C C6    . DG  A 1 23  ? 2.499   -2.439  35.741 1.00 43.88  ? 23  DG  I C6    1 
ATOM   468   O O6    . DG  A 1 23  ? 1.995   -1.427  35.198 1.00 44.70  ? 23  DG  I O6    1 
ATOM   469   N N1    . DG  A 1 23  ? 2.697   -3.600  34.997 1.00 44.12  ? 23  DG  I N1    1 
ATOM   470   C C2    . DG  A 1 23  ? 3.237   -4.774  35.488 1.00 46.02  ? 23  DG  I C2    1 
ATOM   471   N N2    . DG  A 1 23  ? 3.367   -5.820  34.658 1.00 45.74  ? 23  DG  I N2    1 
ATOM   472   N N3    . DG  A 1 23  ? 3.629   -4.932  36.739 1.00 45.87  ? 23  DG  I N3    1 
ATOM   473   C C4    . DG  A 1 23  ? 3.442   -3.818  37.475 1.00 43.11  ? 23  DG  I C4    1 
ATOM   474   P P     . DA  A 1 24  ? 8.143   -6.493  40.145 1.00 51.99  ? 24  DA  I P     1 
ATOM   475   O OP1   . DA  A 1 24  ? 8.758   -7.714  40.701 1.00 53.41  ? 24  DA  I OP1   1 
ATOM   476   O OP2   . DA  A 1 24  ? 8.860   -5.195  40.061 1.00 49.94  ? 24  DA  I OP2   1 
ATOM   477   O "O5'" . DA  A 1 24  ? 7.639   -6.830  38.668 1.00 53.00  ? 24  DA  I "O5'" 1 
ATOM   478   C "C5'" . DA  A 1 24  ? 6.930   -8.047  38.395 1.00 54.17  ? 24  DA  I "C5'" 1 
ATOM   479   C "C4'" . DA  A 1 24  ? 7.080   -8.396  36.927 1.00 55.43  ? 24  DA  I "C4'" 1 
ATOM   480   O "O4'" . DA  A 1 24  ? 6.417   -7.402  36.116 1.00 54.15  ? 24  DA  I "O4'" 1 
ATOM   481   C "C3'" . DA  A 1 24  ? 8.514   -8.428  36.404 1.00 56.57  ? 24  DA  I "C3'" 1 
ATOM   482   O "O3'" . DA  A 1 24  ? 8.566   -9.384  35.385 1.00 57.49  ? 24  DA  I "O3'" 1 
ATOM   483   C "C2'" . DA  A 1 24  ? 8.764   -7.021  35.870 1.00 54.41  ? 24  DA  I "C2'" 1 
ATOM   484   C "C1'" . DA  A 1 24  ? 7.377   -6.667  35.374 1.00 55.12  ? 24  DA  I "C1'" 1 
ATOM   485   N N9    . DA  A 1 24  ? 7.007   -5.286  35.577 1.00 54.30  ? 24  DA  I N9    1 
ATOM   486   C C8    . DA  A 1 24  ? 7.035   -4.550  36.731 1.00 53.61  ? 24  DA  I C8    1 
ATOM   487   N N7    . DA  A 1 24  ? 6.615   -3.315  36.582 1.00 52.41  ? 24  DA  I N7    1 
ATOM   488   C C5    . DA  A 1 24  ? 6.289   -3.266  35.243 1.00 52.34  ? 24  DA  I C5    1 
ATOM   489   C C6    . DA  A 1 24  ? 5.780   -2.246  34.449 1.00 51.97  ? 24  DA  I C6    1 
ATOM   490   N N6    . DA  A 1 24  ? 5.506   -1.049  34.930 1.00 50.17  ? 24  DA  I N6    1 
ATOM   491   N N1    . DA  A 1 24  ? 5.560   -2.512  33.144 1.00 55.65  ? 24  DA  I N1    1 
ATOM   492   C C2    . DA  A 1 24  ? 5.839   -3.738  32.666 1.00 57.34  ? 24  DA  I C2    1 
ATOM   493   N N3    . DA  A 1 24  ? 6.326   -4.792  33.322 1.00 56.34  ? 24  DA  I N3    1 
ATOM   494   C C4    . DA  A 1 24  ? 6.521   -4.470  34.609 1.00 54.20  ? 24  DA  I C4    1 
ATOM   495   P P     . DT  A 1 25  ? 9.921   -9.751  34.632 1.00 60.52  ? 25  DT  I P     1 
ATOM   496   O OP1   . DT  A 1 25  ? 9.863   -11.221 34.409 1.00 64.23  ? 25  DT  I OP1   1 
ATOM   497   O OP2   . DT  A 1 25  ? 11.097  -9.156  35.310 1.00 59.21  ? 25  DT  I OP2   1 
ATOM   498   O "O5'" . DT  A 1 25  ? 9.705   -8.974  33.247 1.00 59.47  ? 25  DT  I "O5'" 1 
ATOM   499   C "C5'" . DT  A 1 25  ? 8.538   -9.277  32.491 1.00 59.87  ? 25  DT  I "C5'" 1 
ATOM   500   C "C4'" . DT  A 1 25  ? 8.543   -8.651  31.108 1.00 60.63  ? 25  DT  I "C4'" 1 
ATOM   501   O "O4'" . DT  A 1 25  ? 8.195   -7.247  31.199 1.00 57.94  ? 25  DT  I "O4'" 1 
ATOM   502   C "C3'" . DT  A 1 25  ? 9.841   -8.715  30.321 1.00 63.56  ? 25  DT  I "C3'" 1 
ATOM   503   O "O3'" . DT  A 1 25  ? 9.492   -8.997  28.959 1.00 68.10  ? 25  DT  I "O3'" 1 
ATOM   504   C "C2'" . DT  A 1 25  ? 10.428  -7.314  30.526 1.00 60.83  ? 25  DT  I "C2'" 1 
ATOM   505   C "C1'" . DT  A 1 25  ? 9.168   -6.460  30.540 1.00 57.60  ? 25  DT  I "C1'" 1 
ATOM   506   N N1    . DT  A 1 25  ? 9.202   -5.127  31.241 1.00 53.50  ? 25  DT  I N1    1 
ATOM   507   C C2    . DT  A 1 25  ? 8.671   -4.036  30.589 1.00 51.50  ? 25  DT  I C2    1 
ATOM   508   O O2    . DT  A 1 25  ? 8.194   -4.066  29.478 1.00 53.20  ? 25  DT  I O2    1 
ATOM   509   N N3    . DT  A 1 25  ? 8.719   -2.869  31.279 1.00 50.22  ? 25  DT  I N3    1 
ATOM   510   C C4    . DT  A 1 25  ? 9.229   -2.665  32.542 1.00 49.86  ? 25  DT  I C4    1 
ATOM   511   O O4    . DT  A 1 25  ? 9.215   -1.558  33.065 1.00 49.56  ? 25  DT  I O4    1 
ATOM   512   C C5    . DT  A 1 25  ? 9.774   -3.832  33.185 1.00 50.26  ? 25  DT  I C5    1 
ATOM   513   C C7    . DT  A 1 25  ? 10.354  -3.723  34.563 1.00 48.37  ? 25  DT  I C7    1 
ATOM   514   C C6    . DT  A 1 25  ? 9.726   -4.999  32.515 1.00 52.41  ? 25  DT  I C6    1 
ATOM   515   P P     . DT  A 1 26  ? 10.592  -9.214  27.810 1.00 73.67  ? 26  DT  I P     1 
ATOM   516   O OP1   . DT  A 1 26  ? 10.200  -10.443 27.098 1.00 78.75  ? 26  DT  I OP1   1 
ATOM   517   O OP2   . DT  A 1 26  ? 11.958  -9.081  28.367 1.00 73.15  ? 26  DT  I OP2   1 
ATOM   518   O "O5'" . DT  A 1 26  ? 10.387  -7.961  26.843 1.00 74.42  ? 26  DT  I "O5'" 1 
ATOM   519   C "C5'" . DT  A 1 26  ? 9.098   -7.519  26.429 1.00 75.61  ? 26  DT  I "C5'" 1 
ATOM   520   C "C4'" . DT  A 1 26  ? 9.242   -6.235  25.626 1.00 77.52  ? 26  DT  I "C4'" 1 
ATOM   521   O "O4'" . DT  A 1 26  ? 9.342   -5.114  26.538 1.00 74.15  ? 26  DT  I "O4'" 1 
ATOM   522   C "C3'" . DT  A 1 26  ? 10.476  -6.136  24.731 1.00 82.69  ? 26  DT  I "C3'" 1 
ATOM   523   O "O3'" . DT  A 1 26  ? 10.136  -5.447  23.525 1.00 87.90  ? 26  DT  I "O3'" 1 
ATOM   524   C "C2'" . DT  A 1 26  ? 11.469  -5.342  25.580 1.00 79.73  ? 26  DT  I "C2'" 1 
ATOM   525   C "C1'" . DT  A 1 26  ? 10.510  -4.374  26.267 1.00 75.66  ? 26  DT  I "C1'" 1 
ATOM   526   N N1    . DT  A 1 26  ? 10.962  -3.770  27.555 1.00 72.59  ? 26  DT  I N1    1 
ATOM   527   C C2    . DT  A 1 26  ? 10.616  -2.461  27.811 1.00 71.09  ? 26  DT  I C2    1 
ATOM   528   O O2    . DT  A 1 26  ? 9.964   -1.779  27.042 1.00 72.33  ? 26  DT  I O2    1 
ATOM   529   N N3    . DT  A 1 26  ? 11.061  -1.971  29.012 1.00 68.47  ? 26  DT  I N3    1 
ATOM   530   C C4    . DT  A 1 26  ? 11.789  -2.652  29.965 1.00 67.77  ? 26  DT  I C4    1 
ATOM   531   O O4    . DT  A 1 26  ? 12.122  -2.117  31.011 1.00 66.74  ? 26  DT  I O4    1 
ATOM   532   C C5    . DT  A 1 26  ? 12.123  -4.023  29.646 1.00 70.39  ? 26  DT  I C5    1 
ATOM   533   C C7    . DT  A 1 26  ? 12.930  -4.864  30.605 1.00 70.42  ? 26  DT  I C7    1 
ATOM   534   C C6    . DT  A 1 26  ? 11.691  -4.509  28.469 1.00 72.49  ? 26  DT  I C6    1 
ATOM   535   P P     . DA  A 1 27  ? 11.025  -5.580  22.196 1.00 95.96  ? 27  DA  I P     1 
ATOM   536   O OP1   . DA  A 1 27  ? 10.081  -6.059  21.165 1.00 99.15  ? 27  DA  I OP1   1 
ATOM   537   O OP2   . DA  A 1 27  ? 12.297  -6.301  22.489 1.00 96.55  ? 27  DA  I OP2   1 
ATOM   538   O "O5'" . DA  A 1 27  ? 11.451  -4.083  21.827 1.00 96.61  ? 27  DA  I "O5'" 1 
ATOM   539   C "C5'" . DA  A 1 27  ? 10.561  -2.967  21.972 1.00 94.81  ? 27  DA  I "C5'" 1 
ATOM   540   C "C4'" . DA  A 1 27  ? 11.357  -1.672  22.116 1.00 94.52  ? 27  DA  I "C4'" 1 
ATOM   541   O "O4'" . DA  A 1 27  ? 11.707  -1.413  23.505 1.00 90.21  ? 27  DA  I "O4'" 1 
ATOM   542   C "C3'" . DA  A 1 27  ? 12.680  -1.613  21.348 1.00 98.29  ? 27  DA  I "C3'" 1 
ATOM   543   O "O3'" . DA  A 1 27  ? 12.730  -0.330  20.747 1.00 99.58  ? 27  DA  I "O3'" 1 
ATOM   544   C "C2'" . DA  A 1 27  ? 13.737  -1.808  22.440 1.00 95.72  ? 27  DA  I "C2'" 1 
ATOM   545   C "C1'" . DA  A 1 27  ? 13.063  -1.014  23.551 1.00 91.35  ? 27  DA  I "C1'" 1 
ATOM   546   N N9    . DA  A 1 27  ? 13.560  -1.207  24.909 1.00 88.22  ? 27  DA  I N9    1 
ATOM   547   C C8    . DA  A 1 27  ? 14.226  -2.281  25.441 1.00 88.38  ? 27  DA  I C8    1 
ATOM   548   N N7    . DA  A 1 27  ? 14.533  -2.142  26.714 1.00 85.15  ? 27  DA  I N7    1 
ATOM   549   C C5    . DA  A 1 27  ? 14.031  -0.895  27.036 1.00 82.99  ? 27  DA  I C5    1 
ATOM   550   C C6    . DA  A 1 27  ? 14.026  -0.149  28.236 1.00 80.22  ? 27  DA  I C6    1 
ATOM   551   N N6    . DA  A 1 27  ? 14.565  -0.590  29.378 1.00 77.82  ? 27  DA  I N6    1 
ATOM   552   N N1    . DA  A 1 27  ? 13.441  1.075   28.212 1.00 79.84  ? 27  DA  I N1    1 
ATOM   553   C C2    . DA  A 1 27  ? 12.894  1.521   27.064 1.00 81.75  ? 27  DA  I C2    1 
ATOM   554   N N3    . DA  A 1 27  ? 12.836  0.907   25.877 1.00 84.06  ? 27  DA  I N3    1 
ATOM   555   C C4    . DA  A 1 27  ? 13.429  -0.303  25.934 1.00 84.92  ? 27  DA  I C4    1 
ATOM   556   P P     . DC  A 1 28  ? 13.936  0.170   19.817 1.00 104.14 ? 28  DC  I P     1 
ATOM   557   O OP1   . DC  A 1 28  ? 13.922  -0.664  18.593 1.00 108.40 ? 28  DC  I OP1   1 
ATOM   558   O OP2   . DC  A 1 28  ? 15.194  0.291   20.604 1.00 100.85 ? 28  DC  I OP2   1 
ATOM   559   O "O5'" . DC  A 1 28  ? 13.381  1.643   19.467 1.00 103.08 ? 28  DC  I "O5'" 1 
ATOM   560   C "C5'" . DC  A 1 28  ? 12.654  2.438   20.435 1.00 96.62  ? 28  DC  I "C5'" 1 
ATOM   561   C "C4'" . DC  A 1 28  ? 13.547  3.405   21.205 1.00 93.80  ? 28  DC  I "C4'" 1 
ATOM   562   O "O4'" . DC  A 1 28  ? 13.829  2.886   22.534 1.00 88.89  ? 28  DC  I "O4'" 1 
ATOM   563   C "C3'" . DC  A 1 28  ? 14.912  3.668   20.571 1.00 97.05  ? 28  DC  I "C3'" 1 
ATOM   564   O "O3'" . DC  A 1 28  ? 14.907  4.927   19.891 1.00 99.87  ? 28  DC  I "O3'" 1 
ATOM   565   C "C2'" . DC  A 1 28  ? 15.912  3.613   21.732 1.00 93.63  ? 28  DC  I "C2'" 1 
ATOM   566   C "C1'" . DC  A 1 28  ? 15.045  3.451   22.980 1.00 88.06  ? 28  DC  I "C1'" 1 
ATOM   567   N N1    . DC  A 1 28  ? 15.645  2.614   24.105 1.00 84.69  ? 28  DC  I N1    1 
ATOM   568   C C2    . DC  A 1 28  ? 15.643  3.109   25.432 1.00 81.27  ? 28  DC  I C2    1 
ATOM   569   O O2    . DC  A 1 28  ? 15.153  4.220   25.684 1.00 81.39  ? 28  DC  I O2    1 
ATOM   570   N N3    . DC  A 1 28  ? 16.179  2.356   26.435 1.00 77.96  ? 28  DC  I N3    1 
ATOM   571   C C4    . DC  A 1 28  ? 16.703  1.157   26.172 1.00 78.19  ? 28  DC  I C4    1 
ATOM   572   N N4    . DC  A 1 28  ? 17.210  0.471   27.201 1.00 74.37  ? 28  DC  I N4    1 
ATOM   573   C C5    . DC  A 1 28  ? 16.719  0.629   24.839 1.00 82.02  ? 28  DC  I C5    1 
ATOM   574   C C6    . DC  A 1 28  ? 16.186  1.377   23.854 1.00 84.83  ? 28  DC  I C6    1 
ATOM   575   O "O5'" . DG  B 2 1   ? 20.306  6.880   35.689 1.00 92.91  ? 1   DG  J "O5'" 1 
ATOM   576   C "C5'" . DG  B 2 1   ? 18.942  6.489   35.911 1.00 90.67  ? 1   DG  J "C5'" 1 
ATOM   577   C "C4'" . DG  B 2 1   ? 17.978  7.235   34.995 1.00 89.66  ? 1   DG  J "C4'" 1 
ATOM   578   O "O4'" . DG  B 2 1   ? 18.172  6.798   33.628 1.00 89.04  ? 1   DG  J "O4'" 1 
ATOM   579   C "C3'" . DG  B 2 1   ? 16.496  7.063   35.314 1.00 86.60  ? 1   DG  J "C3'" 1 
ATOM   580   O "O3'" . DG  B 2 1   ? 15.893  8.308   35.707 1.00 88.60  ? 1   DG  J "O3'" 1 
ATOM   581   C "C2'" . DG  B 2 1   ? 15.858  6.425   34.078 1.00 84.32  ? 1   DG  J "C2'" 1 
ATOM   582   C "C1'" . DG  B 2 1   ? 16.972  6.343   33.042 1.00 85.95  ? 1   DG  J "C1'" 1 
ATOM   583   N N9    . DG  B 2 1   ? 17.240  4.989   32.567 1.00 84.21  ? 1   DG  J N9    1 
ATOM   584   C C8    . DG  B 2 1   ? 17.721  3.934   33.305 1.00 83.27  ? 1   DG  J C8    1 
ATOM   585   N N7    . DG  B 2 1   ? 17.866  2.835   32.615 1.00 82.42  ? 1   DG  J N7    1 
ATOM   586   C C5    . DG  B 2 1   ? 17.460  3.178   31.332 1.00 82.30  ? 1   DG  J C5    1 
ATOM   587   C C6    . DG  B 2 1   ? 17.402  2.390   30.151 1.00 81.67  ? 1   DG  J C6    1 
ATOM   588   O O6    . DG  B 2 1   ? 17.708  1.197   30.010 1.00 80.94  ? 1   DG  J O6    1 
ATOM   589   N N1    . DG  B 2 1   ? 16.932  3.124   29.059 1.00 82.82  ? 1   DG  J N1    1 
ATOM   590   C C2    . DG  B 2 1   ? 16.563  4.460   29.116 1.00 84.65  ? 1   DG  J C2    1 
ATOM   591   N N2    . DG  B 2 1   ? 16.129  5.020   27.977 1.00 86.06  ? 1   DG  J N2    1 
ATOM   592   N N3    . DG  B 2 1   ? 16.617  5.210   30.217 1.00 84.62  ? 1   DG  J N3    1 
ATOM   593   C C4    . DG  B 2 1   ? 17.075  4.506   31.287 1.00 83.79  ? 1   DG  J C4    1 
ATOM   594   P P     . DT  B 2 2   ? 15.555  9.540   34.731 1.00 90.22  ? 2   DT  J P     1 
ATOM   595   O OP1   . DT  B 2 2   ? 16.691  9.687   33.792 1.00 92.09  ? 2   DT  J OP1   1 
ATOM   596   O OP2   . DT  B 2 2   ? 15.159  10.702  35.564 1.00 91.45  ? 2   DT  J OP2   1 
ATOM   597   O "O5'" . DT  B 2 2   ? 14.274  9.024   33.913 1.00 86.01  ? 2   DT  J "O5'" 1 
ATOM   598   C "C5'" . DT  B 2 2   ? 14.152  9.315   32.512 1.00 85.58  ? 2   DT  J "C5'" 1 
ATOM   599   C "C4'" . DT  B 2 2   ? 13.179  8.390   31.804 1.00 81.26  ? 2   DT  J "C4'" 1 
ATOM   600   O "O4'" . DT  B 2 2   ? 13.802  7.109   31.504 1.00 78.55  ? 2   DT  J "O4'" 1 
ATOM   601   C "C3'" . DT  B 2 2   ? 11.926  8.064   32.609 1.00 78.90  ? 2   DT  J "C3'" 1 
ATOM   602   O "O3'" . DT  B 2 2   ? 10.790  8.266   31.818 1.00 79.28  ? 2   DT  J "O3'" 1 
ATOM   603   C "C2'" . DT  B 2 2   ? 12.057  6.567   32.867 1.00 75.42  ? 2   DT  J "C2'" 1 
ATOM   604   C "C1'" . DT  B 2 2   ? 12.753  6.167   31.576 1.00 75.19  ? 2   DT  J "C1'" 1 
ATOM   605   N N1    . DT  B 2 2   ? 13.233  4.735   31.479 1.00 73.25  ? 2   DT  J N1    1 
ATOM   606   C C2    . DT  B 2 2   ? 13.207  4.097   30.247 1.00 72.74  ? 2   DT  J C2    1 
ATOM   607   O O2    . DT  B 2 2   ? 12.828  4.599   29.207 1.00 74.30  ? 2   DT  J O2    1 
ATOM   608   N N3    . DT  B 2 2   ? 13.657  2.807   30.248 1.00 71.65  ? 2   DT  J N3    1 
ATOM   609   C C4    . DT  B 2 2   ? 14.117  2.083   31.326 1.00 70.71  ? 2   DT  J C4    1 
ATOM   610   O O4    . DT  B 2 2   ? 14.486  0.917   31.184 1.00 69.37  ? 2   DT  J O4    1 
ATOM   611   C C5    . DT  B 2 2   ? 14.116  2.799   32.590 1.00 70.90  ? 2   DT  J C5    1 
ATOM   612   C C7    . DT  B 2 2   ? 14.592  2.139   33.854 1.00 71.66  ? 2   DT  J C7    1 
ATOM   613   C C6    . DT  B 2 2   ? 13.680  4.067   32.604 1.00 71.69  ? 2   DT  J C6    1 
ATOM   614   P P     . DA  B 2 3   ? 9.996   9.647   31.768 1.00 81.52  ? 3   DA  J P     1 
ATOM   615   O OP1   . DA  B 2 3   ? 10.964  10.698  31.378 1.00 84.87  ? 3   DA  J OP1   1 
ATOM   616   O OP2   . DA  B 2 3   ? 9.129   9.812   32.960 1.00 79.83  ? 3   DA  J OP2   1 
ATOM   617   O "O5'" . DA  B 2 3   ? 9.018   9.308   30.549 1.00 80.01  ? 3   DA  J "O5'" 1 
ATOM   618   C "C5'" . DA  B 2 3   ? 9.561   9.059   29.254 1.00 80.54  ? 3   DA  J "C5'" 1 
ATOM   619   C "C4'" . DA  B 2 3   ? 8.915   7.835   28.649 1.00 77.15  ? 3   DA  J "C4'" 1 
ATOM   620   O "O4'" . DA  B 2 3   ? 9.558   6.656   29.167 1.00 74.58  ? 3   DA  J "O4'" 1 
ATOM   621   C "C3'" . DA  B 2 3   ? 7.434   7.676   28.961 1.00 74.67  ? 3   DA  J "C3'" 1 
ATOM   622   O "O3'" . DA  B 2 3   ? 6.799   7.926   27.738 1.00 76.06  ? 3   DA  J "O3'" 1 
ATOM   623   C "C2'" . DA  B 2 3   ? 7.284   6.231   29.463 1.00 71.62  ? 3   DA  J "C2'" 1 
ATOM   624   C "C1'" . DA  B 2 3   ? 8.631   5.597   29.125 1.00 71.24  ? 3   DA  J "C1'" 1 
ATOM   625   N N9    . DA  B 2 3   ? 9.188   4.604   30.037 1.00 68.39  ? 3   DA  J N9    1 
ATOM   626   C C8    . DA  B 2 3   ? 9.433   4.728   31.377 1.00 68.05  ? 3   DA  J C8    1 
ATOM   627   N N7    . DA  B 2 3   ? 9.978   3.660   31.928 1.00 66.25  ? 3   DA  J N7    1 
ATOM   628   C C5    . DA  B 2 3   ? 10.113  2.780   30.869 1.00 65.55  ? 3   DA  J C5    1 
ATOM   629   C C6    . DA  B 2 3   ? 10.627  1.465   30.776 1.00 64.67  ? 3   DA  J C6    1 
ATOM   630   N N6    . DA  B 2 3   ? 11.124  0.774   31.809 1.00 63.20  ? 3   DA  J N6    1 
ATOM   631   N N1    . DA  B 2 3   ? 10.605  0.877   29.560 1.00 65.86  ? 3   DA  J N1    1 
ATOM   632   C C2    . DA  B 2 3   ? 10.107  1.556   28.509 1.00 67.32  ? 3   DA  J C2    1 
ATOM   633   N N3    . DA  B 2 3   ? 9.602   2.791   28.475 1.00 67.84  ? 3   DA  J N3    1 
ATOM   634   C C4    . DA  B 2 3   ? 9.636   3.352   29.697 1.00 66.97  ? 3   DA  J C4    1 
ATOM   635   P P     . DA  B 2 4   ? 5.227   7.768   27.490 1.00 76.26  ? 4   DA  J P     1 
ATOM   636   O OP1   . DA  B 2 4   ? 4.916   8.769   26.434 1.00 78.21  ? 4   DA  J OP1   1 
ATOM   637   O OP2   . DA  B 2 4   ? 4.486   7.741   28.778 1.00 72.65  ? 4   DA  J OP2   1 
ATOM   638   O "O5'" . DA  B 2 4   ? 5.125   6.288   26.889 1.00 72.60  ? 4   DA  J "O5'" 1 
ATOM   639   C "C5'" . DA  B 2 4   ? 5.823   5.894   25.705 1.00 71.26  ? 4   DA  J "C5'" 1 
ATOM   640   C "C4'" . DA  B 2 4   ? 5.483   4.450   25.372 1.00 67.37  ? 4   DA  J "C4'" 1 
ATOM   641   O "O4'" . DA  B 2 4   ? 6.199   3.554   26.255 1.00 64.31  ? 4   DA  J "O4'" 1 
ATOM   642   C "C3'" . DA  B 2 4   ? 4.007   4.081   25.479 1.00 64.77  ? 4   DA  J "C3'" 1 
ATOM   643   O "O3'" . DA  B 2 4   ? 3.713   3.322   24.325 1.00 66.01  ? 4   DA  J "O3'" 1 
ATOM   644   C "C2'" . DA  B 2 4   ? 3.911   3.282   26.783 1.00 60.99  ? 4   DA  J "C2'" 1 
ATOM   645   C "C1'" . DA  B 2 4   ? 5.306   2.673   26.906 1.00 61.37  ? 4   DA  J "C1'" 1 
ATOM   646   N N9    . DA  B 2 4   ? 5.784   2.435   28.276 1.00 58.95  ? 4   DA  J N9    1 
ATOM   647   C C8    . DA  B 2 4   ? 5.654   3.247   29.368 1.00 58.55  ? 4   DA  J C8    1 
ATOM   648   N N7    . DA  B 2 4   ? 6.194   2.765   30.468 1.00 57.05  ? 4   DA  J N7    1 
ATOM   649   C C5    . DA  B 2 4   ? 6.718   1.549   30.072 1.00 55.93  ? 4   DA  J C5    1 
ATOM   650   C C6    . DA  B 2 4   ? 7.414   0.532   30.766 1.00 55.34  ? 4   DA  J C6    1 
ATOM   651   N N6    . DA  B 2 4   ? 7.729   0.590   32.067 1.00 53.08  ? 4   DA  J N6    1 
ATOM   652   N N1    . DA  B 2 4   ? 7.789   -0.563  30.058 1.00 55.90  ? 4   DA  J N1    1 
ATOM   653   C C2    . DA  B 2 4   ? 7.489   -0.641  28.756 1.00 55.85  ? 4   DA  J C2    1 
ATOM   654   N N3    . DA  B 2 4   ? 6.836   0.249   28.013 1.00 57.21  ? 4   DA  J N3    1 
ATOM   655   C C4    . DA  B 2 4   ? 6.475   1.330   28.728 1.00 57.04  ? 4   DA  J C4    1 
ATOM   656   P P     . DT  B 2 5   ? 2.262   2.782   23.913 1.00 65.90  ? 5   DT  J P     1 
ATOM   657   O OP1   . DT  B 2 5   ? 2.193   2.886   22.439 1.00 68.90  ? 5   DT  J OP1   1 
ATOM   658   O OP2   . DT  B 2 5   ? 1.200   3.403   24.746 1.00 63.90  ? 5   DT  J OP2   1 
ATOM   659   O "O5'" . DT  B 2 5   ? 2.362   1.225   24.282 1.00 63.45  ? 5   DT  J "O5'" 1 
ATOM   660   C "C5'" . DT  B 2 5   ? 3.531   0.463   23.999 1.00 64.29  ? 5   DT  J "C5'" 1 
ATOM   661   C "C4'" . DT  B 2 5   ? 3.579   -0.803  24.849 1.00 62.66  ? 5   DT  J "C4'" 1 
ATOM   662   O "O4'" . DT  B 2 5   ? 4.112   -0.565  26.192 1.00 60.93  ? 5   DT  J "O4'" 1 
ATOM   663   C "C3'" . DT  B 2 5   ? 2.235   -1.506  25.037 1.00 60.68  ? 5   DT  J "C3'" 1 
ATOM   664   O "O3'" . DT  B 2 5   ? 2.415   -2.832  24.513 1.00 62.29  ? 5   DT  J "O3'" 1 
ATOM   665   C "C2'" . DT  B 2 5   ? 2.013   -1.430  26.554 1.00 57.09  ? 5   DT  J "C2'" 1 
ATOM   666   C "C1'" . DT  B 2 5   ? 3.450   -1.437  27.087 1.00 57.14  ? 5   DT  J "C1'" 1 
ATOM   667   N N1    . DT  B 2 5   ? 3.696   -1.054  28.556 1.00 54.67  ? 5   DT  J N1    1 
ATOM   668   C C2    . DT  B 2 5   ? 4.477   -1.875  29.392 1.00 55.33  ? 5   DT  J C2    1 
ATOM   669   O O2    . DT  B 2 5   ? 5.024   -2.919  29.076 1.00 57.00  ? 5   DT  J O2    1 
ATOM   670   N N3    . DT  B 2 5   ? 4.635   -1.444  30.685 1.00 53.61  ? 5   DT  J N3    1 
ATOM   671   C C4    . DT  B 2 5   ? 4.106   -0.293  31.238 1.00 51.82  ? 5   DT  J C4    1 
ATOM   672   O O4    . DT  B 2 5   ? 4.322   -0.010  32.408 1.00 48.13  ? 5   DT  J O4    1 
ATOM   673   C C5    . DT  B 2 5   ? 3.307   0.529   30.338 1.00 52.73  ? 5   DT  J C5    1 
ATOM   674   C C7    . DT  B 2 5   ? 2.685   1.816   30.842 1.00 52.96  ? 5   DT  J C7    1 
ATOM   675   C C6    . DT  B 2 5   ? 3.144   0.109   29.065 1.00 52.64  ? 5   DT  J C6    1 
ATOM   676   P P     . DC  B 2 6   ? 1.265   -3.954  24.495 1.00 62.48  ? 6   DC  J P     1 
ATOM   677   O OP1   . DC  B 2 6   ? 1.481   -4.705  23.239 1.00 63.16  ? 6   DC  J OP1   1 
ATOM   678   O OP2   . DC  B 2 6   ? -0.050  -3.360  24.847 1.00 58.17  ? 6   DC  J OP2   1 
ATOM   679   O "O5'" . DC  B 2 6   ? 1.643   -4.893  25.734 1.00 58.37  ? 6   DC  J "O5'" 1 
ATOM   680   C "C5'" . DC  B 2 6   ? 2.885   -5.585  25.753 1.00 56.56  ? 6   DC  J "C5'" 1 
ATOM   681   C "C4'" . DC  B 2 6   ? 3.024   -6.268  27.099 1.00 53.17  ? 6   DC  J "C4'" 1 
ATOM   682   O "O4'" . DC  B 2 6   ? 3.057   -5.255  28.124 1.00 51.52  ? 6   DC  J "O4'" 1 
ATOM   683   C "C3'" . DC  B 2 6   ? 1.869   -7.176  27.490 1.00 50.51  ? 6   DC  J "C3'" 1 
ATOM   684   O "O3'" . DC  B 2 6   ? 2.426   -8.428  27.775 1.00 49.58  ? 6   DC  J "O3'" 1 
ATOM   685   C "C2'" . DC  B 2 6   ? 1.259   -6.557  28.745 1.00 47.91  ? 6   DC  J "C2'" 1 
ATOM   686   C "C1'" . DC  B 2 6   ? 2.436   -5.757  29.273 1.00 49.30  ? 6   DC  J "C1'" 1 
ATOM   687   N N1    . DC  B 2 6   ? 2.045   -4.580  30.093 1.00 48.80  ? 6   DC  J N1    1 
ATOM   688   C C2    . DC  B 2 6   ? 2.377   -4.546  31.452 1.00 48.69  ? 6   DC  J C2    1 
ATOM   689   O O2    . DC  B 2 6   ? 2.999   -5.482  31.958 1.00 48.82  ? 6   DC  J O2    1 
ATOM   690   N N3    . DC  B 2 6   ? 1.996   -3.475  32.186 1.00 48.61  ? 6   DC  J N3    1 
ATOM   691   C C4    . DC  B 2 6   ? 1.329   -2.476  31.605 1.00 47.33  ? 6   DC  J C4    1 
ATOM   692   N N4    . DC  B 2 6   ? 1.001   -1.437  32.364 1.00 46.19  ? 6   DC  J N4    1 
ATOM   693   C C5    . DC  B 2 6   ? 0.979   -2.495  30.227 1.00 47.44  ? 6   DC  J C5    1 
ATOM   694   C C6    . DC  B 2 6   ? 1.356   -3.554  29.516 1.00 47.45  ? 6   DC  J C6    1 
ATOM   695   P P     . DA  B 2 7   ? 1.499   -9.720  27.816 1.00 48.69  ? 7   DA  J P     1 
ATOM   696   O OP1   . DA  B 2 7   ? 2.442   -10.859 27.869 1.00 50.57  ? 7   DA  J OP1   1 
ATOM   697   O OP2   . DA  B 2 7   ? 0.501   -9.601  26.733 1.00 50.31  ? 7   DA  J OP2   1 
ATOM   698   O "O5'" . DA  B 2 7   ? 0.667   -9.564  29.187 1.00 45.97  ? 7   DA  J "O5'" 1 
ATOM   699   C "C5'" . DA  B 2 7   ? 1.169   -10.044 30.416 1.00 45.02  ? 7   DA  J "C5'" 1 
ATOM   700   C "C4'" . DA  B 2 7   ? 0.427   -9.533  31.638 1.00 42.76  ? 7   DA  J "C4'" 1 
ATOM   701   O "O4'" . DA  B 2 7   ? 0.697   -8.132  31.893 1.00 41.95  ? 7   DA  J "O4'" 1 
ATOM   702   C "C3'" . DA  B 2 7   ? -1.085  -9.560  31.661 1.00 41.82  ? 7   DA  J "C3'" 1 
ATOM   703   O "O3'" . DA  B 2 7   ? -1.545  -10.875 31.931 1.00 42.40  ? 7   DA  J "O3'" 1 
ATOM   704   C "C2'" . DA  B 2 7   ? -1.339  -8.634  32.859 1.00 40.28  ? 7   DA  J "C2'" 1 
ATOM   705   C "C1'" . DA  B 2 7   ? -0.047  -7.853  33.055 1.00 39.93  ? 7   DA  J "C1'" 1 
ATOM   706   N N9    . DA  B 2 7   ? -0.341  -6.422  33.159 1.00 40.23  ? 7   DA  J N9    1 
ATOM   707   C C8    . DA  B 2 7   ? -0.723  -5.590  32.147 1.00 39.33  ? 7   DA  J C8    1 
ATOM   708   N N7    . DA  B 2 7   ? -0.966  -4.365  32.542 1.00 39.71  ? 7   DA  J N7    1 
ATOM   709   C C5    . DA  B 2 7   ? -0.740  -4.374  33.906 1.00 38.38  ? 7   DA  J C5    1 
ATOM   710   C C6    . DA  B 2 7   ? -0.810  -3.367  34.914 1.00 37.34  ? 7   DA  J C6    1 
ATOM   711   N N6    . DA  B 2 7   ? -1.147  -2.085  34.711 1.00 32.22  ? 7   DA  J N6    1 
ATOM   712   N N1    . DA  B 2 7   ? -0.493  -3.755  36.175 1.00 39.57  ? 7   DA  J N1    1 
ATOM   713   C C2    . DA  B 2 7   ? -0.158  -5.028  36.425 1.00 37.48  ? 7   DA  J C2    1 
ATOM   714   N N3    . DA  B 2 7   ? -0.063  -6.031  35.558 1.00 37.90  ? 7   DA  J N3    1 
ATOM   715   C C4    . DA  B 2 7   ? -0.356  -5.643  34.306 1.00 38.50  ? 7   DA  J C4    1 
ATOM   716   P P     . DT  B 2 8   ? -3.059  -11.173 32.393 1.00 41.72  ? 8   DT  J P     1 
ATOM   717   O OP1   . DT  B 2 8   ? -3.213  -12.657 32.420 1.00 46.46  ? 8   DT  J OP1   1 
ATOM   718   O OP2   . DT  B 2 8   ? -3.965  -10.372 31.560 1.00 41.67  ? 8   DT  J OP2   1 
ATOM   719   O "O5'" . DT  B 2 8   ? -3.245  -10.591 33.871 1.00 39.63  ? 8   DT  J "O5'" 1 
ATOM   720   C "C5'" . DT  B 2 8   ? -2.530  -11.114 34.995 1.00 40.87  ? 8   DT  J "C5'" 1 
ATOM   721   C "C4'" . DT  B 2 8   ? -3.082  -10.541 36.287 1.00 39.79  ? 8   DT  J "C4'" 1 
ATOM   722   O "O4'" . DT  B 2 8   ? -2.786  -9.120  36.315 1.00 39.08  ? 8   DT  J "O4'" 1 
ATOM   723   C "C3'" . DT  B 2 8   ? -4.590  -10.681 36.445 1.00 41.00  ? 8   DT  J "C3'" 1 
ATOM   724   O "O3'" . DT  B 2 8   ? -4.861  -11.357 37.657 1.00 45.28  ? 8   DT  J "O3'" 1 
ATOM   725   C "C2'" . DT  B 2 8   ? -5.109  -9.254  36.511 1.00 38.10  ? 8   DT  J "C2'" 1 
ATOM   726   C "C1'" . DT  B 2 8   ? -3.855  -8.456  36.915 1.00 37.26  ? 8   DT  J "C1'" 1 
ATOM   727   N N1    . DT  B 2 8   ? -3.930  -7.009  36.515 1.00 34.35  ? 8   DT  J N1    1 
ATOM   728   C C2    . DT  B 2 8   ? -3.893  -6.036  37.509 1.00 33.99  ? 8   DT  J C2    1 
ATOM   729   O O2    . DT  B 2 8   ? -3.762  -6.261  38.703 1.00 32.86  ? 8   DT  J O2    1 
ATOM   730   N N3    . DT  B 2 8   ? -4.010  -4.747  37.057 1.00 33.76  ? 8   DT  J N3    1 
ATOM   731   C C4    . DT  B 2 8   ? -4.179  -4.320  35.753 1.00 34.12  ? 8   DT  J C4    1 
ATOM   732   O O4    . DT  B 2 8   ? -4.298  -3.119  35.478 1.00 36.62  ? 8   DT  J O4    1 
ATOM   733   C C5    . DT  B 2 8   ? -4.234  -5.375  34.766 1.00 33.10  ? 8   DT  J C5    1 
ATOM   734   C C7    . DT  B 2 8   ? -4.417  -5.035  33.317 1.00 30.92  ? 8   DT  J C7    1 
ATOM   735   C C6    . DT  B 2 8   ? -4.112  -6.654  35.190 1.00 33.89  ? 8   DT  J C6    1 
ATOM   736   P P     . DG  B 2 9   ? -6.208  -12.192 37.880 1.00 47.29  ? 9   DG  J P     1 
ATOM   737   O OP1   . DG  B 2 9   ? -5.915  -13.247 38.856 1.00 52.94  ? 9   DG  J OP1   1 
ATOM   738   O OP2   . DG  B 2 9   ? -6.856  -12.576 36.604 1.00 48.97  ? 9   DG  J OP2   1 
ATOM   739   O "O5'" . DG  B 2 9   ? -7.099  -11.134 38.614 1.00 47.07  ? 9   DG  J "O5'" 1 
ATOM   740   C "C5'" . DG  B 2 9   ? -6.717  -10.923 39.951 1.00 48.74  ? 9   DG  J "C5'" 1 
ATOM   741   C "C4'" . DG  B 2 9   ? -6.987  -9.480  40.338 1.00 46.44  ? 9   DG  J "C4'" 1 
ATOM   742   O "O4'" . DG  B 2 9   ? -6.614  -8.538  39.310 1.00 42.91  ? 9   DG  J "O4'" 1 
ATOM   743   C "C3'" . DG  B 2 9   ? -8.443  -9.146  40.556 1.00 44.00  ? 9   DG  J "C3'" 1 
ATOM   744   O "O3'" . DG  B 2 9   ? -8.875  -9.684  41.788 1.00 44.31  ? 9   DG  J "O3'" 1 
ATOM   745   C "C2'" . DG  B 2 9   ? -8.263  -7.653  40.709 1.00 44.19  ? 9   DG  J "C2'" 1 
ATOM   746   C "C1'" . DG  B 2 9   ? -6.994  -7.345  39.931 1.00 42.10  ? 9   DG  J "C1'" 1 
ATOM   747   N N9    . DG  B 2 9   ? -7.141  -6.208  39.016 1.00 38.64  ? 9   DG  J N9    1 
ATOM   748   C C8    . DG  B 2 9   ? -7.199  -6.182  37.648 1.00 36.91  ? 9   DG  J C8    1 
ATOM   749   N N7    . DG  B 2 9   ? -7.293  -4.975  37.173 1.00 36.15  ? 9   DG  J N7    1 
ATOM   750   C C5    . DG  B 2 9   ? -7.307  -4.153  38.299 1.00 36.33  ? 9   DG  J C5    1 
ATOM   751   C C6    . DG  B 2 9   ? -7.401  -2.739  38.434 1.00 34.40  ? 9   DG  J C6    1 
ATOM   752   O O6    . DG  B 2 9   ? -7.498  -1.888  37.542 1.00 35.04  ? 9   DG  J O6    1 
ATOM   753   N N1    . DG  B 2 9   ? -7.373  -2.328  39.760 1.00 34.18  ? 9   DG  J N1    1 
ATOM   754   C C2    . DG  B 2 9   ? -7.273  -3.168  40.840 1.00 36.42  ? 9   DG  J C2    1 
ATOM   755   N N2    . DG  B 2 9   ? -7.270  -2.599  42.057 1.00 37.16  ? 9   DG  J N2    1 
ATOM   756   N N3    . DG  B 2 9   ? -7.188  -4.489  40.729 1.00 37.52  ? 9   DG  J N3    1 
ATOM   757   C C4    . DG  B 2 9   ? -7.216  -4.907  39.438 1.00 36.97  ? 9   DG  J C4    1 
ATOM   758   P P     . DT  B 2 10  ? -10.294 -9.295  42.412 1.00 44.98  ? 10  DT  J P     1 
ATOM   759   O OP1   . DT  B 2 10  ? -10.611 -10.346 43.415 1.00 46.27  ? 10  DT  J OP1   1 
ATOM   760   O OP2   . DT  B 2 10  ? -11.249 -8.869  41.378 1.00 39.52  ? 10  DT  J OP2   1 
ATOM   761   O "O5'" . DT  B 2 10  ? -10.090 -7.875  43.114 1.00 44.88  ? 10  DT  J "O5'" 1 
ATOM   762   C "C5'" . DT  B 2 10  ? -9.232  -7.633  44.208 1.00 45.45  ? 10  DT  J "C5'" 1 
ATOM   763   C "C4'" . DT  B 2 10  ? -9.619  -6.263  44.719 1.00 44.82  ? 10  DT  J "C4'" 1 
ATOM   764   O "O4'" . DT  B 2 10  ? -9.489  -5.293  43.648 1.00 42.41  ? 10  DT  J "O4'" 1 
ATOM   765   C "C3'" . DT  B 2 10  ? -11.058 -6.156  45.201 1.00 45.01  ? 10  DT  J "C3'" 1 
ATOM   766   O "O3'" . DT  B 2 10  ? -11.008 -5.474  46.463 1.00 48.15  ? 10  DT  J "O3'" 1 
ATOM   767   C "C2'" . DT  B 2 10  ? -11.799 -5.413  44.082 1.00 40.20  ? 10  DT  J "C2'" 1 
ATOM   768   C "C1'" . DT  B 2 10  ? -10.689 -4.570  43.480 1.00 39.24  ? 10  DT  J "C1'" 1 
ATOM   769   N N1    . DT  B 2 10  ? -10.744 -4.180  42.026 1.00 36.48  ? 10  DT  J N1    1 
ATOM   770   C C2    . DT  B 2 10  ? -10.725 -2.828  41.760 1.00 35.11  ? 10  DT  J C2    1 
ATOM   771   O O2    . DT  B 2 10  ? -10.702 -2.016  42.641 1.00 38.26  ? 10  DT  J O2    1 
ATOM   772   N N3    . DT  B 2 10  ? -10.747 -2.450  40.445 1.00 32.18  ? 10  DT  J N3    1 
ATOM   773   C C4    . DT  B 2 10  ? -10.760 -3.314  39.369 1.00 30.59  ? 10  DT  J C4    1 
ATOM   774   O O4    . DT  B 2 10  ? -10.771 -2.901  38.213 1.00 29.82  ? 10  DT  J O4    1 
ATOM   775   C C5    . DT  B 2 10  ? -10.773 -4.721  39.697 1.00 31.11  ? 10  DT  J C5    1 
ATOM   776   C C7    . DT  B 2 10  ? -10.796 -5.719  38.575 1.00 30.97  ? 10  DT  J C7    1 
ATOM   777   C C6    . DT  B 2 10  ? -10.747 -5.096  40.991 1.00 32.82  ? 10  DT  J C6    1 
ATOM   778   P P     . DA  B 2 11  ? -12.326 -4.933  47.192 1.00 50.23  ? 11  DA  J P     1 
ATOM   779   O OP1   . DA  B 2 11  ? -11.974 -4.895  48.627 1.00 52.43  ? 11  DA  J OP1   1 
ATOM   780   O OP2   . DA  B 2 11  ? -13.514 -5.666  46.702 1.00 49.10  ? 11  DA  J OP2   1 
ATOM   781   O "O5'" . DA  B 2 11  ? -12.514 -3.443  46.625 1.00 48.76  ? 11  DA  J "O5'" 1 
ATOM   782   C "C5'" . DA  B 2 11  ? -11.605 -2.387  46.931 1.00 48.33  ? 11  DA  J "C5'" 1 
ATOM   783   C "C4'" . DA  B 2 11  ? -12.285 -1.045  46.722 1.00 47.76  ? 11  DA  J "C4'" 1 
ATOM   784   O "O4'" . DA  B 2 11  ? -12.373 -0.690  45.313 1.00 43.73  ? 11  DA  J "O4'" 1 
ATOM   785   C "C3'" . DA  B 2 11  ? -13.701 -0.935  47.264 1.00 48.66  ? 11  DA  J "C3'" 1 
ATOM   786   O "O3'" . DA  B 2 11  ? -13.724 0.303   47.961 1.00 52.13  ? 11  DA  J "O3'" 1 
ATOM   787   C "C2'" . DA  B 2 11  ? -14.607 -0.993  46.027 1.00 43.78  ? 11  DA  J "C2'" 1 
ATOM   788   C "C1'" . DA  B 2 11  ? -13.713 -0.429  44.926 1.00 42.62  ? 11  DA  J "C1'" 1 
ATOM   789   N N9    . DA  B 2 11  ? -13.825 -0.991  43.564 1.00 39.60  ? 11  DA  J N9    1 
ATOM   790   C C8    . DA  B 2 11  ? -13.826 -2.311  43.212 1.00 38.22  ? 11  DA  J C8    1 
ATOM   791   N N7    . DA  B 2 11  ? -13.895 -2.505  41.918 1.00 37.36  ? 11  DA  J N7    1 
ATOM   792   C C5    . DA  B 2 11  ? -13.923 -1.230  41.382 1.00 35.45  ? 11  DA  J C5    1 
ATOM   793   C C6    . DA  B 2 11  ? -13.997 -0.735  40.061 1.00 34.04  ? 11  DA  J C6    1 
ATOM   794   N N6    . DA  B 2 11  ? -14.047 -1.515  39.006 1.00 29.78  ? 11  DA  J N6    1 
ATOM   795   N N1    . DA  B 2 11  ? -14.023 0.612   39.857 1.00 36.43  ? 11  DA  J N1    1 
ATOM   796   C C2    . DA  B 2 11  ? -13.958 1.421   40.922 1.00 35.46  ? 11  DA  J C2    1 
ATOM   797   N N3    . DA  B 2 11  ? -13.888 1.049   42.204 1.00 36.94  ? 11  DA  J N3    1 
ATOM   798   C C4    . DA  B 2 11  ? -13.882 -0.285  42.378 1.00 36.16  ? 11  DA  J C4    1 
ATOM   799   P P     . DA  B 2 12  ? -15.027 0.922   48.652 1.00 55.11  ? 12  DA  J P     1 
ATOM   800   O OP1   . DA  B 2 12  ? -14.520 1.702   49.807 1.00 56.98  ? 12  DA  J OP1   1 
ATOM   801   O OP2   . DA  B 2 12  ? -16.075 -0.117  48.778 1.00 53.10  ? 12  DA  J OP2   1 
ATOM   802   O "O5'" . DA  B 2 12  ? -15.598 1.931   47.536 1.00 53.12  ? 12  DA  J "O5'" 1 
ATOM   803   C "C5'" . DA  B 2 12  ? -14.810 2.993   46.974 1.00 51.60  ? 12  DA  J "C5'" 1 
ATOM   804   C "C4'" . DA  B 2 12  ? -15.617 3.705   45.898 1.00 49.12  ? 12  DA  J "C4'" 1 
ATOM   805   O "O4'" . DA  B 2 12  ? -15.681 2.931   44.662 1.00 45.72  ? 12  DA  J "O4'" 1 
ATOM   806   C "C3'" . DA  B 2 12  ? -17.064 4.012   46.255 1.00 49.76  ? 12  DA  J "C3'" 1 
ATOM   807   O "O3'" . DA  B 2 12  ? -17.229 5.421   46.030 1.00 53.63  ? 12  DA  J "O3'" 1 
ATOM   808   C "C2'" . DA  B 2 12  ? -17.885 3.106   45.327 1.00 45.00  ? 12  DA  J "C2'" 1 
ATOM   809   C "C1'" . DA  B 2 12  ? -16.973 3.030   44.103 1.00 42.46  ? 12  DA  J "C1'" 1 
ATOM   810   N N9    . DA  B 2 12  ? -17.112 1.856   43.241 1.00 39.70  ? 12  DA  J N9    1 
ATOM   811   C C8    . DA  B 2 12  ? -17.287 0.566   43.667 1.00 37.46  ? 12  DA  J C8    1 
ATOM   812   N N7    . DA  B 2 12  ? -17.351 -0.283  42.682 1.00 35.98  ? 12  DA  J N7    1 
ATOM   813   C C5    . DA  B 2 12  ? -17.214 0.475   41.532 1.00 33.27  ? 12  DA  J C5    1 
ATOM   814   C C6    . DA  B 2 12  ? -17.195 0.150   40.157 1.00 32.28  ? 12  DA  J C6    1 
ATOM   815   N N6    . DA  B 2 12  ? -17.330 -1.094  39.665 1.00 26.97  ? 12  DA  J N6    1 
ATOM   816   N N1    . DA  B 2 12  ? -17.038 1.175   39.278 1.00 34.33  ? 12  DA  J N1    1 
ATOM   817   C C2    . DA  B 2 12  ? -16.889 2.425   39.714 1.00 33.00  ? 12  DA  J C2    1 
ATOM   818   N N3    . DA  B 2 12  ? -16.882 2.818   40.981 1.00 37.42  ? 12  DA  J N3    1 
ATOM   819   C C4    . DA  B 2 12  ? -17.059 1.800   41.853 1.00 36.79  ? 12  DA  J C4    1 
ATOM   820   P P     . DC  B 2 13  ? -18.607 6.221   46.222 1.00 58.43  ? 13  DC  J P     1 
ATOM   821   O OP1   . DC  B 2 13  ? -18.216 7.552   46.748 1.00 60.05  ? 13  DC  J OP1   1 
ATOM   822   O OP2   . DC  B 2 13  ? -19.640 5.364   46.873 1.00 56.01  ? 13  DC  J OP2   1 
ATOM   823   O "O5'" . DC  B 2 13  ? -19.116 6.420   44.714 1.00 57.09  ? 13  DC  J "O5'" 1 
ATOM   824   C "C5'" . DC  B 2 13  ? -18.178 6.769   43.683 1.00 58.59  ? 13  DC  J "C5'" 1 
ATOM   825   C "C4'" . DC  B 2 13  ? -18.792 6.498   42.323 1.00 58.23  ? 13  DC  J "C4'" 1 
ATOM   826   O "O4'" . DC  B 2 13  ? -18.861 5.060   42.087 1.00 55.03  ? 13  DC  J "O4'" 1 
ATOM   827   C "C3'" . DC  B 2 13  ? -20.216 7.027   42.159 1.00 58.56  ? 13  DC  J "C3'" 1 
ATOM   828   O "O3'" . DC  B 2 13  ? -20.182 8.146   41.243 1.00 62.00  ? 13  DC  J "O3'" 1 
ATOM   829   C "C2'" . DC  B 2 13  ? -21.016 5.791   41.696 1.00 54.17  ? 13  DC  J "C2'" 1 
ATOM   830   C "C1'" . DC  B 2 13  ? -19.926 4.840   41.202 1.00 51.41  ? 13  DC  J "C1'" 1 
ATOM   831   N N1    . DC  B 2 13  ? -20.159 3.332   41.072 1.00 48.38  ? 13  DC  J N1    1 
ATOM   832   C C2    . DC  B 2 13  ? -20.135 2.821   39.784 1.00 46.91  ? 13  DC  J C2    1 
ATOM   833   O O2    . DC  B 2 13  ? -19.949 3.622   38.875 1.00 50.72  ? 13  DC  J O2    1 
ATOM   834   N N3    . DC  B 2 13  ? -20.308 1.499   39.536 1.00 46.17  ? 13  DC  J N3    1 
ATOM   835   C C4    . DC  B 2 13  ? -20.503 0.655   40.565 1.00 46.90  ? 13  DC  J C4    1 
ATOM   836   N N4    . DC  B 2 13  ? -20.670 -0.654  40.272 1.00 41.26  ? 13  DC  J N4    1 
ATOM   837   C C5    . DC  B 2 13  ? -20.536 1.147   41.925 1.00 46.62  ? 13  DC  J C5    1 
ATOM   838   C C6    . DC  B 2 13  ? -20.359 2.474   42.120 1.00 48.81  ? 13  DC  J C6    1 
ATOM   839   P P     . DT  B 2 14  ? -21.485 9.068   40.926 1.00 67.14  ? 14  DT  J P     1 
ATOM   840   O OP1   . DT  B 2 14  ? -21.024 10.480  40.968 1.00 68.58  ? 14  DT  J OP1   1 
ATOM   841   O OP2   . DT  B 2 14  ? -22.659 8.578   41.718 1.00 64.98  ? 14  DT  J OP2   1 
ATOM   842   O "O5'" . DT  B 2 14  ? -21.857 8.708   39.399 1.00 62.78  ? 14  DT  J "O5'" 1 
ATOM   843   C "C5'" . DT  B 2 14  ? -20.881 8.401   38.383 1.00 56.75  ? 14  DT  J "C5'" 1 
ATOM   844   C "C4'" . DT  B 2 14  ? -21.563 7.625   37.256 1.00 51.68  ? 14  DT  J "C4'" 1 
ATOM   845   O "O4'" . DT  B 2 14  ? -21.645 6.209   37.577 1.00 47.84  ? 14  DT  J "O4'" 1 
ATOM   846   C "C3'" . DT  B 2 14  ? -22.988 8.063   36.888 1.00 49.64  ? 14  DT  J "C3'" 1 
ATOM   847   O "O3'" . DT  B 2 14  ? -23.001 8.266   35.476 1.00 48.43  ? 14  DT  J "O3'" 1 
ATOM   848   C "C2'" . DT  B 2 14  ? -23.873 6.903   37.351 1.00 46.85  ? 14  DT  J "C2'" 1 
ATOM   849   C "C1'" . DT  B 2 14  ? -22.911 5.722   37.172 1.00 45.35  ? 14  DT  J "C1'" 1 
ATOM   850   N N1    . DT  B 2 14  ? -23.176 4.461   37.952 1.00 42.09  ? 14  DT  J N1    1 
ATOM   851   C C2    . DT  B 2 14  ? -23.184 3.248   37.289 1.00 40.93  ? 14  DT  J C2    1 
ATOM   852   O O2    . DT  B 2 14  ? -22.993 3.139   36.093 1.00 44.15  ? 14  DT  J O2    1 
ATOM   853   N N3    . DT  B 2 14  ? -23.426 2.144   38.073 1.00 38.46  ? 14  DT  J N3    1 
ATOM   854   C C4    . DT  B 2 14  ? -23.650 2.125   39.444 1.00 38.26  ? 14  DT  J C4    1 
ATOM   855   O O4    . DT  B 2 14  ? -23.839 1.052   40.047 1.00 37.27  ? 14  DT  J O4    1 
ATOM   856   C C5    . DT  B 2 14  ? -23.618 3.443   40.081 1.00 37.94  ? 14  DT  J C5    1 
ATOM   857   C C7    . DT  B 2 14  ? -23.857 3.625   41.544 1.00 37.07  ? 14  DT  J C7    1 
ATOM   858   C C6    . DT  B 2 14  ? -23.387 4.519   39.321 1.00 39.93  ? 14  DT  J C6    1 
ATOM   859   P P     . DA  B 2 15  ? -24.296 8.670   34.623 1.00 48.95  ? 15  DA  J P     1 
ATOM   860   O OP1   . DA  B 2 15  ? -23.816 9.547   33.524 1.00 49.27  ? 15  DA  J OP1   1 
ATOM   861   O OP2   . DA  B 2 15  ? -25.379 9.124   35.526 1.00 49.66  ? 15  DA  J OP2   1 
ATOM   862   O "O5'" . DA  B 2 15  ? -24.827 7.259   34.077 1.00 43.11  ? 15  DA  J "O5'" 1 
ATOM   863   C "C5'" . DA  B 2 15  ? -24.001 6.373   33.353 1.00 37.88  ? 15  DA  J "C5'" 1 
ATOM   864   C "C4'" . DA  B 2 15  ? -24.831 5.199   32.879 1.00 33.76  ? 15  DA  J "C4'" 1 
ATOM   865   O "O4'" . DA  B 2 15  ? -24.982 4.212   33.931 1.00 29.19  ? 15  DA  J "O4'" 1 
ATOM   866   C "C3'" . DA  B 2 15  ? -26.242 5.562   32.431 1.00 34.10  ? 15  DA  J "C3'" 1 
ATOM   867   O "O3'" . DA  B 2 15  ? -26.338 5.085   31.086 1.00 33.74  ? 15  DA  J "O3'" 1 
ATOM   868   C "C2'" . DA  B 2 15  ? -27.166 4.857   33.449 1.00 31.14  ? 15  DA  J "C2'" 1 
ATOM   869   C "C1'" . DA  B 2 15  ? -26.289 3.672   33.890 1.00 29.12  ? 15  DA  J "C1'" 1 
ATOM   870   N N9    . DA  B 2 15  ? -26.454 3.112   35.235 1.00 27.95  ? 15  DA  J N9    1 
ATOM   871   C C8    . DA  B 2 15  ? -26.462 3.812   36.418 1.00 26.59  ? 15  DA  J C8    1 
ATOM   872   N N7    . DA  B 2 15  ? -26.599 3.042   37.472 1.00 26.86  ? 15  DA  J N7    1 
ATOM   873   C C5    . DA  B 2 15  ? -26.684 1.755   36.957 1.00 26.06  ? 15  DA  J C5    1 
ATOM   874   C C6    . DA  B 2 15  ? -26.808 0.477   37.558 1.00 25.78  ? 15  DA  J C6    1 
ATOM   875   N N6    . DA  B 2 15  ? -26.906 0.286   38.870 1.00 24.82  ? 15  DA  J N6    1 
ATOM   876   N N1    . DA  B 2 15  ? -26.845 -0.614  36.762 1.00 25.86  ? 15  DA  J N1    1 
ATOM   877   C C2    . DA  B 2 15  ? -26.751 -0.430  35.440 1.00 26.09  ? 15  DA  J C2    1 
ATOM   878   N N3    . DA  B 2 15  ? -26.610 0.719   34.773 1.00 27.25  ? 15  DA  J N3    1 
ATOM   879   C C4    . DA  B 2 15  ? -26.590 1.782   35.584 1.00 25.56  ? 15  DA  J C4    1 
ATOM   880   P P     . DT  B 2 16  ? -27.678 5.262   30.249 1.00 35.25  ? 16  DT  J P     1 
ATOM   881   O OP1   . DT  B 2 16  ? -27.306 5.381   28.830 1.00 38.25  ? 16  DT  J OP1   1 
ATOM   882   O OP2   . DT  B 2 16  ? -28.447 6.338   30.903 1.00 36.18  ? 16  DT  J OP2   1 
ATOM   883   O "O5'" . DT  B 2 16  ? -28.459 3.865   30.384 1.00 33.05  ? 16  DT  J "O5'" 1 
ATOM   884   C "C5'" . DT  B 2 16  ? -27.757 2.593   30.380 1.00 30.70  ? 16  DT  J "C5'" 1 
ATOM   885   C "C4'" . DT  B 2 16  ? -28.691 1.421   30.681 1.00 30.88  ? 16  DT  J "C4'" 1 
ATOM   886   O "O4'" . DT  B 2 16  ? -28.675 1.165   32.107 1.00 30.23  ? 16  DT  J "O4'" 1 
ATOM   887   C "C3'" . DT  B 2 16  ? -30.172 1.588   30.329 1.00 33.84  ? 16  DT  J "C3'" 1 
ATOM   888   O "O3'" . DT  B 2 16  ? -30.468 0.648   29.302 1.00 36.98  ? 16  DT  J "O3'" 1 
ATOM   889   C "C2'" . DT  B 2 16  ? -30.943 1.349   31.636 1.00 32.01  ? 16  DT  J "C2'" 1 
ATOM   890   C "C1'" . DT  B 2 16  ? -29.916 0.636   32.509 1.00 30.67  ? 16  DT  J "C1'" 1 
ATOM   891   N N1    . DT  B 2 16  ? -30.006 0.737   34.018 1.00 31.29  ? 16  DT  J N1    1 
ATOM   892   C C2    . DT  B 2 16  ? -30.048 -0.428  34.767 1.00 33.06  ? 16  DT  J C2    1 
ATOM   893   O O2    . DT  B 2 16  ? -30.049 -1.556  34.313 1.00 36.39  ? 16  DT  J O2    1 
ATOM   894   N N3    . DT  B 2 16  ? -30.096 -0.257  36.122 1.00 32.79  ? 16  DT  J N3    1 
ATOM   895   C C4    . DT  B 2 16  ? -30.108 0.932   36.801 1.00 32.55  ? 16  DT  J C4    1 
ATOM   896   O O4    . DT  B 2 16  ? -30.153 0.917   38.035 1.00 33.62  ? 16  DT  J O4    1 
ATOM   897   C C5    . DT  B 2 16  ? -30.047 2.126   35.976 1.00 31.82  ? 16  DT  J C5    1 
ATOM   898   C C7    . DT  B 2 16  ? -30.055 3.521   36.588 1.00 33.81  ? 16  DT  J C7    1 
ATOM   899   C C6    . DT  B 2 16  ? -29.998 1.965   34.646 1.00 30.95  ? 16  DT  J C6    1 
ATOM   900   P P     . DT  B 2 17  ? -31.924 0.277   28.727 1.00 40.63  ? 17  DT  J P     1 
ATOM   901   O OP1   . DT  B 2 17  ? -31.706 -0.170  27.339 1.00 44.54  ? 17  DT  J OP1   1 
ATOM   902   O OP2   . DT  B 2 17  ? -32.894 1.352   28.955 1.00 43.39  ? 17  DT  J OP2   1 
ATOM   903   O "O5'" . DT  B 2 17  ? -32.370 -0.960  29.652 1.00 39.32  ? 17  DT  J "O5'" 1 
ATOM   904   C "C5'" . DT  B 2 17  ? -31.555 -2.122  29.794 1.00 36.80  ? 17  DT  J "C5'" 1 
ATOM   905   C "C4'" . DT  B 2 17  ? -32.279 -3.202  30.591 1.00 37.32  ? 17  DT  J "C4'" 1 
ATOM   906   O "O4'" . DT  B 2 17  ? -32.201 -2.855  31.992 1.00 34.62  ? 17  DT  J "O4'" 1 
ATOM   907   C "C3'" . DT  B 2 17  ? -33.764 -3.456  30.299 1.00 39.24  ? 17  DT  J "C3'" 1 
ATOM   908   O "O3'" . DT  B 2 17  ? -33.973 -4.843  30.066 1.00 43.99  ? 17  DT  J "O3'" 1 
ATOM   909   C "C2'" . DT  B 2 17  ? -34.518 -3.015  31.550 1.00 36.09  ? 17  DT  J "C2'" 1 
ATOM   910   C "C1'" . DT  B 2 17  ? -33.441 -3.104  32.617 1.00 33.41  ? 17  DT  J "C1'" 1 
ATOM   911   N N1    . DT  B 2 17  ? -33.498 -2.129  33.751 1.00 32.21  ? 17  DT  J N1    1 
ATOM   912   C C2    . DT  B 2 17  ? -33.454 -2.658  35.013 1.00 31.03  ? 17  DT  J C2    1 
ATOM   913   O O2    . DT  B 2 17  ? -33.427 -3.846  35.236 1.00 34.79  ? 17  DT  J O2    1 
ATOM   914   N N3    . DT  B 2 17  ? -33.490 -1.754  36.020 1.00 29.21  ? 17  DT  J N3    1 
ATOM   915   C C4    . DT  B 2 17  ? -33.552 -0.389  35.895 1.00 26.41  ? 17  DT  J C4    1 
ATOM   916   O O4    . DT  B 2 17  ? -33.558 0.279   36.906 1.00 24.81  ? 17  DT  J O4    1 
ATOM   917   C C5    . DT  B 2 17  ? -33.571 0.135   34.553 1.00 27.69  ? 17  DT  J C5    1 
ATOM   918   C C7    . DT  B 2 17  ? -33.650 1.613   34.269 1.00 26.30  ? 17  DT  J C7    1 
ATOM   919   C C6    . DT  B 2 17  ? -33.547 -0.758  33.551 1.00 30.50  ? 17  DT  J C6    1 
ATOM   920   P P     . DT  B 2 18  ? -35.416 -5.424  29.663 1.00 48.43  ? 18  DT  J P     1 
ATOM   921   O OP1   . DT  B 2 18  ? -35.171 -6.493  28.687 1.00 49.44  ? 18  DT  J OP1   1 
ATOM   922   O OP2   . DT  B 2 18  ? -36.334 -4.290  29.349 1.00 49.11  ? 18  DT  J OP2   1 
ATOM   923   O "O5'" . DT  B 2 18  ? -35.942 -6.077  31.029 1.00 46.72  ? 18  DT  J "O5'" 1 
ATOM   924   C "C5'" . DT  B 2 18  ? -35.107 -6.938  31.790 1.00 46.06  ? 18  DT  J "C5'" 1 
ATOM   925   C "C4'" . DT  B 2 18  ? -35.823 -7.395  33.051 1.00 44.70  ? 18  DT  J "C4'" 1 
ATOM   926   O "O4'" . DT  B 2 18  ? -35.781 -6.304  33.987 1.00 42.35  ? 18  DT  J "O4'" 1 
ATOM   927   C "C3'" . DT  B 2 18  ? -37.305 -7.729  32.893 1.00 45.93  ? 18  DT  J "C3'" 1 
ATOM   928   O "O3'" . DT  B 2 18  ? -37.532 -9.050  33.440 1.00 45.76  ? 18  DT  J "O3'" 1 
ATOM   929   C "C2'" . DT  B 2 18  ? -38.073 -6.569  33.570 1.00 41.35  ? 18  DT  J "C2'" 1 
ATOM   930   C "C1'" . DT  B 2 18  ? -37.043 -6.061  34.567 1.00 39.34  ? 18  DT  J "C1'" 1 
ATOM   931   N N1    . DT  B 2 18  ? -36.974 -4.601  34.924 1.00 36.46  ? 18  DT  J N1    1 
ATOM   932   C C2    . DT  B 2 18  ? -36.701 -4.318  36.242 1.00 35.81  ? 18  DT  J C2    1 
ATOM   933   O O2    . DT  B 2 18  ? -36.554 -5.164  37.100 1.00 37.51  ? 18  DT  J O2    1 
ATOM   934   N N3    . DT  B 2 18  ? -36.644 -2.994  36.558 1.00 33.47  ? 18  DT  J N3    1 
ATOM   935   C C4    . DT  B 2 18  ? -36.782 -1.933  35.700 1.00 32.67  ? 18  DT  J C4    1 
ATOM   936   O O4    . DT  B 2 18  ? -36.671 -0.792  36.132 1.00 31.45  ? 18  DT  J O4    1 
ATOM   937   C C5    . DT  B 2 18  ? -37.046 -2.278  34.306 1.00 34.31  ? 18  DT  J C5    1 
ATOM   938   C C7    . DT  B 2 18  ? -37.235 -1.197  33.267 1.00 32.32  ? 18  DT  J C7    1 
ATOM   939   C C6    . DT  B 2 18  ? -37.133 -3.587  33.994 1.00 34.59  ? 18  DT  J C6    1 
ATOM   940   P P     . DA  B 2 19  ? -39.027 -9.643  33.563 1.00 48.19  ? 19  DA  J P     1 
ATOM   941   O OP1   . DA  B 2 19  ? -38.820 -11.113 33.602 1.00 53.08  ? 19  DA  J OP1   1 
ATOM   942   O OP2   . DA  B 2 19  ? -39.979 -9.040  32.598 1.00 45.68  ? 19  DA  J OP2   1 
ATOM   943   O "O5'" . DA  B 2 19  ? -39.514 -9.174  35.011 1.00 46.24  ? 19  DA  J "O5'" 1 
ATOM   944   C "C5'" . DA  B 2 19  ? -38.742 -9.487  36.152 1.00 45.80  ? 19  DA  J "C5'" 1 
ATOM   945   C "C4'" . DA  B 2 19  ? -39.338 -8.768  37.336 1.00 45.22  ? 19  DA  J "C4'" 1 
ATOM   946   O "O4'" . DA  B 2 19  ? -39.091 -7.348  37.190 1.00 43.96  ? 19  DA  J "O4'" 1 
ATOM   947   C "C3'" . DA  B 2 19  ? -40.853 -8.929  37.481 1.00 46.27  ? 19  DA  J "C3'" 1 
ATOM   948   O "O3'" . DA  B 2 19  ? -41.093 -9.686  38.680 1.00 46.45  ? 19  DA  J "O3'" 1 
ATOM   949   C "C2'" . DA  B 2 19  ? -41.387 -7.488  37.513 1.00 43.92  ? 19  DA  J "C2'" 1 
ATOM   950   C "C1'" . DA  B 2 19  ? -40.134 -6.689  37.872 1.00 42.51  ? 19  DA  J "C1'" 1 
ATOM   951   N N9    . DA  B 2 19  ? -40.160 -5.311  37.398 1.00 39.91  ? 19  DA  J N9    1 
ATOM   952   C C8    . DA  B 2 19  ? -40.347 -4.911  36.108 1.00 39.34  ? 19  DA  J C8    1 
ATOM   953   N N7    . DA  B 2 19  ? -40.325 -3.613  35.946 1.00 38.48  ? 19  DA  J N7    1 
ATOM   954   C C5    . DA  B 2 19  ? -40.121 -3.129  37.221 1.00 37.22  ? 19  DA  J C5    1 
ATOM   955   C C6    . DA  B 2 19  ? -40.013 -1.816  37.718 1.00 36.28  ? 19  DA  J C6    1 
ATOM   956   N N6    . DA  B 2 19  ? -40.096 -0.739  36.932 1.00 35.66  ? 19  DA  J N6    1 
ATOM   957   N N1    . DA  B 2 19  ? -39.813 -1.663  39.050 1.00 36.06  ? 19  DA  J N1    1 
ATOM   958   C C2    . DA  B 2 19  ? -39.724 -2.757  39.819 1.00 36.49  ? 19  DA  J C2    1 
ATOM   959   N N3    . DA  B 2 19  ? -39.816 -4.041  39.466 1.00 37.71  ? 19  DA  J N3    1 
ATOM   960   C C4    . DA  B 2 19  ? -40.015 -4.161  38.137 1.00 38.18  ? 19  DA  J C4    1 
ATOM   961   P P     . DC  B 2 20  ? -42.524 -9.771  39.404 1.00 48.71  ? 20  DC  J P     1 
ATOM   962   O OP1   . DC  B 2 20  ? -42.442 -10.990 40.247 1.00 49.76  ? 20  DC  J OP1   1 
ATOM   963   O OP2   . DC  B 2 20  ? -43.649 -9.568  38.452 1.00 45.94  ? 20  DC  J OP2   1 
ATOM   964   O "O5'" . DC  B 2 20  ? -42.526 -8.451  40.331 1.00 43.60  ? 20  DC  J "O5'" 1 
ATOM   965   C "C5'" . DC  B 2 20  ? -41.665 -8.312  41.450 1.00 38.55  ? 20  DC  J "C5'" 1 
ATOM   966   C "C4'" . DC  B 2 20  ? -42.008 -7.057  42.227 1.00 35.96  ? 20  DC  J "C4'" 1 
ATOM   967   O "O4'" . DC  B 2 20  ? -41.895 -5.938  41.323 1.00 35.19  ? 20  DC  J "O4'" 1 
ATOM   968   C "C3'" . DC  B 2 20  ? -43.432 -6.948  42.761 1.00 36.68  ? 20  DC  J "C3'" 1 
ATOM   969   O "O3'" . DC  B 2 20  ? -43.417 -6.509  44.114 1.00 36.89  ? 20  DC  J "O3'" 1 
ATOM   970   C "C2'" . DC  B 2 20  ? -44.125 -5.937  41.850 1.00 33.21  ? 20  DC  J "C2'" 1 
ATOM   971   C "C1'" . DC  B 2 20  ? -42.941 -5.035  41.547 1.00 33.44  ? 20  DC  J "C1'" 1 
ATOM   972   N N1    . DC  B 2 20  ? -43.061 -4.112  40.347 1.00 33.11  ? 20  DC  J N1    1 
ATOM   973   C C2    . DC  B 2 20  ? -42.958 -2.725  40.577 1.00 32.55  ? 20  DC  J C2    1 
ATOM   974   O O2    . DC  B 2 20  ? -42.761 -2.359  41.730 1.00 34.13  ? 20  DC  J O2    1 
ATOM   975   N N3    . DC  B 2 20  ? -43.050 -1.842  39.543 1.00 31.61  ? 20  DC  J N3    1 
ATOM   976   C C4    . DC  B 2 20  ? -43.269 -2.346  38.308 1.00 32.06  ? 20  DC  J C4    1 
ATOM   977   N N4    . DC  B 2 20  ? -43.365 -1.485  37.301 1.00 29.76  ? 20  DC  J N4    1 
ATOM   978   C C5    . DC  B 2 20  ? -43.400 -3.757  38.039 1.00 30.76  ? 20  DC  J C5    1 
ATOM   979   C C6    . DC  B 2 20  ? -43.287 -4.596  39.080 1.00 30.96  ? 20  DC  J C6    1 
ATOM   980   P P     . DA  B 2 21  ? -44.637 -6.886  45.067 1.00 38.23  ? 21  DA  J P     1 
ATOM   981   O OP1   . DA  B 2 21  ? -44.159 -6.874  46.471 1.00 40.16  ? 21  DA  J OP1   1 
ATOM   982   O OP2   . DA  B 2 21  ? -45.209 -8.134  44.502 1.00 37.55  ? 21  DA  J OP2   1 
ATOM   983   O "O5'" . DA  B 2 21  ? -45.663 -5.661  44.855 1.00 35.62  ? 21  DA  J "O5'" 1 
ATOM   984   C "C5'" . DA  B 2 21  ? -45.273 -4.370  45.262 1.00 36.59  ? 21  DA  J "C5'" 1 
ATOM   985   C "C4'" . DA  B 2 21  ? -46.211 -3.272  44.780 1.00 36.75  ? 21  DA  J "C4'" 1 
ATOM   986   O "O4'" . DA  B 2 21  ? -45.697 -2.731  43.537 1.00 35.25  ? 21  DA  J "O4'" 1 
ATOM   987   C "C3'" . DA  B 2 21  ? -47.657 -3.676  44.482 1.00 37.63  ? 21  DA  J "C3'" 1 
ATOM   988   O "O3'" . DA  B 2 21  ? -48.541 -3.311  45.580 1.00 36.64  ? 21  DA  J "O3'" 1 
ATOM   989   C "C2'" . DA  B 2 21  ? -47.957 -2.908  43.191 1.00 36.57  ? 21  DA  J "C2'" 1 
ATOM   990   C "C1'" . DA  B 2 21  ? -46.746 -1.999  42.998 1.00 34.74  ? 21  DA  J "C1'" 1 
ATOM   991   N N9    . DA  B 2 21  ? -46.545 -1.720  41.582 1.00 33.82  ? 21  DA  J N9    1 
ATOM   992   C C8    . DA  B 2 21  ? -46.416 -2.632  40.590 1.00 32.69  ? 21  DA  J C8    1 
ATOM   993   N N7    . DA  B 2 21  ? -46.295 -2.089  39.410 1.00 32.28  ? 21  DA  J N7    1 
ATOM   994   C C5    . DA  B 2 21  ? -46.364 -0.745  39.633 1.00 31.10  ? 21  DA  J C5    1 
ATOM   995   C C6    . DA  B 2 21  ? -46.287 0.349   38.760 1.00 33.47  ? 21  DA  J C6    1 
ATOM   996   N N6    . DA  B 2 21  ? -46.118 0.192   37.440 1.00 31.63  ? 21  DA  J N6    1 
ATOM   997   N N1    . DA  B 2 21  ? -46.374 1.599   39.298 1.00 34.32  ? 21  DA  J N1    1 
ATOM   998   C C2    . DA  B 2 21  ? -46.525 1.707   40.627 1.00 34.07  ? 21  DA  J C2    1 
ATOM   999   N N3    . DA  B 2 21  ? -46.598 0.728   41.546 1.00 33.69  ? 21  DA  J N3    1 
ATOM   1000  C C4    . DA  B 2 21  ? -46.516 -0.484  40.969 1.00 32.62  ? 21  DA  J C4    1 
ATOM   1001  P P     . DT  B 2 22  ? -50.137 -3.357  45.528 1.00 35.34  ? 22  DT  J P     1 
ATOM   1002  O OP1   . DT  B 2 22  ? -50.597 -3.562  46.910 1.00 37.96  ? 22  DT  J OP1   1 
ATOM   1003  O OP2   . DT  B 2 22  ? -50.636 -4.219  44.429 1.00 35.64  ? 22  DT  J OP2   1 
ATOM   1004  O "O5'" . DT  B 2 22  ? -50.538 -1.889  45.041 1.00 37.33  ? 22  DT  J "O5'" 1 
ATOM   1005  C "C5'" . DT  B 2 22  ? -49.923 -0.712  45.486 1.00 36.58  ? 22  DT  J "C5'" 1 
ATOM   1006  C "C4'" . DT  B 2 22  ? -50.541 0.473   44.764 1.00 37.46  ? 22  DT  J "C4'" 1 
ATOM   1007  O "O4'" . DT  B 2 22  ? -49.923 0.511   43.468 1.00 36.62  ? 22  DT  J "O4'" 1 
ATOM   1008  C "C3'" . DT  B 2 22  ? -52.049 0.450   44.500 1.00 39.42  ? 22  DT  J "C3'" 1 
ATOM   1009  O "O3'" . DT  B 2 22  ? -52.701 1.373   45.377 1.00 41.93  ? 22  DT  J "O3'" 1 
ATOM   1010  C "C2'" . DT  B 2 22  ? -52.207 0.850   43.024 1.00 38.11  ? 22  DT  J "C2'" 1 
ATOM   1011  C "C1'" . DT  B 2 22  ? -50.773 1.221   42.603 1.00 36.99  ? 22  DT  J "C1'" 1 
ATOM   1012  N N1    . DT  B 2 22  ? -50.425 0.912   41.166 1.00 34.41  ? 22  DT  J N1    1 
ATOM   1013  C C2    . DT  B 2 22  ? -50.227 1.940   40.270 1.00 35.68  ? 22  DT  J C2    1 
ATOM   1014  O O2    . DT  B 2 22  ? -50.314 3.124   40.536 1.00 36.70  ? 22  DT  J O2    1 
ATOM   1015  N N3    . DT  B 2 22  ? -49.948 1.546   38.985 1.00 36.36  ? 22  DT  J N3    1 
ATOM   1016  C C4    . DT  B 2 22  ? -49.841 0.266   38.500 1.00 35.82  ? 22  DT  J C4    1 
ATOM   1017  O O4    . DT  B 2 22  ? -49.566 0.062   37.329 1.00 36.82  ? 22  DT  J O4    1 
ATOM   1018  C C5    . DT  B 2 22  ? -50.057 -0.782  39.480 1.00 35.41  ? 22  DT  J C5    1 
ATOM   1019  C C7    . DT  B 2 22  ? -49.967 -2.227  39.091 1.00 31.31  ? 22  DT  J C7    1 
ATOM   1020  C C6    . DT  B 2 22  ? -50.336 -0.403  40.747 1.00 35.33  ? 22  DT  J C6    1 
ATOM   1021  P P     . DG  B 2 23  ? -54.286 1.353   45.629 1.00 44.86  ? 23  DG  J P     1 
ATOM   1022  O OP1   . DG  B 2 23  ? -54.540 2.067   46.901 1.00 43.94  ? 23  DG  J OP1   1 
ATOM   1023  O OP2   . DG  B 2 23  ? -54.806 -0.019  45.406 1.00 45.44  ? 23  DG  J OP2   1 
ATOM   1024  O "O5'" . DG  B 2 23  ? -54.838 2.232   44.436 1.00 45.59  ? 23  DG  J "O5'" 1 
ATOM   1025  C "C5'" . DG  B 2 23  ? -54.573 3.643   44.463 1.00 46.74  ? 23  DG  J "C5'" 1 
ATOM   1026  C "C4'" . DG  B 2 23  ? -54.870 4.193   43.089 1.00 45.87  ? 23  DG  J "C4'" 1 
ATOM   1027  O "O4'" . DG  B 2 23  ? -53.975 3.584   42.119 1.00 44.02  ? 23  DG  J "O4'" 1 
ATOM   1028  C "C3'" . DG  B 2 23  ? -56.281 3.866   42.623 1.00 46.20  ? 23  DG  J "C3'" 1 
ATOM   1029  O "O3'" . DG  B 2 23  ? -57.032 5.064   42.723 1.00 48.52  ? 23  DG  J "O3'" 1 
ATOM   1030  C "C2'" . DG  B 2 23  ? -56.063 3.342   41.203 1.00 45.06  ? 23  DG  J "C2'" 1 
ATOM   1031  C "C1'" . DG  B 2 23  ? -54.631 3.789   40.906 1.00 43.75  ? 23  DG  J "C1'" 1 
ATOM   1032  N N9    . DG  B 2 23  ? -54.057 3.035   39.804 1.00 42.08  ? 23  DG  J N9    1 
ATOM   1033  C C8    . DG  B 2 23  ? -53.793 1.686   39.755 1.00 41.96  ? 23  DG  J C8    1 
ATOM   1034  N N7    . DG  B 2 23  ? -53.316 1.292   38.608 1.00 41.25  ? 23  DG  J N7    1 
ATOM   1035  C C5    . DG  B 2 23  ? -53.294 2.447   37.839 1.00 41.00  ? 23  DG  J C5    1 
ATOM   1036  C C6    . DG  B 2 23  ? -52.889 2.639   36.503 1.00 40.72  ? 23  DG  J C6    1 
ATOM   1037  O O6    . DG  B 2 23  ? -52.442 1.809   35.707 1.00 39.12  ? 23  DG  J O6    1 
ATOM   1038  N N1    . DG  B 2 23  ? -53.012 3.970   36.109 1.00 43.63  ? 23  DG  J N1    1 
ATOM   1039  C C2    . DG  B 2 23  ? -53.481 4.994   36.894 1.00 44.29  ? 23  DG  J C2    1 
ATOM   1040  N N2    . DG  B 2 23  ? -53.543 6.196   36.310 1.00 45.14  ? 23  DG  J N2    1 
ATOM   1041  N N3    . DG  B 2 23  ? -53.874 4.828   38.156 1.00 44.47  ? 23  DG  J N3    1 
ATOM   1042  C C4    . DG  B 2 23  ? -53.748 3.531   38.560 1.00 42.46  ? 23  DG  J C4    1 
ATOM   1043  P P     . DT  B 2 24  ? -58.306 5.478   41.848 1.00 49.08  ? 24  DT  J P     1 
ATOM   1044  O OP1   . DT  B 2 24  ? -58.873 6.622   42.583 1.00 53.96  ? 24  DT  J OP1   1 
ATOM   1045  O OP2   . DT  B 2 24  ? -59.169 4.343   41.492 1.00 48.10  ? 24  DT  J OP2   1 
ATOM   1046  O "O5'" . DT  B 2 24  ? -57.643 6.038   40.509 1.00 49.76  ? 24  DT  J "O5'" 1 
ATOM   1047  C "C5'" . DT  B 2 24  ? -56.987 7.306   40.506 1.00 48.94  ? 24  DT  J "C5'" 1 
ATOM   1048  C "C4'" . DT  B 2 24  ? -57.124 7.960   39.140 1.00 49.82  ? 24  DT  J "C4'" 1 
ATOM   1049  O "O4'" . DT  B 2 24  ? -56.523 7.154   38.096 1.00 47.36  ? 24  DT  J "O4'" 1 
ATOM   1050  C "C3'" . DT  B 2 24  ? -58.555 8.224   38.682 1.00 51.91  ? 24  DT  J "C3'" 1 
ATOM   1051  O "O3'" . DT  B 2 24  ? -58.574 9.535   38.080 1.00 53.86  ? 24  DT  J "O3'" 1 
ATOM   1052  C "C2'" . DT  B 2 24  ? -58.857 7.050   37.741 1.00 50.09  ? 24  DT  J "C2'" 1 
ATOM   1053  C "C1'" . DT  B 2 24  ? -57.485 6.778   37.121 1.00 49.82  ? 24  DT  J "C1'" 1 
ATOM   1054  N N1    . DT  B 2 24  ? -57.090 5.368   36.614 1.00 50.06  ? 24  DT  J N1    1 
ATOM   1055  C C2    . DT  B 2 24  ? -56.577 5.307   35.330 1.00 50.99  ? 24  DT  J C2    1 
ATOM   1056  O O2    . DT  B 2 24  ? -56.477 6.280   34.612 1.00 54.78  ? 24  DT  J O2    1 
ATOM   1057  N N3    . DT  B 2 24  ? -56.187 4.073   34.893 1.00 49.54  ? 24  DT  J N3    1 
ATOM   1058  C C4    . DT  B 2 24  ? -56.236 2.895   35.608 1.00 48.64  ? 24  DT  J C4    1 
ATOM   1059  O O4    . DT  B 2 24  ? -55.858 1.832   35.102 1.00 49.80  ? 24  DT  J O4    1 
ATOM   1060  C C5    . DT  B 2 24  ? -56.774 2.998   36.953 1.00 47.11  ? 24  DT  J C5    1 
ATOM   1061  C C7    . DT  B 2 24  ? -56.885 1.744   37.793 1.00 45.00  ? 24  DT  J C7    1 
ATOM   1062  C C6    . DT  B 2 24  ? -57.162 4.215   37.398 1.00 47.09  ? 24  DT  J C6    1 
ATOM   1063  P P     . DT  B 2 25  ? -59.896 10.213  37.475 1.00 57.96  ? 25  DT  J P     1 
ATOM   1064  O OP1   . DT  B 2 25  ? -59.825 11.659  37.814 1.00 61.28  ? 25  DT  J OP1   1 
ATOM   1065  O OP2   . DT  B 2 25  ? -61.092 9.402   37.787 1.00 58.12  ? 25  DT  J OP2   1 
ATOM   1066  O "O5'" . DT  B 2 25  ? -59.697 10.028  35.906 1.00 58.36  ? 25  DT  J "O5'" 1 
ATOM   1067  C "C5'" . DT  B 2 25  ? -58.496 10.439  35.276 1.00 58.40  ? 25  DT  J "C5'" 1 
ATOM   1068  C "C4'" . DT  B 2 25  ? -58.602 10.048  33.828 1.00 59.55  ? 25  DT  J "C4'" 1 
ATOM   1069  O "O4'" . DT  B 2 25  ? -58.419 8.617   33.746 1.00 56.26  ? 25  DT  J "O4'" 1 
ATOM   1070  C "C3'" . DT  B 2 25  ? -59.966 10.339  33.206 1.00 62.90  ? 25  DT  J "C3'" 1 
ATOM   1071  O "O3'" . DT  B 2 25  ? -59.754 11.003  31.987 1.00 68.11  ? 25  DT  J "O3'" 1 
ATOM   1072  C "C2'" . DT  B 2 25  ? -60.600 8.971   32.976 1.00 60.72  ? 25  DT  J "C2'" 1 
ATOM   1073  C "C1'" . DT  B 2 25  ? -59.346 8.133   32.798 1.00 57.60  ? 25  DT  J "C1'" 1 
ATOM   1074  N N1    . DT  B 2 25  ? -59.472 6.693   33.053 1.00 54.16  ? 25  DT  J N1    1 
ATOM   1075  C C2    . DT  B 2 25  ? -59.022 5.834   32.076 1.00 54.40  ? 25  DT  J C2    1 
ATOM   1076  O O2    . DT  B 2 25  ? -58.545 6.212   31.019 1.00 56.72  ? 25  DT  J O2    1 
ATOM   1077  N N3    . DT  B 2 25  ? -59.151 4.507   32.388 1.00 52.69  ? 25  DT  J N3    1 
ATOM   1078  C C4    . DT  B 2 25  ? -59.655 3.975   33.564 1.00 50.53  ? 25  DT  J C4    1 
ATOM   1079  O O4    . DT  B 2 25  ? -59.693 2.757   33.725 1.00 48.80  ? 25  DT  J O4    1 
ATOM   1080  C C5    . DT  B 2 25  ? -60.109 4.945   34.548 1.00 50.23  ? 25  DT  J C5    1 
ATOM   1081  C C7    . DT  B 2 25  ? -60.691 4.540   35.873 1.00 49.41  ? 25  DT  J C7    1 
ATOM   1082  C C6    . DT  B 2 25  ? -59.993 6.241   34.247 1.00 52.10  ? 25  DT  J C6    1 
ATOM   1083  P P     . DC  B 2 26  ? -60.922 11.719  31.152 1.00 73.12  ? 26  DC  J P     1 
ATOM   1084  O OP1   . DC  B 2 26  ? -60.394 13.065  30.856 1.00 75.80  ? 26  DC  J OP1   1 
ATOM   1085  O OP2   . DC  B 2 26  ? -62.248 11.536  31.800 1.00 72.24  ? 26  DC  J OP2   1 
ATOM   1086  O "O5'" . DC  B 2 26  ? -60.888 10.856  29.805 1.00 74.39  ? 26  DC  J "O5'" 1 
ATOM   1087  C "C5'" . DC  B 2 26  ? -59.623 10.376  29.305 1.00 74.42  ? 26  DC  J "C5'" 1 
ATOM   1088  C "C4'" . DC  B 2 26  ? -59.796 9.427   28.129 1.00 76.66  ? 26  DC  J "C4'" 1 
ATOM   1089  O "O4'" . DC  B 2 26  ? -59.889 8.049   28.576 1.00 73.50  ? 26  DC  J "O4'" 1 
ATOM   1090  C "C3'" . DC  B 2 26  ? -61.044 9.661   27.287 1.00 81.91  ? 26  DC  J "C3'" 1 
ATOM   1091  O "O3'" . DC  B 2 26  ? -60.654 9.477   25.944 1.00 86.61  ? 26  DC  J "O3'" 1 
ATOM   1092  C "C2'" . DC  B 2 26  ? -62.044 8.603   27.765 1.00 79.09  ? 26  DC  J "C2'" 1 
ATOM   1093  C "C1'" . DC  B 2 26  ? -61.093 7.458   28.127 1.00 74.68  ? 26  DC  J "C1'" 1 
ATOM   1094  N N1    . DC  B 2 26  ? -61.537 6.523   29.209 1.00 70.60  ? 26  DC  J N1    1 
ATOM   1095  C C2    . DC  B 2 26  ? -61.250 5.152   29.082 1.00 68.82  ? 26  DC  J C2    1 
ATOM   1096  O O2    . DC  B 2 26  ? -60.645 4.741   28.080 1.00 69.10  ? 26  DC  J O2    1 
ATOM   1097  N N3    . DC  B 2 26  ? -61.649 4.305   30.070 1.00 66.50  ? 26  DC  J N3    1 
ATOM   1098  C C4    . DC  B 2 26  ? -62.292 4.778   31.148 1.00 66.14  ? 26  DC  J C4    1 
ATOM   1099  N N4    . DC  B 2 26  ? -62.652 3.902   32.093 1.00 64.23  ? 26  DC  J N4    1 
ATOM   1100  C C5    . DC  B 2 26  ? -62.599 6.170   31.299 1.00 67.56  ? 26  DC  J C5    1 
ATOM   1101  C C6    . DC  B 2 26  ? -62.199 6.995   30.315 1.00 69.84  ? 26  DC  J C6    1 
ATOM   1102  P P     . DC  B 2 27  ? -61.543 10.030  24.737 1.00 93.72  ? 27  DC  J P     1 
ATOM   1103  O OP1   . DC  B 2 27  ? -60.548 10.598  23.794 1.00 95.72  ? 27  DC  J OP1   1 
ATOM   1104  O OP2   . DC  B 2 27  ? -62.678 10.836  25.259 1.00 94.31  ? 27  DC  J OP2   1 
ATOM   1105  O "O5'" . DC  B 2 27  ? -62.185 8.690   24.126 1.00 93.52  ? 27  DC  J "O5'" 1 
ATOM   1106  C "C5'" . DC  B 2 27  ? -61.354 7.539   23.897 1.00 91.17  ? 27  DC  J "C5'" 1 
ATOM   1107  C "C4'" . DC  B 2 27  ? -62.167 6.269   23.692 1.00 90.56  ? 27  DC  J "C4'" 1 
ATOM   1108  O "O4'" . DC  B 2 27  ? -62.397 5.607   24.964 1.00 85.51  ? 27  DC  J "O4'" 1 
ATOM   1109  C "C3'" . DC  B 2 27  ? -63.537 6.450   23.043 1.00 94.93  ? 27  DC  J "C3'" 1 
ATOM   1110  O "O3'" . DC  B 2 27  ? -63.585 5.595   21.904 1.00 99.50  ? 27  DC  J "O3'" 1 
ATOM   1111  C "C2'" . DC  B 2 27  ? -64.532 6.047   24.138 1.00 90.81  ? 27  DC  J "C2'" 1 
ATOM   1112  C "C1'" . DC  B 2 27  ? -63.700 5.069   24.963 1.00 84.95  ? 27  DC  J "C1'" 1 
ATOM   1113  N N1    . DC  B 2 27  ? -64.135 4.792   26.387 1.00 79.41  ? 27  DC  J N1    1 
ATOM   1114  C C2    . DC  B 2 27  ? -63.957 3.493   26.888 1.00 76.28  ? 27  DC  J C2    1 
ATOM   1115  O O2    . DC  B 2 27  ? -63.457 2.633   26.154 1.00 76.78  ? 27  DC  J O2    1 
ATOM   1116  N N3    . DC  B 2 27  ? -64.340 3.198   28.162 1.00 72.92  ? 27  DC  J N3    1 
ATOM   1117  C C4    . DC  B 2 27  ? -64.883 4.147   28.933 1.00 73.05  ? 27  DC  J C4    1 
ATOM   1118  N N4    . DC  B 2 27  ? -65.237 3.806   30.182 1.00 69.32  ? 27  DC  J N4    1 
ATOM   1119  C C5    . DC  B 2 27  ? -65.074 5.486   28.447 1.00 75.45  ? 27  DC  J C5    1 
ATOM   1120  C C6    . DC  B 2 27  ? -64.688 5.760   27.187 1.00 78.41  ? 27  DC  J C6    1 
ATOM   1121  P P     . DG  B 2 28  ? -64.523 5.853   20.624 1.00 107.09 ? 28  DG  J P     1 
ATOM   1122  O OP1   . DG  B 2 28  ? -63.629 6.248   19.511 1.00 110.46 ? 28  DG  J OP1   1 
ATOM   1123  O OP2   . DG  B 2 28  ? -65.691 6.692   20.999 1.00 107.34 ? 28  DG  J OP2   1 
ATOM   1124  O "O5'" . DG  B 2 28  ? -65.068 4.372   20.321 1.00 107.68 ? 28  DG  J "O5'" 1 
ATOM   1125  C "C5'" . DG  B 2 28  ? -64.225 3.204   20.496 1.00 103.40 ? 28  DG  J "C5'" 1 
ATOM   1126  C "C4'" . DG  B 2 28  ? -65.009 2.056   21.116 1.00 100.54 ? 28  DG  J "C4'" 1 
ATOM   1127  O "O4'" . DG  B 2 28  ? -65.115 2.276   22.550 1.00 95.03  ? 28  DG  J "O4'" 1 
ATOM   1128  C "C3'" . DG  B 2 28  ? -66.440 1.897   20.587 1.00 104.02 ? 28  DG  J "C3'" 1 
ATOM   1129  O "O3'" . DG  B 2 28  ? -66.657 0.591   20.057 1.00 106.61 ? 28  DG  J "O3'" 1 
ATOM   1130  C "C2'" . DG  B 2 28  ? -67.322 2.135   21.805 1.00 100.08 ? 28  DG  J "C2'" 1 
ATOM   1131  C "C1'" . DG  B 2 28  ? -66.383 1.825   22.965 1.00 94.04  ? 28  DG  J "C1'" 1 
ATOM   1132  N N9    . DG  B 2 28  ? -66.813 2.481   24.199 1.00 89.56  ? 28  DG  J N9    1 
ATOM   1133  C C8    . DG  B 2 28  ? -67.145 3.804   24.363 1.00 90.01  ? 28  DG  J C8    1 
ATOM   1134  N N7    . DG  B 2 28  ? -67.517 4.108   25.575 1.00 86.78  ? 28  DG  J N7    1 
ATOM   1135  C C5    . DG  B 2 28  ? -67.439 2.909   26.263 1.00 83.57  ? 28  DG  J C5    1 
ATOM   1136  C C6    . DG  B 2 28  ? -67.726 2.620   27.622 1.00 80.22  ? 28  DG  J C6    1 
ATOM   1137  O O6    . DG  B 2 28  ? -68.117 3.403   28.506 1.00 78.50  ? 28  DG  J O6    1 
ATOM   1138  N N1    . DG  B 2 28  ? -67.513 1.265   27.913 1.00 78.48  ? 28  DG  J N1    1 
ATOM   1139  C C2    . DG  B 2 28  ? -67.079 0.316   27.004 1.00 79.08  ? 28  DG  J C2    1 
ATOM   1140  N N2    . DG  B 2 28  ? -66.930 -0.940  27.454 1.00 75.92  ? 28  DG  J N2    1 
ATOM   1141  N N3    . DG  B 2 28  ? -66.805 0.587   25.733 1.00 82.45  ? 28  DG  J N3    1 
ATOM   1142  C C4    . DG  B 2 28  ? -67.007 1.896   25.430 1.00 84.93  ? 28  DG  J C4    1 
ATOM   1143  O "O5'" . DC  C 1 1   ? 105.330 28.964  22.165 1.00 133.06 ? 1   DC  M "O5'" 1 
ATOM   1144  C "C5'" . DC  C 1 1   ? 104.202 28.320  21.582 1.00 133.42 ? 1   DC  M "C5'" 1 
ATOM   1145  C "C4'" . DC  C 1 1   ? 103.411 27.606  22.662 1.00 128.14 ? 1   DC  M "C4'" 1 
ATOM   1146  O "O4'" . DC  C 1 1   ? 103.110 28.543  23.726 1.00 124.11 ? 1   DC  M "O4'" 1 
ATOM   1147  C "C3'" . DC  C 1 1   ? 102.075 27.007  22.231 1.00 126.78 ? 1   DC  M "C3'" 1 
ATOM   1148  O "O3'" . DC  C 1 1   ? 102.026 25.642  22.658 1.00 126.30 ? 1   DC  M "O3'" 1 
ATOM   1149  C "C2'" . DC  C 1 1   ? 101.031 27.877  22.936 1.00 121.61 ? 1   DC  M "C2'" 1 
ATOM   1150  C "C1'" . DC  C 1 1   ? 101.801 28.309  24.183 1.00 119.32 ? 1   DC  M "C1'" 1 
ATOM   1151  N N1    . DC  C 1 1   ? 101.280 29.534  24.900 1.00 115.94 ? 1   DC  M N1    1 
ATOM   1152  C C2    . DC  C 1 1   ? 100.918 29.442  26.263 1.00 111.83 ? 1   DC  M C2    1 
ATOM   1153  O O2    . DC  C 1 1   ? 101.028 28.369  26.877 1.00 110.03 ? 1   DC  M O2    1 
ATOM   1154  N N3    . DC  C 1 1   ? 100.448 30.547  26.898 1.00 109.83 ? 1   DC  M N3    1 
ATOM   1155  C C4    . DC  C 1 1   ? 100.333 31.701  26.235 1.00 112.36 ? 1   DC  M C4    1 
ATOM   1156  N N4    . DC  C 1 1   ? 99.861  32.754  26.911 1.00 111.32 ? 1   DC  M N4    1 
ATOM   1157  C C5    . DC  C 1 1   ? 100.689 31.819  24.852 1.00 116.22 ? 1   DC  M C5    1 
ATOM   1158  C C6    . DC  C 1 1   ? 101.154 30.724  24.232 1.00 117.50 ? 1   DC  M C6    1 
ATOM   1159  P P     . DG  C 1 2   ? 101.028 24.581  21.991 1.00 127.00 ? 2   DG  M P     1 
ATOM   1160  O OP1   . DG  C 1 2   ? 101.698 23.264  21.945 1.00 130.24 ? 2   DG  M OP1   1 
ATOM   1161  O OP2   . DG  C 1 2   ? 100.459 25.165  20.760 1.00 130.17 ? 2   DG  M OP2   1 
ATOM   1162  O "O5'" . DG  C 1 2   ? 99.859  24.497  23.063 1.00 122.46 ? 2   DG  M "O5'" 1 
ATOM   1163  C "C5'" . DG  C 1 2   ? 100.133 24.012  24.378 1.00 121.72 ? 2   DG  M "C5'" 1 
ATOM   1164  C "C4'" . DG  C 1 2   ? 98.996  24.400  25.308 1.00 116.92 ? 2   DG  M "C4'" 1 
ATOM   1165  O "O4'" . DG  C 1 2   ? 98.988  25.828  25.474 1.00 114.81 ? 2   DG  M "O4'" 1 
ATOM   1166  C "C3'" . DG  C 1 2   ? 97.610  24.063  24.796 1.00 116.07 ? 2   DG  M "C3'" 1 
ATOM   1167  O "O3'" . DG  C 1 2   ? 97.275  22.848  25.428 1.00 116.81 ? 2   DG  M "O3'" 1 
ATOM   1168  C "C2'" . DG  C 1 2   ? 96.749  25.245  25.252 1.00 112.03 ? 2   DG  M "C2'" 1 
ATOM   1169  C "C1'" . DG  C 1 2   ? 97.729  26.190  25.944 1.00 111.14 ? 2   DG  M "C1'" 1 
ATOM   1170  N N9    . DG  C 1 2   ? 97.582  27.596  25.603 1.00 111.08 ? 2   DG  M N9    1 
ATOM   1171  C C8    . DG  C 1 2   ? 97.726  28.179  24.365 1.00 114.73 ? 2   DG  M C8    1 
ATOM   1172  N N7    . DG  C 1 2   ? 97.536  29.470  24.368 1.00 114.61 ? 2   DG  M N7    1 
ATOM   1173  C C5    . DG  C 1 2   ? 97.254  29.761  25.699 1.00 111.22 ? 2   DG  M C5    1 
ATOM   1174  C C6    . DG  C 1 2   ? 96.961  31.000  26.328 1.00 110.55 ? 2   DG  M C6    1 
ATOM   1175  O O6    . DG  C 1 2   ? 96.885  32.124  25.812 1.00 112.77 ? 2   DG  M O6    1 
ATOM   1176  N N1    . DG  C 1 2   ? 96.733  30.854  27.700 1.00 107.77 ? 2   DG  M N1    1 
ATOM   1177  C C2    . DG  C 1 2   ? 96.790  29.653  28.375 1.00 106.20 ? 2   DG  M C2    1 
ATOM   1178  N N2    . DG  C 1 2   ? 96.552  29.693  29.692 1.00 105.29 ? 2   DG  M N2    1 
ATOM   1179  N N3    . DG  C 1 2   ? 97.065  28.488  27.800 1.00 106.48 ? 2   DG  M N3    1 
ATOM   1180  C C4    . DG  C 1 2   ? 97.283  28.616  26.468 1.00 108.92 ? 2   DG  M C4    1 
ATOM   1181  P P     . DG  C 1 3   ? 95.896  22.060  25.224 1.00 117.79 ? 3   DG  M P     1 
ATOM   1182  O OP1   . DG  C 1 3   ? 96.274  20.658  25.540 1.00 119.37 ? 3   DG  M OP1   1 
ATOM   1183  O OP2   . DG  C 1 3   ? 95.215  22.416  23.955 1.00 118.19 ? 3   DG  M OP2   1 
ATOM   1184  O "O5'" . DG  C 1 3   ? 94.944  22.655  26.360 1.00 112.46 ? 3   DG  M "O5'" 1 
ATOM   1185  C "C5'" . DG  C 1 3   ? 95.330  22.598  27.732 1.00 112.34 ? 3   DG  M "C5'" 1 
ATOM   1186  C "C4'" . DG  C 1 3   ? 94.425  23.515  28.523 1.00 108.95 ? 3   DG  M "C4'" 1 
ATOM   1187  O "O4'" . DG  C 1 3   ? 94.736  24.886  28.172 1.00 108.50 ? 3   DG  M "O4'" 1 
ATOM   1188  C "C3'" . DG  C 1 3   ? 92.945  23.307  28.218 1.00 107.88 ? 3   DG  M "C3'" 1 
ATOM   1189  O "O3'" . DG  C 1 3   ? 92.247  23.088  29.439 1.00 107.12 ? 3   DG  M "O3'" 1 
ATOM   1190  C "C2'" . DG  C 1 3   ? 92.527  24.586  27.485 1.00 106.36 ? 3   DG  M "C2'" 1 
ATOM   1191  C "C1'" . DG  C 1 3   ? 93.525  25.594  28.039 1.00 106.38 ? 3   DG  M "C1'" 1 
ATOM   1192  N N9    . DG  C 1 3   ? 93.690  26.769  27.186 1.00 106.67 ? 3   DG  M N9    1 
ATOM   1193  C C8    . DG  C 1 3   ? 93.978  26.808  25.845 1.00 109.17 ? 3   DG  M C8    1 
ATOM   1194  N N7    . DG  C 1 3   ? 94.053  28.018  25.361 1.00 110.36 ? 3   DG  M N7    1 
ATOM   1195  C C5    . DG  C 1 3   ? 93.790  28.839  26.450 1.00 108.16 ? 3   DG  M C5    1 
ATOM   1196  C C6    . DG  C 1 3   ? 93.728  30.255  26.544 1.00 108.60 ? 3   DG  M C6    1 
ATOM   1197  O O6    . DG  C 1 3   ? 93.904  31.091  25.649 1.00 110.40 ? 3   DG  M O6    1 
ATOM   1198  N N1    . DG  C 1 3   ? 93.429  30.682  27.842 1.00 107.18 ? 3   DG  M N1    1 
ATOM   1199  C C2    . DG  C 1 3   ? 93.226  29.836  28.917 1.00 105.59 ? 3   DG  M C2    1 
ATOM   1200  N N2    . DG  C 1 3   ? 92.950  30.409  30.100 1.00 104.98 ? 3   DG  M N2    1 
ATOM   1201  N N3    . DG  C 1 3   ? 93.283  28.508  28.839 1.00 104.65 ? 3   DG  M N3    1 
ATOM   1202  C C4    . DG  C 1 3   ? 93.564  28.080  27.581 1.00 106.06 ? 3   DG  M C4    1 
ATOM   1203  P P     . DA  C 1 4   ? 90.641  23.021  29.500 1.00 105.87 ? 4   DA  M P     1 
ATOM   1204  O OP1   . DA  C 1 4   ? 90.239  21.669  29.048 1.00 107.40 ? 4   DA  M OP1   1 
ATOM   1205  O OP2   . DA  C 1 4   ? 90.052  24.192  28.820 1.00 103.67 ? 4   DA  M OP2   1 
ATOM   1206  O "O5'" . DA  C 1 4   ? 90.384  23.203  31.078 1.00 103.28 ? 4   DA  M "O5'" 1 
ATOM   1207  C "C5'" . DA  C 1 4   ? 91.102  24.196  31.837 1.00 100.99 ? 4   DA  M "C5'" 1 
ATOM   1208  C "C4'" . DA  C 1 4   ? 90.344  25.510  32.045 1.00 97.93  ? 4   DA  M "C4'" 1 
ATOM   1209  O "O4'" . DA  C 1 4   ? 90.723  26.513  31.064 1.00 97.13  ? 4   DA  M "O4'" 1 
ATOM   1210  C "C3'" . DA  C 1 4   ? 88.817  25.457  32.042 1.00 95.55  ? 4   DA  M "C3'" 1 
ATOM   1211  O "O3'" . DA  C 1 4   ? 88.400  26.082  33.246 1.00 95.45  ? 4   DA  M "O3'" 1 
ATOM   1212  C "C2'" . DA  C 1 4   ? 88.412  26.265  30.809 1.00 94.78  ? 4   DA  M "C2'" 1 
ATOM   1213  C "C1'" . DA  C 1 4   ? 89.585  27.227  30.628 1.00 96.09  ? 4   DA  M "C1'" 1 
ATOM   1214  N N9    . DA  C 1 4   ? 89.840  27.688  29.253 1.00 96.96  ? 4   DA  M N9    1 
ATOM   1215  C C8    . DA  C 1 4   ? 90.035  26.911  28.144 1.00 97.64  ? 4   DA  M C8    1 
ATOM   1216  N N7    . DA  C 1 4   ? 90.260  27.577  27.039 1.00 99.24  ? 4   DA  M N7    1 
ATOM   1217  C C5    . DA  C 1 4   ? 90.219  28.898  27.444 1.00 99.29  ? 4   DA  M C5    1 
ATOM   1218  C C6    . DA  C 1 4   ? 90.378  30.113  26.738 1.00 101.40 ? 4   DA  M C6    1 
ATOM   1219  N N6    . DA  C 1 4   ? 90.627  30.171  25.428 1.00 103.20 ? 4   DA  M N6    1 
ATOM   1220  N N1    . DA  C 1 4   ? 90.278  31.269  27.434 1.00 101.60 ? 4   DA  M N1    1 
ATOM   1221  C C2    . DA  C 1 4   ? 90.033  31.208  28.752 1.00 99.82  ? 4   DA  M C2    1 
ATOM   1222  N N3    . DA  C 1 4   ? 89.859  30.126  29.520 1.00 97.77  ? 4   DA  M N3    1 
ATOM   1223  C C4    . DA  C 1 4   ? 89.963  28.989  28.803 1.00 97.62  ? 4   DA  M C4    1 
ATOM   1224  P P     . DA  C 1 5   ? 86.926  25.969  33.848 1.00 94.46  ? 5   DA  M P     1 
ATOM   1225  O OP1   . DA  C 1 5   ? 87.059  26.007  35.330 1.00 95.62  ? 5   DA  M OP1   1 
ATOM   1226  O OP2   . DA  C 1 5   ? 86.249  24.829  33.195 1.00 93.49  ? 5   DA  M OP2   1 
ATOM   1227  O "O5'" . DA  C 1 5   ? 86.238  27.323  33.340 1.00 93.08  ? 5   DA  M "O5'" 1 
ATOM   1228  C "C5'" . DA  C 1 5   ? 86.618  28.562  33.937 1.00 94.22  ? 5   DA  M "C5'" 1 
ATOM   1229  C "C4'" . DA  C 1 5   ? 86.378  29.736  33.009 1.00 94.29  ? 5   DA  M "C4'" 1 
ATOM   1230  O "O4'" . DA  C 1 5   ? 86.959  29.457  31.711 1.00 93.88  ? 5   DA  M "O4'" 1 
ATOM   1231  C "C3'" . DA  C 1 5   ? 84.904  30.079  32.771 1.00 93.15  ? 5   DA  M "C3'" 1 
ATOM   1232  O "O3'" . DA  C 1 5   ? 84.654  31.408  33.227 1.00 95.31  ? 5   DA  M "O3'" 1 
ATOM   1233  C "C2'" . DA  C 1 5   ? 84.723  29.942  31.262 1.00 92.00  ? 5   DA  M "C2'" 1 
ATOM   1234  C "C1'" . DA  C 1 5   ? 86.151  30.113  30.762 1.00 93.84  ? 5   DA  M "C1'" 1 
ATOM   1235  N N9    . DA  C 1 5   ? 86.372  29.565  29.428 1.00 93.87  ? 5   DA  M N9    1 
ATOM   1236  C C8    . DA  C 1 5   ? 86.293  28.259  29.021 1.00 93.29  ? 5   DA  M C8    1 
ATOM   1237  N N7    . DA  C 1 5   ? 86.538  28.070  27.744 1.00 93.75  ? 5   DA  M N7    1 
ATOM   1238  C C5    . DA  C 1 5   ? 86.790  29.348  27.286 1.00 96.07  ? 5   DA  M C5    1 
ATOM   1239  C C6    . DA  C 1 5   ? 87.115  29.836  26.009 1.00 99.30  ? 5   DA  M C6    1 
ATOM   1240  N N6    . DA  C 1 5   ? 87.243  29.040  24.943 1.00 100.53 ? 5   DA  M N6    1 
ATOM   1241  N N1    . DA  C 1 5   ? 87.301  31.173  25.882 1.00 102.04 ? 5   DA  M N1    1 
ATOM   1242  C C2    . DA  C 1 5   ? 87.174  31.960  26.966 1.00 101.20 ? 5   DA  M C2    1 
ATOM   1243  N N3    . DA  C 1 5   ? 86.875  31.613  28.221 1.00 97.83  ? 5   DA  M N3    1 
ATOM   1244  C C4    . DA  C 1 5   ? 86.693  30.283  28.306 1.00 95.76  ? 5   DA  M C4    1 
ATOM   1245  P P     . DC  C 1 6   ? 83.197  32.077  33.262 1.00 96.86  ? 6   DC  M P     1 
ATOM   1246  O OP1   . DC  C 1 6   ? 83.127  32.958  34.451 1.00 98.75  ? 6   DC  M OP1   1 
ATOM   1247  O OP2   . DC  C 1 6   ? 82.154  31.045  33.039 1.00 93.48  ? 6   DC  M OP2   1 
ATOM   1248  O "O5'" . DC  C 1 6   ? 83.239  32.985  31.948 1.00 98.46  ? 6   DC  M "O5'" 1 
ATOM   1249  C "C5'" . DC  C 1 6   ? 83.987  34.196  31.906 1.00 100.81 ? 6   DC  M "C5'" 1 
ATOM   1250  C "C4'" . DC  C 1 6   ? 83.841  34.831  30.535 1.00 101.75 ? 6   DC  M "C4'" 1 
ATOM   1251  O "O4'" . DC  C 1 6   ? 84.300  33.891  29.536 1.00 100.33 ? 6   DC  M "O4'" 1 
ATOM   1252  C "C3'" . DC  C 1 6   ? 82.426  35.235  30.134 1.00 101.57 ? 6   DC  M "C3'" 1 
ATOM   1253  O "O3'" . DC  C 1 6   ? 82.447  36.636  29.959 1.00 104.92 ? 6   DC  M "O3'" 1 
ATOM   1254  C "C2'" . DC  C 1 6   ? 82.161  34.509  28.811 1.00 100.64 ? 6   DC  M "C2'" 1 
ATOM   1255  C "C1'" . DC  C 1 6   ? 83.554  34.074  28.358 1.00 101.83 ? 6   DC  M "C1'" 1 
ATOM   1256  N N1    . DC  C 1 6   ? 83.603  32.796  27.563 1.00 100.83 ? 6   DC  M N1    1 
ATOM   1257  C C2    . DC  C 1 6   ? 84.087  32.812  26.246 1.00 103.01 ? 6   DC  M C2    1 
ATOM   1258  O O2    . DC  C 1 6   ? 84.470  33.879  25.765 1.00 107.46 ? 6   DC  M O2    1 
ATOM   1259  N N3    . DC  C 1 6   ? 84.133  31.652  25.534 1.00 102.02 ? 6   DC  M N3    1 
ATOM   1260  C C4    . DC  C 1 6   ? 83.718  30.505  26.084 1.00 98.91  ? 6   DC  M C4    1 
ATOM   1261  N N4    . DC  C 1 6   ? 83.772  29.387  25.346 1.00 98.01  ? 6   DC  M N4    1 
ATOM   1262  C C5    . DC  C 1 6   ? 83.219  30.464  27.426 1.00 97.01  ? 6   DC  M C5    1 
ATOM   1263  C C6    . DC  C 1 6   ? 83.181  31.615  28.119 1.00 98.10  ? 6   DC  M C6    1 
ATOM   1264  P P     . DA  C 1 7   ? 81.152  37.566  30.052 1.00 107.79 ? 7   DA  M P     1 
ATOM   1265  O OP1   . DA  C 1 7   ? 81.674  38.946  29.992 1.00 112.35 ? 7   DA  M OP1   1 
ATOM   1266  O OP2   . DA  C 1 7   ? 80.320  37.157  31.204 1.00 106.63 ? 7   DA  M OP2   1 
ATOM   1267  O "O5'" . DA  C 1 7   ? 80.297  37.212  28.736 1.00 107.04 ? 7   DA  M "O5'" 1 
ATOM   1268  C "C5'" . DA  C 1 7   ? 80.674  37.753  27.463 1.00 109.77 ? 7   DA  M "C5'" 1 
ATOM   1269  C "C4'" . DA  C 1 7   ? 80.153  37.031  26.220 1.00 107.39 ? 7   DA  M "C4'" 1 
ATOM   1270  O "O4'" . DA  C 1 7   ? 80.940  35.852  25.898 1.00 104.81 ? 7   DA  M "O4'" 1 
ATOM   1271  C "C3'" . DA  C 1 7   ? 78.737  36.485  26.226 1.00 104.73 ? 7   DA  M "C3'" 1 
ATOM   1272  O "O3'" . DA  C 1 7   ? 77.784  37.512  25.944 1.00 108.59 ? 7   DA  M "O3'" 1 
ATOM   1273  C "C2'" . DA  C 1 7   ? 78.798  35.470  25.084 1.00 102.70 ? 7   DA  M "C2'" 1 
ATOM   1274  C "C1'" . DA  C 1 7   ? 80.278  35.286  24.787 1.00 102.57 ? 7   DA  M "C1'" 1 
ATOM   1275  N N9    . DA  C 1 7   ? 80.567  33.866  24.600 1.00 98.24  ? 7   DA  M N9    1 
ATOM   1276  C C8    . DA  C 1 7   ? 80.683  32.896  25.564 1.00 94.55  ? 7   DA  M C8    1 
ATOM   1277  N N7    . DA  C 1 7   ? 80.928  31.699  25.084 1.00 92.46  ? 7   DA  M N7    1 
ATOM   1278  C C5    . DA  C 1 7   ? 80.964  31.892  23.707 1.00 94.26  ? 7   DA  M C5    1 
ATOM   1279  C C6    . DA  C 1 7   ? 81.183  31.020  22.615 1.00 94.17  ? 7   DA  M C6    1 
ATOM   1280  N N6    . DA  C 1 7   ? 81.414  29.711  22.728 1.00 91.73  ? 7   DA  M N6    1 
ATOM   1281  N N1    . DA  C 1 7   ? 81.161  31.543  21.369 1.00 98.58  ? 7   DA  M N1    1 
ATOM   1282  C C2    . DA  C 1 7   ? 80.933  32.854  21.218 1.00 102.12 ? 7   DA  M C2    1 
ATOM   1283  N N3    . DA  C 1 7   ? 80.713  33.770  22.163 1.00 102.19 ? 7   DA  M N3    1 
ATOM   1284  C C4    . DA  C 1 7   ? 80.742  33.223  23.396 1.00 97.96  ? 7   DA  M C4    1 
ATOM   1285  P P     . DT  C 1 8   ? 76.255  37.132  25.657 1.00 106.86 ? 8   DT  M P     1 
ATOM   1286  O OP1   . DT  C 1 8   ? 75.447  38.371  25.628 1.00 112.26 ? 8   DT  M OP1   1 
ATOM   1287  O OP2   . DT  C 1 8   ? 75.895  36.020  26.560 1.00 102.28 ? 8   DT  M OP2   1 
ATOM   1288  O "O5'" . DT  C 1 8   ? 76.283  36.537  24.176 1.00 107.67 ? 8   DT  M "O5'" 1 
ATOM   1289  C "C5'" . DT  C 1 8   ? 76.751  37.319  23.074 1.00 112.45 ? 8   DT  M "C5'" 1 
ATOM   1290  C "C4'" . DT  C 1 8   ? 76.564  36.545  21.786 1.00 111.61 ? 8   DT  M "C4'" 1 
ATOM   1291  O "O4'" . DT  C 1 8   ? 77.321  35.310  21.841 1.00 108.05 ? 8   DT  M "O4'" 1 
ATOM   1292  C "C3'" . DT  C 1 8   ? 75.118  36.141  21.550 1.00 109.69 ? 8   DT  M "C3'" 1 
ATOM   1293  O "O3'" . DT  C 1 8   ? 74.656  36.723  20.343 1.00 114.97 ? 8   DT  M "O3'" 1 
ATOM   1294  C "C2'" . DT  C 1 8   ? 75.152  34.620  21.462 1.00 104.67 ? 8   DT  M "C2'" 1 
ATOM   1295  C "C1'" . DT  C 1 8   ? 76.599  34.357  21.095 1.00 106.04 ? 8   DT  M "C1'" 1 
ATOM   1296  N N1    . DT  C 1 8   ? 77.030  32.958  21.426 1.00 101.91 ? 8   DT  M N1    1 
ATOM   1297  C C2    . DT  C 1 8   ? 77.337  32.105  20.382 1.00 102.76 ? 8   DT  M C2    1 
ATOM   1298  O O2    . DT  C 1 8   ? 77.277  32.435  19.206 1.00 106.85 ? 8   DT  M O2    1 
ATOM   1299  N N3    . DT  C 1 8   ? 77.703  30.836  20.760 1.00 98.87  ? 8   DT  M N3    1 
ATOM   1300  C C4    . DT  C 1 8   ? 77.792  30.352  22.051 1.00 95.81  ? 8   DT  M C4    1 
ATOM   1301  O O4    . DT  C 1 8   ? 78.140  29.197  22.289 1.00 95.12  ? 8   DT  M O4    1 
ATOM   1302  C C5    . DT  C 1 8   ? 77.453  31.294  23.098 1.00 94.86  ? 8   DT  M C5    1 
ATOM   1303  C C7    . DT  C 1 8   ? 77.521  30.877  24.539 1.00 90.46  ? 8   DT  M C7    1 
ATOM   1304  C C6    . DT  C 1 8   ? 77.090  32.537  22.743 1.00 97.43  ? 8   DT  M C6    1 
ATOM   1305  P P     . DG  C 1 9   ? 73.109  37.054  20.153 1.00 115.72 ? 9   DG  M P     1 
ATOM   1306  O OP1   . DG  C 1 9   ? 72.976  37.595  18.786 1.00 122.89 ? 9   DG  M OP1   1 
ATOM   1307  O OP2   . DG  C 1 9   ? 72.645  37.859  21.305 1.00 116.15 ? 9   DG  M OP2   1 
ATOM   1308  O "O5'" . DG  C 1 9   ? 72.396  35.620  20.270 1.00 110.52 ? 9   DG  M "O5'" 1 
ATOM   1309  C "C5'" . DG  C 1 9   ? 71.636  35.035  19.216 1.00 111.31 ? 9   DG  M "C5'" 1 
ATOM   1310  C "C4'" . DG  C 1 9   ? 72.515  34.377  18.161 1.00 113.26 ? 9   DG  M "C4'" 1 
ATOM   1311  O "O4'" . DG  C 1 9   ? 73.635  33.665  18.739 1.00 110.04 ? 9   DG  M "O4'" 1 
ATOM   1312  C "C3'" . DG  C 1 9   ? 71.806  33.311  17.354 1.00 112.21 ? 9   DG  M "C3'" 1 
ATOM   1313  O "O3'" . DG  C 1 9   ? 71.072  33.939  16.331 1.00 116.18 ? 9   DG  M "O3'" 1 
ATOM   1314  C "C2'" . DG  C 1 9   ? 72.973  32.513  16.785 1.00 112.83 ? 9   DG  M "C2'" 1 
ATOM   1315  C "C1'" . DG  C 1 9   ? 74.056  32.644  17.847 1.00 110.82 ? 9   DG  M "C1'" 1 
ATOM   1316  N N9    . DG  C 1 9   ? 74.358  31.397  18.570 1.00 106.69 ? 9   DG  M N9    1 
ATOM   1317  C C8    . DG  C 1 9   ? 74.376  31.230  19.935 1.00 102.65 ? 9   DG  M C8    1 
ATOM   1318  N N7    . DG  C 1 9   ? 74.689  30.024  20.320 1.00 100.08 ? 9   DG  M N7    1 
ATOM   1319  C C5    . DG  C 1 9   ? 74.894  29.330  19.133 1.00 102.19 ? 9   DG  M C5    1 
ATOM   1320  C C6    . DG  C 1 9   ? 75.256  27.970  18.919 1.00 101.10 ? 9   DG  M C6    1 
ATOM   1321  O O6    . DG  C 1 9   ? 75.473  27.088  19.762 1.00 97.94  ? 9   DG  M O6    1 
ATOM   1322  N N1    . DG  C 1 9   ? 75.364  27.657  17.565 1.00 104.82 ? 9   DG  M N1    1 
ATOM   1323  C C2    . DG  C 1 9   ? 75.150  28.550  16.543 1.00 109.80 ? 9   DG  M C2    1 
ATOM   1324  N N2    . DG  C 1 9   ? 75.302  28.065  15.302 1.00 114.25 ? 9   DG  M N2    1 
ATOM   1325  N N3    . DG  C 1 9   ? 74.811  29.825  16.729 1.00 110.87 ? 9   DG  M N3    1 
ATOM   1326  C C4    . DG  C 1 9   ? 74.698  30.158  18.045 1.00 106.50 ? 9   DG  M C4    1 
ATOM   1327  P P     . DT  C 1 10  ? 69.924  33.136  15.564 1.00 116.77 ? 10  DT  M P     1 
ATOM   1328  O OP1   . DT  C 1 10  ? 69.446  34.037  14.493 1.00 123.94 ? 10  DT  M OP1   1 
ATOM   1329  O OP2   . DT  C 1 10  ? 68.951  32.586  16.543 1.00 110.51 ? 10  DT  M OP2   1 
ATOM   1330  O "O5'" . DT  C 1 10  ? 70.701  31.922  14.877 1.00 116.63 ? 10  DT  M "O5'" 1 
ATOM   1331  C "C5'" . DT  C 1 10  ? 71.530  32.156  13.740 1.00 123.01 ? 10  DT  M "C5'" 1 
ATOM   1332  C "C4'" . DT  C 1 10  ? 71.795  30.858  13.002 1.00 123.50 ? 10  DT  M "C4'" 1 
ATOM   1333  O "O4'" . DT  C 1 10  ? 72.396  29.884  13.892 1.00 117.69 ? 10  DT  M "O4'" 1 
ATOM   1334  C "C3'" . DT  C 1 10  ? 70.552  30.186  12.434 1.00 123.65 ? 10  DT  M "C3'" 1 
ATOM   1335  O "O3'" . DT  C 1 10  ? 70.920  29.620  11.176 1.00 129.99 ? 10  DT  M "O3'" 1 
ATOM   1336  C "C2'" . DT  C 1 10  ? 70.199  29.148  13.498 1.00 115.95 ? 10  DT  M "C2'" 1 
ATOM   1337  C "C1'" . DT  C 1 10  ? 71.592  28.715  13.935 1.00 114.78 ? 10  DT  M "C1'" 1 
ATOM   1338  N N1    . DT  C 1 10  ? 71.680  28.115  15.308 1.00 108.52 ? 10  DT  M N1    1 
ATOM   1339  C C2    . DT  C 1 10  ? 72.213  26.843  15.470 1.00 106.49 ? 10  DT  M C2    1 
ATOM   1340  O O2    . DT  C 1 10  ? 72.618  26.147  14.559 1.00 110.59 ? 10  DT  M O2    1 
ATOM   1341  N N3    . DT  C 1 10  ? 72.259  26.390  16.761 1.00 100.52 ? 10  DT  M N3    1 
ATOM   1342  C C4    . DT  C 1 10  ? 71.845  27.070  17.887 1.00 97.06  ? 10  DT  M C4    1 
ATOM   1343  O O4    . DT  C 1 10  ? 71.935  26.573  18.997 1.00 92.50  ? 10  DT  M O4    1 
ATOM   1344  C C5    . DT  C 1 10  ? 71.303  28.392  17.663 1.00 100.45 ? 10  DT  M C5    1 
ATOM   1345  C C7    . DT  C 1 10  ? 70.811  29.222  18.817 1.00 98.58  ? 10  DT  M C7    1 
ATOM   1346  C C6    . DT  C 1 10  ? 71.244  28.848  16.400 1.00 105.42 ? 10  DT  M C6    1 
ATOM   1347  P P     . DA  C 1 11  ? 70.004  28.583  10.364 1.00 131.93 ? 11  DA  M P     1 
ATOM   1348  O OP1   . DA  C 1 11  ? 70.412  28.675  8.934  1.00 139.98 ? 11  DA  M OP1   1 
ATOM   1349  O OP2   . DA  C 1 11  ? 68.576  28.762  10.735 1.00 127.68 ? 11  DA  M OP2   1 
ATOM   1350  O "O5'" . DA  C 1 11  ? 70.518  27.201  10.996 1.00 126.38 ? 11  DA  M "O5'" 1 
ATOM   1351  C "C5'" . DA  C 1 11  ? 71.626  26.498  10.455 1.00 128.10 ? 11  DA  M "C5'" 1 
ATOM   1352  C "C4'" . DA  C 1 11  ? 71.397  25.003  10.577 1.00 125.52 ? 11  DA  M "C4'" 1 
ATOM   1353  O "O4'" . DA  C 1 11  ? 71.326  24.630  11.976 1.00 118.48 ? 11  DA  M "O4'" 1 
ATOM   1354  C "C3'" . DA  C 1 11  ? 70.116  24.481  9.947  1.00 126.97 ? 11  DA  M "C3'" 1 
ATOM   1355  O "O3'" . DA  C 1 11  ? 70.483  23.323  9.216  1.00 131.22 ? 11  DA  M "O3'" 1 
ATOM   1356  C "C2'" . DA  C 1 11  ? 69.183  24.209  11.139 1.00 119.52 ? 11  DA  M "C2'" 1 
ATOM   1357  C "C1'" . DA  C 1 11  ? 70.180  23.843  12.232 1.00 115.64 ? 11  DA  M "C1'" 1 
ATOM   1358  N N9    . DA  C 1 11  ? 69.823  24.170  13.608 1.00 110.21 ? 11  DA  M N9    1 
ATOM   1359  C C8    . DA  C 1 11  ? 69.261  25.334  14.070 1.00 109.27 ? 11  DA  M C8    1 
ATOM   1360  N N7    . DA  C 1 11  ? 69.075  25.363  15.371 1.00 103.48 ? 11  DA  M N7    1 
ATOM   1361  C C5    . DA  C 1 11  ? 69.559  24.136  15.795 1.00 101.07 ? 11  DA  M C5    1 
ATOM   1362  C C6    . DA  C 1 11  ? 69.650  23.543  17.072 1.00 96.48  ? 11  DA  M C6    1 
ATOM   1363  N N6    . DA  C 1 11  ? 69.228  24.151  18.188 1.00 92.47  ? 11  DA  M N6    1 
ATOM   1364  N N1    . DA  C 1 11  ? 70.184  22.301  17.154 1.00 96.34  ? 11  DA  M N1    1 
ATOM   1365  C C2    . DA  C 1 11  ? 70.593  21.690  16.033 1.00 100.14 ? 11  DA  M C2    1 
ATOM   1366  N N3    . DA  C 1 11  ? 70.559  22.148  14.781 1.00 104.80 ? 11  DA  M N3    1 
ATOM   1367  C C4    . DA  C 1 11  ? 70.030  23.387  14.727 1.00 105.22 ? 11  DA  M C4    1 
ATOM   1368  P P     . DA  C 1 12  ? 69.413  22.403  8.457  1.00 135.22 ? 12  DA  M P     1 
ATOM   1369  O OP1   . DA  C 1 12  ? 70.050  21.895  7.220  1.00 143.02 ? 12  DA  M OP1   1 
ATOM   1370  O OP2   . DA  C 1 12  ? 68.104  23.088  8.358  1.00 133.95 ? 12  DA  M OP2   1 
ATOM   1371  O "O5'" . DA  C 1 12  ? 69.263  21.217  9.510  1.00 129.15 ? 12  DA  M "O5'" 1 
ATOM   1372  C "C5'" . DA  C 1 12  ? 70.414  20.509  9.968  1.00 129.13 ? 12  DA  M "C5'" 1 
ATOM   1373  C "C4'" . DA  C 1 12  ? 69.985  19.321  10.810 1.00 125.51 ? 12  DA  M "C4'" 1 
ATOM   1374  O "O4'" . DA  C 1 12  ? 69.680  19.775  12.152 1.00 118.29 ? 12  DA  M "O4'" 1 
ATOM   1375  C "C3'" . DA  C 1 12  ? 68.747  18.581  10.305 1.00 127.65 ? 12  DA  M "C3'" 1 
ATOM   1376  O "O3'" . DA  C 1 12  ? 69.100  17.180  10.209 1.00 131.99 ? 12  DA  M "O3'" 1 
ATOM   1377  C "C2'" . DA  C 1 12  ? 67.635  18.973  11.298 1.00 120.09 ? 12  DA  M "C2'" 1 
ATOM   1378  C "C1'" . DA  C 1 12  ? 68.422  19.284  12.568 1.00 114.11 ? 12  DA  M "C1'" 1 
ATOM   1379  N N9    . DA  C 1 12  ? 67.884  20.285  13.491 1.00 107.96 ? 12  DA  M N9    1 
ATOM   1380  C C8    . DA  C 1 12  ? 67.338  21.507  13.202 1.00 107.94 ? 12  DA  M C8    1 
ATOM   1381  N N7    . DA  C 1 12  ? 66.962  22.189  14.263 1.00 102.85 ? 12  DA  M N7    1 
ATOM   1382  C C5    . DA  C 1 12  ? 67.299  21.365  15.328 1.00 98.87  ? 12  DA  M C5    1 
ATOM   1383  C C6    . DA  C 1 12  ? 67.171  21.501  16.732 1.00 93.46  ? 12  DA  M C6    1 
ATOM   1384  N N6    . DA  C 1 12  ? 66.641  22.573  17.329 1.00 91.11  ? 12  DA  M N6    1 
ATOM   1385  N N1    . DA  C 1 12  ? 67.605  20.488  17.513 1.00 90.89  ? 12  DA  M N1    1 
ATOM   1386  C C2    . DA  C 1 12  ? 68.135  19.410  16.922 1.00 94.32  ? 12  DA  M C2    1 
ATOM   1387  N N3    . DA  C 1 12  ? 68.315  19.169  15.624 1.00 98.80  ? 12  DA  M N3    1 
ATOM   1388  C C4    . DA  C 1 12  ? 67.875  20.192  14.870 1.00 101.63 ? 12  DA  M C4    1 
ATOM   1389  P P     . DA  C 1 13  ? 68.154  15.941  10.577 1.00 132.40 ? 13  DA  M P     1 
ATOM   1390  O OP1   . DA  C 1 13  ? 68.768  14.715  10.021 1.00 137.85 ? 13  DA  M OP1   1 
ATOM   1391  O OP2   . DA  C 1 13  ? 66.747  16.275  10.225 1.00 130.67 ? 13  DA  M OP2   1 
ATOM   1392  O "O5'" . DA  C 1 13  ? 68.288  15.914  12.175 1.00 126.95 ? 13  DA  M "O5'" 1 
ATOM   1393  C "C5'" . DA  C 1 13  ? 68.993  14.899  12.912 1.00 128.11 ? 13  DA  M "C5'" 1 
ATOM   1394  C "C4'" . DA  C 1 13  ? 68.218  14.541  14.180 1.00 123.36 ? 13  DA  M "C4'" 1 
ATOM   1395  O "O4'" . DA  C 1 13  ? 67.809  15.744  14.894 1.00 118.79 ? 13  DA  M "O4'" 1 
ATOM   1396  C "C3'" . DA  C 1 13  ? 66.935  13.743  13.935 1.00 123.89 ? 13  DA  M "C3'" 1 
ATOM   1397  O "O3'" . DA  C 1 13  ? 66.887  12.639  14.842 1.00 121.99 ? 13  DA  M "O3'" 1 
ATOM   1398  C "C2'" . DA  C 1 13  ? 65.810  14.759  14.144 1.00 119.49 ? 13  DA  M "C2'" 1 
ATOM   1399  C "C1'" . DA  C 1 13  ? 66.425  15.676  15.188 1.00 116.07 ? 13  DA  M "C1'" 1 
ATOM   1400  N N9    . DA  C 1 13  ? 65.831  17.008  15.187 1.00 114.39 ? 13  DA  M N9    1 
ATOM   1401  C C8    . DA  C 1 13  ? 65.553  17.798  14.105 1.00 117.55 ? 13  DA  M C8    1 
ATOM   1402  N N7    . DA  C 1 13  ? 65.004  18.950  14.414 1.00 115.28 ? 13  DA  M N7    1 
ATOM   1403  C C5    . DA  C 1 13  ? 64.918  18.911  15.794 1.00 110.48 ? 13  DA  M C5    1 
ATOM   1404  C C6    . DA  C 1 13  ? 64.428  19.833  16.741 1.00 107.08 ? 13  DA  M C6    1 
ATOM   1405  N N6    . DA  C 1 13  ? 63.925  21.021  16.397 1.00 107.58 ? 13  DA  M N6    1 
ATOM   1406  N N1    . DA  C 1 13  ? 64.485  19.487  18.053 1.00 104.37 ? 13  DA  M N1    1 
ATOM   1407  C C2    . DA  C 1 13  ? 65.006  18.293  18.392 1.00 104.46 ? 13  DA  M C2    1 
ATOM   1408  N N3    . DA  C 1 13  ? 65.494  17.344  17.583 1.00 107.25 ? 13  DA  M N3    1 
ATOM   1409  C C4    . DA  C 1 13  ? 65.419  17.718  16.289 1.00 110.03 ? 13  DA  M C4    1 
ATOM   1410  P P     . DT  C 1 14  ? 65.533  11.844  15.185 1.00 120.49 ? 14  DT  M P     1 
ATOM   1411  O OP1   . DT  C 1 14  ? 65.907  10.408  15.209 1.00 124.76 ? 14  DT  M OP1   1 
ATOM   1412  O OP2   . DT  C 1 14  ? 64.367  12.314  14.398 1.00 119.14 ? 14  DT  M OP2   1 
ATOM   1413  O "O5'" . DT  C 1 14  ? 65.263  12.350  16.671 1.00 113.01 ? 14  DT  M "O5'" 1 
ATOM   1414  C "C5'" . DT  C 1 14  ? 66.200  12.085  17.704 1.00 108.99 ? 14  DT  M "C5'" 1 
ATOM   1415  C "C4'" . DT  C 1 14  ? 65.513  12.370  19.019 1.00 102.18 ? 14  DT  M "C4'" 1 
ATOM   1416  O "O4'" . DT  C 1 14  ? 64.968  13.716  19.014 1.00 98.42  ? 14  DT  M "O4'" 1 
ATOM   1417  C "C3'" . DT  C 1 14  ? 64.343  11.450  19.352 1.00 100.47 ? 14  DT  M "C3'" 1 
ATOM   1418  O "O3'" . DT  C 1 14  ? 64.506  11.143  20.741 1.00 96.60  ? 14  DT  M "O3'" 1 
ATOM   1419  C "C2'" . DT  C 1 14  ? 63.105  12.282  18.998 1.00 96.54  ? 14  DT  M "C2'" 1 
ATOM   1420  C "C1'" . DT  C 1 14  ? 63.590  13.689  19.332 1.00 94.03  ? 14  DT  M "C1'" 1 
ATOM   1421  N N1    . DT  C 1 14  ? 62.984  14.828  18.570 1.00 92.84  ? 14  DT  M N1    1 
ATOM   1422  C C2    . DT  C 1 14  ? 62.608  15.960  19.267 1.00 88.82  ? 14  DT  M C2    1 
ATOM   1423  O O2    . DT  C 1 14  ? 62.721  16.061  20.467 1.00 86.45  ? 14  DT  M O2    1 
ATOM   1424  N N3    . DT  C 1 14  ? 62.066  16.972  18.506 1.00 88.64  ? 14  DT  M N3    1 
ATOM   1425  C C4    . DT  C 1 14  ? 61.889  16.968  17.136 1.00 91.53  ? 14  DT  M C4    1 
ATOM   1426  O O4    . DT  C 1 14  ? 61.402  17.930  16.556 1.00 93.04  ? 14  DT  M O4    1 
ATOM   1427  C C5    . DT  C 1 14  ? 62.307  15.761  16.455 1.00 94.75  ? 14  DT  M C5    1 
ATOM   1428  C C7    . DT  C 1 14  ? 62.161  15.633  14.967 1.00 98.76  ? 14  DT  M C7    1 
ATOM   1429  C C6    . DT  C 1 14  ? 62.833  14.766  17.191 1.00 95.33  ? 14  DT  M C6    1 
ATOM   1430  P P     . DA  C 1 15  ? 63.355  10.558  21.669 1.00 93.26  ? 15  DA  M P     1 
ATOM   1431  O OP1   . DA  C 1 15  ? 64.042  9.983   22.842 1.00 93.31  ? 15  DA  M OP1   1 
ATOM   1432  O OP2   . DA  C 1 15  ? 62.415  9.730   20.879 1.00 96.02  ? 15  DA  M OP2   1 
ATOM   1433  O "O5'" . DA  C 1 15  ? 62.563  11.891  22.073 1.00 87.25  ? 15  DA  M "O5'" 1 
ATOM   1434  C "C5'" . DA  C 1 15  ? 63.087  12.770  23.075 1.00 81.86  ? 15  DA  M "C5'" 1 
ATOM   1435  C "C4'" . DA  C 1 15  ? 61.954  13.535  23.732 1.00 76.63  ? 15  DA  M "C4'" 1 
ATOM   1436  O "O4'" . DA  C 1 15  ? 61.445  14.538  22.818 1.00 74.06  ? 15  DA  M "O4'" 1 
ATOM   1437  C "C3'" . DA  C 1 15  ? 60.754  12.685  24.142 1.00 75.69  ? 15  DA  M "C3'" 1 
ATOM   1438  O "O3'" . DA  C 1 15  ? 60.496  12.917  25.546 1.00 72.29  ? 15  DA  M "O3'" 1 
ATOM   1439  C "C2'" . DA  C 1 15  ? 59.635  13.126  23.186 1.00 73.84  ? 15  DA  M "C2'" 1 
ATOM   1440  C "C1'" . DA  C 1 15  ? 60.042  14.553  22.849 1.00 72.53  ? 15  DA  M "C1'" 1 
ATOM   1441  N N9    . DA  C 1 15  ? 59.665  15.082  21.538 1.00 73.69  ? 15  DA  M N9    1 
ATOM   1442  C C8    . DA  C 1 15  ? 59.878  14.524  20.300 1.00 75.63  ? 15  DA  M C8    1 
ATOM   1443  N N7    . DA  C 1 15  ? 59.449  15.264  19.302 1.00 76.13  ? 15  DA  M N7    1 
ATOM   1444  C C5    . DA  C 1 15  ? 58.914  16.380  19.929 1.00 74.10  ? 15  DA  M C5    1 
ATOM   1445  C C6    . DA  C 1 15  ? 58.292  17.550  19.448 1.00 73.96  ? 15  DA  M C6    1 
ATOM   1446  N N6    . DA  C 1 15  ? 58.086  17.791  18.155 1.00 76.50  ? 15  DA  M N6    1 
ATOM   1447  N N1    . DA  C 1 15  ? 57.876  18.469  20.350 1.00 72.43  ? 15  DA  M N1    1 
ATOM   1448  C C2    . DA  C 1 15  ? 58.070  18.242  21.652 1.00 69.77  ? 15  DA  M C2    1 
ATOM   1449  N N3    . DA  C 1 15  ? 58.642  17.186  22.221 1.00 69.71  ? 15  DA  M N3    1 
ATOM   1450  C C4    . DA  C 1 15  ? 59.043  16.288  21.304 1.00 71.84  ? 15  DA  M C4    1 
ATOM   1451  P P     . DG  C 1 16  ? 59.263  12.236  26.295 1.00 70.82  ? 16  DG  M P     1 
ATOM   1452  O OP1   . DG  C 1 16  ? 59.578  12.128  27.731 1.00 70.79  ? 16  DG  M OP1   1 
ATOM   1453  O OP2   . DG  C 1 16  ? 58.874  11.005  25.574 1.00 73.13  ? 16  DG  M OP2   1 
ATOM   1454  O "O5'" . DG  C 1 16  ? 58.132  13.334  26.065 1.00 68.17  ? 16  DG  M "O5'" 1 
ATOM   1455  C "C5'" . DG  C 1 16  ? 58.296  14.676  26.499 1.00 67.32  ? 16  DG  M "C5'" 1 
ATOM   1456  C "C4'" . DG  C 1 16  ? 57.038  15.494  26.248 1.00 67.35  ? 16  DG  M "C4'" 1 
ATOM   1457  O "O4'" . DG  C 1 16  ? 56.960  15.852  24.842 1.00 68.37  ? 16  DG  M "O4'" 1 
ATOM   1458  C "C3'" . DG  C 1 16  ? 55.705  14.825  26.592 1.00 68.38  ? 16  DG  M "C3'" 1 
ATOM   1459  O "O3'" . DG  C 1 16  ? 55.018  15.722  27.442 1.00 67.94  ? 16  DG  M "O3'" 1 
ATOM   1460  C "C2'" . DG  C 1 16  ? 54.997  14.658  25.244 1.00 68.07  ? 16  DG  M "C2'" 1 
ATOM   1461  C "C1'" . DG  C 1 16  ? 55.630  15.755  24.394 1.00 67.56  ? 16  DG  M "C1'" 1 
ATOM   1462  N N9    . DG  C 1 16  ? 55.674  15.518  22.952 1.00 69.45  ? 16  DG  M N9    1 
ATOM   1463  C C8    . DG  C 1 16  ? 56.119  14.407  22.279 1.00 71.66  ? 16  DG  M C8    1 
ATOM   1464  N N7    . DG  C 1 16  ? 56.040  14.507  20.976 1.00 73.36  ? 16  DG  M N7    1 
ATOM   1465  C C5    . DG  C 1 16  ? 55.508  15.773  20.771 1.00 73.06  ? 16  DG  M C5    1 
ATOM   1466  C C6    . DG  C 1 16  ? 55.183  16.458  19.567 1.00 75.57  ? 16  DG  M C6    1 
ATOM   1467  O O6    . DG  C 1 16  ? 55.305  16.075  18.393 1.00 78.93  ? 16  DG  M O6    1 
ATOM   1468  N N1    . DG  C 1 16  ? 54.661  17.730  19.805 1.00 74.91  ? 16  DG  M N1    1 
ATOM   1469  C C2    . DG  C 1 16  ? 54.479  18.274  21.057 1.00 73.48  ? 16  DG  M C2    1 
ATOM   1470  N N2    . DG  C 1 16  ? 53.955  19.511  21.086 1.00 74.58  ? 16  DG  M N2    1 
ATOM   1471  N N3    . DG  C 1 16  ? 54.776  17.644  22.195 1.00 71.02  ? 16  DG  M N3    1 
ATOM   1472  C C4    . DG  C 1 16  ? 55.278  16.402  21.978 1.00 70.63  ? 16  DG  M C4    1 
ATOM   1473  P P     . DT  C 1 17  ? 53.691  15.409  28.267 1.00 67.35  ? 17  DT  M P     1 
ATOM   1474  O OP1   . DT  C 1 17  ? 54.063  15.538  29.686 1.00 69.22  ? 17  DT  M OP1   1 
ATOM   1475  O OP2   . DT  C 1 17  ? 53.023  14.183  27.793 1.00 68.16  ? 17  DT  M OP2   1 
ATOM   1476  O "O5'" . DT  C 1 17  ? 52.790  16.665  27.875 1.00 67.38  ? 17  DT  M "O5'" 1 
ATOM   1477  C "C5'" . DT  C 1 17  ? 53.247  17.693  26.984 1.00 66.87  ? 17  DT  M "C5'" 1 
ATOM   1478  C "C4'" . DT  C 1 17  ? 52.110  18.604  26.514 1.00 67.18  ? 17  DT  M "C4'" 1 
ATOM   1479  O "O4'" . DT  C 1 17  ? 52.113  18.716  25.067 1.00 65.85  ? 17  DT  M "O4'" 1 
ATOM   1480  C "C3'" . DT  C 1 17  ? 50.687  18.217  26.909 1.00 68.10  ? 17  DT  M "C3'" 1 
ATOM   1481  O "O3'" . DT  C 1 17  ? 50.005  19.392  27.318 1.00 70.52  ? 17  DT  M "O3'" 1 
ATOM   1482  C "C2'" . DT  C 1 17  ? 50.116  17.588  25.638 1.00 67.12  ? 17  DT  M "C2'" 1 
ATOM   1483  C "C1'" . DT  C 1 17  ? 50.902  18.257  24.508 1.00 66.45  ? 17  DT  M "C1'" 1 
ATOM   1484  N N1    . DT  C 1 17  ? 51.238  17.399  23.295 1.00 66.02  ? 17  DT  M N1    1 
ATOM   1485  C C2    . DT  C 1 17  ? 51.159  17.965  22.039 1.00 66.97  ? 17  DT  M C2    1 
ATOM   1486  O O2    . DT  C 1 17  ? 50.819  19.106  21.814 1.00 69.45  ? 17  DT  M O2    1 
ATOM   1487  N N3    . DT  C 1 17  ? 51.479  17.143  21.001 1.00 67.91  ? 17  DT  M N3    1 
ATOM   1488  C C4    . DT  C 1 17  ? 51.878  15.828  21.069 1.00 67.59  ? 17  DT  M C4    1 
ATOM   1489  O O4    . DT  C 1 17  ? 52.147  15.201  20.050 1.00 69.47  ? 17  DT  M O4    1 
ATOM   1490  C C5    . DT  C 1 17  ? 51.961  15.281  22.402 1.00 66.00  ? 17  DT  M C5    1 
ATOM   1491  C C7    . DT  C 1 17  ? 52.389  13.860  22.600 1.00 66.36  ? 17  DT  M C7    1 
ATOM   1492  C C6    . DT  C 1 17  ? 51.643  16.080  23.436 1.00 65.38  ? 17  DT  M C6    1 
ATOM   1493  P P     . DT  C 1 18  ? 48.448  19.417  27.713 1.00 74.31  ? 18  DT  M P     1 
ATOM   1494  O OP1   . DT  C 1 18  ? 48.277  20.395  28.809 1.00 76.62  ? 18  DT  M OP1   1 
ATOM   1495  O OP2   . DT  C 1 18  ? 47.913  18.046  27.888 1.00 75.12  ? 18  DT  M OP2   1 
ATOM   1496  O "O5'" . DT  C 1 18  ? 47.787  19.979  26.379 1.00 73.20  ? 18  DT  M "O5'" 1 
ATOM   1497  C "C5'" . DT  C 1 18  ? 48.167  21.223  25.797 1.00 72.71  ? 18  DT  M "C5'" 1 
ATOM   1498  C "C4'" . DT  C 1 18  ? 47.249  21.519  24.616 1.00 72.97  ? 18  DT  M "C4'" 1 
ATOM   1499  O "O4'" . DT  C 1 18  ? 47.653  20.731  23.464 1.00 71.09  ? 18  DT  M "O4'" 1 
ATOM   1500  C "C3'" . DT  C 1 18  ? 45.759  21.232  24.833 1.00 72.19  ? 18  DT  M "C3'" 1 
ATOM   1501  O "O3'" . DT  C 1 18  ? 45.022  22.348  24.339 1.00 74.12  ? 18  DT  M "O3'" 1 
ATOM   1502  C "C2'" . DT  C 1 18  ? 45.522  19.933  24.057 1.00 70.76  ? 18  DT  M "C2'" 1 
ATOM   1503  C "C1'" . DT  C 1 18  ? 46.540  20.039  22.924 1.00 70.28  ? 18  DT  M "C1'" 1 
ATOM   1504  N N1    . DT  C 1 18  ? 47.093  18.759  22.341 1.00 69.14  ? 18  DT  M N1    1 
ATOM   1505  C C2    . DT  C 1 18  ? 47.408  18.741  21.001 1.00 69.18  ? 18  DT  M C2    1 
ATOM   1506  O O2    . DT  C 1 18  ? 47.238  19.692  20.268 1.00 71.27  ? 18  DT  M O2    1 
ATOM   1507  N N3    . DT  C 1 18  ? 47.929  17.564  20.538 1.00 68.63  ? 18  DT  M N3    1 
ATOM   1508  C C4    . DT  C 1 18  ? 48.180  16.415  21.264 1.00 68.46  ? 18  DT  M C4    1 
ATOM   1509  O O4    . DT  C 1 18  ? 48.663  15.410  20.738 1.00 68.43  ? 18  DT  M O4    1 
ATOM   1510  C C5    . DT  C 1 18  ? 47.840  16.496  22.672 1.00 67.64  ? 18  DT  M C5    1 
ATOM   1511  C C7    . DT  C 1 18  ? 48.053  15.324  23.589 1.00 66.96  ? 18  DT  M C7    1 
ATOM   1512  C C6    . DT  C 1 18  ? 47.326  17.648  23.134 1.00 67.84  ? 18  DT  M C6    1 
ATOM   1513  P P     . DA  C 1 19  ? 43.425  22.378  24.186 1.00 75.95  ? 19  DA  M P     1 
ATOM   1514  O OP1   . DA  C 1 19  ? 43.032  23.792  24.325 1.00 78.71  ? 19  DA  M OP1   1 
ATOM   1515  O OP2   . DA  C 1 19  ? 42.798  21.368  25.073 1.00 74.58  ? 19  DA  M OP2   1 
ATOM   1516  O "O5'" . DA  C 1 19  ? 43.206  21.899  22.663 1.00 74.45  ? 19  DA  M "O5'" 1 
ATOM   1517  C "C5'" . DA  C 1 19  ? 43.987  22.426  21.582 1.00 74.56  ? 19  DA  M "C5'" 1 
ATOM   1518  C "C4'" . DA  C 1 19  ? 43.558  21.846  20.236 1.00 75.20  ? 19  DA  M "C4'" 1 
ATOM   1519  O "O4'" . DA  C 1 19  ? 44.283  20.616  19.916 1.00 73.84  ? 19  DA  M "O4'" 1 
ATOM   1520  C "C3'" . DA  C 1 19  ? 42.068  21.524  20.104 1.00 75.23  ? 19  DA  M "C3'" 1 
ATOM   1521  O "O3'" . DA  C 1 19  ? 41.619  21.985  18.839 1.00 77.18  ? 19  DA  M "O3'" 1 
ATOM   1522  C "C2'" . DA  C 1 19  ? 42.018  20.002  20.206 1.00 73.03  ? 19  DA  M "C2'" 1 
ATOM   1523  C "C1'" . DA  C 1 19  ? 43.354  19.595  19.582 1.00 72.73  ? 19  DA  M "C1'" 1 
ATOM   1524  N N9    . DA  C 1 19  ? 43.793  18.254  20.002 1.00 70.27  ? 19  DA  M N9    1 
ATOM   1525  C C8    . DA  C 1 19  ? 43.709  17.678  21.250 1.00 68.02  ? 19  DA  M C8    1 
ATOM   1526  N N7    . DA  C 1 19  ? 44.168  16.447  21.308 1.00 66.90  ? 19  DA  M N7    1 
ATOM   1527  C C5    . DA  C 1 19  ? 44.579  16.195  20.009 1.00 68.12  ? 19  DA  M C5    1 
ATOM   1528  C C6    . DA  C 1 19  ? 45.161  15.067  19.393 1.00 68.17  ? 19  DA  M C6    1 
ATOM   1529  N N6    . DA  C 1 19  ? 45.433  13.938  20.053 1.00 66.83  ? 19  DA  M N6    1 
ATOM   1530  N N1    . DA  C 1 19  ? 45.445  15.143  18.068 1.00 70.10  ? 19  DA  M N1    1 
ATOM   1531  C C2    . DA  C 1 19  ? 45.171  16.269  17.394 1.00 70.88  ? 19  DA  M C2    1 
ATOM   1532  N N3    . DA  C 1 19  ? 44.622  17.393  17.861 1.00 71.07  ? 19  DA  M N3    1 
ATOM   1533  C C4    . DA  C 1 19  ? 44.350  17.292  19.185 1.00 70.00  ? 19  DA  M C4    1 
ATOM   1534  P P     . DC  C 1 20  ? 40.086  21.975  18.377 1.00 79.06  ? 20  DC  M P     1 
ATOM   1535  O OP1   . DC  C 1 20  ? 39.687  23.390  18.191 1.00 82.06  ? 20  DC  M OP1   1 
ATOM   1536  O OP2   . DC  C 1 20  ? 39.270  21.084  19.230 1.00 75.34  ? 20  DC  M OP2   1 
ATOM   1537  O "O5'" . DC  C 1 20  ? 40.191  21.262  16.950 1.00 78.94  ? 20  DC  M "O5'" 1 
ATOM   1538  C "C5'" . DC  C 1 20  ? 41.310  21.452  16.100 1.00 78.36  ? 20  DC  M "C5'" 1 
ATOM   1539  C "C4'" . DC  C 1 20  ? 41.430  20.270  15.157 1.00 77.96  ? 20  DC  M "C4'" 1 
ATOM   1540  O "O4'" . DC  C 1 20  ? 41.974  19.154  15.885 1.00 74.64  ? 20  DC  M "O4'" 1 
ATOM   1541  C "C3'" . DC  C 1 20  ? 40.127  19.755  14.552 1.00 79.43  ? 20  DC  M "C3'" 1 
ATOM   1542  O "O3'" . DC  C 1 20  ? 40.310  19.633  13.146 1.00 83.08  ? 20  DC  M "O3'" 1 
ATOM   1543  C "C2'" . DC  C 1 20  ? 39.902  18.405  15.235 1.00 75.85  ? 20  DC  M "C2'" 1 
ATOM   1544  C "C1'" . DC  C 1 20  ? 41.333  17.966  15.489 1.00 74.53  ? 20  DC  M "C1'" 1 
ATOM   1545  N N1    . DC  C 1 20  ? 41.522  16.930  16.571 1.00 71.71  ? 20  DC  M N1    1 
ATOM   1546  C C2    . DC  C 1 20  ? 42.167  15.714  16.286 1.00 71.39  ? 20  DC  M C2    1 
ATOM   1547  O O2    . DC  C 1 20  ? 42.589  15.496  15.144 1.00 73.83  ? 20  DC  M O2    1 
ATOM   1548  N N3    . DC  C 1 20  ? 42.329  14.801  17.285 1.00 69.49  ? 20  DC  M N3    1 
ATOM   1549  C C4    . DC  C 1 20  ? 41.881  15.058  18.516 1.00 67.22  ? 20  DC  M C4    1 
ATOM   1550  N N4    . DC  C 1 20  ? 42.061  14.133  19.459 1.00 64.97  ? 20  DC  M N4    1 
ATOM   1551  C C5    . DC  C 1 20  ? 41.219  16.283  18.832 1.00 67.83  ? 20  DC  M C5    1 
ATOM   1552  C C6    . DC  C 1 20  ? 41.068  17.176  17.842 1.00 70.01  ? 20  DC  M C6    1 
ATOM   1553  P P     . DA  C 1 21  ? 39.112  19.297  12.142 1.00 86.30  ? 21  DA  M P     1 
ATOM   1554  O OP1   . DA  C 1 21  ? 39.433  19.976  10.870 1.00 92.49  ? 21  DA  M OP1   1 
ATOM   1555  O OP2   . DA  C 1 21  ? 37.818  19.589  12.802 1.00 85.18  ? 21  DA  M OP2   1 
ATOM   1556  O "O5'" . DA  C 1 21  ? 39.259  17.714  11.939 1.00 83.96  ? 21  DA  M "O5'" 1 
ATOM   1557  C "C5'" . DA  C 1 21  ? 38.205  16.921  12.409 1.00 80.37  ? 21  DA  M "C5'" 1 
ATOM   1558  C "C4'" . DA  C 1 21  ? 38.481  15.439  12.462 1.00 78.84  ? 21  DA  M "C4'" 1 
ATOM   1559  O "O4'" . DA  C 1 21  ? 39.259  15.035  13.623 1.00 76.55  ? 21  DA  M "O4'" 1 
ATOM   1560  C "C3'" . DA  C 1 21  ? 37.161  14.753  12.707 1.00 77.06  ? 21  DA  M "C3'" 1 
ATOM   1561  O "O3'" . DA  C 1 21  ? 36.552  14.516  11.471 1.00 78.39  ? 21  DA  M "O3'" 1 
ATOM   1562  C "C2'" . DA  C 1 21  ? 37.515  13.461  13.432 1.00 76.15  ? 21  DA  M "C2'" 1 
ATOM   1563  C "C1'" . DA  C 1 21  ? 38.944  13.676  13.890 1.00 75.31  ? 21  DA  M "C1'" 1 
ATOM   1564  N N9    . DA  C 1 21  ? 39.065  13.344  15.303 1.00 71.89  ? 21  DA  M N9    1 
ATOM   1565  C C8    . DA  C 1 21  ? 38.772  14.141  16.368 1.00 69.82  ? 21  DA  M C8    1 
ATOM   1566  N N7    . DA  C 1 21  ? 38.981  13.562  17.522 1.00 68.22  ? 21  DA  M N7    1 
ATOM   1567  C C5    . DA  C 1 21  ? 39.430  12.297  17.199 1.00 68.71  ? 21  DA  M C5    1 
ATOM   1568  C C6    . DA  C 1 21  ? 39.832  11.187  17.976 1.00 68.80  ? 21  DA  M C6    1 
ATOM   1569  N N6    . DA  C 1 21  ? 39.836  11.182  19.310 1.00 66.77  ? 21  DA  M N6    1 
ATOM   1570  N N1    . DA  C 1 21  ? 40.234  10.065  17.331 1.00 70.95  ? 21  DA  M N1    1 
ATOM   1571  C C2    . DA  C 1 21  ? 40.233  10.060  15.996 1.00 72.32  ? 21  DA  M C2    1 
ATOM   1572  N N3    . DA  C 1 21  ? 39.880  11.043  15.167 1.00 73.45  ? 21  DA  M N3    1 
ATOM   1573  C C4    . DA  C 1 21  ? 39.483  12.144  15.830 1.00 71.44  ? 21  DA  M C4    1 
ATOM   1574  P P     . DT  C 1 22  ? 35.030  14.073  11.445 1.00 78.17  ? 22  DT  M P     1 
ATOM   1575  O OP1   . DT  C 1 22  ? 34.593  14.193  10.045 1.00 82.72  ? 22  DT  M OP1   1 
ATOM   1576  O OP2   . DT  C 1 22  ? 34.301  14.774  12.523 1.00 75.34  ? 22  DT  M OP2   1 
ATOM   1577  O "O5'" . DT  C 1 22  ? 35.083  12.527  11.809 1.00 77.30  ? 22  DT  M "O5'" 1 
ATOM   1578  C "C5'" . DT  C 1 22  ? 35.995  11.669  11.141 1.00 79.80  ? 22  DT  M "C5'" 1 
ATOM   1579  C "C4'" . DT  C 1 22  ? 35.852  10.297  11.744 1.00 79.02  ? 22  DT  M "C4'" 1 
ATOM   1580  O "O4'" . DT  C 1 22  ? 36.510  10.298  13.023 1.00 75.66  ? 22  DT  M "O4'" 1 
ATOM   1581  C "C3'" . DT  C 1 22  ? 34.398  9.905   11.992 1.00 78.41  ? 22  DT  M "C3'" 1 
ATOM   1582  O "O3'" . DT  C 1 22  ? 34.097  8.825   11.114 1.00 82.05  ? 22  DT  M "O3'" 1 
ATOM   1583  C "C2'" . DT  C 1 22  ? 34.321  9.554   13.484 1.00 74.97  ? 22  DT  M "C2'" 1 
ATOM   1584  C "C1'" . DT  C 1 22  ? 35.788  9.473   13.908 1.00 74.28  ? 22  DT  M "C1'" 1 
ATOM   1585  N N1    . DT  C 1 22  ? 36.067  9.864   15.352 1.00 70.87  ? 22  DT  M N1    1 
ATOM   1586  C C2    . DT  C 1 22  ? 36.648  8.922   16.187 1.00 70.62  ? 22  DT  M C2    1 
ATOM   1587  O O2    . DT  C 1 22  ? 36.953  7.802   15.828 1.00 73.23  ? 22  DT  M O2    1 
ATOM   1588  N N3    . DT  C 1 22  ? 36.866  9.334   17.479 1.00 68.16  ? 22  DT  M N3    1 
ATOM   1589  C C4    . DT  C 1 22  ? 36.570  10.570  18.012 1.00 66.10  ? 22  DT  M C4    1 
ATOM   1590  O O4    . DT  C 1 22  ? 36.803  10.832  19.172 1.00 64.67  ? 22  DT  M O4    1 
ATOM   1591  C C5    . DT  C 1 22  ? 35.971  11.525  17.121 1.00 66.50  ? 22  DT  M C5    1 
ATOM   1592  C C7    . DT  C 1 22  ? 35.623  12.893  17.635 1.00 65.20  ? 22  DT  M C7    1 
ATOM   1593  C C6    . DT  C 1 22  ? 35.753  11.130  15.844 1.00 68.79  ? 22  DT  M C6    1 
ATOM   1594  P P     . DG  C 1 23  ? 32.605  8.362   10.780 1.00 83.28  ? 23  DG  M P     1 
ATOM   1595  O OP1   . DG  C 1 23  ? 32.637  7.751   9.433  1.00 88.39  ? 23  DG  M OP1   1 
ATOM   1596  O OP2   . DG  C 1 23  ? 31.613  9.436   11.028 1.00 81.23  ? 23  DG  M OP2   1 
ATOM   1597  O "O5'" . DG  C 1 23  ? 32.399  7.225   11.878 1.00 81.71  ? 23  DG  M "O5'" 1 
ATOM   1598  C "C5'" . DG  C 1 23  ? 33.343  6.164   11.980 1.00 84.05  ? 23  DG  M "C5'" 1 
ATOM   1599  C "C4'" . DG  C 1 23  ? 33.107  5.386   13.255 1.00 83.48  ? 23  DG  M "C4'" 1 
ATOM   1600  O "O4'" . DG  C 1 23  ? 33.777  6.066   14.345 1.00 80.32  ? 23  DG  M "O4'" 1 
ATOM   1601  C "C3'" . DG  C 1 23  ? 31.638  5.285   13.672 1.00 83.50  ? 23  DG  M "C3'" 1 
ATOM   1602  O "O3'" . DG  C 1 23  ? 31.173  3.955   13.386 1.00 87.33  ? 23  DG  M "O3'" 1 
ATOM   1603  C "C2'" . DG  C 1 23  ? 31.647  5.681   15.154 1.00 80.15  ? 23  DG  M "C2'" 1 
ATOM   1604  C "C1'" . DG  C 1 23  ? 33.130  5.635   15.513 1.00 79.69  ? 23  DG  M "C1'" 1 
ATOM   1605  N N9    . DG  C 1 23  ? 33.478  6.495   16.632 1.00 76.91  ? 23  DG  M N9    1 
ATOM   1606  C C8    . DG  C 1 23  ? 33.396  7.866   16.692 1.00 75.75  ? 23  DG  M C8    1 
ATOM   1607  N N7    . DG  C 1 23  ? 33.769  8.363   17.843 1.00 73.51  ? 23  DG  M N7    1 
ATOM   1608  C C5    . DG  C 1 23  ? 34.108  7.248   18.592 1.00 74.47  ? 23  DG  M C5    1 
ATOM   1609  C C6    . DG  C 1 23  ? 34.577  7.155   19.922 1.00 74.28  ? 23  DG  M C6    1 
ATOM   1610  O O6    . DG  C 1 23  ? 34.790  8.082   20.713 1.00 73.09  ? 23  DG  M O6    1 
ATOM   1611  N N1    . DG  C 1 23  ? 34.813  5.832   20.309 1.00 76.78  ? 23  DG  M N1    1 
ATOM   1612  C C2    . DG  C 1 23  ? 34.616  4.733   19.504 1.00 79.36  ? 23  DG  M C2    1 
ATOM   1613  N N2    . DG  C 1 23  ? 34.887  3.533   20.035 1.00 81.52  ? 23  DG  M N2    1 
ATOM   1614  N N3    . DG  C 1 23  ? 34.163  4.812   18.256 1.00 80.16  ? 23  DG  M N3    1 
ATOM   1615  C C4    . DG  C 1 23  ? 33.934  6.092   17.863 1.00 76.97  ? 23  DG  M C4    1 
ATOM   1616  P P     . DA  C 1 24  ? 30.220  3.065   14.321 1.00 87.91  ? 24  DA  M P     1 
ATOM   1617  O OP1   . DA  C 1 24  ? 29.768  1.916   13.500 1.00 92.61  ? 24  DA  M OP1   1 
ATOM   1618  O OP2   . DA  C 1 24  ? 29.210  3.894   15.012 1.00 84.22  ? 24  DA  M OP2   1 
ATOM   1619  O "O5'" . DA  C 1 24  ? 31.261  2.553   15.410 1.00 88.95  ? 24  DA  M "O5'" 1 
ATOM   1620  C "C5'" . DA  C 1 24  ? 31.976  1.349   15.211 1.00 94.14  ? 24  DA  M "C5'" 1 
ATOM   1621  C "C4'" . DA  C 1 24  ? 32.083  0.609   16.531 1.00 95.60  ? 24  DA  M "C4'" 1 
ATOM   1622  O "O4'" . DA  C 1 24  ? 32.530  1.524   17.561 1.00 92.03  ? 24  DA  M "O4'" 1 
ATOM   1623  C "C3'" . DA  C 1 24  ? 30.794  -0.019  17.042 1.00 97.00  ? 24  DA  M "C3'" 1 
ATOM   1624  O "O3'" . DA  C 1 24  ? 31.118  -1.309  17.535 1.00 101.62 ? 24  DA  M "O3'" 1 
ATOM   1625  C "C2'" . DA  C 1 24  ? 30.319  0.930   18.139 1.00 92.99  ? 24  DA  M "C2'" 1 
ATOM   1626  C "C1'" . DA  C 1 24  ? 31.606  1.578   18.622 1.00 91.81  ? 24  DA  M "C1'" 1 
ATOM   1627  N N9    . DA  C 1 24  ? 31.438  2.987   18.937 1.00 89.17  ? 24  DA  M N9    1 
ATOM   1628  C C8    . DA  C 1 24  ? 31.097  3.985   18.068 1.00 88.17  ? 24  DA  M C8    1 
ATOM   1629  N N7    . DA  C 1 24  ? 31.009  5.172   18.614 1.00 85.99  ? 24  DA  M N7    1 
ATOM   1630  C C5    . DA  C 1 24  ? 31.320  4.923   19.933 1.00 85.43  ? 24  DA  M C5    1 
ATOM   1631  C C6    . DA  C 1 24  ? 31.404  5.777   21.036 1.00 84.24  ? 24  DA  M C6    1 
ATOM   1632  N N6    . DA  C 1 24  ? 31.171  7.080   20.930 1.00 82.05  ? 24  DA  M N6    1 
ATOM   1633  N N1    . DA  C 1 24  ? 31.744  5.241   22.228 1.00 86.53  ? 24  DA  M N1    1 
ATOM   1634  C C2    . DA  C 1 24  ? 31.975  3.918   22.290 1.00 89.15  ? 24  DA  M C2    1 
ATOM   1635  N N3    . DA  C 1 24  ? 31.919  3.010   21.313 1.00 89.63  ? 24  DA  M N3    1 
ATOM   1636  C C4    . DA  C 1 24  ? 31.587  3.588   20.154 1.00 87.55  ? 24  DA  M C4    1 
ATOM   1637  P P     . DT  C 1 25  ? 30.078  -2.207  18.353 1.00 104.85 ? 25  DT  M P     1 
ATOM   1638  O OP1   . DT  C 1 25  ? 30.497  -3.609  18.144 1.00 111.33 ? 25  DT  M OP1   1 
ATOM   1639  O OP2   . DT  C 1 25  ? 28.690  -1.778  18.071 1.00 102.02 ? 25  DT  M OP2   1 
ATOM   1640  O "O5'" . DT  C 1 25  ? 30.386  -1.813  19.862 1.00 102.75 ? 25  DT  M "O5'" 1 
ATOM   1641  C "C5'" . DT  C 1 25  ? 31.654  -2.091  20.412 1.00 103.72 ? 25  DT  M "C5'" 1 
ATOM   1642  C "C4'" . DT  C 1 25  ? 31.580  -1.947  21.915 1.00 103.38 ? 25  DT  M "C4'" 1 
ATOM   1643  O "O4'" . DT  C 1 25  ? 31.371  -0.558  22.264 1.00 97.58  ? 25  DT  M "O4'" 1 
ATOM   1644  C "C3'" . DT  C 1 25  ? 30.448  -2.729  22.571 1.00 107.01 ? 25  DT  M "C3'" 1 
ATOM   1645  O "O3'" . DT  C 1 25  ? 31.042  -3.457  23.639 1.00 112.31 ? 25  DT  M "O3'" 1 
ATOM   1646  C "C2'" . DT  C 1 25  ? 29.453  -1.655  23.019 1.00 101.61 ? 25  DT  M "C2'" 1 
ATOM   1647  C "C1'" . DT  C 1 25  ? 30.374  -0.466  23.258 1.00 96.60  ? 25  DT  M "C1'" 1 
ATOM   1648  N N1    . DT  C 1 25  ? 29.766  0.884   23.109 1.00 90.66  ? 25  DT  M N1    1 
ATOM   1649  C C2    . DT  C 1 25  ? 29.846  1.781   24.158 1.00 87.85  ? 25  DT  M C2    1 
ATOM   1650  O O2    . DT  C 1 25  ? 30.368  1.543   25.230 1.00 88.61  ? 25  DT  M O2    1 
ATOM   1651  N N3    . DT  C 1 25  ? 29.265  2.995   23.913 1.00 84.01  ? 25  DT  M N3    1 
ATOM   1652  C C4    . DT  C 1 25  ? 28.634  3.398   22.754 1.00 82.86  ? 25  DT  M C4    1 
ATOM   1653  O O4    . DT  C 1 25  ? 28.157  4.520   22.659 1.00 80.66  ? 25  DT  M O4    1 
ATOM   1654  C C5    . DT  C 1 25  ? 28.585  2.416   21.687 1.00 85.31  ? 25  DT  M C5    1 
ATOM   1655  C C7    . DT  C 1 25  ? 27.928  2.724   20.371 1.00 83.15  ? 25  DT  M C7    1 
ATOM   1656  C C6    . DT  C 1 25  ? 29.153  1.223   21.914 1.00 88.66  ? 25  DT  M C6    1 
ATOM   1657  P P     . DT  C 1 26  ? 30.185  -4.325  24.661 1.00 118.02 ? 26  DT  M P     1 
ATOM   1658  O OP1   . DT  C 1 26  ? 31.114  -5.318  25.247 1.00 123.84 ? 26  DT  M OP1   1 
ATOM   1659  O OP2   . DT  C 1 26  ? 28.922  -4.754  24.019 1.00 119.21 ? 26  DT  M OP2   1 
ATOM   1660  O "O5'" . DT  C 1 26  ? 29.793  -3.240  25.760 1.00 116.18 ? 26  DT  M "O5'" 1 
ATOM   1661  C "C5'" . DT  C 1 26  ? 29.248  -3.686  26.980 1.00 122.26 ? 26  DT  M "C5'" 1 
ATOM   1662  C "C4'" . DT  C 1 26  ? 29.841  -2.899  28.134 1.00 122.41 ? 26  DT  M "C4'" 1 
ATOM   1663  O "O4'" . DT  C 1 26  ? 29.920  -1.491  27.783 1.00 116.26 ? 26  DT  M "O4'" 1 
ATOM   1664  C "C3'" . DT  C 1 26  ? 28.997  -2.972  29.395 1.00 126.68 ? 26  DT  M "C3'" 1 
ATOM   1665  O "O3'" . DT  C 1 26  ? 29.828  -2.876  30.555 1.00 129.94 ? 26  DT  M "O3'" 1 
ATOM   1666  C "C2'" . DT  C 1 26  ? 28.059  -1.780  29.213 1.00 122.01 ? 26  DT  M "C2'" 1 
ATOM   1667  C "C1'" . DT  C 1 26  ? 28.938  -0.758  28.492 1.00 116.20 ? 26  DT  M "C1'" 1 
ATOM   1668  N N1    . DT  C 1 26  ? 28.166  0.132   27.552 1.00 111.94 ? 26  DT  M N1    1 
ATOM   1669  C C2    . DT  C 1 26  ? 28.035  1.485   27.838 1.00 108.35 ? 26  DT  M C2    1 
ATOM   1670  O O2    . DT  C 1 26  ? 28.517  2.030   28.816 1.00 108.58 ? 26  DT  M O2    1 
ATOM   1671  N N3    . DT  C 1 26  ? 27.304  2.199   26.917 1.00 104.53 ? 26  DT  M N3    1 
ATOM   1672  C C4    . DT  C 1 26  ? 26.703  1.713   25.767 1.00 104.08 ? 26  DT  M C4    1 
ATOM   1673  O O4    . DT  C 1 26  ? 26.072  2.439   25.006 1.00 100.91 ? 26  DT  M O4    1 
ATOM   1674  C C5    . DT  C 1 26  ? 26.869  0.298   25.527 1.00 108.24 ? 26  DT  M C5    1 
ATOM   1675  C C7    . DT  C 1 26  ? 26.258  -0.340  24.311 1.00 109.46 ? 26  DT  M C7    1 
ATOM   1676  C C6    . DT  C 1 26  ? 27.580  -0.416  26.418 1.00 111.88 ? 26  DT  M C6    1 
ATOM   1677  P P     . DA  C 1 27  ? 29.196  -2.670  32.015 1.00 134.73 ? 27  DA  M P     1 
ATOM   1678  O OP1   . DA  C 1 27  ? 30.236  -3.034  33.004 1.00 139.18 ? 27  DA  M OP1   1 
ATOM   1679  O OP2   . DA  C 1 27  ? 27.868  -3.329  32.054 1.00 137.69 ? 27  DA  M OP2   1 
ATOM   1680  O "O5'" . DA  C 1 27  ? 28.967  -1.080  32.061 1.00 129.28 ? 27  DA  M "O5'" 1 
ATOM   1681  C "C5'" . DA  C 1 27  ? 28.663  -0.382  33.275 1.00 130.87 ? 27  DA  M "C5'" 1 
ATOM   1682  C "C4'" . DA  C 1 27  ? 27.234  0.148   33.304 1.00 129.72 ? 27  DA  M "C4'" 1 
ATOM   1683  O "O4'" . DA  C 1 27  ? 26.805  0.621   32.000 1.00 123.44 ? 27  DA  M "O4'" 1 
ATOM   1684  C "C3'" . DA  C 1 27  ? 26.184  -0.868  33.751 1.00 135.33 ? 27  DA  M "C3'" 1 
ATOM   1685  O "O3'" . DA  C 1 27  ? 25.838  -0.588  35.125 1.00 140.04 ? 27  DA  M "O3'" 1 
ATOM   1686  C "C2'" . DA  C 1 27  ? 25.045  -0.726  32.732 1.00 131.48 ? 27  DA  M "C2'" 1 
ATOM   1687  C "C1'" . DA  C 1 27  ? 25.397  0.538   31.953 1.00 124.23 ? 27  DA  M "C1'" 1 
ATOM   1688  N N9    . DA  C 1 27  ? 24.979  0.512   30.550 1.00 119.63 ? 27  DA  M N9    1 
ATOM   1689  C C8    . DA  C 1 27  ? 24.985  -0.572  29.715 1.00 120.48 ? 27  DA  M C8    1 
ATOM   1690  N N7    . DA  C 1 27  ? 24.563  -0.326  28.500 1.00 116.30 ? 27  DA  M N7    1 
ATOM   1691  C C5    . DA  C 1 27  ? 24.252  1.017   28.535 1.00 112.15 ? 27  DA  M C5    1 
ATOM   1692  C C6    . DA  C 1 27  ? 23.748  1.886   27.549 1.00 107.52 ? 27  DA  M C6    1 
ATOM   1693  N N6    . DA  C 1 27  ? 23.475  1.481   26.305 1.00 105.63 ? 27  DA  M N6    1 
ATOM   1694  N N1    . DA  C 1 27  ? 23.547  3.178   27.898 1.00 105.24 ? 27  DA  M N1    1 
ATOM   1695  C C2    . DA  C 1 27  ? 23.831  3.569   29.151 1.00 107.40 ? 27  DA  M C2    1 
ATOM   1696  N N3    . DA  C 1 27  ? 24.307  2.838   30.163 1.00 111.78 ? 27  DA  M N3    1 
ATOM   1697  C C4    . DA  C 1 27  ? 24.500  1.557   29.788 1.00 114.19 ? 27  DA  M C4    1 
ATOM   1698  P P     . DC  C 1 28  ? 24.348  -0.532  35.716 1.00 143.69 ? 28  DC  M P     1 
ATOM   1699  O OP1   . DC  C 1 28  ? 24.473  -0.220  37.157 1.00 149.56 ? 28  DC  M OP1   1 
ATOM   1700  O OP2   . DC  C 1 28  ? 23.601  -1.742  35.293 1.00 146.56 ? 28  DC  M OP2   1 
ATOM   1701  O "O5'" . DC  C 1 28  ? 23.706  0.726   34.964 1.00 136.60 ? 28  DC  M "O5'" 1 
ATOM   1702  C "C5'" . DC  C 1 28  ? 24.111  2.064   35.277 1.00 132.31 ? 28  DC  M "C5'" 1 
ATOM   1703  C "C4'" . DC  C 1 28  ? 22.960  3.045   35.085 1.00 129.06 ? 28  DC  M "C4'" 1 
ATOM   1704  O "O4'" . DC  C 1 28  ? 22.662  3.178   33.671 1.00 122.18 ? 28  DC  M "O4'" 1 
ATOM   1705  C "C3'" . DC  C 1 28  ? 21.643  2.673   35.770 1.00 134.10 ? 28  DC  M "C3'" 1 
ATOM   1706  O "O3'" . DC  C 1 28  ? 21.087  3.816   36.413 1.00 135.77 ? 28  DC  M "O3'" 1 
ATOM   1707  C "C2'" . DC  C 1 28  ? 20.756  2.171   34.631 1.00 130.32 ? 28  DC  M "C2'" 1 
ATOM   1708  C "C1'" . DC  C 1 28  ? 21.283  2.967   33.441 1.00 121.81 ? 28  DC  M "C1'" 1 
ATOM   1709  N N1    . DC  C 1 28  ? 21.131  2.336   32.088 1.00 116.40 ? 28  DC  M N1    1 
ATOM   1710  C C2    . DC  C 1 28  ? 20.773  3.152   31.005 1.00 110.38 ? 28  DC  M C2    1 
ATOM   1711  O O2    . DC  C 1 28  ? 20.583  4.359   31.195 1.00 108.49 ? 28  DC  M O2    1 
ATOM   1712  N N3    . DC  C 1 28  ? 20.635  2.600   29.770 1.00 106.84 ? 28  DC  M N3    1 
ATOM   1713  C C4    . DC  C 1 28  ? 20.846  1.293   29.597 1.00 109.03 ? 28  DC  M C4    1 
ATOM   1714  N N4    . DC  C 1 28  ? 20.699  0.801   28.365 1.00 106.04 ? 28  DC  M N4    1 
ATOM   1715  C C5    . DC  C 1 28  ? 21.216  0.439   30.684 1.00 114.98 ? 28  DC  M C5    1 
ATOM   1716  C C6    . DC  C 1 28  ? 21.349  0.997   31.898 1.00 118.18 ? 28  DC  M C6    1 
ATOM   1717  O "O5'" . DG  D 2 1   ? 15.160  7.194   22.246 1.00 110.91 ? 1   DG  N "O5'" 1 
ATOM   1718  C "C5'" . DG  D 2 1   ? 16.336  7.989   22.025 1.00 108.26 ? 1   DG  N "C5'" 1 
ATOM   1719  C "C4'" . DG  D 2 1   ? 16.676  8.856   23.234 1.00 106.35 ? 1   DG  N "C4'" 1 
ATOM   1720  O "O4'" . DG  D 2 1   ? 16.388  8.130   24.458 1.00 106.64 ? 1   DG  N "O4'" 1 
