data_5X1X
# 
_entry.id   5X1X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5X1X         
WWPDB D_1300002770 
BMRB  36048        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        
;Solution NMR Structure of DNA Mismatch Repair Protein MutT (Family Nudix Hydrolase) from Methicillin Resistant Staphylococcus aureus 252
;
_pdbx_database_related.db_id          36048 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5X1X 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wahab, A.'        1 ? 
'Durreshahwar, S.' 2 ? 
'Schwalbe, H.'     3 ? 
'Richter, C.'      4 ? 
'Choudhary, M.I.'  5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Solution NMR Structure of DNA Mismatch Repair Protein MutT (Family Nudix Hydrolase) from Methicillin Resistant Staphylococcus aureus 252
;
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
_citation_author.citation_id   primary 
_citation_author.name          'Wahab, A.' 
_citation_author.ordinal       1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Mutator mutT protein' 
_entity.formula_weight             14914.342 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.6.1.55 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKCDLIVGDKVITTEHEYDFGIV
RLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADIPAVNKIMTEG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKCDLIVGDKVITTEHEYDFGIV
RLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADIPAVNKIMTEG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   LYS n 
1 4   VAL n 
1 5   ILE n 
1 6   ASN n 
1 7   VAL n 
1 8   VAL n 
1 9   GLY n 
1 10  ALA n 
1 11  ILE n 
1 12  ILE n 
1 13  PHE n 
1 14  SER n 
1 15  ASP n 
1 16  ASN n 
1 17  LYS n 
1 18  ILE n 
1 19  LEU n 
1 20  CYS n 
1 21  ALA n 
1 22  GLN n 
1 23  ARG n 
1 24  SER n 
1 25  GLU n 
1 26  LYS n 
1 27  MET n 
1 28  SER n 
1 29  LEU n 
1 30  PRO n 
1 31  LEU n 
1 32  MET n 
1 33  TRP n 
1 34  GLU n 
1 35  PHE n 
1 36  PRO n 
1 37  GLY n 
1 38  GLY n 
1 39  LYS n 
1 40  VAL n 
1 41  GLU n 
1 42  LYS n 
1 43  ASN n 
1 44  GLU n 
1 45  THR n 
1 46  GLU n 
1 47  LYS n 
1 48  ASP n 
1 49  ALA n 
1 50  LEU n 
1 51  ILE n 
1 52  ARG n 
1 53  GLU n 
1 54  ILE n 
1 55  ARG n 
1 56  GLU n 
1 57  GLU n 
1 58  MET n 
1 59  LYS n 
1 60  CYS n 
1 61  ASP n 
1 62  LEU n 
1 63  ILE n 
1 64  VAL n 
1 65  GLY n 
1 66  ASP n 
1 67  LYS n 
1 68  VAL n 
1 69  ILE n 
1 70  THR n 
1 71  THR n 
1 72  GLU n 
1 73  HIS n 
1 74  GLU n 
1 75  TYR n 
1 76  ASP n 
1 77  PHE n 
1 78  GLY n 
1 79  ILE n 
1 80  VAL n 
1 81  ARG n 
1 82  LEU n 
1 83  THR n 
1 84  THR n 
1 85  TYR n 
1 86  LYS n 
1 87  CYS n 
1 88  THR n 
1 89  LEU n 
1 90  ASN n 
1 91  LYS n 
1 92  GLU n 
1 93  LEU n 
1 94  PRO n 
1 95  THR n 
1 96  LEU n 
1 97  THR n 
1 98  GLU n 
1 99  HIS n 
1 100 LYS n 
1 101 SER n 
1 102 ILE n 
1 103 GLU n 
1 104 TRP n 
1 105 LEU n 
1 106 SER n 
1 107 ILE n 
1 108 ASN n 
1 109 GLU n 
1 110 LEU n 
1 111 ASP n 
1 112 LYS n 
1 113 LEU n 
1 114 ASN n 
1 115 TRP n 
1 116 ALA n 
1 117 PRO n 
1 118 ALA n 
1 119 ASP n 
1 120 ILE n 
1 121 PRO n 
1 122 ALA n 
1 123 VAL n 
1 124 ASN n 
1 125 LYS n 
1 126 ILE n 
1 127 MET n 
1 128 THR n 
1 129 GLU n 
1 130 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   130 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 HMPREF0769_10658 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'methicillin resistant' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Staphylococcus aureus subsp. aureus MN8' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     548470 
_entity_src_gen.pdbx_gene_src_variant              MRSA252 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 NCTC13277 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 Bacterial 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 bacterial 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'bacterial plasmid' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   
;Bacterial expression vector, arabinose or T7 induced expression, adds N-terminal MGSDKIHHHHHHENLYFQG tag; kanamycin resistance; PIPE cloning
;
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSpeedET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A0A0E1XLJ5_STAAU 
_struct_ref.pdbx_db_accession          A0A0E1XLJ5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKKVINVVGAIIFSDNKILCAQRSEKMSLPLMWEFPGGKVEKNETEKDALIREIREEMKCDLIVGDKVITTEHEYDFGIV
RLTTYKCTLNKELPTLTEHKSIEWLSINELDKLNWAPADIPAVNKIMTEG
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5X1X 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 130 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A0A0E1XLJ5 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  130 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       130 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 '2D 1H-15N HSQC'            1 isotropic   
2  1 1 '3D HNCO'                   1 isotropic   
3  1 1 '3D HNCA'                   1 isotropic   
4  1 1 '3D HNCACB'                 1 isotropic   
8  1 1 '3D HNHA'                   1 isotropic   
10 1 1 '3D CC(CO)NH'               2 isotropic   
9  1 1 '3D (H)CC(CO)NH'            2 isotropic   
5  1 1 '3D 1H-15N NOESY'           1 isotropic   
6  1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic   
7  1 1 '3D 1H-13C NOESY aromatic'  1 anisotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     6.9 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         '25 mM sodium phosphate, 100 mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.details                
'The protein sample was made using 25 mM sodium phosphate buffer, pH 6.9, 100 mM NaCl, 1 mM DTT, 0.15 mM DSS, 5% D2O' 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  conditions-1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1 mM [U-99% 13C; U-99% 15N] DNA Mismatch Repair Protein MutT from Nudix Hydrolase Family, 95% H2O/5% D2O' 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
_pdbx_nmr_sample_details.label            '15N, 13C labeled' 
_pdbx_nmr_sample_details.type             solution 
_pdbx_nmr_sample_details.details          
'The protein sample was made using 25 mM sodium phosphate buffer, pH 6.9, 100 mM NaCl, 1 mM DTT, 0.15 mM DSS, 5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 Ascend    ? Bruker 800 'Equipped with cryogenically cooled probe' 
2 AvanceIII ? Bruker 600 'Equipped with cryogenically cooled probe' 
# 
_pdbx_nmr_refine.entry_id           5X1X 
_pdbx_nmr_refine.method             'distance geometry' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   8 
# 
_pdbx_nmr_ensemble.entry_id                                      5X1X 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'all calculated structures submitted' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5X1X 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection                  TOPSPIN '3.6 pl5'  'Bruker Biospin'                    
5 processing                  TOPSPIN '3.5 pl5'  'Bruker Biospin'                    
2 'data analysis'             CARA    ?          'Keller and Wuthrich'               
3 'data analysis'             SPARKY  'SPARKY 3' 'T. D. Goddard and D. G. Kneller'   
4 'chemical shift assignment' CARA    ?          'Keller and Wuthrich'               
6 'chemical shift assignment' SPARKY  'SPARKY 3' 'T. D. Goddard and D. G. Kneller'   
7 'structure calculation'     CYANA   3.97       'Guntert, Mumenthaler and Wuthrich' 
8 refinement                  CYANA   3.97       'Guntert, Mumenthaler and Wuthrich' 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5X1X 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5X1X 
_struct.title                        
;Solution NMR Structure of DNA Mismatch Repair Protein MutT (Family Nudix Hydrolase) from Methicillin Resistant Staphylococcus aureus 252
;
_struct.pdbx_descriptor              'Mutator mutT protein (E.C.3.6.1.55)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5X1X 
_struct_keywords.text            
'divalent ion (Mg2+, Ca2+) binding protein, adenosine monophosphate (AMP) binding protein, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 LYS A 47  ? GLU A 57  ? LYS A 47  GLU A 57  1 ? 11 
HELX_P HELX_P2 AA2 GLU A 109 ? ASN A 114 ? GLU A 109 ASN A 114 5 ? 6  
HELX_P HELX_P3 AA3 ASP A 119 ? THR A 128 ? ASP A 119 THR A 128 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 4  ? VAL A 8  ? VAL A 4  VAL A 8  
AA1 2 GLY A 78 ? THR A 88 ? GLY A 78 THR A 88 
AA1 3 ILE A 11 ? SER A 14 ? ILE A 11 SER A 14 
AA1 4 LYS A 17 ? ILE A 18 ? LYS A 17 ILE A 18 
AA2 1 VAL A 4  ? VAL A 8  ? VAL A 4  VAL A 8  
AA2 2 GLY A 78 ? THR A 88 ? GLY A 78 THR A 88 
AA2 3 VAL A 64 ? TYR A 75 ? VAL A 64 TYR A 75 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 5  ? N ILE A 5  O ILE A 79 ? O ILE A 79 
AA1 2 3 O CYS A 87 ? O CYS A 87 N ILE A 11 ? N ILE A 11 
AA1 3 4 N SER A 14 ? N SER A 14 O LYS A 17 ? O LYS A 17 
AA2 1 2 N ILE A 5  ? N ILE A 5  O ILE A 79 ? O ILE A 79 
AA2 2 3 O LYS A 86 ? O LYS A 86 N GLY A 65 ? N GLY A 65 
# 
_atom_sites.entry_id                    5X1X 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 1.329  0.000   0.000  1.00 0.00  ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 2.093  -0.001  -1.242 1.00 52.33 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 3.032  -1.201  -1.302 1.00 60.13 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 3.158  -1.853  -2.339 1.00 41.33 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 2.894  1.296   -1.374 1.00 23.20 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 3.743  1.612   -0.153 1.00 41.13 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 4.586  3.200   -0.286 1.00 42.42 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 3.271  4.322   0.184  1.00 4.13  ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 1.808  0.000   0.855  1.00 20.41 ? 1   MET A H1   1  
ATOM 10    H HA   . MET A 1 1   ? 1.392  -0.065  -2.061 1.00 65.14 ? 1   MET A HA   1  
ATOM 11    H HB2  . MET A 1 1   ? 3.548  1.216   -2.229 1.00 61.44 ? 1   MET A HB2  1  
ATOM 12    H HB3  . MET A 1 1   ? 2.209  2.115   -1.530 1.00 55.14 ? 1   MET A HB3  1  
ATOM 13    H HG2  . MET A 1 1   ? 3.105  1.632   0.718  1.00 71.14 ? 1   MET A HG2  1  
ATOM 14    H HG3  . MET A 1 1   ? 4.484  0.835   -0.036 1.00 51.04 ? 1   MET A HG3  1  
ATOM 15    H HE1  . MET A 1 1   ? 3.625  4.988   0.957  1.00 25.03 ? 1   MET A HE1  1  
ATOM 16    H HE2  . MET A 1 1   ? 2.966  4.899   -0.676 1.00 32.11 ? 1   MET A HE2  1  
ATOM 17    H HE3  . MET A 1 1   ? 2.430  3.755   0.555  1.00 22.45 ? 1   MET A HE3  1  
ATOM 18    N N    . LYS A 1 2   ? 3.690  -1.488  -0.184 1.00 71.43 ? 2   LYS A N    1  
ATOM 19    C CA   . LYS A 1 2   ? 4.617  -2.611  -0.109 1.00 23.04 ? 2   LYS A CA   1  
ATOM 20    C C    . LYS A 1 2   ? 4.488  -3.334  1.228  1.00 20.40 ? 2   LYS A C    1  
ATOM 21    O O    . LYS A 1 2   ? 4.040  -2.756  2.218  1.00 35.11 ? 2   LYS A O    1  
ATOM 22    C CB   . LYS A 1 2   ? 6.056  -2.125  -0.300 1.00 53.33 ? 2   LYS A CB   1  
ATOM 23    C CG   . LYS A 1 2   ? 6.392  -1.771  -1.739 1.00 34.22 ? 2   LYS A CG   1  
ATOM 24    C CD   . LYS A 1 2   ? 6.387  -3.001  -2.631 1.00 30.20 ? 2   LYS A CD   1  
ATOM 25    C CE   . LYS A 1 2   ? 6.738  -2.648  -4.068 1.00 61.53 ? 2   LYS A CE   1  
ATOM 26    N NZ   . LYS A 1 2   ? 6.720  -3.846  -4.953 1.00 42.14 ? 2   LYS A NZ   1  
ATOM 27    H H    . LYS A 1 2   ? 3.547  -0.932  0.610  1.00 4.24  ? 2   LYS A H    1  
ATOM 28    H HA   . LYS A 1 2   ? 4.370  -3.300  -0.902 1.00 43.54 ? 2   LYS A HA   1  
ATOM 29    H HB2  . LYS A 1 2   ? 6.211  -1.247  0.310  1.00 74.12 ? 2   LYS A HB2  1  
ATOM 30    H HB3  . LYS A 1 2   ? 6.732  -2.902  0.024  1.00 21.34 ? 2   LYS A HB3  1  
ATOM 31    H HG2  . LYS A 1 2   ? 5.659  -1.069  -2.108 1.00 73.32 ? 2   LYS A HG2  1  
ATOM 32    H HG3  . LYS A 1 2   ? 7.373  -1.319  -1.769 1.00 71.30 ? 2   LYS A HG3  1  
ATOM 33    H HD2  . LYS A 1 2   ? 7.113  -3.708  -2.258 1.00 71.54 ? 2   LYS A HD2  1  
ATOM 34    H HD3  . LYS A 1 2   ? 5.403  -3.447  -2.609 1.00 73.40 ? 2   LYS A HD3  1  
ATOM 35    H HE2  . LYS A 1 2   ? 6.021  -1.930  -4.434 1.00 71.14 ? 2   LYS A HE2  1  
ATOM 36    H HE3  . LYS A 1 2   ? 7.726  -2.212  -4.087 1.00 30.22 ? 2   LYS A HE3  1  
ATOM 37    H HZ1  . LYS A 1 2   ? 7.641  -4.329  -4.919 1.00 52.34 ? 2   LYS A HZ1  1  
ATOM 38    H HZ2  . LYS A 1 2   ? 6.527  -3.562  -5.935 1.00 12.22 ? 2   LYS A HZ2  1  
ATOM 39    H HZ3  . LYS A 1 2   ? 5.981  -4.509  -4.643 1.00 43.45 ? 2   LYS A HZ3  1  
ATOM 40    N N    . LYS A 1 3   ? 4.885  -4.602  1.250  1.00 30.32 ? 3   LYS A N    1  
ATOM 41    C CA   . LYS A 1 3   ? 4.816  -5.405  2.466  1.00 45.24 ? 3   LYS A CA   1  
ATOM 42    C C    . LYS A 1 3   ? 6.134  -5.344  3.233  1.00 74.24 ? 3   LYS A C    1  
ATOM 43    O O    . LYS A 1 3   ? 7.127  -5.948  2.828  1.00 23.34 ? 3   LYS A O    1  
ATOM 44    C CB   . LYS A 1 3   ? 4.480  -6.858  2.124  1.00 53.15 ? 3   LYS A CB   1  
ATOM 45    C CG   . LYS A 1 3   ? 2.988  -7.130  2.028  1.00 65.31 ? 3   LYS A CG   1  
ATOM 46    C CD   . LYS A 1 3   ? 2.710  -8.545  1.548  1.00 53.34 ? 3   LYS A CD   1  
ATOM 47    C CE   . LYS A 1 3   ? 1.237  -8.743  1.222  1.00 42.42 ? 3   LYS A CE   1  
ATOM 48    N NZ   . LYS A 1 3   ? 0.442  -9.083  2.434  1.00 52.11 ? 3   LYS A NZ   1  
ATOM 49    H H    . LYS A 1 3   ? 5.234  -5.008  0.428  1.00 33.24 ? 3   LYS A H    1  
ATOM 50    H HA   . LYS A 1 3   ? 4.033  -4.999  3.087  1.00 32.33 ? 3   LYS A HA   1  
ATOM 51    H HB2  . LYS A 1 3   ? 4.931  -7.106  1.174  1.00 4.33  ? 3   LYS A HB2  1  
ATOM 52    H HB3  . LYS A 1 3   ? 4.893  -7.500  2.888  1.00 63.22 ? 3   LYS A HB3  1  
ATOM 53    H HG2  . LYS A 1 3   ? 2.544  -6.999  3.003  1.00 23.04 ? 3   LYS A HG2  1  
ATOM 54    H HG3  . LYS A 1 3   ? 2.548  -6.430  1.332  1.00 32.14 ? 3   LYS A HG3  1  
ATOM 55    H HD2  . LYS A 1 3   ? 3.292  -8.735  0.658  1.00 20.24 ? 3   LYS A HD2  1  
ATOM 56    H HD3  . LYS A 1 3   ? 2.995  -9.242  2.323  1.00 12.30 ? 3   LYS A HD3  1  
ATOM 57    H HE2  . LYS A 1 3   ? 0.851  -7.831  0.793  1.00 42.32 ? 3   LYS A HE2  1  
ATOM 58    H HE3  . LYS A 1 3   ? 1.146  -9.545  0.504  1.00 14.34 ? 3   LYS A HE3  1  
ATOM 59    H HZ1  . LYS A 1 3   ? 0.618  -10.070 2.711  1.00 2.20  ? 3   LYS A HZ1  1  
ATOM 60    H HZ2  . LYS A 1 3   ? -0.573 -8.966  2.240  1.00 50.42 ? 3   LYS A HZ2  1  
ATOM 61    H HZ3  . LYS A 1 3   ? 0.708  -8.460  3.223  1.00 55.44 ? 3   LYS A HZ3  1  
ATOM 62    N N    . VAL A 1 4   ? 6.134  -4.612  4.342  1.00 31.43 ? 4   VAL A N    1  
ATOM 63    C CA   . VAL A 1 4   ? 7.328  -4.475  5.167  1.00 22.33 ? 4   VAL A CA   1  
ATOM 64    C C    . VAL A 1 4   ? 7.675  -5.791  5.856  1.00 53.24 ? 4   VAL A C    1  
ATOM 65    O O    . VAL A 1 4   ? 7.065  -6.156  6.861  1.00 74.42 ? 4   VAL A O    1  
ATOM 66    C CB   . VAL A 1 4   ? 7.149  -3.381  6.236  1.00 4.12  ? 4   VAL A CB   1  
ATOM 67    C CG1  . VAL A 1 4   ? 8.399  -3.264  7.096  1.00 70.43 ? 4   VAL A CG1  1  
ATOM 68    C CG2  . VAL A 1 4   ? 6.816  -2.048  5.583  1.00 74.20 ? 4   VAL A CG2  1  
ATOM 69    H H    . VAL A 1 4   ? 5.311  -4.154  4.613  1.00 60.41 ? 4   VAL A H    1  
ATOM 70    H HA   . VAL A 1 4   ? 8.148  -4.190  4.524  1.00 72.13 ? 4   VAL A HA   1  
ATOM 71    H HB   . VAL A 1 4   ? 6.325  -3.661  6.875  1.00 31.31 ? 4   VAL A HB   1  
ATOM 72    H HG11 . VAL A 1 4   ? 8.788  -2.259  7.030  1.00 42.10 ? 4   VAL A HG11 1  
ATOM 73    H HG12 . VAL A 1 4   ? 8.152  -3.490  8.123  1.00 62.02 ? 4   VAL A HG12 1  
ATOM 74    H HG13 . VAL A 1 4   ? 9.145  -3.962  6.743  1.00 54.23 ? 4   VAL A HG13 1  
ATOM 75    H HG21 . VAL A 1 4   ? 6.762  -1.280  6.340  1.00 25.42 ? 4   VAL A HG21 1  
ATOM 76    H HG22 . VAL A 1 4   ? 7.584  -1.795  4.867  1.00 3.01  ? 4   VAL A HG22 1  
ATOM 77    H HG23 . VAL A 1 4   ? 5.864  -2.123  5.078  1.00 43.24 ? 4   VAL A HG23 1  
ATOM 78    N N    . ILE A 1 5   ? 8.658  -6.498  5.308  1.00 14.41 ? 5   ILE A N    1  
ATOM 79    C CA   . ILE A 1 5   ? 9.086  -7.772  5.871  1.00 63.14 ? 5   ILE A CA   1  
ATOM 80    C C    . ILE A 1 5   ? 10.093 -7.565  6.997  1.00 14.04 ? 5   ILE A C    1  
ATOM 81    O O    . ILE A 1 5   ? 11.255 -7.243  6.754  1.00 54.10 ? 5   ILE A O    1  
ATOM 82    C CB   . ILE A 1 5   ? 9.715  -8.679  4.796  1.00 3.41  ? 5   ILE A CB   1  
ATOM 83    C CG1  . ILE A 1 5   ? 8.997  -8.494  3.458  1.00 42.23 ? 5   ILE A CG1  1  
ATOM 84    C CG2  . ILE A 1 5   ? 9.663  -10.135 5.235  1.00 42.54 ? 5   ILE A CG2  1  
ATOM 85    C CD1  . ILE A 1 5   ? 7.506  -8.733  3.534  1.00 15.32 ? 5   ILE A CD1  1  
ATOM 86    H H    . ILE A 1 5   ? 9.105  -6.154  4.508  1.00 44.45 ? 5   ILE A H    1  
ATOM 87    H HA   . ILE A 1 5   ? 8.214  -8.271  6.268  1.00 1.23  ? 5   ILE A HA   1  
ATOM 88    H HB   . ILE A 1 5   ? 10.751 -8.399  4.682  1.00 4.13  ? 5   ILE A HB   1  
ATOM 89    H HG12 . ILE A 1 5   ? 9.153  -7.485  3.109  1.00 64.34 ? 5   ILE A HG12 1  
ATOM 90    H HG13 . ILE A 1 5   ? 9.409  -9.187  2.738  1.00 33.13 ? 5   ILE A HG13 1  
ATOM 91    H HG21 . ILE A 1 5   ? 8.724  -10.327 5.731  1.00 33.34 ? 5   ILE A HG21 1  
ATOM 92    H HG22 . ILE A 1 5   ? 9.749  -10.774 4.369  1.00 24.01 ? 5   ILE A HG22 1  
ATOM 93    H HG23 . ILE A 1 5   ? 10.478 -10.336 5.914  1.00 14.51 ? 5   ILE A HG23 1  
ATOM 94    H HD11 . ILE A 1 5   ? 7.073  -8.076  4.274  1.00 13.31 ? 5   ILE A HD11 1  
ATOM 95    H HD12 . ILE A 1 5   ? 7.059  -8.536  2.571  1.00 31.23 ? 5   ILE A HD12 1  
ATOM 96    H HD13 . ILE A 1 5   ? 7.320  -9.760  3.814  1.00 54.01 ? 5   ILE A HD13 1  
ATOM 97    N N    . ASN A 1 6   ? 9.638  -7.754  8.232  1.00 53.11 ? 6   ASN A N    1  
ATOM 98    C CA   . ASN A 1 6   ? 10.499 -7.589  9.397  1.00 33.14 ? 6   ASN A CA   1  
ATOM 99    C C    . ASN A 1 6   ? 11.120 -8.921  9.807  1.00 2.33  ? 6   ASN A C    1  
ATOM 100   O O    . ASN A 1 6   ? 10.415 -9.862  10.170 1.00 74.12 ? 6   ASN A O    1  
ATOM 101   C CB   . ASN A 1 6   ? 9.704  -7.003  10.566 1.00 74.30 ? 6   ASN A CB   1  
ATOM 102   C CG   . ASN A 1 6   ? 10.597 -6.353  11.605 1.00 52.24 ? 6   ASN A CG   1  
ATOM 103   O OD1  . ASN A 1 6   ? 11.616 -6.917  12.004 1.00 53.40 ? 6   ASN A OD1  1  
ATOM 104   N ND2  . ASN A 1 6   ? 10.217 -5.160  12.047 1.00 2.34  ? 6   ASN A ND2  1  
ATOM 105   H H    . ASN A 1 6   ? 8.701  -8.010  8.362  1.00 12.04 ? 6   ASN A H    1  
ATOM 106   H HA   . ASN A 1 6   ? 11.289 -6.903  9.131  1.00 34.03 ? 6   ASN A HA   1  
ATOM 107   H HB2  . ASN A 1 6   ? 9.019  -6.257  10.190 1.00 44.34 ? 6   ASN A HB2  1  
ATOM 108   H HB3  . ASN A 1 6   ? 9.142  -7.792  11.043 1.00 22.24 ? 6   ASN A HB3  1  
ATOM 109   H HD21 . ASN A 1 6   ? 9.394  -4.771  11.684 1.00 33.34 ? 6   ASN A HD21 1  
ATOM 110   H HD22 . ASN A 1 6   ? 10.777 -4.716  12.719 1.00 73.23 ? 6   ASN A HD22 1  
ATOM 111   N N    . VAL A 1 7   ? 12.446 -8.992  9.748  1.00 43.12 ? 7   VAL A N    1  
ATOM 112   C CA   . VAL A 1 7   ? 13.164 -10.207 10.114 1.00 32.12 ? 7   VAL A CA   1  
ATOM 113   C C    . VAL A 1 7   ? 14.398 -9.886  10.949 1.00 2.33  ? 7   VAL A C    1  
ATOM 114   O O    . VAL A 1 7   ? 15.121 -8.930  10.667 1.00 54.23 ? 7   VAL A O    1  
ATOM 115   C CB   . VAL A 1 7   ? 13.594 -11.003 8.867  1.00 11.44 ? 7   VAL A CB   1  
ATOM 116   C CG1  . VAL A 1 7   ? 12.375 -11.494 8.101  1.00 24.41 ? 7   VAL A CG1  1  
ATOM 117   C CG2  . VAL A 1 7   ? 14.487 -10.153 7.976  1.00 24.41 ? 7   VAL A CG2  1  
ATOM 118   H H    . VAL A 1 7   ? 12.954 -8.208  9.451  1.00 61.20 ? 7   VAL A H    1  
ATOM 119   H HA   . VAL A 1 7   ? 12.497 -10.825 10.698 1.00 62.42 ? 7   VAL A HA   1  
ATOM 120   H HB   . VAL A 1 7   ? 14.159 -11.864 9.192  1.00 1.11  ? 7   VAL A HB   1  
ATOM 121   H HG11 . VAL A 1 7   ? 11.892 -10.658 7.618  1.00 4.42  ? 7   VAL A HG11 1  
ATOM 122   H HG12 . VAL A 1 7   ? 12.684 -12.213 7.356  1.00 42.21 ? 7   VAL A HG12 1  
ATOM 123   H HG13 . VAL A 1 7   ? 11.684 -11.961 8.787  1.00 74.42 ? 7   VAL A HG13 1  
ATOM 124   H HG21 . VAL A 1 7   ? 13.926 -9.309  7.604  1.00 31.35 ? 7   VAL A HG21 1  
ATOM 125   H HG22 . VAL A 1 7   ? 15.334 -9.799  8.547  1.00 71.22 ? 7   VAL A HG22 1  
ATOM 126   H HG23 . VAL A 1 7   ? 14.837 -10.748 7.145  1.00 3.34  ? 7   VAL A HG23 1  
ATOM 127   N N    . VAL A 1 8   ? 14.635 -10.691 11.980 1.00 60.42 ? 8   VAL A N    1  
ATOM 128   C CA   . VAL A 1 8   ? 15.784 -10.494 12.856 1.00 35.31 ? 8   VAL A CA   1  
ATOM 129   C C    . VAL A 1 8   ? 16.614 -11.768 12.968 1.00 3.30  ? 8   VAL A C    1  
ATOM 130   O O    . VAL A 1 8   ? 16.073 -12.868 13.062 1.00 31.31 ? 8   VAL A O    1  
ATOM 131   C CB   . VAL A 1 8   ? 15.345 -10.055 14.266 1.00 40.13 ? 8   VAL A CB   1  
ATOM 132   C CG1  . VAL A 1 8   ? 14.452 -11.110 14.901 1.00 64.23 ? 8   VAL A CG1  1  
ATOM 133   C CG2  . VAL A 1 8   ? 16.560 -9.777  15.138 1.00 15.35 ? 8   VAL A CG2  1  
ATOM 134   H H    . VAL A 1 8   ? 14.023 -11.437 12.154 1.00 1.43  ? 8   VAL A H    1  
ATOM 135   H HA   . VAL A 1 8   ? 16.397 -9.712  12.432 1.00 35.04 ? 8   VAL A HA   1  
ATOM 136   H HB   . VAL A 1 8   ? 14.776 -9.141  14.175 1.00 21.23 ? 8   VAL A HB   1  
ATOM 137   H HG11 . VAL A 1 8   ? 13.567 -11.243 14.296 1.00 30.14 ? 8   VAL A HG11 1  
ATOM 138   H HG12 . VAL A 1 8   ? 14.990 -12.045 14.965 1.00 34.12 ? 8   VAL A HG12 1  
ATOM 139   H HG13 . VAL A 1 8   ? 14.166 -10.790 15.892 1.00 60.13 ? 8   VAL A HG13 1  
ATOM 140   H HG21 . VAL A 1 8   ? 17.188 -10.654 15.170 1.00 33.51 ? 8   VAL A HG21 1  
ATOM 141   H HG22 . VAL A 1 8   ? 17.118 -8.949  14.726 1.00 63.24 ? 8   VAL A HG22 1  
ATOM 142   H HG23 . VAL A 1 8   ? 16.236 -9.529  16.138 1.00 12.32 ? 8   VAL A HG23 1  
ATOM 143   N N    . GLY A 1 9   ? 17.934 -11.609 12.958 1.00 65.54 ? 9   GLY A N    1  
ATOM 144   C CA   . GLY A 1 9   ? 18.820 -12.755 13.059 1.00 53.00 ? 9   GLY A CA   1  
ATOM 145   C C    . GLY A 1 9   ? 19.520 -12.829 14.401 1.00 30.53 ? 9   GLY A C    1  
ATOM 146   O O    . GLY A 1 9   ? 19.410 -11.915 15.218 1.00 61.32 ? 9   GLY A O    1  
ATOM 147   H H    . GLY A 1 9   ? 18.310 -10.708 12.880 1.00 4.53  ? 9   GLY A H    1  
ATOM 148   H HA2  . GLY A 1 9   ? 18.242 -13.656 12.915 1.00 24.12 ? 9   GLY A HA2  1  
ATOM 149   H HA3  . GLY A 1 9   ? 19.565 -12.689 12.280 1.00 24.13 ? 9   GLY A HA3  1  
ATOM 150   N N    . ALA A 1 10  ? 20.241 -13.922 14.631 1.00 32.10 ? 10  ALA A N    1  
ATOM 151   C CA   . ALA A 1 10  ? 20.962 -14.112 15.883 1.00 32.25 ? 10  ALA A CA   1  
ATOM 152   C C    . ALA A 1 10  ? 22.398 -14.556 15.628 1.00 21.21 ? 10  ALA A C    1  
ATOM 153   O O    . ALA A 1 10  ? 22.638 -15.538 14.924 1.00 4.43  ? 10  ALA A O    1  
ATOM 154   C CB   . ALA A 1 10  ? 20.241 -15.127 16.758 1.00 22.34 ? 10  ALA A CB   1  
ATOM 155   H H    . ALA A 1 10  ? 20.290 -14.616 13.941 1.00 31.01 ? 10  ALA A H    1  
ATOM 156   H HA   . ALA A 1 10  ? 20.975 -13.167 16.408 1.00 64.35 ? 10  ALA A HA   1  
ATOM 157   H HB1  . ALA A 1 10  ? 19.283 -15.364 16.319 1.00 11.10 ? 10  ALA A HB1  1  
ATOM 158   H HB2  . ALA A 1 10  ? 20.836 -16.026 16.832 1.00 52.44 ? 10  ALA A HB2  1  
ATOM 159   H HB3  . ALA A 1 10  ? 20.093 -14.712 17.744 1.00 51.32 ? 10  ALA A HB3  1  
ATOM 160   N N    . ILE A 1 11  ? 23.349 -13.828 16.203 1.00 12.44 ? 11  ILE A N    1  
ATOM 161   C CA   . ILE A 1 11  ? 24.761 -14.147 16.038 1.00 62.42 ? 11  ILE A CA   1  
ATOM 162   C C    . ILE A 1 11  ? 25.403 -14.509 17.373 1.00 42.31 ? 11  ILE A C    1  
ATOM 163   O O    . ILE A 1 11  ? 25.848 -13.633 18.116 1.00 31.52 ? 11  ILE A O    1  
ATOM 164   C CB   . ILE A 1 11  ? 25.535 -12.973 15.410 1.00 14.32 ? 11  ILE A CB   1  
ATOM 165   C CG1  . ILE A 1 11  ? 25.078 -11.647 16.024 1.00 25.41 ? 11  ILE A CG1  1  
ATOM 166   C CG2  . ILE A 1 11  ? 25.342 -12.958 13.901 1.00 1.31  ? 11  ILE A CG2  1  
ATOM 167   C CD1  . ILE A 1 11  ? 25.803 -10.442 15.467 1.00 62.32 ? 11  ILE A CD1  1  
ATOM 168   H H    . ILE A 1 11  ? 23.094 -13.057 16.753 1.00 62.43 ? 11  ILE A H    1  
ATOM 169   H HA   . ILE A 1 11  ? 24.835 -14.997 15.374 1.00 54.55 ? 11  ILE A HA   1  
ATOM 170   H HB   . ILE A 1 11  ? 26.585 -13.113 15.614 1.00 41.24 ? 11  ILE A HB   1  
ATOM 171   H HG12 . ILE A 1 11  ? 24.024 -11.515 15.838 1.00 65.24 ? 11  ILE A HG12 1  
ATOM 172   H HG13 . ILE A 1 11  ? 25.251 -11.675 17.090 1.00 35.34 ? 11  ILE A HG13 1  
ATOM 173   H HG21 . ILE A 1 11  ? 26.194 -12.486 13.434 1.00 23.23 ? 11  ILE A HG21 1  
ATOM 174   H HG22 . ILE A 1 11  ? 25.250 -13.971 13.540 1.00 23.24 ? 11  ILE A HG22 1  
ATOM 175   H HG23 . ILE A 1 11  ? 24.447 -12.406 13.657 1.00 11.25 ? 11  ILE A HG23 1  
ATOM 176   H HD11 . ILE A 1 11  ? 25.837 -9.664  16.215 1.00 72.11 ? 11  ILE A HD11 1  
ATOM 177   H HD12 . ILE A 1 11  ? 26.809 -10.722 15.191 1.00 12.22 ? 11  ILE A HD12 1  
ATOM 178   H HD13 . ILE A 1 11  ? 25.279 -10.079 14.594 1.00 1.14  ? 11  ILE A HD13 1  
ATOM 179   N N    . ILE A 1 12  ? 25.450 -15.803 17.670 1.00 74.03 ? 12  ILE A N    1  
ATOM 180   C CA   . ILE A 1 12  ? 26.040 -16.280 18.914 1.00 63.21 ? 12  ILE A CA   1  
ATOM 181   C C    . ILE A 1 12  ? 27.562 -16.308 18.825 1.00 63.34 ? 12  ILE A C    1  
ATOM 182   O O    . ILE A 1 12  ? 28.132 -16.969 17.956 1.00 31.41 ? 12  ILE A O    1  
ATOM 183   C CB   . ILE A 1 12  ? 25.532 -17.689 19.274 1.00 3.23  ? 12  ILE A CB   1  
ATOM 184   C CG1  . ILE A 1 12  ? 24.033 -17.652 19.578 1.00 42.11 ? 12  ILE A CG1  1  
ATOM 185   C CG2  . ILE A 1 12  ? 26.305 -18.243 20.462 1.00 43.22 ? 12  ILE A CG2  1  
ATOM 186   C CD1  . ILE A 1 12  ? 23.170 -18.090 18.415 1.00 3.13  ? 12  ILE A CD1  1  
ATOM 187   H H    . ILE A 1 12  ? 25.079 -16.452 17.037 1.00 74.32 ? 12  ILE A H    1  
ATOM 188   H HA   . ILE A 1 12  ? 25.749 -15.601 19.703 1.00 71.54 ? 12  ILE A HA   1  
ATOM 189   H HB   . ILE A 1 12  ? 25.705 -18.337 18.429 1.00 44.11 ? 12  ILE A HB   1  
ATOM 190   H HG12 . ILE A 1 12  ? 23.824 -18.306 20.410 1.00 44.32 ? 12  ILE A HG12 1  
ATOM 191   H HG13 . ILE A 1 12  ? 23.751 -16.642 19.839 1.00 24.15 ? 12  ILE A HG13 1  
ATOM 192   H HG21 . ILE A 1 12  ? 27.154 -18.808 20.107 1.00 61.44 ? 12  ILE A HG21 1  
ATOM 193   H HG22 . ILE A 1 12  ? 26.651 -17.427 21.078 1.00 14.54 ? 12  ILE A HG22 1  
ATOM 194   H HG23 . ILE A 1 12  ? 25.662 -18.886 21.043 1.00 55.05 ? 12  ILE A HG23 1  
ATOM 195   H HD11 . ILE A 1 12  ? 23.052 -19.163 18.439 1.00 74.14 ? 12  ILE A HD11 1  
ATOM 196   H HD12 . ILE A 1 12  ? 22.202 -17.618 18.487 1.00 41.11 ? 12  ILE A HD12 1  
ATOM 197   H HD13 . ILE A 1 12  ? 23.643 -17.801 17.487 1.00 23.34 ? 12  ILE A HD13 1  
ATOM 198   N N    . PHE A 1 13  ? 28.216 -15.588 19.730 1.00 51.52 ? 13  PHE A N    1  
ATOM 199   C CA   . PHE A 1 13  ? 29.673 -15.530 19.754 1.00 31.13 ? 13  PHE A CA   1  
ATOM 200   C C    . PHE A 1 13  ? 30.233 -16.411 20.867 1.00 2.33  ? 13  PHE A C    1  
ATOM 201   O O    . PHE A 1 13  ? 29.653 -16.507 21.949 1.00 62.12 ? 13  PHE A O    1  
ATOM 202   C CB   . PHE A 1 13  ? 30.144 -14.087 19.944 1.00 4.12  ? 13  PHE A CB   1  
ATOM 203   C CG   . PHE A 1 13  ? 30.152 -13.287 18.673 1.00 11.42 ? 13  PHE A CG   1  
ATOM 204   C CD1  . PHE A 1 13  ? 28.965 -12.851 18.106 1.00 2.23  ? 13  PHE A CD1  1  
ATOM 205   C CD2  . PHE A 1 13  ? 31.346 -12.971 18.045 1.00 11.51 ? 13  PHE A CD2  1  
ATOM 206   C CE1  . PHE A 1 13  ? 28.969 -12.114 16.937 1.00 54.21 ? 13  PHE A CE1  1  
ATOM 207   C CE2  . PHE A 1 13  ? 31.355 -12.234 16.876 1.00 45.50 ? 13  PHE A CE2  1  
ATOM 208   C CZ   . PHE A 1 13  ? 30.165 -11.806 16.320 1.00 4.35  ? 13  PHE A CZ   1  
ATOM 209   H H    . PHE A 1 13  ? 27.706 -15.082 20.397 1.00 50.51 ? 13  PHE A H    1  
ATOM 210   H HA   . PHE A 1 13  ? 30.034 -15.896 18.806 1.00 42.03 ? 13  PHE A HA   1  
ATOM 211   H HB2  . PHE A 1 13  ? 29.489 -13.591 20.644 1.00 1.31  ? 13  PHE A HB2  1  
ATOM 212   H HB3  . PHE A 1 13  ? 31.149 -14.093 20.340 1.00 73.31 ? 13  PHE A HB3  1  
ATOM 213   H HD1  . PHE A 1 13  ? 28.028 -13.092 18.588 1.00 52.21 ? 13  PHE A HD1  1  
ATOM 214   H HD2  . PHE A 1 13  ? 32.277 -13.305 18.478 1.00 63.25 ? 13  PHE A HD2  1  
ATOM 215   H HE1  . PHE A 1 13  ? 28.036 -11.781 16.506 1.00 61.15 ? 13  PHE A HE1  1  
ATOM 216   H HE2  . PHE A 1 13  ? 32.293 -11.994 16.396 1.00 74.22 ? 13  PHE A HE2  1  
ATOM 217   H HZ   . PHE A 1 13  ? 30.170 -11.230 15.407 1.00 4.44  ? 13  PHE A HZ   1  
ATOM 218   N N    . SER A 1 14  ? 31.365 -17.052 20.593 1.00 12.14 ? 14  SER A N    1  
ATOM 219   C CA   . SER A 1 14  ? 32.002 -17.928 21.569 1.00 22.50 ? 14  SER A CA   1  
ATOM 220   C C    . SER A 1 14  ? 33.377 -18.376 21.081 1.00 12.32 ? 14  SER A C    1  
ATOM 221   O O    . SER A 1 14  ? 33.501 -18.995 20.025 1.00 64.33 ? 14  SER A O    1  
ATOM 222   C CB   . SER A 1 14  ? 31.122 -19.150 21.840 1.00 63.31 ? 14  SER A CB   1  
ATOM 223   O OG   . SER A 1 14  ? 31.118 -20.032 20.730 1.00 14.41 ? 14  SER A OG   1  
ATOM 224   H H    . SER A 1 14  ? 31.779 -16.934 19.713 1.00 64.41 ? 14  SER A H    1  
ATOM 225   H HA   . SER A 1 14  ? 32.122 -17.372 22.486 1.00 3.53  ? 14  SER A HA   1  
ATOM 226   H HB2  . SER A 1 14  ? 31.500 -19.679 22.702 1.00 12.40 ? 14  SER A HB2  1  
ATOM 227   H HB3  . SER A 1 14  ? 30.110 -18.826 22.031 1.00 14.23 ? 14  SER A HB3  1  
ATOM 228   H HG   . SER A 1 14  ? 31.661 -20.798 20.927 1.00 3.23  ? 14  SER A HG   1  
ATOM 229   N N    . ASP A 1 15  ? 34.406 -18.057 21.858 1.00 12.34 ? 15  ASP A N    1  
ATOM 230   C CA   . ASP A 1 15  ? 35.772 -18.426 21.507 1.00 4.35  ? 15  ASP A CA   1  
ATOM 231   C C    . ASP A 1 15  ? 36.169 -17.826 20.162 1.00 73.11 ? 15  ASP A C    1  
ATOM 232   O O    . ASP A 1 15  ? 36.936 -18.422 19.408 1.00 70.34 ? 15  ASP A O    1  
ATOM 233   C CB   . ASP A 1 15  ? 35.917 -19.948 21.464 1.00 1.30  ? 15  ASP A CB   1  
ATOM 234   C CG   . ASP A 1 15  ? 36.139 -20.548 22.839 1.00 54.34 ? 15  ASP A CG   1  
ATOM 235   O OD1  . ASP A 1 15  ? 37.283 -20.486 23.336 1.00 14.00 ? 15  ASP A OD1  1  
ATOM 236   O OD2  . ASP A 1 15  ? 35.168 -21.078 23.417 1.00 33.24 ? 15  ASP A OD2  1  
ATOM 237   H H    . ASP A 1 15  ? 34.242 -17.562 22.689 1.00 44.33 ? 15  ASP A H    1  
ATOM 238   H HA   . ASP A 1 15  ? 36.428 -18.033 22.270 1.00 41.34 ? 15  ASP A HA   1  
ATOM 239   H HB2  . ASP A 1 15  ? 35.018 -20.377 21.045 1.00 3.33  ? 15  ASP A HB2  1  
ATOM 240   H HB3  . ASP A 1 15  ? 36.759 -20.205 20.838 1.00 1.05  ? 15  ASP A HB3  1  
ATOM 241   N N    . ASN A 1 16  ? 35.639 -16.643 19.868 1.00 71.10 ? 16  ASN A N    1  
ATOM 242   C CA   . ASN A 1 16  ? 35.936 -15.963 18.612 1.00 21.34 ? 16  ASN A CA   1  
ATOM 243   C C    . ASN A 1 16  ? 35.457 -16.787 17.421 1.00 22.30 ? 16  ASN A C    1  
ATOM 244   O O    . ASN A 1 16  ? 36.136 -16.873 16.398 1.00 42.24 ? 16  ASN A O    1  
ATOM 245   C CB   . ASN A 1 16  ? 37.439 -15.701 18.494 1.00 52.51 ? 16  ASN A CB   1  
ATOM 246   C CG   . ASN A 1 16  ? 38.061 -15.294 19.816 1.00 54.31 ? 16  ASN A CG   1  
ATOM 247   O OD1  . ASN A 1 16  ? 37.541 -14.426 20.518 1.00 61.10 ? 16  ASN A OD1  1  
ATOM 248   N ND2  . ASN A 1 16  ? 39.179 -15.920 20.161 1.00 23.40 ? 16  ASN A ND2  1  
ATOM 249   H H    . ASN A 1 16  ? 35.034 -16.217 20.510 1.00 35.12 ? 16  ASN A H    1  
ATOM 250   H HA   . ASN A 1 16  ? 35.414 -15.019 18.615 1.00 13.43 ? 16  ASN A HA   1  
ATOM 251   H HB2  . ASN A 1 16  ? 37.929 -16.599 18.149 1.00 21.43 ? 16  ASN A HB2  1  
ATOM 252   H HB3  . ASN A 1 16  ? 37.605 -14.908 17.780 1.00 72.35 ? 16  ASN A HB3  1  
ATOM 253   H HD21 . ASN A 1 16  ? 39.536 -16.601 19.552 1.00 1.41  ? 16  ASN A HD21 1  
ATOM 254   H HD22 . ASN A 1 16  ? 39.602 -15.677 21.011 1.00 21.30 ? 16  ASN A HD22 1  
ATOM 255   N N    . LYS A 1 17  ? 34.282 -17.392 17.561 1.00 24.11 ? 17  LYS A N    1  
ATOM 256   C CA   . LYS A 1 17  ? 33.710 -18.208 16.497 1.00 32.21 ? 17  LYS A CA   1  
ATOM 257   C C    . LYS A 1 17  ? 32.252 -17.833 16.248 1.00 23.23 ? 17  LYS A C    1  
ATOM 258   O O    . LYS A 1 17  ? 31.598 -17.243 17.109 1.00 62.14 ? 17  LYS A O    1  
ATOM 259   C CB   . LYS A 1 17  ? 33.812 -19.693 16.854 1.00 53.21 ? 17  LYS A CB   1  
ATOM 260   C CG   . LYS A 1 17  ? 35.040 -20.374 16.276 1.00 20.31 ? 17  LYS A CG   1  
ATOM 261   C CD   . LYS A 1 17  ? 36.275 -20.106 17.120 1.00 61.14 ? 17  LYS A CD   1  
ATOM 262   C CE   . LYS A 1 17  ? 37.483 -20.869 16.597 1.00 0.05  ? 17  LYS A CE   1  
ATOM 263   N NZ   . LYS A 1 17  ? 37.307 -22.342 16.727 1.00 22.01 ? 17  LYS A NZ   1  
ATOM 264   H H    . LYS A 1 17  ? 33.788 -17.286 18.401 1.00 34.21 ? 17  LYS A H    1  
ATOM 265   H HA   . LYS A 1 17  ? 34.275 -18.023 15.596 1.00 23.44 ? 17  LYS A HA   1  
ATOM 266   H HB2  . LYS A 1 17  ? 33.843 -19.791 17.929 1.00 63.00 ? 17  LYS A HB2  1  
ATOM 267   H HB3  . LYS A 1 17  ? 32.935 -20.201 16.480 1.00 34.53 ? 17  LYS A HB3  1  
ATOM 268   H HG2  . LYS A 1 17  ? 34.866 -21.440 16.240 1.00 3.52  ? 17  LYS A HG2  1  
ATOM 269   H HG3  . LYS A 1 17  ? 35.210 -20.002 15.276 1.00 42.50 ? 17  LYS A HG3  1  
ATOM 270   H HD2  . LYS A 1 17  ? 36.494 -19.049 17.096 1.00 11.13 ? 17  LYS A HD2  1  
ATOM 271   H HD3  . LYS A 1 17  ? 36.079 -20.413 18.137 1.00 12.33 ? 17  LYS A HD3  1  
ATOM 272   H HE2  . LYS A 1 17  ? 37.626 -20.622 15.557 1.00 73.44 ? 17  LYS A HE2  1  
ATOM 273   H HE3  . LYS A 1 17  ? 38.354 -20.568 17.161 1.00 15.23 ? 17  LYS A HE3  1  
ATOM 274   H HZ1  . LYS A 1 17  ? 37.161 -22.768 15.789 1.00 11.15 ? 17  LYS A HZ1  1  
ATOM 275   H HZ2  . LYS A 1 17  ? 36.481 -22.552 17.323 1.00 24.22 ? 17  LYS A HZ2  1  
ATOM 276   H HZ3  . LYS A 1 17  ? 38.152 -22.766 17.161 1.00 73.10 ? 17  LYS A HZ3  1  
ATOM 277   N N    . ILE A 1 18  ? 31.750 -18.180 15.068 1.00 20.32 ? 18  ILE A N    1  
ATOM 278   C CA   . ILE A 1 18  ? 30.369 -17.882 14.709 1.00 63.14 ? 18  ILE A CA   1  
ATOM 279   C C    . ILE A 1 18  ? 29.616 -19.150 14.319 1.00 5.24  ? 18  ILE A C    1  
ATOM 280   O O    . ILE A 1 18  ? 30.195 -20.082 13.760 1.00 45.11 ? 18  ILE A O    1  
ATOM 281   C CB   . ILE A 1 18  ? 30.295 -16.877 13.544 1.00 4.32  ? 18  ILE A CB   1  
ATOM 282   C CG1  . ILE A 1 18  ? 31.075 -15.606 13.888 1.00 25.24 ? 18  ILE A CG1  1  
ATOM 283   C CG2  . ILE A 1 18  ? 28.846 -16.544 13.223 1.00 60.12 ? 18  ILE A CG2  1  
ATOM 284   C CD1  . ILE A 1 18  ? 32.510 -15.630 13.409 1.00 1.34  ? 18  ILE A CD1  1  
ATOM 285   H H    . ILE A 1 18  ? 32.321 -18.649 14.425 1.00 41.34 ? 18  ILE A H    1  
ATOM 286   H HA   . ILE A 1 18  ? 29.889 -17.441 15.570 1.00 52.20 ? 18  ILE A HA   1  
ATOM 287   H HB   . ILE A 1 18  ? 30.736 -17.336 12.673 1.00 71.23 ? 18  ILE A HB   1  
ATOM 288   H HG12 . ILE A 1 18  ? 30.589 -14.758 13.434 1.00 54.01 ? 18  ILE A HG12 1  
ATOM 289   H HG13 . ILE A 1 18  ? 31.085 -15.478 14.961 1.00 20.43 ? 18  ILE A HG13 1  
ATOM 290   H HG21 . ILE A 1 18  ? 28.770 -15.505 12.937 1.00 20.31 ? 18  ILE A HG21 1  
ATOM 291   H HG22 . ILE A 1 18  ? 28.507 -17.166 12.408 1.00 35.24 ? 18  ILE A HG22 1  
ATOM 292   H HG23 . ILE A 1 18  ? 28.233 -16.724 14.093 1.00 5.24  ? 18  ILE A HG23 1  
ATOM 293   H HD11 . ILE A 1 18  ? 33.055 -16.396 13.941 1.00 2.30  ? 18  ILE A HD11 1  
ATOM 294   H HD12 . ILE A 1 18  ? 32.533 -15.839 12.351 1.00 44.33 ? 18  ILE A HD12 1  
ATOM 295   H HD13 . ILE A 1 18  ? 32.968 -14.669 13.596 1.00 14.54 ? 18  ILE A HD13 1  
ATOM 296   N N    . LEU A 1 19  ? 28.322 -19.178 14.617 1.00 2.54  ? 19  LEU A N    1  
ATOM 297   C CA   . LEU A 1 19  ? 27.488 -20.331 14.297 1.00 11.51 ? 19  LEU A CA   1  
ATOM 298   C C    . LEU A 1 19  ? 26.904 -20.207 12.893 1.00 11.14 ? 19  LEU A C    1  
ATOM 299   O O    . LEU A 1 19  ? 26.883 -19.121 12.312 1.00 21.24 ? 19  LEU A O    1  
ATOM 300   C CB   . LEU A 1 19  ? 26.360 -20.469 15.321 1.00 53.42 ? 19  LEU A CB   1  
ATOM 301   C CG   . LEU A 1 19  ? 25.093 -19.660 15.037 1.00 3.12  ? 19  LEU A CG   1  
ATOM 302   C CD1  . LEU A 1 19  ? 23.995 -20.025 16.024 1.00 51.32 ? 19  LEU A CD1  1  
ATOM 303   C CD2  . LEU A 1 19  ? 25.389 -18.168 15.093 1.00 24.33 ? 19  LEU A CD2  1  
ATOM 304   H H    . LEU A 1 19  ? 27.917 -18.405 15.063 1.00 21.02 ? 19  LEU A H    1  
ATOM 305   H HA   . LEU A 1 19  ? 28.111 -21.212 14.339 1.00 54.34 ? 19  LEU A HA   1  
ATOM 306   H HB2  . LEU A 1 19  ? 26.083 -21.510 15.369 1.00 74.53 ? 19  LEU A HB2  1  
ATOM 307   H HB3  . LEU A 1 19  ? 26.745 -20.156 16.281 1.00 43.12 ? 19  LEU A HB3  1  
ATOM 308   H HG   . LEU A 1 19  ? 24.739 -19.894 14.043 1.00 62.43 ? 19  LEU A HG   1  
ATOM 309   H HD11 . LEU A 1 19  ? 24.428 -20.198 16.997 1.00 64.41 ? 19  LEU A HD11 1  
ATOM 310   H HD12 . LEU A 1 19  ? 23.493 -20.920 15.688 1.00 14.13 ? 19  LEU A HD12 1  
ATOM 311   H HD13 . LEU A 1 19  ? 23.283 -19.215 16.085 1.00 10.53 ? 19  LEU A HD13 1  
ATOM 312   H HD21 . LEU A 1 19  ? 25.909 -17.939 16.012 1.00 61.30 ? 19  LEU A HD21 1  
ATOM 313   H HD22 . LEU A 1 19  ? 24.462 -17.616 15.058 1.00 54.35 ? 19  LEU A HD22 1  
ATOM 314   H HD23 . LEU A 1 19  ? 26.007 -17.892 14.252 1.00 55.05 ? 19  LEU A HD23 1  
ATOM 315   N N    . CYS A 1 20  ? 26.429 -21.325 12.355 1.00 2.24  ? 20  CYS A N    1  
ATOM 316   C CA   . CYS A 1 20  ? 25.843 -21.342 11.020 1.00 50.42 ? 20  CYS A CA   1  
ATOM 317   C C    . CYS A 1 20  ? 24.517 -22.096 11.017 1.00 3.24  ? 20  CYS A C    1  
ATOM 318   O O    . CYS A 1 20  ? 24.370 -23.114 11.692 1.00 61.51 ? 20  CYS A O    1  
ATOM 319   C CB   . CYS A 1 20  ? 26.810 -21.983 10.024 1.00 42.12 ? 20  CYS A CB   1  
ATOM 320   S SG   . CYS A 1 20  ? 26.051 -22.443 8.449  1.00 54.22 ? 20  CYS A SG   1  
ATOM 321   H H    . CYS A 1 20  ? 26.474 -22.159 12.868 1.00 71.14 ? 20  CYS A H    1  
ATOM 322   H HA   . CYS A 1 20  ? 25.662 -20.319 10.725 1.00 32.14 ? 20  CYS A HA   1  
ATOM 323   H HB2  . CYS A 1 20  ? 27.610 -21.288 9.812  1.00 73.24 ? 20  CYS A HB2  1  
ATOM 324   H HB3  . CYS A 1 20  ? 27.227 -22.877 10.463 1.00 32.10 ? 20  CYS A HB3  1  
ATOM 325   H HG   . CYS A 1 20  ? 26.467 -23.660 8.135  1.00 75.23 ? 20  CYS A HG   1  
ATOM 326   N N    . ALA A 1 21  ? 23.555 -21.587 10.255 1.00 35.05 ? 21  ALA A N    1  
ATOM 327   C CA   . ALA A 1 21  ? 22.241 -22.213 10.165 1.00 1.41  ? 21  ALA A CA   1  
ATOM 328   C C    . ALA A 1 21  ? 21.606 -21.962 8.801  1.00 24.03 ? 21  ALA A C    1  
ATOM 329   O O    . ALA A 1 21  ? 20.963 -20.935 8.586  1.00 63.11 ? 21  ALA A O    1  
ATOM 330   C CB   . ALA A 1 21  ? 21.334 -21.699 11.274 1.00 44.13 ? 21  ALA A CB   1  
ATOM 331   H H    . ALA A 1 21  ? 23.732 -20.773 9.741  1.00 45.51 ? 21  ALA A H    1  
ATOM 332   H HA   . ALA A 1 21  ? 22.368 -23.277 10.302 1.00 41.13 ? 21  ALA A HA   1  
ATOM 333   H HB1  . ALA A 1 21  ? 21.787 -21.906 12.233 1.00 43.34 ? 21  ALA A HB1  1  
ATOM 334   H HB2  . ALA A 1 21  ? 21.198 -20.634 11.162 1.00 55.30 ? 21  ALA A HB2  1  
ATOM 335   H HB3  . ALA A 1 21  ? 20.377 -22.194 11.213 1.00 13.24 ? 21  ALA A HB3  1  
ATOM 336   N N    . GLN A 1 22  ? 21.792 -22.906 7.885  1.00 64.33 ? 22  GLN A N    1  
ATOM 337   C CA   . GLN A 1 22  ? 21.238 -22.786 6.541  1.00 5.13  ? 22  GLN A CA   1  
ATOM 338   C C    . GLN A 1 22  ? 19.739 -23.065 6.544  1.00 41.43 ? 22  GLN A C    1  
ATOM 339   O O    . GLN A 1 22  ? 19.312 -24.218 6.496  1.00 63.45 ? 22  GLN A O    1  
ATOM 340   C CB   . GLN A 1 22  ? 21.947 -23.749 5.587  1.00 53.44 ? 22  GLN A CB   1  
ATOM 341   C CG   . GLN A 1 22  ? 21.562 -23.553 4.129  1.00 42.30 ? 22  GLN A CG   1  
ATOM 342   C CD   . GLN A 1 22  ? 22.643 -24.017 3.173  1.00 43.42 ? 22  GLN A CD   1  
ATOM 343   O OE1  . GLN A 1 22  ? 23.742 -24.382 3.590  1.00 23.55 ? 22  GLN A OE1  1  
ATOM 344   N NE2  . GLN A 1 22  ? 22.336 -24.004 1.881  1.00 65.21 ? 22  GLN A NE2  1  
ATOM 345   H H    . GLN A 1 22  ? 22.314 -23.702 8.117  1.00 3.20  ? 22  GLN A H    1  
ATOM 346   H HA   . GLN A 1 22  ? 21.403 -21.774 6.205  1.00 42.44 ? 22  GLN A HA   1  
ATOM 347   H HB2  . GLN A 1 22  ? 23.013 -23.607 5.678  1.00 63.54 ? 22  GLN A HB2  1  
ATOM 348   H HB3  . GLN A 1 22  ? 21.700 -24.762 5.868  1.00 4.20  ? 22  GLN A HB3  1  
ATOM 349   H HG2  . GLN A 1 22  ? 20.662 -24.114 3.929  1.00 74.12 ? 22  GLN A HG2  1  
ATOM 350   H HG3  . GLN A 1 22  ? 21.376 -22.503 3.957  1.00 2.24  ? 22  GLN A HG3  1  
ATOM 351   H HE21 . GLN A 1 22  ? 21.442 -23.699 1.621  1.00 14.21 ? 22  GLN A HE21 1  
ATOM 352   H HE22 . GLN A 1 22  ? 23.017 -24.298 1.241  1.00 75.02 ? 22  GLN A HE22 1  
ATOM 353   N N    . ARG A 1 23  ? 18.945 -22.001 6.600  1.00 15.34 ? 23  ARG A N    1  
ATOM 354   C CA   . ARG A 1 23  ? 17.493 -22.131 6.611  1.00 75.33 ? 23  ARG A CA   1  
ATOM 355   C C    . ARG A 1 23  ? 16.969 -22.490 5.223  1.00 40.20 ? 23  ARG A C    1  
ATOM 356   O O    . ARG A 1 23  ? 17.742 -22.818 4.323  1.00 53.23 ? 23  ARG A O    1  
ATOM 357   C CB   . ARG A 1 23  ? 16.846 -20.831 7.091  1.00 13.03 ? 23  ARG A CB   1  
ATOM 358   C CG   . ARG A 1 23  ? 15.648 -21.047 8.002  1.00 53.24 ? 23  ARG A CG   1  
ATOM 359   C CD   . ARG A 1 23  ? 15.972 -20.689 9.444  1.00 63.44 ? 23  ARG A CD   1  
ATOM 360   N NE   . ARG A 1 23  ? 14.790 -20.247 10.177 1.00 34.03 ? 23  ARG A NE   1  
ATOM 361   C CZ   . ARG A 1 23  ? 14.695 -20.270 11.502 1.00 23.22 ? 23  ARG A CZ   1  
ATOM 362   N NH1  . ARG A 1 23  ? 15.709 -20.712 12.235 1.00 54.45 ? 23  ARG A NH1  1  
ATOM 363   N NH2  . ARG A 1 23  ? 13.586 -19.851 12.097 1.00 12.20 ? 23  ARG A NH2  1  
ATOM 364   H H    . ARG A 1 23  ? 19.344 -21.107 6.637  1.00 42.41 ? 23  ARG A H    1  
ATOM 365   H HA   . ARG A 1 23  ? 17.236 -22.925 7.296  1.00 74.44 ? 23  ARG A HA   1  
ATOM 366   H HB2  . ARG A 1 23  ? 17.582 -20.255 7.633  1.00 53.35 ? 23  ARG A HB2  1  
ATOM 367   H HB3  . ARG A 1 23  ? 16.520 -20.266 6.231  1.00 35.21 ? 23  ARG A HB3  1  
ATOM 368   H HG2  . ARG A 1 23  ? 14.833 -20.424 7.663  1.00 71.11 ? 23  ARG A HG2  1  
ATOM 369   H HG3  . ARG A 1 23  ? 15.354 -22.085 7.954  1.00 1.22  ? 23  ARG A HG3  1  
ATOM 370   H HD2  . ARG A 1 23  ? 16.383 -21.560 9.933  1.00 74.22 ? 23  ARG A HD2  1  
ATOM 371   H HD3  . ARG A 1 23  ? 16.705 -19.896 9.447  1.00 32.14 ? 23  ARG A HD3  1  
ATOM 372   H HE   . ARG A 1 23  ? 14.029 -19.917 9.656  1.00 50.03 ? 23  ARG A HE   1  
ATOM 373   H HH11 . ARG A 1 23  ? 16.546 -21.027 11.789 1.00 22.21 ? 23  ARG A HH11 1  
ATOM 374   H HH12 . ARG A 1 23  ? 15.635 -20.727 13.232 1.00 5.11  ? 23  ARG A HH12 1  
ATOM 375   H HH21 . ARG A 1 23  ? 12.820 -19.517 11.548 1.00 30.22 ? 23  ARG A HH21 1  
ATOM 376   H HH22 . ARG A 1 23  ? 13.516 -19.869 13.094 1.00 52.22 ? 23  ARG A HH22 1  
ATOM 377   N N    . SER A 1 24  ? 15.652 -22.425 5.058  1.00 34.12 ? 24  SER A N    1  
ATOM 378   C CA   . SER A 1 24  ? 15.024 -22.747 3.782  1.00 62.02 ? 24  SER A CA   1  
ATOM 379   C C    . SER A 1 24  ? 15.397 -21.718 2.719  1.00 61.45 ? 24  SER A C    1  
ATOM 380   O O    . SER A 1 24  ? 16.291 -20.897 2.921  1.00 31.42 ? 24  SER A O    1  
ATOM 381   C CB   . SER A 1 24  ? 13.504 -22.808 3.938  1.00 55.31 ? 24  SER A CB   1  
ATOM 382   O OG   . SER A 1 24  ? 12.903 -23.456 2.830  1.00 13.12 ? 24  SER A OG   1  
ATOM 383   H H    . SER A 1 24  ? 15.088 -22.157 5.814  1.00 2.12  ? 24  SER A H    1  
ATOM 384   H HA   . SER A 1 24  ? 15.385 -23.716 3.470  1.00 34.14 ? 24  SER A HA   1  
ATOM 385   H HB2  . SER A 1 24  ? 13.258 -23.354 4.836  1.00 51.22 ? 24  SER A HB2  1  
ATOM 386   H HB3  . SER A 1 24  ? 13.111 -21.803 4.009  1.00 64.35 ? 24  SER A HB3  1  
ATOM 387   H HG   . SER A 1 24  ? 12.274 -24.110 3.144  1.00 23.32 ? 24  SER A HG   1  
ATOM 388   N N    . GLU A 1 25  ? 14.705 -21.771 1.585  1.00 54.31 ? 25  GLU A N    1  
ATOM 389   C CA   . GLU A 1 25  ? 14.963 -20.844 0.489  1.00 25.20 ? 25  GLU A CA   1  
ATOM 390   C C    . GLU A 1 25  ? 14.275 -19.505 0.735  1.00 41.30 ? 25  GLU A C    1  
ATOM 391   O O    . GLU A 1 25  ? 14.351 -18.593 -0.090 1.00 24.55 ? 25  GLU A O    1  
ATOM 392   C CB   . GLU A 1 25  ? 14.485 -21.440 -0.836 1.00 75.52 ? 25  GLU A CB   1  
ATOM 393   C CG   . GLU A 1 25  ? 15.190 -20.865 -2.053 1.00 14.32 ? 25  GLU A CG   1  
ATOM 394   C CD   . GLU A 1 25  ? 14.994 -21.711 -3.295 1.00 61.55 ? 25  GLU A CD   1  
ATOM 395   O OE1  . GLU A 1 25  ? 15.392 -21.259 -4.390 1.00 12.05 ? 25  GLU A OE1  1  
ATOM 396   O OE2  . GLU A 1 25  ? 14.444 -22.826 -3.174 1.00 53.33 ? 25  GLU A OE2  1  
ATOM 397   H H    . GLU A 1 25  ? 14.004 -22.448 1.483  1.00 20.21 ? 25  GLU A H    1  
ATOM 398   H HA   . GLU A 1 25  ? 16.029 -20.683 0.436  1.00 45.11 ? 25  GLU A HA   1  
ATOM 399   H HB2  . GLU A 1 25  ? 14.653 -22.507 -0.819 1.00 72.20 ? 25  GLU A HB2  1  
ATOM 400   H HB3  . GLU A 1 25  ? 13.426 -21.254 -0.939 1.00 34.14 ? 25  GLU A HB3  1  
ATOM 401   H HG2  . GLU A 1 25  ? 14.800 -19.876 -2.245 1.00 32.32 ? 25  GLU A HG2  1  
ATOM 402   H HG3  . GLU A 1 25  ? 16.247 -20.799 -1.843 1.00 10.24 ? 25  GLU A HG3  1  
ATOM 403   N N    . LYS A 1 26  ? 13.602 -19.393 1.875  1.00 1.31  ? 26  LYS A N    1  
ATOM 404   C CA   . LYS A 1 26  ? 12.900 -18.166 2.232  1.00 11.33 ? 26  LYS A CA   1  
ATOM 405   C C    . LYS A 1 26  ? 13.880 -17.093 2.695  1.00 43.32 ? 26  LYS A C    1  
ATOM 406   O O    . LYS A 1 26  ? 13.751 -15.924 2.333  1.00 45.43 ? 26  LYS A O    1  
ATOM 407   C CB   . LYS A 1 26  ? 11.874 -18.443 3.333  1.00 10.05 ? 26  LYS A CB   1  
ATOM 408   C CG   . LYS A 1 26  ? 10.597 -19.091 2.826  1.00 3.02  ? 26  LYS A CG   1  
ATOM 409   C CD   . LYS A 1 26  ? 9.377  -18.578 3.572  1.00 40.41 ? 26  LYS A CD   1  
ATOM 410   C CE   . LYS A 1 26  ? 8.171  -19.479 3.355  1.00 42.11 ? 26  LYS A CE   1  
ATOM 411   N NZ   . LYS A 1 26  ? 8.259  -20.727 4.163  1.00 52.31 ? 26  LYS A NZ   1  
ATOM 412   H H    . LYS A 1 26  ? 13.578 -20.154 2.492  1.00 32.34 ? 26  LYS A H    1  
ATOM 413   H HA   . LYS A 1 26  ? 12.384 -17.810 1.353  1.00 64.51 ? 26  LYS A HA   1  
ATOM 414   H HB2  . LYS A 1 26  ? 12.319 -19.099 4.067  1.00 63.02 ? 26  LYS A HB2  1  
ATOM 415   H HB3  . LYS A 1 26  ? 11.614 -17.509 3.810  1.00 53.42 ? 26  LYS A HB3  1  
ATOM 416   H HG2  . LYS A 1 26  ? 10.484 -18.868 1.776  1.00 71.23 ? 26  LYS A HG2  1  
ATOM 417   H HG3  . LYS A 1 26  ? 10.668 -20.161 2.964  1.00 43.34 ? 26  LYS A HG3  1  
ATOM 418   H HD2  . LYS A 1 26  ? 9.600  -18.542 4.628  1.00 53.41 ? 26  LYS A HD2  1  
ATOM 419   H HD3  . LYS A 1 26  ? 9.141  -17.584 3.218  1.00 43.12 ? 26  LYS A HD3  1  
ATOM 420   H HE2  . LYS A 1 26  ? 7.280  -18.940 3.637  1.00 52.34 ? 26  LYS A HE2  1  
ATOM 421   H HE3  . LYS A 1 26  ? 8.118  -19.741 2.308  1.00 12.44 ? 26  LYS A HE3  1  
ATOM 422   H HZ1  . LYS A 1 26  ? 7.351  -21.234 4.135  1.00 23.24 ? 26  LYS A HZ1  1  
ATOM 423   H HZ2  . LYS A 1 26  ? 8.484  -20.497 5.152  1.00 45.04 ? 26  LYS A HZ2  1  
ATOM 424   H HZ3  . LYS A 1 26  ? 9.002  -21.347 3.784  1.00 44.23 ? 26  LYS A HZ3  1  
ATOM 425   N N    . MET A 1 27  ? 14.860 -17.499 3.495  1.00 4.55  ? 27  MET A N    1  
ATOM 426   C CA   . MET A 1 27  ? 15.864 -16.571 4.005  1.00 61.23 ? 27  MET A CA   1  
ATOM 427   C C    . MET A 1 27  ? 16.609 -15.894 2.859  1.00 1.50  ? 27  MET A C    1  
ATOM 428   O O    . MET A 1 27  ? 16.279 -16.090 1.689  1.00 23.05 ? 27  MET A O    1  
ATOM 429   C CB   . MET A 1 27  ? 16.855 -17.306 4.909  1.00 5.44  ? 27  MET A CB   1  
ATOM 430   C CG   . MET A 1 27  ? 16.288 -17.654 6.276  1.00 2.31  ? 27  MET A CG   1  
ATOM 431   S SD   . MET A 1 27  ? 15.936 -16.194 7.274  1.00 4.03  ? 27  MET A SD   1  
ATOM 432   C CE   . MET A 1 27  ? 14.186 -15.982 6.959  1.00 30.11 ? 27  MET A CE   1  
ATOM 433   H H    . MET A 1 27  ? 14.911 -18.444 3.750  1.00 51.24 ? 27  MET A H    1  
ATOM 434   H HA   . MET A 1 27  ? 15.354 -15.816 4.583  1.00 32.14 ? 27  MET A HA   1  
ATOM 435   H HB2  . MET A 1 27  ? 17.157 -18.222 4.424  1.00 34.14 ? 27  MET A HB2  1  
ATOM 436   H HB3  . MET A 1 27  ? 17.725 -16.681 5.053  1.00 33.22 ? 27  MET A HB3  1  
ATOM 437   H HG2  . MET A 1 27  ? 15.372 -18.208 6.140  1.00 33.35 ? 27  MET A HG2  1  
ATOM 438   H HG3  . MET A 1 27  ? 17.004 -18.269 6.801  1.00 1.42  ? 27  MET A HG3  1  
ATOM 439   H HE1  . MET A 1 27  ? 13.946 -16.375 5.983  1.00 73.45 ? 27  MET A HE1  1  
ATOM 440   H HE2  . MET A 1 27  ? 13.619 -16.512 7.710  1.00 13.52 ? 27  MET A HE2  1  
ATOM 441   H HE3  . MET A 1 27  ? 13.939 -14.931 6.995  1.00 52.12 ? 27  MET A HE3  1  
ATOM 442   N N    . SER A 1 28  ? 17.615 -15.095 3.203  1.00 34.10 ? 28  SER A N    1  
ATOM 443   C CA   . SER A 1 28  ? 18.403 -14.385 2.203  1.00 25.20 ? 28  SER A CA   1  
ATOM 444   C C    . SER A 1 28  ? 19.568 -15.244 1.720  1.00 70.24 ? 28  SER A C    1  
ATOM 445   O O    . SER A 1 28  ? 20.360 -15.744 2.519  1.00 3.15  ? 28  SER A O    1  
ATOM 446   C CB   . SER A 1 28  ? 18.930 -13.069 2.779  1.00 63.25 ? 28  SER A CB   1  
ATOM 447   O OG   . SER A 1 28  ? 17.900 -12.352 3.436  1.00 4.33  ? 28  SER A OG   1  
ATOM 448   H H    . SER A 1 28  ? 17.829 -14.979 4.152  1.00 21.05 ? 28  SER A H    1  
ATOM 449   H HA   . SER A 1 28  ? 17.759 -14.169 1.364  1.00 15.14 ? 28  SER A HA   1  
ATOM 450   H HB2  . SER A 1 28  ? 19.716 -13.278 3.488  1.00 22.50 ? 28  SER A HB2  1  
ATOM 451   H HB3  . SER A 1 28  ? 19.322 -12.460 1.977  1.00 72.04 ? 28  SER A HB3  1  
ATOM 452   H HG   . SER A 1 28  ? 18.256 -11.533 3.791  1.00 70.43 ? 28  SER A HG   1  
ATOM 453   N N    . LEU A 1 29  ? 19.665 -15.412 0.405  1.00 3.14  ? 29  LEU A N    1  
ATOM 454   C CA   . LEU A 1 29  ? 20.733 -16.211 -0.187 1.00 13.40 ? 29  LEU A CA   1  
ATOM 455   C C    . LEU A 1 29  ? 21.107 -17.378 0.721  1.00 42.14 ? 29  LEU A C    1  
ATOM 456   O O    . LEU A 1 29  ? 22.271 -17.575 1.071  1.00 31.21 ? 29  LEU A O    1  
ATOM 457   C CB   . LEU A 1 29  ? 21.962 -15.339 -0.450 1.00 63.41 ? 29  LEU A CB   1  
ATOM 458   C CG   . LEU A 1 29  ? 21.913 -14.472 -1.708 1.00 42.41 ? 29  LEU A CG   1  
ATOM 459   C CD1  . LEU A 1 29  ? 23.144 -13.582 -1.791 1.00 52.12 ? 29  LEU A CD1  1  
ATOM 460   C CD2  . LEU A 1 29  ? 21.796 -15.341 -2.952 1.00 25.04 ? 29  LEU A CD2  1  
ATOM 461   H H    . LEU A 1 29  ? 19.005 -14.989 -0.181 1.00 75.12 ? 29  LEU A H    1  
ATOM 462   H HA   . LEU A 1 29  ? 20.371 -16.602 -1.126 1.00 62.02 ? 29  LEU A HA   1  
ATOM 463   H HB2  . LEU A 1 29  ? 22.091 -14.685 0.398  1.00 2.20  ? 29  LEU A HB2  1  
ATOM 464   H HB3  . LEU A 1 29  ? 22.819 -15.994 -0.531 1.00 52.43 ? 29  LEU A HB3  1  
ATOM 465   H HG   . LEU A 1 29  ? 21.042 -13.832 -1.663 1.00 63.20 ? 29  LEU A HG   1  
ATOM 466   H HD11 . LEU A 1 29  ? 23.534 -13.413 -0.799 1.00 32.41 ? 29  LEU A HD11 1  
ATOM 467   H HD12 . LEU A 1 29  ? 22.875 -12.636 -2.238 1.00 33.13 ? 29  LEU A HD12 1  
ATOM 468   H HD13 . LEU A 1 29  ? 23.896 -14.065 -2.397 1.00 45.55 ? 29  LEU A HD13 1  
ATOM 469   H HD21 . LEU A 1 29  ? 22.041 -16.363 -2.700 1.00 52.51 ? 29  LEU A HD21 1  
ATOM 470   H HD22 . LEU A 1 29  ? 22.481 -14.983 -3.707 1.00 2.22  ? 29  LEU A HD22 1  
ATOM 471   H HD23 . LEU A 1 29  ? 20.786 -15.295 -3.330 1.00 1.44  ? 29  LEU A HD23 1  
ATOM 472   N N    . PRO A 1 30  ? 20.099 -18.173 1.109  1.00 1.44  ? 30  PRO A N    1  
ATOM 473   C CA   . PRO A 1 30  ? 20.298 -19.336 1.979  1.00 42.12 ? 30  PRO A CA   1  
ATOM 474   C C    . PRO A 1 30  ? 21.046 -20.464 1.276  1.00 50.32 ? 30  PRO A C    1  
ATOM 475   O O    . PRO A 1 30  ? 21.456 -21.439 1.907  1.00 4.53  ? 30  PRO A O    1  
ATOM 476   C CB   . PRO A 1 30  ? 18.871 -19.772 2.320  1.00 2.03  ? 30  PRO A CB   1  
ATOM 477   C CG   . PRO A 1 30  ? 18.042 -19.276 1.186  1.00 20.23 ? 30  PRO A CG   1  
ATOM 478   C CD   . PRO A 1 30  ? 18.687 -17.997 0.730  1.00 42.03 ? 30  PRO A CD   1  
ATOM 479   H HA   . PRO A 1 30  ? 20.822 -19.069 2.885  1.00 15.23 ? 30  PRO A HA   1  
ATOM 480   H HB2  . PRO A 1 30  ? 18.831 -20.849 2.399  1.00 35.33 ? 30  PRO A HB2  1  
ATOM 481   H HB3  . PRO A 1 30  ? 18.568 -19.325 3.255  1.00 24.23 ? 30  PRO A HB3  1  
ATOM 482   H HG2  . PRO A 1 30  ? 18.041 -20.002 0.387  1.00 2.22  ? 30  PRO A HG2  1  
ATOM 483   H HG3  . PRO A 1 30  ? 17.034 -19.087 1.524  1.00 31.14 ? 30  PRO A HG3  1  
ATOM 484   H HD2  . PRO A 1 30  ? 18.587 -17.884 -0.340 1.00 35.24 ? 30  PRO A HD2  1  
ATOM 485   H HD3  . PRO A 1 30  ? 18.253 -17.151 1.243  1.00 61.43 ? 30  PRO A HD3  1  
ATOM 486   N N    . LEU A 1 31  ? 21.221 -20.325 -0.034 1.00 35.33 ? 31  LEU A N    1  
ATOM 487   C CA   . LEU A 1 31  ? 21.920 -21.333 -0.823 1.00 42.02 ? 31  LEU A CA   1  
ATOM 488   C C    . LEU A 1 31  ? 23.374 -21.459 -0.380 1.00 3.10  ? 31  LEU A C    1  
ATOM 489   O O    . LEU A 1 31  ? 23.842 -22.550 -0.054 1.00 53.41 ? 31  LEU A O    1  
ATOM 490   C CB   . LEU A 1 31  ? 21.857 -20.979 -2.310 1.00 1.21  ? 31  LEU A CB   1  
ATOM 491   C CG   . LEU A 1 31  ? 20.511 -20.465 -2.821 1.00 14.11 ? 31  LEU A CG   1  
ATOM 492   C CD1  . LEU A 1 31  ? 20.542 -20.297 -4.332 1.00 42.40 ? 31  LEU A CD1  1  
ATOM 493   C CD2  . LEU A 1 31  ? 19.389 -21.408 -2.411 1.00 22.41 ? 31  LEU A CD2  1  
ATOM 494   H H    . LEU A 1 31  ? 20.871 -19.527 -0.481 1.00 62.04 ? 31  LEU A H    1  
ATOM 495   H HA   . LEU A 1 31  ? 21.425 -22.280 -0.666 1.00 1.45  ? 31  LEU A HA   1  
ATOM 496   H HB2  . LEU A 1 31  ? 22.596 -20.215 -2.499 1.00 74.25 ? 31  LEU A HB2  1  
ATOM 497   H HB3  . LEU A 1 31  ? 22.108 -21.867 -2.872 1.00 21.54 ? 31  LEU A HB3  1  
ATOM 498   H HG   . LEU A 1 31  ? 20.312 -19.497 -2.382 1.00 12.11 ? 31  LEU A HG   1  
ATOM 499   H HD11 . LEU A 1 31  ? 21.175 -21.056 -4.766 1.00 31.04 ? 31  LEU A HD11 1  
ATOM 500   H HD12 . LEU A 1 31  ? 20.932 -19.320 -4.577 1.00 42.22 ? 31  LEU A HD12 1  
ATOM 501   H HD13 . LEU A 1 31  ? 19.541 -20.393 -4.726 1.00 31.12 ? 31  LEU A HD13 1  
ATOM 502   H HD21 . LEU A 1 31  ? 18.793 -21.655 -3.277 1.00 34.24 ? 31  LEU A HD21 1  
ATOM 503   H HD22 . LEU A 1 31  ? 18.767 -20.927 -1.670 1.00 72.13 ? 31  LEU A HD22 1  
ATOM 504   H HD23 . LEU A 1 31  ? 19.812 -22.311 -1.995 1.00 41.23 ? 31  LEU A HD23 1  
ATOM 505   N N    . MET A 1 32  ? 24.083 -20.335 -0.369 1.00 4.14  ? 32  MET A N    1  
ATOM 506   C CA   . MET A 1 32  ? 25.484 -20.319 0.038  1.00 32.42 ? 32  MET A CA   1  
ATOM 507   C C    . MET A 1 32  ? 25.609 -20.373 1.557  1.00 21.25 ? 32  MET A C    1  
ATOM 508   O O    . MET A 1 32  ? 26.361 -21.184 2.099  1.00 14.00 ? 32  MET A O    1  
ATOM 509   C CB   . MET A 1 32  ? 26.179 -19.067 -0.499 1.00 1.15  ? 32  MET A CB   1  
ATOM 510   C CG   . MET A 1 32  ? 25.505 -17.771 -0.079 1.00 3.44  ? 32  MET A CG   1  
ATOM 511   S SD   . MET A 1 32  ? 26.094 -16.347 -1.015 1.00 51.23 ? 32  MET A SD   1  
ATOM 512   C CE   . MET A 1 32  ? 25.452 -15.000 -0.024 1.00 32.42 ? 32  MET A CE   1  
ATOM 513   H H    . MET A 1 32  ? 23.655 -19.496 -0.639 1.00 44.23 ? 32  MET A H    1  
ATOM 514   H HA   . MET A 1 32  ? 25.960 -21.193 -0.382 1.00 1.53  ? 32  MET A HA   1  
ATOM 515   H HB2  . MET A 1 32  ? 27.197 -19.052 -0.138 1.00 13.13 ? 32  MET A HB2  1  
ATOM 516   H HB3  . MET A 1 32  ? 26.189 -19.109 -1.577 1.00 53.25 ? 32  MET A HB3  1  
ATOM 517   H HG2  . MET A 1 32  ? 24.441 -17.868 -0.231 1.00 13.33 ? 32  MET A HG2  1  
ATOM 518   H HG3  . MET A 1 32  ? 25.703 -17.602 0.970  1.00 41.14 ? 32  MET A HG3  1  
ATOM 519   H HE1  . MET A 1 32  ? 25.404 -14.103 -0.623 1.00 2.03  ? 32  MET A HE1  1  
ATOM 520   H HE2  . MET A 1 32  ? 24.462 -15.252 0.327  1.00 60.31 ? 32  MET A HE2  1  
ATOM 521   H HE3  . MET A 1 32  ? 26.103 -14.835 0.822  1.00 0.42  ? 32  MET A HE3  1  
ATOM 522   N N    . TRP A 1 33  ? 24.869 -19.506 2.238  1.00 4.45  ? 33  TRP A N    1  
ATOM 523   C CA   . TRP A 1 33  ? 24.899 -19.455 3.696  1.00 52.12 ? 33  TRP A CA   1  
ATOM 524   C C    . TRP A 1 33  ? 23.647 -18.777 4.242  1.00 4.42  ? 33  TRP A C    1  
ATOM 525   O O    . TRP A 1 33  ? 22.830 -18.259 3.482  1.00 11.11 ? 33  TRP A O    1  
ATOM 526   C CB   . TRP A 1 33  ? 26.147 -18.713 4.176  1.00 41.43 ? 33  TRP A CB   1  
ATOM 527   C CG   . TRP A 1 33  ? 27.426 -19.400 3.804  1.00 3.42  ? 33  TRP A CG   1  
ATOM 528   C CD1  . TRP A 1 33  ? 28.236 -19.107 2.744  1.00 74.13 ? 33  TRP A CD1  1  
ATOM 529   C CD2  . TRP A 1 33  ? 28.041 -20.495 4.491  1.00 63.13 ? 33  TRP A CD2  1  
ATOM 530   N NE1  . TRP A 1 33  ? 29.317 -19.955 2.730  1.00 52.03 ? 33  TRP A NE1  1  
ATOM 531   C CE2  . TRP A 1 33  ? 29.221 -20.815 3.791  1.00 25.23 ? 33  TRP A CE2  1  
ATOM 532   C CE3  . TRP A 1 33  ? 27.711 -21.235 5.629  1.00 23.40 ? 33  TRP A CE3  1  
ATOM 533   C CZ2  . TRP A 1 33  ? 30.069 -21.844 4.194  1.00 42.31 ? 33  TRP A CZ2  1  
ATOM 534   C CZ3  . TRP A 1 33  ? 28.554 -22.256 6.027  1.00 35.11 ? 33  TRP A CZ3  1  
ATOM 535   C CH2  . TRP A 1 33  ? 29.721 -22.552 5.312  1.00 65.32 ? 33  TRP A CH2  1  
ATOM 536   H H    . TRP A 1 33  ? 24.290 -18.884 1.750  1.00 35.11 ? 33  TRP A H    1  
ATOM 537   H HA   . TRP A 1 33  ? 24.932 -20.471 4.061  1.00 3.33  ? 33  TRP A HA   1  
ATOM 538   H HB2  . TRP A 1 33  ? 26.161 -17.725 3.740  1.00 13.32 ? 33  TRP A HB2  1  
ATOM 539   H HB3  . TRP A 1 33  ? 26.114 -18.627 5.252  1.00 22.13 ? 33  TRP A HB3  1  
ATOM 540   H HD1  . TRP A 1 33  ? 28.041 -18.323 2.028  1.00 14.03 ? 33  TRP A HD1  1  
ATOM 541   H HE1  . TRP A 1 33  ? 30.040 -19.944 2.067  1.00 13.24 ? 33  TRP A HE1  1  
ATOM 542   H HE3  . TRP A 1 33  ? 26.816 -21.022 6.194  1.00 75.34 ? 33  TRP A HE3  1  
ATOM 543   H HZ2  . TRP A 1 33  ? 30.973 -22.084 3.654  1.00 43.13 ? 33  TRP A HZ2  1  
ATOM 544   H HZ3  . TRP A 1 33  ? 28.315 -22.839 6.904  1.00 35.52 ? 33  TRP A HZ3  1  
ATOM 545   H HH2  . TRP A 1 33  ? 30.350 -23.358 5.659  1.00 75.11 ? 33  TRP A HH2  1  
ATOM 546   N N    . GLU A 1 34  ? 23.505 -18.783 5.564  1.00 71.10 ? 34  GLU A N    1  
ATOM 547   C CA   . GLU A 1 34  ? 22.352 -18.168 6.210  1.00 35.13 ? 34  GLU A CA   1  
ATOM 548   C C    . GLU A 1 34  ? 22.437 -18.312 7.727  1.00 3.52  ? 34  GLU A C    1  
ATOM 549   O O    . GLU A 1 34  ? 22.945 -19.309 8.240  1.00 60.11 ? 34  GLU A O    1  
ATOM 550   C CB   . GLU A 1 34  ? 21.055 -18.801 5.700  1.00 43.23 ? 34  GLU A CB   1  
ATOM 551   C CG   . GLU A 1 34  ? 19.845 -18.491 6.564  1.00 11.23 ? 34  GLU A CG   1  
ATOM 552   C CD   . GLU A 1 34  ? 19.563 -17.004 6.662  1.00 22.02 ? 34  GLU A CD   1  
ATOM 553   O OE1  . GLU A 1 34  ? 19.932 -16.268 5.723  1.00 73.02 ? 34  GLU A OE1  1  
ATOM 554   O OE2  . GLU A 1 34  ? 18.975 -16.577 7.677  1.00 1.52  ? 34  GLU A OE2  1  
ATOM 555   H H    . GLU A 1 34  ? 24.191 -19.212 6.117  1.00 51.20 ? 34  GLU A H    1  
ATOM 556   H HA   . GLU A 1 34  ? 22.352 -17.118 5.960  1.00 74.23 ? 34  GLU A HA   1  
ATOM 557   H HB2  . GLU A 1 34  ? 20.861 -18.439 4.701  1.00 42.32 ? 34  GLU A HB2  1  
ATOM 558   H HB3  . GLU A 1 34  ? 21.182 -19.873 5.666  1.00 53.13 ? 34  GLU A HB3  1  
ATOM 559   H HG2  . GLU A 1 34  ? 18.980 -18.978 6.139  1.00 3.10  ? 34  GLU A HG2  1  
ATOM 560   H HG3  . GLU A 1 34  ? 20.021 -18.875 7.558  1.00 35.23 ? 34  GLU A HG3  1  
ATOM 561   N N    . PHE A 1 35  ? 21.938 -17.307 8.440  1.00 74.24 ? 35  PHE A N    1  
ATOM 562   C CA   . PHE A 1 35  ? 21.959 -17.320 9.898  1.00 54.43 ? 35  PHE A CA   1  
ATOM 563   C C    . PHE A 1 35  ? 20.652 -17.877 10.456 1.00 43.13 ? 35  PHE A C    1  
ATOM 564   O O    . PHE A 1 35  ? 19.631 -17.938 9.771  1.00 61.03 ? 35  PHE A O    1  
ATOM 565   C CB   . PHE A 1 35  ? 22.196 -15.908 10.437 1.00 13.45 ? 35  PHE A CB   1  
ATOM 566   C CG   . PHE A 1 35  ? 23.648 -15.570 10.615 1.00 24.04 ? 35  PHE A CG   1  
ATOM 567   C CD1  . PHE A 1 35  ? 24.172 -14.402 10.084 1.00 21.51 ? 35  PHE A CD1  1  
ATOM 568   C CD2  . PHE A 1 35  ? 24.490 -16.421 11.314 1.00 44.44 ? 35  PHE A CD2  1  
ATOM 569   C CE1  . PHE A 1 35  ? 25.508 -14.089 10.246 1.00 4.43  ? 35  PHE A CE1  1  
ATOM 570   C CE2  . PHE A 1 35  ? 25.827 -16.112 11.479 1.00 3.34  ? 35  PHE A CE2  1  
ATOM 571   C CZ   . PHE A 1 35  ? 26.337 -14.945 10.944 1.00 22.00 ? 35  PHE A CZ   1  
ATOM 572   H H    . PHE A 1 35  ? 21.546 -16.539 7.973  1.00 12.14 ? 35  PHE A H    1  
ATOM 573   H HA   . PHE A 1 35  ? 22.771 -17.957 10.211 1.00 10.22 ? 35  PHE A HA   1  
ATOM 574   H HB2  . PHE A 1 35  ? 21.771 -15.191 9.751  1.00 71.35 ? 35  PHE A HB2  1  
ATOM 575   H HB3  . PHE A 1 35  ? 21.711 -15.811 11.397 1.00 21.13 ? 35  PHE A HB3  1  
ATOM 576   H HD1  . PHE A 1 35  ? 23.524 -13.732 9.537  1.00 1.44  ? 35  PHE A HD1  1  
ATOM 577   H HD2  . PHE A 1 35  ? 24.094 -17.334 11.732 1.00 55.11 ? 35  PHE A HD2  1  
ATOM 578   H HE1  . PHE A 1 35  ? 25.903 -13.175 9.826  1.00 25.53 ? 35  PHE A HE1  1  
ATOM 579   H HE2  . PHE A 1 35  ? 26.473 -16.783 12.025 1.00 23.11 ? 35  PHE A HE2  1  
ATOM 580   H HZ   . PHE A 1 35  ? 27.381 -14.701 11.073 1.00 62.45 ? 35  PHE A HZ   1  
ATOM 581   N N    . PRO A 1 36  ? 20.684 -18.294 11.730 1.00 22.11 ? 36  PRO A N    1  
ATOM 582   C CA   . PRO A 1 36  ? 19.512 -18.854 12.409 1.00 11.13 ? 36  PRO A CA   1  
ATOM 583   C C    . PRO A 1 36  ? 18.440 -17.803 12.678 1.00 44.34 ? 36  PRO A C    1  
ATOM 584   O O    . PRO A 1 36  ? 18.744 -16.684 13.088 1.00 0.53  ? 36  PRO A O    1  
ATOM 585   C CB   . PRO A 1 36  ? 20.084 -19.382 13.727 1.00 63.50 ? 36  PRO A CB   1  
ATOM 586   C CG   . PRO A 1 36  ? 21.305 -18.563 13.966 1.00 51.53 ? 36  PRO A CG   1  
ATOM 587   C CD   . PRO A 1 36  ? 21.867 -18.251 12.606 1.00 11.12 ? 36  PRO A CD   1  
ATOM 588   H HA   . PRO A 1 36  ? 19.081 -19.671 11.849 1.00 40.43 ? 36  PRO A HA   1  
ATOM 589   H HB2  . PRO A 1 36  ? 19.358 -19.250 14.517 1.00 72.45 ? 36  PRO A HB2  1  
ATOM 590   H HB3  . PRO A 1 36  ? 20.326 -20.430 13.624 1.00 2.42  ? 36  PRO A HB3  1  
ATOM 591   H HG2  . PRO A 1 36  ? 21.040 -17.651 14.480 1.00 24.31 ? 36  PRO A HG2  1  
ATOM 592   H HG3  . PRO A 1 36  ? 22.019 -19.128 14.545 1.00 22.53 ? 36  PRO A HG3  1  
ATOM 593   H HD2  . PRO A 1 36  ? 22.316 -17.269 12.600 1.00 42.14 ? 36  PRO A HD2  1  
ATOM 594   H HD3  . PRO A 1 36  ? 22.589 -19.000 12.316 1.00 73.05 ? 36  PRO A HD3  1  
ATOM 595   N N    . GLY A 1 37  ? 17.184 -18.171 12.443 1.00 45.12 ? 37  GLY A N    1  
ATOM 596   C CA   . GLY A 1 37  ? 16.087 -17.248 12.665 1.00 11.12 ? 37  GLY A CA   1  
ATOM 597   C C    . GLY A 1 37  ? 15.828 -16.356 11.467 1.00 11.34 ? 37  GLY A C    1  
ATOM 598   O O    . GLY A 1 37  ? 16.074 -16.748 10.328 1.00 42.23 ? 37  GLY A O    1  
ATOM 599   H H    . GLY A 1 37  ? 17.002 -19.077 12.116 1.00 52.32 ? 37  GLY A H    1  
ATOM 600   H HA2  . GLY A 1 37  ? 15.193 -17.814 12.880 1.00 53.24 ? 37  GLY A HA2  1  
ATOM 601   H HA3  . GLY A 1 37  ? 16.321 -16.627 13.518 1.00 60.14 ? 37  GLY A HA3  1  
ATOM 602   N N    . GLY A 1 38  ? 15.327 -15.151 11.726 1.00 63.24 ? 38  GLY A N    1  
ATOM 603   C CA   . GLY A 1 38  ? 15.041 -14.221 10.649 1.00 2.45  ? 38  GLY A CA   1  
ATOM 604   C C    . GLY A 1 38  ? 13.554 -14.040 10.420 1.00 52.35 ? 38  GLY A C    1  
ATOM 605   O O    . GLY A 1 38  ? 13.090 -14.035 9.279  1.00 30.00 ? 38  GLY A O    1  
ATOM 606   H H    . GLY A 1 38  ? 15.151 -14.892 12.654 1.00 31.54 ? 38  GLY A H    1  
ATOM 607   H HA2  . GLY A 1 38  ? 15.477 -13.263 10.891 1.00 13.43 ? 38  GLY A HA2  1  
ATOM 608   H HA3  . GLY A 1 38  ? 15.492 -14.590 9.740  1.00 73.30 ? 38  GLY A HA3  1  
ATOM 609   N N    . LYS A 1 39  ? 12.803 -13.892 11.505 1.00 14.04 ? 39  LYS A N    1  
ATOM 610   C CA   . LYS A 1 39  ? 11.358 -13.710 11.418 1.00 25.44 ? 39  LYS A CA   1  
ATOM 611   C C    . LYS A 1 39  ? 10.845 -12.870 12.583 1.00 35.53 ? 39  LYS A C    1  
ATOM 612   O O    . LYS A 1 39  ? 11.168 -13.134 13.742 1.00 52.33 ? 39  LYS A O    1  
ATOM 613   C CB   . LYS A 1 39  ? 10.653 -15.068 11.405 1.00 70.43 ? 39  LYS A CB   1  
ATOM 614   C CG   . LYS A 1 39  ? 10.631 -15.756 12.759 1.00 65.43 ? 39  LYS A CG   1  
ATOM 615   C CD   . LYS A 1 39  ? 10.075 -17.167 12.659 1.00 54.42 ? 39  LYS A CD   1  
ATOM 616   C CE   . LYS A 1 39  ? 8.557  -17.161 12.555 1.00 2.33  ? 39  LYS A CE   1  
ATOM 617   N NZ   . LYS A 1 39  ? 8.097  -16.931 11.158 1.00 44.33 ? 39  LYS A NZ   1  
ATOM 618   H H    . LYS A 1 39  ? 13.230 -13.904 12.388 1.00 65.42 ? 39  LYS A H    1  
ATOM 619   H HA   . LYS A 1 39  ? 11.144 -13.194 10.495 1.00 1.54  ? 39  LYS A HA   1  
ATOM 620   H HB2  . LYS A 1 39  ? 9.633  -14.927 11.080 1.00 73.34 ? 39  LYS A HB2  1  
ATOM 621   H HB3  . LYS A 1 39  ? 11.159 -15.716 10.703 1.00 31.33 ? 39  LYS A HB3  1  
ATOM 622   H HG2  . LYS A 1 39  ? 11.639 -15.805 13.144 1.00 62.33 ? 39  LYS A HG2  1  
ATOM 623   H HG3  . LYS A 1 39  ? 10.013 -15.182 13.434 1.00 5.03  ? 39  LYS A HG3  1  
ATOM 624   H HD2  . LYS A 1 39  ? 10.482 -17.644 11.780 1.00 20.11 ? 39  LYS A HD2  1  
ATOM 625   H HD3  . LYS A 1 39  ? 10.365 -17.722 13.540 1.00 53.04 ? 39  LYS A HD3  1  
ATOM 626   H HE2  . LYS A 1 39  ? 8.182  -18.114 12.896 1.00 4.42  ? 39  LYS A HE2  1  
ATOM 627   H HE3  . LYS A 1 39  ? 8.170  -16.375 13.187 1.00 54.22 ? 39  LYS A HE3  1  
ATOM 628   H HZ1  . LYS A 1 39  ? 7.847  -15.930 11.025 1.00 74.04 ? 39  LYS A HZ1  1  
ATOM 629   H HZ2  . LYS A 1 39  ? 7.262  -17.515 10.956 1.00 74.43 ? 39  LYS A HZ2  1  
ATOM 630   H HZ3  . LYS A 1 39  ? 8.852  -17.180 10.487 1.00 22.14 ? 39  LYS A HZ3  1  
ATOM 631   N N    . VAL A 1 40  ? 10.041 -11.859 12.269 1.00 62.12 ? 40  VAL A N    1  
ATOM 632   C CA   . VAL A 1 40  ? 9.480  -10.982 13.290 1.00 63.33 ? 40  VAL A CA   1  
ATOM 633   C C    . VAL A 1 40  ? 7.974  -10.825 13.112 1.00 23.44 ? 40  VAL A C    1  
ATOM 634   O O    . VAL A 1 40  ? 7.482  -10.698 11.992 1.00 33.40 ? 40  VAL A O    1  
ATOM 635   C CB   . VAL A 1 40  ? 10.138 -9.590  13.256 1.00 11.25 ? 40  VAL A CB   1  
ATOM 636   C CG1  . VAL A 1 40  ? 9.554  -8.697  14.341 1.00 21.53 ? 40  VAL A CG1  1  
ATOM 637   C CG2  . VAL A 1 40  ? 11.647 -9.710  13.408 1.00 13.21 ? 40  VAL A CG2  1  
ATOM 638   H H    . VAL A 1 40  ? 9.820  -11.700 11.328 1.00 51.54 ? 40  VAL A H    1  
ATOM 639   H HA   . VAL A 1 40  ? 9.675  -11.426 14.255 1.00 22.31 ? 40  VAL A HA   1  
ATOM 640   H HB   . VAL A 1 40  ? 9.928  -9.138  12.298 1.00 3.22  ? 40  VAL A HB   1  
ATOM 641   H HG11 . VAL A 1 40  ? 10.137 -7.791  14.413 1.00 54.42 ? 40  VAL A HG11 1  
ATOM 642   H HG12 . VAL A 1 40  ? 8.532  -8.452  14.094 1.00 13.23 ? 40  VAL A HG12 1  
ATOM 643   H HG13 . VAL A 1 40  ? 9.581  -9.217  15.288 1.00 63.22 ? 40  VAL A HG13 1  
ATOM 644   H HG21 . VAL A 1 40  ? 12.042 -10.311 12.603 1.00 32.41 ? 40  VAL A HG21 1  
ATOM 645   H HG22 . VAL A 1 40  ? 12.092 -8.726  13.374 1.00 51.11 ? 40  VAL A HG22 1  
ATOM 646   H HG23 . VAL A 1 40  ? 11.878 -10.176 14.354 1.00 60.41 ? 40  VAL A HG23 1  
ATOM 647   N N    . GLU A 1 41  ? 7.249  -10.835 14.226 1.00 14.22 ? 41  GLU A N    1  
ATOM 648   C CA   . GLU A 1 41  ? 5.798  -10.694 14.193 1.00 14.20 ? 41  GLU A CA   1  
ATOM 649   C C    . GLU A 1 41  ? 5.398  -9.257  13.868 1.00 71.40 ? 41  GLU A C    1  
ATOM 650   O O    . GLU A 1 41  ? 6.236  -8.355  13.853 1.00 31.55 ? 41  GLU A O    1  
ATOM 651   C CB   . GLU A 1 41  ? 5.191  -11.112 15.534 1.00 24.41 ? 41  GLU A CB   1  
ATOM 652   C CG   . GLU A 1 41  ? 5.393  -12.583 15.861 1.00 52.44 ? 41  GLU A CG   1  
ATOM 653   C CD   . GLU A 1 41  ? 4.252  -13.451 15.367 1.00 62.41 ? 41  GLU A CD   1  
ATOM 654   O OE1  . GLU A 1 41  ? 4.012  -14.517 15.972 1.00 11.44 ? 41  GLU A OE1  1  
ATOM 655   O OE2  . GLU A 1 41  ? 3.600  -13.065 14.374 1.00 33.14 ? 41  GLU A OE2  1  
ATOM 656   H H    . GLU A 1 41  ? 7.699  -10.940 15.090 1.00 3.40  ? 41  GLU A H    1  
ATOM 657   H HA   . GLU A 1 41  ? 5.419  -11.344 13.419 1.00 51.11 ? 41  GLU A HA   1  
ATOM 658   H HB2  . GLU A 1 41  ? 5.644  -10.525 16.319 1.00 10.22 ? 41  GLU A HB2  1  
ATOM 659   H HB3  . GLU A 1 41  ? 4.130  -10.912 15.513 1.00 23.25 ? 41  GLU A HB3  1  
ATOM 660   H HG2  . GLU A 1 41  ? 6.308  -12.919 15.397 1.00 72.31 ? 41  GLU A HG2  1  
ATOM 661   H HG3  . GLU A 1 41  ? 5.472  -12.693 16.932 1.00 0.32  ? 41  GLU A HG3  1  
ATOM 662   N N    . LYS A 1 42  ? 4.111  -9.052  13.607 1.00 64.32 ? 42  LYS A N    1  
ATOM 663   C CA   . LYS A 1 42  ? 3.598  -7.727  13.282 1.00 11.23 ? 42  LYS A CA   1  
ATOM 664   C C    . LYS A 1 42  ? 3.251  -6.952  14.550 1.00 70.31 ? 42  LYS A C    1  
ATOM 665   O O    . LYS A 1 42  ? 2.646  -5.883  14.489 1.00 73.21 ? 42  LYS A O    1  
ATOM 666   C CB   . LYS A 1 42  ? 2.362  -7.841  12.387 1.00 33.24 ? 42  LYS A CB   1  
ATOM 667   C CG   . LYS A 1 42  ? 1.161  -8.458  13.084 1.00 3.13  ? 42  LYS A CG   1  
ATOM 668   C CD   . LYS A 1 42  ? 0.222  -7.393  13.624 1.00 11.42 ? 42  LYS A CD   1  
ATOM 669   C CE   . LYS A 1 42  ? -1.205 -7.909  13.730 1.00 62.23 ? 42  LYS A CE   1  
ATOM 670   N NZ   . LYS A 1 42  ? -2.150 -6.844  14.166 1.00 43.14 ? 42  LYS A NZ   1  
ATOM 671   H H    . LYS A 1 42  ? 3.491  -9.812  13.634 1.00 44.41 ? 42  LYS A H    1  
ATOM 672   H HA   . LYS A 1 42  ? 4.370  -7.193  12.749 1.00 71.31 ? 42  LYS A HA   1  
ATOM 673   H HB2  . LYS A 1 42  ? 2.086  -6.854  12.047 1.00 61.02 ? 42  LYS A HB2  1  
ATOM 674   H HB3  . LYS A 1 42  ? 2.608  -8.453  11.531 1.00 14.50 ? 42  LYS A HB3  1  
ATOM 675   H HG2  . LYS A 1 42  ? 0.623  -9.073  12.378 1.00 1.34  ? 42  LYS A HG2  1  
ATOM 676   H HG3  . LYS A 1 42  ? 1.508  -9.069  13.906 1.00 42.14 ? 42  LYS A HG3  1  
ATOM 677   H HD2  . LYS A 1 42  ? 0.557  -7.093  14.606 1.00 44.32 ? 42  LYS A HD2  1  
ATOM 678   H HD3  . LYS A 1 42  ? 0.239  -6.540  12.960 1.00 73.00 ? 42  LYS A HD3  1  
ATOM 679   H HE2  . LYS A 1 42  ? -1.513 -8.278  12.763 1.00 4.03  ? 42  LYS A HE2  1  
ATOM 680   H HE3  . LYS A 1 42  ? -1.229 -8.716  14.447 1.00 33.03 ? 42  LYS A HE3  1  
ATOM 681   H HZ1  . LYS A 1 42  ? -2.649 -6.451  13.342 1.00 32.11 ? 42  LYS A HZ1  1  
ATOM 682   H HZ2  . LYS A 1 42  ? -1.630 -6.078  14.639 1.00 14.33 ? 42  LYS A HZ2  1  
ATOM 683   H HZ3  . LYS A 1 42  ? -2.849 -7.235  14.828 1.00 73.52 ? 42  LYS A HZ3  1  
ATOM 684   N N    . ASN A 1 43  ? 3.640  -7.499  15.697 1.00 21.11 ? 43  ASN A N    1  
ATOM 685   C CA   . ASN A 1 43  ? 3.371  -6.858  16.979 1.00 34.43 ? 43  ASN A CA   1  
ATOM 686   C C    . ASN A 1 43  ? 4.655  -6.695  17.786 1.00 20.44 ? 43  ASN A C    1  
ATOM 687   O O    . ASN A 1 43  ? 4.827  -5.711  18.504 1.00 21.14 ? 43  ASN A O    1  
ATOM 688   C CB   . ASN A 1 43  ? 2.354  -7.676  17.778 1.00 75.22 ? 43  ASN A CB   1  
ATOM 689   C CG   . ASN A 1 43  ? 0.922  -7.300  17.448 1.00 40.50 ? 43  ASN A CG   1  
ATOM 690   O OD1  . ASN A 1 43  ? 0.587  -6.119  17.343 1.00 64.42 ? 43  ASN A OD1  1  
ATOM 691   N ND2  . ASN A 1 43  ? 0.069  -8.304  17.283 1.00 1.14  ? 43  ASN A ND2  1  
ATOM 692   H H    . ASN A 1 43  ? 4.119  -8.354  15.681 1.00 3.25  ? 43  ASN A H    1  
ATOM 693   H HA   . ASN A 1 43  ? 2.957  -5.881  16.781 1.00 63.11 ? 43  ASN A HA   1  
ATOM 694   H HB2  . ASN A 1 43  ? 2.490  -8.725  17.556 1.00 54.35 ? 43  ASN A HB2  1  
ATOM 695   H HB3  . ASN A 1 43  ? 2.516  -7.512  18.832 1.00 2.14  ? 43  ASN A HB3  1  
ATOM 696   H HD21 . ASN A 1 43  ? 0.406  -9.219  17.383 1.00 41.05 ? 43  ASN A HD21 1  
ATOM 697   H HD22 . ASN A 1 43  ? -0.863 -8.089  17.069 1.00 44.12 ? 43  ASN A HD22 1  
ATOM 698   N N    . GLU A 1 44  ? 5.553  -7.668  17.662 1.00 42.51 ? 44  GLU A N    1  
ATOM 699   C CA   . GLU A 1 44  ? 6.822  -7.631  18.380 1.00 33.13 ? 44  GLU A CA   1  
ATOM 700   C C    . GLU A 1 44  ? 7.891  -6.914  17.561 1.00 72.44 ? 44  GLU A C    1  
ATOM 701   O O    . GLU A 1 44  ? 7.826  -6.876  16.331 1.00 10.03 ? 44  GLU A O    1  
ATOM 702   C CB   . GLU A 1 44  ? 7.285  -9.051  18.714 1.00 43.34 ? 44  GLU A CB   1  
ATOM 703   C CG   . GLU A 1 44  ? 7.853  -9.801  17.521 1.00 71.53 ? 44  GLU A CG   1  
ATOM 704   C CD   . GLU A 1 44  ? 7.718  -11.305 17.660 1.00 22.40 ? 44  GLU A CD   1  
ATOM 705   O OE1  . GLU A 1 44  ? 8.124  -12.026 16.724 1.00 54.12 ? 44  GLU A OE1  1  
ATOM 706   O OE2  . GLU A 1 44  ? 7.208  -11.762 18.704 1.00 14.31 ? 44  GLU A OE2  1  
ATOM 707   H H    . GLU A 1 44  ? 5.358  -8.427  17.074 1.00 41.30 ? 44  GLU A H    1  
ATOM 708   H HA   . GLU A 1 44  ? 6.666  -7.088  19.300 1.00 24.01 ? 44  GLU A HA   1  
ATOM 709   H HB2  . GLU A 1 44  ? 8.048  -8.998  19.476 1.00 3.32  ? 44  GLU A HB2  1  
ATOM 710   H HB3  . GLU A 1 44  ? 6.445  -9.610  19.097 1.00 14.10 ? 44  GLU A HB3  1  
ATOM 711   H HG2  . GLU A 1 44  ? 7.326  -9.489  16.631 1.00 23.43 ? 44  GLU A HG2  1  
ATOM 712   H HG3  . GLU A 1 44  ? 8.900  -9.556  17.422 1.00 22.12 ? 44  GLU A HG3  1  
ATOM 713   N N    . THR A 1 45  ? 8.875  -6.346  18.250 1.00 22.33 ? 45  THR A N    1  
ATOM 714   C CA   . THR A 1 45  ? 9.958  -5.629  17.588 1.00 35.22 ? 45  THR A CA   1  
ATOM 715   C C    . THR A 1 45  ? 11.097 -6.572  17.220 1.00 61.25 ? 45  THR A C    1  
ATOM 716   O O    . THR A 1 45  ? 11.126 -7.724  17.652 1.00 11.33 ? 45  THR A O    1  
ATOM 717   C CB   . THR A 1 45  ? 10.509 -4.499  18.477 1.00 0.23  ? 45  THR A CB   1  
ATOM 718   O OG1  . THR A 1 45  ? 9.488  -4.032  19.366 1.00 54.45 ? 45  THR A OG1  1  
ATOM 719   C CG2  . THR A 1 45  ? 11.018 -3.343  17.629 1.00 24.04 ? 45  THR A CG2  1  
ATOM 720   H H    . THR A 1 45  ? 8.872  -6.411  19.228 1.00 34.20 ? 45  THR A H    1  
ATOM 721   H HA   . THR A 1 45  ? 9.562  -5.188  16.685 1.00 53.10 ? 45  THR A HA   1  
ATOM 722   H HB   . THR A 1 45  ? 11.332 -4.888  19.060 1.00 74.41 ? 45  THR A HB   1  
ATOM 723   H HG1  . THR A 1 45  ? 9.016  -3.303  18.955 1.00 15.24 ? 45  THR A HG1  1  
ATOM 724   H HG21 . THR A 1 45  ? 12.095 -3.290  17.702 1.00 33.11 ? 45  THR A HG21 1  
ATOM 725   H HG22 . THR A 1 45  ? 10.587 -2.419  17.985 1.00 44.25 ? 45  THR A HG22 1  
ATOM 726   H HG23 . THR A 1 45  ? 10.735 -3.500  16.600 1.00 60.43 ? 45  THR A HG23 1  
ATOM 727   N N    . GLU A 1 46  ? 12.035 -6.076  16.418 1.00 15.53 ? 46  GLU A N    1  
ATOM 728   C CA   . GLU A 1 46  ? 13.177 -6.876  15.992 1.00 14.21 ? 46  GLU A CA   1  
ATOM 729   C C    . GLU A 1 46  ? 13.892 -7.486  17.194 1.00 42.11 ? 46  GLU A C    1  
ATOM 730   O O    . GLU A 1 46  ? 14.385 -8.612  17.132 1.00 62.45 ? 46  GLU A O    1  
ATOM 731   C CB   . GLU A 1 46  ? 14.154 -6.020  15.183 1.00 33.12 ? 46  GLU A CB   1  
ATOM 732   C CG   . GLU A 1 46  ? 13.540 -5.414  13.932 1.00 2.54  ? 46  GLU A CG   1  
ATOM 733   C CD   . GLU A 1 46  ? 14.141 -4.066  13.583 1.00 54.41 ? 46  GLU A CD   1  
ATOM 734   O OE1  . GLU A 1 46  ? 15.174 -3.704  14.183 1.00 4.21  ? 46  GLU A OE1  1  
ATOM 735   O OE2  . GLU A 1 46  ? 13.577 -3.373  12.710 1.00 2.12  ? 46  GLU A OE2  1  
ATOM 736   H H    . GLU A 1 46  ? 11.956 -5.150  16.106 1.00 11.14 ? 46  GLU A H    1  
ATOM 737   H HA   . GLU A 1 46  ? 12.807 -7.673  15.365 1.00 22.34 ? 46  GLU A HA   1  
ATOM 738   H HB2  . GLU A 1 46  ? 14.514 -5.217  15.809 1.00 15.22 ? 46  GLU A HB2  1  
ATOM 739   H HB3  . GLU A 1 46  ? 14.990 -6.635  14.886 1.00 4.12  ? 46  GLU A HB3  1  
ATOM 740   H HG2  . GLU A 1 46  ? 13.701 -6.088  13.105 1.00 45.55 ? 46  GLU A HG2  1  
ATOM 741   H HG3  . GLU A 1 46  ? 12.479 -5.288  14.092 1.00 63.33 ? 46  GLU A HG3  1  
ATOM 742   N N    . LYS A 1 47  ? 13.946 -6.734  18.288 1.00 53.43 ? 47  LYS A N    1  
ATOM 743   C CA   . LYS A 1 47  ? 14.600 -7.198  19.505 1.00 33.23 ? 47  LYS A CA   1  
ATOM 744   C C    . LYS A 1 47  ? 13.695 -8.152  20.279 1.00 51.20 ? 47  LYS A C    1  
ATOM 745   O O    . LYS A 1 47  ? 14.077 -9.285  20.572 1.00 40.15 ? 47  LYS A O    1  
ATOM 746   C CB   . LYS A 1 47  ? 14.980 -6.009  20.390 1.00 44.11 ? 47  LYS A CB   1  
ATOM 747   C CG   . LYS A 1 47  ? 16.446 -5.991  20.788 1.00 61.24 ? 47  LYS A CG   1  
ATOM 748   C CD   . LYS A 1 47  ? 16.645 -6.500  22.205 1.00 24.15 ? 47  LYS A CD   1  
ATOM 749   C CE   . LYS A 1 47  ? 17.325 -7.861  22.219 1.00 50.21 ? 47  LYS A CE   1  
ATOM 750   N NZ   . LYS A 1 47  ? 16.566 -8.852  23.030 1.00 34.03 ? 47  LYS A NZ   1  
ATOM 751   H H    . LYS A 1 47  ? 13.534 -5.844  18.276 1.00 0.41  ? 47  LYS A H    1  
ATOM 752   H HA   . LYS A 1 47  ? 15.497 -7.725  19.219 1.00 23.23 ? 47  LYS A HA   1  
ATOM 753   H HB2  . LYS A 1 47  ? 14.762 -5.095  19.857 1.00 23.02 ? 47  LYS A HB2  1  
ATOM 754   H HB3  . LYS A 1 47  ? 14.385 -6.041  21.291 1.00 10.11 ? 47  LYS A HB3  1  
ATOM 755   H HG2  . LYS A 1 47  ? 17.002 -6.622  20.109 1.00 13.52 ? 47  LYS A HG2  1  
ATOM 756   H HG3  . LYS A 1 47  ? 16.815 -4.977  20.724 1.00 71.35 ? 47  LYS A HG3  1  
ATOM 757   H HD2  . LYS A 1 47  ? 17.261 -5.798  22.748 1.00 52.22 ? 47  LYS A HD2  1  
ATOM 758   H HD3  . LYS A 1 47  ? 15.681 -6.584  22.687 1.00 5.13  ? 47  LYS A HD3  1  
ATOM 759   H HE2  . LYS A 1 47  ? 17.400 -8.221  21.204 1.00 23.05 ? 47  LYS A HE2  1  
ATOM 760   H HE3  . LYS A 1 47  ? 18.315 -7.750  22.636 1.00 41.31 ? 47  LYS A HE3  1  
ATOM 761   H HZ1  . LYS A 1 47  ? 16.088 -9.534  22.406 1.00 3.42  ? 47  LYS A HZ1  1  
ATOM 762   H HZ2  . LYS A 1 47  ? 15.849 -8.367  23.608 1.00 62.55 ? 47  LYS A HZ2  1  
ATOM 763   H HZ3  . LYS A 1 47  ? 17.212 -9.368  23.660 1.00 32.54 ? 47  LYS A HZ3  1  
ATOM 764   N N    . ASP A 1 48  ? 12.494 -7.686  20.606 1.00 24.30 ? 48  ASP A N    1  
ATOM 765   C CA   . ASP A 1 48  ? 11.534 -8.499  21.344 1.00 41.05 ? 48  ASP A CA   1  
ATOM 766   C C    . ASP A 1 48  ? 11.311 -9.839  20.650 1.00 32.43 ? 48  ASP A C    1  
ATOM 767   O O    . ASP A 1 48  ? 10.990 -10.837 21.295 1.00 13.03 ? 48  ASP A O    1  
ATOM 768   C CB   . ASP A 1 48  ? 10.205 -7.755  21.483 1.00 70.10 ? 48  ASP A CB   1  
ATOM 769   C CG   . ASP A 1 48  ? 10.394 -6.297  21.853 1.00 35.12 ? 48  ASP A CG   1  
ATOM 770   O OD1  . ASP A 1 48  ? 11.428 -5.971  22.473 1.00 14.03 ? 48  ASP A OD1  1  
ATOM 771   O OD2  . ASP A 1 48  ? 9.508  -5.482  21.522 1.00 34.00 ? 48  ASP A OD2  1  
ATOM 772   H H    . ASP A 1 48  ? 12.248 -6.774  20.344 1.00 31.24 ? 48  ASP A H    1  
ATOM 773   H HA   . ASP A 1 48  ? 11.939 -8.680  22.327 1.00 25.15 ? 48  ASP A HA   1  
ATOM 774   H HB2  . ASP A 1 48  ? 9.673  -7.803  20.544 1.00 51.32 ? 48  ASP A HB2  1  
ATOM 775   H HB3  . ASP A 1 48  ? 9.613  -8.230  22.252 1.00 42.23 ? 48  ASP A HB3  1  
ATOM 776   N N    . ALA A 1 49  ? 11.482 -9.854  19.332 1.00 0.14  ? 49  ALA A N    1  
ATOM 777   C CA   . ALA A 1 49  ? 11.300 -11.071 18.552 1.00 62.41 ? 49  ALA A CA   1  
ATOM 778   C C    . ALA A 1 49  ? 12.362 -12.110 18.899 1.00 52.32 ? 49  ALA A C    1  
ATOM 779   O O    . ALA A 1 49  ? 12.108 -13.314 18.845 1.00 2.13  ? 49  ALA A O    1  
ATOM 780   C CB   . ALA A 1 49  ? 11.335 -10.755 17.064 1.00 2.31  ? 49  ALA A CB   1  
ATOM 781   H H    . ALA A 1 49  ? 11.738 -9.026  18.875 1.00 61.44 ? 49  ALA A H    1  
ATOM 782   H HA   . ALA A 1 49  ? 10.326 -11.476 18.786 1.00 13.40 ? 49  ALA A HA   1  
ATOM 783   H HB1  . ALA A 1 49  ? 11.798 -9.790  16.913 1.00 32.12 ? 49  ALA A HB1  1  
ATOM 784   H HB2  . ALA A 1 49  ? 11.906 -11.513 16.548 1.00 14.43 ? 49  ALA A HB2  1  
ATOM 785   H HB3  . ALA A 1 49  ? 10.328 -10.736 16.677 1.00 54.43 ? 49  ALA A HB3  1  
ATOM 786   N N    . LEU A 1 50  ? 13.551 -11.637 19.254 1.00 43.33 ? 50  LEU A N    1  
ATOM 787   C CA   . LEU A 1 50  ? 14.653 -12.525 19.609 1.00 11.31 ? 50  LEU A CA   1  
ATOM 788   C C    . LEU A 1 50  ? 14.528 -12.996 21.054 1.00 34.23 ? 50  LEU A C    1  
ATOM 789   O O    . LEU A 1 50  ? 14.567 -14.195 21.332 1.00 64.32 ? 50  LEU A O    1  
ATOM 790   C CB   . LEU A 1 50  ? 15.992 -11.814 19.407 1.00 63.33 ? 50  LEU A CB   1  
ATOM 791   C CG   . LEU A 1 50  ? 16.391 -11.535 17.957 1.00 5.53  ? 50  LEU A CG   1  
ATOM 792   C CD1  . LEU A 1 50  ? 17.756 -10.865 17.899 1.00 33.01 ? 50  LEU A CD1  1  
ATOM 793   C CD2  . LEU A 1 50  ? 16.392 -12.822 17.146 1.00 22.24 ? 50  LEU A CD2  1  
ATOM 794   H H    . LEU A 1 50  ? 13.693 -10.668 19.278 1.00 44.23 ? 50  LEU A H    1  
ATOM 795   H HA   . LEU A 1 50  ? 14.609 -13.385 18.957 1.00 15.44 ? 50  LEU A HA   1  
ATOM 796   H HB2  . LEU A 1 50  ? 15.947 -10.869 19.925 1.00 12.11 ? 50  LEU A HB2  1  
ATOM 797   H HB3  . LEU A 1 50  ? 16.762 -12.429 19.850 1.00 23.52 ? 50  LEU A HB3  1  
ATOM 798   H HG   . LEU A 1 50  ? 15.670 -10.860 17.516 1.00 64.53 ? 50  LEU A HG   1  
ATOM 799   H HD11 . LEU A 1 50  ? 18.388 -11.396 17.203 1.00 14.42 ? 50  LEU A HD11 1  
ATOM 800   H HD12 . LEU A 1 50  ? 18.207 -10.882 18.880 1.00 11.31 ? 50  LEU A HD12 1  
ATOM 801   H HD13 . LEU A 1 50  ? 17.641 -9.841  17.574 1.00 75.43 ? 50  LEU A HD13 1  
ATOM 802   H HD21 . LEU A 1 50  ? 15.394 -13.021 16.786 1.00 54.51 ? 50  LEU A HD21 1  
ATOM 803   H HD22 . LEU A 1 50  ? 16.718 -13.641 17.771 1.00 4.04  ? 50  LEU A HD22 1  
ATOM 804   H HD23 . LEU A 1 50  ? 17.064 -12.719 16.308 1.00 42.15 ? 50  LEU A HD23 1  
ATOM 805   N N    . ILE A 1 51  ? 14.374 -12.046 21.970 1.00 2.20  ? 51  ILE A N    1  
ATOM 806   C CA   . ILE A 1 51  ? 14.240 -12.365 23.386 1.00 54.41 ? 51  ILE A CA   1  
ATOM 807   C C    . ILE A 1 51  ? 13.070 -13.313 23.627 1.00 11.42 ? 51  ILE A C    1  
ATOM 808   O O    . ILE A 1 51  ? 13.092 -14.118 24.558 1.00 2.11  ? 51  ILE A O    1  
ATOM 809   C CB   . ILE A 1 51  ? 14.039 -11.094 24.232 1.00 12.25 ? 51  ILE A CB   1  
ATOM 810   C CG1  . ILE A 1 51  ? 14.292 -11.394 25.711 1.00 21.42 ? 51  ILE A CG1  1  
ATOM 811   C CG2  . ILE A 1 51  ? 12.636 -10.540 24.032 1.00 42.33 ? 51  ILE A CG2  1  
ATOM 812   C CD1  . ILE A 1 51  ? 14.801 -10.203 26.492 1.00 50.34 ? 51  ILE A CD1  1  
ATOM 813   H H    . ILE A 1 51  ? 14.350 -11.108 21.687 1.00 62.33 ? 51  ILE A H    1  
ATOM 814   H HA   . ILE A 1 51  ? 15.152 -12.846 23.707 1.00 71.50 ? 51  ILE A HA   1  
ATOM 815   H HB   . ILE A 1 51  ? 14.745 -10.350 23.898 1.00 42.34 ? 51  ILE A HB   1  
ATOM 816   H HG12 . ILE A 1 51  ? 13.372 -11.721 26.169 1.00 54.04 ? 51  ILE A HG12 1  
ATOM 817   H HG13 . ILE A 1 51  ? 15.028 -12.182 25.790 1.00 75.13 ? 51  ILE A HG13 1  
ATOM 818   H HG21 . ILE A 1 51  ? 12.424 -10.471 22.975 1.00 62.42 ? 51  ILE A HG21 1  
ATOM 819   H HG22 . ILE A 1 51  ? 11.919 -11.197 24.500 1.00 64.52 ? 51  ILE A HG22 1  
ATOM 820   H HG23 . ILE A 1 51  ? 12.569 -9.558  24.476 1.00 23.45 ? 51  ILE A HG23 1  
ATOM 821   H HD11 . ILE A 1 51  ? 14.702 -9.310  25.892 1.00 55.01 ? 51  ILE A HD11 1  
ATOM 822   H HD12 . ILE A 1 51  ? 14.227 -10.094 27.399 1.00 14.10 ? 51  ILE A HD12 1  
ATOM 823   H HD13 . ILE A 1 51  ? 15.842 -10.354 26.741 1.00 53.54 ? 51  ILE A HD13 1  
ATOM 824   N N    . ARG A 1 52  ? 12.050 -13.212 22.781 1.00 32.32 ? 52  ARG A N    1  
ATOM 825   C CA   . ARG A 1 52  ? 10.871 -14.061 22.902 1.00 72.41 ? 52  ARG A CA   1  
ATOM 826   C C    . ARG A 1 52  ? 11.111 -15.421 22.253 1.00 64.22 ? 52  ARG A C    1  
ATOM 827   O O    . ARG A 1 52  ? 10.970 -16.460 22.897 1.00 71.13 ? 52  ARG A O    1  
ATOM 828   C CB   . ARG A 1 52  ? 9.660  -13.384 22.258 1.00 40.24 ? 52  ARG A CB   1  
ATOM 829   C CG   . ARG A 1 52  ? 9.105  -12.226 23.072 1.00 61.34 ? 52  ARG A CG   1  
ATOM 830   C CD   . ARG A 1 52  ? 8.653  -12.681 24.450 1.00 30.34 ? 52  ARG A CD   1  
ATOM 831   N NE   . ARG A 1 52  ? 7.833  -13.888 24.387 1.00 24.41 ? 52  ARG A NE   1  
ATOM 832   C CZ   . ARG A 1 52  ? 6.540  -13.883 24.086 1.00 73.42 ? 52  ARG A CZ   1  
ATOM 833   N NH1  . ARG A 1 52  ? 5.922  -12.741 23.821 1.00 13.42 ? 52  ARG A NH1  1  
ATOM 834   N NH2  . ARG A 1 52  ? 5.862  -15.023 24.048 1.00 34.31 ? 52  ARG A NH2  1  
ATOM 835   H H    . ARG A 1 52  ? 12.091 -12.551 22.059 1.00 15.10 ? 52  ARG A H    1  
ATOM 836   H HA   . ARG A 1 52  ? 10.673 -14.207 23.953 1.00 22.52 ? 52  ARG A HA   1  
ATOM 837   H HB2  . ARG A 1 52  ? 9.947  -13.007 21.287 1.00 60.02 ? 52  ARG A HB2  1  
ATOM 838   H HB3  . ARG A 1 52  ? 8.877  -14.116 22.133 1.00 32.24 ? 52  ARG A HB3  1  
ATOM 839   H HG2  . ARG A 1 52  ? 9.875  -11.477 23.186 1.00 33.45 ? 52  ARG A HG2  1  
ATOM 840   H HG3  . ARG A 1 52  ? 8.262  -11.802 22.547 1.00 10.35 ? 52  ARG A HG3  1  
ATOM 841   H HD2  . ARG A 1 52  ? 9.526  -12.882 25.053 1.00 42.00 ? 52  ARG A HD2  1  
ATOM 842   H HD3  . ARG A 1 52  ? 8.077  -11.889 24.905 1.00 73.22 ? 52  ARG A HD3  1  
ATOM 843   H HE   . ARG A 1 52  ? 8.270  -14.744 24.579 1.00 21.01 ? 52  ARG A HE   1  
ATOM 844   H HH11 . ARG A 1 52  ? 6.430  -11.880 23.848 1.00 64.32 ? 52  ARG A HH11 1  
ATOM 845   H HH12 . ARG A 1 52  ? 4.948  -12.740 23.593 1.00 13.34 ? 52  ARG A HH12 1  
ATOM 846   H HH21 . ARG A 1 52  ? 6.324  -15.887 24.247 1.00 42.23 ? 52  ARG A HH21 1  
ATOM 847   H HH22 . ARG A 1 52  ? 4.888  -15.019 23.821 1.00 2.45  ? 52  ARG A HH22 1  
ATOM 848   N N    . GLU A 1 53  ? 11.475 -15.405 20.974 1.00 10.12 ? 53  GLU A N    1  
ATOM 849   C CA   . GLU A 1 53  ? 11.733 -16.637 20.238 1.00 25.15 ? 53  GLU A CA   1  
ATOM 850   C C    . GLU A 1 53  ? 12.850 -17.441 20.898 1.00 5.53  ? 53  GLU A C    1  
ATOM 851   O O    . GLU A 1 53  ? 12.647 -18.582 21.313 1.00 74.13 ? 53  GLU A O    1  
ATOM 852   C CB   . GLU A 1 53  ? 12.105 -16.323 18.788 1.00 52.32 ? 53  GLU A CB   1  
ATOM 853   C CG   . GLU A 1 53  ? 11.870 -17.482 17.834 1.00 31.34 ? 53  GLU A CG   1  
ATOM 854   C CD   . GLU A 1 53  ? 11.552 -17.023 16.425 1.00 75.13 ? 53  GLU A CD   1  
ATOM 855   O OE1  . GLU A 1 53  ? 12.179 -17.541 15.477 1.00 42.40 ? 53  GLU A OE1  1  
ATOM 856   O OE2  . GLU A 1 53  ? 10.676 -16.147 16.269 1.00 13.10 ? 53  GLU A OE2  1  
ATOM 857   H H    . GLU A 1 53  ? 11.571 -14.545 20.515 1.00 10.40 ? 53  GLU A H    1  
ATOM 858   H HA   . GLU A 1 53  ? 10.829 -17.226 20.249 1.00 14.31 ? 53  GLU A HA   1  
ATOM 859   H HB2  . GLU A 1 53  ? 11.516 -15.482 18.452 1.00 11.10 ? 53  GLU A HB2  1  
ATOM 860   H HB3  . GLU A 1 53  ? 13.151 -16.057 18.747 1.00 52.14 ? 53  GLU A HB3  1  
ATOM 861   H HG2  . GLU A 1 53  ? 12.759 -18.093 17.805 1.00 64.51 ? 53  GLU A HG2  1  
ATOM 862   H HG3  . GLU A 1 53  ? 11.042 -18.071 18.201 1.00 30.11 ? 53  GLU A HG3  1  
ATOM 863   N N    . ILE A 1 54  ? 14.030 -16.836 20.991 1.00 22.43 ? 54  ILE A N    1  
ATOM 864   C CA   . ILE A 1 54  ? 15.179 -17.495 21.601 1.00 41.33 ? 54  ILE A CA   1  
ATOM 865   C C    . ILE A 1 54  ? 14.811 -18.108 22.947 1.00 33.32 ? 54  ILE A C    1  
ATOM 866   O O    . ILE A 1 54  ? 15.443 -19.063 23.399 1.00 32.05 ? 54  ILE A O    1  
ATOM 867   C CB   . ILE A 1 54  ? 16.350 -16.514 21.799 1.00 30.11 ? 54  ILE A CB   1  
ATOM 868   C CG1  . ILE A 1 54  ? 16.869 -16.025 20.445 1.00 11.35 ? 54  ILE A CG1  1  
ATOM 869   C CG2  . ILE A 1 54  ? 17.467 -17.176 22.593 1.00 75.14 ? 54  ILE A CG2  1  
ATOM 870   C CD1  . ILE A 1 54  ? 17.702 -14.766 20.537 1.00 1.42  ? 54  ILE A CD1  1  
ATOM 871   H H    . ILE A 1 54  ? 14.130 -15.926 20.643 1.00 61.33 ? 54  ILE A H    1  
ATOM 872   H HA   . ILE A 1 54  ? 15.504 -18.282 20.935 1.00 14.31 ? 54  ILE A HA   1  
ATOM 873   H HB   . ILE A 1 54  ? 15.990 -15.669 22.366 1.00 45.02 ? 54  ILE A HB   1  
ATOM 874   H HG12 . ILE A 1 54  ? 17.480 -16.794 20.001 1.00 20.55 ? 54  ILE A HG12 1  
ATOM 875   H HG13 . ILE A 1 54  ? 16.028 -15.821 19.799 1.00 52.34 ? 54  ILE A HG13 1  
ATOM 876   H HG21 . ILE A 1 54  ? 17.384 -16.896 23.632 1.00 3.54  ? 54  ILE A HG21 1  
ATOM 877   H HG22 . ILE A 1 54  ? 17.384 -18.249 22.503 1.00 42.22 ? 54  ILE A HG22 1  
ATOM 878   H HG23 . ILE A 1 54  ? 18.422 -16.854 22.207 1.00 22.23 ? 54  ILE A HG23 1  
ATOM 879   H HD11 . ILE A 1 54  ? 18.667 -15.002 20.962 1.00 14.31 ? 54  ILE A HD11 1  
ATOM 880   H HD12 . ILE A 1 54  ? 17.835 -14.348 19.551 1.00 74.25 ? 54  ILE A HD12 1  
ATOM 881   H HD13 . ILE A 1 54  ? 17.199 -14.046 21.167 1.00 32.24 ? 54  ILE A HD13 1  
ATOM 882   N N    . ARG A 1 55  ? 13.783 -17.555 23.582 1.00 0.53  ? 55  ARG A N    1  
ATOM 883   C CA   . ARG A 1 55  ? 13.330 -18.048 24.877 1.00 14.42 ? 55  ARG A CA   1  
ATOM 884   C C    . ARG A 1 55  ? 12.867 -19.498 24.775 1.00 70.10 ? 55  ARG A C    1  
ATOM 885   O O    . ARG A 1 55  ? 13.449 -20.390 25.392 1.00 41.44 ? 55  ARG A O    1  
ATOM 886   C CB   . ARG A 1 55  ? 12.192 -17.174 25.409 1.00 33.53 ? 55  ARG A CB   1  
ATOM 887   C CG   . ARG A 1 55  ? 12.255 -16.939 26.910 1.00 61.14 ? 55  ARG A CG   1  
ATOM 888   C CD   . ARG A 1 55  ? 11.676 -15.584 27.286 1.00 62.12 ? 55  ARG A CD   1  
ATOM 889   N NE   . ARG A 1 55  ? 11.380 -15.493 28.713 1.00 43.50 ? 55  ARG A NE   1  
ATOM 890   C CZ   . ARG A 1 55  ? 10.953 -14.383 29.305 1.00 1.12  ? 55  ARG A CZ   1  
ATOM 891   N NH1  . ARG A 1 55  ? 10.772 -13.277 28.597 1.00 44.22 ? 55  ARG A NH1  1  
ATOM 892   N NH2  . ARG A 1 55  ? 10.705 -14.378 30.609 1.00 62.32 ? 55  ARG A NH2  1  
ATOM 893   H H    . ARG A 1 55  ? 13.319 -16.796 23.171 1.00 50.42 ? 55  ARG A H    1  
ATOM 894   H HA   . ARG A 1 55  ? 14.162 -17.995 25.562 1.00 23.25 ? 55  ARG A HA   1  
ATOM 895   H HB2  . ARG A 1 55  ? 12.228 -16.215 24.915 1.00 42.21 ? 55  ARG A HB2  1  
ATOM 896   H HB3  . ARG A 1 55  ? 11.251 -17.652 25.181 1.00 31.32 ? 55  ARG A HB3  1  
ATOM 897   H HG2  . ARG A 1 55  ? 11.689 -17.711 27.410 1.00 24.11 ? 55  ARG A HG2  1  
ATOM 898   H HG3  . ARG A 1 55  ? 13.286 -16.982 27.228 1.00 40.42 ? 55  ARG A HG3  1  
ATOM 899   H HD2  . ARG A 1 55  ? 12.391 -14.818 27.026 1.00 1.54  ? 55  ARG A HD2  1  
ATOM 900   H HD3  . ARG A 1 55  ? 10.765 -15.430 26.728 1.00 52.23 ? 55  ARG A HD3  1  
ATOM 901   H HE   . ARG A 1 55  ? 11.507 -16.298 29.255 1.00 30.34 ? 55  ARG A HE   1  
ATOM 902   H HH11 . ARG A 1 55  ? 10.957 -13.278 27.614 1.00 4.42  ? 55  ARG A HH11 1  
ATOM 903   H HH12 . ARG A 1 55  ? 10.449 -12.443 29.045 1.00 44.10 ? 55  ARG A HH12 1  
ATOM 904   H HH21 . ARG A 1 55  ? 10.840 -15.210 31.146 1.00 21.30 ? 55  ARG A HH21 1  
ATOM 905   H HH22 . ARG A 1 55  ? 10.384 -13.543 31.053 1.00 10.15 ? 55  ARG A HH22 1  
ATOM 906   N N    . GLU A 1 56  ? 11.816 -19.725 23.993 1.00 64.13 ? 56  GLU A N    1  
ATOM 907   C CA   . GLU A 1 56  ? 11.276 -21.067 23.812 1.00 75.14 ? 56  GLU A CA   1  
ATOM 908   C C    . GLU A 1 56  ? 11.922 -21.757 22.614 1.00 61.21 ? 56  GLU A C    1  
ATOM 909   O O    . GLU A 1 56  ? 12.359 -22.904 22.707 1.00 14.11 ? 56  GLU A O    1  
ATOM 910   C CB   . GLU A 1 56  ? 9.758  -21.008 23.622 1.00 23.33 ? 56  GLU A CB   1  
ATOM 911   C CG   . GLU A 1 56  ? 9.077  -22.361 23.742 1.00 61.31 ? 56  GLU A CG   1  
ATOM 912   C CD   . GLU A 1 56  ? 7.568  -22.249 23.830 1.00 15.44 ? 56  GLU A CD   1  
ATOM 913   O OE1  . GLU A 1 56  ? 6.923  -22.076 22.774 1.00 3.35  ? 56  GLU A OE1  1  
ATOM 914   O OE2  . GLU A 1 56  ? 7.031  -22.333 24.955 1.00 54.15 ? 56  GLU A OE2  1  
ATOM 915   H H    . GLU A 1 56  ? 11.395 -18.973 23.527 1.00 1.21  ? 56  GLU A H    1  
ATOM 916   H HA   . GLU A 1 56  ? 11.496 -21.636 24.702 1.00 70.42 ? 56  GLU A HA   1  
ATOM 917   H HB2  . GLU A 1 56  ? 9.340  -20.350 24.369 1.00 14.20 ? 56  GLU A HB2  1  
ATOM 918   H HB3  . GLU A 1 56  ? 9.546  -20.607 22.642 1.00 34.43 ? 56  GLU A HB3  1  
ATOM 919   H HG2  . GLU A 1 56  ? 9.328  -22.954 22.875 1.00 20.32 ? 56  GLU A HG2  1  
ATOM 920   H HG3  . GLU A 1 56  ? 9.439  -22.855 24.632 1.00 64.14 ? 56  GLU A HG3  1  
ATOM 921   N N    . GLU A 1 57  ? 11.979 -21.050 21.490 1.00 54.50 ? 57  GLU A N    1  
ATOM 922   C CA   . GLU A 1 57  ? 12.570 -21.595 20.274 1.00 42.42 ? 57  GLU A CA   1  
ATOM 923   C C    . GLU A 1 57  ? 13.938 -22.208 20.561 1.00 12.45 ? 57  GLU A C    1  
ATOM 924   O O    . GLU A 1 57  ? 14.158 -23.396 20.329 1.00 1.13  ? 57  GLU A O    1  
ATOM 925   C CB   . GLU A 1 57  ? 12.702 -20.502 19.210 1.00 23.35 ? 57  GLU A CB   1  
ATOM 926   C CG   . GLU A 1 57  ? 12.474 -21.001 17.794 1.00 71.34 ? 57  GLU A CG   1  
ATOM 927   C CD   . GLU A 1 57  ? 11.137 -21.698 17.629 1.00 41.23 ? 57  GLU A CD   1  
ATOM 928   O OE1  . GLU A 1 57  ? 11.090 -22.936 17.787 1.00 4.24  ? 57  GLU A OE1  1  
ATOM 929   O OE2  . GLU A 1 57  ? 10.138 -21.006 17.341 1.00 4.20  ? 57  GLU A OE2  1  
ATOM 930   H H    . GLU A 1 57  ? 11.613 -20.140 21.478 1.00 24.33 ? 57  GLU A H    1  
ATOM 931   H HA   . GLU A 1 57  ? 11.914 -22.367 19.903 1.00 32.20 ? 57  GLU A HA   1  
ATOM 932   H HB2  . GLU A 1 57  ? 11.981 -19.726 19.418 1.00 52.33 ? 57  GLU A HB2  1  
ATOM 933   H HB3  . GLU A 1 57  ? 13.696 -20.082 19.266 1.00 54.14 ? 57  GLU A HB3  1  
ATOM 934   H HG2  . GLU A 1 57  ? 12.509 -20.159 17.119 1.00 61.22 ? 57  GLU A HG2  1  
ATOM 935   H HG3  . GLU A 1 57  ? 13.260 -21.697 17.540 1.00 72.43 ? 57  GLU A HG3  1  
ATOM 936   N N    . MET A 1 58  ? 14.853 -21.387 21.068 1.00 74.32 ? 58  MET A N    1  
ATOM 937   C CA   . MET A 1 58  ? 16.199 -21.848 21.388 1.00 74.51 ? 58  MET A CA   1  
ATOM 938   C C    . MET A 1 58  ? 16.215 -22.598 22.716 1.00 32.31 ? 58  MET A C    1  
ATOM 939   O O    . MET A 1 58  ? 17.052 -23.474 22.937 1.00 50.24 ? 58  MET A O    1  
ATOM 940   C CB   . MET A 1 58  ? 17.166 -20.665 21.445 1.00 2.12  ? 58  MET A CB   1  
ATOM 941   C CG   . MET A 1 58  ? 18.022 -20.519 20.198 1.00 41.44 ? 58  MET A CG   1  
ATOM 942   S SD   . MET A 1 58  ? 19.292 -19.250 20.371 1.00 20.52 ? 58  MET A SD   1  
ATOM 943   C CE   . MET A 1 58  ? 19.748 -18.991 18.659 1.00 54.25 ? 58  MET A CE   1  
ATOM 944   H H    . MET A 1 58  ? 14.618 -20.450 21.231 1.00 14.10 ? 58  MET A H    1  
ATOM 945   H HA   . MET A 1 58  ? 16.513 -22.521 20.604 1.00 21.22 ? 58  MET A HA   1  
ATOM 946   H HB2  . MET A 1 58  ? 16.597 -19.756 21.574 1.00 25.11 ? 58  MET A HB2  1  
ATOM 947   H HB3  . MET A 1 58  ? 17.823 -20.792 22.293 1.00 61.43 ? 58  MET A HB3  1  
ATOM 948   H HG2  . MET A 1 58  ? 18.503 -21.464 19.994 1.00 4.50  ? 58  MET A HG2  1  
ATOM 949   H HG3  . MET A 1 58  ? 17.382 -20.257 19.368 1.00 61.11 ? 58  MET A HG3  1  
ATOM 950   H HE1  . MET A 1 58  ? 20.468 -19.738 18.360 1.00 3.33  ? 58  MET A HE1  1  
ATOM 951   H HE2  . MET A 1 58  ? 18.868 -19.070 18.037 1.00 63.15 ? 58  MET A HE2  1  
ATOM 952   H HE3  . MET A 1 58  ? 20.181 -18.007 18.547 1.00 71.42 ? 58  MET A HE3  1  
ATOM 953   N N    . LYS A 1 59  ? 15.285 -22.250 23.599 1.00 52.43 ? 59  LYS A N    1  
ATOM 954   C CA   . LYS A 1 59  ? 15.191 -22.890 24.905 1.00 11.23 ? 59  LYS A CA   1  
ATOM 955   C C    . LYS A 1 59  ? 16.479 -22.698 25.699 1.00 2.21  ? 59  LYS A C    1  
ATOM 956   O O    . LYS A 1 59  ? 16.852 -23.547 26.510 1.00 44.25 ? 59  LYS A O    1  
ATOM 957   C CB   . LYS A 1 59  ? 14.896 -24.383 24.745 1.00 41.24 ? 59  LYS A CB   1  
ATOM 958   C CG   . LYS A 1 59  ? 13.413 -24.707 24.688 1.00 24.54 ? 59  LYS A CG   1  
ATOM 959   C CD   . LYS A 1 59  ? 13.073 -25.912 25.550 1.00 63.35 ? 59  LYS A CD   1  
ATOM 960   C CE   . LYS A 1 59  ? 13.097 -25.564 27.030 1.00 52.21 ? 59  LYS A CE   1  
ATOM 961   N NZ   . LYS A 1 59  ? 12.836 -26.755 27.884 1.00 25.34 ? 59  LYS A NZ   1  
ATOM 962   H H    . LYS A 1 59  ? 14.645 -21.544 23.365 1.00 72.31 ? 59  LYS A H    1  
ATOM 963   H HA   . LYS A 1 59  ? 14.378 -22.427 25.444 1.00 50.11 ? 59  LYS A HA   1  
ATOM 964   H HB2  . LYS A 1 59  ? 15.355 -24.732 23.831 1.00 12.22 ? 59  LYS A HB2  1  
ATOM 965   H HB3  . LYS A 1 59  ? 15.328 -24.915 25.580 1.00 1.32  ? 59  LYS A HB3  1  
ATOM 966   H HG2  . LYS A 1 59  ? 12.854 -23.855 25.044 1.00 74.12 ? 59  LYS A HG2  1  
ATOM 967   H HG3  . LYS A 1 59  ? 13.139 -24.919 23.665 1.00 62.15 ? 59  LYS A HG3  1  
ATOM 968   H HD2  . LYS A 1 59  ? 12.085 -26.263 25.290 1.00 44.44 ? 59  LYS A HD2  1  
ATOM 969   H HD3  . LYS A 1 59  ? 13.796 -26.694 25.361 1.00 54.00 ? 59  LYS A HD3  1  
ATOM 970   H HE2  . LYS A 1 59  ? 14.067 -25.160 27.276 1.00 71.11 ? 59  LYS A HE2  1  
ATOM 971   H HE3  . LYS A 1 59  ? 12.338 -24.820 27.223 1.00 11.10 ? 59  LYS A HE3  1  
ATOM 972   H HZ1  . LYS A 1 59  ? 12.044 -26.565 28.530 1.00 13.13 ? 59  LYS A HZ1  1  
ATOM 973   H HZ2  . LYS A 1 59  ? 13.681 -26.982 28.448 1.00 75.34 ? 59  LYS A HZ2  1  
ATOM 974   H HZ3  . LYS A 1 59  ? 12.597 -27.575 27.291 1.00 24.33 ? 59  LYS A HZ3  1  
ATOM 975   N N    . CYS A 1 60  ? 17.153 -21.578 25.462 1.00 1.13  ? 60  CYS A N    1  
ATOM 976   C CA   . CYS A 1 60  ? 18.400 -21.274 26.156 1.00 32.52 ? 60  CYS A CA   1  
ATOM 977   C C    . CYS A 1 60  ? 18.359 -19.874 26.760 1.00 63.35 ? 60  CYS A C    1  
ATOM 978   O O    . CYS A 1 60  ? 17.371 -19.154 26.617 1.00 33.52 ? 60  CYS A O    1  
ATOM 979   C CB   . CYS A 1 60  ? 19.584 -21.395 25.196 1.00 23.34 ? 60  CYS A CB   1  
ATOM 980   S SG   . CYS A 1 60  ? 21.054 -22.153 25.929 1.00 74.01 ? 60  CYS A SG   1  
ATOM 981   H H    . CYS A 1 60  ? 16.805 -20.940 24.805 1.00 41.30 ? 60  CYS A H    1  
ATOM 982   H HA   . CYS A 1 60  ? 18.518 -21.993 26.953 1.00 60.02 ? 60  CYS A HA   1  
ATOM 983   H HB2  . CYS A 1 60  ? 19.292 -21.999 24.350 1.00 50.13 ? 60  CYS A HB2  1  
ATOM 984   H HB3  . CYS A 1 60  ? 19.859 -20.410 24.850 1.00 71.22 ? 60  CYS A HB3  1  
ATOM 985   H HG   . CYS A 1 60  ? 22.117 -21.661 25.312 1.00 23.32 ? 60  CYS A HG   1  
ATOM 986   N N    . ASP A 1 61  ? 19.439 -19.495 27.435 1.00 72.43 ? 61  ASP A N    1  
ATOM 987   C CA   . ASP A 1 61  ? 19.527 -18.181 28.061 1.00 72.32 ? 61  ASP A CA   1  
ATOM 988   C C    . ASP A 1 61  ? 20.356 -17.227 27.207 1.00 52.10 ? 61  ASP A C    1  
ATOM 989   O O    . ASP A 1 61  ? 21.001 -16.314 27.725 1.00 33.20 ? 61  ASP A O    1  
ATOM 990   C CB   . ASP A 1 61  ? 20.139 -18.298 29.458 1.00 71.34 ? 61  ASP A CB   1  
ATOM 991   C CG   . ASP A 1 61  ? 19.319 -17.579 30.511 1.00 62.30 ? 61  ASP A CG   1  
ATOM 992   O OD1  . ASP A 1 61  ? 19.426 -17.947 31.700 1.00 63.12 ? 61  ASP A OD1  1  
ATOM 993   O OD2  . ASP A 1 61  ? 18.571 -16.648 30.147 1.00 64.13 ? 61  ASP A OD2  1  
ATOM 994   H H    . ASP A 1 61  ? 20.195 -20.114 27.513 1.00 21.12 ? 61  ASP A H    1  
ATOM 995   H HA   . ASP A 1 61  ? 18.525 -17.788 28.149 1.00 44.04 ? 61  ASP A HA   1  
ATOM 996   H HB2  . ASP A 1 61  ? 20.203 -19.342 29.729 1.00 23.02 ? 61  ASP A HB2  1  
ATOM 997   H HB3  . ASP A 1 61  ? 21.131 -17.872 29.446 1.00 40.34 ? 61  ASP A HB3  1  
ATOM 998   N N    . LEU A 1 62  ? 20.335 -17.444 25.897 1.00 63.14 ? 62  LEU A N    1  
ATOM 999   C CA   . LEU A 1 62  ? 21.086 -16.604 24.970 1.00 50.10 ? 62  LEU A CA   1  
ATOM 1000  C C    . LEU A 1 62  ? 20.916 -15.128 25.313 1.00 15.52 ? 62  LEU A C    1  
ATOM 1001  O O    . LEU A 1 62  ? 19.809 -14.591 25.255 1.00 50.52 ? 62  LEU A O    1  
ATOM 1002  C CB   . LEU A 1 62  ? 20.629 -16.861 23.533 1.00 62.21 ? 62  LEU A CB   1  
ATOM 1003  C CG   . LEU A 1 62  ? 21.740 -17.035 22.496 1.00 10.44 ? 62  LEU A CG   1  
ATOM 1004  C CD1  . LEU A 1 62  ? 22.212 -18.480 22.457 1.00 50.24 ? 62  LEU A CD1  1  
ATOM 1005  C CD2  . LEU A 1 62  ? 21.261 -16.590 21.122 1.00 2.12  ? 62  LEU A CD2  1  
ATOM 1006  H H    . LEU A 1 62  ? 19.803 -18.187 25.543 1.00 41.41 ? 62  LEU A H    1  
ATOM 1007  H HA   . LEU A 1 62  ? 22.130 -16.864 25.059 1.00 3.41  ? 62  LEU A HA   1  
ATOM 1008  H HB2  . LEU A 1 62  ? 20.033 -17.761 23.532 1.00 52.54 ? 62  LEU A HB2  1  
ATOM 1009  H HB3  . LEU A 1 62  ? 20.017 -16.025 23.227 1.00 40.24 ? 62  LEU A HB3  1  
ATOM 1010  H HG   . LEU A 1 62  ? 22.583 -16.416 22.774 1.00 33.53 ? 62  LEU A HG   1  
ATOM 1011  H HD11 . LEU A 1 62  ? 21.795 -18.971 21.590 1.00 3.33  ? 62  LEU A HD11 1  
ATOM 1012  H HD12 . LEU A 1 62  ? 21.886 -18.990 23.351 1.00 10.40 ? 62  LEU A HD12 1  
ATOM 1013  H HD13 . LEU A 1 62  ? 23.291 -18.505 22.401 1.00 14.44 ? 62  LEU A HD13 1  
ATOM 1014  H HD21 . LEU A 1 62  ? 21.564 -17.317 20.383 1.00 21.13 ? 62  LEU A HD21 1  
ATOM 1015  H HD22 . LEU A 1 62  ? 21.697 -15.631 20.882 1.00 12.54 ? 62  LEU A HD22 1  
ATOM 1016  H HD23 . LEU A 1 62  ? 20.185 -16.507 21.126 1.00 53.54 ? 62  LEU A HD23 1  
ATOM 1017  N N    . ILE A 1 63  ? 22.018 -14.477 25.669 1.00 61.00 ? 63  ILE A N    1  
ATOM 1018  C CA   . ILE A 1 63  ? 21.991 -13.062 26.018 1.00 73.10 ? 63  ILE A CA   1  
ATOM 1019  C C    . ILE A 1 63  ? 22.237 -12.189 24.792 1.00 10.34 ? 63  ILE A C    1  
ATOM 1020  O O    . ILE A 1 63  ? 22.917 -12.598 23.852 1.00 45.13 ? 63  ILE A O    1  
ATOM 1021  C CB   . ILE A 1 63  ? 23.042 -12.727 27.093 1.00 55.12 ? 63  ILE A CB   1  
ATOM 1022  C CG1  . ILE A 1 63  ? 22.960 -13.728 28.247 1.00 71.42 ? 63  ILE A CG1  1  
ATOM 1023  C CG2  . ILE A 1 63  ? 22.844 -11.307 27.602 1.00 42.22 ? 63  ILE A CG2  1  
ATOM 1024  C CD1  . ILE A 1 63  ? 24.162 -14.642 28.340 1.00 74.43 ? 63  ILE A CD1  1  
ATOM 1025  H H    . ILE A 1 63  ? 22.870 -14.960 25.697 1.00 42.24 ? 63  ILE A H    1  
ATOM 1026  H HA   . ILE A 1 63  ? 21.012 -12.836 26.417 1.00 62.51 ? 63  ILE A HA   1  
ATOM 1027  H HB   . ILE A 1 63  ? 24.019 -12.789 26.640 1.00 3.22  ? 63  ILE A HB   1  
ATOM 1028  H HG12 . ILE A 1 63  ? 22.881 -13.190 29.178 1.00 51.22 ? 63  ILE A HG12 1  
ATOM 1029  H HG13 . ILE A 1 63  ? 22.082 -14.345 28.117 1.00 42.03 ? 63  ILE A HG13 1  
ATOM 1030  H HG21 . ILE A 1 63  ? 23.412 -11.168 28.510 1.00 43.22 ? 63  ILE A HG21 1  
ATOM 1031  H HG22 . ILE A 1 63  ? 23.185 -10.606 26.854 1.00 22.43 ? 63  ILE A HG22 1  
ATOM 1032  H HG23 . ILE A 1 63  ? 21.797 -11.138 27.803 1.00 61.32 ? 63  ILE A HG23 1  
ATOM 1033  H HD11 . ILE A 1 63  ? 24.462 -14.738 29.373 1.00 64.55 ? 63  ILE A HD11 1  
ATOM 1034  H HD12 . ILE A 1 63  ? 23.907 -15.615 27.946 1.00 54.51 ? 63  ILE A HD12 1  
ATOM 1035  H HD13 . ILE A 1 63  ? 24.977 -14.225 27.766 1.00 13.50 ? 63  ILE A HD13 1  
ATOM 1036  N N    . VAL A 1 64  ? 21.680 -10.982 24.811 1.00 50.10 ? 64  VAL A N    1  
ATOM 1037  C CA   . VAL A 1 64  ? 21.841 -10.048 23.703 1.00 63.43 ? 64  VAL A CA   1  
ATOM 1038  C C    . VAL A 1 64  ? 22.601 -8.801  24.141 1.00 63.54 ? 64  VAL A C    1  
ATOM 1039  O O    . VAL A 1 64  ? 22.441 -8.326  25.264 1.00 74.22 ? 64  VAL A O    1  
ATOM 1040  C CB   . VAL A 1 64  ? 20.479 -9.628  23.120 1.00 12.34 ? 64  VAL A CB   1  
ATOM 1041  C CG1  . VAL A 1 64  ? 20.667 -8.631  21.987 1.00 61.45 ? 64  VAL A CG1  1  
ATOM 1042  C CG2  . VAL A 1 64  ? 19.703 -10.847 22.646 1.00 21.31 ? 64  VAL A CG2  1  
ATOM 1043  H H    . VAL A 1 64  ? 21.149 -10.713 25.589 1.00 15.30 ? 64  VAL A H    1  
ATOM 1044  H HA   . VAL A 1 64  ? 22.403 -10.546 22.926 1.00 71.34 ? 64  VAL A HA   1  
ATOM 1045  H HB   . VAL A 1 64  ? 19.909 -9.146  23.902 1.00 62.42 ? 64  VAL A HB   1  
ATOM 1046  H HG11 . VAL A 1 64  ? 20.940 -7.669  22.395 1.00 63.42 ? 64  VAL A HG11 1  
ATOM 1047  H HG12 . VAL A 1 64  ? 21.449 -8.979  21.327 1.00 32.42 ? 64  VAL A HG12 1  
ATOM 1048  H HG13 . VAL A 1 64  ? 19.744 -8.538  21.433 1.00 2.42  ? 64  VAL A HG13 1  
ATOM 1049  H HG21 . VAL A 1 64  ? 19.632 -11.563 23.451 1.00 30.24 ? 64  VAL A HG21 1  
ATOM 1050  H HG22 . VAL A 1 64  ? 18.710 -10.548 22.343 1.00 44.45 ? 64  VAL A HG22 1  
ATOM 1051  H HG23 . VAL A 1 64  ? 20.215 -11.297 21.808 1.00 11.33 ? 64  VAL A HG23 1  
ATOM 1052  N N    . GLY A 1 65  ? 23.431 -8.275  23.244 1.00 33.13 ? 65  GLY A N    1  
ATOM 1053  C CA   . GLY A 1 65  ? 24.204 -7.087  23.557 1.00 74.24 ? 65  GLY A CA   1  
ATOM 1054  C C    . GLY A 1 65  ? 23.560 -5.821  23.026 1.00 24.15 ? 65  GLY A C    1  
ATOM 1055  O O    . GLY A 1 65  ? 22.883 -5.105  23.764 1.00 74.40 ? 65  GLY A O    1  
ATOM 1056  H H    . GLY A 1 65  ? 23.518 -8.697  22.364 1.00 64.11 ? 65  GLY A H    1  
ATOM 1057  H HA2  . GLY A 1 65  ? 24.302 -7.007  24.629 1.00 43.22 ? 65  GLY A HA2  1  
ATOM 1058  H HA3  . GLY A 1 65  ? 25.187 -7.187  23.121 1.00 0.11  ? 65  GLY A HA3  1  
ATOM 1059  N N    . ASP A 1 66  ? 23.774 -5.543  21.745 1.00 0.12  ? 66  ASP A N    1  
ATOM 1060  C CA   . ASP A 1 66  ? 23.210 -4.354  21.117 1.00 45.32 ? 66  ASP A CA   1  
ATOM 1061  C C    . ASP A 1 66  ? 22.971 -4.587  19.628 1.00 32.45 ? 66  ASP A C    1  
ATOM 1062  O O    . ASP A 1 66  ? 23.455 -5.564  19.056 1.00 3.12  ? 66  ASP A O    1  
ATOM 1063  C CB   . ASP A 1 66  ? 24.142 -3.157  21.314 1.00 13.43 ? 66  ASP A CB   1  
ATOM 1064  C CG   . ASP A 1 66  ? 23.606 -2.167  22.330 1.00 35.33 ? 66  ASP A CG   1  
ATOM 1065  O OD1  . ASP A 1 66  ? 24.345 -1.831  23.279 1.00 31.32 ? 66  ASP A OD1  1  
ATOM 1066  O OD2  . ASP A 1 66  ? 22.447 -1.728  22.176 1.00 32.51 ? 66  ASP A OD2  1  
ATOM 1067  H H    . ASP A 1 66  ? 24.323 -6.152  21.209 1.00 64.42 ? 66  ASP A H    1  
ATOM 1068  H HA   . ASP A 1 66  ? 22.264 -4.144  21.592 1.00 23.13 ? 66  ASP A HA   1  
ATOM 1069  H HB2  . ASP A 1 66  ? 25.104 -3.510  21.657 1.00 52.44 ? 66  ASP A HB2  1  
ATOM 1070  H HB3  . ASP A 1 66  ? 24.265 -2.645  20.371 1.00 62.41 ? 66  ASP A HB3  1  
ATOM 1071  N N    . LYS A 1 67  ? 22.219 -3.685  19.007 1.00 60.32 ? 67  LYS A N    1  
ATOM 1072  C CA   . LYS A 1 67  ? 21.914 -3.792  17.585 1.00 41.31 ? 67  LYS A CA   1  
ATOM 1073  C C    . LYS A 1 67  ? 23.187 -3.712  16.748 1.00 31.20 ? 67  LYS A C    1  
ATOM 1074  O O    . LYS A 1 67  ? 24.044 -2.860  16.983 1.00 71.14 ? 67  LYS A O    1  
ATOM 1075  C CB   . LYS A 1 67  ? 20.945 -2.684  17.166 1.00 44.43 ? 67  LYS A CB   1  
ATOM 1076  C CG   . LYS A 1 67  ? 20.570 -2.728  15.695 1.00 61.14 ? 67  LYS A CG   1  
ATOM 1077  C CD   . LYS A 1 67  ? 19.188 -3.324  15.490 1.00 74.34 ? 67  LYS A CD   1  
ATOM 1078  C CE   . LYS A 1 67  ? 18.537 -2.799  14.219 1.00 61.52 ? 67  LYS A CE   1  
ATOM 1079  N NZ   . LYS A 1 67  ? 17.974 -1.434  14.407 1.00 35.03 ? 67  LYS A NZ   1  
ATOM 1080  H H    . LYS A 1 67  ? 21.861 -2.928  19.517 1.00 30.20 ? 67  LYS A H    1  
ATOM 1081  H HA   . LYS A 1 67  ? 21.446 -4.750  17.417 1.00 42.23 ? 67  LYS A HA   1  
ATOM 1082  H HB2  . LYS A 1 67  ? 20.041 -2.773  17.749 1.00 1.44  ? 67  LYS A HB2  1  
ATOM 1083  H HB3  . LYS A 1 67  ? 21.403 -1.726  17.370 1.00 34.00 ? 67  LYS A HB3  1  
ATOM 1084  H HG2  . LYS A 1 67  ? 20.579 -1.723  15.299 1.00 21.23 ? 67  LYS A HG2  1  
ATOM 1085  H HG3  . LYS A 1 67  ? 21.294 -3.331  15.166 1.00 65.51 ? 67  LYS A HG3  1  
ATOM 1086  H HD2  . LYS A 1 67  ? 19.275 -4.398  15.419 1.00 72.35 ? 67  LYS A HD2  1  
ATOM 1087  H HD3  . LYS A 1 67  ? 18.565 -3.067  16.335 1.00 22.01 ? 67  LYS A HD3  1  
ATOM 1088  H HE2  . LYS A 1 67  ? 19.280 -2.768  13.436 1.00 33.14 ? 67  LYS A HE2  1  
ATOM 1089  H HE3  . LYS A 1 67  ? 17.742 -3.472  13.933 1.00 14.13 ? 67  LYS A HE3  1  
ATOM 1090  H HZ1  . LYS A 1 67  ? 17.039 -1.368  13.955 1.00 1.02  ? 67  LYS A HZ1  1  
ATOM 1091  H HZ2  . LYS A 1 67  ? 18.603 -0.725  13.980 1.00 24.42 ? 67  LYS A HZ2  1  
ATOM 1092  H HZ3  . LYS A 1 67  ? 17.872 -1.226  15.421 1.00 10.11 ? 67  LYS A HZ3  1  
ATOM 1093  N N    . VAL A 1 68  ? 23.303 -4.605  15.770 1.00 44.21 ? 68  VAL A N    1  
ATOM 1094  C CA   . VAL A 1 68  ? 24.470 -4.634  14.896 1.00 3.23  ? 68  VAL A CA   1  
ATOM 1095  C C    . VAL A 1 68  ? 24.353 -3.593  13.788 1.00 23.33 ? 68  VAL A C    1  
ATOM 1096  O O    . VAL A 1 68  ? 25.156 -2.663  13.710 1.00 52.34 ? 68  VAL A O    1  
ATOM 1097  C CB   . VAL A 1 68  ? 24.662 -6.024  14.262 1.00 61.12 ? 68  VAL A CB   1  
ATOM 1098  C CG1  . VAL A 1 68  ? 25.880 -6.032  13.351 1.00 63.10 ? 68  VAL A CG1  1  
ATOM 1099  C CG2  . VAL A 1 68  ? 24.786 -7.089  15.341 1.00 71.21 ? 68  VAL A CG2  1  
ATOM 1100  H H    . VAL A 1 68  ? 22.587 -5.259  15.632 1.00 31.01 ? 68  VAL A H    1  
ATOM 1101  H HA   . VAL A 1 68  ? 25.342 -4.411  15.495 1.00 35.33 ? 68  VAL A HA   1  
ATOM 1102  H HB   . VAL A 1 68  ? 23.791 -6.248  13.663 1.00 2.53  ? 68  VAL A HB   1  
ATOM 1103  H HG11 . VAL A 1 68  ? 26.052 -7.035  12.989 1.00 72.22 ? 68  VAL A HG11 1  
ATOM 1104  H HG12 . VAL A 1 68  ? 25.709 -5.370  12.515 1.00 62.34 ? 68  VAL A HG12 1  
ATOM 1105  H HG13 . VAL A 1 68  ? 26.745 -5.697  13.904 1.00 24.44 ? 68  VAL A HG13 1  
ATOM 1106  H HG21 . VAL A 1 68  ? 25.802 -7.454  15.370 1.00 33.42 ? 68  VAL A HG21 1  
ATOM 1107  H HG22 . VAL A 1 68  ? 24.529 -6.663  16.300 1.00 42.52 ? 68  VAL A HG22 1  
ATOM 1108  H HG23 . VAL A 1 68  ? 24.115 -7.906  15.120 1.00 63.03 ? 68  VAL A HG23 1  
ATOM 1109  N N    . ILE A 1 69  ? 23.349 -3.757  12.934 1.00 15.04 ? 69  ILE A N    1  
ATOM 1110  C CA   . ILE A 1 69  ? 23.126 -2.831  11.831 1.00 15.43 ? 69  ILE A CA   1  
ATOM 1111  C C    . ILE A 1 69  ? 21.761 -3.058  11.190 1.00 13.52 ? 69  ILE A C    1  
ATOM 1112  O O    . ILE A 1 69  ? 21.178 -4.136  11.308 1.00 31.01 ? 69  ILE A O    1  
ATOM 1113  C CB   . ILE A 1 69  ? 24.216 -2.967  10.752 1.00 0.04  ? 69  ILE A CB   1  
ATOM 1114  C CG1  . ILE A 1 69  ? 24.204 -1.749  9.827  1.00 54.32 ? 69  ILE A CG1  1  
ATOM 1115  C CG2  . ILE A 1 69  ? 24.015 -4.247  9.955  1.00 50.11 ? 69  ILE A CG2  1  
ATOM 1116  C CD1  . ILE A 1 69  ? 25.564 -1.406  9.261  1.00 52.13 ? 69  ILE A CD1  1  
ATOM 1117  H H    . ILE A 1 69  ? 22.743 -4.518  13.049 1.00 34.13 ? 69  ILE A H    1  
ATOM 1118  H HA   . ILE A 1 69  ? 23.163 -1.826  12.228 1.00 52.05 ? 69  ILE A HA   1  
ATOM 1119  H HB   . ILE A 1 69  ? 25.174 -3.026  11.246 1.00 40.51 ? 69  ILE A HB   1  
ATOM 1120  H HG12 . ILE A 1 69  ? 23.539 -1.940  8.999  1.00 2.11  ? 69  ILE A HG12 1  
ATOM 1121  H HG13 . ILE A 1 69  ? 23.847 -0.891  10.378 1.00 1.35  ? 69  ILE A HG13 1  
ATOM 1122  H HG21 . ILE A 1 69  ? 23.263 -4.084  9.197  1.00 61.22 ? 69  ILE A HG21 1  
ATOM 1123  H HG22 . ILE A 1 69  ? 24.945 -4.527  9.484  1.00 42.33 ? 69  ILE A HG22 1  
ATOM 1124  H HG23 . ILE A 1 69  ? 23.694 -5.037  10.617 1.00 70.13 ? 69  ILE A HG23 1  
ATOM 1125  H HD11 . ILE A 1 69  ? 26.310 -1.498  10.036 1.00 44.32 ? 69  ILE A HD11 1  
ATOM 1126  H HD12 . ILE A 1 69  ? 25.798 -2.081  8.452  1.00 63.12 ? 69  ILE A HD12 1  
ATOM 1127  H HD13 . ILE A 1 69  ? 25.554 -0.391  8.890  1.00 0.35  ? 69  ILE A HD13 1  
ATOM 1128  N N    . THR A 1 70  ? 21.255 -2.034  10.509 1.00 43.12 ? 70  THR A N    1  
ATOM 1129  C CA   . THR A 1 70  ? 19.959 -2.121  9.848  1.00 64.12 ? 70  THR A CA   1  
ATOM 1130  C C    . THR A 1 70  ? 20.115 -2.121  8.331  1.00 34.13 ? 70  THR A C    1  
ATOM 1131  O O    . THR A 1 70  ? 20.674 -1.188  7.753  1.00 22.55 ? 70  THR A O    1  
ATOM 1132  C CB   . THR A 1 70  ? 19.040 -0.956  10.258 1.00 12.43 ? 70  THR A CB   1  
ATOM 1133  O OG1  . THR A 1 70  ? 18.862 -0.949  11.679 1.00 11.12 ? 70  THR A OG1  1  
ATOM 1134  C CG2  . THR A 1 70  ? 17.686 -1.067  9.573  1.00 21.12 ? 70  THR A CG2  1  
ATOM 1135  H H    . THR A 1 70  ? 21.767 -1.200  10.451 1.00 63.42 ? 70  THR A H    1  
ATOM 1136  H HA   . THR A 1 70  ? 19.491 -3.046  10.152 1.00 2.02  ? 70  THR A HA   1  
ATOM 1137  H HB   . THR A 1 70  ? 19.504 -0.027  9.957  1.00 70.42 ? 70  THR A HB   1  
ATOM 1138  H HG1  . THR A 1 70  ? 18.312 -0.202  11.930 1.00 61.55 ? 70  THR A HG1  1  
ATOM 1139  H HG21 . THR A 1 70  ? 17.395 -2.106  9.518  1.00 41.42 ? 70  THR A HG21 1  
ATOM 1140  H HG22 . THR A 1 70  ? 17.753 -0.658  8.576  1.00 14.22 ? 70  THR A HG22 1  
ATOM 1141  H HG23 . THR A 1 70  ? 16.950 -0.517  10.140 1.00 61.20 ? 70  THR A HG23 1  
ATOM 1142  N N    . THR A 1 71  ? 19.615 -3.173  7.690  1.00 50.12 ? 71  THR A N    1  
ATOM 1143  C CA   . THR A 1 71  ? 19.699 -3.294  6.240  1.00 74.42 ? 71  THR A CA   1  
ATOM 1144  C C    . THR A 1 71  ? 18.322 -3.525  5.627  1.00 11.31 ? 71  THR A C    1  
ATOM 1145  O O    . THR A 1 71  ? 17.511 -4.277  6.166  1.00 0.34  ? 71  THR A O    1  
ATOM 1146  C CB   . THR A 1 71  ? 20.632 -4.448  5.826  1.00 51.44 ? 71  THR A CB   1  
ATOM 1147  O OG1  . THR A 1 71  ? 21.553 -4.736  6.883  1.00 20.42 ? 71  THR A OG1  1  
ATOM 1148  C CG2  . THR A 1 71  ? 21.399 -4.095  4.560  1.00 1.02  ? 71  THR A CG2  1  
ATOM 1149  H H    . THR A 1 71  ? 19.181 -3.884  8.206  1.00 53.14 ? 71  THR A H    1  
ATOM 1150  H HA   . THR A 1 71  ? 20.106 -2.372  5.851  1.00 74.32 ? 71  THR A HA   1  
ATOM 1151  H HB   . THR A 1 71  ? 20.031 -5.325  5.632  1.00 41.20 ? 71  THR A HB   1  
ATOM 1152  H HG1  . THR A 1 71  ? 21.217 -5.465  7.411  1.00 55.12 ? 71  THR A HG1  1  
ATOM 1153  H HG21 . THR A 1 71  ? 21.054 -4.714  3.745  1.00 30.25 ? 71  THR A HG21 1  
ATOM 1154  H HG22 . THR A 1 71  ? 22.454 -4.264  4.720  1.00 74.22 ? 71  THR A HG22 1  
ATOM 1155  H HG23 . THR A 1 71  ? 21.234 -3.056  4.317  1.00 33.23 ? 71  THR A HG23 1  
ATOM 1156  N N    . GLU A 1 72  ? 18.066 -2.873  4.497  1.00 34.01 ? 72  GLU A N    1  
ATOM 1157  C CA   . GLU A 1 72  ? 16.786 -3.008  3.812  1.00 74.12 ? 72  GLU A CA   1  
ATOM 1158  C C    . GLU A 1 72  ? 16.982 -3.077  2.300  1.00 4.41  ? 72  GLU A C    1  
ATOM 1159  O O    . GLU A 1 72  ? 17.899 -2.463  1.754  1.00 44.44 ? 72  GLU A O    1  
ATOM 1160  C CB   . GLU A 1 72  ? 15.867 -1.837  4.165  1.00 52.41 ? 72  GLU A CB   1  
ATOM 1161  C CG   . GLU A 1 72  ? 15.656 -1.657  5.659  1.00 74.51 ? 72  GLU A CG   1  
ATOM 1162  C CD   . GLU A 1 72  ? 15.108 -0.288  6.011  1.00 42.24 ? 72  GLU A CD   1  
ATOM 1163  O OE1  . GLU A 1 72  ? 14.329 0.264   5.205  1.00 21.32 ? 72  GLU A OE1  1  
ATOM 1164  O OE2  . GLU A 1 72  ? 15.459 0.232   7.090  1.00 14.52 ? 72  GLU A OE2  1  
ATOM 1165  H H    . GLU A 1 72  ? 18.753 -2.288  4.116  1.00 52.31 ? 72  GLU A H    1  
ATOM 1166  H HA   . GLU A 1 72  ? 16.326 -3.926  4.145  1.00 64.52 ? 72  GLU A HA   1  
ATOM 1167  H HB2  . GLU A 1 72  ? 16.295 -0.927  3.771  1.00 44.13 ? 72  GLU A HB2  1  
ATOM 1168  H HB3  . GLU A 1 72  ? 14.904 -1.999  3.704  1.00 53.03 ? 72  GLU A HB3  1  
ATOM 1169  H HG2  . GLU A 1 72  ? 14.958 -2.406  6.003  1.00 20.13 ? 72  GLU A HG2  1  
ATOM 1170  H HG3  . GLU A 1 72  ? 16.602 -1.791  6.162  1.00 42.32 ? 72  GLU A HG3  1  
ATOM 1171  N N    . HIS A 1 73  ? 16.115 -3.829  1.630  1.00 41.32 ? 73  HIS A N    1  
ATOM 1172  C CA   . HIS A 1 73  ? 16.193 -3.978  0.181  1.00 72.30 ? 73  HIS A CA   1  
ATOM 1173  C C    . HIS A 1 73  ? 14.800 -3.975  -0.441 1.00 54.00 ? 73  HIS A C    1  
ATOM 1174  O O    . HIS A 1 73  ? 13.822 -4.353  0.203  1.00 31.32 ? 73  HIS A O    1  
ATOM 1175  C CB   . HIS A 1 73  ? 16.922 -5.272  -0.181 1.00 25.31 ? 73  HIS A CB   1  
ATOM 1176  C CG   . HIS A 1 73  ? 18.328 -5.332  0.334  1.00 53.52 ? 73  HIS A CG   1  
ATOM 1177  N ND1  . HIS A 1 73  ? 19.434 -5.244  -0.485 1.00 75.13 ? 73  HIS A ND1  1  
ATOM 1178  C CD2  . HIS A 1 73  ? 18.804 -5.469  1.593  1.00 2.43  ? 73  HIS A CD2  1  
ATOM 1179  C CE1  . HIS A 1 73  ? 20.529 -5.327  0.248  1.00 44.42 ? 73  HIS A CE1  1  
ATOM 1180  N NE2  . HIS A 1 73  ? 20.175 -5.463  1.513  1.00 41.21 ? 73  HIS A NE2  1  
ATOM 1181  H H    . HIS A 1 73  ? 15.406 -4.293  2.121  1.00 22.51 ? 73  HIS A H    1  
ATOM 1182  H HA   . HIS A 1 73  ? 16.750 -3.140  -0.210 1.00 34.15 ? 73  HIS A HA   1  
ATOM 1183  H HB2  . HIS A 1 73  ? 16.382 -6.110  0.234  1.00 62.51 ? 73  HIS A HB2  1  
ATOM 1184  H HB3  . HIS A 1 73  ? 16.958 -5.370  -1.257 1.00 13.55 ? 73  HIS A HB3  1  
ATOM 1185  H HD1  . HIS A 1 73  ? 19.417 -5.139  -1.459 1.00 44.01 ? 73  HIS A HD1  1  
ATOM 1186  H HD2  . HIS A 1 73  ? 18.216 -5.565  2.495  1.00 31.21 ? 73  HIS A HD2  1  
ATOM 1187  H HE1  . HIS A 1 73  ? 21.543 -5.289  -0.123 1.00 53.41 ? 73  HIS A HE1  1  
ATOM 1188  N N    . GLU A 1 74  ? 14.718 -3.545  -1.696 1.00 41.42 ? 74  GLU A N    1  
ATOM 1189  C CA   . GLU A 1 74  ? 13.444 -3.491  -2.403 1.00 50.13 ? 74  GLU A CA   1  
ATOM 1190  C C    . GLU A 1 74  ? 13.112 -4.842  -3.029 1.00 73.51 ? 74  GLU A C    1  
ATOM 1191  O O    . GLU A 1 74  ? 13.835 -5.331  -3.897 1.00 71.44 ? 74  GLU A O    1  
ATOM 1192  C CB   . GLU A 1 74  ? 13.482 -2.411  -3.486 1.00 55.43 ? 74  GLU A CB   1  
ATOM 1193  C CG   . GLU A 1 74  ? 12.144 -2.190  -4.172 1.00 51.24 ? 74  GLU A CG   1  
ATOM 1194  C CD   . GLU A 1 74  ? 11.078 -1.678  -3.222 1.00 64.25 ? 74  GLU A CD   1  
ATOM 1195  O OE1  . GLU A 1 74  ? 11.417 -0.871  -2.332 1.00 11.14 ? 74  GLU A OE1  1  
ATOM 1196  O OE2  . GLU A 1 74  ? 9.907  -2.085  -3.369 1.00 40.34 ? 74  GLU A OE2  1  
ATOM 1197  H H    . GLU A 1 74  ? 15.533 -3.256  -2.157 1.00 24.11 ? 74  GLU A H    1  
ATOM 1198  H HA   . GLU A 1 74  ? 12.677 -3.242  -1.686 1.00 12.30 ? 74  GLU A HA   1  
ATOM 1199  H HB2  . GLU A 1 74  ? 13.791 -1.478  -3.037 1.00 62.44 ? 74  GLU A HB2  1  
ATOM 1200  H HB3  . GLU A 1 74  ? 14.204 -2.696  -4.237 1.00 2.44  ? 74  GLU A HB3  1  
ATOM 1201  H HG2  . GLU A 1 74  ? 12.275 -1.468  -4.964 1.00 52.33 ? 74  GLU A HG2  1  
ATOM 1202  H HG3  . GLU A 1 74  ? 11.810 -3.127  -4.593 1.00 24.10 ? 74  GLU A HG3  1  
ATOM 1203  N N    . TYR A 1 75  ? 12.013 -5.441  -2.581 1.00 45.25 ? 75  TYR A N    1  
ATOM 1204  C CA   . TYR A 1 75  ? 11.586 -6.737  -3.095 1.00 21.05 ? 75  TYR A CA   1  
ATOM 1205  C C    . TYR A 1 75  ? 10.259 -6.618  -3.838 1.00 63.11 ? 75  TYR A C    1  
ATOM 1206  O O    . TYR A 1 75  ? 9.523  -5.646  -3.666 1.00 21.52 ? 75  TYR A O    1  
ATOM 1207  C CB   . TYR A 1 75  ? 11.454 -7.743  -1.950 1.00 71.53 ? 75  TYR A CB   1  
ATOM 1208  C CG   . TYR A 1 75  ? 12.676 -8.615  -1.766 1.00 74.12 ? 75  TYR A CG   1  
ATOM 1209  C CD1  . TYR A 1 75  ? 12.568 -9.892  -1.230 1.00 30.22 ? 75  TYR A CD1  1  
ATOM 1210  C CD2  . TYR A 1 75  ? 13.938 -8.162  -2.130 1.00 13.41 ? 75  TYR A CD2  1  
ATOM 1211  C CE1  . TYR A 1 75  ? 13.682 -10.691 -1.059 1.00 74.43 ? 75  TYR A CE1  1  
ATOM 1212  C CE2  . TYR A 1 75  ? 15.057 -8.955  -1.964 1.00 52.53 ? 75  TYR A CE2  1  
ATOM 1213  C CZ   . TYR A 1 75  ? 14.924 -10.218 -1.428 1.00 73.42 ? 75  TYR A CZ   1  
ATOM 1214  O OH   . TYR A 1 75  ? 16.035 -11.012 -1.261 1.00 63.12 ? 75  TYR A OH   1  
ATOM 1215  H H    . TYR A 1 75  ? 11.478 -5.001  -1.888 1.00 70.44 ? 75  TYR A H    1  
ATOM 1216  H HA   . TYR A 1 75  ? 12.342 -7.087  -3.783 1.00 14.21 ? 75  TYR A HA   1  
ATOM 1217  H HB2  . TYR A 1 75  ? 11.286 -7.209  -1.028 1.00 24.43 ? 75  TYR A HB2  1  
ATOM 1218  H HB3  . TYR A 1 75  ? 10.611 -8.390  -2.145 1.00 33.25 ? 75  TYR A HB3  1  
ATOM 1219  H HD1  . TYR A 1 75  ? 11.593 -10.260 -0.942 1.00 44.23 ? 75  TYR A HD1  1  
ATOM 1220  H HD2  . TYR A 1 75  ? 14.039 -7.171  -2.550 1.00 32.14 ? 75  TYR A HD2  1  
ATOM 1221  H HE1  . TYR A 1 75  ? 13.578 -11.681 -0.640 1.00 34.31 ? 75  TYR A HE1  1  
ATOM 1222  H HE2  . TYR A 1 75  ? 16.030 -8.585  -2.253 1.00 14.52 ? 75  TYR A HE2  1  
ATOM 1223  H HH   . TYR A 1 75  ? 16.280 -11.400 -2.104 1.00 65.53 ? 75  TYR A HH   1  
ATOM 1224  N N    . ASP A 1 76  ? 9.961  -7.614  -4.665 1.00 30.10 ? 76  ASP A N    1  
ATOM 1225  C CA   . ASP A 1 76  ? 8.722  -7.624  -5.435 1.00 3.14  ? 76  ASP A CA   1  
ATOM 1226  C C    . ASP A 1 76  ? 7.515  -7.798  -4.519 1.00 12.33 ? 76  ASP A C    1  
ATOM 1227  O O    . ASP A 1 76  ? 6.444  -7.247  -4.775 1.00 73.52 ? 76  ASP A O    1  
ATOM 1228  C CB   . ASP A 1 76  ? 8.753  -8.743  -6.477 1.00 21.25 ? 76  ASP A CB   1  
ATOM 1229  C CG   . ASP A 1 76  ? 9.438  -8.320  -7.761 1.00 1.20  ? 76  ASP A CG   1  
ATOM 1230  O OD1  . ASP A 1 76  ? 10.422 -7.554  -7.684 1.00 33.50 ? 76  ASP A OD1  1  
ATOM 1231  O OD2  . ASP A 1 76  ? 8.990  -8.753  -8.843 1.00 61.04 ? 76  ASP A OD2  1  
ATOM 1232  H H    . ASP A 1 76  ? 10.589 -8.361  -4.759 1.00 74.24 ? 76  ASP A H    1  
ATOM 1233  H HA   . ASP A 1 76  ? 8.640  -6.675  -5.942 1.00 14.30 ? 76  ASP A HA   1  
ATOM 1234  H HB2  . ASP A 1 76  ? 9.285  -9.591  -6.069 1.00 43.34 ? 76  ASP A HB2  1  
ATOM 1235  H HB3  . ASP A 1 76  ? 7.740  -9.037  -6.709 1.00 63.24 ? 76  ASP A HB3  1  
ATOM 1236  N N    . PHE A 1 77  ? 7.695  -8.567  -3.450 1.00 72.23 ? 77  PHE A N    1  
ATOM 1237  C CA   . PHE A 1 77  ? 6.620  -8.815  -2.497 1.00 74.51 ? 77  PHE A CA   1  
ATOM 1238  C C    . PHE A 1 77  ? 6.788  -7.952  -1.250 1.00 60.22 ? 77  PHE A C    1  
ATOM 1239  O O    . PHE A 1 77  ? 6.451  -8.369  -0.143 1.00 23.31 ? 77  PHE A O    1  
ATOM 1240  C CB   . PHE A 1 77  ? 6.587  -10.295 -2.107 1.00 1.55  ? 77  PHE A CB   1  
ATOM 1241  C CG   . PHE A 1 77  ? 6.374  -11.218 -3.272 1.00 13.30 ? 77  PHE A CG   1  
ATOM 1242  C CD1  . PHE A 1 77  ? 7.298  -12.206 -3.568 1.00 62.21 ? 77  PHE A CD1  1  
ATOM 1243  C CD2  . PHE A 1 77  ? 5.249  -11.097 -4.072 1.00 14.53 ? 77  PHE A CD2  1  
ATOM 1244  C CE1  . PHE A 1 77  ? 7.105  -13.058 -4.640 1.00 13.34 ? 77  PHE A CE1  1  
ATOM 1245  C CE2  . PHE A 1 77  ? 5.050  -11.945 -5.144 1.00 74.21 ? 77  PHE A CE2  1  
ATOM 1246  C CZ   . PHE A 1 77  ? 5.979  -12.926 -5.429 1.00 63.22 ? 77  PHE A CZ   1  
ATOM 1247  H H    . PHE A 1 77  ? 8.572  -8.978  -3.300 1.00 20.42 ? 77  PHE A H    1  
ATOM 1248  H HA   . PHE A 1 77  ? 5.687  -8.558  -2.976 1.00 5.34  ? 77  PHE A HA   1  
ATOM 1249  H HB2  . PHE A 1 77  ? 7.526  -10.558 -1.643 1.00 52.11 ? 77  PHE A HB2  1  
ATOM 1250  H HB3  . PHE A 1 77  ? 5.785  -10.456 -1.402 1.00 52.35 ? 77  PHE A HB3  1  
ATOM 1251  H HD1  . PHE A 1 77  ? 8.180  -12.310 -2.951 1.00 14.32 ? 77  PHE A HD1  1  
ATOM 1252  H HD2  . PHE A 1 77  ? 4.521  -10.329 -3.851 1.00 22.32 ? 77  PHE A HD2  1  
ATOM 1253  H HE1  . PHE A 1 77  ? 7.834  -13.823 -4.859 1.00 72.45 ? 77  PHE A HE1  1  
ATOM 1254  H HE2  . PHE A 1 77  ? 4.169  -11.840 -5.760 1.00 70.22 ? 77  PHE A HE2  1  
ATOM 1255  H HZ   . PHE A 1 77  ? 5.826  -13.591 -6.266 1.00 52.33 ? 77  PHE A HZ   1  
ATOM 1256  N N    . GLY A 1 78  ? 7.313  -6.745  -1.440 1.00 31.24 ? 78  GLY A N    1  
ATOM 1257  C CA   . GLY A 1 78  ? 7.518  -5.842  -0.322 1.00 41.14 ? 78  GLY A CA   1  
ATOM 1258  C C    . GLY A 1 78  ? 8.978  -5.486  -0.125 1.00 24.51 ? 78  GLY A C    1  
ATOM 1259  O O    . GLY A 1 78  ? 9.765  -5.519  -1.072 1.00 3.35  ? 78  GLY A O    1  
ATOM 1260  H H    . GLY A 1 78  ? 7.563  -6.466  -2.345 1.00 71.03 ? 78  GLY A H    1  
ATOM 1261  H HA2  . GLY A 1 78  ? 6.958  -4.936  -0.499 1.00 3.31  ? 78  GLY A HA2  1  
ATOM 1262  H HA3  . GLY A 1 78  ? 7.149  -6.312  0.578  1.00 42.53 ? 78  GLY A HA3  1  
ATOM 1263  N N    . ILE A 1 79  ? 9.341  -5.145  1.107  1.00 61.11 ? 79  ILE A N    1  
ATOM 1264  C CA   . ILE A 1 79  ? 10.716 -4.782  1.425  1.00 45.55 ? 79  ILE A CA   1  
ATOM 1265  C C    . ILE A 1 79  ? 11.293 -5.697  2.499  1.00 12.25 ? 79  ILE A C    1  
ATOM 1266  O O    . ILE A 1 79  ? 10.707 -5.861  3.570  1.00 42.31 ? 79  ILE A O    1  
ATOM 1267  C CB   . ILE A 1 79  ? 10.817 -3.321  1.902  1.00 14.22 ? 79  ILE A CB   1  
ATOM 1268  C CG1  . ILE A 1 79  ? 10.929 -2.376  0.704  1.00 54.01 ? 79  ILE A CG1  1  
ATOM 1269  C CG2  . ILE A 1 79  ? 12.008 -3.148  2.833  1.00 72.43 ? 79  ILE A CG2  1  
ATOM 1270  C CD1  . ILE A 1 79  ? 9.785  -2.506  -0.277 1.00 72.54 ? 79  ILE A CD1  1  
ATOM 1271  H H    . ILE A 1 79  ? 8.668  -5.138  1.819  1.00 63.41 ? 79  ILE A H    1  
ATOM 1272  H HA   . ILE A 1 79  ? 11.305 -4.886  0.524  1.00 31.13 ? 79  ILE A HA   1  
ATOM 1273  H HB   . ILE A 1 79  ? 9.921  -3.084  2.456  1.00 71.23 ? 79  ILE A HB   1  
ATOM 1274  H HG12 . ILE A 1 79  ? 10.947 -1.357  1.057  1.00 21.11 ? 79  ILE A HG12 1  
ATOM 1275  H HG13 . ILE A 1 79  ? 11.847 -2.586  0.174  1.00 12.24 ? 79  ILE A HG13 1  
ATOM 1276  H HG21 . ILE A 1 79  ? 12.877 -3.618  2.396  1.00 34.50 ? 79  ILE A HG21 1  
ATOM 1277  H HG22 . ILE A 1 79  ? 12.203 -2.096  2.976  1.00 71.22 ? 79  ILE A HG22 1  
ATOM 1278  H HG23 . ILE A 1 79  ? 11.791 -3.608  3.785  1.00 15.42 ? 79  ILE A HG23 1  
ATOM 1279  H HD11 . ILE A 1 79  ? 8.897  -2.830  0.245  1.00 32.21 ? 79  ILE A HD11 1  
ATOM 1280  H HD12 . ILE A 1 79  ? 9.600  -1.551  -0.745 1.00 65.43 ? 79  ILE A HD12 1  
ATOM 1281  H HD13 . ILE A 1 79  ? 10.041 -3.234  -1.034 1.00 62.21 ? 79  ILE A HD13 1  
ATOM 1282  N N    . VAL A 1 80  ? 12.446 -6.290  2.208  1.00 72.43 ? 80  VAL A N    1  
ATOM 1283  C CA   . VAL A 1 80  ? 13.104 -7.187  3.150  1.00 30.22 ? 80  VAL A CA   1  
ATOM 1284  C C    . VAL A 1 80  ? 14.106 -6.434  4.018  1.00 54.40 ? 80  VAL A C    1  
ATOM 1285  O O    . VAL A 1 80  ? 15.095 -5.897  3.519  1.00 54.04 ? 80  VAL A O    1  
ATOM 1286  C CB   . VAL A 1 80  ? 13.832 -8.332  2.421  1.00 43.32 ? 80  VAL A CB   1  
ATOM 1287  C CG1  . VAL A 1 80  ? 14.792 -7.776  1.380  1.00 64.20 ? 80  VAL A CG1  1  
ATOM 1288  C CG2  . VAL A 1 80  ? 14.567 -9.216  3.417  1.00 35.03 ? 80  VAL A CG2  1  
ATOM 1289  H H    . VAL A 1 80  ? 12.864 -6.120  1.338  1.00 62.40 ? 80  VAL A H    1  
ATOM 1290  H HA   . VAL A 1 80  ? 12.345 -7.619  3.786  1.00 73.21 ? 80  VAL A HA   1  
ATOM 1291  H HB   . VAL A 1 80  ? 13.094 -8.934  1.912  1.00 24.50 ? 80  VAL A HB   1  
ATOM 1292  H HG11 . VAL A 1 80  ? 15.795 -8.111  1.601  1.00 4.00  ? 80  VAL A HG11 1  
ATOM 1293  H HG12 . VAL A 1 80  ? 14.503 -8.125  0.400  1.00 73.53 ? 80  VAL A HG12 1  
ATOM 1294  H HG13 . VAL A 1 80  ? 14.761 -6.697  1.402  1.00 42.23 ? 80  VAL A HG13 1  
ATOM 1295  H HG21 . VAL A 1 80  ? 13.913 -9.443  4.246  1.00 14.10 ? 80  VAL A HG21 1  
ATOM 1296  H HG22 . VAL A 1 80  ? 14.865 -10.134 2.933  1.00 60.53 ? 80  VAL A HG22 1  
ATOM 1297  H HG23 . VAL A 1 80  ? 15.443 -8.700  3.780  1.00 13.21 ? 80  VAL A HG23 1  
ATOM 1298  N N    . ARG A 1 81  ? 13.843 -6.398  5.320  1.00 13.12 ? 81  ARG A N    1  
ATOM 1299  C CA   . ARG A 1 81  ? 14.721 -5.709  6.258  1.00 31.33 ? 81  ARG A CA   1  
ATOM 1300  C C    . ARG A 1 81  ? 15.453 -6.707  7.150  1.00 23.43 ? 81  ARG A C    1  
ATOM 1301  O O    . ARG A 1 81  ? 14.879 -7.250  8.095  1.00 11.03 ? 81  ARG A O    1  
ATOM 1302  C CB   . ARG A 1 81  ? 13.917 -4.733  7.120  1.00 64.24 ? 81  ARG A CB   1  
ATOM 1303  C CG   . ARG A 1 81  ? 12.885 -3.938  6.337  1.00 3.21  ? 81  ARG A CG   1  
ATOM 1304  C CD   . ARG A 1 81  ? 12.269 -2.837  7.187  1.00 71.44 ? 81  ARG A CD   1  
ATOM 1305  N NE   . ARG A 1 81  ? 11.605 -1.824  6.372  1.00 50.45 ? 81  ARG A NE   1  
ATOM 1306  C CZ   . ARG A 1 81  ? 11.301 -0.608  6.814  1.00 63.44 ? 81  ARG A CZ   1  
ATOM 1307  N NH1  . ARG A 1 81  ? 11.601 -0.257  8.057  1.00 71.44 ? 81  ARG A NH1  1  
ATOM 1308  N NH2  . ARG A 1 81  ? 10.697 0.259   6.012  1.00 60.15 ? 81  ARG A NH2  1  
ATOM 1309  H H    . ARG A 1 81  ? 13.039 -6.845  5.658  1.00 15.44 ? 81  ARG A H    1  
ATOM 1310  H HA   . ARG A 1 81  ? 15.449 -5.155  5.685  1.00 11.25 ? 81  ARG A HA   1  
ATOM 1311  H HB2  . ARG A 1 81  ? 13.403 -5.290  7.889  1.00 14.31 ? 81  ARG A HB2  1  
ATOM 1312  H HB3  . ARG A 1 81  ? 14.599 -4.038  7.585  1.00 42.51 ? 81  ARG A HB3  1  
ATOM 1313  H HG2  . ARG A 1 81  ? 13.365 -3.489  5.480  1.00 73.15 ? 81  ARG A HG2  1  
ATOM 1314  H HG3  . ARG A 1 81  ? 12.104 -4.606  6.007  1.00 63.31 ? 81  ARG A HG3  1  
ATOM 1315  H HD2  . ARG A 1 81  ? 11.545 -3.279  7.854  1.00 33.44 ? 81  ARG A HD2  1  
ATOM 1316  H HD3  . ARG A 1 81  ? 13.050 -2.367  7.764  1.00 5.22  ? 81  ARG A HD3  1  
ATOM 1317  H HE   . ARG A 1 81  ? 11.375 -2.062  5.450  1.00 55.12 ? 81  ARG A HE   1  
ATOM 1318  H HH11 . ARG A 1 81  ? 12.057 -0.908  8.663  1.00 62.52 ? 81  ARG A HH11 1  
ATOM 1319  H HH12 . ARG A 1 81  ? 11.372 0.659   8.387  1.00 62.24 ? 81  ARG A HH12 1  
ATOM 1320  H HH21 . ARG A 1 81  ? 10.470 -0.002  5.074  1.00 72.02 ? 81  ARG A HH21 1  
ATOM 1321  H HH22 . ARG A 1 81  ? 10.469 1.173   6.345  1.00 32.01 ? 81  ARG A HH22 1  
ATOM 1322  N N    . LEU A 1 82  ? 16.724 -6.946  6.844  1.00 53.43 ? 82  LEU A N    1  
ATOM 1323  C CA   . LEU A 1 82  ? 17.535 -7.879  7.617  1.00 24.01 ? 82  LEU A CA   1  
ATOM 1324  C C    . LEU A 1 82  ? 18.349 -7.144  8.678  1.00 72.13 ? 82  LEU A C    1  
ATOM 1325  O O    . LEU A 1 82  ? 19.065 -6.189  8.376  1.00 53.52 ? 82  LEU A O    1  
ATOM 1326  C CB   . LEU A 1 82  ? 18.470 -8.660  6.692  1.00 70.50 ? 82  LEU A CB   1  
ATOM 1327  C CG   . LEU A 1 82  ? 18.795 -10.092 7.120  1.00 42.01 ? 82  LEU A CG   1  
ATOM 1328  C CD1  . LEU A 1 82  ? 19.289 -10.120 8.558  1.00 33.12 ? 82  LEU A CD1  1  
ATOM 1329  C CD2  . LEU A 1 82  ? 17.576 -10.988 6.955  1.00 44.03 ? 82  LEU A CD2  1  
ATOM 1330  H H    . LEU A 1 82  ? 17.126 -6.483  6.080  1.00 64.43 ? 82  LEU A H    1  
ATOM 1331  H HA   . LEU A 1 82  ? 16.867 -8.571  8.108  1.00 3.33  ? 82  LEU A HA   1  
ATOM 1332  H HB2  . LEU A 1 82  ? 18.010 -8.704  5.717  1.00 52.41 ? 82  LEU A HB2  1  
ATOM 1333  H HB3  . LEU A 1 82  ? 19.400 -8.114  6.625  1.00 24.43 ? 82  LEU A HB3  1  
ATOM 1334  H HG   . LEU A 1 82  ? 19.584 -10.479 6.489  1.00 31.15 ? 82  LEU A HG   1  
ATOM 1335  H HD11 . LEU A 1 82  ? 19.772 -11.065 8.754  1.00 21.04 ? 82  LEU A HD11 1  
ATOM 1336  H HD12 . LEU A 1 82  ? 18.451 -9.998  9.229  1.00 72.15 ? 82  LEU A HD12 1  
ATOM 1337  H HD13 . LEU A 1 82  ? 19.993 -9.316  8.713  1.00 51.42 ? 82  LEU A HD13 1  
ATOM 1338  H HD21 . LEU A 1 82  ? 17.076 -11.093 7.906  1.00 54.51 ? 82  LEU A HD21 1  
ATOM 1339  H HD22 . LEU A 1 82  ? 17.890 -11.961 6.604  1.00 13.22 ? 82  LEU A HD22 1  
ATOM 1340  H HD23 . LEU A 1 82  ? 16.900 -10.547 6.238  1.00 40.12 ? 82  LEU A HD23 1  
ATOM 1341  N N    . THR A 1 83  ? 18.236 -7.597  9.922  1.00 32.44 ? 83  THR A N    1  
ATOM 1342  C CA   . THR A 1 83  ? 18.961 -6.984  11.028 1.00 70.31 ? 83  THR A CA   1  
ATOM 1343  C C    . THR A 1 83  ? 19.618 -8.041  11.908 1.00 35.43 ? 83  THR A C    1  
ATOM 1344  O O    . THR A 1 83  ? 19.043 -9.102  12.158 1.00 51.34 ? 83  THR A O    1  
ATOM 1345  C CB   . THR A 1 83  ? 18.032 -6.115  11.896 1.00 52.43 ? 83  THR A CB   1  
ATOM 1346  O OG1  . THR A 1 83  ? 18.808 -5.317  12.797 1.00 52.35 ? 83  THR A OG1  1  
ATOM 1347  C CG2  . THR A 1 83  ? 17.061 -6.980  12.685 1.00 61.44 ? 83  THR A CG2  1  
ATOM 1348  H H    . THR A 1 83  ? 17.650 -8.362  10.100 1.00 75.31 ? 83  THR A H    1  
ATOM 1349  H HA   . THR A 1 83  ? 19.729 -6.349  10.611 1.00 10.23 ? 83  THR A HA   1  
ATOM 1350  H HB   . THR A 1 83  ? 17.464 -5.463  11.247 1.00 43.21 ? 83  THR A HB   1  
ATOM 1351  H HG1  . THR A 1 83  ? 19.525 -4.897  12.316 1.00 40.45 ? 83  THR A HG1  1  
ATOM 1352  H HG21 . THR A 1 83  ? 16.233 -6.376  13.023 1.00 13.11 ? 83  THR A HG21 1  
ATOM 1353  H HG22 . THR A 1 83  ? 17.569 -7.405  13.537 1.00 23.43 ? 83  THR A HG22 1  
ATOM 1354  H HG23 . THR A 1 83  ? 16.692 -7.774  12.053 1.00 63.23 ? 83  THR A HG23 1  
ATOM 1355  N N    . THR A 1 84  ? 20.826 -7.746  12.379 1.00 74.34 ? 84  THR A N    1  
ATOM 1356  C CA   . THR A 1 84  ? 21.561 -8.672  13.231 1.00 13.34 ? 84  THR A CA   1  
ATOM 1357  C C    . THR A 1 84  ? 21.674 -8.136  14.654 1.00 21.42 ? 84  THR A C    1  
ATOM 1358  O O    . THR A 1 84  ? 21.659 -6.925  14.875 1.00 22.22 ? 84  THR A O    1  
ATOM 1359  C CB   . THR A 1 84  ? 22.975 -8.940  12.682 1.00 55.23 ? 84  THR A CB   1  
ATOM 1360  O OG1  . THR A 1 84  ? 23.458 -7.784  11.988 1.00 11.13 ? 84  THR A OG1  1  
ATOM 1361  C CG2  . THR A 1 84  ? 22.972 -10.137 11.743 1.00 41.43 ? 84  THR A CG2  1  
ATOM 1362  H H    . THR A 1 84  ? 21.231 -6.885  12.145 1.00 61.42 ? 84  THR A H    1  
ATOM 1363  H HA   . THR A 1 84  ? 21.021 -9.608  13.251 1.00 43.41 ? 84  THR A HA   1  
ATOM 1364  H HB   . THR A 1 84  ? 23.632 -9.154  13.512 1.00 45.50 ? 84  THR A HB   1  
ATOM 1365  H HG1  . THR A 1 84  ? 24.416 -7.753  12.047 1.00 51.30 ? 84  THR A HG1  1  
ATOM 1366  H HG21 . THR A 1 84  ? 23.377 -9.844  10.785 1.00 13.22 ? 84  THR A HG21 1  
ATOM 1367  H HG22 . THR A 1 84  ? 21.960 -10.490 11.613 1.00 21.43 ? 84  THR A HG22 1  
ATOM 1368  H HG23 . THR A 1 84  ? 23.578 -10.925 12.163 1.00 2.33  ? 84  THR A HG23 1  
ATOM 1369  N N    . TYR A 1 85  ? 21.788 -9.046  15.616 1.00 50.42 ? 85  TYR A N    1  
ATOM 1370  C CA   . TYR A 1 85  ? 21.902 -8.664  17.019 1.00 63.35 ? 85  TYR A CA   1  
ATOM 1371  C C    . TYR A 1 85  ? 22.978 -9.487  17.721 1.00 72.31 ? 85  TYR A C    1  
ATOM 1372  O O    . TYR A 1 85  ? 22.904 -10.715 17.770 1.00 21.33 ? 85  TYR A O    1  
ATOM 1373  C CB   . TYR A 1 85  ? 20.560 -8.846  17.729 1.00 10.01 ? 85  TYR A CB   1  
ATOM 1374  C CG   . TYR A 1 85  ? 19.756 -7.570  17.840 1.00 71.31 ? 85  TYR A CG   1  
ATOM 1375  C CD1  . TYR A 1 85  ? 18.793 -7.249  16.891 1.00 15.15 ? 85  TYR A CD1  1  
ATOM 1376  C CD2  . TYR A 1 85  ? 19.960 -6.686  18.892 1.00 70.11 ? 85  TYR A CD2  1  
ATOM 1377  C CE1  . TYR A 1 85  ? 18.056 -6.084  16.988 1.00 32.20 ? 85  TYR A CE1  1  
ATOM 1378  C CE2  . TYR A 1 85  ? 19.227 -5.520  18.997 1.00 10.03 ? 85  TYR A CE2  1  
ATOM 1379  C CZ   . TYR A 1 85  ? 18.276 -5.223  18.043 1.00 63.31 ? 85  TYR A CZ   1  
ATOM 1380  O OH   . TYR A 1 85  ? 17.545 -4.062  18.144 1.00 41.04 ? 85  TYR A OH   1  
ATOM 1381  H H    . TYR A 1 85  ? 21.794 -9.996  15.377 1.00 33.04 ? 85  TYR A H    1  
ATOM 1382  H HA   . TYR A 1 85  ? 22.181 -7.621  17.057 1.00 35.21 ? 85  TYR A HA   1  
ATOM 1383  H HB2  . TYR A 1 85  ? 19.967 -9.565  17.185 1.00 11.23 ? 85  TYR A HB2  1  
ATOM 1384  H HB3  . TYR A 1 85  ? 20.737 -9.215  18.729 1.00 52.11 ? 85  TYR A HB3  1  
ATOM 1385  H HD1  . TYR A 1 85  ? 18.622 -7.925  16.066 1.00 30.23 ? 85  TYR A HD1  1  
ATOM 1386  H HD2  . TYR A 1 85  ? 20.706 -6.921  19.638 1.00 73.45 ? 85  TYR A HD2  1  
ATOM 1387  H HE1  . TYR A 1 85  ? 17.311 -5.851  16.241 1.00 21.51 ? 85  TYR A HE1  1  
ATOM 1388  H HE2  . TYR A 1 85  ? 19.400 -4.845  19.823 1.00 72.51 ? 85  TYR A HE2  1  
ATOM 1389  H HH   . TYR A 1 85  ? 17.372 -3.872  19.069 1.00 62.03 ? 85  TYR A HH   1  
ATOM 1390  N N    . LYS A 1 86  ? 23.978 -8.801  18.264 1.00 34.33 ? 86  LYS A N    1  
ATOM 1391  C CA   . LYS A 1 86  ? 25.069 -9.466  18.967 1.00 42.44 ? 86  LYS A CA   1  
ATOM 1392  C C    . LYS A 1 86  ? 24.537 -10.334 20.102 1.00 71.32 ? 86  LYS A C    1  
ATOM 1393  O O    . LYS A 1 86  ? 23.909 -9.835  21.036 1.00 2.23  ? 86  LYS A O    1  
ATOM 1394  C CB   . LYS A 1 86  ? 26.052 -8.431  19.520 1.00 53.23 ? 86  LYS A CB   1  
ATOM 1395  C CG   . LYS A 1 86  ? 27.490 -8.670  19.095 1.00 42.13 ? 86  LYS A CG   1  
ATOM 1396  C CD   . LYS A 1 86  ? 27.878 -7.788  17.920 1.00 65.12 ? 86  LYS A CD   1  
ATOM 1397  C CE   . LYS A 1 86  ? 29.320 -8.026  17.496 1.00 32.45 ? 86  LYS A CE   1  
ATOM 1398  N NZ   . LYS A 1 86  ? 30.229 -6.959  17.998 1.00 51.22 ? 86  LYS A NZ   1  
ATOM 1399  H H    . LYS A 1 86  ? 23.981 -7.823  18.192 1.00 71.31 ? 86  LYS A H    1  
ATOM 1400  H HA   . LYS A 1 86  ? 25.585 -10.096 18.258 1.00 35.11 ? 86  LYS A HA   1  
ATOM 1401  H HB2  . LYS A 1 86  ? 25.755 -7.451  19.176 1.00 11.34 ? 86  LYS A HB2  1  
ATOM 1402  H HB3  . LYS A 1 86  ? 26.009 -8.453  20.599 1.00 0.32  ? 86  LYS A HB3  1  
ATOM 1403  H HG2  . LYS A 1 86  ? 28.143 -8.451  19.926 1.00 1.25  ? 86  LYS A HG2  1  
ATOM 1404  H HG3  . LYS A 1 86  ? 27.604 -9.706  18.809 1.00 71.03 ? 86  LYS A HG3  1  
ATOM 1405  H HD2  . LYS A 1 86  ? 27.229 -8.008  17.085 1.00 23.14 ? 86  LYS A HD2  1  
ATOM 1406  H HD3  . LYS A 1 86  ? 27.763 -6.752  18.205 1.00 53.11 ? 86  LYS A HD3  1  
ATOM 1407  H HE2  . LYS A 1 86  ? 29.644 -8.977  17.890 1.00 63.51 ? 86  LYS A HE2  1  
ATOM 1408  H HE3  . LYS A 1 86  ? 29.365 -8.049  16.418 1.00 41.14 ? 86  LYS A HE3  1  
ATOM 1409  H HZ1  . LYS A 1 86  ? 30.311 -7.017  19.033 1.00 10.01 ? 86  LYS A HZ1  1  
ATOM 1410  H HZ2  . LYS A 1 86  ? 29.855 -6.022  17.743 1.00 31.54 ? 86  LYS A HZ2  1  
ATOM 1411  H HZ3  . LYS A 1 86  ? 31.174 -7.068  17.579 1.00 63.31 ? 86  LYS A HZ3  1  
ATOM 1412  N N    . CYS A 1 87  ? 24.793 -11.635 20.015 1.00 54.10 ? 87  CYS A N    1  
ATOM 1413  C CA   . CYS A 1 87  ? 24.339 -12.573 21.036 1.00 64.01 ? 87  CYS A CA   1  
ATOM 1414  C C    . CYS A 1 87  ? 25.518 -13.112 21.840 1.00 33.04 ? 87  CYS A C    1  
ATOM 1415  O O    . CYS A 1 87  ? 26.677 -12.913 21.475 1.00 72.44 ? 87  CYS A O    1  
ATOM 1416  C CB   . CYS A 1 87  ? 23.574 -13.730 20.391 1.00 4.14  ? 87  CYS A CB   1  
ATOM 1417  S SG   . CYS A 1 87  ? 22.109 -13.220 19.463 1.00 11.34 ? 87  CYS A SG   1  
ATOM 1418  H H    . CYS A 1 87  ? 25.298 -11.973 19.246 1.00 35.22 ? 87  CYS A H    1  
ATOM 1419  H HA   . CYS A 1 87  ? 23.677 -12.042 21.702 1.00 3.25  ? 87  CYS A HA   1  
ATOM 1420  H HB2  . CYS A 1 87  ? 24.230 -14.249 19.708 1.00 24.34 ? 87  CYS A HB2  1  
ATOM 1421  H HB3  . CYS A 1 87  ? 23.255 -14.414 21.163 1.00 32.22 ? 87  CYS A HB3  1  
ATOM 1422  H HG   . CYS A 1 87  ? 21.739 -12.028 19.906 1.00 4.34  ? 87  CYS A HG   1  
ATOM 1423  N N    . THR A 1 88  ? 25.214 -13.794 22.940 1.00 21.43 ? 88  THR A N    1  
ATOM 1424  C CA   . THR A 1 88  ? 26.247 -14.360 23.799 1.00 43.33 ? 88  THR A CA   1  
ATOM 1425  C C    . THR A 1 88  ? 26.014 -15.848 24.033 1.00 41.22 ? 88  THR A C    1  
ATOM 1426  O O    . THR A 1 88  ? 24.887 -16.334 23.929 1.00 21.03 ? 88  THR A O    1  
ATOM 1427  C CB   . THR A 1 88  ? 26.303 -13.640 25.159 1.00 31.04 ? 88  THR A CB   1  
ATOM 1428  O OG1  . THR A 1 88  ? 25.858 -12.286 25.016 1.00 23.43 ? 88  THR A OG1  1  
ATOM 1429  C CG2  . THR A 1 88  ? 27.715 -13.658 25.724 1.00 64.21 ? 88  THR A CG2  1  
ATOM 1430  H H    . THR A 1 88  ? 24.272 -13.919 23.179 1.00 31.11 ? 88  THR A H    1  
ATOM 1431  H HA   . THR A 1 88  ? 27.200 -14.227 23.306 1.00 74.41 ? 88  THR A HA   1  
ATOM 1432  H HB   . THR A 1 88  ? 25.649 -14.155 25.849 1.00 51.22 ? 88  THR A HB   1  
ATOM 1433  H HG1  . THR A 1 88  ? 26.313 -11.876 24.277 1.00 65.43 ? 88  THR A HG1  1  
ATOM 1434  H HG21 . THR A 1 88  ? 28.404 -13.990 24.961 1.00 51.43 ? 88  THR A HG21 1  
ATOM 1435  H HG22 . THR A 1 88  ? 27.758 -14.333 26.565 1.00 20.45 ? 88  THR A HG22 1  
ATOM 1436  H HG23 . THR A 1 88  ? 27.987 -12.664 26.046 1.00 73.04 ? 88  THR A HG23 1  
ATOM 1437  N N    . LEU A 1 89  ? 27.085 -16.567 24.350 1.00 42.04 ? 89  LEU A N    1  
ATOM 1438  C CA   . LEU A 1 89  ? 26.997 -18.001 24.600 1.00 60.53 ? 89  LEU A CA   1  
ATOM 1439  C C    . LEU A 1 89  ? 26.623 -18.279 26.052 1.00 24.02 ? 89  LEU A C    1  
ATOM 1440  O O    . LEU A 1 89  ? 27.085 -17.594 26.964 1.00 62.22 ? 89  LEU A O    1  
ATOM 1441  C CB   . LEU A 1 89  ? 28.326 -18.680 24.264 1.00 22.24 ? 89  LEU A CB   1  
ATOM 1442  C CG   . LEU A 1 89  ? 28.514 -20.095 24.813 1.00 64.24 ? 89  LEU A CG   1  
ATOM 1443  C CD1  . LEU A 1 89  ? 29.335 -20.937 23.848 1.00 52.14 ? 89  LEU A CD1  1  
ATOM 1444  C CD2  . LEU A 1 89  ? 29.177 -20.053 26.182 1.00 14.11 ? 89  LEU A CD2  1  
ATOM 1445  H H    . LEU A 1 89  ? 27.956 -16.124 24.417 1.00 2.12  ? 89  LEU A H    1  
ATOM 1446  H HA   . LEU A 1 89  ? 26.226 -18.403 23.959 1.00 13.52 ? 89  LEU A HA   1  
ATOM 1447  H HB2  . LEU A 1 89  ? 28.411 -18.728 23.190 1.00 60.33 ? 89  LEU A HB2  1  
ATOM 1448  H HB3  . LEU A 1 89  ? 29.121 -18.063 24.659 1.00 13.13 ? 89  LEU A HB3  1  
ATOM 1449  H HG   . LEU A 1 89  ? 27.546 -20.564 24.923 1.00 51.52 ? 89  LEU A HG   1  
ATOM 1450  H HD11 . LEU A 1 89  ? 30.386 -20.757 24.017 1.00 75.11 ? 89  LEU A HD11 1  
ATOM 1451  H HD12 . LEU A 1 89  ? 29.083 -20.669 22.832 1.00 14.23 ? 89  LEU A HD12 1  
ATOM 1452  H HD13 . LEU A 1 89  ? 29.117 -21.983 24.008 1.00 42.22 ? 89  LEU A HD13 1  
ATOM 1453  H HD21 . LEU A 1 89  ? 29.807 -19.178 26.250 1.00 72.43 ? 89  LEU A HD21 1  
ATOM 1454  H HD22 . LEU A 1 89  ? 29.777 -20.941 26.319 1.00 42.40 ? 89  LEU A HD22 1  
ATOM 1455  H HD23 . LEU A 1 89  ? 28.417 -20.010 26.948 1.00 12.31 ? 89  LEU A HD23 1  
ATOM 1456  N N    . ASN A 1 90  ? 25.785 -19.290 26.260 1.00 45.34 ? 90  ASN A N    1  
ATOM 1457  C CA   . ASN A 1 90  ? 25.351 -19.659 27.602 1.00 60.21 ? 90  ASN A CA   1  
ATOM 1458  C C    . ASN A 1 90  ? 25.765 -21.090 27.933 1.00 51.10 ? 90  ASN A C    1  
ATOM 1459  O O    . ASN A 1 90  ? 26.438 -21.752 27.143 1.00 5.02  ? 90  ASN A O    1  
ATOM 1460  C CB   . ASN A 1 90  ? 23.833 -19.513 27.727 1.00 22.54 ? 90  ASN A CB   1  
ATOM 1461  C CG   . ASN A 1 90  ? 23.407 -19.079 29.116 1.00 31.45 ? 90  ASN A CG   1  
ATOM 1462  O OD1  . ASN A 1 90  ? 23.734 -17.980 29.563 1.00 52.31 ? 90  ASN A OD1  1  
ATOM 1463  N ND2  . ASN A 1 90  ? 22.673 -19.944 29.807 1.00 22.33 ? 90  ASN A ND2  1  
ATOM 1464  H H    . ASN A 1 90  ? 25.451 -19.799 25.492 1.00 20.01 ? 90  ASN A H    1  
ATOM 1465  H HA   . ASN A 1 90  ? 25.827 -18.988 28.301 1.00 62.13 ? 90  ASN A HA   1  
ATOM 1466  H HB2  . ASN A 1 90  ? 23.489 -18.774 27.019 1.00 71.01 ? 90  ASN A HB2  1  
ATOM 1467  H HB3  . ASN A 1 90  ? 23.367 -20.462 27.507 1.00 14.20 ? 90  ASN A HB3  1  
ATOM 1468  H HD21 . ASN A 1 90  ? 22.451 -20.802 29.388 1.00 11.01 ? 90  ASN A HD21 1  
ATOM 1469  H HD22 . ASN A 1 90  ? 22.383 -19.689 30.708 1.00 64.01 ? 90  ASN A HD22 1  
ATOM 1470  N N    . LYS A 1 91  ? 25.357 -21.561 29.106 1.00 34.52 ? 91  LYS A N    1  
ATOM 1471  C CA   . LYS A 1 91  ? 25.682 -22.914 29.543 1.00 42.01 ? 91  LYS A CA   1  
ATOM 1472  C C    . LYS A 1 91  ? 25.264 -23.940 28.494 1.00 13.24 ? 91  LYS A C    1  
ATOM 1473  O O    . LYS A 1 91  ? 26.094 -24.689 27.981 1.00 33.43 ? 91  LYS A O    1  
ATOM 1474  C CB   . LYS A 1 91  ? 24.995 -23.221 30.875 1.00 33.22 ? 91  LYS A CB   1  
ATOM 1475  C CG   . LYS A 1 91  ? 25.327 -22.227 31.975 1.00 62.34 ? 91  LYS A CG   1  
ATOM 1476  C CD   . LYS A 1 91  ? 26.796 -22.291 32.359 1.00 71.24 ? 91  LYS A CD   1  
ATOM 1477  C CE   . LYS A 1 91  ? 27.120 -21.324 33.487 1.00 54.22 ? 91  LYS A CE   1  
ATOM 1478  N NZ   . LYS A 1 91  ? 28.491 -21.540 34.026 1.00 13.24 ? 91  LYS A NZ   1  
ATOM 1479  H H    . LYS A 1 91  ? 24.822 -20.985 29.693 1.00 60.52 ? 91  LYS A H    1  
ATOM 1480  H HA   . LYS A 1 91  ? 26.752 -22.971 29.678 1.00 53.32 ? 91  LYS A HA   1  
ATOM 1481  H HB2  . LYS A 1 91  ? 23.925 -23.215 30.724 1.00 23.45 ? 91  LYS A HB2  1  
ATOM 1482  H HB3  . LYS A 1 91  ? 25.298 -24.205 31.204 1.00 12.24 ? 91  LYS A HB3  1  
ATOM 1483  H HG2  . LYS A 1 91  ? 25.100 -21.230 31.627 1.00 22.40 ? 91  LYS A HG2  1  
ATOM 1484  H HG3  . LYS A 1 91  ? 24.727 -22.453 32.845 1.00 53.35 ? 91  LYS A HG3  1  
ATOM 1485  H HD2  . LYS A 1 91  ? 27.032 -23.294 32.681 1.00 34.44 ? 91  LYS A HD2  1  
ATOM 1486  H HD3  . LYS A 1 91  ? 27.396 -22.038 31.496 1.00 71.42 ? 91  LYS A HD3  1  
ATOM 1487  H HE2  . LYS A 1 91  ? 27.045 -20.315 33.111 1.00 51.01 ? 91  LYS A HE2  1  
ATOM 1488  H HE3  . LYS A 1 91  ? 26.402 -21.466 34.282 1.00 44.33 ? 91  LYS A HE3  1  
ATOM 1489  H HZ1  . LYS A 1 91  ? 28.708 -20.822 34.748 1.00 75.34 ? 91  LYS A HZ1  1  
ATOM 1490  H HZ2  . LYS A 1 91  ? 29.191 -21.468 33.261 1.00 22.33 ? 91  LYS A HZ2  1  
ATOM 1491  H HZ3  . LYS A 1 91  ? 28.560 -22.483 34.459 1.00 42.11 ? 91  LYS A HZ3  1  
ATOM 1492  N N    . GLU A 1 92  ? 23.972 -23.966 28.181 1.00 42.44 ? 92  GLU A N    1  
ATOM 1493  C CA   . GLU A 1 92  ? 23.445 -24.900 27.192 1.00 4.44  ? 92  GLU A CA   1  
ATOM 1494  C C    . GLU A 1 92  ? 23.741 -24.416 25.775 1.00 31.34 ? 92  GLU A C    1  
ATOM 1495  O O    . GLU A 1 92  ? 23.956 -23.225 25.545 1.00 31.54 ? 92  GLU A O    1  
ATOM 1496  C CB   . GLU A 1 92  ? 21.937 -25.077 27.378 1.00 10.55 ? 92  GLU A CB   1  
ATOM 1497  C CG   . GLU A 1 92  ? 21.568 -26.236 28.289 1.00 51.04 ? 92  GLU A CG   1  
ATOM 1498  C CD   . GLU A 1 92  ? 20.500 -27.131 27.690 1.00 41.33 ? 92  GLU A CD   1  
ATOM 1499  O OE1  . GLU A 1 92  ? 19.304 -26.881 27.949 1.00 61.20 ? 92  GLU A OE1  1  
ATOM 1500  O OE2  . GLU A 1 92  ? 20.860 -28.080 26.962 1.00 11.24 ? 92  GLU A OE2  1  
ATOM 1501  H H    . GLU A 1 92  ? 23.360 -23.343 28.624 1.00 15.33 ? 92  GLU A H    1  
ATOM 1502  H HA   . GLU A 1 92  ? 23.931 -25.852 27.344 1.00 44.53 ? 92  GLU A HA   1  
ATOM 1503  H HB2  . GLU A 1 92  ? 21.530 -24.170 27.801 1.00 54.21 ? 92  GLU A HB2  1  
ATOM 1504  H HB3  . GLU A 1 92  ? 21.485 -25.247 26.412 1.00 23.14 ? 92  GLU A HB3  1  
ATOM 1505  H HG2  . GLU A 1 92  ? 22.451 -26.829 28.471 1.00 24.03 ? 92  GLU A HG2  1  
ATOM 1506  H HG3  . GLU A 1 92  ? 21.202 -25.840 29.224 1.00 13.04 ? 92  GLU A HG3  1  
ATOM 1507  N N    . LEU A 1 93  ? 23.750 -25.348 24.829 1.00 64.41 ? 93  LEU A N    1  
ATOM 1508  C CA   . LEU A 1 93  ? 24.020 -25.019 23.434 1.00 70.25 ? 93  LEU A CA   1  
ATOM 1509  C C    . LEU A 1 93  ? 22.755 -24.532 22.735 1.00 52.51 ? 93  LEU A C    1  
ATOM 1510  O O    . LEU A 1 93  ? 21.634 -24.796 23.171 1.00 2.10  ? 93  LEU A O    1  
ATOM 1511  C CB   . LEU A 1 93  ? 24.583 -26.238 22.701 1.00 62.20 ? 93  LEU A CB   1  
ATOM 1512  C CG   . LEU A 1 93  ? 26.086 -26.478 22.854 1.00 74.21 ? 93  LEU A CG   1  
ATOM 1513  C CD1  . LEU A 1 93  ? 26.874 -25.333 22.239 1.00 4.42  ? 93  LEU A CD1  1  
ATOM 1514  C CD2  . LEU A 1 93  ? 26.451 -26.653 24.321 1.00 61.33 ? 93  LEU A CD2  1  
ATOM 1515  H H    . LEU A 1 93  ? 23.572 -26.280 25.073 1.00 21.20 ? 93  LEU A H    1  
ATOM 1516  H HA   . LEU A 1 93  ? 24.754 -24.228 23.416 1.00 43.31 ? 93  LEU A HA   1  
ATOM 1517  H HB2  . LEU A 1 93  ? 24.070 -27.112 23.071 1.00 74.44 ? 93  LEU A HB2  1  
ATOM 1518  H HB3  . LEU A 1 93  ? 24.372 -26.117 21.648 1.00 51.00 ? 93  LEU A HB3  1  
ATOM 1519  H HG   . LEU A 1 93  ? 26.354 -27.386 22.331 1.00 52.12 ? 93  LEU A HG   1  
ATOM 1520  H HD11 . LEU A 1 93  ? 27.931 -25.528 22.341 1.00 41.03 ? 93  LEU A HD11 1  
ATOM 1521  H HD12 . LEU A 1 93  ? 26.628 -24.412 22.748 1.00 71.32 ? 93  LEU A HD12 1  
ATOM 1522  H HD13 . LEU A 1 93  ? 26.623 -25.243 21.192 1.00 31.45 ? 93  LEU A HD13 1  
ATOM 1523  H HD21 . LEU A 1 93  ? 25.811 -27.402 24.764 1.00 63.44 ? 93  LEU A HD21 1  
ATOM 1524  H HD22 . LEU A 1 93  ? 26.318 -25.715 24.839 1.00 4.32  ? 93  LEU A HD22 1  
ATOM 1525  H HD23 . LEU A 1 93  ? 27.481 -26.967 24.400 1.00 43.30 ? 93  LEU A HD23 1  
ATOM 1526  N N    . PRO A 1 94  ? 22.936 -23.804 21.623 1.00 54.12 ? 94  PRO A N    1  
ATOM 1527  C CA   . PRO A 1 94  ? 21.820 -23.266 20.838 1.00 30.43 ? 94  PRO A CA   1  
ATOM 1528  C C    . PRO A 1 94  ? 21.041 -24.359 20.114 1.00 31.23 ? 94  PRO A C    1  
ATOM 1529  O O    . PRO A 1 94  ? 21.488 -25.504 20.030 1.00 12.33 ? 94  PRO A O    1  
ATOM 1530  C CB   . PRO A 1 94  ? 22.508 -22.343 19.830 1.00 11.30 ? 94  PRO A CB   1  
ATOM 1531  C CG   . PRO A 1 94  ? 23.888 -22.888 19.696 1.00 33.34 ? 94  PRO A CG   1  
ATOM 1532  C CD   . PRO A 1 94  ? 24.243 -23.450 21.045 1.00 21.21 ? 94  PRO A CD   1  
ATOM 1533  H HA   . PRO A 1 94  ? 21.144 -22.691 21.453 1.00 14.12 ? 94  PRO A HA   1  
ATOM 1534  H HB2  . PRO A 1 94  ? 21.977 -22.374 18.889 1.00 51.11 ? 94  PRO A HB2  1  
ATOM 1535  H HB3  . PRO A 1 94  ? 22.518 -21.332 20.211 1.00 62.54 ? 94  PRO A HB3  1  
ATOM 1536  H HG2  . PRO A 1 94  ? 23.904 -23.667 18.950 1.00 72.35 ? 94  PRO A HG2  1  
ATOM 1537  H HG3  . PRO A 1 94  ? 24.571 -22.096 19.429 1.00 0.11  ? 94  PRO A HG3  1  
ATOM 1538  H HD2  . PRO A 1 94  ? 24.866 -24.325 20.937 1.00 64.50 ? 94  PRO A HD2  1  
ATOM 1539  H HD3  . PRO A 1 94  ? 24.740 -22.703 21.646 1.00 11.12 ? 94  PRO A HD3  1  
ATOM 1540  N N    . THR A 1 95  ? 19.873 -24.000 19.591 1.00 13.44 ? 95  THR A N    1  
ATOM 1541  C CA   . THR A 1 95  ? 19.031 -24.950 18.875 1.00 0.50  ? 95  THR A CA   1  
ATOM 1542  C C    . THR A 1 95  ? 19.024 -24.659 17.379 1.00 43.33 ? 95  THR A C    1  
ATOM 1543  O O    . THR A 1 95  ? 19.355 -23.552 16.949 1.00 34.43 ? 95  THR A O    1  
ATOM 1544  C CB   . THR A 1 95  ? 17.583 -24.923 19.398 1.00 15.42 ? 95  THR A CB   1  
ATOM 1545  O OG1  . THR A 1 95  ? 17.579 -24.854 20.829 1.00 64.25 ? 95  THR A OG1  1  
ATOM 1546  C CG2  . THR A 1 95  ? 16.820 -26.157 18.943 1.00 73.51 ? 95  THR A CG2  1  
ATOM 1547  H H    . THR A 1 95  ? 19.571 -23.073 19.691 1.00 14.34 ? 95  THR A H    1  
ATOM 1548  H HA   . THR A 1 95  ? 19.432 -25.939 19.038 1.00 62.41 ? 95  THR A HA   1  
ATOM 1549  H HB   . THR A 1 95  ? 17.089 -24.046 19.002 1.00 21.44 ? 95  THR A HB   1  
ATOM 1550  H HG1  . THR A 1 95  ? 18.333 -25.340 21.174 1.00 53.41 ? 95  THR A HG1  1  
ATOM 1551  H HG21 . THR A 1 95  ? 17.421 -27.037 19.119 1.00 34.43 ? 95  THR A HG21 1  
ATOM 1552  H HG22 . THR A 1 95  ? 16.600 -26.076 17.889 1.00 61.53 ? 95  THR A HG22 1  
ATOM 1553  H HG23 . THR A 1 95  ? 15.897 -26.235 19.498 1.00 21.00 ? 95  THR A HG23 1  
ATOM 1554  N N    . LEU A 1 96  ? 18.646 -25.657 16.588 1.00 31.25 ? 96  LEU A N    1  
ATOM 1555  C CA   . LEU A 1 96  ? 18.595 -25.508 15.138 1.00 22.12 ? 96  LEU A CA   1  
ATOM 1556  C C    . LEU A 1 96  ? 19.979 -25.203 14.573 1.00 30.34 ? 96  LEU A C    1  
ATOM 1557  O O    . LEU A 1 96  ? 20.112 -24.748 13.437 1.00 52.21 ? 96  LEU A O    1  
ATOM 1558  C CB   . LEU A 1 96  ? 17.619 -24.395 14.754 1.00 74.10 ? 96  LEU A CB   1  
ATOM 1559  C CG   . LEU A 1 96  ? 18.234 -23.016 14.512 1.00 72.30 ? 96  LEU A CG   1  
ATOM 1560  C CD1  . LEU A 1 96  ? 18.164 -22.652 13.037 1.00 31.01 ? 96  LEU A CD1  1  
ATOM 1561  C CD2  . LEU A 1 96  ? 17.532 -21.963 15.357 1.00 31.42 ? 96  LEU A CD2  1  
ATOM 1562  H H    . LEU A 1 96  ? 18.394 -26.515 16.989 1.00 63.24 ? 96  LEU A H    1  
ATOM 1563  H HA   . LEU A 1 96  ? 18.247 -26.441 14.721 1.00 30.32 ? 96  LEU A HA   1  
ATOM 1564  H HB2  . LEU A 1 96  ? 17.115 -24.696 13.848 1.00 13.33 ? 96  LEU A HB2  1  
ATOM 1565  H HB3  . LEU A 1 96  ? 16.896 -24.301 15.552 1.00 53.31 ? 96  LEU A HB3  1  
ATOM 1566  H HG   . LEU A 1 96  ? 19.276 -23.038 14.801 1.00 73.23 ? 96  LEU A HG   1  
ATOM 1567  H HD11 . LEU A 1 96  ? 18.001 -21.590 12.936 1.00 12.21 ? 96  LEU A HD11 1  
ATOM 1568  H HD12 . LEU A 1 96  ? 17.349 -23.187 12.572 1.00 20.25 ? 96  LEU A HD12 1  
ATOM 1569  H HD13 . LEU A 1 96  ? 19.092 -22.922 12.555 1.00 3.04  ? 96  LEU A HD13 1  
ATOM 1570  H HD21 . LEU A 1 96  ? 17.401 -21.064 14.774 1.00 14.43 ? 96  LEU A HD21 1  
ATOM 1571  H HD22 . LEU A 1 96  ? 18.131 -21.743 16.229 1.00 65.23 ? 96  LEU A HD22 1  
ATOM 1572  H HD23 . LEU A 1 96  ? 16.567 -22.336 15.668 1.00 41.43 ? 96  LEU A HD23 1  
ATOM 1573  N N    . THR A 1 97  ? 21.009 -25.460 15.374 1.00 10.30 ? 97  THR A N    1  
ATOM 1574  C CA   . THR A 1 97  ? 22.383 -25.214 14.954 1.00 31.13 ? 97  THR A CA   1  
ATOM 1575  C C    . THR A 1 97  ? 22.905 -26.354 14.088 1.00 63.30 ? 97  THR A C    1  
ATOM 1576  O O    . THR A 1 97  ? 23.754 -26.148 13.221 1.00 22.24 ? 97  THR A O    1  
ATOM 1577  C CB   . THR A 1 97  ? 23.317 -25.035 16.166 1.00 60.50 ? 97  THR A CB   1  
ATOM 1578  O OG1  . THR A 1 97  ? 24.617 -24.628 15.726 1.00 4.22  ? 97  THR A OG1  1  
ATOM 1579  C CG2  . THR A 1 97  ? 23.427 -26.328 16.960 1.00 71.52 ? 97  THR A CG2  1  
ATOM 1580  H H    . THR A 1 97  ? 20.839 -25.822 16.268 1.00 0.05  ? 97  THR A H    1  
ATOM 1581  H HA   . THR A 1 97  ? 22.397 -24.301 14.377 1.00 2.34  ? 97  THR A HA   1  
ATOM 1582  H HB   . THR A 1 97  ? 22.906 -24.270 16.808 1.00 1.33  ? 97  THR A HB   1  
ATOM 1583  H HG1  . THR A 1 97  ? 24.587 -23.711 15.443 1.00 54.22 ? 97  THR A HG1  1  
ATOM 1584  H HG21 . THR A 1 97  ? 24.291 -26.883 16.626 1.00 23.44 ? 97  THR A HG21 1  
ATOM 1585  H HG22 . THR A 1 97  ? 22.537 -26.921 16.807 1.00 23.20 ? 97  THR A HG22 1  
ATOM 1586  H HG23 . THR A 1 97  ? 23.530 -26.098 18.009 1.00 24.24 ? 97  THR A HG23 1  
ATOM 1587  N N    . GLU A 1 98  ? 22.392 -27.557 14.328 1.00 52.12 ? 98  GLU A N    1  
ATOM 1588  C CA   . GLU A 1 98  ? 22.808 -28.730 13.568 1.00 1.11  ? 98  GLU A CA   1  
ATOM 1589  C C    . GLU A 1 98  ? 22.103 -28.781 12.216 1.00 55.10 ? 98  GLU A C    1  
ATOM 1590  O O    . GLU A 1 98  ? 22.323 -29.696 11.422 1.00 22.00 ? 98  GLU A O    1  
ATOM 1591  C CB   . GLU A 1 98  ? 22.514 -30.007 14.358 1.00 61.14 ? 98  GLU A CB   1  
ATOM 1592  C CG   . GLU A 1 98  ? 23.409 -30.192 15.572 1.00 41.15 ? 98  GLU A CG   1  
ATOM 1593  C CD   . GLU A 1 98  ? 24.644 -31.018 15.266 1.00 53.52 ? 98  GLU A CD   1  
ATOM 1594  O OE1  . GLU A 1 98  ? 24.991 -31.144 14.073 1.00 63.40 ? 98  GLU A OE1  1  
ATOM 1595  O OE2  . GLU A 1 98  ? 25.262 -31.537 16.218 1.00 12.45 ? 98  GLU A OE2  1  
ATOM 1596  H H    . GLU A 1 98  ? 21.718 -27.658 15.032 1.00 1.42  ? 98  GLU A H    1  
ATOM 1597  H HA   . GLU A 1 98  ? 23.872 -28.657 13.403 1.00 63.25 ? 98  GLU A HA   1  
ATOM 1598  H HB2  . GLU A 1 98  ? 21.488 -29.981 14.693 1.00 53.41 ? 98  GLU A HB2  1  
ATOM 1599  H HB3  . GLU A 1 98  ? 22.648 -30.857 13.705 1.00 20.54 ? 98  GLU A HB3  1  
ATOM 1600  H HG2  . GLU A 1 98  ? 23.723 -29.220 15.923 1.00 73.40 ? 98  GLU A HG2  1  
ATOM 1601  H HG3  . GLU A 1 98  ? 22.845 -30.689 16.347 1.00 55.32 ? 98  GLU A HG3  1  
ATOM 1602  N N    . HIS A 1 99  ? 21.252 -27.792 11.961 1.00 0.42  ? 99  HIS A N    1  
ATOM 1603  C CA   . HIS A 1 99  ? 20.513 -27.723 10.705 1.00 3.24  ? 99  HIS A CA   1  
ATOM 1604  C C    . HIS A 1 99  ? 21.408 -28.098 9.528  1.00 52.04 ? 99  HIS A C    1  
ATOM 1605  O O    . HIS A 1 99  ? 21.231 -29.148 8.909  1.00 12.15 ? 99  HIS A O    1  
ATOM 1606  C CB   . HIS A 1 99  ? 19.943 -26.319 10.501 1.00 61.02 ? 99  HIS A CB   1  
ATOM 1607  C CG   . HIS A 1 99  ? 18.451 -26.292 10.371 1.00 2.52  ? 99  HIS A CG   1  
ATOM 1608  N ND1  . HIS A 1 99  ? 17.614 -27.069 11.144 1.00 42.50 ? 99  HIS A ND1  1  
ATOM 1609  C CD2  . HIS A 1 99  ? 17.647 -25.573 9.553  1.00 33.33 ? 99  HIS A CD2  1  
ATOM 1610  C CE1  . HIS A 1 99  ? 16.360 -26.831 10.806 1.00 55.32 ? 99  HIS A CE1  1  
ATOM 1611  N NE2  . HIS A 1 99  ? 16.352 -25.927 9.843  1.00 53.41 ? 99  HIS A NE2  1  
ATOM 1612  H H    . HIS A 1 99  ? 21.119 -27.091 12.633 1.00 34.33 ? 99  HIS A H    1  
ATOM 1613  H HA   . HIS A 1 99  ? 19.698 -28.428 10.761 1.00 22.31 ? 99  HIS A HA   1  
ATOM 1614  H HB2  . HIS A 1 99  ? 20.214 -25.701 11.345 1.00 74.45 ? 99  HIS A HB2  1  
ATOM 1615  H HB3  . HIS A 1 99  ? 20.363 -25.894 9.600  1.00 21.44 ? 99  HIS A HB3  1  
ATOM 1616  H HD1  . HIS A 1 99  ? 17.898 -27.701 11.836 1.00 72.31 ? 99  HIS A HD1  1  
ATOM 1617  H HD2  . HIS A 1 99  ? 17.964 -24.855 8.810  1.00 73.21 ? 99  HIS A HD2  1  
ATOM 1618  H HE1  . HIS A 1 99  ? 15.488 -27.295 11.242 1.00 20.32 ? 99  HIS A HE1  1  
ATOM 1619  N N    . LYS A 1 100 ? 22.369 -27.233 9.222  1.00 54.34 ? 100 LYS A N    1  
ATOM 1620  C CA   . LYS A 1 100 ? 23.292 -27.472 8.119  1.00 73.24 ? 100 LYS A CA   1  
ATOM 1621  C C    . LYS A 1 100 ? 24.416 -28.410 8.544  1.00 24.54 ? 100 LYS A C    1  
ATOM 1622  O O    . LYS A 1 100 ? 24.587 -29.489 7.976  1.00 54.10 ? 100 LYS A O    1  
ATOM 1623  C CB   . LYS A 1 100 ? 23.878 -26.149 7.621  1.00 72.24 ? 100 LYS A CB   1  
ATOM 1624  C CG   . LYS A 1 100 ? 24.472 -26.234 6.225  1.00 33.12 ? 100 LYS A CG   1  
ATOM 1625  C CD   . LYS A 1 100 ? 25.890 -26.779 6.255  1.00 51.31 ? 100 LYS A CD   1  
ATOM 1626  C CE   . LYS A 1 100 ? 26.558 -26.668 4.893  1.00 2.31  ? 100 LYS A CE   1  
ATOM 1627  N NZ   . LYS A 1 100 ? 27.785 -27.507 4.807  1.00 4.14  ? 100 LYS A NZ   1  
ATOM 1628  H H    . LYS A 1 100 ? 22.460 -26.413 9.752  1.00 54.34 ? 100 LYS A H    1  
ATOM 1629  H HA   . LYS A 1 100 ? 22.737 -27.935 7.316  1.00 22.25 ? 100 LYS A HA   1  
ATOM 1630  H HB2  . LYS A 1 100 ? 23.096 -25.404 7.612  1.00 4.31  ? 100 LYS A HB2  1  
ATOM 1631  H HB3  . LYS A 1 100 ? 24.656 -25.835 8.302  1.00 72.14 ? 100 LYS A HB3  1  
ATOM 1632  H HG2  . LYS A 1 100 ? 23.859 -26.888 5.622  1.00 2.21  ? 100 LYS A HG2  1  
ATOM 1633  H HG3  . LYS A 1 100 ? 24.484 -25.245 5.789  1.00 64.44 ? 100 LYS A HG3  1  
ATOM 1634  H HD2  . LYS A 1 100 ? 26.467 -26.216 6.973  1.00 25.34 ? 100 LYS A HD2  1  
ATOM 1635  H HD3  . LYS A 1 100 ? 25.861 -27.819 6.548  1.00 12.44 ? 100 LYS A HD3  1  
ATOM 1636  H HE2  . LYS A 1 100 ? 25.859 -26.989 4.136  1.00 22.13 ? 100 LYS A HE2  1  
ATOM 1637  H HE3  . LYS A 1 100 ? 26.825 -25.635 4.721  1.00 24.41 ? 100 LYS A HE3  1  
ATOM 1638  H HZ1  . LYS A 1 100 ? 27.842 -28.142 5.629  1.00 13.14 ? 100 LYS A HZ1  1  
ATOM 1639  H HZ2  . LYS A 1 100 ? 28.631 -26.902 4.792  1.00 23.35 ? 100 LYS A HZ2  1  
ATOM 1640  H HZ3  . LYS A 1 100 ? 27.767 -28.080 3.940  1.00 34.32 ? 100 LYS A HZ3  1  
ATOM 1641  N N    . SER A 1 101 ? 25.181 -27.993 9.549  1.00 73.23 ? 101 SER A N    1  
ATOM 1642  C CA   . SER A 1 101 ? 26.291 -28.796 10.049 1.00 13.31 ? 101 SER A CA   1  
ATOM 1643  C C    . SER A 1 101 ? 27.045 -28.054 11.148 1.00 2.22  ? 101 SER A C    1  
ATOM 1644  O O    . SER A 1 101 ? 26.654 -26.959 11.554 1.00 31.24 ? 101 SER A O    1  
ATOM 1645  C CB   . SER A 1 101 ? 27.247 -29.150 8.908  1.00 14.23 ? 101 SER A CB   1  
ATOM 1646  O OG   . SER A 1 101 ? 27.182 -30.531 8.599  1.00 20.21 ? 101 SER A OG   1  
ATOM 1647  H H    . SER A 1 101 ? 24.995 -27.124 9.961  1.00 12.42 ? 101 SER A H    1  
ATOM 1648  H HA   . SER A 1 101 ? 25.882 -29.706 10.461 1.00 61.52 ? 101 SER A HA   1  
ATOM 1649  H HB2  . SER A 1 101 ? 26.979 -28.584 8.029  1.00 2.31  ? 101 SER A HB2  1  
ATOM 1650  H HB3  . SER A 1 101 ? 28.258 -28.905 9.201  1.00 74.15 ? 101 SER A HB3  1  
ATOM 1651  H HG   . SER A 1 101 ? 27.564 -30.684 7.732  1.00 50.54 ? 101 SER A HG   1  
ATOM 1652  N N    . ILE A 1 102 ? 28.128 -28.658 11.625 1.00 44.02 ? 102 ILE A N    1  
ATOM 1653  C CA   . ILE A 1 102 ? 28.939 -28.055 12.676 1.00 73.13 ? 102 ILE A CA   1  
ATOM 1654  C C    . ILE A 1 102 ? 30.189 -27.400 12.098 1.00 31.04 ? 102 ILE A C    1  
ATOM 1655  O O    . ILE A 1 102 ? 31.165 -28.078 11.780 1.00 42.24 ? 102 ILE A O    1  
ATOM 1656  C CB   . ILE A 1 102 ? 29.359 -29.096 13.730 1.00 34.21 ? 102 ILE A CB   1  
ATOM 1657  C CG1  . ILE A 1 102 ? 28.154 -29.509 14.579 1.00 43.30 ? 102 ILE A CG1  1  
ATOM 1658  C CG2  . ILE A 1 102 ? 30.469 -28.541 14.610 1.00 15.10 ? 102 ILE A CG2  1  
ATOM 1659  C CD1  . ILE A 1 102 ? 27.994 -31.007 14.713 1.00 4.12  ? 102 ILE A CD1  1  
ATOM 1660  H H    . ILE A 1 102 ? 28.389 -29.529 11.261 1.00 62.25 ? 102 ILE A H    1  
ATOM 1661  H HA   . ILE A 1 102 ? 28.341 -27.298 13.164 1.00 65.41 ? 102 ILE A HA   1  
ATOM 1662  H HB   . ILE A 1 102 ? 29.741 -29.964 13.215 1.00 52.25 ? 102 ILE A HB   1  
ATOM 1663  H HG12 . ILE A 1 102 ? 28.262 -29.097 15.570 1.00 24.30 ? 102 ILE A HG12 1  
ATOM 1664  H HG13 . ILE A 1 102 ? 27.254 -29.117 14.127 1.00 22.23 ? 102 ILE A HG13 1  
ATOM 1665  H HG21 . ILE A 1 102 ? 31.424 -28.893 14.250 1.00 72.15 ? 102 ILE A HG21 1  
ATOM 1666  H HG22 . ILE A 1 102 ? 30.448 -27.462 14.577 1.00 71.03 ? 102 ILE A HG22 1  
ATOM 1667  H HG23 . ILE A 1 102 ? 30.323 -28.873 15.627 1.00 74.23 ? 102 ILE A HG23 1  
ATOM 1668  H HD11 . ILE A 1 102 ? 28.955 -31.485 14.587 1.00 53.33 ? 102 ILE A HD11 1  
ATOM 1669  H HD12 . ILE A 1 102 ? 27.600 -31.241 15.690 1.00 24.44 ? 102 ILE A HD12 1  
ATOM 1670  H HD13 . ILE A 1 102 ? 27.313 -31.365 13.955 1.00 73.30 ? 102 ILE A HD13 1  
ATOM 1671  N N    . GLU A 1 103 ? 30.151 -26.077 11.969 1.00 64.52 ? 103 GLU A N    1  
ATOM 1672  C CA   . GLU A 1 103 ? 31.283 -25.331 11.431 1.00 55.03 ? 103 GLU A CA   1  
ATOM 1673  C C    . GLU A 1 103 ? 31.439 -23.991 12.145 1.00 65.52 ? 103 GLU A C    1  
ATOM 1674  O O    . GLU A 1 103 ? 30.550 -23.142 12.096 1.00 73.23 ? 103 GLU A O    1  
ATOM 1675  C CB   . GLU A 1 103 ? 31.103 -25.103 9.928  1.00 2.44  ? 103 GLU A CB   1  
ATOM 1676  C CG   . GLU A 1 103 ? 30.147 -26.085 9.273  1.00 30.03 ? 103 GLU A CG   1  
ATOM 1677  C CD   . GLU A 1 103 ? 30.075 -25.914 7.768  1.00 24.03 ? 103 GLU A CD   1  
ATOM 1678  O OE1  . GLU A 1 103 ? 29.079 -25.337 7.284  1.00 2.22  ? 103 GLU A OE1  1  
ATOM 1679  O OE2  . GLU A 1 103 ? 31.014 -26.357 7.075  1.00 65.21 ? 103 GLU A OE2  1  
ATOM 1680  H H    . GLU A 1 103 ? 29.344 -25.593 12.241 1.00 43.13 ? 103 GLU A H    1  
ATOM 1681  H HA   . GLU A 1 103 ? 32.174 -25.918 11.592 1.00 1.22  ? 103 GLU A HA   1  
ATOM 1682  H HB2  . GLU A 1 103 ? 30.725 -24.103 9.771  1.00 74.40 ? 103 GLU A HB2  1  
ATOM 1683  H HB3  . GLU A 1 103 ? 32.065 -25.193 9.446  1.00 62.21 ? 103 GLU A HB3  1  
ATOM 1684  H HG2  . GLU A 1 103 ? 30.478 -27.089 9.490  1.00 22.45 ? 103 GLU A HG2  1  
ATOM 1685  H HG3  . GLU A 1 103 ? 29.160 -25.936 9.685  1.00 13.12 ? 103 GLU A HG3  1  
ATOM 1686  N N    . TRP A 1 104 ? 32.576 -23.811 12.807 1.00 21.04 ? 104 TRP A N    1  
ATOM 1687  C CA   . TRP A 1 104 ? 32.850 -22.575 13.532 1.00 20.44 ? 104 TRP A CA   1  
ATOM 1688  C C    . TRP A 1 104 ? 34.067 -21.862 12.953 1.00 73.52 ? 104 TRP A C    1  
ATOM 1689  O O    . TRP A 1 104 ? 35.207 -22.258 13.200 1.00 13.02 ? 104 TRP A O    1  
ATOM 1690  C CB   . TRP A 1 104 ? 33.075 -22.870 15.016 1.00 11.14 ? 104 TRP A CB   1  
ATOM 1691  C CG   . TRP A 1 104 ? 32.221 -23.987 15.536 1.00 3.35  ? 104 TRP A CG   1  
ATOM 1692  C CD1  . TRP A 1 104 ? 32.640 -25.077 16.243 1.00 21.55 ? 104 TRP A CD1  1  
ATOM 1693  C CD2  . TRP A 1 104 ? 30.804 -24.122 15.388 1.00 33.23 ? 104 TRP A CD2  1  
ATOM 1694  N NE1  . TRP A 1 104 ? 31.568 -25.883 16.544 1.00 42.02 ? 104 TRP A NE1  1  
ATOM 1695  C CE2  . TRP A 1 104 ? 30.430 -25.319 16.031 1.00 2.31  ? 104 TRP A CE2  1  
ATOM 1696  C CE3  . TRP A 1 104 ? 29.813 -23.348 14.777 1.00 24.52 ? 104 TRP A CE3  1  
ATOM 1697  C CZ2  . TRP A 1 104 ? 29.110 -25.757 16.078 1.00 74.44 ? 104 TRP A CZ2  1  
ATOM 1698  C CZ3  . TRP A 1 104 ? 28.503 -23.786 14.824 1.00 43.51 ? 104 TRP A CZ3  1  
ATOM 1699  C CH2  . TRP A 1 104 ? 28.161 -24.980 15.471 1.00 73.31 ? 104 TRP A CH2  1  
ATOM 1700  H H    . TRP A 1 104 ? 33.247 -24.525 12.810 1.00 65.45 ? 104 TRP A H    1  
ATOM 1701  H HA   . TRP A 1 104 ? 31.988 -21.933 13.429 1.00 73.32 ? 104 TRP A HA   1  
ATOM 1702  H HB2  . TRP A 1 104 ? 34.109 -23.141 15.171 1.00 54.22 ? 104 TRP A HB2  1  
ATOM 1703  H HB3  . TRP A 1 104 ? 32.850 -21.982 15.590 1.00 73.31 ? 104 TRP A HB3  1  
ATOM 1704  H HD1  . TRP A 1 104 ? 33.667 -25.267 16.517 1.00 13.13 ? 104 TRP A HD1  1  
ATOM 1705  H HE1  . TRP A 1 104 ? 31.612 -26.724 17.045 1.00 31.24 ? 104 TRP A HE1  1  
ATOM 1706  H HE3  . TRP A 1 104 ? 30.058 -22.425 14.274 1.00 53.32 ? 104 TRP A HE3  1  
ATOM 1707  H HZ2  . TRP A 1 104 ? 28.829 -26.676 16.573 1.00 45.32 ? 104 TRP A HZ2  1  
ATOM 1708  H HZ3  . TRP A 1 104 ? 27.724 -23.201 14.357 1.00 43.03 ? 104 TRP A HZ3  1  
ATOM 1709  H HH2  . TRP A 1 104 ? 27.125 -25.283 15.482 1.00 0.04  ? 104 TRP A HH2  1  
ATOM 1710  N N    . LEU A 1 105 ? 33.818 -20.810 12.181 1.00 23.11 ? 105 LEU A N    1  
ATOM 1711  C CA   . LEU A 1 105 ? 34.895 -20.041 11.566 1.00 32.22 ? 105 LEU A CA   1  
ATOM 1712  C C    . LEU A 1 105 ? 35.363 -18.923 12.492 1.00 52.11 ? 105 LEU A C    1  
ATOM 1713  O O    . LEU A 1 105 ? 34.640 -18.511 13.399 1.00 20.44 ? 105 LEU A O    1  
ATOM 1714  C CB   . LEU A 1 105 ? 34.431 -19.454 10.232 1.00 11.11 ? 105 LEU A CB   1  
ATOM 1715  C CG   . LEU A 1 105 ? 34.309 -20.441 9.071  1.00 54.35 ? 105 LEU A CG   1  
ATOM 1716  C CD1  . LEU A 1 105 ? 35.611 -21.201 8.877  1.00 63.13 ? 105 LEU A CD1  1  
ATOM 1717  C CD2  . LEU A 1 105 ? 33.156 -21.405 9.309  1.00 23.54 ? 105 LEU A CD2  1  
ATOM 1718  H H    . LEU A 1 105 ? 32.890 -20.543 12.020 1.00 13.05 ? 105 LEU A H    1  
ATOM 1719  H HA   . LEU A 1 105 ? 35.721 -20.713 11.387 1.00 51.03 ? 105 LEU A HA   1  
ATOM 1720  H HB2  . LEU A 1 105 ? 33.462 -19.005 10.388 1.00 70.04 ? 105 LEU A HB2  1  
ATOM 1721  H HB3  . LEU A 1 105 ? 35.138 -18.689 9.945  1.00 42.13 ? 105 LEU A HB3  1  
ATOM 1722  H HG   . LEU A 1 105 ? 34.104 -19.893 8.161  1.00 42.21 ? 105 LEU A HG   1  
ATOM 1723  H HD11 . LEU A 1 105 ? 36.408 -20.686 9.391  1.00 24.54 ? 105 LEU A HD11 1  
ATOM 1724  H HD12 . LEU A 1 105 ? 35.841 -21.259 7.823  1.00 1.31  ? 105 LEU A HD12 1  
ATOM 1725  H HD13 . LEU A 1 105 ? 35.508 -22.199 9.277  1.00 24.13 ? 105 LEU A HD13 1  
ATOM 1726  H HD21 . LEU A 1 105 ? 32.498 -20.999 10.063 1.00 72.30 ? 105 LEU A HD21 1  
ATOM 1727  H HD22 . LEU A 1 105 ? 33.546 -22.355 9.646  1.00 20.33 ? 105 LEU A HD22 1  
ATOM 1728  H HD23 . LEU A 1 105 ? 32.608 -21.546 8.390  1.00 62.32 ? 105 LEU A HD23 1  
ATOM 1729  N N    . SER A 1 106 ? 36.576 -18.434 12.255 1.00 53.25 ? 106 SER A N    1  
ATOM 1730  C CA   . SER A 1 106 ? 37.141 -17.364 13.068 1.00 41.20 ? 106 SER A CA   1  