ATOM   1721  C "C3'" . DG  D 2 1   ? 18.134  9.299   23.315 1.00 103.20 ? 1   DG  N "C3'" 1 
ATOM   1722  O "O3'" . DG  D 2 1   ? 18.232  10.742  23.154 1.00 103.27 ? 1   DG  N "O3'" 1 
ATOM   1723  C "C2'" . DG  D 2 1   ? 18.641  8.797   24.663 1.00 102.41 ? 1   DG  N "C2'" 1 
ATOM   1724  C "C1'" . DG  D 2 1   ? 17.565  7.850   25.170 1.00 103.67 ? 1   DG  N "C1'" 1 
ATOM   1725  N N9    . DG  D 2 1   ? 17.974  6.464   24.975 1.00 102.31 ? 1   DG  N N9    1 
ATOM   1726  C C8    . DG  D 2 1   ? 17.848  5.680   23.855 1.00 101.68 ? 1   DG  N C8    1 
ATOM   1727  N N7    . DG  D 2 1   ? 18.348  4.485   24.002 1.00 101.94 ? 1   DG  N N7    1 
ATOM   1728  C C5    . DG  D 2 1   ? 18.845  4.482   25.296 1.00 101.18 ? 1   DG  N C5    1 
ATOM   1729  C C6    . DG  D 2 1   ? 19.496  3.457   26.018 1.00 101.27 ? 1   DG  N C6    1 
ATOM   1730  O O6    . DG  D 2 1   ? 19.767  2.311   25.628 1.00 101.58 ? 1   DG  N O6    1 
ATOM   1731  N N1    . DG  D 2 1   ? 19.832  3.874   27.308 1.00 101.37 ? 1   DG  N N1    1 
ATOM   1732  C C2    . DG  D 2 1   ? 19.566  5.127   27.824 1.00 101.18 ? 1   DG  N C2    1 
ATOM   1733  N N2    . DG  D 2 1   ? 19.957  5.371   29.079 1.00 102.22 ? 1   DG  N N2    1 
ATOM   1734  N N3    . DG  D 2 1   ? 18.956  6.091   27.157 1.00 100.40 ? 1   DG  N N3    1 
ATOM   1735  C C4    . DG  D 2 1   ? 18.627  5.696   25.906 1.00 101.26 ? 1   DG  N C4    1 
ATOM   1736  P P     . DT  D 2 2   ? 18.035  11.850  24.310 1.00 103.20 ? 2   DT  N P     1 
ATOM   1737  O OP1   . DT  D 2 2   ? 16.939  11.422  25.209 1.00 105.92 ? 2   DT  N OP1   1 
ATOM   1738  O OP2   . DT  D 2 2   ? 17.913  13.175  23.656 1.00 103.58 ? 2   DT  N OP2   1 
ATOM   1739  O "O5'" . DT  D 2 2   ? 19.439  11.770  25.080 1.00 99.59  ? 2   DT  N "O5'" 1 
ATOM   1740  C "C5'" . DT  D 2 2   ? 19.509  11.659  26.507 1.00 98.42  ? 2   DT  N "C5'" 1 
ATOM   1741  C "C4'" . DT  D 2 2   ? 20.815  11.025  26.962 1.00 94.80  ? 2   DT  N "C4'" 1 
ATOM   1742  O "O4'" . DT  D 2 2   ? 20.756  9.576   26.839 1.00 94.29  ? 2   DT  N "O4'" 1 
ATOM   1743  C "C3'" . DT  D 2 2   ? 22.070  11.465  26.200 1.00 91.81  ? 2   DT  N "C3'" 1 
ATOM   1744  O "O3'" . DT  D 2 2   ? 23.097  11.824  27.093 1.00 91.05  ? 2   DT  N "O3'" 1 
ATOM   1745  C "C2'" . DT  D 2 2   ? 22.510  10.187  25.499 1.00 90.69  ? 2   DT  N "C2'" 1 
ATOM   1746  C "C1'" . DT  D 2 2   ? 22.084  9.179   26.562 1.00 91.91  ? 2   DT  N "C1'" 1 
ATOM   1747  N N1    . DT  D 2 2   ? 22.254  7.717   26.192 1.00 90.96  ? 2   DT  N N1    1 
ATOM   1748  C C2    . DT  D 2 2   ? 22.732  6.834   27.145 1.00 91.19  ? 2   DT  N C2    1 
ATOM   1749  O O2    . DT  D 2 2   ? 23.013  7.147   28.288 1.00 91.86  ? 2   DT  N O2    1 
ATOM   1750  N N3    . DT  D 2 2   ? 22.875  5.538   26.714 1.00 91.35  ? 2   DT  N N3    1 
ATOM   1751  C C4    . DT  D 2 2   ? 22.599  5.036   25.454 1.00 91.09  ? 2   DT  N C4    1 
ATOM   1752  O O4    . DT  D 2 2   ? 22.764  3.851   25.180 1.00 90.71  ? 2   DT  N O4    1 
ATOM   1753  C C5    . DT  D 2 2   ? 22.107  6.007   24.500 1.00 90.68  ? 2   DT  N C5    1 
ATOM   1754  C C7    . DT  D 2 2   ? 21.770  5.596   23.095 1.00 91.02  ? 2   DT  N C7    1 
ATOM   1755  C C6    . DT  D 2 2   ? 21.965  7.279   24.910 1.00 90.50  ? 2   DT  N C6    1 
ATOM   1756  P P     . DA  D 2 3   ? 23.358  13.320  27.577 1.00 90.72  ? 3   DA  N P     1 
ATOM   1757  O OP1   . DA  D 2 3   ? 22.158  13.780  28.318 1.00 91.61  ? 3   DA  N OP1   1 
ATOM   1758  O OP2   . DA  D 2 3   ? 23.911  14.101  26.449 1.00 89.73  ? 3   DA  N OP2   1 
ATOM   1759  O "O5'" . DA  D 2 3   ? 24.573  13.074  28.587 1.00 88.62  ? 3   DA  N "O5'" 1 
ATOM   1760  C "C5'" . DA  D 2 3   ? 24.339  12.432  29.838 1.00 90.18  ? 3   DA  N "C5'" 1 
ATOM   1761  C "C4'" . DA  D 2 3   ? 25.429  11.431  30.175 1.00 88.47  ? 3   DA  N "C4'" 1 
ATOM   1762  O "O4'" . DA  D 2 3   ? 25.231  10.199  29.436 1.00 87.78  ? 3   DA  N "O4'" 1 
ATOM   1763  C "C3'" . DA  D 2 3   ? 26.856  11.883  29.874 1.00 86.00  ? 3   DA  N "C3'" 1 
ATOM   1764  O "O3'" . DA  D 2 3   ? 27.624  11.634  31.020 1.00 86.78  ? 3   DA  N "O3'" 1 
ATOM   1765  C "C2'" . DA  D 2 3   ? 27.303  10.993  28.713 1.00 83.84  ? 3   DA  N "C2'" 1 
ATOM   1766  C "C1'" . DA  D 2 3   ? 26.493  9.735   28.989 1.00 85.44  ? 3   DA  N "C1'" 1 
ATOM   1767  N N9    . DA  D 2 3   ? 26.252  8.871   27.838 1.00 84.16  ? 3   DA  N N9    1 
ATOM   1768  C C8    . DA  D 2 3   ? 25.794  9.230   26.603 1.00 83.26  ? 3   DA  N C8    1 
ATOM   1769  N N7    . DA  D 2 3   ? 25.659  8.226   25.773 1.00 82.99  ? 3   DA  N N7    1 
ATOM   1770  C C5    . DA  D 2 3   ? 26.050  7.134   26.521 1.00 83.31  ? 3   DA  N C5    1 
ATOM   1771  C C6    . DA  D 2 3   ? 26.133  5.764   26.223 1.00 83.91  ? 3   DA  N C6    1 
ATOM   1772  N N6    . DA  D 2 3   ? 25.813  5.253   25.033 1.00 83.70  ? 3   DA  N N6    1 
ATOM   1773  N N1    . DA  D 2 3   ? 26.566  4.935   27.196 1.00 85.67  ? 3   DA  N N1    1 
ATOM   1774  C C2    . DA  D 2 3   ? 26.891  5.440   28.394 1.00 86.03  ? 3   DA  N C2    1 
ATOM   1775  N N3    . DA  D 2 3   ? 26.851  6.712   28.793 1.00 85.58  ? 3   DA  N N3    1 
ATOM   1776  C C4    . DA  D 2 3   ? 26.416  7.510   27.798 1.00 84.29  ? 3   DA  N C4    1 
ATOM   1777  P P     . DA  D 2 4   ? 29.061  12.297  31.218 1.00 86.26  ? 4   DA  N P     1 
ATOM   1778  O OP1   . DA  D 2 4   ? 28.843  13.327  32.263 1.00 88.29  ? 4   DA  N OP1   1 
ATOM   1779  O OP2   . DA  D 2 4   ? 29.659  12.631  29.897 1.00 83.25  ? 4   DA  N OP2   1 
ATOM   1780  O "O5'" . DA  D 2 4   ? 29.969  11.117  31.814 1.00 84.35  ? 4   DA  N "O5'" 1 
ATOM   1781  C "C5'" . DA  D 2 4   ? 29.374  9.981   32.444 1.00 84.05  ? 4   DA  N "C5'" 1 
ATOM   1782  C "C4'" . DA  D 2 4   ? 30.139  8.709   32.132 1.00 80.92  ? 4   DA  N "C4'" 1 
ATOM   1783  O "O4'" . DA  D 2 4   ? 29.645  8.104   30.916 1.00 78.62  ? 4   DA  N "O4'" 1 
ATOM   1784  C "C3'" . DA  D 2 4   ? 31.642  8.877   31.952 1.00 78.35  ? 4   DA  N "C3'" 1 
ATOM   1785  O "O3'" . DA  D 2 4   ? 32.234  7.944   32.840 1.00 79.38  ? 4   DA  N "O3'" 1 
ATOM   1786  C "C2'" . DA  D 2 4   ? 31.893  8.574   30.473 1.00 74.98  ? 4   DA  N "C2'" 1 
ATOM   1787  C "C1'" . DA  D 2 4   ? 30.727  7.656   30.132 1.00 76.03  ? 4   DA  N "C1'" 1 
ATOM   1788  N N9    . DA  D 2 4   ? 30.283  7.681   28.737 1.00 74.80  ? 4   DA  N N9    1 
ATOM   1789  C C8    . DA  D 2 4   ? 29.935  8.776   28.000 1.00 73.72  ? 4   DA  N C8    1 
ATOM   1790  N N7    . DA  D 2 4   ? 29.558  8.513   26.773 1.00 73.65  ? 4   DA  N N7    1 
ATOM   1791  C C5    . DA  D 2 4   ? 29.663  7.138   26.694 1.00 74.84  ? 4   DA  N C5    1 
ATOM   1792  C C6    . DA  D 2 4   ? 29.409  6.226   25.646 1.00 75.69  ? 4   DA  N C6    1 
ATOM   1793  N N6    . DA  D 2 4   ? 28.977  6.586   24.432 1.00 73.75  ? 4   DA  N N6    1 
ATOM   1794  N N1    . DA  D 2 4   ? 29.621  4.915   25.900 1.00 77.80  ? 4   DA  N N1    1 
ATOM   1795  C C2    . DA  D 2 4   ? 30.048  4.540   27.113 1.00 78.04  ? 4   DA  N C2    1 
ATOM   1796  N N3    . DA  D 2 4   ? 30.318  5.306   28.168 1.00 77.34  ? 4   DA  N N3    1 
ATOM   1797  C C4    . DA  D 2 4   ? 30.104  6.607   27.894 1.00 75.43  ? 4   DA  N C4    1 
ATOM   1798  P P     . DT  D 2 5   ? 33.800  7.820   33.074 1.00 78.10  ? 5   DT  N P     1 
ATOM   1799  O OP1   . DT  D 2 5   ? 33.934  7.234   34.417 1.00 82.35  ? 5   DT  N OP1   1 
ATOM   1800  O OP2   . DT  D 2 5   ? 34.476  9.091   32.741 1.00 76.77  ? 5   DT  N OP2   1 
ATOM   1801  O "O5'" . DT  D 2 5   ? 34.260  6.718   32.015 1.00 77.55  ? 5   DT  N "O5'" 1 
ATOM   1802  C "C5'" . DT  D 2 5   ? 33.598  5.461   31.974 1.00 78.95  ? 5   DT  N "C5'" 1 
ATOM   1803  C "C4'" . DT  D 2 5   ? 33.926  4.707   30.698 1.00 77.68  ? 5   DT  N "C4'" 1 
ATOM   1804  O "O4'" . DT  D 2 5   ? 33.242  5.270   29.551 1.00 75.79  ? 5   DT  N "O4'" 1 
ATOM   1805  C "C3'" . DT  D 2 5   ? 35.405  4.662   30.327 1.00 75.68  ? 5   DT  N "C3'" 1 
ATOM   1806  O "O3'" . DT  D 2 5   ? 35.805  3.320   30.538 1.00 77.01  ? 5   DT  N "O3'" 1 
ATOM   1807  C "C2'" . DT  D 2 5   ? 35.448  5.092   28.856 1.00 73.94  ? 5   DT  N "C2'" 1 
ATOM   1808  C "C1'" . DT  D 2 5   ? 33.995  4.877   28.427 1.00 75.36  ? 5   DT  N "C1'" 1 
ATOM   1809  N N1    . DT  D 2 5   ? 33.506  5.629   27.229 1.00 73.77  ? 5   DT  N N1    1 
ATOM   1810  C C2    . DT  D 2 5   ? 33.060  4.917   26.119 1.00 76.10  ? 5   DT  N C2    1 
ATOM   1811  O O2    . DT  D 2 5   ? 33.055  3.694   26.054 1.00 78.24  ? 5   DT  N O2    1 
ATOM   1812  N N3    . DT  D 2 5   ? 32.607  5.691   25.066 1.00 74.78  ? 5   DT  N N3    1 
ATOM   1813  C C4    . DT  D 2 5   ? 32.574  7.077   25.028 1.00 72.36  ? 5   DT  N C4    1 
ATOM   1814  O O4    . DT  D 2 5   ? 32.163  7.673   24.041 1.00 70.30  ? 5   DT  N O4    1 
ATOM   1815  C C5    . DT  D 2 5   ? 33.055  7.753   26.228 1.00 71.58  ? 5   DT  N C5    1 
ATOM   1816  C C7    . DT  D 2 5   ? 33.070  9.251   26.319 1.00 70.50  ? 5   DT  N C7    1 
ATOM   1817  C C6    . DT  D 2 5   ? 33.490  7.011   27.255 1.00 71.52  ? 5   DT  N C6    1 
ATOM   1818  P P     . DC  D 2 6   ? 37.293  2.802   30.278 1.00 76.87  ? 6   DC  N P     1 
ATOM   1819  O OP1   . DC  D 2 6   ? 37.549  1.665   31.187 1.00 79.44  ? 6   DC  N OP1   1 
ATOM   1820  O OP2   . DC  D 2 6   ? 38.213  3.961   30.268 1.00 73.33  ? 6   DC  N OP2   1 
ATOM   1821  O "O5'" . DC  D 2 6   ? 37.143  2.245   28.784 1.00 77.95  ? 6   DC  N "O5'" 1 
ATOM   1822  C "C5'" . DC  D 2 6   ? 36.154  1.262   28.455 1.00 79.45  ? 6   DC  N "C5'" 1 
ATOM   1823  C "C4'" . DC  D 2 6   ? 36.093  1.032   26.958 1.00 79.69  ? 6   DC  N "C4'" 1 
ATOM   1824  O "O4'" . DC  D 2 6   ? 35.584  2.213   26.302 1.00 78.40  ? 6   DC  N "O4'" 1 
ATOM   1825  C "C3'" . DC  D 2 6   ? 37.424  0.753   26.275 1.00 80.37  ? 6   DC  N "C3'" 1 
ATOM   1826  O "O3'" . DC  D 2 6   ? 37.310  -0.417  25.500 1.00 82.54  ? 6   DC  N "O3'" 1 
ATOM   1827  C "C2'" . DC  D 2 6   ? 37.680  1.953   25.368 1.00 77.94  ? 6   DC  N "C2'" 1 
ATOM   1828  C "C1'" . DC  D 2 6   ? 36.253  2.361   25.069 1.00 78.36  ? 6   DC  N "C1'" 1 
ATOM   1829  N N1    . DC  D 2 6   ? 36.112  3.771   24.608 1.00 77.42  ? 6   DC  N N1    1 
ATOM   1830  C C2    . DC  D 2 6   ? 35.640  4.033   23.315 1.00 77.37  ? 6   DC  N C2    1 
ATOM   1831  O O2    . DC  D 2 6   ? 35.346  3.089   22.569 1.00 79.33  ? 6   DC  N O2    1 
ATOM   1832  N N3    . DC  D 2 6   ? 35.519  5.330   22.926 1.00 75.86  ? 6   DC  N N3    1 
ATOM   1833  C C4    . DC  D 2 6   ? 35.839  6.322   23.764 1.00 74.14  ? 6   DC  N C4    1 
ATOM   1834  N N4    . DC  D 2 6   ? 35.704  7.576   23.338 1.00 73.09  ? 6   DC  N N4    1 
ATOM   1835  C C5    . DC  D 2 6   ? 36.320  6.079   25.081 1.00 74.46  ? 6   DC  N C5    1 
ATOM   1836  C C6    . DC  D 2 6   ? 36.440  4.800   25.455 1.00 76.26  ? 6   DC  N C6    1 
ATOM   1837  P P     . DA  D 2 7   ? 38.623  -1.289  25.262 1.00 83.81  ? 7   DA  N P     1 
ATOM   1838  O OP1   . DA  D 2 7   ? 38.128  -2.636  24.915 1.00 87.92  ? 7   DA  N OP1   1 
ATOM   1839  O OP2   . DA  D 2 7   ? 39.514  -1.102  26.431 1.00 82.78  ? 7   DA  N OP2   1 
ATOM   1840  O "O5'" . DA  D 2 7   ? 39.314  -0.629  23.968 1.00 81.48  ? 7   DA  N "O5'" 1 
ATOM   1841  C "C5'" . DA  D 2 7   ? 38.599  -0.554  22.747 1.00 80.56  ? 7   DA  N "C5'" 1 
ATOM   1842  C "C4'" . DA  D 2 7   ? 39.166  0.421   21.724 1.00 78.49  ? 7   DA  N "C4'" 1 
ATOM   1843  O "O4'" . DA  D 2 7   ? 38.475  1.687   21.834 1.00 76.08  ? 7   DA  N "O4'" 1 
ATOM   1844  C "C3'" . DA  D 2 7   ? 40.649  0.794   21.762 1.00 77.04  ? 7   DA  N "C3'" 1 
ATOM   1845  O "O3'" . DA  D 2 7   ? 41.392  -0.009  20.851 1.00 78.68  ? 7   DA  N "O3'" 1 
ATOM   1846  C "C2'" . DA  D 2 7   ? 40.646  2.249   21.292 1.00 74.51  ? 7   DA  N "C2'" 1 
ATOM   1847  C "C1'" . DA  D 2 7   ? 39.181  2.554   20.983 1.00 75.24  ? 7   DA  N "C1'" 1 
ATOM   1848  N N9    . DA  D 2 7   ? 38.863  3.956   21.249 1.00 73.05  ? 7   DA  N N9    1 
ATOM   1849  C C8    . DA  D 2 7   ? 38.946  4.588   22.456 1.00 71.89  ? 7   DA  N C8    1 
ATOM   1850  N N7    . DA  D 2 7   ? 38.628  5.856   22.418 1.00 70.29  ? 7   DA  N N7    1 
ATOM   1851  C C5    . DA  D 2 7   ? 38.328  6.082   21.094 1.00 70.44  ? 7   DA  N C5    1 
ATOM   1852  C C6    . DA  D 2 7   ? 37.915  7.241   20.403 1.00 69.86  ? 7   DA  N C6    1 
ATOM   1853  N N6    . DA  D 2 7   ? 37.747  8.419   21.003 1.00 66.86  ? 7   DA  N N6    1 
ATOM   1854  N N1    . DA  D 2 7   ? 37.683  7.138   19.069 1.00 71.68  ? 7   DA  N N1    1 
ATOM   1855  C C2    . DA  D 2 7   ? 37.863  5.949   18.477 1.00 73.31  ? 7   DA  N C2    1 
ATOM   1856  N N3    . DA  D 2 7   ? 38.256  4.794   19.032 1.00 74.75  ? 7   DA  N N3    1 
ATOM   1857  C C4    . DA  D 2 7   ? 38.474  4.924   20.353 1.00 72.68  ? 7   DA  N C4    1 
ATOM   1858  P P     . DT  D 2 8   ? 42.938  0.271   20.524 1.00 79.29  ? 8   DT  N P     1 
ATOM   1859  O OP1   . DT  D 2 8   ? 43.509  -1.007  20.074 1.00 85.58  ? 8   DT  N OP1   1 
ATOM   1860  O OP2   . DT  D 2 8   ? 43.589  0.948   21.673 1.00 77.13  ? 8   DT  N OP2   1 
ATOM   1861  O "O5'" . DT  D 2 8   ? 42.967  1.292   19.296 1.00 78.21  ? 8   DT  N "O5'" 1 
ATOM   1862  C "C5'" . DT  D 2 8   ? 42.335  1.027   18.062 1.00 81.90  ? 8   DT  N "C5'" 1 
ATOM   1863  C "C4'" . DT  D 2 8   ? 42.372  2.274   17.194 1.00 81.87  ? 8   DT  N "C4'" 1 
ATOM   1864  O "O4'" . DT  D 2 8   ? 41.700  3.386   17.854 1.00 78.72  ? 8   DT  N "O4'" 1 
ATOM   1865  C "C3'" . DT  D 2 8   ? 43.776  2.779   16.872 1.00 82.38  ? 8   DT  N "C3'" 1 
ATOM   1866  O "O3'" . DT  D 2 8   ? 44.001  2.761   15.468 1.00 85.55  ? 8   DT  N "O3'" 1 
ATOM   1867  C "C2'" . DT  D 2 8   ? 43.805  4.208   17.417 1.00 78.48  ? 8   DT  N "C2'" 1 
ATOM   1868  C "C1'" . DT  D 2 8   ? 42.326  4.569   17.403 1.00 77.86  ? 8   DT  N "C1'" 1 
ATOM   1869  N N1    . DT  D 2 8   ? 41.971  5.767   18.250 1.00 75.21  ? 8   DT  N N1    1 
ATOM   1870  C C2    . DT  D 2 8   ? 41.538  6.936   17.635 1.00 75.03  ? 8   DT  N C2    1 
ATOM   1871  O O2    . DT  D 2 8   ? 41.409  7.088   16.434 1.00 76.75  ? 8   DT  N O2    1 
ATOM   1872  N N3    . DT  D 2 8   ? 41.252  7.969   18.486 1.00 73.11  ? 8   DT  N N3    1 
ATOM   1873  C C4    . DT  D 2 8   ? 41.344  7.961   19.864 1.00 71.84  ? 8   DT  N C4    1 
ATOM   1874  O O4    . DT  D 2 8   ? 41.057  8.961   20.516 1.00 71.27  ? 8   DT  N O4    1 
ATOM   1875  C C5    . DT  D 2 8   ? 41.801  6.716   20.451 1.00 71.75  ? 8   DT  N C5    1 
ATOM   1876  C C7    . DT  D 2 8   ? 41.942  6.572   21.935 1.00 69.91  ? 8   DT  N C7    1 
ATOM   1877  C C6    . DT  D 2 8   ? 42.088  5.697   19.628 1.00 73.84  ? 8   DT  N C6    1 
ATOM   1878  P P     . DG  D 2 9   ? 45.467  2.417   14.932 1.00 89.25  ? 9   DG  N P     1 
ATOM   1879  O OP1   . DG  D 2 9   ? 45.440  2.333   13.461 1.00 93.59  ? 9   DG  N OP1   1 
ATOM   1880  O OP2   . DG  D 2 9   ? 45.952  1.252   15.695 1.00 91.88  ? 9   DG  N OP2   1 
ATOM   1881  O "O5'" . DG  D 2 9   ? 46.335  3.687   15.370 1.00 86.96  ? 9   DG  N "O5'" 1 
ATOM   1882  C "C5'" . DG  D 2 9   ? 46.759  4.628   14.400 1.00 89.03  ? 9   DG  N "C5'" 1 
ATOM   1883  C "C4'" . DG  D 2 9   ? 45.702  5.662   14.053 1.00 88.38  ? 9   DG  N "C4'" 1 
ATOM   1884  O "O4'" . DG  D 2 9   ? 44.932  6.048   15.212 1.00 85.11  ? 9   DG  N "O4'" 1 
ATOM   1885  C "C3'" . DG  D 2 9   ? 46.336  6.984   13.688 1.00 87.98  ? 9   DG  N "C3'" 1 
ATOM   1886  O "O3'" . DG  D 2 9   ? 46.813  6.967   12.383 1.00 91.40  ? 9   DG  N "O3'" 1 
ATOM   1887  C "C2'" . DG  D 2 9   ? 45.183  7.950   13.811 1.00 85.99  ? 9   DG  N "C2'" 1 
ATOM   1888  C "C1'" . DG  D 2 9   ? 44.395  7.333   14.955 1.00 84.41  ? 9   DG  N "C1'" 1 
ATOM   1889  N N9    . DG  D 2 9   ? 44.300  8.137   16.173 1.00 81.74  ? 9   DG  N N9    1 
ATOM   1890  C C8    . DG  D 2 9   ? 44.503  7.713   17.463 1.00 80.15  ? 9   DG  N C8    1 
ATOM   1891  N N7    . DG  D 2 9   ? 44.310  8.643   18.353 1.00 77.42  ? 9   DG  N N7    1 
ATOM   1892  C C5    . DG  D 2 9   ? 43.950  9.763   17.618 1.00 78.22  ? 9   DG  N C5    1 
ATOM   1893  C C6    . DG  D 2 9   ? 43.618  11.080  18.038 1.00 76.98  ? 9   DG  N C6    1 
ATOM   1894  O O6    . DG  D 2 9   ? 43.584  11.532  19.187 1.00 77.30  ? 9   DG  N O6    1 
ATOM   1895  N N1    . DG  D 2 9   ? 43.305  11.928  16.979 1.00 78.08  ? 9   DG  N N1    1 
ATOM   1896  C C2    . DG  D 2 9   ? 43.309  11.542  15.656 1.00 80.86  ? 9   DG  N C2    1 
ATOM   1897  N N2    . DG  D 2 9   ? 42.983  12.482  14.759 1.00 80.90  ? 9   DG  N N2    1 
ATOM   1898  N N3    . DG  D 2 9   ? 43.618  10.312  15.246 1.00 82.70  ? 9   DG  N N3    1 
ATOM   1899  C C4    . DG  D 2 9   ? 43.930  9.468   16.271 1.00 80.85  ? 9   DG  N C4    1 
ATOM   1900  P P     . DT  D 2 10  ? 48.070  7.892   12.032 1.00 92.30  ? 10  DT  N P     1 
ATOM   1901  O OP1   . DT  D 2 10  ? 48.543  7.483   10.683 1.00 97.92  ? 10  DT  N OP1   1 
ATOM   1902  O OP2   . DT  D 2 10  ? 49.016  7.935   13.167 1.00 88.29  ? 10  DT  N OP2   1 
ATOM   1903  O "O5'" . DT  D 2 10  ? 47.370  9.319   11.912 1.00 90.05  ? 10  DT  N "O5'" 1 
ATOM   1904  C "C5'" . DT  D 2 10  ? 46.525  9.601   10.814 1.00 92.33  ? 10  DT  N "C5'" 1 
ATOM   1905  C "C4'" . DT  D 2 10  ? 46.417  11.099  10.647 1.00 91.64  ? 10  DT  N "C4'" 1 
ATOM   1906  O "O4'" . DT  D 2 10  ? 45.967  11.683  11.891 1.00 87.99  ? 10  DT  N "O4'" 1 
ATOM   1907  C "C3'" . DT  D 2 10  ? 47.714  11.816  10.307 1.00 93.20  ? 10  DT  N "C3'" 1 
ATOM   1908  O "O3'" . DT  D 2 10  ? 47.363  12.843  9.368  1.00 95.91  ? 10  DT  N "O3'" 1 
ATOM   1909  C "C2'" . DT  D 2 10  ? 48.228  12.301  11.671 1.00 88.43  ? 10  DT  N "C2'" 1 
ATOM   1910  C "C1'" . DT  D 2 10  ? 46.921  12.605  12.392 1.00 86.05  ? 10  DT  N "C1'" 1 
ATOM   1911  N N1    . DT  D 2 10  ? 46.864  12.478  13.887 1.00 82.71  ? 10  DT  N N1    1 
ATOM   1912  C C2    . DT  D 2 10  ? 46.436  13.568  14.622 1.00 79.98  ? 10  DT  N C2    1 
ATOM   1913  O O2    . DT  D 2 10  ? 46.133  14.632  14.124 1.00 81.81  ? 10  DT  N O2    1 
ATOM   1914  N N3    . DT  D 2 10  ? 46.381  13.376  15.975 1.00 76.22  ? 10  DT  N N3    1 
ATOM   1915  C C4    . DT  D 2 10  ? 46.701  12.216  16.654 1.00 76.26  ? 10  DT  N C4    1 
ATOM   1916  O O4    . DT  D 2 10  ? 46.612  12.157  17.877 1.00 74.02  ? 10  DT  N O4    1 
ATOM   1917  C C5    . DT  D 2 10  ? 47.143  11.102  15.831 1.00 79.10  ? 10  DT  N C5    1 
ATOM   1918  C C7    . DT  D 2 10  ? 47.521  9.783   16.438 1.00 78.60  ? 10  DT  N C7    1 
ATOM   1919  C C6    . DT  D 2 10  ? 47.192  11.283  14.504 1.00 82.22  ? 10  DT  N C6    1 
ATOM   1920  P P     . DA  D 2 11  ? 48.170  14.217  9.209  1.00 97.34  ? 11  DA  N P     1 
ATOM   1921  O OP1   . DA  D 2 11  ? 47.780  14.766  7.892  1.00 99.46  ? 11  DA  N OP1   1 
ATOM   1922  O OP2   . DA  D 2 11  ? 49.600  14.010  9.562  1.00 97.05  ? 11  DA  N OP2   1 
ATOM   1923  O "O5'" . DA  D 2 11  ? 47.577  15.117  10.386 1.00 92.99  ? 11  DA  N "O5'" 1 
ATOM   1924  C "C5'" . DA  D 2 11  ? 46.463  15.952  10.158 1.00 92.56  ? 11  DA  N "C5'" 1 
ATOM   1925  C "C4'" . DA  D 2 11  ? 46.722  17.299  10.802 1.00 91.01  ? 11  DA  N "C4'" 1 
ATOM   1926  O "O4'" . DA  D 2 11  ? 46.871  17.143  12.235 1.00 86.02  ? 11  DA  N "O4'" 1 
ATOM   1927  C "C3'" . DA  D 2 11  ? 47.952  18.055  10.319 1.00 93.51  ? 11  DA  N "C3'" 1 
ATOM   1928  O "O3'" . DA  D 2 11  ? 47.485  19.381  10.128 1.00 96.33  ? 11  DA  N "O3'" 1 
ATOM   1929  C "C2'" . DA  D 2 11  ? 48.959  17.896  11.463 1.00 89.87  ? 11  DA  N "C2'" 1 
ATOM   1930  C "C1'" . DA  D 2 11  ? 48.058  17.750  12.686 1.00 85.28  ? 11  DA  N "C1'" 1 
ATOM   1931  N N9    . DA  D 2 11  ? 48.489  16.854  13.757 1.00 82.25  ? 11  DA  N N9    1 
ATOM   1932  C C8    . DA  D 2 11  ? 49.077  15.624  13.643 1.00 82.39  ? 11  DA  N C8    1 
ATOM   1933  N N7    . DA  D 2 11  ? 49.317  15.042  14.795 1.00 79.19  ? 11  DA  N N7    1 
ATOM   1934  C C5    . DA  D 2 11  ? 48.842  15.945  15.734 1.00 76.87  ? 11  DA  N C5    1 
ATOM   1935  C C6    . DA  D 2 11  ? 48.794  15.934  17.149 1.00 73.62  ? 11  DA  N C6    1 
ATOM   1936  N N6    . DA  D 2 11  ? 49.259  14.931  17.905 1.00 72.18  ? 11  DA  N N6    1 
ATOM   1937  N N1    . DA  D 2 11  ? 48.252  17.005  17.770 1.00 71.87  ? 11  DA  N N1    1 
ATOM   1938  C C2    . DA  D 2 11  ? 47.786  18.019  17.033 1.00 72.86  ? 11  DA  N C2    1 
ATOM   1939  N N3    . DA  D 2 11  ? 47.776  18.140  15.706 1.00 76.39  ? 11  DA  N N3    1 
ATOM   1940  C C4    . DA  D 2 11  ? 48.322  17.065  15.109 1.00 78.29  ? 11  DA  N C4    1 
ATOM   1941  P P     . DA  D 2 12  ? 48.342  20.604  9.553  1.00 100.82 ? 12  DA  N P     1 
ATOM   1942  O OP1   . DA  D 2 12  ? 47.407  21.397  8.714  1.00 102.83 ? 12  DA  N OP1   1 
ATOM   1943  O OP2   . DA  D 2 12  ? 49.626  20.122  8.994  1.00 102.50 ? 12  DA  N OP2   1 
ATOM   1944  O "O5'" . DA  D 2 12  ? 48.661  21.416  10.892 1.00 97.83  ? 12  DA  N "O5'" 1 
ATOM   1945  C "C5'" . DA  D 2 12  ? 47.618  21.608  11.851 1.00 96.59  ? 12  DA  N "C5'" 1 
ATOM   1946  C "C4'" . DA  D 2 12  ? 48.168  22.149  13.154 1.00 94.71  ? 12  DA  N "C4'" 1 
ATOM   1947  O "O4'" . DA  D 2 12  ? 48.627  21.052  13.978 1.00 91.98  ? 12  DA  N "O4'" 1 
ATOM   1948  C "C3'" . DA  D 2 12  ? 49.356  23.087  12.978 1.00 97.53  ? 12  DA  N "C3'" 1 
ATOM   1949  O "O3'" . DA  D 2 12  ? 49.073  24.295  13.675 1.00 98.65  ? 12  DA  N "O3'" 1 
ATOM   1950  C "C2'" . DA  D 2 12  ? 50.547  22.311  13.549 1.00 95.15  ? 12  DA  N "C2'" 1 
ATOM   1951  C "C1'" . DA  D 2 12  ? 49.852  21.427  14.574 1.00 91.54  ? 12  DA  N "C1'" 1 
ATOM   1952  N N9    . DA  D 2 12  ? 50.561  20.205  14.949 1.00 90.67  ? 12  DA  N N9    1 
ATOM   1953  C C8    . DA  D 2 12  ? 51.215  19.327  14.126 1.00 92.56  ? 12  DA  N C8    1 
ATOM   1954  N N7    . DA  D 2 12  ? 51.755  18.311  14.763 1.00 91.00  ? 12  DA  N N7    1 
ATOM   1955  C C5    . DA  D 2 12  ? 51.426  18.532  16.089 1.00 87.48  ? 12  DA  N C5    1 
ATOM   1956  C C6    . DA  D 2 12  ? 51.691  17.816  17.272 1.00 84.94  ? 12  DA  N C6    1 
ATOM   1957  N N6    . DA  D 2 12  ? 52.392  16.684  17.301 1.00 85.99  ? 12  DA  N N6    1 
ATOM   1958  N N1    . DA  D 2 12  ? 51.218  18.306  18.435 1.00 82.71  ? 12  DA  N N1    1 
ATOM   1959  C C2    . DA  D 2 12  ? 50.526  19.449  18.419 1.00 83.06  ? 12  DA  N C2    1 
ATOM   1960  N N3    . DA  D 2 12  ? 50.209  20.209  17.370 1.00 85.34  ? 12  DA  N N3    1 
ATOM   1961  C C4    . DA  D 2 12  ? 50.694  19.695  16.225 1.00 87.44  ? 12  DA  N C4    1 
ATOM   1962  P P     . DC  D 2 13  ? 50.036  25.574  13.580 1.00 102.74 ? 13  DC  N P     1 
ATOM   1963  O OP1   . DC  D 2 13  ? 49.132  26.736  13.403 1.00 104.07 ? 13  DC  N OP1   1 
ATOM   1964  O OP2   . DC  D 2 13  ? 51.150  25.314  12.628 1.00 103.96 ? 13  DC  N OP2   1 
ATOM   1965  O "O5'" . DC  D 2 13  ? 50.707  25.644  15.032 1.00 100.37 ? 13  DC  N "O5'" 1 
ATOM   1966  C "C5'" . DC  D 2 13  ? 49.897  25.604  16.216 1.00 98.48  ? 13  DC  N "C5'" 1 
ATOM   1967  C "C4'" . DC  D 2 13  ? 50.724  25.177  17.416 1.00 95.59  ? 13  DC  N "C4'" 1 
ATOM   1968  O "O4'" . DC  D 2 13  ? 51.167  23.814  17.232 1.00 94.73  ? 13  DC  N "O4'" 1 
ATOM   1969  C "C3'" . DC  D 2 13  ? 51.995  25.988  17.652 1.00 96.77  ? 13  DC  N "C3'" 1 
ATOM   1970  O "O3'" . DC  D 2 13  ? 51.779  26.795  18.811 1.00 96.60  ? 13  DC  N "O3'" 1 
ATOM   1971  C "C2'" . DC  D 2 13  ? 53.103  24.935  17.815 1.00 94.74  ? 13  DC  N "C2'" 1 
ATOM   1972  C "C1'" . DC  D 2 13  ? 52.313  23.649  18.034 1.00 92.45  ? 13  DC  N "C1'" 1 
ATOM   1973  N N1    . DC  D 2 13  ? 53.012  22.371  17.668 1.00 91.72  ? 13  DC  N N1    1 
ATOM   1974  C C2    . DC  D 2 13  ? 53.343  21.436  18.671 1.00 90.45  ? 13  DC  N C2    1 
ATOM   1975  O O2    . DC  D 2 13  ? 53.064  21.656  19.857 1.00 88.68  ? 13  DC  N O2    1 
ATOM   1976  N N3    . DC  D 2 13  ? 53.976  20.281  18.325 1.00 90.73  ? 13  DC  N N3    1 
ATOM   1977  C C4    . DC  D 2 13  ? 54.273  20.040  17.049 1.00 92.75  ? 13  DC  N C4    1 
ATOM   1978  N N4    . DC  D 2 13  ? 54.890  18.890  16.775 1.00 93.24  ? 13  DC  N N4    1 
ATOM   1979  C C5    . DC  D 2 13  ? 53.947  20.968  16.012 1.00 94.93  ? 13  DC  N C5    1 
ATOM   1980  C C6    . DC  D 2 13  ? 53.322  22.103  16.364 1.00 94.25  ? 13  DC  N C6    1 
ATOM   1981  P P     . DT  D 2 14  ? 52.911  27.704  19.521 1.00 98.99  ? 14  DT  N P     1 
ATOM   1982  O OP1   . DT  D 2 14  ? 52.101  28.725  20.236 1.00 98.94  ? 14  DT  N OP1   1 
ATOM   1983  O OP2   . DT  D 2 14  ? 54.003  28.097  18.587 1.00 100.30 ? 14  DT  N OP2   1 
ATOM   1984  O "O5'" . DT  D 2 14  ? 53.634  26.717  20.560 1.00 93.66  ? 14  DT  N "O5'" 1 
ATOM   1985  C "C5'" . DT  D 2 14  ? 52.871  26.010  21.537 1.00 88.87  ? 14  DT  N "C5'" 1 
ATOM   1986  C "C4'" . DT  D 2 14  ? 53.759  25.201  22.466 1.00 84.56  ? 14  DT  N "C4'" 1 
ATOM   1987  O "O4'" . DT  D 2 14  ? 54.217  23.990  21.814 1.00 83.90  ? 14  DT  N "O4'" 1 
ATOM   1988  C "C3'" . DT  D 2 14  ? 55.003  25.902  22.990 1.00 83.02  ? 14  DT  N "C3'" 1 
ATOM   1989  O "O3'" . DT  D 2 14  ? 54.958  25.660  24.386 1.00 79.62  ? 14  DT  N "O3'" 1 
ATOM   1990  C "C2'" . DT  D 2 14  ? 56.157  25.218  22.247 1.00 83.76  ? 14  DT  N "C2'" 1 
ATOM   1991  C "C1'" . DT  D 2 14  ? 55.608  23.817  21.991 1.00 82.80  ? 14  DT  N "C1'" 1 
ATOM   1992  N N1    . DT  D 2 14  ? 56.089  23.043  20.777 1.00 83.70  ? 14  DT  N N1    1 
ATOM   1993  C C2    . DT  D 2 14  ? 56.498  21.723  20.927 1.00 82.80  ? 14  DT  N C2    1 
ATOM   1994  O O2    . DT  D 2 14  ? 56.529  21.116  21.984 1.00 81.57  ? 14  DT  N O2    1 
ATOM   1995  N N3    . DT  D 2 14  ? 56.890  21.104  19.770 1.00 84.37  ? 14  DT  N N3    1 
ATOM   1996  C C4    . DT  D 2 14  ? 56.914  21.637  18.496 1.00 86.18  ? 14  DT  N C4    1 
ATOM   1997  O O4    . DT  D 2 14  ? 57.284  20.973  17.537 1.00 87.37  ? 14  DT  N O4    1 
ATOM   1998  C C5    . DT  D 2 14  ? 56.472  23.010  18.392 1.00 87.10  ? 14  DT  N C5    1 
ATOM   1999  C C7    . DT  D 2 14  ? 56.459  23.703  17.057 1.00 89.81  ? 14  DT  N C7    1 
ATOM   2000  C C6    . DT  D 2 14  ? 56.082  23.634  19.522 1.00 85.62  ? 14  DT  N C6    1 
ATOM   2001  P P     . DA  D 2 15  ? 56.095  26.081  25.423 1.00 76.58  ? 15  DA  N P     1 
ATOM   2002  O OP1   . DA  D 2 15  ? 55.510  26.097  26.780 1.00 75.77  ? 15  DA  N OP1   1 
ATOM   2003  O OP2   . DA  D 2 15  ? 56.719  27.309  24.891 1.00 79.90  ? 15  DA  N OP2   1 
ATOM   2004  O "O5'" . DA  D 2 15  ? 57.126  24.862  25.309 1.00 74.73  ? 15  DA  N "O5'" 1 
ATOM   2005  C "C5'" . DA  D 2 15  ? 56.731  23.527  25.656 1.00 71.54  ? 15  DA  N "C5'" 1 
ATOM   2006  C "C4'" . DA  D 2 15  ? 57.927  22.586  25.831 1.00 71.04  ? 15  DA  N "C4'" 1 
ATOM   2007  O "O4'" . DA  D 2 15  ? 58.239  21.928  24.569 1.00 70.54  ? 15  DA  N "O4'" 1 
ATOM   2008  C "C3'" . DA  D 2 15  ? 59.234  23.200  26.347 1.00 70.79  ? 15  DA  N "C3'" 1 
ATOM   2009  O "O3'" . DA  D 2 15  ? 59.592  22.512  27.539 1.00 70.02  ? 15  DA  N "O3'" 1 
ATOM   2010  C "C2'" . DA  D 2 15  ? 60.240  23.017  25.198 1.00 71.57  ? 15  DA  N "C2'" 1 
ATOM   2011  C "C1'" . DA  D 2 15  ? 59.638  21.882  24.373 1.00 71.11  ? 15  DA  N "C1'" 1 
ATOM   2012  N N9    . DA  D 2 15  ? 59.792  21.981  22.932 1.00 72.68  ? 15  DA  N N9    1 
ATOM   2013  C C8    . DA  D 2 15  ? 59.411  23.033  22.147 1.00 74.32  ? 15  DA  N C8    1 
ATOM   2014  N N7    . DA  D 2 15  ? 59.641  22.856  20.870 1.00 76.09  ? 15  DA  N N7    1 
ATOM   2015  C C5    . DA  D 2 15  ? 60.207  21.594  20.812 1.00 75.87  ? 15  DA  N C5    1 
ATOM   2016  C C6    . DA  D 2 15  ? 60.677  20.818  19.730 1.00 78.31  ? 15  DA  N C6    1 
ATOM   2017  N N6    . DA  D 2 15  ? 60.637  21.238  18.455 1.00 79.48  ? 15  DA  N N6    1 
ATOM   2018  N N1    . DA  D 2 15  ? 61.189  19.594  20.018 1.00 78.69  ? 15  DA  N N1    1 
ATOM   2019  C C2    . DA  D 2 15  ? 61.224  19.175  21.293 1.00 75.14  ? 15  DA  N C2    1 
ATOM   2020  N N3    . DA  D 2 15  ? 60.805  19.819  22.381 1.00 73.71  ? 15  DA  N N3    1 
ATOM   2021  C C4    . DA  D 2 15  ? 60.301  21.030  22.073 1.00 73.84  ? 15  DA  N C4    1 
ATOM   2022  P P     . DT  D 2 16  ? 60.947  22.783  28.363 1.00 71.08  ? 16  DT  N P     1 
ATOM   2023  O OP1   . DT  D 2 16  ? 60.795  22.183  29.705 1.00 70.22  ? 16  DT  N OP1   1 
ATOM   2024  O OP2   . DT  D 2 16  ? 61.252  24.224  28.272 1.00 73.53  ? 16  DT  N OP2   1 
ATOM   2025  O "O5'" . DT  D 2 16  ? 62.047  21.956  27.552 1.00 69.70  ? 16  DT  N "O5'" 1 
ATOM   2026  C "C5'" . DT  D 2 16  ? 61.987  20.546  27.549 1.00 69.40  ? 16  DT  N "C5'" 1 
ATOM   2027  C "C4'" . DT  D 2 16  ? 63.047  19.974  26.636 1.00 71.65  ? 16  DT  N "C4'" 1 
ATOM   2028  O "O4'" . DT  D 2 16  ? 62.801  20.393  25.281 1.00 73.82  ? 16  DT  N "O4'" 1 
ATOM   2029  C "C3'" . DT  D 2 16  ? 64.475  20.433  26.911 1.00 74.01  ? 16  DT  N "C3'" 1 
ATOM   2030  O "O3'" . DT  D 2 16  ? 65.119  19.347  27.561 1.00 75.57  ? 16  DT  N "O3'" 1 
ATOM   2031  C "C2'" . DT  D 2 16  ? 65.064  20.733  25.528 1.00 75.08  ? 16  DT  N "C2'" 1 
ATOM   2032  C "C1'" . DT  D 2 16  ? 64.008  20.142  24.608 1.00 74.98  ? 16  DT  N "C1'" 1 
ATOM   2033  N N1    . DT  D 2 16  ? 63.961  20.667  23.202 1.00 76.99  ? 16  DT  N N1    1 
ATOM   2034  C C2    . DT  D 2 16  ? 64.357  19.802  22.196 1.00 79.95  ? 16  DT  N C2    1 
ATOM   2035  O O2    . DT  D 2 16  ? 64.728  18.662  22.418 1.00 81.39  ? 16  DT  N O2    1 
ATOM   2036  N N3    . DT  D 2 16  ? 64.310  20.311  20.919 1.00 81.57  ? 16  DT  N N3    1 
ATOM   2037  C C4    . DT  D 2 16  ? 63.897  21.584  20.561 1.00 81.75  ? 16  DT  N C4    1 
ATOM   2038  O O4    . DT  D 2 16  ? 63.873  21.954  19.386 1.00 84.06  ? 16  DT  N O4    1 
ATOM   2039  C C5    . DT  D 2 16  ? 63.495  22.441  21.659 1.00 79.48  ? 16  DT  N C5    1 
ATOM   2040  C C7    . DT  D 2 16  ? 63.034  23.844  21.379 1.00 80.56  ? 16  DT  N C7    1 
ATOM   2041  C C6    . DT  D 2 16  ? 63.543  21.954  22.914 1.00 76.70  ? 16  DT  N C6    1 
ATOM   2042  P P     . DT  D 2 17  ? 66.664  19.300  27.941 1.00 76.51  ? 17  DT  N P     1 
ATOM   2043  O OP1   . DT  D 2 17  ? 66.770  18.342  29.062 1.00 77.12  ? 17  DT  N OP1   1 
ATOM   2044  O OP2   . DT  D 2 17  ? 67.156  20.691  28.047 1.00 77.62  ? 17  DT  N OP2   1 
ATOM   2045  O "O5'" . DT  D 2 17  ? 67.388  18.657  26.672 1.00 78.55  ? 17  DT  N "O5'" 1 
ATOM   2046  C "C5'" . DT  D 2 17  ? 66.931  17.435  26.109 1.00 78.64  ? 17  DT  N "C5'" 1 
ATOM   2047  C "C4'" . DT  D 2 17  ? 67.811  17.018  24.946 1.00 80.25  ? 17  DT  N "C4'" 1 
ATOM   2048  O "O4'" . DT  D 2 17  ? 67.431  17.756  23.754 1.00 79.32  ? 17  DT  N "O4'" 1 
ATOM   2049  C "C3'" . DT  D 2 17  ? 69.305  17.249  25.164 1.00 82.05  ? 17  DT  N "C3'" 1 
ATOM   2050  O "O3'" . DT  D 2 17  ? 69.987  16.041  24.862 1.00 85.68  ? 17  DT  N "O3'" 1 
ATOM   2051  C "C2'" . DT  D 2 17  ? 69.646  18.385  24.193 1.00 82.48  ? 17  DT  N "C2'" 1 
ATOM   2052  C "C1'" . DT  D 2 17  ? 68.579  18.265  23.104 1.00 81.15  ? 17  DT  N "C1'" 1 
ATOM   2053  N N1    . DT  D 2 17  ? 68.197  19.526  22.361 1.00 79.86  ? 17  DT  N N1    1 
ATOM   2054  C C2    . DT  D 2 17  ? 68.296  19.558  20.977 1.00 82.41  ? 17  DT  N C2    1 
ATOM   2055  O O2    . DT  D 2 17  ? 68.690  18.622  20.292 1.00 83.85  ? 17  DT  N O2    1 
ATOM   2056  N N3    . DT  D 2 17  ? 67.910  20.753  20.402 1.00 82.95  ? 17  DT  N N3    1 
ATOM   2057  C C4    . DT  D 2 17  ? 67.442  21.895  21.038 1.00 80.50  ? 17  DT  N C4    1 
ATOM   2058  O O4    . DT  D 2 17  ? 67.110  22.913  20.420 1.00 81.06  ? 17  DT  N O4    1 
ATOM   2059  C C5    . DT  D 2 17  ? 67.367  21.793  22.479 1.00 77.15  ? 17  DT  N C5    1 
ATOM   2060  C C7    . DT  D 2 17  ? 66.886  22.963  23.287 1.00 74.34  ? 17  DT  N C7    1 
ATOM   2061  C C6    . DT  D 2 17  ? 67.738  20.636  23.057 1.00 77.30  ? 17  DT  N C6    1 
ATOM   2062  P P     . DT  D 2 18  ? 71.557  15.830  25.091 1.00 89.92  ? 18  DT  N P     1 
ATOM   2063  O OP1   . DT  D 2 18  ? 71.684  14.512  25.752 1.00 91.11  ? 18  DT  N OP1   1 
ATOM   2064  O OP2   . DT  D 2 18  ? 72.160  17.031  25.722 1.00 88.99  ? 18  DT  N OP2   1 
ATOM   2065  O "O5'" . DT  D 2 18  ? 72.132  15.728  23.601 1.00 92.49  ? 18  DT  N "O5'" 1 
ATOM   2066  C "C5'" . DT  D 2 18  ? 71.463  14.929  22.629 1.00 93.64  ? 18  DT  N "C5'" 1 
ATOM   2067  C "C4'" . DT  D 2 18  ? 71.905  15.290  21.220 1.00 96.65  ? 18  DT  N "C4'" 1 
ATOM   2068  O "O4'" . DT  D 2 18  ? 71.340  16.570  20.829 1.00 95.29  ? 18  DT  N "O4'" 1 
ATOM   2069  C "C3'" . DT  D 2 18  ? 73.410  15.407  21.011 1.00 99.11  ? 18  DT  N "C3'" 1 
ATOM   2070  O "O3'" . DT  D 2 18  ? 73.782  14.671  19.833 1.00 104.05 ? 18  DT  N "O3'" 1 
ATOM   2071  C "C2'" . DT  D 2 18  ? 73.640  16.918  20.889 1.00 97.49  ? 18  DT  N "C2'" 1 
ATOM   2072  C "C1'" . DT  D 2 18  ? 72.341  17.377  20.240 1.00 95.94  ? 18  DT  N "C1'" 1 
ATOM   2073  N N1    . DT  D 2 18  ? 71.961  18.829  20.432 1.00 92.92  ? 18  DT  N N1    1 
ATOM   2074  C C2    . DT  D 2 18  ? 71.585  19.578  19.326 1.00 93.64  ? 18  DT  N C2    1 
ATOM   2075  O O2    . DT  D 2 18  ? 71.554  19.148  18.183 1.00 95.89  ? 18  DT  N O2    1 
ATOM   2076  N N3    . DT  D 2 18  ? 71.246  20.882  19.608 1.00 91.67  ? 18  DT  N N3    1 
ATOM   2077  C C4    . DT  D 2 18  ? 71.237  21.506  20.847 1.00 88.06  ? 18  DT  N C4    1 
ATOM   2078  O O4    . DT  D 2 18  ? 70.915  22.680  20.985 1.00 86.63  ? 18  DT  N O4    1 
ATOM   2079  C C5    . DT  D 2 18  ? 71.629  20.677  21.961 1.00 86.73  ? 18  DT  N C5    1 
ATOM   2080  C C7    . DT  D 2 18  ? 71.652  21.258  23.347 1.00 82.91  ? 18  DT  N C7    1 
ATOM   2081  C C6    . DT  D 2 18  ? 71.966  19.399  21.702 1.00 89.11  ? 18  DT  N C6    1 
ATOM   2082  P P     . DA  D 2 19  ? 75.323  14.369  19.475 1.00 109.38 ? 19  DA  N P     1 
ATOM   2083  O OP1   . DA  D 2 19  ? 75.426  12.978  18.973 1.00 112.69 ? 19  DA  N OP1   1 
ATOM   2084  O OP2   . DA  D 2 19  ? 76.189  14.813  20.595 1.00 105.87 ? 19  DA  N OP2   1 
ATOM   2085  O "O5'" . DA  D 2 19  ? 75.571  15.367  18.250 1.00 111.04 ? 19  DA  N "O5'" 1 
ATOM   2086  C "C5'" . DA  D 2 19  ? 74.694  15.413  17.135 1.00 112.22 ? 19  DA  N "C5'" 1 
ATOM   2087  C "C4'" . DA  D 2 19  ? 74.930  16.683  16.337 1.00 113.69 ? 19  DA  N "C4'" 1 
ATOM   2088  O "O4'" . DA  D 2 19  ? 74.316  17.811  17.014 1.00 109.86 ? 19  DA  N "O4'" 1 
ATOM   2089  C "C3'" . DA  D 2 19  ? 76.401  17.053  16.127 1.00 116.29 ? 19  DA  N "C3'" 1 
ATOM   2090  O "O3'" . DA  D 2 19  ? 76.636  17.162  14.729 1.00 120.06 ? 19  DA  N "O3'" 1 
ATOM   2091  C "C2'" . DA  D 2 19  ? 76.554  18.390  16.857 1.00 113.86 ? 19  DA  N "C2'" 1 
ATOM   2092  C "C1'" . DA  D 2 19  ? 75.133  18.938  16.782 1.00 111.49 ? 19  DA  N "C1'" 1 
ATOM   2093  N N9    . DA  D 2 19  ? 74.802  20.007  17.729 1.00 107.92 ? 19  DA  N N9    1 
ATOM   2094  C C8    . DA  D 2 19  ? 74.964  20.008  19.086 1.00 104.55 ? 19  DA  N C8    1 
ATOM   2095  N N7    . DA  D 2 19  ? 74.567  21.119  19.664 1.00 102.74 ? 19  DA  N N7    1 
ATOM   2096  C C5    . DA  D 2 19  ? 74.112  21.908  18.615 1.00 104.57 ? 19  DA  N C5    1 
ATOM   2097  C C6    . DA  D 2 19  ? 73.554  23.212  18.548 1.00 103.91 ? 19  DA  N C6    1 
ATOM   2098  N N6    . DA  D 2 19  ? 73.352  23.992  19.615 1.00 101.70 ? 19  DA  N N6    1 
ATOM   2099  N N1    . DA  D 2 19  ? 73.202  23.701  17.338 1.00 106.56 ? 19  DA  N N1    1 
ATOM   2100  C C2    . DA  D 2 19  ? 73.400  22.936  16.255 1.00 109.99 ? 19  DA  N C2    1 
ATOM   2101  N N3    . DA  D 2 19  ? 73.907  21.700  16.191 1.00 111.16 ? 19  DA  N N3    1 
ATOM   2102  C C4    . DA  D 2 19  ? 74.248  21.233  17.414 1.00 107.93 ? 19  DA  N C4    1 
ATOM   2103  P P     . DC  D 2 20  ? 78.081  17.430  14.081 1.00 124.14 ? 20  DC  N P     1 
ATOM   2104  O OP1   . DC  D 2 20  ? 78.225  16.459  12.976 1.00 128.98 ? 20  DC  N OP1   1 
ATOM   2105  O OP2   . DC  D 2 20  ? 79.121  17.497  15.131 1.00 121.83 ? 20  DC  N OP2   1 
ATOM   2106  O "O5'" . DC  D 2 20  ? 77.904  18.899  13.461 1.00 123.50 ? 20  DC  N "O5'" 1 
ATOM   2107  C "C5'" . DC  D 2 20  ? 76.674  19.335  12.850 1.00 120.58 ? 20  DC  N "C5'" 1 
ATOM   2108  C "C4'" . DC  D 2 20  ? 76.633  20.850  12.676 1.00 118.90 ? 20  DC  N "C4'" 1 
ATOM   2109  O "O4'" . DC  D 2 20  ? 76.220  21.518  13.902 1.00 113.57 ? 20  DC  N "O4'" 1 
ATOM   2110  C "C3'" . DC  D 2 20  ? 77.967  21.491  12.296 1.00 121.86 ? 20  DC  N "C3'" 1 
ATOM   2111  O "O3'" . DC  D 2 20  ? 77.777  22.368  11.204 1.00 123.84 ? 20  DC  N "O3'" 1 
ATOM   2112  C "C2'" . DC  D 2 20  ? 78.397  22.253  13.548 1.00 118.26 ? 20  DC  N "C2'" 1 
ATOM   2113  C "C1'" . DC  D 2 20  ? 77.034  22.664  14.082 1.00 114.08 ? 20  DC  N "C1'" 1 
ATOM   2114  N N1    . DC  D 2 20  ? 77.029  23.106  15.514 1.00 109.28 ? 20  DC  N N1    1 
ATOM   2115  C C2    . DC  D 2 20  ? 76.493  24.364  15.852 1.00 107.47 ? 20  DC  N C2    1 
ATOM   2116  O O2    . DC  D 2 20  ? 76.029  25.107  14.976 1.00 109.10 ? 20  DC  N O2    1 
ATOM   2117  N N3    . DC  D 2 20  ? 76.489  24.740  17.158 1.00 104.41 ? 20  DC  N N3    1 
ATOM   2118  C C4    . DC  D 2 20  ? 76.989  23.931  18.100 1.00 101.89 ? 20  DC  N C4    1 
ATOM   2119  N N4    . DC  D 2 20  ? 76.957  24.370  19.359 1.00 98.20  ? 20  DC  N N4    1 
ATOM   2120  C C5    . DC  D 2 20  ? 77.542  22.652  17.781 1.00 103.50 ? 20  DC  N C5    1 
ATOM   2121  C C6    . DC  D 2 20  ? 77.541  22.285  16.489 1.00 107.27 ? 20  DC  N C6    1 
ATOM   2122  P P     . DA  D 2 21  ? 79.009  22.778  10.281 1.00 128.42 ? 21  DA  N P     1 
ATOM   2123  O OP1   . DA  D 2 21  ? 78.424  23.173  8.986  1.00 132.70 ? 21  DA  N OP1   1 
ATOM   2124  O OP2   . DA  D 2 21  ? 80.016  21.692  10.325 1.00 130.67 ? 21  DA  N OP2   1 
ATOM   2125  O "O5'" . DA  D 2 21  ? 79.615  24.058  11.032 1.00 126.84 ? 21  DA  N "O5'" 1 
ATOM   2126  C "C5'" . DA  D 2 21  ? 78.958  25.317  10.927 1.00 126.63 ? 21  DA  N "C5'" 1 
ATOM   2127  C "C4'" . DA  D 2 21  ? 79.445  26.377  11.905 1.00 124.68 ? 21  DA  N "C4'" 1 
ATOM   2128  O "O4'" . DA  D 2 21  ? 78.865  26.162  13.211 1.00 119.24 ? 21  DA  N "O4'" 1 
ATOM   2129  C "C3'" . DA  D 2 21  ? 80.940  26.496  12.206 1.00 126.35 ? 21  DA  N "C3'" 1 
ATOM   2130  O "O3'" . DA  D 2 21  ? 81.622  27.240  11.188 1.00 131.28 ? 21  DA  N "O3'" 1 
ATOM   2131  C "C2'" . DA  D 2 21  ? 80.918  27.244  13.541 1.00 122.47 ? 21  DA  N "C2'" 1 
ATOM   2132  C "C1'" . DA  D 2 21  ? 79.467  27.150  14.020 1.00 119.08 ? 21  DA  N "C1'" 1 
ATOM   2133  N N9    . DA  D 2 21  ? 79.375  26.849  15.454 1.00 115.01 ? 21  DA  N N9    1 
ATOM   2134  C C8    . DA  D 2 21  ? 79.606  25.648  16.072 1.00 113.12 ? 21  DA  N C8    1 
ATOM   2135  N N7    . DA  D 2 21  ? 79.465  25.693  17.375 1.00 110.02 ? 21  DA  N N7    1 
ATOM   2136  C C5    . DA  D 2 21  ? 79.122  27.015  17.636 1.00 109.43 ? 21  DA  N C5    1 
ATOM   2137  C C6    . DA  D 2 21  ? 78.830  27.724  18.833 1.00 106.32 ? 21  DA  N C6    1 
ATOM   2138  N N6    . DA  D 2 21  ? 78.835  27.166  20.045 1.00 102.46 ? 21  DA  N N6    1 
ATOM   2139  N N1    . DA  D 2 21  ? 78.525  29.043  18.737 1.00 107.52 ? 21  DA  N N1    1 
ATOM   2140  C C2    . DA  D 2 21  ? 78.515  29.620  17.521 1.00 110.38 ? 21  DA  N C2    1 
ATOM   2141  N N3    . DA  D 2 21  ? 78.768  29.059  16.337 1.00 113.09 ? 21  DA  N N3    1 
ATOM   2142  C C4    . DA  D 2 21  ? 79.067  27.745  16.459 1.00 112.35 ? 21  DA  N C4    1 
ATOM   2143  P P     . DT  D 2 22  ? 83.143  27.749  11.309 1.00 134.64 ? 22  DT  N P     1 
ATOM   2144  O OP1   . DT  D 2 22  ? 83.574  28.204  9.971  1.00 141.95 ? 22  DT  N OP1   1 
ATOM   2145  O OP2   . DT  D 2 22  ? 83.960  26.725  11.999 1.00 133.19 ? 22  DT  N OP2   1 
ATOM   2146  O "O5'" . DT  D 2 22  ? 83.063  29.014  12.284 1.00 131.85 ? 22  DT  N "O5'" 1 
ATOM   2147  C "C5'" . DT  D 2 22  ? 82.284  30.172  12.015 1.00 132.90 ? 22  DT  N "C5'" 1 
ATOM   2148  C "C4'" . DT  D 2 22  ? 82.461  31.187  13.132 1.00 131.06 ? 22  DT  N "C4'" 1 
ATOM   2149  O "O4'" . DT  D 2 22  ? 81.882  30.650  14.346 1.00 125.09 ? 22  DT  N "O4'" 1 
ATOM   2150  C "C3'" . DT  D 2 22  ? 83.913  31.544  13.475 1.00 134.16 ? 22  DT  N "C3'" 1 
ATOM   2151  O "O3'" . DT  D 2 22  ? 84.208  32.870  13.053 1.00 138.86 ? 22  DT  N "O3'" 1 
ATOM   2152  C "C2'" . DT  D 2 22  ? 83.999  31.427  15.000 1.00 129.11 ? 22  DT  N "C2'" 1 
ATOM   2153  C "C1'" . DT  D 2 22  ? 82.542  31.261  15.431 1.00 124.19 ? 22  DT  N "C1'" 1 
ATOM   2154  N N1    . DT  D 2 22  ? 82.391  30.452  16.682 1.00 119.76 ? 22  DT  N N1    1 
ATOM   2155  C C2    . DT  D 2 22  ? 82.039  31.113  17.846 1.00 116.88 ? 22  DT  N C2    1 
ATOM   2156  O O2    . DT  D 2 22  ? 81.842  32.314  17.899 1.00 117.77 ? 22  DT  N O2    1 
ATOM   2157  N N3    . DT  D 2 22  ? 81.926  30.311  18.959 1.00 113.05 ? 22  DT  N N3    1 
ATOM   2158  C C4    . DT  D 2 22  ? 82.133  28.941  19.032 1.00 112.32 ? 22  DT  N C4    1 
ATOM   2159  O O4    . DT  D 2 22  ? 82.006  28.325  20.089 1.00 109.76 ? 22  DT  N O4    1 
ATOM   2160  C C5    . DT  D 2 22  ? 82.504  28.305  17.783 1.00 116.13 ? 22  DT  N C5    1 
ATOM   2161  C C7    . DT  D 2 22  ? 82.752  26.825  17.727 1.00 115.96 ? 22  DT  N C7    1 
ATOM   2162  C C6    . DT  D 2 22  ? 82.615  29.080  16.683 1.00 119.92 ? 22  DT  N C6    1 
ATOM   2163  P P     . DG  D 2 23  ? 85.695  33.404  12.783 1.00 145.49 ? 23  DG  N P     1 
ATOM   2164  O OP1   . DG  D 2 23  ? 85.586  34.316  11.622 1.00 151.93 ? 23  DG  N OP1   1 
ATOM   2165  O OP2   . DG  D 2 23  ? 86.656  32.278  12.731 1.00 146.05 ? 23  DG  N OP2   1 
ATOM   2166  O "O5'" . DG  D 2 23  ? 86.030  34.270  14.086 1.00 143.31 ? 23  DG  N "O5'" 1 
ATOM   2167  C "C5'" . DG  D 2 23  ? 85.091  35.227  14.590 1.00 142.00 ? 23  DG  N "C5'" 1 
ATOM   2168  C "C4'" . DG  D 2 23  ? 85.343  35.560  16.055 1.00 138.98 ? 23  DG  N "C4'" 1 
ATOM   2169  O "O4'" . DG  D 2 23  ? 84.777  34.519  16.896 1.00 133.44 ? 23  DG  N "O4'" 1 
ATOM   2170  C "C3'" . DG  D 2 23  ? 86.811  35.712  16.480 1.00 140.97 ? 23  DG  N "C3'" 1 
ATOM   2171  O "O3'" . DG  D 2 23  ? 87.101  37.083  16.829 1.00 143.33 ? 23  DG  N "O3'" 1 
ATOM   2172  C "C2'" . DG  D 2 23  ? 86.939  34.740  17.653 1.00 136.05 ? 23  DG  N "C2'" 1 
ATOM   2173  C "C1'" . DG  D 2 23  ? 85.494  34.562  18.106 1.00 131.80 ? 23  DG  N "C1'" 1 
ATOM   2174  N N9    . DG  D 2 23  ? 85.288  33.346  18.898 1.00 127.92 ? 23  DG  N N9    1 
ATOM   2175  C C8    . DG  D 2 23  ? 85.391  32.046  18.461 1.00 127.58 ? 23  DG  N C8    1 
ATOM   2176  N N7    . DG  D 2 23  ? 85.169  31.162  19.389 1.00 123.76 ? 23  DG  N N7    1 
ATOM   2177  C C5    . DG  D 2 23  ? 84.898  31.917  20.527 1.00 121.78 ? 23  DG  N C5    1 
ATOM   2178  C C6    . DG  D 2 23  ? 84.581  31.507  21.856 1.00 117.56 ? 23  DG  N C6    1 
ATOM   2179  O O6    . DG  D 2 23  ? 84.475  30.353  22.297 1.00 114.61 ? 23  DG  N O6    1 
ATOM   2180  N N1    . DG  D 2 23  ? 84.380  32.594  22.715 1.00 117.15 ? 23  DG  N N1    1 
ATOM   2181  C C2    . DG  D 2 23  ? 84.473  33.918  22.333 1.00 120.54 ? 23  DG  N C2    1 
ATOM   2182  N N2    . DG  D 2 23  ? 84.251  34.837  23.285 1.00 119.96 ? 23  DG  N N2    1 
ATOM   2183  N N3    . DG  D 2 23  ? 84.764  34.313  21.090 1.00 124.18 ? 23  DG  N N3    1 
ATOM   2184  C C4    . DG  D 2 23  ? 84.967  33.267  20.239 1.00 124.26 ? 23  DG  N C4    1 
ATOM   2185  P P     . DT  D 2 24  ? 88.298  37.559  17.799 1.00 144.67 ? 24  DT  N P     1 
ATOM   2186  O OP1   . DT  D 2 24  ? 88.452  39.016  17.593 1.00 148.70 ? 24  DT  N OP1   1 
ATOM   2187  O OP2   . DT  D 2 24  ? 89.471  36.669  17.658 1.00 145.08 ? 24  DT  N OP2   1 
ATOM   2188  O "O5'" . DT  D 2 24  ? 87.694  37.326  19.257 1.00 139.26 ? 24  DT  N "O5'" 1 
ATOM   2189  C "C5'" . DT  D 2 24  ? 86.595  38.118  19.699 1.00 137.39 ? 24  DT  N "C5'" 1 
ATOM   2190  C "C4'" . DT  D 2 24  ? 86.741  38.481  21.171 1.00 134.75 ? 24  DT  N "C4'" 1 
ATOM   2191  O "O4'" . DT  D 2 24  ? 86.475  37.315  21.993 1.00 129.95 ? 24  DT  N "O4'" 1 
ATOM   2192  C "C3'" . DT  D 2 24  ? 88.087  39.029  21.634 1.00 136.60 ? 24  DT  N "C3'" 1 
ATOM   2193  O "O3'" . DT  D 2 24  ? 87.807  40.048  22.586 1.00 136.25 ? 24  DT  N "O3'" 1 
ATOM   2194  C "C2'" . DT  D 2 24  ? 88.761  37.802  22.247 1.00 133.97 ? 24  DT  N "C2'" 1 
ATOM   2195  C "C1'" . DT  D 2 24  ? 87.580  37.014  22.811 1.00 129.46 ? 24  DT  N "C1'" 1 
ATOM   2196  N N1    . DT  D 2 24  ? 87.699  35.510  22.837 1.00 127.56 ? 24  DT  N N1    1 
ATOM   2197  C C2    . DT  D 2 24  ? 87.477  34.830  24.032 1.00 123.90 ? 24  DT  N C2    1 
ATOM   2198  O O2    . DT  D 2 24  ? 87.203  35.363  25.095 1.00 122.72 ? 24  DT  N O2    1 
ATOM   2199  N N3    . DT  D 2 24  ? 87.598  33.466  23.953 1.00 121.89 ? 24  DT  N N3    1 
ATOM   2200  C C4    . DT  D 2 24  ? 87.903  32.722  22.829 1.00 123.57 ? 24  DT  N C4    1 
ATOM   2201  O O4    . DT  D 2 24  ? 87.980  31.500  22.883 1.00 122.10 ? 24  DT  N O4    1 
ATOM   2202  C C5    . DT  D 2 24  ? 88.118  33.479  21.610 1.00 127.38 ? 24  DT  N C5    1 
ATOM   2203  C C7    . DT  D 2 24  ? 88.459  32.773  20.329 1.00 129.38 ? 24  DT  N C7    1 
ATOM   2204  C C6    . DT  D 2 24  ? 88.003  34.818  21.669 1.00 128.99 ? 24  DT  N C6    1 
ATOM   2205  P P     . DT  D 2 25  ? 88.902  40.980  23.297 1.00 139.81 ? 25  DT  N P     1 
ATOM   2206  O OP1   . DT  D 2 25  ? 88.251  42.295  23.454 1.00 141.64 ? 25  DT  N OP1   1 
ATOM   2207  O OP2   . DT  D 2 25  ? 90.225  40.881  22.628 1.00 142.83 ? 25  DT  N OP2   1 
ATOM   2208  O "O5'" . DT  D 2 25  ? 89.046  40.312  24.739 1.00 135.84 ? 25  DT  N "O5'" 1 
ATOM   2209  C "C5'" . DT  D 2 25  ? 87.892  40.143  25.558 1.00 132.20 ? 25  DT  N "C5'" 1 
ATOM   2210  C "C4'" . DT  D 2 25  ? 88.183  39.193  26.705 1.00 128.56 ? 25  DT  N "C4'" 1 
ATOM   2211  O "O4'" . DT  D 2 25  ? 88.398  37.855  26.191 1.00 126.60 ? 25  DT  N "O4'" 1 
ATOM   2212  C "C3'" . DT  D 2 25  ? 89.412  39.537  27.538 1.00 130.24 ? 25  DT  N "C3'" 1 
ATOM   2213  O "O3'" . DT  D 2 25  ? 89.018  39.576  28.902 1.00 128.78 ? 25  DT  N "O3'" 1 
ATOM   2214  C "C2'" . DT  D 2 25  ? 90.376  38.385  27.249 1.00 129.96 ? 25  DT  N "C2'" 1 
ATOM   2215  C "C1'" . DT  D 2 25  ? 89.394  37.251  26.978 1.00 126.51 ? 25  DT  N "C1'" 1 
ATOM   2216  N N1    . DT  D 2 25  ? 89.940  36.035  26.269 1.00 126.90 ? 25  DT  N N1    1 
ATOM   2217  C C2    . DT  D 2 25  ? 89.965  34.815  26.936 1.00 123.98 ? 25  DT  N C2    1 
ATOM   2218  O O2    . DT  D 2 25  ? 89.572  34.647  28.078 1.00 121.52 ? 25  DT  N O2    1 
ATOM   2219  N N3    . DT  D 2 25  ? 90.477  33.768  26.206 1.00 124.36 ? 25  DT  N N3    1 
ATOM   2220  C C4    . DT  D 2 25  ? 90.957  33.808  24.905 1.00 127.74 ? 25  DT  N C4    1 
ATOM   2221  O O4    . DT  D 2 25  ? 91.391  32.802  24.351 1.00 128.24 ? 25  DT  N O4    1 
ATOM   2222  C C5    . DT  D 2 25  ? 90.907  35.106  24.260 1.00 130.68 ? 25  DT  N C5    1 
ATOM   2223  C C7    . DT  D 2 25  ? 91.403  35.279  22.850 1.00 134.22 ? 25  DT  N C7    1 
ATOM   2224  C C6    . DT  D 2 25  ? 90.409  36.140  24.964 1.00 130.14 ? 25  DT  N C6    1 
ATOM   2225  P P     . DC  D 2 26  ? 89.848  40.346  30.040 1.00 131.76 ? 26  DC  N P     1 
ATOM   2226  O OP1   . DC  D 2 26  ? 88.866  41.207  30.737 1.00 131.27 ? 26  DC  N OP1   1 
ATOM   2227  O OP2   . DC  D 2 26  ? 91.104  40.906  29.487 1.00 135.09 ? 26  DC  N OP2   1 
ATOM   2228  O "O5'" . DC  D 2 26  ? 90.315  39.176  31.023 1.00 129.75 ? 26  DC  N "O5'" 1 
ATOM   2229  C "C5'" . DC  D 2 26  ? 89.397  38.158  31.435 1.00 126.48 ? 26  DC  N "C5'" 1 
ATOM   2230  C "C4'" . DC  D 2 26  ? 90.146  36.896  31.837 1.00 124.75 ? 26  DC  N "C4'" 1 
ATOM   2231  O "O4'" . DC  D 2 26  ? 90.582  36.181  30.654 1.00 124.26 ? 26  DC  N "O4'" 1 
ATOM   2232  C "C3'" . DC  D 2 26  ? 91.392  37.137  32.677 1.00 126.80 ? 26  DC  N "C3'" 1 
ATOM   2233  O "O3'" . DC  D 2 26  ? 91.304  36.376  33.875 1.00 125.81 ? 26  DC  N "O3'" 1 
ATOM   2234  C "C2'" . DC  D 2 26  ? 92.541  36.670  31.783 1.00 128.45 ? 26  DC  N "C2'" 1 
ATOM   2235  C "C1'" . DC  D 2 26  ? 91.844  35.629  30.915 1.00 125.71 ? 26  DC  N "C1'" 1 
ATOM   2236  N N1    . DC  D 2 26  ? 92.488  35.317  29.600 1.00 127.32 ? 26  DC  N N1    1 
ATOM   2237  C C2    . DC  D 2 26  ? 92.706  33.976  29.238 1.00 125.95 ? 26  DC  N C2    1 
ATOM   2238  O O2    . DC  D 2 26  ? 92.370  33.072  30.014 1.00 123.33 ? 26  DC  N O2    1 
ATOM   2239  N N3    . DC  D 2 26  ? 93.284  33.704  28.039 1.00 127.98 ? 26  DC  N N3    1 
ATOM   2240  C C4    . DC  D 2 26  ? 93.635  34.704  27.220 1.00 131.78 ? 26  DC  N C4    1 
ATOM   2241  N N4    . DC  D 2 26  ? 94.202  34.391  26.051 1.00 134.81 ? 26  DC  N N4    1 
ATOM   2242  C C5    . DC  D 2 26  ? 93.422  36.075  27.565 1.00 133.12 ? 26  DC  N C5    1 
ATOM   2243  C C6    . DC  D 2 26  ? 92.851  36.328  28.751 1.00 130.87 ? 26  DC  N C6    1 
ATOM   2244  P P     . DC  D 2 27  ? 91.907  36.930  35.256 1.00 128.92 ? 27  DC  N P     1 
ATOM   2245  O OP1   . DC  D 2 27  ? 90.742  37.077  36.160 1.00 126.76 ? 27  DC  N OP1   1 
ATOM   2246  O OP2   . DC  D 2 27  ? 92.823  38.070  34.987 1.00 132.43 ? 27  DC  N OP2   1 
ATOM   2247  O "O5'" . DC  D 2 27  ? 92.890  35.776  35.786 1.00 127.97 ? 27  DC  N "O5'" 1 
ATOM   2248  C "C5'" . DC  D 2 27  ? 92.516  34.401  35.800 1.00 124.86 ? 27  DC  N "C5'" 1 
ATOM   2249  C "C4'" . DC  D 2 27  ? 93.634  33.527  35.257 1.00 125.21 ? 27  DC  N "C4'" 1 
ATOM   2250  O "O4'" . DC  D 2 27  ? 93.853  33.820  33.861 1.00 125.09 ? 27  DC  N "O4'" 1 
ATOM   2251  C "C3'" . DC  D 2 27  ? 95.017  33.709  35.885 1.00 128.70 ? 27  DC  N "C3'" 1 
ATOM   2252  O "O3'" . DC  D 2 27  ? 95.169  32.795  36.977 1.00 129.82 ? 27  DC  N "O3'" 1 
ATOM   2253  C "C2'" . DC  D 2 27  ? 95.988  33.441  34.722 1.00 129.03 ? 27  DC  N "C2'" 1 
ATOM   2254  C "C1'" . DC  D 2 27  ? 95.058  33.165  33.538 1.00 126.16 ? 27  DC  N "C1'" 1 
ATOM   2255  N N1    . DC  D 2 27  ? 95.515  33.570  32.147 1.00 126.29 ? 27  DC  N N1    1 
ATOM   2256  C C2    . DC  D 2 27  ? 95.807  32.573  31.193 1.00 125.30 ? 27  DC  N C2    1 
ATOM   2257  O O2    . DC  D 2 27  ? 95.704  31.379  31.498 1.00 123.81 ? 27  DC  N O2    1 
ATOM   2258  N N3    . DC  D 2 27  ? 96.203  32.940  29.946 1.00 126.18 ? 27  DC  N N3    1 
ATOM   2259  C C4    . DC  D 2 27  ? 96.310  34.233  29.637 1.00 127.95 ? 27  DC  N C4    1 
ATOM   2260  N N4    . DC  D 2 27  ? 96.701  34.545  28.399 1.00 129.85 ? 27  DC  N N4    1 
ATOM   2261  C C5    . DC  D 2 27  ? 96.017  35.264  30.584 1.00 128.47 ? 27  DC  N C5    1 
ATOM   2262  C C6    . DC  D 2 27  ? 95.626  34.893  31.811 1.00 127.37 ? 27  DC  N C6    1 
ATOM   2263  P P     . DG  D 2 28  ? 96.492  32.757  37.888 1.00 136.10 ? 28  DG  N P     1 
ATOM   2264  O OP1   . DG  D 2 28  ? 96.049  32.493  39.277 1.00 136.03 ? 28  DG  N OP1   1 
ATOM   2265  O OP2   . DG  D 2 28  ? 97.346  33.938  37.601 1.00 138.14 ? 28  DG  N OP2   1 
ATOM   2266  O "O5'" . DG  D 2 28  ? 97.277  31.467  37.342 1.00 135.61 ? 28  DG  N "O5'" 1 
ATOM   2267  C "C5'" . DG  D 2 28  ? 96.559  30.353  36.769 1.00 131.93 ? 28  DG  N "C5'" 1 
ATOM   2268  C "C4'" . DG  D 2 28  ? 97.506  29.337  36.138 1.00 131.81 ? 28  DG  N "C4'" 1 
ATOM   2269  O "O4'" . DG  D 2 28  ? 97.660  29.611  34.720 1.00 131.61 ? 28  DG  N "O4'" 1 
ATOM   2270  C "C3'" . DG  D 2 28  ? 98.913  29.285  36.723 1.00 133.75 ? 28  DG  N "C3'" 1 
ATOM   2271  O "O3'" . DG  D 2 28  ? 99.305  27.930  36.919 1.00 134.27 ? 28  DG  N "O3'" 1 
ATOM   2272  C "C2'" . DG  D 2 28  ? 99.771  30.012  35.687 1.00 135.34 ? 28  DG  N "C2'" 1 
ATOM   2273  C "C1'" . DG  D 2 28  ? 99.021  29.786  34.379 1.00 132.93 ? 28  DG  N "C1'" 1 
ATOM   2274  N N9    . DG  D 2 28  ? 99.073  30.895  33.423 1.00 132.61 ? 28  DG  N N9    1 
ATOM   2275  C C8    . DG  D 2 28  ? 98.869  32.229  33.683 1.00 132.51 ? 28  DG  N C8    1 
ATOM   2276  N N7    . DG  D 2 28  ? 98.956  32.998  32.633 1.00 133.23 ? 28  DG  N N7    1 
ATOM   2277  C C5    . DG  D 2 28  ? 99.239  32.119  31.598 1.00 133.32 ? 28  DG  N C5    1 
ATOM   2278  C C6    . DG  D 2 28  ? 99.449  32.371  30.219 1.00 134.42 ? 28  DG  N C6    1 
ATOM   2279  O O6    . DG  D 2 28  ? 99.426  33.460  29.629 1.00 134.65 ? 28  DG  N O6    1 
ATOM   2280  N N1    . DG  D 2 28  ? 99.710  31.199  29.507 1.00 134.98 ? 28  DG  N N1    1 
ATOM   2281  C C2    . DG  D 2 28  ? 99.761  29.940  30.065 1.00 134.17 ? 28  DG  N C2    1 
ATOM   2282  N N2    . DG  D 2 28  ? 100.022 28.923  29.234 1.00 134.91 ? 28  DG  N N2    1 
ATOM   2283  N N3    . DG  D 2 28  ? 99.561  29.691  31.355 1.00 132.84 ? 28  DG  N N3    1 
ATOM   2284  C C4    . DG  D 2 28  ? 99.306  30.821  32.065 1.00 132.85 ? 28  DG  N C4    1 
ATOM   2285  N N     . LYS E 3 4   ? -14.256 11.665  32.476 1.00 80.42  ? -2  LYS A N     1 
ATOM   2286  C CA    . LYS E 3 4   ? -13.947 11.993  33.900 1.00 82.85  ? -2  LYS A CA    1 
ATOM   2287  C C     . LYS E 3 4   ? -15.189 12.505  34.644 1.00 80.02  ? -2  LYS A C     1 
ATOM   2288  O O     . LYS E 3 4   ? -15.385 12.212  35.824 1.00 80.99  ? -2  LYS A O     1 
ATOM   2289  C CB    . LYS E 3 4   ? -12.805 13.015  33.974 1.00 86.70  ? -2  LYS A CB    1 
ATOM   2290  C CG    . LYS E 3 4   ? -12.337 13.343  35.387 1.00 90.32  ? -2  LYS A CG    1 
ATOM   2291  C CD    . LYS E 3 4   ? -11.065 14.174  35.393 1.00 94.54  ? -2  LYS A CD    1 
ATOM   2292  C CE    . LYS E 3 4   ? -10.740 14.637  36.802 1.00 97.30  ? -2  LYS A CE    1 
ATOM   2293  N NZ    . LYS E 3 4   ? -9.696  15.691  36.790 1.00 101.48 ? -2  LYS A NZ    1 
ATOM   2294  N N     . ASP E 3 5   ? -16.011 13.281  33.944 1.00 76.93  ? -1  ASP A N     1 
ATOM   2295  C CA    . ASP E 3 5   ? -17.258 13.809  34.490 1.00 74.07  ? -1  ASP A CA    1 
ATOM   2296  C C     . ASP E 3 5   ? -18.409 13.031  33.862 1.00 69.63  ? -1  ASP A C     1 
ATOM   2297  O O     . ASP E 3 5   ? -18.472 12.916  32.629 1.00 68.48  ? -1  ASP A O     1 
ATOM   2298  C CB    . ASP E 3 5   ? -17.405 15.305  34.171 1.00 74.39  ? -1  ASP A CB    1 
ATOM   2299  C CG    . ASP E 3 5   ? -16.191 16.124  34.601 1.00 79.64  ? -1  ASP A CG    1 
ATOM   2300  O OD1   . ASP E 3 5   ? -15.519 16.702  33.717 1.00 81.00  ? -1  ASP A OD1   1 
ATOM   2301  O OD2   . ASP E 3 5   ? -15.904 16.187  35.819 1.00 83.22  ? -1  ASP A OD2   1 
ATOM   2302  N N     . PRO E 3 6   ? -19.328 12.505  34.695 1.00 67.26  ? 0   PRO A N     1 
ATOM   2303  C CA    . PRO E 3 6   ? -20.391 11.679  34.132 1.00 63.44  ? 0   PRO A CA    1 
ATOM   2304  C C     . PRO E 3 6   ? -21.026 12.381  32.936 1.00 60.65  ? 0   PRO A C     1 
ATOM   2305  O O     . PRO E 3 6   ? -21.306 13.574  32.993 1.00 60.72  ? 0   PRO A O     1 
ATOM   2306  C CB    . PRO E 3 6   ? -21.397 11.547  35.281 1.00 62.30  ? 0   PRO A CB    1 
ATOM   2307  C CG    . PRO E 3 6   ? -20.639 11.886  36.519 1.00 65.96  ? 0   PRO A CG    1 
ATOM   2308  C CD    . PRO E 3 6   ? -19.549 12.818  36.120 1.00 68.38  ? 0   PRO A CD    1 
ATOM   2309  N N     . MET E 3 7   ? -21.214 11.644  31.852 1.00 58.79  ? 1   MET A N     1 
ATOM   2310  C CA    . MET E 3 7   ? -21.872 12.166  30.673 1.00 56.44  ? 1   MET A CA    1 
ATOM   2311  C C     . MET E 3 7   ? -23.277 12.625  31.026 1.00 53.25  ? 1   MET A C     1 
ATOM   2312  O O     . MET E 3 7   ? -23.749 13.660  30.531 1.00 52.61  ? 1   MET A O     1 
ATOM   2313  C CB    . MET E 3 7   ? -21.951 11.095  29.578 1.00 56.52  ? 1   MET A CB    1 
ATOM   2314  C CG    . MET E 3 7   ? -20.658 10.337  29.305 1.00 60.41  ? 1   MET A CG    1 
ATOM   2315  S SD    . MET E 3 7   ? -19.268 11.468  29.089 1.00 70.43  ? 1   MET A SD    1 
ATOM   2316  C CE    . MET E 3 7   ? -19.812 12.463  27.677 1.00 68.37  ? 1   MET A CE    1 
ATOM   2317  N N     . ARG E 3 8   ? -23.944 11.845  31.875 1.00 50.88  ? 2   ARG A N     1 
ATOM   2318  C CA    . ARG E 3 8   ? -25.346 12.085  32.228 1.00 48.14  ? 2   ARG A CA    1 
ATOM   2319  C C     . ARG E 3 8   ? -26.210 12.428  31.009 1.00 45.74  ? 2   ARG A C     1 
ATOM   2320  O O     . ARG E 3 8   ? -26.911 13.443  31.001 1.00 45.64  ? 2   ARG A O     1 
ATOM   2321  C CB    . ARG E 3 8   ? -25.451 13.184  33.292 1.00 49.02  ? 2   ARG A CB    1 
ATOM   2322  C CG    . ARG E 3 8   ? -24.715 12.849  34.570 1.00 51.23  ? 2   ARG A CG    1 
ATOM   2323  C CD    . ARG E 3 8   ? -25.148 13.733  35.693 1.00 52.07  ? 2   ARG A CD    1 
ATOM   2324  N NE    . ARG E 3 8   ? -26.597 13.810  35.732 1.00 50.45  ? 2   ARG A NE    1 
ATOM   2325  C CZ    . ARG E 3 8   ? -27.282 14.569  36.574 1.00 50.45  ? 2   ARG A CZ    1 
ATOM   2326  N NH1   . ARG E 3 8   ? -26.650 15.318  37.465 1.00 51.97  ? 2   ARG A NH1   1 
ATOM   2327  N NH2   . ARG E 3 8   ? -28.605 14.577  36.514 1.00 48.98  ? 2   ARG A NH2   1 
ATOM   2328  N N     . VAL E 3 9   ? -26.159 11.582  29.985 1.00 44.10  ? 3   VAL A N     1 
ATOM   2329  C CA    . VAL E 3 9   ? -26.871 11.861  28.745 1.00 42.48  ? 3   VAL A CA    1 
ATOM   2330  C C     . VAL E 3 9   ? -28.371 11.969  28.993 1.00 40.53  ? 3   VAL A C     1 
ATOM   2331  O O     . VAL E 3 9   ? -29.045 12.780  28.357 1.00 40.60  ? 3   VAL A O     1 
ATOM   2332  C CB    . VAL E 3 9   ? -26.608 10.789  27.648 1.00 43.19  ? 3   VAL A CB    1 
ATOM   2333  C CG1   . VAL E 3 9   ? -27.278 11.187  26.337 1.00 41.56  ? 3   VAL A CG1   1 
ATOM   2334  C CG2   . VAL E 3 9   ? -25.107 10.552  27.447 1.00 44.48  ? 3   VAL A CG2   1 
ATOM   2335  N N     . LEU E 3 10  ? -28.891 11.164  29.918 1.00 38.89  ? 4   LEU A N     1 
ATOM   2336  C CA    . LEU E 3 10  ? -30.312 11.193  30.233 1.00 37.35  ? 4   LEU A CA    1 
ATOM   2337  C C     . LEU E 3 10  ? -30.792 12.566  30.741 1.00 37.34  ? 4   LEU A C     1 
ATOM   2338  O O     . LEU E 3 10  ? -31.911 12.979  30.434 1.00 36.93  ? 4   LEU A O     1 
ATOM   2339  C CB    . LEU E 3 10  ? -30.705 10.069  31.205 1.00 36.60  ? 4   LEU A CB    1 
ATOM   2340  C CG    . LEU E 3 10  ? -32.199 10.044  31.578 1.00 34.81  ? 4   LEU A CG    1 
ATOM   2341  C CD1   . LEU E 3 10  ? -33.140 9.884   30.383 1.00 31.30  ? 4   LEU A CD1   1 
ATOM   2342  C CD2   . LEU E 3 10  ? -32.456 8.987   32.612 1.00 34.91  ? 4   LEU A CD2   1 
ATOM   2343  N N     . LYS E 3 11  ? -29.944 13.270  31.487 1.00 37.97  ? 5   LYS A N     1 
ATOM   2344  C CA    . LYS E 3 11  ? -30.258 14.635  31.908 1.00 38.72  ? 5   LYS A CA    1 
ATOM   2345  C C     . LYS E 3 11  ? -30.481 15.552  30.703 1.00 39.45  ? 5   LYS A C     1 
ATOM   2346  O O     . LYS E 3 11  ? -31.446 16.324  30.667 1.00 39.76  ? 5   LYS A O     1 
ATOM   2347  C CB    . LYS E 3 11  ? -29.161 15.163  32.825 1.00 40.23  ? 5   LYS A CB    1 
ATOM   2348  C CG    . LYS E 3 11  ? -28.930 16.643  32.836 1.00 40.58  ? 5   LYS A CG    1 
ATOM   2349  C CD    . LYS E 3 11  ? -27.737 16.942  33.705 1.00 41.94  ? 5   LYS A CD    1 
ATOM   2350  C CE    . LYS E 3 11  ? -27.173 18.324  33.430 1.00 45.58  ? 5   LYS A CE    1 
ATOM   2351  N NZ    . LYS E 3 11  ? -25.781 18.473  33.955 1.00 47.02  ? 5   LYS A NZ    1 
ATOM   2352  N N     . TYR E 3 12  ? -29.605 15.446  29.708 1.00 39.82  ? 6   TYR A N     1 
ATOM   2353  C CA    . TYR E 3 12  ? -29.710 16.300  28.527 1.00 40.62  ? 6   TYR A CA    1 
ATOM   2354  C C     . TYR E 3 12  ? -30.826 15.879  27.571 1.00 39.76  ? 6   TYR A C     1 
ATOM   2355  O O     . TYR E 3 12  ? -31.389 16.719  26.844 1.00 40.22  ? 6   TYR A O     1 
ATOM   2356  C CB    . TYR E 3 12  ? -28.370 16.383  27.813 1.00 41.74  ? 6   TYR A CB    1 
ATOM   2357  C CG    . TYR E 3 12  ? -27.320 17.027  28.677 1.00 43.83  ? 6   TYR A CG    1 
ATOM   2358  C CD1   . TYR E 3 12  ? -27.353 18.406  28.935 1.00 45.18  ? 6   TYR A CD1   1 
ATOM   2359  C CD2   . TYR E 3 12  ? -26.313 16.262  29.271 1.00 43.99  ? 6   TYR A CD2   1 
ATOM   2360  C CE1   . TYR E 3 12  ? -26.407 18.998  29.747 1.00 46.97  ? 6   TYR A CE1   1 
ATOM   2361  C CE2   . TYR E 3 12  ? -25.353 16.851  30.084 1.00 45.77  ? 6   TYR A CE2   1 
ATOM   2362  C CZ    . TYR E 3 12  ? -25.405 18.214  30.312 1.00 47.92  ? 6   TYR A CZ    1 
ATOM   2363  O OH    . TYR E 3 12  ? -24.452 18.807  31.110 1.00 51.31  ? 6   TYR A OH    1 
ATOM   2364  N N     . ALA E 3 13  ? -31.166 14.589  27.589 1.00 38.12  ? 7   ALA A N     1 
ATOM   2365  C CA    . ALA E 3 13  ? -32.289 14.129  26.788 1.00 37.60  ? 7   ALA A CA    1 
ATOM   2366  C C     . ALA E 3 13  ? -33.570 14.791  27.302 1.00 37.36  ? 7   ALA A C     1 
ATOM   2367  O O     . ALA E 3 13  ? -34.413 15.209  26.515 1.00 38.07  ? 7   ALA A O     1 
ATOM   2368  C CB    . ALA E 3 13  ? -32.401 12.612  26.822 1.00 36.69  ? 7   ALA A CB    1 
ATOM   2369  N N     . ILE E 3 14  ? -33.687 14.890  28.627 1.00 36.85  ? 8   ILE A N     1 
ATOM   2370  C CA    . ILE E 3 14  ? -34.852 15.479  29.274 1.00 36.86  ? 8   ILE A CA    1 
ATOM   2371  C C     . ILE E 3 14  ? -34.900 16.998  29.090 1.00 38.80  ? 8   ILE A C     1 
ATOM   2372  O O     . ILE E 3 14  ? -35.904 17.531  28.601 1.00 39.79  ? 8   ILE A O     1 
ATOM   2373  C CB    . ILE E 3 14  ? -34.919 15.088  30.751 1.00 36.37  ? 8   ILE A CB    1 
ATOM   2374  C CG1   . ILE E 3 14  ? -35.175 13.575  30.874 1.00 34.69  ? 8   ILE A CG1   1 
ATOM   2375  C CG2   . ILE E 3 14  ? -35.996 15.879  31.489 1.00 36.35  ? 8   ILE A CG2   1 
ATOM   2376  C CD1   . ILE E 3 14  ? -35.097 13.045  32.307 1.00 33.51  ? 8   ILE A CD1   1 
ATOM   2377  N N     . LEU E 3 15  ? -33.824 17.701  29.442 1.00 39.62  ? 9   LEU A N     1 
ATOM   2378  C CA    . LEU E 3 15  ? -33.817 19.162  29.272 1.00 41.87  ? 9   LEU A CA    1 
ATOM   2379  C C     . LEU E 3 15  ? -34.150 19.548  27.839 1.00 42.83  ? 9   LEU A C     1 
ATOM   2380  O O     . LEU E 3 15  ? -34.885 20.508  27.610 1.00 44.59  ? 9   LEU A O     1 
ATOM   2381  C CB    . LEU E 3 15  ? -32.482 19.786  29.671 1.00 42.97  ? 9   LEU A CB    1 
ATOM   2382  C CG    . LEU E 3 15  ? -31.810 19.415  31.001 1.00 43.07  ? 9   LEU A CG    1 
ATOM   2383  C CD1   . LEU E 3 15  ? -30.556 20.264  31.141 1.00 44.35  ? 9   LEU A CD1   1 
ATOM   2384  C CD2   . LEU E 3 15  ? -32.724 19.565  32.235 1.00 42.30  ? 9   LEU A CD2   1 
ATOM   2385  N N     . GLY E 3 16  ? -33.615 18.786  26.884 1.00 42.10  ? 10  GLY A N     1 
ATOM   2386  C CA    . GLY E 3 16  ? -33.900 18.991  25.469 1.00 43.02  ? 10  GLY A CA    1 
ATOM   2387  C C     . GLY E 3 16  ? -35.360 18.737  25.164 1.00 43.63  ? 10  GLY A C     1 
ATOM   2388  O O     . GLY E 3 16  ? -36.006 19.527  24.456 1.00 45.96  ? 10  GLY A O     1 
ATOM   2389  N N     . LEU E 3 17  ? -35.901 17.649  25.708 1.00 41.60  ? 11  LEU A N     1 
ATOM   2390  C CA    . LEU E 3 17  ? -37.305 17.343  25.497 1.00 41.94  ? 11  LEU A CA    1 
ATOM   2391  C C     . LEU E 3 17  ? -38.241 18.429  26.017 1.00 43.64  ? 11  LEU A C     1 
ATOM   2392  O O     . LEU E 3 17  ? -39.326 18.588  25.479 1.00 45.45  ? 11  LEU A O     1 
ATOM   2393  C CB    . LEU E 3 17  ? -37.672 15.959  26.042 1.00 39.86  ? 11  LEU A CB    1 
ATOM   2394  C CG    . LEU E 3 17  ? -37.266 14.836  25.078 1.00 39.54  ? 11  LEU A CG    1 
ATOM   2395  C CD1   . LEU E 3 17  ? -37.292 13.426  25.729 1.00 35.71  ? 11  LEU A CD1   1 
ATOM   2396  C CD2   . LEU E 3 17  ? -38.079 14.893  23.761 1.00 38.81  ? 11  LEU A CD2   1 
ATOM   2397  N N     . LEU E 3 18  ? -37.805 19.181  27.030 1.00 44.18  ? 12  LEU A N     1 
ATOM   2398  C CA    . LEU E 3 18  ? -38.556 20.331  27.579 1.00 46.52  ? 12  LEU A CA    1 
ATOM   2399  C C     . LEU E 3 18  ? -38.246 21.696  26.932 1.00 49.40  ? 12  LEU A C     1 
ATOM   2400  O O     . LEU E 3 18  ? -38.722 22.739  27.415 1.00 52.00  ? 12  LEU A O     1 
ATOM   2401  C CB    . LEU E 3 18  ? -38.362 20.420  29.100 1.00 45.64  ? 12  LEU A CB    1 
ATOM   2402  C CG    . LEU E 3 18  ? -38.625 19.126  29.889 1.00 44.73  ? 12  LEU A CG    1 
ATOM   2403  C CD1   . LEU E 3 18  ? -38.046 19.135  31.321 1.00 43.59  ? 12  LEU A CD1   1 
ATOM   2404  C CD2   . LEU E 3 18  ? -40.104 18.804  29.910 1.00 45.75  ? 12  LEU A CD2   1 
ATOM   2405  N N     . ARG E 3 19  ? -37.484 21.712  25.839 1.00 50.08  ? 13  ARG A N     1 
ATOM   2406  C CA    . ARG E 3 19  ? -37.025 23.000  25.246 1.00 53.30  ? 13  ARG A CA    1 
ATOM   2407  C C     . ARG E 3 19  ? -38.147 23.873  24.693 1.00 56.44  ? 13  ARG A C     1 
ATOM   2408  O O     . ARG E 3 19  ? -37.979 25.070  24.562 1.00 59.56  ? 13  ARG A O     1 
ATOM   2409  C CB    . ARG E 3 19  ? -35.957 22.776  24.161 1.00 53.05  ? 13  ARG A CB    1 
ATOM   2410  C CG    . ARG E 3 19  ? -36.513 22.258  22.846 1.00 53.90  ? 13  ARG A CG    1 
ATOM   2411  C CD    . ARG E 3 19  ? -35.498 21.507  21.982 1.00 52.42  ? 13  ARG A CD    1 
ATOM   2412  N NE    . ARG E 3 19  ? -36.123 21.137  20.711 1.00 54.67  ? 13  ARG A NE    1 
ATOM   2413  C CZ    . ARG E 3 19  ? -36.998 20.140  20.552 1.00 53.79  ? 13  ARG A CZ    1 
ATOM   2414  N NH1   . ARG E 3 19  ? -37.354 19.373  21.576 1.00 50.59  ? 13  ARG A NH1   1 
ATOM   2415  N NH2   . ARG E 3 19  ? -37.517 19.907  19.354 1.00 56.14  ? 13  ARG A NH2   1 
ATOM   2416  N N     . LYS E 3 20  ? -39.277 23.250  24.366 1.00 56.89  ? 14  LYS A N     1 
ATOM   2417  C CA    . LYS E 3 20  ? -40.435 23.904  23.762 1.00 60.02  ? 14  LYS A CA    1 
ATOM   2418  C C     . LYS E 3 20  ? -41.612 24.002  24.711 1.00 60.58  ? 14  LYS A C     1 
ATOM   2419  O O     . LYS E 3 20  ? -42.712 24.299  24.269 1.00 63.77  ? 14  LYS A O     1 
ATOM   2420  C CB    . LYS E 3 20  ? -40.909 23.111  22.540 1.00 60.37  ? 14  LYS A CB    1 
ATOM   2421  C CG    . LYS E 3 20  ? -40.172 23.403  21.252 1.00 63.58  ? 14  LYS A CG    1 
ATOM   2422  C CD    . LYS E 3 20  ? -40.589 22.409  20.178 1.00 66.49  ? 14  LYS A CD    1 
ATOM   2423  C CE    . LYS E 3 20  ? -40.183 22.877  18.778 1.00 70.76  ? 14  LYS A CE    1 
ATOM   2424  N NZ    . LYS E 3 20  ? -40.082 21.707  17.843 1.00 71.27  ? 14  LYS A NZ    1 
ATOM   2425  N N     . GLY E 3 21  ? -41.417 23.737  25.997 1.00 58.29  ? 15  GLY A N     1 
ATOM   2426  C CA    . GLY E 3 21  ? -42.534 23.800  26.924 1.00 59.21  ? 15  GLY A CA    1 
ATOM   2427  C C     . GLY E 3 21  ? -42.720 22.587  27.808 1.00 56.75  ? 15  GLY A C     1 
ATOM   2428  O O     . GLY E 3 21  ? -41.936 21.623  27.770 1.00 54.14  ? 15  GLY A O     1 
ATOM   2429  N N     . GLU E 3 22  ? -43.782 22.617  28.601 1.00 57.68  ? 16  GLU A N     1 
ATOM   2430  C CA    . GLU E 3 22  ? -43.913 21.662  29.695 1.00 55.39  ? 16  GLU A CA    1 
ATOM   2431  C C     . GLU E 3 22  ? -44.307 20.244  29.266 1.00 53.21  ? 16  GLU A C     1 
ATOM   2432  O O     . GLU E 3 22  ? -45.047 20.062  28.298 1.00 54.65  ? 16  GLU A O     1 
ATOM   2433  C CB    . GLU E 3 22  ? -44.864 22.204  30.762 1.00 57.39  ? 16  GLU A CB    1 
ATOM   2434  C CG    . GLU E 3 22  ? -46.260 22.444  30.292 1.00 59.96  ? 16  GLU A CG    1 
ATOM   2435  C CD    . GLU E 3 22  ? -47.127 23.005  31.390 1.00 64.17  ? 16  GLU A CD    1 
ATOM   2436  O OE1   . GLU E 3 22  ? -46.576 23.391  32.451 1.00 62.95  ? 16  GLU A OE1   1 
ATOM   2437  O OE2   . GLU E 3 22  ? -48.362 23.067  31.190 1.00 67.94  ? 16  GLU A OE2   1 
ATOM   2438  N N     . LEU E 3 23  ? -43.802 19.254  30.000 1.00 50.05  ? 17  LEU A N     1 
ATOM   2439  C CA    . LEU E 3 23  ? -44.129 17.847  29.754 1.00 48.48  ? 17  LEU A CA    1 
ATOM   2440  C C     . LEU E 3 23  ? -44.226 17.073  31.061 1.00 47.16  ? 17  LEU A C     1 
ATOM   2441  O O     . LEU E 3 23  ? -43.613 17.437  32.059 1.00 47.05  ? 17  LEU A O     1 
ATOM   2442  C CB    . LEU E 3 23  ? -43.089 17.171  28.829 1.00 46.51  ? 17  LEU A CB    1 
ATOM   2443  C CG    . LEU E 3 23  ? -42.850 17.703  27.396 1.00 47.42  ? 17  LEU A CG    1 
ATOM   2444  C CD1   . LEU E 3 23  ? -41.681 16.998  26.722 1.00 43.72  ? 17  LEU A CD1   1 
ATOM   2445  C CD2   . LEU E 3 23  ? -44.117 17.655  26.515 1.00 47.46  ? 17  LEU A CD2   1 
ATOM   2446  N N     . SER E 3 24  ? -44.995 15.994  31.051 1.00 46.81  ? 18  SER A N     1 
ATOM   2447  C CA    . SER E 3 24  ? -45.023 15.066  32.175 1.00 45.10  ? 18  SER A CA    1 
ATOM   2448  C C     . SER E 3 24  ? -43.954 14.011  31.977 1.00 42.55  ? 18  SER A C     1 
ATOM   2449  O O     . SER E 3 24  ? -43.491 13.796  30.864 1.00 42.03  ? 18  SER A O     1 
ATOM   2450  C CB    . SER E 3 24  ? -46.392 14.393  32.252 1.00 46.53  ? 18  SER A CB    1 
ATOM   2451  O OG    . SER E 3 24  ? -46.687 13.663  31.060 1.00 46.98  ? 18  SER A OG    1 
ATOM   2452  N N     . GLY E 3 25  ? -43.568 13.342  33.056 1.00 41.61  ? 19  GLY A N     1 
ATOM   2453  C CA    . GLY E 3 25  ? -42.731 12.146  32.947 1.00 39.48  ? 19  GLY A CA    1 
ATOM   2454  C C     . GLY E 3 25  ? -43.317 11.190  31.928 1.00 39.63  ? 19  GLY A C     1 
ATOM   2455  O O     . GLY E 3 25  ? -42.591 10.599  31.129 1.00 38.88  ? 19  GLY A O     1 
ATOM   2456  N N     . TYR E 3 26  ? -44.643 11.062  31.932 1.00 41.27  ? 20  TYR A N     1 
ATOM   2457  C CA    . TYR E 3 26  ? -45.330 10.193  30.972 1.00 41.98  ? 20  TYR A CA    1 
ATOM   2458  C C     . TYR E 3 26  ? -45.088 10.661  29.535 1.00 42.98  ? 20  TYR A C     1 
ATOM   2459  O O     . TYR E 3 26  ? -44.741 9.853   28.652 1.00 43.08  ? 20  TYR A O     1 
ATOM   2460  C CB    . TYR E 3 26  ? -46.829 10.097  31.274 1.00 43.54  ? 20  TYR A CB    1 
ATOM   2461  C CG    . TYR E 3 26  ? -47.504 9.001   30.487 1.00 44.54  ? 20  TYR A CG    1 
ATOM   2462  C CD1   . TYR E 3 26  ? -47.503 7.677   30.958 1.00 43.40  ? 20  TYR A CD1   1 
ATOM   2463  C CD2   . TYR E 3 26  ? -48.116 9.268   29.257 1.00 45.05  ? 20  TYR A CD2   1 
ATOM   2464  C CE1   . TYR E 3 26  ? -48.094 6.653   30.238 1.00 43.61  ? 20  TYR A CE1   1 
ATOM   2465  C CE2   . TYR E 3 26  ? -48.718 8.249   28.529 1.00 47.57  ? 20  TYR A CE2   1 
ATOM   2466  C CZ    . TYR E 3 26  ? -48.698 6.937   29.030 1.00 47.44  ? 20  TYR A CZ    1 
ATOM   2467  O OH    . TYR E 3 26  ? -49.287 5.917   28.321 1.00 48.81  ? 20  TYR A OH    1 
ATOM   2468  N N     . ASP E 3 27  ? -45.250 11.964  29.307 1.00 43.88  ? 21  ASP A N     1 
ATOM   2469  C CA    . ASP E 3 27  ? -44.970 12.549  27.998 1.00 44.95  ? 21  ASP A CA    1 
ATOM   2470  C C     . ASP E 3 27  ? -43.550 12.218  27.523 1.00 43.17  ? 21  ASP A C     1 
ATOM   2471  O O     . ASP E 3 27  ? -43.353 11.884  26.350 1.00 43.67  ? 21  ASP A O     1 
ATOM   2472  C CB    . ASP E 3 27  ? -45.152 14.073  28.020 1.00 46.43  ? 21  ASP A CB    1 
ATOM   2473  C CG    . ASP E 3 27  ? -46.615 14.509  28.053 1.00 50.20  ? 21  ASP A CG    1 
ATOM   2474  O OD1   . ASP E 3 27  ? -47.492 13.835  27.459 1.00 50.96  ? 21  ASP A OD1   1 
ATOM   2475  O OD2   . ASP E 3 27  ? -46.880 15.575  28.665 1.00 54.46  ? 21  ASP A OD2   1 
ATOM   2476  N N     . ILE E 3 28  ? -42.572 12.321  28.432 1.00 41.07  ? 22  ILE A N     1 
ATOM   2477  C CA    . ILE E 3 28  ? -41.170 12.079  28.102 1.00 39.68  ? 22  ILE A CA    1 
ATOM   2478  C C     . ILE E 3 28  ? -40.977 10.616  27.701 1.00 40.01  ? 22  ILE A C     1 
ATOM   2479  O O     . ILE E 3 28  ? -40.356 10.330  26.665 1.00 40.48  ? 22  ILE A O     1 
ATOM   2480  C CB    . ILE E 3 28  ? -40.235 12.466  29.265 1.00 38.36  ? 22  ILE A CB    1 
ATOM   2481  C CG1   . ILE E 3 28  ? -40.058 13.982  29.325 1.00 38.55  ? 22  ILE A CG1   1 
ATOM   2482  C CG2   . ILE E 3 28  ? -38.864 11.805  29.135 1.00 36.65  ? 22  ILE A CG2   1 
ATOM   2483  C CD1   . ILE E 3 28  ? -39.925 14.498  30.729 1.00 38.65  ? 22  ILE A CD1   1 
ATOM   2484  N N     . THR E 3 29  ? -41.531 9.702   28.504 1.00 39.88  ? 23  THR A N     1 
ATOM   2485  C CA    . THR E 3 29  ? -41.489 8.278   28.203 1.00 40.12  ? 23  THR A CA    1 
ATOM   2486  C C     . THR E 3 29  ? -41.985 8.020   26.780 1.00 42.34  ? 23  THR A C     1 
ATOM   2487  O O     . THR E 3 29  ? -41.366 7.245   26.047 1.00 42.69  ? 23  THR A O     1 
ATOM   2488  C CB    . THR E 3 29  ? -42.295 7.456   29.250 1.00 40.64  ? 23  THR A CB    1 
ATOM   2489  O OG1   . THR E 3 29  ? -41.719 7.646   30.558 1.00 40.18  ? 23  THR A OG1   1 
ATOM   2490  C CG2   . THR E 3 29  ? -42.308 5.965   28.918 1.00 39.68  ? 23  THR A CG2   1 
ATOM   2491  N N     . SER E 3 30  ? -43.071 8.698   26.391 1.00 44.06  ? 24  SER A N     1 
ATOM   2492  C CA    . SER E 3 30  ? -43.672 8.556   25.064 1.00 46.72  ? 24  SER A CA    1 
ATOM   2493  C C     . SER E 3 30  ? -42.751 9.000   23.935 1.00 47.32  ? 24  SER A C     1 
ATOM   2494  O O     . SER E 3 30  ? -42.689 8.340   22.886 1.00 48.78  ? 24  SER A O     1 
ATOM   2495  C CB    . SER E 3 30  ? -44.981 9.351   24.958 1.00 48.64  ? 24  SER A CB    1 
ATOM   2496  O OG    . SER E 3 30  ? -45.992 8.803   25.782 1.00 51.32  ? 24  SER A OG    1 
ATOM   2497  N N     . TYR E 3 31  ? -42.066 10.133  24.121 1.00 46.32  ? 25  TYR A N     1 
ATOM   2498  C CA    . TYR E 3 31  ? -41.192 10.641  23.065 1.00 46.81  ? 25  TYR A CA    1 
ATOM   2499  C C     . TYR E 3 31  ? -40.108 9.628   22.747 1.00 46.05  ? 25  TYR A C     1 
ATOM   2500  O O     . TYR E 3 31  ? -39.791 9.418   21.577 1.00 47.60  ? 25  TYR A O     1 
ATOM   2501  C CB    . TYR E 3 31  ? -40.603 12.013  23.397 1.00 45.99  ? 25  TYR A CB    1 
ATOM   2502  C CG    . TYR E 3 31  ? -41.527 13.119  23.015 1.00 48.59  ? 25  TYR A CG    1 
ATOM   2503  C CD1   . TYR E 3 31  ? -41.716 13.457  21.669 1.00 51.83  ? 25  TYR A CD1   1 
ATOM   2504  C CD2   . TYR E 3 31  ? -42.237 13.827  23.982 1.00 49.62  ? 25  TYR A CD2   1 
ATOM   2505  C CE1   . TYR E 3 31  ? -42.590 14.477  21.294 1.00 54.28  ? 25  TYR A CE1   1 
ATOM   2506  C CE2   . TYR E 3 31  ? -43.117 14.861  23.615 1.00 52.49  ? 25  TYR A CE2   1 
ATOM   2507  C CZ    . TYR E 3 31  ? -43.285 15.177  22.268 1.00 54.61  ? 25  TYR A CZ    1 
ATOM   2508  O OH    . TYR E 3 31  ? -44.159 16.180  21.897 1.00 58.25  ? 25  TYR A OH    1 
ATOM   2509  N N     . PHE E 3 32  ? -39.578 8.980   23.787 1.00 44.19  ? 26  PHE A N     1 
ATOM   2510  C CA    . PHE E 3 32  ? -38.628 7.871   23.621 1.00 43.74  ? 26  PHE A CA    1 
ATOM   2511  C C     . PHE E 3 32  ? -39.213 6.660   22.890 1.00 45.88  ? 26  PHE A C     1 
ATOM   2512  O O     . PHE E 3 32  ? -38.459 5.819   22.416 1.00 47.03  ? 26  PHE A O     1 
ATOM   2513  C CB    . PHE E 3 32  ? -38.036 7.435   24.969 1.00 41.72  ? 26  PHE A CB    1 
ATOM   2514  C CG    . PHE E 3 32  ? -37.140 8.472   25.621 1.00 40.48  ? 26  PHE A CG    1 
ATOM   2515  C CD1   . PHE E 3 32  ? -36.160 9.137   24.889 1.00 39.78  ? 26  PHE A CD1   1 
ATOM   2516  C CD2   . PHE E 3 32  ? -37.256 8.754   26.979 1.00 39.26  ? 26  PHE A CD2   1 
ATOM   2517  C CE1   . PHE E 3 32  ? -35.342 10.069  25.483 1.00 38.92  ? 26  PHE A CE1   1 
ATOM   2518  C CE2   . PHE E 3 32  ? -36.429 9.701   27.586 1.00 37.81  ? 26  PHE A CE2   1 
ATOM   2519  C CZ    . PHE E 3 32  ? -35.473 10.355  26.838 1.00 37.86  ? 26  PHE A CZ    1 
ATOM   2520  N N     . LYS E 3 33  ? -40.538 6.543   22.800 1.00 47.35  ? 27  LYS A N     1 
ATOM   2521  C CA    . LYS E 3 33  ? -41.129 5.412   22.062 1.00 49.83  ? 27  LYS A CA    1 
ATOM   2522  C C     . LYS E 3 33  ? -41.478 5.811   20.639 1.00 52.54  ? 27  LYS A C     1 
ATOM   2523  O O     . LYS E 3 33  ? -41.867 4.966   19.838 1.00 55.42  ? 27  LYS A O     1 
ATOM   2524  C CB    . LYS E 3 33  ? -42.367 4.828   22.763 1.00 50.40  ? 27  LYS A CB    1 
ATOM   2525  C CG    . LYS E 3 33  ? -42.115 4.180   24.122 1.00 48.86  ? 27  LYS A CG    1 
ATOM   2526  N N     . GLU E 3 34  ? -41.347 7.095   20.323 1.00 52.53  ? 28  GLU A N     1 
ATOM   2527  C CA    . GLU E 3 34  ? -41.621 7.577   18.971 1.00 55.49  ? 28  GLU A CA    1 
ATOM   2528  C C     . GLU E 3 34  ? -40.300 7.715   18.221 1.00 55.68  ? 28  GLU A C     1 
ATOM   2529  O O     . GLU E 3 34  ? -39.355 6.988   18.538 1.00 54.78  ? 28  GLU A O     1 
ATOM   2530  C CB    . GLU E 3 34  ? -42.439 8.876   18.991 1.00 56.42  ? 28  GLU A CB    1 
ATOM   2531  C CG    . GLU E 3 34  ? -43.936 8.673   19.278 1.00 57.06  ? 28  GLU A CG    1 
ATOM   2532  N N     . GLU E 3 35  ? -40.220 8.627   17.248 1.00 57.14  ? 29  GLU A N     1 
ATOM   2533  C CA    . GLU E 3 35  ? -39.046 8.706   16.358 1.00 57.81  ? 29  GLU A CA    1 
ATOM   2534  C C     . GLU E 3 35  ? -37.688 8.909   17.049 1.00 54.75  ? 29  GLU A C     1 
ATOM   2535  O O     . GLU E 3 35  ? -36.665 8.450   16.539 1.00 55.47  ? 29  GLU A O     1 
ATOM   2536  C CB    . GLU E 3 35  ? -39.244 9.719   15.217 1.00 60.67  ? 29  GLU A CB    1 
ATOM   2537  C CG    . GLU E 3 35  ? -39.253 11.197  15.615 1.00 61.03  ? 29  GLU A CG    1 
ATOM   2538  C CD    . GLU E 3 35  ? -40.588 11.666  16.183 1.00 63.46  ? 29  GLU A CD    1 
ATOM   2539  O OE1   . GLU E 3 35  ? -41.628 11.021  15.899 1.00 65.64  ? 29  GLU A OE1   1 
ATOM   2540  O OE2   . GLU E 3 35  ? -40.591 12.684  16.916 1.00 62.65  ? 29  GLU A OE2   1 
ATOM   2541  N N     . LEU E 3 36  ? -37.673 9.580   18.200 1.00 51.80  ? 30  LEU A N     1 
ATOM   2542  C CA    . LEU E 3 36  ? -36.426 9.765   18.956 1.00 49.02  ? 30  LEU A CA    1 
ATOM   2543  C C     . LEU E 3 36  ? -35.845 8.450   19.477 1.00 47.57  ? 30  LEU A C     1 
ATOM   2544  O O     . LEU E 3 36  ? -34.633 8.321   19.627 1.00 46.66  ? 30  LEU A O     1 
ATOM   2545  C CB    . LEU E 3 36  ? -36.628 10.752  20.108 1.00 47.31  ? 30  LEU A CB    1 
ATOM   2546  C CG    . LEU E 3 36  ? -35.486 11.017  21.090 1.00 45.53  ? 30  LEU A CG    1 
ATOM   2547  C CD1   . LEU E 3 36  ? -34.225 11.498  20.379 1.00 46.66  ? 30  LEU A CD1   1 
ATOM   2548  C CD2   . LEU E 3 36  ? -35.946 12.045  22.099 1.00 45.36  ? 30  LEU A CD2   1 
ATOM   2549  N N     . GLY E 3 37  ? -36.716 7.478   19.730 1.00 47.48  ? 31  GLY A N     1 
ATOM   2550  C CA    . GLY E 3 37  ? -36.313 6.156   20.217 1.00 47.02  ? 31  GLY A CA    1 
ATOM   2551  C C     . GLY E 3 37  ? -35.357 5.374   19.341 1.00 48.60  ? 31  GLY A C     1 
ATOM   2552  O O     . GLY E 3 37  ? -34.804 4.368   19.772 1.00 48.61  ? 31  GLY A O     1 
ATOM   2553  N N     . GLN E 3 38  ? -35.169 5.835   18.106 1.00 50.39  ? 32  GLN A N     1 
ATOM   2554  C CA    . GLN E 3 38  ? -34.170 5.267   17.198 1.00 52.27  ? 32  GLN A CA    1 
ATOM   2555  C C     . GLN E 3 38  ? -32.722 5.501   17.639 1.00 50.83  ? 32  GLN A C     1 
ATOM   2556  O O     . GLN E 3 38  ? -31.823 4.787   17.182 1.00 52.42  ? 32  GLN A O     1 
ATOM   2557  C CB    . GLN E 3 38  ? -34.341 5.846   15.790 1.00 55.05  ? 32  GLN A CB    1 
ATOM   2558  C CG    . GLN E 3 38  ? -35.534 5.310   15.013 1.00 58.19  ? 32  GLN A CG    1 
ATOM   2559  C CD    . GLN E 3 38  ? -35.509 3.809   14.873 1.00 60.13  ? 32  GLN A CD    1 
ATOM   2560  O OE1   . GLN E 3 38  ? -34.507 3.225   14.456 1.00 61.94  ? 32  GLN A OE1   1 
ATOM   2561  N NE2   . GLN E 3 38  ? -36.613 3.170   15.230 1.00 60.52  ? 32  GLN A NE2   1 
ATOM   2562  N N     . PHE E 3 39  ? -32.508 6.493   18.512 1.00 48.04  ? 33  PHE A N     1 
ATOM   2563  C CA    . PHE E 3 39  ? -31.171 6.976   18.868 1.00 47.17  ? 33  PHE A CA    1 
ATOM   2564  C C     . PHE E 3 39  ? -30.944 7.269   20.354 1.00 45.23  ? 33  PHE A C     1 
ATOM   2565  O O     . PHE E 3 39  ? -29.805 7.458   20.782 1.00 44.94  ? 33  PHE A O     1 
ATOM   2566  C CB    . PHE E 3 39  ? -30.825 8.219   18.044 1.00 47.46  ? 33  PHE A CB    1 
ATOM   2567  C CG    . PHE E 3 39  ? -30.730 7.948   16.584 1.00 50.08  ? 33  PHE A CG    1 
ATOM   2568  C CD1   . PHE E 3 39  ? -29.732 7.118   16.089 1.00 50.91  ? 33  PHE A CD1   1 
ATOM   2569  C CD2   . PHE E 3 39  ? -31.659 8.490   15.702 1.00 50.98  ? 33  PHE A CD2   1 
ATOM   2570  C CE1   . PHE E 3 39  ? -29.650 6.851   14.756 1.00 53.76  ? 33  PHE A CE1   1 
ATOM   2571  C CE2   . PHE E 3 39  ? -31.589 8.225   14.360 1.00 53.11  ? 33  PHE A CE2   1 
ATOM   2572  C CZ    . PHE E 3 39  ? -30.581 7.401   13.882 1.00 55.87  ? 33  PHE A CZ    1 
ATOM   2573  N N     . TRP E 3 40  ? -32.031 7.354   21.117 1.00 44.24  ? 34  TRP A N     1 
ATOM   2574  C CA    . TRP E 3 40  ? -31.974 7.390   22.571 1.00 42.37  ? 34  TRP A CA    1 
ATOM   2575  C C     . TRP E 3 40  ? -33.293 6.920   23.182 1.00 41.93  ? 34  TRP A C     1 
ATOM   2576  O O     . TRP E 3 40  ? -34.368 7.359   22.775 1.00 42.50  ? 34  TRP A O     1 
ATOM   2577  C CB    . TRP E 3 40  ? -31.602 8.776   23.130 1.00 41.35  ? 34  TRP A CB    1 
ATOM   2578  C CG    . TRP E 3 40  ? -30.949 8.577   24.452 1.00 40.87  ? 34  TRP A CG    1 
ATOM   2579  C CD1   . TRP E 3 40  ? -31.568 8.472   25.666 1.00 39.69  ? 34  TRP A CD1   1 
ATOM   2580  C CD2   . TRP E 3 40  ? -29.559 8.327   24.682 1.00 40.94  ? 34  TRP A CD2   1 
ATOM   2581  N NE1   . TRP E 3 40  ? -30.641 8.199   26.645 1.00 40.37  ? 34  TRP A NE1   1 
ATOM   2582  C CE2   . TRP E 3 40  ? -29.401 8.102   26.069 1.00 41.59  ? 34  TRP A CE2   1 
ATOM   2583  C CE3   . TRP E 3 40  ? -28.431 8.293   23.855 1.00 41.44  ? 34  TRP A CE3   1 
ATOM   2584  C CZ2   . TRP E 3 40  ? -28.150 7.841   26.651 1.00 42.99  ? 34  TRP A CZ2   1 
ATOM   2585  C CZ3   . TRP E 3 40  ? -27.193 8.033   24.422 1.00 44.16  ? 34  TRP A CZ3   1 
ATOM   2586  C CH2   . TRP E 3 40  ? -27.060 7.803   25.815 1.00 44.47  ? 34  TRP A CH2   1 
ATOM   2587  N N     . SER E 3 41  ? -33.216 6.017   24.151 1.00 41.09  ? 35  SER A N     1 
ATOM   2588  C CA    . SER E 3 41  ? -34.389 5.709   24.944 1.00 40.58  ? 35  SER A CA    1 
ATOM   2589  C C     . SER E 3 41  ? -34.042 5.530   26.414 1.00 39.16  ? 35  SER A C     1 
ATOM   2590  O O     . SER E 3 41  ? -32.885 5.247   26.776 1.00 39.41  ? 35  SER A O     1 
ATOM   2591  C CB    . SER E 3 41  ? -35.094 4.455   24.416 1.00 42.39  ? 35  SER A CB    1 
ATOM   2592  O OG    . SER E 3 41  ? -34.254 3.312   24.570 1.00 44.86  ? 35  SER A OG    1 
ATOM   2593  N N     . ALA E 3 42  ? -35.067 5.685   27.248 1.00 37.67  ? 36  ALA A N     1 
ATOM   2594  C CA    . ALA E 3 42  ? -34.987 5.380   28.653 1.00 36.45  ? 36  ALA A CA    1 
ATOM   2595  C C     . ALA E 3 42  ? -36.318 4.802   29.077 1.00 36.32  ? 36  ALA A C     1 
ATOM   2596  O O     . ALA E 3 42  ? -37.323 5.045   28.452 1.00 36.55  ? 36  ALA A O     1 
ATOM   2597  C CB    . ALA E 3 42  ? -34.665 6.636   29.446 1.00 35.35  ? 36  ALA A CB    1 
ATOM   2598  N N     . LYS E 3 43  ? -36.319 4.035   30.154 1.00 36.92  ? 37  LYS A N     1 
ATOM   2599  C CA    . LYS E 3 43  ? -37.557 3.512   30.710 1.00 37.21  ? 37  LYS A CA    1 
ATOM   2600  C C     . LYS E 3 43  ? -38.056 4.477   31.754 1.00 36.27  ? 37  LYS A C     1 
ATOM   2601  O O     . LYS E 3 43  ? -37.263 5.210   32.345 1.00 36.19  ? 37  LYS A O     1 
ATOM   2602  C CB    . LYS E 3 43  ? -37.316 2.159   31.364 1.00 38.68  ? 37  LYS A CB    1 
ATOM   2603  C CG    . LYS E 3 43  ? -36.537 1.165   30.529 1.00 40.44  ? 37  LYS A CG    1 
ATOM   2604  C CD    . LYS E 3 43  ? -37.415 0.469   29.533 1.00 42.80  ? 37  LYS A CD    1 
ATOM   2605  C CE    . LYS E 3 43  ? -36.644 -0.636  28.860 1.00 46.03  ? 37  LYS A CE    1 
ATOM   2606  N NZ    . LYS E 3 43  ? -37.313 -1.029  27.595 1.00 48.83  ? 37  LYS A NZ    1 
ATOM   2607  N N     . HIS E 3 44  ? -39.364 4.466   31.998 1.00 36.26  ? 38  HIS A N     1 
ATOM   2608  C CA    . HIS E 3 44  ? -39.976 5.326   33.013 1.00 35.33  ? 38  HIS A CA    1 
ATOM   2609  C C     . HIS E 3 44  ? -39.276 5.205   34.385 1.00 35.25  ? 38  HIS A C     1 
ATOM   2610  O O     . HIS E 3 44  ? -39.134 6.185   35.098 1.00 35.24  ? 38  HIS A O     1 
ATOM   2611  C CB    . HIS E 3 44  ? -41.511 5.109   33.077 1.00 35.48  ? 38  HIS A CB    1 
ATOM   2612  C CG    . HIS E 3 44  ? -41.944 3.942   33.906 1.00 36.67  ? 38  HIS A CG    1 
ATOM   2613  N ND1   . HIS E 3 44  ? -41.970 2.648   33.423 1.00 38.93  ? 38  HIS A ND1   1 
ATOM   2614  C CD2   . HIS E 3 44  ? -42.366 3.866   35.193 1.00 37.42  ? 38  HIS A CD2   1 
ATOM   2615  C CE1   . HIS E 3 44  ? -42.391 1.826   34.372 1.00 38.80  ? 38  HIS A CE1   1 
ATOM   2616  N NE2   . HIS E 3 44  ? -42.646 2.539   35.455 1.00 38.68  ? 38  HIS A NE2   1 
ATOM   2617  N N     . SER E 3 45  ? -38.797 4.006   34.710 1.00 36.17  ? 39  SER A N     1 
ATOM   2618  C CA    . SER E 3 45  ? -38.144 3.730   35.991 1.00 36.73  ? 39  SER A CA    1 
ATOM   2619  C C     . SER E 3 45  ? -36.827 4.479   36.122 1.00 36.44  ? 39  SER A C     1 
ATOM   2620  O O     . SER E 3 45  ? -36.311 4.634   37.220 1.00 37.23  ? 39  SER A O     1 
ATOM   2621  C CB    . SER E 3 45  ? -37.895 2.222   36.183 1.00 37.71  ? 39  SER A CB    1 
ATOM   2622  O OG    . SER E 3 45  ? -36.955 1.729   35.248 1.00 37.48  ? 39  SER A OG    1 
ATOM   2623  N N     . GLN E 3 46  ? -36.273 4.919   35.006 1.00 35.56  ? 40  GLN A N     1 
ATOM   2624  C CA    . GLN E 3 46  ? -35.068 5.711   35.065 1.00 35.99  ? 40  GLN A CA    1 
ATOM   2625  C C     . GLN E 3 46  ? -35.433 7.200   35.006 1.00 35.89  ? 40  GLN A C     1 
ATOM   2626  O O     . GLN E 3 46  ? -34.788 8.024   35.652 1.00 36.77  ? 40  GLN A O     1 
ATOM   2627  C CB    . GLN E 3 46  ? -34.143 5.326   33.924 1.00 36.02  ? 40  GLN A CB    1 
ATOM   2628  C CG    . GLN E 3 46  ? -32.709 5.765   34.085 1.00 37.50  ? 40  GLN A CG    1 
ATOM   2629  C CD    . GLN E 3 46  ? -31.863 5.447   32.864 1.00 39.35  ? 40  GLN A CD    1 
ATOM   2630  O OE1   . GLN E 3 46  ? -32.279 4.700   31.986 1.00 41.62  ? 40  GLN A OE1   1 
ATOM   2631  N NE2   . GLN E 3 46  ? -30.672 6.014   32.806 1.00 40.33  ? 40  GLN A NE2   1 
ATOM   2632  N N     . ILE E 3 47  ? -36.490 7.522   34.257 1.00 35.40  ? 41  ILE A N     1 
ATOM   2633  C CA    . ILE E 3 47  ? -36.886 8.887   34.012 1.00 35.10  ? 41  ILE A CA    1 
ATOM   2634  C C     . ILE E 3 47  ? -37.400 9.553   35.281 1.00 35.92  ? 41  ILE A C     1 
ATOM   2635  O O     . ILE E 3 47  ? -36.969 10.657  35.611 1.00 36.82  ? 41  ILE A O     1 
ATOM   2636  C CB    . ILE E 3 47  ? -37.908 8.974   32.852 1.00 35.32  ? 41  ILE A CB    1 
ATOM   2637  C CG1   . ILE E 3 47  ? -37.230 8.605   31.529 1.00 34.89  ? 41  ILE A CG1   1 
ATOM   2638  C CG2   . ILE E 3 47  ? -38.571 10.363  32.781 1.00 34.13  ? 41  ILE A CG2   1 
ATOM   2639  C CD1   . ILE E 3 47  ? -38.175 8.172   30.428 1.00 34.70  ? 41  ILE A CD1   1 
ATOM   2640  N N     . TYR E 3 48  ? -38.295 8.896   36.009 1.00 36.28  ? 42  TYR A N     1 
ATOM   2641  C CA    . TYR E 3 48  ? -38.883 9.537   37.206 1.00 37.04  ? 42  TYR A CA    1 
ATOM   2642  C C     . TYR E 3 48  ? -37.868 9.955   38.276 1.00 37.98  ? 42  TYR A C     1 
ATOM   2643  O O     . TYR E 3 48  ? -37.915 11.109  38.729 1.00 39.32  ? 42  TYR A O     1 
ATOM   2644  C CB    . TYR E 3 48  ? -40.011 8.707   37.812 1.00 37.17  ? 42  TYR A CB    1 
ATOM   2645  C CG    . TYR E 3 48  ? -41.262 8.757   36.984 1.00 36.14  ? 42  TYR A CG    1 
ATOM   2646  C CD1   . TYR E 3 48  ? -41.928 9.975   36.771 1.00 33.51  ? 42  TYR A CD1   1 
ATOM   2647  C CD2   . TYR E 3 48  ? -41.783 7.585   36.406 1.00 33.39  ? 42  TYR A CD2   1 
ATOM   2648  C CE1   . TYR E 3 48  ? -43.069 10.031  36.009 1.00 34.31  ? 42  TYR A CE1   1 
ATOM   2649  C CE2   . TYR E 3 48  ? -42.930 7.627   35.631 1.00 33.99  ? 42  TYR A CE2   1 
ATOM   2650  C CZ    . TYR E 3 48  ? -43.565 8.858   35.434 1.00 36.57  ? 42  TYR A CZ    1 
ATOM   2651  O OH    . TYR E 3 48  ? -44.707 8.919   34.672 1.00 39.30  ? 42  TYR A OH    1 
ATOM   2652  N N     . PRO E 3 49  ? -36.946 9.043   38.674 1.00 38.36  ? 43  PRO A N     1 
ATOM   2653  C CA    . PRO E 3 49  ? -35.890 9.454   39.618 1.00 39.56  ? 43  PRO A CA    1 
ATOM   2654  C C     . PRO E 3 49  ? -35.022 10.600  39.083 1.00 39.77  ? 43  PRO A C     1 
ATOM   2655  O O     . PRO E 3 49  ? -34.600 11.464  39.856 1.00 41.06  ? 43  PRO A O     1 
ATOM   2656  C CB    . PRO E 3 49  ? -35.039 8.198   39.765 1.00 39.17  ? 43  PRO A CB    1 
ATOM   2657  C CG    . PRO E 3 49  ? -35.973 7.072   39.478 1.00 39.03  ? 43  PRO A CG    1 
ATOM   2658  C CD    . PRO E 3 49  ? -36.876 7.594   38.392 1.00 38.20  ? 43  PRO A CD    1 
ATOM   2659  N N     . GLU E 3 50  ? -34.760 10.593  37.776 1.00 38.75  ? 44  GLU A N     1 
ATOM   2660  C CA    . GLU E 3 50  ? -33.949 11.616  37.146 1.00 39.28  ? 44  GLU A CA    1 
ATOM   2661  C C     . GLU E 3 50  ? -34.679 12.980  37.166 1.00 39.80  ? 44  GLU A C     1 
ATOM   2662  O O     . GLU E 3 50  ? -34.068 14.023  37.398 1.00 40.87  ? 44  GLU A O     1 
ATOM   2663  C CB    . GLU E 3 50  ? -33.561 11.184  35.721 1.00 38.32  ? 44  GLU A CB    1 
ATOM   2664  C CG    . GLU E 3 50  ? -32.627 12.169  34.971 1.00 40.76  ? 44  GLU A CG    1 
ATOM   2665  C CD    . GLU E 3 50  ? -31.216 12.290  35.575 1.00 44.55  ? 44  GLU A CD    1 
ATOM   2666  O OE1   . GLU E 3 50  ? -30.746 11.357  36.289 1.00 45.93  ? 44  GLU A OE1   1 
ATOM   2667  O OE2   . GLU E 3 50  ? -30.574 13.336  35.333 1.00 44.92  ? 44  GLU A OE2   1 
ATOM   2668  N N     . LEU E 3 51  ? -35.989 12.959  36.948 1.00 39.32  ? 45  LEU A N     1 
ATOM   2669  C CA    . LEU E 3 51  ? -36.794 14.165  37.060 1.00 40.52  ? 45  LEU A CA    1 
ATOM   2670  C C     . LEU E 3 51  ? -36.704 14.786  38.463 1.00 42.44  ? 45  LEU A C     1 
ATOM   2671  O O     . LEU E 3 51  ? -36.644 16.017  38.602 1.00 43.78  ? 45  LEU A O     1 
ATOM   2672  C CB    . LEU E 3 51  ? -38.244 13.880  36.661 1.00 40.30  ? 45  LEU A CB    1 
ATOM   2673  C CG    . LEU E 3 51  ? -38.542 13.742  35.155 1.00 38.70  ? 45  LEU A CG    1 
ATOM   2674  C CD1   . LEU E 3 51  ? -39.947 13.224  34.948 1.00 37.45  ? 45  LEU A CD1   1 
ATOM   2675  C CD2   . LEU E 3 51  ? -38.355 15.080  34.418 1.00 38.67  ? 45  LEU A CD2   1 
ATOM   2676  N N     . LYS E 3 52  ? -36.665 13.930  39.485 1.00 42.41  ? 46  LYS A N     1 
ATOM   2677  C CA    . LYS E 3 52  ? -36.527 14.377  40.865 1.00 44.47  ? 46  LYS A CA    1 
ATOM   2678  C C     . LYS E 3 52  ? -35.184 15.076  41.031 1.00 46.01  ? 46  LYS A C     1 
ATOM   2679  O O     . LYS E 3 52  ? -35.108 16.218  41.521 1.00 48.87  ? 46  LYS A O     1 
ATOM   2680  C CB    . LYS E 3 52  ? -36.654 13.197  41.839 1.00 44.33  ? 46  LYS A CB    1 
ATOM   2681  C CG    . LYS E 3 52  ? -36.907 13.614  43.276 1.00 47.15  ? 46  LYS A CG    1 
ATOM   2682  C CD    . LYS E 3 52  ? -36.400 12.591  44.287 1.00 47.65  ? 46  LYS A CD    1 
ATOM   2683  N N     . LYS E 3 53  ? -34.137 14.389  40.586 1.00 44.97  ? 47  LYS A N     1 
ATOM   2684  C CA    . LYS E 3 53  ? -32.766 14.844  40.685 1.00 46.35  ? 47  LYS A CA    1 
ATOM   2685  C C     . LYS E 3 53  ? -32.566 16.209  40.010 1.00 47.18  ? 47  LYS A C     1 
ATOM   2686  O O     . LYS E 3 53  ? -31.920 17.087  40.574 1.00 49.94  ? 47  LYS A O     1 
ATOM   2687  C CB    . LYS E 3 53  ? -31.863 13.816  40.028 1.00 45.25  ? 47  LYS A CB    1 
ATOM   2688  C CG    . LYS E 3 53  ? -30.579 13.568  40.743 1.00 48.09  ? 47  LYS A CG    1 
ATOM   2689  C CD    . LYS E 3 53  ? -29.491 13.278  39.735 1.00 49.26  ? 47  LYS A CD    1 
ATOM   2690  C CE    . LYS E 3 53  ? -28.231 12.769  40.407 1.00 52.85  ? 47  LYS A CE    1 
ATOM   2691  N NZ    . LYS E 3 53  ? -27.046 13.035  39.555 1.00 54.18  ? 47  LYS A NZ    1 
ATOM   2692  N N     . LEU E 3 54  ? -33.140 16.395  38.826 1.00 45.27  ? 48  LEU A N     1 
ATOM   2693  C CA    . LEU E 3 54  ? -32.968 17.630  38.090 1.00 46.23  ? 48  LEU A CA    1 
ATOM   2694  C C     . LEU E 3 54  ? -33.681 18.786  38.779 1.00 49.23  ? 48  LEU A C     1 
ATOM   2695  O O     . LEU E 3 54  ? -33.189 19.933  38.772 1.00 51.55  ? 48  LEU A O     1 
ATOM   2696  C CB    . LEU E 3 54  ? -33.461 17.473  36.657 1.00 44.46  ? 48  LEU A CB    1 
ATOM   2697  C CG    . LEU E 3 54  ? -32.773 16.459  35.741 1.00 41.39  ? 48  LEU A CG    1 
ATOM   2698  C CD1   . LEU E 3 54  ? -33.615 16.239  34.523 1.00 38.78  ? 48  LEU A CD1   1 
ATOM   2699  C CD2   . LEU E 3 54  ? -31.367 16.895  35.353 1.00 41.18  ? 48  LEU A CD2   1 
ATOM   2700  N N     . THR E 3 55  ? -34.830 18.476  39.385 1.00 49.45  ? 49  THR A N     1 
ATOM   2701  C CA    . THR E 3 55  ? -35.582 19.434  40.195 1.00 51.74  ? 49  THR A CA    1 
ATOM   2702  C C     . THR E 3 55  ? -34.743 19.842  41.397 1.00 54.71  ? 49  THR A C     1 
ATOM   2703  O O     . THR E 3 55  ? -34.678 21.020  41.725 1.00 57.34  ? 49  THR A O     1 
ATOM   2704  C CB    . THR E 3 55  ? -36.924 18.848  40.673 1.00 51.21  ? 49  THR A CB    1 
ATOM   2705  O OG1   . THR E 3 55  ? -37.699 18.454  39.540 1.00 49.46  ? 49  THR A OG1   1 
ATOM   2706  C CG2   . THR E 3 55  ? -37.720 19.860  41.480 1.00 53.66  ? 49  THR A CG2   1 
ATOM   2707  N N     . ASP E 3 56  ? -34.085 18.877  42.042 1.00 54.85  ? 50  ASP A N     1 
ATOM   2708  C CA    . ASP E 3 56  ? -33.244 19.202  43.207 1.00 58.42  ? 50  ASP A CA    1 
ATOM   2709  C C     . ASP E 3 56  ? -32.055 20.059  42.791 1.00 59.64  ? 50  ASP A C     1 
ATOM   2710  O O     . ASP E 3 56  ? -31.522 20.829  43.585 1.00 62.30  ? 50  ASP A O     1 
ATOM   2711  C CB    . ASP E 3 56  ? -32.774 17.935  43.936 1.00 58.27  ? 50  ASP A CB    1 
ATOM   2712  C CG    . ASP E 3 56  ? -33.906 17.232  44.696 1.00 60.11  ? 50  ASP A CG    1 
ATOM   2713  O OD1   . ASP E 3 56  ? -35.038 17.780  44.732 1.00 62.60  ? 50  ASP A OD1   1 
ATOM   2714  O OD2   . ASP E 3 56  ? -33.670 16.130  45.266 1.00 61.19  ? 50  ASP A OD2   1 
ATOM   2715  N N     . GLU E 3 57  ? -31.670 19.929  41.523 1.00 57.41  ? 51  GLU A N     1 
ATOM   2716  C CA    . GLU E 3 57  ? -30.530 20.662  40.979 1.00 58.89  ? 51  GLU A CA    1 
ATOM   2717  C C     . GLU E 3 57  ? -30.878 22.030  40.374 1.00 59.94  ? 51  GLU A C     1 
ATOM   2718  O O     . GLU E 3 57  ? -29.988 22.777  39.987 1.00 61.69  ? 51  GLU A O     1 
ATOM   2719  C CB    . GLU E 3 57  ? -29.797 19.784  39.966 1.00 56.47  ? 51  GLU A CB    1 
ATOM   2720  C CG    . GLU E 3 57  ? -29.016 18.676  40.619 1.00 57.56  ? 51  GLU A CG    1 
ATOM   2721  C CD    . GLU E 3 57  ? -28.327 17.761  39.631 1.00 59.47  ? 51  GLU A CD    1 
ATOM   2722  O OE1   . GLU E 3 57  ? -28.969 17.253  38.677 1.00 56.48  ? 51  GLU A OE1   1 
ATOM   2723  O OE2   . GLU E 3 57  ? -27.118 17.530  39.834 1.00 64.18  ? 51  GLU A OE2   1 
ATOM   2724  N N     . GLY E 3 58  ? -32.170 22.343  40.294 1.00 59.36  ? 52  GLY A N     1 
ATOM   2725  C CA    . GLY E 3 58  ? -32.635 23.636  39.805 1.00 60.60  ? 52  GLY A CA    1 
ATOM   2726  C C     . GLY E 3 58  ? -32.578 23.819  38.296 1.00 58.70  ? 52  GLY A C     1 
ATOM   2727  O O     . GLY E 3 58  ? -32.572 24.948  37.806 1.00 60.67  ? 52  GLY A O     1 
ATOM   2728  N N     . PHE E 3 59  ? -32.516 22.721  37.548 1.00 54.95  ? 53  PHE A N     1 
ATOM   2729  C CA    . PHE E 3 59  ? -32.552 22.830  36.092 1.00 53.17  ? 53  PHE A CA    1 
ATOM   2730  C C     . PHE E 3 59  ? -33.982 22.815  35.616 1.00 52.18  ? 53  PHE A C     1 
ATOM   2731  O O     . PHE E 3 59  ? -34.299 23.382  34.569 1.00 52.71  ? 53  PHE A O     1 
ATOM   2732  C CB    . PHE E 3 59  ? -31.738 21.736  35.403 1.00 50.43  ? 53  PHE A CB    1 
ATOM   2733  C CG    . PHE E 3 59  ? -30.280 21.755  35.759 1.00 51.64  ? 53  PHE A CG    1 
ATOM   2734  C CD1   . PHE E 3 59  ? -29.504 22.891  35.525 1.00 54.09  ? 53  PHE A CD1   1 
ATOM   2735  C CD2   . PHE E 3 59  ? -29.677 20.634  36.320 1.00 50.22  ? 53  PHE A CD2   1 
ATOM   2736  C CE1   . PHE E 3 59  ? -28.156 22.910  35.854 1.00 55.63  ? 53  PHE A CE1   1 
ATOM   2737  C CE2   . PHE E 3 59  ? -28.331 20.643  36.651 1.00 51.73  ? 53  PHE A CE2   1 
ATOM   2738  C CZ    . PHE E 3 59  ? -27.567 21.778  36.421 1.00 54.23  ? 53  PHE A CZ    1 
ATOM   2739  N N     . ILE E 3 60  ? -34.849 22.172  36.388 1.00 51.13  ? 54  ILE A N     1 
ATOM   2740  C CA    . ILE E 3 60  ? -36.258 22.132  36.042 1.00 51.01  ? 54  ILE A CA    1 
ATOM   2741  C C     . ILE E 3 60  ? -37.144 22.387  37.246 1.00 53.28  ? 54  ILE A C     1 
ATOM   2742  O O     . ILE E 3 60  ? -36.722 22.240  38.395 1.00 54.43  ? 54  ILE A O     1 
ATOM   2743  C CB    . ILE E 3 60  ? -36.675 20.814  35.334 1.00 47.84  ? 54  ILE A CB    1 
ATOM   2744  C CG1   . ILE E 3 60  ? -36.564 19.614  36.286 1.00 45.83  ? 54  ILE A CG1   1 
ATOM   2745  C CG2   . ILE E 3 60  ? -35.876 20.617  34.051 1.00 46.26  ? 54  ILE A CG2   1 
ATOM   2746  C CD1   . ILE E 3 60  ? -36.754 18.304  35.623 1.00 42.23  ? 54  ILE A CD1   1 
ATOM   2747  N N     . THR E 3 61  ? -38.377 22.782  36.960 1.00 54.72  ? 55  THR A N     1 
ATOM   2748  C CA    . THR E 3 61  ? -39.379 23.056  37.971 1.00 56.84  ? 55  THR A CA    1 
ATOM   2749  C C     . THR E 3 61  ? -40.616 22.259  37.571 1.00 55.17  ? 55  THR A C     1 
ATOM   2750  O O     . THR E 3 61  ? -40.686 21.754  36.445 1.00 53.21  ? 55  THR A O     1 
ATOM   2751  C CB    . THR E 3 61  ? -39.653 24.571  38.013 1.00 60.96  ? 55  THR A CB    1 
ATOM   2752  O OG1   . THR E 3 61  ? -39.854 24.992  39.367 1.00 65.45  ? 55  THR A OG1   1 
ATOM   2753  C CG2   . THR E 3 61  ? -40.850 24.975  37.125 1.00 62.55  ? 55  THR A CG2   1 
ATOM   2754  N N     . PHE E 3 62  ? -41.582 22.123  38.473 1.00 56.16  ? 56  PHE A N     1 
ATOM   2755  C CA    . PHE E 3 62  ? -42.844 21.479  38.103 1.00 55.28  ? 56  PHE A CA    1 
ATOM   2756  C C     . PHE E 3 62  ? -44.039 22.021  38.860 1.00 58.11  ? 56  PHE A C     1 
ATOM   2757  O O     . PHE E 3 62  ? -43.922 22.457  40.003 1.00 59.83  ? 56  PHE A O     1 
ATOM   2758  C CB    . PHE E 3 62  ? -42.777 19.942  38.248 1.00 52.27  ? 56  PHE A CB    1 
ATOM   2759  C CG    . PHE E 3 62  ? -42.758 19.455  39.674 1.00 52.68  ? 56  PHE A CG    1 
ATOM   2760  C CD1   . PHE E 3 62  ? -43.943 19.344  40.406 1.00 54.13  ? 56  PHE A CD1   1 
ATOM   2761  C CD2   . PHE E 3 62  ? -41.557 19.092  40.282 1.00 52.23  ? 56  PHE A CD2   1 
ATOM   2762  C CE1   . PHE E 3 62  ? -43.929 18.903  41.734 1.00 55.10  ? 56  PHE A CE1   1 
ATOM   2763  C CE2   . PHE E 3 62  ? -41.532 18.629  41.615 1.00 53.23  ? 56  PHE A CE2   1 
ATOM   2764  C CZ    . PHE E 3 62  ? -42.723 18.536  42.337 1.00 54.38  ? 56  PHE A CZ    1 
ATOM   2765  N N     . ARG E 3 63  ? -45.187 21.971  38.197 1.00 58.81  ? 57  ARG A N     1 
ATOM   2766  C CA    . ARG E 3 63  ? -46.465 22.186  38.839 1.00 61.74  ? 57  ARG A CA    1 
ATOM   2767  C C     . ARG E 3 63  ? -47.223 20.864  38.839 1.00 60.24  ? 57  ARG A C     1 
ATOM   2768  O O     . ARG E 3 63  ? -46.863 19.930  38.123 1.00 57.18  ? 57  ARG A O     1 
ATOM   2769  C CB    . ARG E 3 63  ? -47.258 23.249  38.091 1.00 64.89  ? 57  ARG A CB    1 
ATOM   2770  C CG    . ARG E 3 63  ? -47.496 22.916  36.626 1.00 63.15  ? 57  ARG A CG    1 
ATOM   2771  C CD    . ARG E 3 63  ? -48.011 24.124  35.897 1.00 65.27  ? 57  ARG A CD    1 
ATOM   2772  N NE    . ARG E 3 63  ? -48.593 23.795  34.602 1.00 64.20  ? 57  ARG A NE    1 
ATOM   2773  C CZ    . ARG E 3 63  ? -49.897 23.684  34.372 1.00 67.17  ? 57  ARG A CZ    1 
ATOM   2774  N NH1   . ARG E 3 63  ? -50.779 23.862  35.352 1.00 69.29  ? 57  ARG A NH1   1 
ATOM   2775  N NH2   . ARG E 3 63  ? -50.321 23.394  33.151 1.00 67.85  ? 57  ARG A NH2   1 
ATOM   2776  N N     . THR E 3 64  ? -48.268 20.789  39.654 1.00 62.80  ? 58  THR A N     1 
ATOM   2777  C CA    . THR E 3 64  ? -49.129 19.624  39.662 1.00 62.06  ? 58  THR A CA    1 
ATOM   2778  C C     . THR E 3 64  ? -50.454 19.980  39.022 1.00 64.71  ? 58  THR A C     1 
ATOM   2779  O O     . THR E 3 64  ? -51.197 20.786  39.542 1.00 68.19  ? 58  THR A O     1 
ATOM   2780  C CB    . THR E 3 64  ? -49.329 19.068  41.088 1.00 62.54  ? 58  THR A CB    1 
ATOM   2781  O OG1   . THR E 3 64  ? -48.056 18.684  41.620 1.00 61.11  ? 58  THR A OG1   1 
ATOM   2782  C CG2   . THR E 3 64  ? -50.236 17.835  41.072 1.00 61.82  ? 58  THR A CG2   1 
ATOM   2783  N N     . THR E 3 65  ? -50.728 19.388  37.869 1.00 63.92  ? 59  THR A N     1 
ATOM   2784  C CA    . THR E 3 65  ? -52.039 19.518  37.253 1.00 66.92  ? 59  THR A CA    1 
ATOM   2785  C C     . THR E 3 65  ? -52.862 18.262  37.557 1.00 66.69  ? 59  THR A C     1 
ATOM   2786  O O     . THR E 3 65  ? -52.312 17.212  37.930 1.00 63.03  ? 59  THR A O     1 
ATOM   2787  C CB    . THR E 3 65  ? -51.942 19.741  35.725 1.00 66.82  ? 59  THR A CB    1 
ATOM   2788  N N     . ILE E 3 66  ? -54.180 18.403  37.406 1.00 70.29  ? 60  ILE A N     1 
ATOM   2789  C CA    . ILE E 3 66  ? -55.137 17.335  37.659 1.00 70.87  ? 60  ILE A CA    1 
ATOM   2790  C C     . ILE E 3 66  ? -55.942 16.977  36.404 1.00 72.40  ? 60  ILE A C     1 
ATOM   2791  O O     . ILE E 3 66  ? -56.785 17.750  35.931 1.00 75.80  ? 60  ILE A O     1 
ATOM   2792  C CB    . ILE E 3 66  ? -56.046 17.671  38.871 1.00 74.12  ? 60  ILE A CB    1 
ATOM   2793  C CG1   . ILE E 3 66  ? -55.334 17.273  40.167 1.00 72.31  ? 60  ILE A CG1   1 
ATOM   2794  C CG2   . ILE E 3 66  ? -57.401 16.972  38.768 1.00 76.86  ? 60  ILE A CG2   1 
ATOM   2795  C CD1   . ILE E 3 66  ? -56.006 17.800  41.433 1.00 77.39  ? 60  ILE A CD1   1 
ATOM   2796  N N     . GLN E 3 67  ? -55.643 15.789  35.876 1.00 70.19  ? 61  GLN A N     1 
ATOM   2797  C CA    . GLN E 3 67  ? -56.423 15.157  34.814 1.00 71.67  ? 61  GLN A CA    1 
ATOM   2798  C C     . GLN E 3 67  ? -57.665 14.524  35.406 1.00 73.85  ? 61  GLN A C     1 
ATOM   2799  O O     . GLN E 3 67  ? -57.595 13.893  36.465 1.00 72.82  ? 61  GLN A O     1 
ATOM   2800  C CB    . GLN E 3 67  ? -55.591 14.085  34.112 1.00 68.45  ? 61  GLN A CB    1 
ATOM   2801  C CG    . GLN E 3 67  ? -54.505 14.651  33.202 1.00 68.55  ? 61  GLN A CG    1 
ATOM   2802  C CD    . GLN E 3 67  ? -55.076 15.459  32.046 1.00 74.92  ? 61  GLN A CD    1 
ATOM   2803  O OE1   . GLN E 3 67  ? -54.713 16.628  31.845 1.00 77.43  ? 61  GLN A OE1   1 
ATOM   2804  N NE2   . GLN E 3 67  ? -55.991 14.847  31.289 1.00 77.49  ? 61  GLN A NE2   1 
ATOM   2805  N N     . GLY E 3 68  ? -58.793 14.699  34.719 1.00 77.35  ? 62  GLY A N     1 
ATOM   2806  C CA    . GLY E 3 68  ? -60.088 14.205  35.186 1.00 80.24  ? 62  GLY A CA    1 
ATOM   2807  C C     . GLY E 3 68  ? -60.517 14.905  36.461 1.00 82.16  ? 62  GLY A C     1 
ATOM   2808  O O     . GLY E 3 68  ? -60.526 16.133  36.537 1.00 83.74  ? 62  GLY A O     1 
ATOM   2809  N N     . THR E 3 69  ? -60.850 14.109  37.471 1.00 82.00  ? 63  THR A N     1 
ATOM   2810  C CA    . THR E 3 69  ? -61.234 14.615  38.783 1.00 83.76  ? 63  THR A CA    1 
ATOM   2811  C C     . THR E 3 69  ? -60.085 14.532  39.794 1.00 80.02  ? 63  THR A C     1 
ATOM   2812  O O     . THR E 3 69  ? -59.852 15.487  40.538 1.00 80.92  ? 63  THR A O     1 
ATOM   2813  C CB    . THR E 3 69  ? -62.465 13.850  39.313 1.00 86.98  ? 63  THR A CB    1 
ATOM   2814  O OG1   . THR E 3 69  ? -63.628 14.274  38.592 1.00 92.43  ? 63  THR A OG1   1 
ATOM   2815  C CG2   . THR E 3 69  ? -62.687 14.091  40.811 1.00 88.82  ? 63  THR A CG2   1 
ATOM   2816  N N     . LYS E 3 70  ? -59.362 13.407  39.807 1.00 75.97  ? 64  LYS A N     1 
ATOM   2817  C CA    . LYS E 3 70  ? -58.411 13.124  40.883 1.00 73.13  ? 64  LYS A CA    1 
ATOM   2818  C C     . LYS E 3 70  ? -57.074 12.472  40.477 1.00 68.55  ? 64  LYS A C     1 
ATOM   2819  O O     . LYS E 3 70  ? -56.380 11.917  41.323 1.00 66.64  ? 64  LYS A O     1 
ATOM   2820  C CB    . LYS E 3 70  ? -59.095 12.294  41.979 1.00 74.71  ? 64  LYS A CB    1 
ATOM   2821  C CG    . LYS E 3 70  ? -59.579 10.915  41.528 1.00 75.06  ? 64  LYS A CG    1 
ATOM   2822  N N     . LEU E 3 71  ? -56.704 12.546  39.203 1.00 67.07  ? 65  LEU A N     1 
ATOM   2823  C CA    . LEU E 3 71  ? -55.409 12.016  38.766 1.00 63.08  ? 65  LEU A CA    1 
ATOM   2824  C C     . LEU E 3 71  ? -54.364 13.124  38.628 1.00 62.11  ? 65  LEU A C     1 
ATOM   2825  O O     . LEU E 3 71  ? -54.523 14.048  37.819 1.00 63.57  ? 65  LEU A O     1 
ATOM   2826  C CB    . LEU E 3 71  ? -55.535 11.237  37.452 1.00 62.20  ? 65  LEU A CB    1 
ATOM   2827  C CG    . LEU E 3 71  ? -54.254 10.608  36.895 1.00 57.73  ? 65  LEU A CG    1 
ATOM   2828  C CD1   . LEU E 3 71  ? -53.703 9.597   37.879 1.00 55.16  ? 65  LEU A CD1   1 
ATOM   2829  C CD2   . LEU E 3 71  ? -54.489 9.949   35.538 1.00 56.52  ? 65  LEU A CD2   1 
ATOM   2830  N N     . GLU E 3 72  ? -53.300 13.023  39.418 1.00 60.01  ? 66  GLU A N     1 
ATOM   2831  C CA    . GLU E 3 72  ? -52.267 14.045  39.455 1.00 59.14  ? 66  GLU A CA    1 
ATOM   2832  C C     . GLU E 3 72  ? -51.215 13.798  38.415 1.00 56.06  ? 66  GLU A C     1 
ATOM   2833  O O     . GLU E 3 72  ? -50.931 12.668  38.051 1.00 55.26  ? 66  GLU A O     1 
ATOM   2834  C CB    . GLU E 3 72  ? -51.609 14.107  40.828 1.00 58.95  ? 66  GLU A CB    1 
ATOM   2835  C CG    . GLU E 3 72  ? -52.488 14.722  41.905 1.00 64.37  ? 66  GLU A CG    1 
ATOM   2836  C CD    . GLU E 3 72  ? -51.719 14.993  43.182 1.00 67.61  ? 66  GLU A CD    1 
ATOM   2837  O OE1   . GLU E 3 72  ? -50.502 14.694  43.222 1.00 67.43  ? 66  GLU A OE1   1 
ATOM   2838  O OE2   . GLU E 3 72  ? -52.324 15.504  44.147 1.00 70.72  ? 66  GLU A OE2   1 
ATOM   2839  N N     . LYS E 3 73  ? -50.611 14.876  37.968 1.00 55.83  ? 67  LYS A N     1 
ATOM   2840  C CA    . LYS E 3 73  ? -49.671 14.855  36.886 1.00 53.42  ? 67  LYS A CA    1 
ATOM   2841  C C     . LYS E 3 73  ? -48.692 15.986  37.180 1.00 53.15  ? 67  LYS A C     1 
ATOM   2842  O O     . LYS E 3 73  ? -49.111 17.090  37.514 1.00 56.02  ? 67  LYS A O     1 
ATOM   2843  C CB    . LYS E 3 73  ? -50.436 15.120  35.595 1.00 54.71  ? 67  LYS A CB    1 
ATOM   2844  C CG    . LYS E 3 73  ? -49.720 14.713  34.337 1.00 53.88  ? 67  LYS A CG    1 
ATOM   2845  C CD    . LYS E 3 73  ? -50.702 14.541  33.200 1.00 55.52  ? 67  LYS A CD    1 
ATOM   2846  C CE    . LYS E 3 73  ? -50.783 15.767  32.337 1.00 57.58  ? 67  LYS A CE    1 
ATOM   2847  N NZ    . LYS E 3 73  ? -51.768 15.573  31.244 1.00 60.37  ? 67  LYS A NZ    1 
ATOM   2848  N N     . LYS E 3 74  ? -47.398 15.708  37.107 1.00 50.46  ? 68  LYS A N     1 
ATOM   2849  C CA    . LYS E 3 74  ? -46.396 16.750  37.279 1.00 50.56  ? 68  LYS A CA    1 
ATOM   2850  C C     . LYS E 3 74  ? -45.872 17.199  35.930 1.00 50.35  ? 68  LYS A C     1 
ATOM   2851  O O     . LYS E 3 74  ? -45.255 16.418  35.195 1.00 48.66  ? 68  LYS A O     1 
ATOM   2852  C CB    . LYS E 3 74  ? -45.233 16.273  38.137 1.00 48.62  ? 68  LYS A CB    1 
ATOM   2853  C CG    . LYS E 3 74  ? -45.568 16.099  39.587 1.00 49.89  ? 68  LYS A CG    1 
ATOM   2854  C CD    . LYS E 3 74  ? -44.342 15.674  40.329 1.00 49.20  ? 68  LYS A CD    1 
ATOM   2855  C CE    . LYS E 3 74  ? -44.668 15.179  41.711 1.00 49.92  ? 68  LYS A CE    1 
ATOM   2856  N NZ    . LYS E 3 74  ? -43.786 14.007  41.979 1.00 49.29  ? 68  LYS A NZ    1 
ATOM   2857  N N     . MET E 3 75  ? -46.113 18.459  35.605 1.00 52.57  ? 69  MET A N     1 
ATOM   2858  C CA    . MET E 3 75  ? -45.663 19.006  34.341 1.00 52.89  ? 69  MET A CA    1 
ATOM   2859  C C     . MET E 3 75  ? -44.396 19.779  34.606 1.00 52.47  ? 69  MET A C     1 
ATOM   2860  O O     . MET E 3 75  ? -44.397 20.718  35.402 1.00 55.62  ? 69  MET A O     1 
ATOM   2861  C CB    . MET E 3 75  ? -46.736 19.923  33.744 1.00 56.37  ? 69  MET A CB    1 
ATOM   2862  C CG    . MET E 3 75  ? -48.085 19.228  33.499 1.00 58.46  ? 69  MET A CG    1 
ATOM   2863  S SD    . MET E 3 75  ? -48.009 17.987  32.187 1.00 58.35  ? 69  MET A SD    1 
ATOM   2864  C CE    . MET E 3 75  ? -48.023 19.039  30.735 1.00 61.47  ? 69  MET A CE    1 
ATOM   2865  N N     . TYR E 3 76  ? -43.318 19.394  33.939 1.00 49.72  ? 70  TYR A N     1 
ATOM   2866  C CA    . TYR E 3 76  ? -42.028 20.033  34.146 1.00 49.15  ? 70  TYR A CA    1 
ATOM   2867  C C     . TYR E 3 76  ? -41.700 21.157  33.170 1.00 50.70  ? 70  TYR A C     1 
ATOM   2868  O O     . TYR E 3 76  ? -41.966 21.044  31.974 1.00 50.68  ? 70  TYR A O     1 
ATOM   2869  C CB    . TYR E 3 76  ? -40.925 19.002  34.092 1.00 45.86  ? 70  TYR A CB    1 
ATOM   2870  C CG    . TYR E 3 76  ? -40.952 18.080  35.257 1.00 44.54  ? 70  TYR A CG    1 
ATOM   2871  C CD1   . TYR E 3 76  ? -41.698 16.894  35.216 1.00 42.64  ? 70  TYR A CD1   1 
ATOM   2872  C CD2   . TYR E 3 76  ? -40.238 18.374  36.409 1.00 44.14  ? 70  TYR A CD2   1 
ATOM   2873  C CE1   . TYR E 3 76  ? -41.728 16.043  36.283 1.00 41.05  ? 70  TYR A CE1   1 
ATOM   2874  C CE2   . TYR E 3 76  ? -40.263 17.511  37.492 1.00 43.67  ? 70  TYR A CE2   1 
ATOM   2875  C CZ    . TYR E 3 76  ? -41.008 16.344  37.413 1.00 41.42  ? 70  TYR A CZ    1 
ATOM   2876  O OH    . TYR E 3 76  ? -41.036 15.486  38.468 1.00 41.49  ? 70  TYR A OH    1 
ATOM   2877  N N     . THR E 3 77  ? -41.095 22.222  33.697 1.00 52.07  ? 71  THR A N     1 
ATOM   2878  C CA    . THR E 3 77  ? -40.591 23.319  32.876 1.00 53.89  ? 71  THR A CA    1 
ATOM   2879  C C     . THR E 3 77  ? -39.111 23.543  33.145 1.00 53.07  ? 71  THR A C     1 
ATOM   2880  O O     . THR E 3 77  ? -38.647 23.374  34.266 1.00 52.82  ? 71  THR A O     1 
ATOM   2881  C CB    . THR E 3 77  ? -41.344 24.667  33.149 1.00 57.93  ? 71  THR A CB    1 
ATOM   2882  O OG1   . THR E 3 77  ? -42.745 24.430  33.330 1.00 59.12  ? 71  THR A OG1   1 
ATOM   2883  C CG2   . THR E 3 77  ? -41.154 25.629  31.998 1.00 59.72  ? 71  THR A CG2   1 
ATOM   2884  N N     . LEU E 3 78  ? -38.383 23.936  32.105 1.00 53.19  ? 72  LEU A N     1 
ATOM   2885  C CA    . LEU E 3 78  ? -37.019 24.450  32.244 1.00 53.69  ? 72  LEU A CA    1 
ATOM   2886  C C     . LEU E 3 78  ? -36.913 25.718  33.110 1.00 57.15  ? 72  LEU A C     1 
ATOM   2887  O O     . LEU E 3 78  ? -37.823 26.567  33.123 1.00 59.74  ? 72  LEU A O     1 
ATOM   2888  C CB    . LEU E 3 78  ? -36.416 24.736  30.862 1.00 53.84  ? 72  LEU A CB    1 
ATOM   2889  C CG    . LEU E 3 78  ? -35.985 23.528  30.017 1.00 50.32  ? 72  LEU A CG    1 
ATOM   2890  C CD1   . LEU E 3 78  ? -35.619 23.971  28.598 1.00 51.04  ? 72  LEU A CD1   1 
ATOM   2891  C CD2   . LEU E 3 78  ? -34.835 22.780  30.660 1.00 47.19  ? 72  LEU A CD2   1 
ATOM   2892  N N     . THR E 3 79  ? -35.805 25.814  33.844 1.00 57.29  ? 73  THR A N     1 
ATOM   2893  C CA    . THR E 3 79  ? -35.412 27.040  34.532 1.00 61.08  ? 73  THR A CA    1 
ATOM   2894  C C     . THR E 3 79  ? -34.372 27.709  33.651 1.00 62.59  ? 73  THR A C     1 
ATOM   2895  O O     . THR E 3 79  ? -33.832 27.056  32.743 1.00 60.30  ? 73  THR A O     1 
ATOM   2896  C CB    . THR E 3 79  ? -34.738 26.759  35.890 1.00 61.03  ? 73  THR A CB    1 
ATOM   2897  O OG1   . THR E 3 79  ? -33.596 25.919  35.683 1.00 59.46  ? 73  THR A OG1   1 
ATOM   2898  C CG2   . THR E 3 79  ? -35.685 26.084  36.847 1.00 59.86  ? 73  THR A CG2   1 
ATOM   2899  N N     . ASP E 3 80  ? -34.086 28.990  33.919 1.00 66.67  ? 74  ASP A N     1 
ATOM   2900  C CA    . ASP E 3 80  ? -32.982 29.694  33.267 1.00 68.60  ? 74  ASP A CA    1 
ATOM   2901  C C     . ASP E 3 80  ? -31.703 28.863  33.356 1.00 66.09  ? 74  ASP A C     1 
ATOM   2902  O O     . ASP E 3 80  ? -31.013 28.676  32.355 1.00 65.05  ? 74  ASP A O     1 
ATOM   2903  C CB    . ASP E 3 80  ? -32.766 31.095  33.866 1.00 73.84  ? 74  ASP A CB    1 
ATOM   2904  C CG    . ASP E 3 80  ? -33.530 32.198  33.114 1.00 78.05  ? 74  ASP A CG    1 
ATOM   2905  O OD1   . ASP E 3 80  ? -34.532 31.897  32.431 1.00 77.16  ? 74  ASP A OD1   1 
ATOM   2906  O OD2   . ASP E 3 80  ? -33.129 33.386  33.213 1.00 84.19  ? 74  ASP A OD2   1 
ATOM   2907  N N     . SER E 3 81  ? -31.414 28.342  34.548 1.00 65.44  ? 75  SER A N     1 
ATOM   2908  C CA    . SER E 3 81  ? -30.243 27.489  34.778 1.00 63.79  ? 75  SER A CA    1 
ATOM   2909  C C     . SER E 3 81  ? -30.234 26.215  33.902 1.00 59.66  ? 75  SER A C     1 
ATOM   2910  O O     . SER E 3 81  ? -29.176 25.786  33.430 1.00 58.72  ? 75  SER A O     1 
ATOM   2911  C CB    . SER E 3 81  ? -30.143 27.144  36.265 1.00 64.50  ? 75  SER A CB    1 
ATOM   2912  O OG    . SER E 3 81  ? -29.285 26.042  36.503 1.00 63.00  ? 75  SER A OG    1 
ATOM   2913  N N     . GLY E 3 82  ? -31.412 25.636  33.675 1.00 57.30  ? 76  GLY A N     1 
ATOM   2914  C CA    . GLY E 3 82  ? -31.556 24.512  32.753 1.00 54.24  ? 76  GLY A CA    1 
ATOM   2915  C C     . GLY E 3 82  ? -31.407 24.828  31.267 1.00 54.61  ? 76  GLY A C     1 
ATOM   2916  O O     . GLY E 3 82  ? -30.899 23.998  30.506 1.00 52.74  ? 76  GLY A O     1 
ATOM   2917  N N     . LYS E 3 83  ? -31.866 26.005  30.835 1.00 57.22  ? 77  LYS A N     1 
ATOM   2918  C CA    . LYS E 3 83  ? -31.730 26.399  29.431 1.00 57.94  ? 77  LYS A CA    1 
ATOM   2919  C C     . LYS E 3 83  ? -30.262 26.584  29.047 1.00 58.50  ? 77  LYS A C     1 
ATOM   2920  O O     . LYS E 3 83  ? -29.834 26.193  27.960 1.00 57.33  ? 77  LYS A O     1 
ATOM   2921  C CB    . LYS E 3 83  ? -32.505 27.681  29.139 1.00 61.50  ? 77  LYS A CB    1 
ATOM   2922  C CG    . LYS E 3 83  ? -34.016 27.527  29.120 1.00 62.18  ? 77  LYS A CG    1 
ATOM   2923  C CD    . LYS E 3 83  ? -34.678 28.853  28.728 1.00 65.51  ? 77  LYS A CD    1 
ATOM   2924  C CE    . LYS E 3 83  ? -36.110 28.950  29.254 1.00 66.49  ? 77  LYS A CE    1 
ATOM   2925  N N     . GLN E 3 84  ? -29.496 27.185  29.948 1.00 60.39  ? 78  GLN A N     1 
ATOM   2926  C CA    . GLN E 3 84  ? -28.073 27.353  29.722 1.00 61.60  ? 78  GLN A CA    1 
ATOM   2927  C C     . GLN E 3 84  ? -27.389 25.991  29.780 1.00 58.51  ? 78  GLN A C     1 
ATOM   2928  O O     . GLN E 3 84  ? -26.482 25.715  29.000 1.00 58.29  ? 78  GLN A O     1 
ATOM   2929  C CB    . GLN E 3 84  ? -27.455 28.311  30.745 1.00 64.85  ? 78  GLN A CB    1 
ATOM   2930  C CG    . GLN E 3 84  ? -26.121 28.874  30.300 1.00 67.91  ? 78  GLN A CG    1 
ATOM   2931  C CD    . GLN E 3 84  ? -26.273 29.982  29.258 1.00 71.52  ? 78  GLN A CD    1 
ATOM   2932  O OE1   . GLN E 3 84  ? -26.948 30.983  29.495 1.00 74.41  ? 78  GLN A OE1   1 
ATOM   2933  N NE2   . GLN E 3 84  ? -25.645 29.802  28.102 1.00 71.41  ? 78  GLN A NE2   1 
ATOM   2934  N N     . GLU E 3 85  ? -27.830 25.144  30.704 1.00 56.29  ? 79  GLU A N     1 
ATOM   2935  C CA    . GLU E 3 85  ? -27.285 23.792  30.798 1.00 54.26  ? 79  GLU A CA    1 
ATOM   2936  C C     . GLU E 3 85  ? -27.475 23.031  29.484 1.00 51.96  ? 79  GLU A C     1 
ATOM   2937  O O     . GLU E 3 85  ? -26.546 22.395  28.994 1.00 51.40  ? 79  GLU A O     1 
ATOM   2938  C CB    . GLU E 3 85  ? -27.901 23.035  31.978 1.00 52.71  ? 79  GLU A CB    1 
ATOM   2939  C CG    . GLU E 3 85  ? -27.058 21.902  32.524 1.00 52.45  ? 79  GLU A CG    1 
ATOM   2940  C CD    . GLU E 3 85  ? -25.713 22.327  33.120 1.00 56.82  ? 79  GLU A CD    1 
ATOM   2941  O OE1   . GLU E 3 85  ? -25.303 23.509  32.975 1.00 59.89  ? 79  GLU A OE1   1 
ATOM   2942  O OE2   . GLU E 3 85  ? -25.046 21.447  33.724 1.00 56.59  ? 79  GLU A OE2   1 
ATOM   2943  N N     . LEU E 3 86  ? -28.673 23.132  28.911 1.00 51.33  ? 80  LEU A N     1 
ATOM   2944  C CA    . LEU E 3 86  ? -28.969 22.565  27.598 1.00 50.00  ? 80  LEU A CA    1 
ATOM   2945  C C     . LEU E 3 86  ? -28.081 23.170  26.517 1.00 52.25  ? 80  LEU A C     1 
ATOM   2946  O O     . LEU E 3 86  ? -27.442 22.437  25.754 1.00 51.81  ? 80  LEU A O     1 
ATOM   2947  C CB    . LEU E 3 86  ? -30.442 22.779  27.244 1.00 49.51  ? 80  LEU A CB    1 
ATOM   2948  C CG    . LEU E 3 86  ? -30.960 22.300  25.881 1.00 47.82  ? 80  LEU A CG    1 
ATOM   2949  C CD1   . LEU E 3 86  ? -30.639 20.812  25.626 1.00 43.29  ? 80  LEU A CD1   1 
ATOM   2950  C CD2   . LEU E 3 86  ? -32.458 22.593  25.750 1.00 44.83  ? 80  LEU A CD2   1 
ATOM   2951  N N     . HIS E 3 87  ? -28.037 24.500  26.467 1.00 55.05  ? 81  HIS A N     1 
ATOM   2952  C CA    . HIS E 3 87  ? -27.262 25.223  25.462 1.00 57.74  ? 81  HIS A CA    1 
ATOM   2953  C C     . HIS E 3 87  ? -25.788 24.809  25.420 1.00 58.37  ? 81  HIS A C     1 
ATOM   2954  O O     . HIS E 3 87  ? -25.283 24.411  24.358 1.00 58.52  ? 81  HIS A O     1 
ATOM   2955  C CB    . HIS E 3 87  ? -27.381 26.731  25.685 1.00 61.14  ? 81  HIS A CB    1 
ATOM   2956  C CG    . HIS E 3 87  ? -26.599 27.551  24.709 1.00 64.41  ? 81  HIS A CG    1 
ATOM   2957  N ND1   . HIS E 3 87  ? -26.952 27.664  23.381 1.00 65.35  ? 81  HIS A ND1   1 
ATOM   2958  C CD2   . HIS E 3 87  ? -25.486 28.307  24.869 1.00 67.05  ? 81  HIS A CD2   1 
ATOM   2959  C CE1   . HIS E 3 87  ? -26.090 28.452  22.765 1.00 68.02  ? 81  HIS A CE1   1 
ATOM   2960  N NE2   . HIS E 3 87  ? -25.189 28.853  23.645 1.00 69.42  ? 81  HIS A NE2   1 
ATOM   2961  N N     . ASP E 3 88  ? -25.107 24.900  26.567 1.00 59.30  ? 82  ASP A N     1 
ATOM   2962  C CA    . ASP E 3 88  ? -23.673 24.579  26.654 1.00 60.30  ? 82  ASP A CA    1 
ATOM   2963  C C     . ASP E 3 88  ? -23.377 23.186  26.108 1.00 57.54  ? 82  ASP A C     1 
ATOM   2964  O O     . ASP E 3 88  ? -22.375 22.978  25.425 1.00 58.65  ? 82  ASP A O     1 
ATOM   2965  C CB    . ASP E 3 88  ? -23.151 24.678  28.093 1.00 61.27  ? 82  ASP A CB    1 
ATOM   2966  C CG    . ASP E 3 88  ? -23.381 26.043  28.720 1.00 65.85  ? 82  ASP A CG    1 
ATOM   2967  O OD1   . ASP E 3 88  ? -23.310 27.086  28.018 1.00 68.51  ? 82  ASP A OD1   1 
ATOM   2968  O OD2   . ASP E 3 88  ? -23.624 26.063  29.947 1.00 68.05  ? 82  ASP A OD2   1 
ATOM   2969  N N     . TRP E 3 89  ? -24.262 22.244  26.406 1.00 54.55  ? 83  TRP A N     1 
ATOM   2970  C CA    . TRP E 3 89  ? -24.078 20.846  26.003 1.00 52.48  ? 83  TRP A CA    1 
ATOM   2971  C C     . TRP E 3 89  ? -24.248 20.695  24.495 1.00 52.64  ? 83  TRP A C     1 
ATOM   2972  O O     . TRP E 3 89  ? -23.451 20.013  23.850 1.00 52.82  ? 83  TRP A O     1 
ATOM   2973  C CB    . TRP E 3 89  ? -25.037 19.936  26.784 1.00 49.36  ? 83  TRP A CB    1 
ATOM   2974  C CG    . TRP E 3 89  ? -25.124 18.524  26.298 1.00 47.71  ? 83  TRP A CG    1 