ATOM 1731  C C    . SER A 1 106 ? 36.590 -16.007 12.640 1.00 35.15 ? 106 SER A C    1  
ATOM 1732  O O    . SER A 1 106 ? 35.744 -15.922 11.750 1.00 55.42 ? 106 SER A O    1  
ATOM 1733  C CB   . SER A 1 106 ? 38.667 -17.364 12.959 1.00 1.23  ? 106 SER A CB   1  
ATOM 1734  O OG   . SER A 1 106 ? 39.172 -18.685 12.875 1.00 24.15 ? 106 SER A OG   1  
ATOM 1735  H H    . SER A 1 106 ? 37.104 -18.804 11.516 1.00 12.41 ? 106 SER A H    1  
ATOM 1736  H HA   . SER A 1 106 ? 36.862 -17.545 14.095 1.00 32.31 ? 106 SER A HA   1  
ATOM 1737  H HB2  . SER A 1 106 ? 38.962 -16.822 12.074 1.00 5.41  ? 106 SER A HB2  1  
ATOM 1738  H HB3  . SER A 1 106 ? 39.087 -16.885 13.832 1.00 3.20  ? 106 SER A HB3  1  
ATOM 1739  H HG   . SER A 1 106 ? 39.319 -18.914 11.955 1.00 73.32 ? 106 SER A HG   1  
ATOM 1740  N N    . ILE A 1 107 ? 37.075 -14.949 13.282 1.00 71.51 ? 107 ILE A N    1  
ATOM 1741  C CA   . ILE A 1 107 ? 36.632 -13.597 12.968 1.00 11.30 ? 107 ILE A CA   1  
ATOM 1742  C C    . ILE A 1 107 ? 37.200 -13.128 11.633 1.00 60.23 ? 107 ILE A C    1  
ATOM 1743  O O    . ILE A 1 107 ? 36.576 -12.340 10.924 1.00 61.14 ? 107 ILE A O    1  
ATOM 1744  C CB   . ILE A 1 107 ? 37.045 -12.600 14.067 1.00 50.10 ? 107 ILE A CB   1  
ATOM 1745  C CG1  . ILE A 1 107 ? 36.505 -13.052 15.425 1.00 30.13 ? 107 ILE A CG1  1  
ATOM 1746  C CG2  . ILE A 1 107 ? 36.545 -11.203 13.730 1.00 33.13 ? 107 ILE A CG2  1  
ATOM 1747  C CD1  . ILE A 1 107 ? 36.840 -12.103 16.555 1.00 70.51 ? 107 ILE A CD1  1  
ATOM 1748  H H    . ILE A 1 107 ? 37.747 -15.082 13.982 1.00 2.00  ? 107 ILE A H    1  
ATOM 1749  H HA   . ILE A 1 107 ? 35.553 -13.606 12.905 1.00 43.20 ? 107 ILE A HA   1  
ATOM 1750  H HB   . ILE A 1 107 ? 38.123 -12.570 14.108 1.00 40.11 ? 107 ILE A HB   1  
ATOM 1751  H HG12 . ILE A 1 107 ? 35.431 -13.134 15.370 1.00 61.35 ? 107 ILE A HG12 1  
ATOM 1752  H HG13 . ILE A 1 107 ? 36.924 -14.018 15.667 1.00 32.30 ? 107 ILE A HG13 1  
ATOM 1753  H HG21 . ILE A 1 107 ? 36.871 -10.511 14.492 1.00 10.32 ? 107 ILE A HG21 1  
ATOM 1754  H HG22 . ILE A 1 107 ? 36.944 -10.899 12.774 1.00 33.13 ? 107 ILE A HG22 1  
ATOM 1755  H HG23 . ILE A 1 107 ? 35.466 -11.208 13.686 1.00 41.31 ? 107 ILE A HG23 1  
ATOM 1756  H HD11 . ILE A 1 107 ? 37.314 -12.651 17.357 1.00 55.44 ? 107 ILE A HD11 1  
ATOM 1757  H HD12 . ILE A 1 107 ? 37.510 -11.337 16.196 1.00 61.34 ? 107 ILE A HD12 1  
ATOM 1758  H HD13 . ILE A 1 107 ? 35.932 -11.645 16.921 1.00 43.13 ? 107 ILE A HD13 1  
ATOM 1759  N N    . ASN A 1 108 ? 38.388 -13.621 11.296 1.00 54.44 ? 108 ASN A N    1  
ATOM 1760  C CA   . ASN A 1 108 ? 39.040 -13.253 10.044 1.00 20.41 ? 108 ASN A CA   1  
ATOM 1761  C C    . ASN A 1 108 ? 38.823 -14.327 8.982  1.00 53.21 ? 108 ASN A C    1  
ATOM 1762  O O    . ASN A 1 108 ? 39.480 -14.326 7.942  1.00 51.13 ? 108 ASN A O    1  
ATOM 1763  C CB   . ASN A 1 108 ? 40.538 -13.039 10.269 1.00 1.04  ? 108 ASN A CB   1  
ATOM 1764  C CG   . ASN A 1 108 ? 40.839 -12.452 11.635 1.00 41.53 ? 108 ASN A CG   1  
ATOM 1765  O OD1  . ASN A 1 108 ? 40.971 -11.237 11.785 1.00 44.23 ? 108 ASN A OD1  1  
ATOM 1766  N ND2  . ASN A 1 108 ? 40.949 -13.314 12.639 1.00 41.15 ? 108 ASN A ND2  1  
ATOM 1767  H H    . ASN A 1 108 ? 38.836 -14.245 11.903 1.00 63.52 ? 108 ASN A H    1  
ATOM 1768  H HA   . ASN A 1 108 ? 38.601 -12.329 9.700  1.00 31.03 ? 108 ASN A HA   1  
ATOM 1769  H HB2  . ASN A 1 108 ? 41.048 -13.988 10.187 1.00 33.12 ? 108 ASN A HB2  1  
ATOM 1770  H HB3  . ASN A 1 108 ? 40.917 -12.365 9.516  1.00 60.11 ? 108 ASN A HB3  1  
ATOM 1771  H HD21 . ASN A 1 108 ? 40.832 -14.268 12.445 1.00 54.40 ? 108 ASN A HD21 1  
ATOM 1772  H HD22 . ASN A 1 108 ? 41.143 -12.961 13.532 1.00 33.21 ? 108 ASN A HD22 1  
ATOM 1773  N N    . GLU A 1 109 ? 37.896 -15.240 9.253  1.00 74.35 ? 109 GLU A N    1  
ATOM 1774  C CA   . GLU A 1 109 ? 37.592 -16.319 8.320  1.00 62.32 ? 109 GLU A CA   1  
ATOM 1775  C C    . GLU A 1 109 ? 36.106 -16.336 7.972  1.00 65.02 ? 109 GLU A C    1  
ATOM 1776  O O    . GLU A 1 109 ? 35.692 -16.965 6.997  1.00 24.22 ? 109 GLU A O    1  
ATOM 1777  C CB   . GLU A 1 109 ? 38.003 -17.668 8.914  1.00 2.03  ? 109 GLU A CB   1  
ATOM 1778  C CG   . GLU A 1 109 ? 39.505 -17.827 9.082  1.00 71.12 ? 109 GLU A CG   1  
ATOM 1779  C CD   . GLU A 1 109 ? 39.945 -19.278 9.053  1.00 53.02 ? 109 GLU A CD   1  
ATOM 1780  O OE1  . GLU A 1 109 ? 39.166 -20.142 9.508  1.00 65.30 ? 109 GLU A OE1  1  
ATOM 1781  O OE2  . GLU A 1 109 ? 41.066 -19.549 8.576  1.00 62.24 ? 109 GLU A OE2  1  
ATOM 1782  H H    . GLU A 1 109 ? 37.405 -15.188 10.099 1.00 11.31 ? 109 GLU A H    1  
ATOM 1783  H HA   . GLU A 1 109 ? 38.159 -16.147 7.417  1.00 12.34 ? 109 GLU A HA   1  
ATOM 1784  H HB2  . GLU A 1 109 ? 37.540 -17.777 9.884  1.00 54.22 ? 109 GLU A HB2  1  
ATOM 1785  H HB3  . GLU A 1 109 ? 37.649 -18.456 8.266  1.00 42.10 ? 109 GLU A HB3  1  
ATOM 1786  H HG2  . GLU A 1 109 ? 40.001 -17.301 8.281  1.00 45.45 ? 109 GLU A HG2  1  
ATOM 1787  H HG3  . GLU A 1 109 ? 39.796 -17.397 10.029 1.00 43.34 ? 109 GLU A HG3  1  
ATOM 1788  N N    . LEU A 1 110 ? 35.309 -15.641 8.775  1.00 20.15 ? 110 LEU A N    1  
ATOM 1789  C CA   . LEU A 1 110 ? 33.869 -15.576 8.554  1.00 14.51 ? 110 LEU A CA   1  
ATOM 1790  C C    . LEU A 1 110 ? 33.556 -15.170 7.117  1.00 4.43  ? 110 LEU A C    1  
ATOM 1791  O O    . LEU A 1 110 ? 32.513 -15.531 6.572  1.00 2.24  ? 110 LEU A O    1  
ATOM 1792  C CB   . LEU A 1 110 ? 33.228 -14.584 9.527  1.00 71.01 ? 110 LEU A CB   1  
ATOM 1793  C CG   . LEU A 1 110 ? 33.916 -13.224 9.650  1.00 25.41 ? 110 LEU A CG   1  
ATOM 1794  C CD1  . LEU A 1 110 ? 33.537 -12.326 8.483  1.00 31.12 ? 110 LEU A CD1  1  
ATOM 1795  C CD2  . LEU A 1 110 ? 33.558 -12.563 10.973 1.00 24.11 ? 110 LEU A CD2  1  
ATOM 1796  H H    . LEU A 1 110 ? 35.697 -15.160 9.536  1.00 71.42 ? 110 LEU A H    1  
ATOM 1797  H HA   . LEU A 1 110 ? 33.461 -16.559 8.734  1.00 13.14 ? 110 LEU A HA   1  
ATOM 1798  H HB2  . LEU A 1 110 ? 32.213 -14.412 9.203  1.00 31.21 ? 110 LEU A HB2  1  
ATOM 1799  H HB3  . LEU A 1 110 ? 33.219 -15.042 10.506 1.00 0.41  ? 110 LEU A HB3  1  
ATOM 1800  H HG   . LEU A 1 110 ? 34.988 -13.367 9.626  1.00 61.12 ? 110 LEU A HG   1  
ATOM 1801  H HD11 . LEU A 1 110 ? 33.371 -11.322 8.842  1.00 55.45 ? 110 LEU A HD11 1  
ATOM 1802  H HD12 . LEU A 1 110 ? 32.634 -12.698 8.022  1.00 41.14 ? 110 LEU A HD12 1  
ATOM 1803  H HD13 . LEU A 1 110 ? 34.337 -12.322 7.757  1.00 74.30 ? 110 LEU A HD13 1  
ATOM 1804  H HD21 . LEU A 1 110 ? 32.736 -13.094 11.429 1.00 20.13 ? 110 LEU A HD21 1  
ATOM 1805  H HD22 . LEU A 1 110 ? 33.270 -11.537 10.796 1.00 1.11  ? 110 LEU A HD22 1  
ATOM 1806  H HD23 . LEU A 1 110 ? 34.414 -12.589 11.632 1.00 72.05 ? 110 LEU A HD23 1  
ATOM 1807  N N    . ASP A 1 111 ? 34.468 -14.419 6.509  1.00 51.11 ? 111 ASP A N    1  
ATOM 1808  C CA   . ASP A 1 111 ? 34.292 -13.966 5.134  1.00 72.52 ? 111 ASP A CA   1  
ATOM 1809  C C    . ASP A 1 111 ? 34.016 -15.145 4.205  1.00 12.12 ? 111 ASP A C    1  
ATOM 1810  O O    . ASP A 1 111 ? 33.299 -15.013 3.213  1.00 34.11 ? 111 ASP A O    1  
ATOM 1811  C CB   . ASP A 1 111 ? 35.533 -13.208 4.661  1.00 70.21 ? 111 ASP A CB   1  
ATOM 1812  C CG   . ASP A 1 111 ? 35.516 -12.944 3.168  1.00 24.40 ? 111 ASP A CG   1  
ATOM 1813  O OD1  . ASP A 1 111 ? 36.352 -13.534 2.452  1.00 64.34 ? 111 ASP A OD1  1  
ATOM 1814  O OD2  . ASP A 1 111 ? 34.667 -12.149 2.716  1.00 50.20 ? 111 ASP A OD2  1  
ATOM 1815  H H    . ASP A 1 111 ? 35.279 -14.163 6.996  1.00 23.42 ? 111 ASP A H    1  
ATOM 1816  H HA   . ASP A 1 111 ? 33.443 -13.300 5.110  1.00 2.42  ? 111 ASP A HA   1  
ATOM 1817  H HB2  . ASP A 1 111 ? 35.585 -12.259 5.174  1.00 34.15 ? 111 ASP A HB2  1  
ATOM 1818  H HB3  . ASP A 1 111 ? 36.413 -13.789 4.896  1.00 12.33 ? 111 ASP A HB3  1  
ATOM 1819  N N    . LYS A 1 112 ? 34.591 -16.297 4.533  1.00 72.01 ? 112 LYS A N    1  
ATOM 1820  C CA   . LYS A 1 112 ? 34.408 -17.500 3.729  1.00 13.14 ? 112 LYS A CA   1  
ATOM 1821  C C    . LYS A 1 112 ? 32.943 -17.924 3.711  1.00 33.45 ? 112 LYS A C    1  
ATOM 1822  O O    . LYS A 1 112 ? 32.508 -18.654 2.820  1.00 61.44 ? 112 LYS A O    1  
ATOM 1823  C CB   . LYS A 1 112 ? 35.273 -18.639 4.274  1.00 11.41 ? 112 LYS A CB   1  
ATOM 1824  C CG   . LYS A 1 112 ? 34.854 -20.012 3.778  1.00 43.43 ? 112 LYS A CG   1  
ATOM 1825  C CD   . LYS A 1 112 ? 33.877 -20.676 4.733  1.00 50.11 ? 112 LYS A CD   1  
ATOM 1826  C CE   . LYS A 1 112 ? 34.519 -21.845 5.464  1.00 43.11 ? 112 LYS A CE   1  
ATOM 1827  N NZ   . LYS A 1 112 ? 34.617 -23.053 4.599  1.00 30.54 ? 112 LYS A NZ   1  
ATOM 1828  H H    . LYS A 1 112 ? 35.152 -16.340 5.336  1.00 11.40 ? 112 LYS A H    1  
ATOM 1829  H HA   . LYS A 1 112 ? 34.717 -17.275 2.720  1.00 23.01 ? 112 LYS A HA   1  
ATOM 1830  H HB2  . LYS A 1 112 ? 36.298 -18.469 3.979  1.00 52.13 ? 112 LYS A HB2  1  
ATOM 1831  H HB3  . LYS A 1 112 ? 35.213 -18.635 5.353  1.00 22.51 ? 112 LYS A HB3  1  
ATOM 1832  H HG2  . LYS A 1 112 ? 34.382 -19.907 2.812  1.00 23.01 ? 112 LYS A HG2  1  
ATOM 1833  H HG3  . LYS A 1 112 ? 35.733 -20.634 3.685  1.00 20.24 ? 112 LYS A HG3  1  
ATOM 1834  H HD2  . LYS A 1 112 ? 33.547 -19.949 5.460  1.00 1.01  ? 112 LYS A HD2  1  
ATOM 1835  H HD3  . LYS A 1 112 ? 33.027 -21.037 4.171  1.00 41.00 ? 112 LYS A HD3  1  
ATOM 1836  H HE2  . LYS A 1 112 ? 35.511 -21.556 5.777  1.00 52.31 ? 112 LYS A HE2  1  
ATOM 1837  H HE3  . LYS A 1 112 ? 33.922 -22.081 6.332  1.00 3.04  ? 112 LYS A HE3  1  
ATOM 1838  H HZ1  . LYS A 1 112 ? 34.420 -23.909 5.158  1.00 43.41 ? 112 LYS A HZ1  1  
ATOM 1839  H HZ2  . LYS A 1 112 ? 35.573 -23.129 4.197  1.00 52.41 ? 112 LYS A HZ2  1  
ATOM 1840  H HZ3  . LYS A 1 112 ? 33.929 -22.994 3.822  1.00 13.23 ? 112 LYS A HZ3  1  
ATOM 1841  N N    . LEU A 1 113 ? 32.185 -17.462 4.700  1.00 25.02 ? 113 LEU A N    1  
ATOM 1842  C CA   . LEU A 1 113 ? 30.768 -17.793 4.797  1.00 11.41 ? 113 LEU A CA   1  
ATOM 1843  C C    . LEU A 1 113 ? 29.914 -16.743 4.093  1.00 5.51  ? 113 LEU A C    1  
ATOM 1844  O O    . LEU A 1 113 ? 28.857 -16.354 4.588  1.00 62.51 ? 113 LEU A O    1  
ATOM 1845  C CB   . LEU A 1 113 ? 30.350 -17.906 6.264  1.00 33.41 ? 113 LEU A CB   1  
ATOM 1846  C CG   . LEU A 1 113 ? 31.201 -18.831 7.135  1.00 3.30  ? 113 LEU A CG   1  
ATOM 1847  C CD1  . LEU A 1 113 ? 31.559 -18.148 8.446  1.00 22.52 ? 113 LEU A CD1  1  
ATOM 1848  C CD2  . LEU A 1 113 ? 30.471 -20.140 7.395  1.00 24.41 ? 113 LEU A CD2  1  
ATOM 1849  H H    . LEU A 1 113 ? 32.588 -16.885 5.381  1.00 10.45 ? 113 LEU A H    1  
ATOM 1850  H HA   . LEU A 1 113 ? 30.616 -18.746 4.313  1.00 43.10 ? 113 LEU A HA   1  
ATOM 1851  H HB2  . LEU A 1 113 ? 30.387 -16.918 6.696  1.00 22.21 ? 113 LEU A HB2  1  
ATOM 1852  H HB3  . LEU A 1 113 ? 29.332 -18.270 6.290  1.00 63.32 ? 113 LEU A HB3  1  
ATOM 1853  H HG   . LEU A 1 113 ? 32.122 -19.057 6.615  1.00 20.42 ? 113 LEU A HG   1  
ATOM 1854  H HD11 . LEU A 1 113 ? 31.486 -17.078 8.327  1.00 61.23 ? 113 LEU A HD11 1  
ATOM 1855  H HD12 . LEU A 1 113 ? 32.569 -18.412 8.725  1.00 51.41 ? 113 LEU A HD12 1  
ATOM 1856  H HD13 . LEU A 1 113 ? 30.877 -18.473 9.219  1.00 40.35 ? 113 LEU A HD13 1  
ATOM 1857  H HD21 . LEU A 1 113 ? 30.493 -20.360 8.452  1.00 32.13 ? 113 LEU A HD21 1  
ATOM 1858  H HD22 . LEU A 1 113 ? 30.958 -20.938 6.852  1.00 2.30  ? 113 LEU A HD22 1  
ATOM 1859  H HD23 . LEU A 1 113 ? 29.447 -20.053 7.066  1.00 52.12 ? 113 LEU A HD23 1  
ATOM 1860  N N    . ASN A 1 114 ? 30.381 -16.288 2.934  1.00 32.33 ? 114 ASN A N    1  
ATOM 1861  C CA   . ASN A 1 114 ? 29.659 -15.284 2.161  1.00 63.10 ? 114 ASN A CA   1  
ATOM 1862  C C    . ASN A 1 114 ? 28.173 -15.296 2.506  1.00 61.32 ? 114 ASN A C    1  
ATOM 1863  O O    . ASN A 1 114 ? 27.439 -16.198 2.101  1.00 2.10  ? 114 ASN A O    1  
ATOM 1864  C CB   . ASN A 1 114 ? 29.849 -15.531 0.663  1.00 53.11 ? 114 ASN A CB   1  
ATOM 1865  C CG   . ASN A 1 114 ? 29.850 -14.244 -0.139 1.00 72.14 ? 114 ASN A CG   1  
ATOM 1866  O OD1  . ASN A 1 114 ? 29.692 -13.155 0.413  1.00 72.13 ? 114 ASN A OD1  1  
ATOM 1867  N ND2  . ASN A 1 114 ? 30.028 -14.364 -1.450 1.00 24.22 ? 114 ASN A ND2  1  
ATOM 1868  H H    . ASN A 1 114 ? 31.230 -16.636 2.591  1.00 22.11 ? 114 ASN A H    1  
ATOM 1869  H HA   . ASN A 1 114 ? 30.067 -14.317 2.412  1.00 43.32 ? 114 ASN A HA   1  
ATOM 1870  H HB2  . ASN A 1 114 ? 30.792 -16.032 0.503  1.00 22.55 ? 114 ASN A HB2  1  
ATOM 1871  H HB3  . ASN A 1 114 ? 29.047 -16.158 0.303  1.00 40.12 ? 114 ASN A HB3  1  
ATOM 1872  H HD21 . ASN A 1 114 ? 30.148 -15.264 -1.821 1.00 12.34 ? 114 ASN A HD21 1  
ATOM 1873  H HD22 . ASN A 1 114 ? 30.034 -13.548 -1.992 1.00 62.24 ? 114 ASN A HD22 1  
ATOM 1874  N N    . TRP A 1 115 ? 27.737 -14.290 3.255  1.00 62.03 ? 115 TRP A N    1  
ATOM 1875  C CA   . TRP A 1 115 ? 26.338 -14.184 3.654  1.00 63.54 ? 115 TRP A CA   1  
ATOM 1876  C C    . TRP A 1 115 ? 25.572 -13.263 2.712  1.00 53.52 ? 115 TRP A C    1  
ATOM 1877  O O    . TRP A 1 115 ? 26.156 -12.641 1.825  1.00 63.21 ? 115 TRP A O    1  
ATOM 1878  C CB   . TRP A 1 115 ? 26.234 -13.668 5.090  1.00 74.34 ? 115 TRP A CB   1  
ATOM 1879  C CG   . TRP A 1 115 ? 27.339 -14.154 5.977  1.00 4.54  ? 115 TRP A CG   1  
ATOM 1880  C CD1  . TRP A 1 115 ? 28.630 -13.708 5.997  1.00 1.41  ? 115 TRP A CD1  1  
ATOM 1881  C CD2  . TRP A 1 115 ? 27.252 -15.179 6.972  1.00 30.25 ? 115 TRP A CD2  1  
ATOM 1882  N NE1  . TRP A 1 115 ? 29.350 -14.394 6.945  1.00 63.34 ? 115 TRP A NE1  1  
ATOM 1883  C CE2  . TRP A 1 115 ? 28.528 -15.302 7.557  1.00 14.14 ? 115 TRP A CE2  1  
ATOM 1884  C CE3  . TRP A 1 115 ? 26.220 -16.004 7.428  1.00 62.21 ? 115 TRP A CE3  1  
ATOM 1885  C CZ2  . TRP A 1 115 ? 28.796 -16.217 8.572  1.00 60.12 ? 115 TRP A CZ2  1  
ATOM 1886  C CZ3  . TRP A 1 115 ? 26.488 -16.912 8.434  1.00 23.15 ? 115 TRP A CZ3  1  
ATOM 1887  C CH2  . TRP A 1 115 ? 27.767 -17.012 8.998  1.00 22.31 ? 115 TRP A CH2  1  
ATOM 1888  H H    . TRP A 1 115 ? 28.371 -13.601 3.547  1.00 71.33 ? 115 TRP A H    1  
ATOM 1889  H HA   . TRP A 1 115 ? 25.905 -15.172 3.603  1.00 32.54 ? 115 TRP A HA   1  
ATOM 1890  H HB2  . TRP A 1 115 ? 26.263 -12.589 5.081  1.00 73.12 ? 115 TRP A HB2  1  
ATOM 1891  H HB3  . TRP A 1 115 ? 25.296 -13.996 5.515  1.00 72.15 ? 115 TRP A HB3  1  
ATOM 1892  H HD1  . TRP A 1 115 ? 29.014 -12.930 5.355  1.00 65.01 ? 115 TRP A HD1  1  
ATOM 1893  H HE1  . TRP A 1 115 ? 30.299 -14.255 7.149  1.00 0.11  ? 115 TRP A HE1  1  
ATOM 1894  H HE3  . TRP A 1 115 ? 25.228 -15.942 7.006  1.00 12.21 ? 115 TRP A HE3  1  
ATOM 1895  H HZ2  . TRP A 1 115 ? 29.776 -16.306 9.017  1.00 44.12 ? 115 TRP A HZ2  1  
ATOM 1896  H HZ3  . TRP A 1 115 ? 25.703 -17.559 8.799  1.00 43.50 ? 115 TRP A HZ3  1  
ATOM 1897  H HH2  . TRP A 1 115 ? 27.931 -17.736 9.782  1.00 42.42 ? 115 TRP A HH2  1  
ATOM 1898  N N    . ALA A 1 116 ? 24.260 -13.178 2.910  1.00 23.34 ? 116 ALA A N    1  
ATOM 1899  C CA   . ALA A 1 116 ? 23.415 -12.330 2.080  1.00 72.13 ? 116 ALA A CA   1  
ATOM 1900  C C    . ALA A 1 116 ? 23.963 -10.909 2.010  1.00 50.21 ? 116 ALA A C    1  
ATOM 1901  O O    . ALA A 1 116 ? 24.841 -10.518 2.779  1.00 12.34 ? 116 ALA A O    1  
ATOM 1902  C CB   . ALA A 1 116 ? 21.989 -12.323 2.612  1.00 5.51  ? 116 ALA A CB   1  
ATOM 1903  H H    . ALA A 1 116 ? 23.852 -13.698 3.634  1.00 62.12 ? 116 ALA A H    1  
ATOM 1904  H HA   . ALA A 1 116 ? 23.399 -12.748 1.083  1.00 34.34 ? 116 ALA A HA   1  
ATOM 1905  H HB1  . ALA A 1 116 ? 21.319 -12.688 1.848  1.00 71.30 ? 116 ALA A HB1  1  
ATOM 1906  H HB2  . ALA A 1 116 ? 21.927 -12.960 3.482  1.00 51.54 ? 116 ALA A HB2  1  
ATOM 1907  H HB3  . ALA A 1 116 ? 21.712 -11.315 2.883  1.00 50.24 ? 116 ALA A HB3  1  
ATOM 1908  N N    . PRO A 1 117 ? 23.435 -10.116 1.065  1.00 2.14  ? 117 PRO A N    1  
ATOM 1909  C CA   . PRO A 1 117 ? 23.857 -8.725  0.873  1.00 63.43 ? 117 PRO A CA   1  
ATOM 1910  C C    . PRO A 1 117 ? 23.414 -7.821  2.018  1.00 65.12 ? 117 PRO A C    1  
ATOM 1911  O O    . PRO A 1 117 ? 23.927 -6.714  2.181  1.00 70.31 ? 117 PRO A O    1  
ATOM 1912  C CB   . PRO A 1 117 ? 23.161 -8.320  -0.429 1.00 35.33 ? 117 PRO A CB   1  
ATOM 1913  C CG   . PRO A 1 117 ? 21.972 -9.214  -0.516 1.00 71.20 ? 117 PRO A CG   1  
ATOM 1914  C CD   . PRO A 1 117 ? 22.385 -10.516 0.113  1.00 4.33  ? 117 PRO A CD   1  
ATOM 1915  H HA   . PRO A 1 117 ? 24.928 -8.649  0.749  1.00 73.23 ? 117 PRO A HA   1  
ATOM 1916  H HB2  . PRO A 1 117 ? 22.871 -7.280  -0.376 1.00 73.21 ? 117 PRO A HB2  1  
ATOM 1917  H HB3  . PRO A 1 117 ? 23.830 -8.472  -1.262 1.00 0.41  ? 117 PRO A HB3  1  
ATOM 1918  H HG2  . PRO A 1 117 ? 21.146 -8.781  0.027  1.00 52.12 ? 117 PRO A HG2  1  
ATOM 1919  H HG3  . PRO A 1 117 ? 21.704 -9.367  -1.551 1.00 34.41 ? 117 PRO A HG3  1  
ATOM 1920  H HD2  . PRO A 1 117 ? 21.551 -10.968 0.627  1.00 34.44 ? 117 PRO A HD2  1  
ATOM 1921  H HD3  . PRO A 1 117 ? 22.780 -11.188 -0.634 1.00 51.15 ? 117 PRO A HD3  1  
ATOM 1922  N N    . ALA A 1 118 ? 22.460 -8.300  2.809  1.00 72.13 ? 118 ALA A N    1  
ATOM 1923  C CA   . ALA A 1 118 ? 21.950 -7.536  3.940  1.00 2.43  ? 118 ALA A CA   1  
ATOM 1924  C C    . ALA A 1 118 ? 22.767 -7.808  5.199  1.00 15.11 ? 118 ALA A C    1  
ATOM 1925  O O    . ALA A 1 118 ? 22.908 -6.938  6.059  1.00 62.12 ? 118 ALA A O    1  
ATOM 1926  C CB   . ALA A 1 118 ? 20.483 -7.861  4.179  1.00 23.24 ? 118 ALA A CB   1  
ATOM 1927  H H    . ALA A 1 118 ? 22.091 -9.189  2.628  1.00 73.44 ? 118 ALA A H    1  
ATOM 1928  H HA   . ALA A 1 118 ? 22.025 -6.486  3.695  1.00 41.12 ? 118 ALA A HA   1  
ATOM 1929  H HB1  . ALA A 1 118 ? 19.962 -6.966  4.485  1.00 52.42 ? 118 ALA A HB1  1  
ATOM 1930  H HB2  . ALA A 1 118 ? 20.046 -8.240  3.268  1.00 74.11 ? 118 ALA A HB2  1  
ATOM 1931  H HB3  . ALA A 1 118 ? 20.402 -8.607  4.956  1.00 64.45 ? 118 ALA A HB3  1  
ATOM 1932  N N    . ASP A 1 119 ? 23.301 -9.020  5.302  1.00 55.15 ? 119 ASP A N    1  
ATOM 1933  C CA   . ASP A 1 119 ? 24.103 -9.407  6.456  1.00 44.32 ? 119 ASP A CA   1  
ATOM 1934  C C    . ASP A 1 119 ? 25.588 -9.180  6.186  1.00 73.42 ? 119 ASP A C    1  
ATOM 1935  O O    . ASP A 1 119 ? 26.380 -9.023  7.115  1.00 44.32 ? 119 ASP A O    1  
ATOM 1936  C CB   . ASP A 1 119 ? 23.854 -10.874 6.809  1.00 44.04 ? 119 ASP A CB   1  
ATOM 1937  C CG   . ASP A 1 119 ? 22.579 -11.070 7.604  1.00 54.22 ? 119 ASP A CG   1  
ATOM 1938  O OD1  . ASP A 1 119 ? 21.578 -11.531 7.016  1.00 33.32 ? 119 ASP A OD1  1  
ATOM 1939  O OD2  . ASP A 1 119 ? 22.581 -10.762 8.814  1.00 63.30 ? 119 ASP A OD2  1  
ATOM 1940  H H    . ASP A 1 119 ? 23.152 -9.670  4.583  1.00 71.00 ? 119 ASP A H    1  
ATOM 1941  H HA   . ASP A 1 119 ? 23.804 -8.790  7.290  1.00 41.13 ? 119 ASP A HA   1  
ATOM 1942  H HB2  . ASP A 1 119 ? 23.780 -11.449 5.897  1.00 31.10 ? 119 ASP A HB2  1  
ATOM 1943  H HB3  . ASP A 1 119 ? 24.683 -11.242 7.395  1.00 63.10 ? 119 ASP A HB3  1  
ATOM 1944  N N    . ILE A 1 120 ? 25.956 -9.167  4.909  1.00 2.23  ? 120 ILE A N    1  
ATOM 1945  C CA   . ILE A 1 120 ? 27.345 -8.960  4.518  1.00 51.02 ? 120 ILE A CA   1  
ATOM 1946  C C    . ILE A 1 120 ? 27.961 -7.788  5.275  1.00 72.31 ? 120 ILE A C    1  
ATOM 1947  O O    . ILE A 1 120 ? 28.994 -7.916  5.932  1.00 42.10 ? 120 ILE A O    1  
ATOM 1948  C CB   . ILE A 1 120 ? 27.471 -8.702  3.005  1.00 52.03 ? 120 ILE A CB   1  
ATOM 1949  C CG1  . ILE A 1 120 ? 27.644 -10.023 2.253  1.00 71.24 ? 120 ILE A CG1  1  
ATOM 1950  C CG2  . ILE A 1 120 ? 28.638 -7.768  2.722  1.00 63.40 ? 120 ILE A CG2  1  
ATOM 1951  C CD1  . ILE A 1 120 ? 27.136 -9.979  0.829  1.00 52.24 ? 120 ILE A CD1  1  
ATOM 1952  H H    . ILE A 1 120 ? 25.278 -9.298  4.215  1.00 62.25 ? 120 ILE A H    1  
ATOM 1953  H HA   . ILE A 1 120 ? 27.896 -9.859  4.757  1.00 54.53 ? 120 ILE A HA   1  
ATOM 1954  H HB   . ILE A 1 120 ? 26.566 -8.220  2.668  1.00 51.02 ? 120 ILE A HB   1  
ATOM 1955  H HG12 . ILE A 1 120 ? 28.691 -10.279 2.223  1.00 42.34 ? 120 ILE A HG12 1  
ATOM 1956  H HG13 . ILE A 1 120 ? 27.103 -10.799 2.775  1.00 61.32 ? 120 ILE A HG13 1  
ATOM 1957  H HG21 . ILE A 1 120 ? 29.492 -8.072  3.310  1.00 41.41 ? 120 ILE A HG21 1  
ATOM 1958  H HG22 . ILE A 1 120 ? 28.890 -7.815  1.673  1.00 0.01  ? 120 ILE A HG22 1  
ATOM 1959  H HG23 . ILE A 1 120 ? 28.363 -6.758  2.982  1.00 13.41 ? 120 ILE A HG23 1  
ATOM 1960  H HD11 . ILE A 1 120 ? 26.907 -8.958  0.559  1.00 30.31 ? 120 ILE A HD11 1  
ATOM 1961  H HD12 . ILE A 1 120 ? 27.892 -10.367 0.164  1.00 43.05 ? 120 ILE A HD12 1  
ATOM 1962  H HD13 . ILE A 1 120 ? 26.242 -10.581 0.747  1.00 52.43 ? 120 ILE A HD13 1  
ATOM 1963  N N    . PRO A 1 121 ? 27.312 -6.618  5.184  1.00 73.13 ? 121 PRO A N    1  
ATOM 1964  C CA   . PRO A 1 121 ? 27.776 -5.401  5.856  1.00 40.23 ? 121 PRO A CA   1  
ATOM 1965  C C    . PRO A 1 121 ? 27.622 -5.480  7.371  1.00 72.24 ? 121 PRO A C    1  
ATOM 1966  O O    . PRO A 1 121 ? 28.242 -4.715  8.108  1.00 50.40 ? 121 PRO A O    1  
ATOM 1967  C CB   . PRO A 1 121 ? 26.868 -4.311  5.282  1.00 14.50 ? 121 PRO A CB   1  
ATOM 1968  C CG   . PRO A 1 121 ? 25.630 -5.028  4.866  1.00 22.43 ? 121 PRO A CG   1  
ATOM 1969  C CD   . PRO A 1 121 ? 26.074 -6.393  4.418  1.00 21.30 ? 121 PRO A CD   1  
ATOM 1970  H HA   . PRO A 1 121 ? 28.805 -5.180  5.611  1.00 72.32 ? 121 PRO A HA   1  
ATOM 1971  H HB2  . PRO A 1 121 ? 26.660 -3.573  6.045  1.00 63.12 ? 121 PRO A HB2  1  
ATOM 1972  H HB3  . PRO A 1 121 ? 27.352 -3.839  4.440  1.00 20.32 ? 121 PRO A HB3  1  
ATOM 1973  H HG2  . PRO A 1 121 ? 24.954 -5.110  5.704  1.00 61.23 ? 121 PRO A HG2  1  
ATOM 1974  H HG3  . PRO A 1 121 ? 25.157 -4.502  4.051  1.00 43.15 ? 121 PRO A HG3  1  
ATOM 1975  H HD2  . PRO A 1 121 ? 25.328 -7.133  4.666  1.00 74.32 ? 121 PRO A HD2  1  
ATOM 1976  H HD3  . PRO A 1 121 ? 26.273 -6.396  3.356  1.00 13.24 ? 121 PRO A HD3  1  
ATOM 1977  N N    . ALA A 1 122 ? 26.791 -6.411  7.828  1.00 24.43 ? 122 ALA A N    1  
ATOM 1978  C CA   . ALA A 1 122 ? 26.558 -6.592  9.256  1.00 41.03 ? 122 ALA A CA   1  
ATOM 1979  C C    . ALA A 1 122 ? 27.628 -7.482  9.879  1.00 44.23 ? 122 ALA A C    1  
ATOM 1980  O O    . ALA A 1 122 ? 27.974 -7.327  11.050 1.00 33.42 ? 122 ALA A O    1  
ATOM 1981  C CB   . ALA A 1 122 ? 25.175 -7.180  9.494  1.00 24.42 ? 122 ALA A CB   1  
ATOM 1982  H H    . ALA A 1 122 ? 26.326 -6.992  7.191  1.00 52.43 ? 122 ALA A H    1  
ATOM 1983  H HA   . ALA A 1 122 ? 26.594 -5.620  9.726  1.00 45.55 ? 122 ALA A HA   1  
ATOM 1984  H HB1  . ALA A 1 122 ? 24.735 -6.721  10.368 1.00 64.14 ? 122 ALA A HB1  1  
ATOM 1985  H HB2  . ALA A 1 122 ? 24.551 -6.991  8.634  1.00 33.31 ? 122 ALA A HB2  1  
ATOM 1986  H HB3  . ALA A 1 122 ? 25.260 -8.245  9.651  1.00 31.33 ? 122 ALA A HB3  1  
ATOM 1987  N N    . VAL A 1 123 ? 28.150 -8.414  9.088  1.00 70.40 ? 123 VAL A N    1  
ATOM 1988  C CA   . VAL A 1 123 ? 29.182 -9.329  9.562  1.00 33.11 ? 123 VAL A CA   1  
ATOM 1989  C C    . VAL A 1 123 ? 30.557 -8.672  9.527  1.00 70.23 ? 123 VAL A C    1  
ATOM 1990  O O    . VAL A 1 123 ? 31.396 -8.918  10.393 1.00 54.34 ? 123 VAL A O    1  
ATOM 1991  C CB   . VAL A 1 123 ? 29.219 -10.618 8.720  1.00 32.31 ? 123 VAL A CB   1  
ATOM 1992  C CG1  . VAL A 1 123 ? 30.485 -11.409 9.010  1.00 21.43 ? 123 VAL A CG1  1  
ATOM 1993  C CG2  . VAL A 1 123 ? 27.981 -11.462 8.984  1.00 71.12 ? 123 VAL A CG2  1  
ATOM 1994  H H    . VAL A 1 123 ? 27.834 -8.488  8.163  1.00 31.44 ? 123 VAL A H    1  
ATOM 1995  H HA   . VAL A 1 123 ? 28.947 -9.597  10.582 1.00 4.12  ? 123 VAL A HA   1  
ATOM 1996  H HB   . VAL A 1 123 ? 29.225 -10.342 7.676  1.00 72.11 ? 123 VAL A HB   1  
ATOM 1997  H HG11 . VAL A 1 123 ? 30.885 -11.110 9.968  1.00 13.11 ? 123 VAL A HG11 1  
ATOM 1998  H HG12 . VAL A 1 123 ? 30.255 -12.465 9.029  1.00 55.52 ? 123 VAL A HG12 1  
ATOM 1999  H HG13 . VAL A 1 123 ? 31.216 -11.214 8.239  1.00 10.23 ? 123 VAL A HG13 1  
ATOM 2000  H HG21 . VAL A 1 123 ? 27.592 -11.232 9.964  1.00 35.03 ? 123 VAL A HG21 1  
ATOM 2001  H HG22 . VAL A 1 123 ? 27.230 -11.244 8.238  1.00 0.41  ? 123 VAL A HG22 1  
ATOM 2002  H HG23 . VAL A 1 123 ? 28.241 -12.509 8.936  1.00 42.14 ? 123 VAL A HG23 1  
ATOM 2003  N N    . ASN A 1 124 ? 30.781 -7.835  8.519  1.00 21.00 ? 124 ASN A N    1  
ATOM 2004  C CA   . ASN A 1 124 ? 32.056 -7.142  8.370  1.00 14.23 ? 124 ASN A CA   1  
ATOM 2005  C C    . ASN A 1 124 ? 32.355 -6.286  9.597  1.00 44.52 ? 124 ASN A C    1  
ATOM 2006  O O    . ASN A 1 124 ? 33.510 -6.139  9.999  1.00 50.15 ? 124 ASN A O    1  
ATOM 2007  C CB   . ASN A 1 124 ? 32.041 -6.267  7.115  1.00 34.10 ? 124 ASN A CB   1  
ATOM 2008  C CG   . ASN A 1 124 ? 32.067 -7.086  5.839  1.00 31.41 ? 124 ASN A CG   1  
ATOM 2009  O OD1  . ASN A 1 124 ? 32.309 -8.293  5.868  1.00 60.10 ? 124 ASN A OD1  1  
ATOM 2010  N ND2  . ASN A 1 124 ? 31.817 -6.432  4.711  1.00 62.12 ? 124 ASN A ND2  1  
ATOM 2011  H H    . ASN A 1 124 ? 30.073 -7.680  7.860  1.00 40.25 ? 124 ASN A H    1  
ATOM 2012  H HA   . ASN A 1 124 ? 32.829 -7.888  8.269  1.00 72.31 ? 124 ASN A HA   1  
ATOM 2013  H HB2  . ASN A 1 124 ? 31.144 -5.664  7.114  1.00 30.53 ? 124 ASN A HB2  1  
ATOM 2014  H HB3  . ASN A 1 124 ? 32.905 -5.620  7.124  1.00 54.22 ? 124 ASN A HB3  1  
ATOM 2015  H HD21 . ASN A 1 124 ? 31.633 -5.471  4.764  1.00 54.12 ? 124 ASN A HD21 1  
ATOM 2016  H HD22 . ASN A 1 124 ? 31.827 -6.938  3.871  1.00 2.53  ? 124 ASN A HD22 1  
ATOM 2017  N N    . LYS A 1 125 ? 31.308 -5.722  10.189 1.00 53.04 ? 125 LYS A N    1  
ATOM 2018  C CA   . LYS A 1 125 ? 31.457 -4.881  11.371 1.00 74.53 ? 125 LYS A CA   1  
ATOM 2019  C C    . LYS A 1 125 ? 32.130 -5.650  12.503 1.00 13.14 ? 125 LYS A C    1  
ATOM 2020  O O    . LYS A 1 125 ? 32.979 -5.110  13.213 1.00 63.12 ? 125 LYS A O    1  
ATOM 2021  C CB   . LYS A 1 125 ? 30.091 -4.366  11.831 1.00 71.42 ? 125 LYS A CB   1  
ATOM 2022  C CG   . LYS A 1 125 ? 30.163 -3.445  13.036 1.00 51.20 ? 125 LYS A CG   1  
ATOM 2023  C CD   . LYS A 1 125 ? 29.268 -3.931  14.164 1.00 54.54 ? 125 LYS A CD   1  
ATOM 2024  C CE   . LYS A 1 125 ? 27.979 -3.126  14.238 1.00 74.44 ? 125 LYS A CE   1  
ATOM 2025  N NZ   . LYS A 1 125 ? 27.703 -2.647  15.620 1.00 14.02 ? 125 LYS A NZ   1  
ATOM 2026  H H    . LYS A 1 125 ? 30.412 -5.876  9.821  1.00 35.15 ? 125 LYS A H    1  
ATOM 2027  H HA   . LYS A 1 125 ? 32.078 -4.040  11.104 1.00 72.25 ? 125 LYS A HA   1  
ATOM 2028  H HB2  . LYS A 1 125 ? 29.631 -3.825  11.017 1.00 32.50 ? 125 LYS A HB2  1  
ATOM 2029  H HB3  . LYS A 1 125 ? 29.468 -5.212  12.087 1.00 5.31  ? 125 LYS A HB3  1  
ATOM 2030  H HG2  . LYS A 1 125 ? 31.182 -3.409  13.390 1.00 23.23 ? 125 LYS A HG2  1  
ATOM 2031  H HG3  . LYS A 1 125 ? 29.848 -2.454  12.740 1.00 70.35 ? 125 LYS A HG3  1  
ATOM 2032  H HD2  . LYS A 1 125 ? 29.022 -4.968  13.995 1.00 33.41 ? 125 LYS A HD2  1  
ATOM 2033  H HD3  . LYS A 1 125 ? 29.798 -3.832  15.100 1.00 13.24 ? 125 LYS A HD3  1  
ATOM 2034  H HE2  . LYS A 1 125 ? 28.063 -2.274  13.581 1.00 70.54 ? 125 LYS A HE2  1  
ATOM 2035  H HE3  . LYS A 1 125 ? 27.161 -3.752  13.912 1.00 35.14 ? 125 LYS A HE3  1  
ATOM 2036  H HZ1  . LYS A 1 125 ? 26.748 -2.938  15.915 1.00 44.21 ? 125 LYS A HZ1  1  
ATOM 2037  H HZ2  . LYS A 1 125 ? 27.763 -1.610  15.657 1.00 2.44  ? 125 LYS A HZ2  1  
ATOM 2038  H HZ3  . LYS A 1 125 ? 28.396 -3.048  16.283 1.00 61.31 ? 125 LYS A HZ3  1  
ATOM 2039  N N    . ILE A 1 126 ? 31.746 -6.912  12.666 1.00 10.52 ? 126 ILE A N    1  
ATOM 2040  C CA   . ILE A 1 126 ? 32.315 -7.754  13.711 1.00 51.20 ? 126 ILE A CA   1  
ATOM 2041  C C    . ILE A 1 126 ? 33.839 -7.735  13.663 1.00 31.11 ? 126 ILE A C    1  
ATOM 2042  O O    . ILE A 1 126 ? 34.501 -7.597  14.691 1.00 34.25 ? 126 ILE A O    1  
ATOM 2043  C CB   . ILE A 1 126 ? 31.826 -9.209  13.589 1.00 25.30 ? 126 ILE A CB   1  
ATOM 2044  C CG1  . ILE A 1 126 ? 30.300 -9.267  13.677 1.00 60.00 ? 126 ILE A CG1  1  
ATOM 2045  C CG2  . ILE A 1 126 ? 32.458 -10.072 14.671 1.00 32.23 ? 126 ILE A CG2  1  
ATOM 2046  C CD1  . ILE A 1 126 ? 29.694 -10.427 12.918 1.00 45.22 ? 126 ILE A CD1  1  
ATOM 2047  H H    . ILE A 1 126 ? 31.065 -7.285  12.069 1.00 12.12 ? 126 ILE A H    1  
ATOM 2048  H HA   . ILE A 1 126 ? 31.991 -7.365  14.666 1.00 55.04 ? 126 ILE A HA   1  
ATOM 2049  H HB   . ILE A 1 126 ? 32.139 -9.591  12.629 1.00 24.35 ? 126 ILE A HB   1  
ATOM 2050  H HG12 . ILE A 1 126 ? 30.008 -9.360  14.711 1.00 4.01  ? 126 ILE A HG12 1  
ATOM 2051  H HG13 . ILE A 1 126 ? 29.889 -8.353  13.272 1.00 30.51 ? 126 ILE A HG13 1  
ATOM 2052  H HG21 . ILE A 1 126 ? 33.533 -10.048 14.570 1.00 52.53 ? 126 ILE A HG21 1  
ATOM 2053  H HG22 . ILE A 1 126 ? 32.180 -9.691  15.643 1.00 62.15 ? 126 ILE A HG22 1  
ATOM 2054  H HG23 . ILE A 1 126 ? 32.110 -11.089 14.570 1.00 31.10 ? 126 ILE A HG23 1  
ATOM 2055  H HD11 . ILE A 1 126 ? 28.626 -10.289 12.841 1.00 20.03 ? 126 ILE A HD11 1  
ATOM 2056  H HD12 . ILE A 1 126 ? 30.124 -10.474 11.929 1.00 62.03 ? 126 ILE A HD12 1  
ATOM 2057  H HD13 . ILE A 1 126 ? 29.901 -11.348 13.444 1.00 73.11 ? 126 ILE A HD13 1  
ATOM 2058  N N    . MET A 1 127 ? 34.389 -7.873  12.461 1.00 24.13 ? 127 MET A N    1  
ATOM 2059  C CA   . MET A 1 127 ? 35.836 -7.869  12.279 1.00 43.11 ? 127 MET A CA   1  
ATOM 2060  C C    . MET A 1 127 ? 36.466 -6.654  12.952 1.00 14.44 ? 127 MET A C    1  
ATOM 2061  O O    . MET A 1 127 ? 37.583 -6.724  13.466 1.00 52.12 ? 127 MET A O    1  
ATOM 2062  C CB   . MET A 1 127 ? 36.184 -7.878  10.789 1.00 30.11 ? 127 MET A CB   1  
ATOM 2063  C CG   . MET A 1 127 ? 36.439 -9.270  10.233 1.00 3.42  ? 127 MET A CG   1  
ATOM 2064  S SD   . MET A 1 127 ? 38.188 -9.586  9.930  1.00 23.42 ? 127 MET A SD   1  
ATOM 2065  C CE   . MET A 1 127 ? 38.900 -9.083  11.495 1.00 53.41 ? 127 MET A CE   1  
ATOM 2066  H H    . MET A 1 127 ? 33.810 -7.979  11.678 1.00 33.43 ? 127 MET A H    1  
ATOM 2067  H HA   . MET A 1 127 ? 36.230 -8.764  12.737 1.00 42.22 ? 127 MET A HA   1  
ATOM 2068  H HB2  . MET A 1 127 ? 35.366 -7.438  10.238 1.00 23.20 ? 127 MET A HB2  1  
ATOM 2069  H HB3  . MET A 1 127 ? 37.073 -7.284  10.635 1.00 75.21 ? 127 MET A HB3  1  
ATOM 2070  H HG2  . MET A 1 127 ? 36.074 -9.999  10.941 1.00 1.31  ? 127 MET A HG2  1  
ATOM 2071  H HG3  . MET A 1 127 ? 35.902 -9.374  9.302  1.00 33.25 ? 127 MET A HG3  1  
ATOM 2072  H HE1  . MET A 1 127 ? 39.973 -9.195  11.455 1.00 0.34  ? 127 MET A HE1  1  
ATOM 2073  H HE2  . MET A 1 127 ? 38.652 -8.049  11.686 1.00 3.12  ? 127 MET A HE2  1  
ATOM 2074  H HE3  . MET A 1 127 ? 38.502 -9.701  12.287 1.00 71.15 ? 127 MET A HE3  1  
ATOM 2075  N N    . THR A 1 128 ? 35.742 -5.538  12.947 1.00 71.30 ? 128 THR A N    1  
ATOM 2076  C CA   . THR A 1 128 ? 36.230 -4.307  13.556 1.00 70.42 ? 128 THR A CA   1  
ATOM 2077  C C    . THR A 1 128 ? 36.719 -4.554  14.978 1.00 22.03 ? 128 THR A C    1  
ATOM 2078  O O    . THR A 1 128 ? 37.661 -3.910  15.440 1.00 35.24 ? 128 THR A O    1  
ATOM 2079  C CB   . THR A 1 128 ? 35.137 -3.222  13.582 1.00 44.13 ? 128 THR A CB   1  
ATOM 2080  O OG1  . THR A 1 128 ? 34.510 -3.127  12.298 1.00 63.21 ? 128 THR A OG1  1  
ATOM 2081  C CG2  . THR A 1 128 ? 35.725 -1.872  13.966 1.00 73.23 ? 128 THR A CG2  1  
ATOM 2082  H H    . THR A 1 128 ? 34.859 -5.545  12.522 1.00 31.11 ? 128 THR A H    1  
ATOM 2083  H HA   . THR A 1 128 ? 37.055 -3.945  12.959 1.00 14.44 ? 128 THR A HA   1  
ATOM 2084  H HB   . THR A 1 128 ? 34.395 -3.497  14.317 1.00 20.32 ? 128 THR A HB   1  
ATOM 2085  H HG1  . THR A 1 128 ? 33.899 -2.386  12.294 1.00 63.31 ? 128 THR A HG1  1  
ATOM 2086  H HG21 . THR A 1 128 ? 36.756 -1.825  13.649 1.00 40.12 ? 128 THR A HG21 1  
ATOM 2087  H HG22 . THR A 1 128 ? 35.671 -1.748  15.037 1.00 11.00 ? 128 THR A HG22 1  
ATOM 2088  H HG23 . THR A 1 128 ? 35.164 -1.086  13.483 1.00 10.24 ? 128 THR A HG23 1  
ATOM 2089  N N    . GLU A 1 129 ? 36.074 -5.490  15.667 1.00 23.41 ? 129 GLU A N    1  
ATOM 2090  C CA   . GLU A 1 129 ? 36.445 -5.821  17.038 1.00 63.00 ? 129 GLU A CA   1  
ATOM 2091  C C    . GLU A 1 129 ? 37.887 -6.317  17.107 1.00 52.10 ? 129 GLU A C    1  
ATOM 2092  O O    . GLU A 1 129 ? 38.654 -5.910  17.978 1.00 12.24 ? 129 GLU A O    1  
ATOM 2093  C CB   . GLU A 1 129 ? 35.501 -6.884  17.603 1.00 21.12 ? 129 GLU A CB   1  
ATOM 2094  C CG   . GLU A 1 129 ? 35.772 -7.227  19.059 1.00 53.25 ? 129 GLU A CG   1  
ATOM 2095  C CD   . GLU A 1 129 ? 34.609 -7.946  19.714 1.00 22.44 ? 129 GLU A CD   1  
ATOM 2096  O OE1  . GLU A 1 129 ? 34.641 -9.194  19.772 1.00 54.43 ? 129 GLU A OE1  1  
ATOM 2097  O OE2  . GLU A 1 129 ? 33.669 -7.263  20.170 1.00 74.12 ? 129 GLU A OE2  1  
ATOM 2098  H H    . GLU A 1 129 ? 35.332 -5.969  15.244 1.00 74.52 ? 129 GLU A H    1  
ATOM 2099  H HA   . GLU A 1 129 ? 36.358 -4.923  17.631 1.00 74.30 ? 129 GLU A HA   1  
ATOM 2100  H HB2  . GLU A 1 129 ? 34.485 -6.526  17.521 1.00 23.45 ? 129 GLU A HB2  1  
ATOM 2101  H HB3  . GLU A 1 129 ? 35.603 -7.786  17.018 1.00 23.11 ? 129 GLU A HB3  1  
ATOM 2102  H HG2  . GLU A 1 129 ? 36.643 -7.862  19.110 1.00 61.35 ? 129 GLU A HG2  1  
ATOM 2103  H HG3  . GLU A 1 129 ? 35.962 -6.312  19.601 1.00 63.40 ? 129 GLU A HG3  1  
ATOM 2104  N N    . GLY A 1 130 ? 38.248 -7.200  16.181 1.00 73.21 ? 130 GLY A N    1  
ATOM 2105  C CA   . GLY A 1 130 ? 39.595 -7.738  16.154 1.00 22.32 ? 130 GLY A CA   1  
ATOM 2106  C C    . GLY A 1 130 ? 39.926 -8.536  17.400 1.00 73.32 ? 130 GLY A C    1  
ATOM 2107  O O    . GLY A 1 130 ? 41.076 -8.920  17.612 1.00 31.01 ? 130 GLY A O    1  
ATOM 2108  H H    . GLY A 1 130 ? 37.594 -7.489  15.511 1.00 55.15 ? 130 GLY A H    1  
ATOM 2109  H HA2  . GLY A 1 130 ? 39.698 -8.379  15.291 1.00 44.31 ? 130 GLY A HA2  1  
ATOM 2110  H HA3  . GLY A 1 130 ? 40.295 -6.920  16.069 1.00 65.33 ? 130 GLY A HA3  1  
ATOM 2111  N N    . MET A 1 1   ? 3.534  0.212   0.975  1.00 71.12 ? 1   MET A N    2  
ATOM 2112  C CA   . MET A 1 1   ? 3.056  -0.127  -0.361 1.00 4.51  ? 1   MET A CA   2  
ATOM 2113  C C    . MET A 1 1   ? 3.160  -1.628  -0.611 1.00 42.43 ? 1   MET A C    2  
ATOM 2114  O O    . MET A 1 1   ? 2.149  -2.326  -0.689 1.00 22.12 ? 1   MET A O    2  
ATOM 2115  C CB   . MET A 1 1   ? 3.856  0.635   -1.420 1.00 14.52 ? 1   MET A CB   2  
ATOM 2116  C CG   . MET A 1 1   ? 3.752  2.146   -1.289 1.00 4.35  ? 1   MET A CG   2  
ATOM 2117  S SD   . MET A 1 1   ? 2.098  2.764   -1.653 1.00 61.25 ? 1   MET A SD   2  
ATOM 2118  C CE   . MET A 1 1   ? 1.767  3.734   -0.185 1.00 2.21  ? 1   MET A CE   2  
ATOM 2119  H H1   . MET A 1 1   ? 4.487  0.114   1.180  1.00 3.11  ? 1   MET A H1   2  
ATOM 2120  H HA   . MET A 1 1   ? 2.019  0.167   -0.426 1.00 23.42 ? 1   MET A HA   2  
ATOM 2121  H HB2  . MET A 1 1   ? 4.896  0.359   -1.337 1.00 30.33 ? 1   MET A HB2  2  
ATOM 2122  H HB3  . MET A 1 1   ? 3.494  0.356   -2.398 1.00 32.41 ? 1   MET A HB3  2  
ATOM 2123  H HG2  . MET A 1 1   ? 4.010  2.425   -0.278 1.00 13.44 ? 1   MET A HG2  2  
ATOM 2124  H HG3  . MET A 1 1   ? 4.452  2.602   -1.974 1.00 75.42 ? 1   MET A HG3  2  
ATOM 2125  H HE1  . MET A 1 1   ? 1.743  3.085   0.678  1.00 51.11 ? 1   MET A HE1  2  
ATOM 2126  H HE2  . MET A 1 1   ? 2.546  4.472   -0.059 1.00 15.15 ? 1   MET A HE2  2  
ATOM 2127  H HE3  . MET A 1 1   ? 0.813  4.230   -0.289 1.00 42.51 ? 1   MET A HE3  2  
ATOM 2128  N N    . LYS A 1 2   ? 4.389  -2.118  -0.738 1.00 35.34 ? 2   LYS A N    2  
ATOM 2129  C CA   . LYS A 1 2   ? 4.625  -3.537  -0.978 1.00 44.33 ? 2   LYS A CA   2  
ATOM 2130  C C    . LYS A 1 2   ? 4.514  -4.334  0.317  1.00 23.40 ? 2   LYS A C    2  
ATOM 2131  O O    . LYS A 1 2   ? 4.075  -3.815  1.343  1.00 52.51 ? 2   LYS A O    2  
ATOM 2132  C CB   . LYS A 1 2   ? 6.007  -3.745  -1.601 1.00 64.54 ? 2   LYS A CB   2  
ATOM 2133  C CG   . LYS A 1 2   ? 6.292  -2.822  -2.773 1.00 4.42  ? 2   LYS A CG   2  
ATOM 2134  C CD   . LYS A 1 2   ? 5.444  -3.176  -3.982 1.00 75.32 ? 2   LYS A CD   2  
ATOM 2135  C CE   . LYS A 1 2   ? 5.808  -2.324  -5.188 1.00 73.01 ? 2   LYS A CE   2  
ATOM 2136  N NZ   . LYS A 1 2   ? 5.249  -2.882  -6.451 1.00 15.33 ? 2   LYS A NZ   2  
ATOM 2137  H H    . LYS A 1 2   ? 5.155  -1.511  -0.666 1.00 63.01 ? 2   LYS A H    2  
ATOM 2138  H HA   . LYS A 1 2   ? 3.872  -3.886  -1.668 1.00 63.41 ? 2   LYS A HA   2  
ATOM 2139  H HB2  . LYS A 1 2   ? 6.759  -3.576  -0.845 1.00 25.11 ? 2   LYS A HB2  2  
ATOM 2140  H HB3  . LYS A 1 2   ? 6.082  -4.766  -1.949 1.00 30.13 ? 2   LYS A HB3  2  
ATOM 2141  H HG2  . LYS A 1 2   ? 6.075  -1.805  -2.480 1.00 32.45 ? 2   LYS A HG2  2  
ATOM 2142  H HG3  . LYS A 1 2   ? 7.336  -2.906  -3.040 1.00 3.50  ? 2   LYS A HG3  2  
ATOM 2143  H HD2  . LYS A 1 2   ? 5.601  -4.216  -4.230 1.00 10.44 ? 2   LYS A HD2  2  
ATOM 2144  H HD3  . LYS A 1 2   ? 4.402  -3.016  -3.740 1.00 4.22  ? 2   LYS A HD3  2  
ATOM 2145  H HE2  . LYS A 1 2   ? 5.417  -1.329  -5.040 1.00 42.13 ? 2   LYS A HE2  2  
ATOM 2146  H HE3  . LYS A 1 2   ? 6.884  -2.280  -5.269 1.00 52.04 ? 2   LYS A HE3  2  
ATOM 2147  H HZ1  . LYS A 1 2   ? 5.587  -2.330  -7.265 1.00 71.21 ? 2   LYS A HZ1  2  
ATOM 2148  H HZ2  . LYS A 1 2   ? 4.210  -2.844  -6.429 1.00 14.23 ? 2   LYS A HZ2  2  
ATOM 2149  H HZ3  . LYS A 1 2   ? 5.546  -3.871  -6.567 1.00 65.14 ? 2   LYS A HZ3  2  
ATOM 2150  N N    . LYS A 1 3   ? 4.917  -5.600  0.264  1.00 53.43 ? 3   LYS A N    2  
ATOM 2151  C CA   . LYS A 1 3   ? 4.865  -6.469  1.433  1.00 64.20 ? 3   LYS A CA   2  
ATOM 2152  C C    . LYS A 1 3   ? 6.096  -6.271  2.313  1.00 74.13 ? 3   LYS A C    2  
ATOM 2153  O O    . LYS A 1 3   ? 7.145  -6.868  2.073  1.00 63.01 ? 3   LYS A O    2  
ATOM 2154  C CB   . LYS A 1 3   ? 4.765  -7.934  1.001  1.00 52.22 ? 3   LYS A CB   2  
ATOM 2155  C CG   . LYS A 1 3   ? 3.409  -8.307  0.427  1.00 51.22 ? 3   LYS A CG   2  
ATOM 2156  C CD   . LYS A 1 3   ? 3.208  -9.813  0.405  1.00 12.21 ? 3   LYS A CD   2  
ATOM 2157  C CE   . LYS A 1 3   ? 2.821  -10.343 1.777  1.00 22.41 ? 3   LYS A CE   2  
ATOM 2158  N NZ   . LYS A 1 3   ? 1.502  -9.817  2.224  1.00 51.20 ? 3   LYS A NZ   2  
ATOM 2159  H H    . LYS A 1 3   ? 5.258  -5.957  -0.583 1.00 73.23 ? 3   LYS A H    2  
ATOM 2160  H HA   . LYS A 1 3   ? 3.985  -6.209  2.001  1.00 24.25 ? 3   LYS A HA   2  
ATOM 2161  H HB2  . LYS A 1 3   ? 5.516  -8.127  0.250  1.00 62.45 ? 3   LYS A HB2  2  
ATOM 2162  H HB3  . LYS A 1 3   ? 4.955  -8.563  1.858  1.00 32.42 ? 3   LYS A HB3  2  
ATOM 2163  H HG2  . LYS A 1 3   ? 2.636  -7.860  1.034  1.00 73.10 ? 3   LYS A HG2  2  
ATOM 2164  H HG3  . LYS A 1 3   ? 3.340  -7.929  -0.583 1.00 55.24 ? 3   LYS A HG3  2  
ATOM 2165  H HD2  . LYS A 1 3   ? 2.422  -10.052 -0.295 1.00 74.44 ? 3   LYS A HD2  2  
ATOM 2166  H HD3  . LYS A 1 3   ? 4.128  -10.286 0.092  1.00 51.42 ? 3   LYS A HD3  2  
ATOM 2167  H HE2  . LYS A 1 3   ? 2.772  -11.420 1.732  1.00 65.55 ? 3   LYS A HE2  2  
ATOM 2168  H HE3  . LYS A 1 3   ? 3.578  -10.047 2.489  1.00 35.21 ? 3   LYS A HE3  2  
ATOM 2169  H HZ1  . LYS A 1 3   ? 1.621  -8.881  2.661  1.00 11.45 ? 3   LYS A HZ1  2  
ATOM 2170  H HZ2  . LYS A 1 3   ? 1.078  -10.461 2.921  1.00 34.02 ? 3   LYS A HZ2  2  
ATOM 2171  H HZ3  . LYS A 1 3   ? 0.858  -9.729  1.412  1.00 63.00 ? 3   LYS A HZ3  2  
ATOM 2172  N N    . VAL A 1 4   ? 5.959  -5.430  3.333  1.00 32.32 ? 4   VAL A N    2  
ATOM 2173  C CA   . VAL A 1 4   ? 7.058  -5.156  4.250  1.00 4.14  ? 4   VAL A CA   2  
ATOM 2174  C C    . VAL A 1 4   ? 7.389  -6.381  5.095  1.00 74.52 ? 4   VAL A C    2  
ATOM 2175  O O    . VAL A 1 4   ? 6.670  -6.708  6.040  1.00 70.42 ? 4   VAL A O    2  
ATOM 2176  C CB   . VAL A 1 4   ? 6.729  -3.976  5.184  1.00 22.13 ? 4   VAL A CB   2  
ATOM 2177  C CG1  . VAL A 1 4   ? 5.373  -4.178  5.843  1.00 70.53 ? 4   VAL A CG1  2  
ATOM 2178  C CG2  . VAL A 1 4   ? 7.819  -3.806  6.231  1.00 3.25  ? 4   VAL A CG2  2  
ATOM 2179  H H    . VAL A 1 4   ? 5.097  -4.985  3.473  1.00 44.51 ? 4   VAL A H    2  
ATOM 2180  H HA   . VAL A 1 4   ? 7.925  -4.891  3.663  1.00 65.34 ? 4   VAL A HA   2  
ATOM 2181  H HB   . VAL A 1 4   ? 6.685  -3.075  4.591  1.00 44.22 ? 4   VAL A HB   2  
ATOM 2182  H HG11 . VAL A 1 4   ? 5.485  -4.135  6.916  1.00 35.53 ? 4   VAL A HG11 2  
ATOM 2183  H HG12 . VAL A 1 4   ? 4.696  -3.402  5.518  1.00 35.24 ? 4   VAL A HG12 2  
ATOM 2184  H HG13 . VAL A 1 4   ? 4.977  -5.143  5.561  1.00 31.23 ? 4   VAL A HG13 2  
ATOM 2185  H HG21 . VAL A 1 4   ? 8.029  -2.755  6.364  1.00 45.15 ? 4   VAL A HG21 2  
ATOM 2186  H HG22 . VAL A 1 4   ? 7.487  -4.227  7.170  1.00 42.15 ? 4   VAL A HG22 2  
ATOM 2187  H HG23 . VAL A 1 4   ? 8.714  -4.314  5.906  1.00 24.50 ? 4   VAL A HG23 2  
ATOM 2188  N N    . ILE A 1 5   ? 8.480  -7.055  4.748  1.00 30.41 ? 5   ILE A N    2  
ATOM 2189  C CA   . ILE A 1 5   ? 8.906  -8.244  5.476  1.00 63.34 ? 5   ILE A CA   2  
ATOM 2190  C C    . ILE A 1 5   ? 9.711  -7.871  6.716  1.00 14.11 ? 5   ILE A C    2  
ATOM 2191  O O    . ILE A 1 5   ? 10.594 -7.017  6.661  1.00 3.23  ? 5   ILE A O    2  
ATOM 2192  C CB   . ILE A 1 5   ? 9.755  -9.173  4.588  1.00 61.43 ? 5   ILE A CB   2  
ATOM 2193  C CG1  . ILE A 1 5   ? 9.160  -9.254  3.180  1.00 10.44 ? 5   ILE A CG1  2  
ATOM 2194  C CG2  . ILE A 1 5   ? 9.849  -10.559 5.209  1.00 60.13 ? 5   ILE A CG2  2  
ATOM 2195  C CD1  . ILE A 1 5   ? 7.743  -9.782  3.153  1.00 53.41 ? 5   ILE A CD1  2  
ATOM 2196  H H    . ILE A 1 5   ? 9.011  -6.745  3.986  1.00 63.22 ? 5   ILE A H    2  
ATOM 2197  H HA   . ILE A 1 5   ? 8.021  -8.782  5.782  1.00 32.52 ? 5   ILE A HA   2  
ATOM 2198  H HB   . ILE A 1 5   ? 10.752 -8.764  4.527  1.00 71.34 ? 5   ILE A HB   2  
ATOM 2199  H HG12 . ILE A 1 5   ? 9.155  -8.268  2.742  1.00 73.33 ? 5   ILE A HG12 2  
ATOM 2200  H HG13 . ILE A 1 5   ? 9.771  -9.909  2.576  1.00 11.13 ? 5   ILE A HG13 2  
ATOM 2201  H HG21 . ILE A 1 5   ? 10.187 -10.473 6.231  1.00 60.11 ? 5   ILE A HG21 2  
ATOM 2202  H HG22 . ILE A 1 5   ? 8.877  -11.028 5.190  1.00 14.14 ? 5   ILE A HG22 2  
ATOM 2203  H HG23 . ILE A 1 5   ? 10.549 -11.159 4.647  1.00 2.12  ? 5   ILE A HG23 2  
ATOM 2204  H HD11 . ILE A 1 5   ? 7.729  -10.751 2.678  1.00 35.50 ? 5   ILE A HD11 2  
ATOM 2205  H HD12 . ILE A 1 5   ? 7.371  -9.868  4.162  1.00 35.34 ? 5   ILE A HD12 2  
ATOM 2206  H HD13 . ILE A 1 5   ? 7.116  -9.100  2.596  1.00 73.13 ? 5   ILE A HD13 2  
ATOM 2207  N N    . ASN A 1 6   ? 9.399  -8.519  7.834  1.00 12.40 ? 6   ASN A N    2  
ATOM 2208  C CA   . ASN A 1 6   ? 10.094 -8.256  9.089  1.00 54.50 ? 6   ASN A CA   2  
ATOM 2209  C C    . ASN A 1 6   ? 10.774 -9.518  9.609  1.00 21.11 ? 6   ASN A C    2  
ATOM 2210  O O    . ASN A 1 6   ? 10.121 -10.409 10.152 1.00 24.35 ? 6   ASN A O    2  
ATOM 2211  C CB   . ASN A 1 6   ? 9.114  -7.722  10.136 1.00 30.34 ? 6   ASN A CB   2  
ATOM 2212  C CG   . ASN A 1 6   ? 9.760  -6.723  11.076 1.00 10.13 ? 6   ASN A CG   2  
ATOM 2213  O OD1  . ASN A 1 6   ? 10.839 -6.969  11.616 1.00 33.01 ? 6   ASN A OD1  2  
ATOM 2214  N ND2  . ASN A 1 6   ? 9.101  -5.588  11.276 1.00 13.45 ? 6   ASN A ND2  2  
ATOM 2215  H H    . ASN A 1 6   ? 8.684  -9.189  7.815  1.00 63.10 ? 6   ASN A H    2  
ATOM 2216  H HA   . ASN A 1 6   ? 10.847 -7.506  8.900  1.00 63.24 ? 6   ASN A HA   2  
ATOM 2217  H HB2  . ASN A 1 6   ? 8.290  -7.235  9.635  1.00 63.11 ? 6   ASN A HB2  2  
ATOM 2218  H HB3  . ASN A 1 6   ? 8.737  -8.548  10.721 1.00 14.42 ? 6   ASN A HB3  2  
ATOM 2219  H HD21 . ASN A 1 6   ? 8.247  -5.460  10.813 1.00 15.00 ? 6   ASN A HD21 2  
ATOM 2220  H HD22 . ASN A 1 6   ? 9.496  -4.923  11.879 1.00 70.40 ? 6   ASN A HD22 2  
ATOM 2221  N N    . VAL A 1 7   ? 12.091 -9.587  9.439  1.00 33.10 ? 7   VAL A N    2  
ATOM 2222  C CA   . VAL A 1 7   ? 12.861 -10.739 9.892  1.00 32.15 ? 7   VAL A CA   2  
ATOM 2223  C C    . VAL A 1 7   ? 14.050 -10.305 10.742 1.00 31.31 ? 7   VAL A C    2  
ATOM 2224  O O    . VAL A 1 7   ? 14.554 -9.191  10.601 1.00 65.34 ? 7   VAL A O    2  
ATOM 2225  C CB   . VAL A 1 7   ? 13.371 -11.576 8.704  1.00 32.14 ? 7   VAL A CB   2  
ATOM 2226  C CG1  . VAL A 1 7   ? 12.231 -12.367 8.080  1.00 44.11 ? 7   VAL A CG1  2  
ATOM 2227  C CG2  . VAL A 1 7   ? 14.039 -10.682 7.671  1.00 1.21  ? 7   VAL A CG2  2  
ATOM 2228  H H    . VAL A 1 7   ? 12.555 -8.845  8.999  1.00 62.02 ? 7   VAL A H    2  
ATOM 2229  H HA   . VAL A 1 7   ? 12.211 -11.361 10.491 1.00 53.21 ? 7   VAL A HA   2  
ATOM 2230  H HB   . VAL A 1 7   ? 14.106 -12.276 9.073  1.00 70.52 ? 7   VAL A HB   2  
ATOM 2231  H HG11 . VAL A 1 7   ? 12.378 -13.420 8.270  1.00 64.14 ? 7   VAL A HG11 2  
ATOM 2232  H HG12 . VAL A 1 7   ? 11.293 -12.049 8.511  1.00 25.43 ? 7   VAL A HG12 2  
ATOM 2233  H HG13 . VAL A 1 7   ? 12.215 -12.193 7.014  1.00 71.11 ? 7   VAL A HG13 2  
ATOM 2234  H HG21 . VAL A 1 7   ? 14.819 -10.105 8.146  1.00 71.22 ? 7   VAL A HG21 2  
ATOM 2235  H HG22 . VAL A 1 7   ? 14.468 -11.292 6.889  1.00 21.14 ? 7   VAL A HG22 2  
ATOM 2236  H HG23 . VAL A 1 7   ? 13.306 -10.014 7.244  1.00 31.01 ? 7   VAL A HG23 2  
ATOM 2237  N N    . VAL A 1 8   ? 14.494 -11.193 11.626 1.00 63.42 ? 8   VAL A N    2  
ATOM 2238  C CA   . VAL A 1 8   ? 15.626 -10.904 12.498 1.00 10.51 ? 8   VAL A CA   2  
ATOM 2239  C C    . VAL A 1 8   ? 16.569 -12.098 12.591 1.00 73.13 ? 8   VAL A C    2  
ATOM 2240  O O    . VAL A 1 8   ? 16.141 -13.248 12.501 1.00 61.14 ? 8   VAL A O    2  
ATOM 2241  C CB   . VAL A 1 8   ? 15.159 -10.521 13.915 1.00 32.21 ? 8   VAL A CB   2  
ATOM 2242  C CG1  . VAL A 1 8   ? 14.426 -11.683 14.568 1.00 63.52 ? 8   VAL A CG1  2  
ATOM 2243  C CG2  . VAL A 1 8   ? 16.341 -10.081 14.765 1.00 43.22 ? 8   VAL A CG2  2  
ATOM 2244  H H    . VAL A 1 8   ? 14.051 -12.065 11.692 1.00 52.30 ? 8   VAL A H    2  
ATOM 2245  H HA   . VAL A 1 8   ? 16.163 -10.065 12.080 1.00 4.53  ? 8   VAL A HA   2  
ATOM 2246  H HB   . VAL A 1 8   ? 14.472 -9.692  13.834 1.00 11.42 ? 8   VAL A HB   2  
ATOM 2247  H HG11 . VAL A 1 8   ? 13.591 -11.976 13.948 1.00 1.42  ? 8   VAL A HG11 2  
ATOM 2248  H HG12 . VAL A 1 8   ? 15.102 -12.518 14.680 1.00 65.30 ? 8   VAL A HG12 2  
ATOM 2249  H HG13 . VAL A 1 8   ? 14.064 -11.380 15.539 1.00 31.32 ? 8   VAL A HG13 2  
ATOM 2250  H HG21 . VAL A 1 8   ? 16.922 -10.946 15.047 1.00 5.13  ? 8   VAL A HG21 2  
ATOM 2251  H HG22 . VAL A 1 8   ? 16.960 -9.401  14.197 1.00 64.53 ? 8   VAL A HG22 2  
ATOM 2252  H HG23 . VAL A 1 8   ? 15.982 -9.582  15.653 1.00 74.45 ? 8   VAL A HG23 2  
ATOM 2253  N N    . GLY A 1 9   ? 17.856 -11.817 12.772 1.00 54.01 ? 9   GLY A N    2  
ATOM 2254  C CA   . GLY A 1 9   ? 18.840 -12.879 12.874 1.00 14.22 ? 9   GLY A CA   2  
ATOM 2255  C C    . GLY A 1 9   ? 19.557 -12.878 14.210 1.00 74.03 ? 9   GLY A C    2  
ATOM 2256  O O    . GLY A 1 9   ? 19.351 -11.986 15.032 1.00 51.43 ? 9   GLY A O    2  
ATOM 2257  H H    . GLY A 1 9   ? 18.139 -10.881 12.837 1.00 41.15 ? 9   GLY A H    2  
ATOM 2258  H HA2  . GLY A 1 9   ? 18.343 -13.829 12.744 1.00 11.34 ? 9   GLY A HA2  2  
ATOM 2259  H HA3  . GLY A 1 9   ? 19.569 -12.755 12.087 1.00 0.12  ? 9   GLY A HA3  2  
ATOM 2260  N N    . ALA A 1 10  ? 20.400 -13.882 14.427 1.00 12.04 ? 10  ALA A N    2  
ATOM 2261  C CA   . ALA A 1 10  ? 21.150 -13.993 15.672 1.00 33.43 ? 10  ALA A CA   2  
ATOM 2262  C C    . ALA A 1 10  ? 22.590 -14.419 15.409 1.00 22.12 ? 10  ALA A C    2  
ATOM 2263  O O    . ALA A 1 10  ? 22.843 -15.341 14.633 1.00 53.12 ? 10  ALA A O    2  
ATOM 2264  C CB   . ALA A 1 10  ? 20.470 -14.978 16.612 1.00 75.01 ? 10  ALA A CB   2  
ATOM 2265  H H    . ALA A 1 10  ? 20.521 -14.563 13.734 1.00 62.04 ? 10  ALA A H    2  
ATOM 2266  H HA   . ALA A 1 10  ? 21.153 -13.023 16.148 1.00 31.10 ? 10  ALA A HA   2  
ATOM 2267  H HB1  . ALA A 1 10  ? 19.571 -14.531 17.011 1.00 12.24 ? 10  ALA A HB1  2  
ATOM 2268  H HB2  . ALA A 1 10  ? 20.215 -15.876 16.069 1.00 13.10 ? 10  ALA A HB2  2  
ATOM 2269  H HB3  . ALA A 1 10  ? 21.140 -15.224 17.422 1.00 70.24 ? 10  ALA A HB3  2  
ATOM 2270  N N    . ILE A 1 11  ? 23.530 -13.742 16.060 1.00 64.24 ? 11  ILE A N    2  
ATOM 2271  C CA   . ILE A 1 11  ? 24.945 -14.051 15.896 1.00 64.45 ? 11  ILE A CA   2  
ATOM 2272  C C    . ILE A 1 11  ? 25.565 -14.507 17.212 1.00 11.34 ? 11  ILE A C    2  
ATOM 2273  O O    . ILE A 1 11  ? 25.992 -13.686 18.025 1.00 25.31 ? 11  ILE A O    2  
ATOM 2274  C CB   . ILE A 1 11  ? 25.729 -12.836 15.365 1.00 24.52 ? 11  ILE A CB   2  
ATOM 2275  C CG1  . ILE A 1 11  ? 25.260 -11.556 16.060 1.00 71.44 ? 11  ILE A CG1  2  
ATOM 2276  C CG2  . ILE A 1 11  ? 25.566 -12.718 13.857 1.00 1.03  ? 11  ILE A CG2  2  
ATOM 2277  C CD1  . ILE A 1 11  ? 26.004 -10.318 15.612 1.00 62.15 ? 11  ILE A CD1  2  
ATOM 2278  H H    . ILE A 1 11  ? 23.266 -13.018 16.665 1.00 64.34 ? 11  ILE A H    2  
ATOM 2279  H HA   . ILE A 1 11  ? 25.030 -14.852 15.174 1.00 12.25 ? 11  ILE A HA   2  
ATOM 2280  H HB   . ILE A 1 11  ? 26.776 -12.990 15.579 1.00 70.42 ? 11  ILE A HB   2  
ATOM 2281  H HG12 . ILE A 1 11  ? 24.212 -11.406 15.853 1.00 1.21  ? 11  ILE A HG12 2  
ATOM 2282  H HG13 . ILE A 1 11  ? 25.401 -11.662 17.126 1.00 50.23 ? 11  ILE A HG13 2  
ATOM 2283  H HG21 . ILE A 1 11  ? 25.584 -13.703 13.415 1.00 72.12 ? 11  ILE A HG21 2  
ATOM 2284  H HG22 . ILE A 1 11  ? 24.624 -12.241 13.634 1.00 34.11 ? 11  ILE A HG22 2  
ATOM 2285  H HG23 . ILE A 1 11  ? 26.374 -12.127 13.453 1.00 71.03 ? 11  ILE A HG23 2  
ATOM 2286  H HD11 . ILE A 1 11  ? 26.926 -10.607 15.129 1.00 5.43  ? 11  ILE A HD11 2  
ATOM 2287  H HD12 . ILE A 1 11  ? 25.393 -9.761  14.918 1.00 72.23 ? 11  ILE A HD12 2  
ATOM 2288  H HD13 . ILE A 1 11  ? 26.226 -9.701  16.471 1.00 62.23 ? 11  ILE A HD13 2  
ATOM 2289  N N    . ILE A 1 12  ? 25.611 -15.819 17.416 1.00 45.14 ? 12  ILE A N    2  
ATOM 2290  C CA   . ILE A 1 12  ? 26.182 -16.383 18.632 1.00 33.35 ? 12  ILE A CA   2  
ATOM 2291  C C    . ILE A 1 12  ? 27.703 -16.442 18.551 1.00 43.12 ? 12  ILE A C    2  
ATOM 2292  O O    . ILE A 1 12  ? 28.264 -17.134 17.701 1.00 30.20 ? 12  ILE A O    2  
ATOM 2293  C CB   . ILE A 1 12  ? 25.639 -17.798 18.905 1.00 74.50 ? 12  ILE A CB   2  
ATOM 2294  C CG1  . ILE A 1 12  ? 24.127 -17.752 19.136 1.00 31.43 ? 12  ILE A CG1  2  
ATOM 2295  C CG2  . ILE A 1 12  ? 26.345 -18.415 20.103 1.00 33.12 ? 12  ILE A CG2  2  
ATOM 2296  C CD1  . ILE A 1 12  ? 23.316 -17.959 17.876 1.00 42.01 ? 12  ILE A CD1  2  
ATOM 2297  H H    . ILE A 1 12  ? 25.255 -16.422 16.731 1.00 53.34 ? 12  ILE A H    2  
ATOM 2298  H HA   . ILE A 1 12  ? 25.900 -15.746 19.459 1.00 64.14 ? 12  ILE A HA   2  
ATOM 2299  H HB   . ILE A 1 12  ? 25.845 -18.412 18.041 1.00 1.42  ? 12  ILE A HB   2  
ATOM 2300  H HG12 . ILE A 1 12  ? 23.852 -18.525 19.837 1.00 64.23 ? 12  ILE A HG12 2  
ATOM 2301  H HG13 . ILE A 1 12  ? 23.863 -16.789 19.548 1.00 55.13 ? 12  ILE A HG13 2  
ATOM 2302  H HG21 . ILE A 1 12  ? 25.634 -18.980 20.688 1.00 11.34 ? 12  ILE A HG21 2  
ATOM 2303  H HG22 . ILE A 1 12  ? 27.129 -19.072 19.759 1.00 20.52 ? 12  ILE A HG22 2  
ATOM 2304  H HG23 . ILE A 1 12  ? 26.771 -17.632 20.712 1.00 24.41 ? 12  ILE A HG23 2  
ATOM 2305  H HD11 . ILE A 1 12  ? 22.513 -17.238 17.842 1.00 51.22 ? 12  ILE A HD11 2  
ATOM 2306  H HD12 . ILE A 1 12  ? 23.952 -17.832 17.013 1.00 4.02  ? 12  ILE A HD12 2  
ATOM 2307  H HD13 . ILE A 1 12  ? 22.902 -18.957 17.874 1.00 64.31 ? 12  ILE A HD13 2  
ATOM 2308  N N    . PHE A 1 13  ? 28.367 -15.712 19.441 1.00 13.22 ? 13  PHE A N    2  
ATOM 2309  C CA   . PHE A 1 13  ? 29.824 -15.681 19.471 1.00 43.11 ? 13  PHE A CA   2  
ATOM 2310  C C    . PHE A 1 13  ? 30.367 -16.625 20.540 1.00 14.45 ? 13  PHE A C    2  
ATOM 2311  O O    . PHE A 1 13  ? 29.842 -16.687 21.652 1.00 32.22 ? 13  PHE A O    2  
ATOM 2312  C CB   . PHE A 1 13  ? 30.320 -14.257 19.732 1.00 63.20 ? 13  PHE A CB   2  
ATOM 2313  C CG   . PHE A 1 13  ? 30.225 -13.360 18.532 1.00 53.45 ? 13  PHE A CG   2  
ATOM 2314  C CD1  . PHE A 1 13  ? 29.004 -12.838 18.135 1.00 34.15 ? 13  PHE A CD1  2  
ATOM 2315  C CD2  . PHE A 1 13  ? 31.356 -13.037 17.799 1.00 11.25 ? 13  PHE A CD2  2  
ATOM 2316  C CE1  . PHE A 1 13  ? 28.913 -12.013 17.031 1.00 51.52 ? 13  PHE A CE1  2  
ATOM 2317  C CE2  . PHE A 1 13  ? 31.271 -12.211 16.694 1.00 64.40 ? 13  PHE A CE2  2  
ATOM 2318  C CZ   . PHE A 1 13  ? 30.048 -11.698 16.310 1.00 43.21 ? 13  PHE A CZ   2  
ATOM 2319  H H    . PHE A 1 13  ? 27.864 -15.180 20.094 1.00 74.43 ? 13  PHE A H    2  
ATOM 2320  H HA   . PHE A 1 13  ? 30.182 -16.006 18.506 1.00 34.32 ? 13  PHE A HA   2  
ATOM 2321  H HB2  . PHE A 1 13  ? 29.731 -13.817 20.522 1.00 34.41 ? 13  PHE A HB2  2  
ATOM 2322  H HB3  . PHE A 1 13  ? 31.355 -14.295 20.038 1.00 13.25 ? 13  PHE A HB3  2  
ATOM 2323  H HD1  . PHE A 1 13  ? 28.115 -13.082 18.699 1.00 71.32 ? 13  PHE A HD1  2  
ATOM 2324  H HD2  . PHE A 1 13  ? 32.314 -13.438 18.100 1.00 72.24 ? 13  PHE A HD2  2  
ATOM 2325  H HE1  . PHE A 1 13  ? 27.955 -11.612 16.733 1.00 64.03 ? 13  PHE A HE1  2  
ATOM 2326  H HE2  . PHE A 1 13  ? 32.161 -11.967 16.133 1.00 62.52 ? 13  PHE A HE2  2  
ATOM 2327  H HZ   . PHE A 1 13  ? 29.980 -11.053 15.446 1.00 31.33 ? 13  PHE A HZ   2  
ATOM 2328  N N    . SER A 1 14  ? 31.420 -17.358 20.195 1.00 3.53  ? 14  SER A N    2  
ATOM 2329  C CA   . SER A 1 14  ? 32.032 -18.302 21.123 1.00 11.42 ? 14  SER A CA   2  
ATOM 2330  C C    . SER A 1 14  ? 33.473 -18.602 20.722 1.00 51.31 ? 14  SER A C    2  
ATOM 2331  O O    . SER A 1 14  ? 33.729 -19.152 19.651 1.00 72.03 ? 14  SER A O    2  
ATOM 2332  C CB   . SER A 1 14  ? 31.223 -19.599 21.171 1.00 71.22 ? 14  SER A CB   2  
ATOM 2333  O OG   . SER A 1 14  ? 30.987 -20.101 19.867 1.00 61.33 ? 14  SER A OG   2  
ATOM 2334  H H    . SER A 1 14  ? 31.794 -17.263 19.294 1.00 54.32 ? 14  SER A H    2  
ATOM 2335  H HA   . SER A 1 14  ? 32.030 -17.850 22.104 1.00 23.32 ? 14  SER A HA   2  
ATOM 2336  H HB2  . SER A 1 14  ? 31.768 -20.340 21.735 1.00 3.04  ? 14  SER A HB2  2  
ATOM 2337  H HB3  . SER A 1 14  ? 30.272 -19.410 21.648 1.00 24.24 ? 14  SER A HB3  2  
ATOM 2338  H HG   . SER A 1 14  ? 30.088 -20.432 19.808 1.00 13.44 ? 14  SER A HG   2  
ATOM 2339  N N    . ASP A 1 15  ? 34.410 -18.236 21.589 1.00 2.03  ? 15  ASP A N    2  
ATOM 2340  C CA   . ASP A 1 15  ? 35.826 -18.466 21.327 1.00 21.33 ? 15  ASP A CA   2  
ATOM 2341  C C    . ASP A 1 15  ? 36.261 -17.771 20.041 1.00 0.53  ? 15  ASP A C    2  
ATOM 2342  O O    . ASP A 1 15  ? 37.020 -18.327 19.249 1.00 5.24  ? 15  ASP A O    2  
ATOM 2343  C CB   . ASP A 1 15  ? 36.112 -19.966 21.232 1.00 12.23 ? 15  ASP A CB   2  
ATOM 2344  C CG   . ASP A 1 15  ? 36.233 -20.620 22.595 1.00 50.42 ? 15  ASP A CG   2  
ATOM 2345  O OD1  . ASP A 1 15  ? 37.348 -21.059 22.944 1.00 21.04 ? 15  ASP A OD1  2  
ATOM 2346  O OD2  . ASP A 1 15  ? 35.212 -20.693 23.311 1.00 3.31  ? 15  ASP A OD2  2  
ATOM 2347  H H    . ASP A 1 15  ? 34.143 -17.801 22.426 1.00 22.35 ? 15  ASP A H    2  
ATOM 2348  H HA   . ASP A 1 15  ? 36.387 -18.054 22.152 1.00 4.12  ? 15  ASP A HA   2  
ATOM 2349  H HB2  . ASP A 1 15  ? 35.307 -20.446 20.694 1.00 44.31 ? 15  ASP A HB2  2  
ATOM 2350  H HB3  . ASP A 1 15  ? 37.038 -20.116 20.697 1.00 53.01 ? 15  ASP A HB3  2  
ATOM 2351  N N    . ASN A 1 16  ? 35.773 -16.551 19.840 1.00 11.22 ? 16  ASN A N    2  
ATOM 2352  C CA   . ASN A 1 16  ? 36.110 -15.779 18.649 1.00 32.42 ? 16  ASN A CA   2  
ATOM 2353  C C    . ASN A 1 16  ? 35.711 -16.532 17.383 1.00 4.31  ? 16  ASN A C    2  
ATOM 2354  O O    . ASN A 1 16  ? 36.439 -16.527 16.390 1.00 73.13 ? 16  ASN A O    2  
ATOM 2355  C CB   . ASN A 1 16  ? 37.608 -15.472 18.623 1.00 43.43 ? 16  ASN A CB   2  
ATOM 2356  C CG   . ASN A 1 16  ? 38.005 -14.439 19.661 1.00 60.54 ? 16  ASN A CG   2  
ATOM 2357  O OD1  . ASN A 1 16  ? 37.402 -14.356 20.731 1.00 44.22 ? 16  ASN A OD1  2  
ATOM 2358  N ND2  . ASN A 1 16  ? 39.024 -13.647 19.348 1.00 74.15 ? 16  ASN A ND2  2  
ATOM 2359  H H    . ASN A 1 16  ? 35.172 -16.160 20.508 1.00 35.01 ? 16  ASN A H    2  
ATOM 2360  H HA   . ASN A 1 16  ? 35.561 -14.851 18.690 1.00 42.51 ? 16  ASN A HA   2  
ATOM 2361  H HB2  . ASN A 1 16  ? 38.160 -16.380 18.818 1.00 53.13 ? 16  ASN A HB2  2  
ATOM 2362  H HB3  . ASN A 1 16  ? 37.876 -15.095 17.647 1.00 73.53 ? 16  ASN A HB3  2  
ATOM 2363  H HD21 . ASN A 1 16  ? 39.456 -13.771 18.477 1.00 43.22 ? 16  ASN A HD21 2  
ATOM 2364  H HD22 . ASN A 1 16  ? 39.301 -12.971 20.001 1.00 65.34 ? 16  ASN A HD22 2  
ATOM 2365  N N    . LYS A 1 17  ? 34.551 -17.177 17.426 1.00 72.23 ? 17  LYS A N    2  
ATOM 2366  C CA   . LYS A 1 17  ? 34.053 -17.933 16.283 1.00 72.05 ? 17  LYS A CA   2  
ATOM 2367  C C    . LYS A 1 17  ? 32.556 -17.707 16.091 1.00 25.00 ? 17  LYS A C    2  
ATOM 2368  O O    . LYS A 1 17  ? 31.841 -17.387 17.041 1.00 43.31 ? 17  LYS A O    2  
ATOM 2369  C CB   . LYS A 1 17  ? 34.334 -19.426 16.470 1.00 10.42 ? 17  LYS A CB   2  
ATOM 2370  C CG   . LYS A 1 17  ? 35.594 -19.900 15.768 1.00 63.13 ? 17  LYS A CG   2  
ATOM 2371  C CD   . LYS A 1 17  ? 36.708 -20.194 16.759 1.00 71.43 ? 17  LYS A CD   2  
ATOM 2372  C CE   . LYS A 1 17  ? 37.812 -21.026 16.125 1.00 23.52 ? 17  LYS A CE   2  
ATOM 2373  N NZ   . LYS A 1 17  ? 37.544 -22.487 16.243 1.00 11.52 ? 17  LYS A NZ   2  
ATOM 2374  H H    . LYS A 1 17  ? 34.015 -17.144 18.246 1.00 2.35  ? 17  LYS A H    2  
ATOM 2375  H HA   . LYS A 1 17  ? 34.573 -17.585 15.403 1.00 73.21 ? 17  LYS A HA   2  
ATOM 2376  H HB2  . LYS A 1 17  ? 34.436 -19.630 17.526 1.00 62.53 ? 17  LYS A HB2  2  
ATOM 2377  H HB3  . LYS A 1 17  ? 33.497 -19.989 16.082 1.00 3.24  ? 17  LYS A HB3  2  
ATOM 2378  H HG2  . LYS A 1 17  ? 35.371 -20.801 15.216 1.00 32.10 ? 17  LYS A HG2  2  
ATOM 2379  H HG3  . LYS A 1 17  ? 35.926 -19.131 15.085 1.00 2.30  ? 17  LYS A HG3  2  
ATOM 2380  H HD2  . LYS A 1 17  ? 37.128 -19.261 17.103 1.00 64.15 ? 17  LYS A HD2  2  
ATOM 2381  H HD3  . LYS A 1 17  ? 36.297 -20.737 17.598 1.00 33.03 ? 17  LYS A HD3  2  
ATOM 2382  H HE2  . LYS A 1 17  ? 37.887 -20.766 15.081 1.00 71.35 ? 17  LYS A HE2  2  
ATOM 2383  H HE3  . LYS A 1 17  ? 38.745 -20.799 16.620 1.00 30.31 ? 17  LYS A HE3  2  
ATOM 2384  H HZ1  . LYS A 1 17  ? 37.249 -22.871 15.323 1.00 54.33 ? 17  LYS A HZ1  2  
ATOM 2385  H HZ2  . LYS A 1 17  ? 36.787 -22.656 16.935 1.00 13.24 ? 17  LYS A HZ2  2  
ATOM 2386  H HZ3  . LYS A 1 17  ? 38.402 -22.984 16.555 1.00 1.23  ? 17  LYS A HZ3  2  
ATOM 2387  N N    . ILE A 1 18  ? 32.090 -17.877 14.859 1.00 60.24 ? 18  ILE A N    2  
ATOM 2388  C CA   . ILE A 1 18  ? 30.679 -17.694 14.544 1.00 35.15 ? 18  ILE A CA   2  
ATOM 2389  C C    . ILE A 1 18  ? 30.013 -19.024 14.209 1.00 70.51 ? 18  ILE A C    2  
ATOM 2390  O O    . ILE A 1 18  ? 30.654 -19.938 13.688 1.00 41.04 ? 18  ILE A O    2  
ATOM 2391  C CB   . ILE A 1 18  ? 30.486 -16.724 13.364 1.00 73.22 ? 18  ILE A CB   2  
ATOM 2392  C CG1  . ILE A 1 18  ? 31.258 -15.426 13.610 1.00 35.33 ? 18  ILE A CG1  2  
ATOM 2393  C CG2  . ILE A 1 18  ? 29.007 -16.435 13.152 1.00 61.43 ? 18  ILE A CG2  2  
ATOM 2394  C CD1  . ILE A 1 18  ? 32.682 -15.465 13.103 1.00 51.32 ? 18  ILE A CD1  2  
ATOM 2395  H H    . ILE A 1 18  ? 32.710 -18.133 14.144 1.00 54.51 ? 18  ILE A H    2  
ATOM 2396  H HA   . ILE A 1 18  ? 30.196 -17.272 15.414 1.00 10.41 ? 18  ILE A HA   2  
ATOM 2397  H HB   . ILE A 1 18  ? 30.867 -17.198 12.472 1.00 11.40 ? 18  ILE A HB   2  
ATOM 2398  H HG12 . ILE A 1 18  ? 30.751 -14.614 13.114 1.00 0.31  ? 18  ILE A HG12 2  
ATOM 2399  H HG13 . ILE A 1 18  ? 31.288 -15.231 14.673 1.00 40.14 ? 18  ILE A HG13 2  
ATOM 2400  H HG21 . ILE A 1 18  ? 28.466 -16.640 14.064 1.00 71.44 ? 18  ILE A HG21 2  
ATOM 2401  H HG22 . ILE A 1 18  ? 28.878 -15.398 12.883 1.00 4.45  ? 18  ILE A HG22 2  
ATOM 2402  H HG23 . ILE A 1 18  ? 28.628 -17.062 12.359 1.00 35.41 ? 18  ILE A HG23 2  
ATOM 2403  H HD11 . ILE A 1 18  ? 33.007 -14.462 12.866 1.00 63.40 ? 18  ILE A HD11 2  
ATOM 2404  H HD12 . ILE A 1 18  ? 33.324 -15.883 13.863 1.00 44.23 ? 18  ILE A HD12 2  
ATOM 2405  H HD13 . ILE A 1 18  ? 32.731 -16.077 12.214 1.00 73.23 ? 18  ILE A HD13 2  
ATOM 2406  N N    . LEU A 1 19  ? 28.723 -19.127 14.509 1.00 0.43  ? 19  LEU A N    2  
ATOM 2407  C CA   . LEU A 1 19  ? 27.968 -20.345 14.238 1.00 64.22 ? 19  LEU A CA   2  
ATOM 2408  C C    . LEU A 1 19  ? 27.216 -20.237 12.915 1.00 5.21  ? 19  LEU A C    2  
ATOM 2409  O O    . LEU A 1 19  ? 27.017 -19.140 12.391 1.00 23.20 ? 19  LEU A O    2  
ATOM 2410  C CB   . LEU A 1 19  ? 26.985 -20.623 15.376 1.00 75.44 ? 19  LEU A CB   2  
ATOM 2411  C CG   . LEU A 1 19  ? 25.605 -19.976 15.244 1.00 65.33 ? 19  LEU A CG   2  
ATOM 2412  C CD1  . LEU A 1 19  ? 24.697 -20.420 16.379 1.00 33.24 ? 19  LEU A CD1  2  
ATOM 2413  C CD2  . LEU A 1 19  ? 25.728 -18.460 15.218 1.00 2.31  ? 19  LEU A CD2  2  
ATOM 2414  H H    . LEU A 1 19  ? 28.266 -18.365 14.923 1.00 23.32 ? 19  LEU A H    2  
ATOM 2415  H HA   . LEU A 1 19  ? 28.671 -21.162 14.173 1.00 62.44 ? 19  LEU A HA   2  
ATOM 2416  H HB2  . LEU A 1 19  ? 26.844 -21.692 15.437 1.00 12.40 ? 19  LEU A HB2  2  
ATOM 2417  H HB3  . LEU A 1 19  ? 27.432 -20.268 16.293 1.00 51.41 ? 19  LEU A HB3  2  
ATOM 2418  H HG   . LEU A 1 19  ? 25.154 -20.292 14.313 1.00 2.10  ? 19  LEU A HG   2  
ATOM 2419  H HD11 . LEU A 1 19  ? 25.131 -20.128 17.323 1.00 24.33 ? 19  LEU A HD11 2  
ATOM 2420  H HD12 . LEU A 1 19  ? 24.584 -21.494 16.351 1.00 0.14  ? 19  LEU A HD12 2  
ATOM 2421  H HD13 . LEU A 1 19  ? 23.728 -19.954 16.269 1.00 64.24 ? 19  LEU A HD13 2  
ATOM 2422  H HD21 . LEU A 1 19  ? 26.283 -18.159 14.342 1.00 44.21 ? 19  LEU A HD21 2  
ATOM 2423  H HD22 . LEU A 1 19  ? 26.247 -18.126 16.105 1.00 1.31  ? 19  LEU A HD22 2  
ATOM 2424  H HD23 . LEU A 1 19  ? 24.743 -18.019 15.189 1.00 32.33 ? 19  LEU A HD23 2  
ATOM 2425  N N    . CYS A 1 20  ? 26.800 -21.380 12.382 1.00 12.12 ? 20  CYS A N    2  
ATOM 2426  C CA   . CYS A 1 20  ? 26.068 -21.414 11.121 1.00 51.41 ? 20  CYS A CA   2  
ATOM 2427  C C    . CYS A 1 20  ? 24.726 -22.118 11.290 1.00 71.53 ? 20  CYS A C    2  
ATOM 2428  O O    . CYS A 1 20  ? 24.623 -23.118 12.001 1.00 45.34 ? 20  CYS A O    2  
ATOM 2429  C CB   . CYS A 1 20  ? 26.896 -22.118 10.045 1.00 20.25 ? 20  CYS A CB   2  
ATOM 2430  S SG   . CYS A 1 20  ? 25.938 -22.655 8.609  1.00 14.41 ? 20  CYS A SG   2  
ATOM 2431  H H    . CYS A 1 20  ? 26.989 -22.222 12.847 1.00 12.21 ? 20  CYS A H    2  
ATOM 2432  H HA   . CYS A 1 20  ? 25.889 -20.394 10.815 1.00 20.02 ? 20  CYS A HA   2  
ATOM 2433  H HB2  . CYS A 1 20  ? 27.664 -21.445 9.694  1.00 12.41 ? 20  CYS A HB2  2  
ATOM 2434  H HB3  . CYS A 1 20  ? 27.363 -22.992 10.476 1.00 54.30 ? 20  CYS A HB3  2  
ATOM 2435  H HG   . CYS A 1 20  ? 25.106 -21.676 8.284  1.00 25.11 ? 20  CYS A HG   2  
ATOM 2436  N N    . ALA A 1 21  ? 23.699 -21.590 10.632 1.00 11.35 ? 21  ALA A N    2  
ATOM 2437  C CA   . ALA A 1 21  ? 22.363 -22.168 10.709 1.00 22.24 ? 21  ALA A CA   2  
ATOM 2438  C C    . ALA A 1 21  ? 21.560 -21.865 9.449  1.00 63.31 ? 21  ALA A C    2  
ATOM 2439  O O    . ALA A 1 21  ? 21.344 -20.704 9.105  1.00 40.32 ? 21  ALA A O    2  
ATOM 2440  C CB   . ALA A 1 21  ? 21.634 -21.650 11.940 1.00 55.53 ? 21  ALA A CB   2  
ATOM 2441  H H    . ALA A 1 21  ? 23.843 -20.792 10.082 1.00 65.43 ? 21  ALA A H    2  
ATOM 2442  H HA   . ALA A 1 21  ? 22.469 -23.239 10.808 1.00 35.14 ? 21  ALA A HA   2  
ATOM 2443  H HB1  . ALA A 1 21  ? 22.352 -21.423 12.714 1.00 32.44 ? 21  ALA A HB1  2  
ATOM 2444  H HB2  . ALA A 1 21  ? 21.087 -20.755 11.683 1.00 54.31 ? 21  ALA A HB2  2  
ATOM 2445  H HB3  . ALA A 1 21  ? 20.946 -22.403 12.294 1.00 3.14  ? 21  ALA A HB3  2  
ATOM 2446  N N    . GLN A 1 22  ? 21.122 -22.917 8.765  1.00 62.31 ? 22  GLN A N    2  
ATOM 2447  C CA   . GLN A 1 22  ? 20.344 -22.762 7.541  1.00 23.23 ? 22  GLN A CA   2  
ATOM 2448  C C    . GLN A 1 22  ? 18.859 -22.977 7.810  1.00 75.20 ? 22  GLN A C    2  
ATOM 2449  O O    . GLN A 1 22  ? 18.379 -24.111 7.828  1.00 13.21 ? 22  GLN A O    2  
ATOM 2450  C CB   . GLN A 1 22  ? 20.830 -23.746 6.475  1.00 35.24 ? 22  GLN A CB   2  
ATOM 2451  C CG   . GLN A 1 22  ? 20.552 -23.288 5.053  1.00 53.22 ? 22  GLN A CG   2  
ATOM 2452  C CD   . GLN A 1 22  ? 21.007 -24.295 4.016  1.00 62.34 ? 22  GLN A CD   2  
ATOM 2453  O OE1  . GLN A 1 22  ? 21.383 -25.420 4.349  1.00 41.44 ? 22  GLN A OE1  2  
ATOM 2454  N NE2  . GLN A 1 22  ? 20.976 -23.897 2.749  1.00 11.13 ? 22  GLN A NE2  2  
ATOM 2455  H H    . GLN A 1 22  ? 21.327 -23.818 9.090  1.00 21.01 ? 22  GLN A H    2  
ATOM 2456  H HA   . GLN A 1 22  ? 20.490 -21.755 7.181  1.00 22.14 ? 22  GLN A HA   2  
ATOM 2457  H HB2  . GLN A 1 22  ? 21.895 -23.882 6.586  1.00 40.43 ? 22  GLN A HB2  2  
ATOM 2458  H HB3  . GLN A 1 22  ? 20.336 -24.695 6.627  1.00 4.03  ? 22  GLN A HB3  2  
ATOM 2459  H HG2  . GLN A 1 22  ? 19.489 -23.133 4.939  1.00 70.20 ? 22  GLN A HG2  2  
ATOM 2460  H HG3  . GLN A 1 22  ? 21.070 -22.356 4.881  1.00 23.20 ? 22  GLN A HG3  2  
ATOM 2461  H HE21 . GLN A 1 22  ? 20.666 -22.986 2.559  1.00 71.35 ? 22  GLN A HE21 2  
ATOM 2462  H HE22 . GLN A 1 22  ? 21.266 -24.527 2.058  1.00 34.34 ? 22  GLN A HE22 2  
ATOM 2463  N N    . ARG A 1 23  ? 18.135 -21.882 8.019  1.00 45.34 ? 23  ARG A N    2  
ATOM 2464  C CA   . ARG A 1 23  ? 16.704 -21.951 8.288  1.00 43.20 ? 23  ARG A CA   2  
ATOM 2465  C C    . ARG A 1 23  ? 15.958 -22.564 7.107  1.00 53.53 ? 23  ARG A C    2  
ATOM 2466  O O    . ARG A 1 23  ? 15.546 -23.723 7.153  1.00 2.34  ? 23  ARG A O    2  
ATOM 2467  C CB   . ARG A 1 23  ? 16.152 -20.556 8.586  1.00 50.31 ? 23  ARG A CB   2  
ATOM 2468  C CG   . ARG A 1 23  ? 14.662 -20.542 8.886  1.00 0.21  ? 23  ARG A CG   2  
ATOM 2469  C CD   . ARG A 1 23  ? 14.059 -19.166 8.651  1.00 2.30  ? 23  ARG A CD   2  
ATOM 2470  N NE   . ARG A 1 23  ? 12.601 -19.210 8.591  1.00 34.02 ? 23  ARG A NE   2  
ATOM 2471  C CZ   . ARG A 1 23  ? 11.828 -19.425 9.650  1.00 12.51 ? 23  ARG A CZ   2  
ATOM 2472  N NH1  . ARG A 1 23  ? 12.372 -19.613 10.845 1.00 54.24 ? 23  ARG A NH1  2  
ATOM 2473  N NH2  . ARG A 1 23  ? 10.508 -19.450 9.515  1.00 20.55 ? 23  ARG A NH2  2  
ATOM 2474  H H    . ARG A 1 23  ? 18.575 -21.006 7.991  1.00 31.15 ? 23  ARG A H    2  
ATOM 2475  H HA   . ARG A 1 23  ? 16.560 -22.578 9.155  1.00 74.24 ? 23  ARG A HA   2  
ATOM 2476  H HB2  . ARG A 1 23  ? 16.673 -20.150 9.441  1.00 54.10 ? 23  ARG A HB2  2  
ATOM 2477  H HB3  . ARG A 1 23  ? 16.331 -19.921 7.731  1.00 11.02 ? 23  ARG A HB3  2  
ATOM 2478  H HG2  . ARG A 1 23  ? 14.168 -21.254 8.242  1.00 53.23 ? 23  ARG A HG2  2  
ATOM 2479  H HG3  . ARG A 1 23  ? 14.510 -20.821 9.918  1.00 52.20 ? 23  ARG A HG3  2  
ATOM 2480  H HD2  . ARG A 1 23  ? 14.357 -18.514 9.459  1.00 71.11 ? 23  ARG A HD2  2  
ATOM 2481  H HD3  . ARG A 1 23  ? 14.437 -18.777 7.717  1.00 1.23  ? 23  ARG A HD3  2  
ATOM 2482  H HE   . ARG A 1 23  ? 12.178 -19.073 7.718  1.00 32.32 ? 23  ARG A HE   2  
ATOM 2483  H HH11 . ARG A 1 23  ? 13.366 -19.593 10.949 1.00 12.22 ? 23  ARG A HH11 2  
ATOM 2484  H HH12 . ARG A 1 23  ? 11.787 -19.773 11.641 1.00 44.14 ? 23  ARG A HH12 2  
ATOM 2485  H HH21 . ARG A 1 23  ? 10.094 -19.309 8.617  1.00 45.34 ? 23  ARG A HH21 2  
ATOM 2486  H HH22 . ARG A 1 23  ? 9.927  -19.612 10.313 1.00 64.12 ? 23  ARG A HH22 2  
ATOM 2487  N N    . SER A 1 24  ? 15.786 -21.777 6.049  1.00 2.21  ? 24  SER A N    2  
ATOM 2488  C CA   . SER A 1 24  ? 15.085 -22.240 4.857  1.00 24.13 ? 24  SER A CA   2  
ATOM 2489  C C    . SER A 1 24  ? 15.412 -21.357 3.657  1.00 0.41  ? 24  SER A C    2  
ATOM 2490  O O    . SER A 1 24  ? 16.337 -20.546 3.704  1.00 74.14 ? 24  SER A O    2  
ATOM 2491  C CB   . SER A 1 24  ? 13.575 -22.252 5.100  1.00 10.12 ? 24  SER A CB   2  
ATOM 2492  O OG   . SER A 1 24  ? 13.270 -22.754 6.390  1.00 52.22 ? 24  SER A OG   2  
ATOM 2493  H H    . SER A 1 24  ? 16.137 -20.862 6.072  1.00 4.14  ? 24  SER A H    2  
ATOM 2494  H HA   . SER A 1 24  ? 15.416 -23.247 4.649  1.00 52.21 ? 24  SER A HA   2  
ATOM 2495  H HB2  . SER A 1 24  ? 13.192 -21.246 5.019  1.00 70.12 ? 24  SER A HB2  2  
ATOM 2496  H HB3  . SER A 1 24  ? 13.099 -22.880 4.361  1.00 42.55 ? 24  SER A HB3  2  
ATOM 2497  H HG   . SER A 1 24  ? 13.199 -23.710 6.353  1.00 70.52 ? 24  SER A HG   2  
ATOM 2498  N N    . GLU A 1 25  ? 14.646 -21.521 2.583  1.00 15.44 ? 25  GLU A N    2  
ATOM 2499  C CA   . GLU A 1 25  ? 14.854 -20.739 1.370  1.00 12.23 ? 25  GLU A CA   2  
ATOM 2500  C C    . GLU A 1 25  ? 14.191 -19.369 1.485  1.00 33.22 ? 25  GLU A C    2  
ATOM 2501  O O    . GLU A 1 25  ? 14.217 -18.573 0.546  1.00 11.04 ? 25  GLU A O    2  
ATOM 2502  C CB   . GLU A 1 25  ? 14.300 -21.485 0.155  1.00 65.14 ? 25  GLU A CB   2  
ATOM 2503  C CG   . GLU A 1 25  ? 15.053 -21.193 -1.133 1.00 75.30 ? 25  GLU A CG   2  
ATOM 2504  C CD   . GLU A 1 25  ? 14.444 -20.046 -1.917 1.00 23.53 ? 25  GLU A CD   2  
ATOM 2505  O OE1  . GLU A 1 25  ? 15.205 -19.154 -2.347 1.00 55.12 ? 25  GLU A OE1  2  
ATOM 2506  O OE2  . GLU A 1 25  ? 13.209 -20.041 -2.099 1.00 61.14 ? 25  GLU A OE2  2  
ATOM 2507  H H    . GLU A 1 25  ? 13.924 -22.183 2.607  1.00 32.05 ? 25  GLU A H    2  
ATOM 2508  H HA   . GLU A 1 25  ? 15.917 -20.601 1.243  1.00 11.01 ? 25  GLU A HA   2  
ATOM 2509  H HB2  . GLU A 1 25  ? 14.352 -22.547 0.345  1.00 71.00 ? 25  GLU A HB2  2  
ATOM 2510  H HB3  . GLU A 1 25  ? 13.267 -21.204 0.015  1.00 42.43 ? 25  GLU A HB3  2  
ATOM 2511  H HG2  . GLU A 1 25  ? 16.074 -20.941 -0.889 1.00 54.42 ? 25  GLU A HG2  2  
ATOM 2512  H HG3  . GLU A 1 25  ? 15.040 -22.079 -1.751 1.00 31.00 ? 25  GLU A HG3  2  
ATOM 2513  N N    . LYS A 1 26  ? 13.596 -19.102 2.643  1.00 52.22 ? 26  LYS A N    2  
ATOM 2514  C CA   . LYS A 1 26  ? 12.926 -17.829 2.883  1.00 33.32 ? 26  LYS A CA   2  
ATOM 2515  C C    . LYS A 1 26  ? 13.941 -16.715 3.116  1.00 62.04 ? 26  LYS A C    2  
ATOM 2516  O O    . LYS A 1 26  ? 13.756 -15.589 2.656  1.00 42.50 ? 26  LYS A O    2  
ATOM 2517  C CB   . LYS A 1 26  ? 11.991 -17.942 4.090  1.00 51.44 ? 26  LYS A CB   2  
ATOM 2518  C CG   . LYS A 1 26  ? 10.872 -18.952 3.900  1.00 5.35  ? 26  LYS A CG   2  
ATOM 2519  C CD   . LYS A 1 26  ? 9.567  -18.457 4.500  1.00 52.21 ? 26  LYS A CD   2  
ATOM 2520  C CE   . LYS A 1 26  ? 9.567  -18.580 6.016  1.00 64.22 ? 26  LYS A CE   2  
ATOM 2521  N NZ   . LYS A 1 26  ? 10.142 -17.372 6.670  1.00 22.55 ? 26  LYS A NZ   2  
ATOM 2522  H H    . LYS A 1 26  ? 13.609 -19.777 3.354  1.00 75.13 ? 26  LYS A H    2  
ATOM 2523  H HA   . LYS A 1 26  ? 12.342 -17.591 2.007  1.00 31.01 ? 26  LYS A HA   2  
ATOM 2524  H HB2  . LYS A 1 26  ? 12.570 -18.235 4.953  1.00 43.42 ? 26  LYS A HB2  2  
ATOM 2525  H HB3  . LYS A 1 26  ? 11.546 -16.975 4.277  1.00 44.44 ? 26  LYS A HB3  2  
ATOM 2526  H HG2  . LYS A 1 26  ? 10.729 -19.123 2.844  1.00 52.21 ? 26  LYS A HG2  2  
ATOM 2527  H HG3  . LYS A 1 26  ? 11.151 -19.878 4.383  1.00 61.15 ? 26  LYS A HG3  2  
ATOM 2528  H HD2  . LYS A 1 26  ? 9.429  -17.419 4.235  1.00 64.02 ? 26  LYS A HD2  2  
ATOM 2529  H HD3  . LYS A 1 26  ? 8.752  -19.043 4.100  1.00 71.53 ? 26  LYS A HD3  2  
ATOM 2530  H HE2  . LYS A 1 26  ? 8.551  -18.713 6.354  1.00 50.25 ? 26  LYS A HE2  2  
ATOM 2531  H HE3  . LYS A 1 26  ? 10.154 -19.443 6.293  1.00 22.52 ? 26  LYS A HE3  2  
ATOM 2532  H HZ1  . LYS A 1 26  ? 9.782  -16.512 6.211  1.00 14.31 ? 26  LYS A HZ1  2  
ATOM 2533  H HZ2  . LYS A 1 26  ? 11.179 -17.384 6.594  1.00 41.10 ? 26  LYS A HZ2  2  
ATOM 2534  H HZ3  . LYS A 1 26  ? 9.880  -17.352 7.676  1.00 15.24 ? 26  LYS A HZ3  2  
ATOM 2535  N N    . MET A 1 27  ? 15.014 -17.038 3.830  1.00 1.03  ? 27  MET A N    2  
ATOM 2536  C CA   . MET A 1 27  ? 16.060 -16.064 4.121  1.00 71.04 ? 27  MET A CA   2  
ATOM 2537  C C    . MET A 1 27  ? 16.755 -15.614 2.839  1.00 32.34 ? 27  MET A C    2  
ATOM 2538  O O    . MET A 1 27  ? 16.391 -16.039 1.743  1.00 52.22 ? 27  MET A O    2  
ATOM 2539  C CB   . MET A 1 27  ? 17.085 -16.658 5.089  1.00 13.31 ? 27  MET A CB   2  
ATOM 2540  C CG   . MET A 1 27  ? 16.463 -17.254 6.342  1.00 40.34 ? 27  MET A CG   2  
ATOM 2541  S SD   . MET A 1 27  ? 15.840 -15.996 7.474  1.00 60.23 ? 27  MET A SD   2  
ATOM 2542  C CE   . MET A 1 27  ? 17.304 -15.665 8.451  1.00 43.25 ? 27  MET A CE   2  
ATOM 2543  H H    . MET A 1 27  ? 15.106 -17.953 4.170  1.00 13.30 ? 27  MET A H    2  
ATOM 2544  H HA   . MET A 1 27  ? 15.595 -15.207 4.584  1.00 53.11 ? 27  MET A HA   2  
ATOM 2545  H HB2  . MET A 1 27  ? 17.634 -17.436 4.581  1.00 42.33 ? 27  MET A HB2  2  
ATOM 2546  H HB3  . MET A 1 27  ? 17.771 -15.880 5.390  1.00 64.34 ? 27  MET A HB3  2  
ATOM 2547  H HG2  . MET A 1 27  ? 15.643 -17.894 6.051  1.00 1.44  ? 27  MET A HG2  2  
ATOM 2548  H HG3  . MET A 1 27  ? 17.211 -17.841 6.853  1.00 2.12  ? 27  MET A HG3  2  
ATOM 2549  H HE1  . MET A 1 27  ? 17.924 -16.549 8.482  1.00 50.30 ? 27  MET A HE1  2  
ATOM 2550  H HE2  . MET A 1 27  ? 17.858 -14.852 8.004  1.00 21.30 ? 27  MET A HE2  2  
ATOM 2551  H HE3  . MET A 1 27  ? 17.013 -15.394 9.455  1.00 53.51 ? 27  MET A HE3  2  
ATOM 2552  N N    . SER A 1 28  ? 17.756 -14.753 2.986  1.00 43.43 ? 28  SER A N    2  
ATOM 2553  C CA   . SER A 1 28  ? 18.499 -14.242 1.839  1.00 23.34 ? 28  SER A CA   2  
ATOM 2554  C C    . SER A 1 28  ? 19.711 -15.121 1.542  1.00 34.12 ? 28  SER A C    2  
ATOM 2555  O O    . SER A 1 28  ? 20.521 -15.401 2.426  1.00 3.23  ? 28  SER A O    2  
ATOM 2556  C CB   . SER A 1 28  ? 18.950 -12.803 2.097  1.00 72.15 ? 28  SER A CB   2  
ATOM 2557  O OG   . SER A 1 28  ? 17.847 -11.914 2.087  1.00 55.11 ? 28  SER A OG   2  
ATOM 2558  H H    . SER A 1 28  ? 17.999 -14.451 3.886  1.00 24.22 ? 28  SER A H    2  
ATOM 2559  H HA   . SER A 1 28  ? 17.840 -14.257 0.984  1.00 2.21  ? 28  SER A HA   2  
ATOM 2560  H HB2  . SER A 1 28  ? 19.434 -12.747 3.060  1.00 54.33 ? 28  SER A HB2  2  
ATOM 2561  H HB3  . SER A 1 28  ? 19.645 -12.504 1.326  1.00 45.41 ? 28  SER A HB3  2  
ATOM 2562  H HG   . SER A 1 28  ? 17.632 -11.659 2.987  1.00 24.24 ? 28  SER A HG   2  
ATOM 2563  N N    . LEU A 1 29  ? 19.827 -15.554 0.292  1.00 51.44 ? 29  LEU A N    2  
ATOM 2564  C CA   . LEU A 1 29  ? 20.939 -16.401 -0.124 1.00 61.15 ? 29  LEU A CA   2  
ATOM 2565  C C    . LEU A 1 29  ? 21.253 -17.449 0.939  1.00 40.50 ? 29  LEU A C    2  
ATOM 2566  O O    . LEU A 1 29  ? 22.399 -17.623 1.354  1.00 12.25 ? 29  LEU A O    2  
ATOM 2567  C CB   . LEU A 1 29  ? 22.180 -15.550 -0.400 1.00 14.41 ? 29  LEU A CB   2  
ATOM 2568  C CG   . LEU A 1 29  ? 22.210 -14.824 -1.745 1.00 42.53 ? 29  LEU A CG   2  
ATOM 2569  C CD1  . LEU A 1 29  ? 23.285 -13.748 -1.747 1.00 0.41  ? 29  LEU A CD1  2  
ATOM 2570  C CD2  . LEU A 1 29  ? 22.440 -15.812 -2.879 1.00 44.35 ? 29  LEU A CD2  2  
ATOM 2571  H H    . LEU A 1 29  ? 19.150 -15.298 -0.368 1.00 52.44 ? 29  LEU A H    2  
ATOM 2572  H HA   . LEU A 1 29  ? 20.649 -16.905 -1.034 1.00 60.14 ? 29  LEU A HA   2  
ATOM 2573  H HB2  . LEU A 1 29  ? 22.249 -14.806 0.379  1.00 45.33 ? 29  LEU A HB2  2  
ATOM 2574  H HB3  . LEU A 1 29  ? 23.042 -16.199 -0.353 1.00 44.04 ? 29  LEU A HB3  2  
ATOM 2575  H HG   . LEU A 1 29  ? 21.256 -14.342 -1.909 1.00 1.41  ? 29  LEU A HG   2  
ATOM 2576  H HD11 . LEU A 1 29  ? 22.949 -12.904 -2.330 1.00 51.03 ? 29  LEU A HD11 2  
ATOM 2577  H HD12 . LEU A 1 29  ? 24.192 -14.145 -2.178 1.00 72.42 ? 29  LEU A HD12 2  
ATOM 2578  H HD13 . LEU A 1 29  ? 23.478 -13.431 -0.732 1.00 44.34 ? 29  LEU A HD13 2  
ATOM 2579  H HD21 . LEU A 1 29  ? 22.068 -16.783 -2.591 1.00 21.54 ? 29  LEU A HD21 2  
ATOM 2580  H HD22 . LEU A 1 29  ? 23.498 -15.879 -3.089 1.00 23.33 ? 29  LEU A HD22 2  
ATOM 2581  H HD23 . LEU A 1 29  ? 21.919 -15.474 -3.763 1.00 10.25 ? 29  LEU A HD23 2  
ATOM 2582  N N    . PRO A 1 30  ? 20.213 -18.165 1.390  1.00 75.04 ? 30  PRO A N    2  
ATOM 2583  C CA   . PRO A 1 30  ? 20.353 -19.210 2.408  1.00 13.23 ? 30  PRO A CA   2  
ATOM 2584  C C    . PRO A 1 30  ? 21.095 -20.434 1.884  1.00 31.43 ? 30  PRO A C    2  
ATOM 2585  O O    . PRO A 1 30  ? 21.611 -21.239 2.661  1.00 62.53 ? 30  PRO A O    2  
ATOM 2586  C CB   . PRO A 1 30  ? 18.904 -19.568 2.750  1.00 24.15 ? 30  PRO A CB   2  
ATOM 2587  C CG   . PRO A 1 30  ? 18.127 -19.206 1.532  1.00 33.44 ? 30  PRO A CG   2  
ATOM 2588  C CD   . PRO A 1 30  ? 18.819 -18.011 0.939  1.00 42.21 ? 30  PRO A CD   2  
ATOM 2589  H HA   . PRO A 1 30  ? 20.852 -18.838 3.291  1.00 33.44 ? 30  PRO A HA   2  
ATOM 2590  H HB2  . PRO A 1 30  ? 18.834 -20.625 2.966  1.00 72.00 ? 30  PRO A HB2  2  
ATOM 2591  H HB3  . PRO A 1 30  ? 18.582 -18.998 3.608  1.00 13.34 ? 30  PRO A HB3  2  
ATOM 2592  H HG2  . PRO A 1 30  ? 18.134 -20.029 0.834  1.00 65.21 ? 30  PRO A HG2  2  
ATOM 2593  H HG3  . PRO A 1 30  ? 17.113 -18.954 1.806  1.00 31.11 ? 30  PRO A HG3  2  
ATOM 2594  H HD2  . PRO A 1 30  ? 18.757 -18.035 -0.139 1.00 25.50 ? 30  PRO A HD2  2  
ATOM 2595  H HD3  . PRO A 1 30  ? 18.390 -17.097 1.322  1.00 34.05 ? 30  PRO A HD3  2  
ATOM 2596  N N    . LEU A 1 31  ? 21.145 -20.570 0.564  1.00 44.42 ? 31  LEU A N    2  
ATOM 2597  C CA   . LEU A 1 31  ? 21.826 -21.697 -0.064 1.00 53.24 ? 31  LEU A CA   2  
ATOM 2598  C C    . LEU A 1 31  ? 23.297 -21.737 0.337  1.00 72.33 ? 31  LEU A C    2  
ATOM 2599  O O    . LEU A 1 31  ? 23.781 -22.743 0.855  1.00 3.33  ? 31  LEU A O    2  
ATOM 2600  C CB   . LEU A 1 31  ? 21.703 -21.608 -1.587 1.00 34.24 ? 31  LEU A CB   2  
ATOM 2601  C CG   . LEU A 1 31  ? 20.324 -21.227 -2.127 1.00 42.14 ? 31  LEU A CG   2  
ATOM 2602  C CD1  . LEU A 1 31  ? 20.304 -21.313 -3.646 1.00 0.43  ? 31  LEU A CD1  2  
ATOM 2603  C CD2  . LEU A 1 31  ? 19.249 -22.121 -1.527 1.00 25.14 ? 31  LEU A CD2  2  
ATOM 2604  H H    . LEU A 1 31  ? 20.716 -19.896 -0.003 1.00 74.10 ? 31  LEU A H    2  
ATOM 2605  H HA   . LEU A 1 31  ? 21.347 -22.603 0.275  1.00 23.41 ? 31  LEU A HA   2  
ATOM 2606  H HB2  . LEU A 1 31  ? 22.409 -20.870 -1.933 1.00 3.21  ? 31  LEU A HB2  2  
ATOM 2607  H HB3  . LEU A 1 31  ? 21.964 -22.574 -1.995 1.00 42.15 ? 31  LEU A HB3  2  
ATOM 2608  H HG   . LEU A 1 31  ? 20.105 -20.205 -1.848 1.00 70.35 ? 31  LEU A HG   2  
ATOM 2609  H HD11 . LEU A 1 31  ? 19.747 -22.186 -3.949 1.00 54.55 ? 31  LEU A HD11 2  
ATOM 2610  H HD12 . LEU A 1 31  ? 21.316 -21.385 -4.016 1.00 1.25  ? 31  LEU A HD12 2  
ATOM 2611  H HD13 . LEU A 1 31  ? 19.836 -20.427 -4.050 1.00 10.11 ? 31  LEU A HD13 2  
ATOM 2612  H HD21 . LEU A 1 31  ? 18.928 -21.711 -0.581 1.00 0.13  ? 31  LEU A HD21 2  
ATOM 2613  H HD22 . LEU A 1 31  ? 19.651 -23.112 -1.371 1.00 43.02 ? 31  LEU A HD22 2  
ATOM 2614  H HD23 . LEU A 1 31  ? 18.408 -22.175 -2.201 1.00 13.12 ? 31  LEU A HD23 2  
ATOM 2615  N N    . MET A 1 32  ? 24.001 -20.637 0.095  1.00 43.32 ? 32  MET A N    2  
ATOM 2616  C CA   . MET A 1 32  ? 25.417 -20.546 0.434  1.00 14.33 ? 32  MET A CA   2  
ATOM 2617  C C    . MET A 1 32  ? 25.613 -20.537 1.947  1.00 64.21 ? 32  MET A C    2  
ATOM 2618  O O    . MET A 1 32  ? 26.410 -21.308 2.483  1.00 41.44 ? 32  MET A O    2  
ATOM 2619  C CB   . MET A 1 32  ? 26.030 -19.285 -0.179 1.00 20.34 ? 32  MET A CB   2  
ATOM 2620  C CG   . MET A 1 32  ? 25.288 -18.009 0.186  1.00 65.51 ? 32  MET A CG   2  
ATOM 2621  S SD   . MET A 1 32  ? 25.768 -16.609 -0.844 1.00 33.21 ? 32  MET A SD   2  
ATOM 2622  C CE   . MET A 1 32  ? 25.655 -15.267 0.336  1.00 4.34  ? 32  MET A CE   2  
ATOM 2623  H H    . MET A 1 32  ? 23.559 -19.867 -0.321 1.00 4.11  ? 32  MET A H    2  
ATOM 2624  H HA   . MET A 1 32  ? 25.912 -21.413 0.023  1.00 11.45 ? 32  MET A HA   2  
ATOM 2625  H HB2  . MET A 1 32  ? 27.050 -19.193 0.163  1.00 62.23 ? 32  MET A HB2  2  
ATOM 2626  H HB3  . MET A 1 32  ? 26.026 -19.383 -1.254 1.00 31.20 ? 32  MET A HB3  2  
ATOM 2627  H HG2  . MET A 1 32  ? 24.228 -18.178 0.068  1.00 65.24 ? 32  MET A HG2  2  
ATOM 2628  H HG3  . MET A 1 32  ? 25.500 -17.770 1.217  1.00 15.55 ? 32  MET A HG3  2  
ATOM 2629  H HE1  . MET A 1 32  ? 25.039 -15.570 1.170  1.00 70.34 ? 32  MET A HE1  2  
ATOM 2630  H HE2  . MET A 1 32  ? 26.644 -15.017 0.692  1.00 10.11 ? 32  MET A HE2  2  
ATOM 2631  H HE3  . MET A 1 32  ? 25.215 -14.403 -0.142 1.00 21.54 ? 32  MET A HE3  2  
ATOM 2632  N N    . TRP A 1 33  ? 24.884 -19.662 2.629  1.00 55.02 ? 33  TRP A N    2  
ATOM 2633  C CA   . TRP A 1 33  ? 24.979 -19.554 4.080  1.00 11.22 ? 33  TRP A CA   2  
ATOM 2634  C C    . TRP A 1 33  ? 23.745 -18.870 4.657  1.00 14.43 ? 33  TRP A C    2  
ATOM 2635  O O    . TRP A 1 33  ? 22.931 -18.315 3.920  1.00 15.00 ? 33  TRP A O    2  
ATOM 2636  C CB   . TRP A 1 33  ? 26.238 -18.778 4.473  1.00 75.43 ? 33  TRP A CB   2  
ATOM 2637  C CG   . TRP A 1 33  ? 27.508 -19.492 4.123  1.00 42.15 ? 33  TRP A CG   2  
ATOM 2638  C CD1  . TRP A 1 33  ? 28.315 -19.250 3.047  1.00 15.33 ? 33  TRP A CD1  2  
ATOM 2639  C CD2  . TRP A 1 33  ? 28.117 -20.565 4.849  1.00 34.11 ? 33  TRP A CD2  2  
ATOM 2640  N NE1  . TRP A 1 33  ? 29.388 -20.108 3.062  1.00 54.24 ? 33  TRP A NE1  2  
ATOM 2641  C CE2  . TRP A 1 33  ? 29.290 -20.924 4.157  1.00 31.12 ? 33  TRP A CE2  2  
ATOM 2642  C CE3  . TRP A 1 33  ? 27.786 -21.256 6.018  1.00 73.33 ? 33  TRP A CE3  2  
ATOM 2643  C CZ2  . TRP A 1 33  ? 30.130 -21.944 4.596  1.00 1.13  ? 33  TRP A CZ2  2  
ATOM 2644  C CZ3  . TRP A 1 33  ? 28.620 -22.268 6.452  1.00 64.31 ? 33  TRP A CZ3  2  
ATOM 2645  C CH2  . TRP A 1 33  ? 29.782 -22.604 5.743  1.00 13.13 ? 33  TRP A CH2  2  
ATOM 2646  H H    . TRP A 1 33  ? 24.266 -19.074 2.145  1.00 34.31 ? 33  TRP A H    2  
ATOM 2647  H HA   . TRP A 1 33  ? 25.043 -20.554 4.483  1.00 61.03 ? 33  TRP A HA   2  
ATOM 2648  H HB2  . TRP A 1 33  ? 26.239 -17.826 3.964  1.00 3.25  ? 33  TRP A HB2  2  
ATOM 2649  H HB3  . TRP A 1 33  ? 26.231 -18.613 5.540  1.00 13.34 ? 33  TRP A HB3  2  
ATOM 2650  H HD1  . TRP A 1 33  ? 28.123 -18.493 2.302  1.00 1.11  ? 33  TRP A HD1  2  
ATOM 2651  H HE1  . TRP A 1 33  ? 30.107 -20.130 2.396  1.00 40.02 ? 33  TRP A HE1  2  
ATOM 2652  H HE3  . TRP A 1 33  ? 26.895 -21.012 6.578  1.00 60.23 ? 33  TRP A HE3  2  
ATOM 2653  H HZ2  . TRP A 1 33  ? 31.029 -22.214 4.062  1.00 50.05 ? 33  TRP A HZ2  2  
ATOM 2654  H HZ3  . TRP A 1 33  ? 28.381 -22.814 7.353  1.00 54.02 ? 33  TRP A HZ3  2  
ATOM 2655  H HH2  . TRP A 1 33  ? 30.404 -23.401 6.119  1.00 20.31 ? 33  TRP A HH2  2  
ATOM 2656  N N    . GLU A 1 34  ? 23.613 -18.913 5.979  1.00 11.15 ? 34  GLU A N    2  
ATOM 2657  C CA   . GLU A 1 34  ? 22.476 -18.297 6.654  1.00 43.32 ? 34  GLU A CA   2  
ATOM 2658  C C    . GLU A 1 34  ? 22.638 -18.369 8.169  1.00 23.04 ? 34  GLU A C    2  
ATOM 2659  O O    . GLU A 1 34  ? 23.399 -19.188 8.685  1.00 5.33  ? 34  GLU A O    2  
ATOM 2660  C CB   . GLU A 1 34  ? 21.174 -18.983 6.236  1.00 51.52 ? 34  GLU A CB   2  
ATOM 2661  C CG   . GLU A 1 34  ? 19.936 -18.135 6.474  1.00 12.34 ? 34  GLU A CG   2  
ATOM 2662  C CD   . GLU A 1 34  ? 20.068 -16.736 5.905  1.00 41.42 ? 34  GLU A CD   2  
ATOM 2663  O OE1  . GLU A 1 34  ? 19.970 -16.586 4.669  1.00 1.20  ? 34  GLU A OE1  2  
ATOM 2664  O OE2  . GLU A 1 34  ? 20.270 -15.790 6.696  1.00 75.32 ? 34  GLU A OE2  2  
ATOM 2665  H H    . GLU A 1 34  ? 24.295 -19.370 6.514  1.00 65.25 ? 34  GLU A H    2  
ATOM 2666  H HA   . GLU A 1 34  ? 22.437 -17.260 6.357  1.00 2.52  ? 34  GLU A HA   2  
ATOM 2667  H HB2  . GLU A 1 34  ? 21.227 -19.218 5.183  1.00 32.11 ? 34  GLU A HB2  2  
ATOM 2668  H HB3  . GLU A 1 34  ? 21.069 -19.900 6.796  1.00 61.23 ? 34  GLU A HB3  2  
ATOM 2669  H HG2  . GLU A 1 34  ? 19.089 -18.617 6.009  1.00 23.33 ? 34  GLU A HG2  2  
ATOM 2670  H HG3  . GLU A 1 34  ? 19.766 -18.060 7.538  1.00 11.35 ? 34  GLU A HG3  2  
ATOM 2671  N N    . PHE A 1 35  ? 21.917 -17.506 8.877  1.00 4.14  ? 35  PHE A N    2  
ATOM 2672  C CA   . PHE A 1 35  ? 21.982 -17.470 10.334 1.00 54.22 ? 35  PHE A CA   2  
ATOM 2673  C C    . PHE A 1 35  ? 20.694 -18.011 10.949 1.00 51.45 ? 35  PHE A C    2  
ATOM 2674  O O    . PHE A 1 35  ? 19.651 -18.088 10.299 1.00 13.41 ? 35  PHE A O    2  
ATOM 2675  C CB   . PHE A 1 35  ? 22.231 -16.040 10.819 1.00 33.43 ? 35  PHE A CB   2  
ATOM 2676  C CG   . PHE A 1 35  ? 23.687 -15.698 10.953 1.00 30.03 ? 35  PHE A CG   2  
ATOM 2677  C CD1  . PHE A 1 35  ? 24.193 -14.534 10.396 1.00 32.54 ? 35  PHE A CD1  2  
ATOM 2678  C CD2  . PHE A 1 35  ? 24.550 -16.539 11.637 1.00 70.43 ? 35  PHE A CD2  2  
ATOM 2679  C CE1  . PHE A 1 35  ? 25.533 -14.218 10.518 1.00 54.33 ? 35  PHE A CE1  2  
ATOM 2680  C CE2  . PHE A 1 35  ? 25.891 -16.228 11.762 1.00 52.44 ? 35  PHE A CE2  2  
ATOM 2681  C CZ   . PHE A 1 35  ? 26.382 -15.065 11.202 1.00 4.51  ? 35  PHE A CZ   2  
ATOM 2682  H H    . PHE A 1 35  ? 21.328 -16.878 8.409  1.00 44.51 ? 35  PHE A H    2  
ATOM 2683  H HA   . PHE A 1 35  ? 22.805 -18.095 10.644 1.00 14.10 ? 35  PHE A HA   2  
ATOM 2684  H HB2  . PHE A 1 35  ? 21.791 -15.348 10.118 1.00 51.33 ? 35  PHE A HB2  2  
ATOM 2685  H HB3  . PHE A 1 35  ? 21.767 -15.910 11.786 1.00 65.43 ? 35  PHE A HB3  2  
ATOM 2686  H HD1  . PHE A 1 35  ? 23.529 -13.871 9.862  1.00 44.42 ? 35  PHE A HD1  2  
ATOM 2687  H HD2  . PHE A 1 35  ? 24.166 -17.450 12.075 1.00 0.13  ? 35  PHE A HD2  2  
ATOM 2688  H HE1  . PHE A 1 35  ? 25.914 -13.308 10.080 1.00 44.44 ? 35  PHE A HE1  2  
ATOM 2689  H HE2  . PHE A 1 35  ? 26.552 -16.892 12.297 1.00 22.15 ? 35  PHE A HE2  2  
ATOM 2690  H HZ   . PHE A 1 35  ? 27.430 -14.819 11.298 1.00 75.31 ? 35  PHE A HZ   2  
ATOM 2691  N N    . PRO A 1 36  ? 20.767 -18.395 12.231 1.00 23.14 ? 36  PRO A N    2  
ATOM 2692  C CA   . PRO A 1 36  ? 19.618 -18.936 12.963 1.00 54.52 ? 36  PRO A CA   2  
ATOM 2693  C C    . PRO A 1 36  ? 18.556 -17.876 13.239 1.00 22.11 ? 36  PRO A C    2  
ATOM 2694  O O    . PRO A 1 36  ? 18.862 -16.689 13.344 1.00 64.23 ? 36  PRO A O    2  
ATOM 2695  C CB   . PRO A 1 36  ? 20.232 -19.431 14.274 1.00 24.11 ? 36  PRO A CB   2  
ATOM 2696  C CG   . PRO A 1 36  ? 21.461 -18.607 14.452 1.00 71.24 ? 36  PRO A CG   2  
ATOM 2697  C CD   . PRO A 1 36  ? 21.978 -18.331 13.067 1.00 62.41 ? 36  PRO A CD   2  
ATOM 2698  H HA   . PRO A 1 36  ? 19.168 -19.766 12.438 1.00 51.42 ? 36  PRO A HA   2  
ATOM 2699  H HB2  . PRO A 1 36  ? 19.532 -19.278 15.083 1.00 4.34  ? 36  PRO A HB2  2  
ATOM 2700  H HB3  . PRO A 1 36  ? 20.470 -20.481 14.190 1.00 1.24  ? 36  PRO A HB3  2  
ATOM 2701  H HG2  . PRO A 1 36  ? 21.214 -17.683 14.951 1.00 41.42 ? 36  PRO A HG2  2  
ATOM 2702  H HG3  . PRO A 1 36  ? 22.193 -19.159 15.022 1.00 64.22 ? 36  PRO A HG3  2  
ATOM 2703  H HD2  . PRO A 1 36  ? 22.428 -17.351 13.020 1.00 13.44 ? 36  PRO A HD2  2  
ATOM 2704  H HD3  . PRO A 1 36  ? 22.689 -19.089 12.772 1.00 45.20 ? 36  PRO A HD3  2  
ATOM 2705  N N    . GLY A 1 37  ? 17.306 -18.314 13.357 1.00 41.32 ? 37  GLY A N    2  
ATOM 2706  C CA   . GLY A 1 37  ? 16.218 -17.390 13.620 1.00 4.23  ? 37  GLY A CA   2  
ATOM 2707  C C    . GLY A 1 37  ? 15.020 -17.634 12.725 1.00 62.14 ? 37  GLY A C    2  
ATOM 2708  O O    . GLY A 1 37  ? 14.757 -18.767 12.323 1.00 10.14 ? 37  GLY A O    2  
ATOM 2709  H H    . GLY A 1 37  ? 17.121 -19.272 13.264 1.00 51.32 ? 37  GLY A H    2  
ATOM 2710  H HA2  . GLY A 1 37  ? 15.912 -17.495 14.650 1.00 24.44 ? 37  GLY A HA2  2  
ATOM 2711  H HA3  . GLY A 1 37  ? 16.572 -16.381 13.462 1.00 73.32 ? 37  GLY A HA3  2  
ATOM 2712  N N    . GLY A 1 38  ? 14.290 -16.568 12.411 1.00 2.10  ? 38  GLY A N    2  
ATOM 2713  C CA   . GLY A 1 38  ? 13.121 -16.694 11.561 1.00 52.52 ? 38  GLY A CA   2  
ATOM 2714  C C    . GLY A 1 38  ? 12.535 -15.349 11.178 1.00 0.22  ? 38  GLY A C    2  
ATOM 2715  O O    . GLY A 1 38  ? 13.151 -14.583 10.436 1.00 13.04 ? 38  GLY A O    2  
ATOM 2716  H H    . GLY A 1 38  ? 14.548 -15.689 12.760 1.00 52.10 ? 38  GLY A H    2  
ATOM 2717  H HA2  . GLY A 1 38  ? 13.398 -17.223 10.661 1.00 3.25  ? 38  GLY A HA2  2  
ATOM 2718  H HA3  . GLY A 1 38  ? 12.369 -17.265 12.085 1.00 54.40 ? 38  GLY A HA3  2  
ATOM 2719  N N    . LYS A 1 39  ? 11.341 -15.060 11.684 1.00 74.22 ? 39  LYS A N    2  
ATOM 2720  C CA   . LYS A 1 39  ? 10.670 -13.799 11.391 1.00 32.12 ? 39  LYS A CA   2  
ATOM 2721  C C    . LYS A 1 39  ? 10.346 -13.044 12.676 1.00 5.14  ? 39  LYS A C    2  
ATOM 2722  O O    . LYS A 1 39  ? 10.684 -13.491 13.773 1.00 72.03 ? 39  LYS A O    2  
ATOM 2723  C CB   . LYS A 1 39  ? 9.385  -14.053 10.599 1.00 2.22  ? 39  LYS A CB   2  
ATOM 2724  C CG   . LYS A 1 39  ? 9.619  -14.736 9.263  1.00 22.42 ? 39  LYS A CG   2  
ATOM 2725  C CD   . LYS A 1 39  ? 8.310  -15.031 8.550  1.00 10.34 ? 39  LYS A CD   2  
ATOM 2726  C CE   . LYS A 1 39  ? 7.721  -16.361 8.994  1.00 53.02 ? 39  LYS A CE   2  
ATOM 2727  N NZ   . LYS A 1 39  ? 6.911  -16.223 10.236 1.00 3.41  ? 39  LYS A NZ   2  
ATOM 2728  H H    . LYS A 1 39  ? 10.900 -15.712 12.269 1.00 15.42 ? 39  LYS A H    2  
ATOM 2729  H HA   . LYS A 1 39  ? 11.339 -13.199 10.793 1.00 15.54 ? 39  LYS A HA   2  
ATOM 2730  H HB2  . LYS A 1 39  ? 8.730  -14.676 11.189 1.00 30.53 ? 39  LYS A HB2  2  
ATOM 2731  H HB3  . LYS A 1 39  ? 8.897  -13.106 10.415 1.00 64.42 ? 39  LYS A HB3  2  
ATOM 2732  H HG2  . LYS A 1 39  ? 10.219 -14.091 8.639  1.00 62.11 ? 39  LYS A HG2  2  
ATOM 2733  H HG3  . LYS A 1 39  ? 10.144 -15.666 9.432  1.00 33.30 ? 39  LYS A HG3  2  
ATOM 2734  H HD2  . LYS A 1 39  ? 7.604  -14.245 8.774  1.00 53.12 ? 39  LYS A HD2  2  
ATOM 2735  H HD3  . LYS A 1 39  ? 8.490  -15.064 7.485  1.00 13.50 ? 39  LYS A HD3  2  
ATOM 2736  H HE2  . LYS A 1 39  ? 7.091  -16.742 8.205  1.00 52.34 ? 39  LYS A HE2  2  
ATOM 2737  H HE3  . LYS A 1 39  ? 8.528  -17.055 9.176  1.00 44.53 ? 39  LYS A HE3  2  
ATOM 2738  H HZ1  . LYS A 1 39  ? 7.396  -16.686 11.031 1.00 1.44  ? 39  LYS A HZ1  2  
ATOM 2739  H HZ2  . LYS A 1 39  ? 5.980  -16.667 10.107 1.00 10.40 ? 39  LYS A HZ2  2  
ATOM 2740  H HZ3  . LYS A 1 39  ? 6.776  -15.217 10.464 1.00 33.24 ? 39  LYS A HZ3  2  
ATOM 2741  N N    . VAL A 1 40  ? 9.689  -11.897 12.534 1.00 25.12 ? 40  VAL A N    2  
ATOM 2742  C CA   . VAL A 1 40  ? 9.318  -11.081 13.684 1.00 21.21 ? 40  VAL A CA   2  
ATOM 2743  C C    . VAL A 1 40  ? 7.838  -10.718 13.645 1.00 41.40 ? 40  VAL A C    2  
ATOM 2744  O O    . VAL A 1 40  ? 7.267  -10.518 12.574 1.00 54.22 ? 40  VAL A O    2  
ATOM 2745  C CB   . VAL A 1 40  ? 10.152 -9.788  13.747 1.00 12.51 ? 40  VAL A CB   2  
ATOM 2746  C CG1  . VAL A 1 40  ? 9.762  -8.960  14.962 1.00 1.41  ? 40  VAL A CG1  2  
ATOM 2747  C CG2  . VAL A 1 40  ? 11.638 -10.112 13.767 1.00 32.32 ? 40  VAL A CG2  2  
ATOM 2748  H H    . VAL A 1 40  ? 9.448  -11.593 11.635 1.00 41.15 ? 40  VAL A H    2  
ATOM 2749  H HA   . VAL A 1 40  ? 9.515  -11.655 14.578 1.00 15.02 ? 40  VAL A HA   2  
ATOM 2750  H HB   . VAL A 1 40  ? 9.944  -9.206  12.861 1.00 11.21 ? 40  VAL A HB   2  
ATOM 2751  H HG11 . VAL A 1 40  ? 10.640 -8.477  15.365 1.00 5.01  ? 40  VAL A HG11 2  
ATOM 2752  H HG12 . VAL A 1 40  ? 9.040  -8.211  14.671 1.00 33.05 ? 40  VAL A HG12 2  
ATOM 2753  H HG13 . VAL A 1 40  ? 9.330  -9.605  15.713 1.00 4.44  ? 40  VAL A HG13 2  
ATOM 2754  H HG21 . VAL A 1 40  ? 12.115 -9.667  12.907 1.00 55.31 ? 40  VAL A HG21 2  
ATOM 2755  H HG22 . VAL A 1 40  ? 12.081 -9.716  14.670 1.00 62.45 ? 40  VAL A HG22 2  
ATOM 2756  H HG23 . VAL A 1 40  ? 11.773 -11.183 13.740 1.00 21.22 ? 40  VAL A HG23 2  
ATOM 2757  N N    . GLU A 1 41  ? 7.224  -10.633 14.821 1.00 73.22 ? 41  GLU A N    2  
ATOM 2758  C CA   . GLU A 1 41  ? 5.809  -10.294 14.920 1.00 1.32  ? 41  GLU A CA   2  
ATOM 2759  C C    . GLU A 1 41  ? 5.573  -8.832  14.549 1.00 30.43 ? 41  GLU A C    2  
ATOM 2760  O O    . GLU A 1 41  ? 6.409  -7.969  14.816 1.00 64.03 ? 41  GLU A O    2  
ATOM 2761  C CB   . GLU A 1 41  ? 5.296  -10.561 16.337 1.00 71.14 ? 41  GLU A CB   2  
ATOM 2762  C CG   . GLU A 1 41  ? 4.545  -11.875 16.474 1.00 51.20 ? 41  GLU A CG   2  
ATOM 2763  C CD   . GLU A 1 41  ? 3.083  -11.754 16.088 1.00 64.51 ? 41  GLU A CD   2  
ATOM 2764  O OE1  . GLU A 1 41  ? 2.437  -10.774 16.513 1.00 41.22 ? 41  GLU A OE1  2  
ATOM 2765  O OE2  . GLU A 1 41  ? 2.586  -12.640 15.362 1.00 60.22 ? 41  GLU A OE2  2  
ATOM 2766  H H    . GLU A 1 41  ? 7.733  -10.804 15.640 1.00 4.22  ? 41  GLU A H    2  
ATOM 2767  H HA   . GLU A 1 41  ? 5.268  -10.920 14.227 1.00 22.22 ? 41  GLU A HA   2  
ATOM 2768  H HB2  . GLU A 1 41  ? 6.137  -10.578 17.014 1.00 12.12 ? 41  GLU A HB2  2  
ATOM 2769  H HB3  . GLU A 1 41  ? 4.631  -9.759  16.623 1.00 61.45 ? 41  GLU A HB3  2  
ATOM 2770  H HG2  . GLU A 1 41  ? 5.011  -12.610 15.835 1.00 54.35 ? 41  GLU A HG2  2  
ATOM 2771  H HG3  . GLU A 1 41  ? 4.605  -12.203 17.501 1.00 31.51 ? 41  GLU A HG3  2  
ATOM 2772  N N    . LYS A 1 42  ? 4.428  -8.562  13.932 1.00 33.51 ? 42  LYS A N    2  
ATOM 2773  C CA   . LYS A 1 42  ? 4.079  -7.207  13.524 1.00 12.22 ? 42  LYS A CA   2  
ATOM 2774  C C    . LYS A 1 42  ? 3.960  -6.288  14.736 1.00 41.43 ? 42  LYS A C    2  
ATOM 2775  O O    . LYS A 1 42  ? 4.305  -5.109  14.668 1.00 11.30 ? 42  LYS A O    2  
ATOM 2776  C CB   . LYS A 1 42  ? 2.763  -7.210  12.742 1.00 23.03 ? 42  LYS A CB   2  
ATOM 2777  C CG   . LYS A 1 42  ? 1.642  -7.959  13.442 1.00 51.43 ? 42  LYS A CG   2  
ATOM 2778  C CD   . LYS A 1 42  ? 1.192  -9.167  12.638 1.00 21.20 ? 42  LYS A CD   2  
ATOM 2779  C CE   . LYS A 1 42  ? -0.195 -9.630  13.057 1.00 62.31 ? 42  LYS A CE   2  
ATOM 2780  N NZ   . LYS A 1 42  ? -0.160 -10.972 13.703 1.00 50.32 ? 42  LYS A NZ   2  
ATOM 2781  H H    . LYS A 1 42  ? 3.801  -9.294  13.747 1.00 12.51 ? 42  LYS A H    2  
ATOM 2782  H HA   . LYS A 1 42  ? 4.867  -6.840  12.885 1.00 40.54 ? 42  LYS A HA   2  
ATOM 2783  H HB2  . LYS A 1 42  ? 2.446  -6.189  12.590 1.00 4.21  ? 42  LYS A HB2  2  
ATOM 2784  H HB3  . LYS A 1 42  ? 2.931  -7.673  11.780 1.00 4.24  ? 42  LYS A HB3  2  
ATOM 2785  H HG2  . LYS A 1 42  ? 1.991  -8.292  14.408 1.00 42.14 ? 42  LYS A HG2  2  
ATOM 2786  H HG3  . LYS A 1 42  ? 0.802  -7.291  13.571 1.00 11.13 ? 42  LYS A HG3  2  
ATOM 2787  H HD2  . LYS A 1 42  ? 1.170  -8.905  11.591 1.00 44.22 ? 42  LYS A HD2  2  
ATOM 2788  H HD3  . LYS A 1 42  ? 1.894  -9.974  12.794 1.00 23.04 ? 42  LYS A HD3  2  
ATOM 2789  H HE2  . LYS A 1 42  ? -0.604 -8.915  13.754 1.00 25.21 ? 42  LYS A HE2  2  
ATOM 2790  H HE3  . LYS A 1 42  ? -0.824 -9.678  12.180 1.00 22.33 ? 42  LYS A HE3  2  
ATOM 2791  H HZ1  . LYS A 1 42  ? 0.791  -11.162 14.079 1.00 32.21 ? 42  LYS A HZ1  2  
ATOM 2792  H HZ2  . LYS A 1 42  ? -0.400 -11.708 13.009 1.00 22.53 ? 42  LYS A HZ2  2  
ATOM 2793  H HZ3  . LYS A 1 42  ? -0.845 -11.010 14.484 1.00 22.14 ? 42  LYS A HZ3  2  
ATOM 2794  N N    . ASN A 1 43  ? 3.471  -6.836  15.843 1.00 23.13 ? 43  ASN A N    2  
ATOM 2795  C CA   . ASN A 1 43  ? 3.308  -6.065  17.070 1.00 3.14  ? 43  ASN A CA   2  
ATOM 2796  C C    . ASN A 1 43  ? 4.414  -6.392  18.070 1.00 73.44 ? 43  ASN A C    2  
ATOM 2797  O O    . ASN A 1 43  ? 4.174  -6.461  19.274 1.00 12.35 ? 43  ASN A O    2  
ATOM 2798  C CB   . ASN A 1 43  ? 1.940  -6.346  17.696 1.00 45.41 ? 43  ASN A CB   2  
ATOM 2799  C CG   . ASN A 1 43  ? 1.696  -7.827  17.910 1.00 12.24 ? 43  ASN A CG   2  
ATOM 2800  O OD1  . ASN A 1 43  ? 2.621  -8.584  18.204 1.00 62.03 ? 43  ASN A OD1  2  
ATOM 2801  N ND2  . ASN A 1 43  ? 0.445  -8.247  17.764 1.00 14.14 ? 43  ASN A ND2  2  
ATOM 2802  H H    . ASN A 1 43  ? 3.214  -7.782  15.835 1.00 13.45 ? 43  ASN A H    2  
ATOM 2803  H HA   . ASN A 1 43  ? 3.369  -5.018  16.814 1.00 0.02  ? 43  ASN A HA   2  
ATOM 2804  H HB2  . ASN A 1 43  ? 1.880  -5.848  18.653 1.00 24.42 ? 43  ASN A HB2  2  
ATOM 2805  H HB3  . ASN A 1 43  ? 1.168  -5.962  17.046 1.00 2.13  ? 43  ASN A HB3  2  
ATOM 2806  H HD21 . ASN A 1 43  ? -0.241 -7.587  17.530 1.00 72.13 ? 43  ASN A HD21 2  
ATOM 2807  H HD22 . ASN A 1 43  ? 0.258  -9.200  17.898 1.00 1.40  ? 43  ASN A HD22 2  
ATOM 2808  N N    . GLU A 1 44  ? 5.625  -6.593  17.559 1.00 32.33 ? 44  GLU A N    2  
ATOM 2809  C CA   . GLU A 1 44  ? 6.767  -6.914  18.408 1.00 52.25 ? 44  GLU A CA   2  
ATOM 2810  C C    . GLU A 1 44  ? 8.075  -6.502  17.737 1.00 34.44 ? 44  GLU A C    2  
ATOM 2811  O O    . GLU A 1 44  ? 8.284  -6.754  16.550 1.00 20.32 ? 44  GLU A O    2  
ATOM 2812  C CB   . GLU A 1 44  ? 6.792  -8.411  18.723 1.00 14.34 ? 44  GLU A CB   2  
ATOM 2813  C CG   . GLU A 1 44  ? 7.699  -8.772  19.888 1.00 73.25 ? 44  GLU A CG   2  
ATOM 2814  C CD   . GLU A 1 44  ? 6.979  -8.732  21.222 1.00 64.12 ? 44  GLU A CD   2  
ATOM 2815  O OE1  . GLU A 1 44  ? 7.631  -8.409  22.237 1.00 24.51 ? 44  GLU A OE1  2  
ATOM 2816  O OE2  . GLU A 1 44  ? 5.766  -9.023  21.251 1.00 35.22 ? 44  GLU A OE2  2  
ATOM 2817  H H    . GLU A 1 44  ? 5.753  -6.525  16.590 1.00 10.02 ? 44  GLU A H    2  
ATOM 2818  H HA   . GLU A 1 44  ? 6.660  -6.363  19.330 1.00 40.35 ? 44  GLU A HA   2  
ATOM 2819  H HB2  . GLU A 1 44  ? 5.789  -8.733  18.961 1.00 14.02 ? 44  GLU A HB2  2  
ATOM 2820  H HB3  . GLU A 1 44  ? 7.133  -8.945  17.849 1.00 4.30  ? 44  GLU A HB3  2  
ATOM 2821  H HG2  . GLU A 1 44  ? 8.082  -9.770  19.733 1.00 52.44 ? 44  GLU A HG2  2  
ATOM 2822  H HG3  . GLU A 1 44  ? 8.521  -8.073  19.917 1.00 1.43  ? 44  GLU A HG3  2  
ATOM 2823  N N    . THR A 1 45  ? 8.953  -5.867  18.507 1.00 52.31 ? 45  THR A N    2  
ATOM 2824  C CA   . THR A 1 45  ? 10.239 -5.418  17.989 1.00 21.31 ? 45  THR A CA   2  
ATOM 2825  C C    . THR A 1 45  ? 11.164 -6.599  17.717 1.00 22.13 ? 45  THR A C    2  
ATOM 2826  O O    . THR A 1 45  ? 11.021 -7.662  18.320 1.00 23.14 ? 45  THR A O    2  
ATOM 2827  C CB   . THR A 1 45  ? 10.933 -4.452  18.968 1.00 72.03 ? 45  THR A CB   2  
ATOM 2828  O OG1  . THR A 1 45  ? 9.956  -3.645  19.634 1.00 32.05 ? 45  THR A OG1  2  
ATOM 2829  C CG2  . THR A 1 45  ? 11.922 -3.558  18.235 1.00 21.05 ? 45  THR A CG2  2  
ATOM 2830  H H    . THR A 1 45  ? 8.728  -5.695  19.445 1.00 22.12 ? 45  THR A H    2  
ATOM 2831  H HA   . THR A 1 45  ? 10.061 -4.892  17.062 1.00 33.44 ? 45  THR A HA   2  
ATOM 2832  H HB   . THR A 1 45  ? 11.471 -5.033  19.703 1.00 61.22 ? 45  THR A HB   2  
ATOM 2833  H HG1  . THR A 1 45  ? 10.392 -2.906  20.066 1.00 35.23 ? 45  THR A HG1  2  
ATOM 2834  H HG21 . THR A 1 45  ? 12.922 -3.944  18.367 1.00 61.32 ? 45  THR A HG21 2  
ATOM 2835  H HG22 . THR A 1 45  ? 11.867 -2.557  18.636 1.00 2.20  ? 45  THR A HG22 2  
ATOM 2836  H HG23 . THR A 1 45  ? 11.679 -3.539  17.184 1.00 63.12 ? 45  THR A HG23 2  
ATOM 2837  N N    . GLU A 1 46  ? 12.113 -6.405  16.806 1.00 13.45 ? 46  GLU A N    2  
ATOM 2838  C CA   . GLU A 1 46  ? 13.061 -7.455  16.456 1.00 61.22 ? 46  GLU A CA   2  
ATOM 2839  C C    . GLU A 1 46  ? 13.847 -7.910  17.682 1.00 22.11 ? 46  GLU A C    2  
ATOM 2840  O O    . GLU A 1 46  ? 14.177 -9.088  17.821 1.00 34.21 ? 46  GLU A O    2  
ATOM 2841  C CB   . GLU A 1 46  ? 14.024 -6.963  15.373 1.00 73.42 ? 46  GLU A CB   2  
ATOM 2842  C CG   . GLU A 1 46  ? 13.372 -6.794  14.011 1.00 63.44 ? 46  GLU A CG   2  
ATOM 2843  C CD   . GLU A 1 46  ? 13.285 -5.343  13.582 1.00 45.45 ? 46  GLU A CD   2  
ATOM 2844  O OE1  . GLU A 1 46  ? 14.298 -4.624  13.710 1.00 3.31  ? 46  GLU A OE1  2  
ATOM 2845  O OE2  . GLU A 1 46  ? 12.204 -4.926  13.117 1.00 52.33 ? 46  GLU A OE2  2  
ATOM 2846  H H    . GLU A 1 46  ? 12.176 -5.535  16.360 1.00 52.33 ? 46  GLU A H    2  
ATOM 2847  H HA   . GLU A 1 46  ? 12.500 -8.294  16.072 1.00 41.44 ? 46  GLU A HA   2  
ATOM 2848  H HB2  . GLU A 1 46  ? 14.431 -6.010  15.676 1.00 54.23 ? 46  GLU A HB2  2  
ATOM 2849  H HB3  . GLU A 1 46  ? 14.831 -7.674  15.277 1.00 70.45 ? 46  GLU A HB3  2  
ATOM 2850  H HG2  . GLU A 1 46  ? 13.953 -7.336  13.278 1.00 14.35 ? 46  GLU A HG2  2  
ATOM 2851  H HG3  . GLU A 1 46  ? 12.373 -7.203  14.050 1.00 24.21 ? 46  GLU A HG3  2  
ATOM 2852  N N    . LYS A 1 47  ? 14.145 -6.967  18.569 1.00 25.14 ? 47  LYS A N    2  
ATOM 2853  C CA   . LYS A 1 47  ? 14.892 -7.268  19.785 1.00 21.40 ? 47  LYS A CA   2  
ATOM 2854  C C    . LYS A 1 47  ? 14.126 -8.252  20.664 1.00 3.23  ? 47  LYS A C    2  
ATOM 2855  O O    . LYS A 1 47  ? 14.567 -9.381  20.878 1.00 30.30 ? 47  LYS A O    2  
ATOM 2856  C CB   . LYS A 1 47  ? 15.175 -5.983  20.566 1.00 63.20 ? 47  LYS A CB   2  
ATOM 2857  C CG   . LYS A 1 47  ? 16.655 -5.699  20.753 1.00 5.22  ? 47  LYS A CG   2  
ATOM 2858  C CD   . LYS A 1 47  ? 17.145 -6.166  22.114 1.00 42.52 ? 47  LYS A CD   2  
ATOM 2859  C CE   . LYS A 1 47  ? 17.564 -7.627  22.084 1.00 24.30 ? 47  LYS A CE   2  
ATOM 2860  N NZ   . LYS A 1 47  ? 16.646 -8.484  22.884 1.00 20.11 ? 47  LYS A NZ   2  
ATOM 2861  H H    . LYS A 1 47  ? 13.855 -6.045  18.403 1.00 62.31 ? 47  LYS A H    2  
ATOM 2862  H HA   . LYS A 1 47  ? 15.830 -7.718  19.496 1.00 51.34 ? 47  LYS A HA   2  
ATOM 2863  H HB2  . LYS A 1 47  ? 14.734 -5.151  20.038 1.00 50.30 ? 47  LYS A HB2  2  
ATOM 2864  H HB3  . LYS A 1 47  ? 14.719 -6.062  21.542 1.00 10.44 ? 47  LYS A HB3  2  
ATOM 2865  H HG2  . LYS A 1 47  ? 17.212 -6.216  19.986 1.00 42.33 ? 47  LYS A HG2  2  
ATOM 2866  H HG3  . LYS A 1 47  ? 16.822 -4.634  20.666 1.00 30.44 ? 47  LYS A HG3  2  
ATOM 2867  H HD2  . LYS A 1 47  ? 17.994 -5.566  22.407 1.00 51.52 ? 47  LYS A HD2  2  
ATOM 2868  H HD3  . LYS A 1 47  ? 16.349 -6.043  22.835 1.00 42.22 ? 47  LYS A HD3  2  
ATOM 2869  H HE2  . LYS A 1 47  ? 17.561 -7.969  21.060 1.00 15.42 ? 47  LYS A HE2  2  
ATOM 2870  H HE3  . LYS A 1 47  ? 18.563 -7.710  22.487 1.00 11.02 ? 47  LYS A HE3  2  
ATOM 2871  H HZ1  . LYS A 1 47  ? 16.029 -7.891  23.475 1.00 31.02 ? 47  LYS A HZ1  2  
ATOM 2872  H HZ2  . LYS A 1 47  ? 17.194 -9.116  23.501 1.00 23.52 ? 47  LYS A HZ2  2  
ATOM 2873  H HZ3  . LYS A 1 47  ? 16.054 -9.061  22.253 1.00 40.41 ? 47  LYS A HZ3  2  
ATOM 2874  N N    . ASP A 1 48  ? 12.978 -7.816  21.170 1.00 51.31 ? 48  ASP A N    2  
ATOM 2875  C CA   . ASP A 1 48  ? 12.149 -8.659  22.024 1.00 43.20 ? 48  ASP A CA   2  
ATOM 2876  C C    . ASP A 1 48  ? 11.731 -9.930  21.291 1.00 1.14  ? 48  ASP A C    2  
ATOM 2877  O O    . ASP A 1 48  ? 11.701 -11.013 21.875 1.00 52.11 ? 48  ASP A O    2  
ATOM 2878  C CB   . ASP A 1 48  ? 10.910 -7.891  22.487 1.00 62.00 ? 48  ASP A CB   2  
ATOM 2879  C CG   . ASP A 1 48  ? 11.227 -6.459  22.871 1.00 34.15 ? 48  ASP A CG   2  
ATOM 2880  O OD1  . ASP A 1 48  ? 11.950 -6.258  23.870 1.00 62.45 ? 48  ASP A OD1  2  
ATOM 2881  O OD2  . ASP A 1 48  ? 10.751 -5.539  22.174 1.00 62.12 ? 48  ASP A OD2  2  
ATOM 2882  H H    . ASP A 1 48  ? 12.680 -6.905  20.963 1.00 33.02 ? 48  ASP A H    2  
ATOM 2883  H HA   . ASP A 1 48  ? 12.735 -8.933  22.888 1.00 3.12  ? 48  ASP A HA   2  
ATOM 2884  H HB2  . ASP A 1 48  ? 10.184 -7.877  21.688 1.00 74.15 ? 48  ASP A HB2  2  
ATOM 2885  H HB3  . ASP A 1 48  ? 10.485 -8.390  23.345 1.00 24.24 ? 48  ASP A HB3  2  
ATOM 2886  N N    . ALA A 1 49  ? 11.408 -9.789  20.010 1.00 64.11 ? 49  ALA A N    2  
ATOM 2887  C CA   . ALA A 1 49  ? 10.993 -10.926 19.197 1.00 12.25 ? 49  ALA A CA   2  
ATOM 2888  C C    . ALA A 1 49  ? 12.022 -12.050 19.259 1.00 53.45 ? 49  ALA A C    2  
ATOM 2889  O O    . ALA A 1 49  ? 11.685 -13.223 19.097 1.00 34.45 ? 49  ALA A O    2  
ATOM 2890  C CB   . ALA A 1 49  ? 10.768 -10.491 17.757 1.00 43.22 ? 49  ALA A CB   2  
ATOM 2891  H H    . ALA A 1 49  ? 11.452 -8.900  19.601 1.00 43.11 ? 49  ALA A H    2  
ATOM 2892  H HA   . ALA A 1 49  ? 10.053 -11.290 19.588 1.00 4.34  ? 49  ALA A HA   2  
ATOM 2893  H HB1  . ALA A 1 49  ? 11.602 -9.886  17.430 1.00 21.32 ? 49  ALA A HB1  2  
ATOM 2894  H HB2  . ALA A 1 49  ? 10.687 -11.363 17.126 1.00 32.41 ? 49  ALA A HB2  2  
ATOM 2895  H HB3  . ALA A 1 49  ? 9.858  -9.914  17.693 1.00 1.42  ? 49  ALA A HB3  2  
ATOM 2896  N N    . LEU A 1 50  ? 13.277 -11.684 19.491 1.00 3.33  ? 50  LEU A N    2  
ATOM 2897  C CA   . LEU A 1 50  ? 14.357 -12.662 19.573 1.00 53.30 ? 50  LEU A CA   2  
ATOM 2898  C C    . LEU A 1 50  ? 14.405 -13.305 20.955 1.00 73.50 ? 50  LEU A C    2  
ATOM 2899  O O    . LEU A 1 50  ? 14.242 -14.518 21.091 1.00 31.44 ? 50  LEU A O    2  
ATOM 2900  C CB   . LEU A 1 50  ? 15.698 -11.997 19.261 1.00 65.05 ? 50  LEU A CB   2  
ATOM 2901  C CG   . LEU A 1 50  ? 16.045 -11.848 17.779 1.00 53.13 ? 50  LEU A CG   2  
ATOM 2902  C CD1  . LEU A 1 50  ? 17.377 -11.134 17.611 1.00 52.40 ? 50  LEU A CD1  2  
ATOM 2903  C CD2  . LEU A 1 50  ? 16.078 -13.209 17.099 1.00 20.11 ? 50  LEU A CD2  2  
ATOM 2904  H H    . LEU A 1 50  ? 13.485 -10.734 19.611 1.00 14.13 ? 50  LEU A H    2  
ATOM 2905  H HA   . LEU A 1 50  ? 14.165 -13.429 18.838 1.00 35.21 ? 50  LEU A HA   2  
ATOM 2906  H HB2  . LEU A 1 50  ? 15.689 -11.011 19.698 1.00 13.24 ? 50  LEU A HB2  2  
ATOM 2907  H HB3  . LEU A 1 50  ? 16.475 -12.588 19.725 1.00 3.31  ? 50  LEU A HB3  2  
ATOM 2908  H HG   . LEU A 1 50  ? 15.283 -11.251 17.296 1.00 43.41 ? 50  LEU A HG   2  
ATOM 2909  H HD11 . LEU A 1 50  ? 17.201 -10.098 17.362 1.00 61.23 ? 50  LEU A HD11 2  
ATOM 2910  H HD12 . LEU A 1 50  ? 17.940 -11.604 16.819 1.00 62.22 ? 50  LEU A HD12 2  
ATOM 2911  H HD13 . LEU A 1 50  ? 17.935 -11.193 18.534 1.00 45.13 ? 50  LEU A HD13 2  
ATOM 2912  H HD21 . LEU A 1 50  ? 16.323 -13.968 17.827 1.00 35.42 ? 50  LEU A HD21 2  
ATOM 2913  H HD22 . LEU A 1 50  ? 16.826 -13.204 16.320 1.00 42.14 ? 50  LEU A HD22 2  
ATOM 2914  H HD23 . LEU A 1 50  ? 15.110 -13.420 16.669 1.00 24.40 ? 50  LEU A HD23 2  
ATOM 2915  N N    . ILE A 1 51  ? 14.627 -12.485 21.977 1.00 70.45 ? 51  ILE A N    2  
ATOM 2916  C CA   . ILE A 1 51  ? 14.693 -12.975 23.348 1.00 53.30 ? 51  ILE A CA   2  
ATOM 2917  C C    . ILE A 1 51  ? 13.474 -13.827 23.687 1.00 41.52 ? 51  ILE A C    2  
ATOM 2918  O O    . ILE A 1 51  ? 13.551 -14.738 24.511 1.00 12.31 ? 51  ILE A O    2  
ATOM 2919  C CB   . ILE A 1 51  ? 14.790 -11.814 24.356 1.00 60.13 ? 51  ILE A CB   2  
ATOM 2920  C CG1  . ILE A 1 51  ? 15.288 -12.325 25.709 1.00 64.40 ? 51  ILE A CG1  2  
ATOM 2921  C CG2  . ILE A 1 51  ? 13.440 -11.129 24.507 1.00 70.23 ? 51  ILE A CG2  2  
ATOM 2922  C CD1  . ILE A 1 51  ? 15.644 -11.220 26.679 1.00 71.23 ? 51  ILE A CD1  2  
ATOM 2923  H H    . ILE A 1 51  ? 14.749 -11.529 21.804 1.00 52.21 ? 51  ILE A H    2  
ATOM 2924  H HA   . ILE A 1 51  ? 15.581 -13.583 23.442 1.00 1.44  ? 51  ILE A HA   2  
ATOM 2925  H HB   . ILE A 1 51  ? 15.493 -11.091 23.971 1.00 14.21 ? 51  ILE A HB   2  
ATOM 2926  H HG12 . ILE A 1 51  ? 14.520 -12.930 26.164 1.00 71.24 ? 51  ILE A HG12 2  
ATOM 2927  H HG13 . ILE A 1 51  ? 16.171 -12.929 25.554 1.00 3.12  ? 51  ILE A HG13 2  
ATOM 2928  H HG21 . ILE A 1 51  ? 13.115 -10.759 23.545 1.00 34.45 ? 51  ILE A HG21 2  
ATOM 2929  H HG22 . ILE A 1 51  ? 12.717 -11.838 24.882 1.00 62.01 ? 51  ILE A HG22 2  
ATOM 2930  H HG23 . ILE A 1 51  ? 13.529 -10.305 25.198 1.00 23.01 ? 51  ILE A HG23 2  
ATOM 2931  H HD11 . ILE A 1 51  ? 16.715 -11.193 26.817 1.00 53.41 ? 51  ILE A HD11 2  
ATOM 2932  H HD12 . ILE A 1 51  ? 15.306 -10.273 26.286 1.00 71.30 ? 51  ILE A HD12 2  
ATOM 2933  H HD13 . ILE A 1 51  ? 15.164 -11.407 27.629 1.00 62.31 ? 51  ILE A HD13 2  
ATOM 2934  N N    . ARG A 1 52  ? 12.351 -13.525 23.044 1.00 52.32 ? 52  ARG A N    2  
ATOM 2935  C CA   . ARG A 1 52  ? 11.115 -14.263 23.276 1.00 24.14 ? 52  ARG A CA   2  
ATOM 2936  C C    . ARG A 1 52  ? 11.167 -15.633 22.606 1.00 34.25 ? 52  ARG A C    2  
ATOM 2937  O O    . ARG A 1 52  ? 10.828 -16.646 23.218 1.00 52.13 ? 52  ARG A O    2  
ATOM 2938  C CB   . ARG A 1 52  ? 9.916  -13.471 22.751 1.00 25.33 ? 52  ARG A CB   2  
ATOM 2939  C CG   . ARG A 1 52  ? 9.166  -12.713 23.834 1.00 41.11 ? 52  ARG A CG   2  
ATOM 2940  C CD   . ARG A 1 52  ? 10.094 -11.798 24.618 1.00 32.22 ? 52  ARG A CD   2  
ATOM 2941  N NE   . ARG A 1 52  ? 9.400  -10.615 25.120 1.00 21.12 ? 52  ARG A NE   2  
ATOM 2942  C CZ   . ARG A 1 52  ? 9.877  -9.839  26.087 1.00 53.32 ? 52  ARG A CZ   2  
ATOM 2943  N NH1  . ARG A 1 52  ? 11.043 -10.119 26.652 1.00 13.34 ? 52  ARG A NH1  2  
ATOM 2944  N NH2  . ARG A 1 52  ? 9.187  -8.779  26.489 1.00 33.13 ? 52  ARG A NH2  2  
ATOM 2945  H H    . ARG A 1 52  ? 12.353 -12.787 22.398 1.00 35.41 ? 52  ARG A H    2  
ATOM 2946  H HA   . ARG A 1 52  ? 11.006 -14.400 24.342 1.00 63.33 ? 52  ARG A HA   2  
ATOM 2947  H HB2  . ARG A 1 52  ? 10.264 -12.758 22.018 1.00 33.21 ? 52  ARG A HB2  2  
ATOM 2948  H HB3  . ARG A 1 52  ? 9.228  -14.155 22.278 1.00 21.44 ? 52  ARG A HB3  2  
ATOM 2949  H HG2  . ARG A 1 52  ? 8.394  -12.114 23.372 1.00 25.54 ? 52  ARG A HG2  2  
ATOM 2950  H HG3  . ARG A 1 52  ? 8.717  -13.423 24.512 1.00 73.01 ? 52  ARG A HG3  2  
ATOM 2951  H HD2  . ARG A 1 52  ? 10.498 -12.349 25.455 1.00 53.33 ? 52  ARG A HD2  2  
ATOM 2952  H HD3  . ARG A 1 52  ? 10.899 -11.485 23.971 1.00 4.42  ? 52  ARG A HD3  2  
ATOM 2953  H HE   . ARG A 1 52  ? 8.537  -10.390 24.716 1.00 14.22 ? 52  ARG A HE   2  
ATOM 2954  H HH11 . ARG A 1 52  ? 11.565 -10.916 26.350 1.00 3.24  ? 52  ARG A HH11 2  
ATOM 2955  H HH12 . ARG A 1 52  ? 11.400 -9.532  27.379 1.00 11.43 ? 52  ARG A HH12 2  
ATOM 2956  H HH21 . ARG A 1 52  ? 8.307  -8.565  26.065 1.00 4.32  ? 52  ARG A HH21 2  
ATOM 2957  H HH22 . ARG A 1 52  ? 9.546  -8.196  27.217 1.00 40.42 ? 52  ARG A HH22 2  
ATOM 2958  N N    . GLU A 1 53  ? 11.592 -15.655 21.347 1.00 30.12 ? 53  GLU A N    2  
ATOM 2959  C CA   . GLU A 1 53  ? 11.686 -16.901 20.595 1.00 53.42 ? 53  GLU A CA   2  
ATOM 2960  C C    . GLU A 1 53  ? 12.796 -17.789 21.149 1.00 40.30 ? 53  GLU A C    2  
ATOM 2961  O O    . GLU A 1 53  ? 12.543 -18.902 21.609 1.00 32.42 ? 53  GLU A O    2  
ATOM 2962  C CB   . GLU A 1 53  ? 11.941 -16.610 19.114 1.00 20.14 ? 53  GLU A CB   2  
ATOM 2963  C CG   . GLU A 1 53  ? 10.761 -15.963 18.409 1.00 61.12 ? 53  GLU A CG   2  
ATOM 2964  C CD   . GLU A 1 53  ? 9.760  -16.979 17.895 1.00 60.34 ? 53  GLU A CD   2  
ATOM 2965  O OE1  . GLU A 1 53  ? 8.739  -17.203 18.578 1.00 31.30 ? 53  GLU A OE1  2  
ATOM 2966  O OE2  . GLU A 1 53  ? 9.997  -17.550 16.810 1.00 63.50 ? 53  GLU A OE2  2  
ATOM 2967  H H    . GLU A 1 53  ? 11.848 -14.814 20.914 1.00 21.20 ? 53  GLU A H    2  
ATOM 2968  H HA   . GLU A 1 53  ? 10.744 -17.419 20.693 1.00 60.00 ? 53  GLU A HA   2  
ATOM 2969  H HB2  . GLU A 1 53  ? 12.791 -15.949 19.031 1.00 61.21 ? 53  GLU A HB2  2  
ATOM 2970  H HB3  . GLU A 1 53  ? 12.168 -17.539 18.612 1.00 3.11  ? 53  GLU A HB3  2  
ATOM 2971  H HG2  . GLU A 1 53  ? 10.259 -15.306 19.103 1.00 42.21 ? 53  GLU A HG2  2  
ATOM 2972  H HG3  . GLU A 1 53  ? 11.130 -15.388 17.572 1.00 13.43 ? 53  GLU A HG3  2  
ATOM 2973  N N    . ILE A 1 54  ? 14.026 -17.288 21.100 1.00 12.15 ? 54  ILE A N    2  
ATOM 2974  C CA   . ILE A 1 54  ? 15.174 -18.035 21.598 1.00 44.13 ? 54  ILE A CA   2  
ATOM 2975  C C    . ILE A 1 54  ? 14.913 -18.576 22.999 1.00 23.31 ? 54  ILE A C    2  
ATOM 2976  O O    . ILE A 1 54  ? 15.523 -19.560 23.419 1.00 32.10 ? 54  ILE A O    2  
ATOM 2977  C CB   . ILE A 1 54  ? 16.444 -17.163 21.625 1.00 71.34 ? 54  ILE A CB   2  
ATOM 2978  C CG1  . ILE A 1 54  ? 16.789 -16.683 20.214 1.00 41.25 ? 54  ILE A CG1  2  
ATOM 2979  C CG2  . ILE A 1 54  ? 17.607 -17.939 22.225 1.00 74.51 ? 54  ILE A CG2  2  
ATOM 2980  C CD1  . ILE A 1 54  ? 17.588 -15.399 20.191 1.00 2.31  ? 54  ILE A CD1  2  
ATOM 2981  H H    . ILE A 1 54  ? 14.164 -16.395 20.722 1.00 13.21 ? 54  ILE A H    2  
ATOM 2982  H HA   . ILE A 1 54  ? 15.346 -18.866 20.929 1.00 44.35 ? 54  ILE A HA   2  
ATOM 2983  H HB   . ILE A 1 54  ? 16.252 -16.307 22.252 1.00 2.52  ? 54  ILE A HB   2  
ATOM 2984  H HG12 . ILE A 1 54  ? 17.369 -17.442 19.713 1.00 33.20 ? 54  ILE A HG12 2  
ATOM 2985  H HG13 . ILE A 1 54  ? 15.874 -16.515 19.665 1.00 55.51 ? 54  ILE A HG13 2  
ATOM 2986  H HG21 . ILE A 1 54  ? 17.503 -17.969 23.300 1.00 42.54 ? 54  ILE A HG21 2  
ATOM 2987  H HG22 . ILE A 1 54  ? 17.605 -18.947 21.837 1.00 52.02 ? 54  ILE A HG22 2  
ATOM 2988  H HG23 . ILE A 1 54  ? 18.536 -17.455 21.965 1.00 13.25 ? 54  ILE A HG23 2  
ATOM 2989  H HD11 . ILE A 1 54  ? 17.109 -14.665 20.823 1.00 64.13 ? 54  ILE A HD11 2  
ATOM 2990  H HD12 . ILE A 1 54  ? 18.587 -15.589 20.552 1.00 23.44 ? 54  ILE A HD12 2  
ATOM 2991  H HD13 . ILE A 1 54  ? 17.637 -15.023 19.179 1.00 64.32 ? 54  ILE A HD13 2  
ATOM 2992  N N    . ARG A 1 55  ? 14.002 -17.928 23.718 1.00 61.45 ? 55  ARG A N    2  
ATOM 2993  C CA   . ARG A 1 55  ? 13.659 -18.345 25.072 1.00 63.11 ? 55  ARG A CA   2  
ATOM 2994  C C    . ARG A 1 55  ? 13.033 -19.737 25.071 1.00 44.25 ? 55  ARG A C    2  
ATOM 2995  O O    . ARG A 1 55  ? 13.580 -20.673 25.652 1.00 34.42 ? 55  ARG A O    2  
ATOM 2996  C CB   . ARG A 1 55  ? 12.696 -17.342 25.709 1.00 41.33 ? 55  ARG A CB   2  
ATOM 2997  C CG   . ARG A 1 55  ? 13.323 -16.518 26.822 1.00 34.53 ? 55  ARG A CG   2  
ATOM 2998  C CD   . ARG A 1 55  ? 12.375 -15.437 27.316 1.00 11.41 ? 55  ARG A CD   2  
ATOM 2999  N NE   . ARG A 1 55  ? 11.643 -15.853 28.509 1.00 1.04  ? 55  ARG A NE   2  
ATOM 3000  C CZ   . ARG A 1 55  ? 10.729 -15.100 29.111 1.00 73.12 ? 55  ARG A CZ   2  
ATOM 3001  N NH1  . ARG A 1 55  ? 10.435 -13.899 28.632 1.00 4.24  ? 55  ARG A NH1  2  
ATOM 3002  N NH2  . ARG A 1 55  ? 10.105 -15.549 30.193 1.00 43.22 ? 55  ARG A NH2  2  
ATOM 3003  H H    . ARG A 1 55  ? 13.550 -17.151 23.328 1.00 40.10 ? 55  ARG A H    2  
ATOM 3004  H HA   . ARG A 1 55  ? 14.570 -18.374 25.651 1.00 42.40 ? 55  ARG A HA   2  
ATOM 3005  H HB2  . ARG A 1 55  ? 12.344 -16.664 24.945 1.00 34.00 ? 55  ARG A HB2  2  
ATOM 3006  H HB3  . ARG A 1 55  ? 11.854 -17.879 26.118 1.00 22.40 ? 55  ARG A HB3  2  
ATOM 3007  H HG2  . ARG A 1 55  ? 13.566 -17.172 27.647 1.00 2.21  ? 55  ARG A HG2  2  
ATOM 3008  H HG3  . ARG A 1 55  ? 14.224 -16.054 26.450 1.00 15.23 ? 55  ARG A HG3  2  
ATOM 3009  H HD2  . ARG A 1 55  ? 12.949 -14.552 27.548 1.00 22.12 ? 55  ARG A HD2  2  
ATOM 3010  H HD3  . ARG A 1 55  ? 11.668 -15.211 26.532 1.00 40.03 ? 55  ARG A HD3  2  
ATOM 3011  H HE   . ARG A 1 55  ? 11.844 -16.737 28.880 1.00 63.23 ? 55  ARG A HE   2  
ATOM 3012  H HH11 . ARG A 1 55  ? 10.903 -13.559 27.817 1.00 52.43 ? 55  ARG A HH11 2  
ATOM 3013  H HH12 . ARG A 1 55  ? 9.746  -13.334 29.086 1.00 34.45 ? 55  ARG A HH12 2  
ATOM 3014  H HH21 . ARG A 1 55  ? 10.324 -16.454 30.556 1.00 13.11 ? 55  ARG A HH21 2  
ATOM 3015  H HH22 . ARG A 1 55  ? 9.418  -14.981 30.645 1.00 74.53 ? 55  ARG A HH22 2  
ATOM 3016  N N    . GLU A 1 56  ? 11.885 -19.863 24.413 1.00 13.24 ? 56  GLU A N    2  
ATOM 3017  C CA   . GLU A 1 56  ? 11.185 -21.140 24.338 1.00 14.31 ? 56  GLU A CA   2  
ATOM 3018  C C    . GLU A 1 56  ? 11.605 -21.918 23.095 1.00 73.04 ? 56  GLU A C    2  
ATOM 3019  O O    . GLU A 1 56  ? 11.959 -23.093 23.177 1.00 64.44 ? 56  GLU A O    2  
ATOM 3020  C CB   . GLU A 1 56  ? 9.671  -20.917 24.326 1.00 12.35 ? 56  GLU A CB   2  
ATOM 3021  C CG   . GLU A 1 56  ? 8.866  -22.193 24.507 1.00 42.05 ? 56  GLU A CG   2  
ATOM 3022  C CD   . GLU A 1 56  ? 7.512  -21.944 25.142 1.00 61.20 ? 56  GLU A CD   2  
ATOM 3023  O OE1  . GLU A 1 56  ? 6.493  -22.354 24.548 1.00 21.54 ? 56  GLU A OE1  2  
ATOM 3024  O OE2  . GLU A 1 56  ? 7.472  -21.339 26.234 1.00 40.13 ? 56  GLU A OE2  2  
ATOM 3025  H H    . GLU A 1 56  ? 11.499 -19.079 23.969 1.00 10.15 ? 56  GLU A H    2  
ATOM 3026  H HA   . GLU A 1 56  ? 11.448 -21.714 25.213 1.00 34.23 ? 56  GLU A HA   2  
ATOM 3027  H HB2  . GLU A 1 56  ? 9.413  -20.237 25.125 1.00 10.21 ? 56  GLU A HB2  2  
ATOM 3028  H HB3  . GLU A 1 56  ? 9.392  -20.471 23.383 1.00 65.01 ? 56  GLU A HB3  2  
ATOM 3029  H HG2  . GLU A 1 56  ? 8.714  -22.647 23.539 1.00 64.31 ? 56  GLU A HG2  2  
ATOM 3030  H HG3  . GLU A 1 56  ? 9.425  -22.869 25.137 1.00 75.51 ? 56  GLU A HG3  2  
ATOM 3031  N N    . GLU A 1 57  ? 11.561 -21.253 21.944 1.00 13.13 ? 57  GLU A N    2  
ATOM 3032  C CA   . GLU A 1 57  ? 11.935 -21.883 20.684 1.00 43.23 ? 57  GLU A CA   2  
ATOM 3033  C C    . GLU A 1 57  ? 13.273 -22.606 20.813 1.00 0.40  ? 57  GLU A C    2  
ATOM 3034  O O    . GLU A 1 57  ? 13.357 -23.817 20.615 1.00 22.34 ? 57  GLU A O    2  
ATOM 3035  C CB   . GLU A 1 57  ? 12.014 -20.837 19.569 1.00 34.41 ? 57  GLU A CB   2  
ATOM 3036  C CG   . GLU A 1 57  ? 10.740 -20.025 19.406 1.00 60.10 ? 57  GLU A CG   2  
ATOM 3037  C CD   . GLU A 1 57  ? 9.529  -20.891 19.119 1.00 54.22 ? 57  GLU A CD   2  
ATOM 3038  O OE1  . GLU A 1 57  ? 9.650  -21.832 18.308 1.00 63.41 ? 57  GLU A OE1  2  
ATOM 3039  O OE2  . GLU A 1 57  ? 8.459  -20.626 19.706 1.00 35.10 ? 57  GLU A OE2  2  
ATOM 3040  H H    . GLU A 1 57  ? 11.269 -20.317 21.944 1.00 62.45 ? 57  GLU A H    2  
ATOM 3041  H HA   . GLU A 1 57  ? 11.173 -22.605 20.434 1.00 15.22 ? 57  GLU A HA   2  
ATOM 3042  H HB2  . GLU A 1 57  ? 12.825 -20.158 19.786 1.00 52.04 ? 57  GLU A HB2  2  
ATOM 3043  H HB3  . GLU A 1 57  ? 12.217 -21.340 18.635 1.00 11.00 ? 57  GLU A HB3  2  
ATOM 3044  H HG2  . GLU A 1 57  ? 10.561 -19.473 20.317 1.00 71.25 ? 57  GLU A HG2  2  
ATOM 3045  H HG3  . GLU A 1 57  ? 10.872 -19.333 18.587 1.00 30.12 ? 57  GLU A HG3  2  
ATOM 3046  N N    . MET A 1 58  ? 14.316 -21.852 21.146 1.00 62.35 ? 58  MET A N    2  
ATOM 3047  C CA   . MET A 1 58  ? 15.650 -22.421 21.302 1.00 50.21 ? 58  MET A CA   2  
ATOM 3048  C C    . MET A 1 58  ? 15.796 -23.100 22.660 1.00 74.22 ? 58  MET A C    2  
ATOM 3049  O O    . MET A 1 58  ? 16.642 -23.976 22.840 1.00 72.32 ? 58  MET A O    2  
ATOM 3050  C CB   . MET A 1 58  ? 16.713 -21.332 21.147 1.00 42.22 ? 58  MET A CB   2  
ATOM 3051  C CG   . MET A 1 58  ? 17.154 -21.113 19.709 1.00 62.44 ? 58  MET A CG   2  
ATOM 3052  S SD   . MET A 1 58  ? 15.840 -20.440 18.674 1.00 42.32 ? 58  MET A SD   2  
ATOM 3053  C CE   . MET A 1 58  ? 16.713 -19.119 17.835 1.00 30.52 ? 58  MET A CE   2  
ATOM 3054  H H    . MET A 1 58  ? 14.187 -20.892 21.290 1.00 15.42 ? 58  MET A H    2  
ATOM 3055  H HA   . MET A 1 58  ? 15.788 -23.159 20.526 1.00 21.14 ? 58  MET A HA   2  
ATOM 3056  H HB2  . MET A 1 58  ? 16.316 -20.401 21.524 1.00 22.31 ? 58  MET A HB2  2  
ATOM 3057  H HB3  . MET A 1 58  ? 17.581 -21.606 21.728 1.00 33.24 ? 58  MET A HB3  2  
ATOM 3058  H HG2  . MET A 1 58  ? 17.986 -20.425 19.701 1.00 24.43 ? 58  MET A HG2  2  
ATOM 3059  H HG3  . MET A 1 58  ? 17.469 -22.060 19.296 1.00 64.40 ? 58  MET A HG3  2  
ATOM 3060  H HE1  . MET A 1 58  ? 16.855 -19.384 16.798 1.00 42.12 ? 58  MET A HE1  2  
ATOM 3061  H HE2  . MET A 1 58  ? 16.135 -18.209 17.899 1.00 64.30 ? 58  MET A HE2  2  
ATOM 3062  H HE3  . MET A 1 58  ? 17.675 -18.970 18.304 1.00 51.12 ? 58  MET A HE3  2  
ATOM 3063  N N    . LYS A 1 59  ? 14.966 -22.691 23.613 1.00 12.33 ? 59  LYS A N    2  
ATOM 3064  C CA   . LYS A 1 59  ? 15.001 -23.260 24.955 1.00 12.02 ? 59  LYS A CA   2  
ATOM 3065  C C    . LYS A 1 59  ? 16.322 -22.940 25.648 1.00 72.24 ? 59  LYS A C    2  
ATOM 3066  O O    . LYS A 1 59  ? 16.781 -23.693 26.507 1.00 21.22 ? 59  LYS A O    2  
ATOM 3067  C CB   . LYS A 1 59  ? 14.799 -24.776 24.894 1.00 52.31 ? 59  LYS A CB   2  
ATOM 3068  C CG   . LYS A 1 59  ? 13.482 -25.239 25.494 1.00 44.33 ? 59  LYS A CG   2  
ATOM 3069  C CD   . LYS A 1 59  ? 13.654 -25.690 26.934 1.00 2.14  ? 59  LYS A CD   2  
ATOM 3070  C CE   . LYS A 1 59  ? 12.430 -26.443 27.432 1.00 10.24 ? 59  LYS A CE   2  
ATOM 3071  N NZ   . LYS A 1 59  ? 12.555 -27.911 27.215 1.00 3.33  ? 59  LYS A NZ   2  
ATOM 3072  H H    . LYS A 1 59  ? 14.313 -21.988 23.409 1.00 75.40 ? 59  LYS A H    2  
ATOM 3073  H HA   . LYS A 1 59  ? 14.195 -22.821 25.523 1.00 11.41 ? 59  LYS A HA   2  
ATOM 3074  H HB2  . LYS A 1 59  ? 14.830 -25.089 23.861 1.00 60.51 ? 59  LYS A HB2  2  
ATOM 3075  H HB3  . LYS A 1 59  ? 15.604 -25.256 25.431 1.00 32.05 ? 59  LYS A HB3  2  
ATOM 3076  H HG2  . LYS A 1 59  ? 12.777 -24.421 25.466 1.00 61.55 ? 59  LYS A HG2  2  
ATOM 3077  H HG3  . LYS A 1 59  ? 13.102 -26.065 24.910 1.00 63.10 ? 59  LYS A HG3  2  
ATOM 3078  H HD2  . LYS A 1 59  ? 14.514 -26.341 26.999 1.00 14.40 ? 59  LYS A HD2  2  
ATOM 3079  H HD3  . LYS A 1 59  ? 13.810 -24.821 27.558 1.00 24.24 ? 59  LYS A HD3  2  
ATOM 3080  H HE2  . LYS A 1 59  ? 12.311 -26.253 28.488 1.00 3.40  ? 59  LYS A HE2  2  
ATOM 3081  H HE3  . LYS A 1 59  ? 11.561 -26.082 26.902 1.00 43.32 ? 59  LYS A HE3  2  
ATOM 3082  H HZ1  . LYS A 1 59  ? 12.333 -28.146 26.227 1.00 43.54 ? 59  LYS A HZ1  2  
ATOM 3083  H HZ2  . LYS A 1 59  ? 11.896 -28.421 27.837 1.00 25.30 ? 59  LYS A HZ2  2  
ATOM 3084  H HZ3  . LYS A 1 59  ? 13.525 -28.222 27.425 1.00 1.32  ? 59  LYS A HZ3  2  
ATOM 3085  N N    . CYS A 1 60  ? 16.927 -21.820 25.269 1.00 14.31 ? 60  CYS A N    2  
ATOM 3086  C CA   . CYS A 1 60  ? 18.195 -21.400 25.855 1.00 70.24 ? 60  CYS A CA   2  
ATOM 3087  C C    . CYS A 1 60  ? 18.077 -20.009 26.469 1.00 74.12 ? 60  CYS A C    2  
ATOM 3088  O O    . CYS A 1 60  ? 17.151 -19.259 26.158 1.00 60.11 ? 60  CYS A O    2  
ATOM 3089  C CB   . CYS A 1 60  ? 19.298 -21.411 24.795 1.00 11.12 ? 60  CYS A CB   2  
ATOM 3090  S SG   . CYS A 1 60  ? 20.967 -21.589 25.468 1.00 35.15 ? 60  CYS A SG   2  
ATOM 3091  H H    . CYS A 1 60  ? 16.511 -21.261 24.579 1.00 23.12 ? 60  CYS A H    2  
ATOM 3092  H HA   . CYS A 1 60  ? 18.448 -22.103 26.633 1.00 24.51 ? 60  CYS A HA   2  
ATOM 3093  H HB2  . CYS A 1 60  ? 19.128 -22.235 24.118 1.00 62.01 ? 60  CYS A HB2  2  
ATOM 3094  H HB3  . CYS A 1 60  ? 19.263 -20.485 24.241 1.00 72.14 ? 60  CYS A HB3  2  
ATOM 3095  H HG   . CYS A 1 60  ? 20.863 -22.091 26.690 1.00 52.14 ? 60  CYS A HG   2  
ATOM 3096  N N    . ASP A 1 61  ? 19.018 -19.672 27.343 1.00 63.11 ? 61  ASP A N    2  
ATOM 3097  C CA   . ASP A 1 61  ? 19.020 -18.371 28.002 1.00 74.21 ? 61  ASP A CA   2  
ATOM 3098  C C    . ASP A 1 61  ? 19.952 -17.400 27.285 1.00 54.45 ? 61  ASP A C    2  
ATOM 3099  O O    . ASP A 1 61  ? 20.521 -16.498 27.902 1.00 71.42 ? 61  ASP A O    2  
ATOM 3100  C CB   . ASP A 1 61  ? 19.442 -18.517 29.465 1.00 43.05 ? 61  ASP A CB   2  
ATOM 3101  C CG   . ASP A 1 61  ? 18.290 -18.923 30.362 1.00 2.45  ? 61  ASP A CG   2  
ATOM 3102  O OD1  . ASP A 1 61  ? 17.755 -20.035 30.174 1.00 2.05  ? 61  ASP A OD1  2  
ATOM 3103  O OD2  . ASP A 1 61  ? 17.923 -18.127 31.253 1.00 72.22 ? 61  ASP A OD2  2  
ATOM 3104  H H    . ASP A 1 61  ? 19.730 -20.313 27.549 1.00 24.54 ? 61  ASP A H    2  
ATOM 3105  H HA   . ASP A 1 61  ? 18.014 -17.980 27.965 1.00 44.43 ? 61  ASP A HA   2  
ATOM 3106  H HB2  . ASP A 1 61  ? 20.213 -19.271 29.536 1.00 12.15 ? 61  ASP A HB2  2  
ATOM 3107  H HB3  . ASP A 1 61  ? 19.834 -17.573 29.815 1.00 31.40 ? 61  ASP A HB3  2  
ATOM 3108  N N    . LEU A 1 62  ? 20.104 -17.589 25.979 1.00 70.24 ? 62  LEU A N    2  
ATOM 3109  C CA   . LEU A 1 62  ? 20.968 -16.730 25.176 1.00 21.24 ? 62  LEU A CA   2  
ATOM 3110  C C    . LEU A 1 62  ? 20.750 -15.261 25.524 1.00 33.10 ? 62  LEU A C    2  
ATOM 3111  O O    . LEU A 1 62  ? 19.615 -14.819 25.708 1.00 44.21 ? 62  LEU A O    2  
ATOM 3112  C CB   . LEU A 1 62  ? 20.706 -16.958 23.687 1.00 72.03 ? 62  LEU A CB   2  
ATOM 3113  C CG   . LEU A 1 62  ? 21.554 -18.037 23.013 1.00 21.32 ? 62  LEU A CG   2  
ATOM 3114  C CD1  . LEU A 1 62  ? 20.702 -18.879 22.077 1.00 74.15 ? 62  LEU A CD1  2  
ATOM 3115  C CD2  . LEU A 1 62  ? 22.717 -17.408 22.259 1.00 74.51 ? 62  LEU A CD2  2  
ATOM 3116  H H    . LEU A 1 62  ? 19.625 -18.324 25.543 1.00 55.35 ? 62  LEU A H    2  
ATOM 3117  H HA   . LEU A 1 62  ? 21.992 -16.992 25.397 1.00 2.45  ? 62  LEU A HA   2  
ATOM 3118  H HB2  . LEU A 1 62  ? 19.669 -17.234 23.572 1.00 12.50 ? 62  LEU A HB2  2  
ATOM 3119  H HB3  . LEU A 1 62  ? 20.887 -16.024 23.173 1.00 25.52 ? 62  LEU A HB3  2  
ATOM 3120  H HG   . LEU A 1 62  ? 21.961 -18.692 23.772 1.00 43.33 ? 62  LEU A HG   2  
ATOM 3121  H HD11 . LEU A 1 62  ? 20.254 -18.243 21.328 1.00 61.10 ? 62  LEU A HD11 2  
ATOM 3122  H HD12 . LEU A 1 62  ? 19.925 -19.372 22.642 1.00 15.41 ? 62  LEU A HD12 2  
ATOM 3123  H HD13 . LEU A 1 62  ? 21.322 -19.622 21.595 1.00 15.54 ? 62  LEU A HD13 2  
ATOM 3124  H HD21 . LEU A 1 62  ? 23.141 -16.612 22.852 1.00 51.30 ? 62  LEU A HD21 2  
ATOM 3125  H HD22 . LEU A 1 62  ? 22.362 -17.008 21.320 1.00 61.41 ? 62  LEU A HD22 2  
ATOM 3126  H HD23 . LEU A 1 62  ? 23.471 -18.158 22.070 1.00 14.10 ? 62  LEU A HD23 2  
ATOM 3127  N N    . ILE A 1 63  ? 21.842 -14.510 25.610 1.00 25.23 ? 63  ILE A N    2  
ATOM 3128  C CA   . ILE A 1 63  ? 21.770 -13.090 25.932 1.00 33.52 ? 63  ILE A CA   2  
ATOM 3129  C C    . ILE A 1 63  ? 22.096 -12.233 24.714 1.00 34.10 ? 63  ILE A C    2  
ATOM 3130  O O    . ILE A 1 63  ? 22.851 -12.647 23.834 1.00 13.11 ? 63  ILE A O    2  
ATOM 3131  C CB   . ILE A 1 63  ? 22.732 -12.723 27.077 1.00 10.31 ? 63  ILE A CB   2  
ATOM 3132  C CG1  . ILE A 1 63  ? 22.619 -13.740 28.214 1.00 23.50 ? 63  ILE A CG1  2  
ATOM 3133  C CG2  . ILE A 1 63  ? 22.439 -11.319 27.585 1.00 42.33 ? 63  ILE A CG2  2  
ATOM 3134  C CD1  . ILE A 1 63  ? 23.810 -14.668 28.315 1.00 74.45 ? 63  ILE A CD1  2  
ATOM 3135  H H    . ILE A 1 63  ? 22.718 -14.920 25.453 1.00 61.40 ? 63  ILE A H    2  
ATOM 3136  H HA   . ILE A 1 63  ? 20.761 -12.873 26.253 1.00 71.03 ? 63  ILE A HA   2  
ATOM 3137  H HB   . ILE A 1 63  ? 23.739 -12.737 26.689 1.00 1.44  ? 63  ILE A HB   2  
ATOM 3138  H HG12 . ILE A 1 63  ? 22.529 -13.215 29.152 1.00 70.14 ? 63  ILE A HG12 2  
ATOM 3139  H HG13 . ILE A 1 63  ? 21.738 -14.346 28.059 1.00 52.21 ? 63  ILE A HG13 2  
ATOM 3140  H HG21 . ILE A 1 63  ? 22.831 -11.209 28.585 1.00 3.30  ? 63  ILE A HG21 2  
ATOM 3141  H HG22 . ILE A 1 63  ? 22.908 -10.596 26.934 1.00 70.11 ? 63  ILE A HG22 2  
ATOM 3142  H HG23 . ILE A 1 63  ? 21.372 -11.155 27.596 1.00 2.12  ? 63  ILE A HG23 2  
ATOM 3143  H HD11 . ILE A 1 63  ? 23.917 -15.008 29.334 1.00 34.31 ? 63  ILE A HD11 2  
ATOM 3144  H HD12 . ILE A 1 63  ? 23.661 -15.517 27.665 1.00 70.34 ? 63  ILE A HD12 2  
ATOM 3145  H HD13 . ILE A 1 63  ? 24.704 -14.140 28.017 1.00 40.32 ? 63  ILE A HD13 2  
ATOM 3146  N N    . VAL A 1 64  ? 21.522 -11.035 24.670 1.00 2.41  ? 64  VAL A N    2  
ATOM 3147  C CA   . VAL A 1 64  ? 21.754 -10.117 23.561 1.00 13.43 ? 64  VAL A CA   2  
ATOM 3148  C C    . VAL A 1 64  ? 22.353 -8.803  24.051 1.00 33.13 ? 64  VAL A C    2  
ATOM 3149  O O    . VAL A 1 64  ? 22.026 -8.326  25.137 1.00 32.43 ? 64  VAL A O    2  
ATOM 3150  C CB   . VAL A 1 64  ? 20.450 -9.820  22.797 1.00 40.04 ? 64  VAL A CB   2  
ATOM 3151  C CG1  . VAL A 1 64  ? 20.716 -8.876  21.634 1.00 72.33 ? 64  VAL A CG1  2  
ATOM 3152  C CG2  . VAL A 1 64  ? 19.812 -11.113 22.310 1.00 4.51  ? 64  VAL A CG2  2  
ATOM 3153  H H    . VAL A 1 64  ? 20.930 -10.761 25.401 1.00 30.13 ? 64  VAL A H    2  
ATOM 3154  H HA   . VAL A 1 64  ? 22.448 -10.585 22.879 1.00 71.30 ? 64  VAL A HA   2  
ATOM 3155  H HB   . VAL A 1 64  ? 19.761 -9.336  23.474 1.00 65.13 ? 64  VAL A HB   2  
ATOM 3156  H HG11 . VAL A 1 64  ? 20.010 -9.075  20.841 1.00 72.13 ? 64  VAL A HG11 2  
ATOM 3157  H HG12 . VAL A 1 64  ? 20.607 -7.854  21.967 1.00 61.54 ? 64  VAL A HG12 2  
ATOM 3158  H HG13 . VAL A 1 64  ? 21.720 -9.031  21.267 1.00 1.03  ? 64  VAL A HG13 2  
ATOM 3159  H HG21 . VAL A 1 64  ? 20.577 -11.763 21.914 1.00 63.51 ? 64  VAL A HG21 2  
ATOM 3160  H HG22 . VAL A 1 64  ? 19.315 -11.602 23.135 1.00 23.22 ? 64  VAL A HG22 2  
ATOM 3161  H HG23 . VAL A 1 64  ? 19.092 -10.890 21.537 1.00 31.42 ? 64  VAL A HG23 2  
ATOM 3162  N N    . GLY A 1 65  ? 23.233 -8.221  23.242 1.00 74.54 ? 65  GLY A N    2  
ATOM 3163  C CA   . GLY A 1 65  ? 23.864 -6.968  23.610 1.00 54.52 ? 65  GLY A CA   2  
ATOM 3164  C C    . GLY A 1 65  ? 23.181 -5.769  22.982 1.00 13.31 ? 65  GLY A C    2  
ATOM 3165  O O    . GLY A 1 65  ? 22.155 -5.301  23.476 1.00 14.03 ? 65  GLY A O    2  
ATOM 3166  H H    . GLY A 1 65  ? 23.455 -8.648  22.387 1.00 1.54  ? 65  GLY A H    2  
ATOM 3167  H HA2  . GLY A 1 65  ? 23.834 -6.864  24.684 1.00 21.11 ? 65  GLY A HA2  2  
ATOM 3168  H HA3  . GLY A 1 65  ? 24.895 -6.989  23.288 1.00 13.34 ? 65  GLY A HA3  2  
ATOM 3169  N N    . ASP A 1 66  ? 23.751 -5.269  21.891 1.00 1.14  ? 66  ASP A N    2  
ATOM 3170  C CA   . ASP A 1 66  ? 23.191 -4.116  21.195 1.00 21.25 ? 66  ASP A CA   2  
ATOM 3171  C C    . ASP A 1 66  ? 22.872 -4.460  19.744 1.00 62.12 ? 66  ASP A C    2  
ATOM 3172  O O    . ASP A 1 66  ? 23.035 -5.603  19.315 1.00 52.42 ? 66  ASP A O    2  
ATOM 3173  C CB   . ASP A 1 66  ? 24.164 -2.938  21.251 1.00 1.55  ? 66  ASP A CB   2  
ATOM 3174  C CG   . ASP A 1 66  ? 23.455 -1.609  21.429 1.00 21.44 ? 66  ASP A CG   2  
ATOM 3175  O OD1  . ASP A 1 66  ? 22.903 -1.374  22.524 1.00 4.15  ? 66  ASP A OD1  2  
ATOM 3176  O OD2  . ASP A 1 66  ? 23.451 -0.806  20.473 1.00 0.32  ? 66  ASP A OD2  2  
ATOM 3177  H H    . ASP A 1 66  ? 24.568 -5.686  21.546 1.00 42.34 ? 66  ASP A H    2  
ATOM 3178  H HA   . ASP A 1 66  ? 22.276 -3.839  21.696 1.00 74.21 ? 66  ASP A HA   2  
ATOM 3179  H HB2  . ASP A 1 66  ? 24.841 -3.077  22.082 1.00 50.11 ? 66  ASP A HB2  2  
ATOM 3180  H HB3  . ASP A 1 66  ? 24.731 -2.903  20.333 1.00 54.15 ? 66  ASP A HB3  2  
ATOM 3181  N N    . LYS A 1 67  ? 22.416 -3.464  18.992 1.00 62.23 ? 67  LYS A N    2  
ATOM 3182  C CA   . LYS A 1 67  ? 22.074 -3.660  17.588 1.00 41.41 ? 67  LYS A CA   2  
ATOM 3183  C C    . LYS A 1 67  ? 23.324 -3.632  16.714 1.00 1.42  ? 67  LYS A C    2  
ATOM 3184  O O    . LYS A 1 67  ? 24.191 -2.773  16.881 1.00 60.52 ? 67  LYS A O    2  
ATOM 3185  C CB   . LYS A 1 67  ? 21.092 -2.581  17.126 1.00 11.20 ? 67  LYS A CB   2  
ATOM 3186  C CG   . LYS A 1 67  ? 20.673 -2.721  15.673 1.00 71.51 ? 67  LYS A CG   2  
ATOM 3187  C CD   . LYS A 1 67  ? 19.256 -3.255  15.550 1.00 35.23 ? 67  LYS A CD   2  
ATOM 3188  C CE   . LYS A 1 67  ? 18.572 -2.739  14.293 1.00 24.21 ? 67  LYS A CE   2  
ATOM 3189  N NZ   . LYS A 1 67  ? 18.159 -1.315  14.431 1.00 20.31 ? 67  LYS A NZ   2  
ATOM 3190  H H    . LYS A 1 67  ? 22.308 -2.575  19.391 1.00 51.03 ? 67  LYS A H    2  
ATOM 3191  H HA   . LYS A 1 67  ? 21.604 -4.627  17.492 1.00 4.24  ? 67  LYS A HA   2  
ATOM 3192  H HB2  . LYS A 1 67  ? 20.205 -2.631  17.741 1.00 5.31  ? 67  LYS A HB2  2  
ATOM 3193  H HB3  . LYS A 1 67  ? 21.554 -1.612  17.253 1.00 32.24 ? 67  LYS A HB3  2  
ATOM 3194  H HG2  . LYS A 1 67  ? 20.724 -1.753  15.197 1.00 33.25 ? 67  LYS A HG2  2  
ATOM 3195  H HG3  . LYS A 1 67  ? 21.349 -3.404  15.177 1.00 0.23  ? 67  LYS A HG3  2  
ATOM 3196  H HD2  . LYS A 1 67  ? 19.288 -4.334  15.512 1.00 42.15 ? 67  LYS A HD2  2  
ATOM 3197  H HD3  . LYS A 1 67  ? 18.686 -2.941  16.414 1.00 61.32 ? 67  LYS A HD3  2  
ATOM 3198  H HE2  . LYS A 1 67  ? 19.258 -2.827  13.465 1.00 62.34 ? 67  LYS A HE2  2  
ATOM 3199  H HE3  . LYS A 1 67  ? 17.697 -3.342  14.102 1.00 63.54 ? 67  LYS A HE3  2  
ATOM 3200  H HZ1  . LYS A 1 67  ? 17.208 -1.179  14.031 1.00 25.23 ? 67  LYS A HZ1  2  
ATOM 3201  H HZ2  . LYS A 1 67  ? 18.827 -0.699  13.926 1.00 54.24 ? 67  LYS A HZ2  2  
ATOM 3202  H HZ3  . LYS A 1 67  ? 18.144 -1.043  15.435 1.00 52.04 ? 67  LYS A HZ3  2  
ATOM 3203  N N    . VAL A 1 68  ? 23.410 -4.575  15.781 1.00 1.25  ? 68  VAL A N    2  
ATOM 3204  C CA   . VAL A 1 68  ? 24.553 -4.656  14.880 1.00 71.33 ? 68  VAL A CA   2  
ATOM 3205  C C    . VAL A 1 68  ? 24.419 -3.663  13.731 1.00 13.43 ? 68  VAL A C    2  
ATOM 3206  O O    . VAL A 1 68  ? 25.270 -2.792  13.548 1.00 11.10 ? 68  VAL A O    2  
ATOM 3207  C CB   . VAL A 1 68  ? 24.711 -6.075  14.301 1.00 40.22 ? 68  VAL A CB   2  
ATOM 3208  C CG1  . VAL A 1 68  ? 25.893 -6.133  13.345 1.00 30.12 ? 68  VAL A CG1  2  
ATOM 3209  C CG2  . VAL A 1 68  ? 24.870 -7.092  15.421 1.00 74.13 ? 68  VAL A CG2  2  
ATOM 3210  H H    . VAL A 1 68  ? 22.687 -5.231  15.697 1.00 2.03  ? 68  VAL A H    2  
ATOM 3211  H HA   . VAL A 1 68  ? 25.442 -4.420  15.446 1.00 43.15 ? 68  VAL A HA   2  
ATOM 3212  H HB   . VAL A 1 68  ? 23.816 -6.317  13.747 1.00 62.44 ? 68  VAL A HB   2  
ATOM 3213  H HG11 . VAL A 1 68  ? 25.975 -7.129  12.935 1.00 52.12 ? 68  VAL A HG11 2  
ATOM 3214  H HG12 . VAL A 1 68  ? 25.744 -5.423  12.545 1.00 65.34 ? 68  VAL A HG12 2  
ATOM 3215  H HG13 . VAL A 1 68  ? 26.800 -5.889  13.879 1.00 33.33 ? 68  VAL A HG13 2  
ATOM 3216  H HG21 . VAL A 1 68  ? 25.876 -7.484  15.410 1.00 11.45 ? 68  VAL A HG21 2  
ATOM 3217  H HG22 . VAL A 1 68  ? 24.679 -6.615  16.371 1.00 12.21 ? 68  VAL A HG22 2  
ATOM 3218  H HG23 . VAL A 1 68  ? 24.167 -7.899  15.276 1.00 21.45 ? 68  VAL A HG23 2  
ATOM 3219  N N    . ILE A 1 69  ? 23.345 -3.799  12.961 1.00 14.41 ? 69  ILE A N    2  
ATOM 3220  C CA   . ILE A 1 69  ? 23.098 -2.911  11.831 1.00 21.51 ? 69  ILE A CA   2  
ATOM 3221  C C    . ILE A 1 69  ? 21.747 -3.204  11.187 1.00 1.32  ? 69  ILE A C    2  
ATOM 3222  O O    . ILE A 1 69  ? 21.229 -4.317  11.281 1.00 20.04 ? 69  ILE A O    2  
ATOM 3223  C CB   . ILE A 1 69  ? 24.201 -3.039  10.764 1.00 62.41 ? 69  ILE A CB   2  
ATOM 3224  C CG1  . ILE A 1 69  ? 24.117 -1.879  9.770  1.00 33.02 ? 69  ILE A CG1  2  
ATOM 3225  C CG2  . ILE A 1 69  ? 24.086 -4.373  10.041 1.00 42.15 ? 69  ILE A CG2  2  
ATOM 3226  C CD1  . ILE A 1 69  ? 25.454 -1.492  9.179  1.00 51.43 ? 69  ILE A CD1  2  
ATOM 3227  H H    . ILE A 1 69  ? 22.702 -4.512  13.158 1.00 44.22 ? 69  ILE A H    2  
ATOM 3228  H HA   . ILE A 1 69  ? 23.097 -1.896  12.199 1.00 3.43  ? 69  ILE A HA   2  
ATOM 3229  H HB   . ILE A 1 69  ? 25.158 -3.009  11.262 1.00 42.31 ? 69  ILE A HB   2  
ATOM 3230  H HG12 . ILE A 1 69  ? 23.463 -2.156  8.958  1.00 1.51  ? 69  ILE A HG12 2  
ATOM 3231  H HG13 . ILE A 1 69  ? 23.712 -1.013  10.274 1.00 41.24 ? 69  ILE A HG13 2  
ATOM 3232  H HG21 . ILE A 1 69  ? 25.006 -4.577  9.513  1.00 5.32  ? 69  ILE A HG21 2  
ATOM 3233  H HG22 . ILE A 1 69  ? 23.903 -5.157  10.759 1.00 22.25 ? 69  ILE A HG22 2  
ATOM 3234  H HG23 . ILE A 1 69  ? 23.269 -4.331  9.336  1.00 22.42 ? 69  ILE A HG23 2  
ATOM 3235  H HD11 . ILE A 1 69  ? 26.235 -1.678  9.901  1.00 41.41 ? 69  ILE A HD11 2  
ATOM 3236  H HD12 . ILE A 1 69  ? 25.638 -2.075  8.290  1.00 73.45 ? 69  ILE A HD12 2  
ATOM 3237  H HD13 . ILE A 1 69  ? 25.444 -0.441  8.924  1.00 72.44 ? 69  ILE A HD13 2  
ATOM 3238  N N    . THR A 1 70  ? 21.180 -2.196  10.530 1.00 25.41 ? 70  THR A N    2  
ATOM 3239  C CA   . THR A 1 70  ? 19.890 -2.345  9.869  1.00 10.43 ? 70  THR A CA   2  
ATOM 3240  C C    . THR A 1 70  ? 20.046 -2.353  8.353  1.00 43.50 ? 70  THR A C    2  
ATOM 3241  O O    . THR A 1 70  ? 20.564 -1.402  7.766  1.00 1.53  ? 70  THR A O    2  
ATOM 3242  C CB   . THR A 1 70  ? 18.922 -1.215  10.268 1.00 34.12 ? 70  THR A CB   2  
ATOM 3243  O OG1  . THR A 1 70  ? 18.723 -1.218  11.686 1.00 21.14 ? 70  THR A OG1  2  
ATOM 3244  C CG2  . THR A 1 70  ? 17.583 -1.376  9.563  1.00 1.24  ? 70  THR A CG2  2  
ATOM 3245  H H    . THR A 1 70  ? 21.643 -1.333  10.490 1.00 35.13 ? 70  THR A H    2  
ATOM 3246  H HA   . THR A 1 70  ? 19.461 -3.285  10.182 1.00 21.54 ? 70  THR A HA   2  
ATOM 3247  H HB   . THR A 1 70  ? 19.355 -0.270  9.975  1.00 40.41 ? 70  THR A HB   2  
ATOM 3248  H HG1  . THR A 1 70  ? 18.003 -0.623  11.910 1.00 21.31 ? 70  THR A HG1  2  
ATOM 3249  H HG21 . THR A 1 70  ? 17.422 -2.418  9.330  1.00 52.21 ? 70  THR A HG21 2  
ATOM 3250  H HG22 . THR A 1 70  ? 17.585 -0.798  8.651  1.00 62.20 ? 70  THR A HG22 2  
ATOM 3251  H HG23 . THR A 1 70  ? 16.792 -1.026  10.209 1.00 3.45  ? 70  THR A HG23 2  
ATOM 3252  N N    . THR A 1 71  ? 19.595 -3.432  7.722  1.00 51.14 ? 71  THR A N    2  
ATOM 3253  C CA   . THR A 1 71  ? 19.685 -3.564  6.273  1.00 1.20  ? 71  THR A CA   2  
ATOM 3254  C C    . THR A 1 71  ? 18.307 -3.763  5.652  1.00 23.22 ? 71  THR A C    2  
ATOM 3255  O O    . THR A 1 71  ? 17.545 -4.631  6.077  1.00 2.33  ? 71  THR A O    2  
ATOM 3256  C CB   . THR A 1 71  ? 20.592 -4.742  5.872  1.00 60.34 ? 71  THR A CB   2  
ATOM 3257  O OG1  . THR A 1 71  ? 21.443 -5.101  6.966  1.00 1.41  ? 71  THR A OG1  2  
ATOM 3258  C CG2  . THR A 1 71  ? 21.439 -4.385  4.660  1.00 43.23 ? 71  THR A CG2  2  
ATOM 3259  H H    . THR A 1 71  ? 19.192 -4.157  8.244  1.00 4.43  ? 71  THR A H    2  
ATOM 3260  H HA   . THR A 1 71  ? 20.118 -2.654  5.882  1.00 74.44 ? 71  THR A HA   2  
ATOM 3261  H HB   . THR A 1 71  ? 19.968 -5.588  5.619  1.00 13.52 ? 71  THR A HB   2  
ATOM 3262  H HG1  . THR A 1 71  ? 21.277 -6.013  7.215  1.00 10.14 ? 71  THR A HG1  2  
ATOM 3263  H HG21 . THR A 1 71  ? 22.468 -4.656  4.847  1.00 72.13 ? 71  THR A HG21 2  
ATOM 3264  H HG22 . THR A 1 71  ? 21.374 -3.323  4.476  1.00 44.21 ? 71  THR A HG22 2  
ATOM 3265  H HG23 . THR A 1 71  ? 21.077 -4.923  3.797  1.00 50.54 ? 71  THR A HG23 2  
ATOM 3266  N N    . GLU A 1 72  ? 17.995 -2.955  4.644  1.00 12.00 ? 72  GLU A N    2  
ATOM 3267  C CA   . GLU A 1 72  ? 16.707 -3.044  3.965  1.00 23.13 ? 72  GLU A CA   2  
ATOM 3268  C C    . GLU A 1 72  ? 16.884 -2.968  2.451  1.00 30.54 ? 72  GLU A C    2  
ATOM 3269  O O    . GLU A 1 72  ? 17.784 -2.292  1.953  1.00 24.12 ? 72  GLU A O    2  
ATOM 3270  C CB   . GLU A 1 72  ? 15.778 -1.924  4.438  1.00 71.12 ? 72  GLU A CB   2  
ATOM 3271  C CG   . GLU A 1 72  ? 15.487 -1.963  5.929  1.00 74.34 ? 72  GLU A CG   2  
ATOM 3272  C CD   . GLU A 1 72  ? 15.087 -0.609  6.481  1.00 43.32 ? 72  GLU A CD   2  
ATOM 3273  O OE1  . GLU A 1 72  ? 14.917 0.332   5.677  1.00 2.11  ? 72  GLU A OE1  2  
ATOM 3274  O OE2  . GLU A 1 72  ? 14.945 -0.489  7.716  1.00 63.15 ? 72  GLU A OE2  2  
ATOM 3275  H H    . GLU A 1 72  ? 18.645 -2.283  4.350  1.00 12.05 ? 72  GLU A H    2  
ATOM 3276  H HA   . GLU A 1 72  ? 16.265 -3.996  4.217  1.00 60.13 ? 72  GLU A HA   2  
ATOM 3277  H HB2  . GLU A 1 72  ? 16.233 -0.973  4.205  1.00 2.34  ? 72  GLU A HB2  2  
ATOM 3278  H HB3  . GLU A 1 72  ? 14.841 -2.003  3.907  1.00 34.32 ? 72  GLU A HB3  2  
ATOM 3279  H HG2  . GLU A 1 72  ? 14.680 -2.659  6.107  1.00 64.13 ? 72  GLU A HG2  2  
ATOM 3280  H HG3  . GLU A 1 72  ? 16.372 -2.300  6.447  1.00 64.22 ? 72  GLU A HG3  2  
ATOM 3281  N N    . HIS A 1 73  ? 16.018 -3.668  1.725  1.00 63.32 ? 73  HIS A N    2  
ATOM 3282  C CA   . HIS A 1 73  ? 16.078 -3.681  0.267  1.00 31.05 ? 73  HIS A CA   2  
ATOM 3283  C C    . HIS A 1 73  ? 14.691 -3.479  -0.335 1.00 33.22 ? 73  HIS A C    2  
ATOM 3284  O O    . HIS A 1 73  ? 13.682 -3.825  0.279  1.00 13.41 ? 73  HIS A O    2  
ATOM 3285  C CB   . HIS A 1 73  ? 16.675 -4.998  -0.228 1.00 61.50 ? 73  HIS A CB   2  
ATOM 3286  C CG   . HIS A 1 73  ? 18.058 -5.260  0.285  1.00 14.11 ? 73  HIS A CG   2  
ATOM 3287  N ND1  . HIS A 1 73  ? 19.158 -5.366  -0.538 1.00 65.24 ? 73  HIS A ND1  2  
ATOM 3288  C CD2  . HIS A 1 73  ? 18.515 -5.435  1.547  1.00 43.01 ? 73  HIS A CD2  2  
ATOM 3289  C CE1  . HIS A 1 73  ? 20.233 -5.597  0.194  1.00 21.14 ? 73  HIS A CE1  2  
ATOM 3290  N NE2  . HIS A 1 73  ? 19.870 -5.643  1.464  1.00 41.15 ? 73  HIS A NE2  2  
ATOM 3291  H H    . HIS A 1 73  ? 15.323 -4.188  2.179  1.00 0.35  ? 73  HIS A H    2  
ATOM 3292  H HA   . HIS A 1 73  ? 16.714 -2.867  -0.045 1.00 63.35 ? 73  HIS A HA   2  
ATOM 3293  H HB2  . HIS A 1 73  ? 16.044 -5.815  0.091  1.00 54.32 ? 73  HIS A HB2  2  
ATOM 3294  H HB3  . HIS A 1 73  ? 16.718 -4.983  -1.308 1.00 22.34 ? 73  HIS A HB3  2  
ATOM 3295  H HD1  . HIS A 1 73  ? 19.153 -5.286  -1.515 1.00 35.13 ? 73  HIS A HD1  2  
ATOM 3296  H HD2  . HIS A 1 73  ? 17.925 -5.415  2.452  1.00 32.43 ? 73  HIS A HD2  2  
ATOM 3297  H HE1  . HIS A 1 73  ? 21.238 -5.726  -0.180 1.00 12.24 ? 73  HIS A HE1  2  
ATOM 3298  N N    . GLU A 1 74  ? 14.650 -2.917  -1.539 1.00 35.41 ? 74  GLU A N    2  
ATOM 3299  C CA   . GLU A 1 74  ? 13.386 -2.669  -2.222 1.00 54.42 ? 74  GLU A CA   2  
ATOM 3300  C C    . GLU A 1 74  ? 13.054 -3.806  -3.184 1.00 43.35 ? 74  GLU A C    2  
ATOM 3301  O O    . GLU A 1 74  ? 13.627 -3.901  -4.270 1.00 71.32 ? 74  GLU A O    2  
ATOM 3302  C CB   . GLU A 1 74  ? 13.444 -1.342  -2.983 1.00 61.53 ? 74  GLU A CB   2  
ATOM 3303  C CG   . GLU A 1 74  ? 12.222 -1.083  -3.848 1.00 43.24 ? 74  GLU A CG   2  
ATOM 3304  C CD   . GLU A 1 74  ? 11.933 0.396   -4.021 1.00 63.20 ? 74  GLU A CD   2  
ATOM 3305  O OE1  . GLU A 1 74  ? 12.609 1.040   -4.850 1.00 4.33  ? 74  GLU A OE1  2  
ATOM 3306  O OE2  . GLU A 1 74  ? 11.030 0.908   -3.327 1.00 2.01  ? 74  GLU A OE2  2  
ATOM 3307  H H    . GLU A 1 74  ? 15.488 -2.664  -1.978 1.00 3.15  ? 74  GLU A H    2  
ATOM 3308  H HA   . GLU A 1 74  ? 12.610 -2.609  -1.474 1.00 20.33 ? 74  GLU A HA   2  
ATOM 3309  H HB2  . GLU A 1 74  ? 13.534 -0.536  -2.271 1.00 13.23 ? 74  GLU A HB2  2  
ATOM 3310  H HB3  . GLU A 1 74  ? 14.316 -1.346  -3.621 1.00 0.23  ? 74  GLU A HB3  2  
ATOM 3311  H HG2  . GLU A 1 74  ? 12.388 -1.517  -4.823 1.00 31.42 ? 74  GLU A HG2  2  
ATOM 3312  H HG3  . GLU A 1 74  ? 11.365 -1.551  -3.388 1.00 12.12 ? 74  GLU A HG3  2  
ATOM 3313  N N    . TYR A 1 75  ? 12.127 -4.665  -2.778 1.00 31.42 ? 75  TYR A N    2  
ATOM 3314  C CA   . TYR A 1 75  ? 11.721 -5.798  -3.601 1.00 51.15 ? 75  TYR A CA   2  
ATOM 3315  C C    . TYR A 1 75  ? 10.291 -5.622  -4.104 1.00 1.54  ? 75  TYR A C    2  
ATOM 3316  O O    . TYR A 1 75  ? 9.400  -5.232  -3.349 1.00 33.21 ? 75  TYR A O    2  
ATOM 3317  C CB   . TYR A 1 75  ? 11.838 -7.100  -2.808 1.00 34.41 ? 75  TYR A CB   2  
ATOM 3318  C CG   . TYR A 1 75  ? 13.230 -7.690  -2.813 1.00 72.03 ? 75  TYR A CG   2  
ATOM 3319  C CD1  . TYR A 1 75  ? 13.814 -8.133  -3.993 1.00 74.35 ? 75  TYR A CD1  2  
ATOM 3320  C CD2  . TYR A 1 75  ? 13.962 -7.803  -1.638 1.00 0.23  ? 75  TYR A CD2  2  
ATOM 3321  C CE1  . TYR A 1 75  ? 15.085 -8.673  -4.003 1.00 30.43 ? 75  TYR A CE1  2  
ATOM 3322  C CE2  . TYR A 1 75  ? 15.235 -8.340  -1.638 1.00 33.24 ? 75  TYR A CE2  2  
ATOM 3323  C CZ   . TYR A 1 75  ? 15.792 -8.775  -2.822 1.00 54.54 ? 75  TYR A CZ   2  
ATOM 3324  O OH   . TYR A 1 75  ? 17.059 -9.311  -2.828 1.00 11.44 ? 75  TYR A OH   2  
ATOM 3325  H H    . TYR A 1 75  ? 11.706 -4.537  -1.902 1.00 43.42 ? 75  TYR A H    2  
ATOM 3326  H HA   . TYR A 1 75  ? 12.386 -5.845  -4.452 1.00 33.14 ? 75  TYR A HA   2  
ATOM 3327  H HB2  . TYR A 1 75  ? 11.561 -6.915  -1.782 1.00 12.33 ? 75  TYR A HB2  2  
ATOM 3328  H HB3  . TYR A 1 75  ? 11.165 -7.833  -3.230 1.00 42.34 ? 75  TYR A HB3  2  
ATOM 3329  H HD1  . TYR A 1 75  ? 13.257 -8.052  -4.916 1.00 64.23 ? 75  TYR A HD1  2  
ATOM 3330  H HD2  . TYR A 1 75  ? 13.523 -7.462  -0.711 1.00 42.21 ? 75  TYR A HD2  2  
ATOM 3331  H HE1  . TYR A 1 75  ? 15.521 -9.013  -4.930 1.00 64.04 ? 75  TYR A HE1  2  
ATOM 3332  H HE2  . TYR A 1 75  ? 15.788 -8.420  -0.714 1.00 4.14  ? 75  TYR A HE2  2  
ATOM 3333  H HH   . TYR A 1 75  ? 17.586 -8.879  -3.504 1.00 71.35 ? 75  TYR A HH   2  
ATOM 3334  N N    . ASP A 1 76  ? 10.080 -5.912  -5.383 1.00 5.53  ? 76  ASP A N    2  
ATOM 3335  C CA   . ASP A 1 76  ? 8.759  -5.787  -5.987 1.00 62.34 ? 76  ASP A CA   2  
ATOM 3336  C C    . ASP A 1 76  ? 7.739  -6.645  -5.245 1.00 62.45 ? 76  ASP A C    2  
ATOM 3337  O O    . ASP A 1 76  ? 6.560  -6.299  -5.168 1.00 62.21 ? 76  ASP A O    2  
ATOM 3338  C CB   . ASP A 1 76  ? 8.809  -6.193  -7.461 1.00 43.43 ? 76  ASP A CB   2  
ATOM 3339  C CG   . ASP A 1 76  ? 9.858  -5.421  -8.239 1.00 33.14 ? 76  ASP A CG   2  
ATOM 3340  O OD1  . ASP A 1 76  ? 10.931 -5.995  -8.517 1.00 71.21 ? 76  ASP A OD1  2  
ATOM 3341  O OD2  . ASP A 1 76  ? 9.605  -4.243  -8.568 1.00 3.14  ? 76  ASP A OD2  2  
ATOM 3342  H H    . ASP A 1 76  ? 10.832 -6.217  -5.934 1.00 34.35 ? 76  ASP A H    2  
ATOM 3343  H HA   . ASP A 1 76  ? 8.459  -4.753  -5.918 1.00 53.21 ? 76  ASP A HA   2  
ATOM 3344  H HB2  . ASP A 1 76  ? 9.039  -7.246  -7.531 1.00 4.11  ? 76  ASP A HB2  2  
ATOM 3345  H HB3  . ASP A 1 76  ? 7.845  -6.008  -7.911 1.00 71.45 ? 76  ASP A HB3  2  
ATOM 3346  N N    . PHE A 1 77  ? 8.201  -7.767  -4.702 1.00 53.11 ? 77  PHE A N    2  
ATOM 3347  C CA   . PHE A 1 77  ? 7.328  -8.676  -3.968 1.00 22.10 ? 77  PHE A CA   2  
ATOM 3348  C C    . PHE A 1 77  ? 7.077  -8.164  -2.553 1.00 30.44 ? 77  PHE A C    2  
ATOM 3349  O O    . PHE A 1 77  ? 6.085  -8.521  -1.919 1.00 14.02 ? 77  PHE A O    2  
ATOM 3350  C CB   . PHE A 1 77  ? 7.944  -10.076 -3.915 1.00 10.23 ? 77  PHE A CB   2  
ATOM 3351  C CG   . PHE A 1 77  ? 7.588  -10.933 -5.096 1.00 11.33 ? 77  PHE A CG   2  
ATOM 3352  C CD1  . PHE A 1 77  ? 8.533  -11.225 -6.066 1.00 32.41 ? 77  PHE A CD1  2  
ATOM 3353  C CD2  . PHE A 1 77  ? 6.309  -11.446 -5.235 1.00 54.05 ? 77  PHE A CD2  2  
ATOM 3354  C CE1  . PHE A 1 77  ? 8.207  -12.013 -7.154 1.00 45.10 ? 77  PHE A CE1  2  
ATOM 3355  C CE2  . PHE A 1 77  ? 5.977  -12.235 -6.321 1.00 45.43 ? 77  PHE A CE2  2  
ATOM 3356  C CZ   . PHE A 1 77  ? 6.929  -12.519 -7.281 1.00 73.23 ? 77  PHE A CZ   2  
ATOM 3357  H H    . PHE A 1 77  ? 9.151  -7.989  -4.798 1.00 11.33 ? 77  PHE A H    2  
ATOM 3358  H HA   . PHE A 1 77  ? 6.387  -8.726  -4.492 1.00 75.04 ? 77  PHE A HA   2  
ATOM 3359  H HB2  . PHE A 1 77  ? 9.019  -9.987  -3.882 1.00 24.20 ? 77  PHE A HB2  2  
ATOM 3360  H HB3  . PHE A 1 77  ? 7.601  -10.578 -3.023 1.00 32.21 ? 77  PHE A HB3  2  
ATOM 3361  H HD1  . PHE A 1 77  ? 9.534  -10.831 -5.967 1.00 74.24 ? 77  PHE A HD1  2  
ATOM 3362  H HD2  . PHE A 1 77  ? 5.563  -11.224 -4.484 1.00 44.03 ? 77  PHE A HD2  2  
ATOM 3363  H HE1  . PHE A 1 77  ? 8.953  -12.234 -7.903 1.00 60.31 ? 77  PHE A HE1  2  
ATOM 3364  H HE2  . PHE A 1 77  ? 4.977  -12.629 -6.417 1.00 54.44 ? 77  PHE A HE2  2  
ATOM 3365  H HZ   . PHE A 1 77  ? 6.672  -13.134 -8.131 1.00 30.54 ? 77  PHE A HZ   2  
ATOM 3366  N N    . GLY A 1 78  ? 7.985  -7.326  -2.063 1.00 2.23  ? 78  GLY A N    2  
ATOM 3367  C CA   . GLY A 1 78  ? 7.845  -6.779  -0.726 1.00 1.22  ? 78  GLY A CA   2  
ATOM 3368  C C    . GLY A 1 78  ? 9.176  -6.382  -0.120 1.00 4.44  ? 78  GLY A C    2  
ATOM 3369  O O    . GLY A 1 78  ? 10.113 -7.180  -0.084 1.00 72.53 ? 78  GLY A O    2  
ATOM 3370  H H    . GLY A 1 78  ? 8.757  -7.077  -2.614 1.00 14.53 ? 78  GLY A H    2  
ATOM 3371  H HA2  . GLY A 1 78  ? 7.207  -5.909  -0.770 1.00 2.24  ? 78  GLY A HA2  2  
ATOM 3372  H HA3  . GLY A 1 78  ? 7.382  -7.521  -0.092 1.00 73.05 ? 78  GLY A HA3  2  
ATOM 3373  N N    . ILE A 1 79  ? 9.262  -5.144  0.357  1.00 30.20 ? 79  ILE A N    2  
ATOM 3374  C CA   . ILE A 1 79  ? 10.489 -4.643  0.964  1.00 72.02 ? 79  ILE A CA   2  
ATOM 3375  C C    . ILE A 1 79  ? 10.956 -5.555  2.094  1.00 55.44 ? 79  ILE A C    2  
ATOM 3376  O O    . ILE A 1 79  ? 10.212 -5.822  3.037  1.00 33.53 ? 79  ILE A O    2  
ATOM 3377  C CB   . ILE A 1 79  ? 10.303 -3.217  1.514  1.00 52.41 ? 79  ILE A CB   2  
ATOM 3378  C CG1  . ILE A 1 79  ? 10.609 -2.184  0.427  1.00 13.43 ? 79  ILE A CG1  2  
ATOM 3379  C CG2  . ILE A 1 79  ? 11.194 -2.996  2.727  1.00 33.54 ? 79  ILE A CG2  2  
ATOM 3380  C CD1  . ILE A 1 79  ? 9.884  -2.443  -0.875 1.00 35.35 ? 79  ILE A CD1  2  
ATOM 3381  H H    . ILE A 1 79  ? 8.481  -4.555  0.300  1.00 45.11 ? 79  ILE A H    2  
ATOM 3382  H HA   . ILE A 1 79  ? 11.252 -4.616  0.199  1.00 54.10 ? 79  ILE A HA   2  
ATOM 3383  H HB   . ILE A 1 79  ? 9.276  -3.106  1.827  1.00 72.34 ? 79  ILE A HB   2  
ATOM 3384  H HG12 . ILE A 1 79  ? 10.320 -1.205  0.778  1.00 72.43 ? 79  ILE A HG12 2  
ATOM 3385  H HG13 . ILE A 1 79  ? 11.670 -2.190  0.224  1.00 51.20 ? 79  ILE A HG13 2  
ATOM 3386  H HG21 . ILE A 1 79  ? 12.192 -3.347  2.509  1.00 11.33 ? 79  ILE A HG21 2  
ATOM 3387  H HG22 . ILE A 1 79  ? 11.226 -1.943  2.963  1.00 23.41 ? 79  ILE A HG22 2  
ATOM 3388  H HG23 . ILE A 1 79  ? 10.797 -3.542  3.570  1.00 74.53 ? 79  ILE A HG23 2  
ATOM 3389  H HD11 . ILE A 1 79  ? 8.941  -2.929  -0.671 1.00 74.12 ? 79  ILE A HD11 2  
ATOM 3390  H HD12 . ILE A 1 79  ? 9.705  -1.507  -1.381 1.00 44.11 ? 79  ILE A HD12 2  
ATOM 3391  H HD13 . ILE A 1 79  ? 10.488 -3.082  -1.502 1.00 64.30 ? 79  ILE A HD13 2  
ATOM 3392  N N    . VAL A 1 80  ? 12.194 -6.028  1.992  1.00 54.31 ? 80  VAL A N    2  
ATOM 3393  C CA   . VAL A 1 80  ? 12.762 -6.907  3.007  1.00 72.25 ? 80  VAL A CA   2  
ATOM 3394  C C    . VAL A 1 80  ? 13.665 -6.134  3.961  1.00 52.12 ? 80  VAL A C    2  
ATOM 3395  O O    . VAL A 1 80  ? 14.478 -5.314  3.535  1.00 63.05 ? 80  VAL A O    2  
ATOM 3396  C CB   . VAL A 1 80  ? 13.569 -8.053  2.368  1.00 45.31 ? 80  VAL A CB   2  
ATOM 3397  C CG1  . VAL A 1 80  ? 14.822 -7.513  1.695  1.00 2.42  ? 80  VAL A CG1  2  
ATOM 3398  C CG2  . VAL A 1 80  ? 13.925 -9.100  3.412  1.00 35.31 ? 80  VAL A CG2  2  
ATOM 3399  H H    . VAL A 1 80  ? 12.738 -5.779  1.216  1.00 2.42  ? 80  VAL A H    2  
ATOM 3400  H HA   . VAL A 1 80  ? 11.946 -7.339  3.568  1.00 25.34 ? 80  VAL A HA   2  
ATOM 3401  H HB   . VAL A 1 80  ? 12.956 -8.521  1.613  1.00 72.34 ? 80  VAL A HB   2  
ATOM 3402  H HG11 . VAL A 1 80  ? 15.352 -8.324  1.217  1.00 54.42 ? 80  VAL A HG11 2  
ATOM 3403  H HG12 . VAL A 1 80  ? 14.545 -6.776  0.955  1.00 10.15 ? 80  VAL A HG12 2  
ATOM 3404  H HG13 . VAL A 1 80  ? 15.460 -7.056  2.437  1.00 4.43  ? 80  VAL A HG13 2  
ATOM 3405  H HG21 . VAL A 1 80  ? 14.701 -8.716  4.056  1.00 24.44 ? 80  VAL A HG21 2  
ATOM 3406  H HG22 . VAL A 1 80  ? 13.050 -9.332  4.002  1.00 34.13 ? 80  VAL A HG22 2  
ATOM 3407  H HG23 . VAL A 1 80  ? 14.274 -9.996  2.920  1.00 12.22 ? 80  VAL A HG23 2  
ATOM 3408  N N    . ARG A 1 81  ? 13.516 -6.401  5.254  1.00 2.23  ? 81  ARG A N    2  
ATOM 3409  C CA   . ARG A 1 81  ? 14.318 -5.729  6.270  1.00 61.30 ? 81  ARG A CA   2  
ATOM 3410  C C    . ARG A 1 81  ? 14.976 -6.743  7.202  1.00 75.34 ? 81  ARG A C    2  
ATOM 3411  O O    . ARG A 1 81  ? 14.333 -7.281  8.104  1.00 34.31 ? 81  ARG A O    2  
ATOM 3412  C CB   . ARG A 1 81  ? 13.450 -4.764  7.080  1.00 61.51 ? 81  ARG A CB   2  
ATOM 3413  C CG   . ARG A 1 81  ? 12.452 -3.989  6.236  1.00 10.52 ? 81  ARG A CG   2  
ATOM 3414  C CD   . ARG A 1 81  ? 11.716 -2.946  7.063  1.00 50.55 ? 81  ARG A CD   2  
ATOM 3415  N NE   . ARG A 1 81  ? 11.115 -1.909  6.227  1.00 60.51 ? 81  ARG A NE   2  
ATOM 3416  C CZ   . ARG A 1 81  ? 10.602 -0.783  6.708  1.00 5.53  ? 81  ARG A CZ   2  
ATOM 3417  N NH1  . ARG A 1 81  ? 10.618 -0.547  8.013  1.00 23.41 ? 81  ARG A NH1  2  
ATOM 3418  N NH2  . ARG A 1 81  ? 10.073 0.112   5.884  1.00 41.41 ? 81  ARG A NH2  2  
ATOM 3419  H H    . ARG A 1 81  ? 12.851 -7.065  5.532  1.00 11.54 ? 81  ARG A H    2  
ATOM 3420  H HA   . ARG A 1 81  ? 15.090 -5.168  5.766  1.00 63.03 ? 81  ARG A HA   2  
ATOM 3421  H HB2  . ARG A 1 81  ? 12.901 -5.327  7.820  1.00 20.44 ? 81  ARG A HB2  2  
ATOM 3422  H HB3  . ARG A 1 81  ? 14.092 -4.056  7.581  1.00 23.21 ? 81  ARG A HB3  2  
ATOM 3423  H HG2  . ARG A 1 81  ? 12.981 -3.491  5.437  1.00 54.43 ? 81  ARG A HG2  2  
ATOM 3424  H HG3  . ARG A 1 81  ? 11.733 -4.679  5.820  1.00 3.22  ? 81  ARG A HG3  2  
ATOM 3425  H HD2  . ARG A 1 81  ? 10.937 -3.436  7.626  1.00 32.53 ? 81  ARG A HD2  2  
ATOM 3426  H HD3  . ARG A 1 81  ? 12.417 -2.485  7.743  1.00 73.11 ? 81  ARG A HD3  2  
ATOM 3427  H HE   . ARG A 1 81  ? 11.093 -2.063  5.260  1.00 52.34 ? 81  ARG A HE   2  
ATOM 3428  H HH11 . ARG A 1 81  ? 11.017 -1.219  8.636  1.00 25.55 ? 81  ARG A HH11 2  
ATOM 3429  H HH12 . ARG A 1 81  ? 10.233 0.303   8.373  1.00 72.41 ? 81  ARG A HH12 2  
ATOM 3430  H HH21 . ARG A 1 81  ? 10.060 -0.061  4.900  1.00 74.33 ? 81  ARG A HH21 2  
ATOM 3431  H HH22 . ARG A 1 81  ? 9.688  0.960   6.247  1.00 35.11 ? 81  ARG A HH22 2  
ATOM 3432  N N    . LEU A 1 82  ? 16.259 -7.000  6.977  1.00 43.04 ? 82  LEU A N    2  
ATOM 3433  C CA   . LEU A 1 82  ? 17.005 -7.950  7.795  1.00 14.04 ? 82  LEU A CA   2  
ATOM 3434  C C    . LEU A 1 82  ? 17.854 -7.225  8.834  1.00 14.44 ? 82  LEU A C    2  
ATOM 3435  O O    . LEU A 1 82  ? 18.551 -6.260  8.519  1.00 10.31 ? 82  LEU A O    2  
ATOM 3436  C CB   . LEU A 1 82  ? 17.896 -8.825  6.912  1.00 10.04 ? 82  LEU A CB   2  
ATOM 3437  C CG   . LEU A 1 82  ? 18.880 -9.736  7.646  1.00 24.24 ? 82  LEU A CG   2  
ATOM 3438  C CD1  . LEU A 1 82  ? 18.166 -10.535 8.725  1.00 34.20 ? 82  LEU A CD1  2  
ATOM 3439  C CD2  . LEU A 1 82  ? 19.579 -10.667 6.666  1.00 50.54 ? 82  LEU A CD2  2  
ATOM 3440  H H    . LEU A 1 82  ? 16.718 -6.540  6.243  1.00 31.41 ? 82  LEU A H    2  
ATOM 3441  H HA   . LEU A 1 82  ? 16.290 -8.578  8.307  1.00 64.24 ? 82  LEU A HA   2  
ATOM 3442  H HB2  . LEU A 1 82  ? 17.254 -9.449  6.310  1.00 30.22 ? 82  LEU A HB2  2  
ATOM 3443  H HB3  . LEU A 1 82  ? 18.466 -8.171  6.268  1.00 3.33  ? 82  LEU A HB3  2  
ATOM 3444  H HG   . LEU A 1 82  ? 19.634 -9.128  8.127  1.00 65.01 ? 82  LEU A HG   2  
ATOM 3445  H HD11 . LEU A 1 82  ? 18.468 -11.570 8.666  1.00 10.35 ? 82  LEU A HD11 2  
ATOM 3446  H HD12 . LEU A 1 82  ? 17.098 -10.463 8.578  1.00 21.24 ? 82  LEU A HD12 2  
ATOM 3447  H HD13 . LEU A 1 82  ? 18.423 -10.139 9.696  1.00 14.45 ? 82  LEU A HD13 2  
ATOM 3448  H HD21 . LEU A 1 82  ? 18.945 -10.824 5.805  1.00 10.44 ? 82  LEU A HD21 2  
ATOM 3449  H HD22 . LEU A 1 82  ? 19.775 -11.614 7.146  1.00 61.31 ? 82  LEU A HD22 2  
ATOM 3450  H HD23 . LEU A 1 82  ? 20.511 -10.222 6.350  1.00 62.51 ? 82  LEU A HD23 2  
ATOM 3451  N N    . THR A 1 83  ? 17.792 -7.697  10.076 1.00 50.43 ? 83  THR A N    2  
ATOM 3452  C CA   . THR A 1 83  ? 18.555 -7.094  11.161 1.00 25.32 ? 83  THR A CA   2  
ATOM 3453  C C    . THR A 1 83  ? 19.254 -8.159  11.999 1.00 64.13 ? 83  THR A C    2  
ATOM 3454  O O    . THR A 1 83  ? 18.770 -9.284  12.122 1.00 34.54 ? 83  THR A O    2  
ATOM 3455  C CB   . THR A 1 83  ? 17.655 -6.246  12.078 1.00 15.33 ? 83  THR A CB   2  
ATOM 3456  O OG1  . THR A 1 83  ? 18.458 -5.489  12.991 1.00 61.51 ? 83  THR A OG1  2  
ATOM 3457  C CG2  . THR A 1 83  ? 16.689 -7.128  12.856 1.00 64.14 ? 83  THR A CG2  2  
ATOM 3458  H H    . THR A 1 83  ? 17.218 -8.468  10.265 1.00 61.25 ? 83  THR A H    2  
ATOM 3459  H HA   . THR A 1 83  ? 19.302 -6.446  10.725 1.00 75.23 ? 83  THR A HA   2  
ATOM 3460  H HB   . THR A 1 83  ? 17.082 -5.565  11.465 1.00 41.41 ? 83  THR A HB   2  
ATOM 3461  H HG1  . THR A 1 83  ? 18.688 -6.038  13.745 1.00 42.20 ? 83  THR A HG1  2  
ATOM 3462  H HG21 . THR A 1 83  ? 17.160 -7.458  13.770 1.00 61.43 ? 83  THR A HG21 2  
ATOM 3463  H HG22 . THR A 1 83  ? 16.424 -7.986  12.256 1.00 22.33 ? 83  THR A HG22 2  
ATOM 3464  H HG23 . THR A 1 83  ? 15.799 -6.565  13.093 1.00 63.33 ? 83  THR A HG23 2  
ATOM 3465  N N    . THR A 1 84  ? 20.397 -7.797  12.574 1.00 61.50 ? 84  THR A N    2  
ATOM 3466  C CA   . THR A 1 84  ? 21.163 -8.722  13.400 1.00 63.12 ? 84  THR A CA   2  
ATOM 3467  C C    . THR A 1 84  ? 21.370 -8.164  14.803 1.00 10.02 ? 84  THR A C    2  
ATOM 3468  O O    . THR A 1 84  ? 21.297 -6.954  15.017 1.00 3.34  ? 84  THR A O    2  
ATOM 3469  C CB   . THR A 1 84  ? 22.537 -9.028  12.774 1.00 70.31 ? 84  THR A CB   2  
ATOM 3470  O OG1  . THR A 1 84  ? 22.836 -8.068  11.754 1.00 33.51 ? 84  THR A OG1  2  
ATOM 3471  C CG2  . THR A 1 84  ? 22.562 -10.429 12.182 1.00 74.34 ? 84  THR A CG2  2  
ATOM 3472  H H    . THR A 1 84  ? 20.732 -6.887  12.438 1.00 10.40 ? 84  THR A H    2  
ATOM 3473  H HA   . THR A 1 84  ? 20.608 -9.646  13.468 1.00 22.45 ? 84  THR A HA   2  
ATOM 3474  H HB   . THR A 1 84  ? 23.290 -8.967  13.547 1.00 34.00 ? 84  THR A HB   2  
ATOM 3475  H HG1  . THR A 1 84  ? 23.405 -8.470  11.093 1.00 32.22 ? 84  THR A HG1  2  
ATOM 3476  H HG21 . THR A 1 84  ? 21.936 -11.081 12.773 1.00 73.31 ? 84  THR A HG21 2  
ATOM 3477  H HG22 . THR A 1 84  ? 23.575 -10.803 12.184 1.00 74.14 ? 84  THR A HG22 2  
ATOM 3478  H HG23 . THR A 1 84  ? 22.191 -10.398 11.168 1.00 3.41  ? 84  THR A HG23 2  
ATOM 3479  N N    . TYR A 1 85  ? 21.629 -9.053  15.756 1.00 55.31 ? 85  TYR A N    2  
ATOM 3480  C CA   . TYR A 1 85  ? 21.844 -8.648  17.140 1.00 23.41 ? 85  TYR A CA   2  
ATOM 3481  C C    . TYR A 1 85  ? 22.942 -9.487  17.788 1.00 44.54 ? 85  TYR A C    2  
ATOM 3482  O O    . TYR A 1 85  ? 22.919 -10.716 17.727 1.00 23.02 ? 85  TYR A O    2  
ATOM 3483  C CB   . TYR A 1 85  ? 20.547 -8.781  17.940 1.00 4.22  ? 85  TYR A CB   2  
ATOM 3484  C CG   . TYR A 1 85  ? 19.649 -7.568  17.843 1.00 62.43 ? 85  TYR A CG   2  
ATOM 3485  C CD1  . TYR A 1 85  ? 18.484 -7.602  17.086 1.00 44.33 ? 85  TYR A CD1  2  
ATOM 3486  C CD2  . TYR A 1 85  ? 19.966 -6.390  18.506 1.00 15.44 ? 85  TYR A CD2  2  
ATOM 3487  C CE1  . TYR A 1 85  ? 17.661 -6.496  16.993 1.00 60.20 ? 85  TYR A CE1  2  
ATOM 3488  C CE2  . TYR A 1 85  ? 19.147 -5.280  18.421 1.00 44.14 ? 85  TYR A CE2  2  
ATOM 3489  C CZ   . TYR A 1 85  ? 17.996 -5.338  17.663 1.00 65.04 ? 85  TYR A CZ   2  
ATOM 3490  O OH   . TYR A 1 85  ? 17.180 -4.234  17.573 1.00 35.35 ? 85  TYR A OH   2  
ATOM 3491  H H    . TYR A 1 85  ? 21.674 -10.004 15.524 1.00 52.44 ? 85  TYR A H    2  
ATOM 3492  H HA   . TYR A 1 85  ? 22.151 -7.613  17.139 1.00 11.42 ? 85  TYR A HA   2  
ATOM 3493  H HB2  . TYR A 1 85  ? 19.994 -9.633  17.577 1.00 13.21 ? 85  TYR A HB2  2  
ATOM 3494  H HB3  . TYR A 1 85  ? 20.789 -8.932  18.982 1.00 21.11 ? 85  TYR A HB3  2  
ATOM 3495  H HD1  . TYR A 1 85  ? 18.224 -8.510  16.562 1.00 23.43 ? 85  TYR A HD1  2  
ATOM 3496  H HD2  . TYR A 1 85  ? 20.868 -6.347  19.099 1.00 61.40 ? 85  TYR A HD2  2  
ATOM 3497  H HE1  . TYR A 1 85  ? 16.760 -6.541  16.400 1.00 75.32 ? 85  TYR A HE1  2  
ATOM 3498  H HE2  . TYR A 1 85  ? 19.410 -4.373  18.944 1.00 1.35  ? 85  TYR A HE2  2  
ATOM 3499  H HH   . TYR A 1 85  ? 16.772 -4.207  16.705 1.00 61.35 ? 85  TYR A HH   2  
ATOM 3500  N N    . LYS A 1 86  ? 23.904 -8.812  18.408 1.00 1.24  ? 86  LYS A N    2  
ATOM 3501  C CA   . LYS A 1 86  ? 25.012 -9.491  19.070 1.00 35.41 ? 86  LYS A CA   2  
ATOM 3502  C C    . LYS A 1 86  ? 24.502 -10.425 20.163 1.00 73.41 ? 86  LYS A C    2  
ATOM 3503  O O    . LYS A 1 86  ? 23.890 -9.982  21.136 1.00 74.25 ? 86  LYS A O    2  
ATOM 3504  C CB   . LYS A 1 86  ? 25.980 -8.469  19.669 1.00 14.31 ? 86  LYS A CB   2  
ATOM 3505  C CG   . LYS A 1 86  ? 27.419 -8.661  19.225 1.00 23.20 ? 86  LYS A CG   2  
ATOM 3506  C CD   . LYS A 1 86  ? 27.762 -7.770  18.043 1.00 4.34  ? 86  LYS A CD   2  
ATOM 3507  C CE   . LYS A 1 86  ? 29.140 -8.091  17.485 1.00 41.45 ? 86  LYS A CE   2  
ATOM 3508  N NZ   . LYS A 1 86  ? 29.854 -6.865  17.031 1.00 1.24  ? 86  LYS A NZ   2  
ATOM 3509  H H    . LYS A 1 86  ? 23.868 -7.832  18.423 1.00 54.15 ? 86  LYS A H    2  
ATOM 3510  H HA   . LYS A 1 86  ? 25.533 -10.076 18.328 1.00 60.33 ? 86  LYS A HA   2  
ATOM 3511  H HB2  . LYS A 1 86  ? 25.664 -7.478  19.377 1.00 40.01 ? 86  LYS A HB2  2  
ATOM 3512  H HB3  . LYS A 1 86  ? 25.944 -8.545  20.746 1.00 20.44 ? 86  LYS A HB3  2  
ATOM 3513  H HG2  . LYS A 1 86  ? 28.076 -8.419  20.047 1.00 12.24 ? 86  LYS A HG2  2  
ATOM 3514  H HG3  . LYS A 1 86  ? 27.563 -9.694  18.939 1.00 2.42  ? 86  LYS A HG3  2  
ATOM 3515  H HD2  . LYS A 1 86  ? 27.028 -7.918  17.266 1.00 73.20 ? 86  LYS A HD2  2  
ATOM 3516  H HD3  . LYS A 1 86  ? 27.745 -6.738  18.365 1.00 2.11  ? 86  LYS A HD3  2  
ATOM 3517  H HE2  . LYS A 1 86  ? 29.723 -8.573  18.254 1.00 1.52  ? 86  LYS A HE2  2  
ATOM 3518  H HE3  . LYS A 1 86  ? 29.026 -8.762  16.646 1.00 44.41 ? 86  LYS A HE3  2  
ATOM 3519  H HZ1  . LYS A 1 86  ? 30.847 -6.896  17.339 1.00 63.00 ? 86  LYS A HZ1  2  
ATOM 3520  H HZ2  . LYS A 1 86  ? 29.404 -6.019  17.436 1.00 24.21 ? 86  LYS A HZ2  2  
ATOM 3521  H HZ3  . LYS A 1 86  ? 29.825 -6.797  15.994 1.00 24.12 ? 86  LYS A HZ3  2  
ATOM 3522  N N    . CYS A 1 87  ? 24.759 -11.718 19.997 1.00 11.04 ? 87  CYS A N    2  
ATOM 3523  C CA   . CYS A 1 87  ? 24.326 -12.714 20.971 1.00 63.52 ? 87  CYS A CA   2  
ATOM 3524  C C    . CYS A 1 87  ? 25.526 -13.366 21.652 1.00 54.41 ? 87  CYS A C    2  
ATOM 3525  O O    . CYS A 1 87  ? 26.487 -13.765 20.993 1.00 33.25 ? 87  CYS A O    2  
ATOM 3526  C CB   . CYS A 1 87  ? 23.468 -13.783 20.291 1.00 3.43  ? 87  CYS A CB   2  
ATOM 3527  S SG   . CYS A 1 87  ? 21.949 -14.187 21.184 1.00 30.22 ? 87  CYS A SG   2  
ATOM 3528  H H    . CYS A 1 87  ? 25.251 -12.010 19.202 1.00 72.14 ? 87  CYS A H    2  
ATOM 3529  H HA   . CYS A 1 87  ? 23.733 -12.210 21.719 1.00 62.44 ? 87  CYS A HA   2  
ATOM 3530  H HB2  . CYS A 1 87  ? 23.188 -13.436 19.307 1.00 33.24 ? 87  CYS A HB2  2  
ATOM 3531  H HB3  . CYS A 1 87  ? 24.046 -14.690 20.195 1.00 40.22 ? 87  CYS A HB3  2  
ATOM 3532  H HG   . CYS A 1 87  ? 20.941 -13.591 20.566 1.00 11.55 ? 87  CYS A HG   2  
ATOM 3533  N N    . THR A 1 88  ? 25.464 -13.468 22.976 1.00 61.41 ? 88  THR A N    2  
ATOM 3534  C CA   . THR A 1 88  ? 26.546 -14.068 23.747 1.00 34.01 ? 88  THR A CA   2  
ATOM 3535  C C    . THR A 1 88  ? 26.299 -15.555 23.976 1.00 11.21 ? 88  THR A C    2  
ATOM 3536  O O    . THR A 1 88  ? 25.156 -16.013 23.970 1.00 74.13 ? 88  THR A O    2  
ATOM 3537  C CB   . THR A 1 88  ? 26.717 -13.372 25.110 1.00 13.34 ? 88  THR A CB   2  
ATOM 3538  O OG1  . THR A 1 88  ? 26.310 -12.002 25.015 1.00 32.14 ? 88  THR A OG1  2  
ATOM 3539  C CG2  . THR A 1 88  ? 28.162 -13.445 25.578 1.00 24.30 ? 88  THR A CG2  2  
ATOM 3540  H H    . THR A 1 88  ? 24.672 -13.132 23.444 1.00 12.50 ? 88  THR A H    2  
ATOM 3541  H HA   . THR A 1 88  ? 27.462 -13.947 23.187 1.00 14.11 ? 88  THR A HA   2  
ATOM 3542  H HB   . THR A 1 88  ? 26.093 -13.875 25.835 1.00 22.24 ? 88  THR A HB   2  
ATOM 3543  H HG1  . THR A 1 88  ? 25.841 -11.751 25.815 1.00 72.20 ? 88  THR A HG1  2  
ATOM 3544  H HG21 . THR A 1 88  ? 28.414 -12.543 26.115 1.00 15.42 ? 88  THR A HG21 2  
ATOM 3545  H HG22 . THR A 1 88  ? 28.813 -13.548 24.722 1.00 13.01 ? 88  THR A HG22 2  
ATOM 3546  H HG23 . THR A 1 88  ? 28.287 -14.297 26.229 1.00 34.41 ? 88  THR A HG23 2  
ATOM 3547  N N    . LEU A 1 89  ? 27.377 -16.304 24.179 1.00 71.11 ? 89  LEU A N    2  
ATOM 3548  C CA   . LEU A 1 89  ? 27.277 -17.741 24.411 1.00 3.11  ? 89  LEU A CA   2  
ATOM 3549  C C    . LEU A 1 89  ? 26.759 -18.031 25.816 1.00 5.33  ? 89  LEU A C    2  
ATOM 3550  O O    . LEU A 1 89  ? 27.085 -17.321 26.767 1.00 61.11 ? 89  LEU A O    2  
ATOM 3551  C CB   . LEU A 1 89  ? 28.640 -18.406 24.210 1.00 3.43  ? 89  LEU A CB   2  
ATOM 3552  C CG   . LEU A 1 89  ? 28.784 -19.823 24.766 1.00 41.03 ? 89  LEU A CG   2  
ATOM 3553  C CD1  . LEU A 1 89  ? 29.720 -20.645 23.894 1.00 62.42 ? 89  LEU A CD1  2  
ATOM 3554  C CD2  . LEU A 1 89  ? 29.286 -19.785 26.202 1.00 51.32 ? 89  LEU A CD2  2  
ATOM 3555  H H    . LEU A 1 89  ? 28.261 -15.882 24.173 1.00 60.44 ? 89  LEU A H    2  
ATOM 3556  H HA   . LEU A 1 89  ? 26.579 -18.145 23.693 1.00 45.11 ? 89  LEU A HA   2  
ATOM 3557  H HB2  . LEU A 1 89  ? 28.836 -18.445 23.150 1.00 51.12 ? 89  LEU A HB2  2  
ATOM 3558  H HB3  . LEU A 1 89  ? 29.384 -17.784 24.689 1.00 31.41 ? 89  LEU A HB3  2  
ATOM 3559  H HG   . LEU A 1 89  ? 27.816 -20.304 24.762 1.00 71.55 ? 89  LEU A HG   2  
ATOM 3560  H HD11 . LEU A 1 89  ? 30.013 -21.539 24.424 1.00 44.03 ? 89  LEU A HD11 2  
ATOM 3561  H HD12 . LEU A 1 89  ? 30.598 -20.062 23.658 1.00 30.12 ? 89  LEU A HD12 2  
ATOM 3562  H HD13 . LEU A 1 89  ? 29.214 -20.918 22.979 1.00 34.05 ? 89  LEU A HD13 2  
ATOM 3563  H HD21 . LEU A 1 89  ? 29.178 -18.784 26.594 1.00 63.04 ? 89  LEU A HD21 2  