ATOM   2975  C CD1   . TRP E 3 89  ? -24.230 17.512  26.529 1.00 47.18  ? 83  TRP A CD1   1 
ATOM   2976  C CD2   . TRP E 3 89  ? -26.182 17.949  25.517 1.00 45.23  ? 83  TRP A CD2   1 
ATOM   2977  N NE1   . TRP E 3 89  ? -24.660 16.353  25.930 1.00 44.28  ? 83  TRP A NE1   1 
ATOM   2978  C CE2   . TRP E 3 89  ? -25.854 16.590  25.304 1.00 43.69  ? 83  TRP A CE2   1 
ATOM   2979  C CE3   . TRP E 3 89  ? -27.371 18.449  24.980 1.00 43.91  ? 83  TRP A CE3   1 
ATOM   2980  C CZ2   . TRP E 3 89  ? -26.672 15.724  24.578 1.00 42.92  ? 83  TRP A CZ2   1 
ATOM   2981  C CZ3   . TRP E 3 89  ? -28.183 17.589  24.251 1.00 44.41  ? 83  TRP A CZ3   1 
ATOM   2982  C CH2   . TRP E 3 89  ? -27.828 16.240  24.055 1.00 43.01  ? 83  TRP A CH2   1 
ATOM   2983  N N     . LEU E 3 90  ? -25.265 21.364  23.945 1.00 53.07  ? 84  LEU A N     1 
ATOM   2984  C CA    . LEU E 3 90  ? -25.536 21.350  22.509 1.00 53.76  ? 84  LEU A CA    1 
ATOM   2985  C C     . LEU E 3 90  ? -24.386 21.893  21.672 1.00 56.70  ? 84  LEU A C     1 
ATOM   2986  O O     . LEU E 3 90  ? -24.073 21.329  20.619 1.00 57.20  ? 84  LEU A O     1 
ATOM   2987  C CB    . LEU E 3 90  ? -26.809 22.137  22.187 1.00 54.33  ? 84  LEU A CB    1 
ATOM   2988  C CG    . LEU E 3 90  ? -28.164 21.491  22.488 1.00 51.99  ? 84  LEU A CG    1 
ATOM   2989  C CD1   . LEU E 3 90  ? -29.270 22.487  22.179 1.00 52.60  ? 84  LEU A CD1   1 
ATOM   2990  C CD2   . LEU E 3 90  ? -28.364 20.192  21.703 1.00 49.66  ? 84  LEU A CD2   1 
ATOM   2991  N N     . ILE E 3 91  ? -23.758 22.978  22.126 1.00 58.91  ? 85  ILE A N     1 
ATOM   2992  C CA    . ILE E 3 91  ? -22.715 23.611  21.325 1.00 62.21  ? 85  ILE A CA    1 
ATOM   2993  C C     . ILE E 3 91  ? -21.327 23.037  21.581 1.00 63.07  ? 85  ILE A C     1 
ATOM   2994  O O     . ILE E 3 91  ? -20.382 23.341  20.854 1.00 65.51  ? 85  ILE A O     1 
ATOM   2995  C CB    . ILE E 3 91  ? -22.715 25.158  21.452 1.00 65.29  ? 85  ILE A CB    1 
ATOM   2996  C CG1   . ILE E 3 91  ? -22.175 25.599  22.821 1.00 66.06  ? 85  ILE A CG1   1 
ATOM   2997  C CG2   . ILE E 3 91  ? -24.120 25.711  21.151 1.00 65.19  ? 85  ILE A CG2   1 
ATOM   2998  C CD1   . ILE E 3 91  ? -21.891 27.069  22.934 1.00 68.89  ? 85  ILE A CD1   1 
ATOM   2999  N N     . ARG E 3 92  ? -21.218 22.203  22.610 1.00 61.80  ? 86  ARG A N     1 
ATOM   3000  C CA    . ARG E 3 92  ? -19.969 21.518  22.941 1.00 63.18  ? 86  ARG A CA    1 
ATOM   3001  C C     . ARG E 3 92  ? -19.612 20.455  21.902 1.00 62.74  ? 86  ARG A C     1 
ATOM   3002  O O     . ARG E 3 92  ? -20.480 19.728  21.412 1.00 60.83  ? 86  ARG A O     1 
ATOM   3003  C CB    . ARG E 3 92  ? -20.086 20.866  24.319 1.00 61.79  ? 86  ARG A CB    1 
ATOM   3004  C CG    . ARG E 3 92  ? -18.793 20.807  25.100 1.00 66.10  ? 86  ARG A CG    1 
ATOM   3005  C CD    . ARG E 3 92  ? -19.086 20.733  26.587 1.00 69.15  ? 86  ARG A CD    1 
ATOM   3006  N NE    . ARG E 3 92  ? -19.471 19.384  27.010 1.00 69.64  ? 86  ARG A NE    1 
ATOM   3007  C CZ    . ARG E 3 92  ? -20.457 19.108  27.867 1.00 69.31  ? 86  ARG A CZ    1 
ATOM   3008  N NH1   . ARG E 3 92  ? -21.194 20.095  28.388 1.00 69.36  ? 86  ARG A NH1   1 
ATOM   3009  N NH2   . ARG E 3 92  ? -20.722 17.839  28.191 1.00 66.92  ? 86  ARG A NH2   1 
ATOM   3010  N N     . HIS E 3 93  ? -18.333 20.368  21.572 1.00 66.58  ? 87  HIS A N     1 
ATOM   3011  C CA    . HIS E 3 93  ? -17.856 19.345  20.659 1.00 66.01  ? 87  HIS A CA    1 
ATOM   3012  C C     . HIS E 3 93  ? -17.338 18.131  21.436 1.00 64.88  ? 87  HIS A C     1 
ATOM   3013  O O     . HIS E 3 93  ? -16.226 18.134  21.956 1.00 66.85  ? 87  HIS A O     1 
ATOM   3014  C CB    . HIS E 3 93  ? -16.777 19.907  19.722 1.00 69.30  ? 87  HIS A CB    1 
ATOM   3015  C CG    . HIS E 3 93  ? -17.194 21.140  18.980 1.00 71.24  ? 87  HIS A CG    1 
ATOM   3016  N ND1   . HIS E 3 93  ? -16.311 22.148  18.662 1.00 75.23  ? 87  HIS A ND1   1 
ATOM   3017  C CD2   . HIS E 3 93  ? -18.398 21.528  18.494 1.00 70.62  ? 87  HIS A CD2   1 
ATOM   3018  C CE1   . HIS E 3 93  ? -16.950 23.103  18.011 1.00 76.73  ? 87  HIS A CE1   1 
ATOM   3019  N NE2   . HIS E 3 93  ? -18.219 22.753  17.897 1.00 73.87  ? 87  HIS A NE2   1 
ATOM   3020  N N     . GLN E 3 94  ? -18.174 17.104  21.527 1.00 62.45  ? 88  GLN A N     1 
ATOM   3021  C CA    . GLN E 3 94  ? -17.799 15.844  22.163 1.00 61.71  ? 88  GLN A CA    1 
ATOM   3022  C C     . GLN E 3 94  ? -17.044 14.963  21.163 1.00 61.73  ? 88  GLN A C     1 
ATOM   3023  O O     . GLN E 3 94  ? -17.337 15.004  19.959 1.00 61.86  ? 88  GLN A O     1 
ATOM   3024  C CB    . GLN E 3 94  ? -19.045 15.115  22.689 1.00 59.16  ? 88  GLN A CB    1 
ATOM   3025  C CG    . GLN E 3 94  ? -19.840 15.908  23.733 1.00 60.30  ? 88  GLN A CG    1 
ATOM   3026  N N     . PRO E 3 95  ? -16.053 14.188  21.646 1.00 62.06  ? 89  PRO A N     1 
ATOM   3027  C CA    . PRO E 3 95  ? -15.383 13.213  20.773 1.00 62.20  ? 89  PRO A CA    1 
ATOM   3028  C C     . PRO E 3 95  ? -16.335 12.089  20.380 1.00 59.28  ? 89  PRO A C     1 
ATOM   3029  O O     . PRO E 3 95  ? -17.162 11.670  21.196 1.00 57.71  ? 89  PRO A O     1 
ATOM   3030  C CB    . PRO E 3 95  ? -14.245 12.663  21.644 1.00 63.58  ? 89  PRO A CB    1 
ATOM   3031  C CG    . PRO E 3 95  ? -14.629 12.998  23.069 1.00 63.32  ? 89  PRO A CG    1 
ATOM   3032  C CD    . PRO E 3 95  ? -15.436 14.263  22.985 1.00 63.32  ? 89  PRO A CD    1 
ATOM   3033  N N     . ILE E 3 96  ? -16.226 11.619  19.142 1.00 59.11  ? 90  ILE A N     1 
ATOM   3034  C CA    . ILE E 3 96  ? -17.099 10.561  18.638 1.00 56.90  ? 90  ILE A CA    1 
ATOM   3035  C C     . ILE E 3 96  ? -16.734 9.223   19.279 1.00 55.70  ? 90  ILE A C     1 
ATOM   3036  O O     . ILE E 3 96  ? -15.557 8.904   19.421 1.00 57.44  ? 90  ILE A O     1 
ATOM   3037  C CB    . ILE E 3 96  ? -17.051 10.457  17.093 1.00 58.38  ? 90  ILE A CB    1 
ATOM   3038  C CG1   . ILE E 3 96  ? -15.645 10.089  16.612 1.00 60.97  ? 90  ILE A CG1   1 
ATOM   3039  C CG2   . ILE E 3 96  ? -17.538 11.764  16.455 1.00 59.46  ? 90  ILE A CG2   1 
ATOM   3040  C CD1   . ILE E 3 96  ? -15.517 9.907   15.115 1.00 64.63  ? 90  ILE A CD1   1 
ATOM   3041  N N     . PRO E 3 97  ? -17.740 8.450   19.702 1.00 53.35  ? 91  PRO A N     1 
ATOM   3042  C CA    . PRO E 3 97  ? -17.440 7.192   20.384 1.00 52.60  ? 91  PRO A CA    1 
ATOM   3043  C C     . PRO E 3 97  ? -16.730 6.172   19.499 1.00 53.34  ? 91  PRO A C     1 
ATOM   3044  O O     . PRO E 3 97  ? -17.012 6.059   18.306 1.00 53.67  ? 91  PRO A O     1 
ATOM   3045  C CB    . PRO E 3 97  ? -18.823 6.674   20.804 1.00 50.48  ? 91  PRO A CB    1 
ATOM   3046  C CG    . PRO E 3 97  ? -19.789 7.410   19.962 1.00 50.37  ? 91  PRO A CG    1 
ATOM   3047  C CD    . PRO E 3 97  ? -19.178 8.753   19.731 1.00 51.75  ? 91  PRO A CD    1 
ATOM   3048  N N     . GLU E 3 98  ? -15.795 5.451   20.103 1.00 54.14  ? 92  GLU A N     1 
ATOM   3049  C CA    . GLU E 3 98  ? -15.080 4.379   19.425 1.00 54.98  ? 92  GLU A CA    1 
ATOM   3050  C C     . GLU E 3 98  ? -16.042 3.246   19.106 1.00 53.15  ? 92  GLU A C     1 
ATOM   3051  O O     . GLU E 3 98  ? -16.095 2.775   17.975 1.00 54.69  ? 92  GLU A O     1 
ATOM   3052  C CB    . GLU E 3 98  ? -13.932 3.873   20.309 1.00 56.49  ? 92  GLU A CB    1 
ATOM   3053  N N     . THR E 3 99  ? -16.824 2.840   20.102 1.00 50.82  ? 93  THR A N     1 
ATOM   3054  C CA    . THR E 3 99  ? -17.720 1.691   19.988 1.00 48.98  ? 93  THR A CA    1 
ATOM   3055  C C     . THR E 3 99  ? -19.175 2.115   19.871 1.00 47.12  ? 93  THR A C     1 
ATOM   3056  O O     . THR E 3 99  ? -19.669 2.883   20.688 1.00 45.91  ? 93  THR A O     1 
ATOM   3057  C CB    . THR E 3 99  ? -17.590 0.762   21.235 1.00 48.86  ? 93  THR A CB    1 
ATOM   3058  O OG1   . THR E 3 99  ? -16.212 0.453   21.483 1.00 49.37  ? 93  THR A OG1   1 
ATOM   3059  C CG2   . THR E 3 99  ? -18.395 -0.536  21.056 1.00 48.27  ? 93  THR A CG2   1 
ATOM   3060  N N     . VAL E 3 100 ? -19.865 1.610   18.855 1.00 47.26  ? 94  VAL A N     1 
ATOM   3061  C CA    . VAL E 3 100 ? -21.335 1.672   18.834 1.00 45.74  ? 94  VAL A CA    1 
ATOM   3062  C C     . VAL E 3 100 ? -21.831 0.230   18.794 1.00 46.35  ? 94  VAL A C     1 
ATOM   3063  O O     . VAL E 3 100 ? -21.776 -0.426  17.761 1.00 47.73  ? 94  VAL A O     1 
ATOM   3064  C CB    . VAL E 3 100 ? -21.890 2.519   17.659 1.00 45.67  ? 94  VAL A CB    1 
ATOM   3065  C CG1   . VAL E 3 100 ? -23.373 2.761   17.827 1.00 43.98  ? 94  VAL A CG1   1 
ATOM   3066  C CG2   . VAL E 3 100 ? -21.166 3.844   17.553 1.00 44.89  ? 94  VAL A CG2   1 
ATOM   3067  N N     . LYS E 3 101 ? -22.298 -0.252  19.940 1.00 46.19  ? 95  LYS A N     1 
ATOM   3068  C CA    . LYS E 3 101 ? -22.571 -1.667  20.157 1.00 47.78  ? 95  LYS A CA    1 
ATOM   3069  C C     . LYS E 3 101 ? -23.618 -2.260  19.211 1.00 49.27  ? 95  LYS A C     1 
ATOM   3070  O O     . LYS E 3 101 ? -24.667 -1.649  18.971 1.00 49.14  ? 95  LYS A O     1 
ATOM   3071  C CB    . LYS E 3 101 ? -22.946 -1.924  21.622 1.00 47.72  ? 95  LYS A CB    1 
ATOM   3072  C CG    . LYS E 3 101 ? -21.743 -1.921  22.573 1.00 47.80  ? 95  LYS A CG    1 
ATOM   3073  C CD    . LYS E 3 101 ? -22.096 -2.222  24.033 1.00 47.21  ? 95  LYS A CD    1 
ATOM   3074  C CE    . LYS E 3 101 ? -20.840 -2.142  24.913 1.00 47.73  ? 95  LYS A CE    1 
ATOM   3075  N NZ    . LYS E 3 101 ? -21.021 -2.509  26.369 1.00 48.42  ? 95  LYS A NZ    1 
ATOM   3076  N N     . ASP E 3 102 ? -23.304 -3.441  18.667 1.00 50.88  ? 96  ASP A N     1 
ATOM   3077  C CA    . ASP E 3 102 ? -24.206 -4.214  17.794 1.00 52.55  ? 96  ASP A CA    1 
ATOM   3078  C C     . ASP E 3 102 ? -23.893 -5.702  17.985 1.00 54.06  ? 96  ASP A C     1 
ATOM   3079  O O     . ASP E 3 102 ? -22.839 -6.193  17.566 1.00 54.80  ? 96  ASP A O     1 
ATOM   3080  C CB    . ASP E 3 102 ? -24.041 -3.796  16.322 1.00 53.44  ? 96  ASP A CB    1 
ATOM   3081  C CG    . ASP E 3 102 ? -25.031 -4.503  15.365 1.00 56.79  ? 96  ASP A CG    1 
ATOM   3082  O OD1   . ASP E 3 102 ? -25.498 -5.632  15.634 1.00 58.49  ? 96  ASP A OD1   1 
ATOM   3083  O OD2   . ASP E 3 102 ? -25.332 -3.919  14.300 1.00 59.12  ? 96  ASP A OD2   1 
ATOM   3084  N N     . GLU E 3 103 ? -24.820 -6.412  18.616 1.00 54.75  ? 97  GLU A N     1 
ATOM   3085  C CA    . GLU E 3 103 ? -24.618 -7.809  18.975 1.00 56.67  ? 97  GLU A CA    1 
ATOM   3086  C C     . GLU E 3 103 ? -24.541 -8.703  17.741 1.00 59.00  ? 97  GLU A C     1 
ATOM   3087  O O     . GLU E 3 103 ? -23.848 -9.728  17.752 1.00 60.80  ? 97  GLU A O     1 
ATOM   3088  C CB    . GLU E 3 103 ? -25.732 -8.280  19.910 1.00 57.65  ? 97  GLU A CB    1 
ATOM   3089  C CG    . GLU E 3 103 ? -25.372 -9.482  20.781 1.00 60.73  ? 97  GLU A CG    1 
ATOM   3090  C CD    . GLU E 3 103 ? -26.540 -9.964  21.639 1.00 64.57  ? 97  GLU A CD    1 
ATOM   3091  O OE1   . GLU E 3 103 ? -27.413 -9.131  21.992 1.00 64.34  ? 97  GLU A OE1   1 
ATOM   3092  O OE2   . GLU E 3 103 ? -26.590 -11.180 21.955 1.00 67.55  ? 97  GLU A OE2   1 
ATOM   3093  N N     . PHE E 3 104 ? -25.251 -8.322  16.679 1.00 59.27  ? 98  PHE A N     1 
ATOM   3094  C CA    . PHE E 3 104 ? -25.181 -9.067  15.440 1.00 61.47  ? 98  PHE A CA    1 
ATOM   3095  C C     . PHE E 3 104 ? -23.771 -9.004  14.862 1.00 61.71  ? 98  PHE A C     1 
ATOM   3096  O O     . PHE E 3 104 ? -23.250 -10.007 14.360 1.00 64.15  ? 98  PHE A O     1 
ATOM   3097  C CB    . PHE E 3 104 ? -26.195 -8.573  14.405 1.00 62.30  ? 98  PHE A CB    1 
ATOM   3098  C CG    . PHE E 3 104 ? -26.059 -9.261  13.069 1.00 65.14  ? 98  PHE A CG    1 
ATOM   3099  C CD1   . PHE E 3 104 ? -26.541 -10.547 12.888 1.00 67.79  ? 98  PHE A CD1   1 
ATOM   3100  C CD2   . PHE E 3 104 ? -25.408 -8.638  12.015 1.00 65.02  ? 98  PHE A CD2   1 
ATOM   3101  C CE1   . PHE E 3 104 ? -26.393 -11.196 11.676 1.00 72.05  ? 98  PHE A CE1   1 
ATOM   3102  C CE2   . PHE E 3 104 ? -25.255 -9.272  10.800 1.00 69.18  ? 98  PHE A CE2   1 
ATOM   3103  C CZ    . PHE E 3 104 ? -25.748 -10.557 10.624 1.00 72.44  ? 98  PHE A CZ    1 
ATOM   3104  N N     . MET E 3 105 ? -23.162 -7.822  14.924 1.00 59.46  ? 99  MET A N     1 
ATOM   3105  C CA    . MET E 3 105 ? -21.827 -7.635  14.372 1.00 59.97  ? 99  MET A CA    1 
ATOM   3106  C C     . MET E 3 105 ? -20.754 -8.342  15.193 1.00 59.99  ? 99  MET A C     1 
ATOM   3107  O O     . MET E 3 105 ? -19.697 -8.689  14.665 1.00 61.70  ? 99  MET A O     1 
ATOM   3108  C CB    . MET E 3 105 ? -21.503 -6.158  14.204 1.00 58.12  ? 99  MET A CB    1 
ATOM   3109  C CG    . MET E 3 105 ? -22.193 -5.516  13.035 1.00 59.39  ? 99  MET A CG    1 
ATOM   3110  S SD    . MET E 3 105 ? -21.997 -6.440  11.499 1.00 65.17  ? 99  MET A SD    1 
ATOM   3111  C CE    . MET E 3 105 ? -20.221 -6.427  11.266 1.00 64.56  ? 99  MET A CE    1 
ATOM   3112  N N     . LEU E 3 106 ? -21.037 -8.556  16.476 1.00 58.35  ? 100 LEU A N     1 
ATOM   3113  C CA    . LEU E 3 106 ? -20.193 -9.380  17.320 1.00 58.92  ? 100 LEU A CA    1 
ATOM   3114  C C     . LEU E 3 106 ? -20.271 -10.811 16.815 1.00 62.25  ? 100 LEU A C     1 
ATOM   3115  O O     . LEU E 3 106 ? -19.242 -11.436 16.572 1.00 64.18  ? 100 LEU A O     1 
ATOM   3116  C CB    . LEU E 3 106 ? -20.645 -9.292  18.778 1.00 57.48  ? 100 LEU A CB    1 
ATOM   3117  C CG    . LEU E 3 106 ? -19.904 -10.019 19.906 1.00 57.70  ? 100 LEU A CG    1 
ATOM   3118  C CD1   . LEU E 3 106 ? -18.467 -9.545  20.078 1.00 56.39  ? 100 LEU A CD1   1 
ATOM   3119  C CD2   . LEU E 3 106 ? -20.675 -9.828  21.193 1.00 55.97  ? 100 LEU A CD2   1 
ATOM   3120  N N     . LYS E 3 107 ? -21.494 -11.316 16.635 1.00 63.46  ? 101 LYS A N     1 
ATOM   3121  C CA    . LYS E 3 107 ? -21.722 -12.639 16.069 1.00 66.58  ? 101 LYS A CA    1 
ATOM   3122  C C     . LYS E 3 107 ? -20.987 -12.782 14.749 1.00 68.80  ? 101 LYS A C     1 
ATOM   3123  O O     . LYS E 3 107 ? -20.427 -13.845 14.469 1.00 71.54  ? 101 LYS A O     1 
ATOM   3124  C CB    . LYS E 3 107 ? -23.209 -12.878 15.813 1.00 67.75  ? 101 LYS A CB    1 
ATOM   3125  C CG    . LYS E 3 107 ? -24.005 -13.481 16.949 1.00 68.09  ? 101 LYS A CG    1 
ATOM   3126  C CD    . LYS E 3 107 ? -25.483 -13.474 16.583 1.00 69.73  ? 101 LYS A CD    1 
ATOM   3127  C CE    . LYS E 3 107 ? -26.390 -13.564 17.800 1.00 70.03  ? 101 LYS A CE    1 
ATOM   3128  N NZ    . LYS E 3 107 ? -27.038 -14.900 17.912 1.00 74.98  ? 101 LYS A NZ    1 
ATOM   3129  N N     . ALA E 3 108 ? -20.991 -11.715 13.945 1.00 67.78  ? 102 ALA A N     1 
ATOM   3130  C CA    . ALA E 3 108 ? -20.460 -11.780 12.582 1.00 70.35  ? 102 ALA A CA    1 
ATOM   3131  C C     . ALA E 3 108 ? -18.954 -11.988 12.595 1.00 70.94  ? 102 ALA A C     1 
ATOM   3132  O O     . ALA E 3 108 ? -18.399 -12.674 11.731 1.00 74.49  ? 102 ALA A O     1 
ATOM   3133  C CB    . ALA E 3 108 ? -20.821 -10.532 11.808 1.00 69.74  ? 102 ALA A CB    1 
ATOM   3134  N N     . TYR E 3 109 ? -18.313 -11.406 13.603 1.00 67.68  ? 103 TYR A N     1 
ATOM   3135  C CA    . TYR E 3 109 ? -16.878 -11.524 13.821 1.00 67.75  ? 103 TYR A CA    1 
ATOM   3136  C C     . TYR E 3 109 ? -16.456 -12.978 14.068 1.00 70.09  ? 103 TYR A C     1 
ATOM   3137  O O     . TYR E 3 109 ? -15.311 -13.352 13.798 1.00 71.91  ? 103 TYR A O     1 
ATOM   3138  C CB    . TYR E 3 109 ? -16.485 -10.626 15.003 1.00 64.20  ? 103 TYR A CB    1 
ATOM   3139  C CG    . TYR E 3 109 ? -15.010 -10.384 15.179 1.00 64.17  ? 103 TYR A CG    1 
ATOM   3140  C CD1   . TYR E 3 109 ? -14.242 -9.805  14.169 1.00 65.38  ? 103 TYR A CD1   1 
ATOM   3141  C CD2   . TYR E 3 109 ? -14.381 -10.708 16.375 1.00 63.45  ? 103 TYR A CD2   1 
ATOM   3142  C CE1   . TYR E 3 109 ? -12.875 -9.583  14.345 1.00 66.12  ? 103 TYR A CE1   1 
ATOM   3143  C CE2   . TYR E 3 109 ? -13.019 -10.489 16.560 1.00 63.62  ? 103 TYR A CE2   1 
ATOM   3144  C CZ    . TYR E 3 109 ? -12.278 -9.929  15.546 1.00 65.23  ? 103 TYR A CZ    1 
ATOM   3145  O OH    . TYR E 3 109 ? -10.939 -9.718  15.748 1.00 67.15  ? 103 TYR A OH    1 
ATOM   3146  N N     . PHE E 3 110 ? -17.393 -13.784 14.566 1.00 70.17  ? 104 PHE A N     1 
ATOM   3147  C CA    . PHE E 3 110 ? -17.123 -15.168 14.959 1.00 72.74  ? 104 PHE A CA    1 
ATOM   3148  C C     . PHE E 3 110 ? -17.643 -16.202 13.942 1.00 76.57  ? 104 PHE A C     1 
ATOM   3149  O O     . PHE E 3 110 ? -17.884 -17.367 14.281 1.00 78.33  ? 104 PHE A O     1 
ATOM   3150  C CB    . PHE E 3 110 ? -17.703 -15.458 16.350 1.00 70.96  ? 104 PHE A CB    1 
ATOM   3151  C CG    . PHE E 3 110 ? -17.269 -14.488 17.417 1.00 67.91  ? 104 PHE A CG    1 
ATOM   3152  C CD1   . PHE E 3 110 ? -15.935 -14.120 17.556 1.00 67.85  ? 104 PHE A CD1   1 
ATOM   3153  C CD2   . PHE E 3 110 ? -18.195 -13.970 18.313 1.00 65.04  ? 104 PHE A CD2   1 
ATOM   3154  C CE1   . PHE E 3 110 ? -15.542 -13.230 18.551 1.00 64.90  ? 104 PHE A CE1   1 
ATOM   3155  C CE2   . PHE E 3 110 ? -17.805 -13.088 19.311 1.00 62.39  ? 104 PHE A CE2   1 
ATOM   3156  C CZ    . PHE E 3 110 ? -16.480 -12.717 19.430 1.00 62.15  ? 104 PHE A CZ    1 
ATOM   3157  N N     . ILE E 3 111 ? -17.790 -15.764 12.695 1.00 78.03  ? 105 ILE A N     1 
ATOM   3158  C CA    . ILE E 3 111 ? -18.365 -16.584 11.629 1.00 82.16  ? 105 ILE A CA    1 
ATOM   3159  C C     . ILE E 3 111 ? -17.656 -17.941 11.441 1.00 86.16  ? 105 ILE A C     1 
ATOM   3160  O O     . ILE E 3 111 ? -18.303 -18.939 11.102 1.00 89.34  ? 105 ILE A O     1 
ATOM   3161  C CB    . ILE E 3 111 ? -18.468 -15.774 10.305 1.00 83.28  ? 105 ILE A CB    1 
ATOM   3162  C CG1   . ILE E 3 111 ? -19.545 -16.351 9.380  1.00 86.36  ? 105 ILE A CG1   1 
ATOM   3163  C CG2   . ILE E 3 111 ? -17.103 -15.629 9.628  1.00 85.33  ? 105 ILE A CG2   1 
ATOM   3164  C CD1   . ILE E 3 111 ? -20.255 -15.283 8.546  1.00 85.68  ? 105 ILE A CD1   1 
ATOM   3165  N N     . SER E 3 112 ? -16.351 -17.972 11.717 1.00 86.27  ? 106 SER A N     1 
ATOM   3166  C CA    . SER E 3 112 ? -15.524 -19.182 11.598 1.00 90.14  ? 106 SER A CA    1 
ATOM   3167  C C     . SER E 3 112 ? -16.101 -20.385 12.335 1.00 91.40  ? 106 SER A C     1 
ATOM   3168  O O     . SER E 3 112 ? -15.802 -21.529 11.999 1.00 95.75  ? 106 SER A O     1 
ATOM   3169  C CB    . SER E 3 112 ? -14.106 -18.920 12.110 1.00 89.29  ? 106 SER A CB    1 
ATOM   3170  O OG    . SER E 3 112 ? -14.068 -18.927 13.529 1.00 86.84  ? 106 SER A OG    1 
ATOM   3171  N N     . SER E 3 113 ? -16.910 -20.117 13.349 1.00 88.34  ? 107 SER A N     1 
ATOM   3172  C CA    . SER E 3 113 ? -17.588 -21.163 14.093 1.00 89.74  ? 107 SER A CA    1 
ATOM   3173  C C     . SER E 3 113 ? -18.915 -21.502 13.423 1.00 91.54  ? 107 SER A C     1 
ATOM   3174  O O     . SER E 3 113 ? -19.770 -22.153 14.017 1.00 92.28  ? 107 SER A O     1 
ATOM   3175  C CB    . SER E 3 113 ? -17.808 -20.717 15.542 1.00 86.36  ? 107 SER A CB    1 
ATOM   3176  O OG    . SER E 3 113 ? -16.605 -20.789 16.286 1.00 86.02  ? 107 SER A OG    1 
ATOM   3177  N N     . ARG E 3 116 ? -21.484 -22.829 6.989  1.00 114.11 ? 110 ARG A N     1 
ATOM   3178  C CA    . ARG E 3 116 ? -21.886 -22.107 5.779  1.00 116.16 ? 110 ARG A CA    1 
ATOM   3179  C C     . ARG E 3 116 ? -23.407 -21.968 5.676  1.00 116.70 ? 110 ARG A C     1 
ATOM   3180  O O     . ARG E 3 116 ? -23.917 -20.889 5.374  1.00 114.67 ? 110 ARG A O     1 
ATOM   3181  C CB    . ARG E 3 116 ? -21.325 -22.783 4.520  1.00 122.46 ? 110 ARG A CB    1 
ATOM   3182  C CG    . ARG E 3 116 ? -21.284 -21.891 3.276  1.00 124.66 ? 110 ARG A CG    1 
ATOM   3183  C CD    . ARG E 3 116 ? -20.359 -22.473 2.198  1.00 130.80 ? 110 ARG A CD    1 
ATOM   3184  N NE    . ARG E 3 116 ? -19.624 -21.422 1.487  1.00 130.95 ? 110 ARG A NE    1 
ATOM   3185  C CZ    . ARG E 3 116 ? -18.477 -21.601 0.831  1.00 134.77 ? 110 ARG A CZ    1 
ATOM   3186  N NH1   . ARG E 3 116 ? -17.909 -22.802 0.773  1.00 139.76 ? 110 ARG A NH1   1 
ATOM   3187  N NH2   . ARG E 3 116 ? -17.891 -20.574 0.226  1.00 134.09 ? 110 ARG A NH2   1 
ATOM   3188  N N     . GLN E 3 117 ? -24.122 -23.061 5.926  1.00 119.96 ? 111 GLN A N     1 
ATOM   3189  C CA    . GLN E 3 117 ? -25.582 -23.036 5.949  1.00 121.01 ? 111 GLN A CA    1 
ATOM   3190  C C     . GLN E 3 117 ? -26.087 -22.171 7.103  1.00 115.12 ? 111 GLN A C     1 
ATOM   3191  O O     . GLN E 3 117 ? -26.997 -21.355 6.928  1.00 113.86 ? 111 GLN A O     1 
ATOM   3192  C CB    . GLN E 3 117 ? -26.151 -24.455 6.058  1.00 126.10 ? 111 GLN A CB    1 
ATOM   3193  N N     . GLU E 3 118 ? -25.479 -22.347 8.274  1.00 111.92 ? 112 GLU A N     1 
ATOM   3194  C CA    . GLU E 3 118 ? -25.875 -21.624 9.482  1.00 106.90 ? 112 GLU A CA    1 
ATOM   3195  C C     . GLU E 3 118 ? -25.671 -20.117 9.351  1.00 102.05 ? 112 GLU A C     1 
ATOM   3196  O O     . GLU E 3 118 ? -26.497 -19.334 9.827  1.00 99.07  ? 112 GLU A O     1 
ATOM   3197  C CB    . GLU E 3 118 ? -25.119 -22.161 10.697 1.00 105.27 ? 112 GLU A CB    1 
ATOM   3198  C CG    . GLU E 3 118 ? -25.493 -23.594 11.058 1.00 110.74 ? 112 GLU A CG    1 
ATOM   3199  C CD    . GLU E 3 118 ? -24.595 -24.199 12.128 1.00 111.24 ? 112 GLU A CD    1 
ATOM   3200  O OE1   . GLU E 3 118 ? -23.423 -23.773 12.266 1.00 108.31 ? 112 GLU A OE1   1 
ATOM   3201  O OE2   . GLU E 3 118 ? -25.069 -25.119 12.831 1.00 114.81 ? 112 GLU A OE2   1 
ATOM   3202  N N     . ALA E 3 119 ? -24.579 -19.721 8.699  1.00 101.59 ? 113 ALA A N     1 
ATOM   3203  C CA    . ALA E 3 119 ? -24.293 -18.308 8.450  1.00 97.95  ? 113 ALA A CA    1 
ATOM   3204  C C     . ALA E 3 119 ? -25.290 -17.705 7.468  1.00 99.47  ? 113 ALA A C     1 
ATOM   3205  O O     . ALA E 3 119 ? -25.674 -16.544 7.615  1.00 95.93  ? 113 ALA A O     1 
ATOM   3206  C CB    . ALA E 3 119 ? -22.867 -18.119 7.946  1.00 98.22  ? 113 ALA A CB    1 
ATOM   3207  N N     . SER E 3 120 ? -25.699 -18.499 6.474  1.00 104.82 ? 114 SER A N     1 
ATOM   3208  C CA    . SER E 3 120 ? -26.705 -18.071 5.500  1.00 107.39 ? 114 SER A CA    1 
ATOM   3209  C C     . SER E 3 120 ? -28.036 -17.764 6.189  1.00 105.55 ? 114 SER A C     1 
ATOM   3210  O O     . SER E 3 120 ? -28.619 -16.696 5.979  1.00 103.47 ? 114 SER A O     1 
ATOM   3211  C CB    . SER E 3 120 ? -26.902 -19.125 4.401  1.00 114.27 ? 114 SER A CB    1 
ATOM   3212  N N     . ASP E 3 121 ? -28.496 -18.703 7.019  1.00 106.47 ? 115 ASP A N     1 
ATOM   3213  C CA    . ASP E 3 121 ? -29.767 -18.575 7.731  1.00 105.67 ? 115 ASP A CA    1 
ATOM   3214  C C     . ASP E 3 121 ? -29.766 -17.343 8.622  1.00 99.77  ? 115 ASP A C     1 
ATOM   3215  O O     . ASP E 3 121 ? -30.691 -16.526 8.558  1.00 99.13  ? 115 ASP A O     1 
ATOM   3216  C CB    . ASP E 3 121 ? -30.050 -19.830 8.562  1.00 107.82 ? 115 ASP A CB    1 
ATOM   3217  N N     . LEU E 3 122 ? -28.710 -17.213 9.431  1.00 95.96  ? 116 LEU A N     1 
ATOM   3218  C CA    . LEU E 3 122 ? -28.540 -16.113 10.372 1.00 90.10  ? 116 LEU A CA    1 
ATOM   3219  C C     . LEU E 3 122 ? -28.546 -14.755 9.681  1.00 87.97  ? 116 LEU A C     1 
ATOM   3220  O O     . LEU E 3 122 ? -29.081 -13.787 10.217 1.00 85.19  ? 116 LEU A O     1 
ATOM   3221  C CB    . LEU E 3 122 ? -27.239 -16.292 11.171 1.00 87.58  ? 116 LEU A CB    1 
ATOM   3222  C CG    . LEU E 3 122 ? -26.901 -15.267 12.269 1.00 82.42  ? 116 LEU A CG    1 
ATOM   3223  C CD1   . LEU E 3 122 ? -27.911 -15.313 13.430 1.00 80.85  ? 116 LEU A CD1   1 
ATOM   3224  C CD2   . LEU E 3 122 ? -25.477 -15.449 12.777 1.00 80.13  ? 116 LEU A CD2   1 
ATOM   3225  N N     . PHE E 3 123 ? -27.937 -14.680 8.504  1.00 89.87  ? 117 PHE A N     1 
ATOM   3226  C CA    . PHE E 3 123 ? -27.904 -13.435 7.744  1.00 88.65  ? 117 PHE A CA    1 
ATOM   3227  C C     . PHE E 3 123 ? -29.204 -13.182 6.989  1.00 91.30  ? 117 PHE A C     1 
ATOM   3228  O O     . PHE E 3 123 ? -29.669 -12.044 6.916  1.00 89.38  ? 117 PHE A O     1 
ATOM   3229  C CB    . PHE E 3 123 ? -26.709 -13.411 6.794  1.00 90.41  ? 117 PHE A CB    1 
ATOM   3230  C CG    . PHE E 3 123 ? -25.424 -13.014 7.453  1.00 86.73  ? 117 PHE A CG    1 
ATOM   3231  C CD1   . PHE E 3 123 ? -24.810 -13.848 8.378  1.00 85.94  ? 117 PHE A CD1   1 
ATOM   3232  C CD2   . PHE E 3 123 ? -24.824 -11.800 7.148  1.00 84.89  ? 117 PHE A CD2   1 
ATOM   3233  C CE1   . PHE E 3 123 ? -23.615 -13.480 8.989  1.00 83.30  ? 117 PHE A CE1   1 
ATOM   3234  C CE2   . PHE E 3 123 ? -23.628 -11.421 7.756  1.00 82.22  ? 117 PHE A CE2   1 
ATOM   3235  C CZ    . PHE E 3 123 ? -23.024 -12.263 8.676  1.00 81.37  ? 117 PHE A CZ    1 
ATOM   3236  N N     . THR E 3 124 ? -29.786 -14.243 6.435  1.00 96.22  ? 118 THR A N     1 
ATOM   3237  C CA    . THR E 3 124 ? -31.066 -14.150 5.740  1.00 99.56  ? 118 THR A CA    1 
ATOM   3238  C C     . THR E 3 124 ? -32.132 -13.612 6.691  1.00 96.81  ? 118 THR A C     1 
ATOM   3239  O O     . THR E 3 124 ? -32.912 -12.739 6.311  1.00 96.84  ? 118 THR A O     1 
ATOM   3240  C CB    . THR E 3 124 ? -31.499 -15.514 5.130  1.00 105.79 ? 118 THR A CB    1 
ATOM   3241  O OG1   . THR E 3 124 ? -30.495 -15.964 4.215  1.00 108.76 ? 118 THR A OG1   1 
ATOM   3242  C CG2   . THR E 3 124 ? -32.831 -15.397 4.377  1.00 109.65 ? 118 THR A CG2   1 
ATOM   3243  N N     . ASP E 3 125 ? -32.142 -14.116 7.926  1.00 94.76  ? 119 ASP A N     1 
ATOM   3244  C CA    . ASP E 3 125 ? -33.091 -13.658 8.935  1.00 92.53  ? 119 ASP A CA    1 
ATOM   3245  C C     . ASP E 3 125 ? -32.897 -12.171 9.223  1.00 87.75  ? 119 ASP A C     1 
ATOM   3246  O O     . ASP E 3 125 ? -33.866 -11.408 9.303  1.00 87.16  ? 119 ASP A O     1 
ATOM   3247  C CB    . ASP E 3 125 ? -32.944 -14.455 10.231 1.00 91.42  ? 119 ASP A CB    1 
ATOM   3248  C CG    . ASP E 3 125 ? -33.844 -13.918 11.354 1.00 89.67  ? 119 ASP A CG    1 
ATOM   3249  O OD1   . ASP E 3 125 ? -33.329 -13.238 12.281 1.00 83.64  ? 119 ASP A OD1   1 
ATOM   3250  O OD2   . ASP E 3 125 ? -35.069 -14.172 11.296 1.00 92.65  ? 119 ASP A OD2   1 
ATOM   3251  N N     . GLN E 3 126 ? -31.636 -11.780 9.387  1.00 84.62  ? 120 GLN A N     1 
ATOM   3252  C CA    . GLN E 3 126 ? -31.269 -10.400 9.636  1.00 80.42  ? 120 GLN A CA    1 
ATOM   3253  C C     . GLN E 3 126 ? -31.704 -9.523  8.459  1.00 81.74  ? 120 GLN A C     1 
ATOM   3254  O O     . GLN E 3 126 ? -32.219 -8.424  8.671  1.00 79.49  ? 120 GLN A O     1 
ATOM   3255  C CB    . GLN E 3 126 ? -29.763 -10.288 9.910  1.00 77.87  ? 120 GLN A CB    1 
ATOM   3256  C CG    . GLN E 3 126 ? -29.300 -8.944  10.491 1.00 74.10  ? 120 GLN A CG    1 
ATOM   3257  C CD    . GLN E 3 126 ? -29.638 -8.741  11.979 1.00 72.26  ? 120 GLN A CD    1 
ATOM   3258  O OE1   . GLN E 3 126 ? -29.592 -7.614  12.485 1.00 70.10  ? 120 GLN A OE1   1 
ATOM   3259  N NE2   . GLN E 3 126 ? -29.955 -9.826  12.680 1.00 72.99  ? 120 GLN A NE2   1 
ATOM   3260  N N     . LEU E 3 127 ? -31.530 -10.020 7.230  1.00 85.62  ? 121 LEU A N     1 
ATOM   3261  C CA    . LEU E 3 127 ? -31.992 -9.301  6.036  1.00 87.87  ? 121 LEU A CA    1 
ATOM   3262  C C     . LEU E 3 127 ? -33.496 -9.053  6.098  1.00 89.05  ? 121 LEU A C     1 
ATOM   3263  O O     . LEU E 3 127 ? -33.949 -7.926  5.899  1.00 87.75  ? 121 LEU A O     1 
ATOM   3264  C CB    . LEU E 3 127 ? -31.631 -10.052 4.749  1.00 93.08  ? 121 LEU A CB    1 
ATOM   3265  N N     . LEU E 3 128 ? -34.254 -10.106 6.406  1.00 91.68  ? 122 LEU A N     1 
ATOM   3266  C CA    . LEU E 3 128 ? -35.716 -10.044 6.447  1.00 93.97  ? 122 LEU A CA    1 
ATOM   3267  C C     . LEU E 3 128 ? -36.237 -9.094  7.527  1.00 89.77  ? 122 LEU A C     1 
ATOM   3268  O O     . LEU E 3 128 ? -37.136 -8.290  7.276  1.00 90.16  ? 122 LEU A O     1 
ATOM   3269  C CB    . LEU E 3 128 ? -36.316 -11.448 6.619  1.00 98.15  ? 122 LEU A CB    1 
ATOM   3270  N N     . LYS E 3 129 ? -35.661 -9.191  8.722  1.00 86.16  ? 123 LYS A N     1 
ATOM   3271  C CA    . LYS E 3 129 ? -36.033 -8.320  9.839  1.00 82.39  ? 123 LYS A CA    1 
ATOM   3272  C C     . LYS E 3 129 ? -35.702 -6.864  9.544  1.00 79.16  ? 123 LYS A C     1 
ATOM   3273  O O     . LYS E 3 129 ? -36.509 -5.968  9.824  1.00 77.89  ? 123 LYS A O     1 
ATOM   3274  C CB    . LYS E 3 129 ? -35.380 -8.786  11.144 1.00 79.64  ? 123 LYS A CB    1 
ATOM   3275  C CG    . LYS E 3 129 ? -35.965 -10.095 11.673 1.00 83.34  ? 123 LYS A CG    1 
ATOM   3276  C CD    . LYS E 3 129 ? -35.326 -10.531 12.982 1.00 81.96  ? 123 LYS A CD    1 
ATOM   3277  C CE    . LYS E 3 129 ? -35.999 -11.796 13.509 1.00 85.95  ? 123 LYS A CE    1 
ATOM   3278  N NZ    . LYS E 3 129 ? -35.316 -12.318 14.729 1.00 85.08  ? 123 LYS A NZ    1 
ATOM   3279  N N     . ARG E 3 130 ? -34.537 -6.637  8.945  1.00 78.02  ? 124 ARG A N     1 
ATOM   3280  C CA    . ARG E 3 130 ? -34.117 -5.279  8.614  1.00 75.77  ? 124 ARG A CA    1 
ATOM   3281  C C     . ARG E 3 130 ? -34.874 -4.684  7.440  1.00 78.86  ? 124 ARG A C     1 
ATOM   3282  O O     . ARG E 3 130 ? -35.085 -3.474  7.406  1.00 77.21  ? 124 ARG A O     1 
ATOM   3283  C CB    . ARG E 3 130 ? -32.599 -5.182  8.432  1.00 74.31  ? 124 ARG A CB    1 
ATOM   3284  C CG    . ARG E 3 130 ? -31.852 -5.496  9.733  1.00 71.07  ? 124 ARG A CG    1 
ATOM   3285  C CD    . ARG E 3 130 ? -30.570 -4.743  9.911  1.00 68.26  ? 124 ARG A CD    1 
ATOM   3286  N NE    . ARG E 3 130 ? -30.028 -5.049  11.234 1.00 67.28  ? 124 ARG A NE    1 
ATOM   3287  C CZ    . ARG E 3 130 ? -30.107 -4.256  12.304 1.00 62.81  ? 124 ARG A CZ    1 
ATOM   3288  N NH1   . ARG E 3 130 ? -30.672 -3.058  12.233 1.00 61.45  ? 124 ARG A NH1   1 
ATOM   3289  N NH2   . ARG E 3 130 ? -29.601 -4.668  13.447 1.00 60.92  ? 124 ARG A NH2   1 
ATOM   3290  N N     . LYS E 3 131 ? -35.293 -5.533  6.494  1.00 83.79  ? 125 LYS A N     1 
ATOM   3291  C CA    . LYS E 3 131 ? -36.196 -5.119  5.415  1.00 87.43  ? 125 LYS A CA    1 
ATOM   3292  C C     . LYS E 3 131 ? -37.524 -4.647  5.994  1.00 87.10  ? 125 LYS A C     1 
ATOM   3293  O O     . LYS E 3 131 ? -38.077 -3.636  5.555  1.00 87.43  ? 125 LYS A O     1 
ATOM   3294  C CB    . LYS E 3 131 ? -36.445 -6.258  4.422  1.00 93.29  ? 125 LYS A CB    1 
ATOM   3295  C CG    . LYS E 3 131 ? -35.441 -6.336  3.280  1.00 95.85  ? 125 LYS A CG    1 
ATOM   3296  C CD    . LYS E 3 131 ? -36.003 -7.112  2.096  1.00 101.80 ? 125 LYS A CD    1 
ATOM   3297  N N     . ALA E 3 132 ? -38.021 -5.385  6.985  1.00 86.81  ? 126 ALA A N     1 
ATOM   3298  C CA    . ALA E 3 132 ? -39.264 -5.039  7.673  1.00 87.03  ? 126 ALA A CA    1 
ATOM   3299  C C     . ALA E 3 132 ? -39.145 -3.698  8.401  1.00 82.63  ? 126 ALA A C     1 
ATOM   3300  O O     . ALA E 3 132 ? -39.980 -2.818  8.215  1.00 83.29  ? 126 ALA A O     1 
ATOM   3301  C CB    . ALA E 3 132 ? -39.680 -6.152  8.634  1.00 87.77  ? 126 ALA A CB    1 
ATOM   3302  N N     . LYS E 3 133 ? -38.096 -3.537  9.204  1.00 78.67  ? 127 LYS A N     1 
ATOM   3303  C CA    . LYS E 3 133 ? -37.873 -2.281  9.921  1.00 75.03  ? 127 LYS A CA    1 
ATOM   3304  C C     . LYS E 3 133 ? -37.760 -1.103  8.950  1.00 75.05  ? 127 LYS A C     1 
ATOM   3305  O O     . LYS E 3 133 ? -38.140 0.026   9.288  1.00 73.57  ? 127 LYS A O     1 
ATOM   3306  C CB    . LYS E 3 133 ? -36.643 -2.350  10.843 1.00 71.31  ? 127 LYS A CB    1 
ATOM   3307  C CG    . LYS E 3 133 ? -36.467 -1.090  11.714 1.00 69.25  ? 127 LYS A CG    1 
ATOM   3308  C CD    . LYS E 3 133 ? -35.250 -1.127  12.651 1.00 67.61  ? 127 LYS A CD    1 
ATOM   3309  C CE    . LYS E 3 133 ? -35.216 0.116   13.556 1.00 66.14  ? 127 LYS A CE    1 
ATOM   3310  N NZ    . LYS E 3 133 ? -34.225 0.059   14.693 1.00 64.30  ? 127 LYS A NZ    1 
ATOM   3311  N N     . LEU E 3 134 ? -37.253 -1.373  7.748  1.00 77.18  ? 128 LEU A N     1 
ATOM   3312  C CA    . LEU E 3 134 ? -37.091 -0.334  6.731  1.00 77.72  ? 128 LEU A CA    1 
ATOM   3313  C C     . LEU E 3 134 ? -38.445 0.073   6.177  1.00 80.74  ? 128 LEU A C     1 
ATOM   3314  O O     . LEU E 3 134 ? -38.699 1.256   5.951  1.00 80.28  ? 128 LEU A O     1 
ATOM   3315  C CB    . LEU E 3 134 ? -36.167 -0.807  5.604  1.00 80.01  ? 128 LEU A CB    1 
ATOM   3316  C CG    . LEU E 3 134 ? -35.896 0.137   4.428  1.00 81.54  ? 128 LEU A CG    1 
ATOM   3317  C CD1   . LEU E 3 134 ? -35.080 1.346   4.848  1.00 77.53  ? 128 LEU A CD1   1 
ATOM   3318  C CD2   . LEU E 3 134 ? -35.191 -0.614  3.324  1.00 85.11  ? 128 LEU A CD2   1 
ATOM   3319  N N     . SER E 3 135 ? -39.310 -0.916  5.969  1.00 84.27  ? 129 SER A N     1 
ATOM   3320  C CA    . SER E 3 135 ? -40.663 -0.674  5.465  1.00 87.92  ? 129 SER A CA    1 
ATOM   3321  C C     . SER E 3 135 ? -41.445 0.228   6.413  1.00 85.52  ? 129 SER A C     1 
ATOM   3322  O O     . SER E 3 135 ? -42.091 1.182   5.979  1.00 86.62  ? 129 SER A O     1 
ATOM   3323  C CB    . SER E 3 135 ? -41.401 -1.994  5.249  1.00 92.06  ? 129 SER A CB    1 
ATOM   3324  O OG    . SER E 3 135 ? -42.800 -1.799  5.314  1.00 95.01  ? 129 SER A OG    1 
ATOM   3325  N N     . ASP E 3 136 ? -41.366 -0.079  7.707  1.00 82.73  ? 130 ASP A N     1 
ATOM   3326  C CA    . ASP E 3 136 ? -41.994 0.731   8.746  1.00 80.70  ? 130 ASP A CA    1 
ATOM   3327  C C     . ASP E 3 136 ? -41.428 2.157   8.775  1.00 77.65  ? 130 ASP A C     1 
ATOM   3328  O O     . ASP E 3 136 ? -42.175 3.117   8.968  1.00 77.75  ? 130 ASP A O     1 
ATOM   3329  C CB    . ASP E 3 136 ? -41.848 0.060   10.115 1.00 78.46  ? 130 ASP A CB    1 
ATOM   3330  N N     . LEU E 3 137 ? -40.119 2.288   8.562  1.00 75.46  ? 131 LEU A N     1 
ATOM   3331  C CA    . LEU E 3 137 ? -39.450 3.593   8.584  1.00 73.00  ? 131 LEU A CA    1 
ATOM   3332  C C     . LEU E 3 137 ? -39.763 4.473   7.382  1.00 75.61  ? 131 LEU A C     1 
ATOM   3333  O O     . LEU E 3 137 ? -39.861 5.697   7.511  1.00 74.21  ? 131 LEU A O     1 
ATOM   3334  C CB    . LEU E 3 137 ? -37.938 3.425   8.714  1.00 70.38  ? 131 LEU A CB    1 
ATOM   3335  C CG    . LEU E 3 137 ? -37.419 3.134   10.122 1.00 67.21  ? 131 LEU A CG    1 
ATOM   3336  C CD1   . LEU E 3 137 ? -35.923 2.825   10.068 1.00 65.07  ? 131 LEU A CD1   1 
ATOM   3337  C CD2   . LEU E 3 137 ? -37.723 4.273   11.104 1.00 64.55  ? 131 LEU A CD2   1 
ATOM   3338  N N     . GLN E 3 138 ? -39.900 3.840   6.218  1.00 79.79  ? 132 GLN A N     1 
ATOM   3339  C CA    . GLN E 3 138 ? -40.277 4.519   4.984  1.00 83.45  ? 132 GLN A CA    1 
ATOM   3340  C C     . GLN E 3 138 ? -41.681 5.077   5.153  1.00 84.90  ? 132 GLN A C     1 
ATOM   3341  O O     . GLN E 3 138 ? -41.937 6.241   4.836  1.00 85.33  ? 132 GLN A O     1 
ATOM   3342  C CB    . GLN E 3 138 ? -40.240 3.539   3.807  1.00 88.16  ? 132 GLN A CB    1 
ATOM   3343  C CG    . GLN E 3 138 ? -40.075 4.187   2.427  1.00 92.62  ? 132 GLN A CG    1 
ATOM   3344  C CD    . GLN E 3 138 ? -38.626 4.190   1.956  1.00 93.43  ? 132 GLN A CD    1 
ATOM   3345  O OE1   . GLN E 3 138 ? -37.992 3.133   1.839  1.00 93.89  ? 132 GLN A OE1   1 
ATOM   3346  N NE2   . GLN E 3 138 ? -38.095 5.382   1.677  1.00 92.91  ? 132 GLN A NE2   1 
ATOM   3347  N N     . GLY E 3 139 ? -42.579 4.239   5.672  1.00 86.05  ? 133 GLY A N     1 
ATOM   3348  C CA    . GLY E 3 139 ? -43.957 4.632   5.955  1.00 88.00  ? 133 GLY A CA    1 
ATOM   3349  C C     . GLY E 3 139 ? -44.067 5.863   6.841  1.00 84.97  ? 133 GLY A C     1 
ATOM   3350  O O     . GLY E 3 139 ? -44.907 6.737   6.590  1.00 86.89  ? 133 GLY A O     1 
ATOM   3351  N N     . SER E 3 140 ? -43.217 5.929   7.869  1.00 80.49  ? 134 SER A N     1 
ATOM   3352  C CA    . SER E 3 140 ? -43.197 7.042   8.816  1.00 77.52  ? 134 SER A CA    1 
ATOM   3353  C C     . SER E 3 140 ? -42.625 8.312   8.194  1.00 76.90  ? 134 SER A C     1 
ATOM   3354  O O     . SER E 3 140 ? -43.061 9.425   8.512  1.00 76.52  ? 134 SER A O     1 
ATOM   3355  C CB    . SER E 3 140 ? -42.402 6.665   10.064 1.00 73.69  ? 134 SER A CB    1 
ATOM   3356  O OG    . SER E 3 140 ? -43.135 5.760   10.866 1.00 74.56  ? 134 SER A OG    1 
ATOM   3357  N N     . TYR E 3 141 ? -41.646 8.131   7.311  1.00 77.10  ? 135 TYR A N     1 
ATOM   3358  C CA    . TYR E 3 141 ? -41.064 9.226   6.557  1.00 77.37  ? 135 TYR A CA    1 
ATOM   3359  C C     . TYR E 3 141 ? -42.096 9.848   5.614  1.00 81.55  ? 135 TYR A C     1 
ATOM   3360  O O     . TYR E 3 141 ? -42.101 11.066  5.411  1.00 81.68  ? 135 TYR A O     1 
ATOM   3361  C CB    . TYR E 3 141 ? -39.846 8.736   5.771  1.00 77.52  ? 135 TYR A CB    1 
ATOM   3362  C CG    . TYR E 3 141 ? -39.263 9.760   4.826  1.00 79.02  ? 135 TYR A CG    1 
ATOM   3363  C CD1   . TYR E 3 141 ? -38.495 10.823  5.305  1.00 75.90  ? 135 TYR A CD1   1 
ATOM   3364  C CD2   . TYR E 3 141 ? -39.480 9.670   3.449  1.00 83.61  ? 135 TYR A CD2   1 
ATOM   3365  C CE1   . TYR E 3 141 ? -37.959 11.771  4.436  1.00 78.07  ? 135 TYR A CE1   1 
ATOM   3366  C CE2   . TYR E 3 141 ? -38.951 10.616  2.573  1.00 85.67  ? 135 TYR A CE2   1 
ATOM   3367  C CZ    . TYR E 3 141 ? -38.190 11.662  3.074  1.00 83.01  ? 135 TYR A CZ    1 
ATOM   3368  O OH    . TYR E 3 141 ? -37.665 12.598  2.210  1.00 85.84  ? 135 TYR A OH    1 
ATOM   3369  N N     . GLU E 3 142 ? -42.961 9.010   5.045  1.00 85.27  ? 136 GLU A N     1 
ATOM   3370  C CA    . GLU E 3 142 ? -43.998 9.473   4.115  1.00 90.23  ? 136 GLU A CA    1 
ATOM   3371  C C     . GLU E 3 142 ? -45.131 10.202  4.842  1.00 90.07  ? 136 GLU A C     1 
ATOM   3372  O O     . GLU E 3 142 ? -45.673 11.183  4.326  1.00 92.21  ? 136 GLU A O     1 
ATOM   3373  C CB    . GLU E 3 142 ? -44.526 8.317   3.253  1.00 94.68  ? 136 GLU A CB    1 
ATOM   3374  C CG    . GLU E 3 142 ? -43.507 7.822   2.211  1.00 97.36  ? 136 GLU A CG    1 
ATOM   3375  C CD    . GLU E 3 142 ? -43.888 6.500   1.542  1.00 103.11 ? 136 GLU A CD    1 
ATOM   3376  O OE1   . GLU E 3 142 ? -43.241 6.137   0.536  1.00 106.28 ? 136 GLU A OE1   1 
ATOM   3377  O OE2   . GLU E 3 142 ? -44.827 5.819   2.009  1.00 104.97 ? 136 GLU A OE2   1 
ATOM   3378  N N     . LYS E 3 143 ? -45.459 9.724   6.044  1.00 88.00  ? 137 LYS A N     1 
ATOM   3379  C CA    . LYS E 3 143 ? -46.440 10.368  6.928  1.00 87.72  ? 137 LYS A CA    1 
ATOM   3380  C C     . LYS E 3 143 ? -45.984 11.775  7.334  1.00 85.20  ? 137 LYS A C     1 
ATOM   3381  O O     . LYS E 3 143 ? -46.787 12.714  7.341  1.00 86.59  ? 137 LYS A O     1 
ATOM   3382  C CB    . LYS E 3 143 ? -46.691 9.503   8.174  1.00 86.03  ? 137 LYS A CB    1 
ATOM   3383  C CG    . LYS E 3 143 ? -47.971 9.828   8.943  1.00 87.34  ? 137 LYS A CG    1 
ATOM   3384  N N     . LEU E 3 144 ? -44.697 11.911  7.662  1.00 81.67  ? 138 LEU A N     1 
ATOM   3385  C CA    . LEU E 3 144 ? -44.115 13.209  7.997  1.00 79.64  ? 138 LEU A CA    1 
ATOM   3386  C C     . LEU E 3 144 ? -44.128 14.187  6.815  1.00 82.62  ? 138 LEU A C     1 
ATOM   3387  O O     . LEU E 3 144 ? -44.519 15.346  6.973  1.00 83.08  ? 138 LEU A O     1 
ATOM   3388  C CB    . LEU E 3 144 ? -42.691 13.042  8.539  1.00 75.82  ? 138 LEU A CB    1 
ATOM   3389  C CG    . LEU E 3 144 ? -41.800 14.289  8.681  1.00 74.15  ? 138 LEU A CG    1 
ATOM   3390  C CD1   . LEU E 3 144 ? -42.248 15.201  9.826  1.00 73.20  ? 138 LEU A CD1   1 
ATOM   3391  C CD2   . LEU E 3 144 ? -40.349 13.896  8.855  1.00 70.78  ? 138 LEU A CD2   1 
ATOM   3392  N N     . MET E 3 145 ? -43.717 13.718  5.638  1.00 85.22  ? 139 MET A N     1 
ATOM   3393  C CA    . MET E 3 145 ? -43.564 14.599  4.473  1.00 88.70  ? 139 MET A CA    1 
ATOM   3394  C C     . MET E 3 145 ? -44.877 15.169  3.923  1.00 92.97  ? 139 MET A C     1 
ATOM   3395  O O     . MET E 3 145 ? -44.904 16.296  3.418  1.00 94.60  ? 139 MET A O     1 
ATOM   3396  C CB    . MET E 3 145 ? -42.772 13.916  3.358  1.00 90.66  ? 139 MET A CB    1 
ATOM   3397  C CG    . MET E 3 145 ? -41.273 13.818  3.612  1.00 89.02  ? 139 MET A CG    1 
ATOM   3398  S SD    . MET E 3 145 ? -40.551 15.183  4.566  1.00 87.91  ? 139 MET A SD    1 
ATOM   3399  C CE    . MET E 3 145 ? -39.215 15.668  3.474  1.00 89.41  ? 139 MET A CE    1 
ATOM   3400  N N     . ALA E 3 146 ? -45.951 14.386  4.022  1.00 95.31  ? 140 ALA A N     1 
ATOM   3401  C CA    . ALA E 3 146 ? -47.279 14.805  3.574  1.00 99.81  ? 140 ALA A CA    1 
ATOM   3402  C C     . ALA E 3 146 ? -47.794 16.036  4.331  1.00 99.08  ? 140 ALA A C     1 
ATOM   3403  O O     . ALA E 3 146 ? -48.389 16.937  3.732  1.00 102.30 ? 140 ALA A O     1 
ATOM   3404  C CB    . ALA E 3 146 ? -48.260 13.655  3.707  1.00 101.85 ? 140 ALA A CB    1 
ATOM   3405  N N     . SER E 3 147 ? -47.550 16.065  5.642  1.00 95.32  ? 141 SER A N     1 
ATOM   3406  C CA    . SER E 3 147 ? -48.010 17.149  6.520  1.00 94.45  ? 141 SER A CA    1 
ATOM   3407  C C     . SER E 3 147 ? -47.078 18.367  6.501  1.00 92.68  ? 141 SER A C     1 
ATOM   3408  O O     . SER E 3 147 ? -45.906 18.279  6.881  1.00 89.13  ? 141 SER A O     1 
ATOM   3409  C CB    . SER E 3 147 ? -48.179 16.633  7.955  1.00 91.66  ? 141 SER A CB    1 
ATOM   3410  N N     . PRO E 3 150 ? -42.348 20.801  2.069  1.00 95.77  ? 144 PRO A N     1 
ATOM   3411  C CA    . PRO E 3 150 ? -41.510 21.998  2.095  1.00 95.56  ? 144 PRO A CA    1 
ATOM   3412  C C     . PRO E 3 150 ? -40.637 22.041  3.355  1.00 90.23  ? 144 PRO A C     1 
ATOM   3413  O O     . PRO E 3 150 ? -40.825 22.894  4.225  1.00 88.47  ? 144 PRO A O     1 
ATOM   3414  C CB    . PRO E 3 150 ? -42.535 23.143  2.068  1.00 97.99  ? 144 PRO A CB    1 
ATOM   3415  C CG    . PRO E 3 150 ? -43.816 22.547  2.626  1.00 97.42  ? 144 PRO A CG    1 
ATOM   3416  C CD    . PRO E 3 150 ? -43.683 21.040  2.648  1.00 95.96  ? 144 PRO A CD    1 
ATOM   3417  N N     . MET E 3 151 ? -39.688 21.110  3.427  1.00 88.05  ? 145 MET A N     1 
ATOM   3418  C CA    . MET E 3 151 ? -38.807 20.941  4.590  1.00 83.46  ? 145 MET A CA    1 
ATOM   3419  C C     . MET E 3 151 ? -37.554 21.805  4.470  1.00 83.67  ? 145 MET A C     1 
ATOM   3420  O O     . MET E 3 151 ? -36.994 21.963  3.373  1.00 86.95  ? 145 MET A O     1 
ATOM   3421  C CB    . MET E 3 151 ? -38.416 19.470  4.744  1.00 81.28  ? 145 MET A CB    1 
ATOM   3422  C CG    . MET E 3 151 ? -37.514 19.156  5.938  1.00 77.32  ? 145 MET A CG    1 
ATOM   3423  S SD    . MET E 3 151 ? -38.280 19.384  7.567  1.00 74.19  ? 145 MET A SD    1 
ATOM   3424  C CE    . MET E 3 151 ? -39.713 18.306  7.439  1.00 75.08  ? 145 MET A CE    1 
ATOM   3425  N N     . SER E 3 152 ? -37.123 22.356  5.603  1.00 80.30  ? 146 SER A N     1 
ATOM   3426  C CA    . SER E 3 152 ? -36.003 23.289  5.641  1.00 80.62  ? 146 SER A CA    1 
ATOM   3427  C C     . SER E 3 152 ? -35.472 23.426  7.058  1.00 76.81  ? 146 SER A C     1 
ATOM   3428  O O     . SER E 3 152 ? -36.118 22.985  8.011  1.00 74.16  ? 146 SER A O     1 
ATOM   3429  C CB    . SER E 3 152 ? -36.440 24.665  5.117  1.00 84.07  ? 146 SER A CB    1 
ATOM   3430  O OG    . SER E 3 152 ? -37.446 25.226  5.941  1.00 82.50  ? 146 SER A OG    1 
ATOM   3431  N N     . PHE E 3 153 ? -34.306 24.054  7.202  1.00 77.02  ? 147 PHE A N     1 
ATOM   3432  C CA    . PHE E 3 153 ? -33.768 24.348  8.531  1.00 74.28  ? 147 PHE A CA    1 
ATOM   3433  C C     . PHE E 3 153 ? -34.782 25.113  9.389  1.00 73.81  ? 147 PHE A C     1 
ATOM   3434  O O     . PHE E 3 153 ? -34.889 24.871  10.579 1.00 71.27  ? 147 PHE A O     1 
ATOM   3435  C CB    . PHE E 3 153 ? -32.436 25.115  8.455  1.00 75.65  ? 147 PHE A CB    1 
ATOM   3436  C CG    . PHE E 3 153 ? -31.943 25.602  9.800  1.00 73.51  ? 147 PHE A CG    1 
ATOM   3437  C CD1   . PHE E 3 153 ? -31.371 24.718  10.711 1.00 69.69  ? 147 PHE A CD1   1 
ATOM   3438  C CD2   . PHE E 3 153 ? -32.075 26.943  10.165 1.00 74.76  ? 147 PHE A CD2   1 
ATOM   3439  C CE1   . PHE E 3 153 ? -30.931 25.161  11.956 1.00 67.70  ? 147 PHE A CE1   1 
ATOM   3440  C CE2   . PHE E 3 153 ? -31.639 27.391  11.411 1.00 73.05  ? 147 PHE A CE2   1 
ATOM   3441  C CZ    . PHE E 3 153 ? -31.068 26.494  12.309 1.00 69.71  ? 147 PHE A CZ    1 
ATOM   3442  N N     . SER E 3 154 ? -35.523 26.030  8.776  1.00 76.85  ? 148 SER A N     1 
ATOM   3443  C CA    . SER E 3 154 ? -36.497 26.853  9.500  1.00 77.02  ? 148 SER A CA    1 
ATOM   3444  C C     . SER E 3 154 ? -37.689 26.051  10.042 1.00 75.03  ? 148 SER A C     1 
ATOM   3445  O O     . SER E 3 154 ? -38.321 26.456  11.025 1.00 74.30  ? 148 SER A O     1 
ATOM   3446  C CB    . SER E 3 154 ? -36.983 28.013  8.615  1.00 80.78  ? 148 SER A CB    1 
ATOM   3447  N N     . SER E 3 155 ? -37.976 24.916  9.404  1.00 74.53  ? 149 SER A N     1 
ATOM   3448  C CA    . SER E 3 155 ? -39.145 24.093  9.725  1.00 73.28  ? 149 SER A CA    1 
ATOM   3449  C C     . SER E 3 155 ? -39.138 23.573  11.163 1.00 69.90  ? 149 SER A C     1 
ATOM   3450  O O     . SER E 3 155 ? -38.136 23.027  11.625 1.00 67.59  ? 149 SER A O     1 
ATOM   3451  C CB    . SER E 3 155 ? -39.256 22.921  8.746  1.00 73.88  ? 149 SER A CB    1 
ATOM   3452  O OG    . SER E 3 155 ? -40.177 21.949  9.210  1.00 72.91  ? 149 SER A OG    1 
ATOM   3453  N N     . PRO E 3 156 ? -40.268 23.736  11.875 1.00 69.92  ? 150 PRO A N     1 
ATOM   3454  C CA    . PRO E 3 156 ? -40.406 23.259  13.255 1.00 67.29  ? 150 PRO A CA    1 
ATOM   3455  C C     . PRO E 3 156 ? -40.277 21.741  13.398 1.00 65.07  ? 150 PRO A C     1 
ATOM   3456  O O     . PRO E 3 156 ? -40.205 21.236  14.516 1.00 63.39  ? 150 PRO A O     1 
ATOM   3457  C CB    . PRO E 3 156 ? -41.821 23.705  13.643 1.00 69.04  ? 150 PRO A CB    1 
ATOM   3458  C CG    . PRO E 3 156 ? -42.523 23.934  12.353 1.00 72.02  ? 150 PRO A CG    1 
ATOM   3459  C CD    . PRO E 3 156 ? -41.481 24.435  11.414 1.00 72.66  ? 150 PRO A CD    1 
ATOM   3460  N N     . ASP E 3 157 ? -40.244 21.025  12.280 1.00 65.47  ? 151 ASP A N     1 
ATOM   3461  C CA    . ASP E 3 157 ? -40.108 19.571  12.307 1.00 63.97  ? 151 ASP A CA    1 
ATOM   3462  C C     . ASP E 3 157 ? -38.763 19.099  11.748 1.00 62.54  ? 151 ASP A C     1 
ATOM   3463  O O     . ASP E 3 157 ? -38.599 17.938  11.375 1.00 62.08  ? 151 ASP A O     1 
ATOM   3464  C CB    . ASP E 3 157 ? -41.276 18.921  11.565 1.00 66.39  ? 151 ASP A CB    1 
ATOM   3465  C CG    . ASP E 3 157 ? -42.605 19.129  12.278 1.00 68.28  ? 151 ASP A CG    1 
ATOM   3466  O OD1   . ASP E 3 157 ? -42.706 18.752  13.468 1.00 67.95  ? 151 ASP A OD1   1 
ATOM   3467  O OD2   . ASP E 3 157 ? -43.543 19.668  11.653 1.00 70.64  ? 151 ASP A OD2   1 
ATOM   3468  N N     . PHE E 3 158 ? -37.798 20.008  11.715 1.00 61.99  ? 152 PHE A N     1 
ATOM   3469  C CA    . PHE E 3 158 ? -36.489 19.711  11.174 1.00 61.32  ? 152 PHE A CA    1 
ATOM   3470  C C     . PHE E 3 158 ? -35.804 18.595  11.950 1.00 58.50  ? 152 PHE A C     1 
ATOM   3471  O O     . PHE E 3 158 ? -35.203 17.703  11.353 1.00 57.91  ? 152 PHE A O     1 
ATOM   3472  C CB    . PHE E 3 158 ? -35.612 20.968  11.145 1.00 62.20  ? 152 PHE A CB    1 
ATOM   3473  C CG    . PHE E 3 158 ? -34.404 20.833  10.278 1.00 62.82  ? 152 PHE A CG    1 
ATOM   3474  C CD1   . PHE E 3 158 ? -34.522 20.374  8.965  1.00 65.10  ? 152 PHE A CD1   1 
ATOM   3475  C CD2   . PHE E 3 158 ? -33.155 21.161  10.764 1.00 61.90  ? 152 PHE A CD2   1 
ATOM   3476  C CE1   . PHE E 3 158 ? -33.406 20.239  8.151  1.00 66.67  ? 152 PHE A CE1   1 
ATOM   3477  C CE2   . PHE E 3 158 ? -32.025 21.036  9.957  1.00 63.71  ? 152 PHE A CE2   1 
ATOM   3478  C CZ    . PHE E 3 158 ? -32.150 20.572  8.647  1.00 65.93  ? 152 PHE A CZ    1 
ATOM   3479  N N     . GLY E 3 159 ? -35.914 18.651  13.278 1.00 56.66  ? 153 GLY A N     1 
ATOM   3480  C CA    . GLY E 3 159 ? -35.344 17.635  14.146 1.00 54.42  ? 153 GLY A CA    1 
ATOM   3481  C C     . GLY E 3 159 ? -35.893 16.258  13.831 1.00 54.49  ? 153 GLY A C     1 
ATOM   3482  O O     . GLY E 3 159 ? -35.136 15.303  13.645 1.00 53.87  ? 153 GLY A O     1 
ATOM   3483  N N     . HIS E 3 160 ? -37.218 16.166  13.754 1.00 55.73  ? 154 HIS A N     1 
ATOM   3484  C CA    . HIS E 3 160 ? -37.916 14.913  13.465 1.00 56.19  ? 154 HIS A CA    1 
ATOM   3485  C C     . HIS E 3 160 ? -37.415 14.376  12.128 1.00 57.00  ? 154 HIS A C     1 
ATOM   3486  O O     . HIS E 3 160 ? -37.108 13.184  11.991 1.00 56.73  ? 154 HIS A O     1 
ATOM   3487  C CB    . HIS E 3 160 ? -39.425 15.187  13.450 1.00 58.46  ? 154 HIS A CB    1 
ATOM   3488  C CG    . HIS E 3 160 ? -40.288 13.971  13.297 1.00 60.46  ? 154 HIS A CG    1 
ATOM   3489  N ND1   . HIS E 3 160 ? -41.546 13.889  13.856 1.00 62.57  ? 154 HIS A ND1   1 
ATOM   3490  C CD2   . HIS E 3 160 ? -40.104 12.813  12.618 1.00 61.67  ? 154 HIS A CD2   1 
ATOM   3491  C CE1   . HIS E 3 160 ? -42.095 12.731  13.537 1.00 63.70  ? 154 HIS A CE1   1 
ATOM   3492  N NE2   . HIS E 3 160 ? -41.236 12.053  12.796 1.00 63.43  ? 154 HIS A NE2   1 
ATOM   3493  N N     . TYR E 3 161 ? -37.296 15.279  11.161 1.00 58.33  ? 155 TYR A N     1 
ATOM   3494  C CA    . TYR E 3 161 ? -36.799 14.960  9.832  1.00 59.82  ? 155 TYR A CA    1 
ATOM   3495  C C     . TYR E 3 161 ? -35.403 14.369  9.903  1.00 58.18  ? 155 TYR A C     1 
ATOM   3496  O O     . TYR E 3 161 ? -35.120 13.379  9.235  1.00 58.88  ? 155 TYR A O     1 
ATOM   3497  C CB    . TYR E 3 161 ? -36.813 16.223  8.969  1.00 62.08  ? 155 TYR A CB    1 
ATOM   3498  C CG    . TYR E 3 161 ? -36.162 16.111  7.607  1.00 64.18  ? 155 TYR A CG    1 
ATOM   3499  C CD1   . TYR E 3 161 ? -36.853 15.567  6.524  1.00 67.18  ? 155 TYR A CD1   1 
ATOM   3500  C CD2   . TYR E 3 161 ? -34.871 16.591  7.390  1.00 63.54  ? 155 TYR A CD2   1 
ATOM   3501  C CE1   . TYR E 3 161 ? -36.269 15.486  5.262  1.00 70.21  ? 155 TYR A CE1   1 
ATOM   3502  C CE2   . TYR E 3 161 ? -34.273 16.512  6.130  1.00 67.21  ? 155 TYR A CE2   1 
ATOM   3503  C CZ    . TYR E 3 161 ? -34.982 15.959  5.070  1.00 70.52  ? 155 TYR A CZ    1 
ATOM   3504  O OH    . TYR E 3 161 ? -34.408 15.874  3.819  1.00 74.07  ? 155 TYR A OH    1 
ATOM   3505  N N     . LEU E 3 162 ? -34.550 14.981  10.725 1.00 56.42  ? 156 LEU A N     1 
ATOM   3506  C CA    . LEU E 3 162 ? -33.162 14.546  10.904 1.00 55.10  ? 156 LEU A CA    1 
ATOM   3507  C C     . LEU E 3 162 ? -33.069 13.132  11.450 1.00 53.47  ? 156 LEU A C     1 
ATOM   3508  O O     . LEU E 3 162 ? -32.322 12.312  10.918 1.00 53.90  ? 156 LEU A O     1 
ATOM   3509  C CB    . LEU E 3 162 ? -32.388 15.495  11.825 1.00 53.58  ? 156 LEU A CB    1 
ATOM   3510  C CG    . LEU E 3 162 ? -32.220 16.951  11.395 1.00 55.18  ? 156 LEU A CG    1 
ATOM   3511  C CD1   . LEU E 3 162 ? -31.409 17.721  12.414 1.00 53.37  ? 156 LEU A CD1   1 
ATOM   3512  C CD2   . LEU E 3 162 ? -31.593 17.046  10.024 1.00 57.33  ? 156 LEU A CD2   1 
ATOM   3513  N N     . VAL E 3 163 ? -33.829 12.839  12.500 1.00 51.99  ? 157 VAL A N     1 
ATOM   3514  C CA    . VAL E 3 163 ? -33.751 11.519  13.105 1.00 50.89  ? 157 VAL A CA    1 
ATOM   3515  C C     . VAL E 3 163 ? -34.354 10.457  12.197 1.00 52.95  ? 157 VAL A C     1 
ATOM   3516  O O     . VAL E 3 163 ? -33.852 9.338   12.141 1.00 52.59  ? 157 VAL A O     1 
ATOM   3517  C CB    . VAL E 3 163 ? -34.327 11.472  14.539 1.00 49.34  ? 157 VAL A CB    1 
ATOM   3518  C CG1   . VAL E 3 163 ? -33.574 12.447  15.424 1.00 48.24  ? 157 VAL A CG1   1 
ATOM   3519  C CG2   . VAL E 3 163 ? -35.801 11.780  14.565 1.00 50.86  ? 157 VAL A CG2   1 
ATOM   3520  N N     . LEU E 3 164 ? -35.404 10.822  11.464 1.00 55.55  ? 158 LEU A N     1 
ATOM   3521  C CA    . LEU E 3 164 ? -36.018 9.912   10.510 1.00 58.36  ? 158 LEU A CA    1 
ATOM   3522  C C     . LEU E 3 164 ? -35.131 9.591   9.313  1.00 60.18  ? 158 LEU A C     1 
ATOM   3523  O O     . LEU E 3 164 ? -34.973 8.419   8.960  1.00 61.25  ? 158 LEU A O     1 
ATOM   3524  C CB    . LEU E 3 164 ? -37.365 10.438  10.037 1.00 61.05  ? 158 LEU A CB    1 
ATOM   3525  C CG    . LEU E 3 164 ? -38.586 9.781   10.675 1.00 62.20  ? 158 LEU A CG    1 
ATOM   3526  C CD1   . LEU E 3 164 ? -39.860 10.360  10.064 1.00 65.09  ? 158 LEU A CD1   1 
ATOM   3527  C CD2   . LEU E 3 164 ? -38.540 8.261   10.505 1.00 63.01  ? 158 LEU A CD2   1 
ATOM   3528  N N     . THR E 3 165 ? -34.560 10.621  8.689  1.00 61.12  ? 159 THR A N     1 
ATOM   3529  C CA    . THR E 3 165 ? -33.602 10.412  7.593  1.00 63.23  ? 159 THR A CA    1 
ATOM   3530  C C     . THR E 3 165 ? -32.433 9.524   8.029  1.00 61.70  ? 159 THR A C     1 
ATOM   3531  O O     . THR E 3 165 ? -32.074 8.581   7.315  1.00 63.61  ? 159 THR A O     1 
ATOM   3532  C CB    . THR E 3 165 ? -33.041 11.734  7.012  1.00 64.45  ? 159 THR A CB    1 
ATOM   3533  O OG1   . THR E 3 165 ? -32.631 12.599  8.079  1.00 61.54  ? 159 THR A OG1   1 
ATOM   3534  C CG2   . THR E 3 165 ? -34.083 12.436  6.152  1.00 67.19  ? 159 THR A CG2   1 
ATOM   3535  N N     . LYS E 3 166 ? -31.864 9.813   9.201  1.00 58.60  ? 160 LYS A N     1 
ATOM   3536  C CA    . LYS E 3 166 ? -30.716 9.069   9.712  1.00 57.36  ? 160 LYS A CA    1 
ATOM   3537  C C     . LYS E 3 166 ? -31.065 7.608   9.948  1.00 57.17  ? 160 LYS A C     1 
ATOM   3538  O O     . LYS E 3 166 ? -30.322 6.715   9.545  1.00 58.00  ? 160 LYS A O     1 
ATOM   3539  C CB    . LYS E 3 166 ? -30.161 9.709   10.997 1.00 54.88  ? 160 LYS A CB    1 
ATOM   3540  C CG    . LYS E 3 166 ? -28.776 9.216   11.435 1.00 53.83  ? 160 LYS A CG    1 
ATOM   3541  C CD    . LYS E 3 166 ? -27.706 9.588   10.420 1.00 57.02  ? 160 LYS A CD    1 
ATOM   3542  C CE    . LYS E 3 166 ? -26.300 9.277   10.926 1.00 57.93  ? 160 LYS A CE    1 
ATOM   3543  N NZ    . LYS E 3 166 ? -25.902 7.853   10.733 1.00 58.67  ? 160 LYS A NZ    1 
ATOM   3544  N N     . ALA E 3 167 ? -32.200 7.369   10.593 1.00 56.71  ? 161 ALA A N     1 
ATOM   3545  C CA    . ALA E 3 167 ? -32.676 6.007   10.822 1.00 57.26  ? 161 ALA A CA    1 
ATOM   3546  C C     . ALA E 3 167 ? -32.876 5.257   9.499  1.00 60.71  ? 161 ALA A C     1 
ATOM   3547  O O     . ALA E 3 167 ? -32.510 4.086   9.384  1.00 61.38  ? 161 ALA A O     1 
ATOM   3548  C CB    . ALA E 3 167 ? -33.953 6.027   11.638 1.00 56.62  ? 161 ALA A CB    1 
ATOM   3549  N N     . LEU E 3 168 ? -33.451 5.945   8.511  1.00 63.44  ? 162 LEU A N     1 
ATOM   3550  C CA    . LEU E 3 168 ? -33.646 5.404   7.166  1.00 67.57  ? 162 LEU A CA    1 
ATOM   3551  C C     . LEU E 3 168 ? -32.339 5.052   6.462  1.00 69.01  ? 162 LEU A C     1 
ATOM   3552  O O     . LEU E 3 168 ? -32.176 3.933   5.972  1.00 70.78  ? 162 LEU A O     1 
ATOM   3553  C CB    . LEU E 3 168 ? -34.440 6.383   6.306  1.00 70.06  ? 162 LEU A CB    1 
ATOM   3554  C CG    . LEU E 3 168 ? -35.921 6.077   6.097  1.00 72.59  ? 162 LEU A CG    1 
ATOM   3555  C CD1   . LEU E 3 168 ? -36.595 7.267   5.461  1.00 74.39  ? 162 LEU A CD1   1 
ATOM   3556  C CD2   . LEU E 3 168 ? -36.111 4.835   5.236  1.00 75.96  ? 162 LEU A CD2   1 
ATOM   3557  N N     . GLU E 3 169 ? -31.419 6.016   6.403  1.00 68.70  ? 163 GLU A N     1 
ATOM   3558  C CA    . GLU E 3 169 ? -30.077 5.784   5.856  1.00 70.36  ? 163 GLU A CA    1 
ATOM   3559  C C     . GLU E 3 169 ? -29.417 4.589   6.537  1.00 68.77  ? 163 GLU A C     1 
ATOM   3560  O O     . GLU E 3 169 ? -28.724 3.802   5.890  1.00 70.89  ? 163 GLU A O     1 
ATOM   3561  C CB    . GLU E 3 169 ? -29.179 7.012   6.044  1.00 69.38  ? 163 GLU A CB    1 
ATOM   3562  C CG    . GLU E 3 169 ? -29.710 8.314   5.485  1.00 71.92  ? 163 GLU A CG    1 
ATOM   3563  C CD    . GLU E 3 169 ? -29.538 8.430   3.987  1.00 78.53  ? 163 GLU A CD    1 
ATOM   3564  O OE1   . GLU E 3 169 ? -28.548 9.062   3.558  1.00 80.75  ? 163 GLU A OE1   1 
ATOM   3565  O OE2   . GLU E 3 169 ? -30.389 7.895   3.239  1.00 82.46  ? 163 GLU A OE2   1 
ATOM   3566  N N     . ARG E 3 170 ? -29.644 4.465   7.845  1.00 65.57  ? 164 ARG A N     1 
ATOM   3567  C CA    . ARG E 3 170 ? -29.042 3.404   8.650  1.00 64.19  ? 164 ARG A CA    1 
ATOM   3568  C C     . ARG E 3 170 ? -29.523 2.011   8.237  1.00 66.22  ? 164 ARG A C     1 
ATOM   3569  O O     . ARG E 3 170 ? -28.707 1.095   8.097  1.00 66.91  ? 164 ARG A O     1 
ATOM   3570  C CB    . ARG E 3 170 ? -29.280 3.651   10.143 1.00 60.71  ? 164 ARG A CB    1 
ATOM   3571  C CG    . ARG E 3 170 ? -28.626 2.637   11.065 1.00 59.87  ? 164 ARG A CG    1 
ATOM   3572  C CD    . ARG E 3 170 ? -28.649 3.099   12.518 1.00 59.06  ? 164 ARG A CD    1 
ATOM   3573  N NE    . ARG E 3 170 ? -29.994 3.082   13.091 1.00 60.17  ? 164 ARG A NE    1 
ATOM   3574  C CZ    . ARG E 3 170 ? -30.289 3.473   14.325 1.00 58.63  ? 164 ARG A CZ    1 
ATOM   3575  N NH1   . ARG E 3 170 ? -29.330 3.917   15.130 1.00 58.01  ? 164 ARG A NH1   1 
ATOM   3576  N NH2   . ARG E 3 170 ? -31.543 3.421   14.754 1.00 58.22  ? 164 ARG A NH2   1 
ATOM   3577  N N     . GLU E 3 171 ? -30.833 1.856   8.043  1.00 67.54  ? 165 GLU A N     1 
ATOM   3578  C CA    . GLU E 3 171 ? -31.386 0.565   7.606  1.00 70.64  ? 165 GLU A CA    1 
ATOM   3579  C C     . GLU E 3 171 ? -31.088 0.247   6.141  1.00 74.30  ? 165 GLU A C     1 
ATOM   3580  O O     . GLU E 3 171 ? -30.722 -0.878  5.829  1.00 76.26  ? 165 GLU A O     1 
ATOM   3581  C CB    . GLU E 3 171 ? -32.887 0.432   7.897  1.00 71.34  ? 165 GLU A CB    1 
ATOM   3582  C CG    . GLU E 3 171 ? -33.279 0.552   9.380  1.00 70.46  ? 165 GLU A CG    1 
ATOM   3583  C CD    . GLU E 3 171 ? -32.576 -0.442  10.312 1.00 71.58  ? 165 GLU A CD    1 
ATOM   3584  O OE1   . GLU E 3 171 ? -32.481 -1.649  9.964  1.00 74.35  ? 165 GLU A OE1   1 
ATOM   3585  O OE2   . GLU E 3 171 ? -32.142 -0.004  11.407 1.00 69.15  ? 165 GLU A OE2   1 
ATOM   3586  N N     . LYS E 3 172 ? -31.239 1.232   5.255  1.00 75.85  ? 166 LYS A N     1 
ATOM   3587  C CA    . LYS E 3 172 ? -30.874 1.075   3.838  1.00 80.24  ? 166 LYS A CA    1 
ATOM   3588  C C     . LYS E 3 172 ? -29.451 0.542   3.695  1.00 80.26  ? 166 LYS A C     1 
ATOM   3589  O O     . LYS E 3 172 ? -29.207 -0.421  2.960  1.00 83.55  ? 166 LYS A O     1 
ATOM   3590  C CB    . LYS E 3 172 ? -30.971 2.407   3.089  1.00 81.69  ? 166 LYS A CB    1 
ATOM   3591  C CG    . LYS E 3 172 ? -32.357 2.818   2.676  1.00 83.93  ? 166 LYS A CG    1 
ATOM   3592  C CD    . LYS E 3 172 ? -32.323 4.224   2.109  1.00 85.84  ? 166 LYS A CD    1 
ATOM   3593  C CE    . LYS E 3 172 ? -33.704 4.681   1.697  1.00 88.86  ? 166 LYS A CE    1 
ATOM   3594  N NZ    . LYS E 3 172 ? -33.711 6.129   1.372  1.00 90.16  ? 166 LYS A NZ    1 
ATOM   3595  N N     . ASN E 3 173 ? -28.523 1.181   4.404  1.00 76.74  ? 167 ASN A N     1 
ATOM   3596  C CA    . ASN E 3 173 ? -27.133 0.757   4.415  1.00 76.64  ? 167 ASN A CA    1 
ATOM   3597  C C     . ASN E 3 173 ? -26.914 -0.601  5.091  1.00 75.38  ? 167 ASN A C     1 
ATOM   3598  O O     . ASN E 3 173 ? -26.014 -1.332  4.695  1.00 77.63  ? 167 ASN A O     1 
ATOM   3599  C CB    . ASN E 3 173 ? -26.245 1.828   5.047  1.00 74.09  ? 167 ASN A CB    1 
ATOM   3600  N N     . TYR E 3 174 ? -27.732 -0.944  6.088  1.00 72.28  ? 168 TYR A N     1 
ATOM   3601  C CA    . TYR E 3 174 ? -27.634 -2.262  6.730  1.00 71.57  ? 168 TYR A CA    1 
ATOM   3602  C C     . TYR E 3 174 ? -28.135 -3.356  5.796  1.00 75.59  ? 168 TYR A C     1 
ATOM   3603  O O     . TYR E 3 174 ? -27.521 -4.414  5.682  1.00 77.17  ? 168 TYR A O     1 
ATOM   3604  C CB    . TYR E 3 174 ? -28.405 -2.313  8.060  1.00 68.37  ? 168 TYR A CB    1 
ATOM   3605  C CG    . TYR E 3 174 ? -27.710 -3.109  9.175  1.00 66.81  ? 168 TYR A CG    1 
ATOM   3606  C CD1   . TYR E 3 174 ? -27.334 -4.449  8.987  1.00 68.93  ? 168 TYR A CD1   1 
ATOM   3607  C CD2   . TYR E 3 174 ? -27.446 -2.523  10.423 1.00 63.11  ? 168 TYR A CD2   1 
ATOM   3608  C CE1   . TYR E 3 174 ? -26.707 -5.183  10.003 1.00 67.33  ? 168 TYR A CE1   1 
ATOM   3609  C CE2   . TYR E 3 174 ? -26.822 -3.250  11.454 1.00 61.78  ? 168 TYR A CE2   1 
ATOM   3610  C CZ    . TYR E 3 174 ? -26.449 -4.579  11.231 1.00 64.60  ? 168 TYR A CZ    1 
ATOM   3611  O OH    . TYR E 3 174 ? -25.826 -5.310  12.226 1.00 63.20  ? 168 TYR A OH    1 
ATOM   3612  N N     . VAL E 3 175 ? -29.251 -3.079  5.128  1.00 77.61  ? 169 VAL A N     1 
ATOM   3613  C CA    . VAL E 3 175 ? -29.887 -4.013  4.213  1.00 81.80  ? 169 VAL A CA    1 
ATOM   3614  C C     . VAL E 3 175 ? -28.973 -4.264  3.013  1.00 85.85  ? 169 VAL A C     1 
ATOM   3615  O O     . VAL E 3 175 ? -28.745 -5.415  2.621  1.00 88.84  ? 169 VAL A O     1 
ATOM   3616  C CB    . VAL E 3 175 ? -31.259 -3.467  3.765  1.00 83.56  ? 169 VAL A CB    1 
ATOM   3617  C CG1   . VAL E 3 175 ? -31.831 -4.259  2.573  1.00 88.69  ? 169 VAL A CG1   1 
ATOM   3618  C CG2   . VAL E 3 175 ? -32.226 -3.460  4.940  1.00 80.19  ? 169 VAL A CG2   1 
ATOM   3619  N N     . SER E 3 176 ? -28.438 -3.177  2.460  1.00 85.86  ? 170 SER A N     1 
ATOM   3620  C CA    . SER E 3 176 ? -27.521 -3.230  1.325  1.00 89.71  ? 170 SER A CA    1 
ATOM   3621  C C     . SER E 3 176 ? -26.234 -3.984  1.668  1.00 88.97  ? 170 SER A C     1 
ATOM   3622  O O     . SER E 3 176 ? -25.683 -4.693  0.831  1.00 92.95  ? 170 SER A O     1 
ATOM   3623  C CB    . SER E 3 176 ? -27.203 -1.812  0.848  1.00 89.78  ? 170 SER A CB    1 
ATOM   3624  O OG    . SER E 3 176 ? -26.177 -1.812  -0.121 1.00 93.80  ? 170 SER A OG    1 
ATOM   3625  N N     . TRP E 3 177 ? -25.762 -3.825  2.902  1.00 84.02  ? 171 TRP A N     1 
ATOM   3626  C CA    . TRP E 3 177 ? -24.563 -4.526  3.349  1.00 83.13  ? 171 TRP A CA    1 
ATOM   3627  C C     . TRP E 3 177 ? -24.820 -6.030  3.437  1.00 85.02  ? 171 TRP A C     1 
ATOM   3628  O O     . TRP E 3 177 ? -24.088 -6.827  2.842  1.00 88.20  ? 171 TRP A O     1 
ATOM   3629  C CB    . TRP E 3 177 ? -24.067 -3.978  4.690  1.00 77.51  ? 171 TRP A CB    1 
ATOM   3630  C CG    . TRP E 3 177 ? -22.845 -4.679  5.191  1.00 76.18  ? 171 TRP A CG    1 
ATOM   3631  C CD1   . TRP E 3 177 ? -21.558 -4.468  4.791  1.00 77.19  ? 171 TRP A CD1   1 
ATOM   3632  C CD2   . TRP E 3 177 ? -22.795 -5.717  6.175  1.00 73.32  ? 171 TRP A CD2   1 
ATOM   3633  N NE1   . TRP E 3 177 ? -20.708 -5.306  5.468  1.00 76.09  ? 171 TRP A NE1   1 
ATOM   3634  C CE2   . TRP E 3 177 ? -21.440 -6.083  6.325  1.00 73.72  ? 171 TRP A CE2   1 
ATOM   3635  C CE3   . TRP E 3 177 ? -23.760 -6.369  6.948  1.00 70.98  ? 171 TRP A CE3   1 
ATOM   3636  C CZ2   . TRP E 3 177 ? -21.026 -7.073  7.219  1.00 72.20  ? 171 TRP A CZ2   1 
ATOM   3637  C CZ3   . TRP E 3 177 ? -23.349 -7.353  7.834  1.00 70.03  ? 171 TRP A CZ3   1 
ATOM   3638  C CH2   . TRP E 3 177 ? -21.991 -7.697  7.961  1.00 70.48  ? 171 TRP A CH2   1 
ATOM   3639  N N     . LEU E 3 178 ? -25.873 -6.399  4.166  1.00 83.27  ? 172 LEU A N     1 
ATOM   3640  C CA    . LEU E 3 178 ? -26.265 -7.797  4.334  1.00 85.25  ? 172 LEU A CA    1 
ATOM   3641  C C     . LEU E 3 178 ? -26.482 -8.519  2.999  1.00 91.46  ? 172 LEU A C     1 
ATOM   3642  O O     . LEU E 3 178 ? -26.189 -9.708  2.883  1.00 94.13  ? 172 LEU A O     1 
ATOM   3643  C CB    . LEU E 3 178 ? -27.525 -7.902  5.198  1.00 82.93  ? 172 LEU A CB    1 
ATOM   3644  C CG    . LEU E 3 178 ? -27.469 -7.503  6.673  1.00 77.26  ? 172 LEU A CG    1 
ATOM   3645  C CD1   . LEU E 3 178 ? -28.867 -7.153  7.159  1.00 75.46  ? 172 LEU A CD1   1 
ATOM   3646  C CD2   . LEU E 3 178 ? -26.861 -8.607  7.526  1.00 76.23  ? 172 LEU A CD2   1 
ATOM   3647  N N     . GLU E 3 179 ? -26.997 -7.805  1.999  1.00 94.35  ? 173 GLU A N     1 
ATOM   3648  C CA    . GLU E 3 179 ? -27.153 -8.380  0.659  1.00 101.11 ? 173 GLU A CA    1 
ATOM   3649  C C     . GLU E 3 179 ? -25.780 -8.688  0.055  1.00 103.91 ? 173 GLU A C     1 
ATOM   3650  O O     . GLU E 3 179 ? -25.539 -9.803  -0.411 1.00 108.01 ? 173 GLU A O     1 
ATOM   3651  C CB    . GLU E 3 179 ? -27.990 -7.471  -0.259 1.00 103.57 ? 173 GLU A CB    1 
ATOM   3652  C CG    . GLU E 3 179 ? -29.503 -7.507  0.034  1.00 103.45 ? 173 GLU A CG    1 
ATOM   3653  C CD    . GLU E 3 179 ? -30.292 -6.335  -0.573 1.00 104.62 ? 173 GLU A CD    1 
ATOM   3654  O OE1   . GLU E 3 179 ? -29.690 -5.289  -0.896 1.00 104.23 ? 173 GLU A OE1   1 
ATOM   3655  O OE2   . GLU E 3 179 ? -31.529 -6.457  -0.714 1.00 105.98 ? 173 GLU A OE2   1 
ATOM   3656  N N     . SER E 3 180 ? -24.876 -7.710  0.101  1.00 102.08 ? 174 SER A N     1 
ATOM   3657  C CA    . SER E 3 180 ? -23.512 -7.884  -0.405 1.00 104.84 ? 174 SER A CA    1 
ATOM   3658  C C     . SER E 3 180 ? -22.809 -9.086  0.216  1.00 104.49 ? 174 SER A C     1 
ATOM   3659  O O     . SER E 3 180 ? -22.141 -9.846  -0.487 1.00 109.22 ? 174 SER A O     1 
ATOM   3660  C CB    . SER E 3 180 ? -22.676 -6.620  -0.188 1.00 102.12 ? 174 SER A CB    1 
ATOM   3661  O OG    . SER E 3 180 ? -23.012 -5.617  -1.130 1.00 104.75 ? 174 SER A OG    1 
ATOM   3662  N N     . ILE E 3 181 ? -22.980 -9.263  1.523  1.00 99.49  ? 175 ILE A N     1 
ATOM   3663  C CA    . ILE E 3 181 ? -22.315 -10.344 2.243  1.00 98.98  ? 175 ILE A CA    1 
ATOM   3664  C C     . ILE E 3 181 ? -22.978 -11.693 1.960  1.00 102.97 ? 175 ILE A C     1 
ATOM   3665  O O     . ILE E 3 181 ? -22.287 -12.707 1.807  1.00 105.85 ? 175 ILE A O     1 
ATOM   3666  C CB    . ILE E 3 181 ? -22.196 -10.046 3.766  1.00 92.78  ? 175 ILE A CB    1 
ATOM   3667  C CG1   . ILE E 3 181 ? -20.975 -9.159  4.070  1.00 90.24  ? 175 ILE A CG1   1 
ATOM   3668  C CG2   . ILE E 3 181 ? -22.037 -11.335 4.561  1.00 92.20  ? 175 ILE A CG2   1 
ATOM   3669  C CD1   . ILE E 3 181 ? -20.842 -7.862  3.264  1.00 90.70  ? 175 ILE A CD1   1 
ATOM   3670  N N     . LEU E 3 182 ? -24.305 -11.697 1.862  1.00 103.79 ? 176 LEU A N     1 
ATOM   3671  C CA    . LEU E 3 182 ? -25.043 -12.910 1.479  1.00 108.58 ? 176 LEU A CA    1 
ATOM   3672  C C     . LEU E 3 182 ? -24.662 -13.475 0.104  1.00 115.64 ? 176 LEU A C     1 
ATOM   3673  O O     . LEU E 3 182 ? -24.605 -14.695 -0.076 1.00 119.40 ? 176 LEU A O     1 
ATOM   3674  C CB    . LEU E 3 182 ? -26.555 -12.684 1.556  1.00 108.30 ? 176 LEU A CB    1 
ATOM   3675  C CG    . LEU E 3 182 ? -27.239 -13.176 2.832  1.00 105.22 ? 176 LEU A CG    1 
ATOM   3676  C CD1   . LEU E 3 182 ? -28.544 -12.430 3.051  1.00 103.71 ? 176 LEU A CD1   1 
ATOM   3677  C CD2   . LEU E 3 182 ? -27.473 -14.687 2.785  1.00 109.04 ? 176 LEU A CD2   1 
ATOM   3678  N N     . ALA E 3 183 ? -24.401 -12.588 -0.855 1.00 118.15 ? 177 ALA A N     1 
ATOM   3679  C CA    . ALA E 3 183 ? -23.994 -12.993 -2.204 1.00 125.48 ? 177 ALA A CA    1 
ATOM   3680  C C     . ALA E 3 183 ? -22.578 -13.574 -2.230 1.00 127.22 ? 177 ALA A C     1 
ATOM   3681  O O     . ALA E 3 183 ? -22.213 -14.286 -3.166 1.00 133.70 ? 177 ALA A O     1 
ATOM   3682  C CB    . ALA E 3 183 ? -24.119 -11.826 -3.178 1.00 127.47 ? 177 ALA A CB    1 
ATOM   3683  N N     . MET E 3 184 ? -21.785 -13.267 -1.203 1.00 122.28 ? 178 MET A N     1 
ATOM   3684  C CA    . MET E 3 184 ? -20.452 -13.860 -1.037 1.00 123.54 ? 178 MET A CA    1 
ATOM   3685  C C     . MET E 3 184 ? -20.543 -15.275 -0.456 1.00 124.38 ? 178 MET A C     1 
ATOM   3686  O O     . MET E 3 184 ? -19.583 -16.057 -0.529 1.00 126.78 ? 178 MET A O     1 
ATOM   3687  C CB    . MET E 3 184 ? -19.571 -12.982 -0.139 1.00 118.01 ? 178 MET A CB    1 
ATOM   3688  C CG    . MET E 3 184 ? -19.302 -11.587 -0.695 1.00 117.90 ? 178 MET A CG    1 
ATOM   3689  S SD    . MET E 3 184 ? -18.088 -10.647 0.254  1.00 112.34 ? 178 MET A SD    1 
ATOM   3690  C CE    . MET E 3 184 ? -16.565 -11.341 -0.400 1.00 117.27 ? 178 MET A CE    1 
ATOM   3691  N N     . ILE E 3 185 ? -21.707 -15.592 0.114  1.00 122.88 ? 179 ILE A N     1 
ATOM   3692  C CA    . ILE E 3 185 ? -21.929 -16.842 0.843  1.00 123.02 ? 179 ILE A CA    1 
ATOM   3693  C C     . ILE E 3 185 ? -23.022 -17.714 0.202  1.00 127.96 ? 179 ILE A C     1 
ATOM   3694  O O     . ILE E 3 185 ? -23.259 -17.649 -1.004 1.00 133.08 ? 179 ILE A O     1 
ATOM   3695  C CB    . ILE E 3 185 ? -22.297 -16.543 2.328  1.00 116.08 ? 179 ILE A CB    1 
ATOM   3696  N N     . ASP F 3 5   ? -34.465 -13.216 31.844 1.00 84.11  ? -1  ASP B N     1 
ATOM   3697  C CA    . ASP F 3 5   ? -33.175 -13.852 31.433 1.00 81.41  ? -1  ASP B CA    1 
ATOM   3698  C C     . ASP F 3 5   ? -32.122 -12.814 31.010 1.00 76.54  ? -1  ASP B C     1 
ATOM   3699  O O     . ASP F 3 5   ? -32.222 -12.230 29.923 1.00 75.19  ? -1  ASP B O     1 
ATOM   3700  C CB    . ASP F 3 5   ? -33.410 -14.883 30.318 1.00 83.34  ? -1  ASP B CB    1 
ATOM   3701  N N     . PRO F 3 6   ? -31.110 -12.576 31.875 1.00 74.28  ? 0   PRO B N     1 
ATOM   3702  C CA    . PRO F 3 6   ? -30.018 -11.635 31.602 1.00 70.13  ? 0   PRO B CA    1 
ATOM   3703  C C     . PRO F 3 6   ? -29.221 -12.022 30.365 1.00 68.57  ? 0   PRO B C     1 
ATOM   3704  O O     . PRO F 3 6   ? -28.888 -13.198 30.180 1.00 69.63  ? 0   PRO B O     1 
ATOM   3705  C CB    . PRO F 3 6   ? -29.134 -11.739 32.851 1.00 69.09  ? 0   PRO B CB    1 
ATOM   3706  C CG    . PRO F 3 6   ? -29.509 -13.041 33.488 1.00 72.74  ? 0   PRO B CG    1 
ATOM   3707  C CD    . PRO F 3 6   ? -30.966 -13.201 33.202 1.00 76.13  ? 0   PRO B CD    1 
ATOM   3708  N N     . MET F 3 7   ? -28.915 -11.027 29.538 1.00 66.66  ? 1   MET B N     1 
ATOM   3709  C CA    . MET F 3 7   ? -28.307 -11.243 28.227 1.00 66.01  ? 1   MET B CA    1 
ATOM   3710  C C     . MET F 3 7   ? -26.868 -11.709 28.276 1.00 63.27  ? 1   MET B C     1 
ATOM   3711  O O     . MET F 3 7   ? -26.482 -12.593 27.515 1.00 64.47  ? 1   MET B O     1 
ATOM   3712  C CB    . MET F 3 7   ? -28.359 -9.969  27.403 1.00 65.09  ? 1   MET B CB    1 
ATOM   3713  C CG    . MET F 3 7   ? -29.729 -9.594  26.912 1.00 70.95  ? 1   MET B CG    1 
ATOM   3714  S SD    . MET F 3 7   ? -29.525 -8.454  25.535 1.00 77.43  ? 1   MET B SD    1 
ATOM   3715  C CE    . MET F 3 7   ? -28.412 -7.206  26.209 1.00 72.50  ? 1   MET B CE    1 
ATOM   3716  N N     . ARG F 3 8   ? -26.081 -11.083 29.151 1.00 60.29  ? 2   ARG B N     1 
ATOM   3717  C CA    . ARG F 3 8   ? -24.665 -11.387 29.345 1.00 57.19  ? 2   ARG B CA    1 
ATOM   3718  C C     . ARG F 3 8   ? -23.889 -11.414 28.041 1.00 55.20  ? 2   ARG B C     1 
ATOM   3719  O O     . ARG F 3 8   ? -23.175 -12.360 27.783 1.00 55.84  ? 2   ARG B O     1 
ATOM   3720  C CB    . ARG F 3 8   ? -24.477 -12.723 30.070 1.00 58.98  ? 2   ARG B CB    1 
ATOM   3721  C CG    . ARG F 3 8   ? -25.523 -13.065 31.116 1.00 61.63  ? 2   ARG B CG    1 
ATOM   3722  C CD    . ARG F 3 8   ? -24.891 -13.280 32.477 1.00 62.03  ? 2   ARG B CD    1 
ATOM   3723  N NE    . ARG F 3 8   ? -23.485 -13.680 32.388 1.00 60.63  ? 2   ARG B NE    1 
ATOM   3724  C CZ    . ARG F 3 8   ? -23.008 -14.869 32.752 1.00 61.03  ? 2   ARG B CZ    1 
ATOM   3725  N NH1   . ARG F 3 8   ? -21.710 -15.124 32.634 1.00 58.48  ? 2   ARG B NH1   1 
ATOM   3726  N NH2   . ARG F 3 8   ? -23.817 -15.796 33.247 1.00 63.61  ? 2   ARG B NH2   1 
ATOM   3727  N N     . VAL F 3 9   ? -24.022 -10.385 27.218 1.00 53.36  ? 3   VAL B N     1 
ATOM   3728  C CA    . VAL F 3 9   ? -23.300 -10.356 25.943 1.00 51.93  ? 3   VAL B CA    1 
ATOM   3729  C C     . VAL F 3 9   ? -21.796 -10.604 26.100 1.00 50.03  ? 3   VAL B C     1 
ATOM   3730  O O     . VAL F 3 9   ? -21.218 -11.403 25.351 1.00 51.07  ? 3   VAL B O     1 
ATOM   3731  C CB    . VAL F 3 9   ? -23.549 -9.064  25.148 1.00 51.04  ? 3   VAL B CB    1 
ATOM   3732  C CG1   . VAL F 3 9   ? -22.755 -9.076  23.854 1.00 50.53  ? 3   VAL B CG1   1 
ATOM   3733  C CG2   . VAL F 3 9   ? -25.026 -8.907  24.849 1.00 52.65  ? 3   VAL B CG2   1 
ATOM   3734  N N     . LEU F 3 10  ? -21.178 -9.934  27.074 1.00 47.54  ? 4   LEU B N     1 
ATOM   3735  C CA    . LEU F 3 10  ? -19.740 -10.053 27.338 1.00 45.50  ? 4   LEU B CA    1 
ATOM   3736  C C     . LEU F 3 10  ? -19.256 -11.492 27.502 1.00 46.65  ? 4   LEU B C     1 
ATOM   3737  O O     . LEU F 3 10  ? -18.150 -11.825 27.071 1.00 46.23  ? 4   LEU B O     1 
ATOM   3738  C CB    . LEU F 3 10  ? -19.344 -9.244  28.572 1.00 43.72  ? 4   LEU B CB    1 
ATOM   3739  C CG    . LEU F 3 10  ? -17.865 -9.245  28.964 1.00 41.56  ? 4   LEU B CG    1 
ATOM   3740  C CD1   . LEU F 3 10  ? -16.970 -8.669  27.877 1.00 38.62  ? 4   LEU B CD1   1 
ATOM   3741  C CD2   . LEU F 3 10  ? -17.674 -8.510  30.278 1.00 41.74  ? 4   LEU B CD2   1 
ATOM   3742  N N     . LYS F 3 11  ? -20.073 -12.330 28.138 1.00 48.19  ? 5   LYS B N     1 
ATOM   3743  C CA    . LYS F 3 11  ? -19.761 -13.749 28.280 1.00 49.63  ? 5   LYS B CA    1 
ATOM   3744  C C     . LYS F 3 11  ? -19.557 -14.357 26.906 1.00 51.03  ? 5   LYS B C     1 
ATOM   3745  O O     . LYS F 3 11  ? -18.599 -15.107 26.685 1.00 51.81  ? 5   LYS B O     1 
ATOM   3746  C CB    . LYS F 3 11  ? -20.852 -14.478 29.076 1.00 51.86  ? 5   LYS B CB    1 
ATOM   3747  C CG    . LYS F 3 11  ? -21.201 -15.897 28.617 1.00 55.29  ? 5   LYS B CG    1 
ATOM   3748  C CD    . LYS F 3 11  ? -22.131 -16.580 29.600 1.00 57.24  ? 5   LYS B CD    1 
ATOM   3749  C CE    . LYS F 3 11  ? -22.967 -17.645 28.914 1.00 62.90  ? 5   LYS B CE    1 
ATOM   3750  N NZ    . LYS F 3 11  ? -23.644 -18.601 29.864 1.00 66.62  ? 5   LYS B NZ    1 
ATOM   3751  N N     . TYR F 3 12  ? -20.433 -14.007 25.972 1.00 51.57  ? 6   TYR B N     1 
ATOM   3752  C CA    . TYR F 3 12  ? -20.342 -14.569 24.634 1.00 53.27  ? 6   TYR B CA    1 
ATOM   3753  C C     . TYR F 3 12  ? -19.209 -13.935 23.829 1.00 51.76  ? 6   TYR B C     1 
ATOM   3754  O O     . TYR F 3 12  ? -18.580 -14.608 23.001 1.00 53.04  ? 6   TYR B O     1 
ATOM   3755  C CB    . TYR F 3 12  ? -21.696 -14.534 23.915 1.00 55.14  ? 6   TYR B CB    1 
ATOM   3756  C CG    . TYR F 3 12  ? -22.751 -15.340 24.653 1.00 57.71  ? 6   TYR B CG    1 
ATOM   3757  C CD1   . TYR F 3 12  ? -22.776 -16.744 24.586 1.00 61.42  ? 6   TYR B CD1   1 
ATOM   3758  C CD2   . TYR F 3 12  ? -23.705 -14.705 25.436 1.00 57.54  ? 6   TYR B CD2   1 
ATOM   3759  C CE1   . TYR F 3 12  ? -23.732 -17.480 25.281 1.00 63.46  ? 6   TYR B CE1   1 
ATOM   3760  C CE2   . TYR F 3 12  ? -24.661 -15.424 26.123 1.00 60.03  ? 6   TYR B CE2   1 
ATOM   3761  C CZ    . TYR F 3 12  ? -24.669 -16.800 26.047 1.00 63.58  ? 6   TYR B CZ    1 
ATOM   3762  O OH    . TYR F 3 12  ? -25.627 -17.478 26.747 1.00 67.57  ? 6   TYR B OH    1 
ATOM   3763  N N     . ALA F 3 13  ? -18.934 -12.658 24.099 1.00 48.77  ? 7   ALA B N     1 
ATOM   3764  C CA    . ALA F 3 13  ? -17.810 -11.973 23.466 1.00 47.56  ? 7   ALA B CA    1 
ATOM   3765  C C     . ALA F 3 13  ? -16.484 -12.651 23.827 1.00 47.24  ? 7   ALA B C     1 
ATOM   3766  O O     . ALA F 3 13  ? -15.649 -12.885 22.965 1.00 48.44  ? 7   ALA B O     1 
ATOM   3767  C CB    . ALA F 3 13  ? -17.786 -10.488 23.850 1.00 45.32  ? 7   ALA B CB    1 
ATOM   3768  N N     . ILE F 3 14  ? -16.305 -12.961 25.107 1.00 46.31  ? 8   ILE B N     1 
ATOM   3769  C CA    . ILE F 3 14  ? -15.119 -13.659 25.582 1.00 46.47  ? 8   ILE B CA    1 
ATOM   3770  C C     . ILE F 3 14  ? -15.037 -15.061 24.957 1.00 49.40  ? 8   ILE B C     1 
ATOM   3771  O O     . ILE F 3 14  ? -14.006 -15.425 24.385 1.00 50.00  ? 8   ILE B O     1 
ATOM   3772  C CB    . ILE F 3 14  ? -15.077 -13.738 27.132 1.00 45.20  ? 8   ILE B CB    1 
ATOM   3773  C CG1   . ILE F 3 14  ? -14.695 -12.370 27.705 1.00 43.16  ? 8   ILE B CG1   1 
ATOM   3774  C CG2   . ILE F 3 14  ? -14.086 -14.794 27.595 1.00 45.84  ? 8   ILE B CG2   1 
ATOM   3775  C CD1   . ILE F 3 14  ? -14.821 -12.237 29.229 1.00 41.05  ? 8   ILE B CD1   1 
ATOM   3776  N N     . LEU F 3 15  ? -16.128 -15.823 25.059 1.00 51.09  ? 9   LEU B N     1 
ATOM   3777  C CA    . LEU F 3 15  ? -16.173 -17.187 24.533 1.00 54.51  ? 9   LEU B CA    1 
ATOM   3778  C C     . LEU F 3 15  ? -15.854 -17.196 23.043 1.00 56.13  ? 9   LEU B C     1 
ATOM   3779  O O     . LEU F 3 15  ? -15.083 -18.031 22.577 1.00 57.98  ? 9   LEU B O     1 
ATOM   3780  C CB    . LEU F 3 15  ? -17.539 -17.836 24.785 1.00 56.51  ? 9   LEU B CB    1 
ATOM   3781  C CG    . LEU F 3 15  ? -18.005 -18.114 26.217 1.00 56.19  ? 9   LEU B CG    1 
ATOM   3782  C CD1   . LEU F 3 15  ? -19.360 -18.829 26.203 1.00 58.21  ? 9   LEU B CD1   1 
ATOM   3783  C CD2   . LEU F 3 15  ? -16.974 -18.905 27.012 1.00 55.79  ? 9   LEU B CD2   1 
ATOM   3784  N N     . GLY F 3 16  ? -16.435 -16.236 22.320 1.00 55.60  ? 10  GLY B N     1 
ATOM   3785  C CA    . GLY F 3 16  ? -16.202 -16.061 20.886 1.00 57.25  ? 10  GLY B CA    1 
ATOM   3786  C C     . GLY F 3 16  ? -14.753 -15.735 20.595 1.00 57.04  ? 10  GLY B C     1 
ATOM   3787  O O     . GLY F 3 16  ? -14.137 -16.350 19.711 1.00 59.80  ? 10  GLY B O     1 
ATOM   3788  N N     . LEU F 3 17  ? -14.196 -14.784 21.348 1.00 53.67  ? 11  LEU B N     1 
ATOM   3789  C CA    . LEU F 3 17  ? -12.798 -14.414 21.167 1.00 53.40  ? 11  LEU B CA    1 
ATOM   3790  C C     . LEU F 3 17  ? -11.825 -15.592 21.341 1.00 55.73  ? 11  LEU B C     1 
ATOM   3791  O O     . LEU F 3 17  ? -10.802 -15.638 20.661 1.00 57.51  ? 11  LEU B O     1 
ATOM   3792  C CB    . LEU F 3 17  ? -12.410 -13.219 22.049 1.00 49.85  ? 11  LEU B CB    1 
ATOM   3793  C CG    . LEU F 3 17  ? -12.785 -11.858 21.445 1.00 48.33  ? 11  LEU B CG    1 
ATOM   3794  C CD1   . LEU F 3 17  ? -12.615 -10.741 22.455 1.00 44.47  ? 11  LEU B CD1   1 
ATOM   3795  C CD2   . LEU F 3 17  ? -11.998 -11.552 20.169 1.00 48.34  ? 11  LEU B CD2   1 
ATOM   3796  N N     . LEU F 3 18  ? -12.173 -16.544 22.213 1.00 56.44  ? 12  LEU B N     1 
ATOM   3797  C CA    . LEU F 3 18  ? -11.326 -17.703 22.535 1.00 58.98  ? 12  LEU B CA    1 
ATOM   3798  C C     . LEU F 3 18  ? -11.507 -18.905 21.592 1.00 63.48  ? 12  LEU B C     1 
ATOM   3799  O O     . LEU F 3 18  ? -10.892 -19.958 21.793 1.00 65.91  ? 12  LEU B O     1 
ATOM   3800  C CB    . LEU F 3 18  ? -11.583 -18.160 23.977 1.00 57.85  ? 12  LEU B CB    1 
ATOM   3801  C CG    . LEU F 3 18  ? -11.181 -17.252 25.140 1.00 54.89  ? 12  LEU B CG    1 
ATOM   3802  C CD1   . LEU F 3 18  ? -11.893 -17.682 26.413 1.00 54.64  ? 12  LEU B CD1   1 
ATOM   3803  C CD2   . LEU F 3 18  ? -9.680  -17.243 25.361 1.00 55.19  ? 12  LEU B CD2   1 
ATOM   3804  N N     . ARG F 3 19  ? -12.342 -18.737 20.566 1.00 65.03  ? 13  ARG B N     1 
ATOM   3805  C CA    . ARG F 3 19  ? -12.778 -19.838 19.704 1.00 69.24  ? 13  ARG B CA    1 
ATOM   3806  C C     . ARG F 3 19  ? -11.649 -20.502 18.913 1.00 72.75  ? 13  ARG B C     1 
ATOM   3807  O O     . ARG F 3 19  ? -11.817 -21.623 18.426 1.00 77.12  ? 13  ARG B O     1 
ATOM   3808  C CB    . ARG F 3 19  ? -13.889 -19.361 18.752 1.00 69.91  ? 13  ARG B CB    1 
ATOM   3809  C CG    . ARG F 3 19  ? -13.369 -18.642 17.515 1.00 71.26  ? 13  ARG B CG    1 
ATOM   3810  C CD    . ARG F 3 19  ? -14.334 -17.609 16.940 1.00 70.35  ? 13  ARG B CD    1 
ATOM   3811  N NE    . ARG F 3 19  ? -13.657 -16.845 15.891 1.00 71.08  ? 13  ARG B NE    1 
ATOM   3812  C CZ    . ARG F 3 19  ? -12.910 -15.766 16.107 1.00 68.39  ? 13  ARG B CZ    1 
ATOM   3813  N NH1   . ARG F 3 19  ? -12.757 -15.275 17.336 1.00 64.98  ? 13  ARG B NH1   1 
ATOM   3814  N NH2   . ARG F 3 19  ? -12.325 -15.165 15.085 1.00 70.22  ? 13  ARG B NH2   1 
ATOM   3815  N N     . LYS F 3 20  ? -10.519 -19.810 18.778 1.00 71.70  ? 14  LYS B N     1 
ATOM   3816  C CA    . LYS F 3 20  ? -9.374  -20.321 18.015 1.00 75.19  ? 14  LYS B CA    1 
ATOM   3817  C C     . LYS F 3 20  ? -8.136  -20.561 18.870 1.00 74.80  ? 14  LYS B C     1 
ATOM   3818  O O     . LYS F 3 20  ? -7.023  -20.626 18.345 1.00 77.23  ? 14  LYS B O     1 
ATOM   3819  C CB    . LYS F 3 20  ? -9.012  -19.377 16.868 1.00 75.66  ? 14  LYS B CB    1 
ATOM   3820  C CG    . LYS F 3 20  ? -10.030 -19.327 15.759 1.00 77.77  ? 14  LYS B CG    1 
ATOM   3821  C CD    . LYS F 3 20  ? -9.504  -18.505 14.608 1.00 79.54  ? 14  LYS B CD    1 
ATOM   3822  C CE    . LYS F 3 20  ? -10.525 -18.418 13.495 1.00 82.35  ? 14  LYS B CE    1 
ATOM   3823  N NZ    . LYS F 3 20  ? -9.946  -17.746 12.303 1.00 85.48  ? 14  LYS B NZ    1 
ATOM   3824  N N     . GLY F 3 21  ? -8.326  -20.693 20.178 1.00 72.30  ? 15  GLY B N     1 
ATOM   3825  C CA    . GLY F 3 21  ? -7.226  -20.999 21.074 1.00 72.24  ? 15  GLY B CA    1 
ATOM   3826  C C     . GLY F 3 21  ? -7.126  -20.062 22.247 1.00 68.19  ? 15  GLY B C     1 
ATOM   3827  O O     . GLY F 3 21  ? -7.861  -19.068 22.338 1.00 65.74  ? 15  GLY B O     1 
ATOM   3828  N N     . GLU F 3 22  ? -6.199  -20.372 23.141 1.00 68.10  ? 16  GLU B N     1 
ATOM   3829  C CA    . GLU F 3 22  ? -6.044  -19.646 24.396 1.00 64.57  ? 16  GLU B CA    1 
ATOM   3830  C C     . GLU F 3 22  ? -5.687  -18.171 24.213 1.00 61.69  ? 16  GLU B C     1 
ATOM   3831  O O     . GLU F 3 22  ? -5.050  -17.811 23.225 1.00 63.04  ? 16  GLU B O     1 
ATOM   3832  C CB    . GLU F 3 22  ? -4.992  -20.328 25.250 1.00 65.81  ? 16  GLU B CB    1 
ATOM   3833  C CG    . GLU F 3 22  ? -3.643  -20.342 24.606 1.00 69.14  ? 16  GLU B CG    1 
ATOM   3834  C CD    . GLU F 3 22  ? -2.652  -21.143 25.390 1.00 74.25  ? 16  GLU B CD    1 
ATOM   3835  O OE1   . GLU F 3 22  ? -3.059  -22.154 26.012 1.00 76.96  ? 16  GLU B OE1   1 
ATOM   3836  O OE2   . GLU F 3 22  ? -1.461  -20.760 25.385 1.00 75.76  ? 16  GLU B OE2   1 
ATOM   3837  N N     . LEU F 3 23  ? -6.118  -17.341 25.171 1.00 58.10  ? 17  LEU B N     1 
ATOM   3838  C CA    . LEU F 3 23  ? -5.806  -15.911 25.226 1.00 55.43  ? 17  LEU B CA    1 
ATOM   3839  C C     . LEU F 3 23  ? -5.807  -15.455 26.674 1.00 53.33  ? 17  LEU B C     1 
ATOM   3840  O O     . LEU F 3 23  ? -6.553  -15.990 27.494 1.00 52.98  ? 17  LEU B O     1 
ATOM   3841  C CB    . LEU F 3 23  ? -6.850  -15.065 24.491 1.00 53.97  ? 17  LEU B CB    1 
ATOM   3842  C CG    . LEU F 3 23  ? -7.306  -15.303 23.049 1.00 56.08  ? 17  LEU B CG    1 
ATOM   3843  C CD1   . LEU F 3 23  ? -8.499  -14.394 22.768 1.00 52.58  ? 17  LEU B CD1   1 
ATOM   3844  C CD2   . LEU F 3 23  ? -6.169  -15.103 22.011 1.00 56.45  ? 17  LEU B CD2   1 
ATOM   3845  N N     . SER F 3 24  ? -4.990  -14.451 26.991 1.00 52.11  ? 18  SER B N     1 
ATOM   3846  C CA    . SER F 3 24  ? -5.033  -13.848 28.312 1.00 49.93  ? 18  SER B CA    1 
ATOM   3847  C C     . SER F 3 24  ? -6.143  -12.816 28.362 1.00 47.67  ? 18  SER B C     1 
ATOM   3848  O O     . SER F 3 24  ? -6.654  -12.385 27.324 1.00 47.59  ? 18  SER B O     1 
ATOM   3849  C CB    . SER F 3 24  ? -3.700  -13.192 28.648 1.00 50.47  ? 18  SER B CB    1 
ATOM   3850  O OG    . SER F 3 24  ? -3.433  -12.067 27.819 1.00 50.66  ? 18  SER B OG    1 
ATOM   3851  N N     . GLY F 3 25  ? -6.527  -12.425 29.572 1.00 46.20  ? 19  GLY B N     1 
ATOM   3852  C CA    . GLY F 3 25  ? -7.399  -11.273 29.757 1.00 44.11  ? 19  GLY B CA    1 
ATOM   3853  C C     . GLY F 3 25  ? -6.830  -10.048 29.053 1.00 43.60  ? 19  GLY B C     1 
ATOM   3854  O O     . GLY F 3 25  ? -7.570  -9.266  28.460 1.00 43.02  ? 19  GLY B O     1 
ATOM   3855  N N     . TYR F 3 26  ? -5.510  -9.896  29.078 1.00 44.23  ? 20  TYR B N     1 
ATOM   3856  C CA    . TYR F 3 26  ? -4.882  -8.781  28.382 1.00 44.48  ? 20  TYR B CA    1 
ATOM   3857  C C     . TYR F 3 26  ? -5.126  -8.818  26.867 1.00 45.80  ? 20  TYR B C     1 
ATOM   3858  O O     . TYR F 3 26  ? -5.453  -7.773  26.264 1.00 45.36  ? 20  TYR B O     1 
ATOM   3859  C CB    . TYR F 3 26  ? -3.389  -8.672  28.713 1.00 45.47  ? 20  TYR B CB    1 
ATOM   3860  C CG    . TYR F 3 26  ? -2.789  -7.351  28.298 1.00 45.93  ? 20  TYR B CG    1 
ATOM   3861  C CD1   . TYR F 3 26  ? -2.981  -6.192  29.075 1.00 44.38  ? 20  TYR B CD1   1 
ATOM   3862  C CD2   . TYR F 3 26  ? -2.049  -7.240  27.122 1.00 47.36  ? 20  TYR B CD2   1 
ATOM   3863  C CE1   . TYR F 3 26  ? -2.445  -4.974  28.696 1.00 43.94  ? 20  TYR B CE1   1 
ATOM   3864  C CE2   . TYR F 3 26  ? -1.514  -6.011  26.728 1.00 48.25  ? 20  TYR B CE2   1 
ATOM   3865  C CZ    . TYR F 3 26  ? -1.711  -4.890  27.527 1.00 47.14  ? 20  TYR B CZ    1 
ATOM   3866  O OH    . TYR F 3 26  ? -1.166  -3.685  27.145 1.00 48.56  ? 20  TYR B OH    1 
ATOM   3867  N N     . ASP F 3 27  ? -4.992  -10.011 26.270 1.00 47.23  ? 21  ASP B N     1 
ATOM   3868  C CA    . ASP F 3 27  ? -5.233  -10.205 24.836 1.00 49.06  ? 21  ASP B CA    1 
ATOM   3869  C C     . ASP F 3 27  ? -6.658  -9.851  24.490 1.00 47.84  ? 21  ASP B C     1 
ATOM   3870  O O     . ASP F 3 27  ? -6.924  -9.228  23.456 1.00 48.43  ? 21  ASP B O     1 
ATOM   3871  C CB    . ASP F 3 27  ? -5.004  -11.657 24.403 1.00 51.78  ? 21  ASP B CB    1 
ATOM   3872  C CG    . ASP F 3 27  ? -3.570  -12.104 24.545 1.00 54.49  ? 21  ASP B CG    1 
ATOM   3873  O OD1   . ASP F 3 27  ? -2.643  -11.280 24.367 1.00 56.18  ? 21  ASP B OD1   1 
ATOM   3874  O OD2   . ASP F 3 27  ? -3.380  -13.303 24.840 1.00 57.73  ? 21  ASP B OD2   1 
ATOM   3875  N N     . ILE F 3 28  ? -7.579  -10.281 25.345 1.00 46.46  ? 22  ILE B N     1 
ATOM   3876  C CA    . ILE F 3 28  ? -8.981  -9.971  25.156 1.00 45.65  ? 22  ILE B CA    1 
ATOM   3877  C C     . ILE F 3 28  ? -9.132  -8.449  25.137 1.00 44.82  ? 22  ILE B C     1 
ATOM   3878  O O     . ILE F 3 28  ? -9.629  -7.884  24.169 1.00 45.78  ? 22  ILE B O     1 
ATOM   3879  C CB    . ILE F 3 28  ? -9.862  -10.639 26.231 1.00 44.59  ? 22  ILE B CB    1 
ATOM   3880  C CG1   . ILE F 3 28  ? -9.925  -12.148 25.973 1.00 47.14  ? 22  ILE B CG1   1 
ATOM   3881  C CG2   . ILE F 3 28  ? -11.263 -10.060 26.206 1.00 43.59  ? 22  ILE B CG2   1 
ATOM   3882  C CD1   . ILE F 3 28  ? -10.467 -12.992 27.114 1.00 48.48  ? 22  ILE B CD1   1 
ATOM   3883  N N     . THR F 3 29  ? -8.653  -7.782  26.182 1.00 43.77  ? 23  THR B N     1 
ATOM   3884  C CA    . THR F 3 29  ? -8.721  -6.333  26.245 1.00 42.82  ? 23  THR B CA    1 
ATOM   3885  C C     . THR F 3 29  ? -8.190  -5.739  24.938 1.00 44.85  ? 23  THR B C     1 
ATOM   3886  O O     . THR F 3 29  ? -8.740  -4.760  24.438 1.00 45.03  ? 23  THR B O     1 
ATOM   3887  C CB    . THR F 3 29  ? -7.958  -5.778  27.487 1.00 42.10  ? 23  THR B CB    1 
ATOM   3888  O OG1   . THR F 3 29  ? -8.417  -6.455  28.663 1.00 40.88  ? 23  THR B OG1   1 
ATOM   3889  C CG2   . THR F 3 29  ? -8.179  -4.291  27.664 1.00 39.85  ? 23  THR B CG2   1 
ATOM   3890  N N     . SER F 3 30  ? -7.150  -6.354  24.370 1.00 46.73  ? 24  SER B N     1 
ATOM   3891  C CA    . SER F 3 30  ? -6.485  -5.790  23.199 1.00 49.15  ? 24  SER B CA    1 
ATOM   3892  C C     . SER F 3 30  ? -7.314  -5.928  21.944 1.00 50.45  ? 24  SER B C     1 
ATOM   3893  O O     . SER F 3 30  ? -7.245  -5.078  21.052 1.00 52.16  ? 24  SER B O     1 
ATOM   3894  C CB    . SER F 3 30  ? -5.121  -6.423  22.983 1.00 51.02  ? 24  SER B CB    1 
ATOM   3895  O OG    . SER F 3 30  ? -4.270  -6.117  24.069 1.00 52.29  ? 24  SER B OG    1 
ATOM   3896  N N     . TYR F 3 31  ? -8.088  -7.005  21.873 1.00 50.29  ? 25  TYR B N     1 
ATOM   3897  C CA    . TYR F 3 31  ? -8.941  -7.241  20.724 1.00 51.80  ? 25  TYR B CA    1 
ATOM   3898  C C     . TYR F 3 31  ? -10.105 -6.250  20.711 1.00 50.71  ? 25  TYR B C     1 
ATOM   3899  O O     . TYR F 3 31  ? -10.538 -5.810  19.640 1.00 52.27  ? 25  TYR B O     1 
ATOM   3900  C CB    . TYR F 3 31  ? -9.448  -8.679  20.699 1.00 52.26  ? 25  TYR B CB    1 
ATOM   3901  C CG    . TYR F 3 31  ? -8.508  -9.666  20.041 1.00 55.41  ? 25  TYR B CG    1 
ATOM   3902  C CD1   . TYR F 3 31  ? -8.142  -9.521  18.700 1.00 59.51  ? 25  TYR B CD1   1 
ATOM   3903  C CD2   . TYR F 3 31  ? -8.012  -10.761 20.742 1.00 55.74  ? 25  TYR B CD2   1 
ATOM   3904  C CE1   . TYR F 3 31  ? -7.286  -10.425 18.083 1.00 62.60  ? 25  TYR B CE1   1 
ATOM   3905  C CE2   . TYR F 3 31  ? -7.150  -11.674 20.136 1.00 59.05  ? 25  TYR B CE2   1 
ATOM   3906  C CZ    . TYR F 3 31  ? -6.794  -11.500 18.805 1.00 62.96  ? 25  TYR B CZ    1 
ATOM   3907  O OH    . TYR F 3 31  ? -5.960  -12.404 18.182 1.00 67.20  ? 25  TYR B OH    1 
ATOM   3908  N N     . PHE F 3 32  ? -10.600 -5.894  21.895 1.00 48.09  ? 26  PHE B N     1 
ATOM   3909  C CA    . PHE F 3 32  ? -11.683 -4.927  21.990 1.00 47.34  ? 26  PHE B CA    1 
ATOM   3910  C C     . PHE F 3 32  ? -11.207 -3.546  21.539 1.00 48.75  ? 26  PHE B C     1 
ATOM   3911  O O     . PHE F 3 32  ? -12.005 -2.636  21.350 1.00 48.94  ? 26  PHE B O     1 
ATOM   3912  C CB    . PHE F 3 32  ? -12.254 -4.858  23.406 1.00 45.03  ? 26  PHE B CB    1 
ATOM   3913  C CG    . PHE F 3 32  ? -13.111 -6.028  23.777 1.00 44.40  ? 26  PHE B CG    1 
ATOM   3914  C CD1   . PHE F 3 32  ? -14.059 -6.523  22.901 1.00 45.84  ? 26  PHE B CD1   1 
ATOM   3915  C CD2   . PHE F 3 32  ? -13.004 -6.609  25.022 1.00 43.68  ? 26  PHE B CD2   1 
ATOM   3916  C CE1   . PHE F 3 32  ? -14.856 -7.606  23.247 1.00 45.75  ? 26  PHE B CE1   1 
ATOM   3917  C CE2   . PHE F 3 32  ? -13.807 -7.693  25.373 1.00 43.85  ? 26  PHE B CE2   1 
ATOM   3918  C CZ    . PHE F 3 32  ? -14.728 -8.188  24.483 1.00 44.00  ? 26  PHE B CZ    1 
ATOM   3919  N N     . LYS F 3 33  ? -9.900  -3.398  21.355 1.00 50.07  ? 27  LYS B N     1 
ATOM   3920  C CA    . LYS F 3 33  ? -9.348  -2.123  20.962 1.00 51.91  ? 27  LYS B CA    1 
ATOM   3921  C C     . LYS F 3 33  ? -8.929  -2.132  19.505 1.00 55.21  ? 27  LYS B C     1 
ATOM   3922  O O     . LYS F 3 33  ? -8.629  -1.087  18.931 1.00 57.21  ? 27  LYS B O     1 
ATOM   3923  C CB    . LYS F 3 33  ? -8.199  -1.736  21.882 1.00 51.55  ? 27  LYS B CB    1 
ATOM   3924  C CG    . LYS F 3 33  ? -8.654  -1.488  23.307 1.00 49.48  ? 27  LYS B CG    1 
ATOM   3925  C CD    . LYS F 3 33  ? -7.533  -0.901  24.144 1.00 51.53  ? 27  LYS B CD    1 
ATOM   3926  C CE    . LYS F 3 33  ? -7.873  -0.930  25.634 1.00 49.84  ? 27  LYS B CE    1 
ATOM   3927  N NZ    . LYS F 3 33  ? -6.661  -0.602  26.434 1.00 50.58  ? 27  LYS B NZ    1 
ATOM   3928  N N     . GLU F 3 34  ? -8.932  -3.315  18.903 1.00 56.40  ? 28  GLU B N     1 
ATOM   3929  C CA    . GLU F 3 34  ? -8.646  -3.443  17.484 1.00 60.09  ? 28  GLU B CA    1 
ATOM   3930  C C     . GLU F 3 34  ? -9.953  -3.322  16.704 1.00 61.08  ? 28  GLU B C     1 
ATOM   3931  O O     . GLU F 3 34  ? -10.793 -2.476  17.046 1.00 60.30  ? 28  GLU B O     1 
ATOM   3932  C CB    . GLU F 3 34  ? -7.899  -4.747  17.190 1.00 61.55  ? 28  GLU B CB    1 
ATOM   3933  C CG    . GLU F 3 34  ? -6.414  -4.719  17.588 1.00 62.17  ? 28  GLU B CG    1 
ATOM   3934  N N     . GLU F 3 35  ? -10.141 -4.156  15.680 1.00 63.09  ? 29  GLU B N     1 
ATOM   3935  C CA    . GLU F 3 35  ? -11.279 -3.987  14.767 1.00 64.43  ? 29  GLU B CA    1 
ATOM   3936  C C     . GLU F 3 35  ? -12.651 -4.304  15.382 1.00 61.53  ? 29  GLU B C     1 
ATOM   3937  O O     . GLU F 3 35  ? -13.662 -3.694  15.011 1.00 62.04  ? 29  GLU B O     1 
ATOM   3938  C CB    . GLU F 3 35  ? -11.070 -4.760  13.461 1.00 68.28  ? 29  GLU B CB    1 
ATOM   3939  C CG    . GLU F 3 35  ? -10.915 -6.272  13.624 1.00 69.75  ? 29  GLU B CG    1 
ATOM   3940  C CD    . GLU F 3 35  ? -9.475  -6.714  13.864 1.00 72.56  ? 29  GLU B CD    1 
ATOM   3941  O OE1   . GLU F 3 35  ? -8.576  -5.841  13.952 1.00 73.58  ? 29  GLU B OE1   1 
ATOM   3942  O OE2   . GLU F 3 35  ? -9.242  -7.943  13.955 1.00 73.53  ? 29  GLU B OE2   1 
ATOM   3943  N N     . LEU F 3 36  ? -12.682 -5.247  16.323 1.00 58.77  ? 30  LEU B N     1 
ATOM   3944  C CA    . LEU F 3 36  ? -13.929 -5.645  16.984 1.00 56.26  ? 30  LEU B CA    1 
ATOM   3945  C C     . LEU F 3 36  ? -14.540 -4.500  17.807 1.00 53.80  ? 30  LEU B C     1 
ATOM   3946  O O     . LEU F 3 36  ? -15.752 -4.467  18.040 1.00 52.52  ? 30  LEU B O     1 
ATOM   3947  C CB    . LEU F 3 36  ? -13.700 -6.880  17.865 1.00 54.70  ? 30  LEU B CB    1 
ATOM   3948  C CG    . LEU F 3 36  ? -14.864 -7.367  18.734 1.00 53.49  ? 30  LEU B CG    1 
ATOM   3949  C CD1   . LEU F 3 36  ? -16.045 -7.841  17.896 1.00 55.51  ? 30  LEU B CD1   1 
ATOM   3950  C CD2   . LEU F 3 36  ? -14.413 -8.459  19.672 1.00 52.84  ? 30  LEU B CD2   1 
ATOM   3951  N N     . GLY F 3 37  ? -13.683 -3.563  18.219 1.00 52.73  ? 31  GLY B N     1 
ATOM   3952  C CA    . GLY F 3 37  ? -14.072 -2.445  19.066 1.00 50.89  ? 31  GLY B CA    1 
ATOM   3953  C C     . GLY F 3 37  ? -14.997 -1.430  18.434 1.00 52.02  ? 31  GLY B C     1 
ATOM   3954  O O     . GLY F 3 37  ? -15.355 -0.437  19.057 1.00 51.43  ? 31  GLY B O     1 
ATOM   3955  N N     . GLN F 3 38  ? -15.377 -1.664  17.192 1.00 54.02  ? 32  GLN B N     1 
ATOM   3956  C CA    . GLN F 3 38  ? -16.354 -0.804  16.549 1.00 55.92  ? 32  GLN B CA    1 
ATOM   3957  C C     . GLN F 3 38  ? -17.777 -1.256  16.888 1.00 54.86  ? 32  GLN B C     1 
ATOM   3958  O O     . GLN F 3 38  ? -18.741 -0.511  16.699 1.00 55.74  ? 32  GLN B O     1 
ATOM   3959  C CB    . GLN F 3 38  ? -16.146 -0.823  15.040 1.00 59.36  ? 32  GLN B CB    1 
ATOM   3960  C CG    . GLN F 3 38  ? -14.787 -0.323  14.611 1.00 61.63  ? 32  GLN B CG    1 
ATOM   3961  C CD    . GLN F 3 38  ? -14.713 1.184   14.585 1.00 63.56  ? 32  GLN B CD    1 
ATOM   3962  O OE1   . GLN F 3 38  ? -15.596 1.858   14.040 1.00 65.18  ? 32  GLN B OE1   1 
ATOM   3963  N NE2   . GLN F 3 38  ? -13.656 1.727   15.175 1.00 63.19  ? 32  GLN B NE2   1 
ATOM   3964  N N     . PHE F 3 39  ? -17.892 -2.479  17.404 1.00 53.21  ? 33  PHE B N     1 
ATOM   3965  C CA    . PHE F 3 39  ? -19.187 -3.124  17.593 1.00 52.83  ? 33  PHE B CA    1 
ATOM   3966  C C     . PHE F 3 39  ? -19.399 -3.743  18.982 1.00 50.41  ? 33  PHE B C     1 
ATOM   3967  O O     . PHE F 3 39  ? -20.533 -3.998  19.376 1.00 50.46  ? 33  PHE B O     1 
ATOM   3968  C CB    . PHE F 3 39  ? -19.427 -4.115  16.451 1.00 54.67  ? 33  PHE B CB    1 
ATOM   3969  C CG    . PHE F 3 39  ? -19.394 -3.460  15.103 1.00 57.30  ? 33  PHE B CG    1 
ATOM   3970  C CD1   . PHE F 3 39  ? -20.454 -2.658  14.677 1.00 58.24  ? 33  PHE B CD1   1 
ATOM   3971  C CD2   . PHE F 3 39  ? -18.285 -3.588  14.278 1.00 58.60  ? 33  PHE B CD2   1 
ATOM   3972  C CE1   . PHE F 3 39  ? -20.424 -2.018  13.435 1.00 61.00  ? 33  PHE B CE1   1 
ATOM   3973  C CE2   . PHE F 3 39  ? -18.247 -2.946  13.032 1.00 61.54  ? 33  PHE B CE2   1 
ATOM   3974  C CZ    . PHE F 3 39  ? -19.319 -2.160  12.613 1.00 62.95  ? 33  PHE B CZ    1 
ATOM   3975  N N     . TRP F 3 40  ? -18.308 -3.967  19.710 1.00 48.85  ? 34  TRP B N     1 
ATOM   3976  C CA    . TRP F 3 40  ? -18.355 -4.323  21.123 1.00 47.07  ? 34  TRP B CA    1 
ATOM   3977  C C     . TRP F 3 40  ? -17.038 -3.960  21.795 1.00 45.91  ? 34  TRP B C     1 
ATOM   3978  O O     . TRP F 3 40  ? -15.970 -4.070  21.192 1.00 46.76  ? 34  TRP B O     1 
ATOM   3979  C CB    . TRP F 3 40  ? -18.672 -5.814  21.364 1.00 47.28  ? 34  TRP B CB    1 
ATOM   3980  C CG    . TRP F 3 40  ? -19.311 -5.976  22.700 1.00 47.35  ? 34  TRP B CG    1 
ATOM   3981  C CD1   . TRP F 3 40  ? -18.680 -6.204  23.903 1.00 46.65  ? 34  TRP B CD1   1 
ATOM   3982  C CD2   . TRP F 3 40  ? -20.701 -5.829  22.998 1.00 47.76  ? 34  TRP B CD2   1 
ATOM   3983  N NE1   . TRP F 3 40  ? -19.603 -6.213  24.927 1.00 46.65  ? 34  TRP B NE1   1 
ATOM   3984  C CE2   . TRP F 3 40  ? -20.850 -5.993  24.398 1.00 47.73  ? 34  TRP B CE2   1 
ATOM   3985  C CE3   . TRP F 3 40  ? -21.834 -5.570  22.221 1.00 49.91  ? 34  TRP B CE3   1 
ATOM   3986  C CZ2   . TRP F 3 40  ? -22.095 -5.913  25.035 1.00 48.68  ? 34  TRP B CZ2   1 
ATOM   3987  C CZ3   . TRP F 3 40  ? -23.078 -5.497  22.851 1.00 51.60  ? 34  TRP B CZ3   1 
ATOM   3988  C CH2   . TRP F 3 40  ? -23.197 -5.670  24.248 1.00 50.94  ? 34  TRP B CH2   1 
ATOM   3989  N N     . SER F 3 41  ? -17.109 -3.533  23.051 1.00 44.32  ? 35  SER B N     1 
ATOM   3990  C CA    . SER F 3 41  ? -15.895 -3.345  23.833 1.00 43.31  ? 35  SER B CA    1 
ATOM   3991  C C     . SER F 3 41  ? -16.156 -3.499  25.310 1.00 41.73  ? 35  SER B C     1 
ATOM   3992  O O     . SER F 3 41  ? -17.289 -3.377  25.774 1.00 41.84  ? 35  SER B O     1 
ATOM   3993  C CB    . SER F 3 41  ? -15.258 -1.976  23.567 1.00 44.03  ? 35  SER B CB    1 
ATOM   3994  O OG    . SER F 3 41  ? -16.195 -0.944  23.786 1.00 44.92  ? 35  SER B OG    1 
ATOM   3995  N N     . ALA F 3 42  ? -15.085 -3.766  26.043 1.00 40.49  ? 36  ALA B N     1 
ATOM   3996  C CA    . ALA F 3 42  ? -15.149 -3.828  27.474 1.00 39.54  ? 36  ALA B CA    1 
ATOM   3997  C C     . ALA F 3 42  ? -13.805 -3.436  28.047 1.00 39.29  ? 36  ALA B C     1 
ATOM   3998  O O     . ALA F 3 42  ? -12.751 -3.716  27.460 1.00 40.30  ? 36  ALA B O     1 
ATOM   3999  C CB    . ALA F 3 42  ? -15.562 -5.222  27.938 1.00 38.92  ? 36  ALA B CB    1 
ATOM   4000  N N     . LYS F 3 43  ? -13.846 -2.785  29.202 1.00 38.99  ? 37  LYS B N     1 
ATOM   4001  C CA    . LYS F 3 43  ? -12.639 -2.507  29.971 1.00 38.32  ? 37  LYS B CA    1 
ATOM   4002  C C     . LYS F 3 43  ? -12.157 -3.753  30.703 1.00 37.63  ? 37  LYS B C     1 
ATOM   4003  O O     . LYS F 3 43  ? -12.968 -4.601  31.105 1.00 37.57  ? 37  LYS B O     1 
ATOM   4004  C CB    . LYS F 3 43  ? -12.909 -1.434  31.010 1.00 38.49  ? 37  LYS B CB    1 
ATOM   4005  C CG    . LYS F 3 43  ? -13.691 -0.276  30.513 1.00 39.36  ? 37  LYS B CG    1 
ATOM   4006  C CD    . LYS F 3 43  ? -12.862 0.594   29.647 1.00 41.39  ? 37  LYS B CD    1 
ATOM   4007  C CE    . LYS F 3 43  ? -13.612 1.853   29.340 1.00 44.37  ? 37  LYS B CE    1 
ATOM   4008  N NZ    . LYS F 3 43  ? -12.721 2.728   28.585 1.00 47.15  ? 37  LYS B NZ    1 
ATOM   4009  N N     . HIS F 3 44  ? -10.836 -3.823  30.897 1.00 37.20  ? 38  HIS B N     1 
ATOM   4010  C CA    . HIS F 3 44  ? -10.185 -4.849  31.696 1.00 36.78  ? 38  HIS B CA    1 
ATOM   4011  C C     . HIS F 3 44  ? -10.860 -5.081  33.049 1.00 36.97  ? 38  HIS B C     1 
ATOM   4012  O O     . HIS F 3 44  ? -10.902 -6.207  33.547 1.00 38.03  ? 38  HIS B O     1 
ATOM   4013  C CB    . HIS F 3 44  ? -8.680  -4.563  31.837 1.00 36.84  ? 38  HIS B CB    1 
ATOM   4014  C CG    . HIS F 3 44  ? -8.321  -3.638  32.950 1.00 36.57  ? 38  HIS B CG    1 
ATOM   4015  N ND1   . HIS F 3 44  ? -8.146  -2.278  32.767 1.00 38.19  ? 38  HIS B ND1   1 
ATOM   4016  C CD2   . HIS F 3 44  ? -8.088  -3.875  34.264 1.00 36.85  ? 38  HIS B CD2   1 
ATOM   4017  C CE1   . HIS F 3 44  ? -7.836  -1.715  33.923 1.00 38.75  ? 38  HIS B CE1   1 
ATOM   4018  N NE2   . HIS F 3 44  ? -7.786  -2.664  34.848 1.00 39.81  ? 38  HIS B NE2   1 
ATOM   4019  N N     . SER F 3 45  ? -11.433 -4.028  33.609 1.00 37.01  ? 39  SER B N     1 
ATOM   4020  C CA    . SER F 3 45  ? -12.060 -4.099  34.922 1.00 37.59  ? 39  SER B CA    1 
ATOM   4021  C C     . SER F 3 45  ? -13.375 -4.852  34.872 1.00 37.56  ? 39  SER B C     1 
ATOM   4022  O O     . SER F 3 45  ? -13.828 -5.377  35.876 1.00 38.11  ? 39  SER B O     1 
ATOM   4023  C CB    . SER F 3 45  ? -12.229 -2.695  35.547 1.00 38.06  ? 39  SER B CB    1 
ATOM   4024  O OG    . SER F 3 45  ? -13.305 -1.986  34.972 1.00 37.02  ? 39  SER B OG    1 
ATOM   4025  N N     . GLN F 3 46  ? -13.981 -4.922  33.696 1.00 37.46  ? 40  GLN B N     1 
ATOM   4026  C CA    . GLN F 3 46  ? -15.141 -5.794  33.528 1.00 38.49  ? 40  GLN B CA    1 
ATOM   4027  C C     . GLN F 3 46  ? -14.745 -7.244  33.172 1.00 38.48  ? 40  GLN B C     1 
ATOM   4028  O O     . GLN F 3 46  ? -15.409 -8.190  33.586 1.00 38.82  ? 40  GLN B O     1 
ATOM   4029  C CB    . GLN F 3 46  ? -16.087 -5.237  32.471 1.00 38.52  ? 40  GLN B CB    1 
ATOM   4030  C CG    . GLN F 3 46  ? -17.524 -5.549  32.730 1.00 40.57  ? 40  GLN B CG    1 
ATOM   4031  C CD    . GLN F 3 46  ? -18.421 -5.066  31.621 1.00 43.21  ? 40  GLN B CD    1 
ATOM   4032  O OE1   . GLN F 3 46  ? -18.081 -4.124  30.894 1.00 43.35  ? 40  GLN B OE1   1 
ATOM   4033  N NE2   . GLN F 3 46  ? -19.579 -5.716  31.470 1.00 44.31  ? 40  GLN B NE2   1 
ATOM   4034  N N     . ILE F 3 47  ? -13.659 -7.385  32.415 1.00 38.03  ? 41  ILE B N     1 
ATOM   4035  C CA    . ILE F 3 47  ? -13.285 -8.644  31.793 1.00 39.09  ? 41  ILE B CA    1 
ATOM   4036  C C     . ILE F 3 47  ? -12.709 -9.636  32.821 1.00 40.61  ? 41  ILE B C     1 
ATOM   4037  O O     . ILE F 3 47  ? -12.964 -10.856 32.742 1.00 41.82  ? 41  ILE B O     1 
ATOM   4038  C CB    . ILE F 3 47  ? -12.265 -8.404  30.661 1.00 38.66  ? 41  ILE B CB    1 
ATOM   4039  C CG1   . ILE F 3 47  ? -12.903 -7.600  29.530 1.00 38.71  ? 41  ILE B CG1   1 
ATOM   4040  C CG2   . ILE F 3 47  ? -11.718 -9.725  30.130 1.00 39.35  ? 41  ILE B CG2   1 
ATOM   4041  C CD1   . ILE F 3 47  ? -11.930 -6.880  28.632 1.00 38.68  ? 41  ILE B CD1   1 
ATOM   4042  N N     . TYR F 3 48  ? -11.929 -9.117  33.773 1.00 40.11  ? 42  TYR B N     1 
ATOM   4043  C CA    . TYR F 3 48  ? -11.245 -9.986  34.719 1.00 40.82  ? 42  TYR B CA    1 
ATOM   4044  C C     . TYR F 3 48  ? -12.230 -10.674 35.655 1.00 42.46  ? 42  TYR B C     1 
ATOM   4045  O O     . TYR F 3 48  ? -12.134 -11.882 35.842 1.00 44.11  ? 42  TYR B O     1 
ATOM   4046  C CB    . TYR F 3 48  ? -10.118 -9.257  35.488 1.00 40.03  ? 42  TYR B CB    1 
ATOM   4047  C CG    . TYR F 3 48  ? -8.857  -9.062  34.669 1.00 38.56  ? 42  TYR B CG    1 
ATOM   4048  C CD1   . TYR F 3 48  ? -8.139  -10.174 34.172 1.00 38.08  ? 42  TYR B CD1   1 
ATOM   4049  C CD2   . TYR F 3 48  ? -8.378  -7.773  34.375 1.00 35.25  ? 42  TYR B CD2   1 
ATOM   4050  C CE1   . TYR F 3 48  ? -6.984  -10.002 33.401 1.00 38.06  ? 42  TYR B CE1   1 
ATOM   4051  C CE2   . TYR F 3 48  ? -7.229  -7.584  33.620 1.00 35.48  ? 42  TYR B CE2   1 
ATOM   4052  C CZ    . TYR F 3 48  ? -6.532  -8.701  33.132 1.00 38.83  ? 42  TYR B CZ    1 
ATOM   4053  O OH    . TYR F 3 48  ? -5.390  -8.526  32.379 1.00 40.85  ? 42  TYR B OH    1 
ATOM   4054  N N     . PRO F 3 49  ? -13.180 -9.921  36.246 1.00 42.82  ? 43  PRO B N     1 
ATOM   4055  C CA    . PRO F 3 49  ? -14.155 -10.613 37.108 1.00 44.66  ? 43  PRO B CA    1 
ATOM   4056  C C     . PRO F 3 49  ? -15.014 -11.607 36.333 1.00 45.51  ? 43  PRO B C     1 
ATOM   4057  O O     . PRO F 3 49  ? -15.392 -12.648 36.874 1.00 47.81  ? 43  PRO B O     1 
ATOM   4058  C CB    . PRO F 3 49  ? -15.029 -9.480  37.659 1.00 44.17  ? 43  PRO B CB    1 
ATOM   4059  C CG    . PRO F 3 49  ? -14.220 -8.217  37.460 1.00 42.99  ? 43  PRO B CG    1 
ATOM   4060  C CD    . PRO F 3 49  ? -13.370 -8.454  36.254 1.00 41.89  ? 43  PRO B CD    1 
ATOM   4061  N N     . GLU F 3 50  ? -15.305 -11.280 35.081 1.00 44.55  ? 44  GLU B N     1 
ATOM   4062  C CA    . GLU F 3 50  ? -16.100 -12.121 34.211 1.00 46.07  ? 44  GLU B CA    1 
ATOM   4063  C C     . GLU F 3 50  ? -15.346 -13.412 33.826 1.00 47.37  ? 44  GLU B C     1 
ATOM   4064  O O     . GLU F 3 50  ? -15.954 -14.494 33.740 1.00 49.47  ? 44  GLU B O     1 
ATOM   4065  C CB    . GLU F 3 50  ? -16.527 -11.337 32.971 1.00 44.83  ? 44  GLU B CB    1 
ATOM   4066  C CG    . GLU F 3 50  ? -17.446 -12.097 32.015 1.00 48.05  ? 44  GLU B CG    1 
ATOM   4067  C CD    . GLU F 3 50  ? -18.845 -12.349 32.569 1.00 52.15  ? 44  GLU B CD    1 
ATOM   4068  O OE1   . GLU F 3 50  ? -19.195 -11.840 33.660 1.00 53.35  ? 44  GLU B OE1   1 
ATOM   4069  O OE2   . GLU F 3 50  ? -19.611 -13.067 31.895 1.00 55.46  ? 44  GLU B OE2   1 
ATOM   4070  N N     . LEU F 3 51  ? -14.034 -13.298 33.611 1.00 46.19  ? 45  LEU B N     1 
ATOM   4071  C CA    . LEU F 3 51  ? -13.200 -14.460 33.350 1.00 47.52  ? 45  LEU B CA    1 
ATOM   4072  C C     . LEU F 3 51  ? -13.260 -15.426 34.511 1.00 49.87  ? 45  LEU B C     1 
ATOM   4073  O O     . LEU F 3 51  ? -13.358 -16.648 34.309 1.00 52.27  ? 45  LEU B O     1 
ATOM   4074  C CB    . LEU F 3 51  ? -11.760 -14.059 33.060 1.00 46.34  ? 45  LEU B CB    1 
ATOM   4075  C CG    . LEU F 3 51  ? -11.515 -13.523 31.649 1.00 45.42  ? 45  LEU B CG    1 
ATOM   4076  C CD1   . LEU F 3 51  ? -10.197 -12.790 31.598 1.00 44.06  ? 45  LEU B CD1   1 
ATOM   4077  C CD2   . LEU F 3 51  ? -11.569 -14.634 30.599 1.00 46.31  ? 45  LEU B CD2   1 
ATOM   4078  N N     . LYS F 3 52  ? -13.229 -14.876 35.722 1.00 49.55  ? 46  LYS B N     1 
ATOM   4079  C CA    . LYS F 3 52  ? -13.371 -15.676 36.928 1.00 52.31  ? 46  LYS B CA    1 
ATOM   4080  C C     . LYS F 3 52  ? -14.750 -16.328 36.972 1.00 54.49  ? 46  LYS B C     1 
ATOM   4081  O O     . LYS F 3 52  ? -14.889 -17.480 37.413 1.00 57.77  ? 46  LYS B O     1 
ATOM   4082  C CB    . LYS F 3 52  ? -13.152 -14.834 38.194 1.00 51.98  ? 46  LYS B CB    1 
ATOM   4083  C CG    . LYS F 3 52  ? -13.528 -15.587 39.449 1.00 55.65  ? 46  LYS B CG    1 
ATOM   4084  C CD    . LYS F 3 52  ? -13.133 -14.887 40.699 1.00 58.90  ? 46  LYS B CD    1 
ATOM   4085  C CE    . LYS F 3 52  ? -13.449 -15.776 41.887 1.00 64.53  ? 46  LYS B CE    1 
ATOM   4086  N NZ    . LYS F 3 52  ? -13.161 -15.082 43.165 1.00 67.58  ? 46  LYS B NZ    1 
ATOM   4087  N N     . LYS F 3 53  ? -15.764 -15.592 36.521 1.00 53.10  ? 47  LYS B N     1 
ATOM   4088  C CA    . LYS F 3 53  ? -17.118 -16.107 36.541 1.00 55.58  ? 47  LYS B CA    1 
ATOM   4089  C C     . LYS F 3 53  ? -17.237 -17.285 35.579 1.00 57.30  ? 47  LYS B C     1 
ATOM   4090  O O     . LYS F 3 53  ? -17.705 -18.353 35.956 1.00 60.38  ? 47  LYS B O     1 
ATOM   4091  C CB    . LYS F 3 53  ? -18.134 -15.022 36.190 1.00 54.20  ? 47  LYS B CB    1 
ATOM   4092  C CG    . LYS F 3 53  ? -19.432 -15.202 36.920 1.00 57.12  ? 47  LYS B CG    1 
ATOM   4093  C CD    . LYS F 3 53  ? -20.579 -14.613 36.161 1.00 58.29  ? 47  LYS B CD    1 
ATOM   4094  C CE    . LYS F 3 53  ? -21.827 -14.576 37.031 1.00 61.37  ? 47  LYS B CE    1 
ATOM   4095  N NZ    . LYS F 3 53  ? -23.022 -14.131 36.263 1.00 61.93  ? 47  LYS B NZ    1 
ATOM   4096  N N     . LEU F 3 54  ? -16.772 -17.080 34.351 1.00 55.59  ? 48  LEU B N     1 
ATOM   4097  C CA    . LEU F 3 54  ? -16.853 -18.079 33.309 1.00 57.56  ? 48  LEU B CA    1 
ATOM   4098  C C     . LEU F 3 54  ? -16.121 -19.374 33.664 1.00 60.71  ? 48  LEU B C     1 
ATOM   4099  O O     . LEU F 3 54  ? -16.530 -20.458 33.237 1.00 63.43  ? 48  LEU B O     1 
ATOM   4100  C CB    . LEU F 3 54  ? -16.324 -17.514 32.001 1.00 55.36  ? 48  LEU B CB    1 
ATOM   4101  C CG    . LEU F 3 54  ? -17.147 -16.456 31.272 1.00 53.11  ? 48  LEU B CG    1 
ATOM   4102  C CD1   . LEU F 3 54  ? -16.334 -15.939 30.115 1.00 50.80  ? 48  LEU B CD1   1 
ATOM   4103  C CD2   . LEU F 3 54  ? -18.478 -17.007 30.785 1.00 54.32  ? 48  LEU B CD2   1 
ATOM   4104  N N     . THR F 3 55  ? -15.050 -19.254 34.450 1.00 60.40  ? 49  THR B N     1 
ATOM   4105  C CA    . THR F 3 55  ? -14.327 -20.421 34.956 1.00 63.23  ? 49  THR B CA    1 
ATOM   4106  C C     . THR F 3 55  ? -15.181 -21.135 35.996 1.00 66.74  ? 49  THR B C     1 
ATOM   4107  O O     . THR F 3 55  ? -15.387 -22.346 35.907 1.00 70.48  ? 49  THR B O     1 
ATOM   4108  C CB    . THR F 3 55  ? -12.958 -20.027 35.548 1.00 61.98  ? 49  THR B CB    1 
ATOM   4109  O OG1   . THR F 3 55  ? -12.226 -19.258 34.581 1.00 59.76  ? 49  THR B OG1   1 
ATOM   4110  C CG2   . THR F 3 55  ? -12.138 -21.263 35.939 1.00 64.32  ? 49  THR B CG2   1 
ATOM   4111  N N     . ASP F 3 56  ? -15.701 -20.386 36.965 1.00 66.35  ? 50  ASP B N     1 
ATOM   4112  C CA    . ASP F 3 56  ? -16.581 -20.965 37.991 1.00 70.12  ? 50  ASP B CA    1 
ATOM   4113  C C     . ASP F 3 56  ? -17.839 -21.612 37.410 1.00 72.36  ? 50  ASP B C     1 
ATOM   4114  O O     . ASP F 3 56  ? -18.353 -22.591 37.958 1.00 76.25  ? 50  ASP B O     1 
ATOM   4115  C CB    . ASP F 3 56  ? -16.931 -19.928 39.066 1.00 69.35  ? 50  ASP B CB    1 
ATOM   4116  C CG    . ASP F 3 56  ? -15.763 -19.656 40.000 1.00 70.34  ? 50  ASP B CG    1 
ATOM   4117  O OD1   . ASP F 3 56  ? -14.910 -20.563 40.134 1.00 74.12  ? 50  ASP B OD1   1 
ATOM   4118  O OD2   . ASP F 3 56  ? -15.685 -18.554 40.595 1.00 69.90  ? 50  ASP B OD2   1 
ATOM   4119  N N     . GLU F 3 57  ? -18.315 -21.070 36.293 1.00 69.91  ? 51  GLU B N     1 
ATOM   4120  C CA    . GLU F 3 57  ? -19.442 -21.652 35.582 1.00 72.29  ? 51  GLU B CA    1 
ATOM   4121  C C     . GLU F 3 57  ? -19.043 -22.874 34.757 1.00 74.43  ? 51  GLU B C     1 
ATOM   4122  O O     . GLU F 3 57  ? -19.908 -23.598 34.280 1.00 77.59  ? 51  GLU B O     1 
ATOM   4123  C CB    . GLU F 3 57  ? -20.095 -20.610 34.682 1.00 69.61  ? 51  GLU B CB    1 
ATOM   4124  C CG    . GLU F 3 57  ? -21.226 -19.852 35.345 1.00 70.85  ? 51  GLU B CG    1 
ATOM   4125  C CD    . GLU F 3 57  ? -21.395 -18.468 34.770 1.00 68.71  ? 51  GLU B CD    1 
ATOM   4126  O OE1   . GLU F 3 57  ? -20.439 -17.671 34.860 1.00 66.43  ? 51  GLU B OE1   1 
ATOM   4127  O OE2   . GLU F 3 57  ? -22.482 -18.173 34.232 1.00 70.95  ? 51  GLU B OE2   1 
ATOM   4128  N N     . GLY F 3 58  ? -17.738 -23.082 34.586 1.00 73.05  ? 52  GLY B N     1 
ATOM   4129  C CA    . GLY F 3 58  ? -17.202 -24.220 33.843 1.00 75.13  ? 52  GLY B CA    1 
ATOM   4130  C C     . GLY F 3 58  ? -17.231 -24.121 32.328 1.00 73.99  ? 52  GLY B C     1 
ATOM   4131  O O     . GLY F 3 58  ? -17.235 -25.143 31.644 1.00 77.55  ? 52  GLY B O     1 
ATOM   4132  N N     . PHE F 3 59  ? -17.264 -22.906 31.795 1.00 69.79  ? 53  PHE B N     1 
ATOM   4133  C CA    . PHE F 3 59  ? -17.217 -22.703 30.346 1.00 69.05  ? 53  PHE B CA    1 
ATOM   4134  C C     . PHE F 3 59  ? -15.788 -22.566 29.816 1.00 67.48  ? 53  PHE B C     1 
ATOM   4135  O O     . PHE F 3 59  ? -15.503 -22.926 28.668 1.00 68.53  ? 53  PHE B O     1 
ATOM   4136  C CB    . PHE F 3 59  ? -18.062 -21.495 29.934 1.00 66.38  ? 53  PHE B CB    1 
ATOM   4137  C CG    . PHE F 3 59  ? -19.538 -21.672 30.181 1.00 69.09  ? 53  PHE B CG    1 
ATOM   4138  C CD1   . PHE F 3 59  ? -20.255 -22.681 29.535 1.00 72.61  ? 53  PHE B CD1   1 
ATOM   4139  C CD2   . PHE F 3 59  ? -20.221 -20.811 31.037 1.00 68.17  ? 53  PHE B CD2   1 
ATOM   4140  C CE1   . PHE F 3 59  ? -21.621 -22.846 29.760 1.00 75.21  ? 53  PHE B CE1   1 
ATOM   4141  C CE2   . PHE F 3 59  ? -21.594 -20.968 31.272 1.00 70.53  ? 53  PHE B CE2   1 
ATOM   4142  C CZ    . PHE F 3 59  ? -22.293 -21.986 30.634 1.00 74.24  ? 53  PHE B CZ    1 
ATOM   4143  N N     . ILE F 3 60  ? -14.901 -22.034 30.656 1.00 65.23  ? 54  ILE B N     1 
ATOM   4144  C CA    . ILE F 3 60  ? -13.486 -21.868 30.308 1.00 64.02  ? 54  ILE B CA    1 
ATOM   4145  C C     . ILE F 3 60  ? -12.516 -22.413 31.363 1.00 65.23  ? 54  ILE B C     1 
ATOM   4146  O O     . ILE F 3 60  ? -12.882 -22.651 32.510 1.00 66.35  ? 54  ILE B O     1 
ATOM   4147  C CB    . ILE F 3 60  ? -13.119 -20.395 29.977 1.00 59.66  ? 54  ILE B CB    1 
ATOM   4148  C CG1   . ILE F 3 60  ? -13.443 -19.474 31.154 1.00 57.14  ? 54  ILE B CG1   1 
ATOM   4149  C CG2   . ILE F 3 60  ? -13.804 -19.946 28.697 1.00 58.68  ? 54  ILE B CG2   1 
ATOM   4150  C CD1   . ILE F 3 60  ? -13.030 -18.032 30.940 1.00 53.25  ? 54  ILE B CD1   1 
ATOM   4151  N N     . THR F 3 61  ? -11.273 -22.596 30.942 1.00 65.59  ? 55  THR B N     1 
ATOM   4152  C CA    . THR F 3 61  ? -10.216 -23.157 31.763 1.00 66.93  ? 55  THR B CA    1 
ATOM   4153  C C     . THR F 3 61  ? -9.005  -22.261 31.577 1.00 64.56  ? 55  THR B C     1 
ATOM   4154  O O     . THR F 3 61  ? -8.866  -21.638 30.525 1.00 63.09  ? 55  THR B O     1 
ATOM   4155  C CB    . THR F 3 61  ? -9.932  -24.634 31.341 1.00 71.59  ? 55  THR B CB    1 
ATOM   4156  O OG1   . THR F 3 61  ? -10.395 -25.508 32.370 1.00 73.47  ? 55  THR B OG1   1 
ATOM   4157  C CG2   . THR F 3 61  ? -8.442  -24.903 31.076 1.00 72.35  ? 55  THR B CG2   1 
ATOM   4158  N N     . PHE F 3 62  ? -8.155  -22.164 32.600 1.00 64.51  ? 56  PHE B N     1 
ATOM   4159  C CA    . PHE F 3 62  ? -6.896  -21.430 32.469 1.00 62.86  ? 56  PHE B CA    1 
ATOM   4160  C C     . PHE F 3 62  ? -5.704  -22.197 33.021 1.00 65.40  ? 56  PHE B C     1 
ATOM   4161  O O     . PHE F 3 62  ? -5.847  -22.999 33.943 1.00 67.49  ? 56  PHE B O     1 
ATOM   4162  C CB    . PHE F 3 62  ? -6.974  -20.034 33.106 1.00 59.22  ? 56  PHE B CB    1 
ATOM   4163  C CG    . PHE F 3 62  ? -6.941  -20.043 34.605 1.00 59.89  ? 56  PHE B CG    1 
ATOM   4164  C CD1   . PHE F 3 62  ? -5.738  -20.192 35.292 1.00 61.51  ? 56  PHE B CD1   1 
ATOM   4165  C CD2   . PHE F 3 62  ? -8.110  -19.886 35.334 1.00 59.79  ? 56  PHE B CD2   1 
ATOM   4166  C CE1   . PHE F 3 62  ? -5.704  -20.222 36.690 1.00 62.69  ? 56  PHE B CE1   1 
ATOM   4167  C CE2   . PHE F 3 62  ? -8.087  -19.901 36.731 1.00 61.33  ? 56  PHE B CE2   1 
ATOM   4168  C CZ    . PHE F 3 62  ? -6.881  -20.077 37.412 1.00 62.39  ? 56  PHE B CZ    1 
ATOM   4169  N N     . ARG F 3 63  ? -4.540  -21.933 32.431 1.00 65.43  ? 57  ARG B N     1 
ATOM   4170  C CA    . ARG F 3 63  ? -3.248  -22.387 32.937 1.00 67.79  ? 57  ARG B CA    1 
ATOM   4171  C C     . ARG F 3 63  ? -2.380  -21.155 33.167 1.00 65.65  ? 57  ARG B C     1 
ATOM   4172  O O     . ARG F 3 63  ? -2.656  -20.083 32.613 1.00 63.01  ? 57  ARG B O     1 
ATOM   4173  C CB    . ARG F 3 63  ? -2.586  -23.338 31.941 1.00 71.32  ? 57  ARG B CB    1 
ATOM   4174  C CG    . ARG F 3 63  ? -2.279  -22.705 30.608 1.00 69.83  ? 57  ARG B CG    1 
ATOM   4175  C CD    . ARG F 3 63  ? -1.813  -23.718 29.584 1.00 73.52  ? 57  ARG B CD    1 
ATOM   4176  N NE    . ARG F 3 63  ? -1.260  -23.015 28.429 1.00 72.24  ? 57  ARG B NE    1 
ATOM   4177  C CZ    . ARG F 3 63  ? 0.022   -22.698 28.278 1.00 71.67  ? 57  ARG B CZ    1 
ATOM   4178  N NH1   . ARG F 3 63  ? 0.922   -23.035 29.194 1.00 72.49  ? 57  ARG B NH1   1 
ATOM   4179  N NH2   . ARG F 3 63  ? 0.406   -22.042 27.201 1.00 71.42  ? 57  ARG B NH2   1 
ATOM   4180  N N     . THR F 3 64  ? -1.346  -21.284 33.992 1.00 67.19  ? 58  THR B N     1 
ATOM   4181  C CA    . THR F 3 64  ? -0.577  -20.109 34.380 1.00 65.32  ? 58  THR B CA    1 
ATOM   4182  C C     . THR F 3 64  ? 0.823   -20.147 33.801 1.00 67.43  ? 58  THR B C     1 
ATOM   4183  O O     . THR F 3 64  ? 1.701   -20.826 34.330 1.00 70.65  ? 58  THR B O     1 
ATOM   4184  C CB    . THR F 3 64  ? -0.549  -19.894 35.933 1.00 65.16  ? 58  THR B CB    1 
ATOM   4185  O OG1   . THR F 3 64  ? -1.880  -19.947 36.467 1.00 63.85  ? 58  THR B OG1   1 
ATOM   4186  C CG2   . THR F 3 64  ? 0.051   -18.525 36.291 1.00 63.30  ? 58  THR B CG2   1 
ATOM   4187  N N     . THR F 3 65  ? 1.022   -19.411 32.711 1.00 66.75  ? 59  THR B N     1 
ATOM   4188  C CA    . THR F 3 65  ? 2.347   -19.269 32.080 1.00 69.15  ? 59  THR B CA    1 
ATOM   4189  C C     . THR F 3 65  ? 3.104   -18.077 32.665 1.00 67.72  ? 59  THR B C     1 
ATOM   4190  O O     . THR F 3 65  ? 2.517   -17.234 33.340 1.00 64.77  ? 59  THR B O     1 
ATOM   4191  C CB    . THR F 3 65  ? 2.249   -19.044 30.548 1.00 69.38  ? 59  THR B CB    1 
ATOM   4192  O OG1   . THR F 3 65  ? 1.963   -17.662 30.287 1.00 66.92  ? 59  THR B OG1   1 
ATOM   4193  C CG2   . THR F 3 65  ? 1.145   -19.888 29.944 1.00 70.35  ? 59  THR B CG2   1 
ATOM   4194  N N     . ILE F 3 66  ? 4.401   -18.010 32.368 1.00 70.18  ? 60  ILE B N     1 
ATOM   4195  C CA    . ILE F 3 66  ? 5.277   -16.944 32.848 1.00 69.85  ? 60  ILE B CA    1 
ATOM   4196  C C     . ILE F 3 66  ? 6.015   -16.213 31.713 1.00 70.78  ? 60  ILE B C     1 
ATOM   4197  O O     . ILE F 3 66  ? 6.839   -16.801 31.001 1.00 73.71  ? 60  ILE B O     1 
ATOM   4198  C CB    . ILE F 3 66  ? 6.293   -17.486 33.899 1.00 72.57  ? 60  ILE B CB    1 
ATOM   4199  C CG1   . ILE F 3 66  ? 5.656   -17.515 35.289 1.00 71.56  ? 60  ILE B CG1   1 
ATOM   4200  C CG2   . ILE F 3 66  ? 7.576   -16.650 33.944 1.00 74.13  ? 60  ILE B CG2   1 
ATOM   4201  C CD1   . ILE F 3 66  ? 5.445   -18.899 35.848 1.00 73.50  ? 60  ILE B CD1   1 
ATOM   4202  N N     . GLN F 3 67  ? 5.715   -14.923 31.563 1.00 68.54  ? 61  GLN B N     1 
ATOM   4203  C CA    . GLN F 3 67  ? 6.462   -14.043 30.659 1.00 69.75  ? 61  GLN B CA    1 
ATOM   4204  C C     . GLN F 3 67  ? 7.751   -13.544 31.319 1.00 71.53  ? 61  GLN B C     1 
ATOM   4205  O O     . GLN F 3 67  ? 7.751   -13.162 32.493 1.00 70.67  ? 61  GLN B O     1 
ATOM   4206  C CB    . GLN F 3 67  ? 5.603   -12.859 30.248 1.00 66.95  ? 61  GLN B CB    1 
ATOM   4207  C CG    . GLN F 3 67  ? 4.427   -13.228 29.346 1.00 67.18  ? 61  GLN B CG    1 
ATOM   4208  C CD    . GLN F 3 67  ? 4.779   -13.242 27.867 1.00 71.01  ? 61  GLN B CD    1 
ATOM   4209  O OE1   . GLN F 3 67  ? 4.310   -14.102 27.114 1.00 73.29  ? 61  GLN B OE1   1 
ATOM   4210  N NE2   . GLN F 3 67  ? 5.601   -12.283 27.440 1.00 72.70  ? 61  GLN B NE2   1 
ATOM   4211  N N     . GLY F 3 68  ? 8.847   -13.552 30.564 1.00 74.49  ? 62  GLY B N     1 
ATOM   4212  C CA    . GLY F 3 68  ? 10.145  -13.158 31.088 1.00 76.59  ? 62  GLY B CA    1 
ATOM   4213  C C     . GLY F 3 68  ? 10.653  -14.105 32.161 1.00 78.10  ? 62  GLY B C     1 
ATOM   4214  O O     . GLY F 3 68  ? 11.137  -15.193 31.862 1.00 81.03  ? 62  GLY B O     1 
ATOM   4215  N N     . THR F 3 69  ? 10.530  -13.685 33.416 1.00 76.44  ? 63  THR B N     1 
ATOM   4216  C CA    . THR F 3 69  ? 11.105  -14.410 34.544 1.00 78.10  ? 63  THR B CA    1 
ATOM   4217  C C     . THR F 3 69  ? 10.104  -14.623 35.682 1.00 75.36  ? 63  THR B C     1 
ATOM   4218  O O     . THR F 3 69  ? 10.021  -15.725 36.231 1.00 76.57  ? 63  THR B O     1 
ATOM   4219  C CB    . THR F 3 69  ? 12.385  -13.699 35.049 1.00 80.69  ? 63  THR B CB    1 
ATOM   4220  O OG1   . THR F 3 69  ? 13.430  -13.905 34.095 1.00 84.45  ? 63  THR B OG1   1 
ATOM   4221  C CG2   . THR F 3 69  ? 12.846  -14.232 36.408 1.00 82.31  ? 63  THR B CG2   1 
ATOM   4222  N N     . LYS F 3 70  ? 9.343   -13.583 36.028 1.00 71.87  ? 64  LYS B N     1 
ATOM   4223  C CA    . LYS F 3 70  ? 8.438   -13.666 37.172 1.00 69.74  ? 64  LYS B CA    1 
ATOM   4224  C C     . LYS F 3 70  ? 7.049   -13.039 36.997 1.00 65.92  ? 64  LYS B C     1 
ATOM   4225  O O     . LYS F 3 70  ? 6.290   -12.967 37.962 1.00 64.55  ? 64  LYS B O     1 
ATOM   4226  C CB    . LYS F 3 70  ? 9.117   -13.153 38.455 1.00 71.06  ? 64  LYS B CB    1 
ATOM   4227  C CG    . LYS F 3 70  ? 9.745   -11.765 38.370 1.00 71.48  ? 64  LYS B CG    1 
ATOM   4228  C CD    . LYS F 3 70  ? 10.258  -11.326 39.746 1.00 73.56  ? 64  LYS B CD    1 