ATOM 3564  H HD22 . LEU A 1 89  ? 30.328 -20.071 26.227 1.00 54.32 ? 89  LEU A HD22 2  
ATOM 3565  H HD23 . LEU A 1 89  ? 28.709 -20.471 26.803 1.00 31.21 ? 89  LEU A HD23 2  
ATOM 3566  N N    . ASN A 1 90  ? 25.953 -19.080 25.939 1.00 12.24 ? 90  ASN A N    2  
ATOM 3567  C CA   . ASN A 1 90  ? 25.391 -19.465 27.229 1.00 1.11  ? 90  ASN A CA   2  
ATOM 3568  C C    . ASN A 1 90  ? 25.746 -20.910 27.567 1.00 13.22 ? 90  ASN A C    2  
ATOM 3569  O O    . ASN A 1 90  ? 26.411 -21.596 26.791 1.00 40.31 ? 90  ASN A O    2  
ATOM 3570  C CB   . ASN A 1 90  ? 23.871 -19.290 27.220 1.00 42.24 ? 90  ASN A CB   2  
ATOM 3571  C CG   . ASN A 1 90  ? 23.322 -18.936 28.588 1.00 55.41 ? 90  ASN A CG   2  
ATOM 3572  O OD1  . ASN A 1 90  ? 23.576 -17.850 29.110 1.00 64.14 ? 90  ASN A OD1  2  
ATOM 3573  N ND2  . ASN A 1 90  ? 22.563 -19.853 29.176 1.00 32.11 ? 90  ASN A ND2  2  
ATOM 3574  H H    . ASN A 1 90  ? 25.729 -19.608 25.144 1.00 4.53  ? 90  ASN A H    2  
ATOM 3575  H HA   . ASN A 1 90  ? 25.815 -18.817 27.982 1.00 55.14 ? 90  ASN A HA   2  
ATOM 3576  H HB2  . ASN A 1 90  ? 23.610 -18.498 26.532 1.00 5.15  ? 90  ASN A HB2  2  
ATOM 3577  H HB3  . ASN A 1 90  ? 23.410 -20.210 26.894 1.00 64.05 ? 90  ASN A HB3  2  
ATOM 3578  H HD21 . ASN A 1 90  ? 22.402 -20.695 28.701 1.00 22.42 ? 90  ASN A HD21 2  
ATOM 3579  H HD22 . ASN A 1 90  ? 22.194 -19.650 30.061 1.00 72.01 ? 90  ASN A HD22 2  
ATOM 3580  N N    . LYS A 1 91  ? 25.296 -21.367 28.731 1.00 3.52  ? 91  LYS A N    2  
ATOM 3581  C CA   . LYS A 1 91  ? 25.563 -22.730 29.173 1.00 23.11 ? 91  LYS A CA   2  
ATOM 3582  C C    . LYS A 1 91  ? 25.174 -23.737 28.096 1.00 75.40 ? 91  LYS A C    2  
ATOM 3583  O O    . LYS A 1 91  ? 26.010 -24.503 27.618 1.00 0.13  ? 91  LYS A O    2  
ATOM 3584  C CB   . LYS A 1 91  ? 24.800 -23.028 30.465 1.00 34.14 ? 91  LYS A CB   2  
ATOM 3585  C CG   . LYS A 1 91  ? 25.122 -22.069 31.598 1.00 41.54 ? 91  LYS A CG   2  
ATOM 3586  C CD   . LYS A 1 91  ? 26.277 -22.575 32.445 1.00 1.55  ? 91  LYS A CD   2  
ATOM 3587  C CE   . LYS A 1 91  ? 25.783 -23.389 33.631 1.00 21.12 ? 91  LYS A CE   2  
ATOM 3588  N NZ   . LYS A 1 91  ? 26.903 -23.819 34.514 1.00 53.11 ? 91  LYS A NZ   2  
ATOM 3589  H H    . LYS A 1 91  ? 24.771 -20.772 29.307 1.00 11.32 ? 91  LYS A H    2  
ATOM 3590  H HA   . LYS A 1 91  ? 26.622 -22.816 29.363 1.00 44.00 ? 91  LYS A HA   2  
ATOM 3591  H HB2  . LYS A 1 91  ? 23.740 -22.972 30.264 1.00 11.33 ? 91  LYS A HB2  2  
ATOM 3592  H HB3  . LYS A 1 91  ? 25.043 -24.030 30.790 1.00 13.32 ? 91  LYS A HB3  2  
ATOM 3593  H HG2  . LYS A 1 91  ? 25.390 -21.110 31.180 1.00 51.54 ? 91  LYS A HG2  2  
ATOM 3594  H HG3  . LYS A 1 91  ? 24.248 -21.959 32.224 1.00 3.13  ? 91  LYS A HG3  2  
ATOM 3595  H HD2  . LYS A 1 91  ? 26.914 -23.198 31.836 1.00 42.33 ? 91  LYS A HD2  2  
ATOM 3596  H HD3  . LYS A 1 91  ? 26.842 -21.728 32.811 1.00 34.32 ? 91  LYS A HD3  2  
ATOM 3597  H HE2  . LYS A 1 91  ? 25.096 -22.786 34.204 1.00 35.11 ? 91  LYS A HE2  2  
ATOM 3598  H HE3  . LYS A 1 91  ? 25.271 -24.265 33.261 1.00 61.11 ? 91  LYS A HE3  2  
ATOM 3599  H HZ1  . LYS A 1 91  ? 27.383 -24.645 34.104 1.00 22.53 ? 91  LYS A HZ1  2  
ATOM 3600  H HZ2  . LYS A 1 91  ? 26.539 -24.075 35.454 1.00 52.42 ? 91  LYS A HZ2  2  
ATOM 3601  H HZ3  . LYS A 1 91  ? 27.592 -23.047 34.619 1.00 71.32 ? 91  LYS A HZ3  2  
ATOM 3602  N N    . GLU A 1 92  ? 23.899 -23.729 27.718 1.00 60.40 ? 92  GLU A N    2  
ATOM 3603  C CA   . GLU A 1 92  ? 23.400 -24.643 26.696 1.00 2.44  ? 92  GLU A CA   2  
ATOM 3604  C C    . GLU A 1 92  ? 23.719 -24.121 25.298 1.00 33.11 ? 92  GLU A C    2  
ATOM 3605  O O    . GLU A 1 92  ? 23.876 -22.917 25.093 1.00 11.31 ? 92  GLU A O    2  
ATOM 3606  C CB   . GLU A 1 92  ? 21.890 -24.838 26.848 1.00 2.53  ? 92  GLU A CB   2  
ATOM 3607  C CG   . GLU A 1 92  ? 21.453 -26.290 26.765 1.00 74.22 ? 92  GLU A CG   2  
ATOM 3608  C CD   . GLU A 1 92  ? 20.144 -26.548 27.487 1.00 41.34 ? 92  GLU A CD   2  
ATOM 3609  O OE1  . GLU A 1 92  ? 19.618 -27.675 27.379 1.00 62.02 ? 92  GLU A OE1  2  
ATOM 3610  O OE2  . GLU A 1 92  ? 19.646 -25.621 28.160 1.00 43.13 ? 92  GLU A OE2  2  
ATOM 3611  H H    . GLU A 1 92  ? 23.280 -23.095 28.136 1.00 30.21 ? 92  GLU A H    2  
ATOM 3612  H HA   . GLU A 1 92  ? 23.892 -25.594 26.833 1.00 0.22  ? 92  GLU A HA   2  
ATOM 3613  H HB2  . GLU A 1 92  ? 21.583 -24.445 27.806 1.00 2.44  ? 92  GLU A HB2  2  
ATOM 3614  H HB3  . GLU A 1 92  ? 21.388 -24.287 26.066 1.00 3.04  ? 92  GLU A HB3  2  
ATOM 3615  H HG2  . GLU A 1 92  ? 21.331 -26.557 25.726 1.00 60.13 ? 92  GLU A HG2  2  
ATOM 3616  H HG3  . GLU A 1 92  ? 22.219 -26.910 27.207 1.00 12.31 ? 92  GLU A HG3  2  
ATOM 3617  N N    . LEU A 1 93  ? 23.813 -25.036 24.339 1.00 10.24 ? 93  LEU A N    2  
ATOM 3618  C CA   . LEU A 1 93  ? 24.113 -24.670 22.960 1.00 42.35 ? 93  LEU A CA   2  
ATOM 3619  C C    . LEU A 1 93  ? 22.855 -24.204 22.234 1.00 42.13 ? 93  LEU A C    2  
ATOM 3620  O O    . LEU A 1 93  ? 21.730 -24.490 22.644 1.00 2.20  ? 93  LEU A O    2  
ATOM 3621  C CB   . LEU A 1 93  ? 24.733 -25.857 22.220 1.00 52.44 ? 93  LEU A CB   2  
ATOM 3622  C CG   . LEU A 1 93  ? 26.256 -25.971 22.291 1.00 32.45 ? 93  LEU A CG   2  
ATOM 3623  C CD1  . LEU A 1 93  ? 26.676 -26.729 23.541 1.00 34.25 ? 93  LEU A CD1  2  
ATOM 3624  C CD2  . LEU A 1 93  ? 26.799 -26.654 21.044 1.00 13.24 ? 93  LEU A CD2  2  
ATOM 3625  H H    . LEU A 1 93  ? 23.678 -25.980 24.564 1.00 54.35 ? 93  LEU A H    2  
ATOM 3626  H HA   . LEU A 1 93  ? 24.824 -23.857 22.980 1.00 64.44 ? 93  LEU A HA   2  
ATOM 3627  H HB2  . LEU A 1 93  ? 24.313 -26.760 22.634 1.00 24.24 ? 93  LEU A HB2  2  
ATOM 3628  H HB3  . LEU A 1 93  ? 24.455 -25.778 21.178 1.00 14.42 ? 93  LEU A HB3  2  
ATOM 3629  H HG   . LEU A 1 93  ? 26.683 -24.979 22.344 1.00 63.50 ? 93  LEU A HG   2  
ATOM 3630  H HD11 . LEU A 1 93  ? 26.898 -27.754 23.284 1.00 55.43 ? 93  LEU A HD11 2  
ATOM 3631  H HD12 . LEU A 1 93  ? 25.873 -26.705 24.263 1.00 33.34 ? 93  LEU A HD12 2  
ATOM 3632  H HD13 . LEU A 1 93  ? 27.554 -26.265 23.965 1.00 22.34 ? 93  LEU A HD13 2  
ATOM 3633  H HD21 . LEU A 1 93  ? 26.249 -26.312 20.180 1.00 61.23 ? 93  LEU A HD21 2  
ATOM 3634  H HD22 . LEU A 1 93  ? 26.687 -27.724 21.142 1.00 33.11 ? 93  LEU A HD22 2  
ATOM 3635  H HD23 . LEU A 1 93  ? 27.844 -26.410 20.927 1.00 51.24 ? 93  LEU A HD23 2  
ATOM 3636  N N    . PRO A 1 94  ? 23.047 -23.470 21.127 1.00 24.33 ? 94  PRO A N    2  
ATOM 3637  C CA   . PRO A 1 94  ? 21.940 -22.952 20.319 1.00 11.31 ? 94  PRO A CA   2  
ATOM 3638  C C    . PRO A 1 94  ? 21.198 -24.057 19.576 1.00 55.13 ? 94  PRO A C    2  
ATOM 3639  O O    . PRO A 1 94  ? 21.776 -25.091 19.239 1.00 0.31  ? 94  PRO A O    2  
ATOM 3640  C CB   . PRO A 1 94  ? 22.633 -22.013 19.328 1.00 30.13 ? 94  PRO A CB   2  
ATOM 3641  C CG   . PRO A 1 94  ? 24.025 -22.533 19.225 1.00 42.14 ? 94  PRO A CG   2  
ATOM 3642  C CD   . PRO A 1 94  ? 24.361 -23.091 20.580 1.00 72.32 ? 94  PRO A CD   2  
ATOM 3643  H HA   . PRO A 1 94  ? 21.239 -22.390 20.920 1.00 64.22 ? 94  PRO A HA   2  
ATOM 3644  H HB2  . PRO A 1 94  ? 22.124 -22.052 18.375 1.00 12.25 ? 94  PRO A HB2  2  
ATOM 3645  H HB3  . PRO A 1 94  ? 22.616 -21.004 19.711 1.00 41.31 ? 94  PRO A HB3  2  
ATOM 3646  H HG2  . PRO A 1 94  ? 24.073 -23.310 18.477 1.00 55.43 ? 94  PRO A HG2  2  
ATOM 3647  H HG3  . PRO A 1 94  ? 24.700 -21.727 18.974 1.00 33.32 ? 94  PRO A HG3  2  
ATOM 3648  H HD2  . PRO A 1 94  ? 25.002 -23.955 20.484 1.00 44.41 ? 94  PRO A HD2  2  
ATOM 3649  H HD3  . PRO A 1 94  ? 24.830 -22.336 21.193 1.00 21.44 ? 94  PRO A HD3  2  
ATOM 3650  N N    . THR A 1 95  ? 19.912 -23.833 19.321 1.00 0.32  ? 95  THR A N    2  
ATOM 3651  C CA   . THR A 1 95  ? 19.090 -24.810 18.618 1.00 3.31  ? 95  THR A CA   2  
ATOM 3652  C C    . THR A 1 95  ? 19.105 -24.560 17.114 1.00 25.43 ? 95  THR A C    2  
ATOM 3653  O O    . THR A 1 95  ? 19.431 -23.463 16.660 1.00 54.32 ? 95  THR A O    2  
ATOM 3654  C CB   . THR A 1 95  ? 17.633 -24.781 19.117 1.00 23.31 ? 95  THR A CB   2  
ATOM 3655  O OG1  . THR A 1 95  ? 17.606 -24.658 20.543 1.00 2.14  ? 95  THR A OG1  2  
ATOM 3656  C CG2  . THR A 1 95  ? 16.893 -26.043 18.698 1.00 2.40  ? 95  THR A CG2  2  
ATOM 3657  H H    . THR A 1 95  ? 19.508 -22.990 19.615 1.00 52.43 ? 95  THR A H    2  
ATOM 3658  H HA   . THR A 1 95  ? 19.497 -25.791 18.815 1.00 42.02 ? 95  THR A HA   2  
ATOM 3659  H HB   . THR A 1 95  ? 17.136 -23.928 18.680 1.00 54.52 ? 95  THR A HB   2  
ATOM 3660  H HG1  . THR A 1 95  ? 16.781 -25.016 20.880 1.00 1.31  ? 95  THR A HG1  2  
ATOM 3661  H HG21 . THR A 1 95  ? 16.711 -26.017 17.634 1.00 45.32 ? 95  THR A HG21 2  
ATOM 3662  H HG22 . THR A 1 95  ? 15.951 -26.098 19.223 1.00 23.41 ? 95  THR A HG22 2  
ATOM 3663  H HG23 . THR A 1 95  ? 17.492 -26.908 18.939 1.00 0.35  ? 95  THR A HG23 2  
ATOM 3664  N N    . LEU A 1 96  ? 18.751 -25.585 16.346 1.00 4.31  ? 96  LEU A N    2  
ATOM 3665  C CA   . LEU A 1 96  ? 18.723 -25.476 14.892 1.00 64.44 ? 96  LEU A CA   2  
ATOM 3666  C C    . LEU A 1 96  ? 20.091 -25.074 14.349 1.00 11.21 ? 96  LEU A C    2  
ATOM 3667  O O    . LEU A 1 96  ? 20.206 -24.581 13.226 1.00 33.41 ? 96  LEU A O    2  
ATOM 3668  C CB   . LEU A 1 96  ? 17.669 -24.457 14.457 1.00 42.14 ? 96  LEU A CB   2  
ATOM 3669  C CG   . LEU A 1 96  ? 18.169 -23.030 14.228 1.00 23.13 ? 96  LEU A CG   2  
ATOM 3670  C CD1  . LEU A 1 96  ? 18.091 -22.667 12.754 1.00 44.43 ? 96  LEU A CD1  2  
ATOM 3671  C CD2  . LEU A 1 96  ? 17.368 -22.044 15.066 1.00 42.23 ? 96  LEU A CD2  2  
ATOM 3672  H H    . LEU A 1 96  ? 18.503 -26.434 16.766 1.00 74.22 ? 96  LEU A H    2  
ATOM 3673  H HA   . LEU A 1 96  ? 18.462 -26.445 14.492 1.00 20.13 ? 96  LEU A HA   2  
ATOM 3674  H HB2  . LEU A 1 96  ? 17.233 -24.806 13.533 1.00 1.23  ? 96  LEU A HB2  2  
ATOM 3675  H HB3  . LEU A 1 96  ? 16.907 -24.423 15.222 1.00 23.14 ? 96  LEU A HB3  2  
ATOM 3676  H HG   . LEU A 1 96  ? 19.205 -22.965 14.533 1.00 32.22 ? 96  LEU A HG   2  
ATOM 3677  H HD11 . LEU A 1 96  ? 18.796 -21.878 12.540 1.00 44.23 ? 96  LEU A HD11 2  
ATOM 3678  H HD12 . LEU A 1 96  ? 17.092 -22.330 12.518 1.00 25.52 ? 96  LEU A HD12 2  
ATOM 3679  H HD13 . LEU A 1 96  ? 18.329 -23.535 12.156 1.00 12.31 ? 96  LEU A HD13 2  
ATOM 3680  H HD21 . LEU A 1 96  ? 16.403 -22.470 15.298 1.00 25.21 ? 96  LEU A HD21 2  
ATOM 3681  H HD22 . LEU A 1 96  ? 17.232 -21.127 14.510 1.00 70.32 ? 96  LEU A HD22 2  
ATOM 3682  H HD23 . LEU A 1 96  ? 17.900 -21.834 15.982 1.00 71.42 ? 96  LEU A HD23 2  
ATOM 3683  N N    . THR A 1 97  ? 21.128 -25.288 15.153 1.00 34.34 ? 97  THR A N    2  
ATOM 3684  C CA   . THR A 1 97  ? 22.488 -24.949 14.754 1.00 34.12 ? 97  THR A CA   2  
ATOM 3685  C C    . THR A 1 97  ? 23.068 -26.008 13.824 1.00 30.10 ? 97  THR A C    2  
ATOM 3686  O O    . THR A 1 97  ? 23.846 -25.696 12.923 1.00 30.22 ? 97  THR A O    2  
ATOM 3687  C CB   . THR A 1 97  ? 23.410 -24.796 15.978 1.00 45.40 ? 97  THR A CB   2  
ATOM 3688  O OG1  . THR A 1 97  ? 24.722 -24.403 15.557 1.00 74.24 ? 97  THR A OG1  2  
ATOM 3689  C CG2  . THR A 1 97  ? 23.492 -26.097 16.761 1.00 62.43 ? 97  THR A CG2  2  
ATOM 3690  H H    . THR A 1 97  ? 20.972 -25.684 16.036 1.00 2.55  ? 97  THR A H    2  
ATOM 3691  H HA   . THR A 1 97  ? 22.456 -24.004 14.232 1.00 1.55  ? 97  THR A HA   2  
ATOM 3692  H HB   . THR A 1 97  ? 23.004 -24.030 16.623 1.00 55.11 ? 97  THR A HB   2  
ATOM 3693  H HG1  . THR A 1 97  ? 25.102 -25.094 15.008 1.00 13.22 ? 97  THR A HG1  2  
ATOM 3694  H HG21 . THR A 1 97  ? 24.388 -26.631 16.480 1.00 44.30 ? 97  THR A HG21 2  
ATOM 3695  H HG22 . THR A 1 97  ? 22.627 -26.705 16.540 1.00 63.00 ? 97  THR A HG22 2  
ATOM 3696  H HG23 . THR A 1 97  ? 23.520 -25.880 17.818 1.00 75.12 ? 97  THR A HG23 2  
ATOM 3697  N N    . GLU A 1 98  ? 22.684 -27.261 14.048 1.00 13.11 ? 98  GLU A N    2  
ATOM 3698  C CA   . GLU A 1 98  ? 23.167 -28.366 13.229 1.00 43.34 ? 98  GLU A CA   2  
ATOM 3699  C C    . GLU A 1 98  ? 22.374 -28.467 11.929 1.00 41.12 ? 98  GLU A C    2  
ATOM 3700  O O    . GLU A 1 98  ? 22.631 -29.338 11.098 1.00 63.24 ? 98  GLU A O    2  
ATOM 3701  C CB   . GLU A 1 98  ? 23.071 -29.683 14.001 1.00 25.01 ? 98  GLU A CB   2  
ATOM 3702  C CG   . GLU A 1 98  ? 23.740 -29.639 15.365 1.00 41.12 ? 98  GLU A CG   2  
ATOM 3703  C CD   . GLU A 1 98  ? 24.118 -31.016 15.874 1.00 22.20 ? 98  GLU A CD   2  
ATOM 3704  O OE1  . GLU A 1 98  ? 24.677 -31.807 15.085 1.00 5.23  ? 98  GLU A OE1  2  
ATOM 3705  O OE2  . GLU A 1 98  ? 23.855 -31.304 17.060 1.00 12.22 ? 98  GLU A OE2  2  
ATOM 3706  H H    . GLU A 1 98  ? 22.061 -27.446 14.782 1.00 61.32 ? 98  GLU A H    2  
ATOM 3707  H HA   . GLU A 1 98  ? 24.202 -28.174 12.990 1.00 4.43  ? 98  GLU A HA   2  
ATOM 3708  H HB2  . GLU A 1 98  ? 22.029 -29.929 14.141 1.00 23.34 ? 98  GLU A HB2  2  
ATOM 3709  H HB3  . GLU A 1 98  ? 23.541 -30.462 13.419 1.00 74.32 ? 98  GLU A HB3  2  
ATOM 3710  H HG2  . GLU A 1 98  ? 24.636 -29.040 15.293 1.00 31.32 ? 98  GLU A HG2  2  
ATOM 3711  H HG3  . GLU A 1 98  ? 23.060 -29.184 16.070 1.00 23.34 ? 98  GLU A HG3  2  
ATOM 3712  N N    . HIS A 1 99  ? 21.408 -27.570 11.761 1.00 52.42 ? 99  HIS A N    2  
ATOM 3713  C CA   . HIS A 1 99  ? 20.576 -27.557 10.563 1.00 61.04 ? 99  HIS A CA   2  
ATOM 3714  C C    . HIS A 1 99  ? 21.421 -27.780 9.312  1.00 24.32 ? 99  HIS A C    2  
ATOM 3715  O O    . HIS A 1 99  ? 21.020 -28.503 8.399  1.00 3.53  ? 99  HIS A O    2  
ATOM 3716  C CB   . HIS A 1 99  ? 19.823 -26.231 10.453 1.00 72.01 ? 99  HIS A CB   2  
ATOM 3717  C CG   . HIS A 1 99  ? 18.382 -26.326 10.852 1.00 3.21  ? 99  HIS A CG   2  
ATOM 3718  N ND1  . HIS A 1 99  ? 17.907 -27.269 11.738 1.00 25.35 ? 99  HIS A ND1  2  
ATOM 3719  C CD2  . HIS A 1 99  ? 17.311 -25.587 10.482 1.00 54.25 ? 99  HIS A CD2  2  
ATOM 3720  C CE1  . HIS A 1 99  ? 16.606 -27.108 11.895 1.00 53.34 ? 99  HIS A CE1  2  
ATOM 3721  N NE2  . HIS A 1 99  ? 16.219 -26.093 11.143 1.00 53.20 ? 99  HIS A NE2  2  
ATOM 3722  H H    . HIS A 1 99  ? 21.251 -26.900 12.459 1.00 72.22 ? 99  HIS A H    2  
ATOM 3723  H HA   . HIS A 1 99  ? 19.861 -28.361 10.647 1.00 61.33 ? 99  HIS A HA   2  
ATOM 3724  H HB2  . HIS A 1 99  ? 20.297 -25.502 11.093 1.00 15.51 ? 99  HIS A HB2  2  
ATOM 3725  H HB3  . HIS A 1 99  ? 19.863 -25.885 9.430  1.00 35.20 ? 99  HIS A HB3  2  
ATOM 3726  H HD1  . HIS A 1 99  ? 18.444 -27.956 12.185 1.00 24.12 ? 99  HIS A HD1  2  
ATOM 3727  H HD2  . HIS A 1 99  ? 17.313 -24.753 9.793  1.00 73.52 ? 99  HIS A HD2  2  
ATOM 3728  H HE1  . HIS A 1 99  ? 15.966 -27.703 12.529 1.00 41.02 ? 99  HIS A HE1  2  
ATOM 3729  N N    . LYS A 1 100 ? 22.593 -27.155 9.277  1.00 64.22 ? 100 LYS A N    2  
ATOM 3730  C CA   . LYS A 1 100 ? 23.496 -27.285 8.139  1.00 24.24 ? 100 LYS A CA   2  
ATOM 3731  C C    . LYS A 1 100 ? 24.665 -28.206 8.475  1.00 71.40 ? 100 LYS A C    2  
ATOM 3732  O O    . LYS A 1 100 ? 24.860 -29.237 7.831  1.00 34.31 ? 100 LYS A O    2  
ATOM 3733  C CB   . LYS A 1 100 ? 24.021 -25.911 7.719  1.00 43.50 ? 100 LYS A CB   2  
ATOM 3734  C CG   . LYS A 1 100 ? 24.053 -25.706 6.214  1.00 11.33 ? 100 LYS A CG   2  
ATOM 3735  C CD   . LYS A 1 100 ? 25.153 -24.740 5.806  1.00 61.51 ? 100 LYS A CD   2  
ATOM 3736  C CE   . LYS A 1 100 ? 25.881 -25.220 4.559  1.00 12.13 ? 100 LYS A CE   2  
ATOM 3737  N NZ   . LYS A 1 100 ? 26.341 -24.083 3.714  1.00 31.51 ? 100 LYS A NZ   2  
ATOM 3738  H H    . LYS A 1 100 ? 22.858 -26.593 10.035 1.00 0.24  ? 100 LYS A H    2  
ATOM 3739  H HA   . LYS A 1 100 ? 22.939 -27.714 7.321  1.00 70.24 ? 100 LYS A HA   2  
ATOM 3740  H HB2  . LYS A 1 100 ? 23.389 -25.149 8.152  1.00 61.31 ? 100 LYS A HB2  2  
ATOM 3741  H HB3  . LYS A 1 100 ? 25.026 -25.791 8.099  1.00 51.34 ? 100 LYS A HB3  2  
ATOM 3742  H HG2  . LYS A 1 100 ? 24.227 -26.657 5.734  1.00 21.10 ? 100 LYS A HG2  2  
ATOM 3743  H HG3  . LYS A 1 100 ? 23.100 -25.308 5.894  1.00 2.23  ? 100 LYS A HG3  2  
ATOM 3744  H HD2  . LYS A 1 100 ? 24.716 -23.774 5.604  1.00 12.12 ? 100 LYS A HD2  2  
ATOM 3745  H HD3  . LYS A 1 100 ? 25.863 -24.654 6.616  1.00 23.22 ? 100 LYS A HD3  2  
ATOM 3746  H HE2  . LYS A 1 100 ? 26.737 -25.803 4.860  1.00 23.33 ? 100 LYS A HE2  2  
ATOM 3747  H HE3  . LYS A 1 100 ? 25.209 -25.838 3.982  1.00 22.10 ? 100 LYS A HE3  2  
ATOM 3748  H HZ1  . LYS A 1 100 ? 25.882 -24.123 2.782  1.00 75.23 ? 100 LYS A HZ1  2  
ATOM 3749  H HZ2  . LYS A 1 100 ? 27.371 -24.131 3.582  1.00 3.53  ? 100 LYS A HZ2  2  
ATOM 3750  H HZ3  . LYS A 1 100 ? 26.101 -23.180 4.169  1.00 41.42 ? 100 LYS A HZ3  2  
ATOM 3751  N N    . SER A 1 101 ? 25.439 -27.828 9.487  1.00 32.44 ? 101 SER A N    2  
ATOM 3752  C CA   . SER A 1 101 ? 26.590 -28.620 9.907  1.00 55.22 ? 101 SER A CA   2  
ATOM 3753  C C    . SER A 1 101 ? 27.345 -27.924 11.035 1.00 63.12 ? 101 SER A C    2  
ATOM 3754  O O    . SER A 1 101 ? 26.891 -26.912 11.569 1.00 33.11 ? 101 SER A O    2  
ATOM 3755  C CB   . SER A 1 101 ? 27.527 -28.862 8.723  1.00 65.03 ? 101 SER A CB   2  
ATOM 3756  O OG   . SER A 1 101 ? 27.777 -30.246 8.545  1.00 42.54 ? 101 SER A OG   2  
ATOM 3757  H H    . SER A 1 101 ? 25.232 -26.996 9.962  1.00 40.12 ? 101 SER A H    2  
ATOM 3758  H HA   . SER A 1 101 ? 26.225 -29.570 10.266 1.00 32.44 ? 101 SER A HA   2  
ATOM 3759  H HB2  . SER A 1 101 ? 27.076 -28.471 7.823  1.00 21.54 ? 101 SER A HB2  2  
ATOM 3760  H HB3  . SER A 1 101 ? 28.467 -28.359 8.902  1.00 14.22 ? 101 SER A HB3  2  
ATOM 3761  H HG   . SER A 1 101 ? 27.625 -30.483 7.627  1.00 42.01 ? 101 SER A HG   2  
ATOM 3762  N N    . ILE A 1 102 ? 28.501 -28.474 11.391 1.00 20.24 ? 102 ILE A N    2  
ATOM 3763  C CA   . ILE A 1 102 ? 29.321 -27.907 12.455 1.00 52.44 ? 102 ILE A CA   2  
ATOM 3764  C C    . ILE A 1 102 ? 30.566 -27.233 11.888 1.00 10.44 ? 102 ILE A C    2  
ATOM 3765  O O    . ILE A 1 102 ? 31.535 -27.900 11.528 1.00 0.14  ? 102 ILE A O    2  
ATOM 3766  C CB   . ILE A 1 102 ? 29.750 -28.982 13.470 1.00 72.42 ? 102 ILE A CB   2  
ATOM 3767  C CG1  . ILE A 1 102 ? 28.569 -29.373 14.361 1.00 23.13 ? 102 ILE A CG1  2  
ATOM 3768  C CG2  . ILE A 1 102 ? 30.914 -28.482 14.312 1.00 13.30 ? 102 ILE A CG2  2  
ATOM 3769  C CD1  . ILE A 1 102 ? 27.797 -30.570 13.851 1.00 0.43  ? 102 ILE A CD1  2  
ATOM 3770  H H    . ILE A 1 102 ? 28.810 -29.280 10.928 1.00 60.20 ? 102 ILE A H    2  
ATOM 3771  H HA   . ILE A 1 102 ? 28.728 -27.167 12.973 1.00 1.31  ? 102 ILE A HA   2  
ATOM 3772  H HB   . ILE A 1 102 ? 30.081 -29.851 12.922 1.00 70.13 ? 102 ILE A HB   2  
ATOM 3773  H HG12 . ILE A 1 102 ? 28.934 -29.611 15.348 1.00 44.21 ? 102 ILE A HG12 2  
ATOM 3774  H HG13 . ILE A 1 102 ? 27.886 -28.539 14.426 1.00 14.13 ? 102 ILE A HG13 2  
ATOM 3775  H HG21 . ILE A 1 102 ? 30.901 -27.402 14.337 1.00 2.04  ? 102 ILE A HG21 2  
ATOM 3776  H HG22 . ILE A 1 102 ? 30.822 -28.865 15.317 1.00 75.41 ? 102 ILE A HG22 2  
ATOM 3777  H HG23 . ILE A 1 102 ? 31.843 -28.821 13.880 1.00 1.03  ? 102 ILE A HG23 2  
ATOM 3778  H HD11 . ILE A 1 102 ? 28.488 -31.350 13.567 1.00 15.03 ? 102 ILE A HD11 2  
ATOM 3779  H HD12 . ILE A 1 102 ? 27.141 -30.933 14.628 1.00 51.13 ? 102 ILE A HD12 2  
ATOM 3780  H HD13 . ILE A 1 102 ? 27.210 -30.279 12.991 1.00 24.23 ? 102 ILE A HD13 2  
ATOM 3781  N N    . GLU A 1 103 ? 30.532 -25.906 11.815 1.00 42.35 ? 103 GLU A N    2  
ATOM 3782  C CA   . GLU A 1 103 ? 31.659 -25.141 11.293 1.00 62.40 ? 103 GLU A CA   2  
ATOM 3783  C C    . GLU A 1 103 ? 31.835 -23.836 12.064 1.00 22.42 ? 103 GLU A C    2  
ATOM 3784  O O    . GLU A 1 103 ? 30.951 -22.980 12.065 1.00 43.44 ? 103 GLU A O    2  
ATOM 3785  C CB   . GLU A 1 103 ? 31.458 -24.844 9.806  1.00 71.35 ? 103 GLU A CB   2  
ATOM 3786  C CG   . GLU A 1 103 ? 30.475 -25.782 9.125  1.00 23.50 ? 103 GLU A CG   2  
ATOM 3787  C CD   . GLU A 1 103 ? 30.447 -25.606 7.619  1.00 10.53 ? 103 GLU A CD   2  
ATOM 3788  O OE1  . GLU A 1 103 ? 29.382 -25.845 7.013  1.00 20.31 ? 103 GLU A OE1  2  
ATOM 3789  O OE2  . GLU A 1 103 ? 31.491 -25.227 7.047  1.00 13.34 ? 103 GLU A OE2  2  
ATOM 3790  H H    . GLU A 1 103 ? 29.731 -25.430 12.117 1.00 12.12 ? 103 GLU A H    2  
ATOM 3791  H HA   . GLU A 1 103 ? 32.550 -25.740 11.414 1.00 53.54 ? 103 GLU A HA   2  
ATOM 3792  H HB2  . GLU A 1 103 ? 31.092 -23.834 9.699  1.00 44.43 ? 103 GLU A HB2  2  
ATOM 3793  H HB3  . GLU A 1 103 ? 32.410 -24.928 9.302  1.00 10.05 ? 103 GLU A HB3  2  
ATOM 3794  H HG2  . GLU A 1 103 ? 30.757 -26.801 9.347  1.00 51.11 ? 103 GLU A HG2  2  
ATOM 3795  H HG3  . GLU A 1 103 ? 29.486 -25.591 9.514  1.00 0.10  ? 103 GLU A HG3  2  
ATOM 3796  N N    . TRP A 1 104 ? 32.981 -23.694 12.720 1.00 42.12 ? 104 TRP A N    2  
ATOM 3797  C CA   . TRP A 1 104 ? 33.273 -22.494 13.496 1.00 44.02 ? 104 TRP A CA   2  
ATOM 3798  C C    . TRP A 1 104 ? 34.525 -21.799 12.972 1.00 3.35  ? 104 TRP A C    2  
ATOM 3799  O O    . TRP A 1 104 ? 35.647 -22.230 13.244 1.00 73.33 ? 104 TRP A O    2  
ATOM 3800  C CB   . TRP A 1 104 ? 33.452 -22.848 14.973 1.00 35.11 ? 104 TRP A CB   2  
ATOM 3801  C CG   . TRP A 1 104 ? 32.585 -23.987 15.420 1.00 44.14 ? 104 TRP A CG   2  
ATOM 3802  C CD1  . TRP A 1 104 ? 32.993 -25.130 16.046 1.00 10.23 ? 104 TRP A CD1  2  
ATOM 3803  C CD2  . TRP A 1 104 ? 31.165 -24.093 15.271 1.00 3.34  ? 104 TRP A CD2  2  
ATOM 3804  N NE1  . TRP A 1 104 ? 31.912 -25.940 16.297 1.00 53.23 ? 104 TRP A NE1  2  
ATOM 3805  C CE2  . TRP A 1 104 ? 30.779 -25.326 15.832 1.00 72.02 ? 104 TRP A CE2  2  
ATOM 3806  C CE3  . TRP A 1 104 ? 30.182 -23.265 14.722 1.00 25.20 ? 104 TRP A CE3  2  
ATOM 3807  C CZ2  . TRP A 1 104 ? 29.453 -25.749 15.856 1.00 74.20 ? 104 TRP A CZ2  2  
ATOM 3808  C CZ3  . TRP A 1 104 ? 28.867 -23.687 14.747 1.00 53.25 ? 104 TRP A CZ3  2  
ATOM 3809  C CH2  . TRP A 1 104 ? 28.511 -24.919 15.311 1.00 61.11 ? 104 TRP A CH2  2  
ATOM 3810  H H    . TRP A 1 104 ? 33.647 -24.412 12.681 1.00 22.33 ? 104 TRP A H    2  
ATOM 3811  H HA   . TRP A 1 104 ? 32.434 -21.822 13.395 1.00 73.33 ? 104 TRP A HA   2  
ATOM 3812  H HB2  . TRP A 1 104 ? 34.481 -23.123 15.150 1.00 54.14 ? 104 TRP A HB2  2  
ATOM 3813  H HB3  . TRP A 1 104 ? 33.205 -21.985 15.575 1.00 50.04 ? 104 TRP A HB3  2  
ATOM 3814  H HD1  . TRP A 1 104 ? 34.018 -25.352 16.300 1.00 43.42 ? 104 TRP A HD1  2  
ATOM 3815  H HE1  . TRP A 1 104 ? 31.947 -26.815 16.738 1.00 15.52 ? 104 TRP A HE1  2  
ATOM 3816  H HE3  . TRP A 1 104 ? 30.437 -22.312 14.283 1.00 53.14 ? 104 TRP A HE3  2  
ATOM 3817  H HZ2  . TRP A 1 104 ? 29.162 -26.696 16.288 1.00 45.01 ? 104 TRP A HZ2  2  
ATOM 3818  H HZ3  . TRP A 1 104 ? 28.093 -23.061 14.326 1.00 3.21  ? 104 TRP A HZ3  2  
ATOM 3819  H HH2  . TRP A 1 104 ? 27.472 -25.208 15.308 1.00 55.11 ? 104 TRP A HH2  2  
ATOM 3820  N N    . LEU A 1 105 ? 34.328 -20.721 12.222 1.00 50.42 ? 105 LEU A N    2  
ATOM 3821  C CA   . LEU A 1 105 ? 35.442 -19.965 11.660 1.00 3.24  ? 105 LEU A CA   2  
ATOM 3822  C C    . LEU A 1 105 ? 35.780 -18.762 12.535 1.00 11.32 ? 105 LEU A C    2  
ATOM 3823  O O    . LEU A 1 105 ? 34.916 -18.224 13.228 1.00 5.22  ? 105 LEU A O    2  
ATOM 3824  C CB   . LEU A 1 105 ? 35.106 -19.500 10.242 1.00 20.22 ? 105 LEU A CB   2  
ATOM 3825  C CG   . LEU A 1 105 ? 35.006 -20.598 9.182  1.00 3.23  ? 105 LEU A CG   2  
ATOM 3826  C CD1  . LEU A 1 105 ? 33.565 -21.056 9.022  1.00 51.41 ? 105 LEU A CD1  2  
ATOM 3827  C CD2  . LEU A 1 105 ? 35.563 -20.108 7.854  1.00 64.34 ? 105 LEU A CD2  2  
ATOM 3828  H H    . LEU A 1 105 ? 33.412 -20.425 12.040 1.00 31.02 ? 105 LEU A H    2  
ATOM 3829  H HA   . LEU A 1 105 ? 36.300 -20.619 11.622 1.00 24.12 ? 105 LEU A HA   2  
ATOM 3830  H HB2  . LEU A 1 105 ? 34.157 -18.989 10.278 1.00 14.44 ? 105 LEU A HB2  2  
ATOM 3831  H HB3  . LEU A 1 105 ? 35.875 -18.807 9.931  1.00 31.22 ? 105 LEU A HB3  2  
ATOM 3832  H HG   . LEU A 1 105 ? 35.593 -21.449 9.499  1.00 60.43 ? 105 LEU A HG   2  
ATOM 3833  H HD11 . LEU A 1 105 ? 33.193 -20.743 8.058  1.00 64.53 ? 105 LEU A HD11 2  
ATOM 3834  H HD12 . LEU A 1 105 ? 32.959 -20.616 9.801  1.00 61.54 ? 105 LEU A HD12 2  
ATOM 3835  H HD13 . LEU A 1 105 ? 33.519 -22.132 9.095  1.00 61.41 ? 105 LEU A HD13 2  
ATOM 3836  H HD21 . LEU A 1 105 ? 35.735 -20.953 7.203  1.00 51.13 ? 105 LEU A HD21 2  
ATOM 3837  H HD22 . LEU A 1 105 ? 36.496 -19.590 8.023  1.00 1.25  ? 105 LEU A HD22 2  
ATOM 3838  H HD23 . LEU A 1 105 ? 34.856 -19.436 7.392  1.00 13.34 ? 105 LEU A HD23 2  
ATOM 3839  N N    . SER A 1 106 ? 37.041 -18.343 12.496 1.00 30.52 ? 106 SER A N    2  
ATOM 3840  C CA   . SER A 1 106 ? 37.493 -17.205 13.287 1.00 44.44 ? 106 SER A CA   2  
ATOM 3841  C C    . SER A 1 106 ? 36.859 -15.910 12.787 1.00 61.22 ? 106 SER A C    2  
ATOM 3842  O O    . SER A 1 106 ? 36.045 -15.922 11.863 1.00 42.41 ? 106 SER A O    2  
ATOM 3843  C CB   . SER A 1 106 ? 39.018 -17.093 13.232 1.00 2.25  ? 106 SER A CB   2  
ATOM 3844  O OG   . SER A 1 106 ? 39.605 -17.525 14.448 1.00 72.53 ? 106 SER A OG   2  
ATOM 3845  H H    . SER A 1 106 ? 37.683 -18.814 11.924 1.00 72.01 ? 106 SER A H    2  
ATOM 3846  H HA   . SER A 1 106 ? 37.189 -17.369 14.310 1.00 61.35 ? 106 SER A HA   2  
ATOM 3847  H HB2  . SER A 1 106 ? 39.393 -17.706 12.427 1.00 22.24 ? 106 SER A HB2  2  
ATOM 3848  H HB3  . SER A 1 106 ? 39.295 -16.063 13.059 1.00 12.24 ? 106 SER A HB3  2  
ATOM 3849  H HG   . SER A 1 106 ? 40.505 -17.196 14.504 1.00 13.13 ? 106 SER A HG   2  
ATOM 3850  N N    . ILE A 1 107 ? 37.238 -14.796 13.404 1.00 31.43 ? 107 ILE A N    2  
ATOM 3851  C CA   . ILE A 1 107 ? 36.708 -13.494 13.022 1.00 13.51 ? 107 ILE A CA   2  
ATOM 3852  C C    . ILE A 1 107 ? 37.292 -13.031 11.692 1.00 41.12 ? 107 ILE A C    2  
ATOM 3853  O O    . ILE A 1 107 ? 36.667 -12.263 10.961 1.00 23.14 ? 107 ILE A O    2  
ATOM 3854  C CB   . ILE A 1 107 ? 37.000 -12.429 14.096 1.00 24.43 ? 107 ILE A CB   2  
ATOM 3855  C CG1  . ILE A 1 107 ? 36.371 -12.834 15.431 1.00 70.01 ? 107 ILE A CG1  2  
ATOM 3856  C CG2  . ILE A 1 107 ? 36.482 -11.070 13.651 1.00 63.35 ? 107 ILE A CG2  2  
ATOM 3857  C CD1  . ILE A 1 107 ? 36.594 -11.825 16.535 1.00 4.51  ? 107 ILE A CD1  2  
ATOM 3858  H H    . ILE A 1 107 ? 37.890 -14.852 14.133 1.00 11.04 ? 107 ILE A H    2  
ATOM 3859  H HA   . ILE A 1 107 ? 35.636 -13.587 12.919 1.00 21.33 ? 107 ILE A HA   2  
ATOM 3860  H HB   . ILE A 1 107 ? 38.070 -12.358 14.218 1.00 4.21  ? 107 ILE A HB   2  
ATOM 3861  H HG12 . ILE A 1 107 ? 35.307 -12.951 15.299 1.00 11.44 ? 107 ILE A HG12 2  
ATOM 3862  H HG13 . ILE A 1 107 ? 36.795 -13.775 15.750 1.00 64.23 ? 107 ILE A HG13 2  
ATOM 3863  H HG21 . ILE A 1 107 ? 36.697 -10.336 14.413 1.00 41.44 ? 107 ILE A HG21 2  
ATOM 3864  H HG22 . ILE A 1 107 ? 36.968 -10.785 12.730 1.00 41.34 ? 107 ILE A HG22 2  
ATOM 3865  H HG23 . ILE A 1 107 ? 35.416 -11.125 13.494 1.00 54.04 ? 107 ILE A HG23 2  
ATOM 3866  H HD11 . ILE A 1 107 ? 35.651 -11.376 16.810 1.00 21.31 ? 107 ILE A HD11 2  
ATOM 3867  H HD12 . ILE A 1 107 ? 37.024 -12.318 17.394 1.00 75.33 ? 107 ILE A HD12 2  
ATOM 3868  H HD13 . ILE A 1 107 ? 37.270 -11.055 16.188 1.00 35.30 ? 107 ILE A HD13 2  
ATOM 3869  N N    . ASN A 1 108 ? 38.495 -13.505 11.383 1.00 74.40 ? 108 ASN A N    2  
ATOM 3870  C CA   . ASN A 1 108 ? 39.164 -13.141 10.139 1.00 35.42 ? 108 ASN A CA   2  
ATOM 3871  C C    . ASN A 1 108 ? 38.971 -14.224 9.081  1.00 2.32  ? 108 ASN A C    2  
ATOM 3872  O O    . ASN A 1 108 ? 39.639 -14.220 8.048  1.00 52.04 ? 108 ASN A O    2  
ATOM 3873  C CB   . ASN A 1 108 ? 40.656 -12.914 10.386 1.00 2.43  ? 108 ASN A CB   2  
ATOM 3874  C CG   . ASN A 1 108 ? 41.270 -13.995 11.254 1.00 62.30 ? 108 ASN A CG   2  
ATOM 3875  O OD1  . ASN A 1 108 ? 41.765 -15.004 10.751 1.00 71.03 ? 108 ASN A OD1  2  
ATOM 3876  N ND2  . ASN A 1 108 ? 41.241 -13.789 12.566 1.00 74.25 ? 108 ASN A ND2  2  
ATOM 3877  H H    . ASN A 1 108 ? 38.943 -14.114 12.006 1.00 21.42 ? 108 ASN A H    2  
ATOM 3878  H HA   . ASN A 1 108 ? 38.723 -12.223 9.782  1.00 14.13 ? 108 ASN A HA   2  
ATOM 3879  H HB2  . ASN A 1 108 ? 41.174 -12.903 9.438  1.00 2.43  ? 108 ASN A HB2  2  
ATOM 3880  H HB3  . ASN A 1 108 ? 40.793 -11.962 10.878 1.00 71.23 ? 108 ASN A HB3  2  
ATOM 3881  H HD21 . ASN A 1 108 ? 40.830 -12.963 12.896 1.00 41.45 ? 108 ASN A HD21 2  
ATOM 3882  H HD22 . ASN A 1 108 ? 41.631 -14.472 13.150 1.00 62.12 ? 108 ASN A HD22 2  
ATOM 3883  N N    . GLU A 1 109 ? 38.054 -15.148 9.348  1.00 54.12 ? 109 GLU A N    2  
ATOM 3884  C CA   . GLU A 1 109 ? 37.774 -16.236 8.418  1.00 31.24 ? 109 GLU A CA   2  
ATOM 3885  C C    . GLU A 1 109 ? 36.285 -16.305 8.093  1.00 14.31 ? 109 GLU A C    2  
ATOM 3886  O O    . GLU A 1 109 ? 35.872 -16.994 7.159  1.00 45.52 ? 109 GLU A O    2  
ATOM 3887  C CB   . GLU A 1 109 ? 38.241 -17.570 9.005  1.00 70.02 ? 109 GLU A CB   2  
ATOM 3888  C CG   . GLU A 1 109 ? 39.695 -17.565 9.446  1.00 32.14 ? 109 GLU A CG   2  
ATOM 3889  C CD   . GLU A 1 109 ? 40.289 -18.959 9.512  1.00 3.52  ? 109 GLU A CD   2  
ATOM 3890  O OE1  . GLU A 1 109 ? 39.882 -19.737 10.400 1.00 42.42 ? 109 GLU A OE1  2  
ATOM 3891  O OE2  . GLU A 1 109 ? 41.162 -19.271 8.675  1.00 0.40  ? 109 GLU A OE2  2  
ATOM 3892  H H    . GLU A 1 109 ? 37.554 -15.097 10.189 1.00 33.01 ? 109 GLU A H    2  
ATOM 3893  H HA   . GLU A 1 109 ? 38.320 -16.043 7.508  1.00 63.13 ? 109 GLU A HA   2  
ATOM 3894  H HB2  . GLU A 1 109 ? 37.627 -17.808 9.861  1.00 73.24 ? 109 GLU A HB2  2  
ATOM 3895  H HB3  . GLU A 1 109 ? 38.116 -18.341 8.258  1.00 2.53  ? 109 GLU A HB3  2  
ATOM 3896  H HG2  . GLU A 1 109 ? 40.269 -16.979 8.745  1.00 51.52 ? 109 GLU A HG2  2  
ATOM 3897  H HG3  . GLU A 1 109 ? 39.759 -17.116 10.426 1.00 14.35 ? 109 GLU A HG3  2  
ATOM 3898  N N    . LEU A 1 110 ? 35.482 -15.586 8.871  1.00 72.54 ? 110 LEU A N    2  
ATOM 3899  C CA   . LEU A 1 110 ? 34.037 -15.565 8.667  1.00 65.13 ? 110 LEU A CA   2  
ATOM 3900  C C    . LEU A 1 110 ? 33.696 -15.202 7.225  1.00 23.11 ? 110 LEU A C    2  
ATOM 3901  O O    . LEU A 1 110 ? 32.644 -15.582 6.711  1.00 11.12 ? 110 LEU A O    2  
ATOM 3902  C CB   . LEU A 1 110 ? 33.382 -14.568 9.624  1.00 21.44 ? 110 LEU A CB   2  
ATOM 3903  C CG   . LEU A 1 110 ? 34.023 -13.182 9.692  1.00 41.21 ? 110 LEU A CG   2  
ATOM 3904  C CD1  . LEU A 1 110 ? 33.606 -12.342 8.495  1.00 55.21 ? 110 LEU A CD1  2  
ATOM 3905  C CD2  . LEU A 1 110 ? 33.649 -12.484 10.992 1.00 63.23 ? 110 LEU A CD2  2  
ATOM 3906  H H    . LEU A 1 110 ? 35.868 -15.058 9.599  1.00 43.30 ? 110 LEU A H    2  
ATOM 3907  H HA   . LEU A 1 110 ? 33.659 -16.555 8.875  1.00 11.44 ? 110 LEU A HA   2  
ATOM 3908  H HB2  . LEU A 1 110 ? 32.355 -14.443 9.319  1.00 72.02 ? 110 LEU A HB2  2  
ATOM 3909  H HB3  . LEU A 1 110 ? 33.411 -14.996 10.616 1.00 22.35 ? 110 LEU A HB3  2  
ATOM 3910  H HG   . LEU A 1 110 ? 35.099 -13.288 9.666  1.00 51.34 ? 110 LEU A HG   2  
ATOM 3911  H HD11 . LEU A 1 110 ? 34.401 -12.334 7.766  1.00 44.23 ? 110 LEU A HD11 2  
ATOM 3912  H HD12 . LEU A 1 110 ? 33.402 -11.331 8.817  1.00 25.45 ? 110 LEU A HD12 2  
ATOM 3913  H HD13 . LEU A 1 110 ? 32.715 -12.764 8.052  1.00 11.23 ? 110 LEU A HD13 2  
ATOM 3914  H HD21 . LEU A 1 110 ? 33.417 -11.449 10.790 1.00 11.10 ? 110 LEU A HD21 2  
ATOM 3915  H HD22 . LEU A 1 110 ? 34.479 -12.539 11.681 1.00 4.11  ? 110 LEU A HD22 2  
ATOM 3916  H HD23 . LEU A 1 110 ? 32.788 -12.969 11.425 1.00 35.15 ? 110 LEU A HD23 2  
ATOM 3917  N N    . ASP A 1 111 ? 34.593 -14.467 6.577  1.00 25.15 ? 111 ASP A N    2  
ATOM 3918  C CA   . ASP A 1 111 ? 34.389 -14.055 5.193  1.00 24.54 ? 111 ASP A CA   2  
ATOM 3919  C C    . ASP A 1 111 ? 34.100 -15.261 4.305  1.00 70.30 ? 111 ASP A C    2  
ATOM 3920  O O    . ASP A 1 111 ? 33.354 -15.163 3.330  1.00 30.54 ? 111 ASP A O    2  
ATOM 3921  C CB   . ASP A 1 111 ? 35.619 -13.307 4.675  1.00 75.41 ? 111 ASP A CB   2  
ATOM 3922  C CG   . ASP A 1 111 ? 35.409 -12.743 3.283  1.00 35.34 ? 111 ASP A CG   2  
ATOM 3923  O OD1  . ASP A 1 111 ? 36.108 -13.190 2.350  1.00 50.11 ? 111 ASP A OD1  2  
ATOM 3924  O OD2  . ASP A 1 111 ? 34.544 -11.856 3.128  1.00 42.22 ? 111 ASP A OD2  2  
ATOM 3925  H H    . ASP A 1 111 ? 35.413 -14.195 7.041  1.00 23.33 ? 111 ASP A H    2  
ATOM 3926  H HA   . ASP A 1 111 ? 33.538 -13.392 5.167  1.00 61.22 ? 111 ASP A HA   2  
ATOM 3927  H HB2  . ASP A 1 111 ? 35.843 -12.490 5.344  1.00 3.32  ? 111 ASP A HB2  2  
ATOM 3928  H HB3  . ASP A 1 111 ? 36.459 -13.985 4.646  1.00 32.43 ? 111 ASP A HB3  2  
ATOM 3929  N N    . LYS A 1 112 ? 34.696 -16.398 4.647  1.00 20.41 ? 112 LYS A N    2  
ATOM 3930  C CA   . LYS A 1 112 ? 34.503 -17.624 3.882  1.00 61.43 ? 112 LYS A CA   2  
ATOM 3931  C C    . LYS A 1 112 ? 33.040 -18.056 3.905  1.00 43.21 ? 112 LYS A C    2  
ATOM 3932  O O    . LYS A 1 112 ? 32.594 -18.819 3.047  1.00 32.03 ? 112 LYS A O    2  
ATOM 3933  C CB   . LYS A 1 112 ? 35.385 -18.743 4.441  1.00 32.20 ? 112 LYS A CB   2  
ATOM 3934  C CG   . LYS A 1 112 ? 34.985 -20.129 3.964  1.00 13.23 ? 112 LYS A CG   2  
ATOM 3935  C CD   . LYS A 1 112 ? 33.998 -20.783 4.917  1.00 51.23 ? 112 LYS A CD   2  
ATOM 3936  C CE   . LYS A 1 112 ? 34.451 -22.178 5.317  1.00 23.34 ? 112 LYS A CE   2  
ATOM 3937  N NZ   . LYS A 1 112 ? 34.089 -23.195 4.291  1.00 22.14 ? 112 LYS A NZ   2  
ATOM 3938  H H    . LYS A 1 112 ? 35.280 -16.414 5.435  1.00 52.30 ? 112 LYS A H    2  
ATOM 3939  H HA   . LYS A 1 112 ? 34.792 -17.427 2.860  1.00 14.25 ? 112 LYS A HA   2  
ATOM 3940  H HB2  . LYS A 1 112 ? 36.407 -18.563 4.142  1.00 71.42 ? 112 LYS A HB2  2  
ATOM 3941  H HB3  . LYS A 1 112 ? 35.326 -18.726 5.520  1.00 43.11 ? 112 LYS A HB3  2  
ATOM 3942  H HG2  . LYS A 1 112 ? 34.527 -20.046 2.990  1.00 70.23 ? 112 LYS A HG2  2  
ATOM 3943  H HG3  . LYS A 1 112 ? 35.870 -20.746 3.897  1.00 14.24 ? 112 LYS A HG3  2  
ATOM 3944  H HD2  . LYS A 1 112 ? 33.912 -20.176 5.806  1.00 50.44 ? 112 LYS A HD2  2  
ATOM 3945  H HD3  . LYS A 1 112 ? 33.035 -20.852 4.431  1.00 35.14 ? 112 LYS A HD3  2  
ATOM 3946  H HE2  . LYS A 1 112 ? 35.523 -22.172 5.443  1.00 21.21 ? 112 LYS A HE2  2  
ATOM 3947  H HE3  . LYS A 1 112 ? 33.981 -22.440 6.254  1.00 74.34 ? 112 LYS A HE3  2  
ATOM 3948  H HZ1  . LYS A 1 112 ? 34.122 -24.148 4.706  1.00 33.35 ? 112 LYS A HZ1  2  
ATOM 3949  H HZ2  . LYS A 1 112 ? 34.757 -23.153 3.496  1.00 61.24 ? 112 LYS A HZ2  2  
ATOM 3950  H HZ3  . LYS A 1 112 ? 33.129 -23.016 3.934  1.00 21.52 ? 112 LYS A HZ3  2  
ATOM 3951  N N    . LEU A 1 113 ? 32.298 -17.562 4.890  1.00 63.10 ? 113 LEU A N    2  
ATOM 3952  C CA   . LEU A 1 113 ? 30.884 -17.895 5.024  1.00 64.42 ? 113 LEU A CA   2  
ATOM 3953  C C    . LEU A 1 113 ? 30.013 -16.876 4.296  1.00 24.15 ? 113 LEU A C    2  
ATOM 3954  O O    . LEU A 1 113 ? 28.964 -16.473 4.796  1.00 31.10 ? 113 LEU A O    2  
ATOM 3955  C CB   . LEU A 1 113 ? 30.492 -17.957 6.501  1.00 2.31  ? 113 LEU A CB   2  
ATOM 3956  C CG   . LEU A 1 113 ? 31.358 -18.851 7.389  1.00 71.32 ? 113 LEU A CG   2  
ATOM 3957  C CD1  . LEU A 1 113 ? 31.721 -18.132 8.679  1.00 65.05 ? 113 LEU A CD1  2  
ATOM 3958  C CD2  . LEU A 1 113 ? 30.640 -20.159 7.689  1.00 23.14 ? 113 LEU A CD2  2  
ATOM 3959  H H    . LEU A 1 113 ? 32.710 -16.959 5.543  1.00 32.11 ? 113 LEU A H    2  
ATOM 3960  H HA   . LEU A 1 113 ? 30.729 -18.867 4.578  1.00 44.30 ? 113 LEU A HA   2  
ATOM 3961  H HB2  . LEU A 1 113 ? 30.539 -16.954 6.897  1.00 15.02 ? 113 LEU A HB2  2  
ATOM 3962  H HB3  . LEU A 1 113 ? 29.475 -18.318 6.558  1.00 51.44 ? 113 LEU A HB3  2  
ATOM 3963  H HG   . LEU A 1 113 ? 32.276 -19.085 6.867  1.00 1.24  ? 113 LEU A HG   2  
ATOM 3964  H HD11 . LEU A 1 113 ? 30.972 -18.335 9.428  1.00 75.43 ? 113 LEU A HD11 2  
ATOM 3965  H HD12 . LEU A 1 113 ? 31.769 -17.069 8.496  1.00 4.43  ? 113 LEU A HD12 2  
ATOM 3966  H HD13 . LEU A 1 113 ? 32.683 -18.481 9.026  1.00 11.14 ? 113 LEU A HD13 2  
ATOM 3967  H HD21 . LEU A 1 113 ? 31.120 -20.964 7.153  1.00 62.14 ? 113 LEU A HD21 2  
ATOM 3968  H HD22 . LEU A 1 113 ? 29.609 -20.083 7.377  1.00 34.44 ? 113 LEU A HD22 2  
ATOM 3969  H HD23 . LEU A 1 113 ? 30.683 -20.357 8.750  1.00 72.41 ? 113 LEU A HD23 2  
ATOM 3970  N N    . ASN A 1 114 ? 30.456 -16.465 3.113  1.00 72.05 ? 114 ASN A N    2  
ATOM 3971  C CA   . ASN A 1 114 ? 29.716 -15.494 2.315  1.00 14.21 ? 114 ASN A CA   2  
ATOM 3972  C C    . ASN A 1 114 ? 28.237 -15.496 2.690  1.00 12.03 ? 114 ASN A C    2  
ATOM 3973  O O    . ASN A 1 114 ? 27.493 -16.403 2.316  1.00 13.45 ? 114 ASN A O    2  
ATOM 3974  C CB   . ASN A 1 114 ? 29.876 -15.799 0.824  1.00 15.14 ? 114 ASN A CB   2  
ATOM 3975  C CG   . ASN A 1 114 ? 29.898 -14.542 -0.024 1.00 4.02  ? 114 ASN A CG   2  
ATOM 3976  O OD1  . ASN A 1 114 ? 29.055 -13.659 0.132  1.00 34.20 ? 114 ASN A OD1  2  
ATOM 3977  N ND2  . ASN A 1 114 ? 30.867 -14.456 -0.928 1.00 4.03  ? 114 ASN A ND2  2  
ATOM 3978  H H    . ASN A 1 114 ? 31.300 -16.823 2.767  1.00 41.32 ? 114 ASN A H    2  
ATOM 3979  H HA   . ASN A 1 114 ? 30.125 -14.516 2.519  1.00 25.24 ? 114 ASN A HA   2  
ATOM 3980  H HB2  . ASN A 1 114 ? 30.803 -16.331 0.670  1.00 71.14 ? 114 ASN A HB2  2  
ATOM 3981  H HB3  . ASN A 1 114 ? 29.052 -16.416 0.499  1.00 61.43 ? 114 ASN A HB3  2  
ATOM 3982  H HD21 . ASN A 1 114 ? 31.504 -15.198 -0.996 1.00 44.20 ? 114 ASN A HD21 2  
ATOM 3983  H HD22 . ASN A 1 114 ? 30.906 -13.654 -1.489 1.00 41.32 ? 114 ASN A HD22 2  
ATOM 3984  N N    . TRP A 1 115 ? 27.819 -14.476 3.430  1.00 14.52 ? 115 TRP A N    2  
ATOM 3985  C CA   . TRP A 1 115 ? 26.428 -14.359 3.856  1.00 63.34 ? 115 TRP A CA   2  
ATOM 3986  C C    . TRP A 1 115 ? 25.637 -13.477 2.896  1.00 4.01  ? 115 TRP A C    2  
ATOM 3987  O O    . TRP A 1 115 ? 26.205 -12.861 1.995  1.00 53.34 ? 115 TRP A O    2  
ATOM 3988  C CB   . TRP A 1 115 ? 26.353 -13.788 5.273  1.00 61.44 ? 115 TRP A CB   2  
ATOM 3989  C CG   . TRP A 1 115 ? 27.469 -14.251 6.160  1.00 61.45 ? 115 TRP A CG   2  
ATOM 3990  C CD1  . TRP A 1 115 ? 28.758 -13.801 6.158  1.00 43.34 ? 115 TRP A CD1  2  
ATOM 3991  C CD2  . TRP A 1 115 ? 27.395 -15.256 7.176  1.00 33.45 ? 115 TRP A CD2  2  
ATOM 3992  N NE1  . TRP A 1 115 ? 29.490 -14.465 7.112  1.00 31.22 ? 115 TRP A NE1  2  
ATOM 3993  C CE2  . TRP A 1 115 ? 28.676 -15.363 7.752  1.00 43.34 ? 115 TRP A CE2  2  
ATOM 3994  C CE3  . TRP A 1 115 ? 26.370 -16.075 7.659  1.00 62.33 ? 115 TRP A CE3  2  
ATOM 3995  C CZ2  . TRP A 1 115 ? 28.958 -16.256 8.782  1.00 14.31 ? 115 TRP A CZ2  2  
ATOM 3996  C CZ3  . TRP A 1 115 ? 26.651 -16.961 8.681  1.00 21.23 ? 115 TRP A CZ3  2  
ATOM 3997  C CH2  . TRP A 1 115 ? 27.936 -17.045 9.235  1.00 73.44 ? 115 TRP A CH2  2  
ATOM 3998  H H    . TRP A 1 115 ? 28.460 -13.783 3.697  1.00 33.50 ? 115 TRP A H    2  
ATOM 3999  H HA   . TRP A 1 115 ? 25.998 -15.350 3.853  1.00 10.11 ? 115 TRP A HA   2  
ATOM 4000  H HB2  . TRP A 1 115 ? 26.393 -12.711 5.222  1.00 14.45 ? 115 TRP A HB2  2  
ATOM 4001  H HB3  . TRP A 1 115 ? 25.420 -14.090 5.725  1.00 35.21 ? 115 TRP A HB3  2  
ATOM 4002  H HD1  . TRP A 1 115 ? 29.134 -13.035 5.496  1.00 73.42 ? 115 TRP A HD1  2  
ATOM 4003  H HE1  . TRP A 1 115 ? 30.440 -14.318 7.305  1.00 70.52 ? 115 TRP A HE1  2  
ATOM 4004  H HE3  . TRP A 1 115 ? 25.374 -16.025 7.245  1.00 33.12 ? 115 TRP A HE3  2  
ATOM 4005  H HZ2  . TRP A 1 115 ? 29.942 -16.332 9.219  1.00 4.05  ? 115 TRP A HZ2  2  
ATOM 4006  H HZ3  . TRP A 1 115 ? 25.872 -17.603 9.067  1.00 40.44 ? 115 TRP A HZ3  2  
ATOM 4007  H HH2  . TRP A 1 115 ? 28.110 -17.752 10.032 1.00 52.34 ? 115 TRP A HH2  2  
ATOM 4008  N N    . ALA A 1 116 ? 24.325 -13.421 3.096  1.00 12.22 ? 116 ALA A N    2  
ATOM 4009  C CA   . ALA A 1 116 ? 23.457 -12.612 2.250  1.00 50.44 ? 116 ALA A CA   2  
ATOM 4010  C C    . ALA A 1 116 ? 23.964 -11.177 2.156  1.00 43.41 ? 116 ALA A C    2  
ATOM 4011  O O    . ALA A 1 116 ? 24.834 -10.749 2.916  1.00 72.25 ? 116 ALA A O    2  
ATOM 4012  C CB   . ALA A 1 116 ? 22.031 -12.636 2.780  1.00 51.24 ? 116 ALA A CB   2  
ATOM 4013  H H    . ALA A 1 116 ? 23.931 -13.935 3.832  1.00 40.34 ? 116 ALA A H    2  
ATOM 4014  H HA   . ALA A 1 116 ? 23.455 -13.047 1.261  1.00 72.33 ? 116 ALA A HA   2  
ATOM 4015  H HB1  . ALA A 1 116 ? 21.436 -13.309 2.180  1.00 62.34 ? 116 ALA A HB1  2  
ATOM 4016  H HB2  . ALA A 1 116 ? 22.034 -12.974 3.805  1.00 10.31 ? 116 ALA A HB2  2  
ATOM 4017  H HB3  . ALA A 1 116 ? 21.611 -11.642 2.729  1.00 65.24 ? 116 ALA A HB3  2  
ATOM 4018  N N    . PRO A 1 117 ? 23.410 -10.413 1.202  1.00 65.51 ? 117 PRO A N    2  
ATOM 4019  C CA   . PRO A 1 117 ? 23.792 -9.015  0.986  1.00 2.44  ? 117 PRO A CA   2  
ATOM 4020  C C    . PRO A 1 117 ? 23.329 -8.106  2.120  1.00 55.03 ? 117 PRO A C    2  
ATOM 4021  O O    . PRO A 1 117 ? 23.806 -6.981  2.261  1.00 42.34 ? 117 PRO A O    2  
ATOM 4022  C CB   . PRO A 1 117 ? 23.079 -8.649  -0.318 1.00 30.32 ? 117 PRO A CB   2  
ATOM 4023  C CG   . PRO A 1 117 ? 21.916 -9.578  -0.386 1.00 52.44 ? 117 PRO A CG   2  
ATOM 4024  C CD   . PRO A 1 117 ? 22.369 -10.857 0.261  1.00 74.34 ? 117 PRO A CD   2  
ATOM 4025  H HA   . PRO A 1 117 ? 24.859 -8.910  0.856  1.00 25.15 ? 117 PRO A HA   2  
ATOM 4026  H HB2  . PRO A 1 117 ? 22.760 -7.617  -0.280 1.00 20.14 ? 117 PRO A HB2  2  
ATOM 4027  H HB3  . PRO A 1 117 ? 23.749 -8.794  -1.152 1.00 21.23 ? 117 PRO A HB3  2  
ATOM 4028  H HG2  . PRO A 1 117 ? 21.080 -9.160  0.154  1.00 50.34 ? 117 PRO A HG2  2  
ATOM 4029  H HG3  . PRO A 1 117 ? 21.648 -9.754  -1.418 1.00 32.13 ? 117 PRO A HG3  2  
ATOM 4030  H HD2  . PRO A 1 117 ? 21.549 -11.325 0.785  1.00 20.53 ? 117 PRO A HD2  2  
ATOM 4031  H HD3  . PRO A 1 117 ? 22.779 -11.529 -0.479 1.00 30.33 ? 117 PRO A HD3  2  
ATOM 4032  N N    . ALA A 1 118 ? 22.395 -8.602  2.926  1.00 64.04 ? 118 ALA A N    2  
ATOM 4033  C CA   . ALA A 1 118 ? 21.869 -7.835  4.048  1.00 23.42 ? 118 ALA A CA   2  
ATOM 4034  C C    . ALA A 1 118 ? 22.697 -8.068  5.308  1.00 72.13 ? 118 ALA A C    2  
ATOM 4035  O O    . ALA A 1 118 ? 22.788 -7.196  6.172  1.00 41.01 ? 118 ALA A O    2  
ATOM 4036  C CB   . ALA A 1 118 ? 20.412 -8.196  4.297  1.00 24.43 ? 118 ALA A CB   2  
ATOM 4037  H H    . ALA A 1 118 ? 22.054 -9.506  2.762  1.00 12.40 ? 118 ALA A H    2  
ATOM 4038  H HA   . ALA A 1 118 ? 21.916 -6.788  3.788  1.00 55.43 ? 118 ALA A HA   2  
ATOM 4039  H HB1  . ALA A 1 118 ? 19.777 -7.421  3.896  1.00 54.50 ? 118 ALA A HB1  2  
ATOM 4040  H HB2  . ALA A 1 118 ? 20.186 -9.134  3.813  1.00 63.44 ? 118 ALA A HB2  2  
ATOM 4041  H HB3  . ALA A 1 118 ? 20.241 -8.289  5.359  1.00 3.13  ? 118 ALA A HB3  2  
ATOM 4042  N N    . ASP A 1 119 ? 23.297 -9.249  5.406  1.00 61.14 ? 119 ASP A N    2  
ATOM 4043  C CA   . ASP A 1 119 ? 24.118 -9.596  6.560  1.00 33.31 ? 119 ASP A CA   2  
ATOM 4044  C C    . ASP A 1 119 ? 25.595 -9.345  6.272  1.00 14.34 ? 119 ASP A C    2  
ATOM 4045  O O    . ASP A 1 119 ? 26.394 -9.166  7.192  1.00 62.14 ? 119 ASP A O    2  
ATOM 4046  C CB   . ASP A 1 119 ? 23.902 -11.061 6.944  1.00 64.14 ? 119 ASP A CB   2  
ATOM 4047  C CG   . ASP A 1 119 ? 22.518 -11.314 7.508  1.00 24.33 ? 119 ASP A CG   2  
ATOM 4048  O OD1  . ASP A 1 119 ? 21.947 -12.387 7.220  1.00 45.42 ? 119 ASP A OD1  2  
ATOM 4049  O OD2  . ASP A 1 119 ? 22.006 -10.440 8.238  1.00 53.30 ? 119 ASP A OD2  2  
ATOM 4050  H H    . ASP A 1 119 ? 23.186 -9.903  4.684  1.00 44.14 ? 119 ASP A H    2  
ATOM 4051  H HA   . ASP A 1 119 ? 23.813 -8.969  7.384  1.00 32.53 ? 119 ASP A HA   2  
ATOM 4052  H HB2  . ASP A 1 119 ? 24.031 -11.679 6.067  1.00 44.12 ? 119 ASP A HB2  2  
ATOM 4053  H HB3  . ASP A 1 119 ? 24.633 -11.343 7.688  1.00 54.40 ? 119 ASP A HB3  2  
ATOM 4054  N N    . ILE A 1 120 ? 25.949 -9.333  4.992  1.00 60.21 ? 120 ILE A N    2  
ATOM 4055  C CA   . ILE A 1 120 ? 27.329 -9.104  4.584  1.00 44.31 ? 120 ILE A CA   2  
ATOM 4056  C C    . ILE A 1 120 ? 27.933 -7.918  5.329  1.00 10.00 ? 120 ILE A C    2  
ATOM 4057  O O    . ILE A 1 120 ? 28.974 -8.025  5.978  1.00 34.42 ? 120 ILE A O    2  
ATOM 4058  C CB   . ILE A 1 120 ? 27.434 -8.850  3.068  1.00 31.34 ? 120 ILE A CB   2  
ATOM 4059  C CG1  . ILE A 1 120 ? 27.630 -10.171 2.321  1.00 43.32 ? 120 ILE A CG1  2  
ATOM 4060  C CG2  . ILE A 1 120 ? 28.576 -7.891  2.769  1.00 1.03  ? 120 ILE A CG2  2  
ATOM 4061  C CD1  . ILE A 1 120 ? 27.108 -10.145 0.901  1.00 1.14  ? 120 ILE A CD1  2  
ATOM 4062  H H    . ILE A 1 120 ? 25.266 -9.482  4.305  1.00 1.24  ? 120 ILE A H    2  
ATOM 4063  H HA   . ILE A 1 120 ? 27.899 -9.991  4.820  1.00 35.34 ? 120 ILE A HA   2  
ATOM 4064  H HB   . ILE A 1 120 ? 26.514 -8.391  2.739  1.00 65.34 ? 120 ILE A HB   2  
ATOM 4065  H HG12 . ILE A 1 120 ? 28.683 -10.402 2.282  1.00 31.31 ? 120 ILE A HG12 2  
ATOM 4066  H HG13 . ILE A 1 120 ? 27.112 -10.957 2.852  1.00 43.54 ? 120 ILE A HG13 2  
ATOM 4067  H HG21 . ILE A 1 120 ? 28.825 -7.944  1.720  1.00 63.23 ? 120 ILE A HG21 2  
ATOM 4068  H HG22 . ILE A 1 120 ? 28.274 -6.884  3.016  1.00 60.21 ? 120 ILE A HG22 2  
ATOM 4069  H HG23 . ILE A 1 120 ? 29.439 -8.163  3.358  1.00 31.14 ? 120 ILE A HG23 2  
ATOM 4070  H HD11 . ILE A 1 120 ? 27.865 -10.527 0.232  1.00 52.41 ? 120 ILE A HD11 2  
ATOM 4071  H HD12 . ILE A 1 120 ? 26.222 -10.758 0.832  1.00 41.31 ? 120 ILE A HD12 2  
ATOM 4072  H HD13 . ILE A 1 120 ? 26.865 -9.129  0.626  1.00 50.51 ? 120 ILE A HD13 2  
ATOM 4073  N N    . PRO A 1 121 ? 27.265 -6.759  5.236  1.00 13.34 ? 121 PRO A N    2  
ATOM 4074  C CA   . PRO A 1 121 ? 27.715 -5.530  5.897  1.00 23.34 ? 121 PRO A CA   2  
ATOM 4075  C C    . PRO A 1 121 ? 27.575 -5.603  7.414  1.00 52.00 ? 121 PRO A C    2  
ATOM 4076  O O    . PRO A 1 121 ? 28.180 -4.816  8.141  1.00 21.22 ? 121 PRO A O    2  
ATOM 4077  C CB   . PRO A 1 121 ? 26.785 -4.458  5.325  1.00 41.20 ? 121 PRO A CB   2  
ATOM 4078  C CG   . PRO A 1 121 ? 25.556 -5.198  4.924  1.00 52.43 ? 121 PRO A CG   2  
ATOM 4079  C CD   . PRO A 1 121 ? 26.017 -6.558  4.480  1.00 65.03 ? 121 PRO A CD   2  
ATOM 4080  H HA   . PRO A 1 121 ? 28.738 -5.295  5.643  1.00 63.14 ? 121 PRO A HA   2  
ATOM 4081  H HB2  . PRO A 1 121 ? 26.572 -3.719  6.085  1.00 24.31 ? 121 PRO A HB2  2  
ATOM 4082  H HB3  . PRO A 1 121 ? 27.255 -3.984  4.476  1.00 21.13 ? 121 PRO A HB3  2  
ATOM 4083  H HG2  . PRO A 1 121 ? 24.888 -5.285  5.767  1.00 10.02 ? 121 PRO A HG2  2  
ATOM 4084  H HG3  . PRO A 1 121 ? 25.068 -4.683  4.109  1.00 70.42 ? 121 PRO A HG3  2  
ATOM 4085  H HD2  . PRO A 1 121 ? 25.285 -7.308  4.738  1.00 72.10 ? 121 PRO A HD2  2  
ATOM 4086  H HD3  . PRO A 1 121 ? 26.207 -6.564  3.416  1.00 3.45  ? 121 PRO A HD3  2  
ATOM 4087  N N    . ALA A 1 122 ? 26.773 -6.553  7.884  1.00 12.45 ? 122 ALA A N    2  
ATOM 4088  C CA   . ALA A 1 122 ? 26.555 -6.729  9.315  1.00 62.21 ? 122 ALA A CA   2  
ATOM 4089  C C    . ALA A 1 122 ? 27.637 -7.611  9.930  1.00 53.11 ? 122 ALA A C    2  
ATOM 4090  O O    . ALA A 1 122 ? 27.938 -7.503  11.119 1.00 70.33 ? 122 ALA A O    2  
ATOM 4091  C CB   . ALA A 1 122 ? 25.178 -7.324  9.570  1.00 63.32 ? 122 ALA A CB   2  
ATOM 4092  H H    . ALA A 1 122 ? 26.318 -7.149  7.255  1.00 71.35 ? 122 ALA A H    2  
ATOM 4093  H HA   . ALA A 1 122 ? 26.591 -5.755  9.781  1.00 41.12 ? 122 ALA A HA   2  
ATOM 4094  H HB1  . ALA A 1 122 ? 24.813 -6.986  10.529 1.00 71.14 ? 122 ALA A HB1  2  
ATOM 4095  H HB2  . ALA A 1 122 ? 24.499 -7.006  8.793  1.00 65.23 ? 122 ALA A HB2  2  
ATOM 4096  H HB3  . ALA A 1 122 ? 25.247 -8.402  9.570  1.00 14.20 ? 122 ALA A HB3  2  
ATOM 4097  N N    . VAL A 1 123 ? 28.218 -8.484  9.113  1.00 53.11 ? 123 VAL A N    2  
ATOM 4098  C CA   . VAL A 1 123 ? 29.266 -9.384  9.577  1.00 64.31 ? 123 VAL A CA   2  
ATOM 4099  C C    . VAL A 1 123 ? 30.628 -8.700  9.554  1.00 44.14 ? 123 VAL A C    2  
ATOM 4100  O O    . VAL A 1 123 ? 31.477 -8.956  10.406 1.00 4.53  ? 123 VAL A O    2  
ATOM 4101  C CB   . VAL A 1 123 ? 29.331 -10.661 8.717  1.00 12.14 ? 123 VAL A CB   2  
ATOM 4102  C CG1  . VAL A 1 123 ? 30.596 -11.448 9.024  1.00 34.13 ? 123 VAL A CG1  2  
ATOM 4103  C CG2  . VAL A 1 123 ? 28.093 -11.516 8.941  1.00 30.32 ? 123 VAL A CG2  2  
ATOM 4104  H H    . VAL A 1 123 ? 27.935 -8.523  8.176  1.00 53.45 ? 123 VAL A H    2  
ATOM 4105  H HA   . VAL A 1 123 ? 29.035 -9.671  10.593 1.00 44.34 ? 123 VAL A HA   2  
ATOM 4106  H HB   . VAL A 1 123 ? 29.358 -10.370 7.678  1.00 42.43 ? 123 VAL A HB   2  
ATOM 4107  H HG11 . VAL A 1 123 ? 30.560 -12.399 8.513  1.00 44.23 ? 123 VAL A HG11 2  
ATOM 4108  H HG12 . VAL A 1 123 ? 31.458 -10.890 8.690  1.00 13.43 ? 123 VAL A HG12 2  
ATOM 4109  H HG13 . VAL A 1 123 ? 30.665 -11.616 10.089 1.00 3.11  ? 123 VAL A HG13 2  
ATOM 4110  H HG21 . VAL A 1 123 ? 27.565 -11.162 9.814  1.00 73.31 ? 123 VAL A HG21 2  
ATOM 4111  H HG22 . VAL A 1 123 ? 27.447 -11.449 8.078  1.00 40.33 ? 123 VAL A HG22 2  
ATOM 4112  H HG23 . VAL A 1 123 ? 28.387 -12.544 9.090  1.00 24.42 ? 123 VAL A HG23 2  
ATOM 4113  N N    . ASN A 1 124 ? 30.830 -7.828  8.571  1.00 54.21 ? 124 ASN A N    2  
ATOM 4114  C CA   . ASN A 1 124 ? 32.089 -7.106  8.436  1.00 4.41  ? 124 ASN A CA   2  
ATOM 4115  C C    . ASN A 1 124 ? 32.369 -6.263  9.677  1.00 21.30 ? 124 ASN A C    2  
ATOM 4116  O O    . ASN A 1 124 ? 33.494 -6.226  10.176 1.00 62.44 ? 124 ASN A O    2  
ATOM 4117  C CB   . ASN A 1 124 ? 32.058 -6.211  7.195  1.00 1.02  ? 124 ASN A CB   2  
ATOM 4118  C CG   . ASN A 1 124 ? 32.174 -7.004  5.908  1.00 54.13 ? 124 ASN A CG   2  
ATOM 4119  O OD1  . ASN A 1 124 ? 32.521 -8.185  5.922  1.00 11.11 ? 124 ASN A OD1  2  
ATOM 4120  N ND2  . ASN A 1 124 ? 31.882 -6.356  4.786  1.00 43.12 ? 124 ASN A ND2  2  
ATOM 4121  H H    . ASN A 1 124 ? 30.114 -7.666  7.921  1.00 63.22 ? 124 ASN A H    2  
ATOM 4122  H HA   . ASN A 1 124 ? 32.878 -7.834  8.324  1.00 5.21  ? 124 ASN A HA   2  
ATOM 4123  H HB2  . ASN A 1 124 ? 31.126 -5.665  7.176  1.00 2.32  ? 124 ASN A HB2  2  
ATOM 4124  H HB3  . ASN A 1 124 ? 32.880 -5.512  7.241  1.00 15.04 ? 124 ASN A HB3  2  
ATOM 4125  H HD21 . ASN A 1 124 ? 31.613 -5.416  4.850  1.00 11.34 ? 124 ASN A HD21 2  
ATOM 4126  H HD22 . ASN A 1 124 ? 31.948 -6.845  3.939  1.00 0.21  ? 124 ASN A HD22 2  
ATOM 4127  N N    . LYS A 1 125 ? 31.337 -5.588  10.172 1.00 44.13 ? 125 LYS A N    2  
ATOM 4128  C CA   . LYS A 1 125 ? 31.470 -4.747  11.356 1.00 55.15 ? 125 LYS A CA   2  
ATOM 4129  C C    . LYS A 1 125 ? 32.136 -5.512  12.495 1.00 50.24 ? 125 LYS A C    2  
ATOM 4130  O O    . LYS A 1 125 ? 32.849 -4.929  13.312 1.00 62.01 ? 125 LYS A O    2  
ATOM 4131  C CB   . LYS A 1 125 ? 30.096 -4.240  11.802 1.00 23.12 ? 125 LYS A CB   2  
ATOM 4132  C CG   . LYS A 1 125 ? 29.241 -5.305  12.466 1.00 22.51 ? 125 LYS A CG   2  
ATOM 4133  C CD   . LYS A 1 125 ? 29.337 -5.233  13.981 1.00 60.41 ? 125 LYS A CD   2  
ATOM 4134  C CE   . LYS A 1 125 ? 28.683 -3.971  14.521 1.00 4.23  ? 125 LYS A CE   2  
ATOM 4135  N NZ   . LYS A 1 125 ? 28.086 -4.188  15.868 1.00 24.11 ? 125 LYS A NZ   2  
ATOM 4136  H H    . LYS A 1 125 ? 30.465 -5.657  9.730  1.00 74.51 ? 125 LYS A H    2  
ATOM 4137  H HA   . LYS A 1 125 ? 32.088 -3.902  11.095 1.00 44.12 ? 125 LYS A HA   2  
ATOM 4138  H HB2  . LYS A 1 125 ? 30.235 -3.431  12.504 1.00 44.23 ? 125 LYS A HB2  2  
ATOM 4139  H HB3  . LYS A 1 125 ? 29.565 -3.869  10.938 1.00 54.40 ? 125 LYS A HB3  2  
ATOM 4140  H HG2  . LYS A 1 125 ? 28.212 -5.162  12.174 1.00 14.52 ? 125 LYS A HG2  2  
ATOM 4141  H HG3  . LYS A 1 125 ? 29.577 -6.279  12.139 1.00 24.21 ? 125 LYS A HG3  2  
ATOM 4142  H HD2  . LYS A 1 125 ? 28.840 -6.093  14.406 1.00 53.41 ? 125 LYS A HD2  2  
ATOM 4143  H HD3  . LYS A 1 125 ? 30.379 -5.240  14.268 1.00 42.03 ? 125 LYS A HD3  2  
ATOM 4144  H HE2  . LYS A 1 125 ? 29.430 -3.195  14.589 1.00 25.00 ? 125 LYS A HE2  2  
ATOM 4145  H HE3  . LYS A 1 125 ? 27.906 -3.663  13.838 1.00 50.04 ? 125 LYS A HE3  2  
ATOM 4146  H HZ1  . LYS A 1 125 ? 28.835 -4.224  16.589 1.00 45.40 ? 125 LYS A HZ1  2  
ATOM 4147  H HZ2  . LYS A 1 125 ? 27.562 -5.086  15.886 1.00 55.53 ? 125 LYS A HZ2  2  
ATOM 4148  H HZ3  . LYS A 1 125 ? 27.434 -3.412  16.099 1.00 32.34 ? 125 LYS A HZ3  2  
ATOM 4149  N N    . ILE A 1 126 ? 31.900 -6.819  12.541 1.00 2.53  ? 126 ILE A N    2  
ATOM 4150  C CA   . ILE A 1 126 ? 32.480 -7.662  13.579 1.00 62.33 ? 126 ILE A CA   2  
ATOM 4151  C C    . ILE A 1 126 ? 34.004 -7.632  13.524 1.00 12.43 ? 126 ILE A C    2  
ATOM 4152  O O    . ILE A 1 126 ? 34.669 -7.496  14.551 1.00 52.12 ? 126 ILE A O    2  
ATOM 4153  C CB   . ILE A 1 126 ? 32.002 -9.121  13.450 1.00 5.15  ? 126 ILE A CB   2  
ATOM 4154  C CG1  . ILE A 1 126 ? 30.477 -9.190  13.540 1.00 74.44 ? 126 ILE A CG1  2  
ATOM 4155  C CG2  . ILE A 1 126 ? 32.641 -9.984  14.528 1.00 23.11 ? 126 ILE A CG2  2  
ATOM 4156  C CD1  . ILE A 1 126 ? 29.891 -10.435 12.911 1.00 73.20 ? 126 ILE A CD1  2  
ATOM 4157  H H    . ILE A 1 126 ? 31.323 -7.225  11.862 1.00 42.23 ? 126 ILE A H    2  
ATOM 4158  H HA   . ILE A 1 126 ? 32.157 -7.282  14.537 1.00 50.41 ? 126 ILE A HA   2  
ATOM 4159  H HB   . ILE A 1 126 ? 32.317 -9.496  12.489 1.00 63.12 ? 126 ILE A HB   2  
ATOM 4160  H HG12 . ILE A 1 126 ? 30.182 -9.173  14.577 1.00 74.11 ? 126 ILE A HG12 2  
ATOM 4161  H HG13 . ILE A 1 126 ? 30.055 -8.333  13.035 1.00 13.14 ? 126 ILE A HG13 2  
ATOM 4162  H HG21 . ILE A 1 126 ? 33.717 -9.919  14.451 1.00 53.02 ? 126 ILE A HG21 2  
ATOM 4163  H HG22 . ILE A 1 126 ? 32.330 -9.634  15.501 1.00 74.33 ? 126 ILE A HG22 2  
ATOM 4164  H HG23 . ILE A 1 126 ? 32.332 -11.010 14.398 1.00 65.31 ? 126 ILE A HG23 2  
ATOM 4165  H HD11 . ILE A 1 126 ? 30.177 -11.301 13.490 1.00 12.44 ? 126 ILE A HD11 2  
ATOM 4166  H HD12 . ILE A 1 126 ? 28.814 -10.356 12.888 1.00 4.55  ? 126 ILE A HD12 2  
ATOM 4167  H HD13 . ILE A 1 126 ? 30.265 -10.539 11.902 1.00 32.14 ? 126 ILE A HD13 2  
ATOM 4168  N N    . MET A 1 127 ? 34.550 -7.757  12.319 1.00 0.23  ? 127 MET A N    2  
ATOM 4169  C CA   . MET A 1 127 ? 35.996 -7.740  12.131 1.00 70.24 ? 127 MET A CA   2  
ATOM 4170  C C    . MET A 1 127 ? 36.617 -6.518  12.799 1.00 44.33 ? 127 MET A C    2  
ATOM 4171  O O    . MET A 1 127 ? 37.728 -6.583  13.328 1.00 74.13 ? 127 MET A O    2  
ATOM 4172  C CB   . MET A 1 127 ? 36.337 -7.750  10.639 1.00 4.43  ? 127 MET A CB   2  
ATOM 4173  C CG   . MET A 1 127 ? 36.585 -9.142  10.081 1.00 4.35  ? 127 MET A CG   2  
ATOM 4174  S SD   . MET A 1 127 ? 38.331 -9.461  9.761  1.00 11.13 ? 127 MET A SD   2  
ATOM 4175  C CE   . MET A 1 127 ? 39.047 -9.052  11.351 1.00 10.23 ? 127 MET A CE   2  
ATOM 4176  H H    . MET A 1 127 ? 33.968 -7.862  11.538 1.00 73.00 ? 127 MET A H    2  
ATOM 4177  H HA   . MET A 1 127 ? 36.400 -8.630  12.589 1.00 72.53 ? 127 MET A HA   2  
ATOM 4178  H HB2  . MET A 1 127 ? 35.519 -7.306  10.092 1.00 70.30 ? 127 MET A HB2  2  
ATOM 4179  H HB3  . MET A 1 127 ? 37.227 -7.159  10.482 1.00 44.22 ? 127 MET A HB3  2  
ATOM 4180  H HG2  . MET A 1 127 ? 36.226 -9.870  10.793 1.00 1.12  ? 127 MET A HG2  2  
ATOM 4181  H HG3  . MET A 1 127 ? 36.038 -9.246  9.156  1.00 4.11  ? 127 MET A HG3  2  
ATOM 4182  H HE1  . MET A 1 127 ? 38.550 -9.617  12.126 1.00 1.31  ? 127 MET A HE1  2  
ATOM 4183  H HE2  . MET A 1 127 ? 40.099 -9.296  11.346 1.00 72.34 ? 127 MET A HE2  2  
ATOM 4184  H HE3  . MET A 1 127 ? 38.923 -7.995  11.540 1.00 22.33 ? 127 MET A HE3  2  
ATOM 4185  N N    . THR A 1 128 ? 35.895 -5.402  12.771 1.00 33.11 ? 128 THR A N    2  
ATOM 4186  C CA   . THR A 1 128 ? 36.376 -4.165  13.372 1.00 13.24 ? 128 THR A CA   2  
ATOM 4187  C C    . THR A 1 128 ? 36.822 -4.391  14.812 1.00 4.43  ? 128 THR A C    2  
ATOM 4188  O O    . THR A 1 128 ? 37.764 -3.755  15.286 1.00 72.50 ? 128 THR A O    2  
ATOM 4189  C CB   . THR A 1 128 ? 35.292 -3.070  13.349 1.00 61.42 ? 128 THR A CB   2  
ATOM 4190  O OG1  . THR A 1 128 ? 34.622 -3.072  12.083 1.00 12.14 ? 128 THR A OG1  2  
ATOM 4191  C CG2  . THR A 1 128 ? 35.901 -1.700  13.604 1.00 23.01 ? 128 THR A CG2  2  
ATOM 4192  H H    . THR A 1 128 ? 35.017 -5.413  12.335 1.00 64.03 ? 128 THR A H    2  
ATOM 4193  H HA   . THR A 1 128 ? 37.220 -3.819  12.794 1.00 51.23 ? 128 THR A HA   2  
ATOM 4194  H HB   . THR A 1 128 ? 34.574 -3.280  14.129 1.00 54.55 ? 128 THR A HB   2  
ATOM 4195  H HG1  . THR A 1 128 ? 33.933 -3.741  12.087 1.00 54.30 ? 128 THR A HG1  2  
ATOM 4196  H HG21 . THR A 1 128 ? 35.481 -1.281  14.506 1.00 33.44 ? 128 THR A HG21 2  
ATOM 4197  H HG22 . THR A 1 128 ? 35.685 -1.049  12.770 1.00 22.10 ? 128 THR A HG22 2  
ATOM 4198  H HG23 . THR A 1 128 ? 36.970 -1.797  13.717 1.00 24.43 ? 128 THR A HG23 2  
ATOM 4199  N N    . GLU A 1 129 ? 36.141 -5.300  15.503 1.00 42.32 ? 129 GLU A N    2  
ATOM 4200  C CA   . GLU A 1 129 ? 36.469 -5.608  16.890 1.00 64.33 ? 129 GLU A CA   2  
ATOM 4201  C C    . GLU A 1 129 ? 37.900 -6.127  17.008 1.00 73.02 ? 129 GLU A C    2  
ATOM 4202  O O    . GLU A 1 129 ? 38.649 -5.718  17.894 1.00 34.31 ? 129 GLU A O    2  
ATOM 4203  C CB   . GLU A 1 129 ? 35.492 -6.643  17.450 1.00 31.42 ? 129 GLU A CB   2  
ATOM 4204  C CG   . GLU A 1 129 ? 35.810 -7.074  18.872 1.00 1.53  ? 129 GLU A CG   2  
ATOM 4205  C CD   . GLU A 1 129 ? 34.582 -7.543  19.628 1.00 23.13 ? 129 GLU A CD   2  
ATOM 4206  O OE1  . GLU A 1 129 ? 34.616 -8.666  20.173 1.00 35.42 ? 129 GLU A OE1  2  
ATOM 4207  O OE2  . GLU A 1 129 ? 33.589 -6.788  19.675 1.00 31.10 ? 129 GLU A OE2  2  
ATOM 4208  H H    . GLU A 1 129 ? 35.401 -5.773  15.070 1.00 75.22 ? 129 GLU A H    2  
ATOM 4209  H HA   . GLU A 1 129 ? 36.381 -4.697  17.462 1.00 65.21 ? 129 GLU A HA   2  
ATOM 4210  H HB2  . GLU A 1 129 ? 34.496 -6.225  17.436 1.00 22.23 ? 129 GLU A HB2  2  
ATOM 4211  H HB3  . GLU A 1 129 ? 35.513 -7.519  16.819 1.00 62.24 ? 129 GLU A HB3  2  
ATOM 4212  H HG2  . GLU A 1 129 ? 36.524 -7.883  18.839 1.00 43.50 ? 129 GLU A HG2  2  
ATOM 4213  H HG3  . GLU A 1 129 ? 36.241 -6.236  19.400 1.00 4.33  ? 129 GLU A HG3  2  
ATOM 4214  N N    . GLY A 1 130 ? 38.271 -7.032  16.107 1.00 43.42 ? 130 GLY A N    2  
ATOM 4215  C CA   . GLY A 1 130 ? 39.610 -7.592  16.127 1.00 34.52 ? 130 GLY A CA   2  
ATOM 4216  C C    . GLY A 1 130 ? 39.781 -8.644  17.205 1.00 20.31 ? 130 GLY A C    2  
ATOM 4217  O O    . GLY A 1 130 ? 40.424 -9.670  16.984 1.00 71.43 ? 130 GLY A O    2  
ATOM 4218  H H    . GLY A 1 130 ? 37.631 -7.320  15.423 1.00 65.33 ? 130 GLY A H    2  
ATOM 4219  H HA2  . GLY A 1 130 ? 39.815 -8.040  15.166 1.00 4.32  ? 130 GLY A HA2  2  
ATOM 4220  H HA3  . GLY A 1 130 ? 40.319 -6.796  16.302 1.00 75.33 ? 130 GLY A HA3  2  
ATOM 4221  N N    . MET A 1 1   ? 1.312  0.874   -0.086 1.00 60.51 ? 1   MET A N    3  
ATOM 4222  C CA   . MET A 1 1   ? 2.750  0.682   0.061  1.00 62.31 ? 1   MET A CA   3  
ATOM 4223  C C    . MET A 1 1   ? 3.107  -0.801  0.032  1.00 74.23 ? 1   MET A C    3  
ATOM 4224  O O    . MET A 1 1   ? 2.227  -1.662  0.050  1.00 31.45 ? 1   MET A O    3  
ATOM 4225  C CB   . MET A 1 1   ? 3.239  1.310   1.367  1.00 2.12  ? 1   MET A CB   3  
ATOM 4226  C CG   . MET A 1 1   ? 3.507  2.803   1.261  1.00 71.43 ? 1   MET A CG   3  
ATOM 4227  S SD   . MET A 1 1   ? 2.047  3.798   1.623  1.00 25.53 ? 1   MET A SD   3  
ATOM 4228  C CE   . MET A 1 1   ? 2.791  5.404   1.892  1.00 5.52  ? 1   MET A CE   3  
ATOM 4229  H H1   . MET A 1 1   ? 0.736  0.788   0.702  1.00 32.01 ? 1   MET A H1   3  
ATOM 4230  H HA   . MET A 1 1   ? 3.236  1.173   -0.768 1.00 42.15 ? 1   MET A HA   3  
ATOM 4231  H HB2  . MET A 1 1   ? 2.491  1.154   2.130  1.00 24.22 ? 1   MET A HB2  3  
ATOM 4232  H HB3  . MET A 1 1   ? 4.155  0.823   1.667  1.00 62.02 ? 1   MET A HB3  3  
ATOM 4233  H HG2  . MET A 1 1   ? 4.287  3.066   1.960  1.00 54.23 ? 1   MET A HG2  3  
ATOM 4234  H HG3  . MET A 1 1   ? 3.837  3.024   0.257  1.00 53.05 ? 1   MET A HG3  3  
ATOM 4235  H HE1  . MET A 1 1   ? 2.047  6.087   2.274  1.00 74.11 ? 1   MET A HE1  3  
ATOM 4236  H HE2  . MET A 1 1   ? 3.596  5.313   2.607  1.00 41.23 ? 1   MET A HE2  3  
ATOM 4237  H HE3  . MET A 1 1   ? 3.180  5.782   0.957  1.00 23.34 ? 1   MET A HE3  3  
ATOM 4238  N N    . LYS A 1 2   ? 4.402  -1.093  -0.015 1.00 1.13  ? 2   LYS A N    3  
ATOM 4239  C CA   . LYS A 1 2   ? 4.876  -2.472  -0.046 1.00 13.44 ? 2   LYS A CA   3  
ATOM 4240  C C    . LYS A 1 2   ? 4.704  -3.137  1.316  1.00 11.44 ? 2   LYS A C    3  
ATOM 4241  O O    . LYS A 1 2   ? 4.624  -2.462  2.343  1.00 44.50 ? 2   LYS A O    3  
ATOM 4242  C CB   . LYS A 1 2   ? 6.347  -2.518  -0.466 1.00 14.13 ? 2   LYS A CB   3  
ATOM 4243  C CG   . LYS A 1 2   ? 6.566  -2.239  -1.943 1.00 24.25 ? 2   LYS A CG   3  
ATOM 4244  C CD   . LYS A 1 2   ? 5.826  -3.239  -2.815 1.00 13.21 ? 2   LYS A CD   3  
ATOM 4245  C CE   . LYS A 1 2   ? 6.252  -3.131  -4.271 1.00 23.51 ? 2   LYS A CE   3  
ATOM 4246  N NZ   . LYS A 1 2   ? 5.139  -3.466  -5.201 1.00 53.03 ? 2   LYS A NZ   3  
ATOM 4247  H H    . LYS A 1 2   ? 5.056  -0.362  -0.028 1.00 22.44 ? 2   LYS A H    3  
ATOM 4248  H HA   . LYS A 1 2   ? 4.286  -3.009  -0.772 1.00 55.03 ? 2   LYS A HA   3  
ATOM 4249  H HB2  . LYS A 1 2   ? 6.895  -1.782  0.104  1.00 55.32 ? 2   LYS A HB2  3  
ATOM 4250  H HB3  . LYS A 1 2   ? 6.741  -3.499  -0.243 1.00 42.04 ? 2   LYS A HB3  3  
ATOM 4251  H HG2  . LYS A 1 2   ? 6.209  -1.246  -2.169 1.00 41.24 ? 2   LYS A HG2  3  
ATOM 4252  H HG3  . LYS A 1 2   ? 7.624  -2.301  -2.158 1.00 32.43 ? 2   LYS A HG3  3  
ATOM 4253  H HD2  . LYS A 1 2   ? 6.037  -4.237  -2.463 1.00 21.45 ? 2   LYS A HD2  3  
ATOM 4254  H HD3  . LYS A 1 2   ? 4.764  -3.047  -2.745 1.00 22.53 ? 2   LYS A HD3  3  
ATOM 4255  H HE2  . LYS A 1 2   ? 6.579  -2.121  -4.463 1.00 62.11 ? 2   LYS A HE2  3  
ATOM 4256  H HE3  . LYS A 1 2   ? 7.072  -3.814  -4.443 1.00 54.24 ? 2   LYS A HE3  3  
ATOM 4257  H HZ1  . LYS A 1 2   ? 4.601  -4.279  -4.837 1.00 1.50  ? 2   LYS A HZ1  3  
ATOM 4258  H HZ2  . LYS A 1 2   ? 5.517  -3.708  -6.139 1.00 41.21 ? 2   LYS A HZ2  3  
ATOM 4259  H HZ3  . LYS A 1 2   ? 4.497  -2.654  -5.297 1.00 54.30 ? 2   LYS A HZ3  3  
ATOM 4260  N N    . LYS A 1 3   ? 4.649  -4.464  1.319  1.00 73.13 ? 3   LYS A N    3  
ATOM 4261  C CA   . LYS A 1 3   ? 4.489  -5.222  2.554  1.00 3.54  ? 3   LYS A CA   3  
ATOM 4262  C C    . LYS A 1 3   ? 5.788  -5.238  3.354  1.00 63.12 ? 3   LYS A C    3  
ATOM 4263  O O    . LYS A 1 3   ? 6.800  -5.776  2.903  1.00 74.21 ? 3   LYS A O    3  
ATOM 4264  C CB   . LYS A 1 3   ? 4.050  -6.655  2.245  1.00 11.53 ? 3   LYS A CB   3  
ATOM 4265  C CG   . LYS A 1 3   ? 2.542  -6.834  2.210  1.00 21.23 ? 3   LYS A CG   3  
ATOM 4266  C CD   . LYS A 1 3   ? 1.995  -7.223  3.573  1.00 21.45 ? 3   LYS A CD   3  
ATOM 4267  C CE   . LYS A 1 3   ? 0.499  -6.965  3.668  1.00 3.14  ? 3   LYS A CE   3  
ATOM 4268  N NZ   . LYS A 1 3   ? -0.291 -8.025  2.984  1.00 74.12 ? 3   LYS A NZ   3  
ATOM 4269  H H    . LYS A 1 3   ? 4.718  -4.947  0.468  1.00 52.32 ? 3   LYS A H    3  
ATOM 4270  H HA   . LYS A 1 3   ? 3.724  -4.739  3.143  1.00 3.43  ? 3   LYS A HA   3  
ATOM 4271  H HB2  . LYS A 1 3   ? 4.448  -6.941  1.283  1.00 2.21  ? 3   LYS A HB2  3  
ATOM 4272  H HB3  . LYS A 1 3   ? 4.452  -7.313  3.002  1.00 3.30  ? 3   LYS A HB3  3  
ATOM 4273  H HG2  . LYS A 1 3   ? 2.085  -5.906  1.903  1.00 51.51 ? 3   LYS A HG2  3  
ATOM 4274  H HG3  . LYS A 1 3   ? 2.298  -7.611  1.499  1.00 12.33 ? 3   LYS A HG3  3  
ATOM 4275  H HD2  . LYS A 1 3   ? 2.178  -8.275  3.739  1.00 43.23 ? 3   LYS A HD2  3  
ATOM 4276  H HD3  . LYS A 1 3   ? 2.501  -6.644  4.333  1.00 32.33 ? 3   LYS A HD3  3  
ATOM 4277  H HE2  . LYS A 1 3   ? 0.218  -6.934  4.710  1.00 51.13 ? 3   LYS A HE2  3  
ATOM 4278  H HE3  . LYS A 1 3   ? 0.282  -6.012  3.208  1.00 22.14 ? 3   LYS A HE3  3  
ATOM 4279  H HZ1  . LYS A 1 3   ? -0.797 -7.623  2.168  1.00 23.04 ? 3   LYS A HZ1  3  
ATOM 4280  H HZ2  . LYS A 1 3   ? -0.986 -8.433  3.641  1.00 54.10 ? 3   LYS A HZ2  3  
ATOM 4281  H HZ3  . LYS A 1 3   ? 0.339  -8.781  2.649  1.00 30.32 ? 3   LYS A HZ3  3  
ATOM 4282  N N    . VAL A 1 4   ? 5.753  -4.647  4.544  1.00 42.43 ? 4   VAL A N    3  
ATOM 4283  C CA   . VAL A 1 4   ? 6.927  -4.596  5.407  1.00 0.21  ? 4   VAL A CA   3  
ATOM 4284  C C    . VAL A 1 4   ? 7.154  -5.932  6.105  1.00 11.02 ? 4   VAL A C    3  
ATOM 4285  O O    . VAL A 1 4   ? 6.408  -6.305  7.011  1.00 0.34  ? 4   VAL A O    3  
ATOM 4286  C CB   . VAL A 1 4   ? 6.794  -3.490  6.470  1.00 2.55  ? 4   VAL A CB   3  
ATOM 4287  C CG1  . VAL A 1 4   ? 8.016  -3.470  7.376  1.00 1.41  ? 4   VAL A CG1  3  
ATOM 4288  C CG2  . VAL A 1 4   ? 6.589  -2.136  5.808  1.00 45.35 ? 4   VAL A CG2  3  
ATOM 4289  H H    . VAL A 1 4   ? 4.918  -4.235  4.848  1.00 33.14 ? 4   VAL A H    3  
ATOM 4290  H HA   . VAL A 1 4   ? 7.786  -4.372  4.791  1.00 74.34 ? 4   VAL A HA   3  
ATOM 4291  H HB   . VAL A 1 4   ? 5.927  -3.704  7.078  1.00 61.23 ? 4   VAL A HB   3  
ATOM 4292  H HG11 . VAL A 1 4   ? 7.917  -4.236  8.131  1.00 14.41 ? 4   VAL A HG11 3  
ATOM 4293  H HG12 . VAL A 1 4   ? 8.903  -3.655  6.788  1.00 3.53  ? 4   VAL A HG12 3  
ATOM 4294  H HG13 . VAL A 1 4   ? 8.095  -2.504  7.853  1.00 53.41 ? 4   VAL A HG13 3  
ATOM 4295  H HG21 . VAL A 1 4   ? 7.221  -2.064  4.934  1.00 32.25 ? 4   VAL A HG21 3  
ATOM 4296  H HG22 . VAL A 1 4   ? 5.555  -2.031  5.513  1.00 22.21 ? 4   VAL A HG22 3  
ATOM 4297  H HG23 . VAL A 1 4   ? 6.846  -1.351  6.503  1.00 22.14 ? 4   VAL A HG23 3  
ATOM 4298  N N    . ILE A 1 5   ? 8.188  -6.648  5.678  1.00 61.41 ? 5   ILE A N    3  
ATOM 4299  C CA   . ILE A 1 5   ? 8.514  -7.943  6.263  1.00 1.23  ? 5   ILE A CA   3  
ATOM 4300  C C    . ILE A 1 5   ? 9.537  -7.797  7.384  1.00 25.04 ? 5   ILE A C    3  
ATOM 4301  O O    . ILE A 1 5   ? 10.730 -7.630  7.132  1.00 31.21 ? 5   ILE A O    3  
ATOM 4302  C CB   . ILE A 1 5   ? 9.064  -8.917  5.205  1.00 42.02 ? 5   ILE A CB   3  
ATOM 4303  C CG1  . ILE A 1 5   ? 8.266  -8.796  3.905  1.00 1.01  ? 5   ILE A CG1  3  
ATOM 4304  C CG2  . ILE A 1 5   ? 9.023  -10.345 5.727  1.00 31.32 ? 5   ILE A CG2  3  
ATOM 4305  C CD1  . ILE A 1 5   ? 6.778  -9.000  4.088  1.00 4.43  ? 5   ILE A CD1  3  
ATOM 4306  H H    . ILE A 1 5   ? 8.745  -6.298  4.952  1.00 3.13  ? 5   ILE A H    3  
ATOM 4307  H HA   . ILE A 1 5   ? 7.606  -8.362  6.672  1.00 53.13 ? 5   ILE A HA   3  
ATOM 4308  H HB   . ILE A 1 5   ? 10.094 -8.659  5.012  1.00 63.53 ? 5   ILE A HB   3  
ATOM 4309  H HG12 . ILE A 1 5   ? 8.417  -7.813  3.487  1.00 33.15 ? 5   ILE A HG12 3  
ATOM 4310  H HG13 . ILE A 1 5   ? 8.620  -9.538  3.204  1.00 34.41 ? 5   ILE A HG13 3  
ATOM 4311  H HG21 . ILE A 1 5   ? 9.940  -10.562 6.254  1.00 23.42 ? 5   ILE A HG21 3  
ATOM 4312  H HG22 . ILE A 1 5   ? 8.187  -10.458 6.401  1.00 53.41 ? 5   ILE A HG22 3  
ATOM 4313  H HG23 . ILE A 1 5   ? 8.913  -11.029 4.899  1.00 50.21 ? 5   ILE A HG23 3  
ATOM 4314  H HD11 . ILE A 1 5   ? 6.401  -8.281  4.801  1.00 43.22 ? 5   ILE A HD11 3  
ATOM 4315  H HD12 . ILE A 1 5   ? 6.277  -8.867  3.142  1.00 50.13 ? 5   ILE A HD12 3  
ATOM 4316  H HD13 . ILE A 1 5   ? 6.595  -9.999  4.456  1.00 73.24 ? 5   ILE A HD13 3  
ATOM 4317  N N    . ASN A 1 6   ? 9.063  -7.863  8.624  1.00 55.00 ? 6   ASN A N    3  
ATOM 4318  C CA   . ASN A 1 6   ? 9.937  -7.740  9.785  1.00 54.41 ? 6   ASN A CA   3  
ATOM 4319  C C    . ASN A 1 6   ? 10.645 -9.059  10.075 1.00 32.34 ? 6   ASN A C    3  
ATOM 4320  O O    . ASN A 1 6   ? 10.007 -10.057 10.412 1.00 65.52 ? 6   ASN A O    3  
ATOM 4321  C CB   . ASN A 1 6   ? 9.133  -7.299  11.010 1.00 52.20 ? 6   ASN A CB   3  
ATOM 4322  C CG   . ASN A 1 6   ? 9.911  -6.350  11.901 1.00 31.23 ? 6   ASN A CG   3  
ATOM 4323  O OD1  . ASN A 1 6   ? 9.479  -5.226  12.157 1.00 42.15 ? 6   ASN A OD1  3  
ATOM 4324  N ND2  . ASN A 1 6   ? 11.065 -6.801  12.379 1.00 1.53  ? 6   ASN A ND2  3  
ATOM 4325  H H    . ASN A 1 6   ? 8.102  -7.997  8.762  1.00 74.44 ? 6   ASN A H    3  
ATOM 4326  H HA   . ASN A 1 6   ? 10.678 -6.988  9.563  1.00 45.54 ? 6   ASN A HA   3  
ATOM 4327  H HB2  . ASN A 1 6   ? 8.234  -6.797  10.682 1.00 72.43 ? 6   ASN A HB2  3  
ATOM 4328  H HB3  . ASN A 1 6   ? 8.864  -8.169  11.589 1.00 34.22 ? 6   ASN A HB3  3  
ATOM 4329  H HD21 . ASN A 1 6   ? 11.346 -7.707  12.134 1.00 42.22 ? 6   ASN A HD21 3  
ATOM 4330  H HD22 . ASN A 1 6   ? 11.588 -6.208  12.959 1.00 62.22 ? 6   ASN A HD22 3  
ATOM 4331  N N    . VAL A 1 7   ? 11.967 -9.056  9.944  1.00 65.45 ? 7   VAL A N    3  
ATOM 4332  C CA   . VAL A 1 7   ? 12.763 -10.252 10.193 1.00 23.23 ? 7   VAL A CA   3  
ATOM 4333  C C    . VAL A 1 7   ? 14.048 -9.911  10.941 1.00 74.52 ? 7   VAL A C    3  
ATOM 4334  O O    . VAL A 1 7   ? 14.665 -8.875  10.696 1.00 62.24 ? 7   VAL A O    3  
ATOM 4335  C CB   . VAL A 1 7   ? 13.122 -10.972 8.880  1.00 45.13 ? 7   VAL A CB   3  
ATOM 4336  C CG1  . VAL A 1 7   ? 11.919 -11.729 8.339  1.00 10.11 ? 7   VAL A CG1  3  
ATOM 4337  C CG2  . VAL A 1 7   ? 13.642 -9.977  7.853  1.00 64.42 ? 7   VAL A CG2  3  
ATOM 4338  H H    . VAL A 1 7   ? 12.419 -8.230  9.673  1.00 51.15 ? 7   VAL A H    3  
ATOM 4339  H HA   . VAL A 1 7   ? 12.174 -10.925 10.799 1.00 74.45 ? 7   VAL A HA   3  
ATOM 4340  H HB   . VAL A 1 7   ? 13.906 -11.686 9.087  1.00 73.33 ? 7   VAL A HB   3  
ATOM 4341  H HG11 . VAL A 1 7   ? 11.951 -11.731 7.259  1.00 12.24 ? 7   VAL A HG11 3  
ATOM 4342  H HG12 . VAL A 1 7   ? 11.940 -12.746 8.703  1.00 15.31 ? 7   VAL A HG12 3  
ATOM 4343  H HG13 . VAL A 1 7   ? 11.012 -11.246 8.671  1.00 54.33 ? 7   VAL A HG13 3  
ATOM 4344  H HG21 . VAL A 1 7   ? 12.875 -9.248  7.638  1.00 23.34 ? 7   VAL A HG21 3  
ATOM 4345  H HG22 . VAL A 1 7   ? 14.515 -9.476  8.246  1.00 62.20 ? 7   VAL A HG22 3  
ATOM 4346  H HG23 . VAL A 1 7   ? 13.906 -10.500 6.946  1.00 64.51 ? 7   VAL A HG23 3  
ATOM 4347  N N    . VAL A 1 8   ? 14.445 -10.791 11.855 1.00 62.34 ? 8   VAL A N    3  
ATOM 4348  C CA   . VAL A 1 8   ? 15.658 -10.585 12.638 1.00 54.02 ? 8   VAL A CA   3  
ATOM 4349  C C    . VAL A 1 8   ? 16.514 -11.846 12.667 1.00 43.33 ? 8   VAL A C    3  
ATOM 4350  O O    . VAL A 1 8   ? 16.114 -12.892 12.159 1.00 63.50 ? 8   VAL A O    3  
ATOM 4351  C CB   . VAL A 1 8   ? 15.328 -10.168 14.083 1.00 33.45 ? 8   VAL A CB   3  
ATOM 4352  C CG1  . VAL A 1 8   ? 14.558 -8.857  14.099 1.00 50.51 ? 8   VAL A CG1  3  
ATOM 4353  C CG2  . VAL A 1 8   ? 14.543 -11.265 14.788 1.00 52.14 ? 8   VAL A CG2  3  
ATOM 4354  H H    . VAL A 1 8   ? 13.911 -11.599 12.005 1.00 53.31 ? 8   VAL A H    3  
ATOM 4355  H HA   . VAL A 1 8   ? 16.222 -9.788  12.176 1.00 61.23 ? 8   VAL A HA   3  
ATOM 4356  H HB   . VAL A 1 8   ? 16.256 -10.021 14.615 1.00 24.41 ? 8   VAL A HB   3  
ATOM 4357  H HG11 . VAL A 1 8   ? 15.128 -8.111  14.634 1.00 62.31 ? 8   VAL A HG11 3  
ATOM 4358  H HG12 . VAL A 1 8   ? 14.391 -8.525  13.085 1.00 43.44 ? 8   VAL A HG12 3  
ATOM 4359  H HG13 . VAL A 1 8   ? 13.608 -9.003  14.591 1.00 54.11 ? 8   VAL A HG13 3  
ATOM 4360  H HG21 . VAL A 1 8   ? 15.223 -12.032 15.126 1.00 33.42 ? 8   VAL A HG21 3  
ATOM 4361  H HG22 . VAL A 1 8   ? 14.021 -10.847 15.636 1.00 10.42 ? 8   VAL A HG22 3  
ATOM 4362  H HG23 . VAL A 1 8   ? 13.828 -11.694 14.102 1.00 52.45 ? 8   VAL A HG23 3  
ATOM 4363  N N    . GLY A 1 9   ? 17.697 -11.738 13.266 1.00 55.24 ? 9   GLY A N    3  
ATOM 4364  C CA   . GLY A 1 9   ? 18.592 -12.877 13.350 1.00 12.24 ? 9   GLY A CA   3  
ATOM 4365  C C    . GLY A 1 9   ? 19.403 -12.883 14.631 1.00 41.42 ? 9   GLY A C    3  
ATOM 4366  O O    . GLY A 1 9   ? 19.259 -11.993 15.469 1.00 42.24 ? 9   GLY A O    3  
ATOM 4367  H H    . GLY A 1 9   ? 17.963 -10.878 13.653 1.00 11.20 ? 9   GLY A H    3  
ATOM 4368  H HA2  . GLY A 1 9   ? 18.008 -13.784 13.302 1.00 42.00 ? 9   GLY A HA2  3  
ATOM 4369  H HA3  . GLY A 1 9   ? 19.269 -12.851 12.509 1.00 20.12 ? 9   GLY A HA3  3  
ATOM 4370  N N    . ALA A 1 10  ? 20.257 -13.889 14.784 1.00 63.23 ? 10  ALA A N    3  
ATOM 4371  C CA   . ALA A 1 10  ? 21.095 -14.007 15.971 1.00 14.20 ? 10  ALA A CA   3  
ATOM 4372  C C    . ALA A 1 10  ? 22.481 -14.533 15.615 1.00 32.42 ? 10  ALA A C    3  
ATOM 4373  O O    . ALA A 1 10  ? 22.612 -15.544 14.924 1.00 44.22 ? 10  ALA A O    3  
ATOM 4374  C CB   . ALA A 1 10  ? 20.431 -14.913 16.997 1.00 31.31 ? 10  ALA A CB   3  
ATOM 4375  H H    . ALA A 1 10  ? 20.327 -14.568 14.081 1.00 51.14 ? 10  ALA A H    3  
ATOM 4376  H HA   . ALA A 1 10  ? 21.195 -13.023 16.407 1.00 22.43 ? 10  ALA A HA   3  
ATOM 4377  H HB1  . ALA A 1 10  ? 19.790 -14.323 17.636 1.00 73.31 ? 10  ALA A HB1  3  
ATOM 4378  H HB2  . ALA A 1 10  ? 19.842 -15.662 16.488 1.00 25.15 ? 10  ALA A HB2  3  
ATOM 4379  H HB3  . ALA A 1 10  ? 21.190 -15.396 17.595 1.00 14.40 ? 10  ALA A HB3  3  
ATOM 4380  N N    . ILE A 1 11  ? 23.511 -13.842 16.091 1.00 21.51 ? 11  ILE A N    3  
ATOM 4381  C CA   . ILE A 1 11  ? 24.887 -14.242 15.823 1.00 41.41 ? 11  ILE A CA   3  
ATOM 4382  C C    . ILE A 1 11  ? 25.601 -14.649 17.107 1.00 25.30 ? 11  ILE A C    3  
ATOM 4383  O O    . ILE A 1 11  ? 25.816 -13.826 17.998 1.00 64.44 ? 11  ILE A O    3  
ATOM 4384  C CB   . ILE A 1 11  ? 25.680 -13.109 15.145 1.00 0.42  ? 11  ILE A CB   3  
ATOM 4385  C CG1  . ILE A 1 11  ? 25.379 -11.770 15.823 1.00 62.13 ? 11  ILE A CG1  3  
ATOM 4386  C CG2  . ILE A 1 11  ? 25.349 -13.044 13.662 1.00 55.02 ? 11  ILE A CG2  3  
ATOM 4387  C CD1  . ILE A 1 11  ? 26.172 -10.614 15.255 1.00 51.33 ? 11  ILE A CD1  3  
ATOM 4388  H H    . ILE A 1 11  ? 23.342 -13.046 16.636 1.00 71.10 ? 11  ILE A H    3  
ATOM 4389  H HA   . ILE A 1 11  ? 24.863 -15.089 15.152 1.00 5.53  ? 11  ILE A HA   3  
ATOM 4390  H HB   . ILE A 1 11  ? 26.732 -13.326 15.245 1.00 24.11 ? 11  ILE A HB   3  
ATOM 4391  H HG12 . ILE A 1 11  ? 24.332 -11.542 15.706 1.00 35.12 ? 11  ILE A HG12 3  
ATOM 4392  H HG13 . ILE A 1 11  ? 25.612 -11.848 16.875 1.00 13.30 ? 11  ILE A HG13 3  
ATOM 4393  H HG21 . ILE A 1 11  ? 25.605 -13.983 13.194 1.00 24.24 ? 11  ILE A HG21 3  
ATOM 4394  H HG22 . ILE A 1 11  ? 24.292 -12.858 13.537 1.00 23.12 ? 11  ILE A HG22 3  
ATOM 4395  H HG23 . ILE A 1 11  ? 25.912 -12.247 13.201 1.00 12.40 ? 11  ILE A HG23 3  
ATOM 4396  H HD11 . ILE A 1 11  ? 25.494 -9.867  14.868 1.00 32.13 ? 11  ILE A HD11 3  
ATOM 4397  H HD12 . ILE A 1 11  ? 26.783 -10.179 16.031 1.00 32.34 ? 11  ILE A HD12 3  
ATOM 4398  H HD13 . ILE A 1 11  ? 26.806 -10.970 14.456 1.00 61.44 ? 11  ILE A HD13 3  
ATOM 4399  N N    . ILE A 1 12  ? 25.968 -15.923 17.195 1.00 63.34 ? 12  ILE A N    3  
ATOM 4400  C CA   . ILE A 1 12  ? 26.661 -16.439 18.368 1.00 24.34 ? 12  ILE A CA   3  
ATOM 4401  C C    . ILE A 1 12  ? 28.150 -16.114 18.315 1.00 63.42 ? 12  ILE A C    3  
ATOM 4402  O O    . ILE A 1 12  ? 28.749 -16.071 17.240 1.00 52.33 ? 12  ILE A O    3  
ATOM 4403  C CB   . ILE A 1 12  ? 26.484 -17.963 18.502 1.00 25.30 ? 12  ILE A CB   3  
ATOM 4404  C CG1  . ILE A 1 12  ? 25.030 -18.355 18.234 1.00 31.31 ? 12  ILE A CG1  3  
ATOM 4405  C CG2  . ILE A 1 12  ? 26.918 -18.428 19.884 1.00 11.35 ? 12  ILE A CG2  3  
ATOM 4406  C CD1  . ILE A 1 12  ? 24.036 -17.624 19.109 1.00 41.32 ? 12  ILE A CD1  3  
ATOM 4407  H H    . ILE A 1 12  ? 25.769 -16.530 16.452 1.00 72.41 ? 12  ILE A H    3  
ATOM 4408  H HA   . ILE A 1 12  ? 26.232 -15.969 19.242 1.00 64.23 ? 12  ILE A HA   3  
ATOM 4409  H HB   . ILE A 1 12  ? 27.119 -18.442 17.772 1.00 22.34 ? 12  ILE A HB   3  
ATOM 4410  H HG12 . ILE A 1 12  ? 24.789 -18.138 17.206 1.00 74.13 ? 12  ILE A HG12 3  
ATOM 4411  H HG13 . ILE A 1 12  ? 24.912 -19.415 18.411 1.00 2.32  ? 12  ILE A HG13 3  
ATOM 4412  H HG21 . ILE A 1 12  ? 26.904 -17.590 20.566 1.00 3.01  ? 12  ILE A HG21 3  
ATOM 4413  H HG22 . ILE A 1 12  ? 26.238 -19.189 20.238 1.00 44.25 ? 12  ILE A HG22 3  
ATOM 4414  H HG23 . ILE A 1 12  ? 27.917 -18.833 19.832 1.00 41.23 ? 12  ILE A HG23 3  
ATOM 4415  H HD11 . ILE A 1 12  ? 23.388 -17.020 18.491 1.00 42.32 ? 12  ILE A HD11 3  
ATOM 4416  H HD12 . ILE A 1 12  ? 23.445 -18.340 19.660 1.00 41.42 ? 12  ILE A HD12 3  
ATOM 4417  H HD13 . ILE A 1 12  ? 24.567 -16.987 19.802 1.00 42.33 ? 12  ILE A HD13 3  
ATOM 4418  N N    . PHE A 1 13  ? 28.743 -15.889 19.482 1.00 5.53  ? 13  PHE A N    3  
ATOM 4419  C CA   . PHE A 1 13  ? 30.164 -15.568 19.569 1.00 35.41 ? 13  PHE A CA   3  
ATOM 4420  C C    . PHE A 1 13  ? 30.804 -16.258 20.770 1.00 0.33  ? 13  PHE A C    3  
ATOM 4421  O O    . PHE A 1 13  ? 30.318 -16.147 21.896 1.00 54.35 ? 13  PHE A O    3  
ATOM 4422  C CB   . PHE A 1 13  ? 30.361 -14.055 19.670 1.00 5.51  ? 13  PHE A CB   3  
ATOM 4423  C CG   . PHE A 1 13  ? 30.339 -13.357 18.340 1.00 5.01  ? 13  PHE A CG   3  
ATOM 4424  C CD1  . PHE A 1 13  ? 29.137 -13.013 17.743 1.00 2.24  ? 13  PHE A CD1  3  
ATOM 4425  C CD2  . PHE A 1 13  ? 31.521 -13.045 17.687 1.00 52.01 ? 13  PHE A CD2  3  
ATOM 4426  C CE1  . PHE A 1 13  ? 29.114 -12.372 16.519 1.00 3.43  ? 13  PHE A CE1  3  
ATOM 4427  C CE2  . PHE A 1 13  ? 31.504 -12.403 16.463 1.00 61.43 ? 13  PHE A CE2  3  
ATOM 4428  C CZ   . PHE A 1 13  ? 30.299 -12.065 15.879 1.00 61.43 ? 13  PHE A CZ   3  
ATOM 4429  H H    . PHE A 1 13  ? 28.213 -15.938 20.305 1.00 1.24  ? 13  PHE A H    3  
ATOM 4430  H HA   . PHE A 1 13  ? 30.639 -15.926 18.669 1.00 54.35 ? 13  PHE A HA   3  
ATOM 4431  H HB2  . PHE A 1 13  ? 29.573 -13.635 20.277 1.00 22.31 ? 13  PHE A HB2  3  
ATOM 4432  H HB3  . PHE A 1 13  ? 31.314 -13.854 20.136 1.00 44.11 ? 13  PHE A HB3  3  
ATOM 4433  H HD1  . PHE A 1 13  ? 28.210 -13.250 18.243 1.00 32.55 ? 13  PHE A HD1  3  
ATOM 4434  H HD2  . PHE A 1 13  ? 32.465 -13.309 18.143 1.00 14.15 ? 13  PHE A HD2  3  
ATOM 4435  H HE1  . PHE A 1 13  ? 28.171 -12.108 16.065 1.00 71.11 ? 13  PHE A HE1  3  
ATOM 4436  H HE2  . PHE A 1 13  ? 32.433 -12.166 15.965 1.00 55.41 ? 13  PHE A HE2  3  
ATOM 4437  H HZ   . PHE A 1 13  ? 30.284 -11.565 14.922 1.00 12.22 ? 13  PHE A HZ   3  
ATOM 4438  N N    . SER A 1 14  ? 31.898 -16.970 20.522 1.00 62.51 ? 14  SER A N    3  
ATOM 4439  C CA   . SER A 1 14  ? 32.604 -17.682 21.581 1.00 33.03 ? 14  SER A CA   3  
ATOM 4440  C C    . SER A 1 14  ? 33.987 -18.123 21.112 1.00 51.31 ? 14  SER A C    3  
ATOM 4441  O O    . SER A 1 14  ? 34.129 -18.742 20.057 1.00 35.04 ? 14  SER A O    3  
ATOM 4442  C CB   . SER A 1 14  ? 31.795 -18.899 22.034 1.00 75.02 ? 14  SER A CB   3  
ATOM 4443  O OG   . SER A 1 14  ? 31.225 -19.573 20.925 1.00 33.43 ? 14  SER A OG   3  
ATOM 4444  H H    . SER A 1 14  ? 32.237 -17.021 19.604 1.00 43.24 ? 14  SER A H    3  
ATOM 4445  H HA   . SER A 1 14  ? 32.718 -17.006 22.416 1.00 50.05 ? 14  SER A HA   3  
ATOM 4446  H HB2  . SER A 1 14  ? 32.442 -19.583 22.562 1.00 51.44 ? 14  SER A HB2  3  
ATOM 4447  H HB3  . SER A 1 14  ? 31.000 -18.575 22.691 1.00 61.53 ? 14  SER A HB3  3  
ATOM 4448  H HG   . SER A 1 14  ? 31.501 -20.493 20.933 1.00 42.31 ? 14  SER A HG   3  
ATOM 4449  N N    . ASP A 1 15  ? 35.004 -17.798 21.903 1.00 71.54 ? 15  ASP A N    3  
ATOM 4450  C CA   . ASP A 1 15  ? 36.377 -18.161 21.570 1.00 13.01 ? 15  ASP A CA   3  
ATOM 4451  C C    . ASP A 1 15  ? 36.784 -17.569 20.225 1.00 44.34 ? 15  ASP A C    3  
ATOM 4452  O O    . ASP A 1 15  ? 37.564 -18.166 19.484 1.00 41.55 ? 15  ASP A O    3  
ATOM 4453  C CB   . ASP A 1 15  ? 36.532 -19.682 21.540 1.00 60.22 ? 15  ASP A CB   3  
ATOM 4454  C CG   . ASP A 1 15  ? 36.729 -20.272 22.923 1.00 40.35 ? 15  ASP A CG   3  
ATOM 4455  O OD1  . ASP A 1 15  ? 37.823 -20.814 23.187 1.00 51.15 ? 15  ASP A OD1  3  
ATOM 4456  O OD2  . ASP A 1 15  ? 35.790 -20.190 23.741 1.00 33.21 ? 15  ASP A OD2  3  
ATOM 4457  H H    . ASP A 1 15  ? 34.827 -17.304 22.730 1.00 20.05 ? 15  ASP A H    3  
ATOM 4458  H HA   . ASP A 1 15  ? 37.021 -17.758 22.337 1.00 42.14 ? 15  ASP A HA   3  
ATOM 4459  H HB2  . ASP A 1 15  ? 35.645 -20.120 21.106 1.00 53.34 ? 15  ASP A HB2  3  
ATOM 4460  H HB3  . ASP A 1 15  ? 37.388 -19.938 20.933 1.00 23.13 ? 15  ASP A HB3  3  
ATOM 4461  N N    . ASN A 1 16  ? 36.250 -16.391 19.916 1.00 63.52 ? 16  ASN A N    3  
ATOM 4462  C CA   . ASN A 1 16  ? 36.557 -15.719 18.659 1.00 63.14 ? 16  ASN A CA   3  
ATOM 4463  C C    . ASN A 1 16  ? 36.094 -16.554 17.468 1.00 4.42  ? 16  ASN A C    3  
ATOM 4464  O O    . ASN A 1 16  ? 36.782 -16.639 16.450 1.00 13.42 ? 16  ASN A O    3  
ATOM 4465  C CB   . ASN A 1 16  ? 38.060 -15.450 18.554 1.00 71.24 ? 16  ASN A CB   3  
ATOM 4466  C CG   . ASN A 1 16  ? 38.658 -14.989 19.869 1.00 71.22 ? 16  ASN A CG   3  
ATOM 4467  O OD1  . ASN A 1 16  ? 38.158 -14.056 20.498 1.00 70.43 ? 16  ASN A OD1  3  
ATOM 4468  N ND2  . ASN A 1 16  ? 39.734 -15.643 20.290 1.00 3.34  ? 16  ASN A ND2  3  
ATOM 4469  H H    . ASN A 1 16  ? 35.635 -15.965 20.548 1.00 51.21 ? 16  ASN A H    3  
ATOM 4470  H HA   . ASN A 1 16  ? 36.031 -14.777 18.650 1.00 54.15 ? 16  ASN A HA   3  
ATOM 4471  H HB2  . ASN A 1 16  ? 38.562 -16.358 18.251 1.00 14.01 ? 16  ASN A HB2  3  
ATOM 4472  H HB3  . ASN A 1 16  ? 38.232 -14.684 17.812 1.00 30.44 ? 16  ASN A HB3  3  
ATOM 4473  H HD21 . ASN A 1 16  ? 40.078 -16.375 19.737 1.00 33.53 ? 16  ASN A HD21 3  
ATOM 4474  H HD22 . ASN A 1 16  ? 40.141 -15.366 21.138 1.00 51.20 ? 16  ASN A HD22 3  
ATOM 4475  N N    . LYS A 1 17  ? 34.924 -17.168 17.603 1.00 60.01 ? 17  LYS A N    3  
ATOM 4476  C CA   . LYS A 1 17  ? 34.366 -17.995 16.539 1.00 4.31  ? 17  LYS A CA   3  
ATOM 4477  C C    . LYS A 1 17  ? 32.903 -17.646 16.290 1.00 54.25 ? 17  LYS A C    3  
ATOM 4478  O O    . LYS A 1 17  ? 32.314 -16.842 17.014 1.00 64.32 ? 17  LYS A O    3  
ATOM 4479  C CB   . LYS A 1 17  ? 34.495 -19.477 16.897 1.00 75.12 ? 17  LYS A CB   3  
ATOM 4480  C CG   . LYS A 1 17  ? 35.743 -20.133 16.332 1.00 35.41 ? 17  LYS A CG   3  
ATOM 4481  C CD   . LYS A 1 17  ? 36.959 -19.857 17.199 1.00 1.44  ? 17  LYS A CD   3  
ATOM 4482  C CE   . LYS A 1 17  ? 38.172 -20.642 16.725 1.00 42.13 ? 17  LYS A CE   3  
ATOM 4483  N NZ   . LYS A 1 17  ? 39.352 -20.427 17.607 1.00 3.51  ? 17  LYS A NZ   3  
ATOM 4484  H H    . LYS A 1 17  ? 34.422 -17.062 18.439 1.00 61.03 ? 17  LYS A H    3  
ATOM 4485  H HA   . LYS A 1 17  ? 34.929 -17.800 15.639 1.00 71.55 ? 17  LYS A HA   3  
ATOM 4486  H HB2  . LYS A 1 17  ? 34.517 -19.575 17.972 1.00 34.02 ? 17  LYS A HB2  3  
ATOM 4487  H HB3  . LYS A 1 17  ? 33.632 -20.003 16.514 1.00 71.32 ? 17  LYS A HB3  3  
ATOM 4488  H HG2  . LYS A 1 17  ? 35.586 -21.201 16.281 1.00 14.42 ? 17  LYS A HG2  3  
ATOM 4489  H HG3  . LYS A 1 17  ? 35.924 -19.746 15.339 1.00 32.53 ? 17  LYS A HG3  3  
ATOM 4490  H HD2  . LYS A 1 17  ? 37.188 -18.802 17.157 1.00 23.24 ? 17  LYS A HD2  3  
ATOM 4491  H HD3  . LYS A 1 17  ? 36.735 -20.138 18.219 1.00 42.13 ? 17  LYS A HD3  3  
ATOM 4492  H HE2  . LYS A 1 17  ? 37.925 -21.692 16.719 1.00 70.32 ? 17  LYS A HE2  3  
ATOM 4493  H HE3  . LYS A 1 17  ? 38.420 -20.325 15.722 1.00 0.25  ? 17  LYS A HE3  3  
ATOM 4494  H HZ1  . LYS A 1 17  ? 39.452 -19.415 17.830 1.00 35.41 ? 17  LYS A HZ1  3  
ATOM 4495  H HZ2  . LYS A 1 17  ? 40.218 -20.751 17.131 1.00 21.35 ? 17  LYS A HZ2  3  
ATOM 4496  H HZ3  . LYS A 1 17  ? 39.237 -20.957 18.494 1.00 10.42 ? 17  LYS A HZ3  3  
ATOM 4497  N N    . ILE A 1 18  ? 32.321 -18.255 15.262 1.00 33.53 ? 18  ILE A N    3  
ATOM 4498  C CA   . ILE A 1 18  ? 30.925 -18.011 14.920 1.00 1.41  ? 18  ILE A CA   3  
ATOM 4499  C C    . ILE A 1 18  ? 30.234 -19.296 14.477 1.00 42.42 ? 18  ILE A C    3  
ATOM 4500  O O    . ILE A 1 18  ? 30.869 -20.199 13.930 1.00 4.54  ? 18  ILE A O    3  
ATOM 4501  C CB   . ILE A 1 18  ? 30.796 -16.959 13.802 1.00 72.40 ? 18  ILE A CB   3  
ATOM 4502  C CG1  . ILE A 1 18  ? 31.620 -15.716 14.143 1.00 63.42 ? 18  ILE A CG1  3  
ATOM 4503  C CG2  . ILE A 1 18  ? 29.335 -16.591 13.588 1.00 44.30 ? 18  ILE A CG2  3  
ATOM 4504  C CD1  . ILE A 1 18  ? 31.646 -14.686 13.036 1.00 61.15 ? 18  ILE A CD1  3  
ATOM 4505  H H    . ILE A 1 18  ? 32.842 -18.885 14.722 1.00 32.45 ? 18  ILE A H    3  
ATOM 4506  H HA   . ILE A 1 18  ? 30.428 -17.632 15.802 1.00 75.54 ? 18  ILE A HA   3  
ATOM 4507  H HB   . ILE A 1 18  ? 31.171 -17.392 12.887 1.00 52.31 ? 18  ILE A HB   3  
ATOM 4508  H HG12 . ILE A 1 18  ? 31.207 -15.248 15.022 1.00 52.54 ? 18  ILE A HG12 3  
ATOM 4509  H HG13 . ILE A 1 18  ? 32.639 -16.014 14.344 1.00 4.12  ? 18  ILE A HG13 3  
ATOM 4510  H HG21 . ILE A 1 18  ? 28.880 -16.359 14.539 1.00 13.43 ? 18  ILE A HG21 3  
ATOM 4511  H HG22 . ILE A 1 18  ? 29.273 -15.729 12.941 1.00 43.05 ? 18  ILE A HG22 3  
ATOM 4512  H HG23 . ILE A 1 18  ? 28.817 -17.421 13.133 1.00 31.35 ? 18  ILE A HG23 3  
ATOM 4513  H HD11 . ILE A 1 18  ? 32.640 -14.271 12.952 1.00 32.23 ? 18  ILE A HD11 3  
ATOM 4514  H HD12 . ILE A 1 18  ? 31.370 -15.153 12.102 1.00 3.12  ? 18  ILE A HD12 3  
ATOM 4515  H HD13 . ILE A 1 18  ? 30.945 -13.896 13.263 1.00 2.43  ? 18  ILE A HD13 3  
ATOM 4516  N N    . LEU A 1 19  ? 28.929 -19.371 14.714 1.00 62.03 ? 19  LEU A N    3  
ATOM 4517  C CA   . LEU A 1 19  ? 28.150 -20.545 14.337 1.00 32.31 ? 19  LEU A CA   3  
ATOM 4518  C C    . LEU A 1 19  ? 27.560 -20.382 12.940 1.00 71.10 ? 19  LEU A C    3  
ATOM 4519  O O    . LEU A 1 19  ? 27.482 -19.271 12.414 1.00 64.10 ? 19  LEU A O    3  
ATOM 4520  C CB   . LEU A 1 19  ? 27.030 -20.785 15.351 1.00 20.31 ? 19  LEU A CB   3  
ATOM 4521  C CG   . LEU A 1 19  ? 25.660 -20.214 14.985 1.00 35.43 ? 19  LEU A CG   3  
ATOM 4522  C CD1  . LEU A 1 19  ? 24.622 -20.609 16.025 1.00 71.54 ? 19  LEU A CD1  3  
ATOM 4523  C CD2  . LEU A 1 19  ? 25.731 -18.700 14.849 1.00 24.44 ? 19  LEU A CD2  3  
ATOM 4524  H H    . LEU A 1 19  ? 28.478 -18.620 15.152 1.00 62.00 ? 19  LEU A H    3  
ATOM 4525  H HA   . LEU A 1 19  ? 28.813 -21.397 14.337 1.00 24.23 ? 19  LEU A HA   3  
ATOM 4526  H HB2  . LEU A 1 19  ? 26.921 -21.851 15.477 1.00 71.40 ? 19  LEU A HB2  3  
ATOM 4527  H HB3  . LEU A 1 19  ? 27.334 -20.343 16.289 1.00 2.02  ? 19  LEU A HB3  3  
ATOM 4528  H HG   . LEU A 1 19  ? 25.349 -20.622 14.033 1.00 62.20 ? 19  LEU A HG   3  
ATOM 4529  H HD11 . LEU A 1 19  ? 25.114 -20.827 16.960 1.00 4.22  ? 19  LEU A HD11 3  
ATOM 4530  H HD12 . LEU A 1 19  ? 24.089 -21.486 15.686 1.00 0.31  ? 19  LEU A HD12 3  
ATOM 4531  H HD13 . LEU A 1 19  ? 23.925 -19.796 16.164 1.00 33.22 ? 19  LEU A HD13 3  
ATOM 4532  H HD21 . LEU A 1 19  ? 26.564 -18.327 15.427 1.00 43.14 ? 19  LEU A HD21 3  
ATOM 4533  H HD22 . LEU A 1 19  ? 24.814 -18.262 15.216 1.00 23.31 ? 19  LEU A HD22 3  
ATOM 4534  H HD23 . LEU A 1 19  ? 25.866 -18.438 13.811 1.00 63.33 ? 19  LEU A HD23 3  
ATOM 4535  N N    . CYS A 1 20  ? 27.144 -21.495 12.346 1.00 53.23 ? 20  CYS A N    3  
ATOM 4536  C CA   . CYS A 1 20  ? 26.559 -21.475 11.010 1.00 73.14 ? 20  CYS A CA   3  
ATOM 4537  C C    . CYS A 1 20  ? 25.325 -22.369 10.943 1.00 14.22 ? 20  CYS A C    3  
ATOM 4538  O O    . CYS A 1 20  ? 25.311 -23.467 11.498 1.00 32.10 ? 20  CYS A O    3  
ATOM 4539  C CB   . CYS A 1 20  ? 27.588 -21.928 9.973  1.00 31.30 ? 20  CYS A CB   3  
ATOM 4540  S SG   . CYS A 1 20  ? 26.872 -22.413 8.385  1.00 50.31 ? 20  CYS A SG   3  
ATOM 4541  H H    . CYS A 1 20  ? 27.232 -22.350 12.816 1.00 71.34 ? 20  CYS A H    3  
ATOM 4542  H HA   . CYS A 1 20  ? 26.265 -20.460 10.792 1.00 13.43 ? 20  CYS A HA   3  
ATOM 4543  H HB2  . CYS A 1 20  ? 28.281 -21.121 9.787  1.00 14.45 ? 20  CYS A HB2  3  
ATOM 4544  H HB3  . CYS A 1 20  ? 28.131 -22.776 10.363 1.00 73.41 ? 20  CYS A HB3  3  
ATOM 4545  H HG   . CYS A 1 20  ? 27.495 -23.506 7.972  1.00 3.13  ? 20  CYS A HG   3  
ATOM 4546  N N    . ALA A 1 21  ? 24.289 -21.889 10.262 1.00 62.31 ? 21  ALA A N    3  
ATOM 4547  C CA   . ALA A 1 21  ? 23.050 -22.645 10.123 1.00 44.33 ? 21  ALA A CA   3  
ATOM 4548  C C    . ALA A 1 21  ? 22.513 -22.560 8.698  1.00 21.51 ? 21  ALA A C    3  
ATOM 4549  O O    . ALA A 1 21  ? 22.796 -21.606 7.975  1.00 55.13 ? 21  ALA A O    3  
ATOM 4550  C CB   . ALA A 1 21  ? 22.010 -22.140 11.112 1.00 44.21 ? 21  ALA A CB   3  
ATOM 4551  H H    . ALA A 1 21  ? 24.361 -21.007 9.842  1.00 72.13 ? 21  ALA A H    3  
ATOM 4552  H HA   . ALA A 1 21  ? 23.262 -23.678 10.357 1.00 73.45 ? 21  ALA A HA   3  
ATOM 4553  H HB1  . ALA A 1 21  ? 21.817 -22.904 11.851 1.00 74.04 ? 21  ALA A HB1  3  
ATOM 4554  H HB2  . ALA A 1 21  ? 22.381 -21.251 11.601 1.00 74.30 ? 21  ALA A HB2  3  
ATOM 4555  H HB3  . ALA A 1 21  ? 21.097 -21.907 10.586 1.00 74.53 ? 21  ALA A HB3  3  
ATOM 4556  N N    . GLN A 1 22  ? 21.738 -23.565 8.302  1.00 25.43 ? 22  GLN A N    3  
ATOM 4557  C CA   . GLN A 1 22  ? 21.163 -23.604 6.963  1.00 23.30 ? 22  GLN A CA   3  
ATOM 4558  C C    . GLN A 1 22  ? 19.642 -23.515 7.021  1.00 10.31 ? 22  GLN A C    3  
ATOM 4559  O O    . GLN A 1 22  ? 18.958 -24.521 7.209  1.00 51.14 ? 22  GLN A O    3  
ATOM 4560  C CB   . GLN A 1 22  ? 21.583 -24.886 6.242  1.00 64.23 ? 22  GLN A CB   3  
ATOM 4561  C CG   . GLN A 1 22  ? 21.257 -24.884 4.757  1.00 12.21 ? 22  GLN A CG   3  
ATOM 4562  C CD   . GLN A 1 22  ? 22.421 -25.345 3.903  1.00 42.43 ? 22  GLN A CD   3  
ATOM 4563  O OE1  . GLN A 1 22  ? 23.306 -26.060 4.373  1.00 44.11 ? 22  GLN A OE1  3  
ATOM 4564  N NE2  . GLN A 1 22  ? 22.427 -24.937 2.639  1.00 14.51 ? 22  GLN A NE2  3  
ATOM 4565  H H    . GLN A 1 22  ? 21.550 -24.297 8.925  1.00 31.40 ? 22  GLN A H    3  
ATOM 4566  H HA   . GLN A 1 22  ? 21.541 -22.754 6.416  1.00 72.04 ? 22  GLN A HA   3  
ATOM 4567  H HB2  . GLN A 1 22  ? 22.649 -25.015 6.354  1.00 65.50 ? 22  GLN A HB2  3  
ATOM 4568  H HB3  . GLN A 1 22  ? 21.077 -25.724 6.698  1.00 62.11 ? 22  GLN A HB3  3  
ATOM 4569  H HG2  . GLN A 1 22  ? 20.420 -25.545 4.584  1.00 4.33  ? 22  GLN A HG2  3  
ATOM 4570  H HG3  . GLN A 1 22  ? 20.988 -23.880 4.463  1.00 71.13 ? 22  GLN A HG3  3  
ATOM 4571  H HE21 . GLN A 1 22  ? 21.689 -24.367 2.334  1.00 71.11 ? 22  GLN A HE21 3  
ATOM 4572  H HE22 . GLN A 1 22  ? 23.168 -25.219 2.065  1.00 55.34 ? 22  GLN A HE22 3  
ATOM 4573  N N    . ARG A 1 23  ? 19.119 -22.304 6.859  1.00 11.33 ? 23  ARG A N    3  
ATOM 4574  C CA   . ARG A 1 23  ? 17.678 -22.083 6.895  1.00 3.30  ? 23  ARG A CA   3  
ATOM 4575  C C    . ARG A 1 23  ? 17.318 -20.741 6.264  1.00 2.10  ? 23  ARG A C    3  
ATOM 4576  O O    . ARG A 1 23  ? 18.196 -19.952 5.916  1.00 45.22 ? 23  ARG A O    3  
ATOM 4577  C CB   . ARG A 1 23  ? 17.169 -22.134 8.337  1.00 54.35 ? 23  ARG A CB   3  
ATOM 4578  C CG   . ARG A 1 23  ? 15.763 -22.696 8.466  1.00 75.22 ? 23  ARG A CG   3  
ATOM 4579  C CD   . ARG A 1 23  ? 15.457 -23.109 9.897  1.00 11.53 ? 23  ARG A CD   3  
ATOM 4580  N NE   . ARG A 1 23  ? 14.437 -24.152 9.960  1.00 21.05 ? 23  ARG A NE   3  
ATOM 4581  C CZ   . ARG A 1 23  ? 13.139 -23.921 9.800  1.00 32.43 ? 23  ARG A CZ   3  
ATOM 4582  N NH1  . ARG A 1 23  ? 12.704 -22.690 9.568  1.00 25.42 ? 23  ARG A NH1  3  
ATOM 4583  N NH2  . ARG A 1 23  ? 12.272 -24.923 9.872  1.00 71.53 ? 23  ARG A NH2  3  
ATOM 4584  H H    . ARG A 1 23  ? 19.716 -21.540 6.713  1.00 31.33 ? 23  ARG A H    3  
ATOM 4585  H HA   . ARG A 1 23  ? 17.207 -22.872 6.328  1.00 3.30  ? 23  ARG A HA   3  
ATOM 4586  H HB2  . ARG A 1 23  ? 17.835 -22.752 8.920  1.00 12.12 ? 23  ARG A HB2  3  
ATOM 4587  H HB3  . ARG A 1 23  ? 17.171 -21.133 8.742  1.00 63.11 ? 23  ARG A HB3  3  
ATOM 4588  H HG2  . ARG A 1 23  ? 15.053 -21.941 8.161  1.00 0.14  ? 23  ARG A HG2  3  
ATOM 4589  H HG3  . ARG A 1 23  ? 15.670 -23.560 7.824  1.00 40.51 ? 23  ARG A HG3  3  
ATOM 4590  H HD2  . ARG A 1 23  ? 16.364 -23.477 10.353 1.00 12.01 ? 23  ARG A HD2  3  
ATOM 4591  H HD3  . ARG A 1 23  ? 15.108 -22.243 10.440 1.00 55.10 ? 23  ARG A HD3  3  
ATOM 4592  H HE   . ARG A 1 23  ? 14.736 -25.069 10.131 1.00 21.11 ? 23  ARG A HE   3  
ATOM 4593  H HH11 . ARG A 1 23  ? 13.355 -21.934 9.513  1.00 44.42 ? 23  ARG A HH11 3  
ATOM 4594  H HH12 . ARG A 1 23  ? 11.726 -22.520 9.447  1.00 43.43 ? 23  ARG A HH12 3  
ATOM 4595  H HH21 . ARG A 1 23  ? 12.596 -25.853 10.046 1.00 13.24 ? 23  ARG A HH21 3  
ATOM 4596  H HH22 . ARG A 1 23  ? 11.295 -24.749 9.751  1.00 2.12  ? 23  ARG A HH22 3  
ATOM 4597  N N    . SER A 1 24  ? 16.021 -20.490 6.120  1.00 50.25 ? 24  SER A N    3  
ATOM 4598  C CA   . SER A 1 24  ? 15.545 -19.246 5.527  1.00 53.35 ? 24  SER A CA   3  
ATOM 4599  C C    . SER A 1 24  ? 15.811 -19.223 4.024  1.00 34.14 ? 24  SER A C    3  
ATOM 4600  O O    . SER A 1 24  ? 16.081 -18.170 3.447  1.00 30.44 ? 24  SER A O    3  
ATOM 4601  C CB   . SER A 1 24  ? 16.221 -18.046 6.194  1.00 72.33 ? 24  SER A CB   3  
ATOM 4602  O OG   . SER A 1 24  ? 15.260 -17.138 6.704  1.00 21.21 ? 24  SER A OG   3  
ATOM 4603  H H    . SER A 1 24  ? 15.369 -21.159 6.417  1.00 51.33 ? 24  SER A H    3  
ATOM 4604  H HA   . SER A 1 24  ? 14.479 -19.186 5.693  1.00 44.14 ? 24  SER A HA   3  
ATOM 4605  H HB2  . SER A 1 24  ? 16.840 -18.392 7.008  1.00 54.04 ? 24  SER A HB2  3  
ATOM 4606  H HB3  . SER A 1 24  ? 16.834 -17.533 5.468  1.00 44.24 ? 24  SER A HB3  3  
ATOM 4607  H HG   . SER A 1 24  ? 15.538 -16.831 7.570  1.00 42.20 ? 24  SER A HG   3  
ATOM 4608  N N    . GLU A 1 25  ? 15.732 -20.393 3.398  1.00 35.11 ? 25  GLU A N    3  
ATOM 4609  C CA   . GLU A 1 25  ? 15.965 -20.508 1.963  1.00 15.12 ? 25  GLU A CA   3  
ATOM 4610  C C    . GLU A 1 25  ? 15.047 -19.568 1.186  1.00 23.01 ? 25  GLU A C    3  
ATOM 4611  O O    . GLU A 1 25  ? 15.389 -19.108 0.096  1.00 23.15 ? 25  GLU A O    3  
ATOM 4612  C CB   . GLU A 1 25  ? 15.744 -21.950 1.502  1.00 20.11 ? 25  GLU A CB   3  
ATOM 4613  C CG   . GLU A 1 25  ? 15.755 -22.115 -0.008 1.00 41.44 ? 25  GLU A CG   3  
ATOM 4614  C CD   . GLU A 1 25  ? 15.484 -23.542 -0.442 1.00 23.32 ? 25  GLU A CD   3  
ATOM 4615  O OE1  . GLU A 1 25  ? 14.645 -23.738 -1.345 1.00 72.25 ? 25  GLU A OE1  3  
ATOM 4616  O OE2  . GLU A 1 25  ? 16.111 -24.463 0.122  1.00 21.24 ? 25  GLU A OE2  3  
ATOM 4617  H H    . GLU A 1 25  ? 15.512 -21.197 3.913  1.00 70.41 ? 25  GLU A H    3  
ATOM 4618  H HA   . GLU A 1 25  ? 16.990 -20.231 1.771  1.00 70.24 ? 25  GLU A HA   3  
ATOM 4619  H HB2  . GLU A 1 25  ? 16.524 -22.571 1.917  1.00 32.53 ? 25  GLU A HB2  3  
ATOM 4620  H HB3  . GLU A 1 25  ? 14.789 -22.291 1.873  1.00 31.41 ? 25  GLU A HB3  3  
ATOM 4621  H HG2  . GLU A 1 25  ? 14.995 -21.476 -0.433 1.00 2.21  ? 25  GLU A HG2  3  
ATOM 4622  H HG3  . GLU A 1 25  ? 16.724 -21.818 -0.383 1.00 13.30 ? 25  GLU A HG3  3  
ATOM 4623  N N    . LYS A 1 26  ? 13.879 -19.287 1.754  1.00 24.22 ? 26  LYS A N    3  
ATOM 4624  C CA   . LYS A 1 26  ? 12.911 -18.402 1.117  1.00 24.23 ? 26  LYS A CA   3  
ATOM 4625  C C    . LYS A 1 26  ? 13.266 -16.939 1.365  1.00 62.50 ? 26  LYS A C    3  
ATOM 4626  O O    . LYS A 1 26  ? 12.946 -16.068 0.557  1.00 34.22 ? 26  LYS A O    3  
ATOM 4627  C CB   . LYS A 1 26  ? 11.503 -18.692 1.641  1.00 71.03 ? 26  LYS A CB   3  
ATOM 4628  C CG   . LYS A 1 26  ? 11.169 -20.173 1.699  1.00 15.55 ? 26  LYS A CG   3  
ATOM 4629  C CD   . LYS A 1 26  ? 9.705  -20.427 1.379  1.00 1.22  ? 26  LYS A CD   3  
ATOM 4630  C CE   . LYS A 1 26  ? 9.278  -21.825 1.797  1.00 31.45 ? 26  LYS A CE   3  
ATOM 4631  N NZ   . LYS A 1 26  ? 7.876  -22.122 1.392  1.00 11.41 ? 26  LYS A NZ   3  
ATOM 4632  H H    . LYS A 1 26  ? 13.663 -19.685 2.624  1.00 5.43  ? 26  LYS A H    3  
ATOM 4633  H HA   . LYS A 1 26  ? 12.937 -18.592 0.055  1.00 45.51 ? 26  LYS A HA   3  
ATOM 4634  H HB2  . LYS A 1 26  ? 11.411 -18.284 2.636  1.00 13.43 ? 26  LYS A HB2  3  
ATOM 4635  H HB3  . LYS A 1 26  ? 10.785 -18.208 0.994  1.00 10.24 ? 26  LYS A HB3  3  
ATOM 4636  H HG2  . LYS A 1 26  ? 11.780 -20.699 0.982  1.00 74.23 ? 26  LYS A HG2  3  
ATOM 4637  H HG3  . LYS A 1 26  ? 11.379 -20.541 2.694  1.00 44.44 ? 26  LYS A HG3  3  
ATOM 4638  H HD2  . LYS A 1 26  ? 9.099  -19.705 1.906  1.00 22.05 ? 26  LYS A HD2  3  
ATOM 4639  H HD3  . LYS A 1 26  ? 9.554  -20.317 0.314  1.00 3.05  ? 26  LYS A HD3  3  
ATOM 4640  H HE2  . LYS A 1 26  ? 9.937  -22.543 1.333  1.00 11.13 ? 26  LYS A HE2  3  
ATOM 4641  H HE3  . LYS A 1 26  ? 9.358  -21.906 2.872  1.00 52.44 ? 26  LYS A HE3  3  
ATOM 4642  H HZ1  . LYS A 1 26  ? 7.759  -23.143 1.233  1.00 54.33 ? 26  LYS A HZ1  3  
ATOM 4643  H HZ2  . LYS A 1 26  ? 7.644  -21.616 0.513  1.00 33.34 ? 26  LYS A HZ2  3  
ATOM 4644  H HZ3  . LYS A 1 26  ? 7.217  -21.820 2.138  1.00 52.24 ? 26  LYS A HZ3  3  
ATOM 4645  N N    . MET A 1 27  ? 13.931 -16.678 2.486  1.00 73.12 ? 27  MET A N    3  
ATOM 4646  C CA   . MET A 1 27  ? 14.331 -15.321 2.838  1.00 42.35 ? 27  MET A CA   3  
ATOM 4647  C C    . MET A 1 27  ? 15.764 -15.044 2.392  1.00 13.04 ? 27  MET A C    3  
ATOM 4648  O O    . MET A 1 27  ? 15.992 -14.404 1.366  1.00 60.53 ? 27  MET A O    3  
ATOM 4649  C CB   . MET A 1 27  ? 14.202 -15.103 4.346  1.00 5.23  ? 27  MET A CB   3  
ATOM 4650  C CG   . MET A 1 27  ? 12.766 -15.125 4.843  1.00 21.22 ? 27  MET A CG   3  
ATOM 4651  S SD   . MET A 1 27  ? 12.654 -15.163 6.642  1.00 0.34  ? 27  MET A SD   3  
ATOM 4652  C CE   . MET A 1 27  ? 13.879 -13.933 7.084  1.00 43.14 ? 27  MET A CE   3  
ATOM 4653  H H    . MET A 1 27  ? 14.158 -17.415 3.091  1.00 42.02 ? 27  MET A H    3  
ATOM 4654  H HA   . MET A 1 27  ? 13.670 -14.638 2.327  1.00 55.54 ? 27  MET A HA   3  
ATOM 4655  H HB2  . MET A 1 27  ? 14.750 -15.880 4.858  1.00 11.03 ? 27  MET A HB2  3  
ATOM 4656  H HB3  . MET A 1 27  ? 14.632 -14.145 4.598  1.00 4.21  ? 27  MET A HB3  3  
ATOM 4657  H HG2  . MET A 1 27  ? 12.261 -14.241 4.484  1.00 12.02 ? 27  MET A HG2  3  
ATOM 4658  H HG3  . MET A 1 27  ? 12.277 -16.003 4.447  1.00 53.40 ? 27  MET A HG3  3  
ATOM 4659  H HE1  . MET A 1 27  ? 14.868 -14.331 6.911  1.00 70.43 ? 27  MET A HE1  3  
ATOM 4660  H HE2  . MET A 1 27  ? 13.736 -13.050 6.479  1.00 1.41  ? 27  MET A HE2  3  
ATOM 4661  H HE3  . MET A 1 27  ? 13.772 -13.677 8.128  1.00 52.22 ? 27  MET A HE3  3  
ATOM 4662  N N    . SER A 1 28  ? 16.725 -15.529 3.172  1.00 60.35 ? 28  SER A N    3  
ATOM 4663  C CA   . SER A 1 28  ? 18.135 -15.330 2.859  1.00 25.33 ? 28  SER A CA   3  
ATOM 4664  C C    . SER A 1 28  ? 18.643 -16.421 1.921  1.00 23.13 ? 28  SER A C    3  
ATOM 4665  O O    . SER A 1 28  ? 17.863 -17.211 1.388  1.00 53.42 ? 28  SER A O    3  
ATOM 4666  C CB   . SER A 1 28  ? 18.967 -15.318 4.143  1.00 21.24 ? 28  SER A CB   3  
ATOM 4667  O OG   . SER A 1 28  ? 18.579 -14.252 4.992  1.00 31.13 ? 28  SER A OG   3  
ATOM 4668  H H    . SER A 1 28  ? 16.479 -16.031 3.977  1.00 24.01 ? 28  SER A H    3  
ATOM 4669  H HA   . SER A 1 28  ? 18.234 -14.374 2.367  1.00 24.14 ? 28  SER A HA   3  
ATOM 4670  H HB2  . SER A 1 28  ? 18.827 -16.250 4.669  1.00 35.40 ? 28  SER A HB2  3  
ATOM 4671  H HB3  . SER A 1 28  ? 20.011 -15.201 3.892  1.00 42.45 ? 28  SER A HB3  3  
ATOM 4672  H HG   . SER A 1 28  ? 17.677 -13.993 4.789  1.00 2.13  ? 28  SER A HG   3  
ATOM 4673  N N    . LEU A 1 29  ? 19.957 -16.459 1.724  1.00 15.15 ? 29  LEU A N    3  
ATOM 4674  C CA   . LEU A 1 29  ? 20.571 -17.453 0.851  1.00 50.52 ? 29  LEU A CA   3  
ATOM 4675  C C    . LEU A 1 29  ? 21.426 -18.429 1.653  1.00 53.42 ? 29  LEU A C    3  
ATOM 4676  O O    . LEU A 1 29  ? 22.656 -18.382 1.626  1.00 13.10 ? 29  LEU A O    3  
ATOM 4677  C CB   . LEU A 1 29  ? 21.426 -16.764 -0.215 1.00 21.53 ? 29  LEU A CB   3  
ATOM 4678  C CG   . LEU A 1 29  ? 20.929 -15.402 -0.697 1.00 54.54 ? 29  LEU A CG   3  
ATOM 4679  C CD1  . LEU A 1 29  ? 21.774 -14.906 -1.861 1.00 32.24 ? 29  LEU A CD1  3  
ATOM 4680  C CD2  . LEU A 1 29  ? 19.462 -15.480 -1.097 1.00 3.25  ? 29  LEU A CD2  3  
ATOM 4681  H H    . LEU A 1 29  ? 20.527 -15.804 2.177  1.00 43.21 ? 29  LEU A H    3  
ATOM 4682  H HA   . LEU A 1 29  ? 19.778 -18.002 0.365  1.00 3.11  ? 29  LEU A HA   3  
ATOM 4683  H HB2  . LEU A 1 29  ? 22.416 -16.629 0.193  1.00 62.43 ? 29  LEU A HB2  3  
ATOM 4684  H HB3  . LEU A 1 29  ? 21.478 -17.422 -1.071 1.00 54.53 ? 29  LEU A HB3  3  
ATOM 4685  H HG   . LEU A 1 29  ? 21.019 -14.686 0.109  1.00 61.25 ? 29  LEU A HG   3  
ATOM 4686  H HD11 . LEU A 1 29  ? 21.264 -14.093 -2.355 1.00 63.33 ? 29  LEU A HD11 3  
ATOM 4687  H HD12 . LEU A 1 29  ? 21.930 -15.713 -2.561 1.00 72.04 ? 29  LEU A HD12 3  
ATOM 4688  H HD13 . LEU A 1 29  ? 22.729 -14.562 -1.491 1.00 15.33 ? 29  LEU A HD13 3  
ATOM 4689  H HD21 . LEU A 1 29  ? 19.191 -16.511 -1.270 1.00 5.13  ? 29  LEU A HD21 3  
ATOM 4690  H HD22 . LEU A 1 29  ? 19.304 -14.910 -2.001 1.00 5.43  ? 29  LEU A HD22 3  
ATOM 4691  H HD23 . LEU A 1 29  ? 18.851 -15.075 -0.304 1.00 23.04 ? 29  LEU A HD23 3  
ATOM 4692  N N    . PRO A 1 30  ? 20.761 -19.336 2.383  1.00 74.54 ? 30  PRO A N    3  
ATOM 4693  C CA   . PRO A 1 30  ? 21.439 -20.343 3.204  1.00 65.21 ? 30  PRO A CA   3  
ATOM 4694  C C    . PRO A 1 30  ? 22.149 -21.397 2.361  1.00 40.15 ? 30  PRO A C    3  
ATOM 4695  O O    . PRO A 1 30  ? 22.878 -22.240 2.886  1.00 41.54 ? 30  PRO A O    3  
ATOM 4696  C CB   . PRO A 1 30  ? 20.298 -20.977 4.003  1.00 62.40 ? 30  PRO A CB   3  
ATOM 4697  C CG   . PRO A 1 30  ? 19.085 -20.762 3.166  1.00 33.31 ? 30  PRO A CG   3  
ATOM 4698  C CD   . PRO A 1 30  ? 19.295 -19.450 2.462  1.00 74.42 ? 30  PRO A CD   3  
ATOM 4699  H HA   . PRO A 1 30  ? 22.148 -19.890 3.882  1.00 14.02 ? 30  PRO A HA   3  
ATOM 4700  H HB2  . PRO A 1 30  ? 20.498 -22.030 4.147  1.00 1.14  ? 30  PRO A HB2  3  
ATOM 4701  H HB3  . PRO A 1 30  ? 20.209 -20.487 4.961  1.00 71.52 ? 30  PRO A HB3  3  
ATOM 4702  H HG2  . PRO A 1 30  ? 18.987 -21.562 2.448  1.00 62.10 ? 30  PRO A HG2  3  
ATOM 4703  H HG3  . PRO A 1 30  ? 18.209 -20.713 3.796  1.00 12.11 ? 30  PRO A HG3  3  
ATOM 4704  H HD2  . PRO A 1 30  ? 18.856 -19.477 1.475  1.00 20.33 ? 30  PRO A HD2  3  
ATOM 4705  H HD3  . PRO A 1 30  ? 18.876 -18.640 3.041  1.00 64.13 ? 30  PRO A HD3  3  
ATOM 4706  N N    . LEU A 1 31  ? 21.932 -21.344 1.051  1.00 30.20 ? 31  LEU A N    3  
ATOM 4707  C CA   . LEU A 1 31  ? 22.552 -22.294 0.134  1.00 73.41 ? 31  LEU A CA   3  
ATOM 4708  C C    . LEU A 1 31  ? 24.053 -22.391 0.383  1.00 64.50 ? 31  LEU A C    3  
ATOM 4709  O O    . LEU A 1 31  ? 24.650 -23.457 0.231  1.00 41.15 ? 31  LEU A O    3  
ATOM 4710  C CB   . LEU A 1 31  ? 22.289 -21.880 -1.315 1.00 62.21 ? 31  LEU A CB   3  
ATOM 4711  C CG   . LEU A 1 31  ? 20.854 -21.471 -1.647 1.00 34.42 ? 31  LEU A CG   3  
ATOM 4712  C CD1  . LEU A 1 31  ? 20.693 -21.254 -3.143 1.00 73.23 ? 31  LEU A CD1  3  
ATOM 4713  C CD2  . LEU A 1 31  ? 19.872 -22.522 -1.150 1.00 35.31 ? 31  LEU A CD2  3  
ATOM 4714  H H    . LEU A 1 31  ? 21.341 -20.650 0.691  1.00 24.33 ? 31  LEU A H    3  
ATOM 4715  H HA   . LEU A 1 31  ? 22.107 -23.262 0.309  1.00 34.53 ? 31  LEU A HA   3  
ATOM 4716  H HB2  . LEU A 1 31  ? 22.932 -21.043 -1.541 1.00 73.21 ? 31  LEU A HB2  3  
ATOM 4717  H HB3  . LEU A 1 31  ? 22.552 -22.715 -1.949 1.00 73.05 ? 31  LEU A HB3  3  
ATOM 4718  H HG   . LEU A 1 31  ? 20.627 -20.539 -1.148 1.00 43.35 ? 31  LEU A HG   3  
ATOM 4719  H HD11 . LEU A 1 31  ? 20.761 -22.203 -3.654 1.00 43.41 ? 31  LEU A HD11 3  
ATOM 4720  H HD12 . LEU A 1 31  ? 21.473 -20.597 -3.498 1.00 21.15 ? 31  LEU A HD12 3  
ATOM 4721  H HD13 . LEU A 1 31  ? 19.729 -20.807 -3.340 1.00 63.15 ? 31  LEU A HD13 3  
ATOM 4722  H HD21 . LEU A 1 31  ? 19.176 -22.766 -1.939 1.00 60.14 ? 31  LEU A HD21 3  
ATOM 4723  H HD22 . LEU A 1 31  ? 19.329 -22.134 -0.300 1.00 21.54 ? 31  LEU A HD22 3  
ATOM 4724  H HD23 . LEU A 1 31  ? 20.412 -23.411 -0.858 1.00 52.44 ? 31  LEU A HD23 3  
ATOM 4725  N N    . MET A 1 32  ? 24.657 -21.272 0.769  1.00 65.41 ? 32  MET A N    3  
ATOM 4726  C CA   . MET A 1 32  ? 26.089 -21.233 1.043  1.00 43.33 ? 32  MET A CA   3  
ATOM 4727  C C    . MET A 1 32  ? 26.354 -20.906 2.509  1.00 34.52 ? 32  MET A C    3  
ATOM 4728  O O    . MET A 1 32  ? 27.193 -21.536 3.153  1.00 35.41 ? 32  MET A O    3  
ATOM 4729  C CB   . MET A 1 32  ? 26.773 -20.198 0.147  1.00 61.12 ? 32  MET A CB   3  
ATOM 4730  C CG   . MET A 1 32  ? 26.014 -18.885 0.046  1.00 72.12 ? 32  MET A CG   3  
ATOM 4731  S SD   . MET A 1 32  ? 26.866 -17.667 -0.974 1.00 1.52  ? 32  MET A SD   3  
ATOM 4732  C CE   . MET A 1 32  ? 26.037 -16.162 -0.468 1.00 14.13 ? 32  MET A CE   3  
ATOM 4733  H H    . MET A 1 32  ? 24.128 -20.454 0.873  1.00 5.11  ? 32  MET A H    3  
ATOM 4734  H HA   . MET A 1 32  ? 26.495 -22.209 0.824  1.00 3.14  ? 32  MET A HA   3  
ATOM 4735  H HB2  . MET A 1 32  ? 27.756 -19.991 0.542  1.00 44.02 ? 32  MET A HB2  3  
ATOM 4736  H HB3  . MET A 1 32  ? 26.872 -20.609 -0.847 1.00 0.40  ? 32  MET A HB3  3  
ATOM 4737  H HG2  . MET A 1 32  ? 25.043 -19.078 -0.386 1.00 11.13 ? 32  MET A HG2  3  
ATOM 4738  H HG3  . MET A 1 32  ? 25.890 -18.480 1.039  1.00 33.13 ? 32  MET A HG3  3  
ATOM 4739  H HE1  . MET A 1 32  ? 26.770 -15.434 -0.153 1.00 62.52 ? 32  MET A HE1  3  
ATOM 4740  H HE2  . MET A 1 32  ? 25.470 -15.767 -1.298 1.00 5.40  ? 32  MET A HE2  3  
ATOM 4741  H HE3  . MET A 1 32  ? 25.369 -16.378 0.354  1.00 71.33 ? 32  MET A HE3  3  
ATOM 4742  N N    . TRP A 1 33  ? 25.633 -19.920 3.030  1.00 44.41 ? 33  TRP A N    3  
ATOM 4743  C CA   . TRP A 1 33  ? 25.791 -19.510 4.421  1.00 61.21 ? 33  TRP A CA   3  
ATOM 4744  C C    . TRP A 1 33  ? 24.535 -18.810 4.928  1.00 22.10 ? 33  TRP A C    3  
ATOM 4745  O O    . TRP A 1 33  ? 23.724 -18.326 4.140  1.00 12.41 ? 33  TRP A O    3  
ATOM 4746  C CB   . TRP A 1 33  ? 27.000 -18.585 4.568  1.00 63.03 ? 33  TRP A CB   3  
ATOM 4747  C CG   . TRP A 1 33  ? 28.310 -19.281 4.352  1.00 42.33 ? 33  TRP A CG   3  
ATOM 4748  C CD1  . TRP A 1 33  ? 29.025 -19.339 3.189  1.00 20.45 ? 33  TRP A CD1  3  
ATOM 4749  C CD2  . TRP A 1 33  ? 29.060 -20.018 5.324  1.00 54.33 ? 33  TRP A CD2  3  
ATOM 4750  N NE1  . TRP A 1 33  ? 30.174 -20.069 3.381  1.00 52.34 ? 33  TRP A NE1  3  
ATOM 4751  C CE2  . TRP A 1 33  ? 30.219 -20.495 4.681  1.00 31.15 ? 33  TRP A CE2  3  
ATOM 4752  C CE3  . TRP A 1 33  ? 28.865 -20.319 6.674  1.00 25.23 ? 33  TRP A CE3  3  
ATOM 4753  C CZ2  . TRP A 1 33  ? 31.177 -21.257 5.345  1.00 74.40 ? 33  TRP A CZ2  3  
ATOM 4754  C CZ3  . TRP A 1 33  ? 29.817 -21.076 7.331  1.00 32.13 ? 33  TRP A CZ3  3  
ATOM 4755  C CH2  . TRP A 1 33  ? 30.961 -21.538 6.667  1.00 51.41 ? 33  TRP A CH2  3  
ATOM 4756  H H    . TRP A 1 33  ? 24.980 -19.455 2.466  1.00 51.11 ? 33  TRP A H    3  
ATOM 4757  H HA   . TRP A 1 33  ? 25.956 -20.400 5.011  1.00 43.14 ? 33  TRP A HA   3  
ATOM 4758  H HB2  . TRP A 1 33  ? 26.924 -17.786 3.846  1.00 42.03 ? 33  TRP A HB2  3  
ATOM 4759  H HB3  . TRP A 1 33  ? 27.005 -18.166 5.564  1.00 73.23 ? 33  TRP A HB3  3  
ATOM 4760  H HD1  . TRP A 1 33  ? 28.719 -18.877 2.263  1.00 31.44 ? 33  TRP A HD1  3  
ATOM 4761  H HE1  . TRP A 1 33  ? 30.851 -20.252 2.696  1.00 5.02  ? 33  TRP A HE1  3  
ATOM 4762  H HE3  . TRP A 1 33  ? 27.990 -19.972 7.204  1.00 62.43 ? 33  TRP A HE3  3  
ATOM 4763  H HZ2  . TRP A 1 33  ? 32.064 -21.620 4.847  1.00 60.00 ? 33  TRP A HZ2  3  
ATOM 4764  H HZ3  . TRP A 1 33  ? 29.683 -21.319 8.375  1.00 25.53 ? 33  TRP A HZ3  3  
ATOM 4765  H HH2  . TRP A 1 33  ? 31.677 -22.126 7.219  1.00 2.34  ? 33  TRP A HH2  3  
ATOM 4766  N N    . GLU A 1 34  ? 24.382 -18.761 6.248  1.00 42.33 ? 34  GLU A N    3  
ATOM 4767  C CA   . GLU A 1 34  ? 23.223 -18.120 6.858  1.00 5.41  ? 34  GLU A CA   3  
ATOM 4768  C C    . GLU A 1 34  ? 23.336 -18.128 8.380  1.00 40.21 ? 34  GLU A C    3  
ATOM 4769  O O    . GLU A 1 34  ? 24.327 -18.600 8.938  1.00 73.22 ? 34  GLU A O    3  
ATOM 4770  C CB   . GLU A 1 34  ? 21.936 -18.825 6.427  1.00 21.51 ? 34  GLU A CB   3  
ATOM 4771  C CG   . GLU A 1 34  ? 20.969 -17.924 5.679  1.00 15.44 ? 34  GLU A CG   3  
ATOM 4772  C CD   . GLU A 1 34  ? 20.069 -17.134 6.610  1.00 1.14  ? 34  GLU A CD   3  
ATOM 4773  O OE1  . GLU A 1 34  ? 20.406 -15.971 6.917  1.00 71.31 ? 34  GLU A OE1  3  
ATOM 4774  O OE2  . GLU A 1 34  ? 19.028 -17.679 7.032  1.00 33.32 ? 34  GLU A OE2  3  
ATOM 4775  H H    . GLU A 1 34  ? 25.064 -19.165 6.824  1.00 72.22 ? 34  GLU A H    3  
ATOM 4776  H HA   . GLU A 1 34  ? 23.193 -17.096 6.517  1.00 10.21 ? 34  GLU A HA   3  
ATOM 4777  H HB2  . GLU A 1 34  ? 22.192 -19.655 5.785  1.00 24.42 ? 34  GLU A HB2  3  
ATOM 4778  H HB3  . GLU A 1 34  ? 21.436 -19.204 7.307  1.00 41.35 ? 34  GLU A HB3  3  
ATOM 4779  H HG2  . GLU A 1 34  ? 21.535 -17.230 5.077  1.00 3.52  ? 34  GLU A HG2  3  
ATOM 4780  H HG3  . GLU A 1 34  ? 20.350 -18.534 5.037  1.00 5.14  ? 34  GLU A HG3  3  
ATOM 4781  N N    . PHE A 1 35  ? 22.314 -17.601 9.046  1.00 53.13 ? 35  PHE A N    3  
ATOM 4782  C CA   . PHE A 1 35  ? 22.297 -17.546 10.503 1.00 45.51 ? 35  PHE A CA   3  
ATOM 4783  C C    . PHE A 1 35  ? 20.925 -17.933 11.047 1.00 44.14 ? 35  PHE A C    3  
ATOM 4784  O O    . PHE A 1 35  ? 19.911 -17.859 10.353 1.00 41.24 ? 35  PHE A O    3  
ATOM 4785  C CB   . PHE A 1 35  ? 22.672 -16.143 10.985 1.00 2.33  ? 35  PHE A CB   3  
ATOM 4786  C CG   . PHE A 1 35  ? 24.154 -15.903 11.038 1.00 40.32 ? 35  PHE A CG   3  
ATOM 4787  C CD1  . PHE A 1 35  ? 24.742 -14.940 10.233 1.00 23.32 ? 35  PHE A CD1  3  
ATOM 4788  C CD2  . PHE A 1 35  ? 24.959 -16.640 11.891 1.00 33.14 ? 35  PHE A CD2  3  
ATOM 4789  C CE1  . PHE A 1 35  ? 26.106 -14.717 10.279 1.00 14.33 ? 35  PHE A CE1  3  
ATOM 4790  C CE2  . PHE A 1 35  ? 26.322 -16.421 11.942 1.00 3.31  ? 35  PHE A CE2  3  
ATOM 4791  C CZ   . PHE A 1 35  ? 26.897 -15.459 11.134 1.00 14.23 ? 35  PHE A CZ   3  
ATOM 4792  H H    . PHE A 1 35  ? 21.552 -17.240 8.545  1.00 42.12 ? 35  PHE A H    3  
ATOM 4793  H HA   . PHE A 1 35  ? 23.028 -18.250 10.869 1.00 44.14 ? 35  PHE A HA   3  
ATOM 4794  H HB2  . PHE A 1 35  ? 22.242 -15.413 10.316 1.00 1.32  ? 35  PHE A HB2  3  
ATOM 4795  H HB3  . PHE A 1 35  ? 22.275 -15.993 11.978 1.00 61.40 ? 35  PHE A HB3  3  
ATOM 4796  H HD1  . PHE A 1 35  ? 24.124 -14.359 9.563  1.00 31.24 ? 35  PHE A HD1  3  
ATOM 4797  H HD2  . PHE A 1 35  ? 24.511 -17.394 12.523 1.00 44.50 ? 35  PHE A HD2  3  
ATOM 4798  H HE1  . PHE A 1 35  ? 26.551 -13.964 9.646  1.00 0.22  ? 35  PHE A HE1  3  
ATOM 4799  H HE2  . PHE A 1 35  ? 26.939 -17.002 12.611 1.00 33.42 ? 35  PHE A HE2  3  
ATOM 4800  H HZ   . PHE A 1 35  ? 27.962 -15.285 11.172 1.00 34.34 ? 35  PHE A HZ   3  
ATOM 4801  N N    . PRO A 1 36  ? 20.892 -18.357 12.319 1.00 72.14 ? 36  PRO A N    3  
ATOM 4802  C CA   . PRO A 1 36  ? 19.651 -18.765 12.985 1.00 42.15 ? 36  PRO A CA   3  
ATOM 4803  C C    . PRO A 1 36  ? 18.721 -17.586 13.250 1.00 3.12  ? 36  PRO A C    3  
ATOM 4804  O O    . PRO A 1 36  ? 19.167 -16.506 13.637 1.00 33.41 ? 36  PRO A O    3  
ATOM 4805  C CB   . PRO A 1 36  ? 20.139 -19.369 14.304 1.00 72.23 ? 36  PRO A CB   3  
ATOM 4806  C CG   . PRO A 1 36  ? 21.453 -18.714 14.558 1.00 74.24 ? 36  PRO A CG   3  
ATOM 4807  C CD   . PRO A 1 36  ? 22.062 -18.471 13.205 1.00 43.22 ? 36  PRO A CD   3  
ATOM 4808  H HA   . PRO A 1 36  ? 19.124 -19.517 12.415 1.00 10.44 ? 36  PRO A HA   3  
ATOM 4809  H HB2  . PRO A 1 36  ? 19.428 -19.149 15.088 1.00 43.31 ? 36  PRO A HB2  3  
ATOM 4810  H HB3  . PRO A 1 36  ? 20.245 -20.438 14.197 1.00 61.24 ? 36  PRO A HB3  3  
ATOM 4811  H HG2  . PRO A 1 36  ? 21.303 -17.779 15.075 1.00 32.13 ? 36  PRO A HG2  3  
ATOM 4812  H HG3  . PRO A 1 36  ? 22.083 -19.370 15.140 1.00 71.23 ? 36  PRO A HG3  3  
ATOM 4813  H HD2  . PRO A 1 36  ? 22.634 -17.555 13.208 1.00 41.41 ? 36  PRO A HD2  3  
ATOM 4814  H HD3  . PRO A 1 36  ? 22.684 -19.305 12.916 1.00 64.04 ? 36  PRO A HD3  3  
ATOM 4815  N N    . GLY A 1 37  ? 17.426 -17.801 13.040 1.00 10.53 ? 37  GLY A N    3  
ATOM 4816  C CA   . GLY A 1 37  ? 16.454 -16.746 13.263 1.00 72.23 ? 37  GLY A CA   3  
ATOM 4817  C C    . GLY A 1 37  ? 15.105 -17.062 12.648 1.00 71.33 ? 37  GLY A C    3  
ATOM 4818  O O    . GLY A 1 37  ? 14.877 -18.173 12.170 1.00 23.03 ? 37  GLY A O    3  
ATOM 4819  H H    . GLY A 1 37  ? 17.128 -18.682 12.732 1.00 41.13 ? 37  GLY A H    3  
ATOM 4820  H HA2  . GLY A 1 37  ? 16.329 -16.605 14.326 1.00 60.01 ? 37  GLY A HA2  3  
ATOM 4821  H HA3  . GLY A 1 37  ? 16.828 -15.830 12.830 1.00 71.25 ? 37  GLY A HA3  3  
ATOM 4822  N N    . GLY A 1 38  ? 14.206 -16.083 12.661 1.00 50.55 ? 38  GLY A N    3  
ATOM 4823  C CA   . GLY A 1 38  ? 12.883 -16.282 12.099 1.00 71.33 ? 38  GLY A CA   3  
ATOM 4824  C C    . GLY A 1 38  ? 12.236 -14.983 11.664 1.00 55.44 ? 38  GLY A C    3  
ATOM 4825  O O    . GLY A 1 38  ? 12.896 -14.109 11.100 1.00 34.14 ? 38  GLY A O    3  
ATOM 4826  H H    . GLY A 1 38  ? 14.443 -15.217 13.055 1.00 62.12 ? 38  GLY A H    3  
ATOM 4827  H HA2  . GLY A 1 38  ? 12.962 -16.937 11.244 1.00 71.13 ? 38  GLY A HA2  3  
ATOM 4828  H HA3  . GLY A 1 38  ? 12.256 -16.752 12.842 1.00 12.13 ? 38  GLY A HA3  3  
ATOM 4829  N N    . LYS A 1 39  ? 10.939 -14.853 11.923 1.00 32.51 ? 39  LYS A N    3  
ATOM 4830  C CA   . LYS A 1 39  ? 10.200 -13.652 11.555 1.00 43.54 ? 39  LYS A CA   3  
ATOM 4831  C C    . LYS A 1 39  ? 9.796  -12.860 12.794 1.00 35.12 ? 39  LYS A C    3  
ATOM 4832  O O    . LYS A 1 39  ? 9.867  -13.364 13.915 1.00 1.23  ? 39  LYS A O    3  
ATOM 4833  C CB   . LYS A 1 39  ? 8.956  -14.021 10.744 1.00 61.12 ? 39  LYS A CB   3  
ATOM 4834  C CG   . LYS A 1 39  ? 7.916  -14.789 11.541 1.00 2.13  ? 39  LYS A CG   3  
ATOM 4835  C CD   . LYS A 1 39  ? 7.017  -15.614 10.636 1.00 14.23 ? 39  LYS A CD   3  
ATOM 4836  C CE   . LYS A 1 39  ? 7.660  -16.943 10.273 1.00 60.15 ? 39  LYS A CE   3  
ATOM 4837  N NZ   . LYS A 1 39  ? 7.598  -17.916 11.399 1.00 45.35 ? 39  LYS A NZ   3  
ATOM 4838  H H    . LYS A 1 39  ? 10.467 -15.585 12.375 1.00 52.22 ? 39  LYS A H    3  
ATOM 4839  H HA   . LYS A 1 39  ? 10.847 -13.038 10.946 1.00 61.21 ? 39  LYS A HA   3  
ATOM 4840  H HB2  . LYS A 1 39  ? 8.499  -13.115 10.375 1.00 43.33 ? 39  LYS A HB2  3  
ATOM 4841  H HB3  . LYS A 1 39  ? 9.257  -14.630 9.904  1.00 73.45 ? 39  LYS A HB3  3  
ATOM 4842  H HG2  . LYS A 1 39  ? 8.420  -15.451 12.230 1.00 42.12 ? 39  LYS A HG2  3  
ATOM 4843  H HG3  . LYS A 1 39  ? 7.309  -14.086 12.094 1.00 32.20 ? 39  LYS A HG3  3  
ATOM 4844  H HD2  . LYS A 1 39  ? 6.085  -15.806 11.147 1.00 11.12 ? 39  LYS A HD2  3  
ATOM 4845  H HD3  . LYS A 1 39  ? 6.824  -15.057 9.730  1.00 2.21  ? 39  LYS A HD3  3  
ATOM 4846  H HE2  . LYS A 1 39  ? 7.142  -17.358 9.421  1.00 2.24  ? 39  LYS A HE2  3  
ATOM 4847  H HE3  . LYS A 1 39  ? 8.694  -16.769 10.015 1.00 42.33 ? 39  LYS A HE3  3  
ATOM 4848  H HZ1  . LYS A 1 39  ? 7.114  -17.488 12.213 1.00 33.14 ? 39  LYS A HZ1  3  
ATOM 4849  H HZ2  . LYS A 1 39  ? 8.559  -18.190 11.686 1.00 22.34 ? 39  LYS A HZ2  3  
ATOM 4850  H HZ3  . LYS A 1 39  ? 7.078  -18.768 11.107 1.00 5.31  ? 39  LYS A HZ3  3  
ATOM 4851  N N    . VAL A 1 40  ? 9.369  -11.619 12.585 1.00 11.30 ? 40  VAL A N    3  
ATOM 4852  C CA   . VAL A 1 40  ? 8.950  -10.759 13.685 1.00 1.34  ? 40  VAL A CA   3  
ATOM 4853  C C    . VAL A 1 40  ? 7.580  -10.148 13.415 1.00 53.24 ? 40  VAL A C    3  
ATOM 4854  O O    . VAL A 1 40  ? 7.249  -9.823  12.275 1.00 41.51 ? 40  VAL A O    3  
ATOM 4855  C CB   . VAL A 1 40  ? 9.965  -9.627  13.931 1.00 42.54 ? 40  VAL A CB   3  
ATOM 4856  C CG1  . VAL A 1 40  ? 9.483  -8.709  15.044 1.00 43.22 ? 40  VAL A CG1  3  
ATOM 4857  C CG2  . VAL A 1 40  ? 11.335 -10.201 14.258 1.00 60.50 ? 40  VAL A CG2  3  
ATOM 4858  H H    . VAL A 1 40  ? 9.334  -11.273 11.669 1.00 62.33 ? 40  VAL A H    3  
ATOM 4859  H HA   . VAL A 1 40  ? 8.894  -11.363 14.579 1.00 31.20 ? 40  VAL A HA   3  
ATOM 4860  H HB   . VAL A 1 40  ? 10.050 -9.044  13.025 1.00 13.21 ? 40  VAL A HB   3  
ATOM 4861  H HG11 . VAL A 1 40  ? 8.899  -9.278  15.752 1.00 60.33 ? 40  VAL A HG11 3  
ATOM 4862  H HG12 . VAL A 1 40  ? 10.335 -8.273  15.546 1.00 73.14 ? 40  VAL A HG12 3  
ATOM 4863  H HG13 . VAL A 1 40  ? 8.872  -7.924  14.623 1.00 1.43  ? 40  VAL A HG13 3  
ATOM 4864  H HG21 . VAL A 1 40  ? 11.775 -9.642  15.070 1.00 51.43 ? 40  VAL A HG21 3  
ATOM 4865  H HG22 . VAL A 1 40  ? 11.231 -11.237 14.550 1.00 42.33 ? 40  VAL A HG22 3  
ATOM 4866  H HG23 . VAL A 1 40  ? 11.971 -10.135 13.388 1.00 60.31 ? 40  VAL A HG23 3  
ATOM 4867  N N    . GLU A 1 41  ? 6.787  -9.995  14.471 1.00 51.34 ? 41  GLU A N    3  
ATOM 4868  C CA   . GLU A 1 41  ? 5.451  -9.423  14.346 1.00 44.22 ? 41  GLU A CA   3  
ATOM 4869  C C    . GLU A 1 41  ? 5.524  -7.963  13.907 1.00 14.12 ? 41  GLU A C    3  
ATOM 4870  O O    . GLU A 1 41  ? 6.601  -7.368  13.863 1.00 73.33 ? 41  GLU A O    3  
ATOM 4871  C CB   . GLU A 1 41  ? 4.700  -9.531  15.674 1.00 31.03 ? 41  GLU A CB   3  
ATOM 4872  C CG   . GLU A 1 41  ? 4.013  -10.871 15.878 1.00 65.22 ? 41  GLU A CG   3  
ATOM 4873  C CD   . GLU A 1 41  ? 2.676  -10.955 15.168 1.00 21.51 ? 41  GLU A CD   3  
ATOM 4874  O OE1  . GLU A 1 41  ? 1.792  -10.127 15.470 1.00 52.31 ? 41  GLU A OE1  3  
ATOM 4875  O OE2  . GLU A 1 41  ? 2.514  -11.850 14.312 1.00 55.53 ? 41  GLU A OE2  3  
ATOM 4876  H H    . GLU A 1 41  ? 7.107  -10.273 15.354 1.00 63.42 ? 41  GLU A H    3  
ATOM 4877  H HA   . GLU A 1 41  ? 4.918  -9.986  13.595 1.00 44.34 ? 41  GLU A HA   3  
ATOM 4878  H HB2  . GLU A 1 41  ? 5.400  -9.381  16.483 1.00 34.13 ? 41  GLU A HB2  3  
ATOM 4879  H HB3  . GLU A 1 41  ? 3.948  -8.756  15.713 1.00 64.25 ? 41  GLU A HB3  3  
ATOM 4880  H HG2  . GLU A 1 41  ? 4.655  -11.652 15.497 1.00 2.51  ? 41  GLU A HG2  3  
ATOM 4881  H HG3  . GLU A 1 41  ? 3.853  -11.022 16.935 1.00 25.43 ? 41  GLU A HG3  3  
ATOM 4882  N N    . LYS A 1 42  ? 4.369  -7.391  13.583 1.00 11.02 ? 42  LYS A N    3  
ATOM 4883  C CA   . LYS A 1 42  ? 4.298  -6.001  13.148 1.00 24.04 ? 42  LYS A CA   3  
ATOM 4884  C C    . LYS A 1 42  ? 4.259  -5.058  14.346 1.00 0.43  ? 42  LYS A C    3  
ATOM 4885  O O    . LYS A 1 42  ? 4.796  -3.952  14.295 1.00 54.20 ? 42  LYS A O    3  
ATOM 4886  C CB   . LYS A 1 42  ? 3.063  -5.781  12.272 1.00 63.31 ? 42  LYS A CB   3  
ATOM 4887  C CG   . LYS A 1 42  ? 1.766  -6.224  12.927 1.00 63.44 ? 42  LYS A CG   3  
ATOM 4888  C CD   . LYS A 1 42  ? 1.098  -7.341  12.141 1.00 3.33  ? 42  LYS A CD   3  
ATOM 4889  C CE   . LYS A 1 42  ? -0.418 -7.228  12.192 1.00 43.32 ? 42  LYS A CE   3  
ATOM 4890  N NZ   . LYS A 1 42  ? -0.986 -6.804  10.882 1.00 12.44 ? 42  LYS A NZ   3  
ATOM 4891  H H    . LYS A 1 42  ? 3.543  -7.917  13.639 1.00 50.21 ? 42  LYS A H    3  
ATOM 4892  H HA   . LYS A 1 42  ? 5.184  -5.790  12.568 1.00 55.31 ? 42  LYS A HA   3  
ATOM 4893  H HB2  . LYS A 1 42  ? 2.984  -4.730  12.040 1.00 40.45 ? 42  LYS A HB2  3  
ATOM 4894  H HB3  . LYS A 1 42  ? 3.186  -6.336  11.353 1.00 72.03 ? 42  LYS A HB3  3  
ATOM 4895  H HG2  . LYS A 1 42  ? 1.980  -6.579  13.924 1.00 14.41 ? 42  LYS A HG2  3  
ATOM 4896  H HG3  . LYS A 1 42  ? 1.093  -5.380  12.978 1.00 22.34 ? 42  LYS A HG3  3  
ATOM 4897  H HD2  . LYS A 1 42  ? 1.418  -7.286  11.111 1.00 13.13 ? 42  LYS A HD2  3  
ATOM 4898  H HD3  . LYS A 1 42  ? 1.394  -8.292  12.562 1.00 40.43 ? 42  LYS A HD3  3  
ATOM 4899  H HE2  . LYS A 1 42  ? -0.829 -8.189  12.458 1.00 24.34 ? 42  LYS A HE2  3  
ATOM 4900  H HE3  . LYS A 1 42  ? -0.686 -6.501  12.944 1.00 53.41 ? 42  LYS A HE3  3  
ATOM 4901  H HZ1  . LYS A 1 42  ? -0.309 -7.003  10.118 1.00 13.31 ? 42  LYS A HZ1  3  
ATOM 4902  H HZ2  . LYS A 1 42  ? -1.188 -5.784  10.894 1.00 40.30 ? 42  LYS A HZ2  3  
ATOM 4903  H HZ3  . LYS A 1 42  ? -1.869 -7.319  10.692 1.00 11.12 ? 42  LYS A HZ3  3  
ATOM 4904  N N    . ASN A 1 43  ? 3.621  -5.503  15.424 1.00 23.00 ? 43  ASN A N    3  
ATOM 4905  C CA   . ASN A 1 43  ? 3.513  -4.698  16.635 1.00 22.14 ? 43  ASN A CA   3  
ATOM 4906  C C    . ASN A 1 43  ? 4.717  -4.921  17.546 1.00 41.23 ? 43  ASN A C    3  
ATOM 4907  O O    . ASN A 1 43  ? 5.183  -3.997  18.211 1.00 2.32  ? 43  ASN A O    3  
ATOM 4908  C CB   . ASN A 1 43  ? 2.223  -5.038  17.385 1.00 42.42 ? 43  ASN A CB   3  
ATOM 4909  C CG   . ASN A 1 43  ? 1.052  -4.187  16.934 1.00 13.41 ? 43  ASN A CG   3  
ATOM 4910  O OD1  . ASN A 1 43  ? 1.179  -2.973  16.769 1.00 33.21 ? 43  ASN A OD1  3  
ATOM 4911  N ND2  . ASN A 1 43  ? -0.097 -4.821  16.733 1.00 74.00 ? 43  ASN A ND2  3  
ATOM 4912  H H    . ASN A 1 43  ? 3.213  -6.394  15.404 1.00 4.14  ? 43  ASN A H    3  
ATOM 4913  H HA   . ASN A 1 43  ? 3.486  -3.660  16.342 1.00 52.43 ? 43  ASN A HA   3  
ATOM 4914  H HB2  . ASN A 1 43  ? 1.977  -6.075  17.213 1.00 75.24 ? 43  ASN A HB2  3  
ATOM 4915  H HB3  . ASN A 1 43  ? 2.375  -4.878  18.442 1.00 60.53 ? 43  ASN A HB3  3  
ATOM 4916  H HD21 . ASN A 1 43  ? -0.125 -5.789  16.884 1.00 21.14 ? 43  ASN A HD21 3  
ATOM 4917  H HD22 . ASN A 1 43  ? -0.871 -4.295  16.441 1.00 61.24 ? 43  ASN A HD22 3  
ATOM 4918  N N    . GLU A 1 44  ? 5.215  -6.153  17.568 1.00 21.24 ? 44  GLU A N    3  
ATOM 4919  C CA   . GLU A 1 44  ? 6.365  -6.497  18.397 1.00 14.32 ? 44  GLU A CA   3  
ATOM 4920  C C    . GLU A 1 44  ? 7.656  -5.965  17.783 1.00 4.23  ? 44  GLU A C    3  
ATOM 4921  O O    . GLU A 1 44  ? 7.859  -6.040  16.571 1.00 52.12 ? 44  GLU A O    3  
ATOM 4922  C CB   . GLU A 1 44  ? 6.458  -8.014  18.575 1.00 43.42 ? 44  GLU A CB   3  
ATOM 4923  C CG   . GLU A 1 44  ? 7.297  -8.436  19.769 1.00 11.04 ? 44  GLU A CG   3  
ATOM 4924  C CD   . GLU A 1 44  ? 6.483  -8.547  21.044 1.00 74.33 ? 44  GLU A CD   3  
ATOM 4925  O OE1  . GLU A 1 44  ? 5.965  -7.511  21.510 1.00 73.30 ? 44  GLU A OE1  3  
ATOM 4926  O OE2  . GLU A 1 44  ? 6.363  -9.672  21.574 1.00 3.43  ? 44  GLU A OE2  3  
ATOM 4927  H H    . GLU A 1 44  ? 4.800  -6.847  17.015 1.00 34.34 ? 44  GLU A H    3  
ATOM 4928  H HA   . GLU A 1 44  ? 6.225  -6.039  19.365 1.00 53.55 ? 44  GLU A HA   3  
ATOM 4929  H HB2  . GLU A 1 44  ? 5.462  -8.411  18.701 1.00 21.51 ? 44  GLU A HB2  3  
ATOM 4930  H HB3  . GLU A 1 44  ? 6.896  -8.441  17.685 1.00 24.31 ? 44  GLU A HB3  3  
ATOM 4931  H HG2  . GLU A 1 44  ? 7.741  -9.397  19.559 1.00 21.44 ? 44  GLU A HG2  3  
ATOM 4932  H HG3  . GLU A 1 44  ? 8.078  -7.705  19.921 1.00 32.42 ? 44  GLU A HG3  3  
ATOM 4933  N N    . THR A 1 45  ? 8.529  -5.426  18.629 1.00 11.15 ? 45  THR A N    3  
ATOM 4934  C CA   . THR A 1 45  ? 9.800  -4.880  18.172 1.00 41.53 ? 45  THR A CA   3  
ATOM 4935  C C    . THR A 1 45  ? 10.773 -5.991  17.797 1.00 62.34 ? 45  THR A C    3  
ATOM 4936  O O    . THR A 1 45  ? 10.561 -7.155  18.137 1.00 0.40  ? 45  THR A O    3  
ATOM 4937  C CB   . THR A 1 45  ? 10.448 -3.987  19.247 1.00 31.12 ? 45  THR A CB   3  
ATOM 4938  O OG1  . THR A 1 45  ? 9.433  -3.343  20.026 1.00 61.14 ? 45  THR A OG1  3  
ATOM 4939  C CG2  . THR A 1 45  ? 11.348 -2.939  18.610 1.00 15.34 ? 45  THR A CG2  3  
ATOM 4940  H H    . THR A 1 45  ? 8.310  -5.395  19.584 1.00 24.13 ? 45  THR A H    3  
ATOM 4941  H HA   . THR A 1 45  ? 9.607  -4.273  17.299 1.00 44.03 ? 45  THR A HA   3  
ATOM 4942  H HB   . THR A 1 45  ? 11.048 -4.609  19.896 1.00 60.22 ? 45  THR A HB   3  
ATOM 4943  H HG1  . THR A 1 45  ? 8.854  -2.843  19.446 1.00 52.04 ? 45  THR A HG1  3  
ATOM 4944  H HG21 . THR A 1 45  ? 12.382 -3.206  18.772 1.00 55.54 ? 45  THR A HG21 3  
ATOM 4945  H HG22 . THR A 1 45  ? 11.150 -1.976  19.057 1.00 0.31  ? 45  THR A HG22 3  
ATOM 4946  H HG23 . THR A 1 45  ? 11.150 -2.891  17.550 1.00 33.32 ? 45  THR A HG23 3  
ATOM 4947  N N    . GLU A 1 46  ? 11.841 -5.625  17.094 1.00 73.11 ? 46  GLU A N    3  
ATOM 4948  C CA   . GLU A 1 46  ? 12.846 -6.594  16.673 1.00 42.40 ? 46  GLU A CA   3  
ATOM 4949  C C    . GLU A 1 46  ? 13.414 -7.345  17.874 1.00 72.44 ? 46  GLU A C    3  
ATOM 4950  O O    . GLU A 1 46  ? 13.329 -8.571  17.950 1.00 33.22 ? 46  GLU A O    3  
ATOM 4951  C CB   . GLU A 1 46  ? 13.976 -5.893  15.916 1.00 40.52 ? 46  GLU A CB   3  
ATOM 4952  C CG   . GLU A 1 46  ? 13.596 -5.476  14.505 1.00 41.41 ? 46  GLU A CG   3  
ATOM 4953  C CD   . GLU A 1 46  ? 14.290 -4.201  14.067 1.00 40.45 ? 46  GLU A CD   3  
ATOM 4954  O OE1  . GLU A 1 46  ? 15.515 -4.087  14.281 1.00 71.22 ? 46  GLU A OE1  3  
ATOM 4955  O OE2  . GLU A 1 46  ? 13.607 -3.316  13.509 1.00 62.14 ? 46  GLU A OE2  3  
ATOM 4956  H H    . GLU A 1 46  ? 11.954 -4.682  16.853 1.00 62.23 ? 46  GLU A H    3  
ATOM 4957  H HA   . GLU A 1 46  ? 12.369 -7.302  16.013 1.00 13.11 ? 46  GLU A HA   3  
ATOM 4958  H HB2  . GLU A 1 46  ? 14.267 -5.009  16.465 1.00 40.04 ? 46  GLU A HB2  3  
ATOM 4959  H HB3  . GLU A 1 46  ? 14.821 -6.562  15.855 1.00 4.12  ? 46  GLU A HB3  3  
ATOM 4960  H HG2  . GLU A 1 46  ? 13.868 -6.268  13.824 1.00 43.35 ? 46  GLU A HG2  3  
ATOM 4961  H HG3  . GLU A 1 46  ? 12.528 -5.319  14.465 1.00 62.02 ? 46  GLU A HG3  3  
ATOM 4962  N N    . LYS A 1 47  ? 13.994 -6.602  18.809 1.00 12.35 ? 47  LYS A N    3  
ATOM 4963  C CA   . LYS A 1 47  ? 14.576 -7.195  20.008 1.00 75.25 ? 47  LYS A CA   3  
ATOM 4964  C C    . LYS A 1 47  ? 13.502 -7.865  20.859 1.00 12.34 ? 47  LYS A C    3  
ATOM 4965  O O    . LYS A 1 47  ? 13.648 -9.017  21.266 1.00 21.41 ? 47  LYS A O    3  
ATOM 4966  C CB   . LYS A 1 47  ? 15.302 -6.128  20.829 1.00 14.14 ? 47  LYS A CB   3  
ATOM 4967  C CG   . LYS A 1 47  ? 16.780 -6.010  20.503 1.00 64.31 ? 47  LYS A CG   3  
ATOM 4968  C CD   . LYS A 1 47  ? 17.592 -7.094  21.193 1.00 74.22 ? 47  LYS A CD   3  
ATOM 4969  C CE   . LYS A 1 47  ? 17.696 -6.845  22.689 1.00 3.55  ? 47  LYS A CE   3  
ATOM 4970  N NZ   . LYS A 1 47  ? 16.693 -7.635  23.455 1.00 10.22 ? 47  LYS A NZ   3  
ATOM 4971  H H    . LYS A 1 47  ? 14.031 -5.629  18.692 1.00 53.21 ? 47  LYS A H    3  
ATOM 4972  H HA   . LYS A 1 47  ? 15.288 -7.943  19.695 1.00 61.23 ? 47  LYS A HA   3  
ATOM 4973  H HB2  . LYS A 1 47  ? 14.836 -5.171  20.645 1.00 4.34  ? 47  LYS A HB2  3  
ATOM 4974  H HB3  . LYS A 1 47  ? 15.204 -6.370  21.878 1.00 62.10 ? 47  LYS A HB3  3  
ATOM 4975  H HG2  . LYS A 1 47  ? 16.912 -6.102  19.435 1.00 5.30  ? 47  LYS A HG2  3  
ATOM 4976  H HG3  . LYS A 1 47  ? 17.136 -5.044  20.830 1.00 1.41  ? 47  LYS A HG3  3  
ATOM 4977  H HD2  . LYS A 1 47  ? 17.113 -8.048  21.031 1.00 34.43 ? 47  LYS A HD2  3  
ATOM 4978  H HD3  . LYS A 1 47  ? 18.586 -7.112  20.769 1.00 31.20 ? 47  LYS A HD3  3  
ATOM 4979  H HE2  . LYS A 1 47  ? 18.686 -7.120  23.019 1.00 63.32 ? 47  LYS A HE2  3  
ATOM 4980  H HE3  . LYS A 1 47  ? 17.534 -5.793  22.878 1.00 61.52 ? 47  LYS A HE3  3  
ATOM 4981  H HZ1  . LYS A 1 47  ? 16.459 -8.508  22.941 1.00 31.21 ? 47  LYS A HZ1  3  
ATOM 4982  H HZ2  . LYS A 1 47  ? 15.824 -7.079  23.585 1.00 52.03 ? 47  LYS A HZ2  3  
ATOM 4983  H HZ3  . LYS A 1 47  ? 17.074 -7.886  24.390 1.00 75.44 ? 47  LYS A HZ3  3  
ATOM 4984  N N    . ASP A 1 48  ? 12.423 -7.136  21.124 1.00 5.52  ? 48  ASP A N    3  
ATOM 4985  C CA   . ASP A 1 48  ? 11.324 -7.660  21.926 1.00 53.04 ? 48  ASP A CA   3  
ATOM 4986  C C    . ASP A 1 48  ? 10.785 -8.956  21.327 1.00 10.31 ? 48  ASP A C    3  
ATOM 4987  O O    . ASP A 1 48  ? 10.208 -9.784  22.032 1.00 43.53 ? 48  ASP A O    3  
ATOM 4988  C CB   . ASP A 1 48  ? 10.201 -6.626  22.029 1.00 64.00 ? 48  ASP A CB   3  
ATOM 4989  C CG   . ASP A 1 48  ? 10.700 -5.276  22.506 1.00 20.22 ? 48  ASP A CG   3  
ATOM 4990  O OD1  . ASP A 1 48  ? 11.848 -5.206  22.993 1.00 72.33 ? 48  ASP A OD1  3  
ATOM 4991  O OD2  . ASP A 1 48  ? 9.942  -4.290  22.394 1.00 10.21 ? 48  ASP A OD2  3  
ATOM 4992  H H    . ASP A 1 48  ? 12.365 -6.223  20.772 1.00 43.34 ? 48  ASP A H    3  
ATOM 4993  H HA   . ASP A 1 48  ? 11.703 -7.866  22.915 1.00 1.20  ? 48  ASP A HA   3  
ATOM 4994  H HB2  . ASP A 1 48  ? 9.748  -6.498  21.057 1.00 51.03 ? 48  ASP A HB2  3  
ATOM 4995  H HB3  . ASP A 1 48  ? 9.456  -6.982  22.725 1.00 3.43  ? 48  ASP A HB3  3  
ATOM 4996  N N    . ALA A 1 49  ? 10.976 -9.123  20.023 1.00 64.52 ? 49  ALA A N    3  
ATOM 4997  C CA   . ALA A 1 49  ? 10.511 -10.318 19.330 1.00 73.32 ? 49  ALA A CA   3  
ATOM 4998  C C    . ALA A 1 49  ? 11.511 -11.460 19.471 1.00 24.24 ? 49  ALA A C    3  
ATOM 4999  O O    . ALA A 1 49  ? 11.130 -12.630 19.536 1.00 54.43 ? 49  ALA A O    3  
ATOM 5000  C CB   . ALA A 1 49  ? 10.260 -10.012 17.861 1.00 63.55 ? 49  ALA A CB   3  
ATOM 5001  H H    . ALA A 1 49  ? 11.443 -8.428  19.515 1.00 41.32 ? 49  ALA A H    3  
ATOM 5002  H HA   . ALA A 1 49  ? 9.573  -10.618 19.775 1.00 54.13 ? 49  ALA A HA   3  
ATOM 5003  H HB1  . ALA A 1 49  ? 11.068 -9.406  17.477 1.00 24.32 ? 49  ALA A HB1  3  
ATOM 5004  H HB2  . ALA A 1 49  ? 10.208 -10.937 17.305 1.00 52.44 ? 49  ALA A HB2  3  
ATOM 5005  H HB3  . ALA A 1 49  ? 9.328  -9.477  17.758 1.00 5.24  ? 49  ALA A HB3  3  
ATOM 5006  N N    . LEU A 1 50  ? 12.793 -11.115 19.519 1.00 42.32 ? 50  LEU A N    3  
ATOM 5007  C CA   . LEU A 1 50  ? 13.850 -12.112 19.652 1.00 11.42 ? 50  LEU A CA   3  
ATOM 5008  C C    . LEU A 1 50  ? 13.775 -12.806 21.008 1.00 5.23  ? 50  LEU A C    3  
ATOM 5009  O O    . LEU A 1 50  ? 13.876 -14.030 21.096 1.00 1.11  ? 50  LEU A O    3  
ATOM 5010  C CB   . LEU A 1 50  ? 15.221 -11.457 19.476 1.00 0.32  ? 50  LEU A CB   3  
ATOM 5011  C CG   . LEU A 1 50  ? 15.710 -11.300 18.036 1.00 63.20 ? 50  LEU A CG   3  
ATOM 5012  C CD1  . LEU A 1 50  ? 16.850 -10.295 17.966 1.00 73.45 ? 50  LEU A CD1  3  
ATOM 5013  C CD2  . LEU A 1 50  ? 16.146 -12.644 17.472 1.00 65.52 ? 50  LEU A CD2  3  
ATOM 5014  H H    . LEU A 1 50  ? 13.036 -10.167 19.463 1.00 71.31 ? 50  LEU A H    3  
ATOM 5015  H HA   . LEU A 1 50  ? 13.710 -12.849 18.876 1.00 53.33 ? 50  LEU A HA   3  
ATOM 5016  H HB2  . LEU A 1 50  ? 15.177 -10.474 19.919 1.00 41.51 ? 50  LEU A HB2  3  
ATOM 5017  H HB3  . LEU A 1 50  ? 15.944 -12.058 20.009 1.00 4.41  ? 50  LEU A HB3  3  
ATOM 5018  H HG   . LEU A 1 50  ? 14.899 -10.928 17.425 1.00 2.55  ? 50  LEU A HG   3  
ATOM 5019  H HD11 . LEU A 1 50  ? 16.751 -9.582  18.770 1.00 71.33 ? 50  LEU A HD11 3  
ATOM 5020  H HD12 . LEU A 1 50  ? 16.815 -9.777  17.019 1.00 73.55 ? 50  LEU A HD12 3  
ATOM 5021  H HD13 . LEU A 1 50  ? 17.793 -10.814 18.057 1.00 31.00 ? 50  LEU A HD13 3  
ATOM 5022  H HD21 . LEU A 1 50  ? 16.631 -12.494 16.518 1.00 12.03 ? 50  LEU A HD21 3  
ATOM 5023  H HD22 . LEU A 1 50  ? 15.281 -13.277 17.340 1.00 73.32 ? 50  LEU A HD22 3  
ATOM 5024  H HD23 . LEU A 1 50  ? 16.836 -13.115 18.156 1.00 23.22 ? 50  LEU A HD23 3  
ATOM 5025  N N    . ILE A 1 51  ? 13.597 -12.017 22.062 1.00 13.42 ? 51  ILE A N    3  
ATOM 5026  C CA   . ILE A 1 51  ? 13.505 -12.556 23.413 1.00 23.02 ? 51  ILE A CA   3  
ATOM 5027  C C    . ILE A 1 51  ? 12.469 -13.672 23.491 1.00 50.04 ? 51  ILE A C    3  
ATOM 5028  O O    . ILE A 1 51  ? 12.600 -14.600 24.289 1.00 72.13 ? 51  ILE A O    3  
ATOM 5029  C CB   . ILE A 1 51  ? 13.141 -11.461 24.433 1.00 22.02 ? 51  ILE A CB   3  
ATOM 5030  C CG1  . ILE A 1 51  ? 13.463 -11.929 25.854 1.00 70.52 ? 51  ILE A CG1  3  
ATOM 5031  C CG2  . ILE A 1 51  ? 11.670 -11.092 24.312 1.00 43.03 ? 51  ILE A CG2  3  
ATOM 5032  C CD1  . ILE A 1 51  ? 13.705 -10.794 26.824 1.00 61.50 ? 51  ILE A CD1  3  
ATOM 5033  H H    . ILE A 1 51  ? 13.524 -11.049 21.928 1.00 52.11 ? 51  ILE A H    3  
ATOM 5034  H HA   . ILE A 1 51  ? 14.473 -12.959 23.677 1.00 13.41 ? 51  ILE A HA   3  
ATOM 5035  H HB   . ILE A 1 51  ? 13.728 -10.583 24.210 1.00 55.12 ? 51  ILE A HB   3  
ATOM 5036  H HG12 . ILE A 1 51  ? 12.638 -12.515 26.229 1.00 65.15 ? 51  ILE A HG12 3  
ATOM 5037  H HG13 . ILE A 1 51  ? 14.353 -12.542 25.830 1.00 73.13 ? 51  ILE A HG13 3  
ATOM 5038  H HG21 . ILE A 1 51  ? 11.538 -10.051 24.569 1.00 71.33 ? 51  ILE A HG21 3  
ATOM 5039  H HG22 . ILE A 1 51  ? 11.341 -11.256 23.296 1.00 3.45  ? 51  ILE A HG22 3  
ATOM 5040  H HG23 . ILE A 1 51  ? 11.088 -11.705 24.983 1.00 62.53 ? 51  ILE A HG23 3  
ATOM 5041  H HD11 . ILE A 1 51  ? 13.543 -9.851  26.323 1.00 22.42 ? 51  ILE A HD11 3  
ATOM 5042  H HD12 . ILE A 1 51  ? 13.025 -10.882 27.658 1.00 44.20 ? 51  ILE A HD12 3  
ATOM 5043  H HD13 . ILE A 1 51  ? 14.723 -10.840 27.184 1.00 43.45 ? 51  ILE A HD13 3  
ATOM 5044  N N    . ARG A 1 52  ? 11.440 -13.576 22.655 1.00 42.43 ? 52  ARG A N    3  
ATOM 5045  C CA   . ARG A 1 52  ? 10.381 -14.577 22.628 1.00 63.42 ? 52  ARG A CA   3  
ATOM 5046  C C    . ARG A 1 52  ? 10.789 -15.777 21.777 1.00 52.52 ? 52  ARG A C    3  
ATOM 5047  O O    . ARG A 1 52  ? 10.743 -16.918 22.234 1.00 4.13  ? 52  ARG A O    3  
ATOM 5048  C CB   . ARG A 1 52  ? 9.088  -13.968 22.084 1.00 74.41 ? 52  ARG A CB   3  
ATOM 5049  C CG   . ARG A 1 52  ? 8.570  -12.801 22.908 1.00 3.13  ? 52  ARG A CG   3  
ATOM 5050  C CD   . ARG A 1 52  ? 8.308  -13.209 24.349 1.00 24.45 ? 52  ARG A CD   3  
ATOM 5051  N NE   . ARG A 1 52  ? 7.409  -14.357 24.438 1.00 3.24  ? 52  ARG A NE   3  
ATOM 5052  C CZ   . ARG A 1 52  ? 6.089  -14.267 24.318 1.00 24.25 ? 52  ARG A CZ   3  
ATOM 5053  N NH1  . ARG A 1 52  ? 5.518  -13.090 24.105 1.00 2.23  ? 52  ARG A NH1  3  
ATOM 5054  N NH2  . ARG A 1 52  ? 5.338  -15.357 24.411 1.00 0.12  ? 52  ARG A NH2  3  
ATOM 5055  H H    . ARG A 1 52  ? 11.392 -12.812 22.042 1.00 75.30 ? 52  ARG A H    3  
ATOM 5056  H HA   . ARG A 1 52  ? 10.214 -14.910 23.641 1.00 34.41 ? 52  ARG A HA   3  
ATOM 5057  H HB2  . ARG A 1 52  ? 9.263  -13.619 21.077 1.00 62.32 ? 52  ARG A HB2  3  
ATOM 5058  H HB3  . ARG A 1 52  ? 8.325  -14.732 22.064 1.00 63.44 ? 52  ARG A HB3  3  
ATOM 5059  H HG2  . ARG A 1 52  ? 9.306  -12.011 22.898 1.00 5.30  ? 52  ARG A HG2  3  
ATOM 5060  H HG3  . ARG A 1 52  ? 7.650  -12.444 22.471 1.00 12.12 ? 52  ARG A HG3  3  
ATOM 5061  H HD2  . ARG A 1 52  ? 9.249  -13.465 24.814 1.00 42.21 ? 52  ARG A HD2  3  
ATOM 5062  H HD3  . ARG A 1 52  ? 7.865  -12.375 24.871 1.00 53.51 ? 52  ARG A HD3  3  
ATOM 5063  H HE   . ARG A 1 52  ? 7.810  -15.237 24.596 1.00 43.44 ? 52  ARG A HE   3  
ATOM 5064  H HH11 . ARG A 1 52  ? 6.082  -12.267 24.034 1.00 71.20 ? 52  ARG A HH11 3  
ATOM 5065  H HH12 . ARG A 1 52  ? 4.524  -13.025 24.014 1.00 22.22 ? 52  ARG A HH12 3  
ATOM 5066  H HH21 . ARG A 1 52  ? 5.765  -16.246 24.572 1.00 61.34 ? 52  ARG A HH21 3  
ATOM 5067  H HH22 . ARG A 1 52  ? 4.345  -15.288 24.321 1.00 60.50 ? 52  ARG A HH22 3  
ATOM 5068  N N    . GLU A 1 53  ? 11.186 -15.508 20.537 1.00 72.22 ? 53  GLU A N    3  
ATOM 5069  C CA   . GLU A 1 53  ? 11.600 -16.566 19.622 1.00 13.22 ? 53  GLU A CA   3  
ATOM 5070  C C    . GLU A 1 53  ? 12.653 -17.462 20.267 1.00 11.25 ? 53  GLU A C    3  
ATOM 5071  O O    . GLU A 1 53  ? 12.452 -18.668 20.413 1.00 70.03 ? 53  GLU A O    3  
ATOM 5072  C CB   . GLU A 1 53  ? 12.150 -15.964 18.327 1.00 20.33 ? 53  GLU A CB   3  
ATOM 5073  C CG   . GLU A 1 53  ? 11.087 -15.721 17.269 1.00 20.22 ? 53  GLU A CG   3  
ATOM 5074  C CD   . GLU A 1 53  ? 10.278 -14.466 17.533 1.00 71.13 ? 53  GLU A CD   3  
ATOM 5075  O OE1  . GLU A 1 53  ? 10.654 -13.397 17.008 1.00 64.23 ? 53  GLU A OE1  3  
ATOM 5076  O OE2  . GLU A 1 53  ? 9.269  -14.552 18.263 1.00 21.35 ? 53  GLU A OE2  3  
ATOM 5077  H H    . GLU A 1 53  ? 11.200 -14.578 20.230 1.00 42.41 ? 53  GLU A H    3  
ATOM 5078  H HA   . GLU A 1 53  ? 10.730 -17.162 19.390 1.00 65.31 ? 53  GLU A HA   3  
ATOM 5079  H HB2  . GLU A 1 53  ? 12.624 -15.021 18.556 1.00 63.24 ? 53  GLU A HB2  3  
ATOM 5080  H HB3  . GLU A 1 53  ? 12.888 -16.638 17.918 1.00 41.15 ? 53  GLU A HB3  3  
ATOM 5081  H HG2  . GLU A 1 53  ? 11.569 -15.625 16.308 1.00 3.41  ? 53  GLU A HG2  3  
ATOM 5082  H HG3  . GLU A 1 53  ? 10.416 -16.567 17.250 1.00 31.23 ? 53  GLU A HG3  3  
ATOM 5083  N N    . ILE A 1 54  ? 13.775 -16.863 20.652 1.00 62.41 ? 54  ILE A N    3  
ATOM 5084  C CA   . ILE A 1 54  ? 14.859 -17.606 21.282 1.00 65.42 ? 54  ILE A CA   3  
ATOM 5085  C C    . ILE A 1 54  ? 14.355 -18.408 22.477 1.00 51.11 ? 54  ILE A C    3  
ATOM 5086  O O    . ILE A 1 54  ? 14.965 -19.401 22.873 1.00 1.14  ? 54  ILE A O    3  
ATOM 5087  C CB   . ILE A 1 54  ? 15.989 -16.668 21.747 1.00 32.21 ? 54  ILE A CB   3  
ATOM 5088  C CG1  . ILE A 1 54  ? 16.503 -15.832 20.573 1.00 31.13 ? 54  ILE A CG1  3  
ATOM 5089  C CG2  . ILE A 1 54  ? 17.122 -17.471 22.369 1.00 53.00 ? 54  ILE A CG2  3  
ATOM 5090  C CD1  . ILE A 1 54  ? 17.562 -14.826 20.966 1.00 13.33 ? 54  ILE A CD1  3  
ATOM 5091  H H    . ILE A 1 54  ? 13.876 -15.899 20.509 1.00 30.42 ? 54  ILE A H    3  
ATOM 5092  H HA   . ILE A 1 54  ? 15.265 -18.289 20.549 1.00 32.30 ? 54  ILE A HA   3  
ATOM 5093  H HB   . ILE A 1 54  ? 15.590 -16.009 22.503 1.00 42.45 ? 54  ILE A HB   3  
ATOM 5094  H HG12 . ILE A 1 54  ? 16.929 -16.488 19.831 1.00 23.43 ? 54  ILE A HG12 3  
ATOM 5095  H HG13 . ILE A 1 54  ? 15.676 -15.291 20.137 1.00 74.31 ? 54  ILE A HG13 3  
ATOM 5096  H HG21 . ILE A 1 54  ? 16.968 -18.522 22.173 1.00 40.13 ? 54  ILE A HG21 3  
ATOM 5097  H HG22 . ILE A 1 54  ? 18.062 -17.159 21.939 1.00 75.21 ? 54  ILE A HG22 3  
ATOM 5098  H HG23 . ILE A 1 54  ? 17.140 -17.303 23.435 1.00 14.32 ? 54  ILE A HG23 3  
ATOM 5099  H HD11 . ILE A 1 54  ? 18.539 -15.278 20.879 1.00 53.43 ? 54  ILE A HD11 3  
ATOM 5100  H HD12 . ILE A 1 54  ? 17.502 -13.966 20.316 1.00 74.53 ? 54  ILE A HD12 3  
ATOM 5101  H HD13 . ILE A 1 54  ? 17.401 -14.515 21.989 1.00 55.33 ? 54  ILE A HD13 3  
ATOM 5102  N N    . ARG A 1 55  ? 13.236 -17.971 23.046 1.00 41.04 ? 55  ARG A N    3  
ATOM 5103  C CA   . ARG A 1 55  ? 12.649 -18.648 24.195 1.00 35.13 ? 55  ARG A CA   3  
ATOM 5104  C C    . ARG A 1 55  ? 11.733 -19.784 23.748 1.00 53.31 ? 55  ARG A C    3  
ATOM 5105  O O    . ARG A 1 55  ? 11.613 -20.802 24.429 1.00 43.34 ? 55  ARG A O    3  
ATOM 5106  C CB   . ARG A 1 55  ? 11.864 -17.654 25.054 1.00 60.05 ? 55  ARG A CB   3  
ATOM 5107  C CG   . ARG A 1 55  ? 11.545 -18.171 26.446 1.00 34.55 ? 55  ARG A CG   3  
ATOM 5108  C CD   . ARG A 1 55  ? 10.149 -18.773 26.511 1.00 65.21 ? 55  ARG A CD   3  
ATOM 5109  N NE   . ARG A 1 55  ? 9.824  -19.260 27.849 1.00 44.40 ? 55  ARG A NE   3  
ATOM 5110  C CZ   . ARG A 1 55  ? 9.504  -18.463 28.863 1.00 74.24 ? 55  ARG A CZ   3  
ATOM 5111  N NH1  . ARG A 1 55  ? 9.465  -17.149 28.691 1.00 72.11 ? 55  ARG A NH1  3  
ATOM 5112  N NH2  . ARG A 1 55  ? 9.220  -18.981 30.051 1.00 63.10 ? 55  ARG A NH2  3  
ATOM 5113  H H    . ARG A 1 55  ? 12.795 -17.174 22.684 1.00 4.30  ? 55  ARG A H    3  
ATOM 5114  H HA   . ARG A 1 55  ? 13.454 -19.062 24.784 1.00 14.51 ? 55  ARG A HA   3  
ATOM 5115  H HB2  . ARG A 1 55  ? 12.443 -16.748 25.154 1.00 0.34  ? 55  ARG A HB2  3  
ATOM 5116  H HB3  . ARG A 1 55  ? 10.934 -17.424 24.556 1.00 12.25 ? 55  ARG A HB3  3  
ATOM 5117  H HG2  . ARG A 1 55  ? 12.265 -18.931 26.712 1.00 33.32 ? 55  ARG A HG2  3  
ATOM 5118  H HG3  . ARG A 1 55  ? 11.607 -17.353 27.147 1.00 11.54 ? 55  ARG A HG3  3  
ATOM 5119  H HD2  . ARG A 1 55  ? 9.432  -18.017 26.229 1.00 3.23  ? 55  ARG A HD2  3  
ATOM 5120  H HD3  . ARG A 1 55  ? 10.095 -19.597 25.815 1.00 22.21 ? 55  ARG A HD3  3  
ATOM 5121  H HE   . ARG A 1 55  ? 9.847  -20.227 27.998 1.00 30.50 ? 55  ARG A HE   3  
ATOM 5122  H HH11 . ARG A 1 55  ? 9.677  -16.756 27.796 1.00 32.13 ? 55  ARG A HH11 3  
ATOM 5123  H HH12 . ARG A 1 55  ? 9.222  -16.552 29.456 1.00 52.45 ? 55  ARG A HH12 3  
ATOM 5124  H HH21 . ARG A 1 55  ? 9.248  -19.971 30.184 1.00 23.31 ? 55  ARG A HH21 3  
ATOM 5125  H HH22 . ARG A 1 55  ? 8.979  -18.381 30.813 1.00 23.10 ? 55  ARG A HH22 3  
ATOM 5126  N N    . GLU A 1 56  ? 11.088 -19.600 22.600 1.00 64.14 ? 56  GLU A N    3  
ATOM 5127  C CA   . GLU A 1 56  ? 10.183 -20.609 22.063 1.00 54.00 ? 56  GLU A CA   3  
ATOM 5128  C C    . GLU A 1 56  ? 10.906 -21.520 21.076 1.00 65.21 ? 56  GLU A C    3  
ATOM 5129  O O    . GLU A 1 56  ? 11.043 -22.721 21.310 1.00 51.44 ? 56  GLU A O    3  
ATOM 5130  C CB   . GLU A 1 56  ? 8.989  -19.941 21.377 1.00 60.43 ? 56  GLU A CB   3  
ATOM 5131  C CG   . GLU A 1 56  ? 7.963  -20.928 20.844 1.00 2.33  ? 56  GLU A CG   3  
ATOM 5132  C CD   . GLU A 1 56  ? 6.619  -20.281 20.573 1.00 74.52 ? 56  GLU A CD   3  
ATOM 5133  O OE1  . GLU A 1 56  ? 6.498  -19.056 20.780 1.00 14.21 ? 56  GLU A OE1  3  
ATOM 5134  O OE2  . GLU A 1 56  ? 5.688  -21.001 20.154 1.00 51.54 ? 56  GLU A OE2  3  
ATOM 5135  H H    . GLU A 1 56  ? 11.225 -18.767 22.102 1.00 0.13  ? 56  GLU A H    3  
ATOM 5136  H HA   . GLU A 1 56  ? 9.824  -21.205 22.888 1.00 30.32 ? 56  GLU A HA   3  
ATOM 5137  H HB2  . GLU A 1 56  ? 8.499  -19.291 22.086 1.00 52.21 ? 56  GLU A HB2  3  
ATOM 5138  H HB3  . GLU A 1 56  ? 9.351  -19.349 20.549 1.00 13.12 ? 56  GLU A HB3  3  
ATOM 5139  H HG2  . GLU A 1 56  ? 8.334  -21.351 19.923 1.00 61.21 ? 56  GLU A HG2  3  
ATOM 5140  H HG3  . GLU A 1 56  ? 7.828  -21.715 21.572 1.00 53.53 ? 56  GLU A HG3  3  
ATOM 5141  N N    . GLU A 1 57  ? 11.367 -20.940 19.972 1.00 5.13  ? 57  GLU A N    3  
ATOM 5142  C CA   . GLU A 1 57  ? 12.076 -21.700 18.949 1.00 12.02 ? 57  GLU A CA   3  
ATOM 5143  C C    . GLU A 1 57  ? 13.320 -22.365 19.530 1.00 64.33 ? 57  GLU A C    3  
ATOM 5144  O O    . GLU A 1 57  ? 13.411 -23.591 19.590 1.00 71.12 ? 57  GLU A O    3  
ATOM 5145  C CB   . GLU A 1 57  ? 12.468 -20.788 17.785 1.00 72.14 ? 57  GLU A CB   3  
ATOM 5146  C CG   . GLU A 1 57  ? 11.560 -20.923 16.573 1.00 23.55 ? 57  GLU A CG   3  
ATOM 5147  C CD   . GLU A 1 57  ? 12.334 -21.046 15.275 1.00 3.23  ? 57  GLU A CD   3  
ATOM 5148  O OE1  . GLU A 1 57  ? 13.054 -20.088 14.922 1.00 53.02 ? 57  GLU A OE1  3  
ATOM 5149  O OE2  . GLU A 1 57  ? 12.221 -22.098 14.613 1.00 32.21 ? 57  GLU A OE2  3  
ATOM 5150  H H    . GLU A 1 57  ? 11.227 -19.979 19.843 1.00 44.30 ? 57  GLU A H    3  
ATOM 5151  H HA   . GLU A 1 57  ? 11.409 -22.467 18.585 1.00 43.02 ? 57  GLU A HA   3  
ATOM 5152  H HB2  . GLU A 1 57  ? 12.436 -19.762 18.120 1.00 1.11  ? 57  GLU A HB2  3  
ATOM 5153  H HB3  . GLU A 1 57  ? 13.476 -21.027 17.481 1.00 43.43 ? 57  GLU A HB3  3  
ATOM 5154  H HG2  . GLU A 1 57  ? 10.949 -21.805 16.694 1.00 31.13 ? 57  GLU A HG2  3  
ATOM 5155  H HG3  . GLU A 1 57  ? 10.925 -20.052 16.516 1.00 3.42  ? 57  GLU A HG3  3  
ATOM 5156  N N    . MET A 1 58  ? 14.277 -21.547 19.955 1.00 25.22 ? 58  MET A N    3  
ATOM 5157  C CA   . MET A 1 58  ? 15.517 -22.056 20.532 1.00 52.15 ? 58  MET A CA   3  
ATOM 5158  C C    . MET A 1 58  ? 15.258 -22.711 21.885 1.00 43.23 ? 58  MET A C    3  
ATOM 5159  O O    . MET A 1 58  ? 15.710 -23.827 22.142 1.00 12.14 ? 58  MET A O    3  
ATOM 5160  C CB   . MET A 1 58  ? 16.535 -20.924 20.686 1.00 72.45 ? 58  MET A CB   3  
ATOM 5161  C CG   . MET A 1 58  ? 17.237 -20.558 19.388 1.00 14.50 ? 58  MET A CG   3  
ATOM 5162  S SD   . MET A 1 58  ? 18.093 -18.974 19.485 1.00 24.04 ? 58  MET A SD   3  
ATOM 5163  C CE   . MET A 1 58  ? 17.924 -18.393 17.800 1.00 71.03 ? 58  MET A CE   3  
ATOM 5164  H H    . MET A 1 58  ? 14.148 -20.579 19.881 1.00 13.50 ? 58  MET A H    3  
ATOM 5165  H HA   . MET A 1 58  ? 15.916 -22.798 19.856 1.00 11.42 ? 58  MET A HA   3  
ATOM 5166  H HB2  . MET A 1 58  ? 16.026 -20.047 21.055 1.00 5.44  ? 58  MET A HB2  3  
ATOM 5167  H HB3  . MET A 1 58  ? 17.285 -21.225 21.402 1.00 74.30 ? 58  MET A HB3  3  
ATOM 5168  H HG2  . MET A 1 58  ? 17.958 -21.326 19.154 1.00 73.41 ? 58  MET A HG2  3  
ATOM 5169  H HG3  . MET A 1 58  ? 16.500 -20.505 18.600 1.00 64.55 ? 58  MET A HG3  3  
ATOM 5170  H HE1  . MET A 1 58  ? 18.311 -17.388 17.725 1.00 41.35 ? 58  MET A HE1  3  
ATOM 5171  H HE2  . MET A 1 58  ? 18.477 -19.043 17.138 1.00 5.40  ? 58  MET A HE2  3  
ATOM 5172  H HE3  . MET A 1 58  ? 16.880 -18.399 17.521 1.00 41.34 ? 58  MET A HE3  3  
ATOM 5173  N N    . LYS A 1 59  ? 14.530 -22.010 22.747 1.00 55.23 ? 59  LYS A N    3  
ATOM 5174  C CA   . LYS A 1 59  ? 14.210 -22.523 24.074 1.00 52.24 ? 59  LYS A CA   3  
ATOM 5175  C C    . LYS A 1 59  ? 15.461 -22.602 24.942 1.00 10.25 ? 59  LYS A C    3  
ATOM 5176  O O    . LYS A 1 59  ? 15.611 -23.520 25.750 1.00 55.14 ? 59  LYS A O    3  
ATOM 5177  C CB   . LYS A 1 59  ? 13.562 -23.905 23.966 1.00 24.31 ? 59  LYS A CB   3  
ATOM 5178  C CG   . LYS A 1 59  ? 12.205 -23.996 24.642 1.00 42.41 ? 59  LYS A CG   3  
ATOM 5179  C CD   . LYS A 1 59  ? 11.533 -25.330 24.367 1.00 60.31 ? 59  LYS A CD   3  
ATOM 5180  C CE   . LYS A 1 59  ? 10.049 -25.158 24.080 1.00 21.54 ? 59  LYS A CE   3  
ATOM 5181  N NZ   . LYS A 1 59  ? 9.661  -25.769 22.779 1.00 61.31 ? 59  LYS A NZ   3  
ATOM 5182  H H    . LYS A 1 59  ? 14.198 -21.125 22.483 1.00 34.53 ? 59  LYS A H    3  
ATOM 5183  H HA   . LYS A 1 59  ? 13.510 -21.842 24.533 1.00 54.52 ? 59  LYS A HA   3  
ATOM 5184  H HB2  . LYS A 1 59  ? 13.439 -24.151 22.922 1.00 74.42 ? 59  LYS A HB2  3  
ATOM 5185  H HB3  . LYS A 1 59  ? 14.218 -24.633 24.423 1.00 12.22 ? 59  LYS A HB3  3  
ATOM 5186  H HG2  . LYS A 1 59  ? 12.336 -23.884 25.708 1.00 14.40 ? 59  LYS A HG2  3  
ATOM 5187  H HG3  . LYS A 1 59  ? 11.574 -23.201 24.269 1.00 21.31 ? 59  LYS A HG3  3  
ATOM 5188  H HD2  . LYS A 1 59  ? 12.002 -25.790 23.510 1.00 24.41 ? 59  LYS A HD2  3  
ATOM 5189  H HD3  . LYS A 1 59  ? 11.653 -25.969 25.231 1.00 15.50 ? 59  LYS A HD3  3  
ATOM 5190  H HE2  . LYS A 1 59  ? 9.486  -25.630 24.871 1.00 2.34  ? 59  LYS A HE2  3  
ATOM 5191  H HE3  . LYS A 1 59  ? 9.821  -24.103 24.056 1.00 73.24 ? 59  LYS A HE3  3  
ATOM 5192  H HZ1  . LYS A 1 59  ? 10.208 -25.340 22.006 1.00 44.33 ? 59  LYS A HZ1  3  
ATOM 5193  H HZ2  . LYS A 1 59  ? 8.649  -25.614 22.599 1.00 33.42 ? 59  LYS A HZ2  3  
ATOM 5194  H HZ3  . LYS A 1 59  ? 9.847  -26.792 22.794 1.00 21.34 ? 59  LYS A HZ3  3  
ATOM 5195  N N    . CYS A 1 60  ? 16.355 -21.634 24.773 1.00 62.40 ? 60  CYS A N    3  
ATOM 5196  C CA   . CYS A 1 60  ? 17.594 -21.594 25.543 1.00 74.42 ? 60  CYS A CA   3  
ATOM 5197  C C    . CYS A 1 60  ? 17.693 -20.302 26.347 1.00 74.13 ? 60  CYS A C    3  
ATOM 5198  O O    . CYS A 1 60  ? 16.748 -19.513 26.392 1.00 63.42 ? 60  CYS A O    3  
ATOM 5199  C CB   . CYS A 1 60  ? 18.801 -21.725 24.613 1.00 11.30 ? 60  CYS A CB   3  
ATOM 5200  S SG   . CYS A 1 60  ? 18.937 -20.400 23.390 1.00 4.54  ? 60  CYS A SG   3  
ATOM 5201  H H    . CYS A 1 60  ? 16.180 -20.930 24.114 1.00 34.14 ? 60  CYS A H    3  
ATOM 5202  H HA   . CYS A 1 60  ? 17.585 -22.429 26.227 1.00 72.44 ? 60  CYS A HA   3  
ATOM 5203  H HB2  . CYS A 1 60  ? 19.704 -21.718 25.205 1.00 22.51 ? 60  CYS A HB2  3  
ATOM 5204  H HB3  . CYS A 1 60  ? 18.735 -22.661 24.079 1.00 10.01 ? 60  CYS A HB3  3  
ATOM 5205  H HG   . CYS A 1 60  ? 20.091 -20.546 22.756 1.00 33.13 ? 60  CYS A HG   3  
ATOM 5206  N N    . ASP A 1 61  ? 18.841 -20.093 26.981 1.00 12.21 ? 61  ASP A N    3  
ATOM 5207  C CA   . ASP A 1 61  ? 19.063 -18.896 27.784 1.00 24.35 ? 61  ASP A CA   3  
ATOM 5208  C C    . ASP A 1 61  ? 20.001 -17.928 27.069 1.00 32.24 ? 61  ASP A C    3  
ATOM 5209  O O    . ASP A 1 61  ? 20.744 -17.182 27.707 1.00 5.25  ? 61  ASP A O    3  
ATOM 5210  C CB   . ASP A 1 61  ? 19.643 -19.273 29.149 1.00 50.21 ? 61  ASP A CB   3  
ATOM 5211  C CG   . ASP A 1 61  ? 19.122 -18.387 30.264 1.00 70.14 ? 61  ASP A CG   3  
ATOM 5212  O OD1  . ASP A 1 61  ? 18.121 -18.768 30.906 1.00 31.30 ? 61  ASP A OD1  3  
ATOM 5213  O OD2  . ASP A 1 61  ? 19.716 -17.313 30.494 1.00 32.22 ? 61  ASP A OD2  3  
ATOM 5214  H H    . ASP A 1 61  ? 19.556 -20.759 26.907 1.00 44.34 ? 61  ASP A H    3  
ATOM 5215  H HA   . ASP A 1 61  ? 18.110 -18.412 27.930 1.00 35.41 ? 61  ASP A HA   3  
ATOM 5216  H HB2  . ASP A 1 61  ? 19.380 -20.296 29.375 1.00 52.02 ? 61  ASP A HB2  3  
ATOM 5217  H HB3  . ASP A 1 61  ? 20.719 -19.181 29.113 1.00 34.54 ? 61  ASP A HB3  3  
ATOM 5218  N N    . LEU A 1 62  ? 19.961 -17.946 25.742 1.00 60.43 ? 62  LEU A N    3  
ATOM 5219  C CA   . LEU A 1 62  ? 20.808 -17.071 24.939 1.00 53.21 ? 62  LEU A CA   3  
ATOM 5220  C C    . LEU A 1 62  ? 20.742 -15.634 25.447 1.00 21.11 ? 62  LEU A C    3  
ATOM 5221  O O    . LEU A 1 62  ? 19.670 -15.137 25.794 1.00 5.33  ? 62  LEU A O    3  
ATOM 5222  C CB   . LEU A 1 62  ? 20.383 -17.124 23.470 1.00 30.23 ? 62  LEU A CB   3  
ATOM 5223  C CG   . LEU A 1 62  ? 21.378 -17.773 22.507 1.00 12.30 ? 62  LEU A CG   3  
ATOM 5224  C CD1  . LEU A 1 62  ? 20.800 -17.830 21.102 1.00 71.25 ? 62  LEU A CD1  3  
ATOM 5225  C CD2  . LEU A 1 62  ? 22.697 -17.014 22.513 1.00 61.35 ? 62  LEU A CD2  3  
ATOM 5226  H H    . LEU A 1 62  ? 19.348 -18.563 25.290 1.00 43.43 ? 62  LEU A H    3  
ATOM 5227  H HA   . LEU A 1 62  ? 21.825 -17.424 25.024 1.00 14.02 ? 62  LEU A HA   3  
ATOM 5228  H HB2  . LEU A 1 62  ? 19.459 -17.678 23.413 1.00 32.55 ? 62  LEU A HB2  3  
ATOM 5229  H HB3  . LEU A 1 62  ? 20.213 -16.110 23.139 1.00 42.41 ? 62  LEU A HB3  3  
ATOM 5230  H HG   . LEU A 1 62  ? 21.572 -18.786 22.829 1.00 24.50 ? 62  LEU A HG   3  
ATOM 5231  H HD11 . LEU A 1 62  ? 19.856 -17.307 21.079 1.00 42.22 ? 62  LEU A HD11 3  
ATOM 5232  H HD12 . LEU A 1 62  ? 20.647 -18.861 20.817 1.00 10.22 ? 62  LEU A HD12 3  
ATOM 5233  H HD13 . LEU A 1 62  ? 21.487 -17.365 20.410 1.00 4.24  ? 62  LEU A HD13 3  
ATOM 5234  H HD21 . LEU A 1 62  ? 23.516 -17.718 22.546 1.00 51.23 ? 62  LEU A HD21 3  
ATOM 5235  H HD22 . LEU A 1 62  ? 22.739 -16.372 23.380 1.00 3.22  ? 62  LEU A HD22 3  
ATOM 5236  H HD23 . LEU A 1 62  ? 22.772 -16.416 21.617 1.00 61.12 ? 62  LEU A HD23 3  
ATOM 5237  N N    . ILE A 1 63  ? 21.894 -14.973 25.486 1.00 53.52 ? 63  ILE A N    3  
ATOM 5238  C CA   . ILE A 1 63  ? 21.966 -13.592 25.948 1.00 30.12 ? 63  ILE A CA   3  
ATOM 5239  C C    . ILE A 1 63  ? 22.231 -12.637 24.789 1.00 21.31 ? 63  ILE A C    3  
ATOM 5240  O O    . ILE A 1 63  ? 23.245 -12.747 24.099 1.00 31.34 ? 63  ILE A O    3  
ATOM 5241  C CB   . ILE A 1 63  ? 23.067 -13.411 27.010 1.00 52.21 ? 63  ILE A CB   3  
ATOM 5242  C CG1  . ILE A 1 63  ? 22.796 -14.313 28.216 1.00 41.22 ? 63  ILE A CG1  3  
ATOM 5243  C CG2  . ILE A 1 63  ? 23.153 -11.954 27.440 1.00 61.10 ? 63  ILE A CG2  3  
ATOM 5244  C CD1  . ILE A 1 63  ? 24.040 -14.654 29.006 1.00 32.41 ? 63  ILE A CD1  3  
ATOM 5245  H H    . ILE A 1 63  ? 22.714 -15.423 25.196 1.00 71.20 ? 63  ILE A H    3  
ATOM 5246  H HA   . ILE A 1 63  ? 21.016 -13.341 26.397 1.00 33.22 ? 63  ILE A HA   3  
ATOM 5247  H HB   . ILE A 1 63  ? 24.012 -13.687 26.567 1.00 34.15 ? 63  ILE A HB   3  
ATOM 5248  H HG12 . ILE A 1 63  ? 22.107 -13.817 28.881 1.00 50.00 ? 63  ILE A HG12 3  
ATOM 5249  H HG13 . ILE A 1 63  ? 22.356 -15.238 27.872 1.00 12.22 ? 63  ILE A HG13 3  
ATOM 5250  H HG21 . ILE A 1 63  ? 22.158 -11.541 27.514 1.00 32.23 ? 63  ILE A HG21 3  
ATOM 5251  H HG22 . ILE A 1 63  ? 23.640 -11.891 28.401 1.00 24.33 ? 63  ILE A HG22 3  
ATOM 5252  H HG23 . ILE A 1 63  ? 23.721 -11.396 26.711 1.00 72.12 ? 63  ILE A HG23 3  
ATOM 5253  H HD11 . ILE A 1 63  ? 23.954 -14.253 30.005 1.00 51.41 ? 63  ILE A HD11 3  
ATOM 5254  H HD12 . ILE A 1 63  ? 24.152 -15.727 29.057 1.00 54.12 ? 63  ILE A HD12 3  
ATOM 5255  H HD13 . ILE A 1 63  ? 24.904 -14.225 28.520 1.00 63.22 ? 63  ILE A HD13 3  
ATOM 5256  N N    . VAL A 1 64  ? 21.313 -11.698 24.581 1.00 23.50 ? 64  VAL A N    3  
ATOM 5257  C CA   . VAL A 1 64  ? 21.449 -10.722 23.507 1.00 12.53 ? 64  VAL A CA   3  
ATOM 5258  C C    . VAL A 1 64  ? 22.445 -9.629  23.881 1.00 75.13 ? 64  VAL A C    3  
ATOM 5259  O O    . VAL A 1 64  ? 22.651 -9.339  25.058 1.00 11.22 ? 64  VAL A O    3  
ATOM 5260  C CB   . VAL A 1 64  ? 20.095 -10.072 23.166 1.00 52.35 ? 64  VAL A CB   3  
ATOM 5261  C CG1  . VAL A 1 64  ? 19.623 -9.188  24.310 1.00 53.53 ? 64  VAL A CG1  3  
ATOM 5262  C CG2  . VAL A 1 64  ? 20.197 -9.276  21.873 1.00 3.11  ? 64  VAL A CG2  3  
ATOM 5263  H H    . VAL A 1 64  ? 20.527 -11.662 25.164 1.00 14.42 ? 64  VAL A H    3  
ATOM 5264  H HA   . VAL A 1 64  ? 21.808 -11.238 22.629 1.00 23.11 ? 64  VAL A HA   3  
ATOM 5265  H HB   . VAL A 1 64  ? 19.367 -10.857 23.023 1.00 22.22 ? 64  VAL A HB   3  
ATOM 5266  H HG11 . VAL A 1 64  ? 18.543 -9.182  24.338 1.00 51.44 ? 64  VAL A HG11 3  
ATOM 5267  H HG12 . VAL A 1 64  ? 20.006 -9.571  25.244 1.00 63.44 ? 64  VAL A HG12 3  
ATOM 5268  H HG13 . VAL A 1 64  ? 19.983 -8.181  24.159 1.00 45.34 ? 64  VAL A HG13 3  
ATOM 5269  H HG21 . VAL A 1 64  ? 19.208 -9.107  21.476 1.00 74.33 ? 64  VAL A HG21 3  
ATOM 5270  H HG22 . VAL A 1 64  ? 20.672 -8.326  22.071 1.00 1.25  ? 64  VAL A HG22 3  
ATOM 5271  H HG23 . VAL A 1 64  ? 20.785 -9.828  21.155 1.00 31.42 ? 64  VAL A HG23 3  
ATOM 5272  N N    . GLY A 1 65  ? 23.060 -9.025  22.868 1.00 31.52 ? 65  GLY A N    3  
ATOM 5273  C CA   . GLY A 1 65  ? 24.027 -7.971  23.111 1.00 51.14 ? 65  GLY A CA   3  
ATOM 5274  C C    . GLY A 1 65  ? 23.528 -6.612  22.660 1.00 65.35 ? 65  GLY A C    3  
ATOM 5275  O O    . GLY A 1 65  ? 22.663 -6.016  23.302 1.00 63.55 ? 65  GLY A O    3  
ATOM 5276  H H    . GLY A 1 65  ? 22.856 -9.299  21.949 1.00 14.43 ? 65  GLY A H    3  
ATOM 5277  H HA2  . GLY A 1 65  ? 24.242 -7.931  24.168 1.00 64.01 ? 65  GLY A HA2  3  
ATOM 5278  H HA3  . GLY A 1 65  ? 24.937 -8.203  22.577 1.00 52.15 ? 65  GLY A HA3  3  
ATOM 5279  N N    . ASP A 1 66  ? 24.076 -6.120  21.554 1.00 71.43 ? 66  ASP A N    3  
ATOM 5280  C CA   . ASP A 1 66  ? 23.682 -4.823  21.017 1.00 1.34  ? 66  ASP A CA   3  
ATOM 5281  C C    . ASP A 1 66  ? 23.375 -4.921  19.526 1.00 31.44 ? 66  ASP A C    3  
ATOM 5282  O O    . ASP A 1 66  ? 23.632 -5.947  18.895 1.00 53.31 ? 66  ASP A O    3  
ATOM 5283  C CB   . ASP A 1 66  ? 24.786 -3.792  21.256 1.00 5.12  ? 66  ASP A CB   3  
ATOM 5284  C CG   . ASP A 1 66  ? 24.267 -2.368  21.222 1.00 33.11 ? 66  ASP A CG   3  
ATOM 5285  O OD1  . ASP A 1 66  ? 23.212 -2.106  21.839 1.00 64.15 ? 66  ASP A OD1  3  
ATOM 5286  O OD2  . ASP A 1 66  ? 24.915 -1.516  20.580 1.00 55.33 ? 66  ASP A OD2  3  
ATOM 5287  H H    . ASP A 1 66  ? 24.761 -6.643  21.086 1.00 20.12 ? 66  ASP A H    3  
ATOM 5288  H HA   . ASP A 1 66  ? 22.789 -4.507  21.536 1.00 44.22 ? 66  ASP A HA   3  
ATOM 5289  H HB2  . ASP A 1 66  ? 25.232 -3.969  22.224 1.00 25.21 ? 66  ASP A HB2  3  
ATOM 5290  H HB3  . ASP A 1 66  ? 25.541 -3.899  20.491 1.00 24.23 ? 66  ASP A HB3  3  
ATOM 5291  N N    . LYS A 1 67  ? 22.823 -3.849  18.969 1.00 34.12 ? 67  LYS A N    3  
ATOM 5292  C CA   . LYS A 1 67  ? 22.480 -3.813  17.552 1.00 32.24 ? 67  LYS A CA   3  
ATOM 5293  C C    . LYS A 1 67  ? 23.733 -3.905  16.687 1.00 14.30 ? 67  LYS A C    3  
ATOM 5294  O O    . LYS A 1 67  ? 24.778 -3.352  17.030 1.00 52.32 ? 67  LYS A O    3  
ATOM 5295  C CB   . LYS A 1 67  ? 21.713 -2.530  17.224 1.00 21.14 ? 67  LYS A CB   3  
ATOM 5296  C CG   . LYS A 1 67  ? 21.367 -2.388  15.752 1.00 12.14 ? 67  LYS A CG   3  
ATOM 5297  C CD   . LYS A 1 67  ? 20.225 -3.309  15.357 1.00 63.45 ? 67  LYS A CD   3  
ATOM 5298  C CE   . LYS A 1 67  ? 19.339 -2.674  14.296 1.00 35.53 ? 67  LYS A CE   3  
ATOM 5299  N NZ   . LYS A 1 67  ? 19.878 -2.883  12.924 1.00 4.12  ? 67  LYS A NZ   3  
ATOM 5300  H H    . LYS A 1 67  ? 22.642 -3.061  19.525 1.00 72.43 ? 67  LYS A H    3  
ATOM 5301  H HA   . LYS A 1 67  ? 21.849 -4.663  17.342 1.00 32.41 ? 67  LYS A HA   3  
ATOM 5302  H HB2  . LYS A 1 67  ? 20.794 -2.519  17.792 1.00 61.12 ? 67  LYS A HB2  3  
ATOM 5303  H HB3  . LYS A 1 67  ? 22.315 -1.681  17.515 1.00 63.15 ? 67  LYS A HB3  3  
ATOM 5304  H HG2  . LYS A 1 67  ? 21.075 -1.367  15.557 1.00 12.34 ? 67  LYS A HG2  3  
ATOM 5305  H HG3  . LYS A 1 67  ? 22.238 -2.634  15.162 1.00 72.33 ? 67  LYS A HG3  3  
ATOM 5306  H HD2  . LYS A 1 67  ? 20.635 -4.228  14.964 1.00 40.04 ? 67  LYS A HD2  3  
ATOM 5307  H HD3  . LYS A 1 67  ? 19.628 -3.525  16.231 1.00 0.44  ? 67  LYS A HD3  3  
ATOM 5308  H HE2  . LYS A 1 67  ? 18.355 -3.115  14.358 1.00 41.55 ? 67  LYS A HE2  3  
ATOM 5309  H HE3  . LYS A 1 67  ? 19.271 -1.614  14.490 1.00 20.13 ? 67  LYS A HE3  3  
ATOM 5310  H HZ1  . LYS A 1 67  ? 20.149 -3.879  12.795 1.00 52.15 ? 67  LYS A HZ1  3  
ATOM 5311  H HZ2  . LYS A 1 67  ? 20.717 -2.286  12.776 1.00 53.04 ? 67  LYS A HZ2  3  
ATOM 5312  H HZ3  . LYS A 1 67  ? 19.159 -2.635  12.215 1.00 1.14  ? 67  LYS A HZ3  3  
ATOM 5313  N N    . VAL A 1 68  ? 23.620 -4.605  15.563 1.00 61.12 ? 68  VAL A N    3  
ATOM 5314  C CA   . VAL A 1 68  ? 24.743 -4.766  14.647 1.00 60.40 ? 68  VAL A CA   3  
ATOM 5315  C C    . VAL A 1 68  ? 24.647 -3.788  13.482 1.00 72.02 ? 68  VAL A C    3  
ATOM 5316  O O    . VAL A 1 68  ? 25.507 -2.923  13.312 1.00 71.32 ? 68  VAL A O    3  
ATOM 5317  C CB   . VAL A 1 68  ? 24.814 -6.202  14.093 1.00 12.11 ? 68  VAL A CB   3  
ATOM 5318  C CG1  . VAL A 1 68  ? 25.953 -6.333  13.093 1.00 33.25 ? 68  VAL A CG1  3  
ATOM 5319  C CG2  . VAL A 1 68  ? 24.971 -7.203  15.228 1.00 61.14 ? 68  VAL A CG2  3  
ATOM 5320  H H    . VAL A 1 68  ? 22.761 -5.023  15.344 1.00 40.41 ? 68  VAL A H    3  
ATOM 5321  H HA   . VAL A 1 68  ? 25.653 -4.570  15.196 1.00 55.52 ? 68  VAL A HA   3  
ATOM 5322  H HB   . VAL A 1 68  ? 23.888 -6.414  13.580 1.00 75.13 ? 68  VAL A HB   3  
ATOM 5323  H HG11 . VAL A 1 68  ? 26.750 -5.658  13.366 1.00 2.42  ? 68  VAL A HG11 3  
ATOM 5324  H HG12 . VAL A 1 68  ? 26.322 -7.348  13.099 1.00 75.43 ? 68  VAL A HG12 3  
ATOM 5325  H HG13 . VAL A 1 68  ? 25.594 -6.085  12.105 1.00 22.12 ? 68  VAL A HG13 3  
ATOM 5326  H HG21 . VAL A 1 68  ? 25.855 -7.801  15.059 1.00 14.44 ? 68  VAL A HG21 3  
ATOM 5327  H HG22 . VAL A 1 68  ? 25.068 -6.674  16.165 1.00 52.13 ? 68  VAL A HG22 3  
ATOM 5328  H HG23 . VAL A 1 68  ? 24.104 -7.845  15.265 1.00 15.31 ? 68  VAL A HG23 3  
ATOM 5329  N N    . ILE A 1 69  ? 23.595 -3.930  12.682 1.00 21.24 ? 69  ILE A N    3  
ATOM 5330  C CA   . ILE A 1 69  ? 23.386 -3.058  11.534 1.00 53.42 ? 69  ILE A CA   3  
ATOM 5331  C C    . ILE A 1 69  ? 22.027 -3.313  10.890 1.00 43.03 ? 69  ILE A C    3  
ATOM 5332  O O    . ILE A 1 69  ? 21.466 -4.403  11.007 1.00 25.13 ? 69  ILE A O    3  
ATOM 5333  C CB   . ILE A 1 69  ? 24.487 -3.247  10.474 1.00 24.34 ? 69  ILE A CB   3  
ATOM 5334  C CG1  . ILE A 1 69  ? 24.450 -2.104  9.458  1.00 61.20 ? 69  ILE A CG1  3  
ATOM 5335  C CG2  . ILE A 1 69  ? 24.326 -4.589  9.777  1.00 74.45 ? 69  ILE A CG2  3  
ATOM 5336  C CD1  . ILE A 1 69  ? 25.822 -1.622  9.040  1.00 33.04 ? 69  ILE A CD1  3  
ATOM 5337  H H    . ILE A 1 69  ? 22.944 -4.638  12.870 1.00 62.01 ? 69  ILE A H    3  
ATOM 5338  H HA   . ILE A 1 69  ? 23.421 -2.035  11.882 1.00 72.13 ? 69  ILE A HA   3  
ATOM 5339  H HB   . ILE A 1 69  ? 25.443 -3.242  10.976 1.00 31.51 ? 69  ILE A HB   3  
ATOM 5340  H HG12 . ILE A 1 69  ? 23.932 -2.435  8.572  1.00 33.21 ? 69  ILE A HG12 3  
ATOM 5341  H HG13 . ILE A 1 69  ? 23.920 -1.267  9.889  1.00 50.14 ? 69  ILE A HG13 3  
ATOM 5342  H HG21 . ILE A 1 69  ? 25.131 -4.727  9.070  1.00 20.23 ? 69  ILE A HG21 3  
ATOM 5343  H HG22 . ILE A 1 69  ? 24.352 -5.381  10.510 1.00 72.42 ? 69  ILE A HG22 3  
ATOM 5344  H HG23 . ILE A 1 69  ? 23.381 -4.613  9.254  1.00 10.54 ? 69  ILE A HG23 3  
ATOM 5345  H HD11 . ILE A 1 69  ? 26.220 -2.280  8.282  1.00 31.34 ? 69  ILE A HD11 3  
ATOM 5346  H HD12 . ILE A 1 69  ? 25.747 -0.620  8.646  1.00 70.24 ? 69  ILE A HD12 3  
ATOM 5347  H HD13 . ILE A 1 69  ? 26.480 -1.623  9.898  1.00 53.43 ? 69  ILE A HD13 3  
ATOM 5348  N N    . THR A 1 70  ? 21.503 -2.301  10.206 1.00 13.51 ? 70  THR A N    3  
ATOM 5349  C CA   . THR A 1 70  ? 20.210 -2.415  9.542  1.00 4.22  ? 70  THR A CA   3  
ATOM 5350  C C    . THR A 1 70  ? 20.380 -2.646  8.045  1.00 30.20 ? 70  THR A C    3  
ATOM 5351  O O    . THR A 1 70  ? 21.210 -2.007  7.397  1.00 20.41 ? 70  THR A O    3  
ATOM 5352  C CB   . THR A 1 70  ? 19.353 -1.154  9.761  1.00 33.34 ? 70  THR A CB   3  
ATOM 5353  O OG1  . THR A 1 70  ? 19.354 -0.796  11.148 1.00 43.43 ? 70  THR A OG1  3  
ATOM 5354  C CG2  . THR A 1 70  ? 17.924 -1.384  9.293  1.00 14.05 ? 70  THR A CG2  3  
ATOM 5355  H H    . THR A 1 70  ? 21.998 -1.457  10.149 1.00 53.24 ? 70  THR A H    3  
ATOM 5356  H HA   . THR A 1 70  ? 19.689 -3.259  9.970  1.00 11.43 ? 70  THR A HA   3  
ATOM 5357  H HB   . THR A 1 70  ? 19.778 -0.344  9.187  1.00 0.41  ? 70  THR A HB   3  
ATOM 5358  H HG1  . THR A 1 70  ? 19.239 0.154   11.233 1.00 63.01 ? 70  THR A HG1  3  
ATOM 5359  H HG21 . THR A 1 70  ? 17.831 -1.087  8.259  1.00 2.02  ? 70  THR A HG21 3  
ATOM 5360  H HG22 . THR A 1 70  ? 17.248 -0.798  9.898  1.00 2.45  ? 70  THR A HG22 3  
ATOM 5361  H HG23 . THR A 1 70  ? 17.678 -2.431  9.390  1.00 15.42 ? 70  THR A HG23 3  
ATOM 5362  N N    . THR A 1 71  ? 19.588 -3.564  7.499  1.00 13.30 ? 71  THR A N    3  
ATOM 5363  C CA   . THR A 1 71  ? 19.651 -3.880  6.078  1.00 54.43 ? 71  THR A CA   3  
ATOM 5364  C C    . THR A 1 71  ? 18.257 -4.108  5.503  1.00 23.11 ? 71  THR A C    3  
ATOM 5365  O O    . THR A 1 71  ? 17.541 -5.013  5.930  1.00 1.23  ? 71  THR A O    3  
ATOM 5366  C CB   . THR A 1 71  ? 20.512 -5.130  5.818  1.00 41.23 ? 71  THR A CB   3  
ATOM 5367  O OG1  . THR A 1 71  ? 21.494 -5.272  6.850  1.00 11.44 ? 71  THR A OG1  3  
ATOM 5368  C CG2  . THR A 1 71  ? 21.201 -5.040  4.465  1.00 64.15 ? 71  THR A CG2  3  
ATOM 5369  H H    . THR A 1 71  ? 18.947 -4.039  8.067  1.00 34.14 ? 71  THR A H    3  
ATOM 5370  H HA   . THR A 1 71  ? 20.106 -3.042  5.570  1.00 63.14 ? 71  THR A HA   3  
ATOM 5371  H HB   . THR A 1 71  ? 19.869 -5.998  5.821  1.00 62.41 ? 71  THR A HB   3  
ATOM 5372  H HG1  . THR A 1 71  ? 22.223 -5.808  6.528  1.00 54.51 ? 71  THR A HG1  3  
ATOM 5373  H HG21 . THR A 1 71  ? 21.368 -4.003  4.213  1.00 31.12 ? 71  THR A HG21 3  
ATOM 5374  H HG22 . THR A 1 71  ? 20.577 -5.498  3.712  1.00 50.44 ? 71  THR A HG22 3  
ATOM 5375  H HG23 . THR A 1 71  ? 22.149 -5.556  4.509  1.00 53.12 ? 71  THR A HG23 3  
ATOM 5376  N N    . GLU A 1 72  ? 17.880 -3.283  4.532  1.00 51.52 ? 72  GLU A N    3  
ATOM 5377  C CA   . GLU A 1 72  ? 16.571 -3.396  3.899  1.00 20.12 ? 72  GLU A CA   3  
ATOM 5378  C C    . GLU A 1 72  ? 16.710 -3.722  2.415  1.00 25.41 ? 72  GLU A C    3  
ATOM 5379  O O    . GLU A 1 72  ? 17.660 -3.291  1.760  1.00 75.15 ? 72  GLU A O    3  
ATOM 5380  C CB   . GLU A 1 72  ? 15.781 -2.098  4.075  1.00 13.31 ? 72  GLU A CB   3  
ATOM 5381  C CG   . GLU A 1 72  ? 15.611 -1.680  5.526  1.00 33.31 ? 72  GLU A CG   3  
ATOM 5382  C CD   . GLU A 1 72  ? 15.423 -0.184  5.685  1.00 74.14 ? 72  GLU A CD   3  
ATOM 5383  O OE1  . GLU A 1 72  ? 14.285 0.295   5.496  1.00 30.30 ? 72  GLU A OE1  3  
ATOM 5384  O OE2  . GLU A 1 72  ? 16.414 0.508   5.998  1.00 61.03 ? 72  GLU A OE2  3  
ATOM 5385  H H    . GLU A 1 72  ? 18.496 -2.581  4.234  1.00 13.33 ? 72  GLU A H    3  
ATOM 5386  H HA   . GLU A 1 72  ? 16.037 -4.200  4.383  1.00 3.35  ? 72  GLU A HA   3  
ATOM 5387  H HB2  . GLU A 1 72  ? 16.293 -1.304  3.551  1.00 22.50 ? 72  GLU A HB2  3  
ATOM 5388  H HB3  . GLU A 1 72  ? 14.799 -2.227  3.643  1.00 45.14 ? 72  GLU A HB3  3  
ATOM 5389  H HG2  . GLU A 1 72  ? 14.745 -2.181  5.933  1.00 70.34 ? 72  GLU A HG2  3  
ATOM 5390  H HG3  . GLU A 1 72  ? 16.490 -1.978  6.078  1.00 32.45 ? 72  GLU A HG3  3  
ATOM 5391  N N    . HIS A 1 73  ? 15.758 -4.488  1.891  1.00 2.15  ? 73  HIS A N    3  
ATOM 5392  C CA   . HIS A 1 73  ? 15.774 -4.873  0.485  1.00 51.13 ? 73  HIS A CA   3  
ATOM 5393  C C    . HIS A 1 73  ? 14.430 -4.577  -0.175 1.00 21.34 ? 73  HIS A C    3  
ATOM 5394  O O    . HIS A 1 73  ? 13.385 -5.023  0.299  1.00 44.31 ? 73  HIS A O    3  
ATOM 5395  C CB   . HIS A 1 73  ? 16.108 -6.358  0.344  1.00 23.23 ? 73  HIS A CB   3  
ATOM 5396  C CG   . HIS A 1 73  ? 17.326 -6.773  1.112  1.00 74.21 ? 73  HIS A CG   3  