ATOM   4229  C CE    . LYS F 3 70  ? 11.574  -10.541 39.656 1.00 76.25  ? 64  LYS B CE    1 
ATOM   4230  N N     . LEU F 3 71  ? 6.715   -12.601 35.782 1.00 64.59  ? 65  LEU B N     1 
ATOM   4231  C CA    . LEU F 3 71  ? 5.379   -12.058 35.482 1.00 61.05  ? 65  LEU B CA    1 
ATOM   4232  C C     . LEU F 3 71  ? 4.356   -13.136 35.102 1.00 60.51  ? 65  LEU B C     1 
ATOM   4233  O O     . LEU F 3 71  ? 4.422   -13.703 34.009 1.00 61.63  ? 65  LEU B O     1 
ATOM   4234  C CB    . LEU F 3 71  ? 5.450   -10.987 34.382 1.00 60.08  ? 65  LEU B CB    1 
ATOM   4235  C CG    . LEU F 3 71  ? 4.153   -10.244 33.976 1.00 56.76  ? 65  LEU B CG    1 
ATOM   4236  C CD1   . LEU F 3 71  ? 3.382   -9.675  35.178 1.00 52.75  ? 65  LEU B CD1   1 
ATOM   4237  C CD2   . LEU F 3 71  ? 4.398   -9.152  32.913 1.00 54.67  ? 65  LEU B CD2   1 
ATOM   4238  N N     . GLU F 3 72  ? 3.407   -13.406 35.999 1.00 59.41  ? 66  GLU B N     1 
ATOM   4239  C CA    . GLU F 3 72  ? 2.348   -14.383 35.722 1.00 59.33  ? 66  GLU B CA    1 
ATOM   4240  C C     . GLU F 3 72  ? 1.286   -13.858 34.778 1.00 56.58  ? 66  GLU B C     1 
ATOM   4241  O O     . GLU F 3 72  ? 0.991   -12.657 34.726 1.00 54.86  ? 66  GLU B O     1 
ATOM   4242  C CB    . GLU F 3 72  ? 1.689   -14.882 37.004 1.00 59.70  ? 66  GLU B CB    1 
ATOM   4243  C CG    . GLU F 3 72  ? 2.518   -15.908 37.739 1.00 67.05  ? 66  GLU B CG    1 
ATOM   4244  C CD    . GLU F 3 72  ? 1.968   -16.217 39.111 1.00 72.78  ? 66  GLU B CD    1 
ATOM   4245  O OE1   . GLU F 3 72  ? 2.414   -15.566 40.085 1.00 76.14  ? 66  GLU B OE1   1 
ATOM   4246  O OE2   . GLU F 3 72  ? 1.085   -17.099 39.213 1.00 75.35  ? 66  GLU B OE2   1 
ATOM   4247  N N     . LYS F 3 73  ? 0.699   -14.795 34.054 1.00 56.68  ? 67  LYS B N     1 
ATOM   4248  C CA    . LYS F 3 73  ? -0.240  -14.526 32.992 1.00 54.88  ? 67  LYS B CA    1 
ATOM   4249  C C     . LYS F 3 73  ? -1.179  -15.740 32.983 1.00 55.78  ? 67  LYS B C     1 
ATOM   4250  O O     . LYS F 3 73  ? -0.757  -16.848 33.345 1.00 58.26  ? 67  LYS B O     1 
ATOM   4251  C CB    . LYS F 3 73  ? 0.567   -14.460 31.712 1.00 56.07  ? 67  LYS B CB    1 
ATOM   4252  C CG    . LYS F 3 73  ? -0.087  -13.861 30.529 1.00 55.07  ? 67  LYS B CG    1 
ATOM   4253  C CD    . LYS F 3 73  ? 1.003   -13.666 29.518 1.00 57.61  ? 67  LYS B CD    1 
ATOM   4254  C CE    . LYS F 3 73  ? 0.469   -13.570 28.118 1.00 58.93  ? 67  LYS B CE    1 
ATOM   4255  N NZ    . LYS F 3 73  ? 1.606   -13.502 27.159 1.00 61.82  ? 67  LYS B NZ    1 
ATOM   4256  N N     . LYS F 3 74  ? -2.439  -15.546 32.598 1.00 53.92  ? 68  LYS B N     1 
ATOM   4257  C CA    . LYS F 3 74  ? -3.404  -16.650 32.587 1.00 54.80  ? 68  LYS B CA    1 
ATOM   4258  C C     . LYS F 3 74  ? -4.025  -16.919 31.215 1.00 55.50  ? 68  LYS B C     1 
ATOM   4259  O O     . LYS F 3 74  ? -4.866  -16.144 30.741 1.00 53.87  ? 68  LYS B O     1 
ATOM   4260  C CB    . LYS F 3 74  ? -4.514  -16.410 33.603 1.00 53.13  ? 68  LYS B CB    1 
ATOM   4261  C CG    . LYS F 3 74  ? -4.097  -16.541 35.032 1.00 53.35  ? 68  LYS B CG    1 
ATOM   4262  C CD    . LYS F 3 74  ? -5.317  -16.484 35.913 1.00 53.25  ? 68  LYS B CD    1 
ATOM   4263  C CE    . LYS F 3 74  ? -4.940  -16.090 37.322 1.00 53.38  ? 68  LYS B CE    1 
ATOM   4264  N NZ    . LYS F 3 74  ? -6.115  -16.117 38.220 1.00 54.25  ? 68  LYS B NZ    1 
ATOM   4265  N N     . MET F 3 75  ? -3.634  -18.030 30.594 1.00 58.37  ? 69  MET B N     1 
ATOM   4266  C CA    . MET F 3 75  ? -4.174  -18.403 29.286 1.00 59.50  ? 69  MET B CA    1 
ATOM   4267  C C     . MET F 3 75  ? -5.510  -19.124 29.438 1.00 59.71  ? 69  MET B C     1 
ATOM   4268  O O     . MET F 3 75  ? -5.632  -20.010 30.276 1.00 61.81  ? 69  MET B O     1 
ATOM   4269  C CB    . MET F 3 75  ? -3.172  -19.269 28.515 1.00 63.01  ? 69  MET B CB    1 
ATOM   4270  C CG    . MET F 3 75  ? -1.921  -18.529 28.042 1.00 64.22  ? 69  MET B CG    1 
ATOM   4271  S SD    . MET F 3 75  ? -2.131  -16.733 27.944 1.00 63.32  ? 69  MET B SD    1 
ATOM   4272  C CE    . MET F 3 75  ? -1.619  -16.378 26.259 1.00 64.89  ? 69  MET B CE    1 
ATOM   4273  N N     . TYR F 3 76  ? -6.504  -18.753 28.632 1.00 58.17  ? 70  TYR B N     1 
ATOM   4274  C CA    . TYR F 3 76  ? -7.836  -19.351 28.745 1.00 58.41  ? 70  TYR B CA    1 
ATOM   4275  C C     . TYR F 3 76  ? -8.230  -20.190 27.527 1.00 61.24  ? 70  TYR B C     1 
ATOM   4276  O O     . TYR F 3 76  ? -8.087  -19.738 26.400 1.00 61.47  ? 70  TYR B O     1 
ATOM   4277  C CB    . TYR F 3 76  ? -8.897  -18.275 28.993 1.00 55.14  ? 70  TYR B CB    1 
ATOM   4278  C CG    . TYR F 3 76  ? -8.856  -17.666 30.380 1.00 53.13  ? 70  TYR B CG    1 
ATOM   4279  C CD1   . TYR F 3 76  ? -9.573  -18.230 31.440 1.00 52.92  ? 70  TYR B CD1   1 
ATOM   4280  C CD2   . TYR F 3 76  ? -8.110  -16.515 30.631 1.00 49.88  ? 70  TYR B CD2   1 
ATOM   4281  C CE1   . TYR F 3 76  ? -9.544  -17.664 32.714 1.00 50.85  ? 70  TYR B CE1   1 
ATOM   4282  C CE2   . TYR F 3 76  ? -8.070  -15.951 31.891 1.00 48.49  ? 70  TYR B CE2   1 
ATOM   4283  C CZ    . TYR F 3 76  ? -8.786  -16.523 32.931 1.00 49.36  ? 70  TYR B CZ    1 
ATOM   4284  O OH    . TYR F 3 76  ? -8.739  -15.932 34.181 1.00 49.12  ? 70  TYR B OH    1 
ATOM   4285  N N     . THR F 3 77  ? -8.733  -21.401 27.762 1.00 63.77  ? 71  THR B N     1 
ATOM   4286  C CA    . THR F 3 77  ? -9.265  -22.253 26.693 1.00 67.07  ? 71  THR B CA    1 
ATOM   4287  C C     . THR F 3 77  ? -10.759 -22.511 26.881 1.00 67.12  ? 71  THR B C     1 
ATOM   4288  O O     . THR F 3 77  ? -11.244 -22.645 28.009 1.00 66.77  ? 71  THR B O     1 
ATOM   4289  C CB    . THR F 3 77  ? -8.576  -23.652 26.650 1.00 71.59  ? 71  THR B CB    1 
ATOM   4290  O OG1   . THR F 3 77  ? -8.340  -24.114 27.987 1.00 72.73  ? 71  THR B OG1   1 
ATOM   4291  C CG2   . THR F 3 77  ? -7.255  -23.614 25.886 1.00 73.20  ? 71  THR B CG2   1 
ATOM   4292  N N     . LEU F 3 78  ? -11.488 -22.606 25.777 1.00 67.70  ? 72  LEU B N     1 
ATOM   4293  C CA    . LEU F 3 78  ? -12.864 -23.048 25.849 1.00 68.68  ? 72  LEU B CA    1 
ATOM   4294  C C     . LEU F 3 78  ? -12.931 -24.503 26.308 1.00 73.00  ? 72  LEU B C     1 
ATOM   4295  O O     . LEU F 3 78  ? -12.046 -25.305 25.992 1.00 75.60  ? 72  LEU B O     1 
ATOM   4296  C CB    . LEU F 3 78  ? -13.531 -22.911 24.485 1.00 69.66  ? 72  LEU B CB    1 
ATOM   4297  C CG    . LEU F 3 78  ? -13.878 -21.496 24.039 1.00 66.14  ? 72  LEU B CG    1 
ATOM   4298  C CD1   . LEU F 3 78  ? -14.412 -21.498 22.611 1.00 68.02  ? 72  LEU B CD1   1 
ATOM   4299  C CD2   . LEU F 3 78  ? -14.884 -20.882 24.992 1.00 63.34  ? 72  LEU B CD2   1 
ATOM   4300  N N     . THR F 3 79  ? -13.977 -24.827 27.067 1.00 73.94  ? 73  THR B N     1 
ATOM   4301  C CA    . THR F 3 79  ? -14.292 -26.207 27.437 1.00 78.49  ? 73  THR B CA    1 
ATOM   4302  C C     . THR F 3 79  ? -15.339 -26.755 26.479 1.00 81.81  ? 73  THR B C     1 
ATOM   4303  O O     . THR F 3 79  ? -15.800 -26.048 25.578 1.00 80.24  ? 73  THR B O     1 
ATOM   4304  C CB    . THR F 3 79  ? -14.863 -26.321 28.874 1.00 78.40  ? 73  THR B CB    1 
ATOM   4305  O OG1   . THR F 3 79  ? -16.127 -25.650 28.947 1.00 77.09  ? 73  THR B OG1   1 
ATOM   4306  C CG2   . THR F 3 79  ? -13.909 -25.729 29.905 1.00 75.53  ? 73  THR B CG2   1 
ATOM   4307  N N     . ASP F 3 80  ? -15.718 -28.014 26.684 1.00 86.81  ? 74  ASP B N     1 
ATOM   4308  C CA    . ASP F 3 80  ? -16.813 -28.616 25.941 1.00 90.37  ? 74  ASP B CA    1 
ATOM   4309  C C     . ASP F 3 80  ? -18.073 -27.776 26.141 1.00 87.78  ? 74  ASP B C     1 
ATOM   4310  O O     . ASP F 3 80  ? -18.707 -27.373 25.168 1.00 87.48  ? 74  ASP B O     1 
ATOM   4311  C CB    . ASP F 3 80  ? -17.029 -30.077 26.365 1.00 96.46  ? 74  ASP B CB    1 
ATOM   4312  N N     . SER F 3 81  ? -18.408 -27.490 27.399 1.00 86.17  ? 75  SER B N     1 
ATOM   4313  C CA    . SER F 3 81  ? -19.535 -26.610 27.732 1.00 84.11  ? 75  SER B CA    1 
ATOM   4314  C C     . SER F 3 81  ? -19.451 -25.293 26.977 1.00 79.54  ? 75  SER B C     1 
ATOM   4315  O O     . SER F 3 81  ? -20.427 -24.862 26.365 1.00 79.45  ? 75  SER B O     1 
ATOM   4316  C CB    . SER F 3 81  ? -19.571 -26.305 29.231 1.00 82.64  ? 75  SER B CB    1 
ATOM   4317  O OG    . SER F 3 81  ? -19.377 -27.481 29.989 1.00 87.52  ? 75  SER B OG    1 
ATOM   4318  N N     . GLY F 3 82  ? -18.274 -24.671 27.026 1.00 76.20  ? 76  GLY B N     1 
ATOM   4319  C CA    . GLY F 3 82  ? -18.035 -23.362 26.428 1.00 72.15  ? 76  GLY B CA    1 
ATOM   4320  C C     . GLY F 3 82  ? -18.332 -23.273 24.946 1.00 73.22  ? 76  GLY B C     1 
ATOM   4321  O O     . GLY F 3 82  ? -18.995 -22.334 24.511 1.00 71.66  ? 76  GLY B O     1 
ATOM   4322  N N     . LYS F 3 83  ? -17.836 -24.245 24.180 1.00 76.56  ? 77  LYS B N     1 
ATOM   4323  C CA    . LYS F 3 83  ? -18.041 -24.316 22.727 1.00 78.49  ? 77  LYS B CA    1 
ATOM   4324  C C     . LYS F 3 83  ? -19.520 -24.395 22.369 1.00 80.36  ? 77  LYS B C     1 
ATOM   4325  O O     . LYS F 3 83  ? -19.981 -23.703 21.462 1.00 79.59  ? 77  LYS B O     1 
ATOM   4326  C CB    . LYS F 3 83  ? -17.291 -25.521 22.128 1.00 82.78  ? 77  LYS B CB    1 
ATOM   4327  N N     . GLN F 3 84  ? -20.248 -25.246 23.093 1.00 83.22  ? 78  GLN B N     1 
ATOM   4328  C CA    . GLN F 3 84  ? -21.685 -25.444 22.902 1.00 85.73  ? 78  GLN B CA    1 
ATOM   4329  C C     . GLN F 3 84  ? -22.474 -24.180 23.271 1.00 81.93  ? 78  GLN B C     1 
ATOM   4330  O O     . GLN F 3 84  ? -23.256 -23.668 22.462 1.00 81.69  ? 78  GLN B O     1 
ATOM   4331  C CB    . GLN F 3 84  ? -22.165 -26.643 23.731 1.00 89.83  ? 78  GLN B CB    1 
ATOM   4332  C CG    . GLN F 3 84  ? -23.636 -26.996 23.558 1.00 93.35  ? 78  GLN B CG    1 
ATOM   4333  C CD    . GLN F 3 84  ? -23.960 -27.554 22.179 1.00 98.08  ? 78  GLN B CD    1 
ATOM   4334  O OE1   . GLN F 3 84  ? -23.230 -28.392 21.634 1.00 100.94 ? 78  GLN B OE1   1 
ATOM   4335  N NE2   . GLN F 3 84  ? -25.074 -27.095 21.613 1.00 98.54  ? 78  GLN B NE2   1 
ATOM   4336  N N     . GLU F 3 85  ? -22.260 -23.697 24.497 1.00 78.97  ? 79  GLU B N     1 
ATOM   4337  C CA    . GLU F 3 85  ? -22.842 -22.443 24.980 1.00 75.61  ? 79  GLU B CA    1 
ATOM   4338  C C     . GLU F 3 85  ? -22.672 -21.324 23.945 1.00 72.52  ? 79  GLU B C     1 
ATOM   4339  O O     . GLU F 3 85  ? -23.640 -20.639 23.597 1.00 72.08  ? 79  GLU B O     1 
ATOM   4340  C CB    . GLU F 3 85  ? -22.215 -22.053 26.322 1.00 72.77  ? 79  GLU B CB    1 
ATOM   4341  C CG    . GLU F 3 85  ? -22.903 -20.891 27.046 1.00 71.34  ? 79  GLU B CG    1 
ATOM   4342  C CD    . GLU F 3 85  ? -24.263 -21.254 27.653 1.00 75.79  ? 79  GLU B CD    1 
ATOM   4343  O OE1   . GLU F 3 85  ? -24.612 -22.465 27.725 1.00 79.19  ? 79  GLU B OE1   1 
ATOM   4344  O OE2   . GLU F 3 85  ? -24.978 -20.303 28.061 1.00 74.24  ? 79  GLU B OE2   1 
ATOM   4345  N N     . LEU F 3 86  ? -21.446 -21.176 23.445 1.00 70.82  ? 80  LEU B N     1 
ATOM   4346  C CA    . LEU F 3 86  ? -21.142 -20.292 22.320 1.00 69.43  ? 80  LEU B CA    1 
ATOM   4347  C C     . LEU F 3 86  ? -22.037 -20.528 21.094 1.00 72.76  ? 80  LEU B C     1 
ATOM   4348  O O     . LEU F 3 86  ? -22.673 -19.589 20.584 1.00 71.31  ? 80  LEU B O     1 
ATOM   4349  C CB    . LEU F 3 86  ? -19.666 -20.436 21.923 1.00 68.76  ? 80  LEU B CB    1 
ATOM   4350  C CG    . LEU F 3 86  ? -19.184 -19.634 20.711 1.00 68.20  ? 80  LEU B CG    1 
ATOM   4351  C CD1   . LEU F 3 86  ? -19.127 -18.134 21.030 1.00 63.13  ? 80  LEU B CD1   1 
ATOM   4352  C CD2   . LEU F 3 86  ? -17.837 -20.140 20.231 1.00 68.65  ? 80  LEU B CD2   1 
ATOM   4353  N N     . HIS F 3 87  ? -22.073 -21.786 20.640 1.00 77.32  ? 81  HIS B N     1 
ATOM   4354  C CA    . HIS F 3 87  ? -22.828 -22.199 19.460 1.00 81.40  ? 81  HIS B CA    1 
ATOM   4355  C C     . HIS F 3 87  ? -24.334 -21.980 19.607 1.00 82.71  ? 81  HIS B C     1 
ATOM   4356  O O     . HIS F 3 87  ? -24.995 -21.563 18.653 1.00 84.14  ? 81  HIS B O     1 
ATOM   4357  C CB    . HIS F 3 87  ? -22.538 -23.670 19.131 1.00 86.50  ? 81  HIS B CB    1 
ATOM   4358  C CG    . HIS F 3 87  ? -23.089 -24.118 17.812 1.00 90.99  ? 81  HIS B CG    1 
ATOM   4359  N ND1   . HIS F 3 87  ? -22.390 -23.987 16.632 1.00 92.21  ? 81  HIS B ND1   1 
ATOM   4360  C CD2   . HIS F 3 87  ? -24.275 -24.687 17.487 1.00 95.13  ? 81  HIS B CD2   1 
ATOM   4361  C CE1   . HIS F 3 87  ? -23.118 -24.463 15.637 1.00 97.15  ? 81  HIS B CE1   1 
ATOM   4362  N NE2   . HIS F 3 87  ? -24.267 -24.892 16.128 1.00 98.65  ? 81  HIS B NE2   1 
ATOM   4363  N N     . ASP F 3 88  ? -24.877 -22.266 20.790 1.00 82.89  ? 82  ASP B N     1 
ATOM   4364  C CA    . ASP F 3 88  ? -26.313 -22.098 21.035 1.00 84.56  ? 82  ASP B CA    1 
ATOM   4365  C C     . ASP F 3 88  ? -26.710 -20.624 20.959 1.00 81.10  ? 82  ASP B C     1 
ATOM   4366  O O     . ASP F 3 88  ? -27.855 -20.301 20.640 1.00 83.01  ? 82  ASP B O     1 
ATOM   4367  C CB    . ASP F 3 88  ? -26.732 -22.696 22.386 1.00 85.66  ? 82  ASP B CB    1 
ATOM   4368  C CG    . ASP F 3 88  ? -26.692 -24.227 22.405 1.00 91.12  ? 82  ASP B CG    1 
ATOM   4369  O OD1   . ASP F 3 88  ? -26.965 -24.877 21.366 1.00 95.10  ? 82  ASP B OD1   1 
ATOM   4370  O OD2   . ASP F 3 88  ? -26.401 -24.789 23.482 1.00 92.06  ? 82  ASP B OD2   1 
ATOM   4371  N N     . TRP F 3 89  ? -25.758 -19.742 21.257 1.00 76.70  ? 83  TRP B N     1 
ATOM   4372  C CA    . TRP F 3 89  ? -25.954 -18.300 21.138 1.00 73.24  ? 83  TRP B CA    1 
ATOM   4373  C C     . TRP F 3 89  ? -25.828 -17.841 19.689 1.00 73.97  ? 83  TRP B C     1 
ATOM   4374  O O     . TRP F 3 89  ? -26.643 -17.043 19.218 1.00 73.95  ? 83  TRP B O     1 
ATOM   4375  C CB    . TRP F 3 89  ? -24.950 -17.559 22.016 1.00 68.68  ? 83  TRP B CB    1 
ATOM   4376  C CG    . TRP F 3 89  ? -24.986 -16.044 21.907 1.00 65.39  ? 83  TRP B CG    1 
ATOM   4377  C CD1   . TRP F 3 89  ? -25.909 -15.203 22.461 1.00 64.03  ? 83  TRP B CD1   1 
ATOM   4378  C CD2   . TRP F 3 89  ? -24.036 -15.202 21.232 1.00 62.57  ? 83  TRP B CD2   1 
ATOM   4379  N NE1   . TRP F 3 89  ? -25.604 -13.897 22.160 1.00 60.96  ? 83  TRP B NE1   1 
ATOM   4380  C CE2   . TRP F 3 89  ? -24.463 -13.867 21.406 1.00 60.01  ? 83  TRP B CE2   1 
ATOM   4381  C CE3   . TRP F 3 89  ? -22.872 -15.449 20.490 1.00 62.32  ? 83  TRP B CE3   1 
ATOM   4382  C CZ2   . TRP F 3 89  ? -23.772 -12.783 20.867 1.00 57.88  ? 83  TRP B CZ2   1 
ATOM   4383  C CZ3   . TRP F 3 89  ? -22.183 -14.370 19.953 1.00 60.60  ? 83  TRP B CZ3   1 
ATOM   4384  C CH2   . TRP F 3 89  ? -22.638 -13.051 20.147 1.00 58.51  ? 83  TRP B CH2   1 
ATOM   4385  N N     . LEU F 3 90  ? -24.818 -18.360 18.987 1.00 74.86  ? 84  LEU B N     1 
ATOM   4386  C CA    . LEU F 3 90  ? -24.494 -17.901 17.633 1.00 75.68  ? 84  LEU B CA    1 
ATOM   4387  C C     . LEU F 3 90  ? -25.641 -17.975 16.629 1.00 79.48  ? 84  LEU B C     1 
ATOM   4388  O O     . LEU F 3 90  ? -25.909 -17.004 15.920 1.00 78.95  ? 84  LEU B O     1 
ATOM   4389  C CB    . LEU F 3 90  ? -23.262 -18.626 17.075 1.00 76.86  ? 84  LEU B CB    1 
ATOM   4390  C CG    . LEU F 3 90  ? -21.877 -18.015 17.324 1.00 73.37  ? 84  LEU B CG    1 
ATOM   4391  C CD1   . LEU F 3 90  ? -20.858 -18.794 16.515 1.00 75.84  ? 84  LEU B CD1   1 
ATOM   4392  C CD2   . LEU F 3 90  ? -21.811 -16.532 16.961 1.00 69.28  ? 84  LEU B CD2   1 
ATOM   4393  N N     . ILE F 3 91  ? -26.309 -19.127 16.572 1.00 83.81  ? 85  ILE B N     1 
ATOM   4394  C CA    . ILE F 3 91  ? -27.347 -19.368 15.572 1.00 88.40  ? 85  ILE B CA    1 
ATOM   4395  C C     . ILE F 3 91  ? -28.735 -18.969 16.063 1.00 89.03  ? 85  ILE B C     1 
ATOM   4396  O O     . ILE F 3 91  ? -29.715 -19.057 15.316 1.00 92.82  ? 85  ILE B O     1 
ATOM   4397  C CB    . ILE F 3 91  ? -27.345 -20.847 15.041 1.00 93.72  ? 85  ILE B CB    1 
ATOM   4398  C CG1   . ILE F 3 91  ? -27.531 -21.865 16.174 1.00 95.08  ? 85  ILE B CG1   1 
ATOM   4399  C CG2   . ILE F 3 91  ? -26.082 -21.138 14.245 1.00 94.28  ? 85  ILE B CG2   1 
ATOM   4400  C CD1   . ILE F 3 91  ? -28.971 -22.324 16.361 1.00 98.41  ? 85  ILE B CD1   1 
ATOM   4401  N N     . ARG F 3 92  ? -28.813 -18.549 17.320 1.00 86.38  ? 86  ARG B N     1 
ATOM   4402  C CA    . ARG F 3 92  ? -30.062 -18.065 17.905 1.00 87.20  ? 86  ARG B CA    1 
ATOM   4403  C C     . ARG F 3 92  ? -30.485 -16.766 17.229 1.00 85.95  ? 86  ARG B C     1 
ATOM   4404  O O     . ARG F 3 92  ? -29.696 -15.828 17.130 1.00 82.59  ? 86  ARG B O     1 
ATOM   4405  C CB    . ARG F 3 92  ? -29.902 -17.854 19.413 1.00 84.32  ? 86  ARG B CB    1 
ATOM   4406  C CG    . ARG F 3 92  ? -31.149 -18.197 20.221 1.00 88.56  ? 86  ARG B CG    1 
ATOM   4407  C CD    . ARG F 3 92  ? -30.977 -17.896 21.718 1.00 88.69  ? 86  ARG B CD    1 
ATOM   4408  N NE    . ARG F 3 92  ? -30.023 -18.798 22.372 1.00 89.55  ? 86  ARG B NE    1 
ATOM   4409  C CZ    . ARG F 3 92  ? -28.939 -18.402 23.036 1.00 86.46  ? 86  ARG B CZ    1 
ATOM   4410  N NH1   . ARG F 3 92  ? -28.653 -17.105 23.156 1.00 83.84  ? 86  ARG B NH1   1 
ATOM   4411  N NH2   . ARG F 3 92  ? -28.140 -19.302 23.591 1.00 86.50  ? 86  ARG B NH2   1 
ATOM   4412  N N     . HIS F 3 93  ? -31.720 -16.731 16.740 1.00 87.29  ? 87  HIS B N     1 
ATOM   4413  C CA    . HIS F 3 93  ? -32.274 -15.530 16.126 1.00 85.57  ? 87  HIS B CA    1 
ATOM   4414  C C     . HIS F 3 93  ? -32.718 -14.554 17.221 1.00 82.96  ? 87  HIS B C     1 
ATOM   4415  O O     . HIS F 3 93  ? -33.485 -14.911 18.121 1.00 84.29  ? 87  HIS B O     1 
ATOM   4416  C CB    . HIS F 3 93  ? -33.459 -15.876 15.218 1.00 88.69  ? 87  HIS B CB    1 
ATOM   4417  C CG    . HIS F 3 93  ? -33.112 -16.769 14.063 1.00 92.43  ? 87  HIS B CG    1 
ATOM   4418  N ND1   . HIS F 3 93  ? -33.337 -16.408 12.753 1.00 93.35  ? 87  HIS B ND1   1 
ATOM   4419  C CD2   . HIS F 3 93  ? -32.586 -18.018 14.020 1.00 95.72  ? 87  HIS B CD2   1 
ATOM   4420  C CE1   . HIS F 3 93  ? -32.954 -17.386 11.953 1.00 96.63  ? 87  HIS B CE1   1 
ATOM   4421  N NE2   . HIS F 3 93  ? -32.491 -18.374 12.697 1.00 97.94  ? 87  HIS B NE2   1 
ATOM   4422  N N     . GLN F 3 94  ? -32.226 -13.326 17.150 1.00 79.64  ? 88  GLN B N     1 
ATOM   4423  C CA    . GLN F 3 94  ? -32.563 -12.333 18.160 1.00 77.61  ? 88  GLN B CA    1 
ATOM   4424  C C     . GLN F 3 94  ? -33.297 -11.159 17.534 1.00 75.91  ? 88  GLN B C     1 
ATOM   4425  O O     . GLN F 3 94  ? -33.038 -10.818 16.373 1.00 75.69  ? 88  GLN B O     1 
ATOM   4426  C CB    . GLN F 3 94  ? -31.306 -11.853 18.888 1.00 75.17  ? 88  GLN B CB    1 
ATOM   4427  C CG    . GLN F 3 94  ? -30.649 -12.921 19.763 1.00 77.68  ? 88  GLN B CG    1 
ATOM   4428  C CD    . GLN F 3 94  ? -29.336 -12.454 20.364 1.00 77.64  ? 88  GLN B CD    1 
ATOM   4429  O OE1   . GLN F 3 94  ? -28.480 -13.267 20.719 1.00 80.23  ? 88  GLN B OE1   1 
ATOM   4430  N NE2   . GLN F 3 94  ? -29.164 -11.139 20.469 1.00 73.86  ? 88  GLN B NE2   1 
ATOM   4431  N N     . PRO F 3 95  ? -34.228 -10.545 18.289 1.00 75.14  ? 89  PRO B N     1 
ATOM   4432  C CA    . PRO F 3 95  ? -34.917 -9.358  17.766 1.00 73.50  ? 89  PRO B CA    1 
ATOM   4433  C C     . PRO F 3 95  ? -33.926 -8.224  17.577 1.00 69.54  ? 89  PRO B C     1 
ATOM   4434  O O     . PRO F 3 95  ? -33.008 -8.086  18.368 1.00 68.11  ? 89  PRO B O     1 
ATOM   4435  C CB    . PRO F 3 95  ? -35.930 -9.011  18.871 1.00 73.76  ? 89  PRO B CB    1 
ATOM   4436  C CG    . PRO F 3 95  ? -35.404 -9.666  20.113 1.00 74.31  ? 89  PRO B CG    1 
ATOM   4437  C CD    . PRO F 3 95  ? -34.699 -10.916 19.638 1.00 76.15  ? 89  PRO B CD    1 
ATOM   4438  N N     . ILE F 3 96  ? -34.084 -7.432  16.529 1.00 68.53  ? 90  ILE B N     1 
ATOM   4439  C CA    . ILE F 3 96  ? -33.215 -6.277  16.370 1.00 65.57  ? 90  ILE B CA    1 
ATOM   4440  C C     . ILE F 3 96  ? -33.591 -5.196  17.406 1.00 62.95  ? 90  ILE B C     1 
ATOM   4441  O O     . ILE F 3 96  ? -34.774 -4.976  17.677 1.00 63.61  ? 90  ILE B O     1 
ATOM   4442  C CB    . ILE F 3 96  ? -33.234 -5.704  14.931 1.00 65.99  ? 90  ILE B CB    1 
ATOM   4443  C CG1   . ILE F 3 96  ? -34.257 -4.570  14.810 1.00 66.17  ? 90  ILE B CG1   1 
ATOM   4444  C CG2   . ILE F 3 96  ? -33.498 -6.799  13.906 1.00 69.25  ? 90  ILE B CG2   1 
ATOM   4445  C CD1   . ILE F 3 96  ? -34.078 -3.729  13.583 1.00 67.61  ? 90  ILE B CD1   1 
ATOM   4446  N N     . PRO F 3 97  ? -32.585 -4.537  18.005 1.00 60.21  ? 91  PRO B N     1 
ATOM   4447  C CA    . PRO F 3 97  ? -32.896 -3.505  18.997 1.00 58.22  ? 91  PRO B CA    1 
ATOM   4448  C C     . PRO F 3 97  ? -33.607 -2.321  18.355 1.00 57.35  ? 91  PRO B C     1 
ATOM   4449  O O     . PRO F 3 97  ? -33.318 -1.981  17.207 1.00 57.25  ? 91  PRO B O     1 
ATOM   4450  C CB    . PRO F 3 97  ? -31.514 -3.076  19.494 1.00 56.02  ? 91  PRO B CB    1 
ATOM   4451  C CG    . PRO F 3 97  ? -30.592 -3.408  18.364 1.00 56.53  ? 91  PRO B CG    1 
ATOM   4452  C CD    . PRO F 3 97  ? -31.133 -4.678  17.793 1.00 59.00  ? 91  PRO B CD    1 
ATOM   4453  N N     . GLU F 3 98  ? -34.533 -1.706  19.081 1.00 57.23  ? 92  GLU B N     1 
ATOM   4454  C CA    . GLU F 3 98  ? -35.191 -0.493  18.583 1.00 56.55  ? 92  GLU B CA    1 
ATOM   4455  C C     . GLU F 3 98  ? -34.194 0.668   18.586 1.00 53.71  ? 92  GLU B C     1 
ATOM   4456  O O     . GLU F 3 98  ? -34.040 1.366   17.579 1.00 53.89  ? 92  GLU B O     1 
ATOM   4457  C CB    . GLU F 3 98  ? -36.444 -0.149  19.406 1.00 57.43  ? 92  GLU B CB    1 
ATOM   4458  N N     . THR F 3 99  ? -33.498 0.829   19.707 1.00 51.60  ? 93  THR B N     1 
ATOM   4459  C CA    . THR F 3 99  ? -32.552 1.925   19.921 1.00 48.91  ? 93  THR B CA    1 
ATOM   4460  C C     . THR F 3 99  ? -31.101 1.509   19.662 1.00 47.92  ? 93  THR B C     1 
ATOM   4461  O O     . THR F 3 99  ? -30.663 0.457   20.123 1.00 48.03  ? 93  THR B O     1 
ATOM   4462  C CB    . THR F 3 99  ? -32.624 2.387   21.388 1.00 48.30  ? 93  THR B CB    1 
ATOM   4463  O OG1   . THR F 3 99  ? -33.989 2.612   21.758 1.00 48.66  ? 93  THR B OG1   1 
ATOM   4464  C CG2   . THR F 3 99  ? -31.788 3.628   21.619 1.00 46.20  ? 93  THR B CG2   1 
ATOM   4465  N N     . VAL F 3 100 ? -30.360 2.334   18.928 1.00 46.75  ? 94  VAL B N     1 
ATOM   4466  C CA    . VAL F 3 100 ? -28.898 2.224   18.896 1.00 46.02  ? 94  VAL B CA    1 
ATOM   4467  C C     . VAL F 3 100 ? -28.387 3.615   19.222 1.00 45.06  ? 94  VAL B C     1 
ATOM   4468  O O     . VAL F 3 100 ? -28.496 4.533   18.401 1.00 45.01  ? 94  VAL B O     1 
ATOM   4469  C CB    . VAL F 3 100 ? -28.347 1.739   17.535 1.00 46.81  ? 94  VAL B CB    1 
ATOM   4470  C CG1   . VAL F 3 100 ? -26.897 1.417   17.655 1.00 46.08  ? 94  VAL B CG1   1 
ATOM   4471  C CG2   . VAL F 3 100 ? -29.099 0.516   17.040 1.00 47.87  ? 94  VAL B CG2   1 
ATOM   4472  N N     . LYS F 3 101 ? -27.858 3.773   20.433 1.00 44.75  ? 95  LYS B N     1 
ATOM   4473  C CA    . LYS F 3 101 ? -27.666 5.105   21.020 1.00 44.37  ? 95  LYS B CA    1 
ATOM   4474  C C     . LYS F 3 101 ? -26.603 5.922   20.306 1.00 44.57  ? 95  LYS B C     1 
ATOM   4475  O O     . LYS F 3 101 ? -25.541 5.400   19.939 1.00 45.11  ? 95  LYS B O     1 
ATOM   4476  C CB    . LYS F 3 101 ? -27.394 5.017   22.521 1.00 44.10  ? 95  LYS B CB    1 
ATOM   4477  C CG    . LYS F 3 101 ? -28.655 4.795   23.340 1.00 44.40  ? 95  LYS B CG    1 
ATOM   4478  C CD    . LYS F 3 101 ? -28.342 4.272   24.712 1.00 44.78  ? 95  LYS B CD    1 
ATOM   4479  C CE    . LYS F 3 101 ? -29.496 4.524   25.667 1.00 45.97  ? 95  LYS B CE    1 
ATOM   4480  N NZ    . LYS F 3 101 ? -29.062 4.352   27.103 1.00 46.73  ? 95  LYS B NZ    1 
ATOM   4481  N N     . ASP F 3 102 ? -26.926 7.195   20.086 1.00 44.34  ? 96  ASP B N     1 
ATOM   4482  C CA    . ASP F 3 102 ? -26.034 8.142   19.424 1.00 44.51  ? 96  ASP B CA    1 
ATOM   4483  C C     . ASP F 3 102 ? -26.325 9.532   19.982 1.00 44.26  ? 96  ASP B C     1 
ATOM   4484  O O     . ASP F 3 102 ? -27.360 10.134  19.682 1.00 44.35  ? 96  ASP B O     1 
ATOM   4485  C CB    . ASP F 3 102 ? -26.236 8.105   17.905 1.00 45.03  ? 96  ASP B CB    1 
ATOM   4486  C CG    . ASP F 3 102 ? -25.245 8.999   17.151 1.00 46.89  ? 96  ASP B CG    1 
ATOM   4487  O OD1   . ASP F 3 102 ? -24.731 9.968   17.745 1.00 47.83  ? 96  ASP B OD1   1 
ATOM   4488  O OD2   . ASP F 3 102 ? -24.977 8.740   15.952 1.00 48.48  ? 96  ASP B OD2   1 
ATOM   4489  N N     . GLU F 3 103 ? -25.402 10.033  20.794 1.00 44.26  ? 97  GLU B N     1 
ATOM   4490  C CA    . GLU F 3 103 ? -25.581 11.298  21.500 1.00 44.54  ? 97  GLU B CA    1 
ATOM   4491  C C     . GLU F 3 103 ? -25.629 12.502  20.533 1.00 44.76  ? 97  GLU B C     1 
ATOM   4492  O O     . GLU F 3 103 ? -26.276 13.528  20.804 1.00 44.69  ? 97  GLU B O     1 
ATOM   4493  C CB    . GLU F 3 103 ? -24.487 11.452  22.557 1.00 44.84  ? 97  GLU B CB    1 
ATOM   4494  C CG    . GLU F 3 103 ? -24.584 12.709  23.401 1.00 47.52  ? 97  GLU B CG    1 
ATOM   4495  C CD    . GLU F 3 103 ? -23.486 12.789  24.449 1.00 50.98  ? 97  GLU B CD    1 
ATOM   4496  O OE1   . GLU F 3 103 ? -22.702 11.822  24.569 1.00 52.90  ? 97  GLU B OE1   1 
ATOM   4497  O OE2   . GLU F 3 103 ? -23.407 13.810  25.162 1.00 52.59  ? 97  GLU B OE2   1 
ATOM   4498  N N     . PHE F 3 104 ? -24.963 12.370  19.395 1.00 44.88  ? 98  PHE B N     1 
ATOM   4499  C CA    . PHE F 3 104 ? -25.010 13.433  18.420 1.00 45.50  ? 98  PHE B CA    1 
ATOM   4500  C C     . PHE F 3 104 ? -26.407 13.546  17.843 1.00 45.63  ? 98  PHE B C     1 
ATOM   4501  O O     . PHE F 3 104 ? -26.923 14.652  17.695 1.00 46.61  ? 98  PHE B O     1 
ATOM   4502  C CB    . PHE F 3 104 ? -23.994 13.242  17.305 1.00 46.09  ? 98  PHE B CB    1 
ATOM   4503  C CG    . PHE F 3 104 ? -24.111 14.277  16.225 1.00 47.94  ? 98  PHE B CG    1 
ATOM   4504  C CD1   . PHE F 3 104 ? -23.579 15.552  16.408 1.00 48.30  ? 98  PHE B CD1   1 
ATOM   4505  C CD2   . PHE F 3 104 ? -24.787 13.994  15.042 1.00 46.73  ? 98  PHE B CD2   1 
ATOM   4506  C CE1   . PHE F 3 104 ? -23.699 16.515  15.434 1.00 49.05  ? 98  PHE B CE1   1 
ATOM   4507  C CE2   . PHE F 3 104 ? -24.910 14.950  14.078 1.00 49.16  ? 98  PHE B CE2   1 
ATOM   4508  C CZ    . PHE F 3 104 ? -24.362 16.222  14.275 1.00 50.25  ? 98  PHE B CZ    1 
ATOM   4509  N N     . MET F 3 105 ? -27.016 12.408  17.510 1.00 45.04  ? 99  MET B N     1 
ATOM   4510  C CA    . MET F 3 105 ? -28.354 12.416  16.944 1.00 45.05  ? 99  MET B CA    1 
ATOM   4511  C C     . MET F 3 105 ? -29.372 12.952  17.941 1.00 44.82  ? 99  MET B C     1 
ATOM   4512  O O     . MET F 3 105 ? -30.314 13.623  17.560 1.00 45.81  ? 99  MET B O     1 
ATOM   4513  C CB    . MET F 3 105 ? -28.753 11.027  16.444 1.00 45.40  ? 99  MET B CB    1 
ATOM   4514  C CG    . MET F 3 105 ? -28.079 10.601  15.132 1.00 46.43  ? 99  MET B CG    1 
ATOM   4515  S SD    . MET F 3 105 ? -28.078 11.835  13.805 1.00 49.43  ? 99  MET B SD    1 
ATOM   4516  C CE    . MET F 3 105 ? -29.851 12.076  13.545 1.00 47.97  ? 99  MET B CE    1 
ATOM   4517  N N     . LEU F 3 106 ? -29.169 12.670  19.223 1.00 44.12  ? 100 LEU B N     1 
ATOM   4518  C CA    . LEU F 3 106 ? -29.972 13.279  20.274 1.00 44.10  ? 100 LEU B CA    1 
ATOM   4519  C C     . LEU F 3 106 ? -29.908 14.817  20.193 1.00 44.84  ? 100 LEU B C     1 
ATOM   4520  O O     . LEU F 3 106 ? -30.930 15.503  20.265 1.00 45.60  ? 100 LEU B O     1 
ATOM   4521  C CB    . LEU F 3 106 ? -29.502 12.767  21.636 1.00 43.72  ? 100 LEU B CB    1 
ATOM   4522  C CG    . LEU F 3 106 ? -30.214 13.243  22.895 1.00 44.04  ? 100 LEU B CG    1 
ATOM   4523  C CD1   . LEU F 3 106 ? -31.647 12.738  22.934 1.00 44.49  ? 100 LEU B CD1   1 
ATOM   4524  C CD2   . LEU F 3 106 ? -29.443 12.737  24.089 1.00 43.35  ? 100 LEU B CD2   1 
ATOM   4525  N N     . LYS F 3 107 ? -28.704 15.349  20.020 1.00 45.04  ? 101 LYS B N     1 
ATOM   4526  C CA    . LYS F 3 107 ? -28.523 16.775  19.787 1.00 45.93  ? 101 LYS B CA    1 
ATOM   4527  C C     . LYS F 3 107 ? -29.275 17.216  18.536 1.00 46.85  ? 101 LYS B C     1 
ATOM   4528  O O     . LYS F 3 107 ? -29.922 18.261  18.545 1.00 47.75  ? 101 LYS B O     1 
ATOM   4529  C CB    . LYS F 3 107 ? -27.046 17.115  19.623 1.00 46.28  ? 101 LYS B CB    1 
ATOM   4530  C CG    . LYS F 3 107 ? -26.216 16.985  20.856 1.00 46.35  ? 101 LYS B CG    1 
ATOM   4531  C CD    . LYS F 3 107 ? -24.825 17.508  20.550 1.00 48.57  ? 101 LYS B CD    1 
ATOM   4532  C CE    . LYS F 3 107 ? -23.925 17.520  21.774 1.00 49.14  ? 101 LYS B CE    1 
ATOM   4533  N NZ    . LYS F 3 107 ? -22.871 18.579  21.612 1.00 51.76  ? 101 LYS B NZ    1 
ATOM   4534  N N     . ALA F 3 108 ? -29.183 16.413  17.471 1.00 46.53  ? 102 ALA B N     1 
ATOM   4535  C CA    . ALA F 3 108 ? -29.832 16.715  16.201 1.00 47.51  ? 102 ALA B CA    1 
ATOM   4536  C C     . ALA F 3 108 ? -31.318 16.974  16.380 1.00 47.72  ? 102 ALA B C     1 
ATOM   4537  O O     . ALA F 3 108 ? -31.862 17.930  15.829 1.00 49.36  ? 102 ALA B O     1 
ATOM   4538  C CB    . ALA F 3 108 ? -29.616 15.590  15.209 1.00 47.61  ? 102 ALA B CB    1 
ATOM   4539  N N     . TYR F 3 109 ? -31.963 16.122  17.165 1.00 46.40  ? 103 TYR B N     1 
ATOM   4540  C CA    . TYR F 3 109 ? -33.385 16.223  17.436 1.00 46.64  ? 103 TYR B CA    1 
ATOM   4541  C C     . TYR F 3 109 ? -33.755 17.552  18.097 1.00 47.41  ? 103 TYR B C     1 
ATOM   4542  O O     . TYR F 3 109 ? -34.844 18.067  17.886 1.00 48.79  ? 103 TYR B O     1 
ATOM   4543  C CB    . TYR F 3 109 ? -33.783 15.052  18.324 1.00 45.71  ? 103 TYR B CB    1 
ATOM   4544  C CG    . TYR F 3 109 ? -35.264 14.796  18.470 1.00 46.02  ? 103 TYR B CG    1 
ATOM   4545  C CD1   . TYR F 3 109 ? -36.029 14.346  17.395 1.00 46.45  ? 103 TYR B CD1   1 
ATOM   4546  C CD2   . TYR F 3 109 ? -35.889 14.958  19.703 1.00 45.78  ? 103 TYR B CD2   1 
ATOM   4547  C CE1   . TYR F 3 109 ? -37.378 14.090  17.544 1.00 47.69  ? 103 TYR B CE1   1 
ATOM   4548  C CE2   . TYR F 3 109 ? -37.239 14.700  19.866 1.00 46.15  ? 103 TYR B CE2   1 
ATOM   4549  C CZ    . TYR F 3 109 ? -37.978 14.267  18.788 1.00 47.92  ? 103 TYR B CZ    1 
ATOM   4550  O OH    . TYR F 3 109 ? -39.322 14.022  18.954 1.00 49.91  ? 103 TYR B OH    1 
ATOM   4551  N N     . PHE F 3 110 ? -32.838 18.110  18.884 1.00 47.14  ? 104 PHE B N     1 
ATOM   4552  C CA    . PHE F 3 110 ? -33.079 19.360  19.592 1.00 47.76  ? 104 PHE B CA    1 
ATOM   4553  C C     . PHE F 3 110 ? -32.557 20.559  18.817 1.00 49.12  ? 104 PHE B C     1 
ATOM   4554  O O     . PHE F 3 110 ? -32.347 21.618  19.404 1.00 50.14  ? 104 PHE B O     1 
ATOM   4555  C CB    . PHE F 3 110 ? -32.412 19.343  20.974 1.00 47.46  ? 104 PHE B CB    1 
ATOM   4556  C CG    . PHE F 3 110 ? -32.784 18.162  21.835 1.00 46.33  ? 104 PHE B CG    1 
ATOM   4557  C CD1   . PHE F 3 110 ? -34.113 17.768  21.983 1.00 46.95  ? 104 PHE B CD1   1 
ATOM   4558  C CD2   . PHE F 3 110 ? -31.800 17.468  22.525 1.00 45.29  ? 104 PHE B CD2   1 
ATOM   4559  C CE1   . PHE F 3 110 ? -34.450 16.679  22.779 1.00 46.79  ? 104 PHE B CE1   1 
ATOM   4560  C CE2   . PHE F 3 110 ? -32.119 16.382  23.334 1.00 44.72  ? 104 PHE B CE2   1 
ATOM   4561  C CZ    . PHE F 3 110 ? -33.446 15.983  23.466 1.00 45.63  ? 104 PHE B CZ    1 
ATOM   4562  N N     . ILE F 3 111 ? -32.367 20.404  17.506 1.00 49.52  ? 105 ILE B N     1 
ATOM   4563  C CA    . ILE F 3 111 ? -31.788 21.464  16.660 1.00 51.34  ? 105 ILE B CA    1 
ATOM   4564  C C     . ILE F 3 111 ? -32.460 22.858  16.762 1.00 53.43  ? 105 ILE B C     1 
ATOM   4565  O O     . ILE F 3 111 ? -31.781 23.883  16.615 1.00 54.93  ? 105 ILE B O     1 
ATOM   4566  C CB    . ILE F 3 111 ? -31.658 21.017  15.163 1.00 52.06  ? 105 ILE B CB    1 
ATOM   4567  C CG1   . ILE F 3 111 ? -30.740 21.975  14.387 1.00 53.53  ? 105 ILE B CG1   1 
ATOM   4568  C CG2   . ILE F 3 111 ? -33.044 20.862  14.502 1.00 52.17  ? 105 ILE B CG2   1 
ATOM   4569  C CD1   . ILE F 3 111 ? -30.064 21.373  13.185 1.00 53.48  ? 105 ILE B CD1   1 
ATOM   4570  N N     . SER F 3 112 ? -33.769 22.897  17.026 1.00 53.73  ? 106 SER B N     1 
ATOM   4571  C CA    . SER F 3 112 ? -34.501 24.164  17.092 1.00 55.83  ? 106 SER B CA    1 
ATOM   4572  C C     . SER F 3 112 ? -33.965 25.081  18.181 1.00 56.63  ? 106 SER B C     1 
ATOM   4573  O O     . SER F 3 112 ? -34.206 26.286  18.155 1.00 58.54  ? 106 SER B O     1 
ATOM   4574  C CB    . SER F 3 112 ? -36.000 23.938  17.295 1.00 56.24  ? 106 SER B CB    1 
ATOM   4575  O OG    . SER F 3 112 ? -36.313 23.725  18.660 1.00 56.65  ? 106 SER B OG    1 
ATOM   4576  N N     . SER F 3 113 ? -33.231 24.513  19.135 1.00 55.41  ? 107 SER B N     1 
ATOM   4577  C CA    . SER F 3 113 ? -32.624 25.316  20.187 1.00 56.53  ? 107 SER B CA    1 
ATOM   4578  C C     . SER F 3 113 ? -31.302 25.950  19.738 1.00 57.91  ? 107 SER B C     1 
ATOM   4579  O O     . SER F 3 113 ? -30.595 26.570  20.545 1.00 58.94  ? 107 SER B O     1 
ATOM   4580  C CB    . SER F 3 113 ? -32.424 24.486  21.453 1.00 54.95  ? 107 SER B CB    1 
ATOM   4581  O OG    . SER F 3 113 ? -33.642 24.329  22.148 1.00 55.08  ? 107 SER B OG    1 
ATOM   4582  N N     . LEU F 3 114 ? -30.971 25.794  18.457 1.00 58.29  ? 108 LEU B N     1 
ATOM   4583  C CA    . LEU F 3 114 ? -29.734 26.339  17.910 1.00 59.77  ? 108 LEU B CA    1 
ATOM   4584  C C     . LEU F 3 114 ? -30.013 27.296  16.765 1.00 62.39  ? 108 LEU B C     1 
ATOM   4585  O O     . LEU F 3 114 ? -30.962 27.106  15.999 1.00 63.09  ? 108 LEU B O     1 
ATOM   4586  C CB    . LEU F 3 114 ? -28.811 25.213  17.427 1.00 58.24  ? 108 LEU B CB    1 
ATOM   4587  C CG    . LEU F 3 114 ? -28.213 24.227  18.435 1.00 55.59  ? 108 LEU B CG    1 
ATOM   4588  C CD1   . LEU F 3 114 ? -27.444 23.131  17.716 1.00 54.60  ? 108 LEU B CD1   1 
ATOM   4589  C CD2   . LEU F 3 114 ? -27.313 24.932  19.426 1.00 56.82  ? 108 LEU B CD2   1 
ATOM   4590  N N     . SER F 3 115 ? -29.180 28.321  16.645 1.00 64.56  ? 109 SER B N     1 
ATOM   4591  C CA    . SER F 3 115 ? -29.274 29.260  15.533 1.00 66.93  ? 109 SER B CA    1 
ATOM   4592  C C     . SER F 3 115 ? -28.590 28.632  14.325 1.00 67.28  ? 109 SER B C     1 
ATOM   4593  O O     . SER F 3 115 ? -27.799 27.698  14.484 1.00 65.61  ? 109 SER B O     1 
ATOM   4594  C CB    . SER F 3 115 ? -28.614 30.596  15.903 1.00 69.65  ? 109 SER B CB    1 
ATOM   4595  O OG    . SER F 3 115 ? -27.250 30.438  16.282 1.00 68.93  ? 109 SER B OG    1 
ATOM   4596  N N     . ARG F 3 116 ? -28.891 29.131  13.123 1.00 69.65  ? 110 ARG B N     1 
ATOM   4597  C CA    . ARG F 3 116 ? -28.279 28.600  11.902 1.00 70.51  ? 110 ARG B CA    1 
ATOM   4598  C C     . ARG F 3 116 ? -26.755 28.501  12.048 1.00 71.14  ? 110 ARG B C     1 
ATOM   4599  O O     . ARG F 3 116 ? -26.158 27.487  11.686 1.00 70.02  ? 110 ARG B O     1 
ATOM   4600  C CB    . ARG F 3 116 ? -28.677 29.422  10.670 1.00 73.69  ? 110 ARG B CB    1 
ATOM   4601  N N     . GLN F 3 117 ? -26.143 29.544  12.613 1.00 73.25  ? 111 GLN B N     1 
ATOM   4602  C CA    . GLN F 3 117 ? -24.693 29.585  12.829 1.00 74.58  ? 111 GLN B CA    1 
ATOM   4603  C C     . GLN F 3 117 ? -24.192 28.501  13.787 1.00 71.59  ? 111 GLN B C     1 
ATOM   4604  O O     . GLN F 3 117 ? -23.188 27.843  13.513 1.00 71.68  ? 111 GLN B O     1 
ATOM   4605  C CB    . GLN F 3 117 ? -24.257 30.965  13.327 1.00 77.45  ? 111 GLN B CB    1 
ATOM   4606  C CG    . GLN F 3 117 ? -22.757 31.233  13.216 1.00 81.30  ? 111 GLN B CG    1 
ATOM   4607  C CD    . GLN F 3 117 ? -22.256 31.209  11.773 1.00 85.70  ? 111 GLN B CD    1 
ATOM   4608  O OE1   . GLN F 3 117 ? -22.099 32.261  11.133 1.00 89.81  ? 111 GLN B OE1   1 
ATOM   4609  N NE2   . GLN F 3 117 ? -22.016 30.006  11.248 1.00 83.81  ? 111 GLN B NE2   1 
ATOM   4610  N N     . GLU F 3 118 ? -24.898 28.324  14.901 1.00 69.40  ? 112 GLU B N     1 
ATOM   4611  C CA    . GLU F 3 118 ? -24.516 27.354  15.925 1.00 66.98  ? 112 GLU B CA    1 
ATOM   4612  C C     . GLU F 3 118 ? -24.616 25.920  15.428 1.00 64.50  ? 112 GLU B C     1 
ATOM   4613  O O     . GLU F 3 118 ? -23.729 25.098  15.699 1.00 63.66  ? 112 GLU B O     1 
ATOM   4614  C CB    . GLU F 3 118 ? -25.390 27.523  17.168 1.00 65.92  ? 112 GLU B CB    1 
ATOM   4615  C CG    . GLU F 3 118 ? -24.944 28.628  18.110 1.00 68.84  ? 112 GLU B CG    1 
ATOM   4616  C CD    . GLU F 3 118 ? -26.066 29.132  19.011 1.00 70.72  ? 112 GLU B CD    1 
ATOM   4617  O OE1   . GLU F 3 118 ? -25.791 30.037  19.827 1.00 74.36  ? 112 GLU B OE1   1 
ATOM   4618  O OE2   . GLU F 3 118 ? -27.219 28.644  18.906 1.00 69.26  ? 112 GLU B OE2   1 
ATOM   4619  N N     . ALA F 3 119 ? -25.705 25.633  14.717 1.00 63.69  ? 113 ALA B N     1 
ATOM   4620  C CA    . ALA F 3 119 ? -25.946 24.323  14.109 1.00 61.77  ? 113 ALA B CA    1 
ATOM   4621  C C     . ALA F 3 119 ? -24.933 24.014  13.017 1.00 63.12  ? 113 ALA B C     1 
ATOM   4622  O O     . ALA F 3 119 ? -24.434 22.892  12.934 1.00 61.93  ? 113 ALA B O     1 
ATOM   4623  C CB    . ALA F 3 119 ? -27.356 24.244  13.552 1.00 61.46  ? 113 ALA B CB    1 
ATOM   4624  N N     . SER F 3 120 ? -24.623 25.013  12.191 1.00 66.02  ? 114 SER B N     1 
ATOM   4625  C CA    . SER F 3 120 ? -23.627 24.847  11.140 1.00 68.04  ? 114 SER B CA    1 
ATOM   4626  C C     . SER F 3 120 ? -22.305 24.454  11.773 1.00 67.82  ? 114 SER B C     1 
ATOM   4627  O O     . SER F 3 120 ? -21.700 23.456  11.389 1.00 67.28  ? 114 SER B O     1 
ATOM   4628  C CB    . SER F 3 120 ? -23.473 26.126  10.319 1.00 71.76  ? 114 SER B CB    1 
ATOM   4629  O OG    . SER F 3 120 ? -22.587 25.927  9.234  1.00 73.94  ? 114 SER B OG    1 
ATOM   4630  N N     . ASP F 3 121 ? -21.893 25.229  12.774 1.00 68.39  ? 115 ASP B N     1 
ATOM   4631  C CA    . ASP F 3 121 ? -20.659 24.988  13.510 1.00 68.43  ? 115 ASP B CA    1 
ATOM   4632  C C     . ASP F 3 121 ? -20.649 23.599  14.141 1.00 65.42  ? 115 ASP B C     1 
ATOM   4633  O O     . ASP F 3 121 ? -19.645 22.885  14.047 1.00 65.89  ? 115 ASP B O     1 
ATOM   4634  C CB    . ASP F 3 121 ? -20.439 26.074  14.568 1.00 69.60  ? 115 ASP B CB    1 
ATOM   4635  N N     . LEU F 3 122 ? -21.762 23.206  14.763 1.00 62.71  ? 116 LEU B N     1 
ATOM   4636  C CA    . LEU F 3 122 ? -21.869 21.863  15.333 1.00 59.78  ? 116 LEU B CA    1 
ATOM   4637  C C     . LEU F 3 122 ? -21.709 20.765  14.277 1.00 59.49  ? 116 LEU B C     1 
ATOM   4638  O O     . LEU F 3 122 ? -20.852 19.889  14.417 1.00 59.19  ? 116 LEU B O     1 
ATOM   4639  C CB    . LEU F 3 122 ? -23.183 21.660  16.111 1.00 57.62  ? 116 LEU B CB    1 
ATOM   4640  C CG    . LEU F 3 122 ? -23.335 20.242  16.710 1.00 54.82  ? 116 LEU B CG    1 
ATOM   4641  C CD1   . LEU F 3 122 ? -22.273 19.944  17.777 1.00 53.83  ? 116 LEU B CD1   1 
ATOM   4642  C CD2   . LEU F 3 122 ? -24.722 20.010  17.256 1.00 53.35  ? 116 LEU B CD2   1 
ATOM   4643  N N     . PHE F 3 123 ? -22.539 20.813  13.237 1.00 59.66  ? 117 PHE B N     1 
ATOM   4644  C CA    . PHE F 3 123 ? -22.506 19.804  12.185 1.00 59.59  ? 117 PHE B CA    1 
ATOM   4645  C C     . PHE F 3 123 ? -21.176 19.766  11.421 1.00 62.12  ? 117 PHE B C     1 
ATOM   4646  O O     . PHE F 3 123 ? -20.693 18.679  11.083 1.00 61.91  ? 117 PHE B O     1 
ATOM   4647  C CB    . PHE F 3 123 ? -23.695 19.972  11.234 1.00 60.13  ? 117 PHE B CB    1 
ATOM   4648  C CG    . PHE F 3 123 ? -24.958 19.317  11.719 1.00 57.57  ? 117 PHE B CG    1 
ATOM   4649  C CD1   . PHE F 3 123 ? -25.712 19.890  12.736 1.00 56.65  ? 117 PHE B CD1   1 
ATOM   4650  C CD2   . PHE F 3 123 ? -25.403 18.129  11.146 1.00 57.28  ? 117 PHE B CD2   1 
ATOM   4651  C CE1   . PHE F 3 123 ? -26.886 19.283  13.191 1.00 55.09  ? 117 PHE B CE1   1 
ATOM   4652  C CE2   . PHE F 3 123 ? -26.579 17.509  11.594 1.00 55.88  ? 117 PHE B CE2   1 
ATOM   4653  C CZ    . PHE F 3 123 ? -27.322 18.090  12.618 1.00 54.38  ? 117 PHE B CZ    1 
ATOM   4654  N N     . THR F 3 124 ? -20.582 20.937  11.161 1.00 64.68  ? 118 THR B N     1 
ATOM   4655  C CA    . THR F 3 124 ? -19.277 21.006  10.490 1.00 67.60  ? 118 THR B CA    1 
ATOM   4656  C C     . THR F 3 124 ? -18.237 20.223  11.296 1.00 66.82  ? 118 THR B C     1 
ATOM   4657  O O     . THR F 3 124 ? -17.521 19.377  10.755 1.00 67.63  ? 118 THR B O     1 
ATOM   4658  C CB    . THR F 3 124 ? -18.775 22.467  10.276 1.00 70.90  ? 118 THR B CB    1 
ATOM   4659  O OG1   . THR F 3 124 ? -19.807 23.263  9.686  1.00 71.89  ? 118 THR B OG1   1 
ATOM   4660  C CG2   . THR F 3 124 ? -17.547 22.500  9.362  1.00 74.07  ? 118 THR B CG2   1 
ATOM   4661  N N     . ASP F 3 125 ? -18.181 20.501  12.594 1.00 65.41  ? 119 ASP B N     1 
ATOM   4662  C CA    . ASP F 3 125 ? -17.234 19.857  13.488 1.00 65.05  ? 119 ASP B CA    1 
ATOM   4663  C C     . ASP F 3 125 ? -17.333 18.339  13.441 1.00 62.88  ? 119 ASP B C     1 
ATOM   4664  O O     . ASP F 3 125 ? -16.318 17.640  13.391 1.00 63.75  ? 119 ASP B O     1 
ATOM   4665  C CB    . ASP F 3 125 ? -17.456 20.329  14.917 1.00 63.83  ? 119 ASP B CB    1 
ATOM   4666  C CG    . ASP F 3 125 ? -16.562 19.613  15.899 1.00 64.46  ? 119 ASP B CG    1 
ATOM   4667  O OD1   . ASP F 3 125 ? -15.358 19.961  15.959 1.00 66.73  ? 119 ASP B OD1   1 
ATOM   4668  O OD2   . ASP F 3 125 ? -17.067 18.693  16.595 1.00 63.22  ? 119 ASP B OD2   1 
ATOM   4669  N N     . GLN F 3 126 ? -18.564 17.847  13.468 1.00 60.45  ? 120 GLN B N     1 
ATOM   4670  C CA    . GLN F 3 126 ? -18.852 16.425  13.426 1.00 58.73  ? 120 GLN B CA    1 
ATOM   4671  C C     . GLN F 3 126 ? -18.318 15.792  12.155 1.00 60.64  ? 120 GLN B C     1 
ATOM   4672  O O     . GLN F 3 126 ? -17.703 14.725  12.198 1.00 60.76  ? 120 GLN B O     1 
ATOM   4673  C CB    . GLN F 3 126 ? -20.358 16.205  13.511 1.00 56.78  ? 120 GLN B CB    1 
ATOM   4674  C CG    . GLN F 3 126 ? -20.771 14.753  13.702 1.00 56.05  ? 120 GLN B CG    1 
ATOM   4675  C CD    . GLN F 3 126 ? -20.388 14.176  15.067 1.00 55.03  ? 120 GLN B CD    1 
ATOM   4676  O OE1   . GLN F 3 126 ? -20.540 12.975  15.293 1.00 54.81  ? 120 GLN B OE1   1 
ATOM   4677  N NE2   . GLN F 3 126 ? -19.914 15.027  15.978 1.00 53.81  ? 120 GLN B NE2   1 
ATOM   4678  N N     . LEU F 3 127 ? -18.553 16.463  11.032 1.00 62.39  ? 121 LEU B N     1 
ATOM   4679  C CA    . LEU F 3 127 ? -18.126 15.990  9.736  1.00 64.47  ? 121 LEU B CA    1 
ATOM   4680  C C     . LEU F 3 127 ? -16.613 15.811  9.664  1.00 66.83  ? 121 LEU B C     1 
ATOM   4681  O O     . LEU F 3 127 ? -16.128 14.790  9.167  1.00 67.29  ? 121 LEU B O     1 
ATOM   4682  C CB    . LEU F 3 127 ? -18.595 16.972  8.662  1.00 66.90  ? 121 LEU B CB    1 
ATOM   4683  C CG    . LEU F 3 127 ? -18.187 16.736  7.210  1.00 69.43  ? 121 LEU B CG    1 
ATOM   4684  C CD1   . LEU F 3 127 ? -18.844 15.469  6.684  1.00 67.91  ? 121 LEU B CD1   1 
ATOM   4685  C CD2   . LEU F 3 127 ? -18.569 17.945  6.388  1.00 71.37  ? 121 LEU B CD2   1 
ATOM   4686  N N     . LEU F 3 128 ? -15.880 16.809  10.159 1.00 68.46  ? 122 LEU B N     1 
ATOM   4687  C CA    . LEU F 3 128 ? -14.413 16.796  10.118 1.00 71.53  ? 122 LEU B CA    1 
ATOM   4688  C C     . LEU F 3 128 ? -13.838 15.635  10.915 1.00 69.96  ? 122 LEU B C     1 
ATOM   4689  O O     . LEU F 3 128 ? -12.846 15.031  10.512 1.00 72.07  ? 122 LEU B O     1 
ATOM   4690  C CB    . LEU F 3 128 ? -13.821 18.130  10.596 1.00 73.57  ? 122 LEU B CB    1 
ATOM   4691  C CG    . LEU F 3 128 ? -13.652 19.225  9.530  1.00 78.22  ? 122 LEU B CG    1 
ATOM   4692  C CD1   . LEU F 3 128 ? -13.299 20.567  10.170 1.00 80.31  ? 122 LEU B CD1   1 
ATOM   4693  C CD2   . LEU F 3 128 ? -12.599 18.846  8.472  1.00 82.80  ? 122 LEU B CD2   1 
ATOM   4694  N N     . LYS F 3 129 ? -14.478 15.320  12.035 1.00 66.60  ? 123 LYS B N     1 
ATOM   4695  C CA    . LYS F 3 129 ? -14.118 14.150  12.812 1.00 65.13  ? 123 LYS B CA    1 
ATOM   4696  C C     . LYS F 3 129 ? -14.497 12.894  12.061 1.00 64.49  ? 123 LYS B C     1 
ATOM   4697  O O     . LYS F 3 129 ? -13.683 11.987  11.913 1.00 65.87  ? 123 LYS B O     1 
ATOM   4698  C CB    . LYS F 3 129 ? -14.801 14.165  14.175 1.00 62.26  ? 123 LYS B CB    1 
ATOM   4699  C CG    . LYS F 3 129 ? -14.335 15.284  15.090 1.00 63.82  ? 123 LYS B CG    1 
ATOM   4700  C CD    . LYS F 3 129 ? -15.074 15.224  16.422 1.00 63.80  ? 123 LYS B CD    1 
ATOM   4701  C CE    . LYS F 3 129 ? -14.969 16.537  17.202 1.00 66.17  ? 123 LYS B CE    1 
ATOM   4702  N NZ    . LYS F 3 129 ? -13.684 17.269  16.991 1.00 69.19  ? 123 LYS B NZ    1 
ATOM   4703  N N     . ARG F 3 130 ? -15.727 12.846  11.566 1.00 63.03  ? 124 ARG B N     1 
ATOM   4704  C CA    . ARG F 3 130 ? -16.216 11.645  10.887 1.00 62.68  ? 124 ARG B CA    1 
ATOM   4705  C C     . ARG F 3 130 ? -15.393 11.298  9.650  1.00 65.87  ? 124 ARG B C     1 
ATOM   4706  O O     . ARG F 3 130 ? -15.245 10.120  9.317  1.00 66.08  ? 124 ARG B O     1 
ATOM   4707  C CB    . ARG F 3 130 ? -17.702 11.767  10.541 1.00 61.03  ? 124 ARG B CB    1 
ATOM   4708  C CG    . ARG F 3 130 ? -18.616 11.806  11.752 1.00 58.54  ? 124 ARG B CG    1 
ATOM   4709  C CD    . ARG F 3 130 ? -18.998 10.425  12.227 1.00 57.22  ? 124 ARG B CD    1 
ATOM   4710  N NE    . ARG F 3 130 ? -19.742 10.481  13.481 1.00 54.94  ? 124 ARG B NE    1 
ATOM   4711  C CZ    . ARG F 3 130 ? -19.985 9.427   14.257 1.00 53.05  ? 124 ARG B CZ    1 
ATOM   4712  N NH1   . ARG F 3 130 ? -19.551 8.222   13.912 1.00 53.15  ? 124 ARG B NH1   1 
ATOM   4713  N NH2   . ARG F 3 130 ? -20.655 9.583   15.388 1.00 51.14  ? 124 ARG B NH2   1 
ATOM   4714  N N     . LYS F 3 131 ? -14.862 12.325  8.983  1.00 68.61  ? 125 LYS B N     1 
ATOM   4715  C CA    . LYS F 3 131 ? -14.001 12.133  7.811  1.00 72.35  ? 125 LYS B CA    1 
ATOM   4716  C C     . LYS F 3 131 ? -12.616 11.645  8.225  1.00 73.77  ? 125 LYS B C     1 
ATOM   4717  O O     . LYS F 3 131 ? -12.008 10.818  7.541  1.00 75.91  ? 125 LYS B O     1 
ATOM   4718  C CB    . LYS F 3 131 ? -13.889 13.420  6.982  1.00 75.24  ? 125 LYS B CB    1 
ATOM   4719  C CG    . LYS F 3 131 ? -15.168 13.797  6.229  1.00 74.62  ? 125 LYS B CG    1 
ATOM   4720  C CD    . LYS F 3 131 ? -14.913 14.854  5.172  1.00 77.36  ? 125 LYS B CD    1 
ATOM   4721  C CE    . LYS F 3 131 ? -14.277 14.244  3.926  1.00 81.13  ? 125 LYS B CE    1 
ATOM   4722  N NZ    . LYS F 3 131 ? -14.341 15.180  2.768  1.00 84.82  ? 125 LYS B NZ    1 
ATOM   4723  N N     . ALA F 3 132 ? -12.130 12.161  9.349  1.00 72.94  ? 126 ALA B N     1 
ATOM   4724  C CA    . ALA F 3 132 ? -10.848 11.736  9.902  1.00 74.68  ? 126 ALA B CA    1 
ATOM   4725  C C     . ALA F 3 132 ? -10.898 10.258  10.277 1.00 73.18  ? 126 ALA B C     1 
ATOM   4726  O O     . ALA F 3 132 ? -9.971  9.501   9.978  1.00 75.42  ? 126 ALA B O     1 
ATOM   4727  C CB    . ALA F 3 132 ? -10.472 12.589  11.106 1.00 73.99  ? 126 ALA B CB    1 
ATOM   4728  N N     . LYS F 3 133 ? -11.999 9.861   10.915 1.00 69.82  ? 127 LYS B N     1 
ATOM   4729  C CA    . LYS F 3 133 ? -12.258 8.468   11.259 1.00 68.62  ? 127 LYS B CA    1 
ATOM   4730  C C     . LYS F 3 133 ? -12.388 7.614   10.000 1.00 69.96  ? 127 LYS B C     1 
ATOM   4731  O O     . LYS F 3 133 ? -11.908 6.484   9.956  1.00 70.96  ? 127 LYS B O     1 
ATOM   4732  C CB    . LYS F 3 133 ? -13.515 8.357   12.132 1.00 65.24  ? 127 LYS B CB    1 
ATOM   4733  C CG    . LYS F 3 133 ? -14.072 6.948   12.220 1.00 66.63  ? 127 LYS B CG    1 
ATOM   4734  C CD    . LYS F 3 133 ? -14.861 6.701   13.492 1.00 66.89  ? 127 LYS B CD    1 
ATOM   4735  C CE    . LYS F 3 133 ? -14.938 5.199   13.764 1.00 67.98  ? 127 LYS B CE    1 
ATOM   4736  N NZ    . LYS F 3 133 ? -15.499 4.898   15.113 1.00 67.27  ? 127 LYS B NZ    1 
ATOM   4737  N N     . LEU F 3 134 ? -13.032 8.169   8.978  1.00 70.64  ? 128 LEU B N     1 
ATOM   4738  C CA    . LEU F 3 134 ? -13.191 7.496   7.693  1.00 72.44  ? 128 LEU B CA    1 
ATOM   4739  C C     . LEU F 3 134 ? -11.831 7.193   7.054  1.00 76.38  ? 128 LEU B C     1 
ATOM   4740  O O     . LEU F 3 134 ? -11.606 6.081   6.574  1.00 77.76  ? 128 LEU B O     1 
ATOM   4741  C CB    . LEU F 3 134 ? -14.088 8.320   6.761  1.00 72.80  ? 128 LEU B CB    1 
ATOM   4742  C CG    . LEU F 3 134 ? -14.368 7.818   5.339  1.00 75.46  ? 128 LEU B CG    1 
ATOM   4743  C CD1   . LEU F 3 134 ? -14.981 6.415   5.317  1.00 73.75  ? 128 LEU B CD1   1 
ATOM   4744  C CD2   . LEU F 3 134 ? -15.263 8.811   4.613  1.00 75.78  ? 128 LEU B CD2   1 
ATOM   4745  N N     . SER F 3 135 ? -10.927 8.173   7.065  1.00 78.46  ? 129 SER B N     1 
ATOM   4746  C CA    . SER F 3 135 ? -9.545  7.953   6.619  1.00 82.71  ? 129 SER B CA    1 
ATOM   4747  C C     . SER F 3 135 ? -8.896  6.766   7.337  1.00 82.40  ? 129 SER B C     1 
ATOM   4748  O O     . SER F 3 135 ? -8.395  5.845   6.685  1.00 84.89  ? 129 SER B O     1 
ATOM   4749  C CB    . SER F 3 135 ? -8.686  9.207   6.819  1.00 84.74  ? 129 SER B CB    1 
ATOM   4750  O OG    . SER F 3 135 ? -8.929  10.164  5.815  1.00 86.97  ? 129 SER B OG    1 
ATOM   4751  N N     . ASP F 3 136 ? -8.909  6.790   8.670  1.00 79.57  ? 130 ASP B N     1 
ATOM   4752  C CA    . ASP F 3 136 ? -8.313  5.708   9.463  1.00 79.58  ? 130 ASP B CA    1 
ATOM   4753  C C     . ASP F 3 136 ? -8.886  4.345   9.052  1.00 79.17  ? 130 ASP B C     1 
ATOM   4754  O O     . ASP F 3 136 ? -8.132  3.394   8.821  1.00 81.61  ? 130 ASP B O     1 
ATOM   4755  C CB    . ASP F 3 136 ? -8.486  5.952   10.969 1.00 76.20  ? 130 ASP B CB    1 
ATOM   4756  N N     . LEU F 3 137 ? -10.211 4.273   8.924  1.00 76.55  ? 131 LEU B N     1 
ATOM   4757  C CA    . LEU F 3 137 ? -10.893 3.049   8.499  1.00 76.21  ? 131 LEU B CA    1 
ATOM   4758  C C     . LEU F 3 137 ? -10.565 2.613   7.062  1.00 80.24  ? 131 LEU B C     1 
ATOM   4759  O O     . LEU F 3 137 ? -10.418 1.416   6.789  1.00 81.51  ? 131 LEU B O     1 
ATOM   4760  C CB    . LEU F 3 137 ? -12.408 3.178   8.686  1.00 72.72  ? 131 LEU B CB    1 
ATOM   4761  C CG    . LEU F 3 137 ? -12.974 3.011   10.101 1.00 69.12  ? 131 LEU B CG    1 
ATOM   4762  C CD1   . LEU F 3 137 ? -14.466 3.272   10.115 1.00 66.24  ? 131 LEU B CD1   1 
ATOM   4763  C CD2   . LEU F 3 137 ? -12.683 1.631   10.662 1.00 69.10  ? 131 LEU B CD2   1 
ATOM   4764  N N     . GLN F 3 138 ? -10.453 3.577   6.151  1.00 82.53  ? 132 GLN B N     1 
ATOM   4765  C CA    . GLN F 3 138 ? -10.132 3.272   4.757  1.00 86.88  ? 132 GLN B CA    1 
ATOM   4766  C C     . GLN F 3 138 ? -8.729  2.702   4.649  1.00 90.35  ? 132 GLN B C     1 
ATOM   4767  O O     . GLN F 3 138 ? -8.501  1.735   3.922  1.00 93.10  ? 132 GLN B O     1 
ATOM   4768  C CB    . GLN F 3 138 ? -10.272 4.517   3.884  1.00 88.86  ? 132 GLN B CB    1 
ATOM   4769  C CG    . GLN F 3 138 ? -10.702 4.218   2.455  1.00 92.77  ? 132 GLN B CG    1 
ATOM   4770  C CD    . GLN F 3 138 ? -11.928 5.022   2.048  1.00 92.49  ? 132 GLN B CD    1 
ATOM   4771  O OE1   . GLN F 3 138 ? -12.052 6.204   2.384  1.00 91.61  ? 132 GLN B OE1   1 
ATOM   4772  N NE2   . GLN F 3 138 ? -12.848 4.378   1.332  1.00 92.74  ? 132 GLN B NE2   1 
ATOM   4773  N N     . GLY F 3 139 ? -7.803  3.305   5.393  1.00 90.67  ? 133 GLY B N     1 
ATOM   4774  C CA    . GLY F 3 139 ? -6.425  2.833   5.484  1.00 94.05  ? 133 GLY B CA    1 
ATOM   4775  C C     . GLY F 3 139 ? -6.325  1.406   5.989  1.00 93.47  ? 133 GLY B C     1 
ATOM   4776  O O     . GLY F 3 139 ? -5.569  0.603   5.435  1.00 97.30  ? 133 GLY B O     1 
ATOM   4777  N N     . SER F 3 140 ? -7.098  1.090   7.030  1.00 89.05  ? 134 SER B N     1 
ATOM   4778  C CA    . SER F 3 140 ? -7.112  -0.250  7.623  1.00 88.38  ? 134 SER B CA    1 
ATOM   4779  C C     . SER F 3 140 ? -7.602  -1.315  6.646  1.00 90.06  ? 134 SER B C     1 
ATOM   4780  O O     . SER F 3 140 ? -7.070  -2.434  6.611  1.00 92.12  ? 134 SER B O     1 
ATOM   4781  C CB    . SER F 3 140 ? -7.978  -0.274  8.881  1.00 83.58  ? 134 SER B CB    1 
ATOM   4782  O OG    . SER F 3 140 ? -7.429  0.559   9.880  1.00 83.08  ? 134 SER B OG    1 
ATOM   4783  N N     . TYR F 3 141 ? -8.623  -0.955  5.869  1.00 89.39  ? 135 TYR B N     1 
ATOM   4784  C CA    . TYR F 3 141 ? -9.172  -1.823  4.837  1.00 91.33  ? 135 TYR B CA    1 
ATOM   4785  C C     . TYR F 3 141 ? -8.067  -2.267  3.896  1.00 96.76  ? 135 TYR B C     1 
ATOM   4786  O O     . TYR F 3 141 ? -7.888  -3.463  3.662  1.00 98.78  ? 135 TYR B O     1 
ATOM   4787  C CB    . TYR F 3 141 ? -10.280 -1.098  4.064  1.00 90.44  ? 135 TYR B CB    1 
ATOM   4788  C CG    . TYR F 3 141 ? -10.974 -1.947  3.026  1.00 92.30  ? 135 TYR B CG    1 
ATOM   4789  C CD1   . TYR F 3 141 ? -11.838 -2.977  3.400  1.00 90.09  ? 135 TYR B CD1   1 
ATOM   4790  C CD2   . TYR F 3 141 ? -10.774 -1.716  1.663  1.00 96.79  ? 135 TYR B CD2   1 
ATOM   4791  C CE1   . TYR F 3 141 ? -12.479 -3.766  2.445  1.00 92.62  ? 135 TYR B CE1   1 
ATOM   4792  C CE2   . TYR F 3 141 ? -11.413 -2.495  0.700  1.00 98.96  ? 135 TYR B CE2   1 
ATOM   4793  C CZ    . TYR F 3 141 ? -12.264 -3.518  1.099  1.00 97.19  ? 135 TYR B CZ    1 
ATOM   4794  O OH    . TYR F 3 141 ? -12.896 -4.294  0.154  1.00 100.03 ? 135 TYR B OH    1 
ATOM   4795  N N     . GLU F 3 142 ? -7.311  -1.300  3.387  1.00 99.48  ? 136 GLU B N     1 
ATOM   4796  C CA    . GLU F 3 142 ? -6.220  -1.581  2.463  1.00 105.26 ? 136 GLU B CA    1 
ATOM   4797  C C     . GLU F 3 142 ? -5.150  -2.458  3.097  1.00 106.77 ? 136 GLU B C     1 
ATOM   4798  O O     . GLU F 3 142 ? -4.675  -3.407  2.467  1.00 110.63 ? 136 GLU B O     1 
ATOM   4799  C CB    . GLU F 3 142 ? -5.616  -0.284  1.934  1.00 107.81 ? 136 GLU B CB    1 
ATOM   4800  C CG    . GLU F 3 142 ? -6.551  0.476   1.007  1.00 108.67 ? 136 GLU B CG    1 
ATOM   4801  C CD    . GLU F 3 142 ? -6.116  1.907   0.764  1.00 111.04 ? 136 GLU B CD    1 
ATOM   4802  O OE1   . GLU F 3 142 ? -4.915  2.218   0.943  1.00 114.34 ? 136 GLU B OE1   1 
ATOM   4803  O OE2   . GLU F 3 142 ? -6.984  2.724   0.388  1.00 109.64 ? 136 GLU B OE2   1 
ATOM   4804  N N     . LYS F 3 143 ? -4.780  -2.152  4.340  1.00 104.13 ? 137 LYS B N     1 
ATOM   4805  C CA    . LYS F 3 143 ? -3.802  -2.963  5.065  1.00 105.53 ? 137 LYS B CA    1 
ATOM   4806  C C     . LYS F 3 143 ? -4.277  -4.412  5.202  1.00 105.09 ? 137 LYS B C     1 
ATOM   4807  O O     . LYS F 3 143 ? -3.456  -5.332  5.251  1.00 108.11 ? 137 LYS B O     1 
ATOM   4808  C CB    . LYS F 3 143 ? -3.494  -2.364  6.443  1.00 102.55 ? 137 LYS B CB    1 
ATOM   4809  N N     . LEU F 3 144 ? -5.598  -4.607  5.244  1.00 101.76 ? 138 LEU B N     1 
ATOM   4810  C CA    . LEU F 3 144 ? -6.189  -5.950  5.298  1.00 101.60 ? 138 LEU B CA    1 
ATOM   4811  C C     . LEU F 3 144 ? -6.246  -6.646  3.929  1.00 106.20 ? 138 LEU B C     1 
ATOM   4812  O O     . LEU F 3 144 ? -6.078  -7.869  3.840  1.00 108.41 ? 138 LEU B O     1 
ATOM   4813  C CB    . LEU F 3 144 ? -7.585  -5.914  5.923  1.00 96.56  ? 138 LEU B CB    1 
ATOM   4814  C CG    . LEU F 3 144 ? -8.234  -7.271  6.210  1.00 95.56  ? 138 LEU B CG    1 
ATOM   4815  N N     . MET F 3 145 ? -6.478  -5.878  2.869  1.00 108.00 ? 139 MET B N     1 
ATOM   4816  C CA    . MET F 3 145 ? -6.650  -6.465  1.539  1.00 112.49 ? 139 MET B CA    1 
ATOM   4817  C C     . MET F 3 145 ? -5.378  -7.082  0.935  1.00 118.33 ? 139 MET B C     1 
ATOM   4818  O O     . MET F 3 145 ? -5.433  -8.152  0.320  1.00 121.42 ? 139 MET B O     1 
ATOM   4819  C CB    . MET F 3 145 ? -7.310  -5.474  0.579  1.00 112.96 ? 139 MET B CB    1 
ATOM   4820  C CG    . MET F 3 145 ? -8.811  -5.291  0.829  1.00 109.38 ? 139 MET B CG    1 
ATOM   4821  S SD    . MET F 3 145 ? -9.614  -6.714  1.617  1.00 107.86 ? 139 MET B SD    1 
ATOM   4822  C CE    . MET F 3 145 ? -10.961 -7.011  0.473  1.00 109.25 ? 139 MET B CE    1 
ATOM   4823  N N     . ALA F 3 146 ? -4.245  -6.410  1.120  1.00 120.17 ? 140 ALA B N     1 
ATOM   4824  C CA    . ALA F 3 146 ? -2.953  -6.939  0.690  1.00 125.92 ? 140 ALA B CA    1 
ATOM   4825  C C     . ALA F 3 146 ? -2.590  -8.213  1.462  1.00 126.12 ? 140 ALA B C     1 
ATOM   4826  O O     . ALA F 3 146 ? -1.938  -9.118  0.921  1.00 130.90 ? 140 ALA B O     1 
ATOM   4827  C CB    . ALA F 3 146 ? -1.874  -5.885  0.857  1.00 127.50 ? 140 ALA B CB    1 
ATOM   4828  N N     . SER F 3 147 ? -3.027  -8.267  2.722  1.00 121.26 ? 141 SER B N     1 
ATOM   4829  C CA    . SER F 3 147 ? -2.784  -9.405  3.608  1.00 120.90 ? 141 SER B CA    1 
ATOM   4830  C C     . SER F 3 147 ? -3.633  -10.608 3.205  1.00 121.38 ? 141 SER B C     1 
ATOM   4831  O O     . SER F 3 147 ? -3.182  -11.752 3.289  1.00 124.10 ? 141 SER B O     1 
ATOM   4832  C CB    . SER F 3 147 ? -3.069  -9.018  5.065  1.00 115.57 ? 141 SER B CB    1 
ATOM   4833  N N     . MET F 3 151 ? -10.701 -12.521 -1.315 1.00 120.00 ? 145 MET B N     1 
ATOM   4834  C CA    . MET F 3 151 ? -11.517 -12.516 -0.101 1.00 114.66 ? 145 MET B CA    1 
ATOM   4835  C C     . MET F 3 151 ? -12.824 -13.285 -0.293 1.00 114.61 ? 145 MET B C     1 
ATOM   4836  O O     . MET F 3 151 ? -13.632 -12.955 -1.162 1.00 115.69 ? 145 MET B O     1 
ATOM   4837  C CB    . MET F 3 151 ? -11.780 -11.080 0.381  1.00 110.08 ? 145 MET B CB    1 
ATOM   4838  C CG    . MET F 3 151 ? -12.662 -10.965 1.631  1.00 104.74 ? 145 MET B CG    1 
ATOM   4839  S SD    . MET F 3 151 ? -12.091 -11.884 3.081  1.00 103.77 ? 145 MET B SD    1 
ATOM   4840  C CE    . MET F 3 151 ? -10.626 -10.959 3.550  1.00 103.01 ? 145 MET B CE    1 
ATOM   4841  N N     . SER F 3 152 ? -13.015 -14.312 0.532  1.00 113.71 ? 146 SER B N     1 
ATOM   4842  C CA    . SER F 3 152 ? -14.161 -15.211 0.417  1.00 114.32 ? 146 SER B CA    1 
ATOM   4843  C C     . SER F 3 152 ? -14.609 -15.700 1.794  1.00 110.65 ? 146 SER B C     1 
ATOM   4844  O O     . SER F 3 152 ? -14.015 -15.330 2.808  1.00 107.63 ? 146 SER B O     1 
ATOM   4845  C CB    . SER F 3 152 ? -13.809 -16.402 -0.483 1.00 120.33 ? 146 SER B CB    1 
ATOM   4846  O OG    . SER F 3 152 ? -12.694 -17.118 0.024  1.00 121.55 ? 146 SER B OG    1 
ATOM   4847  N N     . PHE F 3 153 ? -15.654 -16.531 1.819  1.00 111.21 ? 147 PHE B N     1 
ATOM   4848  C CA    . PHE F 3 153 ? -16.160 -17.133 3.061  1.00 108.47 ? 147 PHE B CA    1 
ATOM   4849  C C     . PHE F 3 153 ? -15.162 -18.102 3.716  1.00 110.07 ? 147 PHE B C     1 
ATOM   4850  O O     . PHE F 3 153 ? -15.153 -18.263 4.937  1.00 107.38 ? 147 PHE B O     1 
ATOM   4851  C CB    . PHE F 3 153 ? -17.501 -17.841 2.815  1.00 109.61 ? 147 PHE B CB    1 
ATOM   4852  C CG    . PHE F 3 153 ? -18.120 -18.428 4.062  1.00 107.02 ? 147 PHE B CG    1 
ATOM   4853  C CD1   . PHE F 3 153 ? -18.010 -19.787 4.335  1.00 109.25 ? 147 PHE B CD1   1 
ATOM   4854  C CD2   . PHE F 3 153 ? -18.803 -17.617 4.968  1.00 101.81 ? 147 PHE B CD2   1 
ATOM   4855  C CE1   . PHE F 3 153 ? -18.572 -20.337 5.486  1.00 107.43 ? 147 PHE B CE1   1 
ATOM   4856  C CE2   . PHE F 3 153 ? -19.371 -18.159 6.123  1.00 99.81  ? 147 PHE B CE2   1 
ATOM   4857  C CZ    . PHE F 3 153 ? -19.253 -19.523 6.382  1.00 103.01 ? 147 PHE B CZ    1 
ATOM   4858  N N     . SER F 3 154 ? -14.331 -18.748 2.903  1.00 114.73 ? 148 SER B N     1 
ATOM   4859  C CA    . SER F 3 154 ? -13.346 -19.700 3.416  1.00 116.84 ? 148 SER B CA    1 
ATOM   4860  C C     . SER F 3 154 ? -12.249 -18.994 4.218  1.00 114.03 ? 148 SER B C     1 
ATOM   4861  O O     . SER F 3 154 ? -11.632 -19.593 5.106  1.00 114.03 ? 148 SER B O     1 
ATOM   4862  C CB    . SER F 3 154 ? -12.736 -20.516 2.270  1.00 122.75 ? 148 SER B CB    1 
ATOM   4863  N N     . SER F 3 155 ? -12.032 -17.718 3.901  1.00 111.76 ? 149 SER B N     1 
ATOM   4864  C CA    . SER F 3 155 ? -10.919 -16.936 4.438  1.00 110.08 ? 149 SER B CA    1 
ATOM   4865  C C     . SER F 3 155 ? -10.942 -16.832 5.968  1.00 105.67 ? 149 SER B C     1 
ATOM   4866  O O     . SER F 3 155 ? -11.979 -16.521 6.555  1.00 101.75 ? 149 SER B O     1 
ATOM   4867  C CB    . SER F 3 155 ? -10.888 -15.543 3.794  1.00 108.77 ? 149 SER B CB    1 
ATOM   4868  O OG    . SER F 3 155 ? -9.969  -14.685 4.451  1.00 107.51 ? 149 SER B OG    1 
ATOM   4869  N N     . PRO F 3 156 ? -9.793  -17.114 6.614  1.00 106.46 ? 150 PRO B N     1 
ATOM   4870  C CA    . PRO F 3 156 ? -9.682  -17.012 8.069  1.00 103.05 ? 150 PRO B CA    1 
ATOM   4871  C C     . PRO F 3 156 ? -9.843  -15.576 8.569  1.00 98.29  ? 150 PRO B C     1 
ATOM   4872  O O     . PRO F 3 156 ? -10.096 -15.369 9.746  1.00 94.80  ? 150 PRO B O     1 
ATOM   4873  C CB    . PRO F 3 156 ? -8.268  -17.533 8.359  1.00 106.14 ? 150 PRO B CB    1 
ATOM   4874  C CG    . PRO F 3 156 ? -7.536  -17.418 7.075  1.00 110.25 ? 150 PRO B CG    1 
ATOM   4875  C CD    . PRO F 3 156 ? -8.551  -17.621 6.002  1.00 111.33 ? 150 PRO B CD    1 
ATOM   4876  N N     . ASP F 3 157 ? -9.705  -14.608 7.666  1.00 98.37  ? 151 ASP B N     1 
ATOM   4877  C CA    . ASP F 3 157 ? -9.896  -13.195 7.984  1.00 94.55  ? 151 ASP B CA    1 
ATOM   4878  C C     . ASP F 3 157 ? -11.281 -12.683 7.578  1.00 91.90  ? 151 ASP B C     1 
ATOM   4879  O O     . ASP F 3 157 ? -11.487 -11.468 7.469  1.00 89.56  ? 151 ASP B O     1 
ATOM   4880  C CB    . ASP F 3 157 ? -8.825  -12.340 7.293  1.00 96.67  ? 151 ASP B CB    1 
ATOM   4881  C CG    . ASP F 3 157 ? -7.416  -12.802 7.596  1.00 100.06 ? 151 ASP B CG    1 
ATOM   4882  O OD1   . ASP F 3 157 ? -7.133  -13.164 8.759  1.00 99.51  ? 151 ASP B OD1   1 
ATOM   4883  O OD2   . ASP F 3 157 ? -6.585  -12.789 6.664  1.00 104.20 ? 151 ASP B OD2   1 
ATOM   4884  N N     . PHE F 3 158 ? -12.224 -13.597 7.351  1.00 92.38  ? 152 PHE B N     1 
ATOM   4885  C CA    . PHE F 3 158 ? -13.557 -13.207 6.895  1.00 90.50  ? 152 PHE B CA    1 
ATOM   4886  C C     . PHE F 3 158 ? -14.306 -12.437 7.974  1.00 85.72  ? 152 PHE B C     1 
ATOM   4887  O O     . PHE F 3 158 ? -15.023 -11.478 7.670  1.00 83.47  ? 152 PHE B O     1 
ATOM   4888  C CB    . PHE F 3 158 ? -14.378 -14.408 6.417  1.00 92.90  ? 152 PHE B CB    1 
ATOM   4889  C CG    . PHE F 3 158 ? -15.657 -14.026 5.720  1.00 92.03  ? 152 PHE B CG    1 
ATOM   4890  C CD1   . PHE F 3 158 ? -15.637 -13.200 4.596  1.00 92.89  ? 152 PHE B CD1   1 
ATOM   4891  C CD2   . PHE F 3 158 ? -16.880 -14.489 6.183  1.00 90.33  ? 152 PHE B CD2   1 
ATOM   4892  C CE1   . PHE F 3 158 ? -16.816 -12.838 3.950  1.00 92.13  ? 152 PHE B CE1   1 
ATOM   4893  C CE2   . PHE F 3 158 ? -18.064 -14.137 5.539  1.00 90.14  ? 152 PHE B CE2   1 
ATOM   4894  C CZ    . PHE F 3 158 ? -18.031 -13.313 4.418  1.00 90.75  ? 152 PHE B CZ    1 
ATOM   4895  N N     . GLY F 3 159 ? -14.119 -12.863 9.224  1.00 84.25  ? 153 GLY B N     1 
ATOM   4896  C CA    . GLY F 3 159 ? -14.662 -12.168 10.388 1.00 80.07  ? 153 GLY B CA    1 
ATOM   4897  C C     . GLY F 3 159 ? -14.139 -10.750 10.483 1.00 77.92  ? 153 GLY B C     1 
ATOM   4898  O O     . GLY F 3 159 ? -14.905 -9.808  10.713 1.00 74.86  ? 153 GLY B O     1 
ATOM   4899  N N     . HIS F 3 160 ? -12.828 -10.606 10.299 1.00 79.77  ? 154 HIS B N     1 
ATOM   4900  C CA    . HIS F 3 160 ? -12.183 -9.299  10.261 1.00 78.69  ? 154 HIS B CA    1 
ATOM   4901  C C     . HIS F 3 160 ? -12.845 -8.446  9.179  1.00 78.26  ? 154 HIS B C     1 
ATOM   4902  O O     . HIS F 3 160 ? -13.338 -7.350  9.459  1.00 75.53  ? 154 HIS B O     1 
ATOM   4903  C CB    . HIS F 3 160 ? -10.689 -9.461  9.972  1.00 82.03  ? 154 HIS B CB    1 
ATOM   4904  C CG    . HIS F 3 160 ? -9.872  -8.241  10.262 1.00 81.91  ? 154 HIS B CG    1 
ATOM   4905  N ND1   . HIS F 3 160 ? -8.544  -8.309  10.628 1.00 84.53  ? 154 HIS B ND1   1 
ATOM   4906  C CD2   . HIS F 3 160 ? -10.190 -6.924  10.248 1.00 80.07  ? 154 HIS B CD2   1 
ATOM   4907  C CE1   . HIS F 3 160 ? -8.079  -7.088  10.821 1.00 83.99  ? 154 HIS B CE1   1 
ATOM   4908  N NE2   . HIS F 3 160 ? -9.060  -6.229  10.604 1.00 81.40  ? 154 HIS B NE2   1 
ATOM   4909  N N     . TYR F 3 161 ? -12.875 -8.980  7.955  1.00 81.06  ? 155 TYR B N     1 
ATOM   4910  C CA    . TYR F 3 161 ? -13.452 -8.306  6.788  1.00 81.37  ? 155 TYR B CA    1 
ATOM   4911  C C     . TYR F 3 161 ? -14.871 -7.796  7.035  1.00 78.10  ? 155 TYR B C     1 
ATOM   4912  O O     . TYR F 3 161 ? -15.219 -6.696  6.591  1.00 76.98  ? 155 TYR B O     1 
ATOM   4913  C CB    . TYR F 3 161 ? -13.429 -9.246  5.571  1.00 85.50  ? 155 TYR B CB    1 
ATOM   4914  C CG    . TYR F 3 161 ? -14.008 -8.674  4.288  1.00 86.22  ? 155 TYR B CG    1 
ATOM   4915  C CD1   . TYR F 3 161 ? -13.277 -7.791  3.497  1.00 87.88  ? 155 TYR B CD1   1 
ATOM   4916  C CD2   . TYR F 3 161 ? -15.279 -9.041  3.855  1.00 86.26  ? 155 TYR B CD2   1 
ATOM   4917  C CE1   . TYR F 3 161 ? -13.807 -7.274  2.314  1.00 89.88  ? 155 TYR B CE1   1 
ATOM   4918  C CE2   . TYR F 3 161 ? -15.821 -8.534  2.673  1.00 87.95  ? 155 TYR B CE2   1 
ATOM   4919  C CZ    . TYR F 3 161 ? -15.081 -7.651  1.904  1.00 89.91  ? 155 TYR B CZ    1 
ATOM   4920  O OH    . TYR F 3 161 ? -15.614 -7.149  0.732  1.00 90.71  ? 155 TYR B OH    1 
ATOM   4921  N N     . LEU F 3 162 ? -15.677 -8.593  7.741  1.00 76.77  ? 156 LEU B N     1 
ATOM   4922  C CA    . LEU F 3 162 ? -17.081 -8.253  7.983  1.00 74.16  ? 156 LEU B CA    1 
ATOM   4923  C C     . LEU F 3 162 ? -17.203 -7.002  8.841  1.00 70.49  ? 156 LEU B C     1 
ATOM   4924  O O     . LEU F 3 162 ? -17.877 -6.048  8.440  1.00 68.93  ? 156 LEU B O     1 
ATOM   4925  C CB    . LEU F 3 162 ? -17.866 -9.430  8.589  1.00 73.89  ? 156 LEU B CB    1 
ATOM   4926  C CG    . LEU F 3 162 ? -18.038 -10.681 7.714  1.00 77.99  ? 156 LEU B CG    1 
ATOM   4927  C CD1   . LEU F 3 162 ? -19.056 -11.648 8.305  1.00 77.54  ? 156 LEU B CD1   1 
ATOM   4928  C CD2   . LEU F 3 162 ? -18.412 -10.329 6.275  1.00 79.56  ? 156 LEU B CD2   1 
ATOM   4929  N N     . VAL F 3 163 ? -16.517 -7.004  9.991  1.00 69.07  ? 157 VAL B N     1 
ATOM   4930  C CA    . VAL F 3 163 ? -16.553 -5.880  10.935 1.00 65.92  ? 157 VAL B CA    1 
ATOM   4931  C C     . VAL F 3 163 ? -15.960 -4.612  10.332 1.00 66.32  ? 157 VAL B C     1 
ATOM   4932  O O     . VAL F 3 163 ? -16.432 -3.516  10.604 1.00 63.97  ? 157 VAL B O     1 
ATOM   4933  C CB    . VAL F 3 163 ? -15.909 -6.205  12.336 1.00 64.68  ? 157 VAL B CB    1 
ATOM   4934  C CG1   . VAL F 3 163 ? -16.612 -7.375  12.996 1.00 64.41  ? 157 VAL B CG1   1 
ATOM   4935  C CG2   . VAL F 3 163 ? -14.419 -6.470  12.247 1.00 66.83  ? 157 VAL B CG2   1 
ATOM   4936  N N     . LEU F 3 164 ? -14.960 -4.773  9.474  1.00 69.72  ? 158 LEU B N     1 
ATOM   4937  C CA    . LEU F 3 164 ? -14.276 -3.636  8.892  1.00 71.05  ? 158 LEU B CA    1 
ATOM   4938  C C     . LEU F 3 164 ? -15.089 -2.974  7.775  1.00 71.91  ? 158 LEU B C     1 
ATOM   4939  O O     . LEU F 3 164 ? -15.192 -1.746  7.749  1.00 71.21  ? 158 LEU B O     1 
ATOM   4940  C CB    . LEU F 3 164 ? -12.899 -4.053  8.382  1.00 74.98  ? 158 LEU B CB    1 
ATOM   4941  C CG    . LEU F 3 164 ? -11.705 -3.127  8.631  1.00 76.40  ? 158 LEU B CG    1 
ATOM   4942  C CD1   . LEU F 3 164 ? -10.475 -3.705  7.943  1.00 80.44  ? 158 LEU B CD1   1 
ATOM   4943  C CD2   . LEU F 3 164 ? -11.965 -1.701  8.153  1.00 76.41  ? 158 LEU B CD2   1 
ATOM   4944  N N     . THR F 3 165 ? -15.654 -3.771  6.859  1.00 73.83  ? 159 THR B N     1 
ATOM   4945  C CA    . THR F 3 165 ? -16.483 -3.225  5.775  1.00 74.79  ? 159 THR B CA    1 
ATOM   4946  C C     . THR F 3 165 ? -17.736 -2.544  6.318  1.00 71.58  ? 159 THR B C     1 
ATOM   4947  O O     . THR F 3 165 ? -18.178 -1.520  5.787  1.00 71.09  ? 159 THR B O     1 
ATOM   4948  C CB    . THR F 3 165 ? -16.922 -4.299  4.745  1.00 77.96  ? 159 THR B CB    1 
ATOM   4949  O OG1   . THR F 3 165 ? -17.381 -5.474  5.425  1.00 77.37  ? 159 THR B OG1   1 
ATOM   4950  C CG2   . THR F 3 165 ? -15.782 -4.656  3.814  1.00 81.59  ? 159 THR B CG2   1 
ATOM   4951  N N     . LYS F 3 166 ? -18.295 -3.126  7.378  1.00 69.51  ? 160 LYS B N     1 
ATOM   4952  C CA    . LYS F 3 166 ? -19.458 -2.578  8.055  1.00 66.53  ? 160 LYS B CA    1 
ATOM   4953  C C     . LYS F 3 166 ? -19.113 -1.233  8.650  1.00 64.54  ? 160 LYS B C     1 
ATOM   4954  O O     . LYS F 3 166 ? -19.853 -0.269  8.470  1.00 63.79  ? 160 LYS B O     1 
ATOM   4955  C CB    . LYS F 3 166 ? -19.926 -3.518  9.160  1.00 64.99  ? 160 LYS B CB    1 
ATOM   4956  C CG    . LYS F 3 166 ? -21.264 -3.157  9.773  1.00 62.75  ? 160 LYS B CG    1 
ATOM   4957  C CD    . LYS F 3 166 ? -22.410 -3.568  8.866  1.00 64.26  ? 160 LYS B CD    1 
ATOM   4958  C CE    . LYS F 3 166 ? -23.751 -3.243  9.485  1.00 61.01  ? 160 LYS B CE    1 
ATOM   4959  N NZ    . LYS F 3 166 ? -24.045 -1.792  9.425  1.00 58.89  ? 160 LYS B NZ    1 
ATOM   4960  N N     . ALA F 3 167 ? -17.984 -1.175  9.351  1.00 64.48  ? 161 ALA B N     1 
ATOM   4961  C CA    . ALA F 3 167 ? -17.556 0.036   10.040 1.00 62.85  ? 161 ALA B CA    1 
ATOM   4962  C C     . ALA F 3 167 ? -17.273 1.134   9.033  1.00 64.47  ? 161 ALA B C     1 
ATOM   4963  O O     . ALA F 3 167 ? -17.629 2.289   9.246  1.00 62.92  ? 161 ALA B O     1 
ATOM   4964  C CB    . ALA F 3 167 ? -16.331 -0.244  10.883 1.00 62.93  ? 161 ALA B CB    1 
ATOM   4965  N N     . LEU F 3 168 ? -16.644 0.751   7.927  1.00 68.14  ? 162 LEU B N     1 
ATOM   4966  C CA    . LEU F 3 168 ? -16.345 1.668   6.833  1.00 70.72  ? 162 LEU B CA    1 
ATOM   4967  C C     . LEU F 3 168 ? -17.629 2.196   6.193  1.00 70.47  ? 162 LEU B C     1 
ATOM   4968  O O     . LEU F 3 168 ? -17.767 3.400   5.960  1.00 70.17  ? 162 LEU B O     1 
ATOM   4969  C CB    . LEU F 3 168 ? -15.488 0.964   5.785  1.00 74.56  ? 162 LEU B CB    1 
ATOM   4970  C CG    . LEU F 3 168 ? -14.415 1.770   5.055  1.00 77.76  ? 162 LEU B CG    1 
ATOM   4971  C CD1   . LEU F 3 168 ? -13.505 0.809   4.321  1.00 82.27  ? 162 LEU B CD1   1 
ATOM   4972  C CD2   . LEU F 3 168 ? -14.989 2.791   4.085  1.00 79.16  ? 162 LEU B CD2   1 
ATOM   4973  N N     . GLU F 3 169 ? -18.568 1.299   5.913  1.00 71.06  ? 163 GLU B N     1 
ATOM   4974  C CA    . GLU F 3 169 ? -19.830 1.717   5.312  1.00 71.73  ? 163 GLU B CA    1 
ATOM   4975  C C     . GLU F 3 169 ? -20.559 2.677   6.243  1.00 68.24  ? 163 GLU B C     1 
ATOM   4976  O O     . GLU F 3 169 ? -21.015 3.737   5.805  1.00 68.28  ? 163 GLU B O     1 
ATOM   4977  C CB    . GLU F 3 169 ? -20.717 0.520   4.951  1.00 72.83  ? 163 GLU B CB    1 
ATOM   4978  C CG    . GLU F 3 169 ? -20.088 -0.493  3.980  1.00 78.92  ? 163 GLU B CG    1 
ATOM   4979  C CD    . GLU F 3 169 ? -19.584 0.107   2.659  1.00 85.55  ? 163 GLU B CD    1 
ATOM   4980  O OE1   . GLU F 3 169 ? -20.271 0.986   2.082  1.00 87.31  ? 163 GLU B OE1   1 
ATOM   4981  O OE2   . GLU F 3 169 ? -18.503 -0.332  2.186  1.00 88.99  ? 163 GLU B OE2   1 
ATOM   4982  N N     . ARG F 3 170 ? -20.625 2.308   7.526  1.00 65.79  ? 164 ARG B N     1 
ATOM   4983  C CA    . ARG F 3 170 ? -21.223 3.128   8.585  1.00 62.74  ? 164 ARG B CA    1 
ATOM   4984  C C     . ARG F 3 170 ? -20.705 4.572   8.617  1.00 62.58  ? 164 ARG B C     1 
ATOM   4985  O O     . ARG F 3 170 ? -21.489 5.501   8.786  1.00 61.36  ? 164 ARG B O     1 
ATOM   4986  C CB    . ARG F 3 170 ? -21.029 2.455   9.946  1.00 60.86  ? 164 ARG B CB    1 
ATOM   4987  C CG    . ARG F 3 170 ? -21.567 3.241   11.137 1.00 58.57  ? 164 ARG B CG    1 
ATOM   4988  C CD    . ARG F 3 170 ? -21.545 2.416   12.413 1.00 58.91  ? 164 ARG B CD    1 
ATOM   4989  N NE    . ARG F 3 170 ? -20.218 2.342   13.019 1.00 60.59  ? 164 ARG B NE    1 
ATOM   4990  C CZ    . ARG F 3 170 ? -19.928 1.617   14.096 1.00 60.48  ? 164 ARG B CZ    1 
ATOM   4991  N NH1   . ARG F 3 170 ? -20.876 0.893   14.687 1.00 60.02  ? 164 ARG B NH1   1 
ATOM   4992  N NH2   . ARG F 3 170 ? -18.690 1.614   14.578 1.00 60.25  ? 164 ARG B NH2   1 
ATOM   4993  N N     . GLU F 3 171 ? -19.398 4.764   8.448  1.00 64.21  ? 165 GLU B N     1 
ATOM   4994  C CA    . GLU F 3 171 ? -18.849 6.120   8.406  1.00 64.92  ? 165 GLU B CA    1 
ATOM   4995  C C     . GLU F 3 171 ? -19.086 6.839   7.064  1.00 66.99  ? 165 GLU B C     1 
ATOM   4996  O O     . GLU F 3 171 ? -19.283 8.056   7.042  1.00 66.72  ? 165 GLU B O     1 
ATOM   4997  C CB    . GLU F 3 171 ? -17.377 6.153   8.825  1.00 65.98  ? 165 GLU B CB    1 
ATOM   4998  C CG    . GLU F 3 171 ? -17.137 5.836   10.306 1.00 66.06  ? 165 GLU B CG    1 
ATOM   4999  C CD    . GLU F 3 171 ? -17.697 6.894   11.274 1.00 67.44  ? 165 GLU B CD    1 
ATOM   5000  O OE1   . GLU F 3 171 ? -17.196 8.046   11.279 1.00 69.21  ? 165 GLU B OE1   1 
ATOM   5001  O OE2   . GLU F 3 171 ? -18.627 6.568   12.054 1.00 66.39  ? 165 GLU B OE2   1 
ATOM   5002  N N     . LYS F 3 172 ? -19.086 6.096   5.958  1.00 69.31  ? 166 LYS B N     1 
ATOM   5003  C CA    . LYS F 3 172 ? -19.427 6.675   4.648  1.00 71.82  ? 166 LYS B CA    1 
ATOM   5004  C C     . LYS F 3 172 ? -20.845 7.229   4.674  1.00 70.14  ? 166 LYS B C     1 
ATOM   5005  O O     . LYS F 3 172 ? -21.094 8.354   4.223  1.00 70.91  ? 166 LYS B O     1 
ATOM   5006  C CB    . LYS F 3 172 ? -19.297 5.639   3.530  1.00 74.88  ? 166 LYS B CB    1 
ATOM   5007  C CG    . LYS F 3 172 ? -17.886 5.444   3.014  1.00 78.35  ? 166 LYS B CG    1 
ATOM   5008  C CD    . LYS F 3 172 ? -17.850 4.398   1.905  1.00 81.93  ? 166 LYS B CD    1 
ATOM   5009  C CE    . LYS F 3 172 ? -16.587 4.523   1.065  1.00 86.04  ? 166 LYS B CE    1 
ATOM   5010  N NZ    . LYS F 3 172 ? -16.669 3.715   -0.185 1.00 89.76  ? 166 LYS B NZ    1 
ATOM   5011  N N     . ASN F 3 173 ? -21.761 6.429   5.223  1.00 67.99  ? 167 ASN B N     1 
ATOM   5012  C CA    . ASN F 3 173 ? -23.161 6.812   5.359  1.00 66.38  ? 167 ASN B CA    1 
ATOM   5013  C C     . ASN F 3 173 ? -23.311 8.062   6.213  1.00 63.96  ? 167 ASN B C     1 
ATOM   5014  O O     . ASN F 3 173 ? -24.036 8.982   5.834  1.00 65.11  ? 167 ASN B O     1 
ATOM   5015  C CB    . ASN F 3 173 ? -23.997 5.667   5.935  1.00 64.79  ? 167 ASN B CB    1 
ATOM   5016  N N     . TYR F 3 174 ? -22.596 8.104   7.332  1.00 61.10  ? 168 TYR B N     1 
ATOM   5017  C CA    . TYR F 3 174 ? -22.657 9.225   8.266  1.00 58.80  ? 168 TYR B CA    1 
ATOM   5018  C C     . TYR F 3 174 ? -22.106 10.520  7.660  1.00 60.10  ? 168 TYR B C     1 
ATOM   5019  O O     . TYR F 3 174 ? -22.638 11.602  7.886  1.00 59.08  ? 168 TYR B O     1 
ATOM   5020  C CB    . TYR F 3 174 ? -21.890 8.876   9.545  1.00 56.88  ? 168 TYR B CB    1 
ATOM   5021  C CG    . TYR F 3 174 ? -22.515 9.391   10.822 1.00 55.28  ? 168 TYR B CG    1 
ATOM   5022  C CD1   . TYR F 3 174 ? -22.813 10.749  10.989 1.00 55.61  ? 168 TYR B CD1   1 
ATOM   5023  C CD2   . TYR F 3 174 ? -22.791 8.519   11.884 1.00 54.26  ? 168 TYR B CD2   1 
ATOM   5024  C CE1   . TYR F 3 174 ? -23.383 11.227  12.173 1.00 53.52  ? 168 TYR B CE1   1 
ATOM   5025  C CE2   . TYR F 3 174 ? -23.354 8.982   13.067 1.00 52.22  ? 168 TYR B CE2   1 
ATOM   5026  C CZ    . TYR F 3 174 ? -23.651 10.337  13.204 1.00 52.17  ? 168 TYR B CZ    1 
ATOM   5027  O OH    . TYR F 3 174 ? -24.212 10.795  14.373 1.00 50.27  ? 168 TYR B OH    1 
ATOM   5028  N N     . VAL F 3 175 ? -21.029 10.397  6.896  1.00 62.48  ? 169 VAL B N     1 
ATOM   5029  C CA    . VAL F 3 175 ? -20.448 11.541  6.211  1.00 64.85  ? 169 VAL B CA    1 
ATOM   5030  C C     . VAL F 3 175 ? -21.428 12.096  5.171  1.00 66.56  ? 169 VAL B C     1 
ATOM   5031  O O     . VAL F 3 175 ? -21.739 13.285  5.200  1.00 66.66  ? 169 VAL B O     1 
ATOM   5032  C CB    . VAL F 3 175 ? -19.067 11.201  5.585  1.00 67.83  ? 169 VAL B CB    1 
ATOM   5033  C CG1   . VAL F 3 175 ? -18.601 12.303  4.634  1.00 70.48  ? 169 VAL B CG1   1 
ATOM   5034  C CG2   . VAL F 3 175 ? -18.033 10.991  6.681  1.00 66.30  ? 169 VAL B CG2   1 
ATOM   5035  N N     . SER F 3 176 ? -21.938 11.235  4.287  1.00 67.79  ? 170 SER B N     1 
ATOM   5036  C CA    . SER F 3 176 ? -22.862 11.685  3.239  1.00 70.29  ? 170 SER B CA    1 
ATOM   5037  C C     . SER F 3 176 ? -24.137 12.305  3.815  1.00 67.82  ? 170 SER B C     1 
ATOM   5038  O O     . SER F 3 176 ? -24.660 13.286  3.269  1.00 69.11  ? 170 SER B O     1 
ATOM   5039  C CB    . SER F 3 176 ? -23.208 10.552  2.254  1.00 72.51  ? 170 SER B CB    1 
ATOM   5040  O OG    . SER F 3 176 ? -23.752 9.435   2.935  1.00 71.86  ? 170 SER B OG    1 
ATOM   5041  N N     . TRP F 3 177 ? -24.625 11.734  4.917  1.00 64.19  ? 171 TRP B N     1 
ATOM   5042  C CA    . TRP F 3 177 ? -25.811 12.247  5.574  1.00 62.02  ? 171 TRP B CA    1 
ATOM   5043  C C     . TRP F 3 177 ? -25.554 13.654  6.104  1.00 61.81  ? 171 TRP B C     1 
ATOM   5044  O O     . TRP F 3 177 ? -26.344 14.562  5.848  1.00 62.62  ? 171 TRP B O     1 
ATOM   5045  C CB    . TRP F 3 177 ? -26.281 11.309  6.698  1.00 59.04  ? 171 TRP B CB    1 
ATOM   5046  C CG    . TRP F 3 177 ? -27.488 11.834  7.437  1.00 56.45  ? 171 TRP B CG    1 
ATOM   5047  C CD1   . TRP F 3 177 ? -28.794 11.734  7.049  1.00 56.19  ? 171 TRP B CD1   1 
ATOM   5048  C CD2   . TRP F 3 177 ? -27.491 12.568  8.670  1.00 52.96  ? 171 TRP B CD2   1 
ATOM   5049  N NE1   . TRP F 3 177 ? -29.610 12.350  7.969  1.00 54.15  ? 171 TRP B NE1   1 
ATOM   5050  C CE2   . TRP F 3 177 ? -28.837 12.873  8.972  1.00 52.15  ? 171 TRP B CE2   1 
ATOM   5051  C CE3   . TRP F 3 177 ? -26.490 12.986  9.554  1.00 51.37  ? 171 TRP B CE3   1 
ATOM   5052  C CZ2   . TRP F 3 177 ? -29.209 13.576  10.126 1.00 50.77  ? 171 TRP B CZ2   1 
ATOM   5053  C CZ3   . TRP F 3 177 ? -26.860 13.684  10.710 1.00 49.57  ? 171 TRP B CZ3   1 
ATOM   5054  C CH2   . TRP F 3 177 ? -28.207 13.973  10.982 1.00 49.13  ? 171 TRP B CH2   1 
ATOM   5055  N N     . LEU F 3 178 ? -24.447 13.827  6.833  1.00 61.21  ? 172 LEU B N     1 
ATOM   5056  C CA    . LEU F 3 178 ? -24.080 15.122  7.431  1.00 61.02  ? 172 LEU B CA    1 
ATOM   5057  C C     . LEU F 3 178 ? -23.934 16.213  6.374  1.00 64.51  ? 172 LEU B C     1 
ATOM   5058  O O     . LEU F 3 178 ? -24.364 17.347  6.582  1.00 64.76  ? 172 LEU B O     1 
ATOM   5059  C CB    . LEU F 3 178 ? -22.786 15.009  8.248  1.00 60.11  ? 172 LEU B CB    1 
ATOM   5060  C CG    . LEU F 3 178 ? -22.813 14.305  9.607  1.00 56.45  ? 172 LEU B CG    1 
ATOM   5061  C CD1   . LEU F 3 178 ? -21.407 13.938  10.023 1.00 56.62  ? 172 LEU B CD1   1 
ATOM   5062  C CD2   . LEU F 3 178 ? -23.457 15.148  10.687 1.00 53.97  ? 172 LEU B CD2   1 
ATOM   5063  N N     . GLU F 3 179 ? -23.343 15.854  5.237  1.00 67.63  ? 173 GLU B N     1 
ATOM   5064  C CA    . GLU F 3 179 ? -23.168 16.782  4.135  1.00 71.74  ? 173 GLU B CA    1 
ATOM   5065  C C     . GLU F 3 179 ? -24.526 17.220  3.565  1.00 72.53  ? 173 GLU B C     1 
ATOM   5066  O O     . GLU F 3 179 ? -24.670 18.352  3.086  1.00 74.71  ? 173 GLU B O     1 
ATOM   5067  C CB    . GLU F 3 179 ? -22.276 16.165  3.048  1.00 75.21  ? 173 GLU B CB    1 
ATOM   5068  C CG    . GLU F 3 179 ? -20.806 15.920  3.470  1.00 77.23  ? 173 GLU B CG    1 
ATOM   5069  C CD    . GLU F 3 179 ? -19.830 17.020  3.026  1.00 83.51  ? 173 GLU B CD    1 
ATOM   5070  O OE1   . GLU F 3 179 ? -20.254 18.189  2.859  1.00 85.08  ? 173 GLU B OE1   1 
ATOM   5071  O OE2   . GLU F 3 179 ? -18.623 16.708  2.841  1.00 86.57  ? 173 GLU B OE2   1 
ATOM   5072  N N     . SER F 3 180 ? -25.515 16.328  3.632  1.00 71.06  ? 174 SER B N     1 
ATOM   5073  C CA    . SER F 3 180 ? -26.879 16.641  3.193  1.00 71.80  ? 174 SER B CA    1 
ATOM   5074  C C     . SER F 3 180 ? -27.525 17.683  4.090  1.00 70.25  ? 174 SER B C     1 
ATOM   5075  O O     . SER F 3 180 ? -28.194 18.595  3.600  1.00 72.37  ? 174 SER B O     1 
ATOM   5076  C CB    . SER F 3 180 ? -27.760 15.392  3.172  1.00 70.54  ? 174 SER B CB    1 
ATOM   5077  O OG    . SER F 3 180 ? -27.393 14.533  2.116  1.00 73.37  ? 174 SER B OG    1 
ATOM   5078  N N     . ILE F 3 181 ? -27.325 17.546  5.400  1.00 66.99  ? 175 ILE B N     1 
ATOM   5079  C CA    . ILE F 3 181 ? -27.961 18.435  6.361  1.00 65.33  ? 175 ILE B CA    1 
ATOM   5080  C C     . ILE F 3 181 ? -27.277 19.803  6.330  1.00 67.31  ? 175 ILE B C     1 
ATOM   5081  O O     . ILE F 3 181 ? -27.940 20.839  6.401  1.00 68.01  ? 175 ILE B O     1 
ATOM   5082  C CB    . ILE F 3 181 ? -27.974 17.827  7.791  1.00 61.91  ? 175 ILE B CB    1 
ATOM   5083  C CG1   . ILE F 3 181 ? -28.929 16.622  7.917  1.00 60.26  ? 175 ILE B CG1   1 
ATOM   5084  C CG2   . ILE F 3 181 ? -28.435 18.855  8.806  1.00 60.28  ? 175 ILE B CG2   1 
ATOM   5085  C CD1   . ILE F 3 181 ? -29.448 15.989  6.618  1.00 62.53  ? 175 ILE B CD1   1 
ATOM   5086  N N     . LEU F 3 182 ? -25.953 19.800  6.197  1.00 68.53  ? 176 LEU B N     1 
ATOM   5087  C CA    . LEU F 3 182 ? -25.181 21.034  6.111  1.00 70.92  ? 176 LEU B CA    1 
ATOM   5088  C C     . LEU F 3 182 ? -25.554 21.870  4.895  1.00 74.78  ? 176 LEU B C     1 
ATOM   5089  O O     . LEU F 3 182 ? -25.517 23.098  4.947  1.00 76.43  ? 176 LEU B O     1 
ATOM   5090  C CB    . LEU F 3 182 ? -23.686 20.732  6.097  1.00 71.93  ? 176 LEU B CB    1 
ATOM   5091  C CG    . LEU F 3 182 ? -22.942 20.753  7.433  1.00 70.09  ? 176 LEU B CG    1 
ATOM   5092  C CD1   . LEU F 3 182 ? -21.521 20.276  7.230  1.00 71.90  ? 176 LEU B CD1   1 
ATOM   5093  C CD2   . LEU F 3 182 ? -22.950 22.148  8.048  1.00 70.93  ? 176 LEU B CD2   1 
ATOM   5094  N N     . ALA F 3 183 ? -25.910 21.196  3.805  1.00 76.58  ? 177 ALA B N     1 
ATOM   5095  C CA    . ALA F 3 183 ? -26.408 21.860  2.603  1.00 80.50  ? 177 ALA B CA    1 
ATOM   5096  C C     . ALA F 3 183 ? -27.721 22.588  2.876  1.00 80.23  ? 177 ALA B C     1 
ATOM   5097  O O     . ALA F 3 183 ? -27.992 23.639  2.286  1.00 83.41  ? 177 ALA B O     1 
ATOM   5098  C CB    . ALA F 3 183 ? -26.599 20.854  1.491  1.00 82.15  ? 177 ALA B CB    1 
ATOM   5099  N N     . MET F 3 184 ? -28.535 22.005  3.754  1.00 76.95  ? 178 MET B N     1 
ATOM   5100  C CA    . MET F 3 184 ? -29.790 22.608  4.178  1.00 76.51  ? 178 MET B CA    1 
ATOM   5101  C C     . MET F 3 184 ? -29.556 23.652  5.271  1.00 75.59  ? 178 MET B C     1 
ATOM   5102  O O     . MET F 3 184 ? -30.291 24.639  5.348  1.00 77.03  ? 178 MET B O     1 
ATOM   5103  C CB    . MET F 3 184 ? -30.759 21.548  4.691  1.00 73.85  ? 178 MET B CB    1 
ATOM   5104  C CG    . MET F 3 184 ? -31.060 20.419  3.727  1.00 75.56  ? 178 MET B CG    1 
ATOM   5105  S SD    . MET F 3 184 ? -32.406 19.389  4.352  1.00 75.72  ? 178 MET B SD    1 
ATOM   5106  C CE    . MET F 3 184 ? -33.817 20.416  3.915  1.00 77.24  ? 178 MET B CE    1 
ATOM   5107  N N     . ILE F 3 185 ? -28.546 23.438  6.116  1.00 73.51  ? 179 ILE B N     1 
ATOM   5108  C CA    . ILE F 3 185 ? -28.242 24.389  7.186  1.00 72.67  ? 179 ILE B CA    1 
ATOM   5109  C C     . ILE F 3 185 ? -27.583 25.657  6.635  1.00 76.53  ? 179 ILE B C     1 
ATOM   5110  O O     . ILE F 3 185 ? -28.087 26.764  6.856  1.00 77.90  ? 179 ILE B O     1 
ATOM   5111  C CB    . ILE F 3 185 ? -27.391 23.765  8.325  1.00 69.77  ? 179 ILE B CB    1 
ATOM   5112  C CG1   . ILE F 3 185 ? -28.186 22.698  9.086  1.00 65.50  ? 179 ILE B CG1   1 
ATOM   5113  C CG2   . ILE F 3 185 ? -26.936 24.842  9.296  1.00 69.63  ? 179 ILE B CG2   1 
ATOM   5114  C CD1   . ILE F 3 185 ? -27.398 22.008  10.183 1.00 63.04  ? 179 ILE B CD1   1 
ATOM   5115  N N     . ASP F 3 186 ? -26.468 25.493  5.922  1.00 78.69  ? 180 ASP B N     1 
ATOM   5116  C CA    . ASP F 3 186 ? -25.771 26.616  5.280  1.00 82.82  ? 180 ASP B CA    1 
ATOM   5117  C C     . ASP F 3 186 ? -26.496 27.073  4.009  1.00 85.77  ? 180 ASP B C     1 
ATOM   5118  O O     . ASP F 3 186 ? -27.354 27.956  4.047  1.00 86.34  ? 180 ASP B O     1 
ATOM   5119  C CB    . ASP F 3 186 ? -24.316 26.242  4.954  1.00 84.43  ? 180 ASP B CB    1 
ATOM   5120  C CG    . ASP F 3 186 ? -23.452 26.070  6.204  1.00 83.29  ? 180 ASP B CG    1 
ATOM   5121  O OD1   . ASP F 3 186 ? -23.029 27.089  6.798  1.00 85.32  ? 180 ASP B OD1   1 
ATOM   5122  O OD2   . ASP F 3 186 ? -23.177 24.910  6.584  1.00 81.96  ? 180 ASP B OD2   1 
ATOM   5123  N N     . ARG G 3 8   ? 12.938  11.978  18.269 1.00 70.69  ? 2   ARG C N     1 
ATOM   5124  C CA    . ARG G 3 8   ? 14.118  12.127  17.373 1.00 69.08  ? 2   ARG C CA    1 
ATOM   5125  C C     . ARG G 3 8   ? 14.568  13.586  17.197 1.00 65.40  ? 2   ARG C C     1 
ATOM   5126  O O     . ARG G 3 8   ? 14.883  14.017  16.085 1.00 65.48  ? 2   ARG C O     1 
ATOM   5127  C CB    . ARG G 3 8   ? 13.814  11.509  16.004 1.00 72.26  ? 2   ARG C CB    1 
ATOM   5128  C CG    . ARG G 3 8   ? 13.810  9.982   15.974 1.00 76.76  ? 2   ARG C CG    1 
ATOM   5129  C CD    . ARG G 3 8   ? 14.057  9.468   14.565 1.00 80.11  ? 2   ARG C CD    1 
ATOM   5130  N NE    . ARG G 3 8   ? 15.435  9.692   14.119 1.00 78.62  ? 2   ARG C NE    1 
ATOM   5131  C CZ    . ARG G 3 8   ? 15.842  9.577   12.856 1.00 80.21  ? 2   ARG C CZ    1 
ATOM   5132  N NH1   . ARG G 3 8   ? 14.981  9.250   11.901 1.00 83.46  ? 2   ARG C NH1   1 
ATOM   5133  N NH2   . ARG G 3 8   ? 17.110  9.796   12.540 1.00 78.52  ? 2   ARG C NH2   1 
ATOM   5134  N N     . VAL G 3 9   ? 14.611  14.338  18.295 1.00 62.75  ? 3   VAL C N     1 
ATOM   5135  C CA    . VAL G 3 9   ? 14.931  15.771  18.258 1.00 59.32  ? 3   VAL C CA    1 
ATOM   5136  C C     . VAL G 3 9   ? 16.358  16.085  17.772 1.00 57.34  ? 3   VAL C C     1 
ATOM   5137  O O     . VAL G 3 9   ? 16.576  17.116  17.130 1.00 56.38  ? 3   VAL C O     1 
ATOM   5138  C CB    . VAL G 3 9   ? 14.673  16.433  19.637 1.00 58.34  ? 3   VAL C CB    1 
ATOM   5139  C CG1   . VAL G 3 9   ? 15.019  17.929  19.618 1.00 56.26  ? 3   VAL C CG1   1 
ATOM   5140  C CG2   . VAL G 3 9   ? 13.219  16.222  20.070 1.00 60.04  ? 3   VAL C CG2   1 
ATOM   5141  N N     . LEU G 3 10  ? 17.322  15.207  18.068 1.00 56.91  ? 4   LEU C N     1 
ATOM   5142  C CA    . LEU G 3 10  ? 18.711  15.400  17.607 1.00 55.32  ? 4   LEU C CA    1 
ATOM   5143  C C     . LEU G 3 10  ? 18.813  15.434  16.078 1.00 56.40  ? 4   LEU C C     1 
ATOM   5144  O O     . LEU G 3 10  ? 19.632  16.166  15.512 1.00 55.93  ? 4   LEU C O     1 
ATOM   5145  C CB    . LEU G 3 10  ? 19.647  14.343  18.201 1.00 55.65  ? 4   LEU C CB    1 
ATOM   5146  C CG    . LEU G 3 10  ? 21.072  14.186  17.644 1.00 55.27  ? 4   LEU C CG    1 
ATOM   5147  C CD1   . LEU G 3 10  ? 21.975  15.332  18.026 1.00 52.08  ? 4   LEU C CD1   1 
ATOM   5148  C CD2   . LEU G 3 10  ? 21.676  12.884  18.111 1.00 56.87  ? 4   LEU C CD2   1 
ATOM   5149  N N     . LYS G 3 11  ? 17.965  14.652  15.417 1.00 58.43  ? 5   LYS C N     1 
ATOM   5150  C CA    . LYS G 3 11  ? 17.878  14.651  13.957 1.00 59.83  ? 5   LYS C CA    1 
ATOM   5151  C C     . LYS G 3 11  ? 17.599  16.055  13.440 1.00 58.89  ? 5   LYS C C     1 
ATOM   5152  O O     . LYS G 3 11  ? 18.247  16.520  12.500 1.00 59.63  ? 5   LYS C O     1 
ATOM   5153  C CB    . LYS G 3 11  ? 16.805  13.658  13.483 1.00 62.88  ? 5   LYS C CB    1 
ATOM   5154  C CG    . LYS G 3 11  ? 16.217  13.915  12.098 1.00 64.67  ? 5   LYS C CG    1 
ATOM   5155  C CD    . LYS G 3 11  ? 14.903  13.187  11.956 1.00 67.44  ? 5   LYS C CD    1 
ATOM   5156  C CE    . LYS G 3 11  ? 14.226  13.504  10.658 1.00 69.64  ? 5   LYS C CE    1 
ATOM   5157  N NZ    . LYS G 3 11  ? 12.888  12.873  10.639 1.00 73.17  ? 5   LYS C NZ    1 
ATOM   5158  N N     . TYR G 3 12  ? 16.652  16.743  14.061 1.00 57.61  ? 6   TYR C N     1 
ATOM   5159  C CA    . TYR G 3 12  ? 16.329  18.084  13.601 1.00 57.26  ? 6   TYR C CA    1 
ATOM   5160  C C     . TYR G 3 12  ? 17.374  19.095  14.053 1.00 55.22  ? 6   TYR C C     1 
ATOM   5161  O O     . TYR G 3 12  ? 17.512  20.155  13.449 1.00 55.81  ? 6   TYR C O     1 
ATOM   5162  C CB    . TYR G 3 12  ? 14.910  18.491  14.010 1.00 57.54  ? 6   TYR C CB    1 
ATOM   5163  C CG    . TYR G 3 12  ? 13.845  17.605  13.409 1.00 59.91  ? 6   TYR C CG    1 
ATOM   5164  C CD1   . TYR G 3 12  ? 13.636  17.564  12.026 1.00 62.67  ? 6   TYR C CD1   1 
ATOM   5165  C CD2   . TYR G 3 12  ? 13.051  16.800  14.215 1.00 60.92  ? 6   TYR C CD2   1 
ATOM   5166  C CE1   . TYR G 3 12  ? 12.660  16.739  11.464 1.00 65.42  ? 6   TYR C CE1   1 
ATOM   5167  C CE2   . TYR G 3 12  ? 12.068  15.976  13.666 1.00 64.66  ? 6   TYR C CE2   1 
ATOM   5168  C CZ    . TYR G 3 12  ? 11.883  15.947  12.291 1.00 66.85  ? 6   TYR C CZ    1 
ATOM   5169  O OH    . TYR G 3 12  ? 10.910  15.133  11.755 1.00 71.17  ? 6   TYR C OH    1 
ATOM   5170  N N     . ALA G 3 13  ? 18.127  18.755  15.096 1.00 53.59  ? 7   ALA C N     1 
ATOM   5171  C CA    . ALA G 3 13  ? 19.214  19.617  15.570 1.00 52.12  ? 7   ALA C CA    1 
ATOM   5172  C C     . ALA G 3 13  ? 20.322  19.630  14.532 1.00 52.90  ? 7   ALA C C     1 
ATOM   5173  O O     . ALA G 3 13  ? 20.879  20.679  14.216 1.00 53.38  ? 7   ALA C O     1 
ATOM   5174  C CB    . ALA G 3 13  ? 19.747  19.128  16.905 1.00 50.64  ? 7   ALA C CB    1 
ATOM   5175  N N     . ILE G 3 14  ? 20.626  18.455  13.993 1.00 53.55  ? 8   ILE C N     1 
ATOM   5176  C CA    . ILE G 3 14  ? 21.651  18.326  12.969 1.00 54.97  ? 8   ILE C CA    1 
ATOM   5177  C C     . ILE G 3 14  ? 21.237  19.001  11.657 1.00 57.25  ? 8   ILE C C     1 
ATOM   5178  O O     . ILE G 3 14  ? 22.041  19.721  11.054 1.00 58.72  ? 8   ILE C O     1 
ATOM   5179  C CB    . ILE G 3 14  ? 22.028  16.853  12.765 1.00 56.20  ? 8   ILE C CB    1 
ATOM   5180  C CG1   . ILE G 3 14  ? 22.845  16.376  13.974 1.00 54.77  ? 8   ILE C CG1   1 
ATOM   5181  C CG2   . ILE G 3 14  ? 22.795  16.646  11.451 1.00 57.96  ? 8   ILE C CG2   1 
ATOM   5182  C CD1   . ILE G 3 14  ? 22.611  14.946  14.335 1.00 55.01  ? 8   ILE C CD1   1 
ATOM   5183  N N     . LEU G 3 15  ? 19.987  18.791  11.238 1.00 57.91  ? 9   LEU C N     1 
ATOM   5184  C CA    . LEU G 3 15  ? 19.480  19.388  10.003 1.00 60.35  ? 9   LEU C CA    1 
ATOM   5185  C C     . LEU G 3 15  ? 19.535  20.906  10.056 1.00 60.31  ? 9   LEU C C     1 
ATOM   5186  O O     . LEU G 3 15  ? 19.833  21.563  9.054  1.00 62.43  ? 9   LEU C O     1 
ATOM   5187  C CB    . LEU G 3 15  ? 18.042  18.930  9.687  1.00 61.54  ? 9   LEU C CB    1 
ATOM   5188  C CG    . LEU G 3 15  ? 17.710  17.458  9.406  1.00 62.48  ? 9   LEU C CG    1 
ATOM   5189  C CD1   . LEU G 3 15  ? 16.328  17.338  8.804  1.00 63.83  ? 9   LEU C CD1   1 
ATOM   5190  C CD2   . LEU G 3 15  ? 18.743  16.787  8.517  1.00 63.83  ? 9   LEU C CD2   1 
ATOM   5191  N N     . GLY G 3 16  ? 19.249  21.457  11.228 1.00 58.18  ? 10  GLY C N     1 
ATOM   5192  C CA    . GLY G 3 16  ? 19.175  22.902  11.382 1.00 59.11  ? 10  GLY C CA    1 
ATOM   5193  C C     . GLY G 3 16  ? 20.548  23.533  11.362 1.00 59.82  ? 10  GLY C C     1 
ATOM   5194  O O     . GLY G 3 16  ? 20.760  24.573  10.732 1.00 62.09  ? 10  GLY C O     1 
ATOM   5195  N N     . LEU G 3 17  ? 21.486  22.888  12.049 1.00 58.14  ? 11  LEU C N     1 
ATOM   5196  C CA    . LEU G 3 17  ? 22.865  23.354  12.085 1.00 59.03  ? 11  LEU C CA    1 
ATOM   5197  C C     . LEU G 3 17  ? 23.512  23.451  10.700 1.00 62.33  ? 11  LEU C C     1 
ATOM   5198  O O     . LEU G 3 17  ? 24.408  24.267  10.500 1.00 64.40  ? 11  LEU C O     1 
ATOM   5199  C CB    . LEU G 3 17  ? 23.703  22.463  13.006 1.00 56.88  ? 11  LEU C CB    1 
ATOM   5200  C CG    . LEU G 3 17  ? 23.490  22.677  14.503 1.00 54.21  ? 11  LEU C CG    1 
ATOM   5201  C CD1   . LEU G 3 17  ? 24.151  21.573  15.306 1.00 51.06  ? 11  LEU C CD1   1 
ATOM   5202  C CD2   . LEU G 3 17  ? 23.999  24.055  14.926 1.00 54.42  ? 11  LEU C CD2   1 
ATOM   5203  N N     . LEU G 3 18  ? 23.048  22.631  9.758  1.00 63.41  ? 12  LEU C N     1 
ATOM   5204  C CA    . LEU G 3 18  ? 23.632  22.555  8.418  1.00 67.20  ? 12  LEU C CA    1 
ATOM   5205  C C     . LEU G 3 18  ? 23.004  23.510  7.394  1.00 70.69  ? 12  LEU C C     1 
ATOM   5206  O O     . LEU G 3 18  ? 23.464  23.592  6.255  1.00 74.34  ? 12  LEU C O     1 
ATOM   5207  C CB    . LEU G 3 18  ? 23.526  21.122  7.888  1.00 67.55  ? 12  LEU C CB    1 
ATOM   5208  C CG    . LEU G 3 18  ? 24.269  19.993  8.605  1.00 66.22  ? 12  LEU C CG    1 
ATOM   5209  C CD1   . LEU G 3 18  ? 23.838  18.638  8.055  1.00 67.01  ? 12  LEU C CD1   1 
ATOM   5210  C CD2   . LEU G 3 18  ? 25.777  20.158  8.486  1.00 67.67  ? 12  LEU C CD2   1 
ATOM   5211  N N     . ARG G 3 19  ? 21.963  24.228  7.812  1.00 70.33  ? 13  ARG C N     1 
ATOM   5212  C CA    . ARG G 3 19  ? 21.135  25.070  6.943  1.00 73.41  ? 13  ARG C CA    1 
ATOM   5213  C C     . ARG G 3 19  ? 21.863  26.215  6.237  1.00 77.64  ? 13  ARG C C     1 
ATOM   5214  O O     . ARG G 3 19  ? 21.258  26.930  5.439  1.00 81.06  ? 13  ARG C O     1 
ATOM   5215  C CB    . ARG G 3 19  ? 19.977  25.649  7.764  1.00 72.00  ? 13  ARG C CB    1 
ATOM   5216  C CG    . ARG G 3 19  ? 20.346  26.895  8.570  1.00 71.62  ? 13  ARG C CG    1 
ATOM   5217  C CD    . ARG G 3 19  ? 19.408  27.139  9.744  1.00 69.08  ? 13  ARG C CD    1 
ATOM   5218  N NE    . ARG G 3 19  ? 19.838  28.302  10.519 1.00 69.67  ? 13  ARG C NE    1 
ATOM   5219  C CZ    . ARG G 3 19  ? 20.866  28.323  11.374 1.00 68.43  ? 13  ARG C CZ    1 
ATOM   5220  N NH1   . ARG G 3 19  ? 21.601  27.238  11.617 1.00 65.08  ? 13  ARG C NH1   1 
ATOM   5221  N NH2   . ARG G 3 19  ? 21.160  29.453  11.997 1.00 70.58  ? 13  ARG C NH2   1 
ATOM   5222  N N     . LYS G 3 20  ? 23.142  26.405  6.544  1.00 78.15  ? 14  LYS C N     1 
ATOM   5223  C CA    . LYS G 3 20  ? 23.918  27.517  5.992  1.00 82.60  ? 14  LYS C CA    1 
ATOM   5224  C C     . LYS G 3 20  ? 25.200  27.050  5.330  1.00 84.82  ? 14  LYS C C     1 
ATOM   5225  O O     . LYS G 3 20  ? 26.003  27.874  4.886  1.00 88.88  ? 14  LYS C O     1 
ATOM   5226  C CB    . LYS G 3 20  ? 24.252  28.540  7.083  1.00 82.17  ? 14  LYS C CB    1 
ATOM   5227  C CG    . LYS G 3 20  ? 23.199  29.614  7.268  1.00 84.17  ? 14  LYS C CG    1 
ATOM   5228  C CD    . LYS G 3 20  ? 23.579  30.583  8.381  1.00 85.51  ? 14  LYS C CD    1 
ATOM   5229  C CE    . LYS G 3 20  ? 22.661  31.808  8.367  1.00 88.73  ? 14  LYS C CE    1 
ATOM   5230  N NZ    . LYS G 3 20  ? 22.985  32.794  9.441  1.00 89.05  ? 14  LYS C NZ    1 
ATOM   5231  N N     . GLY G 3 21  ? 25.395  25.733  5.277  1.00 82.76  ? 15  GLY C N     1 
ATOM   5232  C CA    . GLY G 3 21  ? 26.564  25.152  4.627  1.00 84.87  ? 15  GLY C CA    1 
ATOM   5233  C C     . GLY G 3 21  ? 27.152  23.930  5.302  1.00 81.70  ? 15  GLY C C     1 
ATOM   5234  O O     . GLY G 3 21  ? 26.746  23.542  6.401  1.00 77.67  ? 15  GLY C O     1 
ATOM   5235  N N     . GLU G 3 22  ? 28.126  23.337  4.619  1.00 84.18  ? 16  GLU C N     1 
ATOM   5236  C CA    . GLU G 3 22  ? 28.867  22.159  5.071  1.00 82.15  ? 16  GLU C CA    1 
ATOM   5237  C C     . GLU G 3 22  ? 29.449  22.287  6.479  1.00 78.82  ? 16  GLU C C     1 
ATOM   5238  O O     . GLU G 3 22  ? 29.957  23.346  6.854  1.00 79.72  ? 16  GLU C O     1 
ATOM   5239  C CB    . GLU G 3 22  ? 29.994  21.862  4.078  1.00 86.64  ? 16  GLU C CB    1 
ATOM   5240  C CG    . GLU G 3 22  ? 30.751  23.114  3.622  1.00 90.93  ? 16  GLU C CG    1 
ATOM   5241  C CD    . GLU G 3 22  ? 32.077  22.808  2.968  1.00 95.35  ? 16  GLU C CD    1 
ATOM   5242  O OE1   . GLU G 3 22  ? 32.089  22.143  1.911  1.00 98.50  ? 16  GLU C OE1   1 
ATOM   5243  O OE2   . GLU G 3 22  ? 33.112  23.249  3.509  1.00 96.35  ? 16  GLU C OE2   1 
ATOM   5244  N N     . LEU G 3 23  ? 29.349  21.201  7.246  1.00 75.29  ? 17  LEU C N     1 
ATOM   5245  C CA    . LEU G 3 23  ? 29.972  21.069  8.566  1.00 72.50  ? 17  LEU C CA    1 
ATOM   5246  C C     . LEU G 3 23  ? 30.342  19.607  8.798  1.00 71.70  ? 17  LEU C C     1 
ATOM   5247  O O     . LEU G 3 23  ? 29.657  18.703  8.308  1.00 71.52  ? 17  LEU C O     1 
ATOM   5248  C CB    . LEU G 3 23  ? 29.036  21.532  9.694  1.00 68.57  ? 17  LEU C CB    1 
ATOM   5249  C CG    . LEU G 3 23  ? 28.576  22.990  9.827  1.00 68.84  ? 17  LEU C CG    1 
ATOM   5250  C CD1   . LEU G 3 23  ? 27.408  23.079  10.795 1.00 64.86  ? 17  LEU C CD1   1 
ATOM   5251  C CD2   . LEU G 3 23  ? 29.694  23.948  10.244 1.00 69.34  ? 17  LEU C CD2   1 
ATOM   5252  N N     . SER G 3 24  ? 31.420  19.383  9.548  1.00 71.58  ? 18  SER C N     1 
ATOM   5253  C CA    . SER G 3 24  ? 31.819  18.035  9.946  1.00 71.02  ? 18  SER C CA    1 
ATOM   5254  C C     . SER G 3 24  ? 31.101  17.610  11.226 1.00 67.28  ? 18  SER C C     1 
ATOM   5255  O O     . SER G 3 24  ? 30.504  18.437  11.913 1.00 65.11  ? 18  SER C O     1 
ATOM   5256  C CB    . SER G 3 24  ? 33.332  17.968  10.141 1.00 73.28  ? 18  SER C CB    1 
ATOM   5257  O OG    . SER G 3 24  ? 33.762  18.874  11.146 1.00 72.90  ? 18  SER C OG    1 
ATOM   5258  N N     . GLY G 3 25  ? 31.151  16.317  11.535 1.00 66.98  ? 19  GLY C N     1 
ATOM   5259  C CA    . GLY G 3 25  ? 30.615  15.803  12.793 1.00 64.36  ? 19  GLY C CA    1 
ATOM   5260  C C     . GLY G 3 25  ? 31.270  16.487  13.981 1.00 63.46  ? 19  GLY C C     1 
ATOM   5261  O O     . GLY G 3 25  ? 30.617  16.764  14.996 1.00 61.39  ? 19  GLY C O     1 
ATOM   5262  N N     . TYR G 3 26  ? 32.562  16.774  13.841 1.00 65.24  ? 20  TYR C N     1 
ATOM   5263  C CA    . TYR G 3 26  ? 33.309  17.505  14.853 1.00 64.89  ? 20  TYR C CA    1 
ATOM   5264  C C     . TYR G 3 26  ? 32.807  18.937  15.022 1.00 63.87  ? 20  TYR C C     1 
ATOM   5265  O O     . TYR G 3 26  ? 32.672  19.420  16.139 1.00 62.45  ? 20  TYR C O     1 
ATOM   5266  C CB    . TYR G 3 26  ? 34.812  17.490  14.529 1.00 68.21  ? 20  TYR C CB    1 
ATOM   5267  C CG    . TYR G 3 26  ? 35.685  17.887  15.700 1.00 67.85  ? 20  TYR C CG    1 
ATOM   5268  C CD1   . TYR G 3 26  ? 36.043  16.961  16.676 1.00 66.95  ? 20  TYR C CD1   1 
ATOM   5269  C CD2   . TYR G 3 26  ? 36.130  19.195  15.838 1.00 68.73  ? 20  TYR C CD2   1 
ATOM   5270  C CE1   . TYR G 3 26  ? 36.834  17.333  17.757 1.00 67.91  ? 20  TYR C CE1   1 
ATOM   5271  C CE2   . TYR G 3 26  ? 36.914  19.575  16.907 1.00 69.84  ? 20  TYR C CE2   1 
ATOM   5272  C CZ    . TYR G 3 26  ? 37.268  18.644  17.861 1.00 69.03  ? 20  TYR C CZ    1 
ATOM   5273  O OH    . TYR G 3 26  ? 38.044  19.045  18.916 1.00 69.24  ? 20  TYR C OH    1 
ATOM   5274  N N     . ASP G 3 27  ? 32.544  19.611  13.909 1.00 65.40  ? 21  ASP C N     1 
ATOM   5275  C CA    . ASP G 3 27  ? 32.013  20.971  13.935 1.00 65.53  ? 21  ASP C CA    1 
ATOM   5276  C C     . ASP G 3 27  ? 30.638  21.025  14.611 1.00 62.36  ? 21  ASP C C     1 
ATOM   5277  O O     . ASP G 3 27  ? 30.354  21.955  15.363 1.00 61.81  ? 21  ASP C O     1 
ATOM   5278  C CB    . ASP G 3 27  ? 31.923  21.549  12.519 1.00 68.31  ? 21  ASP C CB    1 
ATOM   5279  C CG    . ASP G 3 27  ? 33.282  21.919  11.930 1.00 72.99  ? 21  ASP C CG    1 
ATOM   5280  O OD1   . ASP G 3 27  ? 34.334  21.796  12.603 1.00 74.07  ? 21  ASP C OD1   1 
ATOM   5281  O OD2   . ASP G 3 27  ? 33.286  22.351  10.761 1.00 77.30  ? 21  ASP C OD2   1 
ATOM   5282  N N     . ILE G 3 28  ? 29.802  20.023  14.347 1.00 60.86  ? 22  ILE C N     1 
ATOM   5283  C CA    . ILE G 3 28  ? 28.489  19.911  14.971 1.00 58.42  ? 22  ILE C CA    1 
ATOM   5284  C C     . ILE G 3 28  ? 28.598  19.727  16.487 1.00 57.17  ? 22  ILE C C     1 
ATOM   5285  O O     . ILE G 3 28  ? 27.932  20.441  17.256 1.00 56.05  ? 22  ILE C O     1 
ATOM   5286  C CB    . ILE G 3 28  ? 27.671  18.765  14.347 1.00 58.18  ? 22  ILE C CB    1 
ATOM   5287  C CG1   . ILE G 3 28  ? 27.211  19.145  12.936 1.00 59.34  ? 22  ILE C CG1   1 
ATOM   5288  C CG2   . ILE G 3 28  ? 26.469  18.424  15.216 1.00 55.95  ? 22  ILE C CG2   1 
ATOM   5289  C CD1   . ILE G 3 28  ? 26.901  17.947  12.037 1.00 60.50  ? 22  ILE C CD1   1 
ATOM   5290  N N     . THR G 3 29  ? 29.443  18.778  16.904 1.00 57.89  ? 23  THR C N     1 
ATOM   5291  C CA    . THR G 3 29  ? 29.734  18.517  18.321 1.00 57.08  ? 23  THR C CA    1 
ATOM   5292  C C     . THR G 3 29  ? 30.133  19.807  19.011 1.00 57.63  ? 23  THR C C     1 
ATOM   5293  O O     . THR G 3 29  ? 29.703  20.070  20.133 1.00 57.05  ? 23  THR C O     1 
ATOM   5294  C CB    . THR G 3 29  ? 30.868  17.474  18.485 1.00 58.75  ? 23  THR C CB    1 
ATOM   5295  O OG1   . THR G 3 29  ? 30.525  16.272  17.779 1.00 59.43  ? 23  THR C OG1   1 
ATOM   5296  C CG2   . THR G 3 29  ? 31.113  17.139  19.955 1.00 57.57  ? 23  THR C CG2   1 
ATOM   5297  N N     . SER G 3 30  ? 30.942  20.612  18.327 1.00 59.71  ? 24  SER C N     1 
ATOM   5298  C CA    . SER G 3 30  ? 31.358  21.914  18.841 1.00 61.21  ? 24  SER C CA    1 
ATOM   5299  C C     . SER G 3 30  ? 30.194  22.876  19.058 1.00 60.06  ? 24  SER C C     1 
ATOM   5300  O O     . SER G 3 30  ? 30.165  23.565  20.076 1.00 59.97  ? 24  SER C O     1 
ATOM   5301  C CB    . SER G 3 30  ? 32.403  22.555  17.928 1.00 64.28  ? 24  SER C CB    1 
ATOM   5302  O OG    . SER G 3 30  ? 33.600  21.804  17.945 1.00 66.76  ? 24  SER C OG    1 
ATOM   5303  N N     . TYR G 3 31  ? 29.244  22.918  18.117 1.00 59.55  ? 25  TYR C N     1 
ATOM   5304  C CA    . TYR G 3 31  ? 28.092  23.828  18.230 1.00 59.23  ? 25  TYR C CA    1 
ATOM   5305  C C     . TYR G 3 31  ? 27.220  23.539  19.465 1.00 57.30  ? 25  TYR C C     1 
ATOM   5306  O O     . TYR G 3 31  ? 26.668  24.462  20.085 1.00 57.45  ? 25  TYR C O     1 
ATOM   5307  C CB    . TYR G 3 31  ? 27.250  23.877  16.943 1.00 59.30  ? 25  TYR C CB    1 
ATOM   5308  C CG    . TYR G 3 31  ? 27.772  24.841  15.890 1.00 62.80  ? 25  TYR C CG    1 
ATOM   5309  C CD1   . TYR G 3 31  ? 27.738  26.229  16.099 1.00 65.40  ? 25  TYR C CD1   1 
ATOM   5310  C CD2   . TYR G 3 31  ? 28.295  24.372  14.681 1.00 64.53  ? 25  TYR C CD2   1 
ATOM   5311  C CE1   . TYR G 3 31  ? 28.228  27.120  15.141 1.00 68.68  ? 25  TYR C CE1   1 
ATOM   5312  C CE2   . TYR G 3 31  ? 28.782  25.254  13.717 1.00 68.24  ? 25  TYR C CE2   1 
ATOM   5313  C CZ    . TYR G 3 31  ? 28.746  26.624  13.954 1.00 70.75  ? 25  TYR C CZ    1 
ATOM   5314  O OH    . TYR G 3 31  ? 29.227  27.496  13.001 1.00 75.54  ? 25  TYR C OH    1 
ATOM   5315  N N     . PHE G 3 32  ? 27.117  22.267  19.836 1.00 56.00  ? 26  PHE C N     1 
ATOM   5316  C CA    . PHE G 3 32  ? 26.417  21.912  21.067 1.00 54.71  ? 26  PHE C CA    1 
ATOM   5317  C C     . PHE G 3 32  ? 27.159  22.351  22.330 1.00 55.65  ? 26  PHE C C     1 
ATOM   5318  O O     . PHE G 3 32  ? 26.552  22.536  23.374 1.00 55.49  ? 26  PHE C O     1 
ATOM   5319  C CB    . PHE G 3 32  ? 26.100  20.419  21.097 1.00 53.74  ? 26  PHE C CB    1 
ATOM   5320  C CG    . PHE G 3 32  ? 24.928  20.032  20.232 1.00 53.07  ? 26  PHE C CG    1 
ATOM   5321  C CD1   . PHE G 3 32  ? 23.674  20.623  20.417 1.00 52.31  ? 26  PHE C CD1   1 
ATOM   5322  C CD2   . PHE G 3 32  ? 25.064  19.066  19.250 1.00 52.92  ? 26  PHE C CD2   1 
ATOM   5323  C CE1   . PHE G 3 32  ? 22.591  20.257  19.626 1.00 51.32  ? 26  PHE C CE1   1 
ATOM   5324  C CE2   . PHE G 3 32  ? 23.987  18.699  18.459 1.00 52.06  ? 26  PHE C CE2   1 
ATOM   5325  C CZ    . PHE G 3 32  ? 22.755  19.285  18.648 1.00 51.64  ? 26  PHE C CZ    1 
ATOM   5326  N N     . LYS G 3 33  ? 28.470  22.531  22.228 1.00 57.69  ? 27  LYS C N     1 
ATOM   5327  C CA    . LYS G 3 33  ? 29.275  23.025  23.348 1.00 59.31  ? 27  LYS C CA    1 
ATOM   5328  C C     . LYS G 3 33  ? 29.265  24.548  23.455 1.00 60.76  ? 27  LYS C C     1 
ATOM   5329  O O     . LYS G 3 33  ? 29.725  25.090  24.443 1.00 62.27  ? 27  LYS C O     1 
ATOM   5330  C CB    . LYS G 3 33  ? 30.717  22.486  23.252 1.00 61.05  ? 27  LYS C CB    1 
ATOM   5331  C CG    . LYS G 3 33  ? 30.906  21.138  23.942 1.00 61.61  ? 27  LYS C CG    1 
ATOM   5332  C CD    . LYS G 3 33  ? 31.820  20.146  23.192 1.00 65.74  ? 27  LYS C CD    1 
ATOM   5333  C CE    . LYS G 3 33  ? 31.512  18.695  23.659 1.00 66.96  ? 27  LYS C CE    1 
ATOM   5334  N NZ    . LYS G 3 33  ? 32.479  17.618  23.230 1.00 69.68  ? 27  LYS C NZ    1 
ATOM   5335  N N     . GLU G 3 34  ? 28.750  25.233  22.435 1.00 61.59  ? 28  GLU C N     1 
ATOM   5336  C CA    . GLU G 3 34  ? 28.684  26.703  22.433 1.00 64.20  ? 28  GLU C CA    1 
ATOM   5337  C C     . GLU G 3 34  ? 27.293  27.193  22.873 1.00 63.13  ? 28  GLU C C     1 
ATOM   5338  O O     . GLU G 3 34  ? 26.715  26.624  23.805 1.00 61.69  ? 28  GLU C O     1 
ATOM   5339  C CB    . GLU G 3 34  ? 29.104  27.295  21.077 1.00 66.34  ? 28  GLU C CB    1 
ATOM   5340  C CG    . GLU G 3 34  ? 30.337  26.650  20.408 1.00 69.50  ? 28  GLU C CG    1 
ATOM   5341  C CD    . GLU G 3 34  ? 31.681  26.942  21.097 1.00 74.81  ? 28  GLU C CD    1 
ATOM   5342  O OE1   . GLU G 3 34  ? 32.704  27.066  20.378 1.00 77.63  ? 28  GLU C OE1   1 
ATOM   5343  O OE2   . GLU G 3 34  ? 31.733  27.029  22.345 1.00 76.63  ? 28  GLU C OE2   1 
ATOM   5344  N N     . GLU G 3 35  ? 26.757  28.232  22.225 1.00 64.44  ? 29  GLU C N     1 
ATOM   5345  C CA    . GLU G 3 35  ? 25.507  28.870  22.704 1.00 63.95  ? 29  GLU C CA    1 
ATOM   5346  C C     . GLU G 3 35  ? 24.259  27.979  22.622 1.00 60.63  ? 29  GLU C C     1 
ATOM   5347  O O     . GLU G 3 35  ? 23.341  28.122  23.444 1.00 60.32  ? 29  GLU C O     1 
ATOM   5348  C CB    . GLU G 3 35  ? 25.256  30.248  22.060 1.00 66.83  ? 29  GLU C CB    1 
ATOM   5349  C CG    . GLU G 3 35  ? 24.995  30.234  20.544 1.00 68.40  ? 29  GLU C CG    1 
ATOM   5350  C CD    . GLU G 3 35  ? 26.273  30.291  19.699 1.00 72.23  ? 29  GLU C CD    1 
ATOM   5351  O OE1   . GLU G 3 35  ? 27.353  30.648  20.238 1.00 74.27  ? 29  GLU C OE1   1 
ATOM   5352  O OE2   . GLU G 3 35  ? 26.188  29.997  18.482 1.00 72.91  ? 29  GLU C OE2   1 
ATOM   5353  N N     . LEU G 3 36  ? 24.239  27.057  21.659 1.00 58.61  ? 30  LEU C N     1 
ATOM   5354  C CA    . LEU G 3 36  ? 23.157  26.065  21.553 1.00 56.10  ? 30  LEU C CA    1 
ATOM   5355  C C     . LEU G 3 36  ? 23.047  25.135  22.781 1.00 54.56  ? 30  LEU C C     1 
ATOM   5356  O O     . LEU G 3 36  ? 21.948  24.691  23.130 1.00 53.80  ? 30  LEU C O     1 
ATOM   5357  C CB    . LEU G 3 36  ? 23.312  25.225  20.281 1.00 55.69  ? 30  LEU C CB    1 
ATOM   5358  C CG    . LEU G 3 36  ? 22.106  24.413  19.776 1.00 54.99  ? 30  LEU C CG    1 
ATOM   5359  C CD1   . LEU G 3 36  ? 20.915  25.318  19.458 1.00 56.18  ? 30  LEU C CD1   1 
ATOM   5360  C CD2   . LEU G 3 36  ? 22.469  23.563  18.549 1.00 55.46  ? 30  LEU C CD2   1 
ATOM   5361  N N     . GLY G 3 37  ? 24.178  24.860  23.436 1.00 54.35  ? 31  GLY C N     1 
ATOM   5362  C CA    . GLY G 3 37  ? 24.227  23.980  24.606 1.00 53.11  ? 31  GLY C CA    1 
ATOM   5363  C C     . GLY G 3 37  ? 23.421  24.402  25.826 1.00 53.44  ? 31  GLY C C     1 
ATOM   5364  O O     . GLY G 3 37  ? 23.268  23.624  26.770 1.00 53.45  ? 31  GLY C O     1 
ATOM   5365  N N     . GLN G 3 38  ? 22.918  25.635  25.830 1.00 53.86  ? 32  GLN C N     1 
ATOM   5366  C CA    . GLN G 3 38  ? 22.040  26.090  26.909 1.00 54.11  ? 32  GLN C CA    1 
ATOM   5367  C C     . GLN G 3 38  ? 20.668  25.432  26.826 1.00 52.62  ? 32  GLN C C     1 
ATOM   5368  O O     . GLN G 3 38  ? 20.009  25.250  27.839 1.00 52.76  ? 32  GLN C O     1 
ATOM   5369  C CB    . GLN G 3 38  ? 21.854  27.602  26.853 1.00 55.93  ? 32  GLN C CB    1 
ATOM   5370  C CG    . GLN G 3 38  ? 23.077  28.397  27.226 1.00 58.54  ? 32  GLN C CG    1 
ATOM   5371  C CD    . GLN G 3 38  ? 23.232  28.564  28.715 1.00 60.21  ? 32  GLN C CD    1 
ATOM   5372  O OE1   . GLN G 3 38  ? 22.268  28.830  29.438 1.00 61.27  ? 32  GLN C OE1   1 
ATOM   5373  N NE2   . GLN G 3 38  ? 24.457  28.420  29.186 1.00 61.79  ? 32  GLN C NE2   1 
ATOM   5374  N N     . PHE G 3 39  ? 20.247  25.069  25.617 1.00 51.33  ? 33  PHE C N     1 
ATOM   5375  C CA    . PHE G 3 39  ? 18.875  24.619  25.394 1.00 50.89  ? 33  PHE C CA    1 
ATOM   5376  C C     . PHE G 3 39  ? 18.772  23.230  24.776 1.00 50.09  ? 33  PHE C C     1 
ATOM   5377  O O     . PHE G 3 39  ? 17.695  22.657  24.681 1.00 50.30  ? 33  PHE C O     1 
ATOM   5378  C CB    . PHE G 3 39  ? 18.129  25.629  24.521 1.00 51.10  ? 33  PHE C CB    1 
ATOM   5379  C CG    . PHE G 3 39  ? 17.978  26.971  25.151 1.00 52.35  ? 33  PHE C CG    1 
ATOM   5380  C CD1   . PHE G 3 39  ? 17.205  27.135  26.293 1.00 53.30  ? 33  PHE C CD1   1 
ATOM   5381  C CD2   . PHE G 3 39  ? 18.599  28.085  24.599 1.00 53.07  ? 33  PHE C CD2   1 
ATOM   5382  C CE1   . PHE G 3 39  ? 17.061  28.393  26.876 1.00 55.14  ? 33  PHE C CE1   1 
ATOM   5383  C CE2   . PHE G 3 39  ? 18.456  29.341  25.178 1.00 54.31  ? 33  PHE C CE2   1 
ATOM   5384  C CZ    . PHE G 3 39  ? 17.691  29.493  26.312 1.00 55.58  ? 33  PHE C CZ    1 
ATOM   5385  N N     . TRP G 3 40  ? 19.891  22.713  24.309 1.00 49.99  ? 34  TRP C N     1 
ATOM   5386  C CA    . TRP G 3 40  ? 19.940  21.364  23.815 1.00 50.04  ? 34  TRP C CA    1 
ATOM   5387  C C     . TRP G 3 40  ? 21.387  20.929  23.861 1.00 50.45  ? 34  TRP C C     1 
ATOM   5388  O O     . TRP G 3 40  ? 22.288  21.766  23.816 1.00 51.33  ? 34  TRP C O     1 
ATOM   5389  C CB    . TRP G 3 40  ? 19.375  21.246  22.401 1.00 50.25  ? 34  TRP C CB    1 
ATOM   5390  C CG    . TRP G 3 40  ? 18.897  19.848  22.173 1.00 51.82  ? 34  TRP C CG    1 
ATOM   5391  C CD1   . TRP G 3 40  ? 19.598  18.814  21.608 1.00 51.91  ? 34  TRP C CD1   1 
ATOM   5392  C CD2   . TRP G 3 40  ? 17.640  19.304  22.586 1.00 53.08  ? 34  TRP C CD2   1 
ATOM   5393  N NE1   . TRP G 3 40  ? 18.843  17.667  21.631 1.00 53.68  ? 34  TRP C NE1   1 
ATOM   5394  C CE2   . TRP G 3 40  ? 17.636  17.942  22.226 1.00 54.63  ? 34  TRP C CE2   1 
ATOM   5395  C CE3   . TRP G 3 40  ? 16.509  19.841  23.217 1.00 54.19  ? 34  TRP C CE3   1 
ATOM   5396  C CZ2   . TRP G 3 40  ? 16.541  17.104  22.478 1.00 56.91  ? 34  TRP C CZ2   1 
ATOM   5397  C CZ3   . TRP G 3 40  ? 15.415  19.007  23.465 1.00 56.03  ? 34  TRP C CZ3   1 
ATOM   5398  C CH2   . TRP G 3 40  ? 15.443  17.656  23.095 1.00 57.17  ? 34  TRP C CH2   1 
ATOM   5399  N N     . SER G 3 41  ? 21.624  19.631  23.984 1.00 50.58  ? 35  SER C N     1 
ATOM   5400  C CA    . SER G 3 41  ? 22.978  19.151  24.113 1.00 51.00  ? 35  SER C CA    1 
ATOM   5401  C C     . SER G 3 41  ? 23.102  17.747  23.565 1.00 51.18  ? 35  SER C C     1 
ATOM   5402  O O     . SER G 3 41  ? 22.199  16.933  23.702 1.00 51.62  ? 35  SER C O     1 
ATOM   5403  C CB    . SER G 3 41  ? 23.393  19.158  25.583 1.00 51.86  ? 35  SER C CB    1 
ATOM   5404  O OG    . SER G 3 41  ? 22.664  18.162  26.284 1.00 53.57  ? 35  SER C OG    1 
ATOM   5405  N N     . ALA G 3 42  ? 24.248  17.469  22.967 1.00 51.18  ? 36  ALA C N     1 
ATOM   5406  C CA    . ALA G 3 42  ? 24.527  16.166  22.432 1.00 52.19  ? 36  ALA C CA    1 
ATOM   5407  C C     . ALA G 3 42  ? 26.034  15.982  22.376 1.00 53.13  ? 36  ALA C C     1 
ATOM   5408  O O     . ALA G 3 42  ? 26.770  16.940  22.163 1.00 53.04  ? 36  ALA C O     1 
ATOM   5409  C CB    . ALA G 3 42  ? 23.907  16.023  21.055 1.00 51.88  ? 36  ALA C CB    1 
ATOM   5410  N N     . LYS G 3 43  ? 26.487  14.750  22.587 1.00 54.76  ? 37  LYS C N     1 
ATOM   5411  C CA    . LYS G 3 43  ? 27.911  14.425  22.498 1.00 55.96  ? 37  LYS C CA    1 
ATOM   5412  C C     . LYS G 3 43  ? 28.252  13.754  21.163 1.00 56.68  ? 37  LYS C C     1 
ATOM   5413  O O     . LYS G 3 43  ? 27.355  13.381  20.386 1.00 56.65  ? 37  LYS C O     1 
ATOM   5414  C CB    . LYS G 3 43  ? 28.317  13.515  23.654 1.00 58.08  ? 37  LYS C CB    1 
ATOM   5415  C CG    . LYS G 3 43  ? 27.798  13.947  25.009 1.00 58.12  ? 37  LYS C CG    1 
ATOM   5416  C CD    . LYS G 3 43  ? 28.623  15.057  25.589 1.00 59.12  ? 37  LYS C CD    1 
ATOM   5417  C CE    . LYS G 3 43  ? 28.233  15.311  27.023 1.00 60.83  ? 37  LYS C CE    1 
ATOM   5418  N NZ    . LYS G 3 43  ? 29.421  15.782  27.775 1.00 63.85  ? 37  LYS C NZ    1 
ATOM   5419  N N     . HIS G 3 44  ? 29.547  13.598  20.894 1.00 57.38  ? 38  HIS C N     1 
ATOM   5420  C CA    . HIS G 3 44  ? 29.985  13.072  19.602 1.00 58.18  ? 38  HIS C CA    1 
ATOM   5421  C C     . HIS G 3 44  ? 29.551  11.615  19.406 1.00 59.86  ? 38  HIS C C     1 
ATOM   5422  O O     . HIS G 3 44  ? 29.337  11.166  18.283 1.00 60.53  ? 38  HIS C O     1 
ATOM   5423  C CB    . HIS G 3 44  ? 31.502  13.255  19.417 1.00 59.49  ? 38  HIS C CB    1 
ATOM   5424  C CG    . HIS G 3 44  ? 32.335  12.226  20.113 1.00 61.25  ? 38  HIS C CG    1 
ATOM   5425  N ND1   . HIS G 3 44  ? 32.734  12.355  21.425 1.00 61.62  ? 38  HIS C ND1   1 
ATOM   5426  C CD2   . HIS G 3 44  ? 32.855  11.054  19.675 1.00 63.45  ? 38  HIS C CD2   1 
ATOM   5427  C CE1   . HIS G 3 44  ? 33.462  11.308  21.767 1.00 64.72  ? 38  HIS C CE1   1 
ATOM   5428  N NE2   . HIS G 3 44  ? 33.548  10.502  20.724 1.00 65.74  ? 38  HIS C NE2   1 
ATOM   5429  N N     . SER G 3 45  ? 29.403  10.903  20.523 1.00 60.95  ? 39  SER C N     1 
ATOM   5430  C CA    . SER G 3 45  ? 29.006  9.502   20.549 1.00 63.21  ? 39  SER C CA    1 
ATOM   5431  C C     . SER G 3 45  ? 27.576  9.301   20.090 1.00 62.86  ? 39  SER C C     1 
ATOM   5432  O O     . SER G 3 45  ? 27.211  8.211   19.662 1.00 65.56  ? 39  SER C O     1 
ATOM   5433  C CB    . SER G 3 45  ? 29.132  8.963   21.963 1.00 64.54  ? 39  SER C CB    1 
ATOM   5434  O OG    . SER G 3 45  ? 28.047  9.407   22.753 1.00 63.69  ? 39  SER C OG    1 
ATOM   5435  N N     . GLN G 3 46  ? 26.761  10.342  20.215 1.00 60.31  ? 40  GLN C N     1 
ATOM   5436  C CA    . GLN G 3 46  ? 25.394  10.302  19.733 1.00 60.16  ? 40  GLN C CA    1 
ATOM   5437  C C     . GLN G 3 46  ? 25.293  10.855  18.308 1.00 59.42  ? 40  GLN C C     1 
ATOM   5438  O O     . GLN G 3 46  ? 24.559  10.314  17.480 1.00 60.65  ? 40  GLN C O     1 
ATOM   5439  C CB    . GLN G 3 46  ? 24.496  11.079  20.671 1.00 58.34  ? 40  GLN C CB    1 
ATOM   5440  C CG    . GLN G 3 46  ? 23.089  10.564  20.729 1.00 60.79  ? 40  GLN C CG    1 
ATOM   5441  C CD    . GLN G 3 46  ? 22.274  11.204  21.833 1.00 62.11  ? 40  GLN C CD    1 
ATOM   5442  O OE1   . GLN G 3 46  ? 22.781  12.030  22.626 1.00 61.57  ? 40  GLN C OE1   1 
ATOM   5443  N NE2   . GLN G 3 46  ? 20.996  10.823  21.904 1.00 63.38  ? 40  GLN C NE2   1 
ATOM   5444  N N     . ILE G 3 47  ? 26.054  11.914  18.036 1.00 57.88  ? 41  ILE C N     1 
ATOM   5445  C CA    . ILE G 3 47  ? 26.051  12.598  16.741 1.00 57.64  ? 41  ILE C CA    1 
ATOM   5446  C C     . ILE G 3 47  ? 26.529  11.725  15.566 1.00 60.42  ? 41  ILE C C     1 
ATOM   5447  O O     . ILE G 3 47  ? 25.866  11.674  14.527 1.00 61.57  ? 41  ILE C O     1 
ATOM   5448  C CB    . ILE G 3 47  ? 26.857  13.923  16.801 1.00 56.14  ? 41  ILE C CB    1 
ATOM   5449  C CG1   . ILE G 3 47  ? 26.180  14.910  17.753 1.00 54.74  ? 41  ILE C CG1   1 
ATOM   5450  C CG2   . ILE G 3 47  ? 26.987  14.560  15.428 1.00 55.98  ? 41  ILE C CG2   1 
ATOM   5451  C CD1   . ILE G 3 47  ? 27.061  16.078  18.173 1.00 54.39  ? 41  ILE C CD1   1 
ATOM   5452  N N     . TYR G 3 48  ? 27.662  11.047  15.714 1.00 62.02  ? 42  TYR C N     1 
ATOM   5453  C CA    . TYR G 3 48  ? 28.211  10.251  14.596 1.00 65.01  ? 42  TYR C CA    1 
ATOM   5454  C C     . TYR G 3 48  ? 27.305  9.119   14.065 1.00 67.50  ? 42  TYR C C     1 
ATOM   5455  O O     . TYR G 3 48  ? 27.162  8.985   12.855 1.00 68.92  ? 42  TYR C O     1 
ATOM   5456  C CB    . TYR G 3 48  ? 29.620  9.727   14.896 1.00 66.41  ? 42  TYR C CB    1 
ATOM   5457  C CG    . TYR G 3 48  ? 30.701  10.780  14.861 1.00 64.51  ? 42  TYR C CG    1 
ATOM   5458  C CD1   . TYR G 3 48  ? 30.959  11.514  13.701 1.00 63.10  ? 42  TYR C CD1   1 
ATOM   5459  C CD2   . TYR G 3 48  ? 31.489  11.025  15.989 1.00 62.46  ? 42  TYR C CD2   1 
ATOM   5460  C CE1   . TYR G 3 48  ? 31.965  12.481  13.672 1.00 63.43  ? 42  TYR C CE1   1 
ATOM   5461  C CE2   . TYR G 3 48  ? 32.492  11.979  15.973 1.00 61.99  ? 42  TYR C CE2   1 
ATOM   5462  C CZ    . TYR G 3 48  ? 32.735  12.700  14.813 1.00 63.63  ? 42  TYR C CZ    1 
ATOM   5463  O OH    . TYR G 3 48  ? 33.739  13.643  14.805 1.00 64.41  ? 42  TYR C OH    1 
ATOM   5464  N N     . PRO G 3 49  ? 26.700  8.307   14.961 1.00 68.48  ? 43  PRO C N     1 
ATOM   5465  C CA    . PRO G 3 49  ? 25.718  7.333   14.502 1.00 71.49  ? 43  PRO C CA    1 
ATOM   5466  C C     . PRO G 3 49  ? 24.514  7.999   13.840 1.00 70.81  ? 43  PRO C C     1 
ATOM   5467  O O     . PRO G 3 49  ? 23.993  7.483   12.848 1.00 73.63  ? 43  PRO C O     1 
ATOM   5468  C CB    . PRO G 3 49  ? 25.275  6.637   15.793 1.00 72.06  ? 43  PRO C CB    1 
ATOM   5469  C CG    . PRO G 3 49  ? 26.381  6.852   16.736 1.00 71.47  ? 43  PRO C CG    1 
ATOM   5470  C CD    . PRO G 3 49  ? 26.891  8.220   16.419 1.00 67.84  ? 43  PRO C CD    1 
ATOM   5471  N N     . GLU G 3 50  ? 24.085  9.134   14.385 1.00 67.75  ? 44  GLU C N     1 
ATOM   5472  C CA    . GLU G 3 50  ? 22.952  9.863   13.853 1.00 67.22  ? 44  GLU C CA    1 
ATOM   5473  C C     . GLU G 3 50  ? 23.221  10.413  12.446 1.00 67.95  ? 44  GLU C C     1 
ATOM   5474  O O     . GLU G 3 50  ? 22.318  10.414  11.595 1.00 69.45  ? 44  GLU C O     1 
ATOM   5475  C CB    . GLU G 3 50  ? 22.528  10.974  14.815 1.00 63.92  ? 44  GLU C CB    1 
ATOM   5476  C CG    . GLU G 3 50  ? 21.242  11.713  14.408 1.00 64.84  ? 44  GLU C CG    1 
ATOM   5477  C CD    . GLU G 3 50  ? 20.002  10.823  14.314 1.00 69.15  ? 44  GLU C CD    1 
ATOM   5478  O OE1   . GLU G 3 50  ? 20.011  9.682   14.828 1.00 72.07  ? 44  GLU C OE1   1 
ATOM   5479  O OE2   . GLU G 3 50  ? 19.000  11.284  13.729 1.00 70.65  ? 44  GLU C OE2   1 
ATOM   5480  N N     . LEU G 3 51  ? 24.452  10.866  12.204 1.00 67.29  ? 45  LEU C N     1 
ATOM   5481  C CA    . LEU G 3 51  ? 24.853  11.344  10.875 1.00 68.60  ? 45  LEU C CA    1 
ATOM   5482  C C     . LEU G 3 51  ? 24.820  10.252  9.820  1.00 72.50  ? 45  LEU C C     1 
ATOM   5483  O O     . LEU G 3 51  ? 24.561  10.531  8.656  1.00 74.42  ? 45  LEU C O     1 
ATOM   5484  C CB    . LEU G 3 51  ? 26.244  11.976  10.900 1.00 67.91  ? 45  LEU C CB    1 
ATOM   5485  C CG    . LEU G 3 51  ? 26.393  13.317  11.620 1.00 64.87  ? 45  LEU C CG    1 
ATOM   5486  C CD1   . LEU G 3 51  ? 27.854  13.508  11.970 1.00 64.30  ? 45  LEU C CD1   1 
ATOM   5487  C CD2   . LEU G 3 51  ? 25.857  14.500  10.793 1.00 63.42  ? 45  LEU C CD2   1 
ATOM   5488  N N     . LYS G 3 52  ? 25.086  9.013   10.221 1.00 74.47  ? 46  LYS C N     1 
ATOM   5489  C CA    . LYS G 3 52  ? 25.021  7.899   9.287  1.00 78.92  ? 46  LYS C CA    1 
ATOM   5490  C C     . LYS G 3 52  ? 23.567  7.535   9.016  1.00 80.36  ? 46  LYS C C     1 
ATOM   5491  O O     . LYS G 3 52  ? 23.208  7.200   7.885  1.00 83.72  ? 46  LYS C O     1 
ATOM   5492  C CB    . LYS G 3 52  ? 25.800  6.692   9.811  1.00 81.25  ? 46  LYS C CB    1 
ATOM   5493  C CG    . LYS G 3 52  ? 26.495  5.888   8.702  1.00 85.78  ? 46  LYS C CG    1 
ATOM   5494  C CD    . LYS G 3 52  ? 25.685  4.690   8.251  1.00 90.43  ? 46  LYS C CD    1 
ATOM   5495  C CE    . LYS G 3 52  ? 26.415  3.903   7.157  1.00 95.85  ? 46  LYS C CE    1 
ATOM   5496  N N     . LYS G 3 53  ? 22.737  7.627   10.054 1.00 78.28  ? 47  LYS C N     1 
ATOM   5497  C CA    . LYS G 3 53  ? 21.321  7.281   9.955  1.00 80.02  ? 47  LYS C CA    1 
ATOM   5498  C C     . LYS G 3 53  ? 20.543  8.296   9.101  1.00 79.28  ? 47  LYS C C     1 
ATOM   5499  O O     . LYS G 3 53  ? 19.673  7.910   8.324  1.00 82.37  ? 47  LYS C O     1 
ATOM   5500  C CB    . LYS G 3 53  ? 20.698  7.112   11.344 1.00 78.40  ? 47  LYS C CB    1 
ATOM   5501  C CG    . LYS G 3 53  ? 19.370  6.385   11.324 1.00 82.18  ? 47  LYS C CG    1 
ATOM   5502  C CD    . LYS G 3 53  ? 18.696  6.394   12.685 1.00 82.27  ? 47  LYS C CD    1 
ATOM   5503  C CE    . LYS G 3 53  ? 17.255  5.909   12.562 1.00 86.33  ? 47  LYS C CE    1 
ATOM   5504  N NZ    . LYS G 3 53  ? 16.453  6.260   13.766 1.00 85.38  ? 47  LYS C NZ    1 
ATOM   5505  N N     . LEU G 3 54  ? 20.886  9.577   9.233  1.00 75.66  ? 48  LEU C N     1 
ATOM   5506  C CA    . LEU G 3 54  ? 20.362  10.625  8.361  1.00 75.46  ? 48  LEU C CA    1 
ATOM   5507  C C     . LEU G 3 54  ? 20.831  10.493  6.908  1.00 79.22  ? 48  LEU C C     1 
ATOM   5508  O O     . LEU G 3 54  ? 20.146  10.960  5.990  1.00 81.04  ? 48  LEU C O     1 
ATOM   5509  C CB    . LEU G 3 54  ? 20.737  12.007  8.890  1.00 71.32  ? 48  LEU C CB    1 
ATOM   5510  C CG    . LEU G 3 54  ? 20.064  12.450  10.179 1.00 67.91  ? 48  LEU C CG    1 
ATOM   5511  C CD1   . LEU G 3 54  ? 20.826  13.599  10.796 1.00 65.02  ? 48  LEU C CD1   1 
ATOM   5512  C CD2   . LEU G 3 54  ? 18.635  12.839  9.927  1.00 68.40  ? 48  LEU C CD2   1 
ATOM   5513  N N     . THR G 3 55  ? 21.992  9.877   6.697  1.00 80.81  ? 49  THR C N     1 
ATOM   5514  C CA    . THR G 3 55  ? 22.500  9.656   5.339  1.00 85.00  ? 49  THR C CA    1 
ATOM   5515  C C     . THR G 3 55  ? 21.780  8.485   4.663  1.00 89.75  ? 49  THR C C     1 
ATOM   5516  O O     . THR G 3 55  ? 21.375  8.588   3.499  1.00 92.79  ? 49  THR C O     1 
ATOM   5517  C CB    . THR G 3 55  ? 24.029  9.440   5.312  1.00 85.47  ? 49  THR C CB    1 
ATOM   5518  O OG1   . THR G 3 55  ? 24.666  10.410  6.153  1.00 81.69  ? 49  THR C OG1   1 
ATOM   5519  C CG2   . THR G 3 55  ? 24.569  9.585   3.897  1.00 88.84  ? 49  THR C CG2   1 
ATOM   5520  N N     . ASP G 3 56  ? 21.613  7.384   5.400  1.00 90.93  ? 50  ASP C N     1 
ATOM   5521  C CA    . ASP G 3 56  ? 20.827  6.235   4.924  1.00 95.91  ? 50  ASP C CA    1 
ATOM   5522  C C     . ASP G 3 56  ? 19.352  6.607   4.703  1.00 96.16  ? 50  ASP C C     1 
ATOM   5523  O O     . ASP G 3 56  ? 18.630  5.899   4.006  1.00 100.75 ? 50  ASP C O     1 
ATOM   5524  C CB    . ASP G 3 56  ? 20.909  5.052   5.904  1.00 97.28  ? 50  ASP C CB    1 
ATOM   5525  C CG    . ASP G 3 56  ? 22.341  4.637   6.231  1.00 98.35  ? 50  ASP C CG    1 
ATOM   5526  O OD1   . ASP G 3 56  ? 23.203  4.644   5.325  1.00 101.62 ? 50  ASP C OD1   1 
ATOM   5527  O OD2   . ASP G 3 56  ? 22.599  4.284   7.407  1.00 98.02  ? 50  ASP C OD2   1 
ATOM   5528  N N     . GLU G 3 57  ? 18.909  7.706   5.314  1.00 91.61  ? 51  GLU C N     1 
ATOM   5529  C CA    . GLU G 3 57  ? 17.533  8.179   5.169  1.00 91.57  ? 51  GLU C CA    1 
ATOM   5530  C C     . GLU G 3 57  ? 17.386  9.236   4.072  1.00 91.67  ? 51  GLU C C     1 
ATOM   5531  O O     . GLU G 3 57  ? 16.275  9.637   3.732  1.00 92.98  ? 51  GLU C O     1 
ATOM   5532  C CB    . GLU G 3 57  ? 17.010  8.718   6.501  1.00 87.44  ? 51  GLU C CB    1 
ATOM   5533  C CG    . GLU G 3 57  ? 16.571  7.642   7.486  1.00 89.35  ? 51  GLU C CG    1 
ATOM   5534  C CD    . GLU G 3 57  ? 16.292  8.191   8.886  1.00 87.34  ? 51  GLU C CD    1 
ATOM   5535  O OE1   . GLU G 3 57  ? 15.342  7.702   9.534  1.00 89.47  ? 51  GLU C OE1   1 
ATOM   5536  O OE2   . GLU G 3 57  ? 17.016  9.108   9.346  1.00 83.65  ? 51  GLU C OE2   1 
ATOM   5537  N N     . GLY G 3 58  ? 18.510  9.687   3.529  1.00 90.94  ? 52  GLY C N     1 
ATOM   5538  C CA    . GLY G 3 58  ? 18.520  10.631  2.416  1.00 91.99  ? 52  GLY C CA    1 
ATOM   5539  C C     . GLY G 3 58  ? 18.360  12.097  2.781  1.00 88.25  ? 52  GLY C C     1 
ATOM   5540  O O     . GLY G 3 58  ? 18.222  12.943  1.903  1.00 89.82  ? 52  GLY C O     1 
ATOM   5541  N N     . PHE G 3 59  ? 18.389  12.414  4.070  1.00 83.83  ? 53  PHE C N     1 
ATOM   5542  C CA    . PHE G 3 59  ? 18.220  13.799  4.496  1.00 80.74  ? 53  PHE C CA    1 
ATOM   5543  C C     . PHE G 3 59  ? 19.477  14.659  4.320  1.00 79.51  ? 53  PHE C C     1 
ATOM   5544  O O     . PHE G 3 59  ? 19.378  15.848  4.033  1.00 79.21  ? 53  PHE C O     1 
ATOM   5545  C CB    . PHE G 3 59  ? 17.665  13.870  5.923  1.00 77.27  ? 53  PHE C CB    1 
ATOM   5546  C CG    . PHE G 3 59  ? 16.302  13.230  6.077  1.00 80.00  ? 53  PHE C CG    1 
ATOM   5547  C CD1   . PHE G 3 59  ? 15.229  13.627  5.270  1.00 83.03  ? 53  PHE C CD1   1 
ATOM   5548  C CD2   . PHE G 3 59  ? 16.089  12.237  7.032  1.00 80.46  ? 53  PHE C CD2   1 
ATOM   5549  C CE1   . PHE G 3 59  ? 13.973  13.037  5.405  1.00 84.99  ? 53  PHE C CE1   1 
ATOM   5550  C CE2   . PHE G 3 59  ? 14.830  11.641  7.179  1.00 82.37  ? 53  PHE C CE2   1 
ATOM   5551  C CZ    . PHE G 3 59  ? 13.774  12.043  6.362  1.00 85.26  ? 53  PHE C CZ    1 
ATOM   5552  N N     . ILE G 3 60  ? 20.652  14.058  4.481  1.00 79.52  ? 54  ILE C N     1 
ATOM   5553  C CA    . ILE G 3 60  ? 21.920  14.766  4.248  1.00 79.54  ? 54  ILE C CA    1 
ATOM   5554  C C     . ILE G 3 60  ? 22.894  13.976  3.391  1.00 82.75  ? 54  ILE C C     1 
ATOM   5555  O O     . ILE G 3 60  ? 22.820  12.750  3.323  1.00 84.37  ? 54  ILE C O     1 
ATOM   5556  C CB    . ILE G 3 60  ? 22.615  15.223  5.562  1.00 75.50  ? 54  ILE C CB    1 
ATOM   5557  C CG1   . ILE G 3 60  ? 22.451  14.196  6.680  1.00 74.17  ? 54  ILE C CG1   1 
ATOM   5558  C CG2   . ILE G 3 60  ? 22.025  16.525  6.034  1.00 74.23  ? 54  ILE C CG2   1 
ATOM   5559  C CD1   . ILE G 3 60  ? 23.696  13.448  7.014  1.00 74.98  ? 54  ILE C CD1   1 
ATOM   5560  N N     . THR G 3 61  ? 23.791  14.700  2.726  1.00 84.39  ? 55  THR C N     1 
ATOM   5561  C CA    . THR G 3 61  ? 24.857  14.095  1.933  1.00 88.02  ? 55  THR C CA    1 
ATOM   5562  C C     . THR G 3 61  ? 26.242  14.560  2.424  1.00 86.84  ? 55  THR C C     1 
ATOM   5563  O O     . THR G 3 61  ? 26.340  15.543  3.164  1.00 83.97  ? 55  THR C O     1 
ATOM   5564  C CB    . THR G 3 61  ? 24.667  14.391  0.433  1.00 92.88  ? 55  THR C CB    1 
ATOM   5565  O OG1   . THR G 3 61  ? 25.569  13.590  -0.329 1.00 96.84  ? 55  THR C OG1   1 
ATOM   5566  C CG2   . THR G 3 61  ? 24.918  15.860  0.121  1.00 93.72  ? 55  THR C CG2   1 
ATOM   5567  N N     . PHE G 3 62  ? 27.301  13.850  2.028  1.00 89.51  ? 56  PHE C N     1 
ATOM   5568  C CA    . PHE G 3 62  ? 28.669  14.210  2.436  1.00 89.12  ? 56  PHE C CA    1 
ATOM   5569  C C     . PHE G 3 62  ? 29.737  14.009  1.360  1.00 94.14  ? 56  PHE C C     1 
ATOM   5570  O O     . PHE G 3 62  ? 29.516  13.315  0.361  1.00 98.01  ? 56  PHE C O     1 
ATOM   5571  C CB    . PHE G 3 62  ? 29.079  13.508  3.750  1.00 85.84  ? 56  PHE C CB    1 
ATOM   5572  C CG    . PHE G 3 62  ? 29.370  12.029  3.613  1.00 87.86  ? 56  PHE C CG    1 
ATOM   5573  C CD1   . PHE G 3 62  ? 30.630  11.584  3.232  1.00 90.87  ? 56  PHE C CD1   1 
ATOM   5574  C CD2   . PHE G 3 62  ? 28.394  11.083  3.913  1.00 87.38  ? 56  PHE C CD2   1 
ATOM   5575  C CE1   . PHE G 3 62  ? 30.903  10.223  3.131  1.00 93.69  ? 56  PHE C CE1   1 
ATOM   5576  C CE2   . PHE G 3 62  ? 28.654  9.721   3.808  1.00 89.94  ? 56  PHE C CE2   1 
ATOM   5577  C CZ    . PHE G 3 62  ? 29.909  9.290   3.419  1.00 93.40  ? 56  PHE C CZ    1 
ATOM   5578  N N     . ARG G 3 63  ? 30.890  14.638  1.581  1.00 94.54  ? 57  ARG C N     1 
ATOM   5579  C CA    . ARG G 3 63  ? 32.066  14.480  0.722  1.00 99.38  ? 57  ARG C CA    1 
ATOM   5580  C C     . ARG G 3 63  ? 33.303  14.381  1.610  1.00 98.33  ? 57  ARG C C     1 
ATOM   5581  O O     . ARG G 3 63  ? 33.483  15.190  2.520  1.00 95.41  ? 57  ARG C O     1 
ATOM   5582  C CB    . ARG G 3 63  ? 32.189  15.636  -0.288 1.00 102.85 ? 57  ARG C CB    1 
ATOM   5583  C CG    . ARG G 3 63  ? 32.318  17.024  0.337  1.00 100.79 ? 57  ARG C CG    1 
ATOM   5584  C CD    . ARG G 3 63  ? 32.322  18.149  -0.688 1.00 105.08 ? 57  ARG C CD    1 
ATOM   5585  N NE    . ARG G 3 63  ? 32.702  19.410  -0.052 1.00 104.25 ? 57  ARG C NE    1 
ATOM   5586  C CZ    . ARG G 3 63  ? 33.927  19.933  -0.080 1.00 107.54 ? 57  ARG C CZ    1 
ATOM   5587  N NH1   . ARG G 3 63  ? 34.907  19.326  -0.744 1.00 111.78 ? 57  ARG C NH1   1 
ATOM   5588  N NH2   . ARG G 3 63  ? 34.172  21.079  0.546  1.00 106.23 ? 57  ARG C NH2   1 
ATOM   5589  N N     . THR G 3 64  ? 34.138  13.378  1.355  1.00 101.24 ? 58  THR C N     1 
ATOM   5590  C CA    . THR G 3 64  ? 35.305  13.124  2.194  1.00 100.85 ? 58  THR C CA    1 
ATOM   5591  C C     . THR G 3 64  ? 36.471  14.035  1.813  1.00 104.26 ? 58  THR C C     1 
ATOM   5592  O O     . THR G 3 64  ? 36.956  13.996  0.674  1.00 109.43 ? 58  THR C O     1 
ATOM   5593  C CB    . THR G 3 64  ? 35.732  11.634  2.140  1.00 102.95 ? 58  THR C CB    1 
ATOM   5594  O OG1   . THR G 3 64  ? 34.588  10.797  2.339  1.00 100.91 ? 58  THR C OG1   1 
ATOM   5595  C CG2   . THR G 3 64  ? 36.763  11.324  3.217  1.00 101.94 ? 58  THR C CG2   1 
ATOM   5596  N N     . THR G 3 65  ? 36.906  14.858  2.769  1.00 102.03 ? 59  THR C N     1 
ATOM   5597  C CA    . THR G 3 65  ? 38.090  15.711  2.588  1.00 105.62 ? 59  THR C CA    1 
ATOM   5598  C C     . THR G 3 65  ? 39.259  15.372  3.535  1.00 105.50 ? 59  THR C C     1 
ATOM   5599  O O     . THR G 3 65  ? 39.100  14.626  4.507  1.00 102.17 ? 59  THR C O     1 
ATOM   5600  C CB    . THR G 3 65  ? 37.749  17.224  2.670  1.00 104.95 ? 59  THR C CB    1 
ATOM   5601  O OG1   . THR G 3 65  ? 38.843  17.978  2.129  1.00 110.54 ? 59  THR C OG1   1 
ATOM   5602  C CG2   . THR G 3 65  ? 37.488  17.666  4.116  1.00 99.44  ? 59  THR C CG2   1 
ATOM   5603  N N     . ILE G 3 66  ? 40.425  15.943  3.249  1.00 109.63 ? 60  ILE C N     1 
ATOM   5604  C CA    . ILE G 3 66  ? 41.638  15.599  3.975  1.00 111.01 ? 60  ILE C CA    1 
ATOM   5605  C C     . ILE G 3 66  ? 42.312  16.807  4.629  1.00 111.54 ? 60  ILE C C     1 
ATOM   5606  O O     . ILE G 3 66  ? 42.797  17.703  3.934  1.00 115.78 ? 60  ILE C O     1 
ATOM   5607  C CB    . ILE G 3 66  ? 42.652  14.872  3.052  1.00 116.69 ? 60  ILE C CB    1 
ATOM   5608  N N     . GLN G 3 67  ? 42.329  16.832  5.963  1.00 107.88 ? 61  GLN C N     1 
ATOM   5609  C CA    . GLN G 3 67  ? 43.188  17.764  6.701  1.00 109.28 ? 61  GLN C CA    1 
ATOM   5610  C C     . GLN G 3 67  ? 44.615  17.239  6.720  1.00 113.55 ? 61  GLN C C     1 
ATOM   5611  O O     . GLN G 3 67  ? 44.844  16.040  6.905  1.00 113.18 ? 61  GLN C O     1 
ATOM   5612  C CB    . GLN G 3 67  ? 42.706  17.979  8.134  1.00 104.41 ? 61  GLN C CB    1 
ATOM   5613  C CG    . GLN G 3 67  ? 41.636  19.060  8.291  1.00 102.62 ? 61  GLN C CG    1 
ATOM   5614  C CD    . GLN G 3 67  ? 42.124  20.462  7.943  1.00 107.37 ? 61  GLN C CD    1 
ATOM   5615  O OE1   . GLN G 3 67  ? 41.409  21.231  7.292  1.00 108.39 ? 61  GLN C OE1   1 
ATOM   5616  N NE2   . GLN G 3 67  ? 43.338  20.801  8.374  1.00 110.44 ? 61  GLN C NE2   1 
ATOM   5617  N N     . GLY G 3 68  ? 45.565  18.148  6.525  1.00 117.94 ? 62  GLY C N     1 
ATOM   5618  C CA    . GLY G 3 68  ? 46.974  17.792  6.469  1.00 122.95 ? 62  GLY C CA    1 
ATOM   5619  C C     . GLY G 3 68  ? 47.260  16.909  5.273  1.00 126.72 ? 62  GLY C C     1 
ATOM   5620  O O     . GLY G 3 68  ? 47.096  17.330  4.128  1.00 129.85 ? 62  GLY C O     1 
ATOM   5621  N N     . THR G 3 69  ? 47.648  15.668  5.552  1.00 126.64 ? 63  THR C N     1 
ATOM   5622  C CA    . THR G 3 69  ? 48.097  14.724  4.531  1.00 130.71 ? 63  THR C CA    1 
ATOM   5623  C C     . THR G 3 69  ? 47.283  13.421  4.516  1.00 127.51 ? 63  THR C C     1 
ATOM   5624  O O     . THR G 3 69  ? 47.134  12.796  3.472  1.00 130.25 ? 63  THR C O     1 
ATOM   5625  C CB    . THR G 3 69  ? 49.609  14.431  4.717  1.00 136.13 ? 63  THR C CB    1 
ATOM   5626  O OG1   . THR G 3 69  ? 50.365  15.571  4.290  1.00 140.40 ? 63  THR C OG1   1 
ATOM   5627  C CG2   . THR G 3 69  ? 50.059  13.212  3.928  1.00 140.06 ? 63  THR C CG2   1 
ATOM   5628  N N     . LYS G 3 70  ? 46.743  13.029  5.667  1.00 122.40 ? 64  LYS C N     1 
ATOM   5629  C CA    . LYS G 3 70  ? 46.159  11.695  5.823  1.00 120.41 ? 64  LYS C CA    1 
ATOM   5630  C C     . LYS G 3 70  ? 44.773  11.630  6.486  1.00 113.99 ? 64  LYS C C     1 
ATOM   5631  O O     . LYS G 3 70  ? 44.007  10.712  6.195  1.00 113.20 ? 64  LYS C O     1 
ATOM   5632  C CB    . LYS G 3 70  ? 47.137  10.783  6.580  1.00 122.66 ? 64  LYS C CB    1 
ATOM   5633  N N     . LEU G 3 71  ? 44.453  12.591  7.355  1.00 109.92 ? 65  LEU C N     1 
ATOM   5634  C CA    . LEU G 3 71  ? 43.240  12.527  8.189  1.00 103.86 ? 65  LEU C CA    1 
ATOM   5635  C C     . LEU G 3 71  ? 41.965  12.845  7.415  1.00 101.79 ? 65  LEU C C     1 
ATOM   5636  O O     . LEU G 3 71  ? 41.799  13.958  6.916  1.00 102.02 ? 65  LEU C O     1 
ATOM   5637  C CB    . LEU G 3 71  ? 43.375  13.452  9.417  1.00 100.93 ? 65  LEU C CB    1 
ATOM   5638  C CG    . LEU G 3 71  ? 42.217  13.600  10.415 1.00 94.36  ? 65  LEU C CG    1 
ATOM   5639  C CD1   . LEU G 3 71  ? 42.111  12.413  11.367 1.00 92.13  ? 65  LEU C CD1   1 
ATOM   5640  C CD2   . LEU G 3 71  ? 42.362  14.887  11.199 1.00 91.96  ? 65  LEU C CD2   1 
ATOM   5641  N N     . GLU G 3 72  ? 41.064  11.866  7.340  1.00 100.37 ? 66  GLU C N     1 
ATOM   5642  C CA    . GLU G 3 72  ? 39.789  12.019  6.614  1.00 99.09  ? 66  GLU C CA    1 
ATOM   5643  C C     . GLU G 3 72  ? 38.686  12.659  7.447  1.00 93.80  ? 66  GLU C C     1 
ATOM   5644  O O     . GLU G 3 72  ? 38.550  12.401  8.647  1.00 90.99  ? 66  GLU C O     1 
ATOM   5645  C CB    . GLU G 3 72  ? 39.291  10.682  6.074  1.00 100.61 ? 66  GLU C CB    1 
ATOM   5646  C CG    . GLU G 3 72  ? 39.956  10.239  4.788  1.00 108.09 ? 66  GLU C CG    1 
ATOM   5647  C CD    . GLU G 3 72  ? 39.660  8.787   4.472  1.00 113.18 ? 66  GLU C CD    1 
ATOM   5648  O OE1   . GLU G 3 72  ? 39.662  7.972   5.428  1.00 112.95 ? 66  GLU C OE1   1 
ATOM   5649  O OE2   . GLU G 3 72  ? 39.427  8.460   3.278  1.00 117.10 ? 66  GLU C OE2   1 
ATOM   5650  N N     . LYS G 3 73  ? 37.876  13.466  6.775  1.00 92.83  ? 67  LYS C N     1 
ATOM   5651  C CA    . LYS G 3 73  ? 36.912  14.337  7.424  1.00 88.43  ? 67  LYS C CA    1 
ATOM   5652  C C     . LYS G 3 73  ? 35.697  14.455  6.489  1.00 88.18  ? 67  LYS C C     1 
ATOM   5653  O O     . LYS G 3 73  ? 35.847  14.775  5.304  1.00 91.40  ? 67  LYS C O     1 
ATOM   5654  C CB    . LYS G 3 73  ? 37.596  15.683  7.670  1.00 88.89  ? 67  LYS C CB    1 
ATOM   5655  C CG    . LYS G 3 73  ? 36.766  16.800  8.244  1.00 85.71  ? 67  LYS C CG    1 
ATOM   5656  C CD    . LYS G 3 73  ? 37.465  18.103  7.909  1.00 88.69  ? 67  LYS C CD    1 
ATOM   5657  C CE    . LYS G 3 73  ? 37.161  19.204  8.889  1.00 86.79  ? 67  LYS C CE    1 
ATOM   5658  N NZ    . LYS G 3 73  ? 38.053  20.373  8.650  1.00 90.59  ? 67  LYS C NZ    1 
ATOM   5659  N N     . LYS G 3 74  ? 34.508  14.158  7.013  1.00 84.54  ? 68  LYS C N     1 
ATOM   5660  C CA    . LYS G 3 74  ? 33.276  14.157  6.211  1.00 84.58  ? 68  LYS C CA    1 
ATOM   5661  C C     . LYS G 3 74  ? 32.498  15.459  6.369  1.00 82.29  ? 68  LYS C C     1 
ATOM   5662  O O     . LYS G 3 74  ? 31.996  15.759  7.448  1.00 79.11  ? 68  LYS C O     1 
ATOM   5663  C CB    . LYS G 3 74  ? 32.375  12.978  6.588  1.00 82.90  ? 68  LYS C CB    1 
ATOM   5664  C CG    . LYS G 3 74  ? 33.037  11.623  6.498  1.00 85.66  ? 68  LYS C CG    1 
ATOM   5665  C CD    . LYS G 3 74  ? 32.098  10.550  7.014  1.00 85.25  ? 68  LYS C CD    1 
ATOM   5666  C CE    . LYS G 3 74  ? 32.525  9.164   6.553  1.00 90.33  ? 68  LYS C CE    1 
ATOM   5667  N NZ    . LYS G 3 74  ? 31.602  8.097   7.042  1.00 89.98  ? 68  LYS C NZ    1 
ATOM   5668  N N     . MET G 3 75  ? 32.408  16.230  5.293  1.00 84.92  ? 69  MET C N     1 
ATOM   5669  C CA    . MET G 3 75  ? 31.660  17.484  5.302  1.00 83.77  ? 69  MET C CA    1 
ATOM   5670  C C     . MET G 3 75  ? 30.232  17.240  4.833  1.00 82.83  ? 69  MET C C     1 
ATOM   5671  O O     . MET G 3 75  ? 30.016  16.755  3.719  1.00 86.25  ? 69  MET C O     1 
ATOM   5672  C CB    . MET G 3 75  ? 32.335  18.526  4.404  1.00 87.98  ? 69  MET C CB    1 
ATOM   5673  C CG    . MET G 3 75  ? 33.750  18.892  4.816  1.00 90.29  ? 69  MET C CG    1 
ATOM   5674  S SD    . MET G 3 75  ? 33.814  19.639  6.449  1.00 88.92  ? 69  MET C SD    1 
ATOM   5675  C CE    . MET G 3 75  ? 33.206  21.289  6.103  1.00 89.60  ? 69  MET C CE    1 
ATOM   5676  N N     . TYR G 3 76  ? 29.266  17.588  5.679  1.00 78.83  ? 70  TYR C N     1 
ATOM   5677  C CA    . TYR G 3 76  ? 27.855  17.316  5.405  1.00 77.65  ? 70  TYR C CA    1 
ATOM   5678  C C     . TYR G 3 76  ? 27.081  18.537  4.899  1.00 78.47  ? 70  TYR C C     1 
ATOM   5679  O O     . TYR G 3 76  ? 27.159  19.624  5.484  1.00 77.44  ? 70  TYR C O     1 
ATOM   5680  C CB    . TYR G 3 76  ? 27.174  16.747  6.656  1.00 73.32  ? 70  TYR C CB    1 
ATOM   5681  C CG    . TYR G 3 76  ? 27.620  15.351  7.013  1.00 72.76  ? 70  TYR C CG    1 
ATOM   5682  C CD1   . TYR G 3 76  ? 28.716  15.135  7.845  1.00 71.27  ? 70  TYR C CD1   1 
ATOM   5683  C CD2   . TYR G 3 76  ? 26.943  14.244  6.527  1.00 73.36  ? 70  TYR C CD2   1 
ATOM   5684  C CE1   . TYR G 3 76  ? 29.127  13.843  8.172  1.00 71.88  ? 70  TYR C CE1   1 
ATOM   5685  C CE2   . TYR G 3 76  ? 27.343  12.952  6.851  1.00 73.90  ? 70  TYR C CE2   1 
ATOM   5686  C CZ    . TYR G 3 76  ? 28.436  12.755  7.670  1.00 73.03  ? 70  TYR C CZ    1 
ATOM   5687  O OH    . TYR G 3 76  ? 28.837  11.466  7.977  1.00 74.26  ? 70  TYR C OH    1 
ATOM   5688  N N     . THR G 3 77  ? 26.327  18.340  3.822  1.00 80.63  ? 71  THR C N     1 
ATOM   5689  C CA    . THR G 3 77  ? 25.367  19.335  3.333  1.00 81.63  ? 71  THR C CA    1 
ATOM   5690  C C     . THR G 3 77  ? 23.936  18.811  3.508  1.00 79.73  ? 71  THR C C     1 
ATOM   5691  O O     . THR G 3 77  ? 23.734  17.616  3.727  1.00 78.93  ? 71  THR C O     1 
ATOM   5692  C CB    . THR G 3 77  ? 25.629  19.687  1.841  1.00 87.06  ? 71  THR C CB    1 
ATOM   5693  O OG1   . THR G 3 77  ? 26.947  20.221  1.707  1.00 89.51  ? 71  THR C OG1   1 
ATOM   5694  C CG2   . THR G 3 77  ? 24.637  20.734  1.321  1.00 89.24  ? 71  THR C CG2   1 
ATOM   5695  N N     . LEU G 3 78  ? 22.956  19.710  3.421  1.00 79.39  ? 72  LEU C N     1 
ATOM   5696  C CA    . LEU G 3 78  ? 21.541  19.336  3.385  1.00 78.98  ? 72  LEU C CA    1 
ATOM   5697  C C     . LEU G 3 78  ? 21.075  18.961  1.979  1.00 83.52  ? 72  LEU C C     1 
ATOM   5698  O O     . LEU G 3 78  ? 21.430  19.631  1.013  1.00 86.94  ? 72  LEU C O     1 
ATOM   5699  C CB    . LEU G 3 78  ? 20.681  20.496  3.871  1.00 77.55  ? 72  LEU C CB    1 
ATOM   5700  C CG    . LEU G 3 78  ? 20.461  20.681  5.369  1.00 72.95  ? 72  LEU C CG    1 
ATOM   5701  C CD1   . LEU G 3 78  ? 19.781  22.008  5.589  1.00 73.00  ? 72  LEU C CD1   1 
ATOM   5702  C CD2   . LEU G 3 78  ? 19.619  19.548  5.951  1.00 71.05  ? 72  LEU C CD2   1 
ATOM   5703  N N     . THR G 3 79  ? 20.277  17.898  1.879  1.00 83.98  ? 73  THR C N     1 
ATOM   5704  C CA    . THR G 3 79  ? 19.610  17.534  0.622  1.00 88.70  ? 73  THR C CA    1 
ATOM   5705  C C     . THR G 3 79  ? 18.288  18.281  0.517  1.00 89.62  ? 73  THR C C     1 
ATOM   5706  O O     . THR G 3 79  ? 17.858  18.931  1.478  1.00 86.30  ? 73  THR C O     1 
ATOM   5707  C CB    . THR G 3 79  ? 19.340  16.005  0.500  1.00 89.78  ? 73  THR C CB    1 
ATOM   5708  O OG1   . THR G 3 79  ? 18.253  15.622  1.353  1.00 87.15  ? 73  THR C OG1   1 
ATOM   5709  C CG2   . THR G 3 79  ? 20.586  15.187  0.843  1.00 88.61  ? 73  THR C CG2   1 
ATOM   5710  N N     . ASP G 3 80  ? 17.645  18.194  -0.645 1.00 94.59  ? 74  ASP C N     1 
ATOM   5711  C CA    . ASP G 3 80  ? 16.305  18.761  -0.822 1.00 96.21  ? 74  ASP C CA    1 
ATOM   5712  C C     . ASP G 3 80  ? 15.282  18.090  0.098  1.00 93.20  ? 74  ASP C C     1 
ATOM   5713  O O     . ASP G 3 80  ? 14.432  18.752  0.692  1.00 91.27  ? 74  ASP C O     1 
ATOM   5714  C CB    . ASP G 3 80  ? 15.874  18.667  -2.288 1.00 102.79 ? 74  ASP C CB    1 
ATOM   5715  C CG    . ASP G 3 80  ? 16.061  19.982  -3.042 1.00 107.42 ? 74  ASP C CG    1 
ATOM   5716  O OD1   . ASP G 3 80  ? 16.329  21.015  -2.376 1.00 105.28 ? 74  ASP C OD1   1 
ATOM   5717  O OD2   . ASP G 3 80  ? 15.922  19.982  -4.299 1.00 114.27 ? 74  ASP C OD2   1 
ATOM   5718  N N     . SER G 3 81  ? 15.396  16.769  0.203  1.00 93.34  ? 75  SER C N     1 
ATOM   5719  C CA    . SER G 3 81  ? 14.630  15.946  1.129  1.00 91.55  ? 75  SER C CA    1 
ATOM   5720  C C     . SER G 3 81  ? 14.819  16.430  2.574  1.00 86.16  ? 75  SER C C     1 
ATOM   5721  O O     . SER G 3 81  ? 13.856  16.513  3.344  1.00 84.70  ? 75  SER C O     1 
ATOM   5722  C CB    . SER G 3 81  ? 15.093  14.489  0.996  1.00 93.06  ? 75  SER C CB    1 
ATOM   5723  O OG    . SER G 3 81  ? 14.190  13.583  1.598  1.00 93.53  ? 75  SER C OG    1 
ATOM   5724  N N     . GLY G 3 82  ? 16.066  16.751  2.922  1.00 83.57  ? 76  GLY C N     1 
ATOM   5725  C CA    . GLY G 3 82  ? 16.412  17.267  4.240  1.00 78.99  ? 76  GLY C CA    1 
ATOM   5726  C C     . GLY G 3 82  ? 15.901  18.669  4.512  1.00 78.11  ? 76  GLY C C     1 
ATOM   5727  O O     . GLY G 3 82  ? 15.500  18.975  5.633  1.00 75.30  ? 76  GLY C O     1 
ATOM   5728  N N     . LYS G 3 83  ? 15.918  19.523  3.491  1.00 81.18  ? 77  LYS C N     1 
ATOM   5729  C CA    . LYS G 3 83  ? 15.435  20.894  3.628  1.00 81.32  ? 77  LYS C CA    1 
ATOM   5730  C C     . LYS G 3 83  ? 13.951  20.934  3.932  1.00 81.63  ? 77  LYS C C     1 
ATOM   5731  O O     . LYS G 3 83  ? 13.502  21.758  4.734  1.00 80.00  ? 77  LYS C O     1 
ATOM   5732  C CB    . LYS G 3 83  ? 15.743  21.725  2.381  1.00 85.59  ? 77  LYS C CB    1 
ATOM   5733  C CG    . LYS G 3 83  ? 17.079  22.464  2.448  1.00 85.83  ? 77  LYS C CG    1 
ATOM   5734  C CD    . LYS G 3 83  ? 17.272  23.407  1.255  1.00 91.71  ? 77  LYS C CD    1 
ATOM   5735  C CE    . LYS G 3 83  ? 18.182  22.809  0.191  1.00 95.34  ? 77  LYS C CE    1 
ATOM   5736  N N     . GLN G 3 84  ? 13.192  20.038  3.307  1.00 84.33  ? 78  GLN C N     1 
ATOM   5737  C CA    . GLN G 3 84  ? 11.747  19.976  3.533  1.00 85.38  ? 78  GLN C CA    1 
ATOM   5738  C C     . GLN G 3 84  ? 11.435  19.345  4.888  1.00 81.75  ? 78  GLN C C     1 
ATOM   5739  O O     . GLN G 3 84  ? 10.471  19.732  5.551  1.00 81.24  ? 78  GLN C O     1 
ATOM   5740  C CB    . GLN G 3 84  ? 11.043  19.202  2.419  1.00 90.04  ? 78  GLN C CB    1 
ATOM   5741  C CG    . GLN G 3 84  ? 9.554   19.464  2.337  1.00 93.21  ? 78  GLN C CG    1 
ATOM   5742  C CD    . GLN G 3 84  ? 9.227   20.746  1.594  1.00 97.15  ? 78  GLN C CD    1 
ATOM   5743  O OE1   . GLN G 3 84  ? 9.185   20.769  0.360  1.00 101.97 ? 78  GLN C OE1   1 
ATOM   5744  N NE2   . GLN G 3 84  ? 8.976   21.821  2.342  1.00 95.04  ? 78  GLN C NE2   1 
ATOM   5745  N N     . GLU G 3 85  ? 12.258  18.377  5.287  1.00 79.67  ? 79  GLU C N     1 
ATOM   5746  C CA    . GLU G 3 85  ? 12.079  17.666  6.547  1.00 76.76  ? 79  GLU C CA    1 
ATOM   5747  C C     . GLU G 3 85  ? 12.204  18.672  7.687  1.00 72.90  ? 79  GLU C C     1 
ATOM   5748  O O     . GLU G 3 85  ? 11.357  18.711  8.582  1.00 71.84  ? 79  GLU C O     1 
ATOM   5749  C CB    . GLU G 3 85  ? 13.110  16.527  6.663  1.00 76.00  ? 79  GLU C CB    1 
ATOM   5750  C CG    . GLU G 3 85  ? 12.933  15.583  7.857  1.00 75.08  ? 79  GLU C CG    1 
ATOM   5751  C CD    . GLU G 3 85  ? 11.707  14.667  7.774  1.00 79.11  ? 79  GLU C CD    1 
ATOM   5752  O OE1   . GLU G 3 85  ? 11.141  14.491  6.680  1.00 83.67  ? 79  GLU C OE1   1 
ATOM   5753  O OE2   . GLU G 3 85  ? 11.311  14.107  8.816  1.00 78.51  ? 79  GLU C OE2   1 
ATOM   5754  N N     . LEU G 3 86  ? 13.254  19.491  7.621  1.00 71.34  ? 80  LEU C N     1 
ATOM   5755  C CA    . LEU G 3 86  ? 13.501  20.564  8.580  1.00 68.62  ? 80  LEU C CA    1 
ATOM   5756  C C     . LEU G 3 86  ? 12.370  21.596  8.563  1.00 70.23  ? 80  LEU C C     1 
ATOM   5757  O O     . LEU G 3 86  ? 11.876  22.009  9.614  1.00 68.56  ? 80  LEU C O     1 
ATOM   5758  C CB    . LEU G 3 86  ? 14.846  21.240  8.283  1.00 67.92  ? 80  LEU C CB    1 
ATOM   5759  C CG    . LEU G 3 86  ? 15.173  22.575  8.963  1.00 65.86  ? 80  LEU C CG    1 
ATOM   5760  C CD1   . LEU G 3 86  ? 15.413  22.384  10.445 1.00 62.47  ? 80  LEU C CD1   1 
ATOM   5761  C CD2   . LEU G 3 86  ? 16.368  23.241  8.307  1.00 66.17  ? 80  LEU C CD2   1 
ATOM   5762  N N     . HIS G 3 87  ? 11.960  21.998  7.364  1.00 73.97  ? 81  HIS C N     1 
ATOM   5763  C CA    . HIS G 3 87  ? 10.891  22.975  7.205  1.00 76.20  ? 81  HIS C CA    1 
ATOM   5764  C C     . HIS G 3 87  ? 9.587   22.492  7.842  1.00 76.35  ? 81  HIS C C     1 
ATOM   5765  O O     . HIS G 3 87  ? 8.944   23.243  8.575  1.00 75.95  ? 81  HIS C O     1 
ATOM   5766  C CB    . HIS G 3 87  ? 10.688  23.315  5.729  1.00 80.63  ? 81  HIS C CB    1 
ATOM   5767  C CG    . HIS G 3 87  ? 9.701   24.413  5.490  1.00 83.55  ? 81  HIS C CG    1 
ATOM   5768  N ND1   . HIS G 3 87  ? 10.001  25.742  5.698  1.00 84.01  ? 81  HIS C ND1   1 
ATOM   5769  C CD2   . HIS G 3 87  ? 8.420   24.381  5.051  1.00 86.97  ? 81  HIS C CD2   1 
ATOM   5770  C CE1   . HIS G 3 87  ? 8.948   26.481  5.400  1.00 87.28  ? 81  HIS C CE1   1 
ATOM   5771  N NE2   . HIS G 3 87  ? 7.976   25.680  5.002  1.00 89.13  ? 81  HIS C NE2   1 
ATOM   5772  N N     . ASP G 3 88  ? 9.218   21.239  7.578  1.00 77.63  ? 82  ASP C N     1 
ATOM   5773  C CA    . ASP G 3 88  ? 7.978   20.657  8.104  1.00 78.86  ? 82  ASP C CA    1 
ATOM   5774  C C     . ASP G 3 88  ? 7.979   20.622  9.629  1.00 75.47  ? 82  ASP C C     1 
ATOM   5775  O O     . ASP G 3 88  ? 6.933   20.785  10.269 1.00 76.15  ? 82  ASP C O     1 
ATOM   5776  C CB    . ASP G 3 88  ? 7.750   19.247  7.545  1.00 81.30  ? 82  ASP C CB    1 
ATOM   5777  C CG    . ASP G 3 88  ? 7.338   19.248  6.072  1.00 86.77  ? 82  ASP C CG    1 
ATOM   5778  O OD1   . ASP G 3 88  ? 6.816   20.274  5.578  1.00 89.85  ? 82  ASP C OD1   1 
ATOM   5779  O OD2   . ASP G 3 88  ? 7.526   18.208  5.405  1.00 89.36  ? 82  ASP C OD2   1 
ATOM   5780  N N     . TRP G 3 89  ? 9.163   20.418  10.202 1.00 72.08  ? 83  TRP C N     1 
ATOM   5781  C CA    . TRP G 3 89  ? 9.327   20.405  11.644 1.00 68.80  ? 83  TRP C CA    1 
ATOM   5782  C C     . TRP G 3 89  ? 9.322   21.820  12.219 1.00 67.71  ? 83  TRP C C     1 
ATOM   5783  O O     . TRP G 3 89  ? 8.671   22.080  13.233 1.00 67.25  ? 83  TRP C O     1 
ATOM   5784  C CB    . TRP G 3 89  ? 10.591  19.640  12.023 1.00 65.99  ? 83  TRP C CB    1 
ATOM   5785  C CG    . TRP G 3 89  ? 10.959  19.735  13.456 1.00 62.87  ? 83  TRP C CG    1 
ATOM   5786  C CD1   . TRP G 3 89  ? 10.392  19.060  14.509 1.00 62.59  ? 83  TRP C CD1   1 
ATOM   5787  C CD2   . TRP G 3 89  ? 11.986  20.559  14.012 1.00 60.02  ? 83  TRP C CD2   1 
ATOM   5788  N NE1   . TRP G 3 89  ? 11.009  19.419  15.692 1.00 59.05  ? 83  TRP C NE1   1 
ATOM   5789  C CE2   . TRP G 3 89  ? 11.989  20.338  15.414 1.00 57.93  ? 83  TRP C CE2   1 
ATOM   5790  C CE3   . TRP G 3 89  ? 12.905  21.466  13.465 1.00 59.18  ? 83  TRP C CE3   1 
ATOM   5791  C CZ2   . TRP G 3 89  ? 12.878  20.986  16.268 1.00 55.60  ? 83  TRP C CZ2   1 
ATOM   5792  C CZ3   . TRP G 3 89  ? 13.784  22.112  14.318 1.00 57.95  ? 83  TRP C CZ3   1 
ATOM   5793  C CH2   . TRP G 3 89  ? 13.769  21.862  15.707 1.00 55.75  ? 83  TRP C CH2   1 
ATOM   5794  N N     . LEU G 3 90  ? 10.027  22.735  11.564 1.00 68.07  ? 84  LEU C N     1 
ATOM   5795  C CA    . LEU G 3 90  ? 10.051  24.130  11.995 1.00 68.10  ? 84  LEU C CA    1 
ATOM   5796  C C     . LEU G 3 90  ? 8.656   24.764  12.119 1.00 70.72  ? 84  LEU C C     1 
ATOM   5797  O O     . LEU G 3 90  ? 8.419   25.531  13.051 1.00 70.19  ? 84  LEU C O     1 
ATOM   5798  C CB    . LEU G 3 90  ? 10.923  24.976  11.064 1.00 69.20  ? 84  LEU C CB    1 
ATOM   5799  C CG    . LEU G 3 90  ? 12.443  24.794  11.108 1.00 67.57  ? 84  LEU C CG    1 
ATOM   5800  C CD1   . LEU G 3 90  ? 13.055  25.426  9.862  1.00 70.81  ? 84  LEU C CD1   1 
ATOM   5801  C CD2   . LEU G 3 90  ? 13.071  25.366  12.378 1.00 63.99  ? 84  LEU C CD2   1 
ATOM   5802  N N     . ILE G 3 91  ? 7.741   24.446  11.200 1.00 73.97  ? 85  ILE C N     1 
ATOM   5803  C CA    . ILE G 3 91  ? 6.406   25.071  11.202 1.00 77.06  ? 85  ILE C CA    1 
ATOM   5804  C C     . ILE G 3 91  ? 5.320   24.293  11.964 1.00 77.81  ? 85  ILE C C     1 
ATOM   5805  O O     . ILE G 3 91  ? 4.238   24.829  12.210 1.00 80.13  ? 85  ILE C O     1 
ATOM   5806  C CB    . ILE G 3 91  ? 5.898   25.429  9.760  1.00 81.24  ? 85  ILE C CB    1 
ATOM   5807  C CG1   . ILE G 3 91  ? 5.706   24.165  8.910  1.00 82.53  ? 85  ILE C CG1   1 
ATOM   5808  C CG2   . ILE G 3 91  ? 6.830   26.440  9.090  1.00 81.47  ? 85  ILE C CG2   1 
ATOM   5809  C CD1   . ILE G 3 91  ? 4.984   24.394  7.607  1.00 86.99  ? 85  ILE C CD1   1 
ATOM   5810  N N     . ARG G 3 92  ? 5.609   23.044  12.327 1.00 76.70  ? 86  ARG C N     1 
ATOM   5811  C CA    . ARG G 3 92  ? 4.677   22.191  13.078 1.00 78.14  ? 86  ARG C CA    1 
ATOM   5812  C C     . ARG G 3 92  ? 4.487   22.714  14.507 1.00 76.74  ? 86  ARG C C     1 
ATOM   5813  O O     . ARG G 3 92  ? 5.464   22.945  15.211 1.00 73.81  ? 86  ARG C O     1 
ATOM   5814  C CB    . ARG G 3 92  ? 5.208   20.751  13.111 1.00 77.39  ? 86  ARG C CB    1 
ATOM   5815  C CG    . ARG G 3 92  ? 4.157   19.672  13.337 1.00 80.36  ? 86  ARG C CG    1 
ATOM   5816  N N     . HIS G 3 93  ? 3.239   22.907  14.932 1.00 75.35  ? 87  HIS C N     1 
ATOM   5817  C CA    . HIS G 3 93  ? 2.959   23.398  16.289 1.00 73.61  ? 87  HIS C CA    1 
ATOM   5818  C C     . HIS G 3 93  ? 2.971   22.257  17.299 1.00 72.93  ? 87  HIS C C     1 
ATOM   5819  O O     . HIS G 3 93  ? 1.971   21.558  17.469 1.00 74.63  ? 87  HIS C O     1 
ATOM   5820  C CB    . HIS G 3 93  ? 1.607   24.107  16.368 1.00 74.96  ? 87  HIS C CB    1 
ATOM   5821  C CG    . HIS G 3 93  ? 1.409   25.162  15.332 1.00 76.78  ? 87  HIS C CG    1 
ATOM   5822  N ND1   . HIS G 3 93  ? 0.232   25.294  14.627 1.00 79.85  ? 87  HIS C ND1   1 
ATOM   5823  C CD2   . HIS G 3 93  ? 2.237   26.130  14.874 1.00 76.79  ? 87  HIS C CD2   1 
ATOM   5824  C CE1   . HIS G 3 93  ? 0.340   26.304  13.782 1.00 81.69  ? 87  HIS C CE1   1 
ATOM   5825  N NE2   . HIS G 3 93  ? 1.547   26.828  13.911 1.00 80.04  ? 87  HIS C NE2   1 
ATOM   5826  N N     . GLN G 3 94  ? 4.097   22.078  17.978 1.00 71.00  ? 88  GLN C N     1 
ATOM   5827  C CA    . GLN G 3 94  ? 4.236   20.991  18.935 1.00 70.49  ? 88  GLN C CA    1 
ATOM   5828  C C     . GLN G 3 94  ? 3.829   21.475  20.334 1.00 68.58  ? 88  GLN C C     1 
ATOM   5829  O O     . GLN G 3 94  ? 4.221   22.569  20.748 1.00 66.96  ? 88  GLN C O     1 
ATOM   5830  C CB    . GLN G 3 94  ? 5.674   20.455  18.923 1.00 69.80  ? 88  GLN C CB    1 
ATOM   5831  C CG    . GLN G 3 94  ? 5.776   18.926  18.880 1.00 71.69  ? 88  GLN C CG    1 
ATOM   5832  N N     . PRO G 3 95  ? 3.030   20.664  21.058 1.00 69.14  ? 89  PRO C N     1 
ATOM   5833  C CA    . PRO G 3 95  ? 2.576   21.029  22.402 1.00 67.63  ? 89  PRO C CA    1 
ATOM   5834  C C     . PRO G 3 95  ? 3.747   21.332  23.328 1.00 64.93  ? 89  PRO C C     1 
ATOM   5835  O O     . PRO G 3 95  ? 4.789   20.676  23.245 1.00 64.48  ? 89  PRO C O     1 
ATOM   5836  C CB    . PRO G 3 95  ? 1.861   19.761  22.892 1.00 68.84  ? 89  PRO C CB    1 
ATOM   5837  C CG    . PRO G 3 95  ? 2.442   18.643  22.055 1.00 70.44  ? 89  PRO C CG    1 
ATOM   5838  C CD    . PRO G 3 95  ? 2.615   19.291  20.704 1.00 71.51  ? 89  PRO C CD    1 
ATOM   5839  N N     . ILE G 3 96  ? 3.580   22.322  24.196 1.00 63.43  ? 90  ILE C N     1 
ATOM   5840  C CA    . ILE G 3 96  ? 4.586   22.593  25.202 1.00 61.06  ? 90  ILE C CA    1 
ATOM   5841  C C     . ILE G 3 96  ? 4.585   21.446  26.218 1.00 60.07  ? 90  ILE C C     1 
ATOM   5842  O O     . ILE G 3 96  ? 3.525   20.906  26.552 1.00 61.16  ? 90  ILE C O     1 
ATOM   5843  C CB    . ILE G 3 96  ? 4.402   23.987  25.867 1.00 60.51  ? 90  ILE C CB    1 
ATOM   5844  C CG1   . ILE G 3 96  ? 3.060   24.080  26.588 1.00 62.13  ? 90  ILE C CG1   1 
ATOM   5845  C CG2   . ILE G 3 96  ? 4.533   25.103  24.809 1.00 61.73  ? 90  ILE C CG2   1 
ATOM   5846  C CD1   . ILE G 3 96  ? 2.631   25.523  26.928 1.00 64.96  ? 90  ILE C CD1   1 
ATOM   5847  N N     . PRO G 3 97  ? 5.779   21.034  26.673 1.00 58.30  ? 91  PRO C N     1 
ATOM   5848  C CA    . PRO G 3 97  ? 5.825   19.954  27.644 1.00 57.55  ? 91  PRO C CA    1 
ATOM   5849  C C     . PRO G 3 97  ? 5.464   20.463  29.033 1.00 56.07  ? 91  PRO C C     1 
ATOM   5850  O O     . PRO G 3 97  ? 5.723   21.629  29.338 1.00 55.58  ? 91  PRO C O     1 
ATOM   5851  C CB    . PRO G 3 97  ? 7.284   19.491  27.579 1.00 57.00  ? 91  PRO C CB    1 
ATOM   5852  C CG    . PRO G 3 97  ? 8.051   20.663  27.127 1.00 56.49  ? 91  PRO C CG    1 
ATOM   5853  C CD    . PRO G 3 97  ? 7.125   21.504  26.285 1.00 57.52  ? 91  PRO C CD    1 
ATOM   5854  N N     . GLU G 3 98  ? 4.854   19.613  29.857 1.00 56.06  ? 92  GLU C N     1 
ATOM   5855  C CA    . GLU G 3 98  ? 4.460   20.013  31.216 1.00 55.38  ? 92  GLU C CA    1 
ATOM   5856  C C     . GLU G 3 98  ? 5.670   20.190  32.142 1.00 53.57  ? 92  GLU C C     1 
ATOM   5857  O O     . GLU G 3 98  ? 5.858   21.269  32.729 1.00 53.12  ? 92  GLU C O     1 
ATOM   5858  C CB    . GLU G 3 98  ? 3.450   19.033  31.831 1.00 56.63  ? 92  GLU C CB    1 
ATOM   5859  N N     . THR G 3 99  ? 6.485   19.137  32.242 1.00 52.57  ? 93  THR C N     1 
ATOM   5860  C CA    . THR G 3 99  ? 7.646   19.096  33.127 1.00 50.73  ? 93  THR C CA    1 
ATOM   5861  C C     . THR G 3 99  ? 8.879   19.682  32.473 1.00 49.84  ? 93  THR C C     1 
ATOM   5862  O O     . THR G 3 99  ? 9.244   19.276  31.380 1.00 50.88  ? 93  THR C O     1 
ATOM   5863  C CB    . THR G 3 99  ? 8.000   17.626  33.503 1.00 51.32  ? 93  THR C CB    1 
ATOM   5864  O OG1   . THR G 3 99  ? 6.845   16.972  34.033 1.00 51.95  ? 93  THR C OG1   1 
ATOM   5865  C CG2   . THR G 3 99  ? 9.135   17.569  34.526 1.00 49.33  ? 93  THR C CG2   1 
ATOM   5866  N N     . VAL G 3 100 ? 9.536   20.610  33.150 1.00 48.74  ? 94  VAL C N     1 
ATOM   5867  C CA    . VAL G 3 100 ? 10.850  21.083  32.718 1.00 48.73  ? 94  VAL C CA    1 
ATOM   5868  C C     . VAL G 3 100 ? 11.737  20.980  33.937 1.00 48.63  ? 94  VAL C C     1 
ATOM   5869  O O     . VAL G 3 100 ? 11.642  21.801  34.844 1.00 48.61  ? 94  VAL C O     1 
ATOM   5870  C CB    . VAL G 3 100 ? 10.815  22.537  32.138 1.00 49.09  ? 94  VAL C CB    1 
ATOM   5871  C CG1   . VAL G 3 100 ? 12.209  22.990  31.686 1.00 49.02  ? 94  VAL C CG1   1 
ATOM   5872  C CG2   . VAL G 3 100 ? 9.811   22.644  30.978 1.00 48.51  ? 94  VAL C CG2   1 
ATOM   5873  N N     . LYS G 3 101 ? 12.587  19.953  33.948 1.00 49.57  ? 95  LYS C N     1 
ATOM   5874  C CA    . LYS G 3 101 ? 13.242  19.448  35.166 1.00 49.85  ? 95  LYS C CA    1 
ATOM   5875  C C     . LYS G 3 101 ? 14.144  20.448  35.888 1.00 50.26  ? 95  LYS C C     1 
ATOM   5876  O O     . LYS G 3 101 ? 15.051  21.025  35.287 1.00 51.38  ? 95  LYS C O     1 
ATOM   5877  C CB    . LYS G 3 101 ? 13.994  18.140  34.878 1.00 50.83  ? 95  LYS C CB    1 
ATOM   5878  C CG    . LYS G 3 101 ? 13.084  16.987  34.345 1.00 52.03  ? 95  LYS C CG    1 
ATOM   5879  C CD    . LYS G 3 101 ? 13.708  15.572  34.485 1.00 52.73  ? 95  LYS C CD    1 
ATOM   5880  C CE    . LYS G 3 101 ? 12.620  14.484  34.540 1.00 54.31  ? 95  LYS C CE    1 
ATOM   5881  N NZ    . LYS G 3 101 ? 13.107  13.051  34.317 1.00 56.14  ? 95  LYS C NZ    1 
ATOM   5882  N N     . ASP G 3 102 ? 13.861  20.669  37.173 1.00 49.95  ? 96  ASP C N     1 
ATOM   5883  C CA    . ASP G 3 102 ? 14.712  21.483  38.039 1.00 50.29  ? 96  ASP C CA    1 
ATOM   5884  C C     . ASP G 3 102 ? 14.879  20.823  39.403 1.00 50.32  ? 96  ASP C C     1 
ATOM   5885  O O     . ASP G 3 102 ? 13.988  20.897  40.254 1.00 49.48  ? 96  ASP C O     1 
ATOM   5886  C CB    . ASP G 3 102 ? 14.145  22.891  38.210 1.00 50.11  ? 96  ASP C CB    1 
ATOM   5887  C CG    . ASP G 3 102 ? 15.167  23.870  38.761 1.00 52.41  ? 96  ASP C CG    1 
ATOM   5888  O OD1   . ASP G 3 102 ? 16.126  23.440  39.448 1.00 53.36  ? 96  ASP C OD1   1 
ATOM   5889  O OD2   . ASP G 3 102 ? 15.019  25.090  38.497 1.00 55.08  ? 96  ASP C OD2   1 
ATOM   5890  N N     . GLU G 3 103 ? 16.039  20.203  39.609 1.00 51.36  ? 97  GLU C N     1 
ATOM   5891  C CA    . GLU G 3 103 ? 16.337  19.464  40.838 1.00 51.96  ? 97  GLU C CA    1 
ATOM   5892  C C     . GLU G 3 103 ? 16.326  20.369  42.068 1.00 52.24  ? 97  GLU C C     1 
ATOM   5893  O O     . GLU G 3 103 ? 15.979  19.928  43.173 1.00 52.43  ? 97  GLU C O     1 
ATOM   5894  C CB    . GLU G 3 103 ? 17.682  18.748  40.714 1.00 53.55  ? 97  GLU C CB    1 
ATOM   5895  C CG    . GLU G 3 103 ? 17.915  17.679  41.761 1.00 56.35  ? 97  GLU C CG    1 
ATOM   5896  C CD    . GLU G 3 103 ? 19.388  17.345  41.973 1.00 61.28  ? 97  GLU C CD    1 
ATOM   5897  O OE1   . GLU G 3 103 ? 20.080  16.978  40.995 1.00 63.88  ? 97  GLU C OE1   1 
ATOM   5898  O OE2   . GLU G 3 103 ? 19.854  17.434  43.130 1.00 63.27  ? 97  GLU C OE2   1 
ATOM   5899  N N     . PHE G 3 104 ? 16.700  21.635  41.881 1.00 52.58  ? 98  PHE C N     1 
ATOM   5900  C CA    . PHE G 3 104 ? 16.668  22.602  42.967 1.00 53.03  ? 98  PHE C CA    1 
ATOM   5901  C C     . PHE G 3 104 ? 15.247  22.908  43.418 1.00 52.25  ? 98  PHE C C     1 
ATOM   5902  O O     . PHE G 3 104 ? 15.003  23.145  44.609 1.00 52.97  ? 98  PHE C O     1 
ATOM   5903  C CB    . PHE G 3 104 ? 17.367  23.906  42.585 1.00 54.46  ? 98  PHE C CB    1 
ATOM   5904  C CG    . PHE G 3 104 ? 17.210  24.994  43.622 1.00 55.47  ? 98  PHE C CG    1 
ATOM   5905  C CD1   . PHE G 3 104 ? 16.198  25.946  43.507 1.00 54.60  ? 98  PHE C CD1   1 
ATOM   5906  C CD2   . PHE G 3 104 ? 18.047  25.036  44.736 1.00 56.75  ? 98  PHE C CD2   1 
ATOM   5907  C CE1   . PHE G 3 104 ? 16.044  26.939  44.477 1.00 57.71  ? 98  PHE C CE1   1 
ATOM   5908  C CE2   . PHE G 3 104 ? 17.898  26.022  45.713 1.00 58.58  ? 98  PHE C CE2   1 
ATOM   5909  C CZ    . PHE G 3 104 ? 16.897  26.977  45.587 1.00 58.74  ? 98  PHE C CZ    1 
ATOM   5910  N N     . MET G 3 105 ? 14.320  22.945  42.464 1.00 50.99  ? 99  MET C N     1 
ATOM   5911  C CA    . MET G 3 105 ? 12.918  23.216  42.778 1.00 50.62  ? 99  MET C CA    1 
ATOM   5912  C C     . MET G 3 105 ? 12.269  22.085  43.582 1.00 50.45  ? 99  MET C C     1 
ATOM   5913  O O     . MET G 3 105 ? 11.361  22.317  44.382 1.00 50.98  ? 99  MET C O     1 
ATOM   5914  C CB    . MET G 3 105 ? 12.127  23.512  41.507 1.00 49.91  ? 99  MET C CB    1 
ATOM   5915  C CG    . MET G 3 105 ? 12.366  24.910  40.950 1.00 50.89  ? 99  MET C CG    1 
ATOM   5916  S SD    . MET G 3 105 ? 12.381  26.160  42.254 1.00 53.43  ? 99  MET C SD    1 
ATOM   5917  C CE    . MET G 3 105 ? 10.697  26.067  42.886 1.00 52.22  ? 99  MET C CE    1 
ATOM   5918  N N     . LEU G 3 106 ? 12.749  20.864  43.363 1.00 49.93  ? 100 LEU C N     1 
ATOM   5919  C CA    . LEU G 3 106 ? 12.363  19.719  44.155 1.00 50.02  ? 100 LEU C CA    1 
ATOM   5920  C C     . LEU G 3 106 ? 12.716  19.975  45.629 1.00 51.17  ? 100 LEU C C     1 
ATOM   5921  O O     . LEU G 3 106 ? 11.913  19.709  46.531 1.00 51.55  ? 100 LEU C O     1 
ATOM   5922  C CB    . LEU G 3 106 ? 13.088  18.495  43.619 1.00 50.14  ? 100 LEU C CB    1 
ATOM   5923  C CG    . LEU G 3 106 ? 12.572  17.085  43.835 1.00 50.48  ? 100 LEU C CG    1 
ATOM   5924  C CD1   . LEU G 3 106 ? 11.150  16.939  43.343 1.00 50.40  ? 100 LEU C CD1   1 
ATOM   5925  C CD2   . LEU G 3 106 ? 13.480  16.130  43.089 1.00 50.46  ? 100 LEU C CD2   1 
ATOM   5926  N N     . LYS G 3 107 ? 13.903  20.523  45.871 1.00 51.89  ? 101 LYS C N     1 
ATOM   5927  C CA    . LYS G 3 107 ? 14.306  20.883  47.228 1.00 53.27  ? 101 LYS C CA    1 
ATOM   5928  C C     . LYS G 3 107 ? 13.425  21.982  47.803 1.00 54.01  ? 101 LYS C C     1 
ATOM   5929  O O     . LYS G 3 107 ? 13.092  21.953  48.982 1.00 55.12  ? 101 LYS C O     1 
ATOM   5930  C CB    . LYS G 3 107 ? 15.764  21.333  47.278 1.00 54.44  ? 101 LYS C CB    1 
ATOM   5931  C CG    . LYS G 3 107 ? 16.777  20.233  47.057 1.00 54.77  ? 101 LYS C CG    1 
ATOM   5932  C CD    . LYS G 3 107 ? 18.146  20.820  47.235 1.00 57.25  ? 101 LYS C CD    1 
ATOM   5933  C CE    . LYS G 3 107 ? 19.232  19.865  46.840 1.00 58.19  ? 101 LYS C CE    1 
ATOM   5934  N NZ    . LYS G 3 107 ? 20.493  20.390  47.420 1.00 60.48  ? 101 LYS C NZ    1 
ATOM   5935  N N     . ALA G 3 108 ? 13.055  22.955  46.972 1.00 53.93  ? 102 ALA C N     1 
ATOM   5936  C CA    . ALA G 3 108 ? 12.186  24.044  47.413 1.00 54.88  ? 102 ALA C CA    1 
ATOM   5937  C C     . ALA G 3 108 ? 10.857  23.495  47.922 1.00 54.47  ? 102 ALA C C     1 
ATOM   5938  O O     . ALA G 3 108 ? 10.300  23.989  48.901 1.00 56.12  ? 102 ALA C O     1 
ATOM   5939  C CB    . ALA G 3 108 ? 11.959  25.043  46.286 1.00 55.14  ? 102 ALA C CB    1 
ATOM   5940  N N     . TYR G 3 109 ? 10.375  22.449  47.268 1.00 52.52  ? 103 TYR C N     1 
ATOM   5941  C CA    . TYR G 3 109 ? 9.112   21.837  47.625 1.00 52.17  ? 103 TYR C CA    1 
ATOM   5942  C C     . TYR G 3 109 ? 9.179   21.132  48.962 1.00 53.04  ? 103 TYR C C     1 
ATOM   5943  O O     . TYR G 3 109 ? 8.151   20.960  49.619 1.00 54.24  ? 103 TYR C O     1 
ATOM   5944  C CB    . TYR G 3 109 ? 8.741   20.833  46.559 1.00 50.64  ? 103 TYR C CB    1 
ATOM   5945  C CG    . TYR G 3 109 ? 7.347   20.280  46.642 1.00 50.64  ? 103 TYR C CG    1 
ATOM   5946  C CD1   . TYR G 3 109 ? 6.225   21.106  46.490 1.00 50.58  ? 103 TYR C CD1   1 
ATOM   5947  C CD2   . TYR G 3 109 ? 7.143   18.913  46.812 1.00 49.43  ? 103 TYR C CD2   1 
ATOM   5948  C CE1   . TYR G 3 109 ? 4.931   20.570  46.539 1.00 50.73  ? 103 TYR C CE1   1 
ATOM   5949  C CE2   . TYR G 3 109 ? 5.868   18.376  46.866 1.00 49.74  ? 103 TYR C CE2   1 
ATOM   5950  C CZ    . TYR G 3 109 ? 4.772   19.202  46.724 1.00 50.55  ? 103 TYR C CZ    1 
ATOM   5951  O OH    . TYR G 3 109 ? 3.526   18.639  46.769 1.00 52.04  ? 103 TYR C OH    1 
ATOM   5952  N N     . PHE G 3 110 ? 10.382  20.711  49.354 1.00 52.79  ? 104 PHE C N     1 
ATOM   5953  C CA    . PHE G 3 110 ? 10.568  19.937  50.578 1.00 53.20  ? 104 PHE C CA    1 
ATOM   5954  C C     . PHE G 3 110 ? 11.095  20.806  51.737 1.00 54.98  ? 104 PHE C C     1 
ATOM   5955  O O     . PHE G 3 110 ? 11.600  20.299  52.743 1.00 55.87  ? 104 PHE C O     1 
ATOM   5956  C CB    . PHE G 3 110 ? 11.491  18.734  50.315 1.00 52.50  ? 104 PHE C CB    1 
ATOM   5957  C CG    . PHE G 3 110 ? 10.959  17.749  49.297 1.00 50.87  ? 104 PHE C CG    1 
ATOM   5958  C CD1   . PHE G 3 110 ? 9.613   17.393  49.272 1.00 50.53  ? 104 PHE C CD1   1 
ATOM   5959  C CD2   . PHE G 3 110 ? 11.820  17.149  48.383 1.00 49.71  ? 104 PHE C CD2   1 
ATOM   5960  C CE1   . PHE G 3 110 ? 9.128   16.475  48.340 1.00 48.66  ? 104 PHE C CE1   1 
ATOM   5961  C CE2   . PHE G 3 110 ? 11.344  16.240  47.445 1.00 48.81  ? 104 PHE C CE2   1 
ATOM   5962  C CZ    . PHE G 3 110 ? 9.991   15.908  47.427 1.00 48.53  ? 104 PHE C CZ    1 
ATOM   5963  N N     . ILE G 3 111 ? 10.931  22.118  51.596 1.00 56.01  ? 105 ILE C N     1 
ATOM   5964  C CA    . ILE G 3 111 ? 11.534  23.109  52.491 1.00 58.13  ? 105 ILE C CA    1 
ATOM   5965  C C     . ILE G 3 111 ? 11.142  22.999  53.980 1.00 60.15  ? 105 ILE C C     1 
ATOM   5966  O O     . ILE G 3 111 ? 11.884  23.459  54.853 1.00 62.33  ? 105 ILE C O     1 
ATOM   5967  C CB    . ILE G 3 111 ? 11.317  24.553  51.953 1.00 59.21  ? 105 ILE C CB    1 
ATOM   5968  C CG1   . ILE G 3 111 ? 12.252  25.550  52.657 1.00 60.96  ? 105 ILE C CG1   1 
ATOM   5969  C CG2   . ILE G 3 111 ? 9.828   24.959  52.018 1.00 59.72  ? 105 ILE C CG2   1 
ATOM   5970  C CD1   . ILE G 3 111 ? 12.295  26.884  51.999 1.00 61.80  ? 105 ILE C CD1   1 
ATOM   5971  N N     . SER G 3 112 ? 10.002  22.371  54.263 1.00 59.99  ? 106 SER C N     1 
ATOM   5972  C CA    . SER G 3 112 ? 9.598   22.055  55.644 1.00 61.72  ? 106 SER C CA    1 
ATOM   5973  C C     . SER G 3 112 ? 10.670  21.285  56.430 1.00 62.17  ? 106 SER C C     1 
ATOM   5974  O O     . SER G 3 112 ? 10.762  21.424  57.652 1.00 64.04  ? 106 SER C O     1 
ATOM   5975  C CB    . SER G 3 112 ? 8.284   21.257  55.670 1.00 61.29  ? 106 SER C CB    1 
ATOM   5976  O OG    . SER G 3 112 ? 8.491   19.886  55.366 1.00 59.25  ? 106 SER C OG    1 
ATOM   5977  N N     . SER G 3 113 ? 11.468  20.483  55.723 1.00 60.56  ? 107 SER C N     1 
ATOM   5978  C CA    . SER G 3 113 ? 12.482  19.624  56.344 1.00 61.25  ? 107 SER C CA    1 
ATOM   5979  C C     . SER G 3 113 ? 13.775  20.363  56.675 1.00 62.90  ? 107 SER C C     1 
ATOM   5980  O O     . SER G 3 113 ? 14.771  19.732  57.048 1.00 63.71  ? 107 SER C O     1 
ATOM   5981  C CB    . SER G 3 113 ? 12.797  18.437  55.431 1.00 59.46  ? 107 SER C CB    1 
ATOM   5982  O OG    . SER G 3 113 ? 11.765  17.480  55.487 1.00 59.38  ? 107 SER C OG    1 
ATOM   5983  N N     . LEU G 3 114 ? 13.746  21.690  56.533 1.00 63.72  ? 108 LEU C N     1 
ATOM   5984  C CA    . LEU G 3 114 ? 14.919  22.547  56.719 1.00 65.68  ? 108 LEU C CA    1 
ATOM   5985  C C     . LEU G 3 114 ? 14.690  23.691  57.713 1.00 68.59  ? 108 LEU C C     1 
ATOM   5986  O O     . LEU G 3 114 ? 13.585  24.227  57.795 1.00 68.89  ? 108 LEU C O     1 
ATOM   5987  C CB    . LEU G 3 114 ? 15.351  23.140  55.374 1.00 64.33  ? 108 LEU C CB    1 
ATOM   5988  C CG    . LEU G 3 114 ? 15.916  22.207  54.309 1.00 61.71  ? 108 LEU C CG    1 
ATOM   5989  C CD1   . LEU G 3 114 ? 16.386  23.049  53.148 1.00 61.79  ? 108 LEU C CD1   1 
ATOM   5990  C CD2   . LEU G 3 114 ? 17.060  21.374  54.845 1.00 61.77  ? 108 LEU C CD2   1 
ATOM   5991  N N     . SER G 3 115 ? 15.742  24.064  58.446 1.00 71.20  ? 109 SER C N     1 
ATOM   5992  C CA    . SER G 3 115 ? 15.709  25.235  59.330 1.00 75.09  ? 109 SER C CA    1 
ATOM   5993  C C     . SER G 3 115 ? 15.652  26.531  58.531 1.00 76.04  ? 109 SER C C     1 
ATOM   5994  O O     . SER G 3 115 ? 15.895  26.534  57.316 1.00 74.06  ? 109 SER C O     1 
ATOM   5995  C CB    . SER G 3 115 ? 16.943  25.267  60.234 1.00 78.12  ? 109 SER C CB    1 
ATOM   5996  N N     . ARG G 3 116 ? 15.334  27.630  59.210 1.00 79.58  ? 110 ARG C N     1 
ATOM   5997  C CA    . ARG G 3 116 ? 15.399  28.952  58.587 1.00 81.64  ? 110 ARG C CA    1 
ATOM   5998  C C     . ARG G 3 116 ? 16.825  29.231  58.109 1.00 82.68  ? 110 ARG C C     1 
ATOM   5999  O O     . ARG G 3 116 ? 17.027  29.642  56.970 1.00 81.48  ? 110 ARG C O     1 
ATOM   6000  C CB    . ARG G 3 116 ? 14.909  30.045  59.540 1.00 86.13  ? 110 ARG C CB    1 
ATOM   6001  C CG    . ARG G 3 116 ? 14.315  31.261  58.831 1.00 87.64  ? 110 ARG C CG    1 
ATOM   6002  C CD    . ARG G 3 116 ? 13.737  32.305  59.800 1.00 92.04  ? 110 ARG C CD    1 
ATOM   6003  N NE    . ARG G 3 116 ? 12.492  32.869  59.271 1.00 92.21  ? 110 ARG C NE    1 
ATOM   6004  C CZ    . ARG G 3 116 ? 11.300  32.766  59.857 1.00 92.70  ? 110 ARG C CZ    1 
ATOM   6005  N NH1   . ARG G 3 116 ? 11.178  32.153  61.024 1.00 93.71  ? 110 ARG C NH1   1 
ATOM   6006  N NH2   . ARG G 3 116 ? 10.228  33.300  59.285 1.00 92.58  ? 110 ARG C NH2   1 
ATOM   6007  N N     . GLN G 3 117 ? 17.803  28.964  58.976 1.00 85.13  ? 111 GLN C N     1 
ATOM   6008  C CA    . GLN G 3 117 ? 19.221  29.113  58.644 1.00 87.01  ? 111 GLN C CA    1 
ATOM   6009  C C     . GLN G 3 117 ? 19.659  28.168  57.528 1.00 83.45  ? 111 GLN C C     1 
ATOM   6010  O O     . GLN G 3 117 ? 20.458  28.549  56.669 1.00 84.20  ? 111 GLN C O     1 
ATOM   6011  C CB    . GLN G 3 117 ? 20.099  28.900  59.880 1.00 90.22  ? 111 GLN C CB    1 
ATOM   6012  N N     . GLU G 3 118 ? 19.134  26.943  57.548 1.00 80.36  ? 112 GLU C N     1 
ATOM   6013  C CA    . GLU G 3 118 ? 19.465  25.934  56.548 1.00 77.16  ? 112 GLU C CA    1 
ATOM   6014  C C     . GLU G 3 118 ? 18.923  26.331  55.173 1.00 74.64  ? 112 GLU C C     1 
ATOM   6015  O O     . GLU G 3 118 ? 19.629  26.211  54.164 1.00 73.89  ? 112 GLU C O     1 
ATOM   6016  C CB    . GLU G 3 118 ? 18.952  24.553  56.983 1.00 75.07  ? 112 GLU C CB    1 
ATOM   6017  N N     . ALA G 3 119 ? 17.682  26.820  55.149 1.00 73.64  ? 113 ALA C N     1 
ATOM   6018  C CA    . ALA G 3 119 ? 17.048  27.304  53.925 1.00 71.92  ? 113 ALA C CA    1 
ATOM   6019  C C     . ALA G 3 119 ? 17.802  28.501  53.362 1.00 74.48  ? 113 ALA C C     1 
ATOM   6020  O O     . ALA G 3 119 ? 18.026  28.593  52.154 1.00 73.32  ? 113 ALA C O     1 
ATOM   6021  C CB    . ALA G 3 119 ? 15.604  27.677  54.189 1.00 71.64  ? 113 ALA C CB    1 
ATOM   6022  N N     . SER G 3 120 ? 18.195  29.415  54.248 1.00 78.31  ? 114 SER C N     1 
ATOM   6023  C CA    . SER G 3 120 ? 18.971  30.577  53.860 1.00 81.28  ? 114 SER C CA    1 
ATOM   6024  C C     . SER G 3 120 ? 20.292  30.189  53.186 1.00 81.20  ? 114 SER C C     1 
ATOM   6025  O O     . SER G 3 120 ? 20.615  30.717  52.121 1.00 81.37  ? 114 SER C O     1 
ATOM   6026  C CB    . SER G 3 120 ? 19.213  31.488  55.057 1.00 85.93  ? 114 SER C CB    1 
ATOM   6027  O OG    . SER G 3 120 ? 19.984  32.609  54.675 1.00 89.23  ? 114 SER C OG    1 
ATOM   6028  N N     . ASP G 3 121 ? 21.040  29.264  53.789 1.00 81.13  ? 115 ASP C N     1 
ATOM   6029  C CA    . ASP G 3 121 ? 22.323  28.834  53.223 1.00 81.60  ? 115 ASP C CA    1 
ATOM   6030  C C     . ASP G 3 121 ? 22.155  28.181  51.839 1.00 78.02  ? 115 ASP C C     1 
ATOM   6031  O O     . ASP G 3 121 ? 22.901  28.497  50.907 1.00 78.63  ? 115 ASP C O     1 
ATOM   6032  C CB    . ASP G 3 121 ? 23.080  27.920  54.196 1.00 82.77  ? 115 ASP C CB    1 
ATOM   6033  C CG    . ASP G 3 121 ? 23.493  28.641  55.482 1.00 87.21  ? 115 ASP C CG    1 
ATOM   6034  N N     . LEU G 3 122 ? 21.166  27.293  51.711 1.00 74.39  ? 116 LEU C N     1 
ATOM   6035  C CA    . LEU G 3 122 ? 20.868  26.637  50.438 1.00 71.12  ? 116 LEU C CA    1 
ATOM   6036  C C     . LEU G 3 122 ? 20.449  27.613  49.330 1.00 70.72  ? 116 LEU C C     1 
ATOM   6037  O O     . LEU G 3 122 ? 20.858  27.466  48.174 1.00 69.66  ? 116 LEU C O     1 
ATOM   6038  C CB    . LEU G 3 122 ? 19.775  25.582  50.617 1.00 68.08  ? 116 LEU C CB    1 
ATOM   6039  C CG    . LEU G 3 122 ? 19.310  24.939  49.310 1.00 64.45  ? 116 LEU C CG    1 
ATOM   6040  C CD1   . LEU G 3 122 ? 20.395  24.017  48.759 1.00 64.03  ? 116 LEU C CD1   1 
ATOM   6041  C CD2   . LEU G 3 122 ? 17.984  24.224  49.499 1.00 62.00  ? 116 LEU C CD2   1 
ATOM   6042  N N     . PHE G 3 123 ? 19.622  28.592  49.691 1.00 71.77  ? 117 PHE C N     1 
ATOM   6043  C CA    . PHE G 3 123 ? 19.119  29.586  48.743 1.00 71.56  ? 117 PHE C CA    1 
ATOM   6044  C C     . PHE G 3 123 ? 20.160  30.661  48.434 1.00 74.84  ? 117 PHE C C     1 
ATOM   6045  O O     . PHE G 3 123 ? 20.220  31.158  47.314 1.00 74.96  ? 117 PHE C O     1 
ATOM   6046  C CB    . PHE G 3 123 ? 17.818  30.211  49.253 1.00 71.83  ? 117 PHE C CB    1 
ATOM   6047  C CG    . PHE G 3 123 ? 16.588  29.389  48.965 1.00 67.81  ? 117 PHE C CG    1 
ATOM   6048  C CD1   . PHE G 3 123 ? 16.437  28.109  49.502 1.00 66.57  ? 117 PHE C CD1   1 
ATOM   6049  C CD2   . PHE G 3 123 ? 15.571  29.904  48.174 1.00 66.41  ? 117 PHE C CD2   1 
ATOM   6050  C CE1   . PHE G 3 123 ? 15.282  27.347  49.243 1.00 64.21  ? 117 PHE C CE1   1 
ATOM   6051  C CE2   . PHE G 3 123 ? 14.422  29.165  47.906 1.00 64.57  ? 117 PHE C CE2   1 
ATOM   6052  C CZ    . PHE G 3 123 ? 14.272  27.880  48.441 1.00 63.24  ? 117 PHE C CZ    1 
ATOM   6053  N N     . THR G 3 124 ? 20.987  31.003  49.416 1.00 78.10  ? 118 THR C N     1 
ATOM   6054  C CA    . THR G 3 124 ? 22.094  31.941  49.199 1.00 82.03  ? 118 THR C CA    1 
ATOM   6055  C C     . THR G 3 124 ? 23.093  31.393  48.182 1.00 81.03  ? 118 THR C C     1 
ATOM   6056  O O     . THR G 3 124 ? 23.587  32.128  47.325 1.00 82.50  ? 118 THR C O     1 
ATOM   6057  C CB    . THR G 3 124 ? 22.815  32.294  50.535 1.00 86.39  ? 118 THR C CB    1 
ATOM   6058  O OG1   . THR G 3 124 ? 21.980  33.162  51.311 1.00 89.02  ? 118 THR C OG1   1 
ATOM   6059  C CG2   . THR G 3 124 ? 24.162  32.992  50.294 1.00 90.98  ? 118 THR C CG2   1 
ATOM   6060  N N     . ASP G 3 125 ? 23.372  30.095  48.284 1.00 78.92  ? 119 ASP C N     1 
ATOM   6061  C CA    . ASP G 3 125 ? 24.347  29.437  47.423 1.00 78.71  ? 119 ASP C CA    1 
ATOM   6062  C C     . ASP G 3 125 ? 23.838  29.285  45.988 1.00 75.80  ? 119 ASP C C     1 
ATOM   6063  O O     . ASP G 3 125 ? 24.632  29.294  45.039 1.00 76.76  ? 119 ASP C O     1 
ATOM   6064  C CB    . ASP G 3 125 ? 24.739  28.073  47.990 1.00 77.74  ? 119 ASP C CB    1 
ATOM   6065  C CG    . ASP G 3 125 ? 25.791  27.381  47.147 1.00 78.56  ? 119 ASP C CG    1 
ATOM   6066  O OD1   . ASP G 3 125 ? 25.415  26.524  46.322 1.00 76.21  ? 119 ASP C OD1   1 
ATOM   6067  O OD2   . ASP G 3 125 ? 26.986  27.717  47.285 1.00 82.33  ? 119 ASP C OD2   1 
ATOM   6068  N N     . GLN G 3 126 ? 22.524  29.134  45.838 1.00 72.55  ? 120 GLN C N     1 
ATOM   6069  C CA    . GLN G 3 126 ? 21.914  29.045  44.523 1.00 70.13  ? 120 GLN C CA    1 
ATOM   6070  C C     . GLN G 3 126 ? 21.970  30.422  43.872 1.00 72.15  ? 120 GLN C C     1 
ATOM   6071  O O     . GLN G 3 126 ? 22.245  30.539  42.679 1.00 71.93  ? 120 GLN C O     1 
ATOM   6072  C CB    . GLN G 3 126 ? 20.475  28.515  44.628 1.00 67.19  ? 120 GLN C CB    1 
ATOM   6073  C CG    . GLN G 3 126 ? 19.781  28.182  43.292 1.00 64.53  ? 120 GLN C CG    1 
ATOM   6074  C CD    . GLN G 3 126 ? 20.251  26.887  42.618 1.00 63.90  ? 120 GLN C CD    1 
ATOM   6075  O OE1   . GLN G 3 126 ? 19.936  26.657  41.444 1.00 63.20  ? 120 GLN C OE1   1 
ATOM   6076  N NE2   . GLN G 3 126 ? 20.982  26.038  43.348 1.00 63.24  ? 120 GLN C NE2   1 
ATOM   6077  N N     . LEU G 3 127 ? 21.752  31.459  44.676 1.00 74.42  ? 121 LEU C N     1 
ATOM   6078  C CA    . LEU G 3 127 ? 21.858  32.839  44.214 1.00 77.18  ? 121 LEU C CA    1 
ATOM   6079  C C     . LEU G 3 127 ? 23.227  33.177  43.594 1.00 79.96  ? 121 LEU C C     1 
ATOM   6080  O O     . LEU G 3 127 ? 23.286  33.675  42.469 1.00 80.06  ? 121 LEU C O     1 
ATOM   6081  C CB    . LEU G 3 127 ? 21.509  33.810  45.350 1.00 80.12  ? 121 LEU C CB    1 
ATOM   6082  C CG    . LEU G 3 127 ? 21.252  35.268  44.962 1.00 82.82  ? 121 LEU C CG    1 
ATOM   6083  C CD1   . LEU G 3 127 ? 20.097  35.388  43.973 1.00 79.66  ? 121 LEU C CD1   1 
ATOM   6084  C CD2   . LEU G 3 127 ? 20.988  36.111  46.196 1.00 85.99  ? 121 LEU C CD2   1 
ATOM   6085  N N     . LEU G 3 128 ? 24.313  32.902  44.321 1.00 82.46  ? 122 LEU C N     1 
ATOM   6086  C CA    . LEU G 3 128 ? 25.677  33.184  43.838 1.00 85.63  ? 122 LEU C CA    1 
ATOM   6087  C C     . LEU G 3 128 ? 26.013  32.445  42.542 1.00 83.43  ? 122 LEU C C     1 
ATOM   6088  O O     . LEU G 3 128 ? 26.587  33.032  41.614 1.00 85.11  ? 122 LEU C O     1 
ATOM   6089  C CB    . LEU G 3 128 ? 26.724  32.842  44.903 1.00 88.46  ? 122 LEU C CB    1 
ATOM   6090  C CG    . LEU G 3 128 ? 26.956  33.834  46.044 1.00 93.26  ? 122 LEU C CG    1 
ATOM   6091  C CD1   . LEU G 3 128 ? 28.025  33.300  46.978 1.00 95.28  ? 122 LEU C CD1   1 
ATOM   6092  C CD2   . LEU G 3 128 ? 27.341  35.230  45.529 1.00 98.32  ? 122 LEU C CD2   1 
ATOM   6093  N N     . LYS G 3 129 ? 25.651  31.159  42.494 1.00 79.62  ? 123 LYS C N     1 
ATOM   6094  C CA    . LYS G 3 129 ? 25.924  30.313  41.336 1.00 77.56  ? 123 LYS C CA    1 
ATOM   6095  C C     . LYS G 3 129 ? 25.226  30.840  40.075 1.00 75.82  ? 123 LYS C C     1 
ATOM   6096  O O     . LYS G 3 129 ? 25.817  30.856  38.991 1.00 76.10  ? 123 LYS C O     1 
ATOM   6097  C CB    . LYS G 3 129 ? 25.529  28.862  41.626 1.00 74.36  ? 123 LYS C CB    1 
ATOM   6098  C CG    . LYS G 3 129 ? 26.538  28.095  42.464 1.00 76.31  ? 123 LYS C CG    1 
ATOM   6099  N N     . ARG G 3 130 ? 23.980  31.282  40.249 1.00 73.97  ? 124 ARG C N     1 
ATOM   6100  C CA    . ARG G 3 130 ? 23.168  31.854  39.182 1.00 72.90  ? 124 ARG C CA    1 
ATOM   6101  C C     . ARG G 3 130 ? 23.707  33.206  38.717 1.00 76.90  ? 124 ARG C C     1 
ATOM   6102  O O     . ARG G 3 130 ? 23.771  33.477  37.511 1.00 77.05  ? 124 ARG C O     1 
ATOM   6103  C CB    . ARG G 3 130 ? 21.723  32.007  39.647 1.00 70.74  ? 124 ARG C CB    1 
ATOM   6104  C CG    . ARG G 3 130 ? 21.015  30.686  39.962 1.00 67.74  ? 124 ARG C CG    1 
ATOM   6105  C CD    . ARG G 3 130 ? 20.325  30.117  38.753 1.00 65.21  ? 124 ARG C CD    1 
ATOM   6106  N NE    . ARG G 3 130 ? 20.174  28.669  38.844 1.00 63.56  ? 124 ARG C NE    1 
ATOM   6107  C CZ    . ARG G 3 130 ? 19.750  27.893  37.846 1.00 61.35  ? 124 ARG C CZ    1 
ATOM   6108  N NH1   . ARG G 3 130 ? 19.436  28.417  36.671 1.00 60.84  ? 124 ARG C NH1   1 
ATOM   6109  N NH2   . ARG G 3 130 ? 19.646  26.584  38.021 1.00 59.64  ? 124 ARG C NH2   1 
ATOM   6110  N N     . LYS G 3 131 ? 24.092  34.052  39.674 1.00 80.46  ? 125 LYS C N     1 
ATOM   6111  C CA    . LYS G 3 131 ? 24.658  35.355  39.357 1.00 84.72  ? 125 LYS C CA    1 
ATOM   6112  C C     . LYS G 3 131 ? 25.959  35.212  38.571 1.00 86.70  ? 125 LYS C C     1 
ATOM   6113  O O     . LYS G 3 131 ? 26.240  36.026  37.691 1.00 88.94  ? 125 LYS C O     1 
ATOM   6114  C CB    . LYS G 3 131 ? 24.888  36.184  40.625 1.00 88.81  ? 125 LYS C CB    1 
ATOM   6115  C CG    . LYS G 3 131 ? 23.632  36.806  41.240 1.00 88.85  ? 125 LYS C CG    1 
ATOM   6116  C CD    . LYS G 3 131 ? 24.003  37.692  42.442 1.00 94.10  ? 125 LYS C CD    1 
ATOM   6117  C CE    . LYS G 3 131 ? 22.771  38.294  43.112 1.00 94.70  ? 125 LYS C CE    1 
ATOM   6118  N NZ    . LYS G 3 131 ? 23.108  39.224  44.232 1.00 100.45 ? 125 LYS C NZ    1 
ATOM   6119  N N     . ALA G 3 132 ? 26.745  34.182  38.888 1.00 86.28  ? 126 ALA C N     1 
ATOM   6120  C CA    . ALA G 3 132 ? 27.985  33.903  38.159 1.00 88.46  ? 126 ALA C CA    1 
ATOM   6121  C C     . ALA G 3 132 ? 27.675  33.486  36.719 1.00 85.97  ? 126 ALA C C     1 
ATOM   6122  O O     . ALA G 3 132 ? 28.311  33.971  35.769 1.00 88.32  ? 126 ALA C O     1 
ATOM   6123  C CB    . ALA G 3 132 ? 28.812  32.841  38.873 1.00 88.72  ? 126 ALA C CB    1 
ATOM   6124  N N     . LYS G 3 133 ? 26.681  32.607  36.570 1.00 81.45  ? 127 LYS C N     1 
ATOM   6125  C CA    . LYS G 3 133 ? 26.168  32.204  35.258 1.00 78.77  ? 127 LYS C CA    1 
ATOM   6126  C C     . LYS G 3 133 ? 25.593  33.395  34.494 1.00 79.37  ? 127 LYS C C     1 
ATOM   6127  O O     . LYS G 3 133 ? 25.777  33.500  33.280 1.00 79.85  ? 127 LYS C O     1 
ATOM   6128  C CB    . LYS G 3 133 ? 25.117  31.096  35.392 1.00 74.29  ? 127 LYS C CB    1 
ATOM   6129  N N     . LEU G 3 134 ? 24.911  34.293  35.204 1.00 79.79  ? 128 LEU C N     1 
ATOM   6130  C CA    . LEU G 3 134 ? 24.359  35.496  34.587 1.00 81.12  ? 128 LEU C CA    1 
ATOM   6131  C C     . LEU G 3 134 ? 25.452  36.421  34.038 1.00 85.74  ? 128 LEU C C     1 
ATOM   6132  O O     . LEU G 3 134 ? 25.293  37.002  32.962 1.00 86.49  ? 128 LEU C O     1 
ATOM   6133  C CB    . LEU G 3 134 ? 23.447  36.250  35.563 1.00 81.53  ? 128 LEU C CB    1 
ATOM   6134  C CG    . LEU G 3 134 ? 22.901  37.628  35.157 1.00 83.65  ? 128 LEU C CG    1 
ATOM   6135  C CD1   . LEU G 3 134 ? 22.112  37.587  33.861 1.00 81.16  ? 128 LEU C CD1   1 
ATOM   6136  C CD2   . LEU G 3 134 ? 22.040  38.192  36.263 1.00 84.54  ? 128 LEU C CD2   1 
ATOM   6137  N N     . SER G 3 135 ? 26.556  36.543  34.772 1.00 89.18  ? 129 SER C N     1 
ATOM   6138  C CA    . SER G 3 135 ? 27.663  37.422  34.376 1.00 94.27  ? 129 SER C CA    1 
ATOM   6139  C C     . SER G 3 135 ? 28.426  36.869  33.170 1.00 94.40  ? 129 SER C C     1 
ATOM   6140  O O     . SER G 3 135 ? 28.936  37.636  32.348 1.00 97.52  ? 129 SER C O     1 
ATOM   6141  C CB    . SER G 3 135 ? 28.614  37.660  35.551 1.00 98.06  ? 129 SER C CB    1 
ATOM   6142  O OG    . SER G 3 135 ? 29.766  38.368  35.138 1.00 102.92 ? 129 SER C OG    1 
ATOM   6143  N N     . ASP G 3 136 ? 28.504  35.542  33.081 1.00 91.41  ? 130 ASP C N     1 
ATOM   6144  C CA    . ASP G 3 136 ? 29.100  34.870  31.931 1.00 91.43  ? 130 ASP C CA    1 
ATOM   6145  C C     . ASP G 3 136 ? 28.253  35.112  30.681 1.00 89.44  ? 130 ASP C C     1 
ATOM   6146  O O     . ASP G 3 136 ? 28.777  35.478  29.626 1.00 91.43  ? 130 ASP C O     1 
ATOM   6147  C CB    . ASP G 3 136 ? 29.248  33.367  32.197 1.00 88.80  ? 130 ASP C CB    1 
ATOM   6148  N N     . LEU G 3 137 ? 26.942  34.922  30.817 1.00 85.72  ? 131 LEU C N     1 
ATOM   6149  C CA    . LEU G 3 137 ? 26.007  35.144  29.721 1.00 83.94  ? 131 LEU C CA    1 
ATOM   6150  C C     . LEU G 3 137 ? 25.933  36.603  29.298 1.00 87.28  ? 131 LEU C C     1 
ATOM   6151  O O     . LEU G 3 137 ? 25.891  36.904  28.099 1.00 88.09  ? 131 LEU C O     1 
ATOM   6152  C CB    . LEU G 3 137 ? 24.611  34.638  30.081 1.00 79.65  ? 131 LEU C CB    1 
ATOM   6153  C CG    . LEU G 3 137 ? 24.411  33.129  30.209 1.00 76.16  ? 131 LEU C CG    1 
ATOM   6154  C CD1   . LEU G 3 137 ? 22.973  32.856  30.565 1.00 72.29  ? 131 LEU C CD1   1 
ATOM   6155  C CD2   . LEU G 3 137 ? 24.791  32.400  28.931 1.00 76.16  ? 131 LEU C CD2   1 
ATOM   6156  N N     . GLN G 3 138 ? 25.914  37.511  30.269 1.00 89.77  ? 132 GLN C N     1 
ATOM   6157  C CA    . GLN G 3 138 ? 25.851  38.932  29.948 1.00 93.66  ? 132 GLN C CA    1 
ATOM   6158  C C     . GLN G 3 138 ? 27.128  39.390  29.238 1.00 97.86  ? 132 GLN C C     1 
ATOM   6159  O O     . GLN G 3 138 ? 27.064  40.186  28.304 1.00 99.80  ? 132 GLN C O     1 
ATOM   6160  C CB    . GLN G 3 138 ? 25.565  39.769  31.198 1.00 95.99  ? 132 GLN C CB    1 
ATOM   6161  C CG    . GLN G 3 138 ? 25.300  41.250  30.908 1.00 100.88 ? 132 GLN C CG    1 
ATOM   6162  C CD    . GLN G 3 138 ? 24.178  41.831  31.755 1.00 101.93 ? 132 GLN C CD    1 
ATOM   6163  O OE1   . GLN G 3 138 ? 23.837  41.304  32.826 1.00 99.70  ? 132 GLN C OE1   1 
ATOM   6164  N NE2   . GLN G 3 138 ? 23.592  42.926  31.273 1.00 104.12 ? 132 GLN C NE2   1 
ATOM   6165  N N     . GLY G 3 139 ? 28.273  38.871  29.681 1.00 99.59  ? 133 GLY C N     1 
ATOM   6166  C CA    . GLY G 3 139 ? 29.562  39.138  29.046 1.00 103.91 ? 133 GLY C CA    1 
ATOM   6167  C C     . GLY G 3 139 ? 29.576  38.627  27.619 1.00 102.46 ? 133 GLY C C     1 
ATOM   6168  O O     . GLY G 3 139 ? 30.033  39.319  26.700 1.00 105.94 ? 133 GLY C O     1 
ATOM   6169  N N     . SER G 3 140 ? 29.051  37.418  27.443 1.00 97.78  ? 134 SER C N     1 
ATOM   6170  C CA    . SER G 3 140 ? 28.893  36.788  26.135 1.00 95.97  ? 134 SER C CA    1 
ATOM   6171  C C     . SER G 3 140 ? 27.947  37.587  25.235 1.00 95.32  ? 134 SER C C     1 
ATOM   6172  O O     . SER G 3 140 ? 28.099  37.584  24.011 1.00 95.95  ? 134 SER C O     1 
ATOM   6173  C CB    . SER G 3 140 ? 28.362  35.363  26.316 1.00 91.41  ? 134 SER C CB    1 
ATOM   6174  O OG    . SER G 3 140 ? 28.833  34.494  25.306 1.00 91.57  ? 134 SER C OG    1 
ATOM   6175  N N     . TYR G 3 141 ? 26.976  38.261  25.854 1.00 94.34  ? 135 TYR C N     1 
ATOM   6176  C CA    . TYR G 3 141 ? 26.013  39.113  25.147 1.00 94.26  ? 135 TYR C CA    1 
ATOM   6177  C C     . TYR G 3 141 ? 26.648  40.409  24.625 1.00 99.59  ? 135 TYR C C     1 
ATOM   6178  O O     . TYR G 3 141 ? 26.402  40.818  23.485 1.00 100.42 ? 135 TYR C O     1 
ATOM   6179  C CB    . TYR G 3 141 ? 24.816  39.433  26.056 1.00 92.12  ? 135 TYR C CB    1 
ATOM   6180  C CG    . TYR G 3 141 ? 23.829  40.413  25.463 1.00 92.81  ? 135 TYR C CG    1 
ATOM   6181  C CD1   . TYR G 3 141 ? 22.891  40.003  24.517 1.00 89.75  ? 135 TYR C CD1   1 
ATOM   6182  C CD2   . TYR G 3 141 ? 23.835  41.755  25.845 1.00 97.16  ? 135 TYR C CD2   1 
ATOM   6183  C CE1   . TYR G 3 141 ? 21.986  40.904  23.964 1.00 90.99  ? 135 TYR C CE1   1 
ATOM   6184  C CE2   . TYR G 3 141 ? 22.935  42.664  25.298 1.00 98.40  ? 135 TYR C CE2   1 
ATOM   6185  C CZ    . TYR G 3 141 ? 22.012  42.229  24.361 1.00 95.38  ? 135 TYR C CZ    1 
ATOM   6186  O OH    . TYR G 3 141 ? 21.120  43.124  23.812 1.00 97.68  ? 135 TYR C OH    1 
ATOM   6187  N N     . GLU G 3 142 ? 27.454  41.051  25.465 1.00 103.54 ? 136 GLU C N     1 
ATOM   6188  C CA    . GLU G 3 142 ? 28.109  42.305  25.103 1.00 109.41 ? 136 GLU C CA    1 
ATOM   6189  C C     . GLU G 3 142 ? 29.081  42.114  23.933 1.00 111.59 ? 136 GLU C C     1 
ATOM   6190  O O     . GLU G 3 142 ? 29.329  43.046  23.161 1.00 115.21 ? 136 GLU C O     1 
ATOM   6191  C CB    . GLU G 3 142 ? 28.814  42.913  26.324 1.00 113.45 ? 136 GLU C CB    1 
ATOM   6192  C CG    . GLU G 3 142 ? 27.871  43.641  27.287 1.00 113.81 ? 136 GLU C CG    1 
ATOM   6193  C CD    . GLU G 3 142 ? 28.304  43.549  28.749 1.00 115.97 ? 136 GLU C CD    1 
ATOM   6194  O OE1   . GLU G 3 142 ? 29.500  43.743  29.053 1.00 120.40 ? 136 GLU C OE1   1 
ATOM   6195  O OE2   . GLU G 3 142 ? 27.437  43.287  29.606 1.00 113.84 ? 136 GLU C OE2   1 
ATOM   6196  N N     . LYS G 3 143 ? 29.609  40.894  23.811 1.00 109.58 ? 137 LYS C N     1 
ATOM   6197  C CA    . LYS G 3 143 ? 30.531  40.529  22.737 1.00 111.57 ? 137 LYS C CA    1 
ATOM   6198  C C     . LYS G 3 143 ? 29.800  40.259  21.433 1.00 109.09 ? 137 LYS C C     1 
ATOM   6199  O O     . LYS G 3 143 ? 30.335  40.529  20.360 1.00 112.02 ? 137 LYS C O     1 
ATOM   6200  C CB    . LYS G 3 143 ? 31.369  39.307  23.123 1.00 110.82 ? 137 LYS C CB    1 
ATOM   6201  N N     . LEU G 3 144 ? 28.588  39.716  21.522 1.00 104.32 ? 138 LEU C N     1 
ATOM   6202  C CA    . LEU G 3 144 ? 27.777  39.485  20.327 1.00 102.18 ? 138 LEU C CA    1 
ATOM   6203  C C     . LEU G 3 144 ? 27.199  40.793  19.795 1.00 104.44 ? 138 LEU C C     1 
ATOM   6204  O O     . LEU G 3 144 ? 27.050  40.958  18.583 1.00 105.15 ? 138 LEU C O     1 
ATOM   6205  C CB    . LEU G 3 144 ? 26.660  38.468  20.576 1.00 96.67  ? 138 LEU C CB    1 
ATOM   6206  C CG    . LEU G 3 144 ? 25.825  38.128  19.332 1.00 94.50  ? 138 LEU C CG    1 
ATOM   6207  C CD1   . LEU G 3 144 ? 26.659  37.433  18.254 1.00 95.44  ? 138 LEU C CD1   1 
ATOM   6208  C CD2   . LEU G 3 144 ? 24.606  37.296  19.686 1.00 90.19  ? 138 LEU C CD2   1 
ATOM   6209  N N     . MET G 3 145 ? 26.883  41.714  20.702 1.00 105.95 ? 139 MET C N     1 
ATOM   6210  C CA    . MET G 3 145 ? 26.413  43.035  20.321 1.00 109.14 ? 139 MET C CA    1 
ATOM   6211  C C     . MET G 3 145 ? 27.566  43.848  19.695 1.00 115.11 ? 139 MET C C     1 
ATOM   6212  O O     . MET G 3 145 ? 28.039  44.839  20.266 1.00 119.49 ? 139 MET C O     1 
ATOM   6213  C CB    . MET G 3 145 ? 25.794  43.743  21.529 1.00 109.52 ? 139 MET C CB    1 
ATOM   6214  N N     . ALA G 3 146 ? 28.007  43.403  18.514 1.00 115.50 ? 140 ALA C N     1 
ATOM   6215  C CA    . ALA G 3 146 ? 29.156  43.969  17.807 1.00 120.96 ? 140 ALA C CA    1 
ATOM   6216  C C     . ALA G 3 146 ? 29.217  43.455  16.367 1.00 120.38 ? 140 ALA C C     1 
ATOM   6217  O O     . ALA G 3 146 ? 29.338  42.250  16.129 1.00 117.51 ? 140 ALA C O     1 
ATOM   6218  C CB    . ALA G 3 146 ? 30.459  43.653  18.549 1.00 123.48 ? 140 ALA C CB    1 
ATOM   6219  N N     . PRO G 3 150 ? 23.681  47.187  15.114 1.00 119.25 ? 144 PRO C N     1 
ATOM   6220  C CA    . PRO G 3 150 ? 22.239  46.995  15.249 1.00 115.77 ? 144 PRO C CA    1 
ATOM   6221  C C     . PRO G 3 150 ? 21.828  45.525  15.100 1.00 110.07 ? 144 PRO C C     1 
ATOM   6222  O O     . PRO G 3 150 ? 22.580  44.727  14.533 1.00 109.53 ? 144 PRO C O     1 
ATOM   6223  C CB    . PRO G 3 150 ? 21.675  47.837  14.103 1.00 118.45 ? 144 PRO C CB    1 
ATOM   6224  C CG    . PRO G 3 150 ? 22.661  48.938  13.951 1.00 124.34 ? 144 PRO C CG    1 
ATOM   6225  C CD    . PRO G 3 150 ? 24.007  48.329  14.239 1.00 124.54 ? 144 PRO C CD    1 
ATOM   6226  N N     . MET G 3 151 ? 20.645  45.184  15.616 1.00 106.38 ? 145 MET C N     1 
ATOM   6227  C CA    . MET G 3 151 ? 20.121  43.812  15.595 1.00 100.68 ? 145 MET C CA    1 
ATOM   6228  C C     . MET G 3 151 ? 18.668  43.778  15.113 1.00 98.88  ? 145 MET C C     1 
ATOM   6229  O O     . MET G 3 151 ? 17.823  44.528  15.609 1.00 99.93  ? 145 MET C O     1 
ATOM   6230  C CB    . MET G 3 151 ? 20.231  43.189  16.993 1.00 98.06  ? 145 MET C CB    1 
ATOM   6231  C CG    . MET G 3 151 ? 19.547  41.821  17.176 1.00 92.38  ? 145 MET C CG    1 
ATOM   6232  S SD    . MET G 3 151 ? 20.079  40.540  16.023 1.00 88.76  ? 145 MET C SD    1 
ATOM   6233  C CE    . MET G 3 151 ? 21.834  40.438  16.392 1.00 90.75  ? 145 MET C CE    1 
ATOM   6234  N N     . SER G 3 152 ? 18.384  42.903  14.150 1.00 96.38  ? 146 SER C N     1 
ATOM   6235  C CA    . SER G 3 152 ? 17.041  42.786  13.575 1.00 94.89  ? 146 SER C CA    1 
ATOM   6236  C C     . SER G 3 152 ? 16.774  41.379  13.045 1.00 91.27  ? 146 SER C C     1 
ATOM   6237  O O     . SER G 3 152 ? 17.704  40.591  12.853 1.00 90.28  ? 146 SER C O     1 
ATOM   6238  C CB    . SER G 3 152 ? 16.849  43.804  12.447 1.00 98.54  ? 146 SER C CB    1 
ATOM   6239  O OG    . SER G 3 152 ? 17.566  43.415  11.290 1.00 98.98  ? 146 SER C OG    1 
ATOM   6240  N N     . PHE G 3 153 ? 15.500  41.078  12.799 1.00 89.60  ? 147 PHE C N     1 
ATOM   6241  C CA    . PHE G 3 153 ? 15.106  39.802  12.213 1.00 86.78  ? 147 PHE C CA    1 
ATOM   6242  C C     . PHE G 3 153 ? 15.964  39.494  10.989 1.00 88.21  ? 147 PHE C C     1 
ATOM   6243  O O     . PHE G 3 153 ? 16.379  38.352  10.794 1.00 86.70  ? 147 PHE C O     1 
ATOM   6244  C CB    . PHE G 3 153 ? 13.618  39.809  11.833 1.00 86.40  ? 147 PHE C CB    1 
ATOM   6245  C CG    . PHE G 3 153 ? 13.169  38.571  11.095 1.00 84.19  ? 147 PHE C CG    1 
ATOM   6246  C CD1   . PHE G 3 153 ? 13.227  38.509  9.706  1.00 85.73  ? 147 PHE C CD1   1 
ATOM   6247  C CD2   . PHE G 3 153 ? 12.692  37.468  11.788 1.00 80.71  ? 147 PHE C CD2   1 
ATOM   6248  C CE1   . PHE G 3 153 ? 12.821  37.362  9.020  1.00 84.40  ? 147 PHE C CE1   1 
ATOM   6249  C CE2   . PHE G 3 153 ? 12.281  36.320  11.113 1.00 79.43  ? 147 PHE C CE2   1 
ATOM   6250  C CZ    . PHE G 3 153 ? 12.348  36.266  9.727  1.00 81.71  ? 147 PHE C CZ    1 
ATOM   6251  N N     . SER G 3 154 ? 16.231  40.525  10.185 1.00 91.56  ? 148 SER C N     1 
ATOM   6252  C CA    . SER G 3 154 ? 16.961  40.395  8.924  1.00 93.44  ? 148 SER C CA    1 
ATOM   6253  C C     . SER G 3 154 ? 18.388  39.893  9.120  1.00 93.45  ? 148 SER C C     1 
ATOM   6254  O O     . SER G 3 154 ? 18.938  39.223  8.242  1.00 94.02  ? 148 SER C O     1 
ATOM   6255  C CB    . SER G 3 154 ? 16.998  41.738  8.186  1.00 97.54  ? 148 SER C CB    1 
ATOM   6256  O OG    . SER G 3 154 ? 15.743  42.393  8.235  1.00 98.32  ? 148 SER C OG    1 
ATOM   6257  N N     . SER G 3 155 ? 18.974  40.225  10.270 1.00 93.21  ? 149 SER C N     1 
ATOM   6258  C CA    . SER G 3 155 ? 20.374  39.918  10.572 1.00 93.93  ? 149 SER C CA    1 
ATOM   6259  C C     . SER G 3 155 ? 20.690  38.418  10.561 1.00 91.20  ? 149 SER C C     1 
ATOM   6260  O O     . SER G 3 155 ? 19.888  37.603  11.034 1.00 87.83  ? 149 SER C O     1 
ATOM   6261  C CB    . SER G 3 155 ? 20.781  40.532  11.917 1.00 94.38  ? 149 SER C CB    1 
ATOM   6262  O OG    . SER G 3 155 ? 22.105  40.167  12.271 1.00 95.70  ? 149 SER C OG    1 
ATOM   6263  N N     . PRO G 3 156 ? 21.869  38.053  10.021 1.00 92.94  ? 150 PRO C N     1 
ATOM   6264  C CA    . PRO G 3 156 ? 22.294  36.655  9.980  1.00 91.31  ? 150 PRO C CA    1 
ATOM   6265  C C     . PRO G 3 156 ? 22.539  36.068  11.371 1.00 88.62  ? 150 PRO C C     1 
ATOM   6266  O O     . PRO G 3 156 ? 22.576  34.852  11.519 1.00 86.62  ? 150 PRO C O     1 
ATOM   6267  C CB    . PRO G 3 156 ? 23.610  36.707  9.187  1.00 95.03  ? 150 PRO C CB    1 
ATOM   6268  C CG    . PRO G 3 156 ? 23.566  37.997  8.439  1.00 98.28  ? 150 PRO C CG    1 
ATOM   6269  C CD    . PRO G 3 156 ? 22.835  38.935  9.340  1.00 97.31  ? 150 PRO C CD    1 
ATOM   6270  N N     . ASP G 3 157 ? 22.704  36.934  12.367 1.00 88.89  ? 151 ASP C N     1 
ATOM   6271  C CA    . ASP G 3 157 ? 22.969  36.516  13.742 1.00 87.12  ? 151 ASP C CA    1 
ATOM   6272  C C     . ASP G 3 157 ? 21.755  36.709  14.657 1.00 83.99  ? 151 ASP C C     1 
ATOM   6273  O O     . ASP G 3 157 ? 21.897  36.986  15.850 1.00 83.43  ? 151 ASP C O     1 
ATOM   6274  C CB    . ASP G 3 157 ? 24.184  37.267  14.298 1.00 90.45  ? 151 ASP C CB    1 
ATOM   6275  C CG    . ASP G 3 157 ? 25.507  36.722  13.775 1.00 94.09  ? 151 ASP C CG    1 
ATOM   6276  O OD1   . ASP G 3 157 ? 25.567  36.261  12.616 1.00 96.53  ? 151 ASP C OD1   1 
ATOM   6277  O OD2   . ASP G 3 157 ? 26.502  36.763  14.526 1.00 97.44  ? 151 ASP C OD2   1 
ATOM   6278  N N     . PHE G 3 158 ? 20.562  36.560  14.089 1.00 82.17  ? 152 PHE C N     1 
ATOM   6279  C CA    . PHE G 3 158 ? 19.324  36.734  14.843 1.00 79.47  ? 152 PHE C CA    1 
ATOM   6280  C C     . PHE G 3 158 ? 19.044  35.497  15.691 1.00 76.01  ? 152 PHE C C     1 
ATOM   6281  O O     . PHE G 3 158 ? 18.571  35.616  16.822 1.00 74.19  ? 152 PHE C O     1 
ATOM   6282  C CB    . PHE G 3 158 ? 18.160  37.051  13.891 1.00 79.54  ? 152 PHE C CB    1 
ATOM   6283  C CG    . PHE G 3 158 ? 16.870  37.407  14.583 1.00 77.68  ? 152 PHE C CG    1 
ATOM   6284  C CD1   . PHE G 3 158 ? 16.806  38.474  15.473 1.00 78.63  ? 152 PHE C CD1   1 
ATOM   6285  C CD2   . PHE G 3 158 ? 15.706  36.689  14.315 1.00 75.53  ? 152 PHE C CD2   1 
ATOM   6286  C CE1   . PHE G 3 158 ? 15.606  38.804  16.105 1.00 77.85  ? 152 PHE C CE1   1 
ATOM   6287  C CE2   . PHE G 3 158 ? 14.503  37.013  14.937 1.00 74.45  ? 152 PHE C CE2   1 
ATOM   6288  C CZ    . PHE G 3 158 ? 14.453  38.072  15.835 1.00 75.62  ? 152 PHE C CZ    1 
ATOM   6289  N N     . GLY G 3 159 ? 19.354  34.320  15.145 1.00 75.11  ? 153 GLY C N     1 
ATOM   6290  C CA    . GLY G 3 159 ? 19.194  33.051  15.874 1.00 72.57  ? 153 GLY C CA    1 
ATOM   6291  C C     . GLY G 3 159 ? 20.049  33.010  17.127 1.00 72.30  ? 153 GLY C C     1 
ATOM   6292  O O     . GLY G 3 159 ? 19.569  32.683  18.219 1.00 69.94  ? 153 GLY C O     1 
ATOM   6293  N N     . HIS G 3 160 ? 21.320  33.361  16.948 1.00 74.94  ? 154 HIS C N     1 
ATOM   6294  C CA    . HIS G 3 160 ? 22.287  33.525  18.025 1.00 75.72  ? 154 HIS C CA    1 
ATOM   6295  C C     . HIS G 3 160 ? 21.750  34.460  19.118 1.00 74.88  ? 154 HIS C C     1 
ATOM   6296  O O     . HIS G 3 160 ? 21.831  34.146  20.312 1.00 73.62  ? 154 HIS C O     1 
ATOM   6297  C CB    . HIS G 3 160 ? 23.583  34.085  17.439 1.00 79.71  ? 154 HIS C CB    1 
ATOM   6298  C CG    . HIS G 3 160 ? 24.811  33.767  18.238 1.00 82.04  ? 154 HIS C CG    1 
ATOM   6299  N ND1   . HIS G 3 160 ? 26.026  33.494  17.647 1.00 85.89  ? 154 HIS C ND1   1 
ATOM   6300  C CD2   . HIS G 3 160 ? 25.017  33.688  19.575 1.00 81.97  ? 154 HIS C CD2   1 
ATOM   6301  C CE1   . HIS G 3 160 ? 26.929  33.268  18.585 1.00 86.91  ? 154 HIS C CE1   1 
ATOM   6302  N NE2   . HIS G 3 160 ? 26.341  33.375  19.763 1.00 84.96  ? 154 HIS C NE2   1 
ATOM   6303  N N     . TYR G 3 161 ? 21.192  35.594  18.692 1.00 75.71  ? 155 TYR C N     1 
ATOM   6304  C CA    . TYR G 3 161 ? 20.592  36.595  19.576 1.00 75.61  ? 155 TYR C CA    1 
ATOM   6305  C C     . TYR G 3 161 ? 19.369  36.073  20.317 1.00 72.21  ? 155 TYR C C     1 
ATOM   6306  O O     . TYR G 3 161 ? 19.115  36.468  21.449 1.00 71.94  ? 155 TYR C O     1 
ATOM   6307  C CB    . TYR G 3 161 ? 20.235  37.850  18.768 1.00 78.18  ? 155 TYR C CB    1 
ATOM   6308  C CG    . TYR G 3 161 ? 19.440  38.922  19.493 1.00 78.52  ? 155 TYR C CG    1 
ATOM   6309  C CD1   . TYR G 3 161 ? 20.085  39.939  20.190 1.00 81.88  ? 155 TYR C CD1   1 
ATOM   6310  C CD2   . TYR G 3 161 ? 18.042  38.937  19.449 1.00 76.38  ? 155 TYR C CD2   1 
ATOM   6311  C CE1   . TYR G 3 161 ? 19.362  40.948  20.837 1.00 83.57  ? 155 TYR C CE1   1 
ATOM   6312  C CE2   . TYR G 3 161 ? 17.308  39.930  20.100 1.00 78.24  ? 155 TYR C CE2   1 
ATOM   6313  C CZ    . TYR G 3 161 ? 17.976  40.939  20.787 1.00 82.02  ? 155 TYR C CZ    1 
ATOM   6314  O OH    . TYR G 3 161 ? 17.271  41.938  21.426 1.00 83.46  ? 155 TYR C OH    1 
ATOM   6315  N N     . LEU G 3 162 ? 18.607  35.192  19.684 1.00 70.10  ? 156 LEU C N     1 
ATOM   6316  C CA    . LEU G 3 162 ? 17.461  34.586  20.356 1.00 67.63  ? 156 LEU C CA    1 
ATOM   6317  C C     . LEU G 3 162 ? 17.887  33.687  21.521 1.00 66.00  ? 156 LEU C C     1 
ATOM   6318  O O     . LEU G 3 162 ? 17.393  33.837  22.645 1.00 65.12  ? 156 LEU C O     1 
ATOM   6319  C CB    . LEU G 3 162 ? 16.564  33.838  19.362 1.00 66.29  ? 156 LEU C CB    1 
ATOM   6320  C CG    . LEU G 3 162 ? 15.921  34.768  18.320 1.00 68.34  ? 156 LEU C CG    1 
ATOM   6321  C CD1   . LEU G 3 162 ? 15.103  34.010  17.276 1.00 67.14  ? 156 LEU C CD1   1 
ATOM   6322  C CD2   . LEU G 3 162 ? 15.090  35.849  19.003 1.00 68.32  ? 156 LEU C CD2   1 
ATOM   6323  N N     . VAL G 3 163 ? 18.827  32.780  21.268 1.00 66.19  ? 157 VAL C N     1 
ATOM   6324  C CA    . VAL G 3 163 ? 19.270  31.847  22.312 1.00 64.92  ? 157 VAL C CA    1 
ATOM   6325  C C     . VAL G 3 163 ? 20.017  32.532  23.456 1.00 66.34  ? 157 VAL C C     1 
ATOM   6326  O O     . VAL G 3 163 ? 19.999  32.034  24.592 1.00 64.72  ? 157 VAL C O     1 
ATOM   6327  C CB    . VAL G 3 163 ? 20.095  30.645  21.760 1.00 65.06  ? 157 VAL C CB    1 
ATOM   6328  C CG1   . VAL G 3 163 ? 19.206  29.717  20.941 1.00 63.79  ? 157 VAL C CG1   1 
ATOM   6329  C CG2   . VAL G 3 163 ? 21.295  31.115  20.947 1.00 67.87  ? 157 VAL C CG2   1 
ATOM   6330  N N     . LEU G 3 164 ? 20.655  33.671  23.162 1.00 69.16  ? 158 LEU C N     1 
ATOM   6331  C CA    . LEU G 3 164 ? 21.323  34.435  24.207 1.00 71.33  ? 158 LEU C CA    1 
ATOM   6332  C C     . LEU G 3 164 ? 20.342  35.237  25.035 1.00 71.00  ? 158 LEU C C     1 
ATOM   6333  O O     . LEU G 3 164 ? 20.417  35.214  26.264 1.00 70.61  ? 158 LEU C O     1 
ATOM   6334  C CB    . LEU G 3 164 ? 22.432  35.333  23.663 1.00 75.38  ? 158 LEU C CB    1 
ATOM   6335  C CG    . LEU G 3 164 ? 23.808  34.665  23.546 1.00 77.61  ? 158 LEU C CG    1 
ATOM   6336  C CD1   . LEU G 3 164 ? 24.897  35.701  23.261 1.00 81.71  ? 158 LEU C CD1   1 
ATOM   6337  C CD2   . LEU G 3 164 ? 24.159  33.824  24.786 1.00 76.54  ? 158 LEU C CD2   1 
ATOM   6338  N N     . THR G 3 165 ? 19.415  35.925  24.370 1.00 71.29  ? 159 THR C N     1 
ATOM   6339  C CA    . THR G 3 165 ? 18.422  36.731  25.085 1.00 71.56  ? 159 THR C CA    1 
ATOM   6340  C C     . THR G 3 165 ? 17.583  35.861  25.990 1.00 68.53  ? 159 THR C C     1 
ATOM   6341  O O     . THR G 3 165 ? 17.322  36.223  27.139 1.00 68.51  ? 159 THR C O     1 
ATOM   6342  C CB    . THR G 3 165 ? 17.490  37.528  24.149 1.00 72.62  ? 159 THR C CB    1 
ATOM   6343  O OG1   . THR G 3 165 ? 17.000  36.678  23.098 1.00 69.92  ? 159 THR C OG1   1 
ATOM   6344  C CG2   . THR G 3 165 ? 18.229  38.729  23.569 1.00 76.34  ? 159 THR C CG2   1 
ATOM   6345  N N     . LYS G 3 166 ? 17.188  34.701  25.468 1.00 66.32  ? 160 LYS C N     1 
ATOM   6346  C CA    . LYS G 3 166 ? 16.395  33.743  26.227 1.00 63.96  ? 160 LYS C CA    1 
ATOM   6347  C C     . LYS G 3 166 ? 17.130  33.222  27.469 1.00 63.35  ? 160 LYS C C     1 
ATOM   6348  O O     . LYS G 3 166 ? 16.562  33.197  28.565 1.00 62.54  ? 160 LYS C O     1 
ATOM   6349  C CB    . LYS G 3 166 ? 15.937  32.596  25.332 1.00 62.25  ? 160 LYS C CB    1 
ATOM   6350  C CG    . LYS G 3 166 ? 14.824  31.746  25.935 1.00 60.45  ? 160 LYS C CG    1 
ATOM   6351  C CD    . LYS G 3 166 ? 13.564  32.552  26.168 1.00 61.59  ? 160 LYS C CD    1 
ATOM   6352  C CE    . LYS G 3 166 ? 12.479  31.703  26.790 1.00 61.25  ? 160 LYS C CE    1 
ATOM   6353  N NZ    . LYS G 3 166 ? 12.851  31.254  28.160 1.00 61.00  ? 160 LYS C NZ    1 
ATOM   6354  N N     . ALA G 3 167 ? 18.393  32.844  27.294 1.00 64.25  ? 161 ALA C N     1 
ATOM   6355  C CA    . ALA G 3 167 ? 19.236  32.390  28.404 1.00 64.57  ? 161 ALA C CA    1 
ATOM   6356  C C     . ALA G 3 167 ? 19.550  33.510  29.403 1.00 67.10  ? 161 ALA C C     1 
ATOM   6357  O O     . ALA G 3 167 ? 19.672  33.263  30.599 1.00 66.62  ? 161 ALA C O     1 
ATOM   6358  C CB    . ALA G 3 167 ? 20.521  31.755  27.877 1.00 65.38  ? 161 ALA C CB    1 
ATOM   6359  N N     . LEU G 3 168 ? 19.674  34.740  28.906 1.00 70.22  ? 162 LEU C N     1 
ATOM   6360  C CA    . LEU G 3 168 ? 19.849  35.906  29.771 1.00 73.43  ? 162 LEU C CA    1 
ATOM   6361  C C     . LEU G 3 168 ? 18.604  36.162  30.623 1.00 72.84  ? 162 LEU C C     1 
ATOM   6362  O O     . LEU G 3 168 ? 18.701  36.236  31.855 1.00 73.25  ? 162 LEU C O     1 
ATOM   6363  C CB    . LEU G 3 168 ? 20.187  37.144  28.947 1.00 76.87  ? 162 LEU C CB    1 
ATOM   6364  C CG    . LEU G 3 168 ? 21.193  38.122  29.545 1.00 81.15  ? 162 LEU C CG    1 
ATOM   6365  C CD1   . LEU G 3 168 ? 21.793  38.943  28.424 1.00 84.74  ? 162 LEU C CD1   1 
ATOM   6366  C CD2   . LEU G 3 168 ? 20.567  39.023  30.616 1.00 83.30  ? 162 LEU C CD2   1 
ATOM   6367  N N     . GLU G 3 169 ? 17.443  36.277  29.968 1.00 72.10  ? 163 GLU C N     1 
ATOM   6368  C CA    . GLU G 3 169 ? 16.176  36.498  30.669 1.00 71.94  ? 163 GLU C CA    1 
ATOM   6369  C C     . GLU G 3 169 ? 15.898  35.404  31.675 1.00 69.47  ? 163 GLU C C     1 
ATOM   6370  O O     . GLU G 3 169 ? 15.406  35.684  32.766 1.00 70.14  ? 163 GLU C O     1 
ATOM   6371  C CB    . GLU G 3 169 ? 14.995  36.626  29.703 1.00 71.23  ? 163 GLU C CB    1 
ATOM   6372  C CG    . GLU G 3 169 ? 14.844  38.001  29.070 1.00 75.57  ? 163 GLU C CG    1 
ATOM   6373  C CD    . GLU G 3 169 ? 15.027  39.143  30.062 1.00 80.38  ? 163 GLU C CD    1 
ATOM   6374  O OE1   . GLU G 3 169 ? 14.280  39.198  31.064 1.00 81.04  ? 163 GLU C OE1   1 
ATOM   6375  O OE2   . GLU G 3 169 ? 15.918  39.992  29.833 1.00 83.92  ? 163 GLU C OE2   1 
ATOM   6376  N N     . ARG G 3 170 ? 16.227  34.166  31.299 1.00 67.30  ? 164 ARG C N     1 
ATOM   6377  C CA    . ARG G 3 170 ? 16.054  33.003  32.162 1.00 65.30  ? 164 ARG C CA    1 
ATOM   6378  C C     . ARG G 3 170 ? 16.814  33.160  33.485 1.00 66.64  ? 164 ARG C C     1 
ATOM   6379  O O     . ARG G 3 170 ? 16.239  32.944  34.553 1.00 66.24  ? 164 ARG C O     1 
ATOM   6380  C CB    . ARG G 3 170 ? 16.466  31.712  31.433 1.00 63.43  ? 164 ARG C CB    1 
ATOM   6381  C CG    . ARG G 3 170 ? 16.192  30.413  32.207 1.00 61.81  ? 164 ARG C CG    1 
ATOM   6382  C CD    . ARG G 3 170 ? 16.131  29.172  31.295 1.00 61.72  ? 164 ARG C CD    1 
ATOM   6383  N NE    . ARG G 3 170 ? 17.427  28.830  30.696 1.00 64.82  ? 164 ARG C NE    1 
ATOM   6384  C CZ    . ARG G 3 170 ? 17.688  27.721  29.986 1.00 65.19  ? 164 ARG C CZ    1 
ATOM   6385  N NH1   . ARG G 3 170 ? 16.747  26.798  29.760 1.00 63.35  ? 164 ARG C NH1   1 
ATOM   6386  N NH2   . ARG G 3 170 ? 18.911  27.532  29.492 1.00 65.76  ? 164 ARG C NH2   1 
ATOM   6387  N N     . GLU G 3 171 ? 18.090  33.542  33.417 1.00 68.69  ? 165 GLU C N     1 
ATOM   6388  C CA    . GLU G 3 171 ? 18.890  33.741  34.630 1.00 70.52  ? 165 GLU C CA    1 
ATOM   6389  C C     . GLU G 3 171 ? 18.436  34.976  35.381 1.00 72.72  ? 165 GLU C C     1 
ATOM   6390  O O     . GLU G 3 171 ? 18.259  34.917  36.593 1.00 73.08  ? 165 GLU C O     1 
ATOM   6391  C CB    . GLU G 3 171 ? 20.389  33.823  34.336 1.00 72.95  ? 165 GLU C CB    1 
ATOM   6392  C CG    . GLU G 3 171 ? 20.988  32.564  33.725 1.00 73.02  ? 165 GLU C CG    1 
ATOM   6393  C CD    . GLU G 3 171 ? 20.717  31.314  34.536 1.00 73.23  ? 165 GLU C CD    1 
ATOM   6394  O OE1   . GLU G 3 171 ? 21.214  31.226  35.681 1.00 75.58  ? 165 GLU C OE1   1 
ATOM   6395  O OE2   . GLU G 3 171 ? 20.017  30.412  34.020 1.00 71.66  ? 165 GLU C OE2   1 
ATOM   6396  N N     . LYS G 3 172 ? 18.242  36.085  34.662 1.00 74.50  ? 166 LYS C N     1 
ATOM   6397  C CA    . LYS G 3 172 ? 17.657  37.290  35.254 1.00 77.04  ? 166 LYS C CA    1 
ATOM   6398  C C     . LYS G 3 172 ? 16.419  36.943  36.090 1.00 75.34  ? 166 LYS C C     1 
ATOM   6399  O O     . LYS G 3 172 ? 16.325  37.328  37.256 1.00 77.09  ? 166 LYS C O     1 
ATOM   6400  C CB    . LYS G 3 172 ? 17.324  38.350  34.191 1.00 79.05  ? 166 LYS C CB    1 
ATOM   6401  C CG    . LYS G 3 172 ? 18.468  39.307  33.859 1.00 82.04  ? 166 LYS C CG    1 
ATOM   6402  N N     . ASN G 3 173 ? 15.495  36.185  35.504 1.00 72.10  ? 167 ASN C N     1 
ATOM   6403  C CA    . ASN G 3 173 ? 14.274  35.785  36.198 1.00 70.60  ? 167 ASN C CA    1 
ATOM   6404  C C     . ASN G 3 173 ? 14.513  34.900  37.437 1.00 69.05  ? 167 ASN C C     1 
ATOM   6405  O O     . ASN G 3 173 ? 13.935  35.158  38.501 1.00 70.48  ? 167 ASN C O     1 
ATOM   6406  C CB    . ASN G 3 173 ? 13.307  35.121  35.219 1.00 68.19  ? 167 ASN C CB    1 
ATOM   6407  C CG    . ASN G 3 173 ? 11.971  34.787  35.849 1.00 67.57  ? 167 ASN C CG    1 
ATOM   6408  O OD1   . ASN G 3 173 ? 11.755  33.657  36.304 1.00 65.04  ? 167 ASN C OD1   1 
ATOM   6409  N ND2   . ASN G 3 173 ? 11.066  35.765  35.882 1.00 68.50  ? 167 ASN C ND2   1 
ATOM   6410  N N     . TYR G 3 174 ? 15.368  33.884  37.302 1.00 66.66  ? 168 TYR C N     1 
ATOM   6411  C CA    . TYR G 3 174 ? 15.722  32.978  38.409 1.00 65.28  ? 168 TYR C CA    1 
ATOM   6412  C C     . TYR G 3 174 ? 16.323  33.758  39.588 1.00 68.17  ? 168 TYR C C     1 
ATOM   6413  O O     . TYR G 3 174 ? 15.893  33.594  40.731 1.00 68.38  ? 168 TYR C O     1 
ATOM   6414  C CB    . TYR G 3 174 ? 16.716  31.914  37.926 1.00 63.67  ? 168 TYR C CB    1 
ATOM   6415  C CG    . TYR G 3 174 ? 16.566  30.520  38.527 1.00 61.54  ? 168 TYR C CG    1 
ATOM   6416  C CD1   . TYR G 3 174 ? 16.644  30.305  39.904 1.00 62.17  ? 168 TYR C CD1   1 
ATOM   6417  C CD2   . TYR G 3 174 ? 16.390  29.408  37.700 1.00 59.10  ? 168 TYR C CD2   1 
ATOM   6418  C CE1   . TYR G 3 174 ? 16.517  29.012  40.449 1.00 60.15  ? 168 TYR C CE1   1 
ATOM   6419  C CE2   . TYR G 3 174 ? 16.271  28.130  38.222 1.00 58.09  ? 168 TYR C CE2   1 
ATOM   6420  C CZ    . TYR G 3 174 ? 16.332  27.929  39.601 1.00 58.74  ? 168 TYR C CZ    1 
ATOM   6421  O OH    . TYR G 3 174 ? 16.204  26.650  40.110 1.00 55.52  ? 168 TYR C OH    1 
ATOM   6422  N N     . VAL G 3 175 ? 17.312  34.606  39.299 1.00 70.63  ? 169 VAL C N     1 
ATOM   6423  C CA    . VAL G 3 175 ? 17.955  35.454  40.303 1.00 73.98  ? 169 VAL C CA    1 
ATOM   6424  C C     . VAL G 3 175 ? 16.932  36.341  41.030 1.00 76.08  ? 169 VAL C C     1 
ATOM   6425  O O     . VAL G 3 175 ? 16.952  36.454  42.267 1.00 77.81  ? 169 VAL C O     1 
ATOM   6426  C CB    . VAL G 3 175 ? 19.080  36.324  39.668 1.00 77.29  ? 169 VAL C CB    1 
ATOM   6427  C CG1   . VAL G 3 175 ? 19.643  37.355  40.672 1.00 80.67  ? 169 VAL C CG1   1 
ATOM   6428  C CG2   . VAL G 3 175 ? 20.193  35.427  39.119 1.00 75.81  ? 169 VAL C CG2   1 
ATOM   6429  N N     . SER G 3 176 ? 16.035  36.948  40.257 1.00 75.89  ? 170 SER C N     1 
ATOM   6430  C CA    . SER G 3 176 ? 14.974  37.798  40.801 1.00 77.94  ? 170 SER C CA    1 
ATOM   6431  C C     . SER G 3 176 ? 14.074  37.022  41.771 1.00 75.68  ? 170 SER C C     1 
ATOM   6432  O O     . SER G 3 176 ? 13.741  37.513  42.855 1.00 77.90  ? 170 SER C O     1 
ATOM   6433  C CB    . SER G 3 176 ? 14.154  38.419  39.660 1.00 78.35  ? 170 SER C CB    1 
ATOM   6434  O OG    . SER G 3 176 ? 13.069  39.183  40.150 1.00 80.58  ? 170 SER C OG    1 
ATOM   6435  N N     . TRP G 3 177 ? 13.708  35.804  41.380 1.00 71.28  ? 171 TRP C N     1 
ATOM   6436  C CA    . TRP G 3 177 ? 12.887  34.934  42.222 1.00 69.10  ? 171 TRP C CA    1 
ATOM   6437  C C     . TRP G 3 177 ? 13.591  34.539  43.513 1.00 69.52  ? 171 TRP C C     1 
ATOM   6438  O O     . TRP G 3 177 ? 12.994  34.621  44.580 1.00 70.47  ? 171 TRP C O     1 
ATOM   6439  C CB    . TRP G 3 177 ? 12.473  33.687  41.446 1.00 65.06  ? 171 TRP C CB    1 
ATOM   6440  C CG    . TRP G 3 177 ? 11.615  32.725  42.220 1.00 62.56  ? 171 TRP C CG    1 
ATOM   6441  C CD1   . TRP G 3 177 ? 10.271  32.812  42.418 1.00 62.13  ? 171 TRP C CD1   1 
ATOM   6442  C CD2   . TRP G 3 177 ? 12.043  31.530  42.883 1.00 59.57  ? 171 TRP C CD2   1 
ATOM   6443  N NE1   . TRP G 3 177 ? 9.831   31.745  43.156 1.00 60.07  ? 171 TRP C NE1   1 
ATOM   6444  C CE2   . TRP G 3 177 ? 10.896  30.940  43.458 1.00 58.69  ? 171 TRP C CE2   1 
ATOM   6445  C CE3   . TRP G 3 177 ? 13.285  30.896  43.043 1.00 59.18  ? 171 TRP C CE3   1 
ATOM   6446  C CZ2   . TRP G 3 177 ? 10.945  29.735  44.186 1.00 56.65  ? 171 TRP C CZ2   1 
ATOM   6447  C CZ3   . TRP G 3 177 ? 13.335  29.690  43.765 1.00 57.47  ? 171 TRP C CZ3   1 
ATOM   6448  C CH2   . TRP G 3 177 ? 12.167  29.129  44.329 1.00 55.67  ? 171 TRP C CH2   1 
ATOM   6449  N N     . LEU G 3 178 ? 14.853  34.118  43.402 1.00 69.22  ? 172 LEU C N     1 
ATOM   6450  C CA    . LEU G 3 178 ? 15.655  33.690  44.557 1.00 70.37  ? 172 LEU C CA    1 
ATOM   6451  C C     . LEU G 3 178 ? 15.824  34.806  45.591 1.00 75.23  ? 172 LEU C C     1 
ATOM   6452  O O     . LEU G 3 178 ? 15.644  34.567  46.786 1.00 76.16  ? 172 LEU C O     1 
ATOM   6453  C CB    . LEU G 3 178 ? 17.027  33.151  44.122 1.00 69.59  ? 172 LEU C CB    1 
ATOM   6454  C CG    . LEU G 3 178 ? 17.127  31.765  43.475 1.00 65.48  ? 172 LEU C CG    1 
ATOM   6455  C CD1   . LEU G 3 178 ? 18.422  31.612  42.688 1.00 64.39  ? 172 LEU C CD1   1 
ATOM   6456  C CD2   . LEU G 3 178 ? 17.006  30.667  44.526 1.00 64.18  ? 172 LEU C CD2   1 
ATOM   6457  N N     . GLU G 3 179 ? 16.165  36.014  45.130 1.00 78.73  ? 173 GLU C N     1 
ATOM   6458  C CA    . GLU G 3 179 ? 16.209  37.190  46.000 1.00 84.07  ? 173 GLU C CA    1 
ATOM   6459  C C     . GLU G 3 179 ? 14.883  37.342  46.734 1.00 84.84  ? 173 GLU C C     1 
ATOM   6460  O O     . GLU G 3 179 ? 14.844  37.344  47.969 1.00 86.72  ? 173 GLU C O     1 
ATOM   6461  C CB    . GLU G 3 179 ? 16.506  38.473  45.209 1.00 87.37  ? 173 GLU C CB    1 
ATOM   6462  C CG    . GLU G 3 179 ? 17.952  38.642  44.787 1.00 88.76  ? 173 GLU C CG    1 
ATOM   6463  C CD    . GLU G 3 179 ? 18.119  39.637  43.650 1.00 91.21  ? 173 GLU C CD    1 
ATOM   6464  O OE1   . GLU G 3 179 ? 17.121  39.918  42.950 1.00 90.19  ? 173 GLU C OE1   1 
ATOM   6465  O OE2   . GLU G 3 179 ? 19.249  40.137  43.451 1.00 94.41  ? 173 GLU C OE2   1 
ATOM   6466  N N     . SER G 3 180 ? 13.801  37.449  45.961 1.00 83.69  ? 174 SER C N     1 
ATOM   6467  C CA    . SER G 3 180 ? 12.452  37.602  46.505 1.00 84.69  ? 174 SER C CA    1 
ATOM   6468  C C     . SER G 3 180 ? 12.139  36.590  47.629 1.00 83.00  ? 174 SER C C     1 
ATOM   6469  O O     . SER G 3 180 ? 11.638  36.977  48.692 1.00 85.75  ? 174 SER C O     1 
ATOM   6470  C CB    . SER G 3 180 ? 11.420  37.536  45.372 1.00 82.62  ? 174 SER C CB    1 
ATOM   6471  O OG    . SER G 3 180 ? 10.106  37.338  45.866 1.00 83.22  ? 174 SER C OG    1 
ATOM   6472  N N     . ILE G 3 181 ? 12.467  35.316  47.400 1.00 78.68  ? 175 ILE C N     1 
ATOM   6473  C CA    . ILE G 3 181 ? 12.251  34.268  48.405 1.00 77.18  ? 175 ILE C CA    1 
ATOM   6474  C C     . ILE G 3 181 ? 13.179  34.400  49.617 1.00 79.94  ? 175 ILE C C     1 
ATOM   6475  O O     . ILE G 3 181 ? 12.728  34.269  50.754 1.00 81.14  ? 175 ILE C O     1 
ATOM   6476  C CB    . ILE G 3 181 ? 12.339  32.830  47.802 1.00 72.30  ? 175 ILE C CB    1 
ATOM   6477  C CG1   . ILE G 3 181 ? 11.291  32.614  46.698 1.00 69.70  ? 175 ILE C CG1   1 
ATOM   6478  C CG2   . ILE G 3 181 ? 12.197  31.782  48.887 1.00 70.61  ? 175 ILE C CG2   1 
ATOM   6479  C CD1   . ILE G 3 181 ? 9.856   32.970  47.081 1.00 70.77  ? 175 ILE C CD1   1 
ATOM   6480  N N     . LEU G 3 182 ? 14.462  34.664  49.369 1.00 81.44  ? 176 LEU C N     1 
ATOM   6481  C CA    . LEU G 3 182 ? 15.432  34.943  50.444 1.00 85.16  ? 176 LEU C CA    1 
ATOM   6482  C C     . LEU G 3 182 ? 15.023  36.088  51.378 1.00 90.23  ? 176 LEU C C     1 
ATOM   6483  O O     . LEU G 3 182 ? 15.454  36.144  52.533 1.00 92.77  ? 176 LEU C O     1 
ATOM   6484  C CB    . LEU G 3 182 ? 16.832  35.207  49.873 1.00 86.16  ? 176 LEU C CB    1 
ATOM   6485  C CG    . LEU G 3 182 ? 17.790  34.010  49.824 1.00 83.73  ? 176 LEU C CG    1 
ATOM   6486  C CD1   . LEU G 3 182 ? 19.085  34.419  49.153 1.00 85.65  ? 176 LEU C CD1   1 
ATOM   6487  C CD2   . LEU G 3 182 ? 18.071  33.449  51.222 1.00 84.05  ? 176 LEU C CD2   1 
ATOM   6488  N N     . ALA G 3 183 ? 14.202  36.998  50.867 1.00 92.43  ? 177 ALA C N     1 
ATOM   6489  C CA    . ALA G 3 183 ? 13.660  38.093  51.667 1.00 98.08  ? 177 ALA C CA    1 
ATOM   6490  C C     . ALA G 3 183 ? 12.474  37.603  52.497 1.00 97.88  ? 177 ALA C C     1 
ATOM   6491  O O     . ALA G 3 183 ? 12.206  38.131  53.575 1.00 102.16 ? 177 ALA C O     1 
ATOM   6492  C CB    . ALA G 3 183 ? 13.253  39.260  50.772 1.00 100.14 ? 177 ALA C CB    1 
ATOM   6493  N N     . MET G 3 184 ? 11.778  36.590  51.985 1.00 93.80  ? 178 MET C N     1 
ATOM   6494  C CA    . MET G 3 184 ? 10.625  35.995  52.653 1.00 93.58  ? 178 MET C CA    1 
ATOM   6495  C C     . MET G 3 184 ? 11.106  35.080  53.779 1.00 93.05  ? 178 MET C C     1 
ATOM   6496  O O     . MET G 3 184 ? 10.479  34.993  54.846 1.00 94.73  ? 178 MET C O     1 
ATOM   6497  C CB    . MET G 3 184 ? 9.806   35.193  51.638 1.00 89.37  ? 178 MET C CB    1 
ATOM   6498  C CG    . MET G 3 184 ? 8.299   35.269  51.823 1.00 91.08  ? 178 MET C CG    1 
ATOM   6499  S SD    . MET G 3 184 ? 7.433   35.039  50.249 1.00 89.51  ? 178 MET C SD    1 
ATOM   6500  C CE    . MET G 3 184 ? 5.793   35.631  50.673 1.00 92.64  ? 178 MET C CE    1 
ATOM   6501  N N     . ILE G 3 185 ? 12.227  34.404  53.525 1.00 90.99  ? 179 ILE C N     1 
ATOM   6502  C CA    . ILE G 3 185 ? 12.842  33.496  54.483 1.00 90.52  ? 179 ILE C CA    1 
ATOM   6503  C C     . ILE G 3 185 ? 13.529  34.290  55.586 1.00 95.66  ? 179 ILE C C     1 
ATOM   6504  O O     . ILE G 3 185 ? 13.319  34.027  56.777 1.00 97.51  ? 179 ILE C O     1 
ATOM   6505  C CB    . ILE G 3 185 ? 13.852  32.539  53.796 1.00 86.99  ? 179 ILE C CB    1 
ATOM   6506  C CG1   . ILE G 3 185 ? 13.109  31.529  52.913 1.00 82.22  ? 179 ILE C CG1   1 
ATOM   6507  C CG2   . ILE G 3 185 ? 14.713  31.810  54.836 1.00 87.85  ? 179 ILE C CG2   1 
ATOM   6508  C CD1   . ILE G 3 185 ? 14.008  30.668  52.036 1.00 79.04  ? 179 ILE C CD1   1 
ATOM   6509  N N     . ASP G 3 186 ? 14.330  35.272  55.184 1.00 98.50  ? 180 ASP C N     1 
ATOM   6510  C CA    . ASP G 3 186 ? 15.134  36.041  56.120 1.00 103.64 ? 180 ASP C CA    1 
ATOM   6511  C C     . ASP G 3 186 ? 14.525  37.416  56.389 1.00 108.92 ? 180 ASP C C     1 
ATOM   6512  O O     . ASP G 3 186 ? 13.841  37.621  57.396 1.00 111.61 ? 180 ASP C O     1 
ATOM   6513  C CB    . ASP G 3 186 ? 16.563  36.169  55.591 1.00 104.19 ? 180 ASP C CB    1 
ATOM   6514  N N     . ARG H 3 8   ? 20.515  8.990   41.285 1.00 58.80  ? 2   ARG D N     1 
ATOM   6515  C CA    . ARG H 3 8   ? 19.030  8.928   41.226 1.00 55.25  ? 2   ARG D CA    1 
ATOM   6516  C C     . ARG H 3 8   ? 18.388  10.037  42.055 1.00 52.89  ? 2   ARG D C     1 
ATOM   6517  O O     . ARG H 3 8   ? 18.357  9.993   43.282 1.00 52.46  ? 2   ARG D O     1 
ATOM   6518  C CB    . ARG H 3 8   ? 18.525  7.552   41.686 1.00 54.28  ? 2   ARG D CB    1 
ATOM   6519  N N     . VAL H 3 9   ? 17.880  11.037  41.360 1.00 52.11  ? 3   VAL D N     1 
ATOM   6520  C CA    . VAL H 3 9   ? 17.101  12.108  41.964 1.00 49.99  ? 3   VAL D CA    1 
ATOM   6521  C C     . VAL H 3 9   ? 15.726  11.591  42.395 1.00 46.97  ? 3   VAL D C     1 
ATOM   6522  O O     . VAL H 3 9   ? 15.119  12.127  43.327 1.00 46.23  ? 3   VAL D O     1 
ATOM   6523  C CB    . VAL H 3 9   ? 16.945  13.277  40.963 1.00 51.24  ? 3   VAL D CB    1 
ATOM   6524  C CG1   . VAL H 3 9   ? 16.048  14.370  41.519 1.00 49.84  ? 3   VAL D CG1   1 
ATOM   6525  C CG2   . VAL H 3 9   ? 18.316  13.830  40.585 1.00 53.79  ? 3   VAL D CG2   1 
ATOM   6526  N N     . LEU H 3 10  ? 15.241  10.548  41.717 1.00 45.66  ? 4   LEU D N     1 
ATOM   6527  C CA    . LEU H 3 10  ? 13.960  9.943   42.041 1.00 42.78  ? 4   LEU D CA    1 
ATOM   6528  C C     . LEU H 3 10  ? 13.951  9.430   43.483 1.00 41.86  ? 4   LEU D C     1 
ATOM   6529  O O     . LEU H 3 10  ? 12.969  9.608   44.203 1.00 41.20  ? 4   LEU D O     1 
ATOM   6530  C CB    . LEU H 3 10  ? 13.611  8.811   41.067 1.00 42.35  ? 4   LEU D CB    1 
ATOM   6531  C CG    . LEU H 3 10  ? 12.271  8.108   41.367 1.00 40.57  ? 4   LEU D CG    1 
ATOM   6532  C CD1   . LEU H 3 10  ? 11.075  9.033   41.120 1.00 38.27  ? 4   LEU D CD1   1 
ATOM   6533  C CD2   . LEU H 3 10  ? 12.109  6.814   40.596 1.00 40.71  ? 4   LEU D CD2   1 
ATOM   6534  N N     . LYS H 3 11  ? 15.038  8.795   43.901 1.00 42.66  ? 5   LYS D N     1 
ATOM   6535  C CA    . LYS H 3 11  ? 15.183  8.360   45.287 1.00 42.28  ? 5   LYS D CA    1 
ATOM   6536  C C     . LYS H 3 11  ? 14.859  9.497   46.280 1.00 42.21  ? 5   LYS D C     1 
ATOM   6537  O O     . LYS H 3 11  ? 14.129  9.270   47.262 1.00 41.40  ? 5   LYS D O     1 
ATOM   6538  C CB    . LYS H 3 11  ? 16.588  7.778   45.513 1.00 44.31  ? 5   LYS D CB    1 
ATOM   6539  C CG    . LYS H 3 11  ? 17.109  7.820   46.933 1.00 45.10  ? 5   LYS D CG    1 
ATOM   6540  C CD    . LYS H 3 11  ? 18.605  7.545   46.955 1.00 48.52  ? 5   LYS D CD    1 
ATOM   6541  C CE    . LYS H 3 11  ? 19.183  7.770   48.331 1.00 49.91  ? 5   LYS D CE    1 
ATOM   6542  N NZ    . LYS H 3 11  ? 20.646  7.525   48.344 1.00 54.03  ? 5   LYS D NZ    1 
ATOM   6543  N N     . TYR H 3 12  ? 15.375  10.704  46.014 1.00 42.64  ? 6   TYR D N     1 
ATOM   6544  C CA    . TYR H 3 12  ? 15.160  11.828  46.917 1.00 42.90  ? 6   TYR D CA    1 
ATOM   6545  C C     . TYR H 3 12  ? 13.783  12.434  46.763 1.00 41.55  ? 6   TYR D C     1 
ATOM   6546  O O     . TYR H 3 12  ? 13.225  12.960  47.727 1.00 41.80  ? 6   TYR D O     1 
ATOM   6547  C CB    . TYR H 3 12  ? 16.256  12.908  46.766 1.00 45.58  ? 6   TYR D CB    1 
ATOM   6548  C CG    . TYR H 3 12  ? 17.598  12.382  47.165 1.00 47.33  ? 6   TYR D CG    1 
ATOM   6549  C CD1   . TYR H 3 12  ? 17.894  12.143  48.501 1.00 48.13  ? 6   TYR D CD1   1 
ATOM   6550  C CD2   . TYR H 3 12  ? 18.552  12.060  46.213 1.00 49.56  ? 6   TYR D CD2   1 
ATOM   6551  C CE1   . TYR H 3 12  ? 19.104  11.613  48.881 1.00 50.17  ? 6   TYR D CE1   1 
ATOM   6552  C CE2   . TYR H 3 12  ? 19.786  11.528  46.592 1.00 51.75  ? 6   TYR D CE2   1 
ATOM   6553  C CZ    . TYR H 3 12  ? 20.047  11.313  47.930 1.00 51.79  ? 6   TYR D CZ    1 
ATOM   6554  O OH    . TYR H 3 12  ? 21.253  10.800  48.335 1.00 55.76  ? 6   TYR D OH    1 
ATOM   6555  N N     . ALA H 3 13  ? 13.241  12.398  45.549 1.00 40.88  ? 7   ALA D N     1 
ATOM   6556  C CA    . ALA H 3 13  ? 11.874  12.879  45.333 1.00 39.92  ? 7   ALA D CA    1 
ATOM   6557  C C     . ALA H 3 13  ? 10.953  12.095  46.271 1.00 38.54  ? 7   ALA D C     1 
ATOM   6558  O O     . ALA H 3 13  ? 10.160  12.693  47.023 1.00 38.53  ? 7   ALA D O     1 
ATOM   6559  C CB    . ALA H 3 13  ? 11.468  12.705  43.903 1.00 39.53  ? 7   ALA D CB    1 
ATOM   6560  N N     . ILE H 3 14  ? 11.124  10.764  46.275 1.00 37.01  ? 8   ILE D N     1 
ATOM   6561  C CA    . ILE H 3 14  ? 10.362  9.888   47.156 1.00 35.78  ? 8   ILE D CA    1 
ATOM   6562  C C     . ILE H 3 14  ? 10.643  10.165  48.638 1.00 36.60  ? 8   ILE D C     1 
ATOM   6563  O O     . ILE H 3 14  ? 9.711   10.445  49.404 1.00 37.02  ? 8   ILE D O     1 
ATOM   6564  C CB    . ILE H 3 14  ? 10.521  8.382   46.789 1.00 35.24  ? 8   ILE D CB    1 
ATOM   6565  C CG1   . ILE H 3 14  ? 9.814   8.091   45.463 1.00 34.37  ? 8   ILE D CG1   1 
ATOM   6566  C CG2   . ILE H 3 14  ? 9.921   7.475   47.882 1.00 34.08  ? 8   ILE D CG2   1 
ATOM   6567  C CD1   . ILE H 3 14  ? 10.241  6.794   44.807 1.00 34.46  ? 8   ILE D CD1   1 
ATOM   6568  N N     . LEU H 3 15  ? 11.907  10.130  49.045 1.00 37.47  ? 9   LEU D N     1 
ATOM   6569  C CA    . LEU H 3 15  ? 12.242  10.468  50.430 1.00 39.14  ? 9   LEU D CA    1 
ATOM   6570  C C     . LEU H 3 15  ? 11.549  11.766  50.865 1.00 40.45  ? 9   LEU D C     1 
ATOM   6571  O O     . LEU H 3 15  ? 10.850  11.792  51.886 1.00 41.23  ? 9   LEU D O     1 
ATOM   6572  C CB    . LEU H 3 15  ? 13.755  10.537  50.654 1.00 40.52  ? 9   LEU D CB    1 
ATOM   6573  C CG    . LEU H 3 15  ? 14.539  9.233   50.470 1.00 40.66  ? 9   LEU D CG    1 
ATOM   6574  C CD1   . LEU H 3 15  ? 15.942  9.381   51.018 1.00 42.12  ? 9   LEU D CD1   1 
ATOM   6575  C CD2   . LEU H 3 15  ? 13.844  8.051   51.110 1.00 38.61  ? 9   LEU D CD2   1 
ATOM   6576  N N     . GLY H 3 16  ? 11.699  12.817  50.059 1.00 40.82  ? 10  GLY D N     1 
ATOM   6577  C CA    . GLY H 3 16  ? 11.065  14.092  50.328 1.00 42.38  ? 10  GLY D CA    1 
ATOM   6578  C C     . GLY H 3 16  ? 9.554   14.049  50.439 1.00 42.30  ? 10  GLY D C     1 
ATOM   6579  O O     . GLY H 3 16  ? 8.975   14.692  51.317 1.00 44.42  ? 10  GLY D O     1 
ATOM   6580  N N     . LEU H 3 17  ? 8.902   13.304  49.556 1.00 40.41  ? 11  LEU D N     1 
ATOM   6581  C CA    . LEU H 3 17  ? 7.448   13.192  49.625 1.00 40.24  ? 11  LEU D CA    1 
ATOM   6582  C C     . LEU H 3 17  ? 6.968   12.509  50.914 1.00 40.90  ? 11  LEU D C     1 
ATOM   6583  O O     . LEU H 3 17  ? 5.829   12.724  51.330 1.00 42.08  ? 11  LEU D O     1 
ATOM   6584  C CB    . LEU H 3 17  ? 6.880   12.496  48.374 1.00 38.30  ? 11  LEU D CB    1 
ATOM   6585  C CG    . LEU H 3 17  ? 6.876   13.295  47.068 1.00 38.17  ? 11  LEU D CG    1 
ATOM   6586  C CD1   . LEU H 3 17  ? 6.600   12.390  45.891 1.00 36.08  ? 11  LEU D CD1   1 
ATOM   6587  C CD2   . LEU H 3 17  ? 5.878   14.460  47.097 1.00 39.29  ? 11  LEU D CD2   1 
ATOM   6588  N N     . LEU H 3 18  ? 7.831   11.703  51.545 1.00 40.80  ? 12  LEU D N     1 
ATOM   6589  C CA    . LEU H 3 18  ? 7.466   10.953  52.780 1.00 41.62  ? 12  LEU D CA    1 
ATOM   6590  C C     . LEU H 3 18  ? 7.737   11.721  54.093 1.00 44.54  ? 12  LEU D C     1 
ATOM   6591  O O     . LEU H 3 18  ? 7.456   11.238  55.191 1.00 45.42  ? 12  LEU D O     1 
ATOM   6592  C CB    . LEU H 3 18  ? 8.154   9.580   52.796 1.00 40.35  ? 12  LEU D CB    1 
ATOM   6593  C CG    . LEU H 3 18  ? 7.668   8.531   51.774 1.00 38.83  ? 12  LEU D CG    1 
ATOM   6594  C CD1   . LEU H 3 18  ? 8.606   7.333   51.663 1.00 37.13  ? 12  LEU D CD1   1 
ATOM   6595  C CD2   . LEU H 3 18  ? 6.262   8.056   52.099 1.00 39.16  ? 12  LEU D CD2   1 
ATOM   6596  N N     . ARG H 3 19  ? 8.243   12.948  53.959 1.00 46.30  ? 13  ARG D N     1 
ATOM   6597  C CA    . ARG H 3 19  ? 8.714   13.741  55.103 1.00 49.24  ? 13  ARG D CA    1 
ATOM   6598  C C     . ARG H 3 19  ? 7.654   14.086  56.166 1.00 51.82  ? 13  ARG D C     1 
ATOM   6599  O O     . ARG H 3 19  ? 8.000   14.290  57.324 1.00 54.51  ? 13  ARG D O     1 
ATOM   6600  C CB    . ARG H 3 19  ? 9.451   15.003  54.614 1.00 49.90  ? 13  ARG D CB    1 
ATOM   6601  C CG    . ARG H 3 19  ? 8.533   16.137  54.220 1.00 51.57  ? 13  ARG D CG    1 
ATOM   6602  C CD    . ARG H 3 19  ? 9.171   17.149  53.270 1.00 51.77  ? 13  ARG D CD    1 
ATOM   6603  N NE    . ARG H 3 19  ? 8.195   18.184  52.942 1.00 53.50  ? 13  ARG D NE    1 
ATOM   6604  C CZ    . ARG H 3 19  ? 7.158   18.001  52.129 1.00 52.53  ? 13  ARG D CZ    1 
ATOM   6605  N NH1   . ARG H 3 19  ? 6.964   16.827  51.536 1.00 49.92  ? 13  ARG D NH1   1 
ATOM   6606  N NH2   . ARG H 3 19  ? 6.308   18.990  51.908 1.00 54.87  ? 13  ARG D NH2   1 
ATOM   6607  N N     . LYS H 3 20  ? 6.386   14.159  55.771 1.00 52.06  ? 14  LYS D N     1 
ATOM   6608  C CA    . LYS H 3 20  ? 5.284   14.508  56.680 1.00 55.14  ? 14  LYS D CA    1 
ATOM   6609  C C     . LYS H 3 20  ? 4.365   13.316  56.937 1.00 54.71  ? 14  LYS D C     1 
ATOM   6610  O O     . LYS H 3 20  ? 3.273   13.478  57.469 1.00 57.23  ? 14  LYS D O     1 
ATOM   6611  C CB    . LYS H 3 20  ? 4.429   15.642  56.108 1.00 56.72  ? 14  LYS D CB    1 
ATOM   6612  C CG    . LYS H 3 20  ? 5.050   17.019  56.114 1.00 59.48  ? 14  LYS D CG    1 
ATOM   6613  C CD    . LYS H 3 20  ? 4.019   18.080  55.696 1.00 62.75  ? 14  LYS D CD    1 
ATOM   6614  C CE    . LYS H 3 20  ? 4.697   19.414  55.375 1.00 65.57  ? 14  LYS D CE    1 
ATOM   6615  N NZ    . LYS H 3 20  ? 3.740   20.506  55.020 1.00 69.82  ? 14  LYS D NZ    1 
ATOM   6616  N N     . GLY H 3 21  ? 4.775   12.122  56.531 1.00 52.24  ? 15  GLY D N     1 
ATOM   6617  C CA    . GLY H 3 21  ? 3.991   10.948  56.854 1.00 51.94  ? 15  GLY D CA    1 
ATOM   6618  C C     . GLY H 3 21  ? 3.795   9.965   55.737 1.00 49.32  ? 15  GLY D C     1 
ATOM   6619  O O     . GLY H 3 21  ? 4.257   10.172  54.606 1.00 47.64  ? 15  GLY D O     1 
ATOM   6620  N N     . GLU H 3 22  ? 3.082   8.890   56.067 1.00 49.58  ? 16  GLU D N     1 
ATOM   6621  C CA    . GLU H 3 22  ? 2.978   7.724   55.202 1.00 46.90  ? 16  GLU D CA    1 
ATOM   6622  C C     . GLU H 3 22  ? 2.233   7.997   53.887 1.00 45.48  ? 16  GLU D C     1 
ATOM   6623  O O     . GLU H 3 22  ? 1.238   8.723   53.861 1.00 47.22  ? 16  GLU D O     1 
ATOM   6624  C CB    . GLU H 3 22  ? 2.363   6.543   55.965 1.00 48.00  ? 16  GLU D CB    1 
ATOM   6625  C CG    . GLU H 3 22  ? 0.945   6.760   56.463 1.00 50.82  ? 16  GLU D CG    1 
ATOM   6626  C CD    . GLU H 3 22  ? 0.333   5.516   57.111 1.00 54.31  ? 16  GLU D CD    1 
ATOM   6627  O OE1   . GLU H 3 22  ? 1.068   4.562   57.490 1.00 54.11  ? 16  GLU D OE1   1 
ATOM   6628  O OE2   . GLU H 3 22  ? -0.905  5.500   57.251 1.00 56.84  ? 16  GLU D OE2   1 
ATOM   6629  N N     . LEU H 3 23  ? 2.743   7.407   52.810 1.00 42.66  ? 17  LEU D N     1 
ATOM   6630  C CA    . LEU H 3 23  ? 2.150   7.493   51.486 1.00 41.24  ? 17  LEU D CA    1 
ATOM   6631  C C     . LEU H 3 23  ? 2.320   6.145   50.811 1.00 39.75  ? 17  LEU D C     1 
ATOM   6632  O O     . LEU H 3 23  ? 3.256   5.414   51.121 1.00 39.01  ? 17  LEU D O     1 
ATOM   6633  C CB    . LEU H 3 23  ? 2.827   8.589   50.649 1.00 40.01  ? 17  LEU D CB    1 
ATOM   6634  C CG    . LEU H 3 23  ? 2.700   10.056  51.107 1.00 42.00  ? 17  LEU D CG    1 
ATOM   6635  C CD1   . LEU H 3 23  ? 3.466   11.004  50.177 1.00 39.94  ? 17  LEU D CD1   1 
ATOM   6636  C CD2   . LEU H 3 23  ? 1.250   10.496  51.256 1.00 41.95  ? 17  LEU D CD2   1 
ATOM   6637  N N     . SER H 3 24  ? 1.410   5.808   49.899 1.00 39.69  ? 18  SER D N     1 
ATOM   6638  C CA    . SER H 3 24  ? 1.593   4.630   49.054 1.00 38.55  ? 18  SER D CA    1 
ATOM   6639  C C     . SER H 3 24  ? 2.257   4.999   47.730 1.00 37.37  ? 18  SER D C     1 
ATOM   6640  O O     . SER H 3 24  ? 2.367   6.192   47.369 1.00 37.28  ? 18  SER D O     1 
ATOM   6641  C CB    . SER H 3 24  ? 0.245   3.998   48.748 1.00 39.55  ? 18  SER D CB    1 
ATOM   6642  O OG    . SER H 3 24  ? -0.459  4.820   47.845 1.00 40.45  ? 18  SER D OG    1 
ATOM   6643  N N     . GLY H 3 25  ? 2.664   3.972   46.988 1.00 36.59  ? 19  GLY D N     1 
ATOM   6644  C CA    . GLY H 3 25  ? 3.119   4.156   45.620 1.00 35.82  ? 19  GLY D CA    1 
ATOM   6645  C C     . GLY H 3 25  ? 2.140   4.978   44.797 1.00 36.59  ? 19  GLY D C     1 
ATOM   6646  O O     . GLY H 3 25  ? 2.553   5.851   44.040 1.00 36.42  ? 19  GLY D O     1 
ATOM   6647  N N     . TYR H 3 26  ? 0.841   4.701   44.946 1.00 37.53  ? 20  TYR D N     1 
ATOM   6648  C CA    . TYR H 3 26  ? -0.186  5.418   44.193 1.00 38.83  ? 20  TYR D CA    1 
ATOM   6649  C C     . TYR H 3 26  ? -0.243  6.907   44.586 1.00 39.43  ? 20  TYR D C     1 
ATOM   6650  O O     . TYR H 3 26  ? -0.363  7.770   43.714 1.00 40.04  ? 20  TYR D O     1 
ATOM   6651  C CB    . TYR H 3 26  ? -1.548  4.730   44.343 1.00 40.10  ? 20  TYR D CB    1 
ATOM   6652  C CG    . TYR H 3 26  ? -2.607  5.182   43.350 1.00 41.65  ? 20  TYR D CG    1 
ATOM   6653  C CD1   . TYR H 3 26  ? -2.540  4.811   41.993 1.00 41.39  ? 20  TYR D CD1   1 
ATOM   6654  C CD2   . TYR H 3 26  ? -3.687  5.968   43.763 1.00 43.30  ? 20  TYR D CD2   1 
ATOM   6655  C CE1   . TYR H 3 26  ? -3.506  5.222   41.081 1.00 42.29  ? 20  TYR D CE1   1 
ATOM   6656  C CE2   . TYR H 3 26  ? -4.666  6.379   42.850 1.00 45.51  ? 20  TYR D CE2   1 
ATOM   6657  C CZ    . TYR H 3 26  ? -4.565  6.005   41.512 1.00 44.88  ? 20  TYR D CZ    1 
ATOM   6658  O OH    . TYR H 3 26  ? -5.534  6.409   40.620 1.00 46.44  ? 20  TYR D OH    1 
ATOM   6659  N N     . ASP H 3 27  ? -0.122  7.189   45.886 1.00 39.62  ? 21  ASP D N     1 
ATOM   6660  C CA    . ASP H 3 27  ? -0.074  8.559   46.412 1.00 40.94  ? 21  ASP D CA    1 
ATOM   6661  C C     . ASP H 3 27  ? 1.078   9.343   45.805 1.00 40.14  ? 21  ASP D C     1 
ATOM   6662  O O     . ASP H 3 27  ? 0.886   10.463  45.308 1.00 41.29  ? 21  ASP D O     1 
ATOM   6663  C CB    . ASP H 3 27  ? 0.112   8.555   47.930 1.00 41.65  ? 21  ASP D CB    1 
ATOM   6664  C CG    . ASP H 3 27  ? -1.139  8.150   48.683 1.00 44.36  ? 21  ASP D CG    1 
ATOM   6665  O OD1   . ASP H 3 27  ? -2.246  8.481   48.207 1.00 45.28  ? 21  ASP D OD1   1 
ATOM   6666  O OD2   . ASP H 3 27  ? -1.002  7.518   49.767 1.00 45.37  ? 21  ASP D OD2   1 
ATOM   6667  N N     . ILE H 3 28  ? 2.267   8.741   45.866 1.00 38.29  ? 22  ILE D N     1 
ATOM   6668  C CA    . ILE H 3 28  ? 3.461   9.295   45.262 1.00 37.66  ? 22  ILE D CA    1 
ATOM   6669  C C     . ILE H 3 28  ? 3.193   9.602   43.796 1.00 38.55  ? 22  ILE D C     1 
ATOM   6670  O O     . ILE H 3 28  ? 3.310   10.762  43.372 1.00 39.92  ? 22  ILE D O     1 
ATOM   6671  C CB    . ILE H 3 28  ? 4.684   8.361   45.444 1.00 36.30  ? 22  ILE D CB    1 
ATOM   6672  C CG1   . ILE H 3 28  ? 5.208   8.463   46.867 1.00 35.65  ? 22  ILE D CG1   1 
ATOM   6673  C CG2   . ILE H 3 28  ? 5.804   8.740   44.499 1.00 35.96  ? 22  ILE D CG2   1 
ATOM   6674  C CD1   . ILE H 3 28  ? 5.613   7.136   47.468 1.00 37.05  ? 22  ILE D CD1   1 
ATOM   6675  N N     . THR H 3 29  ? 2.790   8.590   43.035 1.00 38.29  ? 23  THR D N     1 
ATOM   6676  C CA    . THR H 3 29  ? 2.470   8.789   41.618 1.00 39.40  ? 23  THR D CA    1 
ATOM   6677  C C     . THR H 3 29  ? 1.543   9.993   41.393 1.00 41.49  ? 23  THR D C     1 
ATOM   6678  O O     . THR H 3 29  ? 1.764   10.775  40.466 1.00 42.61  ? 23  THR D O     1 
ATOM   6679  C CB    . THR H 3 29  ? 1.886   7.502   40.978 1.00 39.69  ? 23  THR D CB    1 
ATOM   6680  O OG1   . THR H 3 29  ? 2.802   6.418   41.186 1.00 38.80  ? 23  THR D OG1   1 
ATOM   6681  C CG2   . THR H 3 29  ? 1.646   7.678   39.469 1.00 39.54  ? 23  THR D CG2   1 
ATOM   6682  N N     . SER H 3 30  ? 0.528   10.150  42.245 1.00 42.60  ? 24  SER D N     1 
ATOM   6683  C CA    . SER H 3 30  ? -0.376  11.302  42.154 1.00 45.63  ? 24  SER D CA    1 
ATOM   6684  C C     . SER H 3 30  ? 0.322   12.642  42.366 1.00 46.18  ? 24  SER D C     1 
ATOM   6685  O O     . SER H 3 30  ? 0.017   13.614  41.664 1.00 48.11  ? 24  SER D O     1 
ATOM   6686  C CB    . SER H 3 30  ? -1.549  11.188  43.124 1.00 47.04  ? 24  SER D CB    1 
ATOM   6687  O OG    . SER H 3 30  ? -2.478  10.212  42.676 1.00 50.29  ? 24  SER D OG    1 
ATOM   6688  N N     . TYR H 3 31  ? 1.259   12.692  43.313 1.00 44.87  ? 25  TYR D N     1 
ATOM   6689  C CA    . TYR H 3 31  ? 1.942   13.948  43.620 1.00 46.18  ? 25  TYR D CA    1 
ATOM   6690  C C     . TYR H 3 31  ? 2.761   14.419  42.429 1.00 46.33  ? 25  TYR D C     1 
ATOM   6691  O O     . TYR H 3 31  ? 2.804   15.608  42.137 1.00 48.50  ? 25  TYR D O     1 
ATOM   6692  C CB    . TYR H 3 31  ? 2.808   13.835  44.874 1.00 44.97  ? 25  TYR D CB    1 
ATOM   6693  C CG    . TYR H 3 31  ? 2.063   14.137  46.152 1.00 47.22  ? 25  TYR D CG    1 
ATOM   6694  C CD1   . TYR H 3 31  ? 1.703   15.460  46.480 1.00 50.87  ? 25  TYR D CD1   1 
ATOM   6695  C CD2   . TYR H 3 31  ? 1.719   13.115  47.044 1.00 46.19  ? 25  TYR D CD2   1 
ATOM   6696  C CE1   . TYR H 3 31  ? 1.017   15.759  47.660 1.00 52.38  ? 25  TYR D CE1   1 
ATOM   6697  C CE2   . TYR H 3 31  ? 1.031   13.398  48.232 1.00 49.14  ? 25  TYR D CE2   1 
ATOM   6698  C CZ    . TYR H 3 31  ? 0.681   14.724  48.530 1.00 52.99  ? 25  TYR D CZ    1 
ATOM   6699  O OH    . TYR H 3 31  ? 0.004   15.018  49.695 1.00 56.70  ? 25  TYR D OH    1 
ATOM   6700  N N     . PHE H 3 32  ? 3.385   13.478  41.729 1.00 44.86  ? 26  PHE D N     1 
ATOM   6701  C CA    . PHE H 3 32  ? 4.123   13.795  40.513 1.00 45.50  ? 26  PHE D CA    1 
ATOM   6702  C C     . PHE H 3 32  ? 3.224   14.349  39.419 1.00 47.95  ? 26  PHE D C     1 
ATOM   6703  O O     . PHE H 3 32  ? 3.682   15.127  38.588 1.00 49.53  ? 26  PHE D O     1 
ATOM   6704  C CB    . PHE H 3 32  ? 4.928   12.588  40.019 1.00 43.91  ? 26  PHE D CB    1 
ATOM   6705  C CG    . PHE H 3 32  ? 6.165   12.318  40.834 1.00 41.86  ? 26  PHE D CG    1 
ATOM   6706  C CD1   . PHE H 3 32  ? 7.166   13.271  40.943 1.00 42.62  ? 26  PHE D CD1   1 
ATOM   6707  C CD2   . PHE H 3 32  ? 6.329   11.114  41.491 1.00 40.95  ? 26  PHE D CD2   1 
ATOM   6708  C CE1   . PHE H 3 32  ? 8.306   13.024  41.708 1.00 42.22  ? 26  PHE D CE1   1 
ATOM   6709  C CE2   . PHE H 3 32  ? 7.470   10.854  42.263 1.00 39.33  ? 26  PHE D CE2   1 
ATOM   6710  C CZ    . PHE H 3 32  ? 8.453   11.804  42.365 1.00 39.96  ? 26  PHE D CZ    1 
ATOM   6711  N N     . LYS H 3 33  ? 1.949   13.956  39.427 1.00 48.86  ? 27  LYS D N     1 
ATOM   6712  C CA    . LYS H 3 33  ? 0.956   14.516  38.495 1.00 51.76  ? 27  LYS D CA    1 
ATOM   6713  C C     . LYS H 3 33  ? 0.463   15.922  38.855 1.00 54.39  ? 27  LYS D C     1 
ATOM   6714  O O     . LYS H 3 33  ? -0.127  16.597  38.016 1.00 56.90  ? 27  LYS D O     1 
ATOM   6715  C CB    . LYS H 3 33  ? -0.247  13.583  38.363 1.00 51.95  ? 27  LYS D CB    1 
ATOM   6716  C CG    . LYS H 3 33  ? -0.096  12.569  37.269 1.00 52.26  ? 27  LYS D CG    1 
ATOM   6717  C CD    . LYS H 3 33  ? -0.919  11.315  37.517 1.00 52.47  ? 27  LYS D CD    1 
ATOM   6718  C CE    . LYS H 3 33  ? -0.429  10.205  36.591 1.00 53.58  ? 27  LYS D CE    1 
ATOM   6719  N NZ    . LYS H 3 33  ? -0.826  8.840   37.074 1.00 55.29  ? 27  LYS D NZ    1 
ATOM   6720  N N     . GLU H 3 34  ? 0.685   16.349  40.094 1.00 54.30  ? 28  GLU D N     1 
ATOM   6721  C CA    . GLU H 3 34  ? 0.154   17.621  40.561 1.00 58.14  ? 28  GLU D CA    1 
ATOM   6722  C C     . GLU H 3 34  ? 1.139   18.764  40.318 1.00 59.54  ? 28  GLU D C     1 
ATOM   6723  O O     . GLU H 3 34  ? 1.631   18.912  39.197 1.00 60.63  ? 28  GLU D O     1 
ATOM   6724  C CB    . GLU H 3 34  ? -0.292  17.541  42.024 1.00 58.45  ? 28  GLU D CB    1 
ATOM   6725  C CG    . GLU H 3 34  ? -1.403  16.520  42.297 1.00 59.94  ? 28  GLU D CG    1 
ATOM   6726  C CD    . GLU H 3 34  ? -2.755  16.911  41.706 1.00 67.05  ? 28  GLU D CD    1 
ATOM   6727  O OE1   . GLU H 3 34  ? -3.548  15.982  41.436 1.00 67.78  ? 28  GLU D OE1   1 
ATOM   6728  O OE2   . GLU H 3 34  ? -3.036  18.128  41.520 1.00 71.43  ? 28  GLU D OE2   1 
ATOM   6729  N N     . GLU H 3 35  ? 1.417   19.585  41.331 1.00 60.57  ? 29  GLU D N     1 
ATOM   6730  C CA    . GLU H 3 35  ? 2.213   20.802  41.087 1.00 62.44  ? 29  GLU D CA    1 
ATOM   6731  C C     . GLU H 3 35  ? 3.715   20.506  40.990 1.00 59.47  ? 29  GLU D C     1 
ATOM   6732  O O     . GLU H 3 35  ? 4.450   21.217  40.298 1.00 60.70  ? 29  GLU D O     1 
ATOM   6733  C CB    . GLU H 3 35  ? 1.900   21.936  42.082 1.00 65.40  ? 29  GLU D CB    1 
ATOM   6734  C CG    . GLU H 3 35  ? 2.334   21.668  43.528 1.00 65.61  ? 29  GLU D CG    1 
ATOM   6735  C CD    . GLU H 3 35  ? 1.243   21.028  44.378 1.00 67.06  ? 29  GLU D CD    1 
ATOM   6736  O OE1   . GLU H 3 35  ? 0.057   21.072  43.957 1.00 69.45  ? 29  GLU D OE1   1 