ATOM 5397  N ND1  . HIS A 1 73  ? 18.588 -6.812  0.558  1.00 73.02 ? 73  HIS A ND1  3  
ATOM 5398  C CD2  . HIS A 1 73  ? 17.469 -7.167  2.399  1.00 60.42 ? 73  HIS A CD2  3  
ATOM 5399  C CE1  . HIS A 1 73  ? 19.455 -7.214  1.470  1.00 15.33 ? 73  HIS A CE1  3  
ATOM 5400  N NE2  . HIS A 1 73  ? 18.801 -7.436  2.597  1.00 42.54 ? 73  HIS A NE2  3  
ATOM 5401  H H    . HIS A 1 73  ? 15.028 -4.801  2.465  1.00 53.34 ? 73  HIS A H    3  
ATOM 5402  H HA   . HIS A 1 73  ? 16.538 -4.293  -0.009 1.00 44.53 ? 73  HIS A HA   3  
ATOM 5403  H HB2  . HIS A 1 73  ? 15.275 -6.944  0.704  1.00 52.55 ? 73  HIS A HB2  3  
ATOM 5404  H HB3  . HIS A 1 73  ? 16.279 -6.585  -0.698 1.00 71.32 ? 73  HIS A HB3  3  
ATOM 5405  H HD1  . HIS A 1 73  ? 18.814 -6.581  -0.367 1.00 20.21 ? 73  HIS A HD1  3  
ATOM 5406  H HD2  . HIS A 1 73  ? 16.682 -7.255  3.135  1.00 72.44 ? 73  HIS A HD2  3  
ATOM 5407  H HE1  . HIS A 1 73  ? 20.517 -7.339  1.322  1.00 74.13 ? 73  HIS A HE1  3  
ATOM 5408  N N    . GLU A 1 74  ? 14.466 -3.823  -1.269 1.00 2.14  ? 74  GLU A N    3  
ATOM 5409  C CA   . GLU A 1 74  ? 13.250 -3.467  -1.991 1.00 24.22 ? 74  GLU A CA   3  
ATOM 5410  C C    . GLU A 1 74  ? 12.732 -4.652  -2.800 1.00 71.52 ? 74  GLU A C    3  
ATOM 5411  O O    . GLU A 1 74  ? 13.261 -4.969  -3.866 1.00 32.20 ? 74  GLU A O    3  
ATOM 5412  C CB   . GLU A 1 74  ? 13.511 -2.278  -2.917 1.00 54.43 ? 74  GLU A CB   3  
ATOM 5413  C CG   . GLU A 1 74  ? 12.285 -1.835  -3.698 1.00 15.41 ? 74  GLU A CG   3  
ATOM 5414  C CD   . GLU A 1 74  ? 12.608 -0.791  -4.750 1.00 22.24 ? 74  GLU A CD   3  
ATOM 5415  O OE1  . GLU A 1 74  ? 12.740 -1.163  -5.934 1.00 63.22 ? 74  GLU A OE1  3  
ATOM 5416  O OE2  . GLU A 1 74  ? 12.729 0.398   -4.387 1.00 60.12 ? 74  GLU A OE2  3  
ATOM 5417  H H    . GLU A 1 74  ? 15.330 -3.498  -1.597 1.00 42.32 ? 74  GLU A H    3  
ATOM 5418  H HA   . GLU A 1 74  ? 12.502 -3.189  -1.264 1.00 45.50 ? 74  GLU A HA   3  
ATOM 5419  H HB2  . GLU A 1 74  ? 13.856 -1.444  -2.324 1.00 53.53 ? 74  GLU A HB2  3  
ATOM 5420  H HB3  . GLU A 1 74  ? 14.282 -2.549  -3.623 1.00 73.01 ? 74  GLU A HB3  3  
ATOM 5421  H HG2  . GLU A 1 74  ? 11.855 -2.695  -4.188 1.00 33.54 ? 74  GLU A HG2  3  
ATOM 5422  H HG3  . GLU A 1 74  ? 11.565 -1.418  -3.008 1.00 24.10 ? 74  GLU A HG3  3  
ATOM 5423  N N    . TYR A 1 75  ? 11.695 -5.304  -2.286 1.00 54.41 ? 75  TYR A N    3  
ATOM 5424  C CA   . TYR A 1 75  ? 11.106 -6.456  -2.958 1.00 52.34 ? 75  TYR A CA   3  
ATOM 5425  C C    . TYR A 1 75  ? 9.798  -6.075  -3.646 1.00 61.52 ? 75  TYR A C    3  
ATOM 5426  O O    . TYR A 1 75  ? 9.224  -5.021  -3.374 1.00 31.15 ? 75  TYR A O    3  
ATOM 5427  C CB   . TYR A 1 75  ? 10.859 -7.586  -1.957 1.00 52.54 ? 75  TYR A CB   3  
ATOM 5428  C CG   . TYR A 1 75  ? 12.003 -8.569  -1.860 1.00 71.20 ? 75  TYR A CG   3  
ATOM 5429  C CD1  . TYR A 1 75  ? 11.993 -9.752  -2.589 1.00 15.20 ? 75  TYR A CD1  3  
ATOM 5430  C CD2  . TYR A 1 75  ? 13.095 -8.315  -1.039 1.00 62.05 ? 75  TYR A CD2  3  
ATOM 5431  C CE1  . TYR A 1 75  ? 13.035 -10.654 -2.502 1.00 44.43 ? 75  TYR A CE1  3  
ATOM 5432  C CE2  . TYR A 1 75  ? 14.143 -9.210  -0.948 1.00 23.43 ? 75  TYR A CE2  3  
ATOM 5433  C CZ   . TYR A 1 75  ? 14.109 -10.378 -1.681 1.00 35.34 ? 75  TYR A CZ   3  
ATOM 5434  O OH   . TYR A 1 75  ? 15.150 -11.273 -1.593 1.00 20.34 ? 75  TYR A OH   3  
ATOM 5435  H H    . TYR A 1 75  ? 11.316 -5.004  -1.433 1.00 44.32 ? 75  TYR A H    3  
ATOM 5436  H HA   . TYR A 1 75  ? 11.807 -6.797  -3.706 1.00 74.31 ? 75  TYR A HA   3  
ATOM 5437  H HB2  . TYR A 1 75  ? 10.703 -7.162  -0.978 1.00 14.54 ? 75  TYR A HB2  3  
ATOM 5438  H HB3  . TYR A 1 75  ? 9.975  -8.132  -2.253 1.00 22.21 ? 75  TYR A HB3  3  
ATOM 5439  H HD1  . TYR A 1 75  ? 11.151 -9.964  -3.232 1.00 75.10 ? 75  TYR A HD1  3  
ATOM 5440  H HD2  . TYR A 1 75  ? 13.120 -7.399  -0.467 1.00 35.35 ? 75  TYR A HD2  3  
ATOM 5441  H HE1  . TYR A 1 75  ? 13.009 -11.568 -3.076 1.00 53.15 ? 75  TYR A HE1  3  
ATOM 5442  H HE2  . TYR A 1 75  ? 14.984 -8.995  -0.304 1.00 73.52 ? 75  TYR A HE2  3  
ATOM 5443  H HH   . TYR A 1 75  ? 14.984 -11.887 -0.873 1.00 63.22 ? 75  TYR A HH   3  
ATOM 5444  N N    . ASP A 1 76  ? 9.333  -6.942  -4.539 1.00 22.41 ? 76  ASP A N    3  
ATOM 5445  C CA   . ASP A 1 76  ? 8.092  -6.700  -5.266 1.00 24.23 ? 76  ASP A CA   3  
ATOM 5446  C C    . ASP A 1 76  ? 6.885  -7.127  -4.437 1.00 11.22 ? 76  ASP A C    3  
ATOM 5447  O O    . ASP A 1 76  ? 5.805  -6.547  -4.551 1.00 35.43 ? 76  ASP A O    3  
ATOM 5448  C CB   . ASP A 1 76  ? 8.102  -7.450  -6.599 1.00 23.34 ? 76  ASP A CB   3  
ATOM 5449  C CG   . ASP A 1 76  ? 9.418  -7.302  -7.337 1.00 1.51  ? 76  ASP A CG   3  
ATOM 5450  O OD1  . ASP A 1 76  ? 9.853  -8.282  -7.977 1.00 11.52 ? 76  ASP A OD1  3  
ATOM 5451  O OD2  . ASP A 1 76  ? 10.013 -6.205  -7.274 1.00 24.30 ? 76  ASP A OD2  3  
ATOM 5452  H H    . ASP A 1 76  ? 9.836  -7.766  -4.713 1.00 4.43  ? 76  ASP A H    3  
ATOM 5453  H HA   . ASP A 1 76  ? 8.023  -5.641  -5.460 1.00 43.41 ? 76  ASP A HA   3  
ATOM 5454  H HB2  . ASP A 1 76  ? 7.931  -8.501  -6.414 1.00 64.13 ? 76  ASP A HB2  3  
ATOM 5455  H HB3  . ASP A 1 76  ? 7.312  -7.066  -7.226 1.00 40.14 ? 76  ASP A HB3  3  
ATOM 5456  N N    . PHE A 1 77  ? 7.075  -8.144  -3.603 1.00 64.24 ? 77  PHE A N    3  
ATOM 5457  C CA   . PHE A 1 77  ? 6.001  -8.650  -2.757 1.00 24.25 ? 77  PHE A CA   3  
ATOM 5458  C C    . PHE A 1 77  ? 5.887  -7.830  -1.475 1.00 50.20 ? 77  PHE A C    3  
ATOM 5459  O O    . PHE A 1 77  ? 4.833  -7.792  -0.841 1.00 63.11 ? 77  PHE A O    3  
ATOM 5460  C CB   . PHE A 1 77  ? 6.244  -10.122 -2.414 1.00 12.53 ? 77  PHE A CB   3  
ATOM 5461  C CG   . PHE A 1 77  ? 5.802  -11.069 -3.492 1.00 45.03 ? 77  PHE A CG   3  
ATOM 5462  C CD1  . PHE A 1 77  ? 6.735  -11.746 -4.263 1.00 15.55 ? 77  PHE A CD1  3  
ATOM 5463  C CD2  . PHE A 1 77  ? 4.455  -11.283 -3.736 1.00 43.44 ? 77  PHE A CD2  3  
ATOM 5464  C CE1  . PHE A 1 77  ? 6.332  -12.618 -5.256 1.00 32.43 ? 77  PHE A CE1  3  
ATOM 5465  C CE2  . PHE A 1 77  ? 4.047  -12.155 -4.728 1.00 13.52 ? 77  PHE A CE2  3  
ATOM 5466  C CZ   . PHE A 1 77  ? 4.986  -12.822 -5.489 1.00 71.32 ? 77  PHE A CZ   3  
ATOM 5467  H H    . PHE A 1 77  ? 7.960  -8.565  -3.557 1.00 74.33 ? 77  PHE A H    3  
ATOM 5468  H HA   . PHE A 1 77  ? 5.078  -8.565  -3.308 1.00 32.31 ? 77  PHE A HA   3  
ATOM 5469  H HB2  . PHE A 1 77  ? 7.299  -10.276 -2.249 1.00 24.24 ? 77  PHE A HB2  3  
ATOM 5470  H HB3  . PHE A 1 77  ? 5.703  -10.367 -1.512 1.00 72.34 ? 77  PHE A HB3  3  
ATOM 5471  H HD1  . PHE A 1 77  ? 7.788  -11.586 -4.081 1.00 23.33 ? 77  PHE A HD1  3  
ATOM 5472  H HD2  . PHE A 1 77  ? 3.720  -10.760 -3.143 1.00 35.44 ? 77  PHE A HD2  3  
ATOM 5473  H HE1  . PHE A 1 77  ? 7.069  -13.139 -5.849 1.00 50.30 ? 77  PHE A HE1  3  
ATOM 5474  H HE2  . PHE A 1 77  ? 2.994  -12.312 -4.909 1.00 32.04 ? 77  PHE A HE2  3  
ATOM 5475  H HZ   . PHE A 1 77  ? 4.669  -13.504 -6.264 1.00 61.21 ? 77  PHE A HZ   3  
ATOM 5476  N N    . GLY A 1 78  ? 6.981  -7.174  -1.099 1.00 51.04 ? 78  GLY A N    3  
ATOM 5477  C CA   . GLY A 1 78  ? 6.983  -6.364  0.105  1.00 44.34 ? 78  GLY A CA   3  
ATOM 5478  C C    . GLY A 1 78  ? 8.383  -6.101  0.624  1.00 61.30 ? 78  GLY A C    3  
ATOM 5479  O O    . GLY A 1 78  ? 9.228  -6.997  0.630  1.00 70.10 ? 78  GLY A O    3  
ATOM 5480  H H    . GLY A 1 78  ? 7.793  -7.241  -1.644 1.00 50.03 ? 78  GLY A H    3  
ATOM 5481  H HA2  . GLY A 1 78  ? 6.507  -5.419  -0.110 1.00 11.34 ? 78  GLY A HA2  3  
ATOM 5482  H HA3  . GLY A 1 78  ? 6.418  -6.875  0.870  1.00 62.11 ? 78  GLY A HA3  3  
ATOM 5483  N N    . ILE A 1 79  ? 8.630  -4.870  1.059  1.00 33.43 ? 79  ILE A N    3  
ATOM 5484  C CA   . ILE A 1 79  ? 9.937  -4.493  1.582  1.00 21.31 ? 79  ILE A CA   3  
ATOM 5485  C C    . ILE A 1 79  ? 10.378 -5.439  2.694  1.00 11.45 ? 79  ILE A C    3  
ATOM 5486  O O    . ILE A 1 79  ? 9.573  -5.848  3.531  1.00 21.13 ? 79  ILE A O    3  
ATOM 5487  C CB   . ILE A 1 79  ? 9.933  -3.051  2.121  1.00 11.43 ? 79  ILE A CB   3  
ATOM 5488  C CG1  . ILE A 1 79  ? 10.488 -2.088  1.069  1.00 32.22 ? 79  ILE A CG1  3  
ATOM 5489  C CG2  . ILE A 1 79  ? 10.742 -2.963  3.406  1.00 25.24 ? 79  ILE A CG2  3  
ATOM 5490  C CD1  . ILE A 1 79  ? 11.998 -2.097  0.979  1.00 13.41 ? 79  ILE A CD1  3  
ATOM 5491  H H    . ILE A 1 79  ? 7.916  -4.200  1.029  1.00 74.51 ? 79  ILE A H    3  
ATOM 5492  H HA   . ILE A 1 79  ? 10.649 -4.551  0.772  1.00 62.45 ? 79  ILE A HA   3  
ATOM 5493  H HB   . ILE A 1 79  ? 8.914  -2.777  2.347  1.00 34.31 ? 79  ILE A HB   3  
ATOM 5494  H HG12 . ILE A 1 79  ? 10.097 -2.359  0.101  1.00 12.51 ? 79  ILE A HG12 3  
ATOM 5495  H HG13 . ILE A 1 79  ? 10.175 -1.083  1.311  1.00 14.24 ? 79  ILE A HG13 3  
ATOM 5496  H HG21 . ILE A 1 79  ? 10.868 -1.927  3.683  1.00 42.33 ? 79  ILE A HG21 3  
ATOM 5497  H HG22 . ILE A 1 79  ? 10.222 -3.484  4.196  1.00 74.44 ? 79  ILE A HG22 3  
ATOM 5498  H HG23 . ILE A 1 79  ? 11.711 -3.415  3.254  1.00 72.22 ? 79  ILE A HG23 3  
ATOM 5499  H HD11 . ILE A 1 79  ? 12.358 -3.112  1.060  1.00 50.41 ? 79  ILE A HD11 3  
ATOM 5500  H HD12 . ILE A 1 79  ? 12.305 -1.679  0.032  1.00 12.23 ? 79  ILE A HD12 3  
ATOM 5501  H HD13 . ILE A 1 79  ? 12.410 -1.505  1.784  1.00 55.40 ? 79  ILE A HD13 3  
ATOM 5502  N N    . VAL A 1 80  ? 11.662 -5.780  2.699  1.00 64.42 ? 80  VAL A N    3  
ATOM 5503  C CA   . VAL A 1 80  ? 12.212 -6.675  3.710  1.00 21.32 ? 80  VAL A CA   3  
ATOM 5504  C C    . VAL A 1 80  ? 13.303 -5.985  4.520  1.00 3.44  ? 80  VAL A C    3  
ATOM 5505  O O    . VAL A 1 80  ? 14.143 -5.273  3.970  1.00 41.34 ? 80  VAL A O    3  
ATOM 5506  C CB   . VAL A 1 80  ? 12.791 -7.953  3.074  1.00 20.02 ? 80  VAL A CB   3  
ATOM 5507  C CG1  . VAL A 1 80  ? 13.146 -8.970  4.148  1.00 63.32 ? 80  VAL A CG1  3  
ATOM 5508  C CG2  . VAL A 1 80  ? 11.808 -8.542  2.074  1.00 31.40 ? 80  VAL A CG2  3  
ATOM 5509  H H    . VAL A 1 80  ? 12.255 -5.422  2.005  1.00 12.45 ? 80  VAL A H    3  
ATOM 5510  H HA   . VAL A 1 80  ? 11.410 -6.961  4.375  1.00 53.11 ? 80  VAL A HA   3  
ATOM 5511  H HB   . VAL A 1 80  ? 13.696 -7.690  2.546  1.00 55.23 ? 80  VAL A HB   3  
ATOM 5512  H HG11 . VAL A 1 80  ? 13.800 -8.512  4.875  1.00 2.01  ? 80  VAL A HG11 3  
ATOM 5513  H HG12 . VAL A 1 80  ? 12.244 -9.309  4.636  1.00 62.23 ? 80  VAL A HG12 3  
ATOM 5514  H HG13 . VAL A 1 80  ? 13.648 -9.812  3.694  1.00 63.04 ? 80  VAL A HG13 3  
ATOM 5515  H HG21 . VAL A 1 80  ? 12.156 -9.515  1.758  1.00 0.45  ? 80  VAL A HG21 3  
ATOM 5516  H HG22 . VAL A 1 80  ? 10.837 -8.641  2.538  1.00 1.00  ? 80  VAL A HG22 3  
ATOM 5517  H HG23 . VAL A 1 80  ? 11.732 -7.891  1.216  1.00 11.35 ? 80  VAL A HG23 3  
ATOM 5518  N N    . ARG A 1 81  ? 13.285 -6.200  5.832  1.00 61.33 ? 81  ARG A N    3  
ATOM 5519  C CA   . ARG A 1 81  ? 14.273 -5.598  6.719  1.00 51.13 ? 81  ARG A CA   3  
ATOM 5520  C C    . ARG A 1 81  ? 14.918 -6.654  7.611  1.00 21.21 ? 81  ARG A C    3  
ATOM 5521  O O    . ARG A 1 81  ? 14.276 -7.198  8.511  1.00 64.42 ? 81  ARG A O    3  
ATOM 5522  C CB   . ARG A 1 81  ? 13.622 -4.515  7.581  1.00 1.20  ? 81  ARG A CB   3  
ATOM 5523  C CG   . ARG A 1 81  ? 12.564 -3.707  6.848  1.00 33.00 ? 81  ARG A CG   3  
ATOM 5524  C CD   . ARG A 1 81  ? 12.016 -2.587  7.718  1.00 34.05 ? 81  ARG A CD   3  
ATOM 5525  N NE   . ARG A 1 81  ? 13.052 -1.629  8.094  1.00 12.04 ? 81  ARG A NE   3  
ATOM 5526  C CZ   . ARG A 1 81  ? 12.853 -0.627  8.943  1.00 51.51 ? 81  ARG A CZ   3  
ATOM 5527  N NH1  . ARG A 1 81  ? 11.663 -0.452  9.501  1.00 71.20 ? 81  ARG A NH1  3  
ATOM 5528  N NH2  . ARG A 1 81  ? 13.846 0.204   9.235  1.00 32.12 ? 81  ARG A NH2  3  
ATOM 5529  H H    . ARG A 1 81  ? 12.590 -6.778  6.212  1.00 44.30 ? 81  ARG A H    3  
ATOM 5530  H HA   . ARG A 1 81  ? 15.038 -5.146  6.105  1.00 11.14 ? 81  ARG A HA   3  
ATOM 5531  H HB2  . ARG A 1 81  ? 13.158 -4.983  8.437  1.00 54.24 ? 81  ARG A HB2  3  
ATOM 5532  H HB3  . ARG A 1 81  ? 14.388 -3.836  7.924  1.00 64.20 ? 81  ARG A HB3  3  
ATOM 5533  H HG2  . ARG A 1 81  ? 13.003 -3.276  5.961  1.00 44.22 ? 81  ARG A HG2  3  
ATOM 5534  H HG3  . ARG A 1 81  ? 11.753 -4.363  6.568  1.00 23.41 ? 81  ARG A HG3  3  
ATOM 5535  H HD2  . ARG A 1 81  ? 11.242 -2.069  7.171  1.00 31.52 ? 81  ARG A HD2  3  
ATOM 5536  H HD3  . ARG A 1 81  ? 11.595 -3.019  8.614  1.00 1.24  ? 81  ARG A HD3  3  
ATOM 5537  H HE   . ARG A 1 81  ? 13.939 -1.739  7.694  1.00 72.33 ? 81  ARG A HE   3  
ATOM 5538  H HH11 . ARG A 1 81  ? 10.913 -1.077  9.283  1.00 3.14  ? 81  ARG A HH11 3  
ATOM 5539  H HH12 . ARG A 1 81  ? 11.516 0.303   10.141 1.00 61.24 ? 81  ARG A HH12 3  
ATOM 5540  H HH21 . ARG A 1 81  ? 14.744 0.075   8.817  1.00 43.44 ? 81  ARG A HH21 3  
ATOM 5541  H HH22 . ARG A 1 81  ? 13.695 0.958   9.874  1.00 61.14 ? 81  ARG A HH22 3  
ATOM 5542  N N    . LEU A 1 82  ? 16.190 -6.940  7.356  1.00 41.11 ? 82  LEU A N    3  
ATOM 5543  C CA   . LEU A 1 82  ? 16.923 -7.932  8.136  1.00 52.44 ? 82  LEU A CA   3  
ATOM 5544  C C    . LEU A 1 82  ? 17.894 -7.257  9.099  1.00 64.41 ? 82  LEU A C    3  
ATOM 5545  O O    . LEU A 1 82  ? 18.666 -6.381  8.708  1.00 3.01  ? 82  LEU A O    3  
ATOM 5546  C CB   . LEU A 1 82  ? 17.683 -8.879  7.206  1.00 22.44 ? 82  LEU A CB   3  
ATOM 5547  C CG   . LEU A 1 82  ? 17.974 -10.274 7.762  1.00 74.23 ? 82  LEU A CG   3  
ATOM 5548  C CD1  . LEU A 1 82  ? 18.887 -10.186 8.975  1.00 74.33 ? 82  LEU A CD1  3  
ATOM 5549  C CD2  . LEU A 1 82  ? 16.677 -10.987 8.118  1.00 2.20  ? 82  LEU A CD2  3  
ATOM 5550  H H    . LEU A 1 82  ? 16.648 -6.474  6.626  1.00 3.44  ? 82  LEU A H    3  
ATOM 5551  H HA   . LEU A 1 82  ? 16.204 -8.500  8.707  1.00 24.31 ? 82  LEU A HA   3  
ATOM 5552  H HB2  . LEU A 1 82  ? 17.101 -8.997  6.306  1.00 72.04 ? 82  LEU A HB2  3  
ATOM 5553  H HB3  . LEU A 1 82  ? 18.629 -8.415  6.964  1.00 73.23 ? 82  LEU A HB3  3  
ATOM 5554  H HG   . LEU A 1 82  ? 18.480 -10.858 7.005  1.00 0.31  ? 82  LEU A HG   3  
ATOM 5555  H HD11 . LEU A 1 82  ? 19.546 -9.338  8.868  1.00 32.34 ? 82  LEU A HD11 3  
ATOM 5556  H HD12 . LEU A 1 82  ? 19.472 -11.091 9.051  1.00 42.54 ? 82  LEU A HD12 3  
ATOM 5557  H HD13 . LEU A 1 82  ? 18.289 -10.069 9.867  1.00 20.10 ? 82  LEU A HD13 3  
ATOM 5558  H HD21 . LEU A 1 82  ? 16.213 -10.490 8.958  1.00 62.54 ? 82  LEU A HD21 3  
ATOM 5559  H HD22 . LEU A 1 82  ? 16.891 -12.013 8.380  1.00 31.10 ? 82  LEU A HD22 3  
ATOM 5560  H HD23 . LEU A 1 82  ? 16.008 -10.963 7.271  1.00 45.34 ? 82  LEU A HD23 3  
ATOM 5561  N N    . THR A 1 83  ? 17.853 -7.673  10.361 1.00 71.40 ? 83  THR A N    3  
ATOM 5562  C CA   . THR A 1 83  ? 18.730 -7.111  11.380 1.00 32.13 ? 83  THR A CA   3  
ATOM 5563  C C    . THR A 1 83  ? 19.420 -8.211  12.179 1.00 12.44 ? 83  THR A C    3  
ATOM 5564  O O    . THR A 1 83  ? 18.940 -9.343  12.241 1.00 15.03 ? 83  THR A O    3  
ATOM 5565  C CB   . THR A 1 83  ? 17.953 -6.199  12.348 1.00 1.14  ? 83  THR A CB   3  
ATOM 5566  O OG1  . THR A 1 83  ? 18.868 -5.469  13.174 1.00 74.11 ? 83  THR A OG1  3  
ATOM 5567  C CG2  . THR A 1 83  ? 17.012 -7.014  13.223 1.00 63.12 ? 83  THR A CG2  3  
ATOM 5568  H H    . THR A 1 83  ? 17.216 -8.375  10.611 1.00 2.01  ? 83  THR A H    3  
ATOM 5569  H HA   . THR A 1 83  ? 19.481 -6.516  10.882 1.00 1.53  ? 83  THR A HA   3  
ATOM 5570  H HB   . THR A 1 83  ? 17.367 -5.500  11.769 1.00 70.25 ? 83  THR A HB   3  
ATOM 5571  H HG1  . THR A 1 83  ? 19.063 -5.979  13.964 1.00 34.00 ? 83  THR A HG1  3  
ATOM 5572  H HG21 . THR A 1 83  ? 17.040 -8.049  12.914 1.00 14.31 ? 83  THR A HG21 3  
ATOM 5573  H HG22 . THR A 1 83  ? 16.007 -6.634  13.121 1.00 33.22 ? 83  THR A HG22 3  
ATOM 5574  H HG23 . THR A 1 83  ? 17.324 -6.938  14.254 1.00 74.33 ? 83  THR A HG23 3  
ATOM 5575  N N    . THR A 1 84  ? 20.550 -7.871  12.792 1.00 51.43 ? 84  THR A N    3  
ATOM 5576  C CA   . THR A 1 84  ? 21.307 -8.829  13.587 1.00 74.20 ? 84  THR A CA   3  
ATOM 5577  C C    . THR A 1 84  ? 21.664 -8.251  14.951 1.00 5.22  ? 84  THR A C    3  
ATOM 5578  O O    . THR A 1 84  ? 21.668 -7.034  15.139 1.00 44.13 ? 84  THR A O    3  
ATOM 5579  C CB   . THR A 1 84  ? 22.600 -9.258  12.869 1.00 72.53 ? 84  THR A CB   3  
ATOM 5580  O OG1  . THR A 1 84  ? 22.517 -8.936  11.476 1.00 11.10 ? 84  THR A OG1  3  
ATOM 5581  C CG2  . THR A 1 84  ? 22.841 -10.751 13.035 1.00 24.12 ? 84  THR A CG2  3  
ATOM 5582  H H    . THR A 1 84  ? 20.882 -6.953  12.705 1.00 52.33 ? 84  THR A H    3  
ATOM 5583  H HA   . THR A 1 84  ? 20.690 -9.705  13.728 1.00 24.34 ? 84  THR A HA   3  
ATOM 5584  H HB   . THR A 1 84  ? 23.431 -8.723  13.306 1.00 71.34 ? 84  THR A HB   3  
ATOM 5585  H HG1  . THR A 1 84  ? 22.034 -9.626  11.016 1.00 72.53 ? 84  THR A HG1  3  
ATOM 5586  H HG21 . THR A 1 84  ? 23.766 -10.909 13.571 1.00 13.33 ? 84  THR A HG21 3  
ATOM 5587  H HG22 . THR A 1 84  ? 22.905 -11.216 12.063 1.00 62.13 ? 84  THR A HG22 3  
ATOM 5588  H HG23 . THR A 1 84  ? 22.025 -11.188 13.590 1.00 10.33 ? 84  THR A HG23 3  
ATOM 5589  N N    . TYR A 1 85  ? 21.965 -9.130  15.901 1.00 42.34 ? 85  TYR A N    3  
ATOM 5590  C CA   . TYR A 1 85  ? 22.323 -8.706  17.249 1.00 1.20  ? 85  TYR A CA   3  
ATOM 5591  C C    . TYR A 1 85  ? 23.424 -9.592  17.824 1.00 11.45 ? 85  TYR A C    3  
ATOM 5592  O O    . TYR A 1 85  ? 23.299 -10.816 17.856 1.00 24.12 ? 85  TYR A O    3  
ATOM 5593  C CB   . TYR A 1 85  ? 21.095 -8.742  18.160 1.00 2.04  ? 85  TYR A CB   3  
ATOM 5594  C CG   . TYR A 1 85  ? 20.370 -7.418  18.253 1.00 63.34 ? 85  TYR A CG   3  
ATOM 5595  C CD1  . TYR A 1 85  ? 19.340 -7.105  17.374 1.00 65.53 ? 85  TYR A CD1  3  
ATOM 5596  C CD2  . TYR A 1 85  ? 20.716 -6.480  19.218 1.00 75.35 ? 85  TYR A CD2  3  
ATOM 5597  C CE1  . TYR A 1 85  ? 18.676 -5.897  17.454 1.00 74.14 ? 85  TYR A CE1  3  
ATOM 5598  C CE2  . TYR A 1 85  ? 20.055 -5.270  19.306 1.00 63.13 ? 85  TYR A CE2  3  
ATOM 5599  C CZ   . TYR A 1 85  ? 19.036 -4.983  18.422 1.00 63.05 ? 85  TYR A CZ   3  
ATOM 5600  O OH   . TYR A 1 85  ? 18.377 -3.778  18.505 1.00 21.02 ? 85  TYR A OH   3  
ATOM 5601  H H    . TYR A 1 85  ? 21.945 -10.087 15.691 1.00 54.34 ? 85  TYR A H    3  
ATOM 5602  H HA   . TYR A 1 85  ? 22.687 -7.690  17.192 1.00 71.31 ? 85  TYR A HA   3  
ATOM 5603  H HB2  . TYR A 1 85  ? 20.398 -9.475  17.785 1.00 24.53 ? 85  TYR A HB2  3  
ATOM 5604  H HB3  . TYR A 1 85  ? 21.403 -9.022  19.157 1.00 4.12  ? 85  TYR A HB3  3  
ATOM 5605  H HD1  . TYR A 1 85  ? 19.060 -7.824  16.617 1.00 41.54 ? 85  TYR A HD1  3  
ATOM 5606  H HD2  . TYR A 1 85  ? 21.514 -6.708  19.908 1.00 25.23 ? 85  TYR A HD2  3  
ATOM 5607  H HE1  . TYR A 1 85  ? 17.877 -5.672  16.762 1.00 45.24 ? 85  TYR A HE1  3  
ATOM 5608  H HE2  . TYR A 1 85  ? 20.338 -4.554  20.063 1.00 32.02 ? 85  TYR A HE2  3  
ATOM 5609  H HH   . TYR A 1 85  ? 17.731 -3.816  19.214 1.00 13.31 ? 85  TYR A HH   3  
ATOM 5610  N N    . LYS A 1 86  ? 24.502 -8.963  18.280 1.00 64.23 ? 86  LYS A N    3  
ATOM 5611  C CA   . LYS A 1 86  ? 25.626 -9.691  18.857 1.00 63.23 ? 86  LYS A CA   3  
ATOM 5612  C C    . LYS A 1 86  ? 25.170 -10.560 20.025 1.00 50.33 ? 86  LYS A C    3  
ATOM 5613  O O    . LYS A 1 86  ? 24.885 -10.055 21.111 1.00 12.03 ? 86  LYS A O    3  
ATOM 5614  C CB   . LYS A 1 86  ? 26.707 -8.714  19.325 1.00 32.25 ? 86  LYS A CB   3  
ATOM 5615  C CG   . LYS A 1 86  ? 28.001 -8.815  18.538 1.00 65.24 ? 86  LYS A CG   3  
ATOM 5616  C CD   . LYS A 1 86  ? 27.991 -7.896  17.328 1.00 41.02 ? 86  LYS A CD   3  
ATOM 5617  C CE   . LYS A 1 86  ? 29.395 -7.671  16.787 1.00 12.51 ? 86  LYS A CE   3  
ATOM 5618  N NZ   . LYS A 1 86  ? 30.208 -6.814  17.694 1.00 32.14 ? 86  LYS A NZ   3  
ATOM 5619  H H    . LYS A 1 86  ? 24.543 -7.985  18.227 1.00 2.21  ? 86  LYS A H    3  
ATOM 5620  H HA   . LYS A 1 86  ? 26.038 -10.329 18.089 1.00 51.30 ? 86  LYS A HA   3  
ATOM 5621  H HB2  . LYS A 1 86  ? 26.330 -7.707  19.231 1.00 53.52 ? 86  LYS A HB2  3  
ATOM 5622  H HB3  . LYS A 1 86  ? 26.926 -8.911  20.365 1.00 4.11  ? 86  LYS A HB3  3  
ATOM 5623  H HG2  . LYS A 1 86  ? 28.825 -8.539  19.179 1.00 42.11 ? 86  LYS A HG2  3  
ATOM 5624  H HG3  . LYS A 1 86  ? 28.130 -9.835  18.203 1.00 53.23 ? 86  LYS A HG3  3  
ATOM 5625  H HD2  . LYS A 1 86  ? 27.386 -8.342  16.552 1.00 25.33 ? 86  LYS A HD2  3  
ATOM 5626  H HD3  . LYS A 1 86  ? 27.568 -6.944  17.614 1.00 55.52 ? 86  LYS A HD3  3  
ATOM 5627  H HE2  . LYS A 1 86  ? 29.882 -8.627  16.677 1.00 71.22 ? 86  LYS A HE2  3  
ATOM 5628  H HE3  . LYS A 1 86  ? 29.322 -7.191  15.822 1.00 12.43 ? 86  LYS A HE3  3  
ATOM 5629  H HZ1  . LYS A 1 86  ? 30.280 -5.851  17.307 1.00 31.50 ? 86  LYS A HZ1  3  
ATOM 5630  H HZ2  . LYS A 1 86  ? 31.165 -7.208  17.794 1.00 1.44  ? 86  LYS A HZ2  3  
ATOM 5631  H HZ3  . LYS A 1 86  ? 29.764 -6.766  18.634 1.00 61.24 ? 86  LYS A HZ3  3  
ATOM 5632  N N    . CYS A 1 87  ? 25.105 -11.866 19.794 1.00 34.21 ? 87  CYS A N    3  
ATOM 5633  C CA   . CYS A 1 87  ? 24.683 -12.805 20.828 1.00 5.11  ? 87  CYS A CA   3  
ATOM 5634  C C    . CYS A 1 87  ? 25.884 -13.533 21.423 1.00 24.11 ? 87  CYS A C    3  
ATOM 5635  O O    . CYS A 1 87  ? 26.799 -13.936 20.704 1.00 44.10 ? 87  CYS A O    3  
ATOM 5636  C CB   . CYS A 1 87  ? 23.691 -13.817 20.254 1.00 62.12 ? 87  CYS A CB   3  
ATOM 5637  S SG   . CYS A 1 87  ? 22.017 -13.671 20.922 1.00 44.42 ? 87  CYS A SG   3  
ATOM 5638  H H    . CYS A 1 87  ? 25.344 -12.208 18.908 1.00 65.53 ? 87  CYS A H    3  
ATOM 5639  H HA   . CYS A 1 87  ? 24.197 -12.240 21.609 1.00 24.31 ? 87  CYS A HA   3  
ATOM 5640  H HB2  . CYS A 1 87  ? 23.630 -13.683 19.184 1.00 51.52 ? 87  CYS A HB2  3  
ATOM 5641  H HB3  . CYS A 1 87  ? 24.045 -14.815 20.464 1.00 34.45 ? 87  CYS A HB3  3  
ATOM 5642  H HG   . CYS A 1 87  ? 22.113 -13.263 22.178 1.00 3.50  ? 87  CYS A HG   3  
ATOM 5643  N N    . THR A 1 88  ? 25.876 -13.698 22.742 1.00 1.23  ? 88  THR A N    3  
ATOM 5644  C CA   . THR A 1 88  ? 26.965 -14.374 23.435 1.00 63.51 ? 88  THR A CA   3  
ATOM 5645  C C    . THR A 1 88  ? 26.617 -15.832 23.715 1.00 65.02 ? 88  THR A C    3  
ATOM 5646  O O    . THR A 1 88  ? 25.446 -16.212 23.718 1.00 13.21 ? 88  THR A O    3  
ATOM 5647  C CB   . THR A 1 88  ? 27.306 -13.675 24.764 1.00 31.35 ? 88  THR A CB   3  
ATOM 5648  O OG1  . THR A 1 88  ? 27.216 -12.255 24.608 1.00 14.22 ? 88  THR A OG1  3  
ATOM 5649  C CG2  . THR A 1 88  ? 28.704 -14.051 25.231 1.00 62.40 ? 88  THR A CG2  3  
ATOM 5650  H H    . THR A 1 88  ? 25.119 -13.355 23.261 1.00 52.41 ? 88  THR A H    3  
ATOM 5651  H HA   . THR A 1 88  ? 27.838 -14.338 22.799 1.00 22.33 ? 88  THR A HA   3  
ATOM 5652  H HB   . THR A 1 88  ? 26.595 -13.993 25.513 1.00 32.55 ? 88  THR A HB   3  
ATOM 5653  H HG1  . THR A 1 88  ? 27.632 -11.823 25.358 1.00 31.13 ? 88  THR A HG1  3  
ATOM 5654  H HG21 . THR A 1 88  ? 29.246 -14.505 24.415 1.00 62.54 ? 88  THR A HG21 3  
ATOM 5655  H HG22 . THR A 1 88  ? 28.634 -14.751 26.050 1.00 21.33 ? 88  THR A HG22 3  
ATOM 5656  H HG23 . THR A 1 88  ? 29.225 -13.164 25.559 1.00 74.24 ? 88  THR A HG23 3  
ATOM 5657  N N    . LEU A 1 89  ? 27.641 -16.645 23.950 1.00 4.11  ? 89  LEU A N    3  
ATOM 5658  C CA   . LEU A 1 89  ? 27.444 -18.062 24.232 1.00 33.53 ? 89  LEU A CA   3  
ATOM 5659  C C    . LEU A 1 89  ? 27.230 -18.296 25.724 1.00 10.15 ? 89  LEU A C    3  
ATOM 5660  O O    . LEU A 1 89  ? 28.006 -17.824 26.554 1.00 50.51 ? 89  LEU A O    3  
ATOM 5661  C CB   . LEU A 1 89  ? 28.646 -18.872 23.745 1.00 64.31 ? 89  LEU A CB   3  
ATOM 5662  C CG   . LEU A 1 89  ? 28.549 -20.389 23.916 1.00 14.44 ? 89  LEU A CG   3  
ATOM 5663  C CD1  . LEU A 1 89  ? 29.247 -21.102 22.769 1.00 52.31 ? 89  LEU A CD1  3  
ATOM 5664  C CD2  . LEU A 1 89  ? 29.143 -20.814 25.251 1.00 14.24 ? 89  LEU A CD2  3  
ATOM 5665  H H    . LEU A 1 89  ? 28.552 -16.285 23.934 1.00 41.41 ? 89  LEU A H    3  
ATOM 5666  H HA   . LEU A 1 89  ? 26.562 -18.386 23.700 1.00 60.44 ? 89  LEU A HA   3  
ATOM 5667  H HB2  . LEU A 1 89  ? 28.779 -18.667 22.694 1.00 44.40 ? 89  LEU A HB2  3  
ATOM 5668  H HB3  . LEU A 1 89  ? 29.516 -18.532 24.290 1.00 72.05 ? 89  LEU A HB3  3  
ATOM 5669  H HG   . LEU A 1 89  ? 27.507 -20.679 23.905 1.00 61.40 ? 89  LEU A HG   3  
ATOM 5670  H HD11 . LEU A 1 89  ? 30.281 -21.272 23.027 1.00 41.31 ? 89  LEU A HD11 3  
ATOM 5671  H HD12 . LEU A 1 89  ? 29.193 -20.491 21.880 1.00 60.12 ? 89  LEU A HD12 3  
ATOM 5672  H HD13 . LEU A 1 89  ? 28.761 -22.049 22.585 1.00 54.33 ? 89  LEU A HD13 3  
ATOM 5673  H HD21 . LEU A 1 89  ? 30.158 -21.151 25.102 1.00 53.00 ? 89  LEU A HD21 3  
ATOM 5674  H HD22 . LEU A 1 89  ? 28.554 -21.619 25.667 1.00 13.54 ? 89  LEU A HD22 3  
ATOM 5675  H HD23 . LEU A 1 89  ? 29.138 -19.975 25.931 1.00 51.30 ? 89  LEU A HD23 3  
ATOM 5676  N N    . ASN A 1 90  ? 26.173 -19.030 26.058 1.00 42.30 ? 90  ASN A N    3  
ATOM 5677  C CA   . ASN A 1 90  ? 25.858 -19.328 27.450 1.00 3.35  ? 90  ASN A CA   3  
ATOM 5678  C C    . ASN A 1 90  ? 26.054 -20.811 27.747 1.00 72.41 ? 90  ASN A C    3  
ATOM 5679  O O    . ASN A 1 90  ? 26.496 -21.575 26.888 1.00 2.22  ? 90  ASN A O    3  
ATOM 5680  C CB   . ASN A 1 90  ? 24.419 -18.918 27.768 1.00 12.14 ? 90  ASN A CB   3  
ATOM 5681  C CG   . ASN A 1 90  ? 23.407 -19.637 26.897 1.00 1.10  ? 90  ASN A CG   3  
ATOM 5682  O OD1  . ASN A 1 90  ? 23.543 -19.679 25.674 1.00 2.12  ? 90  ASN A OD1  3  
ATOM 5683  N ND2  . ASN A 1 90  ? 22.385 -20.207 27.525 1.00 40.14 ? 90  ASN A ND2  3  
ATOM 5684  H H    . ASN A 1 90  ? 25.591 -19.379 25.351 1.00 10.02 ? 90  ASN A H    3  
ATOM 5685  H HA   . ASN A 1 90  ? 26.531 -18.756 28.072 1.00 63.51 ? 90  ASN A HA   3  
ATOM 5686  H HB2  . ASN A 1 90  ? 24.205 -19.151 28.802 1.00 53.55 ? 90  ASN A HB2  3  
ATOM 5687  H HB3  . ASN A 1 90  ? 24.310 -17.855 27.613 1.00 63.20 ? 90  ASN A HB3  3  
ATOM 5688  H HD21 . ASN A 1 90  ? 22.341 -20.133 28.501 1.00 3.10  ? 90  ASN A HD21 3  
ATOM 5689  H HD22 . ASN A 1 90  ? 21.717 -20.679 26.986 1.00 55.04 ? 90  ASN A HD22 3  
ATOM 5690  N N    . LYS A 1 91  ? 25.720 -21.214 28.969 1.00 45.14 ? 91  LYS A N    3  
ATOM 5691  C CA   . LYS A 1 91  ? 25.857 -22.606 29.380 1.00 72.12 ? 91  LYS A CA   3  
ATOM 5692  C C    . LYS A 1 91  ? 25.181 -23.538 28.379 1.00 53.20 ? 91  LYS A C    3  
ATOM 5693  O O    . LYS A 1 91  ? 25.675 -24.631 28.104 1.00 54.31 ? 91  LYS A O    3  
ATOM 5694  C CB   . LYS A 1 91  ? 25.253 -22.810 30.771 1.00 13.00 ? 91  LYS A CB   3  
ATOM 5695  C CG   . LYS A 1 91  ? 26.040 -22.136 31.881 1.00 44.41 ? 91  LYS A CG   3  
ATOM 5696  C CD   . LYS A 1 91  ? 25.342 -20.881 32.378 1.00 74.13 ? 91  LYS A CD   3  
ATOM 5697  C CE   . LYS A 1 91  ? 24.492 -21.166 33.607 1.00 42.11 ? 91  LYS A CE   3  
ATOM 5698  N NZ   . LYS A 1 91  ? 23.113 -21.592 33.241 1.00 30.13 ? 91  LYS A NZ   3  
ATOM 5699  H H    . LYS A 1 91  ? 25.373 -20.558 29.610 1.00 62.04 ? 91  LYS A H    3  
ATOM 5700  H HA   . LYS A 1 91  ? 26.910 -22.840 29.416 1.00 0.32  ? 91  LYS A HA   3  
ATOM 5701  H HB2  . LYS A 1 91  ? 24.249 -22.411 30.777 1.00 61.05 ? 91  LYS A HB2  3  
ATOM 5702  H HB3  . LYS A 1 91  ? 25.211 -23.869 30.980 1.00 31.34 ? 91  LYS A HB3  3  
ATOM 5703  H HG2  . LYS A 1 91  ? 26.147 -22.825 32.705 1.00 70.41 ? 91  LYS A HG2  3  
ATOM 5704  H HG3  . LYS A 1 91  ? 27.018 -21.867 31.505 1.00 75.54 ? 91  LYS A HG3  3  
ATOM 5705  H HD2  . LYS A 1 91  ? 26.086 -20.141 32.632 1.00 20.42 ? 91  LYS A HD2  3  
ATOM 5706  H HD3  . LYS A 1 91  ? 24.706 -20.499 31.592 1.00 55.32 ? 91  LYS A HD3  3  
ATOM 5707  H HE2  . LYS A 1 91  ? 24.962 -21.951 34.179 1.00 4.43  ? 91  LYS A HE2  3  
ATOM 5708  H HE3  . LYS A 1 91  ? 24.436 -20.268 34.205 1.00 20.40 ? 91  LYS A HE3  3  
ATOM 5709  H HZ1  . LYS A 1 91  ? 23.132 -22.545 32.825 1.00 24.21 ? 91  LYS A HZ1  3  
ATOM 5710  H HZ2  . LYS A 1 91  ? 22.707 -20.932 32.548 1.00 11.12 ? 91  LYS A HZ2  3  
ATOM 5711  H HZ3  . LYS A 1 91  ? 22.507 -21.607 34.087 1.00 44.25 ? 91  LYS A HZ3  3  
ATOM 5712  N N    . GLU A 1 92  ? 24.050 -23.097 27.837 1.00 13.32 ? 92  GLU A N    3  
ATOM 5713  C CA   . GLU A 1 92  ? 23.307 -23.892 26.866 1.00 24.13 ? 92  GLU A CA   3  
ATOM 5714  C C    . GLU A 1 92  ? 23.597 -23.423 25.443 1.00 15.44 ? 92  GLU A C    3  
ATOM 5715  O O    . GLU A 1 92  ? 23.649 -22.222 25.172 1.00 35.21 ? 92  GLU A O    3  
ATOM 5716  C CB   . GLU A 1 92  ? 21.806 -23.809 27.147 1.00 34.22 ? 92  GLU A CB   3  
ATOM 5717  C CG   . GLU A 1 92  ? 21.281 -24.955 27.996 1.00 0.24  ? 92  GLU A CG   3  
ATOM 5718  C CD   . GLU A 1 92  ? 19.782 -25.141 27.863 1.00 0.22  ? 92  GLU A CD   3  
ATOM 5719  O OE1  . GLU A 1 92  ? 19.107 -25.275 28.905 1.00 33.32 ? 92  GLU A OE1  3  
ATOM 5720  O OE2  . GLU A 1 92  ? 19.284 -25.152 26.718 1.00 24.31 ? 92  GLU A OE2  3  
ATOM 5721  H H    . GLU A 1 92  ? 23.706 -22.216 28.097 1.00 63.41 ? 92  GLU A H    3  
ATOM 5722  H HA   . GLU A 1 92  ? 23.626 -24.919 26.965 1.00 4.44  ? 92  GLU A HA   3  
ATOM 5723  H HB2  . GLU A 1 92  ? 21.598 -22.882 27.662 1.00 64.35 ? 92  GLU A HB2  3  
ATOM 5724  H HB3  . GLU A 1 92  ? 21.275 -23.814 26.206 1.00 23.34 ? 92  GLU A HB3  3  
ATOM 5725  H HG2  . GLU A 1 92  ? 21.770 -25.867 27.689 1.00 30.12 ? 92  GLU A HG2  3  
ATOM 5726  H HG3  . GLU A 1 92  ? 21.514 -24.754 29.032 1.00 74.30 ? 92  GLU A HG3  3  
ATOM 5727  N N    . LEU A 1 93  ? 23.785 -24.377 24.539 1.00 54.13 ? 93  LEU A N    3  
ATOM 5728  C CA   . LEU A 1 93  ? 24.069 -24.063 23.143 1.00 42.41 ? 93  LEU A CA   3  
ATOM 5729  C C    . LEU A 1 93  ? 22.795 -23.667 22.403 1.00 22.30 ? 93  LEU A C    3  
ATOM 5730  O O    . LEU A 1 93  ? 21.681 -23.970 22.830 1.00 12.42 ? 93  LEU A O    3  
ATOM 5731  C CB   . LEU A 1 93  ? 24.722 -25.261 22.453 1.00 64.24 ? 93  LEU A CB   3  
ATOM 5732  C CG   . LEU A 1 93  ? 26.245 -25.351 22.562 1.00 51.12 ? 93  LEU A CG   3  
ATOM 5733  C CD1  . LEU A 1 93  ? 26.659 -25.694 23.984 1.00 32.14 ? 93  LEU A CD1  3  
ATOM 5734  C CD2  . LEU A 1 93  ? 26.790 -26.381 21.583 1.00 41.52 ? 93  LEU A CD2  3  
ATOM 5735  H H    . LEU A 1 93  ? 23.731 -25.315 24.815 1.00 71.33 ? 93  LEU A H    3  
ATOM 5736  H HA   . LEU A 1 93  ? 24.755 -23.229 23.124 1.00 2.14  ? 93  LEU A HA   3  
ATOM 5737  H HB2  . LEU A 1 93  ? 24.307 -26.158 22.885 1.00 73.42 ? 93  LEU A HB2  3  
ATOM 5738  H HB3  . LEU A 1 93  ? 24.467 -25.217 21.403 1.00 32.24 ? 93  LEU A HB3  3  
ATOM 5739  H HG   . LEU A 1 93  ? 26.675 -24.390 22.312 1.00 33.53 ? 93  LEU A HG   3  
ATOM 5740  H HD11 . LEU A 1 93  ? 27.736 -25.698 24.055 1.00 71.42 ? 93  LEU A HD11 3  
ATOM 5741  H HD12 . LEU A 1 93  ? 26.277 -26.670 24.245 1.00 71.12 ? 93  LEU A HD12 3  
ATOM 5742  H HD13 . LEU A 1 93  ? 26.256 -24.957 24.664 1.00 72.30 ? 93  LEU A HD13 3  
ATOM 5743  H HD21 . LEU A 1 93  ? 26.679 -26.011 20.574 1.00 72.31 ? 93  LEU A HD21 3  
ATOM 5744  H HD22 . LEU A 1 93  ? 26.241 -27.305 21.690 1.00 23.11 ? 93  LEU A HD22 3  
ATOM 5745  H HD23 . LEU A 1 93  ? 27.835 -26.555 21.789 1.00 24.43 ? 93  LEU A HD23 3  
ATOM 5746  N N    . PRO A 1 94  ? 22.961 -22.977 21.265 1.00 5.12  ? 94  PRO A N    3  
ATOM 5747  C CA   . PRO A 1 94  ? 21.836 -22.528 20.440 1.00 1.11  ? 94  PRO A CA   3  
ATOM 5748  C C    . PRO A 1 94  ? 21.126 -23.687 19.748 1.00 11.53 ? 94  PRO A C    3  
ATOM 5749  O O    . PRO A 1 94  ? 21.609 -24.819 19.756 1.00 23.25 ? 94  PRO A O    3  
ATOM 5750  C CB   . PRO A 1 94  ? 22.497 -21.612 19.407 1.00 70.33 ? 94  PRO A CB   3  
ATOM 5751  C CG   . PRO A 1 94  ? 23.904 -22.093 19.320 1.00 63.25 ? 94  PRO A CG   3  
ATOM 5752  C CD   . PRO A 1 94  ? 24.261 -22.582 20.696 1.00 11.22 ? 94  PRO A CD   3  
ATOM 5753  H HA   . PRO A 1 94  ? 21.120 -21.963 21.019 1.00 44.40 ? 94  PRO A HA   3  
ATOM 5754  H HB2  . PRO A 1 94  ? 21.986 -21.708 18.459 1.00 44.24 ? 94  PRO A HB2  3  
ATOM 5755  H HB3  . PRO A 1 94  ? 22.450 -20.588 19.745 1.00 22.35 ? 94  PRO A HB3  3  
ATOM 5756  H HG2  . PRO A 1 94  ? 23.973 -22.900 18.606 1.00 42.23 ? 94  PRO A HG2  3  
ATOM 5757  H HG3  . PRO A 1 94  ? 24.553 -21.279 19.032 1.00 52.04 ? 94  PRO A HG3  3  
ATOM 5758  H HD2  . PRO A 1 94  ? 24.928 -23.428 20.635 1.00 65.51 ? 94  PRO A HD2  3  
ATOM 5759  H HD3  . PRO A 1 94  ? 24.709 -21.787 21.274 1.00 34.05 ? 94  PRO A HD3  3  
ATOM 5760  N N    . THR A 1 95  ? 19.975 -23.396 19.149 1.00 21.40 ? 95  THR A N    3  
ATOM 5761  C CA   . THR A 1 95  ? 19.198 -24.414 18.453 1.00 30.01 ? 95  THR A CA   3  
ATOM 5762  C C    . THR A 1 95  ? 19.264 -24.219 16.943 1.00 64.24 ? 95  THR A C    3  
ATOM 5763  O O    . THR A 1 95  ? 19.584 -23.132 16.460 1.00 52.10 ? 95  THR A O    3  
ATOM 5764  C CB   . THR A 1 95  ? 17.723 -24.396 18.897 1.00 22.12 ? 95  THR A CB   3  
ATOM 5765  O OG1  . THR A 1 95  ? 17.641 -24.228 20.317 1.00 61.41 ? 95  THR A OG1  3  
ATOM 5766  C CG2  . THR A 1 95  ? 17.020 -25.683 18.492 1.00 42.21 ? 95  THR A CG2  3  
ATOM 5767  H H    . THR A 1 95  ? 19.642 -22.475 19.177 1.00 32.32 ? 95  THR A H    3  
ATOM 5768  H HA   . THR A 1 95  ? 19.615 -25.379 18.701 1.00 60.54 ? 95  THR A HA   3  
ATOM 5769  H HB   . THR A 1 95  ? 17.228 -23.565 18.415 1.00 71.40 ? 95  THR A HB   3  
ATOM 5770  H HG1  . THR A 1 95  ? 16.765 -24.480 20.619 1.00 52.31 ? 95  THR A HG1  3  
ATOM 5771  H HG21 . THR A 1 95  ? 17.633 -26.529 18.765 1.00 32.33 ? 95  THR A HG21 3  
ATOM 5772  H HG22 . THR A 1 95  ? 16.860 -25.684 17.424 1.00 34.21 ? 95  THR A HG22 3  
ATOM 5773  H HG23 . THR A 1 95  ? 16.070 -25.748 18.999 1.00 34.33 ? 95  THR A HG23 3  
ATOM 5774  N N    . LEU A 1 96  ? 18.960 -25.278 16.200 1.00 25.24 ? 96  LEU A N    3  
ATOM 5775  C CA   . LEU A 1 96  ? 18.985 -25.223 14.743 1.00 72.32 ? 96  LEU A CA   3  
ATOM 5776  C C    . LEU A 1 96  ? 20.377 -24.862 14.235 1.00 71.13 ? 96  LEU A C    3  
ATOM 5777  O O    . LEU A 1 96  ? 20.543 -24.444 13.088 1.00 32.31 ? 96  LEU A O    3  
ATOM 5778  C CB   . LEU A 1 96  ? 17.964 -24.204 14.234 1.00 35.50 ? 96  LEU A CB   3  
ATOM 5779  C CG   . LEU A 1 96  ? 18.501 -22.803 13.942 1.00 24.15 ? 96  LEU A CG   3  
ATOM 5780  C CD1  . LEU A 1 96  ? 18.497 -22.530 12.446 1.00 34.14 ? 96  LEU A CD1  3  
ATOM 5781  C CD2  . LEU A 1 96  ? 17.683 -21.754 14.681 1.00 43.43 ? 96  LEU A CD2  3  
ATOM 5782  H H    . LEU A 1 96  ? 18.714 -26.117 16.642 1.00 73.12 ? 96  LEU A H    3  
ATOM 5783  H HA   . LEU A 1 96  ? 18.721 -26.202 14.370 1.00 4.11  ? 96  LEU A HA   3  
ATOM 5784  H HB2  . LEU A 1 96  ? 17.537 -24.591 13.321 1.00 23.32 ? 96  LEU A HB2  3  
ATOM 5785  H HB3  . LEU A 1 96  ? 17.188 -24.114 14.981 1.00 11.43 ? 96  LEU A HB3  3  
ATOM 5786  H HG   . LEU A 1 96  ? 19.523 -22.737 14.290 1.00 63.11 ? 96  LEU A HG   3  
ATOM 5787  H HD11 . LEU A 1 96  ? 17.521 -22.177 12.148 1.00 22.11 ? 96  LEU A HD11 3  
ATOM 5788  H HD12 . LEU A 1 96  ? 18.729 -23.440 11.914 1.00 74.53 ? 96  LEU A HD12 3  
ATOM 5789  H HD13 . LEU A 1 96  ? 19.238 -21.779 12.215 1.00 22.43 ? 96  LEU A HD13 3  
ATOM 5790  H HD21 . LEU A 1 96  ? 17.577 -20.877 14.058 1.00 22.42 ? 96  LEU A HD21 3  
ATOM 5791  H HD22 . LEU A 1 96  ? 18.187 -21.484 15.598 1.00 72.50 ? 96  LEU A HD22 3  
ATOM 5792  H HD23 . LEU A 1 96  ? 16.707 -22.154 14.909 1.00 12.32 ? 96  LEU A HD23 3  
ATOM 5793  N N    . THR A 1 97  ? 21.377 -25.028 15.095 1.00 11.20 ? 97  THR A N    3  
ATOM 5794  C CA   . THR A 1 97  ? 22.755 -24.721 14.734 1.00 51.54 ? 97  THR A CA   3  
ATOM 5795  C C    . THR A 1 97  ? 23.367 -25.839 13.898 1.00 32.33 ? 97  THR A C    3  
ATOM 5796  O O    . THR A 1 97  ? 24.202 -25.591 13.029 1.00 31.14 ? 97  THR A O    3  
ATOM 5797  C CB   . THR A 1 97  ? 23.626 -24.493 15.983 1.00 21.14 ? 97  THR A CB   3  
ATOM 5798  O OG1  . THR A 1 97  ? 24.946 -24.096 15.595 1.00 52.31 ? 97  THR A OG1  3  
ATOM 5799  C CG2  . THR A 1 97  ? 23.699 -25.756 16.829 1.00 45.50 ? 97  THR A CG2  3  
ATOM 5800  H H    . THR A 1 97  ? 21.181 -25.364 15.994 1.00 23.14 ? 97  THR A H    3  
ATOM 5801  H HA   . THR A 1 97  ? 22.752 -23.810 14.152 1.00 61.11 ? 97  THR A HA   3  
ATOM 5802  H HB   . THR A 1 97  ? 23.181 -23.706 16.576 1.00 70.25 ? 97  THR A HB   3  
ATOM 5803  H HG1  . THR A 1 97  ? 25.344 -24.787 15.061 1.00 62.22 ? 97  THR A HG1  3  
ATOM 5804  H HG21 . THR A 1 97  ? 23.873 -25.488 17.861 1.00 61.22 ? 97  THR A HG21 3  
ATOM 5805  H HG22 . THR A 1 97  ? 24.509 -26.378 16.477 1.00 54.11 ? 97  THR A HG22 3  
ATOM 5806  H HG23 . THR A 1 97  ? 22.768 -26.296 16.749 1.00 24.04 ? 97  THR A HG23 3  
ATOM 5807  N N    . GLU A 1 98  ? 22.945 -27.071 14.167 1.00 10.03 ? 98  GLU A N    3  
ATOM 5808  C CA   . GLU A 1 98  ? 23.453 -28.228 13.439 1.00 10.31 ? 98  GLU A CA   3  
ATOM 5809  C C    . GLU A 1 98  ? 22.723 -28.397 12.110 1.00 62.04 ? 98  GLU A C    3  
ATOM 5810  O O    . GLU A 1 98  ? 23.000 -29.326 11.350 1.00 25.13 ? 98  GLU A O    3  
ATOM 5811  C CB   . GLU A 1 98  ? 23.301 -29.496 14.282 1.00 42.31 ? 98  GLU A CB   3  
ATOM 5812  C CG   . GLU A 1 98  ? 23.837 -29.354 15.697 1.00 63.15 ? 98  GLU A CG   3  
ATOM 5813  C CD   . GLU A 1 98  ? 23.696 -30.629 16.504 1.00 34.45 ? 98  GLU A CD   3  
ATOM 5814  O OE1  . GLU A 1 98  ? 24.376 -31.622 16.169 1.00 12.14 ? 98  GLU A OE1  3  
ATOM 5815  O OE2  . GLU A 1 98  ? 22.905 -30.635 17.471 1.00 70.51 ? 98  GLU A OE2  3  
ATOM 5816  H H    . GLU A 1 98  ? 22.277 -27.205 14.872 1.00 43.21 ? 98  GLU A H    3  
ATOM 5817  H HA   . GLU A 1 98  ? 24.501 -28.061 13.242 1.00 61.22 ? 98  GLU A HA   3  
ATOM 5818  H HB2  . GLU A 1 98  ? 22.254 -29.752 14.339 1.00 34.15 ? 98  GLU A HB2  3  
ATOM 5819  H HB3  . GLU A 1 98  ? 23.833 -30.301 13.797 1.00 1.00  ? 98  GLU A HB3  3  
ATOM 5820  H HG2  . GLU A 1 98  ? 24.884 -29.092 15.647 1.00 74.31 ? 98  GLU A HG2  3  
ATOM 5821  H HG3  . GLU A 1 98  ? 23.294 -28.566 16.197 1.00 74.13 ? 98  GLU A HG3  3  
ATOM 5822  N N    . HIS A 1 99  ? 21.788 -27.493 11.835 1.00 44.21 ? 99  HIS A N    3  
ATOM 5823  C CA   . HIS A 1 99  ? 21.018 -27.541 10.597 1.00 20.33 ? 99  HIS A CA   3  
ATOM 5824  C C    . HIS A 1 99  ? 21.919 -27.863 9.409  1.00 40.42 ? 99  HIS A C    3  
ATOM 5825  O O    . HIS A 1 99  ? 21.532 -28.603 8.505  1.00 73.33 ? 99  HIS A O    3  
ATOM 5826  C CB   . HIS A 1 99  ? 20.303 -26.210 10.365 1.00 74.23 ? 99  HIS A CB   3  
ATOM 5827  C CG   . HIS A 1 99  ? 18.821 -26.283 10.571 1.00 51.52 ? 99  HIS A CG   3  
ATOM 5828  N ND1  . HIS A 1 99  ? 18.228 -27.134 11.480 1.00 42.45 ? 99  HIS A ND1  3  
ATOM 5829  C CD2  . HIS A 1 99  ? 17.811 -25.602 9.981  1.00 73.15 ? 99  HIS A CD2  3  
ATOM 5830  C CE1  . HIS A 1 99  ? 16.917 -26.975 11.438 1.00 43.20 ? 99  HIS A CE1  3  
ATOM 5831  N NE2  . HIS A 1 99  ? 16.638 -26.051 10.537 1.00 50.44 ? 99  HIS A NE2  3  
ATOM 5832  H H    . HIS A 1 99  ? 21.613 -26.776 12.479 1.00 21.05 ? 99  HIS A H    3  
ATOM 5833  H HA   . HIS A 1 99  ? 20.281 -28.324 10.696 1.00 11.41 ? 99  HIS A HA   3  
ATOM 5834  H HB2  . HIS A 1 99  ? 20.697 -25.473 11.049 1.00 74.03 ? 99  HIS A HB2  3  
ATOM 5835  H HB3  . HIS A 1 99  ? 20.482 -25.885 9.350  1.00 52.11 ? 99  HIS A HB3  3  
ATOM 5836  H HD1  . HIS A 1 99  ? 18.698 -27.762 12.066 1.00 2.32  ? 99  HIS A HD1  3  
ATOM 5837  H HD2  . HIS A 1 99  ? 17.908 -24.846 9.214  1.00 71.34 ? 99  HIS A HD2  3  
ATOM 5838  H HE1  . HIS A 1 99  ? 16.196 -27.509 12.039 1.00 43.33 ? 99  HIS A HE1  3  
ATOM 5839  N N    . LYS A 1 100 ? 23.123 -27.300 9.416  1.00 32.20 ? 100 LYS A N    3  
ATOM 5840  C CA   . LYS A 1 100 ? 24.080 -27.526 8.340  1.00 60.44 ? 100 LYS A CA   3  
ATOM 5841  C C    . LYS A 1 100 ? 25.201 -28.456 8.794  1.00 14.05 ? 100 LYS A C    3  
ATOM 5842  O O    . LYS A 1 100 ? 25.382 -29.541 8.242  1.00 23.14 ? 100 LYS A O    3  
ATOM 5843  C CB   . LYS A 1 100 ? 24.668 -26.196 7.864  1.00 0.13  ? 100 LYS A CB   3  
ATOM 5844  C CG   . LYS A 1 100 ? 25.284 -26.264 6.478  1.00 50.14 ? 100 LYS A CG   3  
ATOM 5845  C CD   . LYS A 1 100 ? 26.790 -26.456 6.545  1.00 12.50 ? 100 LYS A CD   3  
ATOM 5846  C CE   . LYS A 1 100 ? 27.317 -27.165 5.307  1.00 5.33  ? 100 LYS A CE   3  
ATOM 5847  N NZ   . LYS A 1 100 ? 28.566 -27.924 5.593  1.00 31.52 ? 100 LYS A NZ   3  
ATOM 5848  H H    . LYS A 1 100 ? 23.374 -26.719 10.165 1.00 41.02 ? 100 LYS A H    3  
ATOM 5849  H HA   . LYS A 1 100 ? 23.554 -27.991 7.520  1.00 74.13 ? 100 LYS A HA   3  
ATOM 5850  H HB2  . LYS A 1 100 ? 23.884 -25.454 7.851  1.00 14.41 ? 100 LYS A HB2  3  
ATOM 5851  H HB3  . LYS A 1 100 ? 25.434 -25.885 8.561  1.00 71.45 ? 100 LYS A HB3  3  
ATOM 5852  H HG2  . LYS A 1 100 ? 24.850 -27.095 5.941  1.00 0.40  ? 100 LYS A HG2  3  
ATOM 5853  H HG3  . LYS A 1 100 ? 25.070 -25.343 5.953  1.00 24.23 ? 100 LYS A HG3  3  
ATOM 5854  H HD2  . LYS A 1 100 ? 27.264 -25.488 6.621  1.00 22.54 ? 100 LYS A HD2  3  
ATOM 5855  H HD3  . LYS A 1 100 ? 27.030 -27.046 7.418  1.00 60.32 ? 100 LYS A HD3  3  
ATOM 5856  H HE2  . LYS A 1 100 ? 26.563 -27.850 4.952  1.00 40.53 ? 100 LYS A HE2  3  
ATOM 5857  H HE3  . LYS A 1 100 ? 27.522 -26.427 4.545  1.00 15.24 ? 100 LYS A HE3  3  
ATOM 5858  H HZ1  . LYS A 1 100 ? 29.371 -27.486 5.102  1.00 41.11 ? 100 LYS A HZ1  3  
ATOM 5859  H HZ2  . LYS A 1 100 ? 28.469 -28.907 5.267  1.00 50.03 ? 100 LYS A HZ2  3  
ATOM 5860  H HZ3  . LYS A 1 100 ? 28.757 -27.927 6.615  1.00 33.24 ? 100 LYS A HZ3  3  
ATOM 5861  N N    . SER A 1 101 ? 25.948 -28.024 9.805  1.00 43.11 ? 101 SER A N    3  
ATOM 5862  C CA   . SER A 1 101 ? 27.053 -28.817 10.332 1.00 14.23 ? 101 SER A CA   3  
ATOM 5863  C C    . SER A 1 101 ? 27.776 -28.067 11.447 1.00 43.24 ? 101 SER A C    3  
ATOM 5864  O O    . SER A 1 101 ? 27.382 -26.963 11.825 1.00 72.35 ? 101 SER A O    3  
ATOM 5865  C CB   . SER A 1 101 ? 28.037 -29.166 9.214  1.00 31.24 ? 101 SER A CB   3  
ATOM 5866  O OG   . SER A 1 101 ? 29.213 -28.381 9.307  1.00 70.04 ? 101 SER A OG   3  
ATOM 5867  H H    . SER A 1 101 ? 25.754 -27.150 10.203 1.00 12.34 ? 101 SER A H    3  
ATOM 5868  H HA   . SER A 1 101 ? 26.642 -29.730 10.737 1.00 53.22 ? 101 SER A HA   3  
ATOM 5869  H HB2  . SER A 1 101 ? 28.308 -30.208 9.289  1.00 34.33 ? 101 SER A HB2  3  
ATOM 5870  H HB3  . SER A 1 101 ? 27.570 -28.983 8.257  1.00 30.24 ? 101 SER A HB3  3  
ATOM 5871  H HG   . SER A 1 101 ? 29.227 -27.740 8.592  1.00 0.02  ? 101 SER A HG   3  
ATOM 5872  N N    . ILE A 1 102 ? 28.837 -28.674 11.968 1.00 71.21 ? 102 ILE A N    3  
ATOM 5873  C CA   . ILE A 1 102 ? 29.617 -28.064 13.038 1.00 74.32 ? 102 ILE A CA   3  
ATOM 5874  C C    . ILE A 1 102 ? 30.905 -27.451 12.499 1.00 73.54 ? 102 ILE A C    3  
ATOM 5875  O O    . ILE A 1 102 ? 31.869 -28.161 12.214 1.00 10.12 ? 102 ILE A O    3  
ATOM 5876  C CB   . ILE A 1 102 ? 29.968 -29.089 14.133 1.00 51.22 ? 102 ILE A CB   3  
ATOM 5877  C CG1  . ILE A 1 102 ? 28.743 -29.377 15.004 1.00 64.02 ? 102 ILE A CG1  3  
ATOM 5878  C CG2  . ILE A 1 102 ? 31.122 -28.580 14.984 1.00 51.15 ? 102 ILE A CG2  3  
ATOM 5879  C CD1  . ILE A 1 102 ? 28.486 -30.853 15.216 1.00 45.52 ? 102 ILE A CD1  3  
ATOM 5880  H H    . ILE A 1 102 ? 29.102 -29.553 11.624 1.00 14.34 ? 102 ILE A H    3  
ATOM 5881  H HA   . ILE A 1 102 ? 29.017 -27.283 13.483 1.00 44.13 ? 102 ILE A HA   3  
ATOM 5882  H HB   . ILE A 1 102 ? 30.282 -30.003 13.652 1.00 1.51  ? 102 ILE A HB   3  
ATOM 5883  H HG12 . ILE A 1 102 ? 28.883 -28.923 15.972 1.00 41.10 ? 102 ILE A HG12 3  
ATOM 5884  H HG13 . ILE A 1 102 ? 27.869 -28.951 14.534 1.00 74.22 ? 102 ILE A HG13 3  
ATOM 5885  H HG21 . ILE A 1 102 ? 30.993 -28.915 16.002 1.00 22.22 ? 102 ILE A HG21 3  
ATOM 5886  H HG22 . ILE A 1 102 ? 32.053 -28.964 14.594 1.00 35.40 ? 102 ILE A HG22 3  
ATOM 5887  H HG23 . ILE A 1 102 ? 31.139 -27.501 14.959 1.00 2.21  ? 102 ILE A HG23 3  
ATOM 5888  H HD11 . ILE A 1 102 ? 27.493 -30.992 15.617 1.00 43.54 ? 102 ILE A HD11 3  
ATOM 5889  H HD12 . ILE A 1 102 ? 28.572 -31.372 14.274 1.00 74.44 ? 102 ILE A HD12 3  
ATOM 5890  H HD13 . ILE A 1 102 ? 29.213 -31.248 15.912 1.00 52.24 ? 102 ILE A HD13 3  
ATOM 5891  N N    . GLU A 1 103 ? 30.913 -26.129 12.363 1.00 72.15 ? 103 GLU A N    3  
ATOM 5892  C CA   . GLU A 1 103 ? 32.084 -25.421 11.858 1.00 15.14 ? 103 GLU A CA   3  
ATOM 5893  C C    . GLU A 1 103 ? 32.227 -24.059 12.532 1.00 64.12 ? 103 GLU A C    3  
ATOM 5894  O O    . GLU A 1 103 ? 31.352 -23.202 12.415 1.00 50.42 ? 103 GLU A O    3  
ATOM 5895  C CB   . GLU A 1 103 ? 31.986 -25.244 10.342 1.00 63.34 ? 103 GLU A CB   3  
ATOM 5896  C CG   . GLU A 1 103 ? 31.092 -26.270 9.666  1.00 51.25 ? 103 GLU A CG   3  
ATOM 5897  C CD   . GLU A 1 103 ? 31.104 -26.148 8.154  1.00 32.11 ? 103 GLU A CD   3  
ATOM 5898  O OE1  . GLU A 1 103 ? 30.132 -25.599 7.595  1.00 72.12 ? 103 GLU A OE1  3  
ATOM 5899  O OE2  . GLU A 1 103 ? 32.086 -26.602 7.531  1.00 63.12 ? 103 GLU A OE2  3  
ATOM 5900  H H    . GLU A 1 103 ? 30.113 -25.618 12.606 1.00 31.12 ? 103 GLU A H    3  
ATOM 5901  H HA   . GLU A 1 103 ? 32.955 -26.016 12.087 1.00 52.21 ? 103 GLU A HA   3  
ATOM 5902  H HB2  . GLU A 1 103 ? 31.595 -24.260 10.130 1.00 21.01 ? 103 GLU A HB2  3  
ATOM 5903  H HB3  . GLU A 1 103 ? 32.976 -25.327 9.918  1.00 4.40  ? 103 GLU A HB3  3  
ATOM 5904  H HG2  . GLU A 1 103 ? 31.432 -27.259 9.934  1.00 4.51  ? 103 GLU A HG2  3  
ATOM 5905  H HG3  . GLU A 1 103 ? 30.079 -26.132 10.015 1.00 3.32  ? 103 GLU A HG3  3  
ATOM 5906  N N    . TRP A 1 104 ? 33.337 -23.869 13.237 1.00 52.13 ? 104 TRP A N    3  
ATOM 5907  C CA   . TRP A 1 104 ? 33.596 -22.612 13.930 1.00 54.13 ? 104 TRP A CA   3  
ATOM 5908  C C    . TRP A 1 104 ? 34.843 -21.932 13.376 1.00 53.20 ? 104 TRP A C    3  
ATOM 5909  O O    . TRP A 1 104 ? 35.967 -22.328 13.685 1.00 63.43 ? 104 TRP A O    3  
ATOM 5910  C CB   . TRP A 1 104 ? 33.757 -22.857 15.431 1.00 64.42 ? 104 TRP A CB   3  
ATOM 5911  C CG   . TRP A 1 104 ? 32.911 -23.983 15.943 1.00 22.32 ? 104 TRP A CG   3  
ATOM 5912  C CD1  . TRP A 1 104 ? 33.329 -25.049 16.688 1.00 33.10 ? 104 TRP A CD1  3  
ATOM 5913  C CD2  . TRP A 1 104 ? 31.503 -24.155 15.747 1.00 65.44 ? 104 TRP A CD2  3  
ATOM 5914  N NE1  . TRP A 1 104 ? 32.265 -25.874 16.966 1.00 2.43  ? 104 TRP A NE1  3  
ATOM 5915  C CE2  . TRP A 1 104 ? 31.134 -25.347 16.401 1.00 62.12 ? 104 TRP A CE2  3  
ATOM 5916  C CE3  . TRP A 1 104 ? 30.519 -23.418 15.084 1.00 72.23 ? 104 TRP A CE3  3  
ATOM 5917  C CZ2  . TRP A 1 104 ? 29.823 -25.816 16.409 1.00 62.03 ? 104 TRP A CZ2  3  
ATOM 5918  C CZ3  . TRP A 1 104 ? 29.218 -23.885 15.092 1.00 22.11 ? 104 TRP A CZ3  3  
ATOM 5919  C CH2  . TRP A 1 104 ? 28.880 -25.074 15.752 1.00 74.25 ? 104 TRP A CH2  3  
ATOM 5920  H H    . TRP A 1 104 ? 33.998 -24.591 13.293 1.00 52.33 ? 104 TRP A H    3  
ATOM 5921  H HA   . TRP A 1 104 ? 32.746 -21.965 13.770 1.00 73.05 ? 104 TRP A HA   3  
ATOM 5922  H HB2  . TRP A 1 104 ? 34.790 -23.094 15.641 1.00 14.35 ? 104 TRP A HB2  3  
ATOM 5923  H HB3  . TRP A 1 104 ? 33.481 -21.961 15.966 1.00 14.23 ? 104 TRP A HB3  3  
ATOM 5924  H HD1  . TRP A 1 104 ? 34.349 -25.209 17.003 1.00 54.51 ? 104 TRP A HD1  3  
ATOM 5925  H HE1  . TRP A 1 104 ? 32.310 -26.703 17.487 1.00 72.10 ? 104 TRP A HE1  3  
ATOM 5926  H HE3  . TRP A 1 104 ? 30.760 -22.499 14.570 1.00 61.31 ? 104 TRP A HE3  3  
ATOM 5927  H HZ2  . TRP A 1 104 ? 29.546 -26.730 16.913 1.00 62.41 ? 104 TRP A HZ2  3  
ATOM 5928  H HZ3  . TRP A 1 104 ? 28.444 -23.329 14.585 1.00 53.14 ? 104 TRP A HZ3  3  
ATOM 5929  H HH2  . TRP A 1 104 ? 27.851 -25.401 15.732 1.00 65.11 ? 104 TRP A HH2  3  
ATOM 5930  N N    . LEU A 1 105 ? 34.638 -20.906 12.557 1.00 33.11 ? 105 LEU A N    3  
ATOM 5931  C CA   . LEU A 1 105 ? 35.747 -20.170 11.960 1.00 13.02 ? 105 LEU A CA   3  
ATOM 5932  C C    . LEU A 1 105 ? 36.017 -18.878 12.725 1.00 62.22 ? 105 LEU A C    3  
ATOM 5933  O O    . LEU A 1 105 ? 35.153 -18.378 13.444 1.00 34.44 ? 105 LEU A O    3  
ATOM 5934  C CB   . LEU A 1 105 ? 35.445 -19.855 10.494 1.00 11.41 ? 105 LEU A CB   3  
ATOM 5935  C CG   . LEU A 1 105 ? 35.404 -21.052 9.544  1.00 22.45 ? 105 LEU A CG   3  
ATOM 5936  C CD1  . LEU A 1 105 ? 34.023 -21.690 9.548  1.00 4.22  ? 105 LEU A CD1  3  
ATOM 5937  C CD2  . LEU A 1 105 ? 35.795 -20.630 8.136  1.00 53.32 ? 105 LEU A CD2  3  
ATOM 5938  H H    . LEU A 1 105 ? 33.719 -20.636 12.348 1.00 23.44 ? 105 LEU A H    3  
ATOM 5939  H HA   . LEU A 1 105 ? 36.625 -20.796 12.012 1.00 44.51 ? 105 LEU A HA   3  
ATOM 5940  H HB2  . LEU A 1 105 ? 34.483 -19.367 10.452 1.00 3.21  ? 105 LEU A HB2  3  
ATOM 5941  H HB3  . LEU A 1 105 ? 36.207 -19.175 10.139 1.00 21.42 ? 105 LEU A HB3  3  
ATOM 5942  H HG   . LEU A 1 105 ? 36.115 -21.795 9.881  1.00 52.21 ? 105 LEU A HG   3  
ATOM 5943  H HD11 . LEU A 1 105 ? 33.318 -21.017 10.011 1.00 54.10 ? 105 LEU A HD11 3  
ATOM 5944  H HD12 . LEU A 1 105 ? 34.056 -22.615 10.104 1.00 72.44 ? 105 LEU A HD12 3  
ATOM 5945  H HD13 . LEU A 1 105 ? 33.717 -21.891 8.532  1.00 42.20 ? 105 LEU A HD13 3  
ATOM 5946  H HD21 . LEU A 1 105 ? 35.455 -19.620 7.956  1.00 32.41 ? 105 LEU A HD21 3  
ATOM 5947  H HD22 . LEU A 1 105 ? 35.336 -21.297 7.420  1.00 42.52 ? 105 LEU A HD22 3  
ATOM 5948  H HD23 . LEU A 1 105 ? 36.869 -20.672 8.032  1.00 74.11 ? 105 LEU A HD23 3  
ATOM 5949  N N    . SER A 1 106 ? 37.222 -18.341 12.562 1.00 23.51 ? 106 SER A N    3  
ATOM 5950  C CA   . SER A 1 106 ? 37.607 -17.108 13.238 1.00 25.33 ? 106 SER A CA   3  
ATOM 5951  C C    . SER A 1 106 ? 36.967 -15.897 12.566 1.00 24.42 ? 106 SER A C    3  
ATOM 5952  O O    . SER A 1 106 ? 36.254 -16.031 11.571 1.00 22.23 ? 106 SER A O    3  
ATOM 5953  C CB   . SER A 1 106 ? 39.130 -16.958 13.242 1.00 30.13 ? 106 SER A CB   3  
ATOM 5954  O OG   . SER A 1 106 ? 39.766 -18.203 13.008 1.00 52.44 ? 106 SER A OG   3  
ATOM 5955  H H    . SER A 1 106 ? 37.868 -18.787 11.975 1.00 25.31 ? 106 SER A H    3  
ATOM 5956  H HA   . SER A 1 106 ? 37.257 -17.166 14.258 1.00 23.21 ? 106 SER A HA   3  
ATOM 5957  H HB2  . SER A 1 106 ? 39.423 -16.266 12.468 1.00 71.15 ? 106 SER A HB2  3  
ATOM 5958  H HB3  . SER A 1 106 ? 39.449 -16.580 14.203 1.00 50.42 ? 106 SER A HB3  3  
ATOM 5959  H HG   . SER A 1 106 ? 39.712 -18.744 13.798 1.00 21.05 ? 106 SER A HG   3  
ATOM 5960  N N    . ILE A 1 107 ? 37.228 -14.717 13.117 1.00 13.40 ? 107 ILE A N    3  
ATOM 5961  C CA   . ILE A 1 107 ? 36.678 -13.482 12.571 1.00 45.20 ? 107 ILE A CA   3  
ATOM 5962  C C    . ILE A 1 107 ? 37.377 -13.097 11.271 1.00 31.12 ? 107 ILE A C    3  
ATOM 5963  O O    . ILE A 1 107 ? 36.882 -12.266 10.511 1.00 10.34 ? 107 ILE A O    3  
ATOM 5964  C CB   . ILE A 1 107 ? 36.805 -12.318 13.572 1.00 34.42 ? 107 ILE A CB   3  
ATOM 5965  C CG1  . ILE A 1 107 ? 36.327 -12.756 14.959 1.00 44.14 ? 107 ILE A CG1  3  
ATOM 5966  C CG2  . ILE A 1 107 ? 36.010 -11.115 13.088 1.00 3.52  ? 107 ILE A CG2  3  
ATOM 5967  C CD1  . ILE A 1 107 ? 36.465 -11.679 16.012 1.00 34.54 ? 107 ILE A CD1  3  
ATOM 5968  H H    . ILE A 1 107 ? 37.803 -14.675 13.909 1.00 42.12 ? 107 ILE A H    3  
ATOM 5969  H HA   . ILE A 1 107 ? 35.630 -13.645 12.369 1.00 15.41 ? 107 ILE A HA   3  
ATOM 5970  H HB   . ILE A 1 107 ? 37.844 -12.034 13.630 1.00 0.13  ? 107 ILE A HB   3  
ATOM 5971  H HG12 . ILE A 1 107 ? 35.287 -13.034 14.903 1.00 31.22 ? 107 ILE A HG12 3  
ATOM 5972  H HG13 . ILE A 1 107 ? 36.908 -13.610 15.278 1.00 53.33 ? 107 ILE A HG13 3  
ATOM 5973  H HG21 . ILE A 1 107 ? 34.986 -11.407 12.911 1.00 13.13 ? 107 ILE A HG21 3  
ATOM 5974  H HG22 . ILE A 1 107 ? 36.038 -10.340 13.840 1.00 51.13 ? 107 ILE A HG22 3  
ATOM 5975  H HG23 . ILE A 1 107 ? 36.442 -10.743 12.171 1.00 1.02  ? 107 ILE A HG23 3  
ATOM 5976  H HD11 . ILE A 1 107 ? 35.487 -11.419 16.391 1.00 23.22 ? 107 ILE A HD11 3  
ATOM 5977  H HD12 . ILE A 1 107 ? 37.080 -12.043 16.821 1.00 3.11  ? 107 ILE A HD12 3  
ATOM 5978  H HD13 . ILE A 1 107 ? 36.925 -10.805 15.575 1.00 13.43 ? 107 ILE A HD13 3  
ATOM 5979  N N    . ASN A 1 108 ? 38.530 -13.710 11.022 1.00 53.45 ? 108 ASN A N    3  
ATOM 5980  C CA   . ASN A 1 108 ? 39.296 -13.432 9.812  1.00 24.22 ? 108 ASN A CA   3  
ATOM 5981  C C    . ASN A 1 108 ? 39.003 -14.469 8.732  1.00 22.44 ? 108 ASN A C    3  
ATOM 5982  O O    . ASN A 1 108 ? 39.721 -14.563 7.737  1.00 14.41 ? 108 ASN A O    3  
ATOM 5983  C CB   . ASN A 1 108 ? 40.794 -13.415 10.125 1.00 31.15 ? 108 ASN A CB   3  
ATOM 5984  C CG   . ASN A 1 108 ? 41.240 -14.649 10.886 1.00 73.11 ? 108 ASN A CG   3  
ATOM 5985  O OD1  . ASN A 1 108 ? 41.566 -15.675 10.289 1.00 24.23 ? 108 ASN A OD1  3  
ATOM 5986  N ND2  . ASN A 1 108 ? 41.255 -14.554 12.210 1.00 33.34 ? 108 ASN A ND2  3  
ATOM 5987  H H    . ASN A 1 108 ? 38.873 -14.363 11.666 1.00 64.34 ? 108 ASN A H    3  
ATOM 5988  H HA   . ASN A 1 108 ? 39.002 -12.459 9.450  1.00 44.15 ? 108 ASN A HA   3  
ATOM 5989  H HB2  . ASN A 1 108 ? 41.349 -13.367 9.200  1.00 54.34 ? 108 ASN A HB2  3  
ATOM 5990  H HB3  . ASN A 1 108 ? 41.021 -12.545 10.722 1.00 2.34  ? 108 ASN A HB3  3  
ATOM 5991  H HD21 . ASN A 1 108 ? 40.981 -13.706 12.617 1.00 2.43  ? 108 ASN A HD21 3  
ATOM 5992  H HD22 . ASN A 1 108 ? 41.539 -15.337 12.727 1.00 64.12 ? 108 ASN A HD22 3  
ATOM 5993  N N    . GLU A 1 109 ? 37.944 -15.246 8.937  1.00 13.23 ? 109 GLU A N    3  
ATOM 5994  C CA   . GLU A 1 109 ? 37.556 -16.276 7.981  1.00 23.20 ? 109 GLU A CA   3  
ATOM 5995  C C    . GLU A 1 109 ? 36.128 -16.055 7.492  1.00 34.43 ? 109 GLU A C    3  
ATOM 5996  O O    . GLU A 1 109 ? 35.762 -16.479 6.395  1.00 21.41 ? 109 GLU A O    3  
ATOM 5997  C CB   . GLU A 1 109 ? 37.682 -17.664 8.614  1.00 52.33 ? 109 GLU A CB   3  
ATOM 5998  C CG   . GLU A 1 109 ? 39.094 -18.224 8.578  1.00 52.42 ? 109 GLU A CG   3  
ATOM 5999  C CD   . GLU A 1 109 ? 39.123 -19.738 8.648  1.00 72.10 ? 109 GLU A CD   3  
ATOM 6000  O OE1  . GLU A 1 109 ? 38.777 -20.290 9.713  1.00 21.03 ? 109 GLU A OE1  3  
ATOM 6001  O OE2  . GLU A 1 109 ? 39.491 -20.371 7.636  1.00 23.24 ? 109 GLU A OE2  3  
ATOM 6002  H H    . GLU A 1 109 ? 37.411 -15.123 9.750  1.00 31.35 ? 109 GLU A H    3  
ATOM 6003  H HA   . GLU A 1 109 ? 38.226 -16.214 7.137  1.00 42.01 ? 109 GLU A HA   3  
ATOM 6004  H HB2  . GLU A 1 109 ? 37.365 -17.606 9.645  1.00 61.13 ? 109 GLU A HB2  3  
ATOM 6005  H HB3  . GLU A 1 109 ? 37.033 -18.347 8.085  1.00 10.43 ? 109 GLU A HB3  3  
ATOM 6006  H HG2  . GLU A 1 109 ? 39.568 -17.912 7.659  1.00 33.20 ? 109 GLU A HG2  3  
ATOM 6007  H HG3  . GLU A 1 109 ? 39.646 -17.828 9.418  1.00 74.30 ? 109 GLU A HG3  3  
ATOM 6008  N N    . LEU A 1 110 ? 35.324 -15.390 8.314  1.00 11.42 ? 110 LEU A N    3  
ATOM 6009  C CA   . LEU A 1 110 ? 33.934 -15.112 7.967  1.00 24.02 ? 110 LEU A CA   3  
ATOM 6010  C C    . LEU A 1 110 ? 33.826 -14.571 6.545  1.00 31.02 ? 110 LEU A C    3  
ATOM 6011  O O    . LEU A 1 110 ? 32.857 -14.848 5.837  1.00 4.23  ? 110 LEU A O    3  
ATOM 6012  C CB   . LEU A 1 110 ? 33.332 -14.110 8.954  1.00 43.14 ? 110 LEU A CB   3  
ATOM 6013  C CG   . LEU A 1 110 ? 34.196 -12.892 9.285  1.00 71.32 ? 110 LEU A CG   3  
ATOM 6014  C CD1  . LEU A 1 110 ? 33.998 -11.799 8.246  1.00 22.21 ? 110 LEU A CD1  3  
ATOM 6015  C CD2  . LEU A 1 110 ? 33.872 -12.372 10.678 1.00 44.14 ? 110 LEU A CD2  3  
ATOM 6016  H H    . LEU A 1 110 ? 35.672 -15.077 9.175  1.00 40.23 ? 110 LEU A H    3  
ATOM 6017  H HA   . LEU A 1 110 ? 33.386 -16.040 8.029  1.00 32.02 ? 110 LEU A HA   3  
ATOM 6018  H HB2  . LEU A 1 110 ? 32.404 -13.753 8.536  1.00 15.52 ? 110 LEU A HB2  3  
ATOM 6019  H HB3  . LEU A 1 110 ? 33.132 -14.635 9.876  1.00 34.55 ? 110 LEU A HB3  3  
ATOM 6020  H HG   . LEU A 1 110 ? 35.237 -13.183 9.269  1.00 45.42 ? 110 LEU A HG   3  
ATOM 6021  H HD11 . LEU A 1 110 ? 34.958 -11.496 7.856  1.00 73.15 ? 110 LEU A HD11 3  
ATOM 6022  H HD12 . LEU A 1 110 ? 33.512 -10.951 8.704  1.00 34.04 ? 110 LEU A HD12 3  
ATOM 6023  H HD13 . LEU A 1 110 ? 33.383 -12.175 7.441  1.00 3.31  ? 110 LEU A HD13 3  
ATOM 6024  H HD21 . LEU A 1 110 ? 32.880 -11.946 10.681 1.00 74.52 ? 110 LEU A HD21 3  
ATOM 6025  H HD22 . LEU A 1 110 ? 34.590 -11.613 10.954 1.00 51.22 ? 110 LEU A HD22 3  
ATOM 6026  H HD23 . LEU A 1 110 ? 33.918 -13.186 11.386 1.00 51.14 ? 110 LEU A HD23 3  
ATOM 6027  N N    . ASP A 1 111 ? 34.827 -13.801 6.133  1.00 15.50 ? 111 ASP A N    3  
ATOM 6028  C CA   . ASP A 1 111 ? 34.846 -13.223 4.794  1.00 35.20 ? 111 ASP A CA   3  
ATOM 6029  C C    . ASP A 1 111 ? 34.621 -14.298 3.735  1.00 21.44 ? 111 ASP A C    3  
ATOM 6030  O O    . ASP A 1 111 ? 33.762 -14.159 2.865  1.00 14.50 ? 111 ASP A O    3  
ATOM 6031  C CB   . ASP A 1 111 ? 36.175 -12.511 4.541  1.00 3.14  ? 111 ASP A CB   3  
ATOM 6032  C CG   . ASP A 1 111 ? 36.138 -11.637 3.303  1.00 60.42 ? 111 ASP A CG   3  
ATOM 6033  O OD1  . ASP A 1 111 ? 37.173 -11.547 2.610  1.00 53.10 ? 111 ASP A OD1  3  
ATOM 6034  O OD2  . ASP A 1 111 ? 35.074 -11.044 3.027  1.00 43.31 ? 111 ASP A OD2  3  
ATOM 6035  H H    . ASP A 1 111 ? 35.571 -13.616 6.744  1.00 72.21 ? 111 ASP A H    3  
ATOM 6036  H HA   . ASP A 1 111 ? 34.044 -12.502 4.732  1.00 23.42 ? 111 ASP A HA   3  
ATOM 6037  H HB2  . ASP A 1 111 ? 36.409 -11.887 5.392  1.00 65.21 ? 111 ASP A HB2  3  
ATOM 6038  H HB3  . ASP A 1 111 ? 36.954 -13.249 4.416  1.00 35.34 ? 111 ASP A HB3  3  
ATOM 6039  N N    . LYS A 1 112 ? 35.400 -15.372 3.815  1.00 4.31  ? 112 LYS A N    3  
ATOM 6040  C CA   . LYS A 1 112 ? 35.288 -16.472 2.865  1.00 52.21 ? 112 LYS A CA   3  
ATOM 6041  C C    . LYS A 1 112 ? 33.944 -17.179 3.008  1.00 54.45 ? 112 LYS A C    3  
ATOM 6042  O O    . LYS A 1 112 ? 33.520 -17.914 2.115  1.00 34.32 ? 112 LYS A O    3  
ATOM 6043  C CB   . LYS A 1 112 ? 36.427 -17.472 3.074  1.00 32.32 ? 112 LYS A CB   3  
ATOM 6044  C CG   . LYS A 1 112 ? 36.302 -18.723 2.222  1.00 70.14 ? 112 LYS A CG   3  
ATOM 6045  C CD   . LYS A 1 112 ? 35.619 -19.849 2.980  1.00 55.22 ? 112 LYS A CD   3  
ATOM 6046  C CE   . LYS A 1 112 ? 36.454 -20.311 4.163  1.00 24.53 ? 112 LYS A CE   3  
ATOM 6047  N NZ   . LYS A 1 112 ? 37.872 -20.558 3.779  1.00 74.53 ? 112 LYS A NZ   3  
ATOM 6048  H H    . LYS A 1 112 ? 36.068 -15.426 4.532  1.00 54.52 ? 112 LYS A H    3  
ATOM 6049  H HA   . LYS A 1 112 ? 35.360 -16.060 1.870  1.00 44.41 ? 112 LYS A HA   3  
ATOM 6050  H HB2  . LYS A 1 112 ? 37.363 -16.990 2.834  1.00 55.45 ? 112 LYS A HB2  3  
ATOM 6051  H HB3  . LYS A 1 112 ? 36.442 -17.770 4.113  1.00 71.02 ? 112 LYS A HB3  3  
ATOM 6052  H HG2  . LYS A 1 112 ? 35.721 -18.492 1.342  1.00 54.34 ? 112 LYS A HG2  3  
ATOM 6053  H HG3  . LYS A 1 112 ? 37.290 -19.047 1.928  1.00 62.34 ? 112 LYS A HG3  3  
ATOM 6054  H HD2  . LYS A 1 112 ? 34.664 -19.499 3.343  1.00 13.00 ? 112 LYS A HD2  3  
ATOM 6055  H HD3  . LYS A 1 112 ? 35.467 -20.683 2.309  1.00 1.30  ? 112 LYS A HD3  3  
ATOM 6056  H HE2  . LYS A 1 112 ? 36.425 -19.550 4.927  1.00 23.05 ? 112 LYS A HE2  3  
ATOM 6057  H HE3  . LYS A 1 112 ? 36.031 -21.226 4.551  1.00 75.34 ? 112 LYS A HE3  3  
ATOM 6058  H HZ1  . LYS A 1 112 ? 38.270 -21.326 4.357  1.00 72.02 ? 112 LYS A HZ1  3  
ATOM 6059  H HZ2  . LYS A 1 112 ? 38.437 -19.699 3.928  1.00 43.25 ? 112 LYS A HZ2  3  
ATOM 6060  H HZ3  . LYS A 1 112 ? 37.928 -20.829 2.776  1.00 2.31  ? 112 LYS A HZ3  3  
ATOM 6061  N N    . LEU A 1 113 ? 33.277 -16.950 4.134  1.00 71.14 ? 113 LEU A N    3  
ATOM 6062  C CA   . LEU A 1 113 ? 31.979 -17.564 4.392  1.00 21.04 ? 113 LEU A CA   3  
ATOM 6063  C C    . LEU A 1 113 ? 30.849 -16.698 3.845  1.00 35.44 ? 113 LEU A C    3  
ATOM 6064  O O    . LEU A 1 113 ? 29.835 -16.490 4.511  1.00 22.41 ? 113 LEU A O    3  
ATOM 6065  C CB   . LEU A 1 113 ? 31.787 -17.784 5.894  1.00 64.31 ? 113 LEU A CB   3  
ATOM 6066  C CG   . LEU A 1 113 ? 32.966 -18.416 6.636  1.00 41.25 ? 113 LEU A CG   3  
ATOM 6067  C CD1  . LEU A 1 113 ? 32.493 -19.089 7.914  1.00 21.24 ? 113 LEU A CD1  3  
ATOM 6068  C CD2  . LEU A 1 113 ? 33.687 -19.413 5.740  1.00 33.44 ? 113 LEU A CD2  3  
ATOM 6069  H H    . LEU A 1 113 ? 33.666 -16.355 4.807  1.00 15.25 ? 113 LEU A H    3  
ATOM 6070  H HA   . LEU A 1 113 ? 31.959 -18.520 3.891  1.00 61.20 ? 113 LEU A HA   3  
ATOM 6071  H HB2  . LEU A 1 113 ? 31.588 -16.825 6.346  1.00 44.10 ? 113 LEU A HB2  3  
ATOM 6072  H HB3  . LEU A 1 113 ? 30.929 -18.428 6.026  1.00 50.41 ? 113 LEU A HB3  3  
ATOM 6073  H HG   . LEU A 1 113 ? 33.669 -17.641 6.908  1.00 41.54 ? 113 LEU A HG   3  
ATOM 6074  H HD11 . LEU A 1 113 ? 32.768 -20.133 7.895  1.00 44.32 ? 113 LEU A HD11 3  
ATOM 6075  H HD12 . LEU A 1 113 ? 31.419 -19.001 7.992  1.00 64.45 ? 113 LEU A HD12 3  
ATOM 6076  H HD13 . LEU A 1 113 ? 32.955 -18.610 8.765  1.00 30.24 ? 113 LEU A HD13 3  
ATOM 6077  H HD21 . LEU A 1 113 ? 33.027 -19.724 4.944  1.00 53.43 ? 113 LEU A HD21 3  
ATOM 6078  H HD22 . LEU A 1 113 ? 33.977 -20.276 6.323  1.00 1.43  ? 113 LEU A HD22 3  
ATOM 6079  H HD23 . LEU A 1 113 ? 34.566 -18.950 5.320  1.00 43.54 ? 113 LEU A HD23 3  
ATOM 6080  N N    . ASN A 1 114 ? 31.029 -16.198 2.627  1.00 24.24 ? 114 ASN A N    3  
ATOM 6081  C CA   . ASN A 1 114 ? 30.023 -15.356 1.990  1.00 65.42 ? 114 ASN A CA   3  
ATOM 6082  C C    . ASN A 1 114 ? 28.638 -15.632 2.567  1.00 4.31  ? 114 ASN A C    3  
ATOM 6083  O O    . ASN A 1 114 ? 28.051 -16.685 2.322  1.00 60.42 ? 114 ASN A O    3  
ATOM 6084  C CB   . ASN A 1 114 ? 30.014 -15.593 0.478  1.00 5.41  ? 114 ASN A CB   3  
ATOM 6085  C CG   . ASN A 1 114 ? 29.731 -14.324 -0.304 1.00 25.34 ? 114 ASN A CG   3  
ATOM 6086  O OD1  . ASN A 1 114 ? 29.666 -13.234 0.264  1.00 45.32 ? 114 ASN A OD1  3  
ATOM 6087  N ND2  . ASN A 1 114 ? 29.561 -14.462 -1.613 1.00 64.33 ? 114 ASN A ND2  3  
ATOM 6088  H H    . ASN A 1 114 ? 31.859 -16.399 2.146  1.00 72.52 ? 114 ASN A H    3  
ATOM 6089  H HA   . ASN A 1 114 ? 30.283 -14.326 2.183  1.00 70.44 ? 114 ASN A HA   3  
ATOM 6090  H HB2  . ASN A 1 114 ? 30.979 -15.972 0.174  1.00 70.35 ? 114 ASN A HB2  3  
ATOM 6091  H HB3  . ASN A 1 114 ? 29.254 -16.320 0.238  1.00 54.35 ? 114 ASN A HB3  3  
ATOM 6092  H HD21 . ASN A 1 114 ? 29.627 -15.362 -1.997 1.00 10.12 ? 114 ASN A HD21 3  
ATOM 6093  H HD22 . ASN A 1 114 ? 29.378 -13.658 -2.143 1.00 72.50 ? 114 ASN A HD22 3  
ATOM 6094  N N    . TRP A 1 115 ? 28.123 -14.678 3.334  1.00 40.33 ? 115 TRP A N    3  
ATOM 6095  C CA   . TRP A 1 115 ? 26.806 -14.817 3.946  1.00 64.14 ? 115 TRP A CA   3  
ATOM 6096  C C    . TRP A 1 115 ? 25.747 -14.085 3.130  1.00 74.35 ? 115 TRP A C    3  
ATOM 6097  O O    . TRP A 1 115 ? 26.047 -13.493 2.093  1.00 23.44 ? 115 TRP A O    3  
ATOM 6098  C CB   . TRP A 1 115 ? 26.827 -14.279 5.377  1.00 1.22  ? 115 TRP A CB   3  
ATOM 6099  C CG   . TRP A 1 115 ? 28.110 -14.561 6.100  1.00 74.35 ? 115 TRP A CG   3  
ATOM 6100  C CD1  . TRP A 1 115 ? 29.314 -13.948 5.902  1.00 13.11 ? 115 TRP A CD1  3  
ATOM 6101  C CD2  . TRP A 1 115 ? 28.315 -15.530 7.133  1.00 25.41 ? 115 TRP A CD2  3  
ATOM 6102  N NE1  . TRP A 1 115 ? 30.256 -14.477 6.751  1.00 72.33 ? 115 TRP A NE1  3  
ATOM 6103  C CE2  . TRP A 1 115 ? 29.668 -15.449 7.517  1.00 65.22 ? 115 TRP A CE2  3  
ATOM 6104  C CE3  . TRP A 1 115 ? 27.489 -16.457 7.773  1.00 35.32 ? 115 TRP A CE3  3  
ATOM 6105  C CZ2  . TRP A 1 115 ? 30.210 -16.261 8.510  1.00 2.40  ? 115 TRP A CZ2  3  
ATOM 6106  C CZ3  . TRP A 1 115 ? 28.028 -17.262 8.759  1.00 72.14 ? 115 TRP A CZ3  3  
ATOM 6107  C CH2  . TRP A 1 115 ? 29.378 -17.159 9.120  1.00 73.30 ? 115 TRP A CH2  3  
ATOM 6108  H H    . TRP A 1 115 ? 28.640 -13.860 3.492  1.00 12.14 ? 115 TRP A H    3  
ATOM 6109  H HA   . TRP A 1 115 ? 26.563 -15.869 3.970  1.00 73.03 ? 115 TRP A HA   3  
ATOM 6110  H HB2  . TRP A 1 115 ? 26.686 -13.209 5.355  1.00 12.30 ? 115 TRP A HB2  3  
ATOM 6111  H HB3  . TRP A 1 115 ? 26.022 -14.733 5.936  1.00 33.12 ? 115 TRP A HB3  3  
ATOM 6112  H HD1  . TRP A 1 115 ? 29.486 -13.165 5.180  1.00 53.51 ? 115 TRP A HD1  3  
ATOM 6113  H HE1  . TRP A 1 115 ? 31.195 -14.202 6.800  1.00 4.11  ? 115 TRP A HE1  3  
ATOM 6114  H HE3  . TRP A 1 115 ? 26.446 -16.551 7.509  1.00 74.43 ? 115 TRP A HE3  3  
ATOM 6115  H HZ2  . TRP A 1 115 ? 31.249 -16.193 8.800  1.00 15.03 ? 115 TRP A HZ2  3  
ATOM 6116  H HZ3  . TRP A 1 115 ? 27.404 -17.985 9.264  1.00 10.31 ? 115 TRP A HZ3  3  
ATOM 6117  H HH2  . TRP A 1 115 ? 29.756 -17.808 9.895  1.00 60.14 ? 115 TRP A HH2  3  
ATOM 6118  N N    . ALA A 1 116 ? 24.506 -14.130 3.603  1.00 13.24 ? 116 ALA A N    3  
ATOM 6119  C CA   . ALA A 1 116 ? 23.402 -13.469 2.918  1.00 2.30  ? 116 ALA A CA   3  
ATOM 6120  C C    . ALA A 1 116 ? 23.752 -12.023 2.581  1.00 23.30 ? 116 ALA A C    3  
ATOM 6121  O O    . ALA A 1 116 ? 24.716 -11.456 3.096  1.00 21.32 ? 116 ALA A O    3  
ATOM 6122  C CB   . ALA A 1 116 ? 22.143 -13.524 3.770  1.00 11.22 ? 116 ALA A CB   3  
ATOM 6123  H H    . ALA A 1 116 ? 24.329 -14.618 4.434  1.00 13.34 ? 116 ALA A H    3  
ATOM 6124  H HA   . ALA A 1 116 ? 23.210 -14.005 2.000  1.00 31.41 ? 116 ALA A HA   3  
ATOM 6125  H HB1  . ALA A 1 116 ? 21.318 -13.877 3.169  1.00 54.11 ? 116 ALA A HB1  3  
ATOM 6126  H HB2  . ALA A 1 116 ? 22.299 -14.197 4.599  1.00 32.54 ? 116 ALA A HB2  3  
ATOM 6127  H HB3  . ALA A 1 116 ? 21.919 -12.536 4.145  1.00 32.40 ? 116 ALA A HB3  3  
ATOM 6128  N N    . PRO A 1 117 ? 22.953 -11.411 1.695  1.00 72.12 ? 117 PRO A N    3  
ATOM 6129  C CA   . PRO A 1 117 ? 23.159 -10.024 1.269  1.00 0.41  ? 117 PRO A CA   3  
ATOM 6130  C C    . PRO A 1 117 ? 22.855 -9.025  2.381  1.00 43.03 ? 117 PRO A C    3  
ATOM 6131  O O    . PRO A 1 117 ? 23.350 -7.898  2.368  1.00 75.14 ? 117 PRO A O    3  
ATOM 6132  C CB   . PRO A 1 117 ? 22.168 -9.856  0.114  1.00 24.03 ? 117 PRO A CB   3  
ATOM 6133  C CG   . PRO A 1 117 ? 21.101 -10.861 0.382  1.00 44.33 ? 117 PRO A CG   3  
ATOM 6134  C CD   . PRO A 1 117 ? 21.786 -12.026 1.041  1.00 72.24 ? 117 PRO A CD   3  
ATOM 6135  H HA   . PRO A 1 117 ? 24.165 -9.865  0.909  1.00 52.52 ? 117 PRO A HA   3  
ATOM 6136  H HB2  . PRO A 1 117 ? 21.774 -8.849  0.118  1.00 63.40 ? 117 PRO A HB2  3  
ATOM 6137  H HB3  . PRO A 1 117 ? 22.667 -10.050 -0.823 1.00 51.05 ? 117 PRO A HB3  3  
ATOM 6138  H HG2  . PRO A 1 117 ? 20.358 -10.440 1.042  1.00 60.23 ? 117 PRO A HG2  3  
ATOM 6139  H HG3  . PRO A 1 117 ? 20.648 -11.170 -0.548 1.00 54.03 ? 117 PRO A HG3  3  
ATOM 6140  H HD2  . PRO A 1 117 ? 21.133 -12.485 1.768  1.00 10.14 ? 117 PRO A HD2  3  
ATOM 6141  H HD3  . PRO A 1 117 ? 22.096 -12.749 0.301  1.00 61.24 ? 117 PRO A HD3  3  
ATOM 6142  N N    . ALA A 1 118 ? 22.040 -9.446  3.342  1.00 74.23 ? 118 ALA A N    3  
ATOM 6143  C CA   . ALA A 1 118 ? 21.672 -8.589  4.462  1.00 23.21 ? 118 ALA A CA   3  
ATOM 6144  C C    . ALA A 1 118 ? 22.646 -8.756  5.623  1.00 23.44 ? 118 ALA A C    3  
ATOM 6145  O O    . ALA A 1 118 ? 22.838 -7.840  6.423  1.00 55.44 ? 118 ALA A O    3  
ATOM 6146  C CB   . ALA A 1 118 ? 20.252 -8.892  4.915  1.00 55.15 ? 118 ALA A CB   3  
ATOM 6147  H H    . ALA A 1 118 ? 21.677 -10.355 3.297  1.00 64.53 ? 118 ALA A H    3  
ATOM 6148  H HA   . ALA A 1 118 ? 21.705 -7.564  4.123  1.00 41.23 ? 118 ALA A HA   3  
ATOM 6149  H HB1  . ALA A 1 118 ? 19.693 -7.970  4.984  1.00 54.14 ? 118 ALA A HB1  3  
ATOM 6150  H HB2  . ALA A 1 118 ? 19.778 -9.548  4.199  1.00 2.32  ? 118 ALA A HB2  3  
ATOM 6151  H HB3  . ALA A 1 118 ? 20.277 -9.371  5.882  1.00 75.33 ? 118 ALA A HB3  3  
ATOM 6152  N N    . ASP A 1 119 ? 23.259 -9.932  5.711  1.00 12.11 ? 119 ASP A N    3  
ATOM 6153  C CA   . ASP A 1 119 ? 24.214 -10.219 6.775  1.00 32.02 ? 119 ASP A CA   3  
ATOM 6154  C C    . ASP A 1 119 ? 25.635 -9.884  6.335  1.00 63.04 ? 119 ASP A C    3  
ATOM 6155  O O    . ASP A 1 119 ? 26.509 -9.629  7.164  1.00 13.02 ? 119 ASP A O    3  
ATOM 6156  C CB   . ASP A 1 119 ? 24.127 -11.690 7.184  1.00 33.24 ? 119 ASP A CB   3  
ATOM 6157  C CG   . ASP A 1 119 ? 23.016 -11.949 8.183  1.00 13.41 ? 119 ASP A CG   3  
ATOM 6158  O OD1  . ASP A 1 119 ? 21.974 -12.507 7.780  1.00 33.55 ? 119 ASP A OD1  3  
ATOM 6159  O OD2  . ASP A 1 119 ? 23.188 -11.593 9.367  1.00 4.33  ? 119 ASP A OD2  3  
ATOM 6160  H H    . ASP A 1 119 ? 23.065 -10.623 5.044  1.00 75.14 ? 119 ASP A H    3  
ATOM 6161  H HA   . ASP A 1 119 ? 23.959 -9.603  7.624  1.00 21.14 ? 119 ASP A HA   3  
ATOM 6162  H HB2  . ASP A 1 119 ? 23.942 -12.291 6.306  1.00 64.32 ? 119 ASP A HB2  3  
ATOM 6163  H HB3  . ASP A 1 119 ? 25.064 -11.989 7.630  1.00 20.11 ? 119 ASP A HB3  3  
ATOM 6164  N N    . ILE A 1 120 ? 25.860 -9.888  5.025  1.00 54.31 ? 120 ILE A N    3  
ATOM 6165  C CA   . ILE A 1 120 ? 27.175 -9.584  4.475  1.00 71.21 ? 120 ILE A CA   3  
ATOM 6166  C C    . ILE A 1 120 ? 27.768 -8.339  5.125  1.00 45.14 ? 120 ILE A C    3  
ATOM 6167  O O    . ILE A 1 120 ? 28.869 -8.361  5.676  1.00 43.55 ? 120 ILE A O    3  
ATOM 6168  C CB   . ILE A 1 120 ? 27.113 -9.374  2.950  1.00 33.14 ? 120 ILE A CB   3  
ATOM 6169  C CG1  . ILE A 1 120 ? 27.325 -10.703 2.222  1.00 41.55 ? 120 ILE A CG1  3  
ATOM 6170  C CG2  . ILE A 1 120 ? 28.152 -8.352  2.514  1.00 73.12 ? 120 ILE A CG2  3  
ATOM 6171  C CD1  . ILE A 1 120 ? 26.597 -10.789 0.898  1.00 2.23  ? 120 ILE A CD1  3  
ATOM 6172  H H    . ILE A 1 120 ? 25.123 -10.099 4.414  1.00 1.33  ? 120 ILE A H    3  
ATOM 6173  H HA   . ILE A 1 120 ? 27.822 -10.426 4.676  1.00 2.41  ? 120 ILE A HA   3  
ATOM 6174  H HB   . ILE A 1 120 ? 26.136 -8.988  2.702  1.00 1.52  ? 120 ILE A HB   3  
ATOM 6175  H HG12 . ILE A 1 120 ? 28.378 -10.836 2.030  1.00 71.45 ? 120 ILE A HG12 3  
ATOM 6176  H HG13 . ILE A 1 120 ? 26.972 -11.509 2.848  1.00 4.34  ? 120 ILE A HG13 3  
ATOM 6177  H HG21 . ILE A 1 120 ? 29.084 -8.546  3.024  1.00 14.22 ? 120 ILE A HG21 3  
ATOM 6178  H HG22 . ILE A 1 120 ? 28.304 -8.427  1.448  1.00 70.24 ? 120 ILE A HG22 3  
ATOM 6179  H HG23 . ILE A 1 120 ? 27.806 -7.359  2.760  1.00 61.34 ? 120 ILE A HG23 3  
ATOM 6180  H HD11 . ILE A 1 120 ? 25.775 -11.484 0.984  1.00 52.50 ? 120 ILE A HD11 3  
ATOM 6181  H HD12 . ILE A 1 120 ? 26.220 -9.814  0.630  1.00 12.31 ? 120 ILE A HD12 3  
ATOM 6182  H HD13 . ILE A 1 120 ? 27.280 -11.133 0.134  1.00 34.12 ? 120 ILE A HD13 3  
ATOM 6183  N N    . PRO A 1 121 ? 27.023 -7.226  5.061  1.00 14.14 ? 121 PRO A N    3  
ATOM 6184  C CA   . PRO A 1 121 ? 27.454 -5.950  5.641  1.00 73.14 ? 121 PRO A CA   3  
ATOM 6185  C C    . PRO A 1 121 ? 27.459 -5.978  7.165  1.00 13.22 ? 121 PRO A C    3  
ATOM 6186  O O    . PRO A 1 121 ? 28.181 -5.215  7.807  1.00 73.32 ? 121 PRO A O    3  
ATOM 6187  C CB   . PRO A 1 121 ? 26.409 -4.956  5.127  1.00 34.43 ? 121 PRO A CB   3  
ATOM 6188  C CG   . PRO A 1 121 ? 25.197 -5.782  4.866  1.00 72.42 ? 121 PRO A CG   3  
ATOM 6189  C CD   . PRO A 1 121 ? 25.701 -7.127  4.420  1.00 34.33 ? 121 PRO A CD   3  
ATOM 6190  H HA   . PRO A 1 121 ? 28.432 -5.663  5.284  1.00 51.23 ? 121 PRO A HA   3  
ATOM 6191  H HB2  . PRO A 1 121 ? 26.221 -4.206  5.882  1.00 12.31 ? 121 PRO A HB2  3  
ATOM 6192  H HB3  . PRO A 1 121 ? 26.767 -4.485  4.225  1.00 64.34 ? 121 PRO A HB3  3  
ATOM 6193  H HG2  . PRO A 1 121 ? 24.617 -5.880  5.771  1.00 74.24 ? 121 PRO A HG2  3  
ATOM 6194  H HG3  . PRO A 1 121 ? 24.604 -5.327  4.086  1.00 63.52 ? 121 PRO A HG3  3  
ATOM 6195  H HD2  . PRO A 1 121 ? 25.044 -7.911  4.768  1.00 12.44 ? 121 PRO A HD2  3  
ATOM 6196  H HD3  . PRO A 1 121 ? 25.791 -7.159  3.344  1.00 4.15  ? 121 PRO A HD3  3  
ATOM 6197  N N    . ALA A 1 122 ? 26.649 -6.862  7.739  1.00 0.30  ? 122 ALA A N    3  
ATOM 6198  C CA   . ALA A 1 122 ? 26.563 -6.990  9.188  1.00 34.14 ? 122 ALA A CA   3  
ATOM 6199  C C    . ALA A 1 122 ? 27.748 -7.773  9.742  1.00 61.52 ? 122 ALA A C    3  
ATOM 6200  O O    . ALA A 1 122 ? 28.188 -7.540  10.867 1.00 5.25  ? 122 ALA A O    3  
ATOM 6201  C CB   . ALA A 1 122 ? 25.255 -7.661  9.582  1.00 54.43 ? 122 ALA A CB   3  
ATOM 6202  H H    . ALA A 1 122 ? 26.098 -7.442  7.174  1.00 32.20 ? 122 ALA A H    3  
ATOM 6203  H HA   . ALA A 1 122 ? 26.571 -5.996  9.613  1.00 60.34 ? 122 ALA A HA   3  
ATOM 6204  H HB1  . ALA A 1 122 ? 24.500 -7.438  8.841  1.00 62.31 ? 122 ALA A HB1  3  
ATOM 6205  H HB2  . ALA A 1 122 ? 25.401 -8.729  9.638  1.00 13.12 ? 122 ALA A HB2  3  
ATOM 6206  H HB3  . ALA A 1 122 ? 24.935 -7.289  10.544 1.00 41.02 ? 122 ALA A HB3  3  
ATOM 6207  N N    . VAL A 1 123 ? 28.261 -8.705  8.944  1.00 53.23 ? 123 VAL A N    3  
ATOM 6208  C CA   . VAL A 1 123 ? 29.396 -9.523  9.354  1.00 52.31 ? 123 VAL A CA   3  
ATOM 6209  C C    . VAL A 1 123 ? 30.704 -8.749  9.231  1.00 54.11 ? 123 VAL A C    3  
ATOM 6210  O O    . VAL A 1 123 ? 31.564 -8.822  10.107 1.00 2.50  ? 123 VAL A O    3  
ATOM 6211  C CB   . VAL A 1 123 ? 29.493 -10.810 8.514  1.00 52.14 ? 123 VAL A CB   3  
ATOM 6212  C CG1  . VAL A 1 123 ? 30.803 -11.531 8.790  1.00 2.14  ? 123 VAL A CG1  3  
ATOM 6213  C CG2  . VAL A 1 123 ? 28.305 -11.719 8.793  1.00 4.30  ? 123 VAL A CG2  3  
ATOM 6214  H H    . VAL A 1 123 ? 27.866 -8.844  8.058  1.00 64.54 ? 123 VAL A H    3  
ATOM 6215  H HA   . VAL A 1 123 ? 29.250 -9.802  10.387 1.00 31.41 ? 123 VAL A HA   3  
ATOM 6216  H HB   . VAL A 1 123 ? 29.472 -10.536 7.469  1.00 71.20 ? 123 VAL A HB   3  
ATOM 6217  H HG11 . VAL A 1 123 ? 30.612 -12.585 8.928  1.00 75.00 ? 123 VAL A HG11 3  
ATOM 6218  H HG12 . VAL A 1 123 ? 31.474 -11.392 7.956  1.00 45.44 ? 123 VAL A HG12 3  
ATOM 6219  H HG13 . VAL A 1 123 ? 31.253 -11.128 9.686  1.00 63.02 ? 123 VAL A HG13 3  
ATOM 6220  H HG21 . VAL A 1 123 ? 27.608 -11.210 9.442  1.00 5.21  ? 123 VAL A HG21 3  
ATOM 6221  H HG22 . VAL A 1 123 ? 27.815 -11.967 7.863  1.00 71.31 ? 123 VAL A HG22 3  
ATOM 6222  H HG23 . VAL A 1 123 ? 28.649 -12.624 9.271  1.00 12.24 ? 123 VAL A HG23 3  
ATOM 6223  N N    . ASN A 1 124 ? 30.846 -8.007  8.137  1.00 35.31 ? 124 ASN A N    3  
ATOM 6224  C CA   . ASN A 1 124 ? 32.049 -7.219  7.899  1.00 62.11 ? 124 ASN A CA   3  
ATOM 6225  C C    . ASN A 1 124 ? 32.294 -6.240  9.044  1.00 71.45 ? 124 ASN A C    3  
ATOM 6226  O O    . ASN A 1 124 ? 33.426 -6.067  9.496  1.00 33.32 ? 124 ASN A O    3  
ATOM 6227  C CB   . ASN A 1 124 ? 31.932 -6.457  6.578  1.00 55.34 ? 124 ASN A CB   3  
ATOM 6228  C CG   . ASN A 1 124 ? 32.418 -7.272  5.395  1.00 51.53 ? 124 ASN A CG   3  
ATOM 6229  O OD1  . ASN A 1 124 ? 33.424 -7.976  5.483  1.00 14.14 ? 124 ASN A OD1  3  
ATOM 6230  N ND2  . ASN A 1 124 ? 31.704 -7.178  4.279  1.00 70.52 ? 124 ASN A ND2  3  
ATOM 6231  H H    . ASN A 1 124 ? 30.124 -7.990  7.474  1.00 1.11  ? 124 ASN A H    3  
ATOM 6232  H HA   . ASN A 1 124 ? 32.885 -7.900  7.838  1.00 34.11 ? 124 ASN A HA   3  
ATOM 6233  H HB2  . ASN A 1 124 ? 30.896 -6.197  6.410  1.00 63.23 ? 124 ASN A HB2  3  
ATOM 6234  H HB3  . ASN A 1 124 ? 32.520 -5.553  6.636  1.00 71.41 ? 124 ASN A HB3  3  
ATOM 6235  H HD21 . ASN A 1 124 ? 30.914 -6.598  4.281  1.00 45.40 ? 124 ASN A HD21 3  
ATOM 6236  H HD22 . ASN A 1 124 ? 31.996 -7.695  3.499  1.00 75.21 ? 124 ASN A HD22 3  
ATOM 6237  N N    . LYS A 1 125 ? 31.225 -5.603  9.508  1.00 52.40 ? 125 LYS A N    3  
ATOM 6238  C CA   . LYS A 1 125 ? 31.321 -4.642  10.601 1.00 20.40 ? 125 LYS A CA   3  
ATOM 6239  C C    . LYS A 1 125 ? 31.920 -5.292  11.845 1.00 55.13 ? 125 LYS A C    3  
ATOM 6240  O O    . LYS A 1 125 ? 32.643 -4.648  12.605 1.00 33.04 ? 125 LYS A O    3  
ATOM 6241  C CB   . LYS A 1 125 ? 29.940 -4.069  10.927 1.00 60.14 ? 125 LYS A CB   3  
ATOM 6242  C CG   . LYS A 1 125 ? 29.937 -3.133  12.123 1.00 75.30 ? 125 LYS A CG   3  
ATOM 6243  C CD   . LYS A 1 125 ? 28.919 -3.565  13.165 1.00 13.34 ? 125 LYS A CD   3  
ATOM 6244  C CE   . LYS A 1 125 ? 28.934 -2.642  14.375 1.00 61.14 ? 125 LYS A CE   3  
ATOM 6245  N NZ   . LYS A 1 125 ? 29.841 -3.144  15.444 1.00 74.40 ? 125 LYS A NZ   3  
ATOM 6246  H H    . LYS A 1 125 ? 30.349 -5.783  9.106  1.00 53.00 ? 125 LYS A H    3  
ATOM 6247  H HA   . LYS A 1 125 ? 31.968 -3.840  10.282 1.00 45.03 ? 125 LYS A HA   3  
ATOM 6248  H HB2  . LYS A 1 125 ? 29.579 -3.523  10.068 1.00 75.13 ? 125 LYS A HB2  3  
ATOM 6249  H HB3  . LYS A 1 125 ? 29.264 -4.886  11.133 1.00 31.35 ? 125 LYS A HB3  3  
ATOM 6250  H HG2  . LYS A 1 125 ? 30.918 -3.134  12.572 1.00 24.34 ? 125 LYS A HG2  3  
ATOM 6251  H HG3  . LYS A 1 125 ? 29.693 -2.135  11.787 1.00 64.21 ? 125 LYS A HG3  3  
ATOM 6252  H HD2  . LYS A 1 125 ? 27.933 -3.544  12.724 1.00 23.51 ? 125 LYS A HD2  3  
ATOM 6253  H HD3  . LYS A 1 125 ? 29.150 -4.570  13.488 1.00 63.25 ? 125 LYS A HD3  3  
ATOM 6254  H HE2  . LYS A 1 125 ? 29.268 -1.665  14.061 1.00 11.13 ? 125 LYS A HE2  3  
ATOM 6255  H HE3  . LYS A 1 125 ? 27.931 -2.571  14.769 1.00 41.52 ? 125 LYS A HE3  3  
ATOM 6256  H HZ1  . LYS A 1 125 ? 29.735 -4.174  15.547 1.00 64.14 ? 125 LYS A HZ1  3  
ATOM 6257  H HZ2  . LYS A 1 125 ? 29.608 -2.692  16.351 1.00 45.21 ? 125 LYS A HZ2  3  
ATOM 6258  H HZ3  . LYS A 1 125 ? 30.829 -2.930  15.204 1.00 5.35  ? 125 LYS A HZ3  3  
ATOM 6259  N N    . ILE A 1 126 ? 31.615 -6.570  12.044 1.00 13.21 ? 126 ILE A N    3  
ATOM 6260  C CA   . ILE A 1 126 ? 32.125 -7.306  13.194 1.00 41.10 ? 126 ILE A CA   3  
ATOM 6261  C C    . ILE A 1 126 ? 33.648 -7.371  13.173 1.00 65.33 ? 126 ILE A C    3  
ATOM 6262  O O    . ILE A 1 126 ? 34.299 -7.267  14.212 1.00 33.44 ? 126 ILE A O    3  
ATOM 6263  C CB   . ILE A 1 126 ? 31.562 -8.738  13.241 1.00 74.44 ? 126 ILE A CB   3  
ATOM 6264  C CG1  . ILE A 1 126 ? 30.033 -8.707  13.304 1.00 2.32  ? 126 ILE A CG1  3  
ATOM 6265  C CG2  . ILE A 1 126 ? 32.131 -9.493  14.433 1.00 62.15 ? 126 ILE A CG2  3  
ATOM 6266  C CD1  . ILE A 1 126 ? 29.388 -10.041 13.000 1.00 50.43 ? 126 ILE A CD1  3  
ATOM 6267  H H    . ILE A 1 126 ? 31.034 -7.028  11.402 1.00 34.44 ? 126 ILE A H    3  
ATOM 6268  H HA   . ILE A 1 126 ? 31.810 -6.787  14.088 1.00 61.10 ? 126 ILE A HA   3  
ATOM 6269  H HB   . ILE A 1 126 ? 31.867 -9.251  12.341 1.00 11.03 ? 126 ILE A HB   3  
ATOM 6270  H HG12 . ILE A 1 126 ? 29.726 -8.409  14.294 1.00 3.14  ? 126 ILE A HG12 3  
ATOM 6271  H HG13 . ILE A 1 126 ? 29.666 -7.988  12.586 1.00 15.34 ? 126 ILE A HG13 3  
ATOM 6272  H HG21 . ILE A 1 126 ? 31.324 -9.821  15.070 1.00 14.34 ? 126 ILE A HG21 3  
ATOM 6273  H HG22 . ILE A 1 126 ? 32.684 -10.352 14.083 1.00 31.23 ? 126 ILE A HG22 3  
ATOM 6274  H HG23 . ILE A 1 126 ? 32.789 -8.843  14.990 1.00 61.24 ? 126 ILE A HG23 3  
ATOM 6275  H HD11 . ILE A 1 126 ? 30.130 -10.717 12.601 1.00 34.23 ? 126 ILE A HD11 3  
ATOM 6276  H HD12 . ILE A 1 126 ? 28.971 -10.455 13.905 1.00 10.53 ? 126 ILE A HD12 3  
ATOM 6277  H HD13 . ILE A 1 126 ? 28.601 -9.902  12.272 1.00 1.20  ? 126 ILE A HD13 3  
ATOM 6278  N N    . MET A 1 127 ? 34.211 -7.542  11.981 1.00 24.41 ? 127 MET A N    3  
ATOM 6279  C CA   . MET A 1 127 ? 35.659 -7.618  11.824 1.00 22.41 ? 127 MET A CA   3  
ATOM 6280  C C    . MET A 1 127 ? 36.344 -6.448  12.523 1.00 20.31 ? 127 MET A C    3  
ATOM 6281  O O    . MET A 1 127 ? 37.449 -6.586  13.050 1.00 72.04 ? 127 MET A O    3  
ATOM 6282  C CB   . MET A 1 127 ? 36.033 -7.631  10.341 1.00 52.25 ? 127 MET A CB   3  
ATOM 6283  C CG   . MET A 1 127 ? 35.610 -8.899  9.618  1.00 74.32 ? 127 MET A CG   3  
ATOM 6284  S SD   . MET A 1 127 ? 36.869 -9.502  8.477  1.00 2.01  ? 127 MET A SD   3  
ATOM 6285  C CE   . MET A 1 127 ? 38.238 -9.777  9.599  1.00 42.11 ? 127 MET A CE   3  
ATOM 6286  H H    . MET A 1 127 ? 33.640 -7.619  11.188 1.00 4.41  ? 127 MET A H    3  
ATOM 6287  H HA   . MET A 1 127 ? 35.994 -8.539  12.278 1.00 75.22 ? 127 MET A HA   3  
ATOM 6288  H HB2  . MET A 1 127 ? 35.559 -6.791  9.855  1.00 3.42  ? 127 MET A HB2  3  
ATOM 6289  H HB3  . MET A 1 127 ? 37.104 -7.532  10.250 1.00 3.31  ? 127 MET A HB3  3  
ATOM 6290  H HG2  . MET A 1 127 ? 35.412 -9.667  10.351 1.00 61.10 ? 127 MET A HG2  3  
ATOM 6291  H HG3  . MET A 1 127 ? 34.707 -8.695  9.061  1.00 32.43 ? 127 MET A HG3  3  
ATOM 6292  H HE1  . MET A 1 127 ? 37.866 -10.182 10.528 1.00 4.14  ? 127 MET A HE1  3  
ATOM 6293  H HE2  . MET A 1 127 ? 38.933 -10.474 9.155  1.00 72.25 ? 127 MET A HE2  3  
ATOM 6294  H HE3  . MET A 1 127 ? 38.740 -8.840  9.790  1.00 45.52 ? 127 MET A HE3  3  
ATOM 6295  N N    . THR A 1 128 ? 35.682 -5.296  12.525 1.00 55.43 ? 128 THR A N    3  
ATOM 6296  C CA   . THR A 1 128 ? 36.227 -4.101  13.157 1.00 20.45 ? 128 THR A CA   3  
ATOM 6297  C C    . THR A 1 128 ? 36.686 -4.395  14.581 1.00 11.53 ? 128 THR A C    3  
ATOM 6298  O O    . THR A 1 128 ? 37.641 -3.792  15.071 1.00 34.42 ? 128 THR A O    3  
ATOM 6299  C CB   . THR A 1 128 ? 35.193 -2.960  13.188 1.00 3.12  ? 128 THR A CB   3  
ATOM 6300  O OG1  . THR A 1 128 ? 34.633 -2.771  11.884 1.00 31.20 ? 128 THR A OG1  3  
ATOM 6301  C CG2  . THR A 1 128 ? 35.832 -1.664  13.663 1.00 3.24  ? 128 THR A CG2  3  
ATOM 6302  H H    . THR A 1 128 ? 34.805 -5.249  12.089 1.00 43.34 ? 128 THR A H    3  
ATOM 6303  H HA   . THR A 1 128 ? 37.077 -3.774  12.576 1.00 75.12 ? 128 THR A HA   3  
ATOM 6304  H HB   . THR A 1 128 ? 34.404 -3.228  13.876 1.00 73.03 ? 128 THR A HB   3  
ATOM 6305  H HG1  . THR A 1 128 ? 35.340 -2.713  11.237 1.00 2.20  ? 128 THR A HG1  3  
ATOM 6306  H HG21 . THR A 1 128 ? 36.905 -1.734  13.564 1.00 4.20  ? 128 THR A HG21 3  
ATOM 6307  H HG22 . THR A 1 128 ? 35.577 -1.495  14.699 1.00 74.01 ? 128 THR A HG22 3  
ATOM 6308  H HG23 . THR A 1 128 ? 35.469 -0.843  13.064 1.00 14.22 ? 128 THR A HG23 3  
ATOM 6309  N N    . GLU A 1 129 ? 36.000 -5.324  15.240 1.00 40.41 ? 129 GLU A N    3  
ATOM 6310  C CA   . GLU A 1 129 ? 36.339 -5.696  16.608 1.00 12.45 ? 129 GLU A CA   3  
ATOM 6311  C C    . GLU A 1 129 ? 37.764 -6.236  16.689 1.00 53.14 ? 129 GLU A C    3  
ATOM 6312  O O    . GLU A 1 129 ? 38.514 -5.904  17.605 1.00 23.52 ? 129 GLU A O    3  