ATOM   6737  O OE2   . GLU H 3 35  ? 1.574   20.503  45.472 1.00 65.45  ? 29  GLU D OE2   1 
ATOM   6738  N N     . LEU H 3 36  ? 4.153   19.439  41.651 1.00 55.68  ? 30  LEU D N     1 
ATOM   6739  C CA    . LEU H 3 36  ? 5.525   18.962  41.488 1.00 53.51  ? 30  LEU D CA    1 
ATOM   6740  C C     . LEU H 3 36  ? 5.796   18.580  40.020 1.00 52.88  ? 30  LEU D C     1 
ATOM   6741  O O     . LEU H 3 36  ? 6.933   18.639  39.535 1.00 52.92  ? 30  LEU D O     1 
ATOM   6742  C CB    . LEU H 3 36  ? 5.807   17.779  42.428 1.00 50.59  ? 30  LEU D CB    1 
ATOM   6743  C CG    . LEU H 3 36  ? 7.284   17.492  42.718 1.00 50.02  ? 30  LEU D CG    1 
ATOM   6744  C CD1   . LEU H 3 36  ? 7.991   18.720  43.309 1.00 52.05  ? 30  LEU D CD1   1 
ATOM   6745  C CD2   . LEU H 3 36  ? 7.469   16.265  43.624 1.00 47.70  ? 30  LEU D CD2   1 
ATOM   6746  N N     . GLY H 3 37  ? 4.733   18.215  39.315 1.00 52.54  ? 31  GLY D N     1 
ATOM   6747  C CA    . GLY H 3 37  ? 4.806   17.905  37.896 1.00 52.70  ? 31  GLY D CA    1 
ATOM   6748  C C     . GLY H 3 37  ? 5.507   18.918  37.018 1.00 55.13  ? 31  GLY D C     1 
ATOM   6749  O O     . GLY H 3 37  ? 6.057   18.542  35.993 1.00 55.72  ? 31  GLY D O     1 
ATOM   6750  N N     . GLN H 3 38  ? 5.490   20.197  37.402 1.00 57.14  ? 32  GLN D N     1 
ATOM   6751  C CA    . GLN H 3 38  ? 6.176   21.252  36.640 1.00 59.76  ? 32  GLN D CA    1 
ATOM   6752  C C     . GLN H 3 38  ? 7.696   21.090  36.654 1.00 58.70  ? 32  GLN D C     1 
ATOM   6753  O O     . GLN H 3 38  ? 8.373   21.552  35.734 1.00 60.85  ? 32  GLN D O     1 
ATOM   6754  C CB    . GLN H 3 38  ? 5.871   22.658  37.197 1.00 63.10  ? 32  GLN D CB    1 
ATOM   6755  C CG    . GLN H 3 38  ? 4.433   23.140  37.157 1.00 65.45  ? 32  GLN D CG    1 
ATOM   6756  C CD    . GLN H 3 38  ? 3.956   23.460  35.765 1.00 68.42  ? 32  GLN D CD    1 
ATOM   6757  O OE1   . GLN H 3 38  ? 4.533   24.292  35.060 1.00 70.75  ? 32  GLN D OE1   1 
ATOM   6758  N NE2   . GLN H 3 38  ? 2.887   22.797  35.357 1.00 68.81  ? 32  GLN D NE2   1 
ATOM   6759  N N     . PHE H 3 39  ? 8.226   20.460  37.704 1.00 55.63  ? 33  PHE D N     1 
ATOM   6760  C CA    . PHE H 3 39  ? 9.671   20.445  37.956 1.00 55.44  ? 33  PHE D CA    1 
ATOM   6761  C C     . PHE H 3 39  ? 10.319  19.061  38.076 1.00 52.98  ? 33  PHE D C     1 
ATOM   6762  O O     . PHE H 3 39  ? 11.543  18.930  37.981 1.00 53.40  ? 33  PHE D O     1 
ATOM   6763  C CB    . PHE H 3 39  ? 9.981   21.279  39.198 1.00 55.79  ? 33  PHE D CB    1 
ATOM   6764  C CG    . PHE H 3 39  ? 9.531   22.691  39.077 1.00 59.29  ? 33  PHE D CG    1 
ATOM   6765  C CD1   . PHE H 3 39  ? 8.316   23.090  39.608 1.00 59.66  ? 33  PHE D CD1   1 
ATOM   6766  C CD2   . PHE H 3 39  ? 10.295  23.621  38.380 1.00 61.68  ? 33  PHE D CD2   1 
ATOM   6767  C CE1   . PHE H 3 39  ? 7.883   24.394  39.465 1.00 62.53  ? 33  PHE D CE1   1 
ATOM   6768  C CE2   . PHE H 3 39  ? 9.871   24.915  38.242 1.00 64.71  ? 33  PHE D CE2   1 
ATOM   6769  C CZ    . PHE H 3 39  ? 8.664   25.305  38.788 1.00 65.97  ? 33  PHE D CZ    1 
ATOM   6770  N N     . TRP H 3 40  ? 9.515   18.037  38.324 1.00 50.74  ? 34  TRP D N     1 
ATOM   6771  C CA    . TRP H 3 40  ? 10.013  16.668  38.258 1.00 49.31  ? 34  TRP D CA    1 
ATOM   6772  C C     . TRP H 3 40  ? 8.849   15.770  37.940 1.00 48.30  ? 34  TRP D C     1 
ATOM   6773  O O     . TRP H 3 40  ? 7.723   16.045  38.366 1.00 48.72  ? 34  TRP D O     1 
ATOM   6774  C CB    . TRP H 3 40  ? 10.726  16.210  39.538 1.00 47.59  ? 34  TRP D CB    1 
ATOM   6775  C CG    . TRP H 3 40  ? 11.764  15.152  39.211 1.00 48.64  ? 34  TRP D CG    1 
ATOM   6776  C CD1   . TRP H 3 40  ? 11.591  13.782  39.211 1.00 47.56  ? 34  TRP D CD1   1 
ATOM   6777  C CD2   . TRP H 3 40  ? 13.113  15.382  38.784 1.00 50.91  ? 34  TRP D CD2   1 
ATOM   6778  N NE1   . TRP H 3 40  ? 12.753  13.159  38.814 1.00 49.31  ? 34  TRP D NE1   1 
ATOM   6779  C CE2   . TRP H 3 40  ? 13.700  14.117  38.547 1.00 51.33  ? 34  TRP D CE2   1 
ATOM   6780  C CE3   . TRP H 3 40  ? 13.887  16.539  38.584 1.00 54.11  ? 34  TRP D CE3   1 
ATOM   6781  C CZ2   . TRP H 3 40  ? 15.023  13.978  38.117 1.00 53.67  ? 34  TRP D CZ2   1 
ATOM   6782  C CZ3   . TRP H 3 40  ? 15.206  16.400  38.162 1.00 55.55  ? 34  TRP D CZ3   1 
ATOM   6783  C CH2   . TRP H 3 40  ? 15.758  15.129  37.932 1.00 55.93  ? 34  TRP D CH2   1 
ATOM   6784  N N     . SER H 3 41  ? 9.103   14.725  37.159 1.00 47.68  ? 35  SER D N     1 
ATOM   6785  C CA    . SER H 3 41  ? 8.063   13.758  36.870 1.00 47.01  ? 35  SER D CA    1 
ATOM   6786  C C     . SER H 3 41  ? 8.580   12.333  36.995 1.00 45.40  ? 35  SER D C     1 
ATOM   6787  O O     . SER H 3 41  ? 9.767   12.070  36.810 1.00 46.23  ? 35  SER D O     1 
ATOM   6788  C CB    . SER H 3 41  ? 7.545   13.962  35.460 1.00 49.63  ? 35  SER D CB    1 
ATOM   6789  O OG    . SER H 3 41  ? 8.541   13.571  34.513 1.00 52.24  ? 35  SER D OG    1 
ATOM   6790  N N     . ALA H 3 42  ? 7.665   11.414  37.274 1.00 43.56  ? 36  ALA D N     1 
ATOM   6791  C CA    . ALA H 3 42  ? 7.972   10.005  37.354 1.00 41.85  ? 36  ALA D CA    1 
ATOM   6792  C C     . ALA H 3 42  ? 6.670   9.234   37.229 1.00 41.39  ? 36  ALA D C     1 
ATOM   6793  O O     . ALA H 3 42  ? 5.651   9.631   37.775 1.00 40.92  ? 36  ALA D O     1 
ATOM   6794  C CB    . ALA H 3 42  ? 8.658   9.698   38.639 1.00 40.05  ? 36  ALA D CB    1 
ATOM   6795  N N     . LYS H 3 43  ? 6.706   8.143   36.478 1.00 42.34  ? 37  LYS D N     1 
ATOM   6796  C CA    . LYS H 3 43  ? 5.543   7.291   36.297 1.00 42.21  ? 37  LYS D CA    1 
ATOM   6797  C C     . LYS H 3 43  ? 5.537   6.155   37.317 1.00 40.73  ? 37  LYS D C     1 
ATOM   6798  O O     . LYS H 3 43  ? 6.565   5.851   37.948 1.00 39.70  ? 37  LYS D O     1 
ATOM   6799  C CB    . LYS H 3 43  ? 5.541   6.705   34.892 1.00 44.85  ? 37  LYS D CB    1 
ATOM   6800  C CG    . LYS H 3 43  ? 5.679   7.714   33.754 1.00 47.29  ? 37  LYS D CG    1 
ATOM   6801  C CD    . LYS H 3 43  ? 4.394   8.443   33.506 1.00 49.62  ? 37  LYS D CD    1 
ATOM   6802  C CE    . LYS H 3 43  ? 4.542   9.469   32.386 1.00 53.97  ? 37  LYS D CE    1 
ATOM   6803  N NZ    . LYS H 3 43  ? 3.585   10.581  32.621 1.00 54.13  ? 37  LYS D NZ    1 
ATOM   6804  N N     . HIS H 3 44  ? 4.379   5.509   37.461 1.00 40.50  ? 38  HIS D N     1 
ATOM   6805  C CA    . HIS H 3 44  ? 4.240   4.408   38.412 1.00 38.84  ? 38  HIS D CA    1 
ATOM   6806  C C     . HIS H 3 44  ? 5.196   3.268   38.090 1.00 39.66  ? 38  HIS D C     1 
ATOM   6807  O O     . HIS H 3 44  ? 5.639   2.559   38.990 1.00 40.22  ? 38  HIS D O     1 
ATOM   6808  C CB    . HIS H 3 44  ? 2.790   3.908   38.494 1.00 38.88  ? 38  HIS D CB    1 
ATOM   6809  C CG    . HIS H 3 44  ? 2.469   2.816   37.522 1.00 40.50  ? 38  HIS D CG    1 
ATOM   6810  N ND1   . HIS H 3 44  ? 1.908   3.059   36.287 1.00 41.61  ? 38  HIS D ND1   1 
ATOM   6811  C CD2   . HIS H 3 44  ? 2.641   1.474   37.599 1.00 41.38  ? 38  HIS D CD2   1 
ATOM   6812  C CE1   . HIS H 3 44  ? 1.751   1.918   35.642 1.00 44.33  ? 38  HIS D CE1   1 
ATOM   6813  N NE2   . HIS H 3 44  ? 2.184   0.938   36.417 1.00 44.27  ? 38  HIS D NE2   1 
ATOM   6814  N N     . SER H 3 45  ? 5.526   3.094   36.819 1.00 41.47  ? 39  SER D N     1 
ATOM   6815  C CA    . SER H 3 45  ? 6.390   1.995   36.397 1.00 43.03  ? 39  SER D CA    1 
ATOM   6816  C C     . SER H 3 45  ? 7.821   2.166   36.905 1.00 42.82  ? 39  SER D C     1 
ATOM   6817  O O     . SER H 3 45  ? 8.581   1.196   36.989 1.00 43.99  ? 39  SER D O     1 
ATOM   6818  C CB    . SER H 3 45  ? 6.369   1.841   34.869 1.00 45.43  ? 39  SER D CB    1 
ATOM   6819  O OG    . SER H 3 45  ? 7.168   2.817   34.235 1.00 46.81  ? 39  SER D OG    1 
ATOM   6820  N N     . GLN H 3 46  ? 8.176   3.408   37.232 1.00 41.97  ? 40  GLN D N     1 
ATOM   6821  C CA    . GLN H 3 46  ? 9.473   3.725   37.799 1.00 42.21  ? 40  GLN D CA    1 
ATOM   6822  C C     . GLN H 3 46  ? 9.430   3.776   39.329 1.00 40.36  ? 40  GLN D C     1 
ATOM   6823  O O     . GLN H 3 46  ? 10.391  3.408   40.005 1.00 41.09  ? 40  GLN D O     1 
ATOM   6824  C CB    . GLN H 3 46  ? 9.927   5.064   37.277 1.00 42.93  ? 40  GLN D CB    1 
ATOM   6825  C CG    . GLN H 3 46  ? 11.384  5.127   37.003 1.00 45.86  ? 40  GLN D CG    1 
ATOM   6826  C CD    . GLN H 3 46  ? 11.815  6.480   36.496 1.00 48.79  ? 40  GLN D CD    1 
ATOM   6827  O OE1   . GLN H 3 46  ? 11.018  7.261   35.914 1.00 49.37  ? 40  GLN D OE1   1 
ATOM   6828  N NE2   . GLN H 3 46  ? 13.099  6.771   36.692 1.00 50.87  ? 40  GLN D NE2   1 
ATOM   6829  N N     . ILE H 3 47  ? 8.305   4.223   39.871 1.00 38.74  ? 41  ILE D N     1 
ATOM   6830  C CA    . ILE H 3 47  ? 8.163   4.415   41.304 1.00 37.08  ? 41  ILE D CA    1 
ATOM   6831  C C     . ILE H 3 47  ? 8.134   3.083   42.083 1.00 37.40  ? 41  ILE D C     1 
ATOM   6832  O O     . ILE H 3 47  ? 8.793   2.957   43.122 1.00 37.34  ? 41  ILE D O     1 
ATOM   6833  C CB    . ILE H 3 47  ? 6.950   5.336   41.611 1.00 35.81  ? 41  ILE D CB    1 
ATOM   6834  C CG1   . ILE H 3 47  ? 7.276   6.762   41.172 1.00 36.42  ? 41  ILE D CG1   1 
ATOM   6835  C CG2   . ILE H 3 47  ? 6.598   5.321   43.078 1.00 34.00  ? 41  ILE D CG2   1 
ATOM   6836  C CD1   . ILE H 3 47  ? 6.068   7.638   40.948 1.00 37.66  ? 41  ILE D CD1   1 
ATOM   6837  N N     . TYR H 3 48  ? 7.403   2.082   41.592 1.00 38.01  ? 42  TYR D N     1 
ATOM   6838  C CA    . TYR H 3 48  ? 7.323   0.807   42.353 1.00 38.07  ? 42  TYR D CA    1 
ATOM   6839  C C     . TYR H 3 48  ? 8.652   0.104   42.551 1.00 39.30  ? 42  TYR D C     1 
ATOM   6840  O O     . TYR H 3 48  ? 8.952   -0.282  43.668 1.00 39.70  ? 42  TYR D O     1 
ATOM   6841  C CB    . TYR H 3 48  ? 6.266   -0.151  41.801 1.00 38.50  ? 42  TYR D CB    1 
ATOM   6842  C CG    . TYR H 3 48  ? 4.895   0.334   42.126 1.00 37.10  ? 42  TYR D CG    1 
ATOM   6843  C CD1   . TYR H 3 48  ? 4.474   0.430   43.449 1.00 33.74  ? 42  TYR D CD1   1 
ATOM   6844  C CD2   . TYR H 3 48  ? 4.030   0.759   41.120 1.00 36.19  ? 42  TYR D CD2   1 
ATOM   6845  C CE1   . TYR H 3 48  ? 3.215   0.910   43.759 1.00 34.52  ? 42  TYR D CE1   1 
ATOM   6846  C CE2   . TYR H 3 48  ? 2.757   1.234   41.427 1.00 36.26  ? 42  TYR D CE2   1 
ATOM   6847  C CZ    . TYR H 3 48  ? 2.358   1.309   42.749 1.00 35.45  ? 42  TYR D CZ    1 
ATOM   6848  O OH    . TYR H 3 48  ? 1.099   1.783   43.063 1.00 36.60  ? 42  TYR D OH    1 
ATOM   6849  N N     . PRO H 3 49  ? 9.454   -0.064  41.482 1.00 41.20  ? 43  PRO D N     1 
ATOM   6850  C CA    . PRO H 3 49  ? 10.764  -0.653  41.726 1.00 43.10  ? 43  PRO D CA    1 
ATOM   6851  C C     . PRO H 3 49  ? 11.639  0.211   42.621 1.00 42.64  ? 43  PRO D C     1 
ATOM   6852  O O     . PRO H 3 49  ? 12.409  -0.325  43.404 1.00 44.16  ? 43  PRO D O     1 
ATOM   6853  C CB    . PRO H 3 49  ? 11.362  -0.776  40.318 1.00 45.14  ? 43  PRO D CB    1 
ATOM   6854  C CG    . PRO H 3 49  ? 10.165  -0.936  39.439 1.00 45.15  ? 43  PRO D CG    1 
ATOM   6855  C CD    . PRO H 3 49  ? 9.195   0.061   40.033 1.00 42.53  ? 43  PRO D CD    1 
ATOM   6856  N N     . GLU H 3 50  ? 11.495  1.528   42.545 1.00 41.56  ? 44  GLU D N     1 
ATOM   6857  C CA    . GLU H 3 50  ? 12.285  2.411   43.385 1.00 41.44  ? 44  GLU D CA    1 
ATOM   6858  C C     . GLU H 3 50  ? 11.861  2.291   44.856 1.00 40.49  ? 44  GLU D C     1 
ATOM   6859  O O     . GLU H 3 50  ? 12.691  2.328   45.766 1.00 41.49  ? 44  GLU D O     1 
ATOM   6860  C CB    . GLU H 3 50  ? 12.212  3.851   42.872 1.00 40.69  ? 44  GLU D CB    1 
ATOM   6861  C CG    . GLU H 3 50  ? 13.147  4.838   43.572 1.00 42.59  ? 44  GLU D CG    1 
ATOM   6862  C CD    . GLU H 3 50  ? 14.629  4.556   43.332 1.00 47.58  ? 44  GLU D CD    1 
ATOM   6863  O OE1   . GLU H 3 50  ? 14.981  3.895   42.326 1.00 50.55  ? 44  GLU D OE1   1 
ATOM   6864  O OE2   . GLU H 3 50  ? 15.452  4.998   44.162 1.00 49.64  ? 44  GLU D OE2   1 
ATOM   6865  N N     . LEU H 3 51  ? 10.573  2.109   45.099 1.00 39.40  ? 45  LEU D N     1 
ATOM   6866  C CA    . LEU H 3 51  ? 10.116  1.876   46.463 1.00 39.04  ? 45  LEU D CA    1 
ATOM   6867  C C     . LEU H 3 51  ? 10.744  0.611   47.045 1.00 40.82  ? 45  LEU D C     1 
ATOM   6868  O O     . LEU H 3 51  ? 11.107  0.568   48.226 1.00 41.49  ? 45  LEU D O     1 
ATOM   6869  C CB    . LEU H 3 51  ? 8.591   1.821   46.526 1.00 37.83  ? 45  LEU D CB    1 
ATOM   6870  C CG    . LEU H 3 51  ? 7.986   3.224   46.346 1.00 37.04  ? 45  LEU D CG    1 
ATOM   6871  C CD1   . LEU H 3 51  ? 6.491   3.181   46.111 1.00 35.41  ? 45  LEU D CD1   1 
ATOM   6872  C CD2   . LEU H 3 51  ? 8.306   4.085   47.558 1.00 37.21  ? 45  LEU D CD2   1 
ATOM   6873  N N     . LYS H 3 52  ? 10.901  -0.413  46.216 1.00 41.82  ? 46  LYS D N     1 
ATOM   6874  C CA    . LYS H 3 52  ? 11.479  -1.650  46.704 1.00 44.02  ? 46  LYS D CA    1 
ATOM   6875  C C     . LYS H 3 52  ? 12.959  -1.460  47.016 1.00 45.77  ? 46  LYS D C     1 
ATOM   6876  O O     . LYS H 3 52  ? 13.460  -1.975  48.017 1.00 47.70  ? 46  LYS D O     1 
ATOM   6877  C CB    . LYS H 3 52  ? 11.288  -2.785  45.695 1.00 45.67  ? 46  LYS D CB    1 
ATOM   6878  C CG    . LYS H 3 52  ? 11.718  -4.124  46.212 1.00 47.40  ? 46  LYS D CG    1 
ATOM   6879  C CD    . LYS H 3 52  ? 11.842  -5.115  45.076 1.00 52.12  ? 46  LYS D CD    1 
ATOM   6880  C CE    . LYS H 3 52  ? 12.570  -6.407  45.507 1.00 56.89  ? 46  LYS D CE    1 
ATOM   6881  N NZ    . LYS H 3 52  ? 12.051  -6.951  46.801 1.00 56.64  ? 46  LYS D NZ    1 
ATOM   6882  N N     . LYS H 3 53  ? 13.654  -0.730  46.153 1.00 45.41  ? 47  LYS D N     1 
ATOM   6883  C CA    . LYS H 3 53  ? 15.077  -0.562  46.300 1.00 47.37  ? 47  LYS D CA    1 
ATOM   6884  C C     . LYS H 3 53  ? 15.391  0.256   47.556 1.00 46.86  ? 47  LYS D C     1 
ATOM   6885  O O     . LYS H 3 53  ? 16.311  -0.071  48.295 1.00 49.06  ? 47  LYS D O     1 
ATOM   6886  C CB    . LYS H 3 53  ? 15.659  0.071   45.045 1.00 48.05  ? 47  LYS D CB    1 
ATOM   6887  C CG    . LYS H 3 53  ? 17.131  -0.109  44.911 1.00 52.17  ? 47  LYS D CG    1 
ATOM   6888  C CD    . LYS H 3 53  ? 17.705  0.724   43.772 1.00 55.59  ? 47  LYS D CD    1 
ATOM   6889  C CE    . LYS H 3 53  ? 19.213  0.883   43.954 1.00 60.68  ? 47  LYS D CE    1 
ATOM   6890  N NZ    . LYS H 3 53  ? 19.907  1.412   42.749 1.00 64.24  ? 47  LYS D NZ    1 
ATOM   6891  N N     . LEU H 3 54  ? 14.613  1.304   47.803 1.00 44.59  ? 48  LEU D N     1 
ATOM   6892  C CA    . LEU H 3 54  ? 14.785  2.128   48.993 1.00 44.49  ? 48  LEU D CA    1 
ATOM   6893  C C     . LEU H 3 54  ? 14.452  1.349   50.271 1.00 45.69  ? 48  LEU D C     1 
ATOM   6894  O O     . LEU H 3 54  ? 14.990  1.625   51.347 1.00 47.14  ? 48  LEU D O     1 
ATOM   6895  C CB    . LEU H 3 54  ? 13.931  3.398   48.895 1.00 42.30  ? 48  LEU D CB    1 
ATOM   6896  C CG    . LEU H 3 54  ? 14.251  4.460   47.823 1.00 41.21  ? 48  LEU D CG    1 
ATOM   6897  C CD1   . LEU H 3 54  ? 13.251  5.586   47.886 1.00 37.65  ? 48  LEU D CD1   1 
ATOM   6898  C CD2   . LEU H 3 54  ? 15.648  5.009   47.984 1.00 42.47  ? 48  LEU D CD2   1 
ATOM   6899  N N     . THR H 3 55  ? 13.559  0.379   50.144 1.00 45.41  ? 49  THR D N     1 
ATOM   6900  C CA    . THR H 3 55  ? 13.217  -0.503  51.242 1.00 46.84  ? 49  THR D CA    1 
ATOM   6901  C C     . THR H 3 55  ? 14.384  -1.450  51.565 1.00 50.13  ? 49  THR D C     1 
ATOM   6902  O O     . THR H 3 55  ? 14.725  -1.624  52.737 1.00 51.72  ? 49  THR D O     1 
ATOM   6903  C CB    . THR H 3 55  ? 11.924  -1.305  50.930 1.00 46.22  ? 49  THR D CB    1 
ATOM   6904  O OG1   . THR H 3 55  ? 10.842  -0.390  50.685 1.00 44.08  ? 49  THR D OG1   1 
ATOM   6905  C CG2   . THR H 3 55  ? 11.567  -2.260  52.076 1.00 45.90  ? 49  THR D CG2   1 
ATOM   6906  N N     . ASP H 3 56  ? 14.977  -2.052  50.528 1.00 51.59  ? 50  ASP D N     1 
ATOM   6907  C CA    . ASP H 3 56  ? 16.206  -2.867  50.646 1.00 55.54  ? 50  ASP D CA    1 
ATOM   6908  C C     . ASP H 3 56  ? 17.408  -2.089  51.184 1.00 56.66  ? 50  ASP D C     1 
ATOM   6909  O O     . ASP H 3 56  ? 18.218  -2.628  51.931 1.00 59.36  ? 50  ASP D O     1 
ATOM   6910  C CB    . ASP H 3 56  ? 16.592  -3.462  49.288 1.00 57.20  ? 50  ASP D CB    1 
ATOM   6911  C CG    . ASP H 3 56  ? 15.710  -4.635  48.883 1.00 59.97  ? 50  ASP D CG    1 
ATOM   6912  O OD1   . ASP H 3 56  ? 15.044  -5.243  49.767 1.00 61.69  ? 50  ASP D OD1   1 
ATOM   6913  O OD2   . ASP H 3 56  ? 15.693  -4.952  47.667 1.00 62.25  ? 50  ASP D OD2   1 
ATOM   6914  N N     . GLU H 3 57  ? 17.516  -0.821  50.791 1.00 54.59  ? 51  GLU D N     1 
ATOM   6915  C CA    . GLU H 3 57  ? 18.623  0.029   51.203 1.00 55.99  ? 51  GLU D CA    1 
ATOM   6916  C C     . GLU H 3 57  ? 18.452  0.603   52.622 1.00 55.54  ? 51  GLU D C     1 
ATOM   6917  O O     . GLU H 3 57  ? 19.356  1.262   53.144 1.00 57.10  ? 51  GLU D O     1 
ATOM   6918  C CB    . GLU H 3 57  ? 18.854  1.140   50.165 1.00 55.13  ? 51  GLU D CB    1 
ATOM   6919  C CG    . GLU H 3 57  ? 19.401  0.639   48.817 1.00 57.51  ? 51  GLU D CG    1 
ATOM   6920  C CD    . GLU H 3 57  ? 19.496  1.735   47.742 1.00 58.73  ? 51  GLU D CD    1 
ATOM   6921  O OE1   . GLU H 3 57  ? 18.498  2.459   47.511 1.00 55.09  ? 51  GLU D OE1   1 
ATOM   6922  O OE2   . GLU H 3 57  ? 20.577  1.855   47.111 1.00 62.16  ? 51  GLU D OE2   1 
ATOM   6923  N N     . GLY H 3 58  ? 17.301  0.338   53.241 1.00 53.60  ? 52  GLY D N     1 
ATOM   6924  C CA    . GLY H 3 58  ? 17.023  0.767   54.610 1.00 53.40  ? 52  GLY D CA    1 
ATOM   6925  C C     . GLY H 3 58  ? 16.522  2.196   54.805 1.00 51.52  ? 52  GLY D C     1 
ATOM   6926  O O     . GLY H 3 58  ? 16.393  2.648   55.944 1.00 52.32  ? 52  GLY D O     1 
ATOM   6927  N N     . PHE H 3 59  ? 16.224  2.913   53.719 1.00 49.06  ? 53  PHE D N     1 
ATOM   6928  C CA    . PHE H 3 59  ? 15.767  4.300   53.849 1.00 47.87  ? 53  PHE D CA    1 
ATOM   6929  C C     . PHE H 3 59  ? 14.268  4.441   54.173 1.00 46.20  ? 53  PHE D C     1 
ATOM   6930  O O     . PHE H 3 59  ? 13.851  5.426   54.784 1.00 46.69  ? 53  PHE D O     1 
ATOM   6931  C CB    . PHE H 3 59  ? 16.143  5.145   52.627 1.00 46.58  ? 53  PHE D CB    1 
ATOM   6932  C CG    . PHE H 3 59  ? 17.614  5.176   52.334 1.00 49.21  ? 53  PHE D CG    1 
ATOM   6933  C CD1   . PHE H 3 59  ? 18.549  5.352   53.358 1.00 52.41  ? 53  PHE D CD1   1 
ATOM   6934  C CD2   . PHE H 3 59  ? 18.074  5.062   51.024 1.00 50.10  ? 53  PHE D CD2   1 
ATOM   6935  C CE1   . PHE H 3 59  ? 19.929  5.398   53.080 1.00 54.93  ? 53  PHE D CE1   1 
ATOM   6936  C CE2   . PHE H 3 59  ? 19.449  5.103   50.732 1.00 52.63  ? 53  PHE D CE2   1 
ATOM   6937  C CZ    . PHE H 3 59  ? 20.374  5.268   51.762 1.00 55.33  ? 53  PHE D CZ    1 
ATOM   6938  N N     . ILE H 3 60  ? 13.454  3.482   53.755 1.00 44.72  ? 54  ILE D N     1 
ATOM   6939  C CA    . ILE H 3 60  ? 12.038  3.494   54.117 1.00 43.63  ? 54  ILE D CA    1 
ATOM   6940  C C     . ILE H 3 60  ? 11.606  2.107   54.524 1.00 44.81  ? 54  ILE D C     1 
ATOM   6941  O O     . ILE H 3 60  ? 12.318  1.130   54.304 1.00 46.30  ? 54  ILE D O     1 
ATOM   6942  C CB    . ILE H 3 60  ? 11.126  3.964   52.977 1.00 41.04  ? 54  ILE D CB    1 
ATOM   6943  C CG1   . ILE H 3 60  ? 11.142  2.938   51.827 1.00 39.91  ? 54  ILE D CG1   1 
ATOM   6944  C CG2   . ILE H 3 60  ? 11.525  5.353   52.525 1.00 40.67  ? 54  ILE D CG2   1 
ATOM   6945  C CD1   . ILE H 3 60  ? 10.495  3.387   50.563 1.00 35.24  ? 54  ILE D CD1   1 
ATOM   6946  N N     . THR H 3 61  ? 10.434  2.024   55.125 1.00 44.83  ? 55  THR D N     1 
ATOM   6947  C CA    . THR H 3 61  ? 9.852   0.752   55.434 1.00 45.84  ? 55  THR D CA    1 
ATOM   6948  C C     . THR H 3 61  ? 8.351   0.854   55.144 1.00 44.60  ? 55  THR D C     1 
ATOM   6949  O O     . THR H 3 61  ? 7.859   1.932   54.819 1.00 43.04  ? 55  THR D O     1 
ATOM   6950  C CB    . THR H 3 61  ? 10.172  0.376   56.880 1.00 48.78  ? 55  THR D CB    1 
ATOM   6951  O OG1   . THR H 3 61  ? 9.819   -0.994  57.114 1.00 52.35  ? 55  THR D OG1   1 
ATOM   6952  C CG2   . THR H 3 61  ? 9.446   1.296   57.850 1.00 49.55  ? 55  THR D CG2   1 
ATOM   6953  N N     . PHE H 3 62  ? 7.622   -0.258  55.220 1.00 45.54  ? 56  PHE D N     1 
ATOM   6954  C CA    . PHE H 3 62  ? 6.206   -0.217  54.875 1.00 44.86  ? 56  PHE D CA    1 
ATOM   6955  C C     . PHE H 3 62  ? 5.360   -1.153  55.694 1.00 47.15  ? 56  PHE D C     1 
ATOM   6956  O O     . PHE H 3 62  ? 5.847   -2.158  56.213 1.00 49.26  ? 56  PHE D O     1 
ATOM   6957  C CB    . PHE H 3 62  ? 5.976   -0.485  53.376 1.00 43.12  ? 56  PHE D CB    1 
ATOM   6958  C CG    . PHE H 3 62  ? 6.345   -1.876  52.934 1.00 43.56  ? 56  PHE D CG    1 
ATOM   6959  C CD1   . PHE H 3 62  ? 5.481   -2.952  53.163 1.00 45.04  ? 56  PHE D CD1   1 
ATOM   6960  C CD2   . PHE H 3 62  ? 7.540   -2.109  52.268 1.00 43.26  ? 56  PHE D CD2   1 
ATOM   6961  C CE1   . PHE H 3 62  ? 5.813   -4.255  52.763 1.00 46.99  ? 56  PHE D CE1   1 
ATOM   6962  C CE2   . PHE H 3 62  ? 7.890   -3.415  51.859 1.00 47.00  ? 56  PHE D CE2   1 
ATOM   6963  C CZ    . PHE H 3 62  ? 7.016   -4.496  52.115 1.00 47.53  ? 56  PHE D CZ    1 
ATOM   6964  N N     . ARG H 3 63  ? 4.077   -0.818  55.785 1.00 47.39  ? 57  ARG D N     1 
ATOM   6965  C CA    . ARG H 3 63  ? 3.077   -1.727  56.324 1.00 49.11  ? 57  ARG D CA    1 
ATOM   6966  C C     . ARG H 3 63  ? 1.995   -1.930  55.254 1.00 48.69  ? 57  ARG D C     1 
ATOM   6967  O O     . ARG H 3 63  ? 1.766   -1.060  54.408 1.00 47.06  ? 57  ARG D O     1 
ATOM   6968  C CB    . ARG H 3 63  ? 2.480   -1.181  57.627 1.00 50.84  ? 57  ARG D CB    1 
ATOM   6969  C CG    . ARG H 3 63  ? 1.596   0.020   57.417 1.00 48.96  ? 57  ARG D CG    1 
ATOM   6970  C CD    . ARG H 3 63  ? 1.119   0.634   58.693 1.00 50.16  ? 57  ARG D CD    1 
ATOM   6971  N NE    . ARG H 3 63  ? 0.311   1.821   58.403 1.00 51.38  ? 57  ARG D NE    1 
ATOM   6972  C CZ    . ARG H 3 63  ? -1.020  1.842   58.306 1.00 51.72  ? 57  ARG D CZ    1 
ATOM   6973  N NH1   . ARG H 3 63  ? -1.736  0.739   58.490 1.00 52.71  ? 57  ARG D NH1   1 
ATOM   6974  N NH2   . ARG H 3 63  ? -1.640  2.980   58.029 1.00 51.13  ? 57  ARG D NH2   1 
ATOM   6975  N N     . THR H 3 64  ? 1.356   -3.092  55.298 1.00 50.48  ? 58  THR D N     1 
ATOM   6976  C CA    . THR H 3 64  ? 0.286   -3.435  54.395 1.00 50.91  ? 58  THR D CA    1 
ATOM   6977  C C     . THR H 3 64  ? -1.036  -3.093  55.058 1.00 53.21  ? 58  THR D C     1 
ATOM   6978  O O     . THR H 3 64  ? -1.306  -3.541  56.179 1.00 56.07  ? 58  THR D O     1 
ATOM   6979  C CB    . THR H 3 64  ? 0.324   -4.948  54.056 1.00 52.13  ? 58  THR D CB    1 
ATOM   6980  O OG1   . THR H 3 64  ? 1.634   -5.292  53.597 1.00 51.54  ? 58  THR D OG1   1 
ATOM   6981  C CG2   . THR H 3 64  ? -0.674  -5.293  52.960 1.00 52.60  ? 58  THR D CG2   1 
ATOM   6982  N N     . THR H 3 65  ? -1.847  -2.297  54.363 1.00 52.78  ? 59  THR D N     1 
ATOM   6983  C CA    . THR H 3 65  ? -3.218  -1.979  54.789 1.00 55.38  ? 59  THR D CA    1 
ATOM   6984  C C     . THR H 3 65  ? -4.223  -2.449  53.729 1.00 55.86  ? 59  THR D C     1 
ATOM   6985  O O     . THR H 3 65  ? -3.856  -2.611  52.565 1.00 54.23  ? 59  THR D O     1 
ATOM   6986  C CB    . THR H 3 65  ? -3.408  -0.452  55.081 1.00 55.17  ? 59  THR D CB    1 
ATOM   6987  O OG1   . THR H 3 65  ? -4.669  -0.235  55.725 1.00 59.28  ? 59  THR D OG1   1 
ATOM   6988  C CG2   . THR H 3 65  ? -3.384  0.366   53.810 1.00 52.81  ? 59  THR D CG2   1 
ATOM   6989  N N     . ILE H 3 66  ? -5.476  -2.656  54.136 1.00 58.75  ? 60  ILE D N     1 
ATOM   6990  C CA    . ILE H 3 66  ? -6.543  -3.091  53.233 1.00 60.14  ? 60  ILE D CA    1 
ATOM   6991  C C     . ILE H 3 66  ? -7.555  -1.981  52.874 1.00 61.24  ? 60  ILE D C     1 
ATOM   6992  O O     . ILE H 3 66  ? -8.239  -1.424  53.742 1.00 63.67  ? 60  ILE D O     1 
ATOM   6993  C CB    . ILE H 3 66  ? -7.265  -4.369  53.772 1.00 63.44  ? 60  ILE D CB    1 
ATOM   6994  C CG1   . ILE H 3 66  ? -6.496  -5.630  53.363 1.00 63.22  ? 60  ILE D CG1   1 
ATOM   6995  C CG2   . ILE H 3 66  ? -8.683  -4.499  53.233 1.00 66.03  ? 60  ILE D CG2   1 
ATOM   6996  C CD1   . ILE H 3 66  ? -5.563  -6.168  54.425 1.00 65.41  ? 60  ILE D CD1   1 
ATOM   6997  N N     . GLN H 3 67  ? -7.632  -1.668  51.583 1.00 59.88  ? 61  GLN D N     1 
ATOM   6998  C CA    . GLN H 3 67  ? -8.705  -0.833  51.046 1.00 61.58  ? 61  GLN D CA    1 
ATOM   6999  C C     . GLN H 3 67  ? -9.889  -1.741  50.749 1.00 64.72  ? 61  GLN D C     1 
ATOM   7000  O O     . GLN H 3 67  ? -9.731  -2.762  50.070 1.00 64.45  ? 61  GLN D O     1 
ATOM   7001  C CB    . GLN H 3 67  ? -8.255  -0.102  49.779 1.00 58.91  ? 61  GLN D CB    1 
ATOM   7002  N N     . GLY H 3 68  ? -11.061 -1.379  51.272 1.00 68.20  ? 62  GLY D N     1 
ATOM   7003  C CA    . GLY H 3 68  ? -12.273 -2.176  51.114 1.00 71.48  ? 62  GLY D CA    1 
ATOM   7004  C C     . GLY H 3 68  ? -12.244 -3.461  51.920 1.00 72.93  ? 62  GLY D C     1 
ATOM   7005  O O     . GLY H 3 68  ? -12.319 -3.437  53.145 1.00 74.61  ? 62  GLY D O     1 
ATOM   7006  N N     . THR H 3 69  ? -12.115 -4.582  51.217 1.00 72.59  ? 63  THR D N     1 
ATOM   7007  C CA    . THR H 3 69  ? -12.181 -5.917  51.803 1.00 74.50  ? 63  THR D CA    1 
ATOM   7008  C C     . THR H 3 69  ? -10.988 -6.772  51.376 1.00 71.61  ? 63  THR D C     1 
ATOM   7009  O O     . THR H 3 69  ? -10.553 -7.640  52.124 1.00 72.54  ? 63  THR D O     1 
ATOM   7010  C CB    . THR H 3 69  ? -13.463 -6.643  51.352 1.00 78.77  ? 63  THR D CB    1 
ATOM   7011  O OG1   . THR H 3 69  ? -14.576 -5.744  51.431 1.00 81.55  ? 63  THR D OG1   1 
ATOM   7012  C CG2   . THR H 3 69  ? -13.744 -7.880  52.219 1.00 82.65  ? 63  THR D CG2   1 
ATOM   7013  N N     . LYS H 3 70  ? -10.462 -6.520  50.179 1.00 68.76  ? 64  LYS D N     1 
ATOM   7014  C CA    . LYS H 3 70  ? -9.501  -7.424  49.546 1.00 66.94  ? 64  LYS D CA    1 
ATOM   7015  C C     . LYS H 3 70  ? -8.269  -6.718  49.006 1.00 62.63  ? 64  LYS D C     1 
ATOM   7016  O O     . LYS H 3 70  ? -7.234  -7.349  48.839 1.00 61.24  ? 64  LYS D O     1 
ATOM   7017  C CB    . LYS H 3 70  ? -10.162 -8.206  48.396 1.00 69.09  ? 64  LYS D CB    1 
ATOM   7018  C CG    . LYS H 3 70  ? -11.181 -9.241  48.830 1.00 74.35  ? 64  LYS D CG    1 
ATOM   7019  C CD    . LYS H 3 70  ? -11.765 -10.005 47.634 1.00 78.06  ? 64  LYS D CD    1 
ATOM   7020  N N     . LEU H 3 71  ? -8.388  -5.421  48.717 1.00 60.92  ? 65  LEU D N     1 
ATOM   7021  C CA    . LEU H 3 71  ? -7.321  -4.682  48.046 1.00 57.02  ? 65  LEU D CA    1 
ATOM   7022  C C     . LEU H 3 71  ? -6.209  -4.234  48.978 1.00 55.13  ? 65  LEU D C     1 
ATOM   7023  O O     . LEU H 3 71  ? -6.420  -3.444  49.894 1.00 55.43  ? 65  LEU D O     1 
ATOM   7024  C CB    . LEU H 3 71  ? -7.880  -3.491  47.266 1.00 56.48  ? 65  LEU D CB    1 
ATOM   7025  C CG    . LEU H 3 71  ? -6.923  -2.772  46.311 1.00 52.36  ? 65  LEU D CG    1 
ATOM   7026  C CD1   . LEU H 3 71  ? -6.308  -3.718  45.303 1.00 50.43  ? 65  LEU D CD1   1 
ATOM   7027  C CD2   . LEU H 3 71  ? -7.658  -1.664  45.601 1.00 52.02  ? 65  LEU D CD2   1 
ATOM   7028  N N     . GLU H 3 72  ? -5.008  -4.730  48.716 1.00 53.86  ? 66  GLU D N     1 
ATOM   7029  C CA    . GLU H 3 72  ? -3.858  -4.427  49.548 1.00 52.25  ? 66  GLU D CA    1 
ATOM   7030  C C     . GLU H 3 72  ? -3.111  -3.216  49.070 1.00 49.49  ? 66  GLU D C     1 
ATOM   7031  O O     . GLU H 3 72  ? -2.917  -3.016  47.866 1.00 48.94  ? 66  GLU D O     1 
ATOM   7032  C CB    . GLU H 3 72  ? -2.912  -5.606  49.577 1.00 52.48  ? 66  GLU D CB    1 
ATOM   7033  C CG    . GLU H 3 72  ? -3.484  -6.786  50.292 1.00 57.65  ? 66  GLU D CG    1 
ATOM   7034  C CD    . GLU H 3 72  ? -2.529  -7.942  50.325 1.00 60.91  ? 66  GLU D CD    1 
ATOM   7035  O OE1   . GLU H 3 72  ? -3.010  -9.096  50.441 1.00 64.30  ? 66  GLU D OE1   1 
ATOM   7036  O OE2   . GLU H 3 72  ? -1.304  -7.691  50.226 1.00 59.68  ? 66  GLU D OE2   1 
ATOM   7037  N N     . LYS H 3 73  ? -2.675  -2.422  50.036 1.00 48.61  ? 67  LYS D N     1 
ATOM   7038  C CA    . LYS H 3 73  ? -1.944  -1.203  49.787 1.00 46.34  ? 67  LYS D CA    1 
ATOM   7039  C C     . LYS H 3 73  ? -0.726  -1.222  50.688 1.00 45.82  ? 67  LYS D C     1 
ATOM   7040  O O     . LYS H 3 73  ? -0.813  -1.680  51.830 1.00 47.75  ? 67  LYS D O     1 
ATOM   7041  C CB    . LYS H 3 73  ? -2.822  -0.021  50.149 1.00 46.85  ? 67  LYS D CB    1 
ATOM   7042  C CG    . LYS H 3 73  ? -2.545  1.210   49.344 1.00 46.19  ? 67  LYS D CG    1 
ATOM   7043  C CD    . LYS H 3 73  ? -2.944  2.467   50.068 1.00 47.17  ? 67  LYS D CD    1 
ATOM   7044  C CE    . LYS H 3 73  ? -4.362  2.425   50.552 1.00 50.57  ? 67  LYS D CE    1 
ATOM   7045  N NZ    . LYS H 3 73  ? -4.801  3.800   50.930 1.00 52.74  ? 67  LYS D NZ    1 
ATOM   7046  N N     . LYS H 3 74  ? 0.410   -0.749  50.183 1.00 43.98  ? 68  LYS D N     1 
ATOM   7047  C CA    . LYS H 3 74  ? 1.620   -0.617  51.010 1.00 43.28  ? 68  LYS D CA    1 
ATOM   7048  C C     . LYS H 3 74  ? 1.906   0.842   51.354 1.00 42.50  ? 68  LYS D C     1 
ATOM   7049  O O     . LYS H 3 74  ? 2.135   1.663   50.470 1.00 40.92  ? 68  LYS D O     1 
ATOM   7050  C CB    . LYS H 3 74  ? 2.833   -1.212  50.307 1.00 42.41  ? 68  LYS D CB    1 
ATOM   7051  C CG    . LYS H 3 74  ? 2.753   -2.697  50.052 1.00 43.54  ? 68  LYS D CG    1 
ATOM   7052  C CD    . LYS H 3 74  ? 3.900   -3.126  49.177 1.00 43.50  ? 68  LYS D CD    1 
ATOM   7053  C CE    . LYS H 3 74  ? 4.216   -4.582  49.367 1.00 46.72  ? 68  LYS D CE    1 
ATOM   7054  N NZ    . LYS H 3 74  ? 5.427   -4.930  48.583 1.00 47.70  ? 68  LYS D NZ    1 
ATOM   7055  N N     . MET H 3 75  ? 1.890   1.149   52.648 1.00 43.87  ? 69  MET D N     1 
ATOM   7056  C CA    . MET H 3 75  ? 2.148   2.495   53.140 1.00 43.71  ? 69  MET D CA    1 
ATOM   7057  C C     . MET H 3 75  ? 3.591   2.593   53.627 1.00 43.39  ? 69  MET D C     1 
ATOM   7058  O O     . MET H 3 75  ? 4.016   1.845   54.504 1.00 45.19  ? 69  MET D O     1 
ATOM   7059  C CB    . MET H 3 75  ? 1.172   2.843   54.266 1.00 46.19  ? 69  MET D CB    1 
ATOM   7060  C CG    . MET H 3 75  ? -0.319  2.668   53.905 1.00 48.33  ? 69  MET D CG    1 
ATOM   7061  S SD    . MET H 3 75  ? -0.862  3.709   52.519 1.00 49.17  ? 69  MET D SD    1 
ATOM   7062  C CE    . MET H 3 75  ? -1.053  5.299   53.326 1.00 50.54  ? 69  MET D CE    1 
ATOM   7063  N N     . TYR H 3 76  ? 4.346   3.512   53.047 1.00 41.85  ? 70  TYR D N     1 
ATOM   7064  C CA    . TYR H 3 76  ? 5.737   3.679   53.395 1.00 41.33  ? 70  TYR D CA    1 
ATOM   7065  C C     . TYR H 3 76  ? 5.938   4.831   54.353 1.00 42.44  ? 70  TYR D C     1 
ATOM   7066  O O     . TYR H 3 76  ? 5.231   5.828   54.277 1.00 43.16  ? 70  TYR D O     1 
ATOM   7067  C CB    . TYR H 3 76  ? 6.536   3.960   52.139 1.00 39.44  ? 70  TYR D CB    1 
ATOM   7068  C CG    . TYR H 3 76  ? 6.635   2.785   51.225 1.00 38.37  ? 70  TYR D CG    1 
ATOM   7069  C CD1   . TYR H 3 76  ? 5.724   2.613   50.193 1.00 37.03  ? 70  TYR D CD1   1 
ATOM   7070  C CD2   . TYR H 3 76  ? 7.651   1.849   51.375 1.00 37.76  ? 70  TYR D CD2   1 
ATOM   7071  C CE1   . TYR H 3 76  ? 5.808   1.536   49.347 1.00 37.08  ? 70  TYR D CE1   1 
ATOM   7072  C CE2   . TYR H 3 76  ? 7.753   0.775   50.513 1.00 37.72  ? 70  TYR D CE2   1 
ATOM   7073  C CZ    . TYR H 3 76  ? 6.817   0.622   49.514 1.00 36.74  ? 70  TYR D CZ    1 
ATOM   7074  O OH    . TYR H 3 76  ? 6.891   -0.430  48.656 1.00 37.70  ? 70  TYR D OH    1 
ATOM   7075  N N     . THR H 3 77  ? 6.916   4.696   55.240 1.00 43.25  ? 71  THR D N     1 
ATOM   7076  C CA    . THR H 3 77  ? 7.365   5.799   56.084 1.00 44.84  ? 71  THR D CA    1 
ATOM   7077  C C     . THR H 3 77  ? 8.869   5.822   56.083 1.00 44.30  ? 71  THR D C     1 
ATOM   7078  O O     . THR H 3 77  ? 9.500   4.789   55.868 1.00 43.81  ? 71  THR D O     1 
ATOM   7079  C CB    . THR H 3 77  ? 6.887   5.693   57.555 1.00 47.56  ? 71  THR D CB    1 
ATOM   7080  O OG1   . THR H 3 77  ? 7.046   4.346   58.023 1.00 51.05  ? 71  THR D OG1   1 
ATOM   7081  C CG2   . THR H 3 77  ? 5.442   6.099   57.683 1.00 48.47  ? 71  THR D CG2   1 
ATOM   7082  N N     . LEU H 3 78  ? 9.433   7.008   56.313 1.00 44.56  ? 72  LEU D N     1 
ATOM   7083  C CA    . LEU H 3 78  ? 10.871  7.158   56.421 1.00 44.88  ? 72  LEU D CA    1 
ATOM   7084  C C     . LEU H 3 78  ? 11.436  6.519   57.681 1.00 47.13  ? 72  LEU D C     1 
ATOM   7085  O O     . LEU H 3 78  ? 10.831  6.596   58.758 1.00 48.44  ? 72  LEU D O     1 
ATOM   7086  C CB    . LEU H 3 78  ? 11.246  8.633   56.433 1.00 45.61  ? 72  LEU D CB    1 
ATOM   7087  C CG    . LEU H 3 78  ? 11.224  9.412   55.134 1.00 43.89  ? 72  LEU D CG    1 
ATOM   7088  C CD1   . LEU H 3 78  ? 11.328  10.918  55.432 1.00 44.31  ? 72  LEU D CD1   1 
ATOM   7089  C CD2   . LEU H 3 78  ? 12.344  8.941   54.228 1.00 42.81  ? 72  LEU D CD2   1 
ATOM   7090  N N     . THR H 3 79  ? 12.609  5.908   57.541 1.00 47.68  ? 73  THR D N     1 
ATOM   7091  C CA    . THR H 3 79  ? 13.425  5.548   58.702 1.00 50.97  ? 73  THR D CA    1 
ATOM   7092  C C     . THR H 3 79  ? 14.273  6.757   59.108 1.00 53.27  ? 73  THR D C     1 
ATOM   7093  O O     . THR H 3 79  ? 14.329  7.766   58.385 1.00 52.22  ? 73  THR D O     1 
ATOM   7094  C CB    . THR H 3 79  ? 14.375  4.377   58.406 1.00 51.43  ? 73  THR D CB    1 
ATOM   7095  O OG1   . THR H 3 79  ? 15.284  4.758   57.367 1.00 50.76  ? 73  THR D OG1   1 
ATOM   7096  C CG2   . THR H 3 79  ? 13.606  3.130   57.989 1.00 49.74  ? 73  THR D CG2   1 
ATOM   7097  N N     . ASP H 3 80  ? 14.929  6.648   60.265 1.00 56.72  ? 74  ASP D N     1 
ATOM   7098  C CA    . ASP H 3 80  ? 15.942  7.610   60.677 1.00 59.21  ? 74  ASP D CA    1 
ATOM   7099  C C     . ASP H 3 80  ? 17.085  7.668   59.667 1.00 58.31  ? 74  ASP D C     1 
ATOM   7100  O O     . ASP H 3 80  ? 17.595  8.740   59.381 1.00 59.07  ? 74  ASP D O     1 
ATOM   7101  C CB    . ASP H 3 80  ? 16.483  7.279   62.077 1.00 63.75  ? 74  ASP D CB    1 
ATOM   7102  C CG    . ASP H 3 80  ? 15.431  7.442   63.181 1.00 65.97  ? 74  ASP D CG    1 
ATOM   7103  O OD1   . ASP H 3 80  ? 14.362  8.051   62.927 1.00 64.57  ? 74  ASP D OD1   1 
ATOM   7104  O OD2   . ASP H 3 80  ? 15.678  6.947   64.307 1.00 69.65  ? 74  ASP D OD2   1 
ATOM   7105  N N     . SER H 3 81  ? 17.474  6.512   59.136 1.00 57.38  ? 75  SER D N     1 
ATOM   7106  C CA    . SER H 3 81  ? 18.462  6.407   58.062 1.00 56.89  ? 75  SER D CA    1 
ATOM   7107  C C     . SER H 3 81  ? 18.030  7.225   56.836 1.00 54.42  ? 75  SER D C     1 
ATOM   7108  O O     . SER H 3 81  ? 18.843  7.949   56.253 1.00 55.06  ? 75  SER D O     1 
ATOM   7109  C CB    . SER H 3 81  ? 18.631  4.933   57.688 1.00 56.69  ? 75  SER D CB    1 
ATOM   7110  O OG    . SER H 3 81  ? 19.536  4.716   56.627 1.00 56.18  ? 75  SER D OG    1 
ATOM   7111  N N     . GLY H 3 82  ? 16.753  7.105   56.459 1.00 51.56  ? 76  GLY D N     1 
ATOM   7112  C CA    . GLY H 3 82  ? 16.183  7.857   55.352 1.00 49.03  ? 76  GLY D CA    1 
ATOM   7113  C C     . GLY H 3 82  ? 16.043  9.345   55.625 1.00 49.90  ? 76  GLY D C     1 
ATOM   7114  O O     . GLY H 3 82  ? 16.325  10.155  54.749 1.00 49.25  ? 76  GLY D O     1 
ATOM   7115  N N     . LYS H 3 83  ? 15.600  9.700   56.834 1.00 51.70  ? 77  LYS D N     1 
ATOM   7116  C CA    . LYS H 3 83  ? 15.443  11.106  57.259 1.00 53.39  ? 77  LYS D CA    1 
ATOM   7117  C C     . LYS H 3 83  ? 16.762  11.844  57.145 1.00 55.54  ? 77  LYS D C     1 
ATOM   7118  O O     . LYS H 3 83  ? 16.801  13.005  56.720 1.00 56.07  ? 77  LYS D O     1 
ATOM   7119  C CB    . LYS H 3 83  ? 14.940  11.204  58.710 1.00 56.02  ? 77  LYS D CB    1 
ATOM   7120  C CG    . LYS H 3 83  ? 13.429  11.328  58.874 1.00 55.41  ? 77  LYS D CG    1 
ATOM   7121  C CD    . LYS H 3 83  ? 12.935  10.591  60.132 1.00 57.34  ? 77  LYS D CD    1 
ATOM   7122  N N     . GLN H 3 84  ? 17.835  11.154  57.525 1.00 57.23  ? 78  GLN D N     1 
ATOM   7123  C CA    . GLN H 3 84  ? 19.184  11.686  57.450 1.00 59.96  ? 78  GLN D CA    1 
ATOM   7124  C C     . GLN H 3 84  ? 19.667  11.783  55.993 1.00 58.25  ? 78  GLN D C     1 
ATOM   7125  O O     . GLN H 3 84  ? 20.352  12.746  55.618 1.00 59.55  ? 78  GLN D O     1 
ATOM   7126  C CB    . GLN H 3 84  ? 20.138  10.828  58.288 1.00 62.58  ? 78  GLN D CB    1 
ATOM   7127  C CG    . GLN H 3 84  ? 21.568  11.369  58.376 1.00 67.90  ? 78  GLN D CG    1 
ATOM   7128  C CD    . GLN H 3 84  ? 21.684  12.689  59.160 1.00 72.38  ? 78  GLN D CD    1 
ATOM   7129  O OE1   . GLN H 3 84  ? 21.263  12.786  60.319 1.00 75.33  ? 78  GLN D OE1   1 
ATOM   7130  N NE2   . GLN H 3 84  ? 22.271  13.698  58.527 1.00 73.29  ? 78  GLN D NE2   1 
ATOM   7131  N N     . GLU H 3 85  ? 19.310  10.784  55.189 1.00 55.41  ? 79  GLU D N     1 
ATOM   7132  C CA    . GLU H 3 85  ? 19.693  10.727  53.781 1.00 54.45  ? 79  GLU D CA    1 
ATOM   7133  C C     . GLU H 3 85  ? 19.096  11.918  53.011 1.00 53.06  ? 79  GLU D C     1 
ATOM   7134  O O     . GLU H 3 85  ? 19.786  12.577  52.213 1.00 53.89  ? 79  GLU D O     1 
ATOM   7135  C CB    . GLU H 3 85  ? 19.248  9.388   53.177 1.00 52.41  ? 79  GLU D CB    1 
ATOM   7136  C CG    . GLU H 3 85  ? 19.741  9.111   51.766 1.00 52.99  ? 79  GLU D CG    1 
ATOM   7137  C CD    . GLU H 3 85  ? 21.187  8.630   51.700 1.00 57.82  ? 79  GLU D CD    1 
ATOM   7138  O OE1   . GLU H 3 85  ? 21.785  8.310   52.745 1.00 59.93  ? 79  GLU D OE1   1 
ATOM   7139  O OE2   . GLU H 3 85  ? 21.734  8.572   50.575 1.00 59.78  ? 79  GLU D OE2   1 
ATOM   7140  N N     . LEU H 3 86  ? 17.824  12.196  53.288 1.00 51.06  ? 80  LEU D N     1 
ATOM   7141  C CA    . LEU H 3 86  ? 17.127  13.355  52.747 1.00 50.57  ? 80  LEU D CA    1 
ATOM   7142  C C     . LEU H 3 86  ? 17.802  14.687  53.142 1.00 53.65  ? 80  LEU D C     1 
ATOM   7143  O O     . LEU H 3 86  ? 18.094  15.521  52.290 1.00 54.07  ? 80  LEU D O     1 
ATOM   7144  C CB    . LEU H 3 86  ? 15.663  13.327  53.217 1.00 48.97  ? 80  LEU D CB    1 
ATOM   7145  C CG    . LEU H 3 86  ? 14.760  14.515  52.860 1.00 48.22  ? 80  LEU D CG    1 
ATOM   7146  C CD1   . LEU H 3 86  ? 14.493  14.515  51.369 1.00 45.44  ? 80  LEU D CD1   1 
ATOM   7147  C CD2   . LEU H 3 86  ? 13.458  14.491  53.661 1.00 45.71  ? 80  LEU D CD2   1 
ATOM   7148  N N     . HIS H 3 87  ? 18.027  14.865  54.442 1.00 56.27  ? 81  HIS D N     1 
ATOM   7149  C CA    . HIS H 3 87  ? 18.671  16.051  54.998 1.00 60.08  ? 81  HIS D CA    1 
ATOM   7150  C C     . HIS H 3 87  ? 20.018  16.350  54.348 1.00 61.95  ? 81  HIS D C     1 
ATOM   7151  O O     . HIS H 3 87  ? 20.266  17.491  53.945 1.00 63.64  ? 81  HIS D O     1 
ATOM   7152  C CB    . HIS H 3 87  ? 18.846  15.898  56.512 1.00 62.84  ? 81  HIS D CB    1 
ATOM   7153  C CG    . HIS H 3 87  ? 19.481  17.086  57.175 1.00 67.64  ? 81  HIS D CG    1 
ATOM   7154  N ND1   . HIS H 3 87  ? 18.757  18.187  57.579 1.00 69.38  ? 81  HIS D ND1   1 
ATOM   7155  C CD2   . HIS H 3 87  ? 20.770  17.338  57.511 1.00 70.50  ? 81  HIS D CD2   1 
ATOM   7156  C CE1   . HIS H 3 87  ? 19.572  19.066  58.135 1.00 73.47  ? 81  HIS D CE1   1 
ATOM   7157  N NE2   . HIS H 3 87  ? 20.798  18.574  58.107 1.00 73.92  ? 81  HIS D NE2   1 
ATOM   7158  N N     . ASP H 3 88  ? 20.876  15.333  54.241 1.00 62.07  ? 82  ASP D N     1 
ATOM   7159  C CA    . ASP H 3 88  ? 22.205  15.506  53.647 1.00 64.74  ? 82  ASP D CA    1 
ATOM   7160  C C     . ASP H 3 88  ? 22.116  16.105  52.234 1.00 63.71  ? 82  ASP D C     1 
ATOM   7161  O O     . ASP H 3 88  ? 22.856  17.030  51.886 1.00 66.47  ? 82  ASP D O     1 
ATOM   7162  C CB    . ASP H 3 88  ? 22.984  14.182  53.619 1.00 65.01  ? 82  ASP D CB    1 
ATOM   7163  C CG    . ASP H 3 88  ? 23.283  13.631  55.017 1.00 68.66  ? 82  ASP D CG    1 
ATOM   7164  O OD1   . ASP H 3 88  ? 23.392  14.414  55.994 1.00 71.87  ? 82  ASP D OD1   1 
ATOM   7165  O OD2   . ASP H 3 88  ? 23.419  12.393  55.141 1.00 69.55  ? 82  ASP D OD2   1 
ATOM   7166  N N     . TRP H 3 89  ? 21.182  15.582  51.448 1.00 60.10  ? 83  TRP D N     1 
ATOM   7167  C CA    . TRP H 3 89  ? 21.034  15.941  50.053 1.00 58.95  ? 83  TRP D CA    1 
ATOM   7168  C C     . TRP H 3 89  ? 20.431  17.334  49.899 1.00 59.61  ? 83  TRP D C     1 
ATOM   7169  O O     . TRP H 3 89  ? 20.805  18.072  48.989 1.00 60.84  ? 83  TRP D O     1 
ATOM   7170  C CB    . TRP H 3 89  ? 20.208  14.868  49.331 1.00 55.24  ? 83  TRP D CB    1 
ATOM   7171  C CG    . TRP H 3 89  ? 19.665  15.268  47.997 1.00 53.65  ? 83  TRP D CG    1 
ATOM   7172  C CD1   . TRP H 3 89  ? 20.318  15.236  46.796 1.00 54.70  ? 83  TRP D CD1   1 
ATOM   7173  C CD2   . TRP H 3 89  ? 18.345  15.743  47.723 1.00 51.22  ? 83  TRP D CD2   1 
ATOM   7174  N NE1   . TRP H 3 89  ? 19.485  15.676  45.789 1.00 52.78  ? 83  TRP D NE1   1 
ATOM   7175  C CE2   . TRP H 3 89  ? 18.269  15.995  46.333 1.00 51.20  ? 83  TRP D CE2   1 
ATOM   7176  C CE3   . TRP H 3 89  ? 17.217  15.986  48.518 1.00 49.68  ? 83  TRP D CE3   1 
ATOM   7177  C CZ2   . TRP H 3 89  ? 17.109  16.469  45.721 1.00 50.12  ? 83  TRP D CZ2   1 
ATOM   7178  C CZ3   . TRP H 3 89  ? 16.063  16.456  47.911 1.00 49.23  ? 83  TRP D CZ3   1 
ATOM   7179  C CH2   . TRP H 3 89  ? 16.016  16.689  46.523 1.00 49.27  ? 83  TRP D CH2   1 
ATOM   7180  N N     . LEU H 3 90  ? 19.515  17.688  50.797 1.00 59.18  ? 84  LEU D N     1 
ATOM   7181  C CA    . LEU H 3 90  ? 18.904  19.015  50.799 1.00 60.41  ? 84  LEU D CA    1 
ATOM   7182  C C     . LEU H 3 90  ? 19.929  20.134  51.037 1.00 64.90  ? 84  LEU D C     1 
ATOM   7183  O O     . LEU H 3 90  ? 19.919  21.142  50.337 1.00 66.48  ? 84  LEU D O     1 
ATOM   7184  C CB    . LEU H 3 90  ? 17.781  19.088  51.843 1.00 59.69  ? 84  LEU D CB    1 
ATOM   7185  C CG    . LEU H 3 90  ? 16.396  18.503  51.543 1.00 55.36  ? 84  LEU D CG    1 
ATOM   7186  C CD1   . LEU H 3 90  ? 15.603  18.380  52.828 1.00 54.17  ? 84  LEU D CD1   1 
ATOM   7187  C CD2   . LEU H 3 90  ? 15.625  19.346  50.533 1.00 53.23  ? 84  LEU D CD2   1 
ATOM   7188  N N     . ILE H 3 91  ? 20.817  19.940  52.010 1.00 67.56  ? 85  ILE D N     1 
ATOM   7189  C CA    . ILE H 3 91  ? 21.814  20.957  52.388 1.00 72.46  ? 85  ILE D CA    1 
ATOM   7190  C C     . ILE H 3 91  ? 23.074  20.950  51.497 1.00 74.54  ? 85  ILE D C     1 
ATOM   7191  O O     . ILE H 3 91  ? 23.869  21.900  51.514 1.00 78.35  ? 85  ILE D O     1 
ATOM   7192  C CB    . ILE H 3 91  ? 22.156  20.896  53.915 1.00 74.99  ? 85  ILE D CB    1 
ATOM   7193  C CG1   . ILE H 3 91  ? 22.758  19.539  54.315 1.00 74.67  ? 85  ILE D CG1   1 
ATOM   7194  C CG2   . ILE H 3 91  ? 20.905  21.135  54.746 1.00 73.69  ? 85  ILE D CG2   1 
ATOM   7195  C CD1   . ILE H 3 91  ? 24.255  19.544  54.587 1.00 78.93  ? 85  ILE D CD1   1 
ATOM   7196  N N     . ARG H 3 92  ? 23.221  19.887  50.704 1.00 72.60  ? 86  ARG D N     1 
ATOM   7197  C CA    . ARG H 3 92  ? 24.304  19.750  49.723 1.00 74.77  ? 86  ARG D CA    1 
ATOM   7198  C C     . ARG H 3 92  ? 24.129  20.758  48.574 1.00 75.83  ? 86  ARG D C     1 
ATOM   7199  O O     . ARG H 3 92  ? 23.056  20.837  47.979 1.00 73.07  ? 86  ARG D O     1 
ATOM   7200  C CB    . ARG H 3 92  ? 24.332  18.310  49.184 1.00 72.10  ? 86  ARG D CB    1 
ATOM   7201  C CG    . ARG H 3 92  ? 25.670  17.834  48.636 1.00 74.53  ? 86  ARG D CG    1 
ATOM   7202  N N     . HIS H 3 93  ? 25.176  21.532  48.280 1.00 86.15  ? 87  HIS D N     1 
ATOM   7203  C CA    . HIS H 3 93  ? 25.134  22.540  47.211 1.00 85.11  ? 87  HIS D CA    1 
ATOM   7204  C C     . HIS H 3 93  ? 25.481  21.945  45.845 1.00 83.82  ? 87  HIS D C     1 
ATOM   7205  O O     . HIS H 3 93  ? 26.652  21.812  45.493 1.00 86.56  ? 87  HIS D O     1 
ATOM   7206  C CB    . HIS H 3 93  ? 26.082  23.711  47.503 1.00 89.09  ? 87  HIS D CB    1 
ATOM   7207  C CG    . HIS H 3 93  ? 25.808  24.422  48.792 1.00 91.69  ? 87  HIS D CG    1 
ATOM   7208  N ND1   . HIS H 3 93  ? 26.810  24.991  49.550 1.00 96.78  ? 87  HIS D ND1   1 
ATOM   7209  C CD2   . HIS H 3 93  ? 24.652  24.656  49.459 1.00 90.65  ? 87  HIS D CD2   1 
ATOM   7210  C CE1   . HIS H 3 93  ? 26.283  25.546  50.627 1.00 98.61  ? 87  HIS D CE1   1 
ATOM   7211  N NE2   . HIS H 3 93  ? 24.977  25.352  50.599 1.00 95.09  ? 87  HIS D NE2   1 
ATOM   7212  N N     . GLN H 3 94  ? 24.455  21.589  45.081 1.00 80.24  ? 88  GLN D N     1 
ATOM   7213  C CA    . GLN H 3 94  ? 24.647  21.010  43.755 1.00 79.30  ? 88  GLN D CA    1 
ATOM   7214  C C     . GLN H 3 94  ? 24.894  22.120  42.731 1.00 78.85  ? 88  GLN D C     1 
ATOM   7215  O O     . GLN H 3 94  ? 24.099  23.065  42.647 1.00 77.08  ? 88  GLN D O     1 
ATOM   7216  C CB    . GLN H 3 94  ? 23.428  20.163  43.336 1.00 75.87  ? 88  GLN D CB    1 
ATOM   7217  C CG    . GLN H 3 94  ? 23.532  18.661  43.648 1.00 77.82  ? 88  GLN D CG    1 
ATOM   7218  C CD    . GLN H 3 94  ? 22.903  18.253  44.992 1.00 80.04  ? 88  GLN D CD    1 
ATOM   7219  O OE1   . GLN H 3 94  ? 23.308  17.261  45.608 1.00 82.81  ? 88  GLN D OE1   1 
ATOM   7220  N NE2   . GLN H 3 94  ? 21.899  19.002  45.431 1.00 78.31  ? 88  GLN D NE2   1 
ATOM   7221  N N     . PRO H 3 95  ? 25.991  22.010  41.946 1.00 80.78  ? 89  PRO D N     1 
ATOM   7222  C CA    . PRO H 3 95  ? 26.256  22.971  40.863 1.00 80.35  ? 89  PRO D CA    1 
ATOM   7223  C C     . PRO H 3 95  ? 25.087  22.981  39.894 1.00 75.87  ? 89  PRO D C     1 
ATOM   7224  O O     . PRO H 3 95  ? 24.442  21.942  39.707 1.00 73.92  ? 89  PRO D O     1 
ATOM   7225  C CB    . PRO H 3 95  ? 27.502  22.400  40.173 1.00 83.03  ? 89  PRO D CB    1 
ATOM   7226  C CG    . PRO H 3 95  ? 27.545  20.953  40.570 1.00 83.50  ? 89  PRO D CG    1 
ATOM   7227  C CD    . PRO H 3 95  ? 26.991  20.924  41.968 1.00 83.55  ? 89  PRO D CD    1 
ATOM   7228  N N     . ILE H 3 96  ? 24.796  24.135  39.303 1.00 74.55  ? 90  ILE D N     1 
ATOM   7229  C CA    . ILE H 3 96  ? 23.659  24.217  38.391 1.00 70.82  ? 90  ILE D CA    1 
ATOM   7230  C C     . ILE H 3 96  ? 23.985  23.605  37.022 1.00 69.64  ? 90  ILE D C     1 
ATOM   7231  O O     . ILE H 3 96  ? 25.066  23.834  36.484 1.00 71.79  ? 90  ILE D O     1 
ATOM   7232  C CB    . ILE H 3 96  ? 23.040  25.647  38.294 1.00 70.53  ? 90  ILE D CB    1 
ATOM   7233  C CG1   . ILE H 3 96  ? 23.930  26.600  37.489 1.00 73.30  ? 90  ILE D CG1   1 
ATOM   7234  C CG2   . ILE H 3 96  ? 22.750  26.196  39.703 1.00 71.92  ? 90  ILE D CG2   1 
ATOM   7235  C CD1   . ILE H 3 96  ? 23.227  27.869  37.028 1.00 73.58  ? 90  ILE D CD1   1 
ATOM   7236  N N     . PRO H 3 97  ? 23.054  22.797  36.477 1.00 66.53  ? 91  PRO D N     1 
ATOM   7237  C CA    . PRO H 3 97  ? 23.226  22.188  35.158 1.00 65.80  ? 91  PRO D CA    1 
ATOM   7238  C C     . PRO H 3 97  ? 23.382  23.227  34.039 1.00 65.42  ? 91  PRO D C     1 
ATOM   7239  O O     . PRO H 3 97  ? 22.715  24.264  34.051 1.00 64.20  ? 91  PRO D O     1 
ATOM   7240  C CB    . PRO H 3 97  ? 21.930  21.387  34.971 1.00 62.88  ? 91  PRO D CB    1 
ATOM   7241  C CG    . PRO H 3 97  ? 20.950  22.022  35.911 1.00 61.38  ? 91  PRO D CG    1 
ATOM   7242  C CD    . PRO H 3 97  ? 21.769  22.404  37.088 1.00 63.93  ? 91  PRO D CD    1 
ATOM   7243  N N     . GLU H 3 98  ? 24.268  22.938  33.091 1.00 66.77  ? 92  GLU D N     1 
ATOM   7244  C CA    . GLU H 3 98  ? 24.498  23.809  31.943 1.00 66.83  ? 92  GLU D CA    1 
ATOM   7245  C C     . GLU H 3 98  ? 23.294  23.834  30.986 1.00 63.33  ? 92  GLU D C     1 
ATOM   7246  O O     . GLU H 3 98  ? 22.861  24.908  30.561 1.00 62.76  ? 92  GLU D O     1 
ATOM   7247  C CB    . GLU H 3 98  ? 25.786  23.396  31.212 1.00 70.04  ? 92  GLU D CB    1 
ATOM   7248  C CG    . GLU H 3 98  ? 26.359  24.457  30.275 1.00 71.79  ? 92  GLU D CG    1 
ATOM   7249  N N     . THR H 3 99  ? 22.752  22.659  30.662 1.00 61.36  ? 93  THR D N     1 
ATOM   7250  C CA    . THR H 3 99  ? 21.640  22.556  29.701 1.00 58.50  ? 93  THR D CA    1 
ATOM   7251  C C     . THR H 3 99  ? 20.300  22.339  30.376 1.00 55.74  ? 93  THR D C     1 
ATOM   7252  O O     . THR H 3 99  ? 20.162  21.450  31.234 1.00 55.66  ? 93  THR D O     1 
ATOM   7253  C CB    . THR H 3 99  ? 21.828  21.360  28.735 1.00 59.22  ? 93  THR D CB    1 
ATOM   7254  O OG1   . THR H 3 99  ? 23.168  21.342  28.227 1.00 62.65  ? 93  THR D OG1   1 
ATOM   7255  C CG2   . THR H 3 99  ? 20.828  21.409  27.586 1.00 55.89  ? 93  THR D CG2   1 
ATOM   7256  N N     . VAL H 3 100 ? 19.312  23.133  29.977 1.00 53.47  ? 94  VAL D N     1 
ATOM   7257  C CA    . VAL H 3 100 ? 17.924  22.822  30.299 1.00 51.48  ? 94  VAL D CA    1 
ATOM   7258  C C     . VAL H 3 100 ? 17.103  22.762  29.012 1.00 50.81  ? 94  VAL D C     1 
ATOM   7259  O O     . VAL H 3 100 ? 16.837  23.789  28.374 1.00 50.78  ? 94  VAL D O     1 
ATOM   7260  C CB    . VAL H 3 100 ? 17.328  23.788  31.345 1.00 51.17  ? 94  VAL D CB    1 
ATOM   7261  C CG1   . VAL H 3 100 ? 15.939  23.333  31.756 1.00 49.69  ? 94  VAL D CG1   1 
ATOM   7262  C CG2   . VAL H 3 100 ? 18.223  23.852  32.581 1.00 51.88  ? 94  VAL D CG2   1 
ATOM   7263  N N     . LYS H 3 101 ? 16.727  21.540  28.633 1.00 50.92  ? 95  LYS D N     1 
ATOM   7264  C CA    . LYS H 3 101 ? 16.138  21.245  27.320 1.00 51.28  ? 95  LYS D CA    1 
ATOM   7265  C C     . LYS H 3 101 ? 14.905  22.073  26.989 1.00 50.51  ? 95  LYS D C     1 
ATOM   7266  O O     . LYS H 3 101 ? 13.988  22.185  27.802 1.00 50.00  ? 95  LYS D O     1 
ATOM   7267  C CB    . LYS H 3 101 ? 15.811  19.753  27.168 1.00 51.67  ? 95  LYS D CB    1 
ATOM   7268  C CG    . LYS H 3 101 ? 17.051  18.888  26.931 1.00 54.74  ? 95  LYS D CG    1 
ATOM   7269  C CD    . LYS H 3 101 ? 16.783  17.401  26.626 1.00 55.45  ? 95  LYS D CD    1 
ATOM   7270  C CE    . LYS H 3 101 ? 18.103  16.743  26.190 1.00 59.03  ? 95  LYS D CE    1 
ATOM   7271  N NZ    . LYS H 3 101 ? 18.089  15.245  25.968 1.00 60.84  ? 95  LYS D NZ    1 
ATOM   7272  N N     . ASP H 3 102 ? 14.900  22.631  25.779 1.00 50.83  ? 96  ASP D N     1 
ATOM   7273  C CA    . ASP H 3 102 ? 13.763  23.350  25.251 1.00 50.29  ? 96  ASP D CA    1 
ATOM   7274  C C     . ASP H 3 102 ? 13.762  23.287  23.711 1.00 51.36  ? 96  ASP D C     1 
ATOM   7275  O O     . ASP H 3 102 ? 14.470  24.041  23.022 1.00 52.17  ? 96  ASP D O     1 
ATOM   7276  C CB    . ASP H 3 102 ? 13.777  24.793  25.755 1.00 50.19  ? 96  ASP D CB    1 
ATOM   7277  C CG    . ASP H 3 102 ? 12.566  25.598  25.295 1.00 50.82  ? 96  ASP D CG    1 
ATOM   7278  O OD1   . ASP H 3 102 ? 11.777  25.115  24.439 1.00 50.29  ? 96  ASP D OD1   1 
ATOM   7279  O OD2   . ASP H 3 102 ? 12.414  26.731  25.809 1.00 52.13  ? 96  ASP D OD2   1 
ATOM   7280  N N     . GLU H 3 103 ? 12.931  22.396  23.185 1.00 51.38  ? 97  GLU D N     1 
ATOM   7281  C CA    . GLU H 3 103 ? 12.819  22.164  21.759 1.00 52.66  ? 97  GLU D CA    1 
ATOM   7282  C C     . GLU H 3 103 ? 12.496  23.431  20.969 1.00 52.89  ? 97  GLU D C     1 
ATOM   7283  O O     . GLU H 3 103 ? 12.914  23.590  19.813 1.00 54.16  ? 97  GLU D O     1 
ATOM   7284  C CB    . GLU H 3 103 ? 11.744  21.115  21.509 1.00 53.43  ? 97  GLU D CB    1 
ATOM   7285  C CG    . GLU H 3 103 ? 11.883  20.375  20.178 1.00 57.29  ? 97  GLU D CG    1 
ATOM   7286  C CD    . GLU H 3 103 ? 10.797  19.330  19.970 1.00 61.10  ? 97  GLU D CD    1 
ATOM   7287  O OE1   . GLU H 3 103 ? 10.428  18.630  20.948 1.00 61.68  ? 97  GLU D OE1   1 
ATOM   7288  O OE2   . GLU H 3 103 ? 10.321  19.203  18.818 1.00 63.81  ? 97  GLU D OE2   1 
ATOM   7289  N N     . PHE H 3 104 ? 11.750  24.343  21.580 1.00 51.80  ? 98  PHE D N     1 
ATOM   7290  C CA    . PHE H 3 104 ? 11.380  25.549  20.862 1.00 52.01  ? 98  PHE D CA    1 
ATOM   7291  C C     . PHE H 3 104 ? 12.583  26.451  20.644 1.00 52.58  ? 98  PHE D C     1 
ATOM   7292  O O     . PHE H 3 104 ? 12.717  27.077  19.607 1.00 53.92  ? 98  PHE D O     1 
ATOM   7293  C CB    . PHE H 3 104 ? 10.261  26.302  21.560 1.00 51.27  ? 98  PHE D CB    1 
ATOM   7294  C CG    . PHE H 3 104 ? 9.859   27.540  20.842 1.00 52.52  ? 98  PHE D CG    1 
ATOM   7295  C CD1   . PHE H 3 104 ? 8.964   27.478  19.778 1.00 52.87  ? 98  PHE D CD1   1 
ATOM   7296  C CD2   . PHE H 3 104 ? 10.397  28.770  21.199 1.00 52.56  ? 98  PHE D CD2   1 
ATOM   7297  C CE1   . PHE H 3 104 ? 8.600   28.611  19.101 1.00 54.05  ? 98  PHE D CE1   1 
ATOM   7298  C CE2   . PHE H 3 104 ? 10.030  29.926  20.515 1.00 54.09  ? 98  PHE D CE2   1 
ATOM   7299  C CZ    . PHE H 3 104 ? 9.133   29.846  19.471 1.00 54.83  ? 98  PHE D CZ    1 
ATOM   7300  N N     . MET H 3 105 ? 13.465  26.512  21.628 1.00 52.28  ? 99  MET D N     1 
ATOM   7301  C CA    . MET H 3 105 ? 14.661  27.327  21.496 1.00 53.32  ? 99  MET D CA    1 
ATOM   7302  C C     . MET H 3 105 ? 15.585  26.836  20.388 1.00 54.59  ? 99  MET D C     1 
ATOM   7303  O O     . MET H 3 105 ? 16.279  27.626  19.758 1.00 56.31  ? 99  MET D O     1 
ATOM   7304  C CB    . MET H 3 105 ? 15.391  27.441  22.828 1.00 52.74  ? 99  MET D CB    1 
ATOM   7305  C CG    . MET H 3 105 ? 14.731  28.435  23.758 1.00 52.63  ? 99  MET D CG    1 
ATOM   7306  S SD    . MET H 3 105 ? 14.121  29.894  22.878 1.00 55.07  ? 99  MET D SD    1 
ATOM   7307  C CE    . MET H 3 105 ? 15.640  30.625  22.249 1.00 55.63  ? 99  MET D CE    1 
ATOM   7308  N N     . LEU H 3 106 ? 15.582  25.530  20.154 1.00 54.32  ? 100 LEU D N     1 
ATOM   7309  C CA    . LEU H 3 106 ? 16.268  24.958  19.012 1.00 55.79  ? 100 LEU D CA    1 
ATOM   7310  C C     . LEU H 3 106 ? 15.697  25.585  17.738 1.00 56.73  ? 100 LEU D C     1 
ATOM   7311  O O     . LEU H 3 106 ? 16.443  26.075  16.888 1.00 58.28  ? 100 LEU D O     1 
ATOM   7312  C CB    . LEU H 3 106 ? 16.058  23.447  19.011 1.00 55.69  ? 100 LEU D CB    1 
ATOM   7313  C CG    . LEU H 3 106 ? 17.106  22.520  18.421 1.00 57.74  ? 100 LEU D CG    1 
ATOM   7314  C CD1   . LEU H 3 106 ? 18.490  22.840  18.933 1.00 58.94  ? 100 LEU D CD1   1 
ATOM   7315  C CD2   . LEU H 3 106 ? 16.746  21.091  18.777 1.00 57.73  ? 100 LEU D CD2   1 
ATOM   7316  N N     . LYS H 3 107 ? 14.368  25.596  17.636 1.00 55.71  ? 101 LYS D N     1 
ATOM   7317  C CA    . LYS H 3 107 ? 13.685  26.170  16.490 1.00 56.86  ? 101 LYS D CA    1 
ATOM   7318  C C     . LYS H 3 107 ? 14.062  27.631  16.318 1.00 57.70  ? 101 LYS D C     1 
ATOM   7319  O O     . LYS H 3 107 ? 14.406  28.068  15.218 1.00 59.48  ? 101 LYS D O     1 
ATOM   7320  C CB    . LYS H 3 107 ? 12.163  26.022  16.617 1.00 56.26  ? 101 LYS D CB    1 
ATOM   7321  C CG    . LYS H 3 107 ? 11.649  24.612  16.354 1.00 56.53  ? 101 LYS D CG    1 
ATOM   7322  C CD    . LYS H 3 107 ? 10.136  24.573  16.365 1.00 57.12  ? 101 LYS D CD    1 
ATOM   7323  C CE    . LYS H 3 107 ? 9.631   23.140  16.285 1.00 58.52  ? 101 LYS D CE    1 
ATOM   7324  N NZ    . LYS H 3 107 ? 8.222   23.114  15.805 1.00 60.16  ? 101 LYS D NZ    1 
ATOM   7325  N N     . ALA H 3 108 ? 14.012  28.378  17.413 1.00 56.77  ? 102 ALA D N     1 
ATOM   7326  C CA    . ALA H 3 108 ? 14.405  29.778  17.401 1.00 57.93  ? 102 ALA D CA    1 
ATOM   7327  C C     . ALA H 3 108 ? 15.818  29.978  16.854 1.00 59.59  ? 102 ALA D C     1 
ATOM   7328  O O     . ALA H 3 108 ? 16.027  30.830  16.000 1.00 61.74  ? 102 ALA D O     1 
ATOM   7329  C CB    . ALA H 3 108 ? 14.267  30.381  18.782 1.00 57.27  ? 102 ALA D CB    1 
ATOM   7330  N N     . TYR H 3 109 ? 16.779  29.187  17.324 1.00 58.97  ? 103 TYR D N     1 
ATOM   7331  C CA    . TYR H 3 109 ? 18.145  29.244  16.793 1.00 61.02  ? 103 TYR D CA    1 
ATOM   7332  C C     . TYR H 3 109 ? 18.218  29.115  15.264 1.00 62.97  ? 103 TYR D C     1 
ATOM   7333  O O     . TYR H 3 109 ? 19.058  29.758  14.628 1.00 65.50  ? 103 TYR D O     1 
ATOM   7334  C CB    . TYR H 3 109 ? 18.999  28.162  17.436 1.00 60.65  ? 103 TYR D CB    1 
ATOM   7335  C CG    . TYR H 3 109 ? 20.494  28.302  17.253 1.00 62.44  ? 103 TYR D CG    1 
ATOM   7336  C CD1   . TYR H 3 109 ? 21.198  29.343  17.843 1.00 62.96  ? 103 TYR D CD1   1 
ATOM   7337  C CD2   . TYR H 3 109 ? 21.208  27.355  16.530 1.00 63.93  ? 103 TYR D CD2   1 
ATOM   7338  C CE1   . TYR H 3 109 ? 22.580  29.456  17.696 1.00 66.26  ? 103 TYR D CE1   1 
ATOM   7339  C CE2   . TYR H 3 109 ? 22.584  27.448  16.378 1.00 66.87  ? 103 TYR D CE2   1 
ATOM   7340  C CZ    . TYR H 3 109 ? 23.273  28.499  16.962 1.00 68.18  ? 103 TYR D CZ    1 
ATOM   7341  O OH    . TYR H 3 109 ? 24.648  28.586  16.795 1.00 70.89  ? 103 TYR D OH    1 
ATOM   7342  N N     . PHE H 3 110 ? 17.331  28.301  14.686 1.00 62.18  ? 104 PHE D N     1 
ATOM   7343  C CA    . PHE H 3 110 ? 17.332  28.014  13.247 1.00 64.03  ? 104 PHE D CA    1 
ATOM   7344  C C     . PHE H 3 110 ? 16.506  29.010  12.420 1.00 65.17  ? 104 PHE D C     1 
ATOM   7345  O O     . PHE H 3 110 ? 16.264  28.793  11.222 1.00 66.80  ? 104 PHE D O     1 
ATOM   7346  C CB    . PHE H 3 110 ? 16.859  26.577  12.981 1.00 63.31  ? 104 PHE D CB    1 
ATOM   7347  C CG    . PHE H 3 110 ? 17.699  25.520  13.655 1.00 63.09  ? 104 PHE D CG    1 
ATOM   7348  C CD1   . PHE H 3 110 ? 19.086  25.666  13.767 1.00 64.25  ? 104 PHE D CD1   1 
ATOM   7349  C CD2   . PHE H 3 110 ? 17.106  24.362  14.157 1.00 61.00  ? 104 PHE D CD2   1 
ATOM   7350  C CE1   . PHE H 3 110 ? 19.857  24.689  14.391 1.00 63.99  ? 104 PHE D CE1   1 
ATOM   7351  C CE2   . PHE H 3 110 ? 17.876  23.378  14.775 1.00 60.81  ? 104 PHE D CE2   1 
ATOM   7352  C CZ    . PHE H 3 110 ? 19.250  23.544  14.891 1.00 62.46  ? 104 PHE D CZ    1 
ATOM   7353  N N     . ILE H 3 111 ? 16.111  30.109  13.062 1.00 64.58  ? 105 ILE D N     1 
ATOM   7354  C CA    . ILE H 3 111 ? 15.197  31.118  12.501 1.00 65.48  ? 105 ILE D CA    1 
ATOM   7355  C C     . ILE H 3 111 ? 15.457  31.517  11.029 1.00 68.59  ? 105 ILE D C     1 
ATOM   7356  O O     . ILE H 3 111 ? 14.510  31.793  10.274 1.00 69.65  ? 105 ILE D O     1 
ATOM   7357  C CB    . ILE H 3 111 ? 15.109  32.366  13.448 1.00 65.24  ? 105 ILE D CB    1 
ATOM   7358  C CG1   . ILE H 3 111 ? 13.922  33.263  13.099 1.00 66.00  ? 105 ILE D CG1   1 
ATOM   7359  C CG2   . ILE H 3 111 ? 16.420  33.127  13.492 1.00 66.79  ? 105 ILE D CG2   1 
ATOM   7360  C CD1   . ILE H 3 111 ? 12.654  32.889  13.790 1.00 64.29  ? 105 ILE D CD1   1 
ATOM   7361  N N     . SER H 3 112 ? 16.724  31.516  10.619 1.00 70.38  ? 106 SER D N     1 
ATOM   7362  C CA    . SER H 3 112 ? 17.105  31.906  9.259  1.00 73.42  ? 106 SER D CA    1 
ATOM   7363  C C     . SER H 3 112 ? 16.415  31.065  8.180  1.00 74.23  ? 106 SER D C     1 
ATOM   7364  O O     . SER H 3 112 ? 16.259  31.517  7.038  1.00 76.68  ? 106 SER D O     1 
ATOM   7365  C CB    . SER H 3 112 ? 18.628  31.869  9.078  1.00 75.24  ? 106 SER D CB    1 
ATOM   7366  O OG    . SER H 3 112 ? 19.097  30.563  8.795  1.00 74.86  ? 106 SER D OG    1 
ATOM   7367  N N     . SER H 3 113 ? 16.004  29.850  8.549  1.00 72.40  ? 107 SER D N     1 
ATOM   7368  C CA    . SER H 3 113 ? 15.308  28.950  7.627  1.00 73.41  ? 107 SER D CA    1 
ATOM   7369  C C     . SER H 3 113 ? 13.806  29.233  7.480  1.00 73.23  ? 107 SER D C     1 
ATOM   7370  O O     . SER H 3 113 ? 13.079  28.451  6.855  1.00 74.23  ? 107 SER D O     1 
ATOM   7371  C CB    . SER H 3 113 ? 15.545  27.496  8.019  1.00 72.16  ? 107 SER D CB    1 
ATOM   7372  O OG    . SER H 3 113 ? 16.791  27.063  7.511  1.00 74.71  ? 107 SER D OG    1 
ATOM   7373  N N     . LEU H 3 114 ? 13.347  30.349  8.042  1.00 72.50  ? 108 LEU D N     1 
ATOM   7374  C CA    . LEU H 3 114 ? 11.941  30.703  7.984  1.00 72.76  ? 108 LEU D CA    1 
ATOM   7375  C C     . LEU H 3 114 ? 11.716  32.093  7.383  1.00 75.32  ? 108 LEU D C     1 
ATOM   7376  O O     . LEU H 3 114 ? 12.526  33.010  7.573  1.00 76.01  ? 108 LEU D O     1 
ATOM   7377  C CB    . LEU H 3 114 ? 11.316  30.618  9.381  1.00 70.07  ? 108 LEU D CB    1 
ATOM   7378  C CG    . LEU H 3 114 ? 11.069  29.221  9.968  1.00 68.66  ? 108 LEU D CG    1 
ATOM   7379  C CD1   . LEU H 3 114 ? 10.699  29.296  11.446 1.00 66.07  ? 108 LEU D CD1   1 
ATOM   7380  C CD2   . LEU H 3 114 ? 9.996   28.464  9.196  1.00 69.91  ? 108 LEU D CD2   1 
ATOM   7381  N N     . SER H 3 115 ? 10.615  32.236  6.649  1.00 77.10  ? 109 SER D N     1 
ATOM   7382  C CA    . SER H 3 115 ? 10.144  33.548  6.228  1.00 79.62  ? 109 SER D CA    1 
ATOM   7383  C C     . SER H 3 115 ? 9.620   34.308  7.449  1.00 78.57  ? 109 SER D C     1 
ATOM   7384  O O     . SER H 3 115 ? 9.246   33.703  8.464  1.00 75.62  ? 109 SER D O     1 
ATOM   7385  C CB    . SER H 3 115 ? 9.039   33.421  5.178  1.00 81.92  ? 109 SER D CB    1 
ATOM   7386  O OG    . SER H 3 115 ? 7.784   33.174  5.795  1.00 81.01  ? 109 SER D OG    1 
ATOM   7387  N N     . ARG H 3 116 ? 9.601   35.634  7.340  1.00 81.08  ? 110 ARG D N     1 
ATOM   7388  C CA    . ARG H 3 116 ? 9.046   36.502  8.370  1.00 81.31  ? 110 ARG D CA    1 
ATOM   7389  C C     . ARG H 3 116 ? 7.621   36.081  8.754  1.00 80.77  ? 110 ARG D C     1 
ATOM   7390  O O     . ARG H 3 116 ? 7.261   36.112  9.934  1.00 79.28  ? 110 ARG D O     1 
ATOM   7391  C CB    . ARG H 3 116 ? 9.079   37.956  7.892  1.00 85.06  ? 110 ARG D CB    1 
ATOM   7392  C CG    . ARG H 3 116 ? 8.701   39.000  8.937  1.00 86.72  ? 110 ARG D CG    1 
ATOM   7393  C CD    . ARG H 3 116 ? 8.863   40.417  8.386  1.00 92.32  ? 110 ARG D CD    1 
ATOM   7394  N NE    . ARG H 3 116 ? 10.272  40.807  8.302  1.00 94.95  ? 110 ARG D NE    1 
ATOM   7395  C CZ    . ARG H 3 116 ? 10.826  41.823  8.964  1.00 97.23  ? 110 ARG D CZ    1 
ATOM   7396  N NH1   . ARG H 3 116 ? 12.122  42.082  8.818  1.00 98.23  ? 110 ARG D NH1   1 
ATOM   7397  N NH2   . ARG H 3 116 ? 10.093  42.589  9.763  1.00 98.65  ? 110 ARG D NH2   1 
ATOM   7398  N N     . GLN H 3 117 ? 6.827   35.668  7.766  1.00 82.47  ? 111 GLN D N     1 
ATOM   7399  C CA    . GLN H 3 117 ? 5.459   35.222  8.023  1.00 82.77  ? 111 GLN D CA    1 
ATOM   7400  C C     . GLN H 3 117 ? 5.439   33.895  8.779  1.00 79.47  ? 111 GLN D C     1 
ATOM   7401  O O     . GLN H 3 117 ? 4.702   33.735  9.763  1.00 78.51  ? 111 GLN D O     1 
ATOM   7402  C CB    . GLN H 3 117 ? 4.663   35.105  6.721  1.00 85.98  ? 111 GLN D CB    1 
ATOM   7403  C CG    . GLN H 3 117 ? 3.157   34.988  6.925  1.00 88.25  ? 111 GLN D CG    1 
ATOM   7404  C CD    . GLN H 3 117 ? 2.553   36.202  7.625  1.00 91.40  ? 111 GLN D CD    1 
ATOM   7405  O OE1   . GLN H 3 117 ? 2.765   37.349  7.213  1.00 94.45  ? 111 GLN D OE1   1 
ATOM   7406  N NE2   . GLN H 3 117 ? 1.789   35.950  8.688  1.00 90.36  ? 111 GLN D NE2   1 
ATOM   7407  N N     . GLU H 3 118 ? 6.255   32.952  8.320  1.00 78.22  ? 112 GLU D N     1 
ATOM   7408  C CA    . GLU H 3 118 ? 6.338   31.645  8.953  1.00 75.54  ? 112 GLU D CA    1 
ATOM   7409  C C     . GLU H 3 118 ? 6.789   31.757  10.404 1.00 72.60  ? 112 GLU D C     1 
ATOM   7410  O O     . GLU H 3 118 ? 6.280   31.040  11.263 1.00 70.96  ? 112 GLU D O     1 
ATOM   7411  C CB    . GLU H 3 118 ? 7.266   30.726  8.161  1.00 75.64  ? 112 GLU D CB    1 
ATOM   7412  C CG    . GLU H 3 118 ? 6.625   30.144  6.918  1.00 78.38  ? 112 GLU D CG    1 
ATOM   7413  C CD    . GLU H 3 118 ? 7.633   29.761  5.860  1.00 80.84  ? 112 GLU D CD    1 
ATOM   7414  O OE1   . GLU H 3 118 ? 8.826   30.119  5.989  1.00 80.55  ? 112 GLU D OE1   1 
ATOM   7415  O OE2   . GLU H 3 118 ? 7.227   29.104  4.882  1.00 84.28  ? 112 GLU D OE2   1 
ATOM   7416  N N     . ALA H 3 119 ? 7.727   32.671  10.661 1.00 72.47  ? 113 ALA D N     1 
ATOM   7417  C CA    . ALA H 3 119 ? 8.270   32.913  12.004 1.00 70.20  ? 113 ALA D CA    1 
ATOM   7418  C C     . ALA H 3 119 ? 7.283   33.648  12.884 1.00 70.37  ? 113 ALA D C     1 
ATOM   7419  O O     . ALA H 3 119 ? 7.369   33.587  14.110 1.00 68.47  ? 113 ALA D O     1 
ATOM   7420  C CB    . ALA H 3 119 ? 9.560   33.699  11.925 1.00 71.03  ? 113 ALA D CB    1 
ATOM   7421  N N     . SER H 3 120 ? 6.360   34.366  12.256 1.00 73.01  ? 114 SER D N     1 
ATOM   7422  C CA    . SER H 3 120 ? 5.305   35.038  12.992 1.00 73.80  ? 114 SER D CA    1 
ATOM   7423  C C     . SER H 3 120 ? 4.292   34.013  13.482 1.00 72.40  ? 114 SER D C     1 
ATOM   7424  O O     . SER H 3 120 ? 3.878   34.054  14.635 1.00 71.20  ? 114 SER D O     1 
ATOM   7425  C CB    . SER H 3 120 ? 4.634   36.096  12.128 1.00 77.56  ? 114 SER D CB    1 
ATOM   7426  O OG    . SER H 3 120 ? 3.894   36.996  12.930 1.00 78.98  ? 114 SER D OG    1 
ATOM   7427  N N     . ASP H 3 121 ? 3.926   33.082  12.604 1.00 72.86  ? 115 ASP D N     1 
ATOM   7428  C CA    . ASP H 3 121 ? 2.960   32.032  12.926 1.00 72.38  ? 115 ASP D CA    1 
ATOM   7429  C C     . ASP H 3 121 ? 3.495   31.032  13.958 1.00 69.08  ? 115 ASP D C     1 
ATOM   7430  O O     . ASP H 3 121 ? 2.718   30.460  14.727 1.00 68.86  ? 115 ASP D O     1 
ATOM   7431  C CB    . ASP H 3 121 ? 2.501   31.310  11.651 1.00 74.38  ? 115 ASP D CB    1 
ATOM   7432  N N     . LEU H 3 122 ? 4.812   30.834  13.984 1.00 66.95  ? 116 LEU D N     1 
ATOM   7433  C CA    . LEU H 3 122 ? 5.435   29.945  14.962 1.00 63.91  ? 116 LEU D CA    1 
ATOM   7434  C C     . LEU H 3 122 ? 5.516   30.579  16.355 1.00 62.71  ? 116 LEU D C     1 
ATOM   7435  O O     . LEU H 3 122 ? 5.206   29.944  17.368 1.00 61.11  ? 116 LEU D O     1 
ATOM   7436  C CB    . LEU H 3 122 ? 6.833   29.514  14.503 1.00 62.98  ? 116 LEU D CB    1 
ATOM   7437  C CG    . LEU H 3 122 ? 7.561   28.601  15.497 1.00 59.84  ? 116 LEU D CG    1 
ATOM   7438  C CD1   . LEU H 3 122 ? 6.892   27.242  15.555 1.00 58.48  ? 116 LEU D CD1   1 
ATOM   7439  C CD2   . LEU H 3 122 ? 9.029   28.473  15.174 1.00 59.25  ? 116 LEU D CD2   1 
ATOM   7440  N N     . PHE H 3 123 ? 5.951   31.832  16.406 1.00 63.68  ? 117 PHE D N     1 
ATOM   7441  C CA    . PHE H 3 123 ? 6.027   32.543  17.674 1.00 63.10  ? 117 PHE D CA    1 
ATOM   7442  C C     . PHE H 3 123 ? 4.643   32.917  18.185 1.00 64.29  ? 117 PHE D C     1 
ATOM   7443  O O     . PHE H 3 123 ? 4.431   32.976  19.394 1.00 63.62  ? 117 PHE D O     1 
ATOM   7444  C CB    . PHE H 3 123 ? 6.937   33.763  17.568 1.00 64.41  ? 117 PHE D CB    1 
ATOM   7445  C CG    . PHE H 3 123 ? 8.401   33.441  17.673 1.00 63.10  ? 117 PHE D CG    1 
ATOM   7446  C CD1   . PHE H 3 123 ? 9.069   32.793  16.635 1.00 63.25  ? 117 PHE D CD1   1 
ATOM   7447  C CD2   . PHE H 3 123 ? 9.118   33.793  18.805 1.00 62.46  ? 117 PHE D CD2   1 
ATOM   7448  C CE1   . PHE H 3 123 ? 10.428  32.499  16.727 1.00 62.14  ? 117 PHE D CE1   1 
ATOM   7449  C CE2   . PHE H 3 123 ? 10.478  33.496  18.907 1.00 62.05  ? 117 PHE D CE2   1 
ATOM   7450  C CZ    . PHE H 3 123 ? 11.133  32.852  17.863 1.00 61.57  ? 117 PHE D CZ    1 
ATOM   7451  N N     . THR H 3 124 ? 3.695   33.133  17.275 1.00 66.68  ? 118 THR D N     1 
ATOM   7452  C CA    . THR H 3 124 ? 2.312   33.421  17.676 1.00 68.53  ? 118 THR D CA    1 
ATOM   7453  C C     . THR H 3 124 ? 1.654   32.179  18.290 1.00 66.94  ? 118 THR D C     1 
ATOM   7454  O O     . THR H 3 124 ? 0.983   32.276  19.318 1.00 67.10  ? 118 THR D O     1 
ATOM   7455  C CB    . THR H 3 124 ? 1.469   34.036  16.523 1.00 71.99  ? 118 THR D CB    1 
ATOM   7456  O OG1   . THR H 3 124 ? 1.937   35.364  16.250 1.00 73.68  ? 118 THR D OG1   1 
ATOM   7457  C CG2   . THR H 3 124 ? -0.014  34.107  16.885 1.00 74.01  ? 118 THR D CG2   1 
ATOM   7458  N N     . ASP H 3 125 ? 1.880   31.019  17.681 1.00 65.66  ? 119 ASP D N     1 
ATOM   7459  C CA    . ASP H 3 125 ? 1.383   29.754  18.237 1.00 64.66  ? 119 ASP D CA    1 
ATOM   7460  C C     . ASP H 3 125 ? 1.938   29.428  19.630 1.00 61.84  ? 119 ASP D C     1 
ATOM   7461  O O     . ASP H 3 125 ? 1.211   28.933  20.500 1.00 61.20  ? 119 ASP D O     1 
ATOM   7462  C CB    . ASP H 3 125 ? 1.685   28.590  17.299 1.00 64.36  ? 119 ASP D CB    1 
ATOM   7463  C CG    . ASP H 3 125 ? 1.350   27.254  17.923 1.00 63.85  ? 119 ASP D CG    1 
ATOM   7464  O OD1   . ASP H 3 125 ? 0.147   26.911  17.972 1.00 65.42  ? 119 ASP D OD1   1 
ATOM   7465  O OD2   . ASP H 3 125 ? 2.291   26.555  18.372 1.00 62.26  ? 119 ASP D OD2   1 
ATOM   7466  N N     . GLN H 3 126 ? 3.227   29.700  19.810 1.00 60.21  ? 120 GLN D N     1 
ATOM   7467  C CA    . GLN H 3 126 ? 3.934   29.450  21.054 1.00 58.42  ? 120 GLN D CA    1 
ATOM   7468  C C     . GLN H 3 126 ? 3.430   30.391  22.160 1.00 59.54  ? 120 GLN D C     1 
ATOM   7469  O O     . GLN H 3 126 ? 3.227   29.956  23.309 1.00 58.59  ? 120 GLN D O     1 
ATOM   7470  C CB    . GLN H 3 126 ? 5.441   29.623  20.822 1.00 57.44  ? 120 GLN D CB    1 
ATOM   7471  C CG    . GLN H 3 126 ? 6.351   29.242  21.991 1.00 55.96  ? 120 GLN D CG    1 
ATOM   7472  C CD    . GLN H 3 126 ? 6.451   27.739  22.244 1.00 56.26  ? 120 GLN D CD    1 
ATOM   7473  O OE1   . GLN H 3 126 ? 6.879   27.315  23.327 1.00 56.22  ? 120 GLN D OE1   1 
ATOM   7474  N NE2   . GLN H 3 126 ? 6.071   26.928  21.254 1.00 55.91  ? 120 GLN D NE2   1 
ATOM   7475  N N     . LEU H 3 127 ? 3.221   31.665  21.802 1.00 61.54  ? 121 LEU D N     1 
ATOM   7476  C CA    . LEU H 3 127 ? 2.690   32.683  22.716 1.00 62.95  ? 121 LEU D CA    1 
ATOM   7477  C C     . LEU H 3 127 ? 1.259   32.342  23.146 1.00 64.17  ? 121 LEU D C     1 
ATOM   7478  O O     . LEU H 3 127 ? 0.912   32.448  24.330 1.00 63.99  ? 121 LEU D O     1 
ATOM   7479  C CB    . LEU H 3 127 ? 2.749   34.068  22.050 1.00 65.75  ? 121 LEU D CB    1 
ATOM   7480  C CG    . LEU H 3 127 ? 2.268   35.349  22.760 1.00 68.49  ? 121 LEU D CG    1 
ATOM   7481  C CD1   . LEU H 3 127 ? 2.955   35.556  24.123 1.00 67.65  ? 121 LEU D CD1   1 
ATOM   7482  C CD2   . LEU H 3 127 ? 2.490   36.563  21.874 1.00 69.13  ? 121 LEU D CD2   1 
ATOM   7483  N N     . LEU H 3 128 ? 0.451   31.925  22.171 1.00 65.40  ? 122 LEU D N     1 
ATOM   7484  C CA    . LEU H 3 128 ? -0.930  31.506  22.384 1.00 67.38  ? 122 LEU D CA    1 
ATOM   7485  C C     . LEU H 3 128 ? -0.949  30.379  23.413 1.00 65.51  ? 122 LEU D C     1 
ATOM   7486  O O     . LEU H 3 128 ? -1.675  30.458  24.405 1.00 67.04  ? 122 LEU D O     1 
ATOM   7487  C CB    . LEU H 3 128 ? -1.538  31.048  21.044 1.00 69.20  ? 122 LEU D CB    1 
ATOM   7488  C CG    . LEU H 3 128 ? -3.024  30.925  20.637 1.00 73.03  ? 122 LEU D CG    1 
ATOM   7489  C CD1   . LEU H 3 128 ? -3.768  29.808  21.402 1.00 73.41  ? 122 LEU D CD1   1 
ATOM   7490  C CD2   . LEU H 3 128 ? -3.785  32.264  20.704 1.00 76.58  ? 122 LEU D CD2   1 
ATOM   7491  N N     . LYS H 3 129 ? -0.116  29.359  23.201 1.00 62.72  ? 123 LYS D N     1 
ATOM   7492  C CA    . LYS H 3 129 ? -0.069  28.188  24.080 1.00 60.79  ? 123 LYS D CA    1 
ATOM   7493  C C     . LYS H 3 129 ? 0.466   28.499  25.489 1.00 59.31  ? 123 LYS D C     1 
ATOM   7494  O O     . LYS H 3 129 ? -0.014  27.953  26.492 1.00 58.70  ? 123 LYS D O     1 
ATOM   7495  C CB    . LYS H 3 129 ? 0.738   27.058  23.423 1.00 58.92  ? 123 LYS D CB    1 
ATOM   7496  C CG    . LYS H 3 129 ? 0.001   26.316  22.311 1.00 61.17  ? 123 LYS D CG    1 
ATOM   7497  C CD    . LYS H 3 129 ? 0.972   25.555  21.386 1.00 61.16  ? 123 LYS D CD    1 
ATOM   7498  C CE    . LYS H 3 129 ? 0.237   24.749  20.310 1.00 62.72  ? 123 LYS D CE    1 
ATOM   7499  N N     . ARG H 3 130 ? 1.459   29.380  25.562 1.00 58.68  ? 124 ARG D N     1 
ATOM   7500  C CA    . ARG H 3 130 ? 2.037   29.737  26.854 1.00 57.81  ? 124 ARG D CA    1 
ATOM   7501  C C     . ARG H 3 130 ? 1.169   30.687  27.649 1.00 60.28  ? 124 ARG D C     1 
ATOM   7502  O O     . ARG H 3 130 ? 1.191   30.631  28.867 1.00 60.50  ? 124 ARG D O     1 
ATOM   7503  C CB    . ARG H 3 130 ? 3.477   30.219  26.721 1.00 56.48  ? 124 ARG D CB    1 
ATOM   7504  C CG    . ARG H 3 130 ? 4.383   29.059  26.356 1.00 54.87  ? 124 ARG D CG    1 
ATOM   7505  C CD    . ARG H 3 130 ? 5.836   29.352  26.554 1.00 54.34  ? 124 ARG D CD    1 
ATOM   7506  N NE    . ARG H 3 130 ? 6.631   28.192  26.162 1.00 53.25  ? 124 ARG D NE    1 
ATOM   7507  C CZ    . ARG H 3 130 ? 7.028   27.227  26.992 1.00 51.65  ? 124 ARG D CZ    1 
ATOM   7508  N NH1   . ARG H 3 130 ? 6.733   27.266  28.281 1.00 52.86  ? 124 ARG D NH1   1 
ATOM   7509  N NH2   . ARG H 3 130 ? 7.731   26.220  26.534 1.00 50.76  ? 124 ARG D NH2   1 
ATOM   7510  N N     . LYS H 3 131 ? 0.382   31.532  26.980 1.00 62.82  ? 125 LYS D N     1 
ATOM   7511  C CA    . LYS H 3 131 ? -0.662  32.285  27.683 1.00 65.86  ? 125 LYS D CA    1 
ATOM   7512  C C     . LYS H 3 131 ? -1.663  31.320  28.328 1.00 66.06  ? 125 LYS D C     1 
ATOM   7513  O O     . LYS H 3 131 ? -2.117  31.546  29.446 1.00 67.30  ? 125 LYS D O     1 
ATOM   7514  C CB    . LYS H 3 131 ? -1.382  33.284  26.760 1.00 69.04  ? 125 LYS D CB    1 
ATOM   7515  C CG    . LYS H 3 131 ? -0.634  34.604  26.540 1.00 69.73  ? 125 LYS D CG    1 
ATOM   7516  C CD    . LYS H 3 131 ? -1.367  35.513  25.553 1.00 73.61  ? 125 LYS D CD    1 
ATOM   7517  C CE    . LYS H 3 131 ? -0.472  36.656  25.074 1.00 75.30  ? 125 LYS D CE    1 
ATOM   7518  N NZ    . LYS H 3 131 ? -1.193  37.754  24.360 1.00 78.57  ? 125 LYS D NZ    1 
ATOM   7519  N N     . ALA H 3 132 ? -1.980  30.235  27.626 1.00 65.20  ? 126 ALA D N     1 
ATOM   7520  C CA    . ALA H 3 132 ? -2.910  29.235  28.141 1.00 65.94  ? 126 ALA D CA    1 
ATOM   7521  C C     . ALA H 3 132 ? -2.337  28.497  29.355 1.00 63.89  ? 126 ALA D C     1 
ATOM   7522  O O     . ALA H 3 132 ? -3.054  28.229  30.325 1.00 64.99  ? 126 ALA D O     1 
ATOM   7523  C CB    . ALA H 3 132 ? -3.312  28.265  27.048 1.00 65.81  ? 126 ALA D CB    1 
ATOM   7524  N N     . LYS H 3 133 ? -1.044  28.193  29.300 1.00 61.14  ? 127 LYS D N     1 
ATOM   7525  C CA    . LYS H 3 133 ? -0.351  27.592  30.428 1.00 59.64  ? 127 LYS D CA    1 
ATOM   7526  C C     . LYS H 3 133 ? -0.347  28.548  31.621 1.00 60.36  ? 127 LYS D C     1 
ATOM   7527  O O     . LYS H 3 133 ? -0.794  28.192  32.709 1.00 61.00  ? 127 LYS D O     1 
ATOM   7528  C CB    . LYS H 3 133 ? 1.077   27.196  30.041 1.00 57.27  ? 127 LYS D CB    1 
ATOM   7529  C CG    . LYS H 3 133 ? 1.763   26.299  31.076 1.00 58.31  ? 127 LYS D CG    1 
ATOM   7530  C CD    . LYS H 3 133 ? 3.080   25.688  30.564 1.00 60.33  ? 127 LYS D CD    1 
ATOM   7531  C CE    . LYS H 3 133 ? 3.388   24.395  31.319 1.00 61.34  ? 127 LYS D CE    1 
ATOM   7532  N NZ    . LYS H 3 133 ? 4.856   24.114  31.454 1.00 62.65  ? 127 LYS D NZ    1 
ATOM   7533  N N     . LEU H 3 134 ? 0.147   29.762  31.393 1.00 60.81  ? 128 LEU D N     1 
ATOM   7534  C CA    . LEU H 3 134 ? 0.191   30.811  32.401 1.00 62.23  ? 128 LEU D CA    1 
ATOM   7535  C C     . LEU H 3 134 ? -1.160  31.051  33.084 1.00 64.96  ? 128 LEU D C     1 
ATOM   7536  O O     . LEU H 3 134 ? -1.215  31.204  34.303 1.00 65.67  ? 128 LEU D O     1 
ATOM   7537  C CB    . LEU H 3 134 ? 0.739   32.112  31.794 1.00 63.46  ? 128 LEU D CB    1 
ATOM   7538  C CG    . LEU H 3 134 ? 0.782   33.368  32.681 1.00 66.50  ? 128 LEU D CG    1 
ATOM   7539  C CD1   . LEU H 3 134 ? 1.572   33.125  33.967 1.00 65.06  ? 128 LEU D CD1   1 
ATOM   7540  C CD2   . LEU H 3 134 ? 1.360   34.546  31.929 1.00 67.51  ? 128 LEU D CD2   1 
ATOM   7541  N N     . SER H 3 135 ? -2.235  31.070  32.301 1.00 66.68  ? 129 SER D N     1 
ATOM   7542  C CA    . SER H 3 135 ? -3.585  31.254  32.839 1.00 70.20  ? 129 SER D CA    1 
ATOM   7543  C C     . SER H 3 135 ? -3.973  30.132  33.803 1.00 69.86  ? 129 SER D C     1 
ATOM   7544  O O     . SER H 3 135 ? -4.516  30.394  34.880 1.00 71.99  ? 129 SER D O     1 
ATOM   7545  C CB    . SER H 3 135 ? -4.604  31.370  31.702 1.00 72.35  ? 129 SER D CB    1 
ATOM   7546  O OG    . SER H 3 135 ? -5.927  31.243  32.179 1.00 74.57  ? 129 SER D OG    1 
ATOM   7547  N N     . ASP H 3 136 ? -3.681  28.891  33.409 1.00 67.59  ? 130 ASP D N     1 
ATOM   7548  C CA    . ASP H 3 136 ? -3.940  27.714  34.239 1.00 67.31  ? 130 ASP D CA    1 
ATOM   7549  C C     . ASP H 3 136 ? -3.177  27.762  35.571 1.00 66.48  ? 130 ASP D C     1 
ATOM   7550  O O     . ASP H 3 136 ? -3.732  27.428  36.623 1.00 67.99  ? 130 ASP D O     1 
ATOM   7551  C CB    . ASP H 3 136 ? -3.606  26.436  33.473 1.00 65.08  ? 130 ASP D CB    1 
ATOM   7552  N N     . LEU H 3 137 ? -1.915  28.189  35.517 1.00 64.58  ? 131 LEU D N     1 
ATOM   7553  C CA    . LEU H 3 137 ? -1.100  28.399  36.716 1.00 64.25  ? 131 LEU D CA    1 
ATOM   7554  C C     . LEU H 3 137 ? -1.626  29.548  37.587 1.00 67.82  ? 131 LEU D C     1 
ATOM   7555  O O     . LEU H 3 137 ? -1.687  29.431  38.816 1.00 68.67  ? 131 LEU D O     1 
ATOM   7556  C CB    . LEU H 3 137 ? 0.362   28.640  36.331 1.00 61.77  ? 131 LEU D CB    1 
ATOM   7557  C CG    . LEU H 3 137 ? 1.179   27.422  35.861 1.00 59.54  ? 131 LEU D CG    1 
ATOM   7558  C CD1   . LEU H 3 137 ? 2.394   27.862  35.044 1.00 58.33  ? 131 LEU D CD1   1 
ATOM   7559  C CD2   . LEU H 3 137 ? 1.617   26.534  37.033 1.00 58.02  ? 131 LEU D CD2   1 
ATOM   7560  N N     . GLN H 3 138 ? -2.017  30.653  36.948 1.00 70.23  ? 132 GLN D N     1 
ATOM   7561  C CA    . GLN H 3 138 ? -2.591  31.793  37.664 1.00 74.25  ? 132 GLN D CA    1 
ATOM   7562  C C     . GLN H 3 138 ? -3.840  31.353  38.417 1.00 76.68  ? 132 GLN D C     1 
ATOM   7563  O O     . GLN H 3 138 ? -4.180  31.926  39.451 1.00 79.68  ? 132 GLN D O     1 
ATOM   7564  C CB    . GLN H 3 138 ? -2.919  32.945  36.700 1.00 76.69  ? 132 GLN D CB    1 
ATOM   7565  C CG    . GLN H 3 138 ? -3.300  34.274  37.377 1.00 82.00  ? 132 GLN D CG    1 
ATOM   7566  C CD    . GLN H 3 138 ? -2.132  34.951  38.097 1.00 83.00  ? 132 GLN D CD    1 
ATOM   7567  O OE1   . GLN H 3 138 ? -1.051  35.126  37.527 1.00 81.68  ? 132 GLN D OE1   1 
ATOM   7568  N NE2   . GLN H 3 138 ? -2.355  35.347  39.347 1.00 85.21  ? 132 GLN D NE2   1 
ATOM   7569  N N     . GLY H 3 139 ? -4.512  30.328  37.894 1.00 75.88  ? 133 GLY D N     1 
ATOM   7570  C CA    . GLY H 3 139 ? -5.711  29.775  38.524 1.00 78.42  ? 133 GLY D CA    1 
ATOM   7571  C C     . GLY H 3 139 ? -5.400  28.984  39.779 1.00 77.43  ? 133 GLY D C     1 
ATOM   7572  O O     . GLY H 3 139 ? -6.125  29.071  40.773 1.00 80.33  ? 133 GLY D O     1 
ATOM   7573  N N     . SER H 3 140 ? -4.314  28.213  39.723 1.00 73.79  ? 134 SER D N     1 
ATOM   7574  C CA    . SER H 3 140 ? -3.877  27.387  40.851 1.00 72.87  ? 134 SER D CA    1 
ATOM   7575  C C     . SER H 3 140 ? -3.353  28.263  41.972 1.00 74.20  ? 134 SER D C     1 
ATOM   7576  O O     . SER H 3 140 ? -3.533  27.942  43.152 1.00 75.64  ? 134 SER D O     1 
ATOM   7577  C CB    . SER H 3 140 ? -2.782  26.411  40.427 1.00 68.83  ? 134 SER D CB    1 
ATOM   7578  O OG    . SER H 3 140 ? -3.163  25.678  39.283 1.00 68.08  ? 134 SER D OG    1 
ATOM   7579  N N     . TYR H 3 141 ? -2.710  29.366  41.585 1.00 74.11  ? 135 TYR D N     1 
ATOM   7580  C CA    . TYR H 3 141 ? -2.124  30.318  42.523 1.00 75.76  ? 135 TYR D CA    1 
ATOM   7581  C C     . TYR H 3 141 ? -3.191  31.010  43.361 1.00 80.54  ? 135 TYR D C     1 
ATOM   7582  O O     . TYR H 3 141 ? -2.971  31.324  44.534 1.00 82.69  ? 135 TYR D O     1 
ATOM   7583  C CB    . TYR H 3 141 ? -1.272  31.359  41.778 1.00 75.21  ? 135 TYR D CB    1 
ATOM   7584  C CG    . TYR H 3 141 ? -0.680  32.400  42.689 1.00 77.56  ? 135 TYR D CG    1 
ATOM   7585  C CD1   . TYR H 3 141 ? 0.281   32.051  43.641 1.00 75.93  ? 135 TYR D CD1   1 
ATOM   7586  C CD2   . TYR H 3 141 ? -1.103  33.739  42.626 1.00 81.82  ? 135 TYR D CD2   1 
ATOM   7587  C CE1   . TYR H 3 141 ? 0.813   33.007  44.507 1.00 79.62  ? 135 TYR D CE1   1 
ATOM   7588  C CE2   . TYR H 3 141 ? -0.573  34.705  43.488 1.00 84.52  ? 135 TYR D CE2   1 
ATOM   7589  C CZ    . TYR H 3 141 ? 0.382   34.329  44.426 1.00 83.58  ? 135 TYR D CZ    1 
ATOM   7590  O OH    . TYR H 3 141 ? 0.921   35.263  45.280 1.00 87.07  ? 135 TYR D OH    1 
ATOM   7591  N N     . GLU H 3 142 ? -4.346  31.246  42.752 1.00 82.84  ? 136 GLU D N     1 
ATOM   7592  C CA    . GLU H 3 142 ? -5.427  31.947  43.424 1.00 87.85  ? 136 GLU D CA    1 
ATOM   7593  C C     . GLU H 3 142 ? -6.261  31.003  44.280 1.00 89.26  ? 136 GLU D C     1 
ATOM   7594  O O     . GLU H 3 142 ? -6.766  31.401  45.334 1.00 93.24  ? 136 GLU D O     1 
ATOM   7595  C CB    . GLU H 3 142 ? -6.275  32.716  42.414 1.00 90.33  ? 136 GLU D CB    1 
ATOM   7596  C CG    . GLU H 3 142 ? -5.506  33.870  41.796 1.00 90.27  ? 136 GLU D CG    1 
ATOM   7597  C CD    . GLU H 3 142 ? -6.303  34.629  40.766 1.00 93.51  ? 136 GLU D CD    1 
ATOM   7598  O OE1   . GLU H 3 142 ? -7.324  35.246  41.151 1.00 99.28  ? 136 GLU D OE1   1 
ATOM   7599  O OE2   . GLU H 3 142 ? -5.897  34.628  39.579 1.00 89.94  ? 136 GLU D OE2   1 
ATOM   7600  N N     . LYS H 3 143 ? -6.385  29.752  43.838 1.00 86.61  ? 137 LYS D N     1 
ATOM   7601  C CA    . LYS H 3 143 ? -7.027  28.714  44.649 1.00 87.79  ? 137 LYS D CA    1 
ATOM   7602  C C     . LYS H 3 143 ? -6.216  28.406  45.908 1.00 87.01  ? 137 LYS D C     1 
ATOM   7603  O O     . LYS H 3 143 ? -6.791  28.117  46.958 1.00 89.77  ? 137 LYS D O     1 
ATOM   7604  C CB    . LYS H 3 143 ? -7.269  27.436  43.841 1.00 85.37  ? 137 LYS D CB    1 
ATOM   7605  N N     . LEU H 3 144 ? -4.887  28.479  45.801 1.00 83.94  ? 138 LEU D N     1 
ATOM   7606  C CA    . LEU H 3 144 ? -4.009  28.286  46.960 1.00 83.62  ? 138 LEU D CA    1 
ATOM   7607  C C     . LEU H 3 144 ? -4.049  29.476  47.906 1.00 87.60  ? 138 LEU D C     1 
ATOM   7608  O O     . LEU H 3 144 ? -3.958  29.300  49.118 1.00 89.32  ? 138 LEU D O     1 
ATOM   7609  C CB    . LEU H 3 144 ? -2.555  27.989  46.554 1.00 79.47  ? 138 LEU D CB    1 
ATOM   7610  C CG    . LEU H 3 144 ? -1.551  27.927  47.724 1.00 79.27  ? 138 LEU D CG    1 
ATOM   7611  C CD1   . LEU H 3 144 ? -1.805  26.718  48.626 1.00 79.42  ? 138 LEU D CD1   1 
ATOM   7612  C CD2   . LEU H 3 144 ? -0.101  27.953  47.261 1.00 76.07  ? 138 LEU D CD2   1 
ATOM   7613  N N     . MET H 3 145 ? -4.183  30.681  47.360 1.00 89.72  ? 139 MET D N     1 
ATOM   7614  C CA    . MET H 3 145 ? -4.199  31.878  48.198 1.00 94.53  ? 139 MET D CA    1 
ATOM   7615  C C     . MET H 3 145 ? -5.470  32.025  49.029 1.00 99.27  ? 139 MET D C     1 
ATOM   7616  O O     . MET H 3 145 ? -5.407  32.466  50.176 1.00 102.67 ? 139 MET D O     1 
ATOM   7617  C CB    . MET H 3 145 ? -3.919  33.141  47.384 1.00 95.88  ? 139 MET D CB    1 
ATOM   7618  C CG    . MET H 3 145 ? -2.444  33.328  47.028 1.00 94.70  ? 139 MET D CG    1 
ATOM   7619  S SD    . MET H 3 145 ? -1.310  32.514  48.185 1.00 95.64  ? 139 MET D SD    1 
ATOM   7620  C CE    . MET H 3 145 ? -0.163  33.853  48.530 1.00 97.34  ? 139 MET D CE    1 
ATOM   7621  N N     . ALA H 3 146 ? -6.609  31.634  48.458 1.00 100.12 ? 140 ALA D N     1 
ATOM   7622  C CA    . ALA H 3 146 ? -7.889  31.642  49.175 1.00 104.91 ? 140 ALA D CA    1 
ATOM   7623  C C     . ALA H 3 146 ? -7.828  30.810  50.461 1.00 105.22 ? 140 ALA D C     1 
ATOM   7624  O O     . ALA H 3 146 ? -8.402  31.191  51.488 1.00 109.82 ? 140 ALA D O     1 
ATOM   7625  C CB    . ALA H 3 146 ? -9.006  31.147  48.268 1.00 105.36 ? 140 ALA D CB    1 
ATOM   7626  N N     . SER H 3 147 ? -7.122  29.681  50.380 1.00 100.57 ? 141 SER D N     1 
ATOM   7627  C CA    . SER H 3 147 ? -6.828  28.822  51.524 1.00 100.26 ? 141 SER D CA    1 
ATOM   7628  C C     . SER H 3 147 ? -5.863  29.534  52.470 1.00 101.20 ? 141 SER D C     1 
ATOM   7629  O O     . SER H 3 147 ? -5.061  28.900  53.155 1.00 99.45  ? 141 SER D O     1 
ATOM   7630  C CB    . SER H 3 147 ? -6.224  27.491  51.047 1.00 95.25  ? 141 SER D CB    1 
ATOM   7631  N N     . PRO H 3 150 ? -2.603  34.206  54.037 1.00 108.69 ? 144 PRO D N     1 
ATOM   7632  C CA    . PRO H 3 150 ? -1.375  34.955  54.315 1.00 109.55 ? 144 PRO D CA    1 
ATOM   7633  C C     . PRO H 3 150 ? -0.155  34.030  54.369 1.00 104.79 ? 144 PRO D C     1 
ATOM   7634  O O     . PRO H 3 150 ? -0.030  33.210  55.283 1.00 104.49 ? 144 PRO D O     1 
ATOM   7635  C CB    . PRO H 3 150 ? -1.650  35.608  55.682 1.00 115.84 ? 144 PRO D CB    1 
ATOM   7636  C CG    . PRO H 3 150 ? -2.744  34.797  56.295 1.00 116.69 ? 144 PRO D CG    1 
ATOM   7637  C CD    . PRO H 3 150 ? -3.561  34.254  55.158 1.00 113.71 ? 144 PRO D CD    1 
ATOM   7638  N N     . MET H 3 151 ? 0.732   34.177  53.386 1.00 101.44 ? 145 MET D N     1 
ATOM   7639  C CA    . MET H 3 151 ? 1.878   33.282  53.203 1.00 96.79  ? 145 MET D CA    1 
ATOM   7640  C C     . MET H 3 151 ? 3.151   33.793  53.900 1.00 98.70  ? 145 MET D C     1 
ATOM   7641  O O     . MET H 3 151 ? 3.457   34.990  53.870 1.00 102.04 ? 145 MET D O     1 
ATOM   7642  C CB    . MET H 3 151 ? 2.112   33.026  51.701 1.00 92.13  ? 145 MET D CB    1 
ATOM   7643  C CG    . MET H 3 151 ? 3.152   31.951  51.337 1.00 86.72  ? 145 MET D CG    1 
ATOM   7644  S SD    . MET H 3 151 ? 2.881   30.235  51.891 1.00 83.25  ? 145 MET D SD    1 
ATOM   7645  C CE    . MET H 3 151 ? 1.205   29.883  51.344 1.00 82.11  ? 145 MET D CE    1 
ATOM   7646  N N     . SER H 3 152 ? 3.863   32.863  54.540 1.00 96.89  ? 146 SER D N     1 
ATOM   7647  C CA    . SER H 3 152 ? 5.142   33.122  55.208 1.00 98.22  ? 146 SER D CA    1 
ATOM   7648  C C     . SER H 3 152 ? 5.959   31.828  55.281 1.00 94.24  ? 146 SER D C     1 
ATOM   7649  O O     . SER H 3 152 ? 5.420   30.736  55.083 1.00 91.20  ? 146 SER D O     1 
ATOM   7650  C CB    . SER H 3 152 ? 4.916   33.682  56.615 1.00 103.89 ? 146 SER D CB    1 
ATOM   7651  O OG    . SER H 3 152 ? 4.319   32.715  57.463 1.00 103.50 ? 146 SER D OG    1 
ATOM   7652  N N     . PHE H 3 153 ? 7.251   31.957  55.578 1.00 94.66  ? 147 PHE D N     1 
ATOM   7653  C CA    . PHE H 3 153 ? 8.154   30.808  55.686 1.00 91.55  ? 147 PHE D CA    1 
ATOM   7654  C C     . PHE H 3 153 ? 7.623   29.722  56.624 1.00 91.44  ? 147 PHE D C     1 
ATOM   7655  O O     . PHE H 3 153 ? 7.904   28.544  56.431 1.00 88.29  ? 147 PHE D O     1 
ATOM   7656  C CB    . PHE H 3 153 ? 9.550   31.263  56.134 1.00 93.91  ? 147 PHE D CB    1 
ATOM   7657  C CG    . PHE H 3 153 ? 10.491  30.127  56.461 1.00 92.09  ? 147 PHE D CG    1 
ATOM   7658  C CD1   . PHE H 3 153 ? 11.197  29.475  55.452 1.00 87.54  ? 147 PHE D CD1   1 
ATOM   7659  C CD2   . PHE H 3 153 ? 10.673  29.712  57.781 1.00 94.32  ? 147 PHE D CD2   1 
ATOM   7660  C CE1   . PHE H 3 153 ? 12.067  28.430  55.749 1.00 86.23  ? 147 PHE D CE1   1 
ATOM   7661  C CE2   . PHE H 3 153 ? 11.536  28.665  58.087 1.00 92.94  ? 147 PHE D CE2   1 
ATOM   7662  C CZ    . PHE H 3 153 ? 12.234  28.023  57.071 1.00 89.41  ? 147 PHE D CZ    1 
ATOM   7663  N N     . SER H 3 154 ? 6.862   30.133  57.634 1.00 95.26  ? 148 SER D N     1 
ATOM   7664  C CA    . SER H 3 154 ? 6.325   29.215  58.640 1.00 95.96  ? 148 SER D CA    1 
ATOM   7665  C C     . SER H 3 154 ? 5.192   28.335  58.101 1.00 92.66  ? 148 SER D C     1 
ATOM   7666  O O     . SER H 3 154 ? 4.977   27.224  58.591 1.00 91.63  ? 148 SER D O     1 
ATOM   7667  C CB    . SER H 3 154 ? 5.854   29.997  59.878 1.00 101.38 ? 148 SER D CB    1 
ATOM   7668  N N     . SER H 3 155 ? 4.482   28.840  57.094 1.00 91.28  ? 149 SER D N     1 
ATOM   7669  C CA    . SER H 3 155 ? 3.288   28.178  56.557 1.00 89.46  ? 149 SER D CA    1 
ATOM   7670  C C     . SER H 3 155 ? 3.532   26.735  56.088 1.00 85.29  ? 149 SER D C     1 
ATOM   7671  O O     . SER H 3 155 ? 4.552   26.443  55.453 1.00 82.37  ? 149 SER D O     1 
ATOM   7672  C CB    . SER H 3 155 ? 2.676   29.005  55.421 1.00 88.80  ? 149 SER D CB    1 
ATOM   7673  N N     . PRO H 3 156 ? 2.598   25.825  56.414 1.00 85.30  ? 150 PRO D N     1 
ATOM   7674  C CA    . PRO H 3 156 ? 2.698   24.449  55.934 1.00 81.90  ? 150 PRO D CA    1 
ATOM   7675  C C     . PRO H 3 156 ? 2.687   24.363  54.407 1.00 78.03  ? 150 PRO D C     1 
ATOM   7676  O O     . PRO H 3 156 ? 3.227   23.420  53.850 1.00 75.21  ? 150 PRO D O     1 
ATOM   7677  C CB    . PRO H 3 156 ? 1.447   23.785  56.514 1.00 83.88  ? 150 PRO D CB    1 
ATOM   7678  C CG    . PRO H 3 156 ? 1.115   24.590  57.717 1.00 88.46  ? 150 PRO D CG    1 
ATOM   7679  C CD    . PRO H 3 156 ? 1.470   26.002  57.346 1.00 89.23  ? 150 PRO D CD    1 
ATOM   7680  N N     . ASP H 3 157 ? 2.105   25.360  53.749 1.00 78.38  ? 151 ASP D N     1 
ATOM   7681  C CA    . ASP H 3 157 ? 1.997   25.385  52.290 1.00 75.43  ? 151 ASP D CA    1 
ATOM   7682  C C     . ASP H 3 157 ? 3.113   26.181  51.589 1.00 73.56  ? 151 ASP D C     1 
ATOM   7683  O O     . ASP H 3 157 ? 2.992   26.517  50.400 1.00 71.58  ? 151 ASP D O     1 
ATOM   7684  C CB    . ASP H 3 157 ? 0.621   25.936  51.864 1.00 77.36  ? 151 ASP D CB    1 
ATOM   7685  C CG    . ASP H 3 157 ? -0.552  25.144  52.449 1.00 80.40  ? 151 ASP D CG    1 
ATOM   7686  O OD1   . ASP H 3 157 ? -0.450  23.902  52.584 1.00 80.23  ? 151 ASP D OD1   1 
ATOM   7687  O OD2   . ASP H 3 157 ? -1.588  25.774  52.766 1.00 84.28  ? 151 ASP D OD2   1 
ATOM   7688  N N     . PHE H 3 158 ? 4.195   26.475  52.306 1.00 74.11  ? 152 PHE D N     1 
ATOM   7689  C CA    . PHE H 3 158 ? 5.281   27.279  51.738 1.00 73.13  ? 152 PHE D CA    1 
ATOM   7690  C C     . PHE H 3 158 ? 5.968   26.605  50.534 1.00 69.17  ? 152 PHE D C     1 
ATOM   7691  O O     . PHE H 3 158 ? 6.241   27.269  49.524 1.00 67.70  ? 152 PHE D O     1 
ATOM   7692  C CB    . PHE H 3 158 ? 6.297   27.687  52.818 1.00 75.57  ? 152 PHE D CB    1 
ATOM   7693  C CG    . PHE H 3 158 ? 7.281   28.742  52.367 1.00 76.13  ? 152 PHE D CG    1 
ATOM   7694  C CD1   . PHE H 3 158 ? 6.842   29.990  51.931 1.00 78.13  ? 152 PHE D CD1   1 
ATOM   7695  C CD2   . PHE H 3 158 ? 8.651   28.492  52.389 1.00 75.29  ? 152 PHE D CD2   1 
ATOM   7696  C CE1   . PHE H 3 158 ? 7.753   30.966  51.513 1.00 78.90  ? 152 PHE D CE1   1 
ATOM   7697  C CE2   . PHE H 3 158 ? 9.567   29.462  51.976 1.00 75.87  ? 152 PHE D CE2   1 
ATOM   7698  C CZ    . PHE H 3 158 ? 9.117   30.696  51.538 1.00 77.73  ? 152 PHE D CZ    1 
ATOM   7699  N N     . GLY H 3 159 ? 6.230   25.297  50.648 1.00 67.34  ? 153 GLY D N     1 
ATOM   7700  C CA    . GLY H 3 159 ? 6.840   24.504  49.569 1.00 63.82  ? 153 GLY D CA    1 
ATOM   7701  C C     . GLY H 3 159 ? 6.000   24.515  48.307 1.00 62.01  ? 153 GLY D C     1 
ATOM   7702  O O     . GLY H 3 159 ? 6.497   24.787  47.206 1.00 60.10  ? 153 GLY D O     1 
ATOM   7703  N N     . HIS H 3 160 ? 4.718   24.218  48.484 1.00 62.85  ? 154 HIS D N     1 
ATOM   7704  C CA    . HIS H 3 160 ? 3.695   24.351  47.447 1.00 62.26  ? 154 HIS D CA    1 
ATOM   7705  C C     . HIS H 3 160 ? 3.750   25.739  46.784 1.00 62.48  ? 154 HIS D C     1 
ATOM   7706  O O     . HIS H 3 160 ? 3.772   25.855  45.555 1.00 60.77  ? 154 HIS D O     1 
ATOM   7707  C CB    . HIS H 3 160 ? 2.322   24.138  48.093 1.00 64.64  ? 154 HIS D CB    1 
ATOM   7708  C CG    . HIS H 3 160 ? 1.222   23.825  47.127 1.00 65.43  ? 154 HIS D CG    1 
ATOM   7709  N ND1   . HIS H 3 160 ? 0.155   23.018  47.460 1.00 67.99  ? 154 HIS D ND1   1 
ATOM   7710  C CD2   . HIS H 3 160 ? 1.023   24.199  45.840 1.00 65.24  ? 154 HIS D CD2   1 
ATOM   7711  C CE1   . HIS H 3 160 ? -0.660  22.919  46.425 1.00 68.12  ? 154 HIS D CE1   1 
ATOM   7712  N NE2   . HIS H 3 160 ? -0.153  23.623  45.427 1.00 66.32  ? 154 HIS D NE2   1 
ATOM   7713  N N     . TYR H 3 161 ? 3.775   26.779  47.616 1.00 64.79  ? 155 TYR D N     1 
ATOM   7714  C CA    . TYR H 3 161 ? 3.841   28.171  47.169 1.00 65.67  ? 155 TYR D CA    1 
ATOM   7715  C C     . TYR H 3 161 ? 5.102   28.431  46.347 1.00 63.47  ? 155 TYR D C     1 
ATOM   7716  O O     . TYR H 3 161 ? 5.045   29.073  45.304 1.00 62.82  ? 155 TYR D O     1 
ATOM   7717  C CB    . TYR H 3 161 ? 3.760   29.110  48.392 1.00 69.43  ? 155 TYR D CB    1 
ATOM   7718  C CG    . TYR H 3 161 ? 4.022   30.568  48.118 1.00 71.18  ? 155 TYR D CG    1 
ATOM   7719  C CD1   . TYR H 3 161 ? 2.976   31.431  47.785 1.00 74.01  ? 155 TYR D CD1   1 
ATOM   7720  C CD2   . TYR H 3 161 ? 5.308   31.097  48.212 1.00 71.33  ? 155 TYR D CD2   1 
ATOM   7721  C CE1   . TYR H 3 161 ? 3.201   32.785  47.546 1.00 76.49  ? 155 TYR D CE1   1 
ATOM   7722  C CE2   . TYR H 3 161 ? 5.550   32.449  47.968 1.00 74.43  ? 155 TYR D CE2   1 
ATOM   7723  C CZ    . TYR H 3 161 ? 4.490   33.289  47.637 1.00 76.93  ? 155 TYR D CZ    1 
ATOM   7724  O OH    . TYR H 3 161 ? 4.716   34.624  47.375 1.00 79.33  ? 155 TYR D OH    1 
ATOM   7725  N N     . LEU H 3 162 ? 6.235   27.927  46.821 1.00 62.75  ? 156 LEU D N     1 
ATOM   7726  C CA    . LEU H 3 162 ? 7.498   28.067  46.105 1.00 61.60  ? 156 LEU D CA    1 
ATOM   7727  C C     . LEU H 3 162 ? 7.471   27.486  44.676 1.00 58.91  ? 156 LEU D C     1 
ATOM   7728  O O     . LEU H 3 162 ? 7.857   28.188  43.730 1.00 58.52  ? 156 LEU D O     1 
ATOM   7729  C CB    . LEU H 3 162 ? 8.656   27.472  46.914 1.00 61.79  ? 156 LEU D CB    1 
ATOM   7730  C CG    . LEU H 3 162 ? 9.024   28.154  48.234 1.00 65.15  ? 156 LEU D CG    1 
ATOM   7731  C CD1   . LEU H 3 162 ? 10.043  27.346  49.003 1.00 64.85  ? 156 LEU D CD1   1 
ATOM   7732  C CD2   . LEU H 3 162 ? 9.552   29.543  47.978 1.00 67.08  ? 156 LEU D CD2   1 
ATOM   7733  N N     . VAL H 3 163 ? 7.014   26.232  44.513 1.00 57.13  ? 157 VAL D N     1 
ATOM   7734  C CA    . VAL H 3 163 ? 6.953   25.630  43.174 1.00 54.99  ? 157 VAL D CA    1 
ATOM   7735  C C     . VAL H 3 163 ? 5.951   26.363  42.291 1.00 55.50  ? 157 VAL D C     1 
ATOM   7736  O O     . VAL H 3 163 ? 6.190   26.518  41.089 1.00 54.36  ? 157 VAL D O     1 
ATOM   7737  C CB    . VAL H 3 163 ? 6.736   24.063  43.128 1.00 53.40  ? 157 VAL D CB    1 
ATOM   7738  C CG1   . VAL H 3 163 ? 7.743   23.337  43.998 1.00 53.90  ? 157 VAL D CG1   1 
ATOM   7739  C CG2   . VAL H 3 163 ? 5.332   23.659  43.509 1.00 54.53  ? 157 VAL D CG2   1 
ATOM   7740  N N     . LEU H 3 164 ? 4.849   26.829  42.878 1.00 57.66  ? 158 LEU D N     1 
ATOM   7741  C CA    . LEU H 3 164 ? 3.882   27.606  42.104 1.00 59.21  ? 158 LEU D CA    1 
ATOM   7742  C C     . LEU H 3 164 ? 4.448   28.941  41.626 1.00 60.25  ? 158 LEU D C     1 
ATOM   7743  O O     . LEU H 3 164 ? 4.455   29.210  40.413 1.00 59.46  ? 158 LEU D O     1 
ATOM   7744  C CB    . LEU H 3 164 ? 2.555   27.799  42.841 1.00 61.97  ? 158 LEU D CB    1 
ATOM   7745  C CG    . LEU H 3 164 ? 1.528   26.699  42.546 1.00 61.92  ? 158 LEU D CG    1 
ATOM   7746  C CD1   . LEU H 3 164 ? 0.354   26.776  43.509 1.00 65.07  ? 158 LEU D CD1   1 
ATOM   7747  C CD2   . LEU H 3 164 ? 1.038   26.768  41.096 1.00 61.60  ? 158 LEU D CD2   1 
ATOM   7748  N N     . THR H 3 165 ? 4.946   29.757  42.550 1.00 62.18  ? 159 THR D N     1 
ATOM   7749  C CA    . THR H 3 165 ? 5.507   31.053  42.156 1.00 64.03  ? 159 THR D CA    1 
ATOM   7750  C C     . THR H 3 165 ? 6.627   30.888  41.121 1.00 61.87  ? 159 THR D C     1 
ATOM   7751  O O     . THR H 3 165 ? 6.686   31.642  40.157 1.00 62.20  ? 159 THR D O     1 
ATOM   7752  C CB    . THR H 3 165 ? 5.989   31.908  43.354 1.00 67.07  ? 159 THR D CB    1 
ATOM   7753  O OG1   . THR H 3 165 ? 7.038   31.224  44.042 1.00 66.63  ? 159 THR D OG1   1 
ATOM   7754  C CG2   . THR H 3 165 ? 4.845   32.185  44.320 1.00 69.30  ? 159 THR D CG2   1 
ATOM   7755  N N     . LYS H 3 166 ? 7.489   29.889  41.296 1.00 60.11  ? 160 LYS D N     1 
ATOM   7756  C CA    . LYS H 3 166 ? 8.543   29.649  40.311 1.00 58.45  ? 160 LYS D CA    1 
ATOM   7757  C C     . LYS H 3 166 ? 7.953   29.379  38.940 1.00 56.83  ? 160 LYS D C     1 
ATOM   7758  O O     . LYS H 3 166 ? 8.358   29.999  37.955 1.00 56.74  ? 160 LYS D O     1 
ATOM   7759  C CB    . LYS H 3 166 ? 9.424   28.472  40.701 1.00 56.77  ? 160 LYS D CB    1 
ATOM   7760  C CG    . LYS H 3 166 ? 10.658  28.335  39.829 1.00 55.70  ? 160 LYS D CG    1 
ATOM   7761  C CD    . LYS H 3 166 ? 11.740  29.325  40.244 1.00 58.88  ? 160 LYS D CD    1 
ATOM   7762  C CE    . LYS H 3 166 ? 12.935  29.304  39.292 1.00 58.89  ? 160 LYS D CE    1 
ATOM   7763  N NZ    . LYS H 3 166 ? 12.616  29.954  37.985 1.00 59.04  ? 160 LYS D NZ    1 
ATOM   7764  N N     . ALA H 3 167 ? 7.006   28.442  38.895 1.00 55.99  ? 161 ALA D N     1 
ATOM   7765  C CA    . ALA H 3 167 ? 6.335   28.047  37.658 1.00 54.83  ? 161 ALA D CA    1 
ATOM   7766  C C     . ALA H 3 167 ? 5.582   29.212  37.012 1.00 56.77  ? 161 ALA D C     1 
ATOM   7767  O O     . ALA H 3 167 ? 5.540   29.308  35.788 1.00 56.26  ? 161 ALA D O     1 
ATOM   7768  C CB    . ALA H 3 167 ? 5.398   26.893  37.908 1.00 53.94  ? 161 ALA D CB    1 
ATOM   7769  N N     . LEU H 3 168 ? 4.992   30.086  37.830 1.00 59.54  ? 162 LEU D N     1 
ATOM   7770  C CA    . LEU H 3 168 ? 4.336   31.280  37.321 1.00 62.14  ? 162 LEU D CA    1 
ATOM   7771  C C     . LEU H 3 168 ? 5.337   32.244  36.707 1.00 63.16  ? 162 LEU D C     1 
ATOM   7772  O O     . LEU H 3 168 ? 5.133   32.719  35.595 1.00 63.84  ? 162 LEU D O     1 
ATOM   7773  C CB    . LEU H 3 168 ? 3.564   32.000  38.420 1.00 65.45  ? 162 LEU D CB    1 
ATOM   7774  C CG    . LEU H 3 168 ? 2.034   31.963  38.443 1.00 67.42  ? 162 LEU D CG    1 
ATOM   7775  C CD1   . LEU H 3 168 ? 1.525   33.046  39.384 1.00 71.51  ? 162 LEU D CD1   1 
ATOM   7776  C CD2   . LEU H 3 168 ? 1.436   32.154  37.063 1.00 67.08  ? 162 LEU D CD2   1 
ATOM   7777  N N     . GLU H 3 169 ? 6.405   32.538  37.445 1.00 64.18  ? 163 GLU D N     1 
ATOM   7778  C CA    . GLU H 3 169 ? 7.456   33.460  37.011 1.00 65.80  ? 163 GLU D CA    1 
ATOM   7779  C C     . GLU H 3 169 ? 8.131   32.986  35.734 1.00 63.49  ? 163 GLU D C     1 
ATOM   7780  O O     . GLU H 3 169 ? 8.347   33.767  34.807 1.00 64.75  ? 163 GLU D O     1 
ATOM   7781  C CB    . GLU H 3 169 ? 8.507   33.630  38.112 1.00 67.03  ? 163 GLU D CB    1 
ATOM   7782  C CG    . GLU H 3 169 ? 8.092   34.547  39.241 1.00 71.51  ? 163 GLU D CG    1 
ATOM   7783  C CD    . GLU H 3 169 ? 8.468   35.991  38.996 1.00 76.56  ? 163 GLU D CD    1 
ATOM   7784  O OE1   . GLU H 3 169 ? 8.489   36.414  37.819 1.00 76.37  ? 163 GLU D OE1   1 
ATOM   7785  O OE2   . GLU H 3 169 ? 8.738   36.706  39.992 1.00 80.96  ? 163 GLU D OE2   1 
ATOM   7786  N N     . ARG H 3 170 ? 8.464   31.702  35.703 1.00 60.94  ? 164 ARG D N     1 
ATOM   7787  C CA    . ARG H 3 170 ? 8.999   31.054  34.514 1.00 59.26  ? 164 ARG D CA    1 
ATOM   7788  C C     . ARG H 3 170 ? 8.147   31.377  33.282 1.00 59.33  ? 164 ARG D C     1 
ATOM   7789  O O     . ARG H 3 170 ? 8.678   31.716  32.217 1.00 59.38  ? 164 ARG D O     1 
ATOM   7790  C CB    . ARG H 3 170 ? 9.052   29.533  34.733 1.00 56.60  ? 164 ARG D CB    1 
ATOM   7791  C CG    . ARG H 3 170 ? 9.695   28.736  33.601 1.00 55.59  ? 164 ARG D CG    1 
ATOM   7792  C CD    . ARG H 3 170 ? 10.117  27.310  34.053 1.00 55.83  ? 164 ARG D CD    1 
ATOM   7793  N NE    . ARG H 3 170 ? 8.983   26.429  34.357 1.00 56.05  ? 164 ARG D NE    1 
ATOM   7794  C CZ    . ARG H 3 170 ? 9.080   25.126  34.632 1.00 57.19  ? 164 ARG D CZ    1 
ATOM   7795  N NH1   . ARG H 3 170 ? 10.268  24.513  34.647 1.00 57.23  ? 164 ARG D NH1   1 
ATOM   7796  N NH2   . ARG H 3 170 ? 7.981   24.421  34.895 1.00 56.56  ? 164 ARG D NH2   1 
ATOM   7797  N N     . GLU H 3 171 ? 6.829   31.281  33.454 1.00 59.58  ? 165 GLU D N     1 
ATOM   7798  C CA    . GLU H 3 171 ? 5.894   31.349  32.348 1.00 59.75  ? 165 GLU D CA    1 
ATOM   7799  C C     . GLU H 3 171 ? 5.591   32.794  31.944 1.00 62.08  ? 165 GLU D C     1 
ATOM   7800  O O     . GLU H 3 171 ? 5.447   33.096  30.756 1.00 62.41  ? 165 GLU D O     1 
ATOM   7801  C CB    . GLU H 3 171 ? 4.620   30.574  32.692 1.00 59.61  ? 165 GLU D CB    1 
ATOM   7802  C CG    . GLU H 3 171 ? 3.952   29.907  31.497 1.00 60.86  ? 165 GLU D CG    1 
ATOM   7803  C CD    . GLU H 3 171 ? 4.790   28.800  30.858 1.00 61.54  ? 165 GLU D CD    1 
ATOM   7804  O OE1   . GLU H 3 171 ? 4.805   28.739  29.614 1.00 62.56  ? 165 GLU D OE1   1 
ATOM   7805  O OE2   . GLU H 3 171 ? 5.424   27.987  31.578 1.00 61.65  ? 165 GLU D OE2   1 
ATOM   7806  N N     . LYS H 3 172 ? 5.504   33.681  32.928 1.00 63.91  ? 166 LYS D N     1 
ATOM   7807  C CA    . LYS H 3 172 ? 5.394   35.103  32.659 1.00 66.99  ? 166 LYS D CA    1 
ATOM   7808  C C     . LYS H 3 172 ? 6.610   35.542  31.853 1.00 66.67  ? 166 LYS D C     1 
ATOM   7809  O O     . LYS H 3 172 ? 6.478   36.237  30.851 1.00 68.00  ? 166 LYS D O     1 
ATOM   7810  C CB    . LYS H 3 172 ? 5.306   35.900  33.964 1.00 69.95  ? 166 LYS D CB    1 
ATOM   7811  C CG    . LYS H 3 172 ? 3.970   35.817  34.673 1.00 70.69  ? 166 LYS D CG    1 
ATOM   7812  C CD    . LYS H 3 172 ? 3.918   36.805  35.835 1.00 74.37  ? 166 LYS D CD    1 
ATOM   7813  C CE    . LYS H 3 172 ? 2.648   36.652  36.655 1.00 75.45  ? 166 LYS D CE    1 
ATOM   7814  N NZ    . LYS H 3 172 ? 2.652   37.581  37.814 1.00 79.25  ? 166 LYS D NZ    1 
ATOM   7815  N N     . ASN H 3 173 ? 7.788   35.098  32.283 1.00 65.16  ? 167 ASN D N     1 
ATOM   7816  C CA    . ASN H 3 173 ? 9.039   35.424  31.611 1.00 65.22  ? 167 ASN D CA    1 
ATOM   7817  C C     . ASN H 3 173 ? 9.077   34.963  30.151 1.00 63.40  ? 167 ASN D C     1 
ATOM   7818  O O     . ASN H 3 173 ? 9.448   35.738  29.264 1.00 65.22  ? 167 ASN D O     1 
ATOM   7819  C CB    . ASN H 3 173 ? 10.228  34.865  32.390 1.00 64.30  ? 167 ASN D CB    1 
ATOM   7820  C CG    . ASN H 3 173 ? 11.561  35.333  31.836 1.00 66.06  ? 167 ASN D CG    1 
ATOM   7821  O OD1   . ASN H 3 173 ? 12.237  34.588  31.122 1.00 66.15  ? 167 ASN D OD1   1 
ATOM   7822  N ND2   . ASN H 3 173 ? 11.939  36.574  32.144 1.00 69.19  ? 167 ASN D ND2   1 
ATOM   7823  N N     . TYR H 3 174 ? 8.682   33.712  29.908 1.00 60.32  ? 168 TYR D N     1 
ATOM   7824  C CA    . TYR H 3 174 ? 8.561   33.188  28.551 1.00 58.71  ? 168 TYR D CA    1 
ATOM   7825  C C     . TYR H 3 174 ? 7.574   34.052  27.748 1.00 60.60  ? 168 TYR D C     1 
ATOM   7826  O O     . TYR H 3 174 ? 7.950   34.627  26.719 1.00 61.93  ? 168 TYR D O     1 
ATOM   7827  C CB    . TYR H 3 174 ? 8.115   31.722  28.567 1.00 56.13  ? 168 TYR D CB    1 
ATOM   7828  C CG    . TYR H 3 174 ? 8.819   30.815  27.565 1.00 54.78  ? 168 TYR D CG    1 
ATOM   7829  C CD1   . TYR H 3 174 ? 8.765   31.068  26.190 1.00 55.48  ? 168 TYR D CD1   1 
ATOM   7830  C CD2   . TYR H 3 174 ? 9.516   29.684  27.995 1.00 53.43  ? 168 TYR D CD2   1 
ATOM   7831  C CE1   . TYR H 3 174 ? 9.397   30.233  25.272 1.00 54.01  ? 168 TYR D CE1   1 
ATOM   7832  C CE2   . TYR H 3 174 ? 10.152  28.841  27.088 1.00 52.65  ? 168 TYR D CE2   1 
ATOM   7833  C CZ    . TYR H 3 174 ? 10.092  29.120  25.728 1.00 53.67  ? 168 TYR D CZ    1 
ATOM   7834  O OH    . TYR H 3 174 ? 10.718  28.275  24.831 1.00 52.85  ? 168 TYR D OH    1 
ATOM   7835  N N     . VAL H 3 175 ? 6.335   34.172  28.236 1.00 61.09  ? 169 VAL D N     1 
ATOM   7836  C CA    . VAL H 3 175 ? 5.302   34.978  27.569 1.00 63.03  ? 169 VAL D CA    1 
ATOM   7837  C C     . VAL H 3 175 ? 5.799   36.378  27.188 1.00 65.79  ? 169 VAL D C     1 
ATOM   7838  O O     . VAL H 3 175 ? 5.560   36.857  26.073 1.00 66.99  ? 169 VAL D O     1 
ATOM   7839  C CB    . VAL H 3 175 ? 3.986   35.047  28.400 1.00 64.57  ? 169 VAL D CB    1 
ATOM   7840  C CG1   . VAL H 3 175 ? 3.140   36.282  28.031 1.00 66.98  ? 169 VAL D CG1   1 
ATOM   7841  C CG2   . VAL H 3 175 ? 3.185   33.757  28.217 1.00 61.71  ? 169 VAL D CG2   1 
ATOM   7842  N N     . SER H 3 176 ? 6.516   37.010  28.107 1.00 66.87  ? 170 SER D N     1 
ATOM   7843  C CA    . SER H 3 176 ? 7.058   38.345  27.861 1.00 70.20  ? 170 SER D CA    1 
ATOM   7844  C C     . SER H 3 176 ? 8.177   38.326  26.827 1.00 69.23  ? 170 SER D C     1 
ATOM   7845  O O     . SER H 3 176 ? 8.320   39.264  26.049 1.00 71.49  ? 170 SER D O     1 
ATOM   7846  C CB    . SER H 3 176 ? 7.562   38.971  29.156 1.00 72.14  ? 170 SER D CB    1 
ATOM   7847  O OG    . SER H 3 176 ? 8.574   39.915  28.863 1.00 74.96  ? 170 SER D OG    1 
ATOM   7848  N N     . TRP H 3 177 ? 8.971   37.256  26.828 1.00 66.03  ? 171 TRP D N     1 
ATOM   7849  C CA    . TRP H 3 177 ? 10.064  37.146  25.876 1.00 65.39  ? 171 TRP D CA    1 
ATOM   7850  C C     . TRP H 3 177 ? 9.520   36.999  24.457 1.00 65.63  ? 171 TRP D C     1 
ATOM   7851  O O     . TRP H 3 177 ? 9.975   37.699  23.537 1.00 67.82  ? 171 TRP D O     1 
ATOM   7852  C CB    . TRP H 3 177 ? 11.003  36.010  26.242 1.00 62.12  ? 171 TRP D CB    1 
ATOM   7853  C CG    . TRP H 3 177 ? 12.141  35.839  25.291 1.00 61.25  ? 171 TRP D CG    1 
ATOM   7854  C CD1   . TRP H 3 177 ? 13.313  36.540  25.276 1.00 62.79  ? 171 TRP D CD1   1 
ATOM   7855  C CD2   . TRP H 3 177 ? 12.223  34.897  24.214 1.00 58.64  ? 171 TRP D CD2   1 
ATOM   7856  N NE1   . TRP H 3 177 ? 14.118  36.101  24.250 1.00 61.79  ? 171 TRP D NE1   1 
ATOM   7857  C CE2   . TRP H 3 177 ? 13.477  35.085  23.588 1.00 59.60  ? 171 TRP D CE2   1 
ATOM   7858  C CE3   . TRP H 3 177 ? 11.361  33.906  23.722 1.00 55.42  ? 171 TRP D CE3   1 
ATOM   7859  C CZ2   . TRP H 3 177 ? 13.894  34.311  22.497 1.00 57.93  ? 171 TRP D CZ2   1 
ATOM   7860  C CZ3   . TRP H 3 177 ? 11.770  33.146  22.637 1.00 54.27  ? 171 TRP D CZ3   1 
ATOM   7861  C CH2   . TRP H 3 177 ? 13.029  33.352  22.036 1.00 55.76  ? 171 TRP D CH2   1 
ATOM   7862  N N     . LEU H 3 178 ? 8.520   36.133  24.298 1.00 63.79  ? 172 LEU D N     1 
ATOM   7863  C CA    . LEU H 3 178 ? 7.873   35.921  23.002 1.00 63.94  ? 172 LEU D CA    1 
ATOM   7864  C C     . LEU H 3 178 ? 7.293   37.201  22.378 1.00 67.84  ? 172 LEU D C     1 
ATOM   7865  O O     . LEU H 3 178 ? 7.513   37.473  21.192 1.00 68.95  ? 172 LEU D O     1 
ATOM   7866  C CB    . LEU H 3 178 ? 6.820   34.808  23.106 1.00 62.03  ? 172 LEU D CB    1 
ATOM   7867  C CG    . LEU H 3 178 ? 7.385   33.395  23.354 1.00 57.83  ? 172 LEU D CG    1 
ATOM   7868  C CD1   . LEU H 3 178 ? 6.327   32.463  23.888 1.00 55.92  ? 172 LEU D CD1   1 
ATOM   7869  C CD2   . LEU H 3 178 ? 7.991   32.824  22.094 1.00 56.57  ? 172 LEU D CD2   1 
ATOM   7870  N N     . GLU H 3 179 ? 6.580   37.990  23.182 1.00 70.45  ? 173 GLU D N     1 
ATOM   7871  C CA    . GLU H 3 179 ? 6.009   39.267  22.733 1.00 74.80  ? 173 GLU D CA    1 
ATOM   7872  C C     . GLU H 3 179 ? 7.086   40.185  22.184 1.00 77.00  ? 173 GLU D C     1 
ATOM   7873  O O     . GLU H 3 179 ? 6.940   40.758  21.102 1.00 79.39  ? 173 GLU D O     1 
ATOM   7874  C CB    . GLU H 3 179 ? 5.303   39.977  23.884 1.00 77.27  ? 173 GLU D CB    1 
ATOM   7875  C CG    . GLU H 3 179 ? 4.020   39.323  24.327 1.00 78.01  ? 173 GLU D CG    1 
ATOM   7876  C CD    . GLU H 3 179 ? 3.522   39.866  25.654 1.00 82.06  ? 173 GLU D CD    1 
ATOM   7877  O OE1   . GLU H 3 179 ? 4.292   39.887  26.640 1.00 81.47  ? 173 GLU D OE1   1 
ATOM   7878  O OE2   . GLU H 3 179 ? 2.346   40.271  25.710 1.00 86.51  ? 173 GLU D OE2   1 
ATOM   7879  N N     . SER H 3 180 ? 8.160   40.320  22.953 1.00 76.83  ? 174 SER D N     1 
ATOM   7880  C CA    . SER H 3 180 ? 9.338   41.074  22.558 1.00 78.97  ? 174 SER D CA    1 
ATOM   7881  C C     . SER H 3 180 ? 9.889   40.608  21.198 1.00 77.95  ? 174 SER D C     1 
ATOM   7882  O O     . SER H 3 180 ? 10.169  41.437  20.323 1.00 81.01  ? 174 SER D O     1 
ATOM   7883  C CB    . SER H 3 180 ? 10.398  40.951  23.654 1.00 78.40  ? 174 SER D CB    1 
ATOM   7884  O OG    . SER H 3 180 ? 11.385  41.948  23.546 1.00 81.48  ? 174 SER D OG    1 
ATOM   7885  N N     . ILE H 3 181 ? 10.020  39.293  21.007 1.00 74.13  ? 175 ILE D N     1 
ATOM   7886  C CA    . ILE H 3 181 ? 10.511  38.757  19.729 1.00 73.51  ? 175 ILE D CA    1 
ATOM   7887  C C     . ILE H 3 181 ? 9.470   38.900  18.608 1.00 75.09  ? 175 ILE D C     1 
ATOM   7888  O O     . ILE H 3 181 ? 9.830   39.149  17.449 1.00 76.48  ? 175 ILE D O     1 
ATOM   7889  C CB    . ILE H 3 181 ? 11.015  37.275  19.828 1.00 69.79  ? 175 ILE D CB    1 
ATOM   7890  C CG1   . ILE H 3 181 ? 12.071  37.104  20.933 1.00 68.51  ? 175 ILE D CG1   1 
ATOM   7891  C CG2   . ILE H 3 181 ? 11.547  36.776  18.466 1.00 68.98  ? 175 ILE D CG2   1 
ATOM   7892  C CD1   . ILE H 3 181 ? 13.212  38.133  20.917 1.00 71.21  ? 175 ILE D CD1   1 
ATOM   7893  N N     . LEU H 3 182 ? 8.191   38.737  18.952 1.00 75.31  ? 176 LEU D N     1 
ATOM   7894  C CA    . LEU H 3 182 ? 7.103   38.994  18.000 1.00 77.60  ? 176 LEU D CA    1 
ATOM   7895  C C     . LEU H 3 182 ? 7.120   40.435  17.508 1.00 82.21  ? 176 LEU D C     1 
ATOM   7896  O O     . LEU H 3 182 ? 7.030   40.679  16.301 1.00 84.01  ? 176 LEU D O     1 
ATOM   7897  C CB    . LEU H 3 182 ? 5.731   38.671  18.600 1.00 77.37  ? 176 LEU D CB    1 
ATOM   7898  C CG    . LEU H 3 182 ? 4.975   37.386  18.244 1.00 75.35  ? 176 LEU D CG    1 
ATOM   7899  C CD1   . LEU H 3 182 ? 3.486   37.735  18.198 1.00 78.22  ? 176 LEU D CD1   1 
ATOM   7900  C CD2   . LEU H 3 182 ? 5.401   36.791  16.907 1.00 74.44  ? 176 LEU D CD2   1 
ATOM   7901  N N     . ALA H 3 183 ? 7.247   41.380  18.440 1.00 84.81  ? 177 ALA D N     1 
ATOM   7902  C CA    . ALA H 3 183 ? 7.322   42.803  18.097 1.00 90.33  ? 177 ALA D CA    1 
ATOM   7903  C C     . ALA H 3 183 ? 8.520   43.094  17.199 1.00 91.66  ? 177 ALA D C     1 
ATOM   7904  O O     . ALA H 3 183 ? 8.483   44.009  16.379 1.00 95.37  ? 177 ALA D O     1 
ATOM   7905  C CB    . ALA H 3 183 ? 7.386   43.659  19.357 1.00 92.56  ? 177 ALA D CB    1 
ATOM   7906  N N     . MET H 3 184 ? 9.573   42.296  17.360 1.00 89.25  ? 178 MET D N     1 
ATOM   7907  C CA    . MET H 3 184 ? 10.815  42.478  16.617 1.00 90.68  ? 178 MET D CA    1 
ATOM   7908  C C     . MET H 3 184 ? 10.739  41.882  15.206 1.00 90.20  ? 178 MET D C     1 
ATOM   7909  O O     . MET H 3 184 ? 11.466  42.307  14.305 1.00 92.45  ? 178 MET D O     1 
ATOM   7910  C CB    . MET H 3 184 ? 11.974  41.875  17.407 1.00 88.26  ? 178 MET D CB    1 
ATOM   7911  C CG    . MET H 3 184 ? 13.316  42.512  17.139 1.00 91.24  ? 178 MET D CG    1 
ATOM   7912  S SD    . MET H 3 184 ? 14.495  42.129  18.447 1.00 91.77  ? 178 MET D SD    1 
ATOM   7913  C CE    . MET H 3 184 ? 15.974  42.891  17.784 1.00 95.42  ? 178 MET D CE    1 
ATOM   7914  N N     . ILE H 3 185 ? 9.854   40.903  15.021 1.00 87.95  ? 179 ILE D N     1 
ATOM   7915  C CA    . ILE H 3 185 ? 9.640   40.286  13.711 1.00 87.92  ? 179 ILE D CA    1 
ATOM   7916  C C     . ILE H 3 185 ? 8.699   41.126  12.848 1.00 91.84  ? 179 ILE D C     1 
ATOM   7917  O O     . ILE H 3 185 ? 8.910   41.264  11.643 1.00 93.74  ? 179 ILE D O     1 
ATOM   7918  C CB    . ILE H 3 185 ? 9.076   38.848  13.836 1.00 84.18  ? 179 ILE D CB    1 
ATOM   7919  N N     . ASP H 3 186 ? 7.670   41.692  13.474 1.00 93.66  ? 180 ASP D N     1 
ATOM   7920  C CA    . ASP H 3 186 ? 6.637   42.443  12.760 1.00 97.56  ? 180 ASP D CA    1 
ATOM   7921  C C     . ASP H 3 186 ? 6.816   43.949  12.932 1.00 102.17 ? 180 ASP D C     1 
ATOM   7922  O O     . ASP H 3 186 ? 7.891   44.487  12.668 1.00 103.59 ? 180 ASP D O     1 
ATOM   7923  C CB    . ASP H 3 186 ? 5.240   42.004  13.229 1.00 97.03  ? 180 ASP D CB    1 
ATOM   7924  C CG    . ASP H 3 186 ? 5.044   40.480  13.172 1.00 92.93  ? 180 ASP D CG    1 
ATOM   7925  O OD1   . ASP H 3 186 ? 5.542   39.836  12.220 1.00 91.94  ? 180 ASP D OD1   1 
ATOM   7926  O OD2   . ASP H 3 186 ? 4.380   39.930  14.074 1.00 90.34  ? 180 ASP D OD2   1 
ATOM   7927  N N     . ASP I 3 5   ? 46.537  27.329  26.262 1.00 108.75 ? -1  ASP E N     1 
ATOM   7928  C CA    . ASP I 3 5   ? 47.597  28.338  26.570 1.00 106.11 ? -1  ASP E CA    1 
ATOM   7929  C C     . ASP I 3 5   ? 48.892  27.673  27.071 1.00 102.86 ? -1  ASP E C     1 
ATOM   7930  O O     . ASP I 3 5   ? 48.904  27.087  28.155 1.00 101.58 ? -1  ASP E O     1 
ATOM   7931  C CB    . ASP I 3 5   ? 47.079  29.364  27.584 1.00 105.69 ? -1  ASP E CB    1 
ATOM   7932  N N     . PRO I 3 6   ? 49.985  27.764  26.279 1.00 102.02 ? 0   PRO E N     1 
ATOM   7933  C CA    . PRO I 3 6   ? 51.273  27.107  26.582 1.00 99.53  ? 0   PRO E CA    1 
ATOM   7934  C C     . PRO I 3 6   ? 51.909  27.539  27.909 1.00 96.67  ? 0   PRO E C     1 
ATOM   7935  O O     . PRO I 3 6   ? 51.835  28.716  28.277 1.00 96.41  ? 0   PRO E O     1 
ATOM   7936  C CB    . PRO I 3 6   ? 52.172  27.535  25.410 1.00 100.02 ? 0   PRO E CB    1 
ATOM   7937  C CG    . PRO I 3 6   ? 51.527  28.774  24.862 1.00 101.92 ? 0   PRO E CG    1 
ATOM   7938  C CD    . PRO I 3 6   ? 50.057  28.535  25.025 1.00 103.74 ? 0   PRO E CD    1 
ATOM   7939  N N     . MET I 3 7   ? 52.545  26.588  28.596 1.00 94.72  ? 1   MET E N     1 
ATOM   7940  C CA    . MET I 3 7   ? 53.132  26.822  29.923 1.00 92.27  ? 1   MET E CA    1 
ATOM   7941  C C     . MET I 3 7   ? 54.192  27.920  29.919 1.00 90.81  ? 1   MET E C     1 
ATOM   7942  O O     . MET I 3 7   ? 54.144  28.827  30.748 1.00 90.27  ? 1   MET E O     1 
ATOM   7943  C CB    . MET I 3 7   ? 53.701  25.523  30.510 1.00 91.13  ? 1   MET E CB    1 
ATOM   7944  C CG    . MET I 3 7   ? 52.657  24.498  30.936 1.00 93.34  ? 1   MET E CG    1 
ATOM   7945  S SD    . MET I 3 7   ? 51.442  25.123  32.135 1.00 97.91  ? 1   MET E SD    1 
ATOM   7946  C CE    . MET I 3 7   ? 52.493  25.348  33.586 1.00 94.13  ? 1   MET E CE    1 
ATOM   7947  N N     . ARG I 3 8   ? 55.134  27.827  28.978 1.00 90.39  ? 2   ARG E N     1 
ATOM   7948  C CA    . ARG I 3 8   ? 56.210  28.811  28.789 1.00 89.49  ? 2   ARG E CA    1 
ATOM   7949  C C     . ARG I 3 8   ? 57.086  29.055  30.031 1.00 87.50  ? 2   ARG E C     1 
ATOM   7950  O O     . ARG I 3 8   ? 57.511  30.181  30.313 1.00 87.43  ? 2   ARG E O     1 
ATOM   7951  C CB    . ARG I 3 8   ? 55.666  30.120  28.203 1.00 90.97  ? 2   ARG E CB    1 
ATOM   7952  C CG    . ARG I 3 8   ? 55.194  29.982  26.762 1.00 93.65  ? 2   ARG E CG    1 
ATOM   7953  C CD    . ARG I 3 8   ? 55.227  31.304  26.020 1.00 95.70  ? 2   ARG E CD    1 
ATOM   7954  N NE    . ARG I 3 8   ? 56.598  31.717  25.748 1.00 95.58  ? 2   ARG E NE    1 
ATOM   7955  C CZ    . ARG I 3 8   ? 56.944  32.859  25.163 1.00 97.27  ? 2   ARG E CZ    1 
ATOM   7956  N NH1   . ARG I 3 8   ? 56.016  33.727  24.770 1.00 97.98  ? 2   ARG E NH1   1 
ATOM   7957  N NH2   . ARG I 3 8   ? 58.229  33.129  24.970 1.00 96.96  ? 2   ARG E NH2   1 
ATOM   7958  N N     . VAL I 3 9   ? 57.382  27.976  30.746 1.00 85.80  ? 3   VAL E N     1 
ATOM   7959  C CA    . VAL I 3 9   ? 58.138  28.049  31.991 1.00 83.98  ? 3   VAL E CA    1 
ATOM   7960  C C     . VAL I 3 9   ? 59.494  28.764  31.855 1.00 83.47  ? 3   VAL E C     1 
ATOM   7961  O O     . VAL I 3 9   ? 59.845  29.579  32.715 1.00 83.29  ? 3   VAL E O     1 
ATOM   7962  C CB    . VAL I 3 9   ? 58.320  26.651  32.605 1.00 83.33  ? 3   VAL E CB    1 
ATOM   7963  C CG1   . VAL I 3 9   ? 58.790  26.759  34.047 1.00 82.53  ? 3   VAL E CG1   1 
ATOM   7964  C CG2   . VAL I 3 9   ? 57.015  25.862  32.526 1.00 83.36  ? 3   VAL E CG2   1 
ATOM   7965  N N     . LEU I 3 10  ? 60.236  28.475  30.781 1.00 83.20  ? 4   LEU E N     1 
ATOM   7966  C CA    . LEU I 3 10  ? 61.516  29.141  30.516 1.00 82.86  ? 4   LEU E CA    1 
ATOM   7967  C C     . LEU I 3 10  ? 61.403  30.667  30.539 1.00 83.42  ? 4   LEU E C     1 
ATOM   7968  O O     . LEU I 3 10  ? 62.242  31.343  31.126 1.00 83.79  ? 4   LEU E O     1 
ATOM   7969  C CB    . LEU I 3 10  ? 62.124  28.680  29.190 1.00 83.32  ? 4   LEU E CB    1 
ATOM   7970  C CG    . LEU I 3 10  ? 63.475  29.308  28.818 1.00 83.77  ? 4   LEU E CG    1 
ATOM   7971  C CD1   . LEU I 3 10  ? 64.502  29.148  29.938 1.00 82.44  ? 4   LEU E CD1   1 
ATOM   7972  C CD2   . LEU I 3 10  ? 64.024  28.732  27.528 1.00 84.48  ? 4   LEU E CD2   1 
ATOM   7973  N N     . LYS I 3 11  ? 60.369  31.196  29.894 1.00 83.97  ? 5   LYS E N     1 
ATOM   7974  C CA    . LYS I 3 11  ? 60.056  32.620  29.955 1.00 84.51  ? 5   LYS E CA    1 
ATOM   7975  C C     . LYS I 3 11  ? 60.080  33.125  31.401 1.00 84.02  ? 5   LYS E C     1 
ATOM   7976  O O     . LYS I 3 11  ? 60.745  34.109  31.711 1.00 84.67  ? 5   LYS E O     1 
ATOM   7977  C CB    . LYS I 3 11  ? 58.697  32.878  29.299 1.00 85.34  ? 5   LYS E CB    1 
ATOM   7978  C CG    . LYS I 3 11  ? 58.036  34.201  29.648 1.00 86.08  ? 5   LYS E CG    1 
ATOM   7979  C CD    . LYS I 3 11  ? 56.581  34.211  29.207 1.00 86.51  ? 5   LYS E CD    1 
ATOM   7980  C CE    . LYS I 3 11  ? 55.887  35.477  29.651 1.00 87.70  ? 5   LYS E CE    1 
ATOM   7981  N NZ    . LYS I 3 11  ? 54.399  35.415  29.471 1.00 89.10  ? 5   LYS E NZ    1 
ATOM   7982  N N     . TYR I 3 12  ? 59.372  32.430  32.284 1.00 83.16  ? 6   TYR E N     1 
ATOM   7983  C CA    . TYR I 3 12  ? 59.276  32.837  33.677 1.00 82.93  ? 6   TYR E CA    1 
ATOM   7984  C C     . TYR I 3 12  ? 60.537  32.538  34.483 1.00 82.49  ? 6   TYR E C     1 
ATOM   7985  O O     . TYR I 3 12  ? 60.832  33.226  35.467 1.00 83.00  ? 6   TYR E O     1 
ATOM   7986  C CB    . TYR I 3 12  ? 58.043  32.220  34.325 1.00 82.65  ? 6   TYR E CB    1 
ATOM   7987  C CG    . TYR I 3 12  ? 56.765  32.752  33.739 1.00 83.92  ? 6   TYR E CG    1 
ATOM   7988  C CD1   . TYR I 3 12  ? 56.449  34.108  33.831 1.00 85.41  ? 6   TYR E CD1   1 
ATOM   7989  C CD2   . TYR I 3 12  ? 55.873  31.910  33.079 1.00 84.40  ? 6   TYR E CD2   1 
ATOM   7990  C CE1   . TYR I 3 12  ? 55.281  34.612  33.284 1.00 86.45  ? 6   TYR E CE1   1 
ATOM   7991  C CE2   . TYR I 3 12  ? 54.696  32.407  32.529 1.00 85.73  ? 6   TYR E CE2   1 
ATOM   7992  C CZ    . TYR I 3 12  ? 54.409  33.757  32.637 1.00 86.94  ? 6   TYR E CZ    1 
ATOM   7993  O OH    . TYR I 3 12  ? 53.250  34.260  32.101 1.00 88.95  ? 6   TYR E OH    1 
ATOM   7994  N N     . ALA I 3 13  ? 61.280  31.518  34.064 1.00 81.56  ? 7   ALA E N     1 
ATOM   7995  C CA    . ALA I 3 13  ? 62.583  31.252  34.646 1.00 81.41  ? 7   ALA E CA    1 
ATOM   7996  C C     . ALA I 3 13  ? 63.510  32.433  34.366 1.00 82.55  ? 7   ALA E C     1 
ATOM   7997  O O     . ALA I 3 13  ? 64.199  32.914  35.264 1.00 83.42  ? 7   ALA E O     1 
ATOM   7998  C CB    . ALA I 3 13  ? 63.160  29.964  34.092 1.00 80.88  ? 7   ALA E CB    1 
ATOM   7999  N N     . ILE I 3 14  ? 63.501  32.908  33.122 1.00 82.80  ? 8   ILE E N     1 
ATOM   8000  C CA    . ILE I 3 14  ? 64.359  34.015  32.714 1.00 84.12  ? 8   ILE E CA    1 
ATOM   8001  C C     . ILE I 3 14  ? 63.946  35.331  33.386 1.00 85.25  ? 8   ILE E C     1 
ATOM   8002  O O     . ILE I 3 14  ? 64.797  36.057  33.910 1.00 86.61  ? 8   ILE E O     1 
ATOM   8003  C CB    . ILE I 3 14  ? 64.449  34.153  31.163 1.00 84.53  ? 8   ILE E CB    1 
ATOM   8004  C CG1   . ILE I 3 14  ? 65.124  32.912  30.561 1.00 83.59  ? 8   ILE E CG1   1 
ATOM   8005  C CG2   . ILE I 3 14  ? 65.196  35.439  30.771 1.00 85.91  ? 8   ILE E CG2   1 
ATOM   8006  C CD1   . ILE I 3 14  ? 65.371  32.960  29.068 1.00 83.61  ? 8   ILE E CD1   1 
ATOM   8007  N N     . LEU I 3 15  ? 62.648  35.625  33.387 1.00 84.96  ? 9   LEU E N     1 
ATOM   8008  C CA    . LEU I 3 15  ? 62.152  36.837  34.037 1.00 86.21  ? 9   LEU E CA    1 
ATOM   8009  C C     . LEU I 3 15  ? 62.526  36.882  35.523 1.00 86.82  ? 9   LEU E C     1 
ATOM   8010  O O     . LEU I 3 15  ? 62.850  37.948  36.053 1.00 88.53  ? 9   LEU E O     1 
ATOM   8011  C CB    . LEU I 3 15  ? 60.637  36.989  33.864 1.00 85.84  ? 9   LEU E CB    1 
ATOM   8012  C CG    . LEU I 3 15  ? 60.023  37.183  32.472 1.00 86.03  ? 9   LEU E CG    1 
ATOM   8013  C CD1   . LEU I 3 15  ? 58.534  37.458  32.607 1.00 86.06  ? 9   LEU E CD1   1 
ATOM   8014  C CD2   . LEU I 3 15  ? 60.687  38.292  31.679 1.00 86.89  ? 9   LEU E CD2   1 
ATOM   8015  N N     . GLY I 3 16  ? 62.492  35.722  36.177 1.00 85.72  ? 10  GLY E N     1 
ATOM   8016  C CA    . GLY I 3 16  ? 62.819  35.606  37.597 1.00 86.38  ? 10  GLY E CA    1 
ATOM   8017  C C     . GLY I 3 16  ? 64.293  35.820  37.889 1.00 87.75  ? 10  GLY E C     1 
ATOM   8018  O O     . GLY I 3 16  ? 64.656  36.492  38.859 1.00 89.41  ? 10  GLY E O     1 
ATOM   8019  N N     . LEU I 3 17  ? 65.142  35.242  37.043 1.00 87.21  ? 11  LEU E N     1 
ATOM   8020  C CA    . LEU I 3 17  ? 66.584  35.421  37.146 1.00 88.72  ? 11  LEU E CA    1 
ATOM   8021  C C     . LEU I 3 17  ? 66.998  36.890  37.047 1.00 91.10  ? 11  LEU E C     1 
ATOM   8022  O O     . LEU I 3 17  ? 68.085  37.267  37.494 1.00 93.04  ? 11  LEU E O     1 
ATOM   8023  C CB    . LEU I 3 17  ? 67.295  34.587  36.080 1.00 87.85  ? 11  LEU E CB    1 
ATOM   8024  C CG    . LEU I 3 17  ? 67.414  33.093  36.393 1.00 86.33  ? 11  LEU E CG    1 
ATOM   8025  C CD1   . LEU I 3 17  ? 67.916  32.311  35.193 1.00 84.87  ? 11  LEU E CD1   1 
ATOM   8026  C CD2   . LEU I 3 17  ? 68.323  32.869  37.595 1.00 87.11  ? 11  LEU E CD2   1 
ATOM   8027  N N     . LEU I 3 18  ? 66.110  37.710  36.485 1.00 91.20  ? 12  LEU E N     1 
ATOM   8028  C CA    . LEU I 3 18  ? 66.370  39.127  36.252 1.00 93.58  ? 12  LEU E CA    1 
ATOM   8029  C C     . LEU I 3 18  ? 65.684  40.049  37.256 1.00 95.12  ? 12  LEU E C     1 
ATOM   8030  O O     . LEU I 3 18  ? 65.758  41.271  37.120 1.00 97.10  ? 12  LEU E O     1 
ATOM   8031  C CB    . LEU I 3 18  ? 65.944  39.510  34.834 1.00 93.18  ? 12  LEU E CB    1 
ATOM   8032  C CG    . LEU I 3 18  ? 66.695  38.899  33.650 1.00 92.80  ? 12  LEU E CG    1 
ATOM   8033  C CD1   . LEU I 3 18  ? 65.828  38.938  32.402 1.00 91.80  ? 12  LEU E CD1   1 
ATOM   8034  C CD2   . LEU I 3 18  ? 68.002  39.620  33.415 1.00 95.06  ? 12  LEU E CD2   1 
ATOM   8035  N N     . ARG I 3 19  ? 65.037  39.465  38.266 1.00 94.73  ? 13  ARG E N     1 
ATOM   8036  C CA    . ARG I 3 19  ? 64.284  40.227  39.277 1.00 96.49  ? 13  ARG E CA    1 
ATOM   8037  C C     . ARG I 3 19  ? 65.133  41.211  40.108 1.00 99.96  ? 13  ARG E C     1 
ATOM   8038  O O     . ARG I 3 19  ? 64.604  42.197  40.637 1.00 101.79 ? 13  ARG E O     1 
ATOM   8039  C CB    . ARG I 3 19  ? 63.510  39.275  40.203 1.00 95.17  ? 13  ARG E CB    1 
ATOM   8040  C CG    . ARG I 3 19  ? 64.334  38.665  41.331 1.00 96.14  ? 13  ARG E CG    1 
ATOM   8041  C CD    . ARG I 3 19  ? 63.744  37.359  41.833 1.00 94.43  ? 13  ARG E CD    1 
ATOM   8042  N NE    . ARG I 3 19  ? 64.603  36.709  42.822 1.00 95.66  ? 13  ARG E NE    1 
ATOM   8043  C CZ    . ARG I 3 19  ? 65.743  36.071  42.548 1.00 95.54  ? 13  ARG E CZ    1 
ATOM   8044  N NH1   . ARG I 3 19  ? 66.201  35.982  41.303 1.00 94.14  ? 13  ARG E NH1   1 
ATOM   8045  N NH2   . ARG I 3 19  ? 66.437  35.522  43.533 1.00 96.71  ? 13  ARG E NH2   1 
ATOM   8046  N N     . LYS I 3 20  ? 66.436  40.939  40.210 1.00 101.11 ? 14  LYS E N     1 
ATOM   8047  C CA    . LYS I 3 20  ? 67.334  41.709  41.070 1.00 104.69 ? 14  LYS E CA    1 
ATOM   8048  C C     . LYS I 3 20  ? 68.330  42.584  40.311 1.00 106.86 ? 14  LYS E C     1 
ATOM   8049  O O     . LYS I 3 20  ? 69.136  43.281  40.931 1.00 110.21 ? 14  LYS E O     1 
ATOM   8050  C CB    . LYS I 3 20  ? 68.085  40.779  42.033 1.00 105.28 ? 14  LYS E CB    1 
ATOM   8051  C CG    . LYS I 3 20  ? 67.330  40.459  43.311 1.00 105.23 ? 14  LYS E CG    1 
ATOM   8052  C CD    . LYS I 3 20  ? 68.186  39.637  44.256 1.00 106.32 ? 14  LYS E CD    1 
ATOM   8053  C CE    . LYS I 3 20  ? 67.495  39.435  45.595 1.00 107.31 ? 14  LYS E CE    1 
ATOM   8054  N NZ    . LYS I 3 20  ? 68.314  38.611  46.530 1.00 108.38 ? 14  LYS E NZ    1 
ATOM   8055  N N     . GLY I 3 21  ? 68.283  42.549  38.982 1.00 105.34 ? 15  GLY E N     1 
ATOM   8056  C CA    . GLY I 3 21  ? 69.168  43.391  38.177 1.00 107.43 ? 15  GLY E CA    1 
ATOM   8057  C C     . GLY I 3 21  ? 69.617  42.799  36.855 1.00 105.84 ? 15  GLY E C     1 
ATOM   8058  O O     . GLY I 3 21  ? 69.268  41.661  36.519 1.00 103.19 ? 15  GLY E O     1 
ATOM   8059  N N     . GLU I 3 22  ? 70.408  43.582  36.121 1.00 107.75 ? 16  GLU E N     1 
ATOM   8060  C CA    . GLU I 3 22  ? 70.842  43.248  34.763 1.00 106.66 ? 16  GLU E CA    1 
ATOM   8061  C C     . GLU I 3 22  ? 71.630  41.947  34.680 1.00 105.45 ? 16  GLU E C     1 
ATOM   8062  O O     . GLU I 3 22  ? 72.466  41.666  35.535 1.00 107.04 ? 16  GLU E O     1 
ATOM   8063  C CB    . GLU I 3 22  ? 71.643  44.404  34.142 1.00 109.81 ? 16  GLU E CB    1 
ATOM   8064  C CG    . GLU I 3 22  ? 72.771  44.967  35.018 1.00 113.32 ? 16  GLU E CG    1 
ATOM   8065  C CD    . GLU I 3 22  ? 73.471  46.175  34.399 1.00 116.61 ? 16  GLU E CD    1 
ATOM   8066  O OE1   . GLU I 3 22  ? 72.791  47.018  33.773 1.00 116.52 ? 16  GLU E OE1   1 
ATOM   8067  O OE2   . GLU I 3 22  ? 74.706  46.287  34.552 1.00 118.71 ? 16  GLU E OE2   1 
ATOM   8068  N N     . LEU I 3 23  ? 71.336  41.156  33.650 1.00 102.90 ? 17  LEU E N     1 
ATOM   8069  C CA    . LEU I 3 23  ? 72.072  39.925  33.364 1.00 101.90 ? 17  LEU E CA    1 
ATOM   8070  C C     . LEU I 3 23  ? 72.265  39.706  31.872 1.00 101.57 ? 17  LEU E C     1 
ATOM   8071  O O     . LEU I 3 23  ? 71.454  40.141  31.055 1.00 100.84 ? 17  LEU E O     1 
ATOM   8072  C CB    . LEU I 3 23  ? 71.365  38.700  33.940 1.00 98.91  ? 17  LEU E CB    1 
ATOM   8073  C CG    . LEU I 3 23  ? 71.188  38.529  35.443 1.00 98.88  ? 17  LEU E CG    1 
ATOM   8074  C CD1   . LEU I 3 23  ? 70.305  37.325  35.671 1.00 95.26  ? 17  LEU E CD1   1 
ATOM   8075  C CD2   . LEU I 3 23  ? 72.523  38.368  36.167 1.00 100.40 ? 17  LEU E CD2   1 
ATOM   8076  N N     . SER I 3 24  ? 73.349  39.017  31.531 1.00 102.49 ? 18  SER E N     1 
ATOM   8077  C CA    . SER I 3 24  ? 73.611  38.610  30.164 1.00 102.15 ? 18  SER E CA    1 
ATOM   8078  C C     . SER I 3 24  ? 72.942  37.269  29.915 1.00 99.28  ? 18  SER E C     1 
ATOM   8079  O O     . SER I 3 24  ? 72.328  36.695  30.818 1.00 97.38  ? 18  SER E O     1 
ATOM   8080  C CB    . SER I 3 24  ? 75.115  38.496  29.925 1.00 104.82 ? 18  SER E CB    1 
ATOM   8081  O OG    . SER I 3 24  ? 75.625  37.311  30.504 1.00 104.12 ? 18  SER E OG    1 
ATOM   8082  N N     . GLY I 3 25  ? 73.069  36.777  28.687 1.00 99.14  ? 19  GLY E N     1 
ATOM   8083  C CA    . GLY I 3 25  ? 72.534  35.472  28.317 1.00 96.98  ? 19  GLY E CA    1 
ATOM   8084  C C     . GLY I 3 25  ? 73.380  34.342  28.864 1.00 96.89  ? 19  GLY E C     1 
ATOM   8085  O O     . GLY I 3 25  ? 72.850  33.320  29.300 1.00 94.92  ? 19  GLY E O     1 
ATOM   8086  N N     . TYR I 3 26  ? 74.697  34.534  28.829 1.00 99.33  ? 20  TYR E N     1 
ATOM   8087  C CA    . TYR I 3 26  ? 75.661  33.568  29.358 1.00 100.11 ? 20  TYR E CA    1 
ATOM   8088  C C     . TYR I 3 26  ? 75.525  33.449  30.875 1.00 99.72  ? 20  TYR E C     1 
ATOM   8089  O O     . TYR I 3 26  ? 75.569  32.344  31.422 1.00 98.82  ? 20  TYR E O     1 
ATOM   8090  C CB    . TYR I 3 26  ? 77.087  33.981  28.976 1.00 103.45 ? 20  TYR E CB    1 
ATOM   8091  C CG    . TYR I 3 26  ? 78.163  32.982  29.336 1.00 104.33 ? 20  TYR E CG    1 
ATOM   8092  C CD1   . TYR I 3 26  ? 78.363  31.830  28.572 1.00 103.50 ? 20  TYR E CD1   1 
ATOM   8093  C CD2   . TYR I 3 26  ? 78.994  33.196  30.433 1.00 106.29 ? 20  TYR E CD2   1 
ATOM   8094  C CE1   . TYR I 3 26  ? 79.360  30.910  28.903 1.00 104.92 ? 20  TYR E CE1   1 
ATOM   8095  C CE2   . TYR I 3 26  ? 79.995  32.286  30.773 1.00 107.72 ? 20  TYR E CE2   1 
ATOM   8096  C CZ    . TYR I 3 26  ? 80.174  31.149  30.005 1.00 107.10 ? 20  TYR E CZ    1 
ATOM   8097  O OH    . TYR I 3 26  ? 81.164  30.254  30.351 1.00 108.69 ? 20  TYR E OH    1 
ATOM   8098  N N     . ASP I 3 27  ? 75.350  34.591  31.542 1.00 100.69 ? 21  ASP E N     1 
ATOM   8099  C CA    . ASP I 3 27  ? 75.101  34.631  32.982 1.00 100.63 ? 21  ASP E CA    1 
ATOM   8100  C C     . ASP I 3 27  ? 73.870  33.797  33.342 1.00 97.36  ? 21  ASP E C     1 
ATOM   8101  O O     . ASP I 3 27  ? 73.869  33.093  34.346 1.00 97.00  ? 21  ASP E O     1 
ATOM   8102  C CB    . ASP I 3 27  ? 74.945  36.078  33.474 1.00 102.36 ? 21  ASP E CB    1 
ATOM   8103  C CG    . ASP I 3 27  ? 76.285  36.774  33.713 1.00 106.98 ? 21  ASP E CG    1 
ATOM   8104  O OD1   . ASP I 3 27  ? 76.503  37.874  33.153 1.00 110.23 ? 21  ASP E OD1   1 
ATOM   8105  O OD2   . ASP I 3 27  ? 77.123  36.232  34.467 1.00 109.17 ? 21  ASP E OD2   1 
ATOM   8106  N N     . ILE I 3 28  ? 72.834  33.869  32.509 1.00 95.35  ? 22  ILE E N     1 
ATOM   8107  C CA    . ILE I 3 28  ? 71.640  33.040  32.680 1.00 92.62  ? 22  ILE E CA    1 
ATOM   8108  C C     . ILE I 3 28  ? 71.967  31.551  32.527 1.00 92.02  ? 22  ILE E C     1 
ATOM   8109  O O     . ILE I 3 28  ? 71.551  30.743  33.356 1.00 90.95  ? 22  ILE E O     1 
ATOM   8110  C CB    . ILE I 3 28  ? 70.483  33.473  31.739 1.00 91.17  ? 22  ILE E CB    1 
ATOM   8111  C CG1   . ILE I 3 28  ? 69.889  34.800  32.213 1.00 91.32  ? 22  ILE E CG1   1 
ATOM   8112  C CG2   . ILE I 3 28  ? 69.390  32.416  31.691 1.00 88.65  ? 22  ILE E CG2   1 
ATOM   8113  C CD1   . ILE I 3 28  ? 69.122  35.557  31.143 1.00 91.13  ? 22  ILE E CD1   1 
ATOM   8114  N N     . THR I 3 29  ? 72.718  31.194  31.486 1.00 93.11  ? 23  THR E N     1 
ATOM   8115  C CA    . THR I 3 29  ? 73.183  29.813  31.310 1.00 93.17  ? 23  THR E CA    1 
ATOM   8116  C C     . THR I 3 29  ? 73.934  29.336  32.558 1.00 94.39  ? 23  THR E C     1 
ATOM   8117  O O     . THR I 3 29  ? 73.718  28.211  33.024 1.00 93.38  ? 23  THR E O     1 
ATOM   8118  C CB    . THR I 3 29  ? 74.073  29.653  30.057 1.00 94.74  ? 23  THR E CB    1 
ATOM   8119  O OG1   . THR I 3 29  ? 73.427  30.261  28.935 1.00 94.86  ? 23  THR E OG1   1 
ATOM   8120  C CG2   . THR I 3 29  ? 74.324  28.179  29.743 1.00 93.95  ? 23  THR E CG2   1 
ATOM   8121  N N     . SER I 3 30  ? 74.796  30.207  33.092 1.00 96.75  ? 24  SER E N     1 
ATOM   8122  C CA    . SER I 3 30  ? 75.526  29.954  34.335 1.00 98.52  ? 24  SER E CA    1 
ATOM   8123  C C     . SER I 3 30  ? 74.608  29.531  35.484 1.00 97.06  ? 24  SER E C     1 
ATOM   8124  O O     . SER I 3 30  ? 74.853  28.505  36.126 1.00 97.27  ? 24  SER E O     1 
ATOM   8125  C CB    . SER I 3 30  ? 76.346  31.183  34.761 1.00 101.36 ? 24  SER E CB    1 
ATOM   8126  O OG    . SER I 3 30  ? 77.514  31.346  33.979 1.00 103.48 ? 24  SER E OG    1 
ATOM   8127  N N     . TYR I 3 31  ? 73.561  30.316  35.740 1.00 95.78  ? 25  TYR E N     1 
ATOM   8128  C CA    . TYR I 3 31  ? 72.663  30.046  36.863 1.00 94.78  ? 25  TYR E CA    1 
ATOM   8129  C C     . TYR I 3 31  ? 72.023  28.674  36.777 1.00 92.77  ? 25  TYR E C     1 
ATOM   8130  O O     . TYR I 3 31  ? 71.907  27.989  37.790 1.00 93.03  ? 25  TYR E O     1 
ATOM   8131  C CB    . TYR I 3 31  ? 71.602  31.140  37.028 1.00 93.99  ? 25  TYR E CB    1 
ATOM   8132  C CG    . TYR I 3 31  ? 72.105  32.346  37.788 1.00 97.11  ? 25  TYR E CG    1 
ATOM   8133  C CD1   . TYR I 3 31  ? 72.218  32.319  39.174 1.00 99.27  ? 25  TYR E CD1   1 
ATOM   8134  C CD2   . TYR I 3 31  ? 72.479  33.512  37.122 1.00 99.15  ? 25  TYR E CD2   1 
ATOM   8135  C CE1   . TYR I 3 31  ? 72.698  33.422  39.880 1.00 102.74 ? 25  TYR E CE1   1 
ATOM   8136  C CE2   . TYR I 3 31  ? 72.955  34.624  37.817 1.00 102.28 ? 25  TYR E CE2   1 
ATOM   8137  C CZ    . TYR I 3 31  ? 73.064  34.571  39.194 1.00 104.29 ? 25  TYR E CZ    1 
ATOM   8138  O OH    . TYR I 3 31  ? 73.536  35.661  39.890 1.00 107.70 ? 25  TYR E OH    1 
ATOM   8139  N N     . PHE I 3 32  ? 71.642  28.266  35.567 1.00 91.47  ? 26  PHE E N     1 
ATOM   8140  C CA    . PHE I 3 32  ? 71.093  26.928  35.321 1.00 89.92  ? 26  PHE E CA    1 
ATOM   8141  C C     . PHE I 3 32  ? 72.114  25.805  35.566 1.00 91.27  ? 26  PHE E C     1 
ATOM   8142  O O     . PHE I 3 32  ? 71.740  24.646  35.753 1.00 90.38  ? 26  PHE E O     1 
ATOM   8143  C CB    . PHE I 3 32  ? 70.530  26.813  33.895 1.00 88.82  ? 26  PHE E CB    1 
ATOM   8144  C CG    . PHE I 3 32  ? 69.241  27.579  33.669 1.00 87.27  ? 26  PHE E CG    1 
ATOM   8145  C CD1   . PHE I 3 32  ? 68.106  27.311  34.428 1.00 85.23  ? 26  PHE E CD1   1 
ATOM   8146  C CD2   . PHE I 3 32  ? 69.159  28.538  32.669 1.00 87.38  ? 26  PHE E CD2   1 
ATOM   8147  C CE1   . PHE I 3 32  ? 66.933  28.002  34.218 1.00 84.43  ? 26  PHE E CE1   1 
ATOM   8148  C CE2   . PHE I 3 32  ? 67.980  29.233  32.445 1.00 86.50  ? 26  PHE E CE2   1 
ATOM   8149  C CZ    . PHE I 3 32  ? 66.863  28.964  33.226 1.00 85.09  ? 26  PHE E CZ    1 
ATOM   8150  N N     . LYS I 3 33  ? 73.399  26.142  35.561 1.00 93.64  ? 27  LYS E N     1 
ATOM   8151  C CA    . LYS I 3 33  ? 74.427  25.141  35.826 1.00 95.55  ? 27  LYS E CA    1 
ATOM   8152  C C     . LYS I 3 33  ? 74.760  25.034  37.315 1.00 97.03  ? 27  LYS E C     1 
ATOM   8153  O O     . LYS I 3 33  ? 75.487  24.130  37.724 1.00 98.29  ? 27  LYS E O     1 
ATOM   8154  C CB    . LYS I 3 33  ? 75.681  25.399  34.990 1.00 97.73  ? 27  LYS E CB    1 
ATOM   8155  C CG    . LYS I 3 33  ? 75.649  24.763  33.608 1.00 97.24  ? 27  LYS E CG    1 
ATOM   8156  N N     . GLU I 3 34  ? 74.201  25.938  38.119 1.00 97.19  ? 28  GLU E N     1 
ATOM   8157  C CA    . GLU I 3 34  ? 74.446  25.949  39.566 1.00 99.06  ? 28  GLU E CA    1 
ATOM   8158  C C     . GLU I 3 34  ? 73.307  25.289  40.372 1.00 97.35  ? 28  GLU E C     1 
ATOM   8159  O O     . GLU I 3 34  ? 72.827  24.215  39.995 1.00 95.91  ? 28  GLU E O     1 
ATOM   8160  C CB    . GLU I 3 34  ? 74.748  27.372  40.056 1.00 100.96 ? 28  GLU E CB    1 
ATOM   8161  C CG    . GLU I 3 34  ? 76.121  27.896  39.640 1.00 103.97 ? 28  GLU E CG    1 
ATOM   8162  C CD    . GLU I 3 34  ? 76.289  29.393  39.867 1.00 105.81 ? 28  GLU E CD    1 
ATOM   8163  O OE1   . GLU I 3 34  ? 75.298  30.062  40.241 1.00 104.70 ? 28  GLU E OE1   1 
ATOM   8164  O OE2   . GLU I 3 34  ? 77.415  29.904  39.667 1.00 108.14 ? 28  GLU E OE2   1 
ATOM   8165  N N     . GLU I 3 35  ? 72.884  25.917  41.470 1.00 97.85  ? 29  GLU E N     1 
ATOM   8166  C CA    . GLU I 3 35  ? 71.937  25.284  42.400 1.00 96.69  ? 29  GLU E CA    1 
ATOM   8167  C C     . GLU I 3 35  ? 70.496  25.195  41.889 1.00 93.15  ? 29  GLU E C     1 
ATOM   8168  O O     . GLU I 3 35  ? 69.775  24.267  42.251 1.00 91.90  ? 29  GLU E O     1 
ATOM   8169  C CB    . GLU I 3 35  ? 71.994  25.915  43.804 1.00 98.94  ? 29  GLU E CB    1 
ATOM   8170  C CG    . GLU I 3 35  ? 71.598  27.388  43.880 1.00 100.63 ? 29  GLU E CG    1 
ATOM   8171  C CD    . GLU I 3 35  ? 72.755  28.337  43.610 1.00 104.65 ? 29  GLU E CD    1 
ATOM   8172  O OE1   . GLU I 3 35  ? 73.906  27.873  43.460 1.00 106.49 ? 29  GLU E OE1   1 
ATOM   8173  O OE2   . GLU I 3 35  ? 72.508  29.561  43.553 1.00 106.00 ? 29  GLU E OE2   1 
ATOM   8174  N N     . LEU I 3 36  ? 70.090  26.151  41.054 1.00 91.75  ? 30  LEU E N     1 
ATOM   8175  C CA    . LEU I 3 36  ? 68.755  26.136  40.443 1.00 88.90  ? 30  LEU E CA    1 
ATOM   8176  C C     . LEU I 3 36  ? 68.622  24.983  39.457 1.00 87.14  ? 30  LEU E C     1 
ATOM   8177  O O     . LEU I 3 36  ? 67.528  24.463  39.235 1.00 85.34  ? 30  LEU E O     1 
ATOM   8178  C CB    . LEU I 3 36  ? 68.452  27.474  39.758 1.00 88.81  ? 30  LEU E CB    1 
ATOM   8179  C CG    . LEU I 3 36  ? 67.153  27.655  38.956 1.00 87.18  ? 30  LEU E CG    1 
ATOM   8180  C CD1   . LEU I 3 36  ? 65.913  27.353  39.783 1.00 86.16  ? 30  LEU E CD1   1 
ATOM   8181  C CD2   . LEU I 3 36  ? 67.081  29.058  38.379 1.00 87.70  ? 30  LEU E CD2   1 
ATOM   8182  N N     . GLY I 3 37  ? 69.757  24.579  38.893 1.00 87.80  ? 31  GLY E N     1 
ATOM   8183  C CA    . GLY I 3 37  ? 69.828  23.474  37.943 1.00 86.71  ? 31  GLY E CA    1 
ATOM   8184  C C     . GLY I 3 37  ? 69.367  22.133  38.475 1.00 85.79  ? 31  GLY E C     1 
ATOM   8185  O O     . GLY I 3 37  ? 69.269  21.170  37.724 1.00 85.30  ? 31  GLY E O     1 
ATOM   8186  N N     . GLN I 3 38  ? 69.089  22.069  39.772 1.00 85.84  ? 32  GLN E N     1 
ATOM   8187  C CA    . GLN I 3 38  ? 68.537  20.863  40.379 1.00 85.29  ? 32  GLN E CA    1 
ATOM   8188  C C     . GLN I 3 38  ? 67.045  20.768  40.094 1.00 83.39  ? 32  GLN E C     1 
ATOM   8189  O O     . GLN I 3 38  ? 66.457  19.690  40.187 1.00 82.84  ? 32  GLN E O     1 
ATOM   8190  C CB    . GLN I 3 38  ? 68.773  20.856  41.893 1.00 86.74  ? 32  GLN E CB    1 
ATOM   8191  C CG    . GLN I 3 38  ? 70.238  20.820  42.320 1.00 89.17  ? 32  GLN E CG    1 
ATOM   8192  C CD    . GLN I 3 38  ? 70.899  19.476  42.072 1.00 90.26  ? 32  GLN E CD    1 
ATOM   8193  O OE1   . GLN I 3 38  ? 70.398  18.433  42.489 1.00 89.97  ? 32  GLN E OE1   1 
ATOM   8194  N NE2   . GLN I 3 38  ? 72.044  19.500  41.401 1.00 91.76  ? 32  GLN E NE2   1 
ATOM   8195  N N     . PHE I 3 39  ? 66.438  21.900  39.739 1.00 82.51  ? 33  PHE E N     1 
ATOM   8196  C CA    . PHE I 3 39  ? 64.992  21.976  39.590 1.00 81.08  ? 33  PHE E CA    1 
ATOM   8197  C C     . PHE I 3 39  ? 64.525  22.570  38.264 1.00 80.51  ? 33  PHE E C     1 
ATOM   8198  O O     . PHE I 3 39  ? 63.423  22.273  37.816 1.00 79.80  ? 33  PHE E O     1 
ATOM   8199  C CB    . PHE I 3 39  ? 64.368  22.703  40.786 1.00 81.11  ? 33  PHE E CB    1 
ATOM   8200  C CG    . PHE I 3 39  ? 64.587  21.999  42.098 1.00 81.60  ? 33  PHE E CG    1 
ATOM   8201  C CD1   . PHE I 3 39  ? 63.944  20.796  42.375 1.00 80.88  ? 33  PHE E CD1   1 
ATOM   8202  C CD2   . PHE I 3 39  ? 65.449  22.527  43.051 1.00 82.54  ? 33  PHE E CD2   1 
ATOM   8203  C CE1   . PHE I 3 39  ? 64.154  20.138  43.580 1.00 81.39  ? 33  PHE E CE1   1 
ATOM   8204  C CE2   . PHE I 3 39  ? 65.660  21.875  44.251 1.00 83.04  ? 33  PHE E CE2   1 
ATOM   8205  C CZ    . PHE I 3 39  ? 65.011  20.678  44.515 1.00 82.82  ? 33  PHE E CZ    1 
ATOM   8206  N N     . TRP I 3 40  ? 65.349  23.414  37.649 1.00 81.29  ? 34  TRP E N     1 
ATOM   8207  C CA    . TRP I 3 40  ? 65.127  23.821  36.257 1.00 81.18  ? 34  TRP E CA    1 
ATOM   8208  C C     . TRP I 3 40  ? 66.422  24.098  35.517 1.00 82.09  ? 34  TRP E C     1 
ATOM   8209  O O     . TRP I 3 40  ? 67.295  24.798  36.027 1.00 83.21  ? 34  TRP E O     1 
ATOM   8210  C CB    . TRP I 3 40  ? 64.198  25.028  36.131 1.00 80.85  ? 34  TRP E CB    1 
ATOM   8211  C CG    . TRP I 3 40  ? 63.502  25.007  34.800 1.00 81.52  ? 34  TRP E CG    1 
ATOM   8212  C CD1   . TRP I 3 40  ? 63.966  25.514  33.618 1.00 81.96  ? 34  TRP E CD1   1 
ATOM   8213  C CD2   . TRP I 3 40  ? 62.241  24.396  34.505 1.00 81.27  ? 34  TRP E CD2   1 
ATOM   8214  N NE1   . TRP I 3 40  ? 63.065  25.268  32.613 1.00 82.27  ? 34  TRP E NE1   1 
ATOM   8215  C CE2   . TRP I 3 40  ? 61.997  24.586  33.130 1.00 81.85  ? 34  TRP E CE2   1 
ATOM   8216  C CE3   . TRP I 3 40  ? 61.287  23.718  35.275 1.00 81.41  ? 34  TRP E CE3   1 
ATOM   8217  C CZ2   . TRP I 3 40  ? 60.839  24.124  32.505 1.00 83.13  ? 34  TRP E CZ2   1 
ATOM   8218  C CZ3   . TRP I 3 40  ? 60.130  23.257  34.653 1.00 82.34  ? 34  TRP E CZ3   1 
ATOM   8219  C CH2   . TRP I 3 40  ? 59.918  23.461  33.280 1.00 83.07  ? 34  TRP E CH2   1 
ATOM   8220  N N     . SER I 3 41  ? 66.541  23.558  34.309 1.00 82.08  ? 35  SER E N     1 
ATOM   8221  C CA    . SER I 3 41  ? 67.719  23.810  33.483 1.00 83.19  ? 35  SER E CA    1 
ATOM   8222  C C     . SER I 3 41  ? 67.313  24.168  32.067 1.00 82.97  ? 35  SER E C     1 
ATOM   8223  O O     . SER I 3 41  ? 66.223  23.816  31.620 1.00 82.14  ? 35  SER E O     1 
ATOM   8224  C CB    . SER I 3 41  ? 68.669  22.603  33.477 1.00 84.03  ? 35  SER E CB    1 
ATOM   8225  O OG    . SER I 3 41  ? 68.096  21.492  32.805 1.00 84.27  ? 35  SER E OG    1 
ATOM   8226  N N     . ALA I 3 42  ? 68.204  24.869  31.376 1.00 83.79  ? 36  ALA E N     1 
ATOM   8227  C CA    . ALA I 3 42  ? 68.024  25.194  29.976 1.00 84.13  ? 36  ALA E CA    1 
ATOM   8228  C C     . ALA I 3 42  ? 69.374  25.367  29.302 1.00 85.49  ? 36  ALA E C     1 
ATOM   8229  O O     . ALA I 3 42  ? 70.238  26.073  29.809 1.00 86.14  ? 36  ALA E O     1 
ATOM   8230  C CB    . ALA I 3 42  ? 67.188  26.458  29.827 1.00 83.70  ? 36  ALA E CB    1 
ATOM   8231  N N     . LYS I 3 43  ? 69.541  24.722  28.153 1.00 86.30  ? 37  LYS E N     1 
ATOM   8232  C CA    . LYS I 3 43  ? 70.745  24.864  27.338 1.00 88.17  ? 37  LYS E CA    1 
ATOM   8233  C C     . LYS I 3 43  ? 70.760  26.228  26.653 1.00 88.74  ? 37  LYS E C     1 
ATOM   8234  O O     . LYS I 3 43  ? 69.703  26.840  26.461 1.00 87.89  ? 37  LYS E O     1 
ATOM   8235  C CB    . LYS I 3 43  ? 70.803  23.758  26.286 1.00 89.25  ? 37  LYS E CB    1 
ATOM   8236  C CG    . LYS I 3 43  ? 70.622  22.356  26.833 1.00 88.86  ? 37  LYS E CG    1 
ATOM   8237  C CD    . LYS I 3 43  ? 71.937  21.704  27.142 1.00 91.29  ? 37  LYS E CD    1 
ATOM   8238  C CE    . LYS I 3 43  ? 71.772  20.235  27.489 1.00 92.37  ? 37  LYS E CE    1 
ATOM   8239  N NZ    . LYS I 3 43  ? 71.818  19.981  28.957 1.00 91.82  ? 37  LYS E NZ    1 
ATOM   8240  N N     . HIS I 3 44  ? 71.952  26.692  26.276 1.00 90.23  ? 38  HIS E N     1 
ATOM   8241  C CA    . HIS I 3 44  ? 72.114  28.008  25.652 1.00 91.14  ? 38  HIS E CA    1 
ATOM   8242  C C     . HIS I 3 44  ? 71.331  28.150  24.337 1.00 91.54  ? 38  HIS E C     1 
ATOM   8243  O O     . HIS I 3 44  ? 70.843  29.236  24.003 1.00 91.39  ? 38  HIS E O     1 
ATOM   8244  C CB    . HIS I 3 44  ? 73.602  28.355  25.467 1.00 93.26  ? 38  HIS E CB    1 
ATOM   8245  C CG    . HIS I 3 44  ? 74.266  27.640  24.330 1.00 94.99  ? 38  HIS E CG    1 
ATOM   8246  N ND1   . HIS I 3 44  ? 74.521  26.285  24.346 1.00 95.39  ? 38  HIS E ND1   1 
ATOM   8247  C CD2   . HIS I 3 44  ? 74.748  28.097  23.151 1.00 97.00  ? 38  HIS E CD2   1 
ATOM   8248  C CE1   . HIS I 3 44  ? 75.122  25.936  23.222 1.00 96.84  ? 38  HIS E CE1   1 
ATOM   8249  N NE2   . HIS I 3 44  ? 75.271  27.018  22.479 1.00 98.32  ? 38  HIS E NE2   1 
ATOM   8250  N N     . SER I 3 45  ? 71.201  27.035  23.619 1.00 92.15  ? 39  SER E N     1 
ATOM   8251  C CA    . SER I 3 45  ? 70.487  26.979  22.342 1.00 93.11  ? 39  SER E CA    1 
ATOM   8252  C C     . SER I 3 45  ? 68.994  27.272  22.472 1.00 91.78  ? 39  SER E C     1 
ATOM   8253  O O     . SER I 3 45  ? 68.305  27.521  21.476 1.00 92.85  ? 39  SER E O     1 
ATOM   8254  C CB    . SER I 3 45  ? 70.689  25.606  21.699 1.00 94.21  ? 39  SER E CB    1 
ATOM   8255  O OG    . SER I 3 45  ? 69.994  24.592  22.404 1.00 92.31  ? 39  SER E OG    1 
ATOM   8256  N N     . GLN I 3 46  ? 68.495  27.225  23.701 1.00 89.85  ? 40  GLN E N     1 
ATOM   8257  C CA    . GLN I 3 46  ? 67.101  27.517  23.966 1.00 88.74  ? 40  GLN E CA    1 
ATOM   8258  C C     . GLN I 3 46  ? 66.946  28.920  24.540 1.00 88.25  ? 40  GLN E C     1 
ATOM   8259  O O     . GLN I 3 46  ? 65.917  29.576  24.324 1.00 88.45  ? 40  GLN E O     1 
ATOM   8260  C CB    . GLN I 3 46  ? 66.516  26.476  24.919 1.00 87.22  ? 40  GLN E CB    1 
ATOM   8261  C CG    . GLN I 3 46  ? 64.992  26.460  24.988 1.00 87.14  ? 40  GLN E CG    1 
ATOM   8262  C CD    . GLN I 3 46  ? 64.454  25.276  25.758 1.00 87.25  ? 40  GLN E CD    1 
ATOM   8263  O OE1   . GLN I 3 46  ? 65.202  24.371  26.133 1.00 88.62  ? 40  GLN E OE1   1 
ATOM   8264  N NE2   . GLN I 3 46  ? 63.152  25.269  25.992 1.00 86.59  ? 40  GLN E NE2   1 
ATOM   8265  N N     . ILE I 3 47  ? 67.973  29.376  25.253 1.00 88.06  ? 41  ILE E N     1 
ATOM   8266  C CA    . ILE I 3 47  ? 67.912  30.636  25.994 1.00 87.79  ? 41  ILE E CA    1 
ATOM   8267  C C     . ILE I 3 47  ? 68.046  31.865  25.093 1.00 89.56  ? 41  ILE E C     1 
ATOM   8268  O O     . ILE I 3 47  ? 67.212  32.777  25.154 1.00 89.23  ? 41  ILE E O     1 
ATOM   8269  C CB    . ILE I 3 47  ? 68.946  30.661  27.150 1.00 87.72  ? 41  ILE E CB    1 
ATOM   8270  C CG1   . ILE I 3 47  ? 68.643  29.533  28.140 1.00 86.11  ? 41  ILE E CG1   1 
ATOM   8271  C CG2   . ILE I 3 47  ? 68.952  32.018  27.859 1.00 87.57  ? 41  ILE E CG2   1 
ATOM   8272  C CD1   . ILE I 3 47  ? 69.680  29.342  29.211 1.00 87.31  ? 41  ILE E CD1   1 
ATOM   8273  N N     . TYR I 3 48  ? 69.090  31.885  24.264 1.00 91.50  ? 42  TYR E N     1 
ATOM   8274  C CA    . TYR I 3 48  ? 69.337  33.010  23.356 1.00 93.26  ? 42  TYR E CA    1 
ATOM   8275  C C     . TYR I 3 48  ? 68.165  33.315  22.417 1.00 93.86  ? 42  TYR E C     1 
ATOM   8276  O O     . TYR I 3 48  ? 67.830  34.485  22.238 1.00 94.62  ? 42  TYR E O     1 
ATOM   8277  C CB    . TYR I 3 48  ? 70.646  32.839  22.576 1.00 95.13  ? 42  TYR E CB    1 
ATOM   8278  C CG    . TYR I 3 48  ? 71.886  33.042  23.417 1.00 94.93  ? 42  TYR E CG    1 
ATOM   8279  C CD1   . TYR I 3 48  ? 72.221  34.303  23.912 1.00 94.84  ? 42  TYR E CD1   1 
ATOM   8280  C CD2   . TYR I 3 48  ? 72.726  31.974  23.717 1.00 94.02  ? 42  TYR E CD2   1 
ATOM   8281  C CE1   . TYR I 3 48  ? 73.357  34.488  24.696 1.00 95.66  ? 42  TYR E CE1   1 
ATOM   8282  C CE2   . TYR I 3 48  ? 73.861  32.148  24.493 1.00 94.72  ? 42  TYR E CE2   1 
ATOM   8283  C CZ    . TYR I 3 48  ? 74.171  33.405  24.982 1.00 96.32  ? 42  TYR E CZ    1 
ATOM   8284  O OH    . TYR I 3 48  ? 75.307  33.578  25.745 1.00 98.91  ? 42  TYR E OH    1 
ATOM   8285  N N     . PRO I 3 49  ? 67.541  32.272  21.817 1.00 93.97  ? 43  PRO E N     1 
ATOM   8286  C CA    . PRO I 3 49  ? 66.309  32.524  21.057 1.00 94.71  ? 43  PRO E CA    1 
ATOM   8287  C C     . PRO I 3 49  ? 65.172  33.046  21.927 1.00 93.57  ? 43  PRO E C     1 
ATOM   8288  O O     . PRO I 3 49  ? 64.415  33.913  21.483 1.00 94.84  ? 43  PRO E O     1 
ATOM   8289  C CB    . PRO I 3 49  ? 65.952  31.144  20.496 1.00 94.78  ? 43  PRO E CB    1 
ATOM   8290  C CG    . PRO I 3 49  ? 67.264  30.440  20.402 1.00 95.26  ? 43  PRO E CG    1 
ATOM   8291  C CD    . PRO I 3 49  ? 68.013  30.886  21.622 1.00 93.80  ? 43  PRO E CD    1 
ATOM   8292  N N     . GLU I 3 50  ? 65.057  32.535  23.151 1.00 91.92  ? 44  GLU E N     1 
ATOM   8293  C CA    . GLU I 3 50  ? 63.995  32.962  24.064 1.00 91.14  ? 44  GLU E CA    1 
ATOM   8294  C C     . GLU I 3 50  ? 64.110  34.439  24.450 1.00 91.60  ? 44  GLU E C     1 
ATOM   8295  O O     . GLU I 3 50  ? 63.101  35.143  24.517 1.00 92.32  ? 44  GLU E O     1 
ATOM   8296  C CB    . GLU I 3 50  ? 63.946  32.074  25.311 1.00 89.28  ? 44  GLU E CB    1 
ATOM   8297  C CG    . GLU I 3 50  ? 62.751  32.325  26.229 1.00 89.47  ? 44  GLU E CG    1 
ATOM   8298  C CD    . GLU I 3 50  ? 61.420  31.933  25.604 1.00 92.08  ? 44  GLU E CD    1 
ATOM   8299  O OE1   . GLU I 3 50  ? 61.414  31.086  24.684 1.00 93.95  ? 44  GLU E OE1   1 
ATOM   8300  O OE2   . GLU I 3 50  ? 60.375  32.468  26.038 1.00 92.81  ? 44  GLU E OE2   1 
ATOM   8301  N N     . LEU I 3 51  ? 65.336  34.898  24.684 1.00 92.08  ? 45  LEU E N     1 
ATOM   8302  C CA    . LEU I 3 51  ? 65.609  36.293  25.043 1.00 92.87  ? 45  LEU E CA    1 
ATOM   8303  C C     . LEU I 3 51  ? 65.165  37.284  23.964 1.00 94.71  ? 45  LEU E C     1 
ATOM   8304  O O     . LEU I 3 51  ? 64.611  38.335  24.284 1.00 95.19  ? 45  LEU E O     1 
ATOM   8305  C CB    . LEU I 3 51  ? 67.103  36.490  25.356 1.00 93.73  ? 45  LEU E CB    1 
ATOM   8306  C CG    . LEU I 3 51  ? 67.712  35.937  26.647 1.00 91.90  ? 45  LEU E CG    1 
ATOM   8307  C CD1   . LEU I 3 51  ? 69.206  35.756  26.469 1.00 93.52  ? 45  LEU E CD1   1 
ATOM   8308  C CD2   . LEU I 3 51  ? 67.430  36.838  27.833 1.00 91.16  ? 45  LEU E CD2   1 
ATOM   8309  N N     . LYS I 3 52  ? 65.418  36.947  22.697 1.00 96.02  ? 46  LYS E N     1 
ATOM   8310  C CA    . LYS I 3 52  ? 65.005  37.780  21.563 1.00 98.26  ? 46  LYS E CA    1 
ATOM   8311  C C     . LYS I 3 52  ? 63.491  37.865  21.509 1.00 98.20  ? 46  LYS E C     1 
ATOM   8312  O O     . LYS I 3 52  ? 62.927  38.943  21.328 1.00 99.49  ? 46  LYS E O     1 
ATOM   8313  C CB    . LYS I 3 52  ? 65.532  37.217  20.241 1.00 99.76  ? 46  LYS E CB    1 
ATOM   8314  N N     . LYS I 3 53  ? 62.847  36.713  21.681 1.00 97.00  ? 47  LYS E N     1 
ATOM   8315  C CA    . LYS I 3 53  ? 61.399  36.621  21.693 1.00 97.17  ? 47  LYS E CA    1 
ATOM   8316  C C     . LYS I 3 53  ? 60.825  37.458  22.831 1.00 96.44  ? 47  LYS E C     1 
ATOM   8317  O O     . LYS I 3 53  ? 59.805  38.126  22.663 1.00 97.56  ? 47  LYS E O     1 
ATOM   8318  C CB    . LYS I 3 53  ? 60.966  35.162  21.832 1.00 96.02  ? 47  LYS E CB    1 
ATOM   8319  C CG    . LYS I 3 53  ? 59.609  34.874  21.248 1.00 97.65  ? 47  LYS E CG    1 
ATOM   8320  C CD    . LYS I 3 53  ? 59.233  33.415  21.389 1.00 98.15  ? 47  LYS E CD    1 
ATOM   8321  C CE    . LYS I 3 53  ? 57.770  33.212  21.012 1.00 101.17 ? 47  LYS E CE    1 
ATOM   8322  N NZ    . LYS I 3 53  ? 57.388  31.778  21.039 1.00 101.70 ? 47  LYS E NZ    1 
ATOM   8323  N N     . LEU I 3 54  ? 61.496  37.426  23.982 1.00 94.91  ? 48  LEU E N     1 
ATOM   8324  C CA    . LEU I 3 54  ? 61.068  38.192  25.149 1.00 94.41  ? 48  LEU E CA    1 
ATOM   8325  C C     . LEU I 3 54  ? 61.292  39.698  24.990 1.00 96.37  ? 48  LEU E C     1 
ATOM   8326  O O     . LEU I 3 54  ? 60.591  40.499  25.610 1.00 96.91  ? 48  LEU E O     1 
ATOM   8327  C CB    . LEU I 3 54  ? 61.755  37.673  26.414 1.00 92.53  ? 48  LEU E CB    1 
ATOM   8328  C CG    . LEU I 3 54  ? 61.285  36.347  27.016 1.00 90.12  ? 48  LEU E CG    1 
ATOM   8329  C CD1   . LEU I 3 54  ? 62.258  35.885  28.089 1.00 88.39  ? 48  LEU E CD1   1 
ATOM   8330  C CD2   . LEU I 3 54  ? 59.894  36.481  27.595 1.00 89.60  ? 48  LEU E CD2   1 
ATOM   8331  N N     . THR I 3 55  ? 62.263  40.075  24.158 1.00 97.87  ? 49  THR E N     1 
ATOM   8332  C CA    . THR I 3 55  ? 62.521  41.481  23.832 1.00 100.15 ? 49  THR E CA    1 
ATOM   8333  C C     . THR I 3 55  ? 61.417  42.032  22.931 1.00 102.00 ? 49  THR E C     1 
ATOM   8334  O O     . THR I 3 55  ? 61.001  43.181  23.086 1.00 103.34 ? 49  THR E O     1 
ATOM   8335  C CB    . THR I 3 55  ? 63.897  41.671  23.139 1.00 101.41 ? 49  THR E CB    1 
ATOM   8336  O OG1   . THR I 3 55  ? 64.903  40.949  23.855 1.00 99.84  ? 49  THR E OG1   1 
ATOM   8337  C CG2   . THR I 3 55  ? 64.292  43.146  23.087 1.00 103.46 ? 49  THR E CG2   1 
ATOM   8338  N N     . ASP I 3 56  ? 60.954  41.197  21.999 1.00 102.49 ? 50  ASP E N     1 
ATOM   8339  C CA    . ASP I 3 56  ? 59.879  41.541  21.065 1.00 104.63 ? 50  ASP E CA    1 
ATOM   8340  C C     . ASP I 3 56  ? 58.525  41.609  21.769 1.00 104.11 ? 50  ASP E C     1 
ATOM   8341  O O     . ASP I 3 56  ? 57.653  42.393  21.382 1.00 106.23 ? 50  ASP E O     1 
ATOM   8342  C CB    . ASP I 3 56  ? 59.815  40.527  19.914 1.00 105.50 ? 50  ASP E CB    1 
ATOM   8343  C CG    . ASP I 3 56  ? 61.114  40.449  19.112 1.00 107.54 ? 50  ASP E CG    1 
ATOM   8344  O OD1   . ASP I 3 56  ? 61.974  41.348  19.238 1.00 109.49 ? 50  ASP E OD1   1 
ATOM   8345  O OD2   . ASP I 3 56  ? 61.278  39.476  18.346 1.00 108.86 ? 50  ASP E OD2   1 
ATOM   8346  N N     . GLU I 3 57  ? 58.359  40.783  22.799 1.00 101.57 ? 51  GLU E N     1 
ATOM   8347  C CA    . GLU I 3 57  ? 57.139  40.759  23.605 1.00 100.97 ? 51  GLU E CA    1 
ATOM   8348  C C     . GLU I 3 57  ? 57.111  41.879  24.651 1.00 100.89 ? 51  GLU E C     1 
ATOM   8349  O O     . GLU I 3 57  ? 56.108  42.063  25.349 1.00 100.88 ? 51  GLU E O     1 
ATOM   8350  C CB    . GLU I 3 57  ? 56.984  39.402  24.294 1.00 98.89  ? 51  GLU E CB    1 
ATOM   8351  C CG    . GLU I 3 57  ? 56.632  38.245  23.369 1.00 98.95  ? 51  GLU E CG    1 
ATOM   8352  C CD    . GLU I 3 57  ? 56.467  36.932  24.117 1.00 96.71  ? 51  GLU E CD    1 
ATOM   8353  O OE1   . GLU I 3 57  ? 57.421  36.494  24.791 1.00 94.65  ? 51  GLU E OE1   1 
ATOM   8354  O OE2   . GLU I 3 57  ? 55.379  36.332  24.029 1.00 97.35  ? 51  GLU E OE2   1 
ATOM   8355  N N     . GLY I 3 58  ? 58.222  42.602  24.768 1.00 100.86 ? 52  GLY E N     1 
ATOM   8356  C CA    . GLY I 3 58  ? 58.306  43.792  25.613 1.00 101.44 ? 52  GLY E CA    1 
ATOM   8357  C C     . GLY I 3 58  ? 58.468  43.578  27.109 1.00 99.82  ? 52  GLY E C     1 
ATOM   8358  O O     . GLY I 3 58  ? 58.356  44.536  27.876 1.00 100.79 ? 52  GLY E O     1 
ATOM   8359  N N     . PHE I 3 59  ? 58.729  42.337  27.528 1.00 97.56  ? 53  PHE E N     1 
ATOM   8360  C CA    . PHE I 3 59  ? 58.928  42.020  28.951 1.00 96.15  ? 53  PHE E CA    1 
ATOM   8361  C C     . PHE I 3 59  ? 60.320  42.419  29.425 1.00 96.34  ? 53  PHE E C     1 
ATOM   8362  O O     . PHE I 3 59  ? 60.506  42.802  30.583 1.00 96.58  ? 53  PHE E O     1 
ATOM   8363  C CB    . PHE I 3 59  ? 58.667  40.534  29.246 1.00 93.94  ? 53  PHE E CB    1 
ATOM   8364  C CG    . PHE I 3 59  ? 57.298  40.062  28.829 1.00 94.63  ? 53  PHE E CG    1 
ATOM   8365  C CD1   . PHE I 3 59  ? 56.149  40.727  29.260 1.00 95.66  ? 53  PHE E CD1   1 
ATOM   8366  C CD2   . PHE I 3 59  ? 57.153  38.952  28.002 1.00 94.45  ? 53  PHE E CD2   1 
ATOM   8367  C CE1   . PHE I 3 59  ? 54.879  40.297  28.866 1.00 96.36  ? 53  PHE E CE1   1 
ATOM   8368  C CE2   . PHE I 3 59  ? 55.879  38.513  27.603 1.00 95.26  ? 53  PHE E CE2   1 
ATOM   8369  C CZ    . PHE I 3 59  ? 54.744  39.186  28.038 1.00 95.76  ? 53  PHE E CZ    1 
ATOM   8370  N N     . ILE I 3 60  ? 61.292  42.334  28.524 1.00 96.57  ? 54  ILE E N     1 
ATOM   8371  C CA    . ILE I 3 60  ? 62.666  42.704  28.845 1.00 97.37  ? 54  ILE E CA    1 
ATOM   8372  C C     . ILE I 3 60  ? 63.262  43.664  27.820 1.00 99.55  ? 54  ILE E C     1 
ATOM   8373  O O     . ILE I 3 60  ? 62.824  43.717  26.669 1.00 100.21 ? 54  ILE E O     1 
ATOM   8374  C CB    . ILE I 3 60  ? 63.581  41.462  29.027 1.00 95.72  ? 54  ILE E CB    1 
ATOM   8375  C CG1   . ILE I 3 60  ? 63.507  40.540  27.802 1.00 94.97  ? 54  ILE E CG1   1 
ATOM   8376  C CG2   . ILE I 3 60  ? 63.207  40.717  30.309 1.00 94.23  ? 54  ILE E CG2   1 
ATOM   8377  C CD1   . ILE I 3 60  ? 64.544  39.428  27.788 1.00 93.68  ? 54  ILE E CD1   1 
ATOM   8378  N N     . THR I 3 61  ? 64.248  44.435  28.265 1.00 101.05 ? 55  THR E N     1 
ATOM   8379  C CA    . THR I 3 61  ? 64.976  45.359  27.407 1.00 103.46 ? 55  THR E CA    1 
ATOM   8380  C C     . THR I 3 61  ? 66.473  45.113  27.602 1.00 104.03 ? 55  THR E C     1 
ATOM   8381  O O     . THR I 3 61  ? 66.876  44.570  28.629 1.00 103.07 ? 55  THR E O     1 
ATOM   8382  C CB    . THR I 3 61  ? 64.580  46.841  27.693 1.00 105.77 ? 55  THR E CB    1 
ATOM   8383  O OG1   . THR I 3 61  ? 65.168  47.700  26.709 1.00 108.17 ? 55  THR E OG1   1 
ATOM   8384  C CG2   . THR I 3 61  ? 65.011  47.291  29.097 1.00 106.47 ? 55  THR E CG2   1 
ATOM   8385  N N     . PHE I 3 62  ? 67.293  45.485  26.621 1.00 105.84 ? 56  PHE E N     1 
ATOM   8386  C CA    . PHE I 3 62  ? 68.737  45.270  26.751 1.00 107.00 ? 56  PHE E CA    1 
ATOM   8387  C C     . PHE I 3 62  ? 69.613  46.473  26.395 1.00 110.42 ? 56  PHE E C     1 
ATOM   8388  O O     . PHE I 3 62  ? 69.217  47.345  25.615 1.00 111.84 ? 56  PHE E O     1 
ATOM   8389  C CB    . PHE I 3 62  ? 69.191  44.003  25.998 1.00 105.64 ? 56  PHE E CB    1 
ATOM   8390  C CG    . PHE I 3 62  ? 69.307  44.171  24.505 1.00 106.98 ? 56  PHE E CG    1 
ATOM   8391  C CD1   . PHE I 3 62  ? 70.492  44.625  23.928 1.00 109.33 ? 56  PHE E CD1   1 
ATOM   8392  C CD2   . PHE I 3 62  ? 68.240  43.848  23.672 1.00 106.38 ? 56  PHE E CD2   1 
ATOM   8393  C CE1   . PHE I 3 62  ? 70.604  44.778  22.551 1.00 111.13 ? 56  PHE E CE1   1 
ATOM   8394  C CE2   . PHE I 3 62  ? 68.341  43.996  22.284 1.00 108.08 ? 56  PHE E CE2   1 
ATOM   8395  C CZ    . PHE I 3 62  ? 69.526  44.462  21.725 1.00 110.45 ? 56  PHE E CZ    1 
ATOM   8396  N N     . ARG I 3 63  ? 70.797  46.506  27.002 1.00 111.95 ? 57  ARG E N     1 
ATOM   8397  C CA    . ARG I 3 63  ? 71.859  47.440  26.638 1.00 115.57 ? 57  ARG E CA    1 
ATOM   8398  C C     . ARG I 3 63  ? 73.107  46.642  26.292 1.00 116.25 ? 57  ARG E C     1 
ATOM   8399  O O     . ARG I 3 63  ? 73.469  45.708  27.010 1.00 114.90 ? 57  ARG E O     1 
ATOM   8400  C CB    . ARG I 3 63  ? 72.161  48.407  27.786 1.00 117.77 ? 57  ARG E CB    1 
ATOM   8401  N N     . THR I 3 64  ? 73.752  47.004  25.187 1.00 118.66 ? 58  THR E N     1 
ATOM   8402  C CA    . THR I 3 64  ? 74.981  46.343  24.763 1.00 119.96 ? 58  THR E CA    1 
ATOM   8403  C C     . THR I 3 64  ? 76.182  47.015  25.421 1.00 123.53 ? 58  THR E C     1 
ATOM   8404  O O     . THR I 3 64  ? 76.346  48.233  25.328 1.00 126.32 ? 58  THR E O     1 
ATOM   8405  C CB    . THR I 3 64  ? 75.147  46.352  23.219 1.00 121.09 ? 58  THR E CB    1 
ATOM   8406  O OG1   . THR I 3 64  ? 73.917  45.964  22.595 1.00 118.73 ? 58  THR E OG1   1 
ATOM   8407  C CG2   . THR I 3 64  ? 76.256  45.393  22.778 1.00 121.89 ? 58  THR E CG2   1 
ATOM   8408  N N     . THR I 3 65  ? 76.998  46.216  26.106 1.00 123.76 ? 59  THR E N     1 
ATOM   8409  C CA    . THR I 3 65  ? 78.290  46.674  26.620 1.00 127.81 ? 59  THR E CA    1 
ATOM   8410  C C     . THR I 3 65  ? 79.420  45.847  26.000 1.00 129.29 ? 59  THR E C     1 
ATOM   8411  O O     . THR I 3 65  ? 79.175  44.765  25.454 1.00 126.93 ? 59  THR E O     1 
ATOM   8412  C CB    . THR I 3 65  ? 78.362  46.653  28.177 1.00 127.96 ? 59  THR E CB    1 
ATOM   8413  O OG1   . THR I 3 65  ? 79.562  47.311  28.611 1.00 132.40 ? 59  THR E OG1   1 
ATOM   8414  C CG2   . THR I 3 65  ? 78.333  45.223  28.729 1.00 124.77 ? 59  THR E CG2   1 
ATOM   8415  N N     . ILE I 3 66  ? 80.647  46.358  26.080 1.00 133.52 ? 60  ILE E N     1 
ATOM   8416  C CA    . ILE I 3 66  ? 81.794  45.679  25.484 1.00 135.64 ? 60  ILE E CA    1 
ATOM   8417  C C     . ILE I 3 66  ? 82.776  45.151  26.531 1.00 137.54 ? 60  ILE E C     1 
ATOM   8418  O O     . ILE I 3 66  ? 83.348  45.923  27.306 1.00 140.90 ? 60  ILE E O     1 
ATOM   8419  C CB    . ILE I 3 66  ? 82.544  46.596  24.489 1.00 139.72 ? 60  ILE E CB    1 
ATOM   8420  N N     . GLN I 3 67  ? 82.955  43.832  26.555 1.00 135.72 ? 61  GLN E N     1 
ATOM   8421  C CA    . GLN I 3 67  ? 84.002  43.213  27.361 1.00 137.82 ? 61  GLN E CA    1 
ATOM   8422  C C     . GLN I 3 67  ? 85.321  43.339  26.610 1.00 142.34 ? 61  GLN E C     1 
ATOM   8423  O O     . GLN I 3 67  ? 85.356  43.205  25.382 1.00 142.41 ? 61  GLN E O     1 
ATOM   8424  C CB    . GLN I 3 67  ? 83.683  41.744  27.641 1.00 134.34 ? 61  GLN E CB    1 
ATOM   8425  N N     . GLY I 3 68  ? 86.397  43.610  27.347 1.00 146.42 ? 62  GLY E N     1 
ATOM   8426  C CA    . GLY I 3 68  ? 87.718  43.793  26.758 1.00 151.21 ? 62  GLY E CA    1 
ATOM   8427  C C     . GLY I 3 68  ? 87.782  44.975  25.806 1.00 153.53 ? 62  GLY E C     1 
ATOM   8428  O O     . GLY I 3 68  ? 87.656  46.128  26.225 1.00 155.38 ? 62  GLY E O     1 
ATOM   8429  N N     . THR I 3 69  ? 87.965  44.676  24.521 1.00 153.58 ? 63  THR E N     1 
ATOM   8430  C CA    . THR I 3 69  ? 88.107  45.698  23.481 1.00 155.98 ? 63  THR E CA    1 
ATOM   8431  C C     . THR I 3 69  ? 87.144  45.489  22.307 1.00 152.30 ? 63  THR E C     1 
ATOM   8432  O O     . THR I 3 69  ? 86.642  46.456  21.733 1.00 152.54 ? 63  THR E O     1 
ATOM   8433  C CB    . THR I 3 69  ? 89.559  45.760  22.944 1.00 161.56 ? 63  THR E CB    1 
ATOM   8434  N N     . LYS I 3 70  ? 86.888  44.227  21.963 1.00 149.12 ? 64  LYS E N     1 
ATOM   8435  C CA    . LYS I 3 70  ? 86.099  43.891  20.779 1.00 146.45 ? 64  LYS E CA    1 
ATOM   8436  C C     . LYS I 3 70  ? 84.786  43.164  21.091 1.00 140.77 ? 64  LYS E C     1 
ATOM   8437  O O     . LYS I 3 70  ? 83.749  43.474  20.499 1.00 138.59 ? 64  LYS E O     1 
ATOM   8438  C CB    . LYS I 3 70  ? 86.942  43.074  19.792 1.00 148.58 ? 64  LYS E CB    1 
ATOM   8439  N N     . LEU I 3 71  ? 84.841  42.211  22.022 1.00 138.65 ? 65  LEU E N     1 
ATOM   8440  C CA    . LEU I 3 71  ? 83.711  41.335  22.341 1.00 133.52 ? 65  LEU E CA    1 
ATOM   8441  C C     . LEU I 3 71  ? 82.520  42.085  22.932 1.00 131.08 ? 65  LEU E C     1 
ATOM   8442  O O     . LEU I 3 71  ? 82.634  42.721  23.986 1.00 131.94 ? 65  LEU E O     1 
ATOM   8443  C CB    . LEU I 3 71  ? 84.156  40.217  23.291 1.00 132.53 ? 65  LEU E CB    1 
ATOM   8444  C CG    . LEU I 3 71  ? 83.166  39.121  23.697 1.00 127.15 ? 65  LEU E CG    1 
ATOM   8445  C CD1   . LEU I 3 71  ? 82.944  38.123  22.567 1.00 124.98 ? 65  LEU E CD1   1 
ATOM   8446  C CD2   . LEU I 3 71  ? 83.671  38.413  24.943 1.00 126.42 ? 65  LEU E CD2   1 
ATOM   8447  N N     . GLU I 3 72  ? 81.383  41.988  22.241 1.00 128.38 ? 66  GLU E N     1 
ATOM   8448  C CA    . GLU I 3 72  ? 80.144  42.649  22.641 1.00 125.93 ? 66  GLU E CA    1 
ATOM   8449  C C     . GLU I 3 72  ? 79.264  41.716  23.469 1.00 121.84 ? 66  GLU E C     1 
ATOM   8450  O O     . GLU I 3 72  ? 79.289  40.494  23.288 1.00 120.23 ? 66  GLU E O     1 
ATOM   8451  C CB    . GLU I 3 72  ? 79.385  43.151  21.409 1.00 125.84 ? 66  GLU E CB    1 
ATOM   8452  N N     . LYS I 3 73  ? 78.483  42.309  24.368 1.00 120.36 ? 67  LYS E N     1 
ATOM   8453  C CA    . LYS I 3 73  ? 77.693  41.564  25.342 1.00 116.92 ? 67  LYS E CA    1 
ATOM   8454  C C     . LYS I 3 73  ? 76.356  42.262  25.615 1.00 114.96 ? 67  LYS E C     1 
ATOM   8455  O O     . LYS I 3 73  ? 76.313  43.481  25.788 1.00 116.71 ? 67  LYS E O     1 
ATOM   8456  C CB    . LYS I 3 73  ? 78.497  41.413  26.638 1.00 118.03 ? 67  LYS E CB    1 
ATOM   8457  C CG    . LYS I 3 73  ? 77.932  40.413  27.637 1.00 115.11 ? 67  LYS E CG    1 
ATOM   8458  C CD    . LYS I 3 73  ? 78.805  40.303  28.881 1.00 117.04 ? 67  LYS E CD    1 
ATOM   8459  C CE    . LYS I 3 73  ? 78.820  41.586  29.697 1.00 119.44 ? 67  LYS E CE    1 
ATOM   8460  N NZ    . LYS I 3 73  ? 79.748  41.481  30.855 1.00 122.14 ? 67  LYS E NZ    1 
ATOM   8461  N N     . LYS I 3 74  ? 75.277  41.480  25.664 1.00 111.54 ? 68  LYS E N     1 
ATOM   8462  C CA    . LYS I 3 74  ? 73.929  42.019  25.863 1.00 109.98 ? 68  LYS E CA    1 
ATOM   8463  C C     . LYS I 3 74  ? 73.391  41.810  27.287 1.00 108.25 ? 68  LYS E C     1 
ATOM   8464  O O     . LYS I 3 74  ? 73.208  40.672  27.732 1.00 106.02 ? 68  LYS E O     1 
ATOM   8465  C CB    . LYS I 3 74  ? 72.952  41.436  24.831 1.00 108.11 ? 68  LYS E CB    1 
ATOM   8466  C CG    . LYS I 3 74  ? 73.209  41.870  23.386 1.00 110.09 ? 68  LYS E CG    1 
ATOM   8467  C CD    . LYS I 3 74  ? 72.045  41.484  22.471 1.00 108.81 ? 68  LYS E CD    1 
ATOM   8468  N N     . MET I 3 75  ? 73.133  42.924  27.978 1.00 109.43 ? 69  MET E N     1 
ATOM   8469  C CA    . MET I 3 75  ? 72.617  42.923  29.353 1.00 108.44 ? 69  MET E CA    1 
ATOM   8470  C C     . MET I 3 75  ? 71.126  43.239  29.380 1.00 106.48 ? 69  MET E C     1 
ATOM   8471  O O     . MET I 3 75  ? 70.693  44.298  28.914 1.00 107.87 ? 69  MET E O     1 
ATOM   8472  C CB    . MET I 3 75  ? 73.358  43.947  30.219 1.00 111.67 ? 69  MET E CB    1 
ATOM   8473  C CG    . MET I 3 75  ? 74.869  43.751  30.319 1.00 115.09 ? 69  MET E CG    1 
ATOM   8474  S SD    . MET I 3 75  ? 75.372  42.262  31.204 1.00 115.19 ? 69  MET E SD    1 
ATOM   8475  C CE    . MET I 3 75  ? 74.911  42.670  32.886 1.00 116.02 ? 69  MET E CE    1 
ATOM   8476  N N     . TYR I 3 76  ? 70.345  42.330  29.949 1.00 103.43 ? 70  TYR E N     1 
ATOM   8477  C CA    . TYR I 3 76  ? 68.896  42.490  29.987 1.00 101.38 ? 70  TYR E CA    1 
ATOM   8478  C C     . TYR I 3 76  ? 68.389  43.044  31.313 1.00 101.69 ? 70  TYR E C     1 
ATOM   8479  O O     . TYR I 3 76  ? 68.948  42.762  32.375 1.00 102.23 ? 70  TYR E O     1 
ATOM   8480  C CB    . TYR I 3 76  ? 68.209  41.164  29.676 1.00 98.33  ? 70  TYR E CB    1 
ATOM   8481  C CG    . TYR I 3 76  ? 68.493  40.656  28.288 1.00 97.58  ? 70  TYR E CG    1 
ATOM   8482  C CD1   . TYR I 3 76  ? 67.656  40.976  27.228 1.00 97.14  ? 70  TYR E CD1   1 
ATOM   8483  C CD2   . TYR I 3 76  ? 69.603  39.862  28.031 1.00 97.08  ? 70  TYR E CD2   1 
ATOM   8484  C CE1   . TYR I 3 76  ? 67.911  40.513  25.947 1.00 97.10  ? 70  TYR E CE1   1 
ATOM   8485  C CE2   . TYR I 3 76  ? 69.868  39.395  26.754 1.00 97.07  ? 70  TYR E CE2   1 
ATOM   8486  C CZ    . TYR I 3 76  ? 69.018  39.721  25.720 1.00 97.09  ? 70  TYR E CZ    1 
ATOM   8487  O OH    . TYR I 3 76  ? 69.275  39.260  24.454 1.00 97.89  ? 70  TYR E OH    1 
ATOM   8488  N N     . THR I 3 77  ? 67.333  43.848  31.226 1.00 101.62 ? 71  THR E N     1 
ATOM   8489  C CA    . THR I 3 77  ? 66.608  44.354  32.385 1.00 101.74 ? 71  THR E CA    1 
ATOM   8490  C C     . THR I 3 77  ? 65.131  44.094  32.128 1.00 99.78  ? 71  THR E C     1 
ATOM   8491  O O     . THR I 3 77  ? 64.687  44.119  30.978 1.00 99.47  ? 71  THR E O     1 
ATOM   8492  C CB    . THR I 3 77  ? 66.846  45.873  32.591 1.00 104.87 ? 71  THR E CB    1 
ATOM   8493  O OG1   . THR I 3 77  ? 68.251  46.132  32.700 1.00 107.10 ? 71  THR E OG1   1 
ATOM   8494  C CG2   . THR I 3 77  ? 66.154  46.381  33.853 1.00 105.57 ? 71  THR E CG2   1 
ATOM   8495  N N     . LEU I 3 78  ? 64.370  43.840  33.187 1.00 98.71  ? 72  LEU E N     1 
ATOM   8496  C CA    . LEU I 3 78  ? 62.915  43.736  33.061 1.00 97.46  ? 72  LEU E CA    1 
ATOM   8497  C C     . LEU I 3 78  ? 62.294  45.093  32.740 1.00 99.39  ? 72  LEU E C     1 
ATOM   8498  O O     . LEU I 3 78  ? 62.857  46.140  33.071 1.00 101.57 ? 72  LEU E O     1 
ATOM   8499  C CB    . LEU I 3 78  ? 62.283  43.188  34.346 1.00 96.49  ? 72  LEU E CB    1 
ATOM   8500  C CG    . LEU I 3 78  ? 62.733  41.847  34.923 1.00 94.22  ? 72  LEU E CG    1 
ATOM   8501  C CD1   . LEU I 3 78  ? 62.177  41.690  36.322 1.00 94.03  ? 72  LEU E CD1   1 
ATOM   8502  C CD2   . LEU I 3 78  ? 62.304  40.693  34.038 1.00 91.75  ? 72  LEU E CD2   1 
ATOM   8503  N N     . THR I 3 79  ? 61.140  45.062  32.084 1.00 98.88  ? 73  THR E N     1 
ATOM   8504  C CA    . THR I 3 79  ? 60.308  46.252  31.920 1.00 100.84 ? 73  THR E CA    1 
ATOM   8505  C C     . THR I 3 79  ? 59.205  46.207  32.974 1.00 100.89 ? 73  THR E C     1 
ATOM   8506  O O     . THR I 3 79  ? 59.100  45.231  33.725 1.00 99.22  ? 73  THR E O     1 
ATOM   8507  C CB    . THR I 3 79  ? 59.670  46.322  30.523 1.00 100.83 ? 73  THR E CB    1 
ATOM   8508  O OG1   . THR I 3 79  ? 58.926  45.125  30.285 1.00 98.81  ? 73  THR E OG1   1 
ATOM   8509  C CG2   . THR I 3 79  ? 60.728  46.472  29.445 1.00 101.28 ? 73  THR E CG2   1 
ATOM   8510  N N     . ASP I 3 80  ? 58.393  47.262  33.036 1.00 103.02 ? 74  ASP E N     1 
ATOM   8511  C CA    . ASP I 3 80  ? 57.215  47.273  33.898 1.00 103.51 ? 74  ASP E CA    1 
ATOM   8512  C C     . ASP I 3 80  ? 56.314  46.099  33.541 1.00 101.52 ? 74  ASP E C     1 
ATOM   8513  O O     . ASP I 3 80  ? 55.726  45.453  34.415 1.00 100.68 ? 74  ASP E O     1 
ATOM   8514  C CB    . ASP I 3 80  ? 56.456  48.585  33.742 1.00 106.39 ? 74  ASP E CB    1 
ATOM   8515  C CG    . ASP I 3 80  ? 57.132  49.727  34.454 1.00 108.62 ? 74  ASP E CG    1 
ATOM   8516  O OD1   . ASP I 3 80  ? 58.180  50.211  33.966 1.00 108.80 ? 74  ASP E OD1   1 
ATOM   8517  O OD2   . ASP I 3 80  ? 56.607  50.137  35.507 1.00 109.81 ? 74  ASP E OD2   1 
ATOM   8518  N N     . SER I 3 81  ? 56.234  45.838  32.240 1.00 101.02 ? 75  SER E N     1 
ATOM   8519  C CA    . SER I 3 81  ? 55.568  44.670  31.692 1.00 99.39  ? 75  SER E CA    1 
ATOM   8520  C C     . SER I 3 81  ? 56.190  43.379  32.238 1.00 96.89  ? 75  SER E C     1 
ATOM   8521  O O     . SER I 3 81  ? 55.476  42.434  32.569 1.00 95.70  ? 75  SER E O     1 
ATOM   8522  C CB    . SER I 3 81  ? 55.658  44.713  30.164 1.00 99.76  ? 75  SER E CB    1 
ATOM   8523  O OG    . SER I 3 81  ? 54.770  43.794  29.562 1.00 99.18  ? 75  SER E OG    1 
ATOM   8524  N N     . GLY I 3 82  ? 57.517  43.356  32.347 1.00 96.34  ? 76  GLY E N     1 
ATOM   8525  C CA    . GLY I 3 82  ? 58.238  42.182  32.835 1.00 94.44  ? 76  GLY E CA    1 
ATOM   8526  C C     . GLY I 3 82  ? 57.956  41.847  34.289 1.00 94.16  ? 76  GLY E C     1 
ATOM   8527  O O     . GLY I 3 82  ? 57.607  40.705  34.612 1.00 92.51  ? 76  GLY E O     1 
ATOM   8528  N N     . LYS I 3 83  ? 58.110  42.846  35.162 1.00 95.96  ? 77  LYS E N     1 
ATOM   8529  C CA    . LYS I 3 83  ? 57.866  42.688  36.599 1.00 96.16  ? 77  LYS E CA    1 
ATOM   8530  C C     . LYS I 3 83  ? 56.443  42.215  36.853 1.00 95.78  ? 77  LYS E C     1 
ATOM   8531  O O     . LYS I 3 83  ? 56.214  41.310  37.656 1.00 94.85  ? 77  LYS E O     1 
ATOM   8532  C CB    . LYS I 3 83  ? 58.122  43.997  37.358 1.00 98.76  ? 77  LYS E CB    1 
ATOM   8533  C CG    . LYS I 3 83  ? 59.589  44.368  37.525 1.00 99.61  ? 77  LYS E CG    1 
ATOM   8534  C CD    . LYS I 3 83  ? 59.747  45.629  38.371 1.00 102.58 ? 77  LYS E CD    1 
ATOM   8535  C CE    . LYS I 3 83  ? 61.198  46.082  38.438 1.00 103.85 ? 77  LYS E CE    1 
ATOM   8536  N N     . GLN I 3 84  ? 55.494  42.829  36.154 1.00 96.87  ? 78  GLN E N     1 
ATOM   8537  C CA    . GLN I 3 84  ? 54.087  42.471  36.272 1.00 97.08  ? 78  GLN E CA    1 
ATOM   8538  C C     . GLN I 3 84  ? 53.845  41.024  35.827 1.00 94.83  ? 78  GLN E C     1 
ATOM   8539  O O     . GLN I 3 84  ? 53.138  40.267  36.498 1.00 94.26  ? 78  GLN E O     1 
ATOM   8540  C CB    . GLN I 3 84  ? 53.226  43.457  35.470 1.00 99.09  ? 78  GLN E CB    1 
ATOM   8541  C CG    . GLN I 3 84  ? 51.717  43.291  35.645 1.00 100.44 ? 78  GLN E CG    1 
ATOM   8542  C CD    . GLN I 3 84  ? 51.265  43.367  37.096 1.00 101.61 ? 78  GLN E CD    1 
ATOM   8543  O OE1   . GLN I 3 84  ? 51.785  44.156  37.889 1.00 103.18 ? 78  GLN E OE1   1 
ATOM   8544  N NE2   . GLN I 3 84  ? 50.284  42.544  37.447 1.00 101.27 ? 78  GLN E NE2   1 
ATOM   8545  N N     . GLU I 3 85  ? 54.458  40.650  34.707 1.00 93.76  ? 79  GLU E N     1 
ATOM   8546  C CA    . GLU I 3 85  ? 54.348  39.300  34.155 1.00 92.13  ? 79  GLU E CA    1 
ATOM   8547  C C     . GLU I 3 85  ? 54.844  38.245  35.148 1.00 90.30  ? 79  GLU E C     1 
ATOM   8548  O O     . GLU I 3 85  ? 54.132  37.280  35.440 1.00 89.57  ? 79  GLU E O     1 
ATOM   8549  C CB    . GLU I 3 85  ? 55.113  39.213  32.829 1.00 91.75  ? 79  GLU E CB    1 
ATOM   8550  C CG    . GLU I 3 85  ? 54.743  38.033  31.941 1.00 91.61  ? 79  GLU E CG    1 
ATOM   8551  C CD    . GLU I 3 85  ? 53.295  38.047  31.455 1.00 94.34  ? 79  GLU E CD    1 
ATOM   8552  O OE1   . GLU I 3 85  ? 52.715  39.140  31.246 1.00 96.38  ? 79  GLU E OE1   1 
ATOM   8553  O OE2   . GLU I 3 85  ? 52.739  36.945  31.274 1.00 94.36  ? 79  GLU E OE2   1 
ATOM   8554  N N     . LEU I 3 86  ? 56.049  38.454  35.677 1.00 89.79  ? 80  LEU E N     1 
ATOM   8555  C CA    . LEU I 3 86  ? 56.625  37.578  36.696 1.00 88.56  ? 80  LEU E CA    1 
ATOM   8556  C C     . LEU I 3 86  ? 55.776  37.494  37.968 1.00 89.35  ? 80  LEU E C     1 
ATOM   8557  O O     . LEU I 3 86  ? 55.591  36.409  38.523 1.00 88.28  ? 80  LEU E O     1 
ATOM   8558  C CB    . LEU I 3 86  ? 58.046  38.025  37.036 1.00 88.76  ? 80  LEU E CB    1 
ATOM   8559  C CG    . LEU I 3 86  ? 58.736  37.367  38.232 1.00 87.84  ? 80  LEU E CG    1 
ATOM   8560  C CD1   . LEU I 3 86  ? 58.983  35.884  37.985 1.00 85.66  ? 80  LEU E CD1   1 
ATOM   8561  C CD2   . LEU I 3 86  ? 60.027  38.086  38.535 1.00 88.92  ? 80  LEU E CD2   1 
ATOM   8562  N N     . HIS I 3 87  ? 55.271  38.642  38.417 1.00 91.43  ? 81  HIS E N     1 
ATOM   8563  C CA    . HIS I 3 87  ? 54.420  38.728  39.605 1.00 92.88  ? 81  HIS E CA    1 
ATOM   8564  C C     . HIS I 3 87  ? 53.183  37.839  39.480 1.00 92.48  ? 81  HIS E C     1 
ATOM   8565  O O     . HIS I 3 87  ? 52.940  36.989  40.342 1.00 91.95  ? 81  HIS E O     1 
ATOM   8566  C CB    . HIS I 3 87  ? 54.019  40.190  39.867 1.00 95.51  ? 81  HIS E CB    1 
ATOM   8567  C CG    . HIS I 3 87  ? 53.433  40.430  41.224 1.00 97.55  ? 81  HIS E CG    1 
ATOM   8568  N ND1   . HIS I 3 87  ? 54.191  40.424  42.376 1.00 98.50  ? 81  HIS E ND1   1 
ATOM   8569  C CD2   . HIS I 3 87  ? 52.163  40.694  41.612 1.00 99.53  ? 81  HIS E CD2   1 
ATOM   8570  C CE1   . HIS I 3 87  ? 53.413  40.666  43.415 1.00 100.42 ? 81  HIS E CE1   1 
ATOM   8571  N NE2   . HIS I 3 87  ? 52.178  40.835  42.979 1.00 101.19 ? 81  HIS E NE2   1 
ATOM   8572  N N     . ASP I 3 88  ? 52.427  38.035  38.395 1.00 93.02  ? 82  ASP E N     1 
ATOM   8573  C CA    . ASP I 3 88  ? 51.197  37.278  38.113 1.00 93.33  ? 82  ASP E CA    1 
ATOM   8574  C C     . ASP I 3 88  ? 51.423  35.774  38.149 1.00 91.52  ? 82  ASP E C     1 
ATOM   8575  O O     . ASP I 3 88  ? 50.601  35.022  38.677 1.00 91.80  ? 82  ASP E O     1 
ATOM   8576  C CB    . ASP I 3 88  ? 50.637  37.642  36.734 1.00 94.06  ? 82  ASP E CB    1 
ATOM   8577  C CG    . ASP I 3 88  ? 49.994  39.012  36.695 1.00 96.05  ? 82  ASP E CG    1 
ATOM   8578  O OD1   . ASP I 3 88  ? 49.570  39.523  37.750 1.00 97.21  ? 82  ASP E OD1   1 
ATOM   8579  O OD2   . ASP I 3 88  ? 49.900  39.574  35.587 1.00 96.53  ? 82  ASP E OD2   1 
ATOM   8580  N N     . TRP I 3 89  ? 52.540  35.351  37.568 1.00 89.85  ? 83  TRP E N     1 
ATOM   8581  C CA    . TRP I 3 89  ? 52.898  33.944  37.501 1.00 88.14  ? 83  TRP E CA    1 
ATOM   8582  C C     . TRP I 3 89  ? 53.264  33.381  38.875 1.00 87.84  ? 83  TRP E C     1 
ATOM   8583  O O     . TRP I 3 89  ? 52.842  32.278  39.219 1.00 87.39  ? 83  TRP E O     1 
ATOM   8584  C CB    . TRP I 3 89  ? 54.033  33.742  36.495 1.00 86.76  ? 83  TRP E CB    1 
ATOM   8585  C CG    . TRP I 3 89  ? 54.610  32.364  36.495 1.00 84.77  ? 83  TRP E CG    1 
ATOM   8586  C CD1   . TRP I 3 89  ? 54.065  31.246  35.937 1.00 83.78  ? 83  TRP E CD1   1 
ATOM   8587  C CD2   . TRP I 3 89  ? 55.844  31.959  37.084 1.00 83.18  ? 83  TRP E CD2   1 
ATOM   8588  N NE1   . TRP I 3 89  ? 54.880  30.169  36.144 1.00 82.07  ? 83  TRP E NE1   1 
ATOM   8589  C CE2   . TRP I 3 89  ? 55.983  30.576  36.845 1.00 82.04  ? 83  TRP E CE2   1 
ATOM   8590  C CE3   . TRP I 3 89  ? 56.847  32.631  37.794 1.00 83.12  ? 83  TRP E CE3   1 
ATOM   8591  C CZ2   . TRP I 3 89  ? 57.085  29.847  37.289 1.00 81.48  ? 83  TRP E CZ2   1 
ATOM   8592  C CZ3   . TRP I 3 89  ? 57.942  31.910  38.238 1.00 83.16  ? 83  TRP E CZ3   1 
ATOM   8593  C CH2   . TRP I 3 89  ? 58.056  30.530  37.980 1.00 82.27  ? 83  TRP E CH2   1 
ATOM   8594  N N     . LEU I 3 90  ? 54.033  34.144  39.652 1.00 88.42  ? 84  LEU E N     1 
ATOM   8595  C CA    . LEU I 3 90  ? 54.470  33.714  40.981 1.00 88.63  ? 84  LEU E CA    1 
ATOM   8596  C C     . LEU I 3 90  ? 53.322  33.443  41.951 1.00 90.16  ? 84  LEU E C     1 
ATOM   8597  O O     . LEU I 3 90  ? 53.345  32.440  42.671 1.00 89.81  ? 84  LEU E O     1 
ATOM   8598  C CB    . LEU I 3 90  ? 55.428  34.735  41.596 1.00 89.49  ? 84  LEU E CB    1 
ATOM   8599  C CG    . LEU I 3 90  ? 56.885  34.700  41.134 1.00 88.40  ? 84  LEU E CG    1 
ATOM   8600  C CD1   . LEU I 3 90  ? 57.591  35.985  41.533 1.00 89.46  ? 84  LEU E CD1   1 
ATOM   8601  C CD2   . LEU I 3 90  ? 57.613  33.482  41.687 1.00 87.12  ? 84  LEU E CD2   1 
ATOM   8602  N N     . ILE I 3 91  ? 52.325  34.327  41.965 1.00 92.09  ? 85  ILE E N     1 
ATOM   8603  C CA    . ILE I 3 91  ? 51.234  34.223  42.935 1.00 94.10  ? 85  ILE E CA    1 
ATOM   8604  C C     . ILE I 3 91  ? 50.055  33.368  42.462 1.00 94.45  ? 85  ILE E C     1 
ATOM   8605  O O     . ILE I 3 91  ? 49.149  33.085  43.248 1.00 95.88  ? 85  ILE E O     1 
ATOM   8606  C CB    . ILE I 3 91  ? 50.742  35.620  43.451 1.00 96.59  ? 85  ILE E CB    1 
ATOM   8607  C CG1   . ILE I 3 91  ? 49.959  36.382  42.371 1.00 97.36  ? 85  ILE E CG1   1 
ATOM   8608  C CG2   . ILE I 3 91  ? 51.914  36.444  43.992 1.00 97.11  ? 85  ILE E CG2   1 
ATOM   8609  C CD1   . ILE I 3 91  ? 49.206  37.601  42.886 1.00 99.53  ? 85  ILE E CD1   1 
ATOM   8610  N N     . ARG I 3 92  ? 50.073  32.955  41.192 1.00 93.72  ? 86  ARG E N     1 
ATOM   8611  C CA    . ARG I 3 92  ? 49.053  32.050  40.652 1.00 94.37  ? 86  ARG E CA    1 
ATOM   8612  C C     . ARG I 3 92  ? 49.269  30.647  41.199 1.00 93.64  ? 86  ARG E C     1 
ATOM   8613  O O     . ARG I 3 92  ? 50.376  30.110  41.126 1.00 92.10  ? 86  ARG E O     1 
ATOM   8614  C CB    . ARG I 3 92  ? 49.077  32.030  39.122 1.00 93.75  ? 86  ARG E CB    1 
ATOM   8615  N N     . HIS I 3 93  ? 48.213  30.071  41.765 1.00 81.53  ? 87  HIS E N     1 
ATOM   8616  C CA    . HIS I 3 93  ? 48.273  28.728  42.343 1.00 79.97  ? 87  HIS E CA    1 
ATOM   8617  C C     . HIS I 3 93  ? 48.180  27.668  41.236 1.00 79.20  ? 87  HIS E C     1 
ATOM   8618  O O     . HIS I 3 93  ? 47.088  27.302  40.800 1.00 80.50  ? 87  HIS E O     1 
ATOM   8619  C CB    . HIS I 3 93  ? 47.151  28.513  43.384 1.00 81.31  ? 87  HIS E CB    1 
ATOM   8620  C CG    . HIS I 3 93  ? 47.178  29.474  44.539 1.00 82.94  ? 87  HIS E CG    1 
ATOM   8621  N ND1   . HIS I 3 93  ? 46.028  29.977  45.112 1.00 85.54  ? 87  HIS E ND1   1 
ATOM   8622  C CD2   . HIS I 3 93  ? 48.209  30.017  45.232 1.00 82.54  ? 87  HIS E CD2   1 
ATOM   8623  C CE1   . HIS I 3 93  ? 46.349  30.790  46.103 1.00 86.79  ? 87  HIS E CE1   1 
ATOM   8624  N NE2   . HIS I 3 93  ? 47.666  30.834  46.196 1.00 84.93  ? 87  HIS E NE2   1 
ATOM   8625  N N     . GLN I 3 94  ? 49.327  27.185  40.775 1.00 77.74  ? 88  GLN E N     1 
ATOM   8626  C CA    . GLN I 3 94  ? 49.345  26.128  39.767 1.00 77.22  ? 88  GLN E CA    1 
ATOM   8627  C C     . GLN I 3 94  ? 49.140  24.757  40.410 1.00 75.65  ? 88  GLN E C     1 
ATOM   8628  O O     . GLN I 3 94  ? 49.705  24.484  41.480 1.00 74.41  ? 88  GLN E O     1 
ATOM   8629  C CB    . GLN I 3 94  ? 50.649  26.149  38.963 1.00 76.45  ? 88  GLN E CB    1 
ATOM   8630  C CG    . GLN I 3 94  ? 50.695  27.221  37.872 1.00 79.31  ? 88  GLN E CG    1 
ATOM   8631  C CD    . GLN I 3 94  ? 51.190  28.565  38.383 1.00 80.49  ? 88  GLN E CD    1 
ATOM   8632  N N     . PRO I 3 95  ? 48.340  23.889  39.758 1.00 75.95  ? 89  PRO E N     1 
ATOM   8633  C CA    . PRO I 3 95  ? 48.113  22.527  40.242 1.00 74.86  ? 89  PRO E CA    1 
ATOM   8634  C C     . PRO I 3 95  ? 49.402  21.723  40.241 1.00 72.42  ? 89  PRO E C     1 
ATOM   8635  O O     . PRO I 3 95  ? 50.311  22.002  39.453 1.00 72.06  ? 89  PRO E O     1 
ATOM   8636  C CB    . PRO I 3 95  ? 47.133  21.944  39.219 1.00 76.34  ? 89  PRO E CB    1 
ATOM   8637  C CG    . PRO I 3 95  ? 47.369  22.734  37.987 1.00 77.60  ? 89  PRO E CG    1 
ATOM   8638  C CD    . PRO I 3 95  ? 47.665  24.124  38.470 1.00 77.91  ? 89  PRO E CD    1 
ATOM   8639  N N     . ILE I 3 96  ? 49.481  20.738  41.123 1.00 71.10  ? 90  ILE E N     1 
ATOM   8640  C CA    . ILE I 3 96  ? 50.678  19.924  41.224 1.00 69.04  ? 90  ILE E CA    1 
ATOM   8641  C C     . ILE I 3 96  ? 50.668  18.835  40.142 1.00 68.59  ? 90  ILE E C     1 
ATOM   8642  O O     . ILE I 3 96  ? 49.661  18.159  39.955 1.00 69.41  ? 90  ILE E O     1 
ATOM   8643  C CB    . ILE I 3 96  ? 50.858  19.336  42.641 1.00 68.48  ? 90  ILE E CB    1 
ATOM   8644  C CG1   . ILE I 3 96  ? 49.920  18.157  42.886 1.00 69.78  ? 90  ILE E CG1   1 
ATOM   8645  C CG2   . ILE I 3 96  ? 50.620  20.406  43.698 1.00 69.52  ? 90  ILE E CG2   1 
ATOM   8646  C CD1   . ILE I 3 96  ? 50.544  17.111  43.760 1.00 70.55  ? 90  ILE E CD1   1 
ATOM   8647  N N     . PRO I 3 97  ? 51.788  18.680  39.417 1.00 67.49  ? 91  PRO E N     1 
ATOM   8648  C CA    . PRO I 3 97  ? 51.879  17.720  38.314 1.00 67.53  ? 91  PRO E CA    1 
ATOM   8649  C C     . PRO I 3 97  ? 51.600  16.282  38.741 1.00 67.02  ? 91  PRO E C     1 
ATOM   8650  O O     . PRO I 3 97  ? 51.976  15.873  39.835 1.00 65.97  ? 91  PRO E O     1 
ATOM   8651  C CB    . PRO I 3 97  ? 53.332  17.855  37.851 1.00 66.68  ? 91  PRO E CB    1 
ATOM   8652  C CG    . PRO I 3 97  ? 54.055  18.472  39.011 1.00 65.61  ? 91  PRO E CG    1 
ATOM   8653  C CD    . PRO I 3 97  ? 53.061  19.393  39.623 1.00 66.49  ? 91  PRO E CD    1 
ATOM   8654  N N     . GLU I 3 98  ? 50.935  15.533  37.870 1.00 68.39  ? 92  GLU E N     1 
ATOM   8655  C CA    . GLU I 3 98  ? 50.620  14.127  38.123 1.00 68.68  ? 92  GLU E CA    1 
ATOM   8656  C C     . GLU I 3 98  ? 51.816  13.248  37.852 1.00 67.09  ? 92  GLU E C     1 
ATOM   8657  O O     . GLU I 3 98  ? 51.955  12.185  38.447 1.00 67.12  ? 92  GLU E O     1 
ATOM   8658  C CB    . GLU I 3 98  ? 49.420  13.660  37.290 1.00 71.30  ? 92  GLU E CB    1 
ATOM   8659  C CG    . GLU I 3 98  ? 49.287  14.285  35.898 1.00 75.04  ? 92  GLU E CG    1 
ATOM   8660  C CD    . GLU I 3 98  ? 47.912  14.036  35.289 1.00 81.88  ? 92  GLU E CD    1 
ATOM   8661  O OE1   . GLU I 3 98  ? 47.524  14.768  34.341 1.00 84.70  ? 92  GLU E OE1   1 
ATOM   8662  O OE2   . GLU I 3 98  ? 47.212  13.105  35.763 1.00 83.99  ? 92  GLU E OE2   1 
ATOM   8663  N N     . THR I 3 99  ? 52.683  13.701  36.951 1.00 66.35  ? 93  THR E N     1 
ATOM   8664  C CA    . THR I 3 99  ? 53.925  12.995  36.655 1.00 64.90  ? 93  THR E CA    1 
ATOM   8665  C C     . THR I 3 99  ? 55.128  13.862  36.978 1.00 63.35  ? 93  THR E C     1 
ATOM   8666  O O     . THR I 3 99  ? 55.150  15.053  36.666 1.00 63.25  ? 93  THR E O     1 
ATOM   8667  C CB    . THR I 3 99  ? 53.987  12.559  35.175 1.00 66.49  ? 93  THR E CB    1 
ATOM   8668  O OG1   . THR I 3 99  ? 52.787  11.857  34.837 1.00 67.09  ? 93  THR E OG1   1 
ATOM   8669  C CG2   . THR I 3 99  ? 55.195  11.649  34.916 1.00 66.05  ? 93  THR E CG2   1 
ATOM   8670  N N     . VAL I 3 100 ? 56.108  13.257  37.640 1.00 62.14  ? 94  VAL E N     1 
ATOM   8671  C CA    . VAL I 3 100 ? 57.460  13.800  37.702 1.00 61.50  ? 94  VAL E CA    1 
ATOM   8672  C C     . VAL I 3 100 ? 58.369  12.679  37.208 1.00 62.17  ? 94  VAL E C     1 
ATOM   8673  O O     . VAL I 3 100 ? 58.641  11.719  37.926 1.00 61.80  ? 94  VAL E O     1 
ATOM   8674  C CB    . VAL I 3 100 ? 57.853  14.292  39.126 1.00 60.28  ? 94  VAL E CB    1 
ATOM   8675  C CG1   . VAL I 3 100 ? 59.210  14.968  39.103 1.00 59.80  ? 94  VAL E CG1   1 
ATOM   8676  C CG2   . VAL I 3 100 ? 56.823  15.267  39.664 1.00 59.68  ? 94  VAL E CG2   1 
ATOM   8677  N N     . LYS I 3 101 ? 58.801  12.795  35.958 1.00 63.75  ? 95  LYS E N     1 
ATOM   8678  C CA    . LYS I 3 101 ? 59.543  11.734  35.283 1.00 65.19  ? 95  LYS E CA    1 
ATOM   8679  C C     . LYS I 3 101 ? 60.847  11.340  35.965 1.00 65.18  ? 95  LYS E C     1 
ATOM   8680  O O     . LYS I 3 101 ? 61.615  12.203  36.416 1.00 64.97  ? 95  LYS E O     1 
ATOM   8681  C CB    . LYS I 3 101 ? 59.797  12.113  33.826 1.00 67.31  ? 95  LYS E CB    1 
ATOM   8682  C CG    . LYS I 3 101 ? 58.600  11.871  32.924 1.00 68.28  ? 95  LYS E CG    1 
ATOM   8683  C CD    . LYS I 3 101 ? 58.825  12.459  31.558 1.00 70.70  ? 95  LYS E CD    1 
ATOM   8684  C CE    . LYS I 3 101 ? 57.665  12.135  30.636 1.00 72.63  ? 95  LYS E CE    1 
ATOM   8685  N NZ    . LYS I 3 101 ? 57.659  13.000  29.428 1.00 74.94  ? 95  LYS E NZ    1 
ATOM   8686  N N     . ASP I 3 102 ? 61.072  10.025  36.035 1.00 65.91  ? 96  ASP E N     1 
ATOM   8687  C CA    . ASP I 3 102 ? 62.251  9.418   36.661 1.00 65.80  ? 96  ASP E CA    1 
ATOM   8688  C C     . ASP I 3 102 ? 62.467  8.051   36.020 1.00 67.55  ? 96  ASP E C     1 
ATOM   8689  O O     . ASP I 3 102 ? 61.692  7.113   36.248 1.00 67.48  ? 96  ASP E O     1 
ATOM   8690  C CB    . ASP I 3 102 ? 62.040  9.273   38.171 1.00 64.33  ? 96  ASP E CB    1 
ATOM   8691  C CG    . ASP I 3 102 ? 63.241  8.671   38.887 1.00 65.20  ? 96  ASP E CG    1 
ATOM   8692  O OD1   . ASP I 3 102 ? 63.862  7.727   38.342 1.00 66.40  ? 96  ASP E OD1   1 
ATOM   8693  O OD2   . ASP I 3 102 ? 63.547  9.137   40.016 1.00 64.94  ? 96  ASP E OD2   1 
ATOM   8694  N N     . GLU I 3 103 ? 63.527  7.944   35.223 1.00 69.26  ? 97  GLU E N     1 
ATOM   8695  C CA    . GLU I 3 103 ? 63.767  6.751   34.424 1.00 71.63  ? 97  GLU E CA    1 
ATOM   8696  C C     . GLU I 3 103 ? 64.071  5.530   35.298 1.00 71.45  ? 97  GLU E C     1 
ATOM   8697  O O     . GLU I 3 103 ? 63.620  4.418   34.999 1.00 72.57  ? 97  GLU E O     1 
ATOM   8698  C CB    . GLU I 3 103 ? 64.880  7.005   33.396 1.00 74.12  ? 97  GLU E CB    1 
ATOM   8699  C CG    . GLU I 3 103 ? 65.063  5.889   32.363 1.00 78.25  ? 97  GLU E CG    1 
ATOM   8700  C CD    . GLU I 3 103 ? 65.842  6.324   31.124 1.00 83.09  ? 97  GLU E CD    1 
ATOM   8701  O OE1   . GLU I 3 103 ? 65.991  7.541   30.901 1.00 84.33  ? 97  GLU E OE1   1 
ATOM   8702  O OE2   . GLU I 3 103 ? 66.298  5.446   30.360 1.00 86.05  ? 97  GLU E OE2   1 
ATOM   8703  N N     . PHE I 3 104 ? 64.830  5.729   36.373 1.00 70.30  ? 98  PHE E N     1 
ATOM   8704  C CA    . PHE I 3 104 ? 65.172  4.611   37.243 1.00 70.48  ? 98  PHE E CA    1 
ATOM   8705  C C     . PHE I 3 104 ? 63.905  3.942   37.763 1.00 69.91  ? 98  PHE E C     1 
ATOM   8706  O O     . PHE I 3 104 ? 63.771  2.718   37.681 1.00 71.43  ? 98  PHE E O     1 
ATOM   8707  C CB    . PHE I 3 104 ? 66.069  5.044   38.403 1.00 69.70  ? 98  PHE E CB    1 
ATOM   8708  C CG    . PHE I 3 104 ? 66.401  3.926   39.361 1.00 69.95  ? 98  PHE E CG    1 
ATOM   8709  C CD1   . PHE I 3 104 ? 67.328  2.944   39.013 1.00 71.68  ? 98  PHE E CD1   1 
ATOM   8710  C CD2   . PHE I 3 104 ? 65.782  3.855   40.607 1.00 67.73  ? 98  PHE E CD2   1 
ATOM   8711  C CE1   . PHE I 3 104 ? 67.631  1.908   39.890 1.00 72.67  ? 98  PHE E CE1   1 
ATOM   8712  C CE2   . PHE I 3 104 ? 66.075  2.829   41.490 1.00 68.92  ? 98  PHE E CE2   1 
ATOM   8713  C CZ    . PHE I 3 104 ? 67.001  1.849   41.134 1.00 71.48  ? 98  PHE E CZ    1 
ATOM   8714  N N     . MET I 3 105 ? 62.969  4.755   38.258 1.00 67.98  ? 99  MET E N     1 
ATOM   8715  C CA    . MET I 3 105 ? 61.730  4.257   38.859 1.00 67.23  ? 99  MET E CA    1 
ATOM   8716  C C     . MET I 3 105 ? 60.828  3.523   37.881 1.00 68.50  ? 99  MET E C     1 
ATOM   8717  O O     . MET I 3 105 ? 60.029  2.677   38.285 1.00 69.09  ? 99  MET E O     1 
ATOM   8718  C CB    . MET I 3 105 ? 60.969  5.391   39.531 1.00 65.21  ? 99  MET E CB    1 
ATOM   8719  C CG    . MET I 3 105 ? 61.615  5.884   40.812 1.00 64.99  ? 99  MET E CG    1 
ATOM   8720  S SD    . MET I 3 105 ? 61.817  4.598   42.069 1.00 67.58  ? 99  MET E SD    1 
ATOM   8721  C CE    . MET I 3 105 ? 60.135  3.962   42.174 1.00 65.71  ? 99  MET E CE    1 
ATOM   8722  N N     . LEU I 3 106 ? 60.950  3.849   36.598 1.00 69.32  ? 100 LEU E N     1 
ATOM   8723  C CA    . LEU I 3 106 ? 60.274  3.079   35.551 1.00 71.30  ? 100 LEU E CA    1 
ATOM   8724  C C     . LEU I 3 106 ? 60.830  1.641   35.536 1.00 73.48  ? 100 LEU E C     1 
ATOM   8725  O O     . LEU I 3 106 ? 60.064  0.678   35.471 1.00 74.85  ? 100 LEU E O     1 
ATOM   8726  C CB    . LEU I 3 106 ? 60.415  3.773   34.186 1.00 72.06  ? 100 LEU E CB    1 
ATOM   8727  C CG    . LEU I 3 106 ? 59.855  3.135   32.912 1.00 74.53  ? 100 LEU E CG    1 
ATOM   8728  C CD1   . LEU I 3 106 ? 58.344  3.301   32.826 1.00 74.48  ? 100 LEU E CD1   1 
ATOM   8729  C CD2   . LEU I 3 106 ? 60.510  3.742   31.684 1.00 75.54  ? 100 LEU E CD2   1 
ATOM   8730  N N     . LYS I 3 107 ? 62.156  1.503   35.629 1.00 74.03  ? 101 LYS E N     1 
ATOM   8731  C CA    . LYS I 3 107 ? 62.791  0.188   35.778 1.00 76.15  ? 101 LYS E CA    1 
ATOM   8732  C C     . LYS I 3 107 ? 62.310  -0.507  37.054 1.00 75.55  ? 101 LYS E C     1 
ATOM   8733  O O     . LYS I 3 107 ? 61.995  -1.694  37.041 1.00 77.68  ? 101 LYS E O     1 
ATOM   8734  C CB    . LYS I 3 107 ? 64.317  0.311   35.818 1.00 76.75  ? 101 LYS E CB    1 
ATOM   8735  C CG    . LYS I 3 107 ? 64.951  0.914   34.573 1.00 78.26  ? 101 LYS E CG    1 
ATOM   8736  C CD    . LYS I 3 107 ? 66.454  1.054   34.769 1.00 79.02  ? 101 LYS E CD    1 
ATOM   8737  C CE    . LYS I 3 107 ? 67.144  1.527   33.509 1.00 81.65  ? 101 LYS E CE    1 
ATOM   8738  N NZ    . LYS I 3 107 ? 68.553  1.021   33.474 1.00 84.91  ? 101 LYS E NZ    1 
ATOM   8739  N N     . ALA I 3 108 ? 62.246  0.241   38.151 1.00 73.15  ? 102 ALA E N     1 
ATOM   8740  C CA    . ALA I 3 108 ? 61.733  -0.289  39.413 1.00 72.73  ? 102 ALA E CA    1 
ATOM   8741  C C     . ALA I 3 108 ? 60.418  -1.027  39.200 1.00 73.62  ? 102 ALA E C     1 
ATOM   8742  O O     . ALA I 3 108 ? 60.225  -2.128  39.704 1.00 75.37  ? 102 ALA E O     1 
ATOM   8743  C CB    . ALA I 3 108 ? 61.552  0.827   40.428 1.00 70.24  ? 102 ALA E CB    1 
ATOM   8744  N N     . TYR I 3 109 ? 59.526  -0.416  38.427 1.00 72.85  ? 103 TYR E N     1 
ATOM   8745  C CA    . TYR I 3 109 ? 58.208  -0.976  38.168 1.00 73.68  ? 103 TYR E CA    1 
ATOM   8746  C C     . TYR I 3 109 ? 58.300  -2.325  37.459 1.00 76.58  ? 103 TYR E C     1 
ATOM   8747  O O     . TYR I 3 109 ? 57.480  -3.213  37.697 1.00 78.28  ? 103 TYR E O     1 
ATOM   8748  C CB    . TYR I 3 109 ? 57.380  0.013   37.342 1.00 72.64  ? 103 TYR E CB    1 
ATOM   8749  C CG    . TYR I 3 109 ? 55.906  -0.297  37.274 1.00 72.86  ? 103 TYR E CG    1 
ATOM   8750  C CD1   . TYR I 3 109 ? 55.112  -0.278  38.421 1.00 72.06  ? 103 TYR E CD1   1 
ATOM   8751  C CD2   . TYR I 3 109 ? 55.298  -0.582  36.063 1.00 74.30  ? 103 TYR E CD2   1 
ATOM   8752  C CE1   . TYR I 3 109 ? 53.749  -0.555  38.359 1.00 73.23  ? 103 TYR E CE1   1 
ATOM   8753  C CE2   . TYR I 3 109 ? 53.932  -0.853  35.987 1.00 75.65  ? 103 TYR E CE2   1 
ATOM   8754  C CZ    . TYR I 3 109 ? 53.166  -0.840  37.137 1.00 74.91  ? 103 TYR E CZ    1 
ATOM   8755  O OH    . TYR I 3 109 ? 51.822  -1.111  37.059 1.00 76.54  ? 103 TYR E OH    1 
ATOM   8756  N N     . PHE I 3 110 ? 59.309  -2.477  36.605 1.00 77.43  ? 104 PHE E N     1 
ATOM   8757  C CA    . PHE I 3 110 ? 59.477  -3.699  35.824 1.00 80.44  ? 104 PHE E CA    1 
ATOM   8758  C C     . PHE I 3 110 ? 60.435  -4.710  36.466 1.00 81.96  ? 104 PHE E C     1 
ATOM   8759  O O     . PHE I 3 110 ? 60.959  -5.591  35.773 1.00 84.67  ? 104 PHE E O     1 
ATOM   8760  C CB    . PHE I 3 110 ? 59.955  -3.362  34.409 1.00 81.39  ? 104 PHE E CB    1 
ATOM   8761  C CG    . PHE I 3 110 ? 59.102  -2.349  33.695 1.00 80.07  ? 104 PHE E CG    1 
ATOM   8762  C CD1   . PHE I 3 110 ? 57.712  -2.436  33.721 1.00 79.99  ? 104 PHE E CD1   1 
ATOM   8763  C CD2   . PHE I 3 110 ? 59.695  -1.321  32.969 1.00 78.99  ? 104 PHE E CD2   1 
ATOM   8764  C CE1   . PHE I 3 110 ? 56.926  -1.502  33.057 1.00 79.08  ? 104 PHE E CE1   1 
ATOM   8765  C CE2   . PHE I 3 110 ? 58.920  -0.381  32.300 1.00 78.22  ? 104 PHE E CE2   1 
ATOM   8766  C CZ    . PHE I 3 110 ? 57.530  -0.472  32.342 1.00 78.46  ? 104 PHE E CZ    1 
ATOM   8767  N N     . ILE I 3 111 ? 60.646  -4.598  37.779 1.00 80.51  ? 105 ILE E N     1 
ATOM   8768  C CA    . ILE I 3 111 ? 61.589  -5.462  38.500 1.00 82.06  ? 105 ILE E CA    1 
ATOM   8769  C C     . ILE I 3 111 ? 61.296  -6.961  38.314 1.00 85.63  ? 105 ILE E C     1 
ATOM   8770  O O     . ILE I 3 111 ? 62.197  -7.806  38.421 1.00 87.84  ? 105 ILE E O     1 
ATOM   8771  C CB    . ILE I 3 111 ? 61.693  -5.083  40.008 1.00 80.38  ? 105 ILE E CB    1 
ATOM   8772  C CG1   . ILE I 3 111 ? 62.869  -5.819  40.672 1.00 81.88  ? 105 ILE E CG1   1 
ATOM   8773  C CG2   . ILE I 3 111 ? 60.354  -5.301  40.732 1.00 80.04  ? 105 ILE E CG2   1 
ATOM   8774  C CD1   . ILE I 3 111 ? 63.384  -5.179  41.944 1.00 80.23  ? 105 ILE E CD1   1 
ATOM   8775  N N     . SER I 3 112 ? 60.038  -7.266  38.014 1.00 86.40  ? 106 SER E N     1 
ATOM   8776  C CA    . SER I 3 112 ? 59.580  -8.619  37.727 1.00 90.07  ? 106 SER E CA    1 
ATOM   8777  C C     . SER I 3 112 ? 60.475  -9.374  36.739 1.00 92.86  ? 106 SER E C     1 
ATOM   8778  O O     . SER I 3 112 ? 60.702  -10.573 36.898 1.00 95.71  ? 106 SER E O     1 
ATOM   8779  C CB    . SER I 3 112 ? 58.161  -8.554  37.172 1.00 90.75  ? 106 SER E CB    1 
ATOM   8780  O OG    . SER I 3 112 ? 57.538  -9.818  37.204 1.00 94.56  ? 106 SER E OG    1 
ATOM   8781  N N     . SER I 3 113 ? 60.981  -8.669  35.728 1.00 92.27  ? 107 SER E N     1 
ATOM   8782  C CA    . SER I 3 113 ? 61.813  -9.276  34.685 1.00 95.33  ? 107 SER E CA    1 
ATOM   8783  C C     . SER I 3 113 ? 63.309  -9.314  35.031 1.00 95.86  ? 107 SER E C     1 
ATOM   8784  O O     . SER I 3 113 ? 64.154  -9.560  34.157 1.00 98.08  ? 107 SER E O     1 
ATOM   8785  C CB    . SER I 3 113 ? 61.596  -8.544  33.362 1.00 95.16  ? 107 SER E CB    1 
ATOM   8786  O OG    . SER I 3 113 ? 60.294  -8.790  32.866 1.00 96.17  ? 107 SER E OG    1 
ATOM   8787  N N     . LEU I 3 114 ? 63.622  -9.095  36.307 1.00 94.11  ? 108 LEU E N     1 
ATOM   8788  C CA    . LEU I 3 114 ? 64.991  -8.899  36.748 1.00 94.11  ? 108 LEU E CA    1 
ATOM   8789  C C     . LEU I 3 114 ? 65.374  -9.930  37.802 1.00 96.26  ? 108 LEU E C     1 
ATOM   8790  O O     . LEU I 3 114 ? 64.603  -10.181 38.734 1.00 95.77  ? 108 LEU E O     1 
ATOM   8791  C CB    . LEU I 3 114 ? 65.134  -7.489  37.320 1.00 90.30  ? 108 LEU E CB    1 
ATOM   8792  C CG    . LEU I 3 114 ? 66.351  -6.644  36.953 1.00 89.49  ? 108 LEU E CG    1 
ATOM   8793  C CD1   . LEU I 3 114 ? 66.452  -6.463  35.439 1.00 90.58  ? 108 LEU E CD1   1 
ATOM   8794  C CD2   . LEU I 3 114 ? 66.274  -5.292  37.657 1.00 85.30  ? 108 LEU E CD2   1 
ATOM   8795  N N     . SER I 3 115 ? 66.561  -10.522 37.643 1.00 99.03  ? 109 SER E N     1 
ATOM   8796  C CA    . SER I 3 115 ? 67.102  -11.502 38.598 1.00 101.75 ? 109 SER E CA    1 
ATOM   8797  C C     . SER I 3 115 ? 67.398  -10.867 39.961 1.00 99.73  ? 109 SER E C     1 
ATOM   8798  O O     . SER I 3 115 ? 67.640  -9.656  40.054 1.00 96.95  ? 109 SER E O     1 
ATOM   8799  C CB    . SER I 3 115 ? 68.375  -12.154 38.043 1.00 105.06 ? 109 SER E CB    1 
ATOM   8800  N N     . ARG I 3 116 ? 67.366  -11.683 41.012 1.00 101.53 ? 110 ARG E N     1 
ATOM   8801  C CA    . ARG I 3 116 ? 67.679  -11.219 42.363 1.00 100.52 ? 110 ARG E CA    1 
ATOM   8802  C C     . ARG I 3 116 ? 69.069  -10.570 42.400 1.00 100.20 ? 110 ARG E C     1 
ATOM   8803  O O     . ARG I 3 116 ? 69.255  -9.507  42.996 1.00 97.60  ? 110 ARG E O     1 
ATOM   8804  C CB    . ARG I 3 116 ? 67.579  -12.378 43.362 1.00 103.78 ? 110 ARG E CB    1 
ATOM   8805  C CG    . ARG I 3 116 ? 67.582  -11.956 44.819 1.00 103.02 ? 110 ARG E CG    1 
ATOM   8806  C CD    . ARG I 3 116 ? 66.801  -12.933 45.666 1.00 106.01 ? 110 ARG E CD    1 
ATOM   8807  N NE    . ARG I 3 116 ? 66.342  -12.299 46.896 1.00 105.15 ? 110 ARG E NE    1 
ATOM   8808  C CZ    . ARG I 3 116 ? 65.248  -12.649 47.567 1.00 106.53 ? 110 ARG E CZ    1 
ATOM   8809  N NH1   . ARG I 3 116 ? 64.470  -13.634 47.133 1.00 108.91 ? 110 ARG E NH1   1 
ATOM   8810  N NH2   . ARG I 3 116 ? 64.924  -12.000 48.676 1.00 105.58 ? 110 ARG E NH2   1 
ATOM   8811  N N     . GLN I 3 117 ? 70.026  -11.217 41.742 1.00 103.33 ? 111 GLN E N     1 
ATOM   8812  C CA    . GLN I 3 117 ? 71.359  -10.665 41.529 1.00 103.81 ? 111 GLN E CA    1 
ATOM   8813  C C     . GLN I 3 117 ? 71.291  -9.390  40.682 1.00 100.88 ? 111 GLN E C     1 
ATOM   8814  O O     . GLN I 3 117 ? 71.844  -8.357  41.064 1.00 99.07  ? 111 GLN E O     1 
ATOM   8815  C CB    . GLN I 3 117 ? 72.268  -11.720 40.874 1.00 108.16 ? 111 GLN E CB    1 
ATOM   8816  C CG    . GLN I 3 117 ? 73.518  -11.180 40.172 1.00 109.45 ? 111 GLN E CG    1 
ATOM   8817  C CD    . GLN I 3 117 ? 74.662  -10.863 41.125 1.00 110.40 ? 111 GLN E CD    1 
ATOM   8818  O OE1   . GLN I 3 117 ? 74.502  -10.107 42.086 1.00 107.97 ? 111 GLN E OE1   1 
ATOM   8819  N NE2   . GLN I 3 117 ? 75.831  -11.429 40.846 1.00 113.91 ? 111 GLN E NE2   1 
ATOM   8820  N N     . GLU I 3 118 ? 70.595  -9.463  39.548 1.00 100.77 ? 112 GLU E N     1 
ATOM   8821  C CA    . GLU I 3 118 ? 70.548  -8.348  38.598 1.00 98.81  ? 112 GLU E CA    1 
ATOM   8822  C C     . GLU I 3 118 ? 69.884  -7.086  39.172 1.00 94.58  ? 112 GLU E C     1 
ATOM   8823  O O     . GLU I 3 118 ? 70.195  -5.971  38.752 1.00 93.01  ? 112 GLU E O     1 
ATOM   8824  C CB    . GLU I 3 118 ? 69.889  -8.777  37.282 1.00 100.17 ? 112 GLU E CB    1 
ATOM   8825  N N     . ALA I 3 119 ? 68.982  -7.267  40.134 1.00 93.22  ? 113 ALA E N     1 
ATOM   8826  C CA    . ALA I 3 119 ? 68.363  -6.140  40.831 1.00 89.57  ? 113 ALA E CA    1 
ATOM   8827  C C     . ALA I 3 119 ? 69.246  -5.618  41.971 1.00 89.02  ? 113 ALA E C     1 
ATOM   8828  O O     . ALA I 3 119 ? 69.251  -4.417  42.251 1.00 86.50  ? 113 ALA E O     1 
ATOM   8829  C CB    . ALA I 3 119 ? 66.982  -6.516  41.345 1.00 88.84  ? 113 ALA E CB    1 
ATOM   8830  N N     . SER I 3 120 ? 69.981  -6.513  42.632 1.00 91.49  ? 114 SER E N     1 
ATOM   8831  C CA    . SER I 3 120 ? 70.968  -6.085  43.629 1.00 91.83  ? 114 SER E CA    1 
ATOM   8832  C C     . SER I 3 120 ? 71.964  -5.137  42.962 1.00 91.32  ? 114 SER E C     1 
ATOM   8833  O O     . SER I 3 120 ? 72.235  -4.050  43.477 1.00 89.50  ? 114 SER E O     1 
ATOM   8834  C CB    . SER I 3 120 ? 71.702  -7.277  44.267 1.00 95.21  ? 114 SER E CB    1 
ATOM   8835  N N     . ASP I 3 121 ? 72.464  -5.548  41.795 1.00 93.21  ? 115 ASP E N     1 
ATOM   8836  C CA    . ASP I 3 121 ? 73.445  -4.775  41.038 1.00 93.46  ? 115 ASP E CA    1 
ATOM   8837  C C     . ASP I 3 121 ? 72.871  -3.446  40.560 1.00 90.03  ? 115 ASP E C     1 
ATOM   8838  O O     . ASP I 3 121 ? 73.507  -2.402  40.727 1.00 89.13  ? 115 ASP E O     1 
ATOM   8839  C CB    . ASP I 3 121 ? 73.980  -5.591  39.850 1.00 97.05  ? 115 ASP E CB    1 
ATOM   8840  N N     . LEU I 3 122 ? 71.669  -3.492  39.983 1.00 88.29  ? 116 LEU E N     1 
ATOM   8841  C CA    . LEU I 3 122 ? 70.981  -2.294  39.496 1.00 85.30  ? 116 LEU E CA    1 
ATOM   8842  C C     . LEU I 3 122 ? 70.788  -1.242  40.592 1.00 82.43  ? 116 LEU E C     1 
ATOM   8843  O O     . LEU I 3 122 ? 71.208  -0.093  40.442 1.00 81.22  ? 116 LEU E O     1 
ATOM   8844  C CB    . LEU I 3 122 ? 69.628  -2.664  38.886 1.00 84.71  ? 116 LEU E CB    1 
ATOM   8845  N N     . PHE I 3 123 ? 70.157  -1.651  41.690 1.00 81.63  ? 117 PHE E N     1 
ATOM   8846  C CA    . PHE I 3 123 ? 69.932  -0.782  42.838 1.00 79.37  ? 117 PHE E CA    1 
ATOM   8847  C C     . PHE I 3 123 ? 71.227  -0.333  43.517 1.00 80.19  ? 117 PHE E C     1 
ATOM   8848  O O     . PHE I 3 123 ? 71.336  0.828   43.914 1.00 78.54  ? 117 PHE E O     1 
ATOM   8849  C CB    . PHE I 3 123 ? 68.986  -1.447  43.843 1.00 79.28  ? 117 PHE E CB    1 
ATOM   8850  C CG    . PHE I 3 123 ? 67.530  -1.323  43.485 1.00 77.41  ? 117 PHE E CG    1 
ATOM   8851  C CD1   . PHE I 3 123 ? 66.966  -2.123  42.497 1.00 78.83  ? 117 PHE E CD1   1 
ATOM   8852  C CD2   . PHE I 3 123 ? 66.718  -0.406  44.141 1.00 75.26  ? 117 PHE E CD2   1 
ATOM   8853  C CE1   . PHE I 3 123 ? 65.608  -2.000  42.162 1.00 77.78  ? 117 PHE E CE1   1 
ATOM   8854  C CE2   . PHE I 3 123 ? 65.360  -0.277  43.814 1.00 73.96  ? 117 PHE E CE2   1 
ATOM   8855  C CZ    . PHE I 3 123 ? 64.807  -1.077  42.830 1.00 74.95  ? 117 PHE E CZ    1 
ATOM   8856  N N     . THR I 3 124 ? 72.203  -1.237  43.638 1.00 82.94  ? 118 THR E N     1 
ATOM   8857  C CA    . THR I 3 124 ? 73.495  -0.887  44.240 1.00 84.40  ? 118 THR E CA    1 
ATOM   8858  C C     . THR I 3 124 ? 74.172  0.259   43.488 1.00 83.81  ? 118 THR E C     1 
ATOM   8859  O O     . THR I 3 124 ? 74.572  1.247   44.105 1.00 82.93  ? 118 THR E O     1 
ATOM   8860  C CB    . THR I 3 124 ? 74.453  -2.109  44.348 1.00 88.34  ? 118 THR E CB    1 
ATOM   8861  O OG1   . THR I 3 124 ? 73.880  -3.093  45.219 1.00 89.56  ? 118 THR E OG1   1 
ATOM   8862  C CG2   . THR I 3 124 ? 75.824  -1.701  44.897 1.00 89.72  ? 118 THR E CG2   1 
ATOM   8863  N N     . ASP I 3 125 ? 74.278  0.124   42.165 1.00 84.60  ? 119 ASP E N     1 
ATOM   8864  C CA    . ASP I 3 125 ? 74.873  1.157   41.304 1.00 84.82  ? 119 ASP E CA    1 
ATOM   8865  C C     . ASP I 3 125 ? 74.180  2.499   41.507 1.00 81.73  ? 119 ASP E C     1 
ATOM   8866  O O     . ASP I 3 125 ? 74.829  3.537   41.669 1.00 81.59  ? 119 ASP E O     1 
ATOM   8867  C CB    . ASP I 3 125 ? 74.817  0.748   39.822 1.00 86.25  ? 119 ASP E CB    1 
ATOM   8868  N N     . GLN I 3 126 ? 72.853  2.460   41.515 1.00 79.45  ? 120 GLN E N     1 
ATOM   8869  C CA    . GLN I 3 126 ? 72.057  3.642   41.769 1.00 76.93  ? 120 GLN E CA    1 
ATOM   8870  C C     . GLN I 3 126 ? 72.380  4.245   43.138 1.00 76.36  ? 120 GLN E C     1 
ATOM   8871  O O     . GLN I 3 126 ? 72.474  5.465   43.267 1.00 75.47  ? 120 GLN E O     1 
ATOM   8872  C CB    . GLN I 3 126 ? 70.567  3.314   41.641 1.00 75.22  ? 120 GLN E CB    1 
ATOM   8873  C CG    . GLN I 3 126 ? 69.648  4.527   41.651 1.00 73.26  ? 120 GLN E CG    1 
ATOM   8874  C CD    . GLN I 3 126 ? 69.657  5.324   40.354 1.00 74.43  ? 120 GLN E CD    1 
ATOM   8875  O OE1   . GLN I 3 126 ? 69.051  6.395   40.285 1.00 73.98  ? 120 GLN E OE1   1 
ATOM   8876  N NE2   . GLN I 3 126 ? 70.327  4.807   39.320 1.00 75.46  ? 120 GLN E NE2   1 
ATOM   8877  N N     . LEU I 3 127 ? 72.572  3.392   44.146 1.00 77.27  ? 121 LEU E N     1 
ATOM   8878  C CA    . LEU I 3 127 ? 72.916  3.858   45.488 1.00 77.03  ? 121 LEU E CA    1 
ATOM   8879  C C     . LEU I 3 127 ? 74.245  4.609   45.507 1.00 78.49  ? 121 LEU E C     1 
ATOM   8880  O O     . LEU I 3 127 ? 74.355  5.671   46.121 1.00 77.59  ? 121 LEU E O     1 
ATOM   8881  C CB    . LEU I 3 127 ? 72.939  2.693   46.485 1.00 78.55  ? 121 LEU E CB    1 
ATOM   8882  C CG    . LEU I 3 127 ? 73.320  2.988   47.941 1.00 78.89  ? 121 LEU E CG    1 
ATOM   8883  C CD1   . LEU I 3 127 ? 72.420  4.060   48.543 1.00 77.00  ? 121 LEU E CD1   1 
ATOM   8884  C CD2   . LEU I 3 127 ? 73.265  1.720   48.772 1.00 80.62  ? 121 LEU E CD2   1 
ATOM   8885  N N     . LEU I 3 128 ? 75.245  4.060   44.825 1.00 81.12  ? 122 LEU E N     1 
ATOM   8886  C CA    . LEU I 3 128 ? 76.582  4.655   44.821 1.00 83.25  ? 122 LEU E CA    1 
ATOM   8887  C C     . LEU I 3 128 ? 76.619  6.031   44.146 1.00 82.06  ? 122 LEU E C     1 
ATOM   8888  O O     . LEU I 3 128 ? 77.151  6.985   44.717 1.00 82.22  ? 122 LEU E O     1 
ATOM   8889  C CB    . LEU I 3 128 ? 77.612  3.702   44.199 1.00 86.72  ? 122 LEU E CB    1 
ATOM   8890  C CG    . LEU I 3 128 ? 77.987  2.436   44.984 1.00 89.63  ? 122 LEU E CG    1 
ATOM   8891  C CD1   . LEU I 3 128 ? 79.058  1.640   44.235 1.00 93.28  ? 122 LEU E CD1   1 
ATOM   8892  C CD2   . LEU I 3 128 ? 78.450  2.745   46.416 1.00 90.36  ? 122 LEU E CD2   1 
ATOM   8893  N N     . LYS I 3 129 ? 76.040  6.136   42.951 1.00 81.04  ? 123 LYS E N     1 
ATOM   8894  C CA    . LYS I 3 129 ? 75.996  7.415   42.238 1.00 80.26  ? 123 LYS E CA    1 
ATOM   8895  C C     . LYS I 3 129 ? 75.230  8.460   43.056 1.00 77.53  ? 123 LYS E C     1 
ATOM   8896  O O     . LYS I 3 129 ? 75.612  9.632   43.081 1.00 77.55  ? 123 LYS E O     1 
ATOM   8897  C CB    . LYS I 3 129 ? 75.398  7.259   40.831 1.00 79.96  ? 123 LYS E CB    1 
ATOM   8898  C CG    . LYS I 3 129 ? 76.132  6.257   39.947 1.00 83.36  ? 123 LYS E CG    1 
ATOM   8899  C CD    . LYS I 3 129 ? 75.384  5.993   38.636 1.00 83.38  ? 123 LYS E CD    1 
ATOM   8900  C CE    . LYS I 3 129 ? 75.895  4.726   37.954 1.00 85.94  ? 123 LYS E CE    1 
ATOM   8901  N N     . ARG I 3 130 ? 74.173  8.016   43.737 1.00 75.52  ? 124 ARG E N     1 
ATOM   8902  C CA    . ARG I 3 130 ? 73.365  8.882   44.605 1.00 73.61  ? 124 ARG E CA    1 
ATOM   8903  C C     . ARG I 3 130 ? 74.098  9.313   45.884 1.00 74.70  ? 124 ARG E C     1 
ATOM   8904  O O     . ARG I 3 130 ? 74.008  10.481  46.278 1.00 74.19  ? 124 ARG E O     1 
ATOM   8905  C CB    . ARG I 3 130 ? 72.038  8.207   44.968 1.00 71.97  ? 124 ARG E CB    1 
ATOM   8906  C CG    . ARG I 3 130 ? 71.104  7.958   43.793 1.00 70.73  ? 124 ARG E CG    1 
ATOM   8907  C CD    . ARG I 3 130 ? 70.070  9.044   43.642 1.00 69.06  ? 124 ARG E CD    1 
ATOM   8908  N NE    . ARG I 3 130 ? 69.208  8.807   42.482 1.00 69.03  ? 124 ARG E NE    1 
ATOM   8909  C CZ    . ARG I 3 130 ? 68.539  9.760   41.843 1.00 67.61  ? 124 ARG E CZ    1 
ATOM   8910  N NH1   . ARG I 3 130 ? 68.621  11.023  42.246 1.00 67.58  ? 124 ARG E NH1   1 
ATOM   8911  N NH2   . ARG I 3 130 ? 67.789  9.455   40.801 1.00 67.23  ? 124 ARG E NH2   1 
ATOM   8912  N N     . LYS I 3 131 ? 74.809  8.380   46.527 1.00 76.54  ? 125 LYS E N     1 
ATOM   8913  C CA    . LYS I 3 131 ? 75.660  8.701   47.684 1.00 78.19  ? 125 LYS E CA    1 
ATOM   8914  C C     . LYS I 3 131 ? 76.651  9.808   47.336 1.00 79.58  ? 125 LYS E C     1 
ATOM   8915  O O     . LYS I 3 131 ? 76.928  10.692  48.157 1.00 80.02  ? 125 LYS E O     1 
ATOM   8916  C CB    . LYS I 3 131 ? 76.435  7.470   48.174 1.00 80.73  ? 125 LYS E CB    1 
ATOM   8917  C CG    . LYS I 3 131 ? 75.918  6.848   49.457 1.00 80.33  ? 125 LYS E CG    1 
ATOM   8918  N N     . ALA I 3 132 ? 77.179  9.743   46.114 1.00 80.65  ? 126 ALA E N     1 
ATOM   8919  C CA    . ALA I 3 132 ? 78.137  10.724  45.619 1.00 82.49  ? 126 ALA E CA    1 
ATOM   8920  C C     . ALA I 3 132 ? 77.483  12.096  45.473 1.00 80.70  ? 126 ALA E C     1 
ATOM   8921  O O     . ALA I 3 132 ? 78.028  13.098  45.948 1.00 81.85  ? 126 ALA E O     1 
ATOM   8922  C CB    . ALA I 3 132 ? 78.743  10.268  44.301 1.00 84.26  ? 126 ALA E CB    1 
ATOM   8923  N N     . LYS I 3 133 ? 76.310  12.134  44.841 1.00 78.02  ? 127 LYS E N     1 
ATOM   8924  C CA    . LYS I 3 133 ? 75.571  13.384  44.687 1.00 76.32  ? 127 LYS E CA    1 
ATOM   8925  C C     . LYS I 3 133 ? 75.211  13.982  46.051 1.00 75.39  ? 127 LYS E C     1 
ATOM   8926  O O     . LYS I 3 133 ? 75.335  15.191  46.259 1.00 75.78  ? 127 LYS E O     1 
ATOM   8927  C CB    . LYS I 3 133 ? 74.317  13.189  43.822 1.00 73.98  ? 127 LYS E CB    1 
ATOM   8928  N N     . LEU I 3 134 ? 74.781  13.132  46.979 1.00 74.54  ? 128 LEU E N     1 
ATOM   8929  C CA    . LEU I 3 134 ? 74.413  13.586  48.313 1.00 74.10  ? 128 LEU E CA    1 
ATOM   8930  C C     . LEU I 3 134 ? 75.614  14.204  49.034 1.00 76.78  ? 128 LEU E C     1 
ATOM   8931  O O     . LEU I 3 134 ? 75.472  15.243  49.681 1.00 77.03  ? 128 LEU E O     1 
ATOM   8932  C CB    . LEU I 3 134 ? 73.803  12.436  49.133 1.00 73.67  ? 128 LEU E CB    1 
ATOM   8933  C CG    . LEU I 3 134 ? 73.472  12.625  50.620 1.00 73.39  ? 128 LEU E CG    1 
ATOM   8934  C CD1   . LEU I 3 134 ? 72.522  13.780  50.811 1.00 72.15  ? 128 LEU E CD1   1 
ATOM   8935  C CD2   . LEU I 3 134 ? 72.874  11.359  51.199 1.00 72.98  ? 128 LEU E CD2   1 
ATOM   8936  N N     . SER I 3 135 ? 76.783  13.568  48.912 1.00 79.00  ? 129 SER E N     1 
ATOM   8937  C CA    . SER I 3 135 ? 78.032  14.095  49.472 1.00 81.84  ? 129 SER E CA    1 
ATOM   8938  C C     . SER I 3 135 ? 78.321  15.511  48.980 1.00 82.33  ? 129 SER E C     1 
ATOM   8939  O O     . SER I 3 135 ? 78.571  16.409  49.782 1.00 83.40  ? 129 SER E O     1 
ATOM   8940  C CB    . SER I 3 135 ? 79.215  13.170  49.154 1.00 84.35  ? 129 SER E CB    1 
ATOM   8941  N N     . ASP I 3 136 ? 78.266  15.707  47.664 1.00 82.04  ? 130 ASP E N     1 
ATOM   8942  C CA    . ASP I 3 136 ? 78.510  17.018  47.056 1.00 83.08  ? 130 ASP E CA    1 
ATOM   8943  C C     . ASP I 3 136 ? 77.432  18.043  47.429 1.00 81.05  ? 130 ASP E C     1 
ATOM   8944  O O     . ASP I 3 136 ? 77.706  19.240  47.538 1.00 82.32  ? 130 ASP E O     1 
ATOM   8945  C CB    . ASP I 3 136 ? 78.637  16.897  45.529 1.00 83.51  ? 130 ASP E CB    1 
ATOM   8946  N N     . LEU I 3 137 ? 76.209  17.571  47.629 1.00 78.34  ? 131 LEU E N     1 
ATOM   8947  C CA    . LEU I 3 137 ? 75.135  18.452  48.051 1.00 76.80  ? 131 LEU E CA    1 
ATOM   8948  C C     . LEU I 3 137 ? 75.318  18.899  49.496 1.00 78.12  ? 131 LEU E C     1 
ATOM   8949  O O     . LEU I 3 137 ? 75.122  20.081  49.818 1.00 78.39  ? 131 LEU E O     1 
ATOM   8950  C CB    . LEU I 3 137 ? 73.779  17.785  47.857 1.00 73.79  ? 131 LEU E CB    1 
ATOM   8951  C CG    . LEU I 3 137 ? 73.135  18.016  46.495 1.00 72.50  ? 131 LEU E CG    1 
ATOM   8952  C CD1   . LEU I 3 137 ? 71.791  17.327  46.446 1.00 70.12  ? 131 LEU E CD1   1 
ATOM   8953  C CD2   . LEU I 3 137 ? 72.976  19.504  46.211 1.00 73.02  ? 131 LEU E CD2   1 
ATOM   8954  N N     . GLN I 3 138 ? 75.698  17.940  50.347 1.00 79.25  ? 132 GLN E N     1 
ATOM   8955  C CA    . GLN I 3 138 ? 76.002  18.176  51.756 1.00 80.97  ? 132 GLN E CA    1 
ATOM   8956  C C     . GLN I 3 138 ? 77.086  19.235  51.864 1.00 83.69  ? 132 GLN E C     1 
ATOM   8957  O O     . GLN I 3 138 ? 76.960  20.184  52.635 1.00 84.68  ? 132 GLN E O     1 
ATOM   8958  C CB    . GLN I 3 138 ? 76.467  16.877  52.430 1.00 82.27  ? 132 GLN E CB    1 
ATOM   8959  C CG    . GLN I 3 138 ? 76.500  16.918  53.967 1.00 84.63  ? 132 GLN E CG    1 
ATOM   8960  C CD    . GLN I 3 138 ? 75.115  16.773  54.592 1.00 84.07  ? 132 GLN E CD    1 
ATOM   8961  O OE1   . GLN I 3 138 ? 74.311  15.928  54.179 1.00 82.25  ? 132 GLN E OE1   1 
ATOM   8962  N NE2   . GLN I 3 138 ? 74.833  17.596  55.594 1.00 84.86  ? 132 GLN E NE2   1 
ATOM   8963  N N     . GLY I 3 139 ? 78.144  19.061  51.073 1.00 85.42  ? 133 GLY E N     1 
ATOM   8964  C CA    . GLY I 3 139 ? 79.262  19.996  51.036 1.00 88.53  ? 133 GLY E CA    1 
ATOM   8965  C C     . GLY I 3 139 ? 78.844  21.392  50.625 1.00 88.21  ? 133 GLY E C     1 
ATOM   8966  O O     . GLY I 3 139 ? 79.220  22.369  51.266 1.00 90.38  ? 133 GLY E O     1 
ATOM   8967  N N     . SER I 3 140 ? 78.049  21.481  49.564 1.00 86.00  ? 134 SER E N     1 
ATOM   8968  C CA    . SER I 3 140 ? 77.616  22.766  49.027 1.00 85.94  ? 134 SER E CA    1 
ATOM   8969  C C     . SER I 3 140 ? 76.744  23.519  50.026 1.00 85.08  ? 134 SER E C     1 
ATOM   8970  O O     . SER I 3 140 ? 76.765  24.752  50.082 1.00 86.33  ? 134 SER E O     1 
ATOM   8971  C CB    . SER I 3 140 ? 76.860  22.557  47.718 1.00 83.78  ? 134 SER E CB    1 
ATOM   8972  O OG    . SER I 3 140 ? 77.288  23.496  46.750 1.00 85.93  ? 134 SER E OG    1 
ATOM   8973  N N     . TYR I 3 141 ? 75.986  22.755  50.809 1.00 83.31  ? 135 TYR E N     1 
ATOM   8974  C CA    . TYR I 3 141 ? 75.116  23.281  51.851 1.00 82.81  ? 135 TYR E CA    1 
ATOM   8975  C C     . TYR I 3 141 ? 75.927  23.963  52.949 1.00 86.16  ? 135 TYR E C     1 
ATOM   8976  O O     . TYR I 3 141 ? 75.641  25.101  53.323 1.00 87.20  ? 135 TYR E O     1 
ATOM   8977  C CB    . TYR I 3 141 ? 74.279  22.137  52.425 1.00 80.72  ? 135 TYR E CB    1 
ATOM   8978  C CG    . TYR I 3 141 ? 73.439  22.481  53.635 1.00 80.66  ? 135 TYR E CG    1 
ATOM   8979  C CD1   . TYR I 3 141 ? 72.246  23.193  53.505 1.00 78.73  ? 135 TYR E CD1   1 
ATOM   8980  C CD2   . TYR I 3 141 ? 73.823  22.064  54.910 1.00 82.55  ? 135 TYR E CD2   1 
ATOM   8981  C CE1   . TYR I 3 141 ? 71.463  23.499  54.615 1.00 79.32  ? 135 TYR E CE1   1 
ATOM   8982  C CE2   . TYR I 3 141 ? 73.047  22.364  56.028 1.00 83.25  ? 135 TYR E CE2   1 
ATOM   8983  C CZ    . TYR I 3 141 ? 71.869  23.079  55.871 1.00 81.78  ? 135 TYR E CZ    1 
ATOM   8984  O OH    . TYR I 3 141 ? 71.109  23.376  56.977 1.00 83.35  ? 135 TYR E OH    1 
ATOM   8985  N N     . GLU I 3 142 ? 76.943  23.262  53.447 1.00 88.28  ? 136 GLU E N     1 
ATOM   8986  C CA    . GLU I 3 142 ? 77.811  23.766  54.509 1.00 91.97  ? 136 GLU E CA    1 
ATOM   8987  C C     . GLU I 3 142 ? 78.611  25.001  54.078 1.00 94.36  ? 136 GLU E C     1 
ATOM   8988  O O     . GLU I 3 142 ? 78.912  25.865  54.902 1.00 97.06  ? 136 GLU E O     1 
ATOM   8989  C CB    . GLU I 3 142 ? 78.768  22.670  54.985 1.00 93.91  ? 136 GLU E CB    1 
ATOM   8990  C CG    . GLU I 3 142 ? 78.104  21.383  55.494 1.00 93.70  ? 136 GLU E CG    1 
ATOM   8991  C CD    . GLU I 3 142 ? 79.112  20.242  55.681 1.00 98.26  ? 136 GLU E CD    1 
ATOM   8992  O OE1   . GLU I 3 142 ? 79.829  19.899  54.709 1.00 99.75  ? 136 GLU E OE1   1 
ATOM   8993  O OE2   . GLU I 3 142 ? 79.194  19.683  56.799 1.00 100.44 ? 136 GLU E OE2   1 
ATOM   8994  N N     . LYS I 3 143 ? 78.963  25.070  52.795 1.00 93.97  ? 137 LYS E N     1 
ATOM   8995  C CA    . LYS I 3 143 ? 79.645  26.235  52.226 1.00 96.47  ? 137 LYS E CA    1 
ATOM   8996  C C     . LYS I 3 143 ? 78.738  27.464  52.319 1.00 95.99  ? 137 LYS E C     1 
ATOM   8997  O O     . LYS I 3 143 ? 79.206  28.570  52.573 1.00 98.91  ? 137 LYS E O     1 
ATOM   8998  C CB    . LYS I 3 143 ? 80.058  25.963  50.769 1.00 96.25  ? 137 LYS E CB    1 
ATOM   8999  C CG    . LYS I 3 143 ? 80.885  27.063  50.105 1.00 99.25  ? 137 LYS E CG    1 
ATOM   9000  N N     . LEU I 3 144 ? 77.440  27.256  52.123 1.00 92.76  ? 138 LEU E N     1 
ATOM   9001  C CA    . LEU I 3 144 ? 76.457  28.320  52.271 1.00 92.41  ? 138 LEU E CA    1 
ATOM   9002  C C     . LEU I 3 144 ? 76.219  28.657  53.745 1.00 93.81  ? 138 LEU E C     1 
ATOM   9003  O O     . LEU I 3 144 ? 76.216  29.830  54.126 1.00 95.99  ? 138 LEU E O     1 
ATOM   9004  C CB    . LEU I 3 144 ? 75.144  27.920  51.599 1.00 88.72  ? 138 LEU E CB    1 
ATOM   9005  C CG    . LEU I 3 144 ? 73.938  28.840  51.783 1.00 88.20  ? 138 LEU E CG    1 
ATOM   9006  C CD1   . LEU I 3 144 ? 73.945  29.960  50.753 1.00 89.98  ? 138 LEU E CD1   1 
ATOM   9007  C CD2   . LEU I 3 144 ? 72.649  28.032  51.684 1.00 85.48  ? 138 LEU E CD2   1 
ATOM   9008  N N     . MET I 3 145 ? 76.043  27.623  54.567 1.00 93.02  ? 139 MET E N     1 
ATOM   9009  C CA    . MET I 3 145 ? 75.588  27.791  55.952 1.00 94.34  ? 139 MET E CA    1 
ATOM   9010  C C     . MET I 3 145 ? 76.597  28.410  56.906 1.00 98.58  ? 139 MET E C     1 
ATOM   9011  O O     . MET I 3 145 ? 76.231  29.247  57.732 1.00 100.53 ? 139 MET E O     1 
ATOM   9012  C CB    . MET I 3 145 ? 75.097  26.461  56.531 1.00 92.64  ? 139 MET E CB    1 
ATOM   9013  C CG    . MET I 3 145 ? 73.798  25.957  55.908 1.00 89.20  ? 139 MET E CG    1 
ATOM   9014  S SD    . MET I 3 145 ? 72.381  27.059  56.110 1.00 87.49  ? 139 MET E SD    1 
ATOM   9015  C CE    . MET I 3 145 ? 71.978  26.779  57.839 1.00 89.39  ? 139 MET E CE    1 
ATOM   9016  N N     . ALA I 3 146 ? 77.859  28.000  56.789 1.00 100.51 ? 140 ALA E N     1 
ATOM   9017  C CA    . ALA I 3 146 ? 78.913  28.409  57.715 1.00 104.49 ? 140 ALA E CA    1 
ATOM   9018  C C     . ALA I 3 146 ? 79.378  29.853  57.503 1.00 107.27 ? 140 ALA E C     1 
ATOM   9019  O O     . ALA I 3 146 ? 80.557  30.168  57.694 1.00 110.96 ? 140 ALA E O     1 
ATOM   9020  C CB    . ALA I 3 146 ? 80.090  27.442  57.619 1.00 105.84 ? 140 ALA E CB    1 
ATOM   9021  N N     . SER I 3 147 ? 78.448  30.727  57.123 1.00 105.77 ? 141 SER E N     1 
ATOM   9022  C CA    . SER I 3 147 ? 78.753  32.138  56.908 1.00 108.46 ? 141 SER E CA    1 
ATOM   9023  C C     . SER I 3 147 ? 78.748  32.913  58.222 1.00 111.78 ? 141 SER E C     1 
ATOM   9024  O O     . SER I 3 147 ? 79.437  33.931  58.350 1.00 115.54 ? 141 SER E O     1 
ATOM   9025  C CB    . SER I 3 147 ? 77.763  32.764  55.924 1.00 105.97 ? 141 SER E CB    1 
ATOM   9026  N N     . ALA I 3 148 ? 77.983  32.407  59.194 1.00 110.62 ? 142 ALA E N     1 
ATOM   9027  C CA    . ALA I 3 148 ? 77.731  33.077  60.484 1.00 113.46 ? 142 ALA E CA    1 
ATOM   9028  C C     . ALA I 3 148 ? 76.520  33.998  60.418 1.00 112.44 ? 142 ALA E C     1 
ATOM   9029  O O     . ALA I 3 148 ? 75.928  34.330  61.447 1.00 114.29 ? 142 ALA E O     1 
ATOM   9030  C CB    . ALA I 3 148 ? 78.951  33.848  60.977 1.00 118.33 ? 142 ALA E CB    1 
ATOM   9031  N N     . GLU I 3 149 ? 76.166  34.417  59.205 1.00 109.96 ? 143 GLU E N     1 
ATOM   9032  C CA    . GLU I 3 149 ? 75.032  35.299  58.994 1.00 108.84 ? 143 GLU E CA    1 
ATOM   9033  C C     . GLU I 3 149 ? 73.748  34.490  59.118 1.00 105.04 ? 143 GLU E C     1 
ATOM   9034  O O     . GLU I 3 149 ? 73.603  33.457  58.458 1.00 101.60 ? 143 GLU E O     1 
ATOM   9035  C CB    . GLU I 3 149 ? 75.119  35.978  57.626 1.00 108.13 ? 143 GLU E CB    1 
ATOM   9036  N N     . PRO I 3 150 ? 72.817  34.952  59.974 1.00 105.86 ? 144 PRO E N     1 
ATOM   9037  C CA    . PRO I 3 150 ? 71.572  34.253  60.251 1.00 103.05 ? 144 PRO E CA    1 
ATOM   9038  C C     . PRO I 3 150 ? 70.742  34.110  58.998 1.00 99.16  ? 144 PRO E C     1 
ATOM   9039  O O     . PRO I 3 150 ? 70.379  35.111  58.378 1.00 99.50  ? 144 PRO E O     1 
ATOM   9040  C CB    . PRO I 3 150 ? 70.856  35.181  61.234 1.00 106.00 ? 144 PRO E CB    1 
ATOM   9041  C CG    . PRO I 3 150 ? 71.925  36.005  61.827 1.00 110.41 ? 144 PRO E CG    1 
ATOM   9042  C CD    . PRO I 3 150 ? 72.896  36.216  60.720 1.00 109.98 ? 144 PRO E CD    1 
ATOM   9043  N N     . MET I 3 151 ? 70.474  32.860  58.634 1.00 95.76  ? 145 MET E N     1 
ATOM   9044  C CA    . MET I 3 151 ? 69.595  32.531  57.531 1.00 92.24  ? 145 MET E CA    1 
ATOM   9045  C C     . MET I 3 151 ? 68.138  32.643  57.977 1.00 91.80  ? 145 MET E C     1 
ATOM   9046  O O     . MET I 3 151 ? 67.727  32.008  58.949 1.00 92.28  ? 145 MET E O     1 
ATOM   9047  C CB    . MET I 3 151 ? 69.895  31.115  57.038 1.00 89.37  ? 145 MET E CB    1 
ATOM   9048  C CG    . MET I 3 151 ? 69.022  30.654  55.880 1.00 85.87  ? 145 MET E CG    1 
ATOM   9049  S SD    . MET I 3 151 ? 69.142  31.737  54.447 1.00 85.26  ? 145 MET E SD    1 
ATOM   9050  C CE    . MET I 3 151 ? 70.817  31.402  53.893 1.00 85.67  ? 145 MET E CE    1 
ATOM   9051  N N     . SER I 3 152 ? 67.370  33.467  57.268 1.00 91.40  ? 146 SER E N     1 
ATOM   9052  C CA    . SER I 3 152 ? 65.949  33.659  57.548 1.00 91.09  ? 146 SER E CA    1 
ATOM   9053  C C     . SER I 3 152 ? 65.238  34.200  56.306 1.00 89.55  ? 146 SER E C     1 
ATOM   9054  O O     . SER I 3 152 ? 65.879  34.450  55.285 1.00 88.87  ? 146 SER E O     1 
ATOM   9055  C CB    . SER I 3 152 ? 65.755  34.601  58.739 1.00 94.85  ? 146 SER E CB    1 
ATOM   9056  O OG    . SER I 3 152 ? 65.992  35.948  58.377 1.00 96.75  ? 146 SER E OG    1 
ATOM   9057  N N     . PHE I 3 153 ? 63.920  34.386  56.400 1.00 89.33  ? 147 PHE E N     1 
ATOM   9058  C CA    . PHE I 3 153 ? 63.120  34.891  55.276 1.00 88.16  ? 147 PHE E CA    1 
ATOM   9059  C C     . PHE I 3 153 ? 63.675  36.188  54.686 1.00 90.15  ? 147 PHE E C     1 
ATOM   9060  O O     . PHE I 3 153 ? 63.678  36.378  53.468 1.00 88.92  ? 147 PHE E O     1 
ATOM   9061  C CB    . PHE I 3 153 ? 61.650  35.087  55.679 1.00 88.76  ? 147 PHE E CB    1 
ATOM   9062  C CG    . PHE I 3 153 ? 60.784  35.627  54.565 1.00 88.19  ? 147 PHE E CG    1 
ATOM   9063  C CD1   . PHE I 3 153 ? 60.594  37.000  54.412 1.00 90.46  ? 147 PHE E CD1   1 
ATOM   9064  C CD2   . PHE I 3 153 ? 60.177  34.761  53.653 1.00 85.11  ? 147 PHE E CD2   1 
ATOM   9065  C CE1   . PHE I 3 153 ? 59.812  37.504  53.374 1.00 89.99  ? 147 PHE E CE1   1 
ATOM   9066  C CE2   . PHE I 3 153 ? 59.390  35.253  52.615 1.00 84.57  ? 147 PHE E CE2   1 
ATOM   9067  C CZ    . PHE I 3 153 ? 59.208  36.629  52.475 1.00 87.38  ? 147 PHE E CZ    1 
ATOM   9068  N N     . SER I 3 154 ? 64.135  37.072  55.567 1.00 93.47  ? 148 SER E N     1 
ATOM   9069  C CA    . SER I 3 154 ? 64.637  38.384  55.182 1.00 96.03  ? 148 SER E CA    1 
ATOM   9070  C C     . SER I 3 154 ? 65.948  38.289  54.415 1.00 95.53  ? 148 SER E C     1 
ATOM   9071  O O     . SER I 3 154 ? 66.227  39.129  53.559 1.00 96.67  ? 148 SER E O     1 
ATOM   9072  C CB    . SER I 3 154 ? 64.808  39.263  56.423 1.00 100.04 ? 148 SER E CB    1 
ATOM   9073  O OG    . SER I 3 154 ? 65.297  38.502  57.514 1.00 100.27 ? 148 SER E OG    1 
ATOM   9074  N N     . SER I 3 155 ? 66.733  37.255  54.725 1.00 94.04  ? 149 SER E N     1 
ATOM   9075  C CA    . SER I 3 155 ? 68.056  37.035  54.134 1.00 93.95  ? 149 SER E CA    1 
ATOM   9076  C C     . SER I 3 155 ? 67.990  36.977  52.603 1.00 92.07  ? 149 SER E C     1 
ATOM   9077  O O     . SER I 3 155 ? 67.138  36.287  52.053 1.00 89.22  ? 149 SER E O     1 
ATOM   9078  C CB    . SER I 3 155 ? 68.687  35.759  54.713 1.00 92.54  ? 149 SER E CB    1 
ATOM   9079  O OG    . SER I 3 155 ? 69.726  35.255  53.892 1.00 91.50  ? 149 SER E OG    1 
ATOM   9080  N N     . PRO I 3 156 ? 68.890  37.712  51.914 1.00 94.02  ? 150 PRO E N     1 
ATOM   9081  C CA    . PRO I 3 156 ? 68.891  37.812  50.452 1.00 93.11  ? 150 PRO E CA    1 
ATOM   9082  C C     . PRO I 3 156 ? 69.273  36.511  49.752 1.00 90.06  ? 150 PRO E C     1 
ATOM   9083  O O     . PRO I 3 156 ? 69.039  36.374  48.554 1.00 89.05  ? 150 PRO E O     1 
ATOM   9084  C CB    . PRO I 3 156 ? 69.961  38.878  50.167 1.00 96.96  ? 150 PRO E CB    1 
ATOM   9085  C CG    . PRO I 3 156 ? 70.255  39.519  51.471 1.00 99.78  ? 150 PRO E CG    1 
ATOM   9086  C CD    . PRO I 3 156 ? 69.994  38.485  52.503 1.00 97.65  ? 150 PRO E CD    1 
ATOM   9087  N N     . ASP I 3 157 ? 69.868  35.581  50.492 1.00 89.06  ? 151 ASP E N     1 
ATOM   9088  C CA    . ASP I 3 157 ? 70.274  34.287  49.951 1.00 86.53  ? 151 ASP E CA    1 
ATOM   9089  C C     . ASP I 3 157 ? 69.226  33.196  50.250 1.00 83.02  ? 151 ASP E C     1 
ATOM   9090  O O     . ASP I 3 157 ? 69.473  32.004  50.045 1.00 80.88  ? 151 ASP E O     1 
ATOM   9091  C CB    . ASP I 3 157 ? 71.655  33.901  50.509 1.00 88.05  ? 151 ASP E CB    1 
ATOM   9092  N N     . PHE I 3 158 ? 68.053  33.619  50.723 1.00 82.63  ? 152 PHE E N     1 
ATOM   9093  C CA    . PHE I 3 158 ? 66.982  32.706  51.144 1.00 80.00  ? 152 PHE E CA    1 
ATOM   9094  C C     . PHE I 3 158 ? 66.530  31.738  50.043 1.00 77.13  ? 152 PHE E C     1 
ATOM   9095  O O     . PHE I 3 158 ? 66.338  30.547  50.302 1.00 75.20  ? 152 PHE E O     1 
ATOM   9096  C CB    . PHE I 3 158 ? 65.792  33.498  51.705 1.00 80.82  ? 152 PHE E CB    1 
ATOM   9097  C CG    . PHE I 3 158 ? 64.776  32.654  52.437 1.00 79.09  ? 152 PHE E CG    1 
ATOM   9098  C CD1   . PHE I 3 158 ? 65.178  31.668  53.340 1.00 78.50  ? 152 PHE E CD1   1 
ATOM   9099  C CD2   . PHE I 3 158 ? 63.415  32.874  52.250 1.00 78.41  ? 152 PHE E CD2   1 
ATOM   9100  C CE1   . PHE I 3 158 ? 64.242  30.897  54.025 1.00 77.32  ? 152 PHE E CE1   1 
ATOM   9101  C CE2   . PHE I 3 158 ? 62.471  32.111  52.932 1.00 77.51  ? 152 PHE E CE2   1 
ATOM   9102  C CZ    . PHE I 3 158 ? 62.886  31.118  53.820 1.00 77.06  ? 152 PHE E CZ    1 
ATOM   9103  N N     . GLY I 3 159 ? 66.377  32.244  48.821 1.00 76.98  ? 153 GLY E N     1 
ATOM   9104  C CA    . GLY I 3 159 ? 66.023  31.397  47.693 1.00 74.82  ? 153 GLY E CA    1 
ATOM   9105  C C     . GLY I 3 159 ? 67.009  30.258  47.517 1.00 73.83  ? 153 GLY E C     1 
ATOM   9106  O O     . GLY I 3 159 ? 66.616  29.091  47.371 1.00 71.76  ? 153 GLY E O     1 
ATOM   9107  N N     . HIS I 3 160 ? 68.291  30.611  47.534 1.00 75.61  ? 154 HIS E N     1 
ATOM   9108  C CA    . HIS I 3 160 ? 69.392  29.658  47.432 1.00 75.49  ? 154 HIS E CA    1 
ATOM   9109  C C     . HIS I 3 160 ? 69.235  28.544  48.483 1.00 73.73  ? 154 HIS E C     1 
ATOM   9110  O O     . HIS I 3 160 ? 69.316  27.358  48.158 1.00 72.21  ? 154 HIS E O     1 
ATOM   9111  C CB    . HIS I 3 160 ? 70.706  30.421  47.611 1.00 78.73  ? 154 HIS E CB    1 
ATOM   9112  C CG    . HIS I 3 160 ? 71.938  29.650  47.250 1.00 80.26  ? 154 HIS E CG    1 
ATOM   9113  N ND1   . HIS I 3 160 ? 73.087  30.269  46.803 1.00 84.19  ? 154 HIS E ND1   1 
ATOM   9114  C CD2   . HIS I 3 160 ? 72.216  28.325  47.290 1.00 79.14  ? 154 HIS E CD2   1 
ATOM   9115  C CE1   . HIS I 3 160 ? 74.018  29.360  46.580 1.00 84.31  ? 154 HIS E CE1   1 
ATOM   9116  N NE2   . HIS I 3 160 ? 73.515  28.172  46.866 1.00 81.89  ? 154 HIS E NE2   1 
ATOM   9117  N N     . TYR I 3 161 ? 68.978  28.941  49.730 1.00 74.19  ? 155 TYR E N     1 
ATOM   9118  C CA    . TYR I 3 161 ? 68.748  28.020  50.852 1.00 73.01  ? 155 TYR E CA    1 
ATOM   9119  C C     . TYR I 3 161 ? 67.611  27.023  50.602 1.00 70.22  ? 155 TYR E C     1 
ATOM   9120  O O     . TYR I 3 161 ? 67.710  25.849  50.973 1.00 68.96  ? 155 TYR E O     1 
ATOM   9121  C CB    . TYR I 3 161 ? 68.470  28.831  52.124 1.00 74.77  ? 155 TYR E CB    1 
ATOM   9122  C CG    . TYR I 3 161 ? 68.128  28.030  53.362 1.00 74.21  ? 155 TYR E CG    1 
ATOM   9123  C CD1   . TYR I 3 161 ? 69.110  27.324  54.061 1.00 75.09  ? 155 TYR E CD1   1 
ATOM   9124  C CD2   . TYR I 3 161 ? 66.825  28.012  53.857 1.00 73.59  ? 155 TYR E CD2   1 
ATOM   9125  C CE1   . TYR I 3 161 ? 68.794  26.602  55.217 1.00 75.54  ? 155 TYR E CE1   1 
ATOM   9126  C CE2   . TYR I 3 161 ? 66.495  27.296  55.008 1.00 73.97  ? 155 TYR E CE2   1 
ATOM   9127  C CZ    . TYR I 3 161 ? 67.482  26.594  55.682 1.00 75.25  ? 155 TYR E CZ    1 
ATOM   9128  O OH    . TYR I 3 161 ? 67.153  25.889  56.818 1.00 75.84  ? 155 TYR E OH    1 
ATOM   9129  N N     . LEU I 3 162 ? 66.541  27.503  49.975 1.00 69.42  ? 156 LEU E N     1 
ATOM   9130  C CA    . LEU I 3 162 ? 65.366  26.686  49.687 1.00 67.28  ? 156 LEU E CA    1 
ATOM   9131  C C     . LEU I 3 162 ? 65.650  25.577  48.671 1.00 65.73  ? 156 LEU E C     1 
ATOM   9132  O O     . LEU I 3 162 ? 65.365  24.407  48.941 1.00 64.18  ? 156 LEU E O     1 
ATOM   9133  C CB    . LEU I 3 162 ? 64.210  27.566  49.204 1.00 67.44  ? 156 LEU E CB    1 
ATOM   9134  C CG    . LEU I 3 162 ? 63.564  28.523  50.201 1.00 68.76  ? 156 LEU E CG    1 
ATOM   9135  C CD1   . LEU I 3 162 ? 62.264  29.063  49.634 1.00 68.25  ? 156 LEU E CD1   1 
ATOM   9136  C CD2   . LEU I 3 162 ? 63.316  27.814  51.513 1.00 68.83  ? 156 LEU E CD2   1 
ATOM   9137  N N     . VAL I 3 163 ? 66.215  25.946  47.518 1.00 66.23  ? 157 VAL E N     1 
ATOM   9138  C CA    . VAL I 3 163 ? 66.569  24.961  46.489 1.00 65.51  ? 157 VAL E CA    1 
ATOM   9139  C C     . VAL I 3 163 ? 67.626  23.991  46.995 1.00 66.02  ? 157 VAL E C     1 
ATOM   9140  O O     . VAL I 3 163 ? 67.573  22.808  46.681 1.00 65.10  ? 157 VAL E O     1 
ATOM   9141  C CB    . VAL I 3 163 ? 67.019  25.591  45.125 1.00 66.62  ? 157 VAL E CB    1 
ATOM   9142  C CG1   . VAL I 3 163 ? 65.845  26.257  44.408 1.00 66.08  ? 157 VAL E CG1   1 
ATOM   9143  C CG2   . VAL I 3 163 ? 68.177  26.562  45.301 1.00 69.01  ? 157 VAL E CG2   1 
ATOM   9144  N N     . LEU I 3 164 ? 68.572  24.491  47.790 1.00 67.93  ? 158 LEU E N     1 
ATOM   9145  C CA    . LEU I 3 164 ? 69.607  23.643  48.366 1.00 68.75  ? 158 LEU E CA    1 
ATOM   9146  C C     . LEU I 3 164 ? 69.077  22.611  49.358 1.00 67.81  ? 158 LEU E C     1 
ATOM   9147  O O     . LEU I 3 164 ? 69.380  21.424  49.218 1.00 67.23  ? 158 LEU E O     1 
ATOM   9148  C CB    . LEU I 3 164 ? 70.721  24.475  49.007 1.00 71.63  ? 158 LEU E CB    1 
ATOM   9149  C CG    . LEU I 3 164 ? 72.075  24.411  48.313 1.00 73.45  ? 158 LEU E CG    1 
ATOM   9150  C CD1   . LEU I 3 164 ? 73.056  25.324  49.011 1.00 76.63  ? 158 LEU E CD1   1 
ATOM   9151  C CD2   . LEU I 3 164 ? 72.586  22.979  48.303 1.00 73.33  ? 158 LEU E CD2   1 
ATOM   9152  N N     . THR I 3 165 ? 68.306  23.057  50.355 1.00 67.86  ? 159 THR E N     1 
ATOM   9153  C CA    . THR I 3 165 ? 67.734  22.140  51.342 1.00 67.60  ? 159 THR E CA    1 
ATOM   9154  C C     . THR I 3 165 ? 66.802  21.131  50.681 1.00 65.85  ? 159 THR E C     1 
ATOM   9155  O O     . THR I 3 165 ? 66.770  19.962  51.074 1.00 65.76  ? 159 THR E O     1 
ATOM   9156  C CB    . THR I 3 165 ? 66.965  22.854  52.492 1.00 68.59  ? 159 THR E CB    1 
ATOM   9157  O OG1   . THR I 3 165 ? 66.059  23.826  51.956 1.00 68.17  ? 159 THR E OG1   1 
ATOM   9158  C CG2   . THR I 3 165 ? 67.920  23.518  53.470 1.00 70.75  ? 159 THR E CG2   1 
ATOM   9159  N N     . LYS I 3 166 ? 66.048  21.579  49.679 1.00 65.02  ? 160 LYS E N     1 
ATOM   9160  C CA    . LYS I 3 166 ? 65.139  20.690  48.968 1.00 63.57  ? 160 LYS E CA    1 
ATOM   9161  C C     . LYS I 3 166 ? 65.941  19.654  48.198 1.00 63.17  ? 160 LYS E C     1 
ATOM   9162  O O     . LYS I 3 166 ? 65.672  18.465  48.293 1.00 62.70  ? 160 LYS E O     1 
ATOM   9163  C CB    . LYS I 3 166 ? 64.204  21.475  48.042 1.00 63.25  ? 160 LYS E CB    1 
ATOM   9164  C CG    . LYS I 3 166 ? 63.040  20.671  47.449 1.00 62.19  ? 160 LYS E CG    1 
ATOM   9165  C CD    . LYS I 3 166 ? 61.925  20.468  48.450 1.00 62.85  ? 160 LYS E CD    1 
ATOM   9166  C CE    . LYS I 3 166 ? 60.728  19.796  47.798 1.00 63.47  ? 160 LYS E CE    1 
ATOM   9167  N NZ    . LYS I 3 166 ? 60.861  18.311  47.699 1.00 63.01  ? 160 LYS E NZ    1 
ATOM   9168  N N     . ALA I 3 167 ? 66.949  20.103  47.463 1.00 64.04  ? 161 ALA E N     1 
ATOM   9169  C CA    . ALA I 3 167 ? 67.813  19.180  46.745 1.00 64.49  ? 161 ALA E CA    1 
ATOM   9170  C C     . ALA I 3 167 ? 68.430  18.182  47.721 1.00 65.34  ? 161 ALA E C     1 
ATOM   9171  O O     . ALA I 3 167 ? 68.467  16.979  47.449 1.00 64.86  ? 161 ALA E O     1 
ATOM   9172  C CB    . ALA I 3 167 ? 68.883  19.933  45.980 1.00 65.72  ? 161 ALA E CB    1 
ATOM   9173  N N     . LEU I 3 168 ? 68.877  18.693  48.868 1.00 66.99  ? 162 LEU E N     1 
ATOM   9174  C CA    . LEU I 3 168 ? 69.514  17.883  49.902 1.00 68.53  ? 162 LEU E CA    1 
ATOM   9175  C C     . LEU I 3 168 ? 68.572  16.809  50.437 1.00 67.98  ? 162 LEU E C     1 
ATOM   9176  O O     . LEU I 3 168 ? 68.924  15.626  50.475 1.00 68.41  ? 162 LEU E O     1 
ATOM   9177  C CB    . LEU I 3 168 ? 69.995  18.766  51.051 1.00 70.16  ? 162 LEU E CB    1 
ATOM   9178  C CG    . LEU I 3 168 ? 71.377  18.477  51.650 1.00 72.75  ? 162 LEU E CG    1 
ATOM   9179  C CD1   . LEU I 3 168 ? 71.666  19.431  52.814 1.00 74.53  ? 162 LEU E CD1   1 
ATOM   9180  C CD2   . LEU I 3 168 ? 71.526  17.027  52.102 1.00 73.27  ? 162 LEU E CD2   1 
ATOM   9181  N N     . GLU I 3 169 ? 67.375  17.224  50.843 1.00 67.70  ? 163 GLU E N     1 
ATOM   9182  C CA    . GLU I 3 169 ? 66.384  16.296  51.382 1.00 67.73  ? 163 GLU E CA    1 
ATOM   9183  C C     . GLU I 3 169 ? 66.031  15.210  50.365 1.00 66.57  ? 163 GLU E C     1 
ATOM   9184  O O     . GLU I 3 169 ? 65.863  14.040  50.731 1.00 66.79  ? 163 GLU E O     1 
ATOM   9185  C CB    . GLU I 3 169 ? 65.128  17.043  51.848 1.00 67.58  ? 163 GLU E CB    1 
ATOM   9186  N N     . ARG I 3 170 ? 65.950  15.611  49.095 1.00 65.74  ? 164 ARG E N     1 
ATOM   9187  C CA    . ARG I 3 170 ? 65.630  14.711  47.988 1.00 65.03  ? 164 ARG E CA    1 
ATOM   9188  C C     . ARG I 3 170 ? 66.645  13.559  47.884 1.00 66.14  ? 164 ARG E C     1 
ATOM   9189  O O     . ARG I 3 170 ? 66.248  12.392  47.839 1.00 66.32  ? 164 ARG E O     1 
ATOM   9190  C CB    . ARG I 3 170 ? 65.506  15.493  46.673 1.00 64.12  ? 164 ARG E CB    1 
ATOM   9191  C CG    . ARG I 3 170 ? 65.171  14.642  45.447 1.00 64.63  ? 164 ARG E CG    1 
ATOM   9192  C CD    . ARG I 3 170 ? 64.895  15.496  44.195 1.00 65.90  ? 164 ARG E CD    1 
ATOM   9193  N NE    . ARG I 3 170 ? 66.107  16.106  43.648 1.00 68.66  ? 164 ARG E NE    1 
ATOM   9194  C CZ    . ARG I 3 170 ? 66.135  16.976  42.639 1.00 70.12  ? 164 ARG E CZ    1 
ATOM   9195  N NH1   . ARG I 3 170 ? 65.006  17.359  42.046 1.00 70.04  ? 164 ARG E NH1   1 
ATOM   9196  N NH2   . ARG I 3 170 ? 67.301  17.464  42.219 1.00 70.87  ? 164 ARG E NH2   1 
ATOM   9197  N N     . GLU I 3 171 ? 67.940  13.875  47.875 1.00 67.16  ? 165 GLU E N     1 
ATOM   9198  C CA    . GLU I 3 171 ? 68.965  12.827  47.821 1.00 68.67  ? 165 GLU E CA    1 
ATOM   9199  C C     . GLU I 3 171 ? 69.022  11.992  49.103 1.00 69.27  ? 165 GLU E C     1 
ATOM   9200  O O     . GLU I 3 171 ? 69.205  10.772  49.036 1.00 69.80  ? 165 GLU E O     1 
ATOM   9201  C CB    . GLU I 3 171 ? 70.353  13.392  47.495 1.00 70.31  ? 165 GLU E CB    1 
ATOM   9202  C CG    . GLU I 3 171 ? 70.470  14.037  46.126 1.00 72.18  ? 165 GLU E CG    1 
ATOM   9203  C CD    . GLU I 3 171 ? 70.208  13.077  44.975 1.00 74.54  ? 165 GLU E CD    1 
ATOM   9204  O OE1   . GLU I 3 171 ? 70.898  12.038  44.912 1.00 76.79  ? 165 GLU E OE1   1 
ATOM   9205  O OE2   . GLU I 3 171 ? 69.325  13.375  44.132 1.00 73.87  ? 165 GLU E OE2   1 
ATOM   9206  N N     . LYS I 3 172 ? 68.870  12.647  50.257 1.00 69.36  ? 166 LYS E N     1 
ATOM   9207  C CA    . LYS I 3 172 ? 68.843  11.944  51.540 1.00 70.52  ? 166 LYS E CA    1 
ATOM   9208  C C     . LYS I 3 172 ? 67.799  10.835  51.506 1.00 69.81  ? 166 LYS E C     1 
ATOM   9209  O O     . LYS I 3 172 ? 68.102  9.674   51.780 1.00 70.79  ? 166 LYS E O     1 
ATOM   9210  C CB    . LYS I 3 172 ? 68.576  12.909  52.708 1.00 71.35  ? 166 LYS E CB    1 
ATOM   9211  C CG    . LYS I 3 172 ? 69.840  13.476  53.366 1.00 73.81  ? 166 LYS E CG    1 
ATOM   9212  C CD    . LYS I 3 172 ? 69.555  14.316  54.619 1.00 75.46  ? 166 LYS E CD    1 
ATOM   9213  C CE    . LYS I 3 172 ? 70.868  14.617  55.353 1.00 78.59  ? 166 LYS E CE    1 
ATOM   9214  N NZ    . LYS I 3 172 ? 70.752  15.554  56.511 1.00 79.89  ? 166 LYS E NZ    1 
ATOM   9215  N N     . ASN I 3 173 ? 66.576  11.197  51.130 1.00 68.28  ? 167 ASN E N     1 
ATOM   9216  C CA    . ASN I 3 173 ? 65.471  10.248  51.085 1.00 67.92  ? 167 ASN E CA    1 
ATOM   9217  C C     . ASN I 3 173 ? 65.595  9.217   49.972 1.00 67.20  ? 167 ASN E C     1 
ATOM   9218  O O     . ASN I 3 173 ? 65.142  8.080   50.126 1.00 67.98  ? 167 ASN E O     1 
ATOM   9219  C CB    . ASN I 3 173 ? 64.139  10.986  51.025 1.00 66.96  ? 167 ASN E CB    1 
ATOM   9220  C CG    . ASN I 3 173 ? 63.893  11.822  52.274 1.00 69.49  ? 167 ASN E CG    1 
ATOM   9221  O OD1   . ASN I 3 173 ? 64.025  11.334  53.406 1.00 71.95  ? 167 ASN E OD1   1 
ATOM   9222  N ND2   . ASN I 3 173 ? 63.550  13.092  52.077 1.00 70.22  ? 167 ASN E ND2   1 
ATOM   9223  N N     . TYR I 3 174 ? 66.233  9.606   48.870 1.00 65.95  ? 168 TYR E N     1 
ATOM   9224  C CA    . TYR I 3 174 ? 66.460  8.692   47.758 1.00 65.64  ? 168 TYR E CA    1 
ATOM   9225  C C     . TYR I 3 174 ? 67.441  7.597   48.180 1.00 67.21  ? 168 TYR E C     1 
ATOM   9226  O O     . TYR I 3 174 ? 67.196  6.413   47.942 1.00 67.81  ? 168 TYR E O     1 
ATOM   9227  C CB    . TYR I 3 174 ? 66.977  9.447   46.530 1.00 64.95  ? 168 TYR E CB    1 
ATOM   9228  C CG    . TYR I 3 174 ? 66.503  8.889   45.203 1.00 65.16  ? 168 TYR E CG    1 
ATOM   9229  C CD1   . TYR I 3 174 ? 66.719  7.555   44.866 1.00 66.33  ? 168 TYR E CD1   1 
ATOM   9230  C CD2   . TYR I 3 174 ? 65.849  9.701   44.278 1.00 64.42  ? 168 TYR E CD2   1 
ATOM   9231  C CE1   . TYR I 3 174 ? 66.299  7.045   43.656 1.00 66.42  ? 168 TYR E CE1   1 
ATOM   9232  C CE2   . TYR I 3 174 ? 65.422  9.197   43.062 1.00 64.77  ? 168 TYR E CE2   1 
ATOM   9233  C CZ    . TYR I 3 174 ? 65.655  7.866   42.756 1.00 65.80  ? 168 TYR E CZ    1 
ATOM   9234  O OH    . TYR I 3 174 ? 65.239  7.350   41.552 1.00 65.55  ? 168 TYR E OH    1 
ATOM   9235  N N     . VAL I 3 175 ? 68.536  8.005   48.821 1.00 67.87  ? 169 VAL E N     1 
ATOM   9236  C CA    . VAL I 3 175 ? 69.538  7.077   49.341 1.00 69.89  ? 169 VAL E CA    1 
ATOM   9237  C C     . VAL I 3 175 ? 68.895  6.110   50.336 1.00 70.70  ? 169 VAL E C     1 
ATOM   9238  O O     . VAL I 3 175 ? 69.039  4.889   50.217 1.00 71.77  ? 169 VAL E O     1 
ATOM   9239  C CB    . VAL I 3 175 ? 70.727  7.846   49.999 1.00 71.23  ? 169 VAL E CB    1 
ATOM   9240  C CG1   . VAL I 3 175 ? 71.603  6.929   50.838 1.00 72.95  ? 169 VAL E CG1   1 
ATOM   9241  C CG2   . VAL I 3 175 ? 71.557  8.537   48.934 1.00 71.38  ? 169 VAL E CG2   1 
ATOM   9242  N N     . SER I 3 176 ? 68.164  6.682   51.291 1.00 70.31  ? 170 SER E N     1 
ATOM   9243  C CA    . SER I 3 176 ? 67.483  5.940   52.344 1.00 71.45  ? 170 SER E CA    1 
ATOM   9244  C C     . SER I 3 176 ? 66.489  4.931   51.782 1.00 71.01  ? 170 SER E C     1 
ATOM   9245  O O     . SER I 3 176 ? 66.418  3.799   52.260 1.00 72.70  ? 170 SER E O     1 
ATOM   9246  C CB    . SER I 3 176 ? 66.776  6.913   53.281 1.00 71.26  ? 170 SER E CB    1 
ATOM   9247  O OG    . SER I 3 176 ? 66.390  6.269   54.475 1.00 73.94  ? 170 SER E OG    1 
ATOM   9248  N N     . TRP I 3 177 ? 65.732  5.342   50.764 1.00 68.87  ? 171 TRP E N     1 
ATOM   9249  C CA    . TRP I 3 177 ? 64.799  4.441   50.098 1.00 68.59  ? 171 TRP E CA    1 
ATOM   9250  C C     . TRP I 3 177 ? 65.558  3.292   49.449 1.00 69.92  ? 171 TRP E C     1 
ATOM   9251  O O     . TRP I 3 177 ? 65.264  2.125   49.706 1.00 71.71  ? 171 TRP E O     1 
ATOM   9252  C CB    . TRP I 3 177 ? 63.950  5.188   49.068 1.00 66.45  ? 171 TRP E CB    1 
ATOM   9253  C CG    . TRP I 3 177 ? 62.912  4.340   48.402 1.00 65.66  ? 171 TRP E CG    1 
ATOM   9254  C CD1   . TRP I 3 177 ? 61.712  3.973   48.918 1.00 65.78  ? 171 TRP E CD1   1 
ATOM   9255  C CD2   . TRP I 3 177 ? 62.986  3.752   47.095 1.00 64.41  ? 171 TRP E CD2   1 
ATOM   9256  N NE1   . TRP I 3 177 ? 61.026  3.192   48.018 1.00 65.46  ? 171 TRP E NE1   1 
ATOM   9257  C CE2   . TRP I 3 177 ? 61.784  3.044   46.888 1.00 64.78  ? 171 TRP E CE2   1 
ATOM   9258  C CE3   . TRP I 3 177 ? 63.948  3.760   46.081 1.00 64.22  ? 171 TRP E CE3   1 
ATOM   9259  C CZ2   . TRP I 3 177 ? 61.512  2.344   45.701 1.00 65.08  ? 171 TRP E CZ2   1 
ATOM   9260  C CZ3   . TRP I 3 177 ? 63.678  3.065   44.897 1.00 65.05  ? 171 TRP E CZ3   1 
ATOM   9261  C CH2   . TRP I 3 177 ? 62.467  2.366   44.721 1.00 65.00  ? 171 TRP E CH2   1 
ATOM   9262  N N     . LEU I 3 178 ? 66.548  3.632   48.630 1.00 69.60  ? 172 LEU E N     1 
ATOM   9263  C CA    . LEU I 3 178 ? 67.394  2.634   47.972 1.00 71.51  ? 172 LEU E CA    1 
ATOM   9264  C C     . LEU I 3 178 ? 68.011  1.622   48.952 1.00 74.47  ? 172 LEU E C     1 
ATOM   9265  O O     . LEU I 3 178 ? 67.982  0.416   48.694 1.00 76.35  ? 172 LEU E O     1 
ATOM   9266  C CB    . LEU I 3 178 ? 68.493  3.316   47.150 1.00 71.02  ? 172 LEU E CB    1 
ATOM   9267  C CG    . LEU I 3 178 ? 68.114  3.985   45.826 1.00 68.98  ? 172 LEU E CG    1 
ATOM   9268  C CD1   . LEU I 3 178 ? 69.195  4.959   45.394 1.00 68.46  ? 172 LEU E CD1   1 
ATOM   9269  C CD2   . LEU I 3 178 ? 67.867  2.952   44.737 1.00 69.51  ? 172 LEU E CD2   1 
ATOM   9270  N N     . GLU I 3 179 ? 68.561  2.115   50.062 1.00 75.36  ? 173 GLU E N     1 
ATOM   9271  C CA    . GLU I 3 179 ? 69.097  1.251   51.119 1.00 78.61  ? 173 GLU E CA    1 
ATOM   9272  C C     . GLU I 3 179 ? 68.031  0.282   51.632 1.00 79.71  ? 173 GLU E C     1 
ATOM   9273  O O     . GLU I 3 179 ? 68.298  -0.902  51.814 1.00 82.04  ? 173 GLU E O     1 
ATOM   9274  C CB    . GLU I 3 179 ? 69.669  2.085   52.281 1.00 79.41  ? 173 GLU E CB    1 
ATOM   9275  C CG    . GLU I 3 179 ? 70.958  2.853   51.949 1.00 80.82  ? 173 GLU E CG    1 
ATOM   9276  C CD    . GLU I 3 179 ? 71.468  3.734   53.095 1.00 85.01  ? 173 GLU E CD    1 
ATOM   9277  O OE1   . GLU I 3 179 ? 70.706  4.024   54.044 1.00 86.92  ? 173 GLU E OE1   1 
ATOM   9278  O OE2   . GLU I 3 179 ? 72.651  4.146   53.053 1.00 87.62  ? 173 GLU E OE2   1 
ATOM   9279  N N     . SER I 3 180 ? 66.819  0.796   51.833 1.00 78.59  ? 174 SER E N     1 
ATOM   9280  C CA    . SER I 3 180 ? 65.685  0.007   52.320 1.00 79.94  ? 174 SER E CA    1 
ATOM   9281  C C     . SER I 3 180 ? 65.307  -1.148  51.383 1.00 80.60  ? 174 SER E C     1 
ATOM   9282  O O     . SER I 3 180 ? 65.094  -2.278  51.841 1.00 83.09  ? 174 SER E O     1 
ATOM   9283  C CB    . SER I 3 180 ? 64.481  0.919   52.550 1.00 78.30  ? 174 SER E CB    1 
ATOM   9284  O OG    . SER I 3 180 ? 63.386  0.196   53.081 1.00 80.81  ? 174 SER E OG    1 
ATOM   9285  N N     . ILE I 3 181 ? 65.235  -0.861  50.082 1.00 78.62  ? 175 ILE E N     1 
ATOM   9286  C CA    . ILE I 3 181 ? 64.882  -1.869  49.071 1.00 79.50  ? 175 ILE E CA    1 
ATOM   9287  C C     . ILE I 3 181 ? 65.960  -2.958  48.962 1.00 82.24  ? 175 ILE E C     1 
ATOM   9288  O O     . ILE I 3 181 ? 65.648  -4.147  48.844 1.00 84.24  ? 175 ILE E O     1 
ATOM   9289  C CB    . ILE I 3 181 ? 64.593  -1.232  47.663 1.00 77.17  ? 175 ILE E CB    1 
ATOM   9290  C CG1   . ILE I 3 181 ? 63.619  -0.040  47.757 1.00 74.51  ? 175 ILE E CG1   1 
ATOM   9291  C CG2   . ILE I 3 181 ? 64.081  -2.279  46.673 1.00 77.85  ? 175 ILE E CG2   1 
ATOM   9292  C CD1   . ILE I 3 181 ? 62.326  -0.296  48.534 1.00 74.83  ? 175 ILE E CD1   1 
ATOM   9293  N N     . LEU I 3 182 ? 67.221  -2.539  49.016 1.00 82.60  ? 176 LEU E N     1 
ATOM   9294  C CA    . LEU I 3 182 ? 68.351  -3.457  48.987 1.00 85.70  ? 176 LEU E CA    1 
ATOM   9295  C C     . LEU I 3 182 ? 68.377  -4.407  50.186 1.00 88.91  ? 176 LEU E C     1 
ATOM   9296  O O     . LEU I 3 182 ? 68.828  -5.551  50.070 1.00 91.47  ? 176 LEU E O     1 
ATOM   9297  C CB    . LEU I 3 182 ? 69.661  -2.678  48.916 1.00 85.56  ? 176 LEU E CB    1 
ATOM   9298  C CG    . LEU I 3 182 ? 70.331  -2.502  47.554 1.00 85.46  ? 176 LEU E CG    1 
ATOM   9299  C CD1   . LEU I 3 182 ? 71.624  -1.706  47.726 1.00 86.13  ? 176 LEU E CD1   1 
ATOM   9300  C CD2   . LEU I 3 182 ? 70.628  -3.857  46.917 1.00 88.06  ? 176 LEU E CD2   1 
ATOM   9301  N N     . ALA I 3 183 ? 67.892  -3.919  51.328 1.00 89.10  ? 177 ALA E N     1 
ATOM   9302  C CA    . ALA I 3 183 ? 67.748  -4.723  52.541 1.00 92.64  ? 177 ALA E CA    1 
ATOM   9303  C C     . ALA I 3 183 ? 66.690  -5.815  52.367 1.00 94.55  ? 177 ALA E C     1 
ATOM   9304  O O     . ALA I 3 183 ? 66.660  -6.789  53.128 1.00 98.02  ? 177 ALA E O     1 
ATOM   9305  C CB    . ALA I 3 183 ? 67.409  -3.837  53.727 1.00 92.08  ? 177 ALA E CB    1 
ATOM   9306  N N     . MET I 3 184 ? 65.824  -5.635  51.369 1.00 92.78  ? 178 MET E N     1 
ATOM   9307  C CA    . MET I 3 184 ? 64.828  -6.635  50.992 1.00 94.60  ? 178 MET E CA    1 
ATOM   9308  C C     . MET I 3 184 ? 65.318  -7.504  49.826 1.00 95.75  ? 178 MET E C     1 
ATOM   9309  O O     . MET I 3 184 ? 64.610  -8.406  49.376 1.00 97.34  ? 178 MET E O     1 
ATOM   9310  C CB    . MET I 3 184 ? 63.505  -5.961  50.626 1.00 92.34  ? 178 MET E CB    1 
ATOM   9311  C CG    . MET I 3 184 ? 62.765  -5.312  51.789 1.00 92.61  ? 178 MET E CG    1 
ATOM   9312  S SD    . MET I 3 184 ? 61.398  -4.283  51.204 1.00 91.24  ? 178 MET E SD    1 
ATOM   9313  C CE    . MET I 3 184 ? 60.197  -5.528  50.712 1.00 92.89  ? 178 MET E CE    1 
ATOM   9314  N N     . ILE I 3 185 ? 66.524  -7.222  49.340 1.00 95.47  ? 179 ILE E N     1 
ATOM   9315  C CA    . ILE I 3 185 ? 67.159  -8.034  48.300 1.00 97.14  ? 179 ILE E CA    1 
ATOM   9316  C C     . ILE I 3 185 ? 68.493  -8.610  48.800 1.00 100.11 ? 179 ILE E C     1 
ATOM   9317  O O     . ILE I 3 185 ? 68.580  -9.182  49.891 1.00 102.66 ? 179 ILE E O     1 
ATOM   9318  C CB    . ILE I 3 185 ? 67.410  -7.226  46.996 1.00 94.45  ? 179 ILE E CB    1 
ATOM   9319  C CG1   . ILE I 3 185 ? 66.163  -6.455  46.569 1.00 91.35  ? 179 ILE E CG1   1 
ATOM   9320  C CG2   . ILE I 3 185 ? 67.866  -8.153  45.871 1.00 96.96  ? 179 ILE E CG2   1 
ATOM   9321  C CD1   . ILE I 3 185 ? 66.422  -5.382  45.520 1.00 88.43  ? 179 ILE E CD1   1 
ATOM   9322  N N     . PRO J 3 6   ? 70.247  9.199   21.574 1.00 125.58 ? 0   PRO F N     1 
ATOM   9323  C CA    . PRO J 3 6   ? 68.784  9.256   21.578 1.00 118.80 ? 0   PRO F CA    1 
ATOM   9324  C C     . PRO J 3 6   ? 68.198  8.295   22.614 1.00 113.79 ? 0   PRO F C     1 
ATOM   9325  O O     . PRO J 3 6   ? 68.233  7.078   22.417 1.00 115.66 ? 0   PRO F O     1 
ATOM   9326  C CB    . PRO J 3 6   ? 68.416  8.821   20.156 1.00 121.72 ? 0   PRO F CB    1 
ATOM   9327  C CG    . PRO J 3 6   ? 69.592  9.220   19.333 1.00 129.64 ? 0   PRO F CG    1 
ATOM   9328  C CD    . PRO J 3 6   ? 70.798  9.041   20.216 1.00 132.68 ? 0   PRO F CD    1 
ATOM   9329  N N     . MET J 3 7   ? 67.670  8.846   23.707 1.00 108.10 ? 1   MET F N     1 
ATOM   9330  C CA    . MET J 3 7   ? 67.212  8.047   24.851 1.00 103.86 ? 1   MET F CA    1 
ATOM   9331  C C     . MET J 3 7   ? 66.026  7.132   24.536 1.00 100.80 ? 1   MET F C     1 
ATOM   9332  O O     . MET J 3 7   ? 66.028  5.964   24.935 1.00 101.09 ? 1   MET F O     1 
ATOM   9333  C CB    . MET J 3 7   ? 66.900  8.946   26.056 1.00 99.29  ? 1   MET F CB    1 
ATOM   9334  N N     . ARG J 3 8   ? 65.032  7.669   23.821 1.00 98.40  ? 2   ARG F N     1 
ATOM   9335  C CA    . ARG J 3 8   ? 63.813  6.942   23.419 1.00 95.64  ? 2   ARG F CA    1 
ATOM   9336  C C     . ARG J 3 8   ? 63.154  6.179   24.573 1.00 91.45  ? 2   ARG F C     1 
ATOM   9337  O O     . ARG J 3 8   ? 62.935  4.969   24.493 1.00 92.80  ? 2   ARG F O     1 
ATOM   9338  C CB    . ARG J 3 8   ? 64.093  6.015   22.228 1.00 100.74 ? 2   ARG F CB    1 
ATOM   9339  C CG    . ARG J 3 8   ? 64.284  6.743   20.896 1.00 104.41 ? 2   ARG F CG    1 
ATOM   9340  C CD    . ARG J 3 8   ? 64.314  5.778   19.708 1.00 108.57 ? 2   ARG F CD    1 
ATOM   9341  N NE    . ARG J 3 8   ? 63.148  4.895   19.712 1.00 105.60 ? 2   ARG F NE    1 
ATOM   9342  C CZ    . ARG J 3 8   ? 62.916  3.934   18.826 1.00 108.88 ? 2   ARG F CZ    1 
ATOM   9343  N NH1   . ARG J 3 8   ? 61.820  3.192   18.936 1.00 106.19 ? 2   ARG F NH1   1 
ATOM   9344  N NH2   . ARG J 3 8   ? 63.765  3.711   17.830 1.00 115.31 ? 2   ARG F NH2   1 
ATOM   9345  N N     . VAL J 3 9   ? 62.833  6.899   25.642 1.00 86.68  ? 3   VAL F N     1 
ATOM   9346  C CA    . VAL J 3 9   ? 62.375  6.264   26.874 1.00 83.44  ? 3   VAL F CA    1 
ATOM   9347  C C     . VAL J 3 9   ? 60.987  5.640   26.736 1.00 80.56  ? 3   VAL F C     1 
ATOM   9348  O O     . VAL J 3 9   ? 60.728  4.564   27.283 1.00 80.64  ? 3   VAL F O     1 
ATOM   9349  C CB    . VAL J 3 9   ? 62.390  7.250   28.060 1.00 80.53  ? 3   VAL F CB    1 
ATOM   9350  C CG1   . VAL J 3 9   ? 62.011  6.535   29.359 1.00 78.09  ? 3   VAL F CG1   1 
ATOM   9351  C CG2   . VAL J 3 9   ? 63.754  7.927   28.175 1.00 83.21  ? 3   VAL F CG2   1 
ATOM   9352  N N     . LEU J 3 10  ? 60.102  6.317   26.007 1.00 78.18  ? 4   LEU F N     1 
ATOM   9353  C CA    . LEU J 3 10  ? 58.762  5.798   25.756 1.00 75.86  ? 4   LEU F CA    1 
ATOM   9354  C C     . LEU J 3 10  ? 58.784  4.375   25.180 1.00 78.96  ? 4   LEU F C     1 
ATOM   9355  O O     . LEU J 3 10  ? 58.009  3.515   25.611 1.00 78.26  ? 4   LEU F O     1 
ATOM   9356  C CB    . LEU J 3 10  ? 57.983  6.748   24.843 1.00 74.54  ? 4   LEU F CB    1 
ATOM   9357  C CG    . LEU J 3 10  ? 56.550  6.400   24.426 1.00 72.33  ? 4   LEU F CG    1 
ATOM   9358  C CD1   . LEU J 3 10  ? 55.708  5.885   25.583 1.00 68.69  ? 4   LEU F CD1   1 
ATOM   9359  C CD2   . LEU J 3 10  ? 55.918  7.624   23.818 1.00 71.07  ? 4   LEU F CD2   1 
ATOM   9360  N N     . LYS J 3 11  ? 59.672  4.134   24.217 1.00 82.73  ? 5   LYS F N     1 
ATOM   9361  C CA    . LYS J 3 11  ? 59.856  2.794   23.673 1.00 86.70  ? 5   LYS F CA    1 
ATOM   9362  C C     . LYS J 3 11  ? 59.981  1.771   24.800 1.00 86.80  ? 5   LYS F C     1 
ATOM   9363  O O     . LYS J 3 11  ? 59.255  0.780   24.835 1.00 87.50  ? 5   LYS F O     1 
ATOM   9364  C CB    . LYS J 3 11  ? 61.085  2.728   22.753 1.00 91.99  ? 5   LYS F CB    1 
ATOM   9365  N N     . TYR J 3 12  ? 60.884  2.033   25.734 1.00 86.46  ? 6   TYR F N     1 
ATOM   9366  C CA    . TYR J 3 12  ? 61.135  1.100   26.820 1.00 87.32  ? 6   TYR F CA    1 
ATOM   9367  C C     . TYR J 3 12  ? 59.968  0.984   27.797 1.00 83.33  ? 6   TYR F C     1 
ATOM   9368  O O     . TYR J 3 12  ? 59.662  -0.114  28.268 1.00 84.80  ? 6   TYR F O     1 
ATOM   9369  C CB    . TYR J 3 12  ? 62.462  1.430   27.508 1.00 88.89  ? 6   TYR F CB    1 
ATOM   9370  C CG    . TYR J 3 12  ? 63.614  1.300   26.539 1.00 94.68  ? 6   TYR F CG    1 
ATOM   9371  C CD1   . TYR J 3 12  ? 64.025  0.042   26.081 1.00 99.93  ? 6   TYR F CD1   1 
ATOM   9372  C CD2   . TYR J 3 12  ? 64.264  2.427   26.037 1.00 95.75  ? 6   TYR F CD2   1 
ATOM   9373  C CE1   . TYR J 3 12  ? 65.067  -0.089  25.166 1.00 105.54 ? 6   TYR F CE1   1 
ATOM   9374  C CE2   . TYR J 3 12  ? 65.320  2.304   25.124 1.00 101.33 ? 6   TYR F CE2   1 
ATOM   9375  C CZ    . TYR J 3 12  ? 65.712  1.042   24.696 1.00 106.34 ? 6   TYR F CZ    1 
ATOM   9376  O OH    . TYR J 3 12  ? 66.739  0.908   23.789 1.00 113.03 ? 6   TYR F OH    1 
ATOM   9377  N N     . ALA J 3 13  ? 59.306  2.107   28.070 1.00 78.68  ? 7   ALA F N     1 
ATOM   9378  C CA    . ALA J 3 13  ? 58.125  2.110   28.923 1.00 75.37  ? 7   ALA F CA    1 
ATOM   9379  C C     . ALA J 3 13  ? 57.109  1.096   28.418 1.00 76.50  ? 7   ALA F C     1 
ATOM   9380  O O     . ALA J 3 13  ? 56.636  0.255   29.185 1.00 77.23  ? 7   ALA F O     1 
ATOM   9381  C CB    . ALA J 3 13  ? 57.502  3.508   28.992 1.00 71.39  ? 7   ALA F CB    1 
ATOM   9382  N N     . ILE J 3 14  ? 56.802  1.177   27.122 1.00 77.12  ? 8   ILE F N     1 
ATOM   9383  C CA    . ILE J 3 14  ? 55.829  0.296   26.474 1.00 78.50  ? 8   ILE F CA    1 
ATOM   9384  C C     . ILE J 3 14  ? 56.257  -1.180  26.506 1.00 83.23  ? 8   ILE F C     1 
ATOM   9385  O O     . ILE J 3 14  ? 55.478  -2.048  26.910 1.00 84.43  ? 8   ILE F O     1 
ATOM   9386  C CB    . ILE J 3 14  ? 55.527  0.751   25.026 1.00 78.77  ? 8   ILE F CB    1 
ATOM   9387  C CG1   . ILE J 3 14  ? 54.919  2.159   25.032 1.00 74.89  ? 8   ILE F CG1   1 
ATOM   9388  C CG2   . ILE J 3 14  ? 54.587  -0.231  24.344 1.00 80.71  ? 8   ILE F CG2   1 
ATOM   9389  C CD1   . ILE J 3 14  ? 54.545  2.704   23.668 1.00 74.74  ? 8   ILE F CD1   1 
ATOM   9390  N N     . LEU J 3 15  ? 57.493  -1.460  26.097 1.00 86.50  ? 9   LEU F N     1 
ATOM   9391  C CA    . LEU J 3 15  ? 58.013  -2.830  26.124 1.00 91.71  ? 9   LEU F CA    1 
ATOM   9392  C C     . LEU J 3 15  ? 57.944  -3.417  27.537 1.00 91.82  ? 9   LEU F C     1 
ATOM   9393  O O     . LEU J 3 15  ? 57.663  -4.601  27.712 1.00 95.25  ? 9   LEU F O     1 
ATOM   9394  C CB    . LEU J 3 15  ? 59.445  -2.894  25.575 1.00 95.43  ? 9   LEU F CB    1 
ATOM   9395  C CG    . LEU J 3 15  ? 59.709  -2.363  24.158 1.00 96.53  ? 9   LEU F CG    1 
ATOM   9396  C CD1   . LEU J 3 15  ? 61.203  -2.243  23.875 1.00 99.67  ? 9   LEU F CD1   1 
ATOM   9397  C CD2   . LEU J 3 15  ? 59.028  -3.205  23.090 1.00 99.38  ? 9   LEU F CD2   1 
ATOM   9398  N N     . GLY J 3 16  ? 58.181  -2.575  28.538 1.00 88.49  ? 10  GLY F N     1 
ATOM   9399  C CA    . GLY J 3 16  ? 58.080  -2.991  29.931 1.00 88.68  ? 10  GLY F CA    1 
ATOM   9400  C C     . GLY J 3 16  ? 56.666  -3.341  30.362 1.00 87.56  ? 10  GLY F C     1 
ATOM   9401  O O     . GLY J 3 16  ? 56.458  -4.272  31.142 1.00 90.19  ? 10  GLY F O     1 
ATOM   9402  N N     . LEU J 3 17  ? 55.690  -2.592  29.858 1.00 84.18  ? 11  LEU F N     1 
ATOM   9403  C CA    . LEU J 3 17  ? 54.294  -2.815  30.223 1.00 83.42  ? 11  LEU F CA    1 
ATOM   9404  C C     . LEU J 3 17  ? 53.738  -4.100  29.614 1.00 88.10  ? 11  LEU F C     1 
ATOM   9405  O O     . LEU J 3 17  ? 52.810  -4.695  30.165 1.00 89.72  ? 11  LEU F O     1 
ATOM   9406  C CB    . LEU J 3 17  ? 53.424  -1.613  29.837 1.00 78.75  ? 11  LEU F CB    1 
ATOM   9407  C CG    . LEU J 3 17  ? 53.543  -0.363  30.712 1.00 74.16  ? 11  LEU F CG    1 
ATOM   9408  C CD1   . LEU J 3 17  ? 52.960  0.851   30.014 1.00 69.90  ? 11  LEU F CD1   1 
ATOM   9409  C CD2   . LEU J 3 17  ? 52.870  -0.570  32.057 1.00 73.31  ? 11  LEU F CD2   1 
ATOM   9410  N N     . LEU J 3 18  ? 54.319  -4.528  28.494 1.00 91.02  ? 12  LEU F N     1 
ATOM   9411  C CA    . LEU J 3 18  ? 53.866  -5.724  27.781 1.00 95.99  ? 12  LEU F CA    1 
ATOM   9412  C C     . LEU J 3 18  ? 54.530  -7.020  28.270 1.00 101.78 ? 12  LEU F C     1 
ATOM   9413  O O     . LEU J 3 18  ? 54.304  -8.090  27.693 1.00 106.64 ? 12  LEU F O     1 
ATOM   9414  C CB    . LEU J 3 18  ? 54.121  -5.565  26.276 1.00 96.98  ? 12  LEU F CB    1 
ATOM   9415  C CG    . LEU J 3 18  ? 53.447  -4.429  25.502 1.00 92.91  ? 12  LEU F CG    1 
ATOM   9416  C CD1   . LEU J 3 18  ? 54.139  -4.205  24.165 1.00 93.85  ? 12  LEU F CD1   1 
ATOM   9417  C CD2   . LEU J 3 18  ? 51.973  -4.721  25.300 1.00 93.19  ? 12  LEU F CD2   1 
ATOM   9418  N N     . ARG J 3 19  ? 55.336  -6.927  29.331 1.00 101.82 ? 13  ARG F N     1 
ATOM   9419  C CA    . ARG J 3 19  ? 56.163  -8.057  29.790 1.00 107.59 ? 13  ARG F CA    1 
ATOM   9420  C C     . ARG J 3 19  ? 55.359  -9.253  30.318 1.00 112.04 ? 13  ARG F C     1 
ATOM   9421  O O     . ARG J 3 19  ? 55.859  -10.378 30.332 1.00 118.07 ? 13  ARG F O     1 
ATOM   9422  C CB    . ARG J 3 19  ? 57.197  -7.594  30.835 1.00 106.36 ? 13  ARG F CB    1 
ATOM   9423  C CG    . ARG J 3 19  ? 56.729  -7.675  32.287 1.00 105.74 ? 13  ARG F CG    1 
ATOM   9424  C CD    . ARG J 3 19  ? 57.534  -6.769  33.216 1.00 102.82 ? 13  ARG F CD    1 
ATOM   9425  N NE    . ARG J 3 19  ? 56.906  -6.673  34.535 1.00 101.65 ? 13  ARG F NE    1 
ATOM   9426  C CZ    . ARG J 3 19  ? 55.934  -5.820  34.849 1.00 97.25  ? 13  ARG F CZ    1 
ATOM   9427  N NH1   . ARG J 3 19  ? 55.468  -4.963  33.949 1.00 93.37  ? 13  ARG F NH1   1 
ATOM   9428  N NH2   . ARG J 3 19  ? 55.423  -5.818  36.071 1.00 97.79  ? 13  ARG F NH2   1 
ATOM   9429  N N     . LYS J 3 20  ? 54.122  -9.006  30.744 1.00 109.83 ? 14  LYS F N     1 
ATOM   9430  C CA    . LYS J 3 20  ? 53.300  -10.034 31.385 1.00 114.26 ? 14  LYS F CA    1 
ATOM   9431  C C     . LYS J 3 20  ? 52.186  -10.588 30.486 1.00 116.68 ? 14  LYS F C     1 
ATOM   9432  O O     . LYS J 3 20  ? 51.454  -11.501 30.884 1.00 121.12 ? 14  LYS F O     1 
ATOM   9433  C CB    . LYS J 3 20  ? 52.721  -9.502  32.702 1.00 111.51 ? 14  LYS F CB    1 
ATOM   9434  N N     . GLY J 3 21  ? 52.063  -10.042 29.278 1.00 114.32 ? 15  GLY F N     1 
ATOM   9435  C CA    . GLY J 3 21  ? 51.034  -10.484 28.340 1.00 116.60 ? 15  GLY F CA    1 
ATOM   9436  C C     . GLY J 3 21  ? 50.411  -9.382  27.498 1.00 111.69 ? 15  GLY F C     1 
ATOM   9437  O O     . GLY J 3 21  ? 50.713  -8.197  27.673 1.00 106.18 ? 15  GLY F O     1 
ATOM   9438  N N     . GLU J 3 22  ? 49.525  -9.795  26.592 1.00 114.09 ? 16  GLU F N     1 
ATOM   9439  C CA    . GLU J 3 22  ? 48.922  -8.915  25.589 1.00 110.52 ? 16  GLU F CA    1 
ATOM   9440  C C     . GLU J 3 22  ? 48.218  -7.709  26.203 1.00 104.67 ? 16  GLU F C     1 
ATOM   9441  O O     . GLU J 3 22  ? 47.591  -7.827  27.257 1.00 104.76 ? 16  GLU F O     1 
ATOM   9442  C CB    . GLU J 3 22  ? 47.955  -9.707  24.697 1.00 114.93 ? 16  GLU F CB    1 
ATOM   9443  N N     . LEU J 3 23  ? 48.349  -6.557  25.540 1.00 100.09 ? 17  LEU F N     1 
ATOM   9444  C CA    . LEU J 3 23  ? 47.689  -5.308  25.946 1.00 94.85  ? 17  LEU F CA    1 
ATOM   9445  C C     . LEU J 3 23  ? 47.326  -4.432  24.740 1.00 92.80  ? 17  LEU F C     1 
ATOM   9446  O O     . LEU J 3 23  ? 48.066  -4.389  23.751 1.00 93.62  ? 17  LEU F O     1 
ATOM   9447  C CB    . LEU J 3 23  ? 48.575  -4.493  26.901 1.00 90.68  ? 17  LEU F CB    1 
ATOM   9448  C CG    . LEU J 3 23  ? 48.906  -4.936  28.332 1.00 90.90  ? 17  LEU F CG    1 
ATOM   9449  C CD1   . LEU J 3 23  ? 49.882  -3.949  28.933 1.00 86.26  ? 17  LEU F CD1   1 
ATOM   9450  C CD2   . LEU J 3 23  ? 47.676  -5.074  29.229 1.00 90.59  ? 17  LEU F CD2   1 
ATOM   9451  N N     . SER J 3 24  ? 46.194  -3.733  24.834 1.00 90.64  ? 18  SER F N     1 
ATOM   9452  C CA    . SER J 3 24  ? 45.793  -2.739  23.831 1.00 88.50  ? 18  SER F CA    1 
ATOM   9453  C C     . SER J 3 24  ? 46.634  -1.477  23.968 1.00 83.99  ? 18  SER F C     1 
ATOM   9454  O O     . SER J 3 24  ? 47.288  -1.266  24.986 1.00 82.11  ? 18  SER F O     1 
ATOM   9455  C CB    . SER J 3 24  ? 44.309  -2.373  23.978 1.00 88.01  ? 18  SER F CB    1 
ATOM   9456  N N     . GLY J 3 25  ? 46.618  -0.642  22.935 1.00 82.89  ? 19  GLY F N     1 
ATOM   9457  C CA    . GLY J 3 25  ? 47.198  0.693   23.022 1.00 79.03  ? 19  GLY F CA    1 
ATOM   9458  C C     . GLY J 3 25  ? 46.449  1.503   24.065 1.00 76.22  ? 19  GLY F C     1 
ATOM   9459  O O     . GLY J 3 25  ? 47.040  2.336   24.764 1.00 73.41  ? 19  GLY F O     1 
ATOM   9460  N N     . TYR J 3 26  ? 45.143  1.246   24.168 1.00 77.37  ? 20  TYR F N     1 
ATOM   9461  C CA    . TYR J 3 26  ? 44.285  1.870   25.180 1.00 75.56  ? 20  TYR F CA    1 
ATOM   9462  C C     . TYR J 3 26  ? 44.661  1.398   26.583 1.00 75.47  ? 20  TYR F C     1 
ATOM   9463  O O     . TYR J 3 26  ? 44.677  2.201   27.526 1.00 73.19  ? 20  TYR F O     1 
ATOM   9464  C CB    . TYR J 3 26  ? 42.812  1.564   24.898 1.00 77.76  ? 20  TYR F CB    1 
ATOM   9465  C CG    . TYR J 3 26  ? 41.836  2.323   25.764 1.00 76.49  ? 20  TYR F CG    1 
ATOM   9466  C CD1   . TYR J 3 26  ? 41.502  3.652   25.474 1.00 74.29  ? 20  TYR F CD1   1 
ATOM   9467  C CD2   . TYR J 3 26  ? 41.231  1.719   26.866 1.00 77.89  ? 20  TYR F CD2   1 
ATOM   9468  C CE1   . TYR J 3 26  ? 40.599  4.363   26.266 1.00 73.12  ? 20  TYR F CE1   1 
ATOM   9469  C CE2   . TYR J 3 26  ? 40.319  2.427   27.667 1.00 77.36  ? 20  TYR F CE2   1 
ATOM   9470  C CZ    . TYR J 3 26  ? 40.012  3.747   27.355 1.00 74.73  ? 20  TYR F CZ    1 
ATOM   9471  O OH    . TYR J 3 26  ? 39.123  4.453   28.122 1.00 73.65  ? 20  TYR F OH    1 
ATOM   9472  N N     . ASP J 3 27  ? 44.964  0.103   26.710 1.00 78.40  ? 21  ASP F N     1 
ATOM   9473  C CA    . ASP J 3 27  ? 45.395  -0.487  27.976 1.00 79.04  ? 21  ASP F CA    1 
ATOM   9474  C C     . ASP J 3 27  ? 46.682  0.177   28.445 1.00 75.99  ? 21  ASP F C     1 
ATOM   9475  O O     . ASP J 3 27  ? 46.829  0.475   29.634 1.00 74.84  ? 21  ASP F O     1 
ATOM   9476  C CB    . ASP J 3 27  ? 45.624  -1.998  27.839 1.00 83.67  ? 21  ASP F CB    1 
ATOM   9477  C CG    . ASP J 3 27  ? 44.354  -2.773  27.523 1.00 88.14  ? 21  ASP F CG    1 
ATOM   9478  O OD1   . ASP J 3 27  ? 43.238  -2.284  27.813 1.00 88.21  ? 21  ASP F OD1   1 
ATOM   9479  O OD2   . ASP J 3 27  ? 44.482  -3.896  26.985 1.00 93.16  ? 21  ASP F OD2   1 
ATOM   9480  N N     . ILE J 3 28  ? 47.606  0.399   27.506 1.00 75.35  ? 22  ILE F N     1 
ATOM   9481  C CA    . ILE J 3 28  ? 48.878  1.077   27.783 1.00 73.19  ? 22  ILE F CA    1 
ATOM   9482  C C     . ILE J 3 28  ? 48.610  2.479   28.350 1.00 69.71  ? 22  ILE F C     1 
ATOM   9483  O O     . ILE J 3 28  ? 49.143  2.854   29.396 1.00 68.38  ? 22  ILE F O     1 
ATOM   9484  C CB    . ILE J 3 28  ? 49.787  1.138   26.515 1.00 74.04  ? 22  ILE F CB    1 
ATOM   9485  C CG1   . ILE J 3 28  ? 50.366  -0.245  26.192 1.00 78.07  ? 22  ILE F CG1   1 
ATOM   9486  C CG2   . ILE J 3 28  ? 50.934  2.134   26.696 1.00 71.94  ? 22  ILE F CG2   1 
ATOM   9487  C CD1   . ILE J 3 28  ? 50.833  -0.404  24.747 1.00 79.85  ? 22  ILE F CD1   1 
ATOM   9488  N N     . THR J 3 29  ? 47.753  3.227   27.665 1.00 68.88  ? 23  THR F N     1 
ATOM   9489  C CA    . THR J 3 29  ? 47.316  4.534   28.120 1.00 66.41  ? 23  THR F CA    1 
ATOM   9490  C C     . THR J 3 29  ? 46.711  4.487   29.526 1.00 66.35  ? 23  THR F C     1 
ATOM   9491  O O     . THR J 3 29  ? 46.917  5.414   30.315 1.00 64.59  ? 23  THR F O     1 
ATOM   9492  C CB    . THR J 3 29  ? 46.311  5.157   27.119 1.00 66.64  ? 23  THR F CB    1 
ATOM   9493  O OG1   . THR J 3 29  ? 46.883  5.128   25.806 1.00 67.99  ? 23  THR F OG1   1 
ATOM   9494  C CG2   . THR J 3 29  ? 45.981  6.596   27.485 1.00 63.29  ? 23  THR F CG2   1 
ATOM   9495  N N     . SER J 3 30  ? 45.976  3.419   29.840 1.00 68.88  ? 24  SER F N     1 
ATOM   9496  C CA    . SER J 3 30  ? 45.370  3.275   31.168 1.00 69.81  ? 24  SER F CA    1 
ATOM   9497  C C     . SER J 3 30  ? 46.401  3.104   32.290 1.00 69.63  ? 24  SER F C     1 
ATOM   9498  O O     . SER J 3 30  ? 46.227  3.648   33.380 1.00 68.86  ? 24  SER F O     1 
ATOM   9499  C CB    . SER J 3 30  ? 44.355  2.133   31.201 1.00 73.34  ? 24  SER F CB    1 
ATOM   9500  O OG    . SER J 3 30  ? 43.103  2.562   30.708 1.00 73.60  ? 24  SER F OG    1 
ATOM   9501  N N     . TYR J 3 31  ? 47.471  2.356   32.022 1.00 70.81  ? 25  TYR F N     1 
ATOM   9502  C CA    . TYR J 3 31  ? 48.517  2.143   33.024 1.00 70.97  ? 25  TYR F CA    1 
ATOM   9503  C C     . TYR J 3 31  ? 49.275  3.411   33.386 1.00 67.76  ? 25  TYR F C     1 
ATOM   9504  O O     . TYR J 3 31  ? 49.685  3.578   34.530 1.00 67.77  ? 25  TYR F O     1 
ATOM   9505  C CB    . TYR J 3 31  ? 49.490  1.043   32.595 1.00 73.52  ? 25  TYR F CB    1 
ATOM   9506  C CG    . TYR J 3 31  ? 49.020  -0.346  32.957 1.00 78.28  ? 25  TYR F CG    1 
ATOM   9507  C CD1   . TYR J 3 31  ? 49.018  -0.775  34.287 1.00 80.35  ? 25  TYR F CD1   1 
ATOM   9508  C CD2   . TYR J 3 31  ? 48.572  -1.234  31.971 1.00 81.30  ? 25  TYR F CD2   1 
ATOM   9509  C CE1   . TYR J 3 31  ? 48.581  -2.055  34.626 1.00 85.80  ? 25  TYR F CE1   1 
ATOM   9510  C CE2   . TYR J 3 31  ? 48.128  -2.517  32.300 1.00 85.95  ? 25  TYR F CE2   1 
ATOM   9511  C CZ    . TYR J 3 31  ? 48.138  -2.922  33.627 1.00 88.40  ? 25  TYR F CZ    1 
ATOM   9512  O OH    . TYR J 3 31  ? 47.704  -4.183  33.965 1.00 93.44  ? 25  TYR F OH    1 
ATOM   9513  N N     . PHE J 3 32  ? 49.454  4.300   32.416 1.00 65.79  ? 26  PHE F N     1 
ATOM   9514  C CA    . PHE J 3 32  ? 50.075  5.597   32.664 1.00 63.43  ? 26  PHE F CA    1 
ATOM   9515  C C     . PHE J 3 32  ? 49.205  6.538   33.504 1.00 62.48  ? 26  PHE F C     1 
ATOM   9516  O O     . PHE J 3 32  ? 49.673  7.575   33.974 1.00 61.08  ? 26  PHE F O     1 
ATOM   9517  C CB    . PHE J 3 32  ? 50.435  6.274   31.346 1.00 62.51  ? 26  PHE F CB    1 
ATOM   9518  C CG    . PHE J 3 32  ? 51.634  5.676   30.663 1.00 63.89  ? 26  PHE F CG    1 
ATOM   9519  C CD1   . PHE J 3 32  ? 52.844  5.544   31.338 1.00 63.44  ? 26  PHE F CD1   1 
ATOM   9520  C CD2   . PHE J 3 32  ? 51.560  5.270   29.334 1.00 64.33  ? 26  PHE F CD2   1 
ATOM   9521  C CE1   . PHE J 3 32  ? 53.956  5.002   30.704 1.00 65.60  ? 26  PHE F CE1   1 
ATOM   9522  C CE2   . PHE J 3 32  ? 52.669  4.731   28.697 1.00 66.16  ? 26  PHE F CE2   1 
ATOM   9523  C CZ    . PHE J 3 32  ? 53.866  4.593   29.380 1.00 66.47  ? 26  PHE F CZ    1 
ATOM   9524  N N     . LYS J 3 33  ? 47.934  6.188   33.671 1.00 64.00  ? 27  LYS F N     1 
ATOM   9525  C CA    . LYS J 3 33  ? 47.025  6.976   34.492 1.00 63.85  ? 27  LYS F CA    1 
ATOM   9526  C C     . LYS J 3 33  ? 46.912  6.377   35.903 1.00 65.69  ? 27  LYS F C     1 
ATOM   9527  O O     . LYS J 3 33  ? 46.321  6.978   36.800 1.00 65.99  ? 27  LYS F O     1 
ATOM   9528  C CB    . LYS J 3 33  ? 45.653  7.093   33.822 1.00 64.78  ? 27  LYS F CB    1 
ATOM   9529  C CG    . LYS J 3 33  ? 45.627  7.928   32.521 1.00 63.93  ? 27  LYS F CG    1 
ATOM   9530  C CD    . LYS J 3 33  ? 44.224  7.890   31.881 1.00 66.66  ? 27  LYS F CD    1 
ATOM   9531  C CE    . LYS J 3 33  ? 44.191  8.409   30.443 1.00 66.15  ? 27  LYS F CE    1 
ATOM   9532  N N     . GLU J 3 34  ? 47.494  5.197   36.095 1.00 67.42  ? 28  GLU F N     1 
ATOM   9533  C CA    . GLU J 3 34  ? 47.468  4.544   37.397 1.00 69.92  ? 28  GLU F CA    1 
ATOM   9534  C C     . GLU J 3 34  ? 48.803  4.769   38.115 1.00 69.27  ? 28  GLU F C     1 
ATOM   9535  O O     . GLU J 3 34  ? 49.501  5.739   37.818 1.00 67.08  ? 28  GLU F O     1 
ATOM   9536  C CB    . GLU J 3 34  ? 47.115  3.059   37.260 1.00 73.42  ? 28  GLU F CB    1 
ATOM   9537  C CG    . GLU J 3 34  ? 45.673  2.789   36.832 1.00 74.83  ? 28  GLU F CG    1 
ATOM   9538  N N     . GLU J 3 35  ? 49.163  3.887   39.046 1.00 71.72  ? 29  GLU F N     1 
ATOM   9539  C CA    . GLU J 3 35  ? 50.331  4.112   39.908 1.00 71.50  ? 29  GLU F CA    1 
ATOM   9540  C C     . GLU J 3 35  ? 51.632  4.478   39.161 1.00 69.28  ? 29  GLU F C     1 
ATOM   9541  O O     . GLU J 3 35  ? 52.447  5.257   39.675 1.00 68.18  ? 29  GLU F O     1 
ATOM   9542  C CB    . GLU J 3 35  ? 50.542  2.946   40.899 1.00 75.37  ? 29  GLU F CB    1 
ATOM   9543  C CG    . GLU J 3 35  ? 51.050  1.622   40.302 1.00 78.82  ? 29  GLU F CG    1 
ATOM   9544  C CD    . GLU J 3 35  ? 49.944  0.718   39.752 1.00 83.21  ? 29  GLU F CD    1 
ATOM   9545  O OE1   . GLU J 3 35  ? 48.742  0.968   40.018 1.00 83.81  ? 29  GLU F OE1   1 
ATOM   9546  O OE2   . GLU J 3 35  ? 50.287  -0.259  39.051 1.00 85.50  ? 29  GLU F OE2   1 
ATOM   9547  N N     . LEU J 3 36  ? 51.809  3.949   37.949 1.00 68.77  ? 30  LEU F N     1 
ATOM   9548  C CA    . LEU J 3 36  ? 53.016  4.214   37.167 1.00 67.25  ? 30  LEU F CA    1 
ATOM   9549  C C     . LEU J 3 36  ? 53.140  5.679   36.743 1.00 64.06  ? 30  LEU F C     1 
ATOM   9550  O O     . LEU J 3 36  ? 54.255  6.189   36.574 1.00 63.38  ? 30  LEU F O     1 
ATOM   9551  C CB    . LEU J 3 36  ? 53.083  3.295   35.946 1.00 68.71  ? 30  LEU F CB    1 
ATOM   9552  C CG    . LEU J 3 36  ? 54.337  3.375   35.066 1.00 69.13  ? 30  LEU F CG    1 
ATOM   9553  C CD1   . LEU J 3 36  ? 55.609  3.138   35.865 1.00 70.75  ? 30  LEU F CD1   1 
ATOM   9554  C CD2   . LEU J 3 36  ? 54.253  2.395   33.913 1.00 71.66  ? 30  LEU F CD2   1 
ATOM   9555  N N     . GLY J 3 37  ? 51.991  6.346   36.593 1.00 62.22  ? 31  GLY F N     1 
ATOM   9556  C CA    . GLY J 3 37  ? 51.926  7.745   36.162 1.00 59.59  ? 31  GLY F CA    1 
ATOM   9557  C C     . GLY J 3 37  ? 52.647  8.751   37.045 1.00 58.57  ? 31  GLY F C     1 
ATOM   9558  O O     . GLY J 3 37  ? 52.947  9.864   36.619 1.00 57.38  ? 31  GLY F O     1 
ATOM   9559  N N     . GLN J 3 38  ? 52.927  8.363   38.280 1.00 59.47  ? 32  GLN F N     1 
ATOM   9560  C CA    . GLN J 3 38  ? 53.752  9.170   39.167 1.00 59.27  ? 32  GLN F CA    1 
ATOM   9561  C C     . GLN J 3 38  ? 55.196  9.330   38.653 1.00 59.38  ? 32  GLN F C     1 
ATOM   9562  O O     . GLN J 3 38  ? 55.864  10.323  38.967 1.00 59.01  ? 32  GLN F O     1 
ATOM   9563  C CB    . GLN J 3 38  ? 53.768  8.540   40.558 1.00 61.11  ? 32  GLN F CB    1 
ATOM   9564  C CG    . GLN J 3 38  ? 52.467  8.657   41.305 1.00 62.10  ? 32  GLN F CG    1 
ATOM   9565  C CD    . GLN J 3 38  ? 52.180  10.083  41.695 1.00 62.45  ? 32  GLN F CD    1 
ATOM   9566  O OE1   . GLN J 3 38  ? 53.006  10.742  42.321 1.00 64.04  ? 32  GLN F OE1   1 
ATOM   9567  N NE2   . GLN J 3 38  ? 51.013  10.577  41.317 1.00 62.04  ? 32  GLN F NE2   1 
ATOM   9568  N N     . PHE J 3 39  ? 55.672  8.363   37.866 1.00 60.08  ? 33  PHE F N     1 
ATOM   9569  C CA    . PHE J 3 39  ? 57.093  8.336   37.485 1.00 61.27  ? 33  PHE F CA    1 
ATOM   9570  C C     . PHE J 3 39  ? 57.391  8.335   35.989 1.00 61.53  ? 33  PHE F C     1 
ATOM   9571  O O     . PHE J 3 39  ? 58.478  8.730   35.576 1.00 62.68  ? 33  PHE F O     1 
ATOM   9572  C CB    . PHE J 3 39  ? 57.833  7.233   38.243 1.00 63.31  ? 33  PHE F CB    1 
ATOM   9573  C CG    . PHE J 3 39  ? 57.833  7.458   39.722 1.00 63.33  ? 33  PHE F CG    1 
ATOM   9574  C CD1   . PHE J 3 39  ? 58.669  8.418   40.291 1.00 62.67  ? 33  PHE F CD1   1 
ATOM   9575  C CD2   . PHE J 3 39  ? 56.953  6.768   40.541 1.00 63.58  ? 33  PHE F CD2   1 
ATOM   9576  C CE1   . PHE J 3 39  ? 58.643  8.662   41.646 1.00 62.99  ? 33  PHE F CE1   1 
ATOM   9577  C CE2   . PHE J 3 39  ? 56.923  7.008   41.905 1.00 63.77  ? 33  PHE F CE2   1 
ATOM   9578  C CZ    . PHE J 3 39  ? 57.768  7.955   42.456 1.00 64.03  ? 33  PHE F CZ    1 
ATOM   9579  N N     . TRP J 3 40  ? 56.424  7.889   35.198 1.00 61.14  ? 34  TRP F N     1 
ATOM   9580  C CA    . TRP J 3 40  ? 56.414  8.140   33.762 1.00 61.38  ? 34  TRP F CA    1 
ATOM   9581  C C     . TRP J 3 40  ? 54.983  8.152   33.216 1.00 60.02  ? 34  TRP F C     1 
ATOM   9582  O O     . TRP J 3 40  ? 54.120  7.404   33.682 1.00 60.01  ? 34  TRP F O     1 
ATOM   9583  C CB    . TRP J 3 40  ? 57.281  7.136   32.990 1.00 64.19  ? 34  TRP F CB    1 
ATOM   9584  C CG    . TRP J 3 40  ? 57.759  7.710   31.684 1.00 65.75  ? 34  TRP F CG    1 
ATOM   9585  C CD1   . TRP J 3 40  ? 57.079  7.729   30.498 1.00 65.77  ? 34  TRP F CD1   1 
ATOM   9586  C CD2   . TRP J 3 40  ? 58.999  8.384   31.447 1.00 67.30  ? 34  TRP F CD2   1 
ATOM   9587  N NE1   . TRP J 3 40  ? 57.825  8.363   29.539 1.00 67.87  ? 34  TRP F NE1   1 
ATOM   9588  C CE2   . TRP J 3 40  ? 59.006  8.779   30.096 1.00 68.88  ? 34  TRP F CE2   1 
ATOM   9589  C CE3   . TRP J 3 40  ? 60.103  8.698   32.250 1.00 68.87  ? 34  TRP F CE3   1 
ATOM   9590  C CZ2   . TRP J 3 40  ? 60.083  9.464   29.522 1.00 72.16  ? 34  TRP F CZ2   1 
ATOM   9591  C CZ3   . TRP J 3 40  ? 61.172  9.386   31.682 1.00 71.43  ? 34  TRP F CZ3   1 
ATOM   9592  C CH2   . TRP J 3 40  ? 61.153  9.762   30.331 1.00 73.10  ? 34  TRP F CH2   1 
ATOM   9593  N N     . SER J 3 41  ? 54.741  9.031   32.249 1.00 59.29  ? 35  SER F N     1 
ATOM   9594  C CA    . SER J 3 41  ? 53.487  9.054   31.516 1.00 58.70  ? 35  SER F CA    1 
ATOM   9595  C C     . SER J 3 41  ? 53.709  9.413   30.052 1.00 59.28  ? 35  SER F C     1 
ATOM   9596  O O     . SER J 3 41  ? 54.779  9.892   29.658 1.00 60.01  ? 35  SER F O     1 
ATOM   9597  C CB    . SER J 3 41  ? 52.515  10.045  32.143 1.00 57.22  ? 35  SER F CB    1 
ATOM   9598  O OG    . SER J 3 41  ? 53.057  11.350  32.096 1.00 58.02  ? 35  SER F OG    1 
ATOM   9599  N N     . ALA J 3 42  ? 52.670  9.176   29.260 1.00 59.15  ? 36  ALA F N     1 
ATOM   9600  C CA    . ALA J 3 42  ? 52.639  9.528   27.858 1.00 59.93  ? 36  ALA F CA    1 
ATOM   9601  C C     . ALA J 3 42  ? 51.173  9.609   27.449 1.00 59.33  ? 36  ALA F C     1 
ATOM   9602  O O     . ALA J 3 42  ? 50.339  8.899   28.013 1.00 59.12  ? 36  ALA F O     1 
ATOM   9603  C CB    . ALA J 3 42  ? 53.364  8.475   27.046 1.00 62.11  ? 36  ALA F CB    1 
ATOM   9604  N N     . LYS J 3 43  ? 50.860  10.479  26.490 1.00 59.48  ? 37  LYS F N     1 
ATOM   9605  C CA    . LYS J 3 43  ? 49.487  10.615  25.981 1.00 59.47  ? 37  LYS F CA    1 
ATOM   9606  C C     . LYS J 3 43  ? 49.277  9.671   24.812 1.00 61.26  ? 37  LYS F C     1 
ATOM   9607  O O     . LYS J 3 43  ? 50.248  9.289   24.152 1.00 63.28  ? 37  LYS F O     1 
ATOM   9608  C CB    . LYS J 3 43  ? 49.235  12.039  25.491 1.00 59.73  ? 37  LYS F CB    1 
ATOM   9609  C CG    . LYS J 3 43  ? 49.589  13.135  26.455 1.00 58.55  ? 37  LYS F CG    1 
ATOM   9610  C CD    . LYS J 3 43  ? 48.566  13.241  27.537 1.00 58.83  ? 37  LYS F CD    1 
ATOM   9611  C CE    . LYS J 3 43  ? 48.764  14.514  28.330 1.00 59.23  ? 37  LYS F CE    1 
ATOM   9612  N NZ    . LYS J 3 43  ? 48.489  14.238  29.758 1.00 59.24  ? 37  LYS F NZ    1 
ATOM   9613  N N     . HIS J 3 44  ? 48.024  9.316   24.528 1.00 61.31  ? 38  HIS F N     1 
ATOM   9614  C CA    . HIS J 3 44  ? 47.732  8.340   23.464 1.00 63.34  ? 38  HIS F CA    1 
ATOM   9615  C C     . HIS J 3 44  ? 48.169  8.797   22.062 1.00 65.24  ? 38  HIS F C     1 
ATOM   9616  O O     . HIS J 3 44  ? 48.411  7.968   21.189 1.00 67.68  ? 38  HIS F O     1 
ATOM   9617  C CB    . HIS J 3 44  ? 46.252  7.929   23.467 1.00 63.93  ? 38  HIS F CB    1 
ATOM   9618  C CG    . HIS J 3 44  ? 45.344  8.912   22.791 1.00 64.08  ? 38  HIS F CG    1 
ATOM   9619  N ND1   . HIS J 3 44  ? 44.955  10.097  23.380 1.00 63.26  ? 38  HIS F ND1   1 
ATOM   9620  C CD2   . HIS J 3 44  ? 44.750  8.886   21.575 1.00 65.66  ? 38  HIS F CD2   1 
ATOM   9621  C CE1   . HIS J 3 44  ? 44.150  10.752  22.560 1.00 64.58  ? 38  HIS F CE1   1 
ATOM   9622  N NE2   . HIS J 3 44  ? 44.009  10.038  21.458 1.00 66.06  ? 38  HIS F NE2   1 
ATOM   9623  N N     . SER J 3 45  ? 48.265  10.109  21.854 1.00 64.94  ? 39  SER F N     1 
ATOM   9624  C CA    . SER J 3 45  ? 48.745  10.663  20.590 1.00 67.32  ? 39  SER F CA    1 
ATOM   9625  C C     . SER J 3 45  ? 50.218  10.324  20.348 1.00 69.26  ? 39  SER F C     1 
ATOM   9626  O O     . SER J 3 45  ? 50.650  10.174  19.191 1.00 72.28  ? 39  SER F O     1 
ATOM   9627  C CB    . SER J 3 45  ? 48.536  12.171  20.542 1.00 67.06  ? 39  SER F CB    1 
ATOM   9628  O OG    . SER J 3 45  ? 49.096  12.815  21.673 1.00 65.01  ? 39  SER F OG    1 
ATOM   9629  N N     . GLN J 3 46  ? 50.979  10.201  21.439 1.00 67.52  ? 40  GLN F N     1 
ATOM   9630  C CA    . GLN J 3 46  ? 52.374  9.808   21.364 1.00 69.08  ? 40  GLN F CA    1 
ATOM   9631  C C     . GLN J 3 46  ? 52.524  8.288   21.363 1.00 70.20  ? 40  GLN F C     1 
ATOM   9632  O O     . GLN J 3 46  ? 53.478  7.756   20.782 1.00 73.10  ? 40  GLN F O     1 
ATOM   9633  C CB    . GLN J 3 46  ? 53.151  10.405  22.534 1.00 67.32  ? 40  GLN F CB    1 
ATOM   9634  C CG    . GLN J 3 46  ? 54.631  10.659  22.262 1.00 70.49  ? 40  GLN F CG    1 
ATOM   9635  C CD    . GLN J 3 46  ? 55.404  11.062  23.514 1.00 70.75  ? 40  GLN F CD    1 
ATOM   9636  O OE1   . GLN J 3 46  ? 54.815  11.330  24.564 1.00 69.01  ? 40  GLN F OE1   1 
ATOM   9637  N NE2   . GLN J 3 46  ? 56.727  11.106  23.408 1.00 72.95  ? 40  GLN F NE2   1 
ATOM   9638  N N     . ILE J 3 47  ? 51.594  7.591   22.015 1.00 68.43  ? 41  ILE F N     1 
ATOM   9639  C CA    . ILE J 3 47  ? 51.708  6.137   22.182 1.00 69.80  ? 41  ILE F CA    1 
ATOM   9640  C C     . ILE J 3 47  ? 51.478  5.354   20.883 1.00 73.32  ? 41  ILE F C     1 
ATOM   9641  O O     . ILE J 3 47  ? 52.269  4.467   20.559 1.00 76.25  ? 41  ILE F O     1 
ATOM   9642  C CB    . ILE J 3 47  ? 50.807  5.604   23.320 1.00 67.80  ? 41  ILE F CB    1 
ATOM   9643  C CG1   . ILE J 3 47  ? 51.220  6.221   24.660 1.00 65.52  ? 41  ILE F CG1   1 
ATOM   9644  C CG2   . ILE J 3 47  ? 50.895  4.090   23.413 1.00 69.65  ? 41  ILE F CG2   1 
ATOM   9645  C CD1   . ILE J 3 47  ? 50.247  5.967   25.791 1.00 64.46  ? 41  ILE F CD1   1 
ATOM   9646  N N     . TYR J 3 48  ? 50.417  5.687   20.146 1.00 73.59  ? 42  TYR F N     1 
ATOM   9647  C CA    . TYR J 3 48  ? 50.059  4.957   18.916 1.00 77.01  ? 42  TYR F CA    1 
ATOM   9648  C C     . TYR J 3 48  ? 51.104  5.023   17.795 1.00 80.67  ? 42  TYR F C     1 
ATOM   9649  O O     . TYR J 3 48  ? 51.417  3.992   17.215 1.00 84.13  ? 42  TYR F O     1 
ATOM   9650  C CB    . TYR J 3 48  ? 48.664  5.343   18.385 1.00 76.72  ? 42  TYR F CB    1 
ATOM   9651  C CG    . TYR J 3 48  ? 47.482  4.849   19.213 1.00 74.25  ? 42  TYR F CG    1 
ATOM   9652  C CD1   . TYR J 3 48  ? 47.193  3.483   19.321 1.00 74.57  ? 42  TYR F CD1   1 
ATOM   9653  C CD2   . TYR J 3 48  ? 46.637  5.754   19.862 1.00 70.24  ? 42  TYR F CD2   1 
ATOM   9654  C CE1   . TYR J 3 48  ? 46.113  3.035   20.075 1.00 74.17  ? 42  TYR F CE1   1 
ATOM   9655  C CE2   . TYR J 3 48  ? 45.549  5.317   20.614 1.00 69.50  ? 42  TYR F CE2   1 
ATOM   9656  C CZ    . TYR J 3 48  ? 45.293  3.958   20.714 1.00 72.23  ? 42  TYR F CZ    1 
ATOM   9657  O OH    . TYR J 3 48  ? 44.219  3.528   21.455 1.00 73.07  ? 42  TYR F OH    1 
ATOM   9658  N N     . PRO J 3 49  ? 51.647  6.225   17.483 1.00 80.76  ? 43  PRO F N     1 
ATOM   9659  C CA    . PRO J 3 49  ? 52.717  6.300   16.484 1.00 84.98  ? 43  PRO F CA    1 
ATOM   9660  C C     . PRO J 3 49  ? 53.953  5.506   16.897 1.00 86.98  ? 43  PRO F C     1 
ATOM   9661  O O     . PRO J 3 49  ? 54.615  4.894   16.046 1.00 91.61  ? 43  PRO F O     1 
ATOM   9662  C CB    . PRO J 3 49  ? 53.050  7.794   16.435 1.00 83.84  ? 43  PRO F CB    1 
ATOM   9663  C CG    . PRO J 3 49  ? 51.806  8.449   16.825 1.00 81.03  ? 43  PRO F CG    1 
ATOM   9664  C CD    . PRO J 3 49  ? 51.244  7.574   17.912 1.00 78.15  ? 43  PRO F CD    1 
ATOM   9665  N N     . GLU J 3 50  ? 54.252  5.519   18.192 1.00 84.11  ? 44  GLU F N     1 
ATOM   9666  C CA    . GLU J 3 50  ? 55.334  4.728   18.731 1.00 85.95  ? 44  GLU F CA    1 
ATOM   9667  C C     . GLU J 3 50  ? 55.034  3.235   18.581 1.00 88.21  ? 44  GLU F C     1 
ATOM   9668  O O     . GLU J 3 50  ? 55.934  2.458   18.257 1.00 92.20  ? 44  GLU F O     1 
ATOM   9669  C CB    . GLU J 3 50  ? 55.628  5.117   20.188 1.00 82.45  ? 44  GLU F CB    1 
ATOM   9670  C CG    . GLU J 3 50  ? 56.892  4.485   20.793 1.00 85.53  ? 44  GLU F CG    1 
ATOM   9671  C CD    . GLU J 3 50  ? 58.200  4.907   20.114 1.00 91.32  ? 44  GLU F CD    1 
ATOM   9672  O OE1   . GLU J 3 50  ? 58.173  5.495   19.012 1.00 94.20  ? 44  GLU F OE1   1 
ATOM   9673  O OE2   . GLU J 3 50  ? 59.276  4.636   20.687 1.00 94.13  ? 44  GLU F OE2   1 
ATOM   9674  N N     . LEU J 3 51  ? 53.778  2.838   18.783 1.00 86.36  ? 45  LEU F N     1 
ATOM   9675  C CA    . LEU J 3 51  ? 53.374  1.452   18.533 1.00 89.26  ? 45  LEU F CA    1 
ATOM   9676  C C     . LEU J 3 51  ? 53.569  1.044   17.071 1.00 94.26  ? 45  LEU F C     1 
ATOM   9677  O O     . LEU J 3 51  ? 53.916  -0.103  16.792 1.00 98.44  ? 45  LEU F O     1 
ATOM   9678  C CB    . LEU J 3 51  ? 51.933  1.199   18.960 1.00 86.96  ? 45  LEU F CB    1 
ATOM   9679  C CG    . LEU J 3 51  ? 51.680  1.100   20.461 1.00 83.78  ? 45  LEU F CG    1 
ATOM   9680  C CD1   . LEU J 3 51  ? 50.254  1.534   20.775 1.00 80.03  ? 45  LEU F CD1   1 
ATOM   9681  C CD2   . LEU J 3 51  ? 51.973  -0.299  20.989 1.00 85.48  ? 45  LEU F CD2   1 
ATOM   9682  N N     . LYS J 3 52  ? 53.358  1.976   16.144 1.00 94.60  ? 46  LYS F N     1 
ATOM   9683  C CA    . LYS J 3 52  ? 53.621  1.704   14.726 1.00 100.00 ? 46  LYS F CA    1 
ATOM   9684  C C     . LYS J 3 52  ? 55.125  1.593   14.471 1.00 103.79 ? 46  LYS F C     1 
ATOM   9685  O O     . LYS J 3 52  ? 55.558  0.807   13.629 1.00 109.17 ? 46  LYS F O     1 
ATOM   9686  C CB    . LYS J 3 52  ? 52.993  2.761   13.811 1.00 99.71  ? 46  LYS F CB    1 
ATOM   9687  N N     . LYS J 3 53  ? 55.911  2.379   15.206 1.00 101.44 ? 47  LYS F N     1 
ATOM   9688  C CA    . LYS J 3 53  ? 57.363  2.350   15.080 1.00 105.21 ? 47  LYS F CA    1 
ATOM   9689  C C     . LYS J 3 53  ? 57.954  1.043   15.592 1.00 107.65 ? 47  LYS F C     1 
ATOM   9690  O O     . LYS J 3 53  ? 58.848  0.474   14.963 1.00 113.42 ? 47  LYS F O     1 
ATOM   9691  C CB    . LYS J 3 53  ? 57.998  3.534   15.805 1.00 102.39 ? 47  LYS F CB    1 
ATOM   9692  C CG    . LYS J 3 53  ? 58.708  4.518   14.894 1.00 106.24 ? 47  LYS F CG    1 
ATOM   9693  C CD    . LYS J 3 53  ? 59.697  5.361   15.693 1.00 106.29 ? 47  LYS F CD    1 
ATOM   9694  C CE    . LYS J 3 53  ? 60.966  5.652   14.897 1.00 112.43 ? 47  LYS F CE    1 
ATOM   9695  N NZ    . LYS J 3 53  ? 62.021  6.267   15.756 1.00 111.80 ? 47  LYS F NZ    1 
ATOM   9696  N N     . LEU J 3 54  ? 57.439  0.568   16.722 1.00 104.10 ? 48  LEU F N     1 
ATOM   9697  C CA    . LEU J 3 54  ? 57.932  -0.656  17.354 1.00 106.32 ? 48  LEU F CA    1 
ATOM   9698  C C     . LEU J 3 54  ? 57.538  -1.926  16.594 1.00 111.20 ? 48  LEU F C     1 
ATOM   9699  O O     . LEU J 3 54  ? 58.171  -2.970  16.753 1.00 115.32 ? 48  LEU F O     1 
ATOM   9700  C CB    . LEU J 3 54  ? 57.488  -0.729  18.820 1.00 101.32 ? 48  LEU F CB    1 
ATOM   9701  C CG    . LEU J 3 54  ? 58.016  0.400   19.718 1.00 97.02  ? 48  LEU F CG    1 
ATOM   9702  C CD1   . LEU J 3 54  ? 57.222  0.494   21.018 1.00 91.14  ? 48  LEU F CD1   1 
ATOM   9703  C CD2   . LEU J 3 54  ? 59.517  0.265   19.994 1.00 99.52  ? 48  LEU F CD2   1 
ATOM   9704  N N     . THR J 3 55  ? 56.503  -1.837  15.766 1.00 111.27 ? 49  THR F N     1 
ATOM   9705  C CA    . THR J 3 55  ? 56.151  -2.951  14.898 1.00 116.58 ? 49  THR F CA    1 
ATOM   9706  C C     . THR J 3 55  ? 57.076  -2.976  13.680 1.00 122.88 ? 49  THR F C     1 
ATOM   9707  O O     . THR J 3 55  ? 57.556  -4.045  13.276 1.00 128.71 ? 49  THR F O     1 
ATOM   9708  C CB    . THR J 3 55  ? 54.681  -2.897  14.446 1.00 114.96 ? 49  THR F CB    1 
ATOM   9709  O OG1   . THR J 3 55  ? 53.854  -2.459  15.534 1.00 108.69 ? 49  THR F OG1   1 
ATOM   9710  C CG2   . THR J 3 55  ? 54.219  -4.275  13.970 1.00 119.49 ? 49  THR F CG2   1 
ATOM   9711  N N     . ASP J 3 56  ? 57.334  -1.795  13.116 1.00 122.30 ? 50  ASP F N     1 
ATOM   9712  C CA    . ASP J 3 56  ? 58.212  -1.655  11.950 1.00 128.70 ? 50  ASP F CA    1 
ATOM   9713  C C     . ASP J 3 56  ? 59.656  -2.012  12.275 1.00 132.35 ? 50  ASP F C     1 
ATOM   9714  O O     . ASP J 3 56  ? 60.372  -2.542  11.428 1.00 139.12 ? 50  ASP F O     1 
ATOM   9715  C CB    . ASP J 3 56  ? 58.152  -0.232  11.385 1.00 127.46 ? 50  ASP F CB    1 
ATOM   9716  C CG    . ASP J 3 56  ? 56.774  0.140   10.856 1.00 126.18 ? 50  ASP F CG    1 
ATOM   9717  O OD1   . ASP J 3 56  ? 55.941  -0.762  10.621 1.00 128.58 ? 50  ASP F OD1   1 
ATOM   9718  O OD2   . ASP J 3 56  ? 56.523  1.349   10.674 1.00 124.94 ? 50  ASP F OD2   1 
ATOM   9719  N N     . GLU J 3 57  ? 60.074  -1.708  13.503 1.00 128.21 ? 51  GLU F N     1 
ATOM   9720  C CA    . GLU J 3 57  ? 61.419  -2.036  13.975 1.00 131.40 ? 51  GLU F CA    1 
ATOM   9721  C C     . GLU J 3 57  ? 61.515  -3.491  14.448 1.00 133.95 ? 51  GLU F C     1 
ATOM   9722  O O     . GLU J 3 57  ? 62.609  -3.995  14.685 1.00 138.53 ? 51  GLU F O     1 
ATOM   9723  C CB    . GLU J 3 57  ? 61.867  -1.062  15.078 1.00 126.58 ? 51  GLU F CB    1 
ATOM   9724  C CG    . GLU J 3 57  ? 62.110  0.376   14.591 1.00 125.93 ? 51  GLU F CG    1 
ATOM   9725  C CD    . GLU J 3 57  ? 62.487  1.352   15.710 1.00 122.02 ? 51  GLU F CD    1 
ATOM   9726  O OE1   . GLU J 3 57  ? 61.890  1.298   16.810 1.00 116.18 ? 51  GLU F OE1   1 
ATOM   9727  O OE2   . GLU J 3 57  ? 63.380  2.194   15.480 1.00 124.82 ? 51  GLU F OE2   1 
ATOM   9728  N N     . GLY J 3 58  ? 60.366  -4.152  14.591 1.00 131.62 ? 52  GLY F N     1 
ATOM   9729  C CA    . GLY J 3 58  ? 60.312  -5.592  14.860 1.00 134.98 ? 52  GLY F CA    1 
ATOM   9730  C C     . GLY J 3 58  ? 60.289  -6.050  16.310 1.00 131.81 ? 52  GLY F C     1 
ATOM   9731  O O     . GLY J 3 58  ? 60.308  -7.257  16.575 1.00 135.57 ? 52  GLY F O     1 
ATOM   9732  N N     . PHE J 3 59  ? 60.240  -5.102  17.248 1.00 125.28 ? 53  PHE F N     1 
ATOM   9733  C CA    . PHE J 3 59  ? 60.251  -5.429  18.678 1.00 122.29 ? 53  PHE F CA    1 
ATOM   9734  C C     . PHE J 3 59  ? 58.910  -5.971  19.177 1.00 119.45 ? 53  PHE F C     1 
ATOM   9735  O O     . PHE J 3 59  ? 58.852  -6.699  20.169 1.00 119.60 ? 53  PHE F O     1 
ATOM   9736  C CB    . PHE J 3 59  ? 60.687  -4.219  19.519 1.00 117.11 ? 53  PHE F CB    1 
ATOM   9737  C CG    . PHE J 3 59  ? 62.059  -3.685  19.173 1.00 120.06 ? 53  PHE F CG    1 
ATOM   9738  C CD1   . PHE J 3 59  ? 63.179  -4.525  19.167 1.00 126.37 ? 53  PHE F CD1   1 
ATOM   9739  C CD2   . PHE J 3 59  ? 62.235  -2.335  18.872 1.00 116.83 ? 53  PHE F CD2   1 
ATOM   9740  C CE1   . PHE J 3 59  ? 64.447  -4.031  18.846 1.00 129.34 ? 53  PHE F CE1   1 
ATOM   9741  C CE2   . PHE J 3 59  ? 63.500  -1.828  18.558 1.00 120.60 ? 53  PHE F CE2   1 
ATOM   9742  C CZ    . PHE J 3 59  ? 64.610  -2.681  18.543 1.00 126.94 ? 53  PHE F CZ    1 
ATOM   9743  N N     . ILE J 3 60  ? 57.839  -5.620  18.477 1.00 117.54 ? 54  ILE F N     1 
ATOM   9744  C CA    . ILE J 3 60  ? 56.487  -5.983  18.886 1.00 115.39 ? 54  ILE F CA    1 
ATOM   9745  C C     . ILE J 3 60  ? 55.682  -6.486  17.698 1.00 118.72 ? 54  ILE F C     1 
ATOM   9746  O O     . ILE J 3 60  ? 55.837  -5.987  16.581 1.00 120.25 ? 54  ILE F O     1 
ATOM   9747  C CB    . ILE J 3 60  ? 55.743  -4.772  19.525 1.00 108.11 ? 54  ILE F CB    1 
ATOM   9748  N N     . THR J 3 61  ? 54.836  -7.484  17.938 1.00 120.71 ? 55  THR F N     1 
ATOM   9749  C CA    . THR J 3 61  ? 53.878  -7.945  16.930 1.00 123.74 ? 55  THR F CA    1 
ATOM   9750  C C     . THR J 3 61  ? 52.463  -7.738  17.469 1.00 119.80 ? 55  THR F C     1 
ATOM   9751  O O     . THR J 3 61  ? 52.265  -7.677  18.687 1.00 116.65 ? 55  THR F O     1 
ATOM   9752  C CB    . THR J 3 61  ? 54.097  -9.428  16.543 1.00 130.95 ? 55  THR F CB    1 
ATOM   9753  N N     . PHE J 3 62  ? 51.488  -7.615  16.570 1.00 120.48 ? 56  PHE F N     1 
ATOM   9754  C CA    . PHE J 3 62  ? 50.099  -7.418  16.988 1.00 117.62 ? 56  PHE F CA    1 
ATOM   9755  C C     . PHE J 3 62  ? 49.098  -8.267  16.228 1.00 122.28 ? 56  PHE F C     1 
ATOM   9756  O O     . PHE J 3 62  ? 49.320  -8.636  15.074 1.00 126.63 ? 56  PHE F O     1 
ATOM   9757  C CB    . PHE J 3 62  ? 49.691  -5.938  16.917 1.00 111.78 ? 56  PHE F CB    1 
ATOM   9758  C CG    . PHE J 3 62  ? 49.345  -5.452  15.530 1.00 113.02 ? 56  PHE F CG    1 
ATOM   9759  C CD1   . PHE J 3 62  ? 48.080  -5.676  14.989 1.00 114.57 ? 56  PHE F CD1   1 
ATOM   9760  C CD2   . PHE J 3 62  ? 50.275  -4.743  14.777 1.00 113.31 ? 56  PHE F CD2   1 
ATOM   9761  C CE1   . PHE J 3 62  ? 47.757  -5.224  13.709 1.00 116.21 ? 56  PHE F CE1   1 
ATOM   9762  C CE2   . PHE J 3 62  ? 49.961  -4.283  13.495 1.00 115.33 ? 56  PHE F CE2   1 
ATOM   9763  C CZ    . PHE J 3 62  ? 48.700  -4.524  12.961 1.00 116.44 ? 56  PHE F CZ    1 
ATOM   9764  N N     . ARG J 3 63  ? 47.987  -8.554  16.897 1.00 121.76 ? 57  ARG F N     1 
ATOM   9765  C CA    . ARG J 3 63  ? 46.846  -9.223  16.283 1.00 126.06 ? 57  ARG F CA    1 
ATOM   9766  C C     . ARG J 3 63  ? 45.589  -8.373  16.483 1.00 122.26 ? 57  ARG F C     1 
ATOM   9767  O O     . ARG J 3 63  ? 45.553  -7.529  17.386 1.00 117.00 ? 57  ARG F O     1 
ATOM   9768  C CB    . ARG J 3 63  ? 46.660  -10.621 16.874 1.00 131.19 ? 57  ARG F CB    1 
ATOM   9769  C CG    . ARG J 3 63  ? 46.322  -10.641 18.351 1.00 128.68 ? 57  ARG F CG    1 
ATOM   9770  C CD    . ARG J 3 63  ? 45.681  -11.955 18.713 1.00 135.27 ? 57  ARG F CD    1 
ATOM   9771  N NE    . ARG J 3 63  ? 45.088  -11.918 20.045 1.00 133.67 ? 57  ARG F NE    1 
ATOM   9772  C CZ    . ARG J 3 63  ? 44.305  -12.874 20.539 1.00 138.56 ? 57  ARG F CZ    1 
ATOM   9773  N NH1   . ARG J 3 63  ? 44.009  -13.939 19.806 1.00 145.12 ? 57  ARG F NH1   1 
ATOM   9774  N NH2   . ARG J 3 63  ? 43.811  -12.756 21.764 1.00 137.10 ? 57  ARG F NH2   1 
ATOM   9775  N N     . THR J 3 64  ? 44.572  -8.597  15.651 1.00 125.33 ? 58  THR F N     1 
ATOM   9776  C CA    . THR J 3 64  ? 43.356  -7.786  15.678 1.00 122.65 ? 58  THR F CA    1 
ATOM   9777  C C     . THR J 3 64  ? 42.174  -8.540  16.276 1.00 125.60 ? 58  THR F C     1 
ATOM   9778  O O     . THR J 3 64  ? 41.531  -9.335  15.600 1.00 130.99 ? 58  THR F O     1 
ATOM   9779  C CB    . THR J 3 64  ? 42.957  -7.282  14.267 1.00 123.97 ? 58  THR F CB    1 
ATOM   9780  O OG1   . THR J 3 64  ? 44.091  -7.303  13.392 1.00 126.02 ? 58  THR F OG1   1 
ATOM   9781  C CG2   . THR J 3 64  ? 42.394  -5.864  14.341 1.00 119.17 ? 58  THR F CG2   1 
ATOM   9782  N N     . THR J 3 65  ? 41.887  -8.280  17.547 1.00 122.83 ? 59  THR F N     1 
ATOM   9783  C CA    . THR J 3 65  ? 40.687  -8.824  18.179 1.00 125.84 ? 59  THR F CA    1 
ATOM   9784  C C     . THR J 3 65  ? 39.529  -7.827  18.046 1.00 123.57 ? 59  THR F C     1 
ATOM   9785  O O     . THR J 3 65  ? 39.751  -6.640  17.796 1.00 118.76 ? 59  THR F O     1 
ATOM   9786  C CB    . THR J 3 65  ? 40.937  -9.249  19.656 1.00 125.36 ? 59  THR F CB    1 
ATOM   9787  O OG1   . THR J 3 65  ? 40.010  -10.278 20.023 1.00 131.46 ? 59  THR F OG1   1 
ATOM   9788  C CG2   . THR J 3 65  ? 40.817  -8.072  20.623 1.00 118.85 ? 59  THR F CG2   1 
ATOM   9789  N N     . ILE J 3 66  ? 38.302  -8.320  18.195 1.00 127.68 ? 60  ILE F N     1 
ATOM   9790  C CA    . ILE J 3 66  ? 37.113  -7.497  18.008 1.00 126.95 ? 60  ILE F CA    1 
ATOM   9791  C C     . ILE J 3 66  ? 36.237  -7.466  19.257 1.00 127.40 ? 60  ILE F C     1 
ATOM   9792  O O     . ILE J 3 66  ? 35.650  -8.485  19.640 1.00 132.80 ? 60  ILE F O     1 
ATOM   9793  C CB    . ILE J 3 66  ? 36.273  -7.973  16.801 1.00 132.37 ? 60  ILE F CB    1 
ATOM   9794  N N     . GLN J 3 67  ? 36.169  -6.292  19.888 1.00 122.20 ? 61  GLN F N     1 
ATOM   9795  C CA    . GLN J 3 67  ? 35.229  -6.044  20.976 1.00 122.68 ? 61  GLN F CA    1 
ATOM   9796  C C     . GLN J 3 67  ? 33.852  -5.745  20.408 1.00 125.80 ? 61  GLN F C     1 
ATOM   9797  O O     . GLN J 3 67  ? 33.728  -5.065  19.387 1.00 124.63 ? 61  GLN F O     1 
ATOM   9798  C CB    . GLN J 3 67  ? 35.691  -4.876  21.843 1.00 116.64 ? 61  GLN F CB    1 
ATOM   9799  C CG    . GLN J 3 67  ? 36.487  -5.281  23.082 1.00 115.63 ? 61  GLN F CG    1 
ATOM   9800  C CD    . GLN J 3 67  ? 35.624  -5.865  24.193 1.00 119.82 ? 61  GLN F CD    1 
ATOM   9801  O OE1   . GLN J 3 67  ? 36.102  -6.662  24.998 1.00 121.38 ? 61  GLN F OE1   1 
ATOM   9802  N NE2   . GLN J 3 67  ? 34.353  -5.467  24.244 1.00 121.73 ? 61  GLN F NE2   1 
ATOM   9803  N N     . GLY J 3 68  ? 32.819  -6.252  21.074 1.00 130.27 ? 62  GLY F N     1 
ATOM   9804  C CA    . GLY J 3 68  ? 31.460  -6.142  20.571 1.00 134.37 ? 62  GLY F CA    1 
ATOM   9805  C C     . GLY J 3 68  ? 31.340  -6.887  19.260 1.00 138.74 ? 62  GLY F C     1 
ATOM   9806  O O     . GLY J 3 68  ? 31.754  -8.042  19.160 1.00 142.41 ? 62  GLY F O     1 
ATOM   9807  N N     . THR J 3 69  ? 30.792  -6.216  18.249 1.00 138.74 ? 63  THR F N     1 
ATOM   9808  C CA    . THR J 3 69  ? 30.577  -6.820  16.932 1.00 143.11 ? 63  THR F CA    1 
ATOM   9809  C C     . THR J 3 69  ? 31.400  -6.150  15.830 1.00 139.07 ? 63  THR F C     1 
ATOM   9810  O O     . THR J 3 69  ? 31.750  -6.793  14.841 1.00 141.88 ? 63  THR F O     1 
ATOM   9811  C CB    . THR J 3 69  ? 29.086  -6.793  16.534 1.00 148.73 ? 63  THR F CB    1 
ATOM   9812  N N     . LYS J 3 70  ? 31.713  -4.867  16.012 1.00 132.97 ? 64  LYS F N     1 
ATOM   9813  C CA    . LYS J 3 70  ? 32.383  -4.080  14.970 1.00 129.71 ? 64  LYS F CA    1 
ATOM   9814  C C     . LYS J 3 70  ? 33.672  -3.350  15.394 1.00 122.90 ? 64  LYS F C     1 
ATOM   9815  O O     . LYS J 3 70  ? 34.477  -2.992  14.533 1.00 121.36 ? 64  LYS F O     1 
ATOM   9816  C CB    . LYS J 3 70  ? 31.394  -3.102  14.320 1.00 130.52 ? 64  LYS F CB    1 
ATOM   9817  N N     . LEU J 3 71  ? 33.872  -3.133  16.697 1.00 119.39 ? 65  LEU F N     1 
ATOM   9818  C CA    . LEU J 3 71  ? 35.047  -2.382  17.205 1.00 113.11 ? 65  LEU F CA    1 
ATOM   9819  C C     . LEU J 3 71  ? 36.357  -3.193  17.243 1.00 112.73 ? 65  LEU F C     1 
ATOM   9820  O O     . LEU J 3 71  ? 36.525  -4.106  18.063 1.00 114.01 ? 65  LEU F O     1 
ATOM   9821  C CB    . LEU J 3 71  ? 34.752  -1.770  18.585 1.00 109.71 ? 65  LEU F CB    1 
ATOM   9822  C CG    . LEU J 3 71  ? 35.796  -0.890  19.287 1.00 103.14 ? 65  LEU F CG    1 
ATOM   9823  C CD1   . LEU J 3 71  ? 36.140  0.365   18.490 1.00 99.30  ? 65  LEU F CD1   1 
ATOM   9824  C CD2   . LEU J 3 71  ? 35.332  -0.509  20.690 1.00 100.63 ? 65  LEU F CD2   1 
ATOM   9825  N N     . GLU J 3 72  ? 37.280  -2.836  16.352 1.00 111.39 ? 66  GLU F N     1 
ATOM   9826  C CA    . GLU J 3 72  ? 38.548  -3.544  16.222 1.00 111.88 ? 66  GLU F CA    1 
ATOM   9827  C C     . GLU J 3 72  ? 39.629  -2.938  17.108 1.00 106.74 ? 66  GLU F C     1 
ATOM   9828  O O     . GLU J 3 72  ? 39.736  -1.715  17.248 1.00 102.81 ? 66  GLU F O     1 
ATOM   9829  C CB    . GLU J 3 72  ? 38.995  -3.623  14.758 1.00 114.40 ? 66  GLU F CB    1 
ATOM   9830  C CG    . GLU J 3 72  ? 38.377  -4.806  14.007 1.00 121.88 ? 66  GLU F CG    1 
ATOM   9831  C CD    . GLU J 3 72  ? 38.507  -4.718  12.487 1.00 126.10 ? 66  GLU F CD    1 
ATOM   9832  O OE1   . GLU J 3 72  ? 38.331  -3.610  11.931 1.00 124.33 ? 66  GLU F OE1   1 
ATOM   9833  O OE2   . GLU J 3 72  ? 38.762  -5.769  11.845 1.00 130.94 ? 66  GLU F OE2   1 
ATOM   9834  N N     . LYS J 3 73  ? 40.424  -3.829  17.692 1.00 107.44 ? 67  LYS F N     1 
ATOM   9835  C CA    . LYS J 3 73  ? 41.378  -3.523  18.744 1.00 103.20 ? 67  LYS F CA    1 
ATOM   9836  C C     . LYS J 3 73  ? 42.663  -4.309  18.451 1.00 104.98 ? 67  LYS F C     1 
ATOM   9837  O O     . LYS J 3 73  ? 42.607  -5.508  18.151 1.00 109.73 ? 67  LYS F O     1 
ATOM   9838  C CB    . LYS J 3 73  ? 40.783  -3.988  20.072 1.00 103.56 ? 67  LYS F CB    1 
ATOM   9839  C CG    . LYS J 3 73  ? 41.348  -3.325  21.302 1.00 99.29  ? 67  LYS F CG    1 
ATOM   9840  C CD    . LYS J 3 73  ? 41.245  -4.227  22.528 1.00 101.45 ? 67  LYS F CD    1 
ATOM   9841  C CE    . LYS J 3 73  ? 39.824  -4.367  23.040 1.00 103.86 ? 67  LYS F CE    1 
ATOM   9842  N NZ    . LYS J 3 73  ? 39.791  -4.818  24.464 1.00 104.60 ? 67  LYS F NZ    1 
ATOM   9843  N N     . LYS J 3 74  ? 43.810  -3.638  18.516 1.00 101.52 ? 68  LYS F N     1 
ATOM   9844  C CA    . LYS J 3 74  ? 45.090  -4.288  18.251 1.00 103.40 ? 68  LYS F CA    1 
ATOM   9845  C C     . LYS J 3 74  ? 45.781  -4.692  19.552 1.00 102.46 ? 68  LYS F C     1 
ATOM   9846  O O     . LYS J 3 74  ? 46.189  -3.834  20.346 1.00 98.46  ? 68  LYS F O     1 
ATOM   9847  C CB    . LYS J 3 74  ? 46.010  -3.372  17.449 1.00 101.50 ? 68  LYS F CB    1 
ATOM   9848  C CG    . LYS J 3 74  ? 45.624  -3.152  16.013 1.00 103.89 ? 68  LYS F CG    1 
ATOM   9849  C CD    . LYS J 3 74  ? 46.533  -2.092  15.422 1.00 102.93 ? 68  LYS F CD    1 
ATOM   9850  C CE    . LYS J 3 74  ? 46.193  -1.774  13.975 1.00 107.38 ? 68  LYS F CE    1 
ATOM   9851  N NZ    . LYS J 3 74  ? 46.650  -0.394  13.618 1.00 105.18 ? 68  LYS F NZ    1 
ATOM   9852  N N     . MET J 3 75  ? 45.907  -5.998  19.768 1.00 106.81 ? 69  MET F N     1 
ATOM   9853  C CA    . MET J 3 75  ? 46.593  -6.518  20.941 1.00 106.79 ? 69  MET F CA    1 
ATOM   9854  C C     . MET J 3 75  ? 48.061  -6.761  20.627 1.00 107.92 ? 69  MET F C     1 
ATOM   9855  O O     . MET J 3 75  ? 48.389  -7.429  19.638 1.00 112.47 ? 69  MET F O     1 
ATOM   9856  C CB    . MET J 3 75  ? 45.930  -7.811  21.420 1.00 111.97 ? 69  MET F CB    1 
ATOM   9857  C CG    . MET J 3 75  ? 44.493  -7.645  21.878 1.00 112.29 ? 69  MET F CG    1 
ATOM   9858  S SD    . MET J 3 75  ? 44.294  -6.158  22.877 1.00 108.47 ? 69  MET F SD    1 
ATOM   9859  C CE    . MET J 3 75  ? 43.226  -6.783  24.178 1.00 110.48 ? 69  MET F CE    1 
ATOM   9860  N N     . TYR J 3 76  ? 48.940  -6.227  21.472 1.00 104.21 ? 70  TYR F N     1 
ATOM   9861  C CA    . TYR J 3 76  ? 50.379  -6.353  21.251 1.00 105.08 ? 70  TYR F CA    1 
ATOM   9862  C C     . TYR J 3 76  ? 51.030  -7.423  22.120 1.00 108.31 ? 70  TYR F C     1 
ATOM   9863  O O     . TYR J 3 76  ? 50.507  -7.783  23.173 1.00 108.20 ? 70  TYR F O     1 
ATOM   9864  C CB    . TYR J 3 76  ? 51.074  -4.999  21.422 1.00 99.85  ? 70  TYR F CB    1 
ATOM   9865  C CG    . TYR J 3 76  ? 50.738  -4.026  20.317 1.00 97.53  ? 70  TYR F CG    1 
ATOM   9866  C CD1   . TYR J 3 76  ? 49.604  -3.213  20.397 1.00 93.69  ? 70  TYR F CD1   1 
ATOM   9867  C CD2   . TYR J 3 76  ? 51.540  -3.928  19.181 1.00 99.14  ? 70  TYR F CD2   1 
ATOM   9868  C CE1   . TYR J 3 76  ? 49.286  -2.318  19.374 1.00 92.30  ? 70  TYR F CE1   1 
ATOM   9869  C CE2   . TYR J 3 76  ? 51.231  -3.043  18.152 1.00 97.74  ? 70  TYR F CE2   1 
ATOM   9870  C CZ    . TYR J 3 76  ? 50.102  -2.241  18.254 1.00 94.60  ? 70  TYR F CZ    1 
ATOM   9871  O OH    . TYR J 3 76  ? 49.792  -1.361  17.242 1.00 94.02  ? 70  TYR F OH    1 
ATOM   9872  N N     . THR J 3 77  ? 52.159  -7.940  21.636 1.00 111.89 ? 71  THR F N     1 
ATOM   9873  C CA    . THR J 3 77  ? 53.005  -8.891  22.362 1.00 115.30 ? 71  THR F CA    1 
ATOM   9874  C C     . THR J 3 77  ? 54.458  -8.625  21.973 1.00 116.10 ? 71  THR F C     1 
ATOM   9875  O O     . THR J 3 77  ? 54.743  -8.241  20.831 1.00 116.86 ? 71  THR F O     1 
ATOM   9876  C CB    . THR J 3 77  ? 52.619  -10.368 22.045 1.00 122.19 ? 71  THR F CB    1 
ATOM   9877  O OG1   . THR J 3 77  ? 51.294  -10.628 22.516 1.00 121.69 ? 71  THR F OG1   1 
ATOM   9878  C CG2   . THR J 3 77  ? 53.576  -11.366 22.712 1.00 127.26 ? 71  THR F CG2   1 
ATOM   9879  N N     . LEU J 3 78  ? 55.366  -8.817  22.927 1.00 116.20 ? 72  LEU F N     1 
ATOM   9880  C CA    . LEU J 3 78  ? 56.799  -8.753  22.659 1.00 118.38 ? 72  LEU F CA    1 
ATOM   9881  C C     . LEU J 3 78  ? 57.262  -9.911  21.772 1.00 125.91 ? 72  LEU F C     1 
ATOM   9882  O O     . LEU J 3 78  ? 56.752  -11.032 21.871 1.00 130.02 ? 72  LEU F O     1 
ATOM   9883  C CB    . LEU J 3 78  ? 57.589  -8.782  23.969 1.00 117.73 ? 72  LEU F CB    1 
ATOM   9884  C CG    . LEU J 3 78  ? 57.454  -7.633  24.966 1.00 110.53 ? 72  LEU F CG    1 
ATOM   9885  C CD1   . LEU J 3 78  ? 57.847  -8.117  26.345 1.00 111.33 ? 72  LEU F CD1   1 
ATOM   9886  C CD2   . LEU J 3 78  ? 58.305  -6.450  24.550 1.00 107.36 ? 72  LEU F CD2   1 
ATOM   9887  N N     . THR J 3 79  ? 58.227  -9.621  20.905 1.00 128.16 ? 73  THR F N     1 
ATOM   9888  C CA    . THR J 3 79  ? 58.915  -10.641 20.120 1.00 135.88 ? 73  THR F CA    1 
ATOM   9889  C C     . THR J 3 79  ? 60.262  -10.932 20.784 1.00 139.39 ? 73  THR F C     1 
ATOM   9890  O O     . THR J 3 79  ? 60.729  -10.142 21.603 1.00 135.25 ? 73  THR F O     1 
ATOM   9891  C CB    . THR J 3 79  ? 59.154  -10.178 18.668 1.00 137.52 ? 73  THR F CB    1 
ATOM   9892  O OG1   . THR J 3 79  ? 60.024  -9.040  18.656 1.00 134.32 ? 73  THR F OG1   1 
ATOM   9893  C CG2   . THR J 3 79  ? 57.845  -9.823  17.985 1.00 134.05 ? 73  THR F CG2   1 
ATOM   9894  N N     . ASP J 3 80  ? 60.887  -12.054 20.431 1.00 147.48 ? 74  ASP F N     1 
ATOM   9895  C CA    . ASP J 3 80  ? 62.197  -12.412 20.985 1.00 152.01 ? 74  ASP F CA    1 
ATOM   9896  C C     . ASP J 3 80  ? 63.140  -11.207 21.029 1.00 148.84 ? 74  ASP F C     1 
ATOM   9897  O O     . ASP J 3 80  ? 63.802  -10.964 22.040 1.00 147.55 ? 74  ASP F O     1 
ATOM   9898  C CB    . ASP J 3 80  ? 62.834  -13.564 20.193 1.00 161.74 ? 74  ASP F CB    1 
ATOM   9899  N N     . SER J 3 81  ? 63.169  -10.451 19.931 1.00 147.99 ? 75  SER F N     1 
ATOM   9900  C CA    . SER J 3 81  ? 64.012  -9.264  19.803 1.00 145.81 ? 75  SER F CA    1 
ATOM   9901  C C     . SER J 3 81  ? 63.690  -8.238  20.881 1.00 137.76 ? 75  SER F C     1 
ATOM   9902  O O     . SER J 3 81  ? 64.592  -7.710  21.538 1.00 137.22 ? 75  SER F O     1 
ATOM   9903  C CB    . SER J 3 81  ? 63.841  -8.642  18.413 1.00 146.29 ? 75  SER F CB    1 
ATOM   9904  O OG    . SER J 3 81  ? 64.698  -7.526  18.241 1.00 145.34 ? 75  SER F OG    1 
ATOM   9905  N N     . GLY J 3 82  ? 62.399  -7.972  21.058 1.00 132.12 ? 76  GLY F N     1 
ATOM   9906  C CA    . GLY J 3 82  ? 61.926  -7.014  22.045 1.00 124.68 ? 76  GLY F CA    1 
ATOM   9907  C C     . GLY J 3 82  ? 62.256  -7.395  23.475 1.00 124.29 ? 76  GLY F C     1 
ATOM   9908  O O     . GLY J 3 82  ? 62.638  -6.537  24.269 1.00 120.71 ? 76  GLY F O     1 
ATOM   9909  N N     . LYS J 3 83  ? 62.106  -8.678  23.804 1.00 128.66 ? 77  LYS F N     1 
ATOM   9910  C CA    . LYS J 3 83  ? 62.378  -9.175  25.155 1.00 129.27 ? 77  LYS F CA    1 
ATOM   9911  C C     . LYS J 3 83  ? 63.819  -8.864  25.546 1.00 131.47 ? 77  LYS F C     1 
ATOM   9912  O O     . LYS J 3 83  ? 64.075  -8.365  26.644 1.00 128.23 ? 77  LYS F O     1 
ATOM   9913  C CB    . LYS J 3 83  ? 62.097  -10.682 25.267 1.00 135.41 ? 77  LYS F CB    1 
ATOM   9914  C CG    . LYS J 3 83  ? 60.799  -11.135 24.596 1.00 135.31 ? 77  LYS F CG    1 
ATOM   9915  C CD    . LYS J 3 83  ? 60.259  -12.455 25.141 1.00 139.62 ? 77  LYS F CD    1 
ATOM   9916  C CE    . LYS J 3 83  ? 59.288  -12.222 26.296 1.00 134.81 ? 77  LYS F CE    1 
ATOM   9917  N NZ    . LYS J 3 83  ? 58.341  -13.357 26.479 1.00 138.42 ? 77  LYS F NZ    1 
ATOM   9918  N N     . GLN J 3 84  ? 64.744  -9.143  24.626 1.00 137.25 ? 78  GLN F N     1 
ATOM   9919  C CA    . GLN J 3 84  ? 66.164  -8.821  24.797 1.00 140.53 ? 78  GLN F CA    1 
ATOM   9920  C C     . GLN J 3 84  ? 66.398  -7.306  24.858 1.00 134.90 ? 78  GLN F C     1 
ATOM   9921  O O     . GLN J 3 84  ? 67.195  -6.834  25.672 1.00 134.61 ? 78  GLN F O     1 
ATOM   9922  C CB    . GLN J 3 84  ? 67.011  -9.486  23.693 1.00 148.73 ? 78  GLN F CB    1 
ATOM   9923  C CG    . GLN J 3 84  ? 68.372  -8.843  23.411 1.00 151.86 ? 78  GLN F CG    1 
ATOM   9924  C CD    . GLN J 3 84  ? 69.388  -9.071  24.517 1.00 154.86 ? 78  GLN F CD    1 
ATOM   9925  O OE1   . GLN J 3 84  ? 70.056  -10.106 24.561 1.00 162.18 ? 78  GLN F OE1   1 
ATOM   9926  N NE2   . GLN J 3 84  ? 69.527  -8.089  25.403 1.00 148.78 ? 78  GLN F NE2   1 
ATOM   9927  N N     . GLU J 3 85  ? 65.693  -6.553  24.013 1.00 130.93 ? 79  GLU F N     1 
ATOM   9928  C CA    . GLU J 3 85  ? 65.836  -5.095  23.959 1.00 126.09 ? 79  GLU F CA    1 
ATOM   9929  C C     . GLU J 3 85  ? 65.477  -4.445  25.294 1.00 119.71 ? 79  GLU F C     1 
ATOM   9930  O O     . GLU J 3 85  ? 66.088  -3.451  25.692 1.00 117.74 ? 79  GLU F O     1 
ATOM   9931  C CB    . GLU J 3 85  ? 64.984  -4.505  22.823 1.00 123.59 ? 79  GLU F CB    1 
ATOM   9932  C CG    . GLU J 3 85  ? 65.310  -3.051  22.465 1.00 121.39 ? 79  GLU F CG    1 
ATOM   9933  C CD    . GLU J 3 85  ? 66.669  -2.900  21.802 1.00 129.07 ? 79  GLU F CD    1 
ATOM   9934  O OE1   . GLU J 3 85  ? 66.852  -3.420  20.684 1.00 134.44 ? 79  GLU F OE1   1 
ATOM   9935  O OE2   . GLU J 3 85  ? 67.562  -2.261  22.400 1.00 130.15 ? 79  GLU F OE2   1 
ATOM   9936  N N     . LEU J 3 86  ? 64.490  -5.020  25.976 1.00 117.16 ? 80  LEU F N     1 
ATOM   9937  C CA    . LEU J 3 86  ? 64.061  -4.550  27.293 1.00 112.00 ? 80  LEU F CA    1 
ATOM   9938  C C     . LEU J 3 86  ? 65.070  -4.916  28.376 1.00 114.95 ? 80  LEU F C     1 
ATOM   9939  O O     . LEU J 3 86  ? 65.508  -4.050  29.134 1.00 112.19 ? 80  LEU F O     1 
ATOM   9940  C CB    . LEU J 3 86  ? 62.678  -5.116  27.643 1.00 109.54 ? 80  LEU F CB    1 
ATOM   9941  C CG    . LEU J 3 86  ? 62.155  -4.976  29.081 1.00 105.80 ? 80  LEU F CG    1 
ATOM   9942  C CD1   . LEU J 3 86  ? 61.872  -3.520  29.454 1.00 99.12  ? 80  LEU F CD1   1 
ATOM   9943  C CD2   . LEU J 3 86  ? 60.913  -5.829  29.278 1.00 105.88 ? 80  LEU F CD2   1 
ATOM   9944  N N     . HIS J 3 87  ? 65.420  -6.202  28.436 1.00 121.00 ? 81  HIS F N     1 
ATOM   9945  C CA    . HIS J 3 87  ? 66.373  -6.731  29.410 1.00 125.30 ? 81  HIS F CA    1 
ATOM   9946  C C     . HIS J 3 87  ? 67.700  -5.976  29.391 1.00 127.13 ? 81  HIS F C     1 
ATOM   9947  O O     . HIS J 3 87  ? 68.267  -5.708  30.449 1.00 126.89 ? 81  HIS F O     1 
ATOM   9948  C CB    . HIS J 3 87  ? 66.598  -8.232  29.176 1.00 132.77 ? 81  HIS F CB    1 
ATOM   9949  C CG    . HIS J 3 87  ? 67.608  -8.854  30.095 1.00 138.39 ? 81  HIS F CG    1 
ATOM   9950  N ND1   . HIS J 3 87  ? 67.304  -9.247  31.381 1.00 138.37 ? 81  HIS F ND1   1 
ATOM   9951  C CD2   . HIS J 3 87  ? 68.913  -9.167  29.907 1.00 145.17 ? 81  HIS F CD2   1 
ATOM   9952  C CE1   . HIS J 3 87  ? 68.380  -9.765  31.949 1.00 144.01 ? 81  HIS F CE1   1 
ATOM   9953  N NE2   . HIS J 3 87  ? 69.370  -9.728  31.075 1.00 148.15 ? 81  HIS F NE2   1 
ATOM   9954  N N     . ASP J 3 88  ? 68.182  -5.623  28.199 1.00 129.46 ? 82  ASP F N     1 
ATOM   9955  C CA    . ASP J 3 88  ? 69.479  -4.945  28.064 1.00 132.68 ? 82  ASP F CA    1 
ATOM   9956  C C     . ASP J 3 88  ? 69.413  -3.496  28.541 1.00 126.60 ? 82  ASP F C     1 
ATOM   9957  O O     . ASP J 3 88  ? 70.386  -2.966  29.080 1.00 128.45 ? 82  ASP F O     1 
ATOM   9958  C CB    . ASP J 3 88  ? 70.017  -5.029  26.628 1.00 137.84 ? 82  ASP F CB    1 
ATOM   9959  N N     . TRP J 3 89  ? 68.258  -2.873  28.346 1.00 120.20 ? 83  TRP F N     1 
ATOM   9960  C CA    . TRP J 3 89  ? 67.990  -1.541  28.870 1.00 114.16 ? 83  TRP F CA    1 
ATOM   9961  C C     . TRP J 3 89  ? 67.845  -1.572  30.395 1.00 111.84 ? 83  TRP F C     1 
ATOM   9962  O O     . TRP J 3 89  ? 68.346  -0.685  31.094 1.00 110.38 ? 83  TRP F O     1 
ATOM   9963  C CB    . TRP J 3 89  ? 66.729  -0.974  28.218 1.00 108.69 ? 83  TRP F CB    1 
ATOM   9964  C CG    . TRP J 3 89  ? 66.273  0.319   28.809 1.00 102.24 ? 83  TRP F CG    1 
ATOM   9965  C CD1   . TRP J 3 89  ? 66.837  1.546   28.627 1.00 101.38 ? 83  TRP F CD1   1 
ATOM   9966  C CD2   . TRP J 3 89  ? 65.159  0.514   29.683 1.00 96.08  ? 83  TRP F CD2   1 
ATOM   9967  N NE1   . TRP J 3 89  ? 66.144  2.496   29.334 1.00 95.35  ? 83  TRP F NE1   1 
ATOM   9968  C CE2   . TRP J 3 89  ? 65.109  1.891   29.993 1.00 92.31  ? 83  TRP F CE2   1 
ATOM   9969  C CE3   . TRP J 3 89  ? 64.197  -0.340  30.236 1.00 94.57  ? 83  TRP F CE3   1 
ATOM   9970  C CZ2   . TRP J 3 89  ? 64.132  2.439   30.829 1.00 86.86  ? 83  TRP F CZ2   1 
ATOM   9971  C CZ3   . TRP J 3 89  ? 63.224  0.203   31.067 1.00 90.07  ? 83  TRP F CZ3   1 
ATOM   9972  C CH2   . TRP J 3 89  ? 63.204  1.581   31.357 1.00 86.09  ? 83  TRP F CH2   1 
ATOM   9973  N N     . LEU J 3 90  ? 67.158  -2.596  30.900 1.00 112.03 ? 84  LEU F N     1 
ATOM   9974  C CA    . LEU J 3 90  ? 66.958  -2.770  32.337 1.00 110.54 ? 84  LEU F CA    1 
ATOM   9975  C C     . LEU J 3 90  ? 68.275  -2.868  33.098 1.00 115.14 ? 84  LEU F C     1 
ATOM   9976  O O     . LEU J 3 90  ? 68.451  -2.210  34.125 1.00 113.12 ? 84  LEU F O     1 
ATOM   9977  C CB    . LEU J 3 90  ? 66.096  -4.007  32.620 1.00 111.56 ? 84  LEU F CB    1 
ATOM   9978  C CG    . LEU J 3 90  ? 64.576  -3.882  32.473 1.00 106.09 ? 84  LEU F CG    1 
ATOM   9979  C CD1   . LEU J 3 90  ? 63.892  -5.222  32.687 1.00 108.08 ? 84  LEU F CD1   1 
ATOM   9980  C CD2   . LEU J 3 90  ? 64.020  -2.855  33.441 1.00 100.47 ? 84  LEU F CD2   1 
ATOM   9981  N N     . ILE J 3 91  ? 69.201  -3.669  32.577 1.00 121.97 ? 85  ILE F N     1 
ATOM   9982  C CA    . ILE J 3 91  ? 70.456  -3.978  33.261 1.00 127.59 ? 85  ILE F CA    1 
ATOM   9983  C C     . ILE J 3 91  ? 71.557  -2.934  33.042 1.00 129.11 ? 85  ILE F C     1 
ATOM   9984  O O     . ILE J 3 91  ? 72.633  -3.032  33.630 1.00 133.71 ? 85  ILE F O     1 
ATOM   9985  C CB    . ILE J 3 91  ? 70.977  -5.370  32.848 1.00 135.01 ? 85  ILE F CB    1 
ATOM   9986  N N     . ARG J 3 92  ? 71.284  -1.936  32.206 1.00 126.13 ? 86  ARG F N     1 
ATOM   9987  C CA    . ARG J 3 92  ? 72.266  -0.897  31.894 1.00 128.19 ? 86  ARG F CA    1 
ATOM   9988  C C     . ARG J 3 92  ? 72.273  0.207   32.946 1.00 124.21 ? 86  ARG F C     1 
ATOM   9989  O O     . ARG J 3 92  ? 71.220  0.692   33.357 1.00 118.17 ? 86  ARG F O     1 
ATOM   9990  C CB    . ARG J 3 92  ? 71.995  -0.301  30.509 1.00 127.23 ? 86  ARG F CB    1 
ATOM   9991  N N     . HIS J 3 93  ? 73.464  0.600   33.378 1.00 105.71 ? 87  HIS F N     1 
ATOM   9992  C CA    . HIS J 3 93  ? 73.605  1.673   34.354 1.00 102.67 ? 87  HIS F CA    1 
ATOM   9993  C C     . HIS J 3 93  ? 73.651  3.020   33.652 1.00 101.48 ? 87  HIS F C     1 
ATOM   9994  O O     . HIS J 3 93  ? 74.660  3.390   33.044 1.00 104.34 ? 87  HIS F O     1 
ATOM   9995  C CB    . HIS J 3 93  ? 74.859  1.485   35.221 1.00 104.92 ? 87  HIS F CB    1 
ATOM   9996  C CG    . HIS J 3 93  ? 74.934  0.154   35.903 1.00 107.32 ? 87  HIS F CG    1 
ATOM   9997  N ND1   . HIS J 3 93  ? 76.114  -0.546  36.035 1.00 111.83 ? 87  HIS F ND1   1 
ATOM   9998  C CD2   . HIS J 3 93  ? 73.976  -0.610  36.479 1.00 106.29 ? 87  HIS F CD2   1 
ATOM   9999  C CE1   . HIS J 3 93  ? 75.881  -1.680  36.672 1.00 113.39 ? 87  HIS F CE1   1 
ATOM   10000 N NE2   . HIS J 3 93  ? 74.591  -1.745  36.950 1.00 109.90 ? 87  HIS F NE2   1 
ATOM   10001 N N     . GLN J 3 94  ? 72.544  3.745   33.734 1.00 97.74  ? 88  GLN F N     1 
ATOM   10002 C CA    . GLN J 3 94  ? 72.469  5.094   33.200 1.00 96.49  ? 88  GLN F CA    1 
ATOM   10003 C C     . GLN J 3 94  ? 72.906  6.088   34.269 1.00 94.19  ? 88  GLN F C     1 
ATOM   10004 O O     . GLN J 3 94  ? 72.657  5.864   35.456 1.00 92.43  ? 88  GLN F O     1 
ATOM   10005 C CB    . GLN J 3 94  ? 71.046  5.392   32.734 1.00 93.95  ? 88  GLN F CB    1 
ATOM   10006 C CG    . GLN J 3 94  ? 70.695  4.731   31.410 1.00 97.45  ? 88  GLN F CG    1 
ATOM   10007 C CD    . GLN J 3 94  ? 69.420  3.910   31.473 1.00 97.01  ? 88  GLN F CD    1 
ATOM   10008 O OE1   . GLN J 3 94  ? 69.415  2.729   31.113 1.00 100.07 ? 88  GLN F OE1   1 
ATOM   10009 N NE2   . GLN J 3 94  ? 68.334  4.523   31.937 1.00 92.90  ? 88  GLN F NE2   1 
ATOM   10010 N N     . PRO J 3 95  ? 73.584  7.179   33.860 1.00 94.77  ? 89  PRO F N     1 
ATOM   10011 C CA    . PRO J 3 95  ? 73.874  8.266   34.801 1.00 92.60  ? 89  PRO F CA    1 
ATOM   10012 C C     . PRO J 3 95  ? 72.601  8.796   35.458 1.00 88.07  ? 89  PRO F C     1 
ATOM   10013 O O     . PRO J 3 95  ? 71.518  8.686   34.882 1.00 86.76  ? 89  PRO F O     1 
ATOM   10014 C CB    . PRO J 3 95  ? 74.496  9.356   33.915 1.00 94.13  ? 89  PRO F CB    1 
ATOM   10015 C CG    . PRO J 3 95  ? 74.382  8.860   32.493 1.00 97.00  ? 89  PRO F CG    1 
ATOM   10016 C CD    . PRO J 3 95  ? 74.263  7.380   32.570 1.00 98.29  ? 89  PRO F CD    1 
ATOM   10017 N N     . ILE J 3 96  ? 72.731  9.350   36.658 1.00 86.02  ? 90  ILE F N     1 
ATOM   10018 C CA    . ILE J 3 96  ? 71.598  9.994   37.313 1.00 82.12  ? 90  ILE F CA    1 
ATOM   10019 C C     . ILE J 3 96  ? 71.437  11.424  36.779 1.00 80.62  ? 90  ILE F C     1 
ATOM   10020 O O     . ILE J 3 96  ? 72.423  12.136  36.609 1.00 82.26  ? 90  ILE F O     1 
ATOM   10021 C CB    . ILE J 3 96  ? 71.710  9.962   38.865 1.00 81.20  ? 90  ILE F CB    1 
ATOM   10022 C CG1   . ILE J 3 96  ? 72.819  10.891  39.374 1.00 82.73  ? 90  ILE F CG1   1 
ATOM   10023 C CG2   . ILE J 3 96  ? 71.958  8.533   39.358 1.00 82.74  ? 90  ILE F CG2   1 
ATOM   10024 C CD1   . ILE J 3 96  ? 72.384  11.765  40.549 1.00 81.56  ? 90  ILE F CD1   1 
ATOM   10025 N N     . PRO J 3 97  ? 70.198  11.838  36.481 1.00 77.97  ? 91  PRO F N     1 
ATOM   10026 C CA    . PRO J 3 97  ? 70.006  13.195  35.952 1.00 77.09  ? 91  PRO F CA    1 
ATOM   10027 C C     . PRO J 3 97  ? 70.462  14.308  36.902 1.00 75.97  ? 91  PRO F C     1 
ATOM   10028 O O     . PRO J 3 97  ? 70.274  14.217  38.120 1.00 74.44  ? 91  PRO F O     1 
ATOM   10029 C CB    . PRO J 3 97  ? 68.485  13.282  35.715 1.00 74.27  ? 91  PRO F CB    1 
ATOM   10030 C CG    . PRO J 3 97  ? 67.899  12.133  36.458 1.00 73.35  ? 91  PRO F CG    1 
ATOM   10031 C CD    . PRO J 3 97  ? 68.943  11.065  36.484 1.00 76.36  ? 91  PRO F CD    1 
ATOM   10032 N N     . GLU J 3 98  ? 71.057  15.349  36.328 1.00 77.03  ? 92  GLU F N     1 
ATOM   10033 C CA    . GLU J 3 98  ? 71.417  16.546  37.077 1.00 76.28  ? 92  GLU F CA    1 
ATOM   10034 C C     . GLU J 3 98  ? 70.177  17.318  37.503 1.00 73.08  ? 92  GLU F C     1 
ATOM   10035 O O     . GLU J 3 98  ? 70.168  17.926  38.572 1.00 72.31  ? 92  GLU F O     1 
ATOM   10036 C CB    . GLU J 3 98  ? 72.331  17.445  36.239 1.00 79.25  ? 92  GLU F CB    1 
ATOM   10037 N N     . THR J 3 99  ? 69.133  17.267  36.675 1.00 71.43  ? 93  THR F N     1 
ATOM   10038 C CA    . THR J 3 99  ? 67.925  18.064  36.870 1.00 68.62  ? 93  THR F CA    1 
ATOM   10039 C C     . THR J 3 99  ? 66.662  17.204  36.906 1.00 66.65  ? 93  THR F C     1 
ATOM   10040 O O     . THR J 3 99  ? 66.474  16.322  36.056 1.00 67.46  ? 93  THR F O     1 
ATOM   10041 C CB    . THR J 3 99  ? 67.771  19.105  35.727 1.00 69.69  ? 93  THR F CB    1 
ATOM   10042 O OG1   . THR J 3 99  ? 68.973  19.875  35.622 1.00 72.11  ? 93  THR F OG1   1 
ATOM   10043 C CG2   . THR J 3 99  ? 66.592  20.052  35.974 1.00 67.47  ? 93  THR F CG2   1 
ATOM   10044 N N     . VAL J 3 100 ? 65.806  17.471  37.896 1.00 64.05  ? 94  VAL F N     1 
ATOM   10045 C CA    . VAL J 3 100 ? 64.431  16.969  37.922 1.00 62.06  ? 94  VAL F CA    1 
ATOM   10046 C C     . VAL J 3 100 ? 63.507  18.172  38.081 1.00 61.12  ? 94  VAL F C     1 
ATOM   10047 O O     . VAL J 3 100 ? 63.430  18.774  39.150 1.00 60.33  ? 94  VAL F O     1 
ATOM   10048 C CB    . VAL J 3 100 ? 64.182  15.961  39.066 1.00 61.13  ? 94  VAL F CB    1 
ATOM   10049 C CG1   . VAL J 3 100 ? 62.861  15.253  38.863 1.00 58.95  ? 94  VAL F CG1   1 
ATOM   10050 C CG2   . VAL J 3 100 ? 65.315  14.943  39.159 1.00 62.07  ? 94  VAL F CG2   1 
ATOM   10051 N N     . LYS J 3 101 ? 62.811  18.510  37.003 1.00 61.82  ? 95  LYS F N     1 
ATOM   10052 C CA    . LYS J 3 101 ? 62.069  19.769  36.891 1.00 61.61  ? 95  LYS F CA    1 
ATOM   10053 C C     . LYS J 3 101 ? 60.876  19.884  37.838 1.00 60.20  ? 95  LYS F C     1 
ATOM   10054 O O     . LYS J 3 101 ? 60.037  18.987  37.914 1.00 59.90  ? 95  LYS F O     1 
ATOM   10055 C CB    . LYS J 3 101 ? 61.655  20.015  35.432 1.00 62.83  ? 95  LYS F CB    1 
ATOM   10056 C CG    . LYS J 3 101 ? 62.833  20.350  34.494 1.00 64.75  ? 95  LYS F CG    1 
ATOM   10057 C CD    . LYS J 3 101 ? 62.364  20.686  33.080 1.00 66.88  ? 95  LYS F CD    1 
ATOM   10058 C CE    . LYS J 3 101 ? 63.519  21.152  32.192 1.00 69.52  ? 95  LYS F CE    1 
ATOM   10059 N NZ    . LYS J 3 101 ? 63.233  21.036  30.732 1.00 70.91  ? 95  LYS F NZ    1 
ATOM   10060 N N     . ASP J 3 102 ? 60.824  20.996  38.563 1.00 60.06  ? 96  ASP F N     1 
ATOM   10061 C CA    . ASP J 3 102 ? 59.750  21.280  39.512 1.00 58.99  ? 96  ASP F CA    1 
ATOM   10062 C C     . ASP J 3 102 ? 59.485  22.778  39.473 1.00 59.60  ? 96  ASP F C     1 
ATOM   10063 O O     . ASP J 3 102 ? 60.252  23.563  40.057 1.00 60.34  ? 96  ASP F O     1 
ATOM   10064 C CB    . ASP J 3 102 ? 60.155  20.851  40.927 1.00 58.28  ? 96  ASP F CB    1 
ATOM   10065 C CG    . ASP J 3 102 ? 59.003  20.926  41.928 1.00 58.26  ? 96  ASP F CG    1 
ATOM   10066 O OD1   . ASP J 3 102 ? 57.915  21.436  41.580 1.00 59.34  ? 96  ASP F OD1   1 
ATOM   10067 O OD2   . ASP J 3 102 ? 59.186  20.468  43.080 1.00 58.60  ? 96  ASP F OD2   1 
ATOM   10068 N N     . GLU J 3 103 ? 58.406  23.164  38.794 1.00 59.44  ? 97  GLU F N     1 
ATOM   10069 C CA    . GLU J 3 103 ? 58.072  24.569  38.579 1.00 60.67  ? 97  GLU F CA    1 
ATOM   10070 C C     . GLU J 3 103 ? 57.775  25.328  39.875 1.00 60.52  ? 97  GLU F C     1 
ATOM   10071 O O     . GLU J 3 103 ? 57.938  26.550  39.935 1.00 62.00  ? 97  GLU F O     1 
ATOM   10072 C CB    . GLU J 3 103 ? 56.898  24.676  37.622 1.00 61.44  ? 97  GLU F CB    1 
ATOM   10073 C CG    . GLU J 3 103 ? 56.472  26.091  37.245 1.00 64.49  ? 97  GLU F CG    1 
ATOM   10074 C CD    . GLU J 3 103 ? 55.283  26.080  36.299 1.00 67.98  ? 97  GLU F CD    1 
ATOM   10075 O OE1   . GLU J 3 103 ? 54.747  24.980  36.048 1.00 68.67  ? 97  GLU F OE1   1 
ATOM   10076 O OE2   . GLU J 3 103 ? 54.885  27.154  35.797 1.00 70.95  ? 97  GLU F OE2   1 
ATOM   10077 N N     . PHE J 3 104 ? 57.347  24.620  40.915 1.00 59.19  ? 98  PHE F N     1 
ATOM   10078 C CA    . PHE J 3 104 ? 57.189  25.266  42.205 1.00 59.21  ? 98  PHE F CA    1 
ATOM   10079 C C     . PHE J 3 104 ? 58.535  25.638  42.840 1.00 59.81  ? 98  PHE F C     1 
ATOM   10080 O O     . PHE J 3 104 ? 58.648  26.700  43.454 1.00 61.16  ? 98  PHE F O     1 
ATOM   10081 C CB    . PHE J 3 104 ? 56.358  24.429  43.173 1.00 58.26  ? 98  PHE F CB    1 
ATOM   10082 C CG    . PHE J 3 104 ? 56.212  25.062  44.518 1.00 58.94  ? 98  PHE F CG    1 
ATOM   10083 C CD1   . PHE J 3 104 ? 55.172  25.940  44.772 1.00 59.21  ? 98  PHE F CD1   1 
ATOM   10084 C CD2   . PHE J 3 104 ? 57.142  24.810  45.527 1.00 58.46  ? 98  PHE F CD2   1 
ATOM   10085 C CE1   . PHE J 3 104 ? 55.041  26.537  46.015 1.00 60.23  ? 98  PHE F CE1   1 
ATOM   10086 C CE2   . PHE J 3 104 ? 57.017  25.401  46.766 1.00 59.30  ? 98  PHE F CE2   1 
ATOM   10087 C CZ    . PHE J 3 104 ? 55.964  26.266  47.013 1.00 60.56  ? 98  PHE F CZ    1 
ATOM   10088 N N     . MET J 3 105 ? 59.544  24.778  42.713 1.00 59.13  ? 99  MET F N     1 
ATOM   10089 C CA    . MET J 3 105 ? 60.862  25.104  43.274 1.00 59.96  ? 99  MET F CA    1 
ATOM   10090 C C     . MET J 3 105 ? 61.508  26.275  42.542 1.00 61.39  ? 99  MET F C     1 
ATOM   10091 O O     . MET J 3 105 ? 62.183  27.092  43.155 1.00 62.84  ? 99  MET F O     1 
ATOM   10092 C CB    . MET J 3 105 ? 61.798  23.894  43.292 1.00 59.49  ? 99  MET F CB    1 
ATOM   10093 C CG    . MET J 3 105 ? 61.451  22.853  44.336 1.00 58.78  ? 99  MET F CG    1 
ATOM   10094 S SD    . MET J 3 105 ? 61.150  23.547  45.978 1.00 61.55  ? 99  MET F SD    1 
ATOM   10095 C CE    . MET J 3 105 ? 62.754  24.263  46.361 1.00 61.32  ? 99  MET F CE    1 
ATOM   10096 N N     . LEU J 3 106 ? 61.278  26.360  41.235 1.00 61.62  ? 100 LEU F N     1 
ATOM   10097 C CA    . LEU J 3 106 ? 61.689  27.517  40.448 1.00 63.25  ? 100 LEU F CA    1 
ATOM   10098 C C     . LEU J 3 106 ? 61.133  28.797  41.064 1.00 64.27  ? 100 LEU F C     1 
ATOM   10099 O O     . LEU J 3 106 ? 61.862  29.775  41.242 1.00 65.99  ? 100 LEU F O     1 
ATOM   10100 C CB    . LEU J 3 106 ? 61.223  27.369  39.003 1.00 63.43  ? 100 LEU F CB    1 
ATOM   10101 C CG    . LEU J 3 106 ? 61.536  28.475  37.992 1.00 65.65  ? 100 LEU F CG    1 
ATOM   10102 C CD1   . LEU J 3 106 ? 63.028  28.669  37.806 1.00 66.62  ? 100 LEU F CD1   1 
ATOM   10103 C CD2   . LEU J 3 106 ? 60.862  28.157  36.654 1.00 65.56  ? 100 LEU F CD2   1 
ATOM   10104 N N     . LYS J 3 107 ? 59.847  28.782  41.402 1.00 63.44  ? 101 LYS F N     1 
ATOM   10105 C CA    . LYS J 3 107 ? 59.251  29.899  42.124 1.00 64.60  ? 101 LYS F CA    1 
ATOM   10106 C C     . LYS J 3 107 ? 59.977  30.097  43.452 1.00 65.09  ? 101 LYS F C     1 
ATOM   10107 O O     . LYS J 3 107 ? 60.455  31.192  43.745 1.00 67.05  ? 101 LYS F O     1 
ATOM   10108 C CB    . LYS J 3 107 ? 57.757  29.679  42.363 1.00 63.89  ? 101 LYS F CB    1 
ATOM   10109 C CG    . LYS J 3 107 ? 56.870  29.824  41.145 1.00 64.06  ? 101 LYS F CG    1 
ATOM   10110 C CD    . LYS J 3 107 ? 55.422  29.643  41.558 1.00 64.04  ? 101 LYS F CD    1 
ATOM   10111 C CE    . LYS J 3 107 ? 54.469  29.762  40.399 1.00 64.64  ? 101 LYS F CE    1 
ATOM   10112 N NZ    . LYS J 3 107 ? 53.076  29.540  40.874 1.00 65.91  ? 101 LYS F NZ    1 
ATOM   10113 N N     . ALA J 3 108 ? 60.086  29.026  44.234 1.00 63.63  ? 102 ALA F N     1 
ATOM   10114 C CA    . ALA J 3 108 ? 60.714  29.096  45.549 1.00 64.34  ? 102 ALA F CA    1 
ATOM   10115 C C     . ALA J 3 108 ? 61.997  29.919  45.509 1.00 66.05  ? 102 ALA F C     1 
ATOM   10116 O O     . ALA J 3 108 ? 62.263  30.696  46.424 1.00 68.04  ? 102 ALA F O     1 
ATOM   10117 C CB    . ALA J 3 108 ? 60.984  27.706  46.091 1.00 62.93  ? 102 ALA F CB    1 
ATOM   10118 N N     . TYR J 3 109 ? 62.758  29.761  44.428 1.00 65.67  ? 103 TYR F N     1 
ATOM   10119 C CA    . TYR J 3 109 ? 64.048  30.423  44.233 1.00 67.36  ? 103 TYR F CA    1 
ATOM   10120 C C     . TYR J 3 109 ? 63.925  31.941  44.037 1.00 69.63  ? 103 TYR F C     1 
ATOM   10121 O O     . TYR J 3 109 ? 64.859  32.691  44.350 1.00 71.87  ? 103 TYR F O     1 
ATOM   10122 C CB    . TYR J 3 109 ? 64.761  29.770  43.053 1.00 66.79  ? 103 TYR F CB    1 
ATOM   10123 C CG    . TYR J 3 109 ? 66.178  30.228  42.796 1.00 69.17  ? 103 TYR F CG    1 
ATOM   10124 C CD1   . TYR J 3 109 ? 67.204  29.969  43.713 1.00 69.45  ? 103 TYR F CD1   1 
ATOM   10125 C CD2   . TYR J 3 109 ? 66.504  30.891  41.613 1.00 70.04  ? 103 TYR F CD2   1 
ATOM   10126 C CE1   . TYR J 3 109 ? 68.510  30.383  43.457 1.00 71.77  ? 103 TYR F CE1   1 
ATOM   10127 C CE2   . TYR J 3 109 ? 67.808  31.306  41.352 1.00 72.16  ? 103 TYR F CE2   1 
ATOM   10128 C CZ    . TYR J 3 109 ? 68.802  31.049  42.272 1.00 72.99  ? 103 TYR F CZ    1 
ATOM   10129 O OH    . TYR J 3 109 ? 70.084  31.464  41.999 1.00 75.75  ? 103 TYR F OH    1 
ATOM   10130 N N     . PHE J 3 110 ? 62.766  32.389  43.551 1.00 69.25  ? 104 PHE F N     1 
ATOM   10131 C CA    . PHE J 3 110 ? 62.510  33.820  43.342 1.00 71.53  ? 104 PHE F CA    1 
ATOM   10132 C C     . PHE J 3 110 ? 61.654  34.434  44.449 1.00 72.22  ? 104 PHE F C     1 
ATOM   10133 O O     . PHE J 3 110 ? 60.908  35.385  44.218 1.00 73.64  ? 104 PHE F O     1 
ATOM   10134 C CB    . PHE J 3 110 ? 61.855  34.064  41.981 1.00 71.52  ? 104 PHE F CB    1 
ATOM   10135 C CG    . PHE J 3 110 ? 62.595  33.452  40.834 1.00 71.11  ? 104 PHE F CG    1 
ATOM   10136 C CD1   . PHE J 3 110 ? 63.960  33.651  40.682 1.00 72.66  ? 104 PHE F CD1   1 
ATOM   10137 C CD2   . PHE J 3 110 ? 61.922  32.682  39.896 1.00 69.25  ? 104 PHE F CD2   1 
ATOM   10138 C CE1   . PHE J 3 110 ? 64.641  33.076  39.616 1.00 72.75  ? 104 PHE F CE1   1 
ATOM   10139 C CE2   . PHE J 3 110 ? 62.595  32.107  38.828 1.00 68.74  ? 104 PHE F CE2   1 
ATOM   10140 C CZ    . PHE J 3 110 ? 63.950  32.303  38.687 1.00 70.57  ? 104 PHE F CZ    1 
ATOM   10141 N N     . ILE J 3 111 ? 61.790  33.900  45.656 1.00 71.80  ? 105 ILE F N     1 
ATOM   10142 C CA    . ILE J 3 111 ? 60.972  34.317  46.785 1.00 72.77  ? 105 ILE F CA    1 
ATOM   10143 C C     . ILE J 3 111 ? 61.233  35.767  47.217 1.00 76.34  ? 105 ILE F C     1 
ATOM   10144 O O     . ILE J 3 111 ? 60.383  36.388  47.850 1.00 77.84  ? 105 ILE F O     1 
ATOM   10145 C CB    . ILE J 3 111 ? 61.118  33.316  47.967 1.00 71.91  ? 105 ILE F CB    1 
ATOM   10146 C CG1   . ILE J 3 111 ? 59.995  33.514  49.003 1.00 72.33  ? 105 ILE F CG1   1 
ATOM   10147 C CG2   . ILE J 3 111 ? 62.553  33.351  48.550 1.00 73.41  ? 105 ILE F CG2   1 
ATOM   10148 C CD1   . ILE J 3 111 ? 59.907  32.436  50.064 1.00 71.06  ? 105 ILE F CD1   1 
ATOM   10149 N N     . SER J 3 112 ? 62.393  36.311  46.855 1.00 78.34  ? 106 SER F N     1 
ATOM   10150 C CA    . SER J 3 112 ? 62.717  37.706  47.169 1.00 82.02  ? 106 SER F CA    1 
ATOM   10151 C C     . SER J 3 112 ? 61.724  38.671  46.516 1.00 83.27  ? 106 SER F C     1 
ATOM   10152 O O     . SER J 3 112 ? 61.527  39.790  46.992 1.00 86.26  ? 106 SER F O     1 
ATOM   10153 C CB    . SER J 3 112 ? 64.147  38.044  46.740 1.00 83.72  ? 106 SER F CB    1 
ATOM   10154 O OG    . SER J 3 112 ? 64.212  38.377  45.364 1.00 84.11  ? 106 SER F OG    1 
ATOM   10155 N N     . SER J 3 113 ? 61.105  38.223  45.426 1.00 81.36  ? 107 SER F N     1 
ATOM   10156 C CA    . SER J 3 113 ? 60.110  39.016  44.700 1.00 82.75  ? 107 SER F CA    1 
ATOM   10157 C C     . SER J 3 113 ? 58.705  38.946  45.310 1.00 82.51  ? 107 SER F C     1 
ATOM   10158 O O     . SER J 3 113 ? 57.739  39.441  44.717 1.00 83.42  ? 107 SER F O     1 
ATOM   10159 C CB    . SER J 3 113 ? 60.065  38.602  43.224 1.00 81.30  ? 107 SER F CB    1 
ATOM   10160 O OG    . SER J 3 113 ? 60.995  39.343  42.454 1.00 83.56  ? 107 SER F OG    1 
ATOM   10161 N N     . LEU J 3 114 ? 58.596  38.344  46.492 1.00 81.87  ? 108 LEU F N     1 
ATOM   10162 C CA    . LEU J 3 114 ? 57.312  38.200  47.176 1.00 81.90  ? 108 LEU F CA    1 
ATOM   10163 C C     . LEU J 3 114 ? 57.305  38.883  48.538 1.00 84.81  ? 108 LEU F C     1 
ATOM   10164 O O     . LEU J 3 114 ? 58.355  39.061  49.155 1.00 85.76  ? 108 LEU F O     1 
ATOM   10165 C CB    . LEU J 3 114 ? 56.957  36.719  47.331 1.00 78.57  ? 108 LEU F CB    1 
ATOM   10166 C CG    . LEU J 3 114 ? 56.758  35.915  46.040 1.00 76.21  ? 108 LEU F CG    1 
ATOM   10167 C CD1   . LEU J 3 114 ? 56.688  34.420  46.331 1.00 73.43  ? 108 LEU F CD1   1 
ATOM   10168 C CD2   . LEU J 3 114 ? 55.523  36.374  45.271 1.00 76.12  ? 108 LEU F CD2   1 
ATOM   10169 N N     . SER J 3 115 ? 56.117  39.280  48.988 1.00 86.64  ? 109 SER F N     1 
ATOM   10170 C CA    . SER J 3 115 ? 55.933  39.769  50.354 1.00 89.83  ? 109 SER F CA    1 
ATOM   10171 C C     . SER J 3 115 ? 55.770  38.565  51.277 1.00 88.35  ? 109 SER F C     1 
ATOM   10172 O O     . SER J 3 115 ? 55.548  37.441  50.805 1.00 85.21  ? 109 SER F O     1 
ATOM   10173 C CB    . SER J 3 115 ? 54.712  40.689  50.456 1.00 92.64  ? 109 SER F CB    1 
ATOM   10174 O OG    . SER J 3 115 ? 53.503  39.951  50.406 1.00 91.26  ? 109 SER F OG    1 
ATOM   10175 N N     . ARG J 3 116 ? 55.877  38.800  52.584 1.00 91.03  ? 110 ARG F N     1 
ATOM   10176 C CA    . ARG J 3 116 ? 55.737  37.732  53.575 1.00 90.33  ? 110 ARG F CA    1 
ATOM   10177 C C     . ARG J 3 116 ? 54.357  37.087  53.482 1.00 89.12  ? 110 ARG F C     1 
ATOM   10178 O O     . ARG J 3 116 ? 54.238  35.856  53.497 1.00 86.55  ? 110 ARG F O     1 
ATOM   10179 C CB    . ARG J 3 116 ? 55.995  38.254  54.990 1.00 94.26  ? 110 ARG F CB    1 
ATOM   10180 C CG    . ARG J 3 116 ? 56.601  37.214  55.916 1.00 94.18  ? 110 ARG F CG    1 
ATOM   10181 C CD    . ARG J 3 116 ? 57.026  37.826  57.246 1.00 99.91  ? 110 ARG F CD    1 
ATOM   10182 N NE    . ARG J 3 116 ? 58.125  37.088  57.872 1.00 99.97  ? 110 ARG F NE    1 
ATOM   10183 C CZ    . ARG J 3 116 ? 59.394  37.487  57.877 1.00 101.77 ? 110 ARG F CZ    1 
ATOM   10184 N NH1   . ARG J 3 116 ? 59.747  38.627  57.295 1.00 103.42 ? 110 ARG F NH1   1 
ATOM   10185 N NH2   . ARG J 3 116 ? 60.317  36.747  58.477 1.00 102.64 ? 110 ARG F NH2   1 
ATOM   10186 N N     . GLN J 3 117 ? 53.325  37.922  53.361 1.00 91.24  ? 111 GLN F N     1 
ATOM   10187 C CA    . GLN J 3 117 ? 51.954  37.444  53.205 1.00 90.68  ? 111 GLN F CA    1 
ATOM   10188 C C     . GLN J 3 117 ? 51.783  36.617  51.918 1.00 86.85  ? 111 GLN F C     1 
ATOM   10189 O O     . GLN J 3 117 ? 51.123  35.572  51.929 1.00 84.93  ? 111 GLN F O     1 
ATOM   10190 C CB    . GLN J 3 117 ? 50.968  38.615  53.240 1.00 94.13  ? 111 GLN F CB    1 
ATOM   10191 C CG    . GLN J 3 117 ? 49.525  38.208  53.503 1.00 95.02  ? 111 GLN F CG    1 
ATOM   10192 N N     . GLU J 3 118 ? 52.391  37.081  50.824 1.00 85.94  ? 112 GLU F N     1 
ATOM   10193 C CA    . GLU J 3 118 ? 52.309  36.388  49.530 1.00 82.97  ? 112 GLU F CA    1 
ATOM   10194 C C     . GLU J 3 118 ? 53.018  35.029  49.530 1.00 79.60  ? 112 GLU F C     1 
ATOM   10195 O O     . GLU J 3 118 ? 52.421  34.020  49.161 1.00 77.49  ? 112 GLU F O     1 
ATOM   10196 C CB    . GLU J 3 118 ? 52.830  37.276  48.395 1.00 83.50  ? 112 GLU F CB    1 
ATOM   10197 C CG    . GLU J 3 118 ? 51.830  38.338  47.939 1.00 86.48  ? 112 GLU F CG    1 
ATOM   10198 C CD    . GLU J 3 118 ? 52.444  39.394  47.031 1.00 88.57  ? 112 GLU F CD    1 
ATOM   10199 O OE1   . GLU J 3 118 ? 53.694  39.498  46.966 1.00 88.76  ? 112 GLU F OE1   1 
ATOM   10200 O OE2   . GLU J 3 118 ? 51.666  40.133  46.389 1.00 90.24  ? 112 GLU F OE2   1 
ATOM   10201 N N     . ALA J 3 119 ? 54.278  35.004  49.958 1.00 79.43  ? 113 ALA F N     1 
ATOM   10202 C CA    . ALA J 3 119 ? 55.024  33.753  50.050 1.00 76.97  ? 113 ALA F CA    1 
ATOM   10203 C C     . ALA J 3 119 ? 54.302  32.752  50.950 1.00 76.65  ? 113 ALA F C     1 
ATOM   10204 O O     . ALA J 3 119 ? 54.268  31.553  50.661 1.00 74.43  ? 113 ALA F O     1 
ATOM   10205 C CB    . ALA J 3 119 ? 56.439  34.003  50.544 1.00 77.73  ? 113 ALA F CB    1 
ATOM   10206 N N     . SER J 3 120 ? 53.717  33.258  52.031 1.00 79.35  ? 114 SER F N     1 
ATOM   10207 C CA    . SER J 3 120 ? 52.937  32.442  52.951 1.00 79.73  ? 114 SER F CA    1 
ATOM   10208 C C     . SER J 3 120 ? 51.731  31.816  52.246 1.00 78.14  ? 114 SER F C     1 
ATOM   10209 O O     . SER J 3 120 ? 51.472  30.626  52.401 1.00 76.67  ? 114 SER F O     1 
ATOM   10210 C CB    . SER J 3 120 ? 52.489  33.281  54.156 1.00 83.63  ? 114 SER F CB    1 
ATOM   10211 O OG    . SER J 3 120 ? 51.892  32.476  55.157 1.00 84.87  ? 114 SER F OG    1 
ATOM   10212 N N     . ASP J 3 121 ? 51.012  32.616  51.459 1.00 78.75  ? 115 ASP F N     1 
ATOM   10213 C CA    . ASP J 3 121 ? 49.827  32.131  50.748 1.00 77.84  ? 115 ASP F CA    1 
ATOM   10214 C C     . ASP J 3 121 ? 50.194  31.126  49.655 1.00 74.52  ? 115 ASP F C     1 
ATOM   10215 O O     . ASP J 3 121 ? 49.475  30.152  49.442 1.00 73.81  ? 115 ASP F O     1 
ATOM   10216 C CB    . ASP J 3 121 ? 49.004  33.292  50.176 1.00 79.89  ? 115 ASP F CB    1 
ATOM   10217 N N     . LEU J 3 122 ? 51.314  31.355  48.975 1.00 72.98  ? 116 LEU F N     1 
ATOM   10218 C CA    . LEU J 3 122 ? 51.798  30.418  47.970 1.00 69.90  ? 116 LEU F CA    1 
ATOM   10219 C C     . LEU J 3 122 ? 52.233  29.095  48.601 1.00 68.41  ? 116 LEU F C     1 
ATOM   10220 O O     . LEU J 3 122 ? 51.931  28.026  48.077 1.00 66.82  ? 116 LEU F O     1 
ATOM   10221 C CB    . LEU J 3 122 ? 52.947  31.027  47.155 1.00 69.46  ? 116 LEU F CB    1 
ATOM   10222 C CG    . LEU J 3 122 ? 53.721  30.093  46.213 1.00 66.60  ? 116 LEU F CG    1 
ATOM   10223 C CD1   . LEU J 3 122 ? 52.865  29.684  45.034 1.00 65.80  ? 116 LEU F CD1   1 
ATOM   10224 C CD2   . LEU J 3 122 ? 55.022  30.736  45.736 1.00 66.67  ? 116 LEU F CD2   1 
ATOM   10225 N N     . PHE J 3 123 ? 52.938  29.168  49.725 1.00 69.25  ? 117 PHE F N     1 
ATOM   10226 C CA    . PHE J 3 123 ? 53.472  27.965  50.358 1.00 68.19  ? 117 PHE F CA    1 
ATOM   10227 C C     . PHE J 3 123 ? 52.412  27.192  51.126 1.00 68.89  ? 117 PHE F C     1 
ATOM   10228 O O     . PHE J 3 123 ? 52.456  25.964  51.178 1.00 67.70  ? 117 PHE F O     1 
ATOM   10229 C CB    . PHE J 3 123 ? 54.678  28.296  51.243 1.00 69.36  ? 117 PHE F CB    1 
ATOM   10230 C CG    . PHE J 3 123 ? 55.987  28.338  50.495 1.00 68.09  ? 117 PHE F CG    1 
ATOM   10231 C CD1   . PHE J 3 123 ? 56.219  29.299  49.509 1.00 68.48  ? 117 PHE F CD1   1 
ATOM   10232 C CD2   . PHE J 3 123 ? 56.985  27.423  50.776 1.00 67.15  ? 117 PHE F CD2   1 
ATOM   10233 C CE1   . PHE J 3 123 ? 57.421  29.337  48.811 1.00 67.39  ? 117 PHE F CE1   1 
ATOM   10234 C CE2   . PHE J 3 123 ? 58.191  27.454  50.081 1.00 66.71  ? 117 PHE F CE2   1 
ATOM   10235 C CZ    . PHE J 3 123 ? 58.406  28.419  49.099 1.00 66.55  ? 117 PHE F CZ    1 
ATOM   10236 N N     . THR J 3 124 ? 51.458  27.919  51.705 1.00 71.25  ? 118 THR F N     1 
ATOM   10237 C CA    . THR J 3 124 ? 50.322  27.322  52.411 1.00 72.53  ? 118 THR F CA    1 
ATOM   10238 C C     . THR J 3 124 ? 49.426  26.568  51.428 1.00 71.15  ? 118 THR F C     1 
ATOM   10239 O O     . THR J 3 124 ? 48.954  25.469  51.726 1.00 71.21  ? 118 THR F O     1 
ATOM   10240 C CB    . THR J 3 124 ? 49.505  28.406  53.161 1.00 75.82  ? 118 THR F CB    1 
ATOM   10241 O OG1   . THR J 3 124 ? 50.364  29.086  54.082 1.00 77.61  ? 118 THR F OG1   1 
ATOM   10242 C CG2   . THR J 3 124 ? 48.327  27.806  53.922 1.00 77.13  ? 118 THR F CG2   1 
ATOM   10243 N N     . ASP J 3 125 ? 49.198  27.170  50.263 1.00 70.41  ? 119 ASP F N     1 
ATOM   10244 C CA    . ASP J 3 125 ? 48.384  26.570  49.215 1.00 69.49  ? 119 ASP F CA    1 
ATOM   10245 C C     . ASP J 3 125 ? 49.018  25.283  48.703 1.00 67.10  ? 119 ASP F C     1 
ATOM   10246 O O     . ASP J 3 125 ? 48.335  24.264  48.544 1.00 66.87  ? 119 ASP F O     1 
ATOM   10247 C CB    . ASP J 3 125 ? 48.197  27.550  48.058 1.00 69.63  ? 119 ASP F CB    1 
ATOM   10248 C CG    . ASP J 3 125 ? 47.685  26.874  46.799 1.00 69.25  ? 119 ASP F CG    1 
ATOM   10249 O OD1   . ASP J 3 125 ? 46.499  26.471  46.763 1.00 70.21  ? 119 ASP F OD1   1 
ATOM   10250 O OD2   . ASP J 3 125 ? 48.478  26.741  45.841 1.00 69.06  ? 119 ASP F OD2   1 
ATOM   10251 N N     . GLN J 3 126 ? 50.322  25.341  48.445 1.00 65.59  ? 120 GLN F N     1 
ATOM   10252 C CA    . GLN J 3 126 ? 51.062  24.174  48.007 1.00 63.76  ? 120 GLN F CA    1 
ATOM   10253 C C     . GLN J 3 126 ? 50.962  23.079  49.062 1.00 64.21  ? 120 GLN F C     1 
ATOM   10254 O O     . GLN J 3 126 ? 50.722  21.919  48.730 1.00 63.63  ? 120 GLN F O     1 
ATOM   10255 C CB    . GLN J 3 126 ? 52.521  24.528  47.712 1.00 62.87  ? 120 GLN F CB    1 
ATOM   10256 C CG    . GLN J 3 126 ? 53.326  23.411  47.042 1.00 61.58  ? 120 GLN F CG    1 
ATOM   10257 C CD    . GLN J 3 126 ? 53.018  23.215  45.552 1.00 61.92  ? 120 GLN F CD    1 
ATOM   10258 O OE1   . GLN J 3 126 ? 53.629  22.369  44.899 1.00 61.14  ? 120 GLN F OE1   1 
ATOM   10259 N NE2   . GLN J 3 126 ? 52.078  23.998  45.013 1.00 62.00  ? 120 GLN F NE2   1 
ATOM   10260 N N     . LEU J 3 127 ? 51.110  23.463  50.328 1.00 65.76  ? 121 LEU F N     1 
ATOM   10261 C CA    . LEU J 3 127 ? 51.021  22.522  51.443 1.00 66.72  ? 121 LEU F CA    1 
ATOM   10262 C C     . LEU J 3 127 ? 49.678  21.797  51.473 1.00 67.63  ? 121 LEU F C     1 
ATOM   10263 O O     . LEU J 3 127 ? 49.635  20.568  51.623 1.00 67.36  ? 121 LEU F O     1 
ATOM   10264 C CB    . LEU J 3 127 ? 51.269  23.231  52.779 1.00 68.89  ? 121 LEU F CB    1 
ATOM   10265 C CG    . LEU J 3 127 ? 51.237  22.315  54.003 1.00 70.29  ? 121 LEU F CG    1 
ATOM   10266 C CD1   . LEU J 3 127 ? 52.465  21.401  54.010 1.00 68.66  ? 121 LEU F CD1   1 
ATOM   10267 C CD2   . LEU J 3 127 ? 51.125  23.123  55.292 1.00 72.54  ? 121 LEU F CD2   1 
ATOM   10268 N N     . LEU J 3 128 ? 48.595  22.566  51.328 1.00 68.86  ? 122 LEU F N     1 
ATOM   10269 C CA    . LEU J 3 128 ? 47.241  22.022  51.307 1.00 70.14  ? 122 LEU F CA    1 
ATOM   10270 C C     . LEU J 3 128 ? 47.077  21.018  50.174 1.00 68.21  ? 122 LEU F C     1 
ATOM   10271 O O     . LEU J 3 128 ? 46.499  19.948  50.365 1.00 68.96  ? 122 LEU F O     1 
ATOM   10272 C CB    . LEU J 3 128 ? 46.195  23.138  51.193 1.00 72.20  ? 122 LEU F CB    1 
ATOM   10273 N N     . LYS J 3 129 ? 47.604  21.355  49.002 1.00 66.11  ? 123 LYS F N     1 
ATOM   10274 C CA    . LYS J 3 129 ? 47.537  20.452  47.864 1.00 64.72  ? 123 LYS F CA    1 
ATOM   10275 C C     . LYS J 3 129 ? 48.338  19.173  48.114 1.00 63.63  ? 123 LYS F C     1 
ATOM   10276 O O     . LYS J 3 129 ? 47.832  18.072  47.908 1.00 63.76  ? 123 LYS F O     1 
ATOM   10277 C CB    . LYS J 3 129 ? 47.995  21.152  46.588 1.00 63.43  ? 123 LYS F CB    1 
ATOM   10278 C CG    . LYS J 3 129 ? 46.998  22.157  46.051 1.00 65.48  ? 123 LYS F CG    1 
ATOM   10279 C CD    . LYS J 3 129 ? 47.428  22.641  44.681 1.00 66.86  ? 123 LYS F CD    1 
ATOM   10280 C CE    . LYS J 3 129 ? 46.450  23.657  44.109 1.00 69.86  ? 123 LYS F CE    1 
ATOM   10281 N NZ    . LYS J 3 129 ? 46.816  25.055  44.485 1.00 71.41  ? 123 LYS F NZ    1 
ATOM   10282 N N     . ARG J 3 130 ? 49.573  19.325  48.586 1.00 62.90  ? 124 ARG F N     1 
ATOM   10283 C CA    . ARG J 3 130 ? 50.454  18.184  48.845 1.00 62.42  ? 124 ARG F CA    1 
ATOM   10284 C C     . ARG J 3 130 ? 49.885  17.239  49.893 1.00 64.05  ? 124 ARG F C     1 
ATOM   10285 O O     . ARG J 3 130 ? 49.925  16.025  49.717 1.00 64.06  ? 124 ARG F O     1 
ATOM   10286 C CB    . ARG J 3 130 ? 51.858  18.642  49.263 1.00 61.85  ? 124 ARG F CB    1 
ATOM   10287 C CG    . ARG J 3 130 ? 52.644  19.386  48.181 1.00 60.81  ? 124 ARG F CG    1 
ATOM   10288 C CD    . ARG J 3 130 ? 53.191  18.468  47.109 1.00 59.43  ? 124 ARG F CD    1 
ATOM   10289 N NE    . ARG J 3 130 ? 53.713  19.232  45.979 1.00 59.35  ? 124 ARG F NE    1 
ATOM   10290 C CZ    . ARG J 3 130 ? 54.354  18.701  44.942 1.00 58.15  ? 124 ARG F CZ    1 
ATOM   10291 N NH1   . ARG J 3 130 ? 54.571  17.396  44.887 1.00 58.00  ? 124 ARG F NH1   1 
ATOM   10292 N NH2   . ARG J 3 130 ? 54.781  19.478  43.958 1.00 57.74  ? 124 ARG F NH2   1 
ATOM   10293 N N     . LYS J 3 131 ? 49.358  17.799  50.979 1.00 66.04  ? 125 LYS F N     1 
ATOM   10294 C CA    . LYS J 3 131 ? 48.747  17.001  52.035 1.00 68.38  ? 125 LYS F CA    1 
ATOM   10295 C C     . LYS J 3 131 ? 47.605  16.160  51.478 1.00 68.80  ? 125 LYS F C     1 
ATOM   10296 O O     . LYS J 3 131 ? 47.454  14.997  51.844 1.00 69.61  ? 125 LYS F O     1 
ATOM   10297 C CB    . LYS J 3 131 ? 48.241  17.889  53.174 1.00 71.05  ? 125 LYS F CB    1 
ATOM   10298 C CG    . LYS J 3 131 ? 49.337  18.531  54.024 1.00 72.43  ? 125 LYS F CG    1 
ATOM   10299 C CD    . LYS J 3 131 ? 48.765  19.175  55.292 1.00 76.70  ? 125 LYS F CD    1 
ATOM   10300 C CE    . LYS J 3 131 ? 48.730  18.188  56.458 1.00 79.58  ? 125 LYS F CE    1 
ATOM   10301 N NZ    . LYS J 3 131 ? 48.296  18.832  57.731 1.00 83.21  ? 125 LYS F NZ    1 
ATOM   10302 N N     . ALA J 3 132 ? 46.815  16.759  50.586 1.00 68.51  ? 126 ALA F N     1 
ATOM   10303 C CA    . ALA J 3 132 ? 45.694  16.066  49.945 1.00 69.53  ? 126 ALA F CA    1 
ATOM   10304 C C     . ALA J 3 132 ? 46.182  14.996  48.969 1.00 68.06  ? 126 ALA F C     1 
ATOM   10305 O O     . ALA J 3 132 ? 45.558  13.945  48.826 1.00 69.33  ? 126 ALA F O     1 
ATOM   10306 C CB    . ALA J 3 132 ? 44.765  17.057  49.249 1.00 69.78  ? 126 ALA F CB    1 
ATOM   10307 N N     . LYS J 3 133 ? 47.301  15.260  48.305 1.00 65.78  ? 127 LYS F N     1 
ATOM   10308 C CA    . LYS J 3 133 ? 47.894  14.253  47.451 1.00 64.88  ? 127 LYS F CA    1 
ATOM   10309 C C     . LYS J 3 133 ? 48.428  13.098  48.304 1.00 65.58  ? 127 LYS F C     1 
ATOM   10310 O O     . LYS J 3 133 ? 48.196  11.936  47.987 1.00 66.61  ? 127 LYS F O     1 
ATOM   10311 C CB    . LYS J 3 133 ? 48.994  14.838  46.563 1.00 62.80  ? 127 LYS F CB    1 
ATOM   10312 C CG    . LYS J 3 133 ? 49.170  14.051  45.278 1.00 63.18  ? 127 LYS F CG    1 
ATOM   10313 C CD    . LYS J 3 133 ? 50.630  13.841  44.912 1.00 64.04  ? 127 LYS F CD    1 
ATOM   10314 C CE    . LYS J 3 133 ? 50.734  13.212  43.523 1.00 65.59  ? 127 LYS F CE    1 
ATOM   10315 N NZ    . LYS J 3 133 ? 52.086  13.290  42.919 1.00 65.43  ? 127 LYS F NZ    1 
ATOM   10316 N N     . LEU J 3 134 ? 49.123  13.433  49.390 1.00 65.51  ? 128 LEU F N     1 
ATOM   10317 C CA    . LEU J 3 134 ? 49.630  12.453  50.351 1.00 66.57  ? 128 LEU F CA    1 
ATOM   10318 C C     . LEU J 3 134 ? 48.509  11.600  50.948 1.00 68.94  ? 128 LEU F C     1 
ATOM   10319 O O     . LEU J 3 134 ? 48.652  10.391  51.119 1.00 69.84  ? 128 LEU F O     1 
ATOM   10320 C CB    . LEU J 3 134 ? 50.412  13.170  51.466 1.00 66.88  ? 128 LEU F CB    1 
ATOM   10321 C CG    . LEU J 3 134 ? 50.907  12.375  52.676 1.00 68.64  ? 128 LEU F CG    1 
ATOM   10322 C CD1   . LEU J 3 134 ? 51.917  11.325  52.264 1.00 67.84  ? 128 LEU F CD1   1 
ATOM   10323 C CD2   . LEU J 3 134 ? 51.507  13.304  53.718 1.00 69.47  ? 128 LEU F CD2   1 
ATOM   10324 N N     . SER J 3 135 ? 47.391  12.245  51.253 1.00 70.37  ? 129 SER F N     1 
ATOM   10325 C CA    . SER J 3 135 ? 46.225  11.561  51.785 1.00 73.32  ? 129 SER F CA    1 
ATOM   10326 C C     . SER J 3 135 ? 45.720  10.482  50.822 1.00 73.54  ? 129 SER F C     1 
ATOM   10327 O O     . SER J 3 135 ? 45.318  9.400   51.256 1.00 75.70  ? 129 SER F O     1 
ATOM   10328 C CB    . SER J 3 135 ? 45.124  12.570  52.089 1.00 74.58  ? 129 SER F CB    1 
ATOM   10329 O OG    . SER J 3 135 ? 44.047  11.947  52.761 1.00 78.71  ? 129 SER F OG    1 
ATOM   10330 N N     . ASP J 3 136 ? 45.766  10.776  49.521 1.00 71.60  ? 130 ASP F N     1 
ATOM   10331 C CA    . ASP J 3 136 ? 45.316  9.838   48.490 1.00 72.08  ? 130 ASP F CA    1 
ATOM   10332 C C     . ASP J 3 136 ? 46.297  8.680   48.319 1.00 71.80  ? 130 ASP F C     1 
ATOM   10333 O O     . ASP J 3 136 ? 45.896  7.549   48.056 1.00 73.30  ? 130 ASP F O     1 
ATOM   10334 C CB    . ASP J 3 136 ? 45.096  10.566  47.159 1.00 70.58  ? 130 ASP F CB    1 
ATOM   10335 N N     . LEU J 3 137 ? 47.582  8.980   48.486 1.00 70.35  ? 131 LEU F N     1 
ATOM   10336 C CA    . LEU J 3 137 ? 48.655  8.002   48.349 1.00 70.19  ? 131 LEU F CA    1 
ATOM   10337 C C     . LEU J 3 137 ? 48.735  7.067   49.546 1.00 72.80  ? 131 LEU F C     1 
ATOM   10338 O O     . LEU J 3 137 ? 49.097  5.901   49.403 1.00 73.93  ? 131 LEU F O     1 
ATOM   10339 C CB    . LEU J 3 137 ? 49.994  8.709   48.170 1.00 67.85  ? 131 LEU F CB    1 
ATOM   10340 C CG    . LEU J 3 137 ? 50.289  9.387   46.836 1.00 65.75  ? 131 LEU F CG    1 
ATOM   10341 C CD1   . LEU J 3 137 ? 51.614  10.085  46.950 1.00 63.96  ? 131 LEU F CD1   1 
ATOM   10342 C CD2   . LEU J 3 137 ? 50.321  8.388   45.689 1.00 66.40  ? 131 LEU F CD2   1 
ATOM   10343 N N     . GLN J 3 138 ? 48.415  7.585   50.728 1.00 74.18  ? 132 GLN F N     1 
ATOM   10344 C CA    . GLN J 3 138 ? 48.364  6.758   51.922 1.00 77.34  ? 132 GLN F CA    1 
ATOM   10345 C C     . GLN J 3 138 ? 47.257  5.726   51.758 1.00 79.96  ? 132 GLN F C     1 
ATOM   10346 O O     . GLN J 3 138 ? 47.453  4.543   52.054 1.00 82.16  ? 132 GLN F O     1 
ATOM   10347 C CB    . GLN J 3 138 ? 48.104  7.612   53.161 1.00 78.70  ? 132 GLN F CB    1 
ATOM   10348 C CG    . GLN J 3 138 ? 48.577  6.968   54.457 1.00 82.24  ? 132 GLN F CG    1 
ATOM   10349 C CD    . GLN J 3 138 ? 50.033  7.281   54.766 1.00 82.41  ? 132 GLN F CD    1 
ATOM   10350 O OE1   . GLN J 3 138 ? 50.435  8.450   54.797 1.00 81.02  ? 132 GLN F OE1   1 
ATOM   10351 N NE2   . GLN J 3 138 ? 50.831  6.238   55.007 1.00 83.44  ? 132 GLN F NE2   1 
ATOM   10352 N N     . GLY J 3 139 ? 46.102  6.192   51.276 1.00 80.07  ? 133 GLY F N     1 
ATOM   10353 C CA    . GLY J 3 139 ? 44.947  5.347   51.005 1.00 82.56  ? 133 GLY F CA    1 
ATOM   10354 C C     . GLY J 3 139 ? 45.202  4.293   49.944 1.00 82.54  ? 133 GLY F C     1 
ATOM   10355 O O     . GLY J 3 139 ? 44.700  3.170   50.053 1.00 85.48  ? 133 GLY F O     1 
ATOM   10356 N N     . SER J 3 140 ? 45.975  4.650   48.917 1.00 79.59  ? 134 SER F N     1 
ATOM   10357 C CA    . SER J 3 140 ? 46.368  3.694   47.877 1.00 79.71  ? 134 SER F CA    1 
ATOM   10358 C C     . SER J 3 140 ? 47.288  2.619   48.450 1.00 80.93  ? 134 SER F C     1 
ATOM   10359 O O     . SER J 3 140 ? 47.204  1.452   48.066 1.00 82.95  ? 134 SER F O     1 
ATOM   10360 C CB    . SER J 3 140 ? 47.056  4.397   46.700 1.00 76.73  ? 134 SER F CB    1 
ATOM   10361 O OG    . SER J 3 140 ? 46.129  5.129   45.921 1.00 76.73  ? 134 SER F OG    1 
ATOM   10362 N N     . TYR J 3 141 ? 48.156  3.026   49.375 1.00 80.10  ? 135 TYR F N     1 
ATOM   10363 C CA    . TYR J 3 141 ? 49.096  2.122   50.025 1.00 81.46  ? 135 TYR F CA    1 
ATOM   10364 C C     . TYR J 3 141 ? 48.391  1.105   50.913 1.00 85.36  ? 135 TYR F C     1 
ATOM   10365 O O     . TYR J 3 141 ? 48.678  -0.090  50.840 1.00 87.39  ? 135 TYR F O     1 
ATOM   10366 C CB    . TYR J 3 141 ? 50.118  2.914   50.841 1.00 80.09  ? 135 TYR F CB    1 
ATOM   10367 C CG    . TYR J 3 141 ? 51.143  2.050   51.536 1.00 81.63  ? 135 TYR F CG    1 
ATOM   10368 C CD1   . TYR J 3 141 ? 52.158  1.426   50.815 1.00 80.69  ? 135 TYR F CD1   1 
ATOM   10369 C CD2   . TYR J 3 141 ? 51.097  1.858   52.913 1.00 84.22  ? 135 TYR F CD2   1 
ATOM   10370 C CE1   . TYR J 3 141 ? 53.098  0.631   51.445 1.00 83.15  ? 135 TYR F CE1   1 
ATOM   10371 C CE2   . TYR J 3 141 ? 52.029  1.060   53.556 1.00 86.46  ? 135 TYR F CE2   1 
ATOM   10372 C CZ    . TYR J 3 141 ? 53.030  0.448   52.817 1.00 85.91  ? 135 TYR F CZ    1 
ATOM   10373 O OH    . TYR J 3 141 ? 53.966  -0.340  53.450 1.00 87.88  ? 135 TYR F OH    1 
ATOM   10374 N N     . GLU J 3 142 ? 47.471  1.590   51.743 1.00 86.76  ? 136 GLU F N     1 
ATOM   10375 C CA    . GLU J 3 142 ? 46.682  0.734   52.626 1.00 91.12  ? 136 GLU F CA    1 
ATOM   10376 C C     . GLU J 3 142 ? 45.902  -0.343  51.865 1.00 93.28  ? 136 GLU F C     1 
ATOM   10377 O O     . GLU J 3 142 ? 45.825  -1.485  52.323 1.00 96.71  ? 136 GLU F O     1 
ATOM   10378 C CB    . GLU J 3 142 ? 45.748  1.577   53.504 1.00 92.27  ? 136 GLU F CB    1 
ATOM   10379 C CG    . GLU J 3 142 ? 46.487  2.406   54.568 1.00 92.39  ? 136 GLU F CG    1 
ATOM   10380 C CD    . GLU J 3 142 ? 45.637  3.510   55.209 1.00 93.60  ? 136 GLU F CD    1 
ATOM   10381 O OE1   . GLU J 3 142 ? 44.420  3.598   54.930 1.00 95.16  ? 136 GLU F OE1   1 
ATOM   10382 O OE2   . GLU J 3 142 ? 46.199  4.299   55.999 1.00 92.97  ? 136 GLU F OE2   1 
ATOM   10383 N N     . LYS J 3 143 ? 45.351  0.011   50.703 1.00 91.69  ? 137 LYS F N     1 
ATOM   10384 C CA    . LYS J 3 143 ? 44.585  -0.941  49.884 1.00 94.00  ? 137 LYS F CA    1 
ATOM   10385 C C     . LYS J 3 143 ? 45.476  -2.030  49.286 1.00 94.46  ? 137 LYS F C     1 
ATOM   10386 O O     . LYS J 3 143 ? 45.098  -3.204  49.260 1.00 97.79  ? 137 LYS F O     1 
ATOM   10387 C CB    . LYS J 3 143 ? 43.799  -0.222  48.775 1.00 92.44  ? 137 LYS F CB    1 
ATOM   10388 N N     . LEU J 3 144 ? 46.655  -1.632  48.810 1.00 91.48  ? 138 LEU F N     1 
ATOM   10389 C CA    . LEU J 3 144 ? 47.633  -2.571  48.261 1.00 92.11  ? 138 LEU F CA    1 
ATOM   10390 C C     . LEU J 3 144 ? 48.117  -3.539  49.334 1.00 95.22  ? 138 LEU F C     1 
ATOM   10391 O O     . LEU J 3 144 ? 48.302  -4.725  49.065 1.00 97.86  ? 138 LEU F O     1 
ATOM   10392 C CB    . LEU J 3 144 ? 48.828  -1.829  47.653 1.00 88.42  ? 138 LEU F CB    1 
ATOM   10393 C CG    . LEU J 3 144 ? 49.960  -2.677  47.060 1.00 88.49  ? 138 LEU F CG    1 
ATOM   10394 C CD1   . LEU J 3 144 ? 49.674  -3.077  45.623 1.00 88.70  ? 138 LEU F CD1   1 
ATOM   10395 C CD2   . LEU J 3 144 ? 51.277  -1.946  47.154 1.00 85.49  ? 138 LEU F CD2   1 
ATOM   10396 N N     . MET J 3 145 ? 48.311  -3.030  50.548 1.00 95.30  ? 139 MET F N     1 
ATOM   10397 C CA    . MET J 3 145 ? 48.763  -3.857  51.663 1.00 98.72  ? 139 MET F CA    1 
ATOM   10398 C C     . MET J 3 145 ? 47.660  -4.777  52.216 1.00 103.31 ? 139 MET F C     1 
ATOM   10399 O O     . MET J 3 145 ? 47.602  -5.040  53.423 1.00 106.07 ? 139 MET F O     1 
ATOM   10400 C CB    . MET J 3 145 ? 49.362  -2.987  52.774 1.00 97.75  ? 139 MET F CB    1 
ATOM   10401 C CG    . MET J 3 145 ? 50.715  -2.340  52.448 1.00 94.50  ? 139 MET F CG    1 
ATOM   10402 S SD    . MET J 3 145 ? 51.872  -3.409  51.569 1.00 94.90  ? 139 MET F SD    1 
ATOM   10403 C CE    . MET J 3 145 ? 53.257  -3.430  52.707 1.00 95.83  ? 139 MET F CE    1 
ATOM   10404 N N     . ALA J 3 146 ? 46.799  -5.264  51.318 1.00 104.40 ? 140 ALA F N     1 
ATOM   10405 C CA    . ALA J 3 146 ? 45.744  -6.229  51.645 1.00 108.87 ? 140 ALA F CA    1 
ATOM   10406 C C     . ALA J 3 146 ? 45.273  -6.965  50.390 1.00 109.87 ? 140 ALA F C     1 
ATOM   10407 O O     . ALA J 3 146 ? 45.924  -7.897  49.918 1.00 110.96 ? 140 ALA F O     1 
ATOM   10408 C CB    . ALA J 3 146 ? 44.569  -5.534  52.326 1.00 109.72 ? 140 ALA F CB    1 
ATOM   10409 N N     . PRO J 3 150 ? 51.872  -9.320  53.352 1.00 114.62 ? 144 PRO F N     1 
ATOM   10410 C CA    . PRO J 3 150 ? 53.208  -9.896  53.542 1.00 116.09 ? 144 PRO F CA    1 
ATOM   10411 C C     . PRO J 3 150 ? 54.139  -9.588  52.356 1.00 112.69 ? 144 PRO F C     1 
ATOM   10412 O O     . PRO J 3 150 ? 54.235  -10.380 51.415 1.00 114.02 ? 144 PRO F O     1 
ATOM   10413 C CB    . PRO J 3 150 ? 52.933  -11.406 53.673 1.00 121.52 ? 144 PRO F CB    1 
ATOM   10414 C CG    . PRO J 3 150 ? 51.568  -11.616 53.082 1.00 121.97 ? 144 PRO F CG    1 
ATOM   10415 C CD    . PRO J 3 150 ? 50.813  -10.345 53.328 1.00 118.73 ? 144 PRO F CD    1 
ATOM   10416 N N     . MET J 3 151 ? 54.820  -8.444  52.418 1.00 108.66 ? 145 MET F N     1 
ATOM   10417 C CA    . MET J 3 151 ? 55.623  -7.947  51.298 1.00 105.12 ? 145 MET F CA    1 
ATOM   10418 C C     . MET J 3 151 ? 57.051  -8.508  51.223 1.00 106.43 ? 145 MET F C     1 
ATOM   10419 O O     . MET J 3 151 ? 57.807  -8.454  52.197 1.00 107.65 ? 145 MET F O     1 
ATOM   10420 C CB    . MET J 3 151 ? 55.657  -6.417  51.306 1.00 100.69 ? 145 MET F CB    1 
ATOM   10421 C CG    . MET J 3 151 ? 56.250  -5.796  50.046 1.00 97.91  ? 145 MET F CG    1 
ATOM   10422 S SD    . MET J 3 151 ? 55.547  -6.450  48.509 1.00 99.92  ? 145 MET F SD    1 
ATOM   10423 C CE    . MET J 3 151 ? 53.859  -5.836  48.600 1.00 98.08  ? 145 MET F CE    1 
ATOM   10424 N N     . SER J 3 152 ? 57.406  -9.023  50.047 1.00 106.23 ? 146 SER F N     1 
ATOM   10425 C CA    . SER J 3 152 ? 58.754  -9.528  49.760 1.00 107.40 ? 146 SER F CA    1 
ATOM   10426 C C     . SER J 3 152 ? 59.118  -9.273  48.297 1.00 105.01 ? 146 SER F C     1 
ATOM   10427 O O     . SER J 3 152 ? 58.259  -8.899  47.499 1.00 103.01 ? 146 SER F O     1 
ATOM   10428 C CB    . SER J 3 152 ? 58.844  -11.026 50.072 1.00 112.66 ? 146 SER F CB    1 
ATOM   10429 N N     . PHE J 3 153 ? 60.389  -9.472  47.953 1.00 105.64 ? 147 PHE F N     1 
ATOM   10430 C CA    . PHE J 3 153 ? 60.858  -9.381  46.565 1.00 104.45 ? 147 PHE F CA    1 
ATOM   10431 C C     . PHE J 3 153 ? 60.140  -10.394 45.666 1.00 106.94 ? 147 PHE F C     1 
ATOM   10432 O O     . PHE J 3 153 ? 59.911  -10.126 44.483 1.00 105.53 ? 147 PHE F O     1 
ATOM   10433 C CB    . PHE J 3 153 ? 62.381  -9.594  46.504 1.00 106.07 ? 147 PHE F CB    1 
ATOM   10434 C CG    . PHE J 3 153 ? 62.941  -9.683  45.103 1.00 105.80 ? 147 PHE F CG    1 
ATOM   10435 C CD1   . PHE J 3 153 ? 63.281  -8.536  44.399 1.00 101.65 ? 147 PHE F CD1   1 
ATOM   10436 C CD2   . PHE J 3 153 ? 63.143  -10.919 44.495 1.00 109.71 ? 147 PHE F CD2   1 
ATOM   10437 C CE1   . PHE J 3 153 ? 63.802  -8.620  43.110 1.00 102.05 ? 147 PHE F CE1   1 
ATOM   10438 C CE2   . PHE J 3 153 ? 63.660  -11.012 43.204 1.00 109.88 ? 147 PHE F CE2   1 
ATOM   10439 C CZ    . PHE J 3 153 ? 63.991  -9.861  42.512 1.00 106.36 ? 147 PHE F CZ    1 
ATOM   10440 N N     . SER J 3 154 ? 59.788  -11.545 46.243 1.00 110.86 ? 148 SER F N     1 
ATOM   10441 C CA    . SER J 3 154 ? 59.142  -12.648 45.522 1.00 114.06 ? 148 SER F CA    1 
ATOM   10442 C C     . SER J 3 154 ? 57.720  -12.337 45.037 1.00 112.26 ? 148 SER F C     1 
ATOM   10443 O O     . SER J 3 154 ? 57.200  -13.024 44.157 1.00 114.43 ? 148 SER F O     1 
ATOM   10444 C CB    . SER J 3 154 ? 59.139  -13.913 46.389 1.00 119.13 ? 148 SER F CB    1 
ATOM   10445 N N     . SER J 3 155 ? 57.105  -11.301 45.607 1.00 108.62 ? 149 SER F N     1 
ATOM   10446 C CA    . SER J 3 155 ? 55.740  -10.893 45.262 1.00 106.83 ? 149 SER F CA    1 
ATOM   10447 C C     . SER J 3 155 ? 55.639  -10.320 43.849 1.00 104.42 ? 149 SER F C     1 
ATOM   10448 O O     . SER J 3 155 ? 56.498  -9.543  43.433 1.00 101.73 ? 149 SER F O     1 
ATOM   10449 C CB    . SER J 3 155 ? 55.226  -9.857  46.263 1.00 103.84 ? 149 SER F CB    1 
ATOM   10450 O OG    . SER J 3 155 ? 55.489  -10.257 47.596 1.00 105.88 ? 149 SER F OG    1 
ATOM   10451 N N     . PRO J 3 156 ? 54.586  -10.704 43.103 1.00 105.69 ? 150 PRO F N     1 
ATOM   10452 C CA    . PRO J 3 156 ? 54.332  -10.059 41.814 1.00 103.57 ? 150 PRO F CA    1 
ATOM   10453 C C     . PRO J 3 156 ? 54.085  -8.566  42.013 1.00 98.56  ? 150 PRO F C     1 
ATOM   10454 O O     . PRO J 3 156 ? 54.564  -7.752  41.226 1.00 96.01  ? 150 PRO F O     1 
ATOM   10455 C CB    . PRO J 3 156 ? 53.055  -10.746 41.318 1.00 106.37 ? 150 PRO F CB    1 
ATOM   10456 C CG    . PRO J 3 156 ? 52.995  -12.037 42.063 1.00 110.81 ? 150 PRO F CG    1 
ATOM   10457 C CD    . PRO J 3 156 ? 53.594  -11.755 43.399 1.00 109.58 ? 150 PRO F CD    1 
ATOM   10458 N N     . ASP J 3 157 ? 53.371  -8.236  43.091 1.00 97.57  ? 151 ASP F N     1 
ATOM   10459 C CA    . ASP J 3 157 ? 52.994  -6.865  43.454 1.00 93.47  ? 151 ASP F CA    1 
ATOM   10460 C C     . ASP J 3 157 ? 54.171  -5.938  43.779 1.00 90.17  ? 151 ASP F C     1 
ATOM   10461 O O     . ASP J 3 157 ? 53.967  -4.763  44.077 1.00 86.98  ? 151 ASP F O     1 
ATOM   10462 C CB    . ASP J 3 157 ? 52.065  -6.899  44.676 1.00 94.37  ? 151 ASP F CB    1 
ATOM   10463 C CG    . ASP J 3 157 ? 50.651  -7.334  44.336 1.00 96.70  ? 151 ASP F CG    1 
ATOM   10464 O OD1   . ASP J 3 157 ? 49.920  -6.551  43.690 1.00 94.79  ? 151 ASP F OD1   1 
ATOM   10465 O OD2   . ASP J 3 157 ? 50.261  -8.450  44.745 1.00 100.95 ? 151 ASP F OD2   1 
ATOM   10466 N N     . PHE J 3 158 ? 55.391  -6.463  43.728 1.00 91.17  ? 152 PHE F N     1 
ATOM   10467 C CA    . PHE J 3 158 ? 56.566  -5.742  44.226 1.00 88.95  ? 152 PHE F CA    1 
ATOM   10468 C C     . PHE J 3 158 ? 56.862  -4.454  43.461 1.00 85.22  ? 152 PHE F C     1 
ATOM   10469 O O     . PHE J 3 158 ? 57.126  -3.413  44.072 1.00 82.39  ? 152 PHE F O     1 
ATOM   10470 C CB    . PHE J 3 158 ? 57.792  -6.665  44.249 1.00 91.72  ? 152 PHE F CB    1 
ATOM   10471 C CG    . PHE J 3 158 ? 58.974  -6.100  44.987 1.00 90.21  ? 152 PHE F CG    1 
ATOM   10472 C CD1   . PHE J 3 158 ? 58.856  -5.679  46.311 1.00 89.54  ? 152 PHE F CD1   1 
ATOM   10473 C CD2   . PHE J 3 158 ? 60.215  -6.015  44.366 1.00 90.07  ? 152 PHE F CD2   1 
ATOM   10474 C CE1   . PHE J 3 158 ? 59.956  -5.163  46.999 1.00 88.80  ? 152 PHE F CE1   1 
ATOM   10475 C CE2   . PHE J 3 158 ? 61.320  -5.506  45.043 1.00 89.55  ? 152 PHE F CE2   1 
ATOM   10476 C CZ    . PHE J 3 158 ? 61.188  -5.076  46.365 1.00 88.89  ? 152 PHE F CZ    1 
ATOM   10477 N N     . GLY J 3 159 ? 56.816  -4.533  42.131 1.00 85.39  ? 153 GLY F N     1 
ATOM   10478 C CA    . GLY J 3 159 ? 56.990  -3.360  41.271 1.00 82.52  ? 153 GLY F CA    1 
ATOM   10479 C C     . GLY J 3 159 ? 56.019  -2.259  41.649 1.00 79.59  ? 153 GLY F C     1 
ATOM   10480 O O     . GLY J 3 159 ? 56.404  -1.100  41.785 1.00 76.96  ? 153 GLY F O     1 
ATOM   10481 N N     . HIS J 3 160 ? 54.756  -2.639  41.828 1.00 80.60  ? 154 HIS F N     1 
ATOM   10482 C CA    . HIS J 3 160 ? 53.718  -1.741  42.317 1.00 78.65  ? 154 HIS F CA    1 
ATOM   10483 C C     . HIS J 3 160 ? 54.104  -1.143  43.678 1.00 76.98  ? 154 HIS F C     1 
ATOM   10484 O O     . HIS J 3 160 ? 54.071  0.076   43.859 1.00 74.28  ? 154 HIS F O     1 
ATOM   10485 C CB    . HIS J 3 160 ? 52.390  -2.500  42.419 1.00 81.22  ? 154 HIS F CB    1 
ATOM   10486 C CG    . HIS J 3 160 ? 51.195  -1.624  42.645 1.00 80.56  ? 154 HIS F CG    1 
ATOM   10487 N ND1   . HIS J 3 160 ? 49.950  -1.930  42.140 1.00 82.95  ? 154 HIS F ND1   1 
ATOM   10488 C CD2   . HIS J 3 160 ? 51.051  -0.458  43.320 1.00 78.25  ? 154 HIS F CD2   1 
ATOM   10489 C CE1   . HIS J 3 160 ? 49.090  -0.995  42.499 1.00 81.79  ? 154 HIS F CE1   1 
ATOM   10490 N NE2   . HIS J 3 160 ? 49.733  -0.089  43.214 1.00 79.49  ? 154 HIS F NE2   1 
ATOM   10491 N N     . TYR J 3 161 ? 54.481  -2.005  44.623 1.00 78.79  ? 155 TYR F N     1 
ATOM   10492 C CA    . TYR J 3 161 ? 54.926  -1.574  45.948 1.00 77.93  ? 155 TYR F CA    1 
ATOM   10493 C C     . TYR J 3 161 ? 56.059  -0.547  45.868 1.00 75.51  ? 155 TYR F C     1 
ATOM   10494 O O     . TYR J 3 161 ? 56.120  0.379   46.683 1.00 73.77  ? 155 TYR F O     1 
ATOM   10495 C CB    . TYR J 3 161 ? 55.360  -2.784  46.786 1.00 81.10  ? 155 TYR F CB    1 
ATOM   10496 C CG    . TYR J 3 161 ? 55.992  -2.443  48.126 1.00 80.70  ? 155 TYR F CG    1 
ATOM   10497 C CD1   . TYR J 3 161 ? 57.363  -2.240  48.239 1.00 80.25  ? 155 TYR F CD1   1 
ATOM   10498 C CD2   . TYR J 3 161 ? 55.222  -2.338  49.277 1.00 81.39  ? 1