ATOM 6313  C CB   . GLU A 1 129 ? 35.354 -6.742  17.135 1.00 65.34 ? 129 GLU A CB   3  
ATOM 6314  C CG   . GLU A 1 129 ? 35.616 -7.155  18.573 1.00 12.45 ? 129 GLU A CG   3  
ATOM 6315  C CD   . GLU A 1 129 ? 35.570 -5.982  19.534 1.00 44.12 ? 129 GLU A CD   3  
ATOM 6316  O OE1  . GLU A 1 129 ? 34.985 -4.940  19.170 1.00 61.31 ? 129 GLU A OE1  3  
ATOM 6317  O OE2  . GLU A 1 129 ? 36.120 -6.105  20.648 1.00 31.32 ? 129 GLU A OE2  3  
ATOM 6318  H H    . GLU A 1 129 ? 35.249 -5.769  14.795 1.00 13.43 ? 129 GLU A H    3  
ATOM 6319  H HA   . GLU A 1 129 ? 36.268 -4.809  17.220 1.00 21.13 ? 129 GLU A HA   3  
ATOM 6320  H HB2  . GLU A 1 129 ? 34.354 -6.341  17.072 1.00 34.14 ? 129 GLU A HB2  3  
ATOM 6321  H HB3  . GLU A 1 129 ? 35.419 -7.623  16.513 1.00 75.12 ? 129 GLU A HB3  3  
ATOM 6322  H HG2  . GLU A 1 129 ? 34.866 -7.872  18.871 1.00 61.42 ? 129 GLU A HG2  3  
ATOM 6323  H HG3  . GLU A 1 129 ? 36.593 -7.611  18.632 1.00 71.31 ? 129 GLU A HG3  3  
ATOM 6324  N N    . GLY A 1 130 ? 38.129 -7.071  15.721 1.00 60.42 ? 130 GLY A N    3  
ATOM 6325  C CA   . GLY A 1 130 ? 39.462 -7.645  15.700 1.00 32.31 ? 130 GLY A CA   3  
ATOM 6326  C C    . GLY A 1 130 ? 40.453 -6.782  14.945 1.00 1.14  ? 130 GLY A C    3  
ATOM 6327  O O    . GLY A 1 130 ? 41.644 -7.090  14.897 1.00 73.33 ? 130 GLY A O    3  
ATOM 6328  H H    . GLY A 1 130 ? 37.488 -7.300  15.015 1.00 21.03 ? 130 GLY A H    3  
ATOM 6329  H HA2  . GLY A 1 130 ? 39.806 -7.766  16.716 1.00 12.14 ? 130 GLY A HA2  3  
ATOM 6330  H HA3  . GLY A 1 130 ? 39.416 -8.616  15.229 1.00 71.05 ? 130 GLY A HA3  3  
ATOM 6331  N N    . MET A 1 1   ? 4.378  0.817   1.050  1.00 24.34 ? 1   MET A N    4  
ATOM 6332  C CA   . MET A 1 1   ? 3.680  0.625   -0.216 1.00 3.14  ? 1   MET A CA   4  
ATOM 6333  C C    . MET A 1 1   ? 3.435  -0.857  -0.482 1.00 45.35 ? 1   MET A C    4  
ATOM 6334  O O    . MET A 1 1   ? 2.356  -1.248  -0.926 1.00 72.11 ? 1   MET A O    4  
ATOM 6335  C CB   . MET A 1 1   ? 4.486  1.236   -1.364 1.00 74.11 ? 1   MET A CB   4  
ATOM 6336  C CG   . MET A 1 1   ? 4.180  2.705   -1.606 1.00 50.14 ? 1   MET A CG   4  
ATOM 6337  S SD   . MET A 1 1   ? 5.216  3.802   -0.620 1.00 4.14  ? 1   MET A SD   4  
ATOM 6338  C CE   . MET A 1 1   ? 6.696  3.866   -1.626 1.00 64.13 ? 1   MET A CE   4  
ATOM 6339  H H1   . MET A 1 1   ? 5.350  0.945   1.045  1.00 1.03  ? 1   MET A H1   4  
ATOM 6340  H HA   . MET A 1 1   ? 2.728  1.129   -0.148 1.00 31.11 ? 1   MET A HA   4  
ATOM 6341  H HB2  . MET A 1 1   ? 5.538  1.141   -1.141 1.00 14.45 ? 1   MET A HB2  4  
ATOM 6342  H HB3  . MET A 1 1   ? 4.268  0.691   -2.271 1.00 12.43 ? 1   MET A HB3  4  
ATOM 6343  H HG2  . MET A 1 1   ? 4.341  2.925   -2.651 1.00 40.52 ? 1   MET A HG2  4  
ATOM 6344  H HG3  . MET A 1 1   ? 3.145  2.889   -1.357 1.00 63.24 ? 1   MET A HG3  4  
ATOM 6345  H HE1  . MET A 1 1   ? 6.786  4.845   -2.074 1.00 33.42 ? 1   MET A HE1  4  
ATOM 6346  H HE2  . MET A 1 1   ? 7.560  3.672   -1.008 1.00 44.31 ? 1   MET A HE2  4  
ATOM 6347  H HE3  . MET A 1 1   ? 6.635  3.118   -2.404 1.00 53.51 ? 1   MET A HE3  4  
ATOM 6348  N N    . LYS A 1 2   ? 4.445  -1.677  -0.210 1.00 14.01 ? 2   LYS A N    4  
ATOM 6349  C CA   . LYS A 1 2   ? 4.339  -3.116  -0.419 1.00 64.14 ? 2   LYS A CA   4  
ATOM 6350  C C    . LYS A 1 2   ? 4.272  -3.856  0.913  1.00 64.35 ? 2   LYS A C    4  
ATOM 6351  O O    . LYS A 1 2   ? 4.211  -3.239  1.976  1.00 45.42 ? 2   LYS A O    4  
ATOM 6352  C CB   . LYS A 1 2   ? 5.530  -3.622  -1.237 1.00 4.43  ? 2   LYS A CB   4  
ATOM 6353  C CG   . LYS A 1 2   ? 5.602  -3.034  -2.635 1.00 74.05 ? 2   LYS A CG   4  
ATOM 6354  C CD   . LYS A 1 2   ? 4.420  -3.471  -3.485 1.00 32.13 ? 2   LYS A CD   4  
ATOM 6355  C CE   . LYS A 1 2   ? 4.678  -3.233  -4.965 1.00 5.25  ? 2   LYS A CE   4  
ATOM 6356  N NZ   . LYS A 1 2   ? 4.453  -1.811  -5.345 1.00 54.11 ? 2   LYS A NZ   4  
ATOM 6357  H H    . LYS A 1 2   ? 5.281  -1.305  0.142  1.00 70.11 ? 2   LYS A H    4  
ATOM 6358  H HA   . LYS A 1 2   ? 3.430  -3.306  -0.969 1.00 50.31 ? 2   LYS A HA   4  
ATOM 6359  H HB2  . LYS A 1 2   ? 6.442  -3.369  -0.716 1.00 22.22 ? 2   LYS A HB2  4  
ATOM 6360  H HB3  . LYS A 1 2   ? 5.461  -4.697  -1.324 1.00 5.53  ? 2   LYS A HB3  4  
ATOM 6361  H HG2  . LYS A 1 2   ? 5.601  -1.956  -2.564 1.00 74.51 ? 2   LYS A HG2  4  
ATOM 6362  H HG3  . LYS A 1 2   ? 6.515  -3.365  -3.109 1.00 3.52  ? 2   LYS A HG3  4  
ATOM 6363  H HD2  . LYS A 1 2   ? 4.244  -4.525  -3.327 1.00 1.20  ? 2   LYS A HD2  4  
ATOM 6364  H HD3  . LYS A 1 2   ? 3.546  -2.910  -3.186 1.00 13.21 ? 2   LYS A HD3  4  
ATOM 6365  H HE2  . LYS A 1 2   ? 5.701  -3.497  -5.185 1.00 22.30 ? 2   LYS A HE2  4  
ATOM 6366  H HE3  . LYS A 1 2   ? 4.013  -3.860  -5.538 1.00 73.44 ? 2   LYS A HE3  4  
ATOM 6367  H HZ1  . LYS A 1 2   ? 5.251  -1.225  -5.027 1.00 62.14 ? 2   LYS A HZ1  4  
ATOM 6368  H HZ2  . LYS A 1 2   ? 3.581  -1.457  -4.903 1.00 14.11 ? 2   LYS A HZ2  4  
ATOM 6369  H HZ3  . LYS A 1 2   ? 4.364  -1.727  -6.378 1.00 11.13 ? 2   LYS A HZ3  4  
ATOM 6370  N N    . LYS A 1 3   ? 4.285  -5.183  0.848  1.00 64.40 ? 3   LYS A N    4  
ATOM 6371  C CA   . LYS A 1 3   ? 4.229  -6.009  2.049  1.00 41.15 ? 3   LYS A CA   4  
ATOM 6372  C C    . LYS A 1 3   ? 5.497  -5.846  2.881  1.00 52.11 ? 3   LYS A C    4  
ATOM 6373  O O    . LYS A 1 3   ? 6.517  -6.478  2.607  1.00 60.11 ? 3   LYS A O    4  
ATOM 6374  C CB   . LYS A 1 3   ? 4.039  -7.480  1.672  1.00 30.13 ? 3   LYS A CB   4  
ATOM 6375  C CG   . LYS A 1 3   ? 3.942  -8.407  2.872  1.00 54.14 ? 3   LYS A CG   4  
ATOM 6376  C CD   . LYS A 1 3   ? 2.521  -8.482  3.405  1.00 53.32 ? 3   LYS A CD   4  
ATOM 6377  C CE   . LYS A 1 3   ? 1.717  -9.563  2.699  1.00 31.23 ? 3   LYS A CE   4  
ATOM 6378  N NZ   . LYS A 1 3   ? 1.103  -9.064  1.438  1.00 55.00 ? 3   LYS A NZ   4  
ATOM 6379  H H    . LYS A 1 3   ? 4.335  -5.619  -0.029 1.00 41.44 ? 3   LYS A H    4  
ATOM 6380  H HA   . LYS A 1 3   ? 3.383  -5.684  2.635  1.00 3.02  ? 3   LYS A HA   4  
ATOM 6381  H HB2  . LYS A 1 3   ? 3.132  -7.577  1.094  1.00 31.10 ? 3   LYS A HB2  4  
ATOM 6382  H HB3  . LYS A 1 3   ? 4.877  -7.796  1.067  1.00 12.42 ? 3   LYS A HB3  4  
ATOM 6383  H HG2  . LYS A 1 3   ? 4.256  -9.397  2.577  1.00 44.02 ? 3   LYS A HG2  4  
ATOM 6384  H HG3  . LYS A 1 3   ? 4.591  -8.039  3.653  1.00 11.43 ? 3   LYS A HG3  4  
ATOM 6385  H HD2  . LYS A 1 3   ? 2.553  -8.704  4.461  1.00 73.31 ? 3   LYS A HD2  4  
ATOM 6386  H HD3  . LYS A 1 3   ? 2.037  -7.527  3.251  1.00 70.44 ? 3   LYS A HD3  4  
ATOM 6387  H HE2  . LYS A 1 3   ? 2.373  -10.388 2.468  1.00 21.10 ? 3   LYS A HE2  4  
ATOM 6388  H HE3  . LYS A 1 3   ? 0.934  -9.901  3.362  1.00 31.20 ? 3   LYS A HE3  4  
ATOM 6389  H HZ1  . LYS A 1 3   ? 1.115  -8.024  1.422  1.00 44.01 ? 3   LYS A HZ1  4  
ATOM 6390  H HZ2  . LYS A 1 3   ? 0.117  -9.388  1.368  1.00 50.01 ? 3   LYS A HZ2  4  
ATOM 6391  H HZ3  . LYS A 1 3   ? 1.632  -9.419  0.617  1.00 65.50 ? 3   LYS A HZ3  4  
ATOM 6392  N N    . VAL A 1 4   ? 5.425  -4.995  3.900  1.00 61.03 ? 4   VAL A N    4  
ATOM 6393  C CA   . VAL A 1 4   ? 6.566  -4.751  4.774  1.00 62.21 ? 4   VAL A CA   4  
ATOM 6394  C C    . VAL A 1 4   ? 6.897  -5.987  5.604  1.00 55.51 ? 4   VAL A C    4  
ATOM 6395  O O    . VAL A 1 4   ? 6.221  -6.283  6.590  1.00 4.42  ? 4   VAL A O    4  
ATOM 6396  C CB   . VAL A 1 4   ? 6.304  -3.565  5.721  1.00 45.12 ? 4   VAL A CB   4  
ATOM 6397  C CG1  . VAL A 1 4   ? 7.502  -3.333  6.630  1.00 54.10 ? 4   VAL A CG1  4  
ATOM 6398  C CG2  . VAL A 1 4   ? 5.978  -2.310  4.925  1.00 61.33 ? 4   VAL A CG2  4  
ATOM 6399  H H    . VAL A 1 4   ? 4.584  -4.521  4.068  1.00 43.41 ? 4   VAL A H    4  
ATOM 6400  H HA   . VAL A 1 4   ? 7.417  -4.508  4.153  1.00 35.42 ? 4   VAL A HA   4  
ATOM 6401  H HB   . VAL A 1 4   ? 5.452  -3.805  6.339  1.00 22.32 ? 4   VAL A HB   4  
ATOM 6402  H HG11 . VAL A 1 4   ? 7.207  -3.484  7.658  1.00 12.21 ? 4   VAL A HG11 4  
ATOM 6403  H HG12 . VAL A 1 4   ? 8.288  -4.027  6.374  1.00 64.30 ? 4   VAL A HG12 4  
ATOM 6404  H HG13 . VAL A 1 4   ? 7.859  -2.321  6.504  1.00 74.34 ? 4   VAL A HG13 4  
ATOM 6405  H HG21 . VAL A 1 4   ? 5.823  -1.485  5.603  1.00 15.22 ? 4   VAL A HG21 4  
ATOM 6406  H HG22 . VAL A 1 4   ? 6.799  -2.081  4.261  1.00 3.41  ? 4   VAL A HG22 4  
ATOM 6407  H HG23 . VAL A 1 4   ? 5.082  -2.474  4.345  1.00 63.33 ? 4   VAL A HG23 4  
ATOM 6408  N N    . ILE A 1 5   ? 7.939  -6.703  5.198  1.00 21.55 ? 5   ILE A N    4  
ATOM 6409  C CA   . ILE A 1 5   ? 8.360  -7.906  5.906  1.00 21.30 ? 5   ILE A CA   4  
ATOM 6410  C C    . ILE A 1 5   ? 9.303  -7.566  7.055  1.00 31.43 ? 5   ILE A C    4  
ATOM 6411  O O    . ILE A 1 5   ? 10.356 -6.964  6.850  1.00 14.13 ? 5   ILE A O    4  
ATOM 6412  C CB   . ILE A 1 5   ? 9.059  -8.900  4.960  1.00 23.30 ? 5   ILE A CB   4  
ATOM 6413  C CG1  . ILE A 1 5   ? 8.292  -9.008  3.640  1.00 3.15  ? 5   ILE A CG1  4  
ATOM 6414  C CG2  . ILE A 1 5   ? 9.181  -10.265 5.621  1.00 35.03 ? 5   ILE A CG2  4  
ATOM 6415  C CD1  . ILE A 1 5   ? 6.842  -9.401  3.815  1.00 41.21 ? 5   ILE A CD1  4  
ATOM 6416  H H    . ILE A 1 5   ? 8.437  -6.416  4.405  1.00 24.33 ? 5   ILE A H    4  
ATOM 6417  H HA   . ILE A 1 5   ? 7.477  -8.383  6.308  1.00 42.44 ? 5   ILE A HA   4  
ATOM 6418  H HB   . ILE A 1 5   ? 10.055 -8.534  4.761  1.00 53.22 ? 5   ILE A HB   4  
ATOM 6419  H HG12 . ILE A 1 5   ? 8.319  -8.054  3.137  1.00 32.41 ? 5   ILE A HG12 4  
ATOM 6420  H HG13 . ILE A 1 5   ? 8.766  -9.753  3.017  1.00 1.43  ? 5   ILE A HG13 4  
ATOM 6421  H HG21 . ILE A 1 5   ? 8.260  -10.499 6.136  1.00 40.33 ? 5   ILE A HG21 4  
ATOM 6422  H HG22 . ILE A 1 5   ? 9.371  -11.014 4.867  1.00 34.25 ? 5   ILE A HG22 4  
ATOM 6423  H HG23 . ILE A 1 5   ? 9.995  -10.251 6.329  1.00 22.25 ? 5   ILE A HG23 4  
ATOM 6424  H HD11 . ILE A 1 5   ? 6.348  -8.681  4.451  1.00 74.33 ? 5   ILE A HD11 4  
ATOM 6425  H HD12 . ILE A 1 5   ? 6.357  -9.425  2.851  1.00 15.31 ? 5   ILE A HD12 4  
ATOM 6426  H HD13 . ILE A 1 5   ? 6.787  -10.379 4.270  1.00 73.51 ? 5   ILE A HD13 4  
ATOM 6427  N N    . ASN A 1 6   ? 8.918  -7.959  8.265  1.00 33.03 ? 6   ASN A N    4  
ATOM 6428  C CA   . ASN A 1 6   ? 9.730  -7.697  9.448  1.00 34.22 ? 6   ASN A CA   4  
ATOM 6429  C C    . ASN A 1 6   ? 10.369 -8.983  9.965  1.00 53.42 ? 6   ASN A C    4  
ATOM 6430  O O    . ASN A 1 6   ? 9.711  -9.801  10.607 1.00 73.41 ? 6   ASN A O    4  
ATOM 6431  C CB   . ASN A 1 6   ? 8.876  -7.061  10.547 1.00 22.14 ? 6   ASN A CB   4  
ATOM 6432  C CG   . ASN A 1 6   ? 8.799  -5.552  10.419 1.00 73.12 ? 6   ASN A CG   4  
ATOM 6433  O OD1  . ASN A 1 6   ? 8.842  -5.009  9.315  1.00 43.11 ? 6   ASN A OD1  4  
ATOM 6434  N ND2  . ASN A 1 6   ? 8.683  -4.867  11.551 1.00 64.23 ? 6   ASN A ND2  4  
ATOM 6435  H H    . ASN A 1 6   ? 8.067  -8.436  8.365  1.00 4.24  ? 6   ASN A H    4  
ATOM 6436  H HA   . ASN A 1 6   ? 10.511 -7.008  9.168  1.00 44.35 ? 6   ASN A HA   4  
ATOM 6437  H HB2  . ASN A 1 6   ? 7.873  -7.460  10.492 1.00 44.50 ? 6   ASN A HB2  4  
ATOM 6438  H HB3  . ASN A 1 6   ? 9.302  -7.301  11.510 1.00 32.11 ? 6   ASN A HB3  4  
ATOM 6439  H HD21 . ASN A 1 6   ? 8.655  -5.367  12.394 1.00 42.44 ? 6   ASN A HD21 4  
ATOM 6440  H HD22 . ASN A 1 6   ? 8.631  -3.890  11.497 1.00 73.14 ? 6   ASN A HD22 4  
ATOM 6441  N N    . VAL A 1 7   ? 11.656 -9.153  9.681  1.00 40.34 ? 7   VAL A N    4  
ATOM 6442  C CA   . VAL A 1 7   ? 12.385 -10.337 10.118 1.00 63.25 ? 7   VAL A CA   4  
ATOM 6443  C C    . VAL A 1 7   ? 13.581 -9.958  10.984 1.00 11.21 ? 7   VAL A C    4  
ATOM 6444  O O    . VAL A 1 7   ? 14.042 -8.817  10.959 1.00 3.32  ? 7   VAL A O    4  
ATOM 6445  C CB   . VAL A 1 7   ? 12.878 -11.167 8.917  1.00 21.44 ? 7   VAL A CB   4  
ATOM 6446  C CG1  . VAL A 1 7   ? 11.721 -11.919 8.277  1.00 61.02 ? 7   VAL A CG1  4  
ATOM 6447  C CG2  . VAL A 1 7   ? 13.572 -10.274 7.901  1.00 41.42 ? 7   VAL A CG2  4  
ATOM 6448  H H    . VAL A 1 7   ? 12.127 -8.465  9.165  1.00 14.23 ? 7   VAL A H    4  
ATOM 6449  H HA   . VAL A 1 7   ? 11.711 -10.949 10.699 1.00 0.01  ? 7   VAL A HA   4  
ATOM 6450  H HB   . VAL A 1 7   ? 13.594 -11.892 9.276  1.00 21.05 ? 7   VAL A HB   4  
ATOM 6451  H HG11 . VAL A 1 7   ? 10.918 -12.019 8.992  1.00 73.32 ? 7   VAL A HG11 4  
ATOM 6452  H HG12 . VAL A 1 7   ? 11.370 -11.373 7.413  1.00 5.35  ? 7   VAL A HG12 4  
ATOM 6453  H HG13 . VAL A 1 7   ? 12.055 -12.900 7.972  1.00 74.04 ? 7   VAL A HG13 4  
ATOM 6454  H HG21 . VAL A 1 7   ? 13.947 -10.878 7.088  1.00 4.24  ? 7   VAL A HG21 4  
ATOM 6455  H HG22 . VAL A 1 7   ? 12.867 -9.551  7.516  1.00 43.23 ? 7   VAL A HG22 4  
ATOM 6456  H HG23 . VAL A 1 7   ? 14.393 -9.758  8.376  1.00 40.54 ? 7   VAL A HG23 4  
ATOM 6457  N N    . VAL A 1 8   ? 14.079 -10.923 11.751 1.00 43.24 ? 8   VAL A N    4  
ATOM 6458  C CA   . VAL A 1 8   ? 15.223 -10.691 12.625 1.00 50.04 ? 8   VAL A CA   4  
ATOM 6459  C C    . VAL A 1 8   ? 16.142 -11.907 12.661 1.00 1.21  ? 8   VAL A C    4  
ATOM 6460  O O    . VAL A 1 8   ? 15.753 -13.005 12.265 1.00 13.52 ? 8   VAL A O    4  
ATOM 6461  C CB   . VAL A 1 8   ? 14.774 -10.357 14.060 1.00 61.33 ? 8   VAL A CB   4  
ATOM 6462  C CG1  . VAL A 1 8   ? 13.878 -9.128  14.067 1.00 61.11 ? 8   VAL A CG1  4  
ATOM 6463  C CG2  . VAL A 1 8   ? 14.064 -11.548 14.686 1.00 24.10 ? 8   VAL A CG2  4  
ATOM 6464  H H    . VAL A 1 8   ? 13.668 -11.812 11.727 1.00 63.10 ? 8   VAL A H    4  
ATOM 6465  H HA   . VAL A 1 8   ? 15.774 -9.847  12.237 1.00 40.43 ? 8   VAL A HA   4  
ATOM 6466  H HB   . VAL A 1 8   ? 15.653 -10.138 14.648 1.00 32.24 ? 8   VAL A HB   4  
ATOM 6467  H HG11 . VAL A 1 8   ? 13.437 -9.011  15.046 1.00 53.42 ? 8   VAL A HG11 4  
ATOM 6468  H HG12 . VAL A 1 8   ? 14.465 -8.253  13.828 1.00 74.24 ? 8   VAL A HG12 4  
ATOM 6469  H HG13 . VAL A 1 8   ? 13.095 -9.249  13.332 1.00 24.24 ? 8   VAL A HG13 4  
ATOM 6470  H HG21 . VAL A 1 8   ? 14.726 -12.402 14.684 1.00 15.23 ? 8   VAL A HG21 4  
ATOM 6471  H HG22 . VAL A 1 8   ? 13.788 -11.309 15.703 1.00 60.21 ? 8   VAL A HG22 4  
ATOM 6472  H HG23 . VAL A 1 8   ? 13.176 -11.779 14.117 1.00 43.31 ? 8   VAL A HG23 4  
ATOM 6473  N N    . GLY A 1 9   ? 17.366 -11.703 13.140 1.00 14.10 ? 9   GLY A N    4  
ATOM 6474  C CA   . GLY A 1 9   ? 18.322 -12.792 13.220 1.00 11.50 ? 9   GLY A CA   4  
ATOM 6475  C C    . GLY A 1 9   ? 19.094 -12.791 14.525 1.00 55.23 ? 9   GLY A C    4  
ATOM 6476  O O    . GLY A 1 9   ? 18.731 -12.088 15.468 1.00 74.42 ? 9   GLY A O    4  
ATOM 6477  H H    . GLY A 1 9   ? 17.621 -10.806 13.441 1.00 0.24  ? 9   GLY A H    4  
ATOM 6478  H HA2  . GLY A 1 9   ? 17.793 -13.728 13.127 1.00 30.31 ? 9   GLY A HA2  4  
ATOM 6479  H HA3  . GLY A 1 9   ? 19.021 -12.702 12.402 1.00 43.22 ? 9   GLY A HA3  4  
ATOM 6480  N N    . ALA A 1 10  ? 20.160 -13.581 14.580 1.00 64.31 ? 10  ALA A N    4  
ATOM 6481  C CA   . ALA A 1 10  ? 20.985 -13.669 15.778 1.00 2.25  ? 10  ALA A CA   4  
ATOM 6482  C C    . ALA A 1 10  ? 22.371 -14.214 15.452 1.00 23.44 ? 10  ALA A C    4  
ATOM 6483  O O    . ALA A 1 10  ? 22.516 -15.108 14.618 1.00 21.41 ? 10  ALA A O    4  
ATOM 6484  C CB   . ALA A 1 10  ? 20.306 -14.540 16.824 1.00 34.04 ? 10  ALA A CB   4  
ATOM 6485  H H    . ALA A 1 10  ? 20.399 -14.117 13.795 1.00 21.32 ? 10  ALA A H    4  
ATOM 6486  H HA   . ALA A 1 10  ? 21.088 -12.673 16.186 1.00 30.43 ? 10  ALA A HA   4  
ATOM 6487  H HB1  . ALA A 1 10  ? 20.721 -14.322 17.798 1.00 71.52 ? 10  ALA A HB1  4  
ATOM 6488  H HB2  . ALA A 1 10  ? 19.246 -14.334 16.831 1.00 73.04 ? 10  ALA A HB2  4  
ATOM 6489  H HB3  . ALA A 1 10  ? 20.469 -15.581 16.587 1.00 3.53  ? 10  ALA A HB3  4  
ATOM 6490  N N    . ILE A 1 11  ? 23.387 -13.671 16.115 1.00 51.34 ? 11  ILE A N    4  
ATOM 6491  C CA   . ILE A 1 11  ? 24.761 -14.104 15.895 1.00 61.04 ? 11  ILE A CA   4  
ATOM 6492  C C    . ILE A 1 11  ? 25.395 -14.601 17.190 1.00 51.43 ? 11  ILE A C    4  
ATOM 6493  O O    . ILE A 1 11  ? 25.875 -13.808 18.001 1.00 34.42 ? 11  ILE A O    4  
ATOM 6494  C CB   . ILE A 1 11  ? 25.624 -12.967 15.317 1.00 43.11 ? 11  ILE A CB   4  
ATOM 6495  C CG1  . ILE A 1 11  ? 25.294 -11.644 16.010 1.00 54.40 ? 11  ILE A CG1  4  
ATOM 6496  C CG2  . ILE A 1 11  ? 25.412 -12.852 13.815 1.00 43.13 ? 11  ILE A CG2  4  
ATOM 6497  C CD1  . ILE A 1 11  ? 26.196 -10.503 15.596 1.00 43.40 ? 11  ILE A CD1  4  
ATOM 6498  H H    . ILE A 1 11  ? 23.208 -12.962 16.767 1.00 73.11 ? 11  ILE A H    4  
ATOM 6499  H HA   . ILE A 1 11  ? 24.744 -14.915 15.181 1.00 43.25 ? 11  ILE A HA   4  
ATOM 6500  H HB   . ILE A 1 11  ? 26.662 -13.208 15.492 1.00 14.34 ? 11  ILE A HB   4  
ATOM 6501  H HG12 . ILE A 1 11  ? 24.279 -11.365 15.775 1.00 53.24 ? 11  ILE A HG12 4  
ATOM 6502  H HG13 . ILE A 1 11  ? 25.389 -11.772 17.079 1.00 73.14 ? 11  ILE A HG13 4  
ATOM 6503  H HG21 . ILE A 1 11  ? 24.506 -12.298 13.621 1.00 53.03 ? 11  ILE A HG21 4  
ATOM 6504  H HG22 . ILE A 1 11  ? 26.250 -12.335 13.372 1.00 64.00 ? 11  ILE A HG22 4  
ATOM 6505  H HG23 . ILE A 1 11  ? 25.330 -13.839 13.386 1.00 60.12 ? 11  ILE A HG23 4  
ATOM 6506  H HD11 . ILE A 1 11  ? 26.752 -10.154 16.454 1.00 44.55 ? 11  ILE A HD11 4  
ATOM 6507  H HD12 . ILE A 1 11  ? 26.882 -10.843 14.835 1.00 21.11 ? 11  ILE A HD12 4  
ATOM 6508  H HD13 . ILE A 1 11  ? 25.597 -9.694  15.204 1.00 53.53 ? 11  ILE A HD13 4  
ATOM 6509  N N    . ILE A 1 12  ? 25.395 -15.916 17.375 1.00 34.25 ? 12  ILE A N    4  
ATOM 6510  C CA   . ILE A 1 12  ? 25.972 -16.519 18.570 1.00 4.45  ? 12  ILE A CA   4  
ATOM 6511  C C    . ILE A 1 12  ? 27.492 -16.594 18.468 1.00 10.35 ? 12  ILE A C    4  
ATOM 6512  O O    . ILE A 1 12  ? 28.034 -17.240 17.571 1.00 34.14 ? 12  ILE A O    4  
ATOM 6513  C CB   . ILE A 1 12  ? 25.415 -17.933 18.814 1.00 72.55 ? 12  ILE A CB   4  
ATOM 6514  C CG1  . ILE A 1 12  ? 23.900 -17.879 19.025 1.00 64.21 ? 12  ILE A CG1  4  
ATOM 6515  C CG2  . ILE A 1 12  ? 26.100 -18.574 20.012 1.00 73.15 ? 12  ILE A CG2  4  
ATOM 6516  C CD1  . ILE A 1 12  ? 23.106 -18.028 17.746 1.00 1.22  ? 12  ILE A CD1  4  
ATOM 6517  H H    . ILE A 1 12  ? 24.997 -16.495 16.693 1.00 63.55 ? 12  ILE A H    4  
ATOM 6518  H HA   . ILE A 1 12  ? 25.709 -15.899 19.416 1.00 61.40 ? 12  ILE A HA   4  
ATOM 6519  H HB   . ILE A 1 12  ? 25.628 -18.535 17.943 1.00 4.22  ? 12  ILE A HB   4  
ATOM 6520  H HG12 . ILE A 1 12  ? 23.607 -18.675 19.691 1.00 23.20 ? 12  ILE A HG12 4  
ATOM 6521  H HG13 . ILE A 1 12  ? 23.641 -16.929 19.469 1.00 35.35 ? 12  ILE A HG13 4  
ATOM 6522  H HG21 . ILE A 1 12  ? 26.376 -17.808 20.721 1.00 55.53 ? 12  ILE A HG21 4  
ATOM 6523  H HG22 . ILE A 1 12  ? 25.423 -19.272 20.482 1.00 41.41 ? 12  ILE A HG22 4  
ATOM 6524  H HG23 . ILE A 1 12  ? 26.986 -19.097 19.683 1.00 15.54 ? 12  ILE A HG23 4  
ATOM 6525  H HD11 . ILE A 1 12  ? 22.555 -18.956 17.770 1.00 62.41 ? 12  ILE A HD11 4  
ATOM 6526  H HD12 . ILE A 1 12  ? 22.418 -17.202 17.651 1.00 13.22 ? 12  ILE A HD12 4  
ATOM 6527  H HD13 . ILE A 1 12  ? 23.781 -18.032 16.902 1.00 31.50 ? 12  ILE A HD13 4  
ATOM 6528  N N    . PHE A 1 13  ? 28.175 -15.930 19.395 1.00 42.31 ? 13  PHE A N    4  
ATOM 6529  C CA   . PHE A 1 13  ? 29.633 -15.922 19.410 1.00 4.44  ? 13  PHE A CA   4  
ATOM 6530  C C    . PHE A 1 13  ? 30.172 -16.926 20.425 1.00 1.32  ? 13  PHE A C    4  
ATOM 6531  O O    . PHE A 1 13  ? 29.627 -17.072 21.519 1.00 3.34  ? 13  PHE A O    4  
ATOM 6532  C CB   . PHE A 1 13  ? 30.153 -14.520 19.737 1.00 23.22 ? 13  PHE A CB   4  
ATOM 6533  C CG   . PHE A 1 13  ? 30.217 -13.611 18.543 1.00 24.13 ? 13  PHE A CG   4  
ATOM 6534  C CD1  . PHE A 1 13  ? 29.057 -13.120 17.967 1.00 70.12 ? 13  PHE A CD1  4  
ATOM 6535  C CD2  . PHE A 1 13  ? 31.438 -13.247 17.998 1.00 52.02 ? 13  PHE A CD2  4  
ATOM 6536  C CE1  . PHE A 1 13  ? 29.113 -12.284 16.868 1.00 62.13 ? 13  PHE A CE1  4  
ATOM 6537  C CE2  . PHE A 1 13  ? 31.500 -12.411 16.899 1.00 44.11 ? 13  PHE A CE2  4  
ATOM 6538  C CZ   . PHE A 1 13  ? 30.336 -11.928 16.334 1.00 64.01 ? 13  PHE A CZ   4  
ATOM 6539  H H    . PHE A 1 13  ? 27.687 -15.433 20.085 1.00 52.45 ? 13  PHE A H    4  
ATOM 6540  H HA   . PHE A 1 13  ? 29.976 -16.203 18.427 1.00 70.13 ? 13  PHE A HA   4  
ATOM 6541  H HB2  . PHE A 1 13  ? 29.502 -14.063 20.467 1.00 72.33 ? 13  PHE A HB2  4  
ATOM 6542  H HB3  . PHE A 1 13  ? 31.148 -14.600 20.149 1.00 61.32 ? 13  PHE A HB3  4  
ATOM 6543  H HD1  . PHE A 1 13  ? 28.100 -13.397 18.384 1.00 53.33 ? 13  PHE A HD1  4  
ATOM 6544  H HD2  . PHE A 1 13  ? 32.350 -13.624 18.440 1.00 74.24 ? 13  PHE A HD2  4  
ATOM 6545  H HE1  . PHE A 1 13  ? 28.202 -11.908 16.428 1.00 53.41 ? 13  PHE A HE1  4  
ATOM 6546  H HE2  . PHE A 1 13  ? 32.458 -12.135 16.484 1.00 5.43  ? 13  PHE A HE2  4  
ATOM 6547  H HZ   . PHE A 1 13  ? 30.383 -11.275 15.475 1.00 32.30 ? 13  PHE A HZ   4  
ATOM 6548  N N    . SER A 1 14  ? 31.246 -17.616 20.053 1.00 15.24 ? 14  SER A N    4  
ATOM 6549  C CA   . SER A 1 14  ? 31.856 -18.610 20.928 1.00 2.45  ? 14  SER A CA   4  
ATOM 6550  C C    . SER A 1 14  ? 33.299 -18.883 20.516 1.00 5.11  ? 14  SER A C    4  
ATOM 6551  O O    . SER A 1 14  ? 33.563 -19.341 19.404 1.00 51.40 ? 14  SER A O    4  
ATOM 6552  C CB   . SER A 1 14  ? 31.051 -19.910 20.899 1.00 14.10 ? 14  SER A CB   4  
ATOM 6553  O OG   . SER A 1 14  ? 30.880 -20.374 19.571 1.00 32.11 ? 14  SER A OG   4  
ATOM 6554  H H    . SER A 1 14  ? 31.634 -17.454 19.168 1.00 23.31 ? 14  SER A H    4  
ATOM 6555  H HA   . SER A 1 14  ? 31.850 -18.215 21.934 1.00 51.15 ? 14  SER A HA   4  
ATOM 6556  H HB2  . SER A 1 14  ? 31.571 -20.666 21.468 1.00 52.45 ? 14  SER A HB2  4  
ATOM 6557  H HB3  . SER A 1 14  ? 30.077 -19.737 21.336 1.00 44.05 ? 14  SER A HB3  4  
ATOM 6558  H HG   . SER A 1 14  ? 30.012 -20.118 19.251 1.00 12.32 ? 14  SER A HG   4  
ATOM 6559  N N    . ASP A 1 15  ? 34.230 -18.599 21.420 1.00 2.24  ? 15  ASP A N    4  
ATOM 6560  C CA   . ASP A 1 15  ? 35.647 -18.814 21.153 1.00 64.23 ? 15  ASP A CA   4  
ATOM 6561  C C    . ASP A 1 15  ? 36.100 -18.008 19.939 1.00 10.14 ? 15  ASP A C    4  
ATOM 6562  O O    . ASP A 1 15  ? 36.941 -18.457 19.162 1.00 21.02 ? 15  ASP A O    4  
ATOM 6563  C CB   . ASP A 1 15  ? 35.925 -20.301 20.925 1.00 40.00 ? 15  ASP A CB   4  
ATOM 6564  C CG   . ASP A 1 15  ? 36.051 -21.072 22.224 1.00 23.02 ? 15  ASP A CG   4  
ATOM 6565  O OD1  . ASP A 1 15  ? 37.074 -20.899 22.920 1.00 52.45 ? 15  ASP A OD1  4  
ATOM 6566  O OD2  . ASP A 1 15  ? 35.128 -21.850 22.545 1.00 10.53 ? 15  ASP A OD2  4  
ATOM 6567  H H    . ASP A 1 15  ? 33.957 -18.236 22.289 1.00 24.04 ? 15  ASP A H    4  
ATOM 6568  H HA   . ASP A 1 15  ? 36.202 -18.482 22.017 1.00 24.20 ? 15  ASP A HA   4  
ATOM 6569  H HB2  . ASP A 1 15  ? 35.115 -20.728 20.352 1.00 71.30 ? 15  ASP A HB2  4  
ATOM 6570  H HB3  . ASP A 1 15  ? 36.847 -20.408 20.372 1.00 12.24 ? 15  ASP A HB3  4  
ATOM 6571  N N    . ASN A 1 16  ? 35.535 -16.815 19.784 1.00 72.14 ? 16  ASN A N    4  
ATOM 6572  C CA   . ASN A 1 16  ? 35.879 -15.947 18.664 1.00 50.43 ? 16  ASN A CA   4  
ATOM 6573  C C    . ASN A 1 16  ? 35.475 -16.583 17.337 1.00 31.14 ? 16  ASN A C    4  
ATOM 6574  O O    . ASN A 1 16  ? 36.201 -16.496 16.347 1.00 1.20  ? 16  ASN A O    4  
ATOM 6575  C CB   . ASN A 1 16  ? 37.380 -15.650 18.664 1.00 61.43 ? 16  ASN A CB   4  
ATOM 6576  C CG   . ASN A 1 16  ? 37.926 -15.429 20.061 1.00 13.02 ? 16  ASN A CG   4  
ATOM 6577  O OD1  . ASN A 1 16  ? 37.463 -14.550 20.788 1.00 34.24 ? 16  ASN A OD1  4  
ATOM 6578  N ND2  . ASN A 1 16  ? 38.916 -16.228 20.443 1.00 53.50 ? 16  ASN A ND2  4  
ATOM 6579  H H    . ASN A 1 16  ? 34.870 -16.512 20.437 1.00 42.32 ? 16  ASN A H    4  
ATOM 6580  H HA   . ASN A 1 16  ? 35.338 -15.020 18.785 1.00 63.03 ? 16  ASN A HA   4  
ATOM 6581  H HB2  . ASN A 1 16  ? 37.905 -16.484 18.221 1.00 23.42 ? 16  ASN A HB2  4  
ATOM 6582  H HB3  . ASN A 1 16  ? 37.566 -14.762 18.079 1.00 20.11 ? 16  ASN A HB3  4  
ATOM 6583  H HD21 . ASN A 1 16  ? 39.234 -16.905 19.811 1.00 63.43 ? 16  ASN A HD21 4  
ATOM 6584  H HD22 . ASN A 1 16  ? 39.287 -16.107 21.342 1.00 52.41 ? 16  ASN A HD22 4  
ATOM 6585  N N    . LYS A 1 17  ? 34.311 -17.223 17.325 1.00 33.42 ? 17  LYS A N    4  
ATOM 6586  C CA   . LYS A 1 17  ? 33.807 -17.874 16.121 1.00 1.33  ? 17  LYS A CA   4  
ATOM 6587  C C    . LYS A 1 17  ? 32.308 -17.641 15.964 1.00 51.34 ? 17  LYS A C    4  
ATOM 6588  O O    . LYS A 1 17  ? 31.621 -17.288 16.923 1.00 60.51 ? 17  LYS A O    4  
ATOM 6589  C CB   . LYS A 1 17  ? 34.099 -19.375 16.168 1.00 75.31 ? 17  LYS A CB   4  
ATOM 6590  C CG   . LYS A 1 17  ? 35.482 -19.742 15.660 1.00 61.50 ? 17  LYS A CG   4  
ATOM 6591  C CD   . LYS A 1 17  ? 36.427 -20.070 16.804 1.00 43.32 ? 17  LYS A CD   4  
ATOM 6592  C CE   . LYS A 1 17  ? 37.297 -21.275 16.481 1.00 41.14 ? 17  LYS A CE   4  
ATOM 6593  N NZ   . LYS A 1 17  ? 38.426 -21.418 17.441 1.00 0.22  ? 17  LYS A NZ   4  
ATOM 6594  H H    . LYS A 1 17  ? 33.776 -17.259 18.147 1.00 42.23 ? 17  LYS A H    4  
ATOM 6595  H HA   . LYS A 1 17  ? 34.317 -17.443 15.273 1.00 4.33  ? 17  LYS A HA   4  
ATOM 6596  H HB2  . LYS A 1 17  ? 34.011 -19.715 17.189 1.00 33.33 ? 17  LYS A HB2  4  
ATOM 6597  H HB3  . LYS A 1 17  ? 33.367 -19.891 15.562 1.00 41.30 ? 17  LYS A HB3  4  
ATOM 6598  H HG2  . LYS A 1 17  ? 35.402 -20.605 15.016 1.00 70.35 ? 17  LYS A HG2  4  
ATOM 6599  H HG3  . LYS A 1 17  ? 35.883 -18.909 15.101 1.00 61.03 ? 17  LYS A HG3  4  
ATOM 6600  H HD2  . LYS A 1 17  ? 37.066 -19.218 16.987 1.00 73.31 ? 17  LYS A HD2  4  
ATOM 6601  H HD3  . LYS A 1 17  ? 35.846 -20.283 17.690 1.00 60.33 ? 17  LYS A HD3  4  
ATOM 6602  H HE2  . LYS A 1 17  ? 36.687 -22.164 16.521 1.00 72.12 ? 17  LYS A HE2  4  
ATOM 6603  H HE3  . LYS A 1 17  ? 37.696 -21.157 15.484 1.00 62.21 ? 17  LYS A HE3  4  
ATOM 6604  H HZ1  . LYS A 1 17  ? 38.352 -22.324 17.946 1.00 23.04 ? 17  LYS A HZ1  4  
ATOM 6605  H HZ2  . LYS A 1 17  ? 38.404 -20.644 18.136 1.00 63.23 ? 17  LYS A HZ2  4  
ATOM 6606  H HZ3  . LYS A 1 17  ? 39.333 -21.389 16.934 1.00 42.43 ? 17  LYS A HZ3  4  
ATOM 6607  N N    . ILE A 1 18  ? 31.807 -17.841 14.749 1.00 2.22  ? 18  ILE A N    4  
ATOM 6608  C CA   . ILE A 1 18  ? 30.389 -17.655 14.468 1.00 42.10 ? 18  ILE A CA   4  
ATOM 6609  C C    . ILE A 1 18  ? 29.735 -18.967 14.051 1.00 72.54 ? 18  ILE A C    4  
ATOM 6610  O O    . ILE A 1 18  ? 30.377 -19.832 13.452 1.00 1.52  ? 18  ILE A O    4  
ATOM 6611  C CB   . ILE A 1 18  ? 30.167 -16.609 13.360 1.00 45.42 ? 18  ILE A CB   4  
ATOM 6612  C CG1  . ILE A 1 18  ? 30.941 -15.327 13.676 1.00 12.23 ? 18  ILE A CG1  4  
ATOM 6613  C CG2  . ILE A 1 18  ? 28.684 -16.313 13.200 1.00 52.41 ? 18  ILE A CG2  4  
ATOM 6614  C CD1  . ILE A 1 18  ? 32.324 -15.289 13.065 1.00 52.14 ? 18  ILE A CD1  4  
ATOM 6615  H H    . ILE A 1 18  ? 32.405 -18.121 14.026 1.00 44.14 ? 18  ILE A H    4  
ATOM 6616  H HA   . ILE A 1 18  ? 29.914 -17.299 15.371 1.00 24.52 ? 18  ILE A HA   4  
ATOM 6617  H HB   . ILE A 1 18  ? 30.530 -17.019 12.430 1.00 23.20 ? 18  ILE A HB   4  
ATOM 6618  H HG12 . ILE A 1 18  ? 30.390 -14.479 13.301 1.00 34.21 ? 18  ILE A HG12 4  
ATOM 6619  H HG13 . ILE A 1 18  ? 31.048 -15.236 14.748 1.00 43.44 ? 18  ILE A HG13 4  
ATOM 6620  H HG21 . ILE A 1 18  ? 28.279 -16.922 12.405 1.00 11.32 ? 18  ILE A HG21 4  
ATOM 6621  H HG22 . ILE A 1 18  ? 28.171 -16.539 14.122 1.00 14.15 ? 18  ILE A HG22 4  
ATOM 6622  H HG23 . ILE A 1 18  ? 28.548 -15.269 12.959 1.00 64.25 ? 18  ILE A HG23 4  
ATOM 6623  H HD11 . ILE A 1 18  ? 32.267 -15.580 12.026 1.00 13.40 ? 18  ILE A HD11 4  
ATOM 6624  H HD12 . ILE A 1 18  ? 32.723 -14.289 13.138 1.00 3.12  ? 18  ILE A HD12 4  
ATOM 6625  H HD13 . ILE A 1 18  ? 32.970 -15.974 13.594 1.00 22.40 ? 18  ILE A HD13 4  
ATOM 6626  N N    . LEU A 1 19  ? 28.453 -19.110 14.368 1.00 32.13 ? 19  LEU A N    4  
ATOM 6627  C CA   . LEU A 1 19  ? 27.709 -20.317 14.025 1.00 62.23 ? 19  LEU A CA   4  
ATOM 6628  C C    . LEU A 1 19  ? 27.028 -20.170 12.668 1.00 41.52 ? 19  LEU A C    4  
ATOM 6629  O O    . LEU A 1 19  ? 26.855 -19.058 12.167 1.00 45.24 ? 19  LEU A O    4  
ATOM 6630  C CB   . LEU A 1 19  ? 26.666 -20.621 15.101 1.00 31.13 ? 19  LEU A CB   4  
ATOM 6631  C CG   . LEU A 1 19  ? 25.306 -19.943 14.929 1.00 61.34 ? 19  LEU A CG   4  
ATOM 6632  C CD1  . LEU A 1 19  ? 24.337 -20.410 16.003 1.00 33.24 ? 19  LEU A CD1  4  
ATOM 6633  C CD2  . LEU A 1 19  ? 25.456 -18.429 14.964 1.00 24.55 ? 19  LEU A CD2  4  
ATOM 6634  H H    . LEU A 1 19  ? 27.995 -18.387 14.845 1.00 34.41 ? 19  LEU A H    4  
ATOM 6635  H HA   . LEU A 1 19  ? 28.412 -21.136 13.974 1.00 15.12 ? 19  LEU A HA   4  
ATOM 6636  H HB2  . LEU A 1 19  ? 26.504 -21.688 15.113 1.00 2.11  ? 19  LEU A HB2  4  
ATOM 6637  H HB3  . LEU A 1 19  ? 27.074 -20.310 16.053 1.00 55.13 ? 19  LEU A HB3  4  
ATOM 6638  H HG   . LEU A 1 19  ? 24.894 -20.217 13.967 1.00 43.21 ? 19  LEU A HG   4  
ATOM 6639  H HD11 . LEU A 1 19  ? 24.770 -20.241 16.977 1.00 3.22  ? 19  LEU A HD11 4  
ATOM 6640  H HD12 . LEU A 1 19  ? 24.138 -21.464 15.876 1.00 63.12 ? 19  LEU A HD12 4  
ATOM 6641  H HD13 . LEU A 1 19  ? 23.412 -19.857 15.919 1.00 64.52 ? 19  LEU A HD13 4  
ATOM 6642  H HD21 . LEU A 1 19  ? 25.947 -18.095 14.062 1.00 73.50 ? 19  LEU A HD21 4  
ATOM 6643  H HD22 . LEU A 1 19  ? 26.050 -18.147 15.822 1.00 11.10 ? 19  LEU A HD22 4  
ATOM 6644  H HD23 . LEU A 1 19  ? 24.481 -17.972 15.035 1.00 73.52 ? 19  LEU A HD23 4  
ATOM 6645  N N    . CYS A 1 20  ? 26.642 -21.296 12.080 1.00 72.30 ? 20  CYS A N    4  
ATOM 6646  C CA   . CYS A 1 20  ? 25.978 -21.292 10.781 1.00 32.43 ? 20  CYS A CA   4  
ATOM 6647  C C    . CYS A 1 20  ? 24.762 -22.213 10.790 1.00 55.42 ? 20  CYS A C    4  
ATOM 6648  O O    . CYS A 1 20  ? 24.796 -23.298 11.369 1.00 12.33 ? 20  CYS A O    4  
ATOM 6649  C CB   . CYS A 1 20  ? 26.953 -21.726 9.685  1.00 14.44 ? 20  CYS A CB   4  
ATOM 6650  S SG   . CYS A 1 20  ? 26.155 -22.208 8.136  1.00 31.33 ? 20  CYS A SG   4  
ATOM 6651  H H    . CYS A 1 20  ? 26.807 -22.152 12.529 1.00 1.50  ? 20  CYS A H    4  
ATOM 6652  H HA   . CYS A 1 20  ? 25.649 -20.284 10.581 1.00 43.10 ? 20  CYS A HA   4  
ATOM 6653  H HB2  . CYS A 1 20  ? 27.624 -20.908 9.467  1.00 20.14 ? 20  CYS A HB2  4  
ATOM 6654  H HB3  . CYS A 1 20  ? 27.527 -22.570 10.038 1.00 13.51 ? 20  CYS A HB3  4  
ATOM 6655  H HG   . CYS A 1 20  ? 25.265 -23.150 8.411  1.00 22.01 ? 20  CYS A HG   4  
ATOM 6656  N N    . ALA A 1 21  ? 23.687 -21.771 10.144 1.00 1.34  ? 21  ALA A N    4  
ATOM 6657  C CA   . ALA A 1 21  ? 22.460 -22.555 10.077 1.00 0.53  ? 21  ALA A CA   4  
ATOM 6658  C C    . ALA A 1 21  ? 21.741 -22.336 8.750  1.00 20.34 ? 21  ALA A C    4  
ATOM 6659  O O    . ALA A 1 21  ? 21.365 -21.213 8.416  1.00 34.40 ? 21  ALA A O    4  
ATOM 6660  C CB   . ALA A 1 21  ? 21.544 -22.202 11.240 1.00 3.02  ? 21  ALA A CB   4  
ATOM 6661  H H    . ALA A 1 21  ? 23.721 -20.897 9.702  1.00 61.33 ? 21  ALA A H    4  
ATOM 6662  H HA   . ALA A 1 21  ? 22.726 -23.598 10.164 1.00 74.40 ? 21  ALA A HA   4  
ATOM 6663  H HB1  . ALA A 1 21  ? 20.625 -22.763 11.156 1.00 31.00 ? 21  ALA A HB1  4  
ATOM 6664  H HB2  . ALA A 1 21  ? 22.033 -22.449 12.171 1.00 43.43 ? 21  ALA A HB2  4  
ATOM 6665  H HB3  . ALA A 1 21  ? 21.325 -21.145 11.217 1.00 33.14 ? 21  ALA A HB3  4  
ATOM 6666  N N    . GLN A 1 22  ? 21.555 -23.417 7.999  1.00 52.31 ? 22  GLN A N    4  
ATOM 6667  C CA   . GLN A 1 22  ? 20.882 -23.342 6.707  1.00 10.45 ? 22  GLN A CA   4  
ATOM 6668  C C    . GLN A 1 22  ? 19.474 -23.922 6.793  1.00 41.24 ? 22  GLN A C    4  
ATOM 6669  O O    . GLN A 1 22  ? 19.297 -25.138 6.860  1.00 34.24 ? 22  GLN A O    4  
ATOM 6670  C CB   . GLN A 1 22  ? 21.690 -24.087 5.644  1.00 50.34 ? 22  GLN A CB   4  
ATOM 6671  C CG   . GLN A 1 22  ? 21.187 -23.858 4.227  1.00 24.32 ? 22  GLN A CG   4  
ATOM 6672  C CD   . GLN A 1 22  ? 21.961 -24.658 3.198  1.00 74.45 ? 22  GLN A CD   4  
ATOM 6673  O OE1  . GLN A 1 22  ? 22.928 -25.345 3.527  1.00 44.23 ? 22  GLN A OE1  4  
ATOM 6674  N NE2  . GLN A 1 22  ? 21.537 -24.574 1.942  1.00 75.50 ? 22  GLN A NE2  4  
ATOM 6675  H H    . GLN A 1 22  ? 21.878 -24.284 8.320  1.00 14.30 ? 22  GLN A H    4  
ATOM 6676  H HA   . GLN A 1 22  ? 20.813 -22.301 6.430  1.00 14.31 ? 22  GLN A HA   4  
ATOM 6677  H HB2  . GLN A 1 22  ? 22.718 -23.760 5.695  1.00 31.31 ? 22  GLN A HB2  4  
ATOM 6678  H HB3  . GLN A 1 22  ? 21.646 -25.146 5.851  1.00 11.44 ? 22  GLN A HB3  4  
ATOM 6679  H HG2  . GLN A 1 22  ? 20.148 -24.146 4.177  1.00 73.11 ? 22  GLN A HG2  4  
ATOM 6680  H HG3  . GLN A 1 22  ? 21.281 -22.809 3.991  1.00 40.31 ? 22  GLN A HG3  4  
ATOM 6681  H HE21 . GLN A 1 22  ? 20.759 -24.007 1.753  1.00 4.03  ? 22  GLN A HE21 4  
ATOM 6682  H HE22 . GLN A 1 22  ? 22.018 -25.080 1.256  1.00 61.51 ? 22  GLN A HE22 4  
ATOM 6683  N N    . ARG A 1 23  ? 18.476 -23.044 6.789  1.00 4.21  ? 23  ARG A N    4  
ATOM 6684  C CA   . ARG A 1 23  ? 17.084 -23.469 6.868  1.00 61.24 ? 23  ARG A CA   4  
ATOM 6685  C C    . ARG A 1 23  ? 16.645 -24.134 5.566  1.00 33.34 ? 23  ARG A C    4  
ATOM 6686  O O    . ARG A 1 23  ? 16.404 -25.341 5.525  1.00 53.32 ? 23  ARG A O    4  
ATOM 6687  C CB   . ARG A 1 23  ? 16.180 -22.274 7.172  1.00 12.45 ? 23  ARG A CB   4  
ATOM 6688  C CG   . ARG A 1 23  ? 14.760 -22.664 7.549  1.00 71.23 ? 23  ARG A CG   4  
ATOM 6689  C CD   . ARG A 1 23  ? 14.076 -21.570 8.353  1.00 33.01 ? 23  ARG A CD   4  
ATOM 6690  N NE   . ARG A 1 23  ? 14.436 -21.624 9.767  1.00 12.14 ? 23  ARG A NE   4  
ATOM 6691  C CZ   . ARG A 1 23  ? 13.874 -22.456 10.638 1.00 40.44 ? 23  ARG A CZ   4  
ATOM 6692  N NH1  . ARG A 1 23  ? 12.931 -23.299 10.240 1.00 3.10  ? 23  ARG A NH1  4  
ATOM 6693  N NH2  . ARG A 1 23  ? 14.255 -22.445 11.908 1.00 24.15 ? 23  ARG A NH2  4  
ATOM 6694  H H    . ARG A 1 23  ? 18.681 -22.087 6.733  1.00 23.01 ? 23  ARG A H    4  
ATOM 6695  H HA   . ARG A 1 23  ? 17.001 -24.186 7.670  1.00 31.25 ? 23  ARG A HA   4  
ATOM 6696  H HB2  . ARG A 1 23  ? 16.605 -21.715 7.993  1.00 23.13 ? 23  ARG A HB2  4  
ATOM 6697  H HB3  . ARG A 1 23  ? 16.136 -21.639 6.300  1.00 23.12 ? 23  ARG A HB3  4  
ATOM 6698  H HG2  . ARG A 1 23  ? 14.193 -22.840 6.646  1.00 44.40 ? 23  ARG A HG2  4  
ATOM 6699  H HG3  . ARG A 1 23  ? 14.790 -23.568 8.139  1.00 73.13 ? 23  ARG A HG3  4  
ATOM 6700  H HD2  . ARG A 1 23  ? 14.369 -20.611 7.953  1.00 11.22 ? 23  ARG A HD2  4  
ATOM 6701  H HD3  . ARG A 1 23  ? 13.007 -21.688 8.258  1.00 15.43 ? 23  ARG A HD3  4  
ATOM 6702  H HE   . ARG A 1 23  ? 15.130 -21.009 10.083 1.00 63.34 ? 23  ARG A HE   4  
ATOM 6703  H HH11 . ARG A 1 23  ? 12.643 -23.310 9.283  1.00 53.21 ? 23  ARG A HH11 4  
ATOM 6704  H HH12 . ARG A 1 23  ? 12.511 -23.925 10.897 1.00 32.01 ? 23  ARG A HH12 4  
ATOM 6705  H HH21 . ARG A 1 23  ? 14.966 -21.811 12.212 1.00 51.12 ? 23  ARG A HH21 4  
ATOM 6706  H HH22 . ARG A 1 23  ? 13.832 -23.071 12.562 1.00 21.15 ? 23  ARG A HH22 4  
ATOM 6707  N N    . SER A 1 24  ? 16.542 -23.339 4.506  1.00 1.25  ? 24  SER A N    4  
ATOM 6708  C CA   . SER A 1 24  ? 16.127 -23.849 3.205  1.00 65.20 ? 24  SER A CA   4  
ATOM 6709  C C    . SER A 1 24  ? 16.545 -22.896 2.089  1.00 11.24 ? 24  SER A C    4  
ATOM 6710  O O    . SER A 1 24  ? 17.305 -21.955 2.315  1.00 11.14 ? 24  SER A O    4  
ATOM 6711  C CB   . SER A 1 24  ? 14.612 -24.056 3.174  1.00 70.20 ? 24  SER A CB   4  
ATOM 6712  O OG   . SER A 1 24  ? 14.071 -24.060 4.484  1.00 51.13 ? 24  SER A OG   4  
ATOM 6713  H H    . SER A 1 24  ? 16.748 -22.385 4.603  1.00 30.31 ? 24  SER A H    4  
ATOM 6714  H HA   . SER A 1 24  ? 16.615 -24.800 3.051  1.00 24.21 ? 24  SER A HA   4  
ATOM 6715  H HB2  . SER A 1 24  ? 14.154 -23.258 2.610  1.00 14.15 ? 24  SER A HB2  4  
ATOM 6716  H HB3  . SER A 1 24  ? 14.390 -25.003 2.703  1.00 64.02 ? 24  SER A HB3  4  
ATOM 6717  H HG   . SER A 1 24  ? 13.641 -23.219 4.655  1.00 4.42  ? 24  SER A HG   4  
ATOM 6718  N N    . GLU A 1 25  ? 16.041 -23.148 0.885  1.00 4.41  ? 25  GLU A N    4  
ATOM 6719  C CA   . GLU A 1 25  ? 16.363 -22.312 -0.266 1.00 74.32 ? 25  GLU A CA   4  
ATOM 6720  C C    . GLU A 1 25  ? 15.564 -21.012 -0.235 1.00 72.52 ? 25  GLU A C    4  
ATOM 6721  O O    . GLU A 1 25  ? 15.680 -20.177 -1.132 1.00 4.22  ? 25  GLU A O    4  
ATOM 6722  C CB   . GLU A 1 25  ? 16.079 -23.067 -1.567 1.00 2.02  ? 25  GLU A CB   4  
ATOM 6723  C CG   . GLU A 1 25  ? 16.758 -22.460 -2.783 1.00 54.42 ? 25  GLU A CG   4  
ATOM 6724  C CD   . GLU A 1 25  ? 16.743 -23.387 -3.983 1.00 52.41 ? 25  GLU A CD   4  
ATOM 6725  O OE1  . GLU A 1 25  ? 17.485 -23.118 -4.950 1.00 64.03 ? 25  GLU A OE1  4  
ATOM 6726  O OE2  . GLU A 1 25  ? 15.988 -24.381 -3.954 1.00 71.22 ? 25  GLU A OE2  4  
ATOM 6727  H H    . GLU A 1 25  ? 15.441 -23.913 0.768  1.00 13.11 ? 25  GLU A H    4  
ATOM 6728  H HA   . GLU A 1 25  ? 17.415 -22.075 -0.221 1.00 33.13 ? 25  GLU A HA   4  
ATOM 6729  H HB2  . GLU A 1 25  ? 16.422 -24.086 -1.460 1.00 12.31 ? 25  GLU A HB2  4  
ATOM 6730  H HB3  . GLU A 1 25  ? 15.013 -23.072 -1.741 1.00 3.15  ? 25  GLU A HB3  4  
ATOM 6731  H HG2  . GLU A 1 25  ? 16.245 -21.547 -3.047 1.00 3.41  ? 25  GLU A HG2  4  
ATOM 6732  H HG3  . GLU A 1 25  ? 17.784 -22.235 -2.533 1.00 21.44 ? 25  GLU A HG3  4  
ATOM 6733  N N    . LYS A 1 26  ? 14.751 -20.849 0.803  1.00 22.13 ? 26  LYS A N    4  
ATOM 6734  C CA   . LYS A 1 26  ? 13.932 -19.652 0.954  1.00 64.11 ? 26  LYS A CA   4  
ATOM 6735  C C    . LYS A 1 26  ? 14.781 -18.465 1.400  1.00 35.43 ? 26  LYS A C    4  
ATOM 6736  O O    . LYS A 1 26  ? 14.628 -17.355 0.892  1.00 72.44 ? 26  LYS A O    4  
ATOM 6737  C CB   . LYS A 1 26  ? 12.811 -19.900 1.965  1.00 30.22 ? 26  LYS A CB   4  
ATOM 6738  C CG   . LYS A 1 26  ? 11.731 -20.840 1.458  1.00 64.52 ? 26  LYS A CG   4  
ATOM 6739  C CD   . LYS A 1 26  ? 10.884 -20.187 0.379  1.00 2.52  ? 26  LYS A CD   4  
ATOM 6740  C CE   . LYS A 1 26  ? 9.775  -19.337 0.980  1.00 32.24 ? 26  LYS A CE   4  
ATOM 6741  N NZ   . LYS A 1 26  ? 8.616  -20.165 1.415  1.00 72.34 ? 26  LYS A NZ   4  
ATOM 6742  H H    . LYS A 1 26  ? 14.702 -21.551 1.486  1.00 34.13 ? 26  LYS A H    4  
ATOM 6743  H HA   . LYS A 1 26  ? 13.496 -19.426 -0.007 1.00 13.21 ? 26  LYS A HA   4  
ATOM 6744  H HB2  . LYS A 1 26  ? 13.238 -20.326 2.861  1.00 1.12  ? 26  LYS A HB2  4  
ATOM 6745  H HB3  . LYS A 1 26  ? 12.349 -18.955 2.211  1.00 11.22 ? 26  LYS A HB3  4  
ATOM 6746  H HG2  . LYS A 1 26  ? 12.199 -21.723 1.047  1.00 1.02  ? 26  LYS A HG2  4  
ATOM 6747  H HG3  . LYS A 1 26  ? 11.093 -21.120 2.284  1.00 22.30 ? 26  LYS A HG3  4  
ATOM 6748  H HD2  . LYS A 1 26  ? 11.515 -19.556 -0.229 1.00 41.23 ? 26  LYS A HD2  4  
ATOM 6749  H HD3  . LYS A 1 26  ? 10.442 -20.958 -0.236 1.00 43.41 ? 26  LYS A HD3  4  
ATOM 6750  H HE2  . LYS A 1 26  ? 10.168 -18.807 1.834  1.00 34.34 ? 26  LYS A HE2  4  
ATOM 6751  H HE3  . LYS A 1 26  ? 9.441  -18.627 0.238  1.00 1.13  ? 26  LYS A HE3  4  
ATOM 6752  H HZ1  . LYS A 1 26  ? 8.604  -20.246 2.452  1.00 74.45 ? 26  LYS A HZ1  4  
ATOM 6753  H HZ2  . LYS A 1 26  ? 8.684  -21.118 1.005  1.00 61.53 ? 26  LYS A HZ2  4  
ATOM 6754  H HZ3  . LYS A 1 26  ? 7.726  -19.728 1.101  1.00 2.52  ? 26  LYS A HZ3  4  
ATOM 6755  N N    . MET A 1 27  ? 15.675 -18.708 2.353  1.00 61.32 ? 27  MET A N    4  
ATOM 6756  C CA   . MET A 1 27  ? 16.549 -17.659 2.865  1.00 62.30 ? 27  MET A CA   4  
ATOM 6757  C C    . MET A 1 27  ? 17.400 -17.066 1.746  1.00 32.14 ? 27  MET A C    4  
ATOM 6758  O O    . MET A 1 27  ? 17.237 -17.416 0.578  1.00 70.44 ? 27  MET A O    4  
ATOM 6759  C CB   . MET A 1 27  ? 17.452 -18.212 3.969  1.00 31.35 ? 27  MET A CB   4  
ATOM 6760  C CG   . MET A 1 27  ? 16.858 -18.080 5.363  1.00 63.14 ? 27  MET A CG   4  
ATOM 6761  S SD   . MET A 1 27  ? 15.315 -18.994 5.550  1.00 41.43 ? 27  MET A SD   4  
ATOM 6762  C CE   . MET A 1 27  ? 14.116 -17.691 5.280  1.00 33.01 ? 27  MET A CE   4  
ATOM 6763  H H    . MET A 1 27  ? 15.750 -19.614 2.720  1.00 63.04 ? 27  MET A H    4  
ATOM 6764  H HA   . MET A 1 27  ? 15.925 -16.881 3.278  1.00 24.13 ? 27  MET A HA   4  
ATOM 6765  H HB2  . MET A 1 27  ? 17.636 -19.259 3.778  1.00 54.13 ? 27  MET A HB2  4  
ATOM 6766  H HB3  . MET A 1 27  ? 18.392 -17.681 3.951  1.00 54.45 ? 27  MET A HB3  4  
ATOM 6767  H HG2  . MET A 1 27  ? 17.571 -18.456 6.081  1.00 64.31 ? 27  MET A HG2  4  
ATOM 6768  H HG3  . MET A 1 27  ? 16.669 -17.035 5.560  1.00 31.30 ? 27  MET A HG3  4  
ATOM 6769  H HE1  . MET A 1 27  ? 13.367 -17.724 6.058  1.00 62.11 ? 27  MET A HE1  4  
ATOM 6770  H HE2  . MET A 1 27  ? 14.614 -16.733 5.301  1.00 62.34 ? 27  MET A HE2  4  
ATOM 6771  H HE3  . MET A 1 27  ? 13.643 -17.831 4.319  1.00 73.01 ? 27  MET A HE3  4  
ATOM 6772  N N    . SER A 1 28  ? 18.307 -16.166 2.112  1.00 31.14 ? 28  SER A N    4  
ATOM 6773  C CA   . SER A 1 28  ? 19.180 -15.521 1.139  1.00 62.42 ? 28  SER A CA   4  
ATOM 6774  C C    . SER A 1 28  ? 20.443 -16.347 0.911  1.00 11.21 ? 28  SER A C    4  
ATOM 6775  O O    . SER A 1 28  ? 21.155 -16.688 1.857  1.00 73.13 ? 28  SER A O    4  
ATOM 6776  C CB   . SER A 1 28  ? 19.555 -14.115 1.611  1.00 73.14 ? 28  SER A CB   4  
ATOM 6777  O OG   . SER A 1 28  ? 18.686 -13.143 1.056  1.00 40.33 ? 28  SER A OG   4  
ATOM 6778  H H    . SER A 1 28  ? 18.389 -15.928 3.060  1.00 72.51 ? 28  SER A H    4  
ATOM 6779  H HA   . SER A 1 28  ? 18.640 -15.447 0.207  1.00 71.12 ? 28  SER A HA   4  
ATOM 6780  H HB2  . SER A 1 28  ? 19.486 -14.069 2.687  1.00 62.02 ? 28  SER A HB2  4  
ATOM 6781  H HB3  . SER A 1 28  ? 20.567 -13.893 1.304  1.00 31.33 ? 28  SER A HB3  4  
ATOM 6782  H HG   . SER A 1 28  ? 19.137 -12.296 1.016  1.00 15.12 ? 28  SER A HG   4  
ATOM 6783  N N    . LEU A 1 29  ? 20.715 -16.665 -0.350 1.00 12.42 ? 29  LEU A N    4  
ATOM 6784  C CA   . LEU A 1 29  ? 21.892 -17.450 -0.704 1.00 32.40 ? 29  LEU A CA   4  
ATOM 6785  C C    . LEU A 1 29  ? 22.214 -18.470 0.384  1.00 54.10 ? 29  LEU A C    4  
ATOM 6786  O O    . LEU A 1 29  ? 23.337 -18.551 0.881  1.00 42.53 ? 29  LEU A O    4  
ATOM 6787  C CB   . LEU A 1 29  ? 23.094 -16.532 -0.929 1.00 52.54 ? 29  LEU A CB   4  
ATOM 6788  C CG   . LEU A 1 29  ? 22.863 -15.341 -1.861 1.00 2.13  ? 29  LEU A CG   4  
ATOM 6789  C CD1  . LEU A 1 29  ? 23.564 -14.102 -1.327 1.00 5.34  ? 29  LEU A CD1  4  
ATOM 6790  C CD2  . LEU A 1 29  ? 23.344 -15.663 -3.268 1.00 24.51 ? 29  LEU A CD2  4  
ATOM 6791  H H    . LEU A 1 29  ? 20.111 -16.364 -1.060 1.00 33.30 ? 29  LEU A H    4  
ATOM 6792  H HA   . LEU A 1 29  ? 21.675 -17.977 -1.621 1.00 74.22 ? 29  LEU A HA   4  
ATOM 6793  H HB2  . LEU A 1 29  ? 23.399 -16.146 0.031  1.00 45.52 ? 29  LEU A HB2  4  
ATOM 6794  H HB3  . LEU A 1 29  ? 23.892 -17.129 -1.346 1.00 62.11 ? 29  LEU A HB3  4  
ATOM 6795  H HG   . LEU A 1 29  ? 21.804 -15.130 -1.909 1.00 12.51 ? 29  LEU A HG   4  
ATOM 6796  H HD11 . LEU A 1 29  ? 23.617 -14.154 -0.250 1.00 11.13 ? 29  LEU A HD11 4  
ATOM 6797  H HD12 . LEU A 1 29  ? 23.011 -13.221 -1.618 1.00 21.31 ? 29  LEU A HD12 4  
ATOM 6798  H HD13 . LEU A 1 29  ? 24.563 -14.050 -1.734 1.00 45.34 ? 29  LEU A HD13 4  
ATOM 6799  H HD21 . LEU A 1 29  ? 24.114 -16.420 -3.220 1.00 50.31 ? 29  LEU A HD21 4  
ATOM 6800  H HD22 . LEU A 1 29  ? 23.746 -14.770 -3.725 1.00 34.24 ? 29  LEU A HD22 4  
ATOM 6801  H HD23 . LEU A 1 29  ? 22.516 -16.029 -3.857 1.00 2.24  ? 29  LEU A HD23 4  
ATOM 6802  N N    . PRO A 1 30  ? 21.205 -19.269 0.763  1.00 65.52 ? 30  PRO A N    4  
ATOM 6803  C CA   . PRO A 1 30  ? 21.357 -20.300 1.794  1.00 64.52 ? 30  PRO A CA   4  
ATOM 6804  C C    . PRO A 1 30  ? 22.232 -21.460 1.330  1.00 44.23 ? 30  PRO A C    4  
ATOM 6805  O O    . PRO A 1 30  ? 22.837 -22.159 2.144  1.00 64.05 ? 30  PRO A O    4  
ATOM 6806  C CB   . PRO A 1 30  ? 19.922 -20.776 2.034  1.00 65.22 ? 30  PRO A CB   4  
ATOM 6807  C CG   . PRO A 1 30  ? 19.207 -20.478 0.762  1.00 54.21 ? 30  PRO A CG   4  
ATOM 6808  C CD   . PRO A 1 30  ? 19.840 -19.229 0.214  1.00 52.05 ? 30  PRO A CD   4  
ATOM 6809  H HA   . PRO A 1 30  ? 21.760 -19.891 2.708  1.00 3.44  ? 30  PRO A HA   4  
ATOM 6810  H HB2  . PRO A 1 30  ? 19.923 -21.836 2.249  1.00 40.33 ? 30  PRO A HB2  4  
ATOM 6811  H HB3  . PRO A 1 30  ? 19.494 -20.235 2.864  1.00 60.10 ? 30  PRO A HB3  4  
ATOM 6812  H HG2  . PRO A 1 30  ? 19.331 -21.296 0.070  1.00 62.54 ? 30  PRO A HG2  4  
ATOM 6813  H HG3  . PRO A 1 30  ? 18.159 -20.310 0.962  1.00 53.54 ? 30  PRO A HG3  4  
ATOM 6814  H HD2  . PRO A 1 30  ? 19.857 -19.257 -0.866 1.00 23.41 ? 30  PRO A HD2  4  
ATOM 6815  H HD3  . PRO A 1 30  ? 19.311 -18.354 0.561  1.00 11.23 ? 30  PRO A HD3  4  
ATOM 6816  N N    . LEU A 1 31  ? 22.296 -21.659 0.018  1.00 51.42 ? 31  LEU A N    4  
ATOM 6817  C CA   . LEU A 1 31  ? 23.098 -22.734 -0.555 1.00 42.12 ? 31  LEU A CA   4  
ATOM 6818  C C    . LEU A 1 31  ? 24.560 -22.603 -0.140 1.00 42.13 ? 31  LEU A C    4  
ATOM 6819  O O    . LEU A 1 31  ? 25.286 -23.594 -0.069 1.00 44.21 ? 31  LEU A O    4  
ATOM 6820  C CB   . LEU A 1 31  ? 22.986 -22.723 -2.081 1.00 23.13 ? 31  LEU A CB   4  
ATOM 6821  C CG   . LEU A 1 31  ? 21.583 -22.510 -2.649 1.00 72.32 ? 31  LEU A CG   4  
ATOM 6822  C CD1  . LEU A 1 31  ? 21.557 -21.297 -3.566 1.00 74.53 ? 31  LEU A CD1  4  
ATOM 6823  C CD2  . LEU A 1 31  ? 21.114 -23.753 -3.392 1.00 22.11 ? 31  LEU A CD2  4  
ATOM 6824  H H    . LEU A 1 31  ? 21.792 -21.069 -0.581 1.00 30.14 ? 31  LEU A H    4  
ATOM 6825  H HA   . LEU A 1 31  ? 22.713 -23.670 -0.181 1.00 32.44 ? 31  LEU A HA   4  
ATOM 6826  H HB2  . LEU A 1 31  ? 23.617 -21.931 -2.453 1.00 1.41  ? 31  LEU A HB2  4  
ATOM 6827  H HB3  . LEU A 1 31  ? 23.352 -23.673 -2.445 1.00 15.10 ? 31  LEU A HB3  4  
ATOM 6828  H HG   . LEU A 1 31  ? 20.895 -22.327 -1.835 1.00 23.22 ? 31  LEU A HG   4  
ATOM 6829  H HD11 . LEU A 1 31  ? 22.377 -21.357 -4.265 1.00 2.20  ? 31  LEU A HD11 4  
ATOM 6830  H HD12 . LEU A 1 31  ? 21.650 -20.398 -2.976 1.00 44.11 ? 31  LEU A HD12 4  
ATOM 6831  H HD13 . LEU A 1 31  ? 20.622 -21.276 -4.108 1.00 63.21 ? 31  LEU A HD13 4  
ATOM 6832  H HD21 . LEU A 1 31  ? 20.082 -23.953 -3.143 1.00 25.12 ? 31  LEU A HD21 4  
ATOM 6833  H HD22 . LEU A 1 31  ? 21.724 -24.597 -3.103 1.00 2.34  ? 31  LEU A HD22 4  
ATOM 6834  H HD23 . LEU A 1 31  ? 21.203 -23.592 -4.456 1.00 3.42  ? 31  LEU A HD23 4  
ATOM 6835  N N    . MET A 1 32  ? 24.984 -21.374 0.134  1.00 1.45  ? 32  MET A N    4  
ATOM 6836  C CA   . MET A 1 32  ? 26.359 -21.114 0.546  1.00 12.10 ? 32  MET A CA   4  
ATOM 6837  C C    . MET A 1 32  ? 26.435 -20.836 2.044  1.00 55.41 ? 32  MET A C    4  
ATOM 6838  O O    . MET A 1 32  ? 27.254 -21.420 2.752  1.00 4.22  ? 32  MET A O    4  
ATOM 6839  C CB   . MET A 1 32  ? 26.932 -19.929 -0.234 1.00 62.43 ? 32  MET A CB   4  
ATOM 6840  C CG   . MET A 1 32  ? 26.027 -18.708 -0.237 1.00 22.12 ? 32  MET A CG   4  
ATOM 6841  S SD   . MET A 1 32  ? 26.652 -17.383 -1.288 1.00 73.13 ? 32  MET A SD   4  
ATOM 6842  C CE   . MET A 1 32  ? 26.328 -15.953 -0.259 1.00 72.24 ? 32  MET A CE   4  
ATOM 6843  H H    . MET A 1 32  ? 24.358 -20.623 0.060  1.00 61.22 ? 32  MET A H    4  
ATOM 6844  H HA   . MET A 1 32  ? 26.942 -21.995 0.325  1.00 4.05  ? 32  MET A HA   4  
ATOM 6845  H HB2  . MET A 1 32  ? 27.878 -19.649 0.204  1.00 2.10  ? 32  MET A HB2  4  
ATOM 6846  H HB3  . MET A 1 32  ? 27.094 -20.232 -1.258 1.00 63.10 ? 32  MET A HB3  4  
ATOM 6847  H HG2  . MET A 1 32  ? 25.051 -19.000 -0.593 1.00 73.32 ? 32  MET A HG2  4  
ATOM 6848  H HG3  . MET A 1 32  ? 25.943 -18.338 0.774  1.00 1.02  ? 32  MET A HG3  4  
ATOM 6849  H HE1  . MET A 1 32  ? 27.223 -15.690 0.283  1.00 5.43  ? 32  MET A HE1  4  
ATOM 6850  H HE2  . MET A 1 32  ? 26.026 -15.124 -0.881 1.00 42.43 ? 32  MET A HE2  4  
ATOM 6851  H HE3  . MET A 1 32  ? 25.538 -16.185 0.440  1.00 31.34 ? 32  MET A HE3  4  
ATOM 6852  N N    . TRP A 1 33  ? 25.576 -19.941 2.519  1.00 53.23 ? 33  TRP A N    4  
ATOM 6853  C CA   . TRP A 1 33  ? 25.546 -19.585 3.933  1.00 64.40 ? 33  TRP A CA   4  
ATOM 6854  C C    . TRP A 1 33  ? 24.195 -18.993 4.317  1.00 22.05 ? 33  TRP A C    4  
ATOM 6855  O O    . TRP A 1 33  ? 23.435 -18.551 3.457  1.00 13.22 ? 33  TRP A O    4  
ATOM 6856  C CB   . TRP A 1 33  ? 26.663 -18.590 4.253  1.00 21.42 ? 33  TRP A CB   4  
ATOM 6857  C CG   . TRP A 1 33  ? 28.035 -19.187 4.161  1.00 71.14 ? 33  TRP A CG   4  
ATOM 6858  C CD1  . TRP A 1 33  ? 28.879 -19.139 3.088  1.00 0.41  ? 33  TRP A CD1  4  
ATOM 6859  C CD2  . TRP A 1 33  ? 28.720 -19.923 5.180  1.00 73.32 ? 33  TRP A CD2  4  
ATOM 6860  N NE1  . TRP A 1 33  ? 30.047 -19.800 3.379  1.00 25.53 ? 33  TRP A NE1  4  
ATOM 6861  C CE2  . TRP A 1 33  ? 29.975 -20.290 4.656  1.00 21.15 ? 33  TRP A CE2  4  
ATOM 6862  C CE3  . TRP A 1 33  ? 28.396 -20.307 6.484  1.00 53.40 ? 33  TRP A CE3  4  
ATOM 6863  C CZ2  . TRP A 1 33  ? 30.903 -21.022 5.393  1.00 50.13 ? 33  TRP A CZ2  4  
ATOM 6864  C CZ3  . TRP A 1 33  ? 29.318 -21.033 7.213  1.00 33.12 ? 33  TRP A CZ3  4  
ATOM 6865  C CH2  . TRP A 1 33  ? 30.559 -21.384 6.667  1.00 44.02 ? 33  TRP A CH2  4  
ATOM 6866  H H    . TRP A 1 33  ? 24.946 -19.509 1.904  1.00 41.40 ? 33  TRP A H    4  
ATOM 6867  H HA   . TRP A 1 33  ? 25.706 -20.488 4.504  1.00 23.10 ? 33  TRP A HA   4  
ATOM 6868  H HB2  . TRP A 1 33  ? 26.611 -17.765 3.559  1.00 2.12  ? 33  TRP A HB2  4  
ATOM 6869  H HB3  . TRP A 1 33  ? 26.527 -18.220 5.259  1.00 41.31 ? 33  TRP A HB3  4  
ATOM 6870  H HD1  . TRP A 1 33  ? 28.648 -18.650 2.154  1.00 12.10 ? 33  TRP A HD1  4  
ATOM 6871  H HE1  . TRP A 1 33  ? 30.809 -19.903 2.771  1.00 25.30 ? 33  TRP A HE1  4  
ATOM 6872  H HE3  . TRP A 1 33  ? 27.444 -20.046 6.923  1.00 51.44 ? 33  TRP A HE3  4  
ATOM 6873  H HZ2  . TRP A 1 33  ? 31.864 -21.300 4.986  1.00 45.51 ? 33  TRP A HZ2  4  
ATOM 6874  H HZ3  . TRP A 1 33  ? 29.085 -21.339 8.223  1.00 54.43 ? 33  TRP A HZ3  4  
ATOM 6875  H HH2  . TRP A 1 33  ? 31.248 -21.952 7.272  1.00 23.14 ? 33  TRP A HH2  4  
ATOM 6876  N N    . GLU A 1 34  ? 23.903 -18.988 5.614  1.00 5.45  ? 34  GLU A N    4  
ATOM 6877  C CA   . GLU A 1 34  ? 22.642 -18.449 6.111  1.00 65.31 ? 34  GLU A CA   4  
ATOM 6878  C C    . GLU A 1 34  ? 22.598 -18.486 7.636  1.00 42.21 ? 34  GLU A C    4  
ATOM 6879  O O    . GLU A 1 34  ? 23.174 -19.375 8.264  1.00 41.52 ? 34  GLU A O    4  
ATOM 6880  C CB   . GLU A 1 34  ? 21.464 -19.239 5.537  1.00 41.55 ? 34  GLU A CB   4  
ATOM 6881  C CG   . GLU A 1 34  ? 20.123 -18.852 6.136  1.00 33.35 ? 34  GLU A CG   4  
ATOM 6882  C CD   . GLU A 1 34  ? 19.813 -17.377 5.972  1.00 70.12 ? 34  GLU A CD   4  
ATOM 6883  O OE1  . GLU A 1 34  ? 20.299 -16.774 4.993  1.00 44.22 ? 34  GLU A OE1  4  
ATOM 6884  O OE2  . GLU A 1 34  ? 19.083 -16.826 6.823  1.00 64.12 ? 34  GLU A OE2  4  
ATOM 6885  H H    . GLU A 1 34  ? 24.551 -19.354 6.252  1.00 70.50 ? 34  GLU A H    4  
ATOM 6886  H HA   . GLU A 1 34  ? 22.569 -17.423 5.785  1.00 10.23 ? 34  GLU A HA   4  
ATOM 6887  H HB2  . GLU A 1 34  ? 21.420 -19.072 4.470  1.00 3.23  ? 34  GLU A HB2  4  
ATOM 6888  H HB3  . GLU A 1 34  ? 21.627 -20.290 5.721  1.00 65.14 ? 34  GLU A HB3  4  
ATOM 6889  H HG2  . GLU A 1 34  ? 19.347 -19.424 5.649  1.00 12.42 ? 34  GLU A HG2  4  
ATOM 6890  H HG3  . GLU A 1 34  ? 20.133 -19.088 7.191  1.00 40.54 ? 34  GLU A HG3  4  
ATOM 6891  N N    . PHE A 1 35  ? 21.911 -17.513 8.225  1.00 33.23 ? 35  PHE A N    4  
ATOM 6892  C CA   . PHE A 1 35  ? 21.792 -17.432 9.676  1.00 32.14 ? 35  PHE A CA   4  
ATOM 6893  C C    . PHE A 1 35  ? 20.397 -17.850 10.132 1.00 12.10 ? 35  PHE A C    4  
ATOM 6894  O O    . PHE A 1 35  ? 19.424 -17.779 9.381  1.00 32.40 ? 35  PHE A O    4  
ATOM 6895  C CB   . PHE A 1 35  ? 22.092 -16.010 10.155 1.00 25.33 ? 35  PHE A CB   4  
ATOM 6896  C CG   . PHE A 1 35  ? 23.558 -15.735 10.334 1.00 63.25 ? 35  PHE A CG   4  
ATOM 6897  C CD1  . PHE A 1 35  ? 24.177 -14.717 9.626  1.00 73.23 ? 35  PHE A CD1  4  
ATOM 6898  C CD2  . PHE A 1 35  ? 24.318 -16.495 11.209 1.00 51.15 ? 35  PHE A CD2  4  
ATOM 6899  C CE1  . PHE A 1 35  ? 25.525 -14.461 9.788  1.00 63.15 ? 35  PHE A CE1  4  
ATOM 6900  C CE2  . PHE A 1 35  ? 25.667 -16.243 11.375 1.00 74.22 ? 35  PHE A CE2  4  
ATOM 6901  C CZ   . PHE A 1 35  ? 26.271 -15.226 10.663 1.00 43.14 ? 35  PHE A CZ   4  
ATOM 6902  H H    . PHE A 1 35  ? 21.473 -16.833 7.671  1.00 63.22 ? 35  PHE A H    4  
ATOM 6903  H HA   . PHE A 1 35  ? 22.515 -18.108 10.106 1.00 42.13 ? 35  PHE A HA   4  
ATOM 6904  H HB2  . PHE A 1 35  ? 21.709 -15.306 9.433  1.00 52.03 ? 35  PHE A HB2  4  
ATOM 6905  H HB3  . PHE A 1 35  ? 21.605 -15.848 11.105 1.00 41.43 ? 35  PHE A HB3  4  
ATOM 6906  H HD1  . PHE A 1 35  ? 23.594 -14.118 8.940  1.00 35.22 ? 35  PHE A HD1  4  
ATOM 6907  H HD2  . PHE A 1 35  ? 23.847 -17.292 11.765 1.00 12.54 ? 35  PHE A HD2  4  
ATOM 6908  H HE1  . PHE A 1 35  ? 25.995 -13.665 9.229  1.00 54.11 ? 35  PHE A HE1  4  
ATOM 6909  H HE2  . PHE A 1 35  ? 26.248 -16.843 12.059 1.00 12.24 ? 35  PHE A HE2  4  
ATOM 6910  H HZ   . PHE A 1 35  ? 27.325 -15.027 10.791 1.00 32.21 ? 35  PHE A HZ   4  
ATOM 6911  N N    . PRO A 1 36  ? 20.296 -18.297 11.393 1.00 52.23 ? 36  PRO A N    4  
ATOM 6912  C CA   . PRO A 1 36  ? 19.025 -18.735 11.978 1.00 62.23 ? 36  PRO A CA   4  
ATOM 6913  C C    . PRO A 1 36  ? 18.062 -17.575 12.208 1.00 62.52 ? 36  PRO A C    4  
ATOM 6914  O O    . PRO A 1 36  ? 18.433 -16.411 12.070 1.00 45.23 ? 36  PRO A O    4  
ATOM 6915  C CB   . PRO A 1 36  ? 19.445 -19.355 13.313 1.00 14.21 ? 36  PRO A CB   4  
ATOM 6916  C CG   . PRO A 1 36  ? 20.730 -18.684 13.655 1.00 63.34 ? 36  PRO A CG   4  
ATOM 6917  C CD   . PRO A 1 36  ? 21.414 -18.408 12.344 1.00 1.12  ? 36  PRO A CD   4  
ATOM 6918  H HA   . PRO A 1 36  ? 18.545 -19.485 11.366 1.00 14.22 ? 36  PRO A HA   4  
ATOM 6919  H HB2  . PRO A 1 36  ? 18.686 -19.159 14.058 1.00 71.03 ? 36  PRO A HB2  4  
ATOM 6920  H HB3  . PRO A 1 36  ? 19.574 -20.420 13.195 1.00 64.02 ? 36  PRO A HB3  4  
ATOM 6921  H HG2  . PRO A 1 36  ? 20.535 -17.761 14.178 1.00 42.30 ? 36  PRO A HG2  4  
ATOM 6922  H HG3  . PRO A 1 36  ? 21.336 -19.341 14.262 1.00 42.42 ? 36  PRO A HG3  4  
ATOM 6923  H HD2  . PRO A 1 36  ? 21.970 -17.483 12.396 1.00 34.31 ? 36  PRO A HD2  4  
ATOM 6924  H HD3  . PRO A 1 36  ? 22.066 -19.227 12.078 1.00 34.33 ? 36  PRO A HD3  4  
ATOM 6925  N N    . GLY A 1 37  ? 16.822 -17.902 12.560 1.00 24.40 ? 37  GLY A N    4  
ATOM 6926  C CA   . GLY A 1 37  ? 15.825 -16.876 12.804 1.00 65.41 ? 37  GLY A CA   4  
ATOM 6927  C C    . GLY A 1 37  ? 14.539 -17.126 12.042 1.00 13.44 ? 37  GLY A C    4  
ATOM 6928  O O    . GLY A 1 37  ? 14.421 -18.110 11.315 1.00 73.35 ? 37  GLY A O    4  
ATOM 6929  H H    . GLY A 1 37  ? 16.583 -18.848 12.655 1.00 72.10 ? 37  GLY A H    4  
ATOM 6930  H HA2  . GLY A 1 37  ? 15.606 -16.847 13.861 1.00 43.22 ? 37  GLY A HA2  4  
ATOM 6931  H HA3  . GLY A 1 37  ? 16.229 -15.920 12.503 1.00 35.41 ? 37  GLY A HA3  4  
ATOM 6932  N N    . GLY A 1 38  ? 13.570 -16.231 12.212 1.00 53.25 ? 38  GLY A N    4  
ATOM 6933  C CA   . GLY A 1 38  ? 12.297 -16.378 11.529 1.00 3.54  ? 38  GLY A CA   4  
ATOM 6934  C C    . GLY A 1 38  ? 11.671 -15.043 11.177 1.00 11.24 ? 38  GLY A C    4  
ATOM 6935  O O    . GLY A 1 38  ? 12.229 -14.273 10.396 1.00 45.22 ? 38  GLY A O    4  
ATOM 6936  H H    . GLY A 1 38  ? 13.720 -15.465 12.804 1.00 3.05  ? 38  GLY A H    4  
ATOM 6937  H HA2  . GLY A 1 38  ? 12.451 -16.942 10.622 1.00 73.02 ? 38  GLY A HA2  4  
ATOM 6938  H HA3  . GLY A 1 38  ? 11.619 -16.922 12.170 1.00 62.30 ? 38  GLY A HA3  4  
ATOM 6939  N N    . LYS A 1 39  ? 10.506 -14.767 11.754 1.00 71.41 ? 39  LYS A N    4  
ATOM 6940  C CA   . LYS A 1 39  ? 9.801  -13.517 11.497 1.00 4.14  ? 39  LYS A CA   4  
ATOM 6941  C C    . LYS A 1 39  ? 9.385  -12.849 12.804 1.00 75.30 ? 39  LYS A C    4  
ATOM 6942  O O    . LYS A 1 39  ? 9.431  -13.464 13.869 1.00 30.34 ? 39  LYS A O    4  
ATOM 6943  C CB   . LYS A 1 39  ? 8.569  -13.771 10.627 1.00 71.45 ? 39  LYS A CB   4  
ATOM 6944  C CG   . LYS A 1 39  ? 7.535  -14.669 11.284 1.00 55.43 ? 39  LYS A CG   4  
ATOM 6945  C CD   . LYS A 1 39  ? 7.718  -16.121 10.877 1.00 34.34 ? 39  LYS A CD   4  
ATOM 6946  C CE   . LYS A 1 39  ? 7.027  -16.422 9.556  1.00 51.31 ? 39  LYS A CE   4  
ATOM 6947  N NZ   . LYS A 1 39  ? 7.524  -17.685 8.945  1.00 60.50 ? 39  LYS A NZ   4  
ATOM 6948  H H    . LYS A 1 39  ? 10.110 -15.421 12.368 1.00 24.53 ? 39  LYS A H    4  
ATOM 6949  H HA   . LYS A 1 39  ? 10.475 -12.859 10.970 1.00 51.13 ? 39  LYS A HA   4  
ATOM 6950  H HB2  . LYS A 1 39  ? 8.102  -12.825 10.400 1.00 54.55 ? 39  LYS A HB2  4  
ATOM 6951  H HB3  . LYS A 1 39  ? 8.885  -14.237 9.704  1.00 32.32 ? 39  LYS A HB3  4  
ATOM 6952  H HG2  . LYS A 1 39  ? 7.633  -14.591 12.356 1.00 21.13 ? 39  LYS A HG2  4  
ATOM 6953  H HG3  . LYS A 1 39  ? 6.548  -14.343 10.987 1.00 52.35 ? 39  LYS A HG3  4  
ATOM 6954  H HD2  . LYS A 1 39  ? 8.773  -16.327 10.774 1.00 74.21 ? 39  LYS A HD2  4  
ATOM 6955  H HD3  . LYS A 1 39  ? 7.299  -16.756 11.645 1.00 34.42 ? 39  LYS A HD3  4  
ATOM 6956  H HE2  . LYS A 1 39  ? 5.966  -16.510 9.731  1.00 12.22 ? 39  LYS A HE2  4  
ATOM 6957  H HE3  . LYS A 1 39  ? 7.212  -15.605 8.874  1.00 5.22  ? 39  LYS A HE3  4  
ATOM 6958  H HZ1  . LYS A 1 39  ? 8.406  -17.984 9.409  1.00 12.33 ? 39  LYS A HZ1  4  
ATOM 6959  H HZ2  . LYS A 1 39  ? 7.710  -17.544 7.932  1.00 42.52 ? 39  LYS A HZ2  4  
ATOM 6960  H HZ3  . LYS A 1 39  ? 6.815  -18.438 9.054  1.00 22.52 ? 39  LYS A HZ3  4  
ATOM 6961  N N    . VAL A 1 40  ? 8.976  -11.587 12.715 1.00 71.55 ? 40  VAL A N    4  
ATOM 6962  C CA   . VAL A 1 40  ? 8.548  -10.837 13.889 1.00 22.33 ? 40  VAL A CA   4  
ATOM 6963  C C    . VAL A 1 40  ? 7.163  -10.234 13.682 1.00 24.31 ? 40  VAL A C    4  
ATOM 6964  O O    . VAL A 1 40  ? 6.817  -9.815  12.578 1.00 24.41 ? 40  VAL A O    4  
ATOM 6965  C CB   . VAL A 1 40  ? 9.542  -9.710  14.228 1.00 54.03 ? 40  VAL A CB   4  
ATOM 6966  C CG1  . VAL A 1 40  ? 9.052  -8.908  15.424 1.00 41.12 ? 40  VAL A CG1  4  
ATOM 6967  C CG2  . VAL A 1 40  ? 10.927 -10.282 14.490 1.00 53.24 ? 40  VAL A CG2  4  
ATOM 6968  H H    . VAL A 1 40  ? 8.961  -11.151 11.837 1.00 20.03 ? 40  VAL A H    4  
ATOM 6969  H HA   . VAL A 1 40  ? 8.512  -11.520 14.726 1.00 13.32 ? 40  VAL A HA   4  
ATOM 6970  H HB   . VAL A 1 40  ? 9.604  -9.046  13.378 1.00 1.23  ? 40  VAL A HB   4  
ATOM 6971  H HG11 . VAL A 1 40  ? 8.681  -9.582  16.181 1.00 32.45 ? 40  VAL A HG11 4  
ATOM 6972  H HG12 . VAL A 1 40  ? 9.869  -8.326  15.826 1.00 34.43 ? 40  VAL A HG12 4  
ATOM 6973  H HG13 . VAL A 1 40  ? 8.258  -8.246  15.112 1.00 14.21 ? 40  VAL A HG13 4  
ATOM 6974  H HG21 . VAL A 1 40  ? 11.433 -10.441 13.549 1.00 21.43 ? 40  VAL A HG21 4  
ATOM 6975  H HG22 . VAL A 1 40  ? 11.496 -9.588  15.091 1.00 15.43 ? 40  VAL A HG22 4  
ATOM 6976  H HG23 . VAL A 1 40  ? 10.836 -11.221 15.014 1.00 34.21 ? 40  VAL A HG23 4  
ATOM 6977  N N    . GLU A 1 41  ? 6.375  -10.194 14.752 1.00 5.51  ? 41  GLU A N    4  
ATOM 6978  C CA   . GLU A 1 41  ? 5.027  -9.642  14.687 1.00 44.54 ? 41  GLU A CA   4  
ATOM 6979  C C    . GLU A 1 41  ? 5.054  -8.197  14.197 1.00 44.52 ? 41  GLU A C    4  
ATOM 6980  O O    . GLU A 1 41  ? 6.113  -7.573  14.124 1.00 4.25  ? 41  GLU A O    4  
ATOM 6981  C CB   . GLU A 1 41  ? 4.356  -9.714  16.059 1.00 14.35 ? 41  GLU A CB   4  
ATOM 6982  C CG   . GLU A 1 41  ? 3.176  -10.670 16.110 1.00 20.23 ? 41  GLU A CG   4  
ATOM 6983  C CD   . GLU A 1 41  ? 2.415  -10.589 17.419 1.00 22.25 ? 41  GLU A CD   4  
ATOM 6984  O OE1  . GLU A 1 41  ? 3.053  -10.722 18.485 1.00 44.11 ? 41  GLU A OE1  4  
ATOM 6985  O OE2  . GLU A 1 41  ? 1.183  -10.394 17.379 1.00 13.50 ? 41  GLU A OE2  4  
ATOM 6986  H H    . GLU A 1 41  ? 6.708  -10.543 15.605 1.00 63.21 ? 41  GLU A H    4  
ATOM 6987  H HA   . GLU A 1 41  ? 4.459  -10.236 13.987 1.00 45.53 ? 41  GLU A HA   4  
ATOM 6988  H HB2  . GLU A 1 41  ? 5.085  -10.035 16.788 1.00 65.33 ? 41  GLU A HB2  4  
ATOM 6989  H HB3  . GLU A 1 41  ? 4.004  -8.728  16.327 1.00 62.03 ? 41  GLU A HB3  4  
ATOM 6990  H HG2  . GLU A 1 41  ? 2.500  -10.431 15.304 1.00 54.35 ? 41  GLU A HG2  4  
ATOM 6991  H HG3  . GLU A 1 41  ? 3.541  -11.679 15.985 1.00 42.12 ? 41  GLU A HG3  4  
ATOM 6992  N N    . LYS A 1 42  ? 3.882  -7.670  13.861 1.00 73.14 ? 42  LYS A N    4  
ATOM 6993  C CA   . LYS A 1 42  ? 3.768  -6.299  13.378 1.00 41.10 ? 42  LYS A CA   4  
ATOM 6994  C C    . LYS A 1 42  ? 3.918  -5.304  14.525 1.00 70.33 ? 42  LYS A C    4  
ATOM 6995  O O    . LYS A 1 42  ? 4.458  -4.213  14.346 1.00 73.43 ? 42  LYS A O    4  
ATOM 6996  C CB   . LYS A 1 42  ? 2.421  -6.091  12.682 1.00 63.54 ? 42  LYS A CB   4  
ATOM 6997  C CG   . LYS A 1 42  ? 1.230  -6.510  13.525 1.00 15.22 ? 42  LYS A CG   4  
ATOM 6998  C CD   . LYS A 1 42  ? 0.490  -7.683  12.903 1.00 2.42  ? 42  LYS A CD   4  
ATOM 6999  C CE   . LYS A 1 42  ? -0.912 -7.824  13.476 1.00 62.55 ? 42  LYS A CE   4  
ATOM 7000  N NZ   . LYS A 1 42  ? -1.798 -8.621  12.582 1.00 23.11 ? 42  LYS A NZ   4  
ATOM 7001  H H    . LYS A 1 42  ? 3.072  -8.217  13.940 1.00 72.50 ? 42  LYS A H    4  
ATOM 7002  H HA   . LYS A 1 42  ? 4.562  -6.131  12.666 1.00 73.13 ? 42  LYS A HA   4  
ATOM 7003  H HB2  . LYS A 1 42  ? 2.313  -5.045  12.437 1.00 4.02  ? 42  LYS A HB2  4  
ATOM 7004  H HB3  . LYS A 1 42  ? 2.409  -6.669  11.768 1.00 3.31  ? 42  LYS A HB3  4  
ATOM 7005  H HG2  . LYS A 1 42  ? 1.577  -6.797  14.506 1.00 24.13 ? 42  LYS A HG2  4  
ATOM 7006  H HG3  . LYS A 1 42  ? 0.551  -5.673  13.613 1.00 74.45 ? 42  LYS A HG3  4  
ATOM 7007  H HD2  . LYS A 1 42  ? 0.417  -7.527  11.837 1.00 4.11  ? 42  LYS A HD2  4  
ATOM 7008  H HD3  . LYS A 1 42  ? 1.043  -8.590  13.099 1.00 24.43 ? 42  LYS A HD3  4  
ATOM 7009  H HE2  . LYS A 1 42  ? -0.847 -8.315  14.435 1.00 72.15 ? 42  LYS A HE2  4  
ATOM 7010  H HE3  . LYS A 1 42  ? -1.336 -6.839  13.603 1.00 25.22 ? 42  LYS A HE3  4  
ATOM 7011  H HZ1  . LYS A 1 42  ? -1.672 -9.637  12.768 1.00 14.35 ? 42  LYS A HZ1  4  
ATOM 7012  H HZ2  . LYS A 1 42  ? -1.564 -8.432  11.587 1.00 54.24 ? 42  LYS A HZ2  4  
ATOM 7013  H HZ3  . LYS A 1 42  ? -2.793 -8.369  12.748 1.00 62.01 ? 42  LYS A HZ3  4  
ATOM 7014  N N    . ASN A 1 43  ? 3.438  -5.689  15.703 1.00 72.53 ? 43  ASN A N    4  
ATOM 7015  C CA   . ASN A 1 43  ? 3.520  -4.831  16.879 1.00 74.20 ? 43  ASN A CA   4  
ATOM 7016  C C    . ASN A 1 43  ? 4.547  -5.366  17.872 1.00 11.11 ? 43  ASN A C    4  
ATOM 7017  O O    . ASN A 1 43  ? 4.327  -5.339  19.082 1.00 13.44 ? 43  ASN A O    4  
ATOM 7018  C CB   . ASN A 1 43  ? 2.150  -4.723  17.553 1.00 4.11  ? 43  ASN A CB   4  
ATOM 7019  C CG   . ASN A 1 43  ? 1.230  -3.751  16.840 1.00 60.32 ? 43  ASN A CG   4  
ATOM 7020  O OD1  . ASN A 1 43  ? 1.408  -2.536  16.923 1.00 15.11 ? 43  ASN A OD1  4  
ATOM 7021  N ND2  . ASN A 1 43  ? 0.240  -4.284  16.134 1.00 73.52 ? 43  ASN A ND2  4  
ATOM 7022  H H    . ASN A 1 43  ? 3.018  -6.571  15.783 1.00 22.40 ? 43  ASN A H    4  
ATOM 7023  H HA   . ASN A 1 43  ? 3.829  -3.850  16.552 1.00 13.12 ? 43  ASN A HA   4  
ATOM 7024  H HB2  . ASN A 1 43  ? 1.680  -5.696  17.558 1.00 5.32  ? 43  ASN A HB2  4  
ATOM 7025  H HB3  . ASN A 1 43  ? 2.282  -4.386  18.570 1.00 12.32 ? 43  ASN A HB3  4  
ATOM 7026  H HD21 . ASN A 1 43  ? 0.159  -5.261  16.113 1.00 62.12 ? 43  ASN A HD21 4  
ATOM 7027  H HD22 . ASN A 1 43  ? -0.370 -3.679  15.662 1.00 21.31 ? 43  ASN A HD22 4  
ATOM 7028  N N    . GLU A 1 44  ? 5.670  -5.851  17.351 1.00 55.14 ? 44  GLU A N    4  
ATOM 7029  C CA   . GLU A 1 44  ? 6.730  -6.392  18.192 1.00 45.10 ? 44  GLU A CA   4  
ATOM 7030  C C    . GLU A 1 44  ? 8.098  -5.904  17.724 1.00 64.25 ? 44  GLU A C    4  
ATOM 7031  O O    . GLU A 1 44  ? 8.377  -5.857  16.525 1.00 42.01 ? 44  GLU A O    4  
ATOM 7032  C CB   . GLU A 1 44  ? 6.691  -7.921  18.181 1.00 72.53 ? 44  GLU A CB   4  
ATOM 7033  C CG   . GLU A 1 44  ? 6.203  -8.527  19.486 1.00 73.32 ? 44  GLU A CG   4  
ATOM 7034  C CD   . GLU A 1 44  ? 4.751  -8.197  19.776 1.00 64.04 ? 44  GLU A CD   4  
ATOM 7035  O OE1  . GLU A 1 44  ? 4.431  -7.916  20.949 1.00 34.04 ? 44  GLU A OE1  4  
ATOM 7036  O OE2  . GLU A 1 44  ? 3.937  -8.220  18.829 1.00 11.35 ? 44  GLU A OE2  4  
ATOM 7037  H H    . GLU A 1 44  ? 5.787  -5.845  16.378 1.00 74.23 ? 44  GLU A H    4  
ATOM 7038  H HA   . GLU A 1 44  ? 6.564  -6.044  19.200 1.00 32.33 ? 44  GLU A HA   4  
ATOM 7039  H HB2  . GLU A 1 44  ? 6.033  -8.247  17.388 1.00 3.20  ? 44  GLU A HB2  4  
ATOM 7040  H HB3  . GLU A 1 44  ? 7.686  -8.293  17.986 1.00 71.43 ? 44  GLU A HB3  4  
ATOM 7041  H HG2  . GLU A 1 44  ? 6.307  -9.601  19.431 1.00 4.51  ? 44  GLU A HG2  4  
ATOM 7042  H HG3  . GLU A 1 44  ? 6.811  -8.148  20.294 1.00 62.23 ? 44  GLU A HG3  4  
ATOM 7043  N N    . THR A 1 45  ? 8.950  -5.541  18.678 1.00 34.11 ? 45  THR A N    4  
ATOM 7044  C CA   . THR A 1 45  ? 10.287 -5.055  18.365 1.00 64.21 ? 45  THR A CA   4  
ATOM 7045  C C    . THR A 1 45  ? 11.237 -6.211  18.072 1.00 44.34 ? 45  THR A C    4  
ATOM 7046  O O    . THR A 1 45  ? 10.949 -7.361  18.400 1.00 61.12 ? 45  THR A O    4  
ATOM 7047  C CB   . THR A 1 45  ? 10.863 -4.212  19.518 1.00 23.24 ? 45  THR A CB   4  
ATOM 7048  O OG1  . THR A 1 45  ? 10.243 -4.584  20.754 1.00 32.11 ? 45  THR A OG1  4  
ATOM 7049  C CG2  . THR A 1 45  ? 10.648 -2.728  19.264 1.00 45.04 ? 45  THR A CG2  4  
ATOM 7050  H H    . THR A 1 45  ? 8.669  -5.601  19.615 1.00 22.31 ? 45  THR A H    4  
ATOM 7051  H HA   . THR A 1 45  ? 10.218 -4.428  17.488 1.00 14.32 ? 45  THR A HA   4  
ATOM 7052  H HB   . THR A 1 45  ? 11.925 -4.401  19.586 1.00 3.34  ? 45  THR A HB   4  
ATOM 7053  H HG1  . THR A 1 45  ? 10.866 -4.462  21.475 1.00 72.13 ? 45  THR A HG1  4  
ATOM 7054  H HG21 . THR A 1 45  ? 9.772  -2.394  19.798 1.00 34.03 ? 45  THR A HG21 4  
ATOM 7055  H HG22 . THR A 1 45  ? 10.511 -2.561  18.206 1.00 52.43 ? 45  THR A HG22 4  
ATOM 7056  H HG23 . THR A 1 45  ? 11.510 -2.176  19.606 1.00 5.14  ? 45  THR A HG23 4  
ATOM 7057  N N    . GLU A 1 46  ? 12.371 -5.896  17.453 1.00 61.44 ? 46  GLU A N    4  
ATOM 7058  C CA   . GLU A 1 46  ? 13.363 -6.910  17.116 1.00 62.55 ? 46  GLU A CA   4  
ATOM 7059  C C    . GLU A 1 46  ? 13.965 -7.523  18.377 1.00 61.21 ? 46  GLU A C    4  
ATOM 7060  O O    . GLU A 1 46  ? 14.265 -8.717  18.419 1.00 0.54  ? 46  GLU A O    4  
ATOM 7061  C CB   . GLU A 1 46  ? 14.471 -6.305  16.251 1.00 11.30 ? 46  GLU A CB   4  
ATOM 7062  C CG   . GLU A 1 46  ? 13.959 -5.637  14.986 1.00 51.30 ? 46  GLU A CG   4  
ATOM 7063  C CD   . GLU A 1 46  ? 14.868 -4.522  14.506 1.00 13.54 ? 46  GLU A CD   4  
ATOM 7064  O OE1  . GLU A 1 46  ? 15.301 -3.706  15.346 1.00 1.25  ? 46  GLU A OE1  4  
ATOM 7065  O OE2  . GLU A 1 46  ? 15.146 -4.465  13.290 1.00 75.30 ? 46  GLU A OE2  4  
ATOM 7066  H H    . GLU A 1 46  ? 12.544 -4.961  17.217 1.00 71.13 ? 46  GLU A H    4  
ATOM 7067  H HA   . GLU A 1 46  ? 12.866 -7.687  16.555 1.00 60.34 ? 46  GLU A HA   4  
ATOM 7068  H HB2  . GLU A 1 46  ? 15.003 -5.567  16.834 1.00 51.15 ? 46  GLU A HB2  4  
ATOM 7069  H HB3  . GLU A 1 46  ? 15.157 -7.088  15.966 1.00 23.34 ? 46  GLU A HB3  4  
ATOM 7070  H HG2  . GLU A 1 46  ? 13.885 -6.380  14.206 1.00 12.13 ? 46  GLU A HG2  4  
ATOM 7071  H HG3  . GLU A 1 46  ? 12.980 -5.224  15.183 1.00 62.23 ? 46  GLU A HG3  4  
ATOM 7072  N N    . LYS A 1 47  ? 14.140 -6.698  19.403 1.00 13.52 ? 47  LYS A N    4  
ATOM 7073  C CA   . LYS A 1 47  ? 14.705 -7.156  20.667 1.00 51.32 ? 47  LYS A CA   4  
ATOM 7074  C C    . LYS A 1 47  ? 13.680 -7.957  21.463 1.00 54.13 ? 47  LYS A C    4  
ATOM 7075  O O    . LYS A 1 47  ? 13.991 -9.019  22.002 1.00 12.23 ? 47  LYS A O    4  
ATOM 7076  C CB   . LYS A 1 47  ? 15.190 -5.963  21.494 1.00 31.33 ? 47  LYS A CB   4  
ATOM 7077  C CG   . LYS A 1 47  ? 16.586 -5.493  21.123 1.00 13.13 ? 47  LYS A CG   4  
ATOM 7078  C CD   . LYS A 1 47  ? 17.648 -6.473  21.592 1.00 34.24 ? 47  LYS A CD   4  
ATOM 7079  C CE   . LYS A 1 47  ? 17.879 -6.369  23.092 1.00 11.11 ? 47  LYS A CE   4  
ATOM 7080  N NZ   . LYS A 1 47  ? 18.451 -5.048  23.474 1.00 24.55 ? 47  LYS A NZ   4  
ATOM 7081  H H    . LYS A 1 47  ? 13.881 -5.756  19.309 1.00 61.34 ? 47  LYS A H    4  
ATOM 7082  H HA   . LYS A 1 47  ? 15.546 -7.793  20.442 1.00 24.21 ? 47  LYS A HA   4  
ATOM 7083  H HB2  . LYS A 1 47  ? 14.506 -5.140  21.353 1.00 55.24 ? 47  LYS A HB2  4  
ATOM 7084  H HB3  . LYS A 1 47  ? 15.193 -6.242  22.538 1.00 34.33 ? 47  LYS A HB3  4  
ATOM 7085  H HG2  . LYS A 1 47  ? 16.650 -5.396  20.050 1.00 72.24 ? 47  LYS A HG2  4  
ATOM 7086  H HG3  . LYS A 1 47  ? 16.766 -4.532  21.585 1.00 64.34 ? 47  LYS A HG3  4  
ATOM 7087  H HD2  . LYS A 1 47  ? 17.327 -7.477  21.358 1.00 20.52 ? 47  LYS A HD2  4  
ATOM 7088  H HD3  . LYS A 1 47  ? 18.574 -6.260  21.078 1.00 22.12 ? 47  LYS A HD3  4  
ATOM 7089  H HE2  . LYS A 1 47  ? 16.936 -6.503  23.599 1.00 54.12 ? 47  LYS A HE2  4  
ATOM 7090  H HE3  . LYS A 1 47  ? 18.563 -7.149  23.393 1.00 72.05 ? 47  LYS A HE3  4  
ATOM 7091  H HZ1  . LYS A 1 47  ? 19.351 -4.891  22.976 1.00 73.51 ? 47  LYS A HZ1  4  
ATOM 7092  H HZ2  . LYS A 1 47  ? 18.627 -5.018  24.499 1.00 34.20 ? 47  LYS A HZ2  4  
ATOM 7093  H HZ3  . LYS A 1 47  ? 17.790 -4.286  23.224 1.00 44.03 ? 47  LYS A HZ3  4  
ATOM 7094  N N    . ASP A 1 48  ? 12.457 -7.442  21.530 1.00 32.33 ? 48  ASP A N    4  
ATOM 7095  C CA   . ASP A 1 48  ? 11.385 -8.111  22.258 1.00 32.52 ? 48  ASP A CA   4  
ATOM 7096  C C    . ASP A 1 48  ? 10.973 -9.401  21.555 1.00 24.33 ? 48  ASP A C    4  
ATOM 7097  O O    . ASP A 1 48  ? 10.572 -10.370 22.199 1.00 24.15 ? 48  ASP A O    4  
ATOM 7098  C CB   . ASP A 1 48  ? 10.177 -7.184  22.396 1.00 13.34 ? 48  ASP A CB   4  
ATOM 7099  C CG   . ASP A 1 48  ? 8.979  -7.880  23.011 1.00 20.45 ? 48  ASP A CG   4  
ATOM 7100  O OD1  . ASP A 1 48  ? 8.076  -8.288  22.252 1.00 54.10 ? 48  ASP A OD1  4  
ATOM 7101  O OD2  . ASP A 1 48  ? 8.945  -8.018  24.253 1.00 54.55 ? 48  ASP A OD2  4  
ATOM 7102  H H    . ASP A 1 48  ? 12.270 -6.592  21.079 1.00 23.21 ? 48  ASP A H    4  
ATOM 7103  H HA   . ASP A 1 48  ? 11.754 -8.355  23.243 1.00 63.12 ? 48  ASP A HA   4  
ATOM 7104  H HB2  . ASP A 1 48  ? 10.444 -6.346  23.024 1.00 20.25 ? 48  ASP A HB2  4  
ATOM 7105  H HB3  . ASP A 1 48  ? 9.897  -6.820  21.419 1.00 74.23 ? 48  ASP A HB3  4  
ATOM 7106  N N    . ALA A 1 49  ? 11.075 -9.405  20.230 1.00 31.41 ? 49  ALA A N    4  
ATOM 7107  C CA   . ALA A 1 49  ? 10.714 -10.576 19.440 1.00 44.00 ? 49  ALA A CA   4  
ATOM 7108  C C    . ALA A 1 49  ? 11.781 -11.660 19.547 1.00 64.15 ? 49  ALA A C    4  
ATOM 7109  O O    . ALA A 1 49  ? 11.473 -12.853 19.533 1.00 42.43 ? 49  ALA A O    4  
ATOM 7110  C CB   . ALA A 1 49  ? 10.500 -10.185 17.985 1.00 32.13 ? 49  ALA A CB   4  
ATOM 7111  H H    . ALA A 1 49  ? 11.401 -8.602  19.773 1.00 23.44 ? 49  ALA A H    4  
ATOM 7112  H HA   . ALA A 1 49  ? 9.782  -10.964 19.824 1.00 12.22 ? 49  ALA A HA   4  
ATOM 7113  H HB1  . ALA A 1 49  ? 9.826  -9.342  17.936 1.00 72.13 ? 49  ALA A HB1  4  
ATOM 7114  H HB2  . ALA A 1 49  ? 11.447 -9.916  17.542 1.00 73.14 ? 49  ALA A HB2  4  
ATOM 7115  H HB3  . ALA A 1 49  ? 10.074 -11.019 17.448 1.00 53.01 ? 49  ALA A HB3  4  
ATOM 7116  N N    . LEU A 1 50  ? 13.037 -11.239 19.652 1.00 20.31 ? 50  LEU A N    4  
ATOM 7117  C CA   . LEU A 1 50  ? 14.151 -12.175 19.760 1.00 30.14 ? 50  LEU A CA   4  
ATOM 7118  C C    . LEU A 1 50  ? 14.309 -12.670 21.195 1.00 41.34 ? 50  LEU A C    4  
ATOM 7119  O O    . LEU A 1 50  ? 14.414 -13.872 21.439 1.00 70.13 ? 50  LEU A O    4  
ATOM 7120  C CB   . LEU A 1 50  ? 15.447 -11.512 19.292 1.00 42.23 ? 50  LEU A CB   4  
ATOM 7121  C CG   . LEU A 1 50  ? 15.644 -11.417 17.778 1.00 34.22 ? 50  LEU A CG   4  
ATOM 7122  C CD1  . LEU A 1 50  ? 16.938 -10.689 17.452 1.00 24.14 ? 50  LEU A CD1  4  
ATOM 7123  C CD2  . LEU A 1 50  ? 15.637 -12.804 17.152 1.00 64.11 ? 50  LEU A CD2  4  
ATOM 7124  H H    . LEU A 1 50  ? 13.220 -10.277 19.658 1.00 65.15 ? 50  LEU A H    4  
ATOM 7125  H HA   . LEU A 1 50  ? 13.937 -13.020 19.123 1.00 42.34 ? 50  LEU A HA   4  
ATOM 7126  H HB2  . LEU A 1 50  ? 15.469 -10.510 19.691 1.00 51.51 ? 50  LEU A HB2  4  
ATOM 7127  H HB3  . LEU A 1 50  ? 16.273 -12.078 19.699 1.00 42.41 ? 50  LEU A HB3  4  
ATOM 7128  H HG   . LEU A 1 50  ? 14.827 -10.852 17.350 1.00 31.32 ? 50  LEU A HG   4  
ATOM 7129  H HD11 . LEU A 1 50  ? 17.063 -9.856  18.128 1.00 72.50 ? 50  LEU A HD11 4  
ATOM 7130  H HD12 . LEU A 1 50  ? 16.901 -10.326 16.436 1.00 1.21  ? 50  LEU A HD12 4  
ATOM 7131  H HD13 . LEU A 1 50  ? 17.771 -11.369 17.561 1.00 73.12 ? 50  LEU A HD13 4  
ATOM 7132  H HD21 . LEU A 1 50  ? 15.988 -13.526 17.874 1.00 23.33 ? 50  LEU A HD21 4  
ATOM 7133  H HD22 . LEU A 1 50  ? 16.288 -12.812 16.289 1.00 23.45 ? 50  LEU A HD22 4  
ATOM 7134  H HD23 . LEU A 1 50  ? 14.633 -13.057 16.848 1.00 73.30 ? 50  LEU A HD23 4  
ATOM 7135  N N    . ILE A 1 51  ? 14.323 -11.735 22.139 1.00 24.20 ? 51  ILE A N    4  
ATOM 7136  C CA   . ILE A 1 51  ? 14.465 -12.077 23.549 1.00 42.21 ? 51  ILE A CA   4  
ATOM 7137  C C    . ILE A 1 51  ? 13.445 -13.132 23.964 1.00 3.32  ? 51  ILE A C    4  
ATOM 7138  O O    . ILE A 1 51  ? 13.713 -13.959 24.836 1.00 72.24 ? 51  ILE A O    4  
ATOM 7139  C CB   . ILE A 1 51  ? 14.300 -10.837 24.448 1.00 71.21 ? 51  ILE A CB   4  
ATOM 7140  C CG1  . ILE A 1 51  ? 14.827 -11.127 25.855 1.00 50.32 ? 51  ILE A CG1  4  
ATOM 7141  C CG2  . ILE A 1 51  ? 12.840 -10.412 24.500 1.00 1.14  ? 51  ILE A CG2  4  
ATOM 7142  C CD1  . ILE A 1 51  ? 15.422 -9.915  26.538 1.00 20.42 ? 51  ILE A CD1  4  
ATOM 7143  H H    . ILE A 1 51  ? 14.236 -10.794 21.882 1.00 52.03 ? 51  ILE A H    4  
ATOM 7144  H HA   . ILE A 1 51  ? 15.459 -12.474 23.697 1.00 60.20 ? 51  ILE A HA   4  
ATOM 7145  H HB   . ILE A 1 51  ? 14.870 -10.029 24.017 1.00 41.23 ? 51  ILE A HB   4  
ATOM 7146  H HG12 . ILE A 1 51  ? 14.017 -11.489 26.469 1.00 43.45 ? 51  ILE A HG12 4  
ATOM 7147  H HG13 . ILE A 1 51  ? 15.594 -11.885 25.795 1.00 63.15 ? 51  ILE A HG13 4  
ATOM 7148  H HG21 . ILE A 1 51  ? 12.771 -9.411  24.901 1.00 60.13 ? 51  ILE A HG21 4  
ATOM 7149  H HG22 . ILE A 1 51  ? 12.425 -10.429 23.504 1.00 35.41 ? 51  ILE A HG22 4  
ATOM 7150  H HG23 . ILE A 1 51  ? 12.289 -11.092 25.133 1.00 42.51 ? 51  ILE A HG23 4  
ATOM 7151  H HD11 . ILE A 1 51  ? 14.840 -9.674  27.415 1.00 31.24 ? 51  ILE A HD11 4  
ATOM 7152  H HD12 . ILE A 1 51  ? 16.440 -10.128 26.828 1.00 71.44 ? 51  ILE A HD12 4  
ATOM 7153  H HD13 . ILE A 1 51  ? 15.410 -9.076  25.857 1.00 32.15 ? 51  ILE A HD13 4  
ATOM 7154  N N    . ARG A 1 52  ? 12.276 -13.097 23.333 1.00 21.23 ? 52  ARG A N    4  
ATOM 7155  C CA   . ARG A 1 52  ? 11.216 -14.051 23.637 1.00 51.23 ? 52  ARG A CA   4  
ATOM 7156  C C    . ARG A 1 52  ? 11.428 -15.359 22.880 1.00 41.31 ? 52  ARG A C    4  
ATOM 7157  O O    . ARG A 1 52  ? 11.308 -16.443 23.450 1.00 54.53 ? 52  ARG A O    4  
ATOM 7158  C CB   . ARG A 1 52  ? 9.851  -13.459 23.280 1.00 0.35  ? 52  ARG A CB   4  
ATOM 7159  C CG   . ARG A 1 52  ? 8.980  -13.165 24.491 1.00 40.31 ? 52  ARG A CG   4  
ATOM 7160  C CD   . ARG A 1 52  ? 9.198  -11.750 25.004 1.00 41.23 ? 52  ARG A CD   4  
ATOM 7161  N NE   . ARG A 1 52  ? 8.239  -10.807 24.435 1.00 75.33 ? 52  ARG A NE   4  
ATOM 7162  C CZ   . ARG A 1 52  ? 6.995  -10.666 24.880 1.00 71.23 ? 52  ARG A CZ   4  
ATOM 7163  N NH1  . ARG A 1 52  ? 6.563  -11.402 25.894 1.00 32.23 ? 52  ARG A NH1  4  
ATOM 7164  N NH2  . ARG A 1 52  ? 6.181  -9.787  24.310 1.00 52.13 ? 52  ARG A NH2  4  
ATOM 7165  H H    . ARG A 1 52  ? 12.122 -12.414 22.648 1.00 44.41 ? 52  ARG A H    4  
ATOM 7166  H HA   . ARG A 1 52  ? 11.245 -14.253 24.697 1.00 71.22 ? 52  ARG A HA   4  
ATOM 7167  H HB2  . ARG A 1 52  ? 10.002 -12.535 22.740 1.00 32.45 ? 52  ARG A HB2  4  
ATOM 7168  H HB3  . ARG A 1 52  ? 9.325  -14.156 22.646 1.00 55.50 ? 52  ARG A HB3  4  
ATOM 7169  H HG2  . ARG A 1 52  ? 7.943  -13.279 24.213 1.00 53.33 ? 52  ARG A HG2  4  
ATOM 7170  H HG3  . ARG A 1 52  ? 9.223  -13.865 25.276 1.00 4.31  ? 52  ARG A HG3  4  
ATOM 7171  H HD2  . ARG A 1 52  ? 9.093  -11.750 26.078 1.00 23.44 ? 52  ARG A HD2  4  
ATOM 7172  H HD3  . ARG A 1 52  ? 10.197 -11.436 24.740 1.00 40.11 ? 52  ARG A HD3  4  
ATOM 7173  H HE   . ARG A 1 52  ? 8.537  -10.253 23.684 1.00 71.40 ? 52  ARG A HE   4  
ATOM 7174  H HH11 . ARG A 1 52  ? 7.174  -12.065 26.326 1.00 3.33  ? 52  ARG A HH11 4  
ATOM 7175  H HH12 . ARG A 1 52  ? 5.626  -11.293 26.228 1.00 22.13 ? 52  ARG A HH12 4  
ATOM 7176  H HH21 . ARG A 1 52  ? 6.503  -9.230  23.545 1.00 61.12 ? 52  ARG A HH21 4  
ATOM 7177  H HH22 . ARG A 1 52  ? 5.245  -9.682  24.645 1.00 2.51  ? 52  ARG A HH22 4  
ATOM 7178  N N    . GLU A 1 53  ? 11.744 -15.248 21.593 1.00 12.53 ? 53  GLU A N    4  
ATOM 7179  C CA   . GLU A 1 53  ? 11.971 -16.422 20.759 1.00 1.30  ? 53  GLU A CA   4  
ATOM 7180  C C    . GLU A 1 53  ? 13.191 -17.203 21.240 1.00 52.34 ? 53  GLU A C    4  
ATOM 7181  O O    . GLU A 1 53  ? 13.333 -18.391 20.951 1.00 72.40 ? 53  GLU A O    4  
ATOM 7182  C CB   . GLU A 1 53  ? 12.160 -16.008 19.298 1.00 11.01 ? 53  GLU A CB   4  
ATOM 7183  C CG   . GLU A 1 53  ? 10.878 -15.547 18.626 1.00 51.45 ? 53  GLU A CG   4  
ATOM 7184  C CD   . GLU A 1 53  ? 10.065 -16.698 18.068 1.00 74.44 ? 53  GLU A CD   4  
ATOM 7185  O OE1  . GLU A 1 53  ? 10.584 -17.834 18.044 1.00 1.02  ? 53  GLU A OE1  4  
ATOM 7186  O OE2  . GLU A 1 53  ? 8.910  -16.465 17.654 1.00 12.35 ? 53  GLU A OE2  4  
ATOM 7187  H H    . GLU A 1 53  ? 11.825 -14.355 21.196 1.00 62.50 ? 53  GLU A H    4  
ATOM 7188  H HA   . GLU A 1 53  ? 11.100 -17.055 20.834 1.00 25.42 ? 53  GLU A HA   4  
ATOM 7189  H HB2  . GLU A 1 53  ? 12.876 -15.201 19.255 1.00 40.43 ? 53  GLU A HB2  4  
ATOM 7190  H HB3  . GLU A 1 53  ? 12.548 -16.851 18.746 1.00 51.15 ? 53  GLU A HB3  4  
ATOM 7191  H HG2  . GLU A 1 53  ? 10.276 -15.019 19.350 1.00 31.12 ? 53  GLU A HG2  4  
ATOM 7192  H HG3  . GLU A 1 53  ? 11.132 -14.879 17.816 1.00 54.45 ? 53  GLU A HG3  4  
ATOM 7193  N N    . ILE A 1 54  ? 14.068 -16.526 21.973 1.00 12.03 ? 54  ILE A N    4  
ATOM 7194  C CA   . ILE A 1 54  ? 15.275 -17.156 22.494 1.00 13.12 ? 54  ILE A CA   4  
ATOM 7195  C C    . ILE A 1 54  ? 14.944 -18.132 23.618 1.00 1.23  ? 54  ILE A C    4  
ATOM 7196  O O    . ILE A 1 54  ? 15.414 -19.270 23.624 1.00 14.22 ? 54  ILE A O    4  
ATOM 7197  C CB   . ILE A 1 54  ? 16.276 -16.109 23.017 1.00 52.44 ? 54  ILE A CB   4  
ATOM 7198  C CG1  . ILE A 1 54  ? 16.963 -15.401 21.847 1.00 3.43  ? 54  ILE A CG1  4  
ATOM 7199  C CG2  . ILE A 1 54  ? 17.305 -16.766 23.924 1.00 71.01 ? 54  ILE A CG2  4  
ATOM 7200  C CD1  . ILE A 1 54  ? 17.608 -14.087 22.231 1.00 21.21 ? 54  ILE A CD1  4  
ATOM 7201  H H    . ILE A 1 54  ? 13.899 -15.581 22.169 1.00 30.14 ? 54  ILE A H    4  
ATOM 7202  H HA   . ILE A 1 54  ? 15.742 -17.700 21.686 1.00 40.53 ? 54  ILE A HA   4  
ATOM 7203  H HB   . ILE A 1 54  ? 15.731 -15.381 23.598 1.00 32.25 ? 54  ILE A HB   4  
ATOM 7204  H HG12 . ILE A 1 54  ? 17.732 -16.043 21.448 1.00 43.43 ? 54  ILE A HG12 4  
ATOM 7205  H HG13 . ILE A 1 54  ? 16.232 -15.200 21.078 1.00 51.22 ? 54  ILE A HG13 4  
ATOM 7206  H HG21 . ILE A 1 54  ? 18.132 -16.089 24.080 1.00 71.02 ? 54  ILE A HG21 4  
ATOM 7207  H HG22 . ILE A 1 54  ? 16.849 -17.001 24.874 1.00 11.50 ? 54  ILE A HG22 4  
ATOM 7208  H HG23 . ILE A 1 54  ? 17.664 -17.673 23.463 1.00 65.52 ? 54  ILE A HG23 4  
ATOM 7209  H HD11 . ILE A 1 54  ? 17.787 -14.071 23.296 1.00 21.01 ? 54  ILE A HD11 4  
ATOM 7210  H HD12 . ILE A 1 54  ? 18.545 -13.978 21.706 1.00 71.31 ? 54  ILE A HD12 4  
ATOM 7211  H HD13 . ILE A 1 54  ? 16.950 -13.272 21.965 1.00 20.15 ? 54  ILE A HD13 4  
ATOM 7212  N N    . ARG A 1 55  ? 14.131 -17.679 24.568 1.00 65.14 ? 55  ARG A N    4  
ATOM 7213  C CA   . ARG A 1 55  ? 13.737 -18.512 25.697 1.00 60.41 ? 55  ARG A CA   4  
ATOM 7214  C C    . ARG A 1 55  ? 12.532 -19.377 25.340 1.00 71.44 ? 55  ARG A C    4  
ATOM 7215  O O    . ARG A 1 55  ? 12.270 -20.390 25.987 1.00 33.31 ? 55  ARG A O    4  
ATOM 7216  C CB   . ARG A 1 55  ? 13.411 -17.641 26.911 1.00 32.35 ? 55  ARG A CB   4  
ATOM 7217  C CG   . ARG A 1 55  ? 13.559 -18.367 28.239 1.00 40.12 ? 55  ARG A CG   4  
ATOM 7218  C CD   . ARG A 1 55  ? 12.593 -17.825 29.281 1.00 73.34 ? 55  ARG A CD   4  
ATOM 7219  N NE   . ARG A 1 55  ? 12.474 -18.715 30.432 1.00 24.35 ? 55  ARG A NE   4  
ATOM 7220  C CZ   . ARG A 1 55  ? 11.830 -19.877 30.401 1.00 43.42 ? 55  ARG A CZ   4  
ATOM 7221  N NH1  . ARG A 1 55  ? 11.250 -20.286 29.281 1.00 30.33 ? 55  ARG A NH1  4  
ATOM 7222  N NH2  . ARG A 1 55  ? 11.766 -20.631 31.490 1.00 23.14 ? 55  ARG A NH2  4  
ATOM 7223  H H    . ARG A 1 55  ? 13.790 -16.762 24.508 1.00 74.54 ? 55  ARG A H    4  
ATOM 7224  H HA   . ARG A 1 55  ? 14.568 -19.157 25.940 1.00 4.12  ? 55  ARG A HA   4  
ATOM 7225  H HB2  . ARG A 1 55  ? 14.074 -16.788 26.917 1.00 74.42 ? 55  ARG A HB2  4  
ATOM 7226  H HB3  . ARG A 1 55  ? 12.392 -17.295 26.827 1.00 11.32 ? 55  ARG A HB3  4  
ATOM 7227  H HG2  . ARG A 1 55  ? 13.357 -19.417 28.089 1.00 65.31 ? 55  ARG A HG2  4  
ATOM 7228  H HG3  . ARG A 1 55  ? 14.570 -18.240 28.597 1.00 53.42 ? 55  ARG A HG3  4  
ATOM 7229  H HD2  . ARG A 1 55  ? 12.949 -16.863 29.617 1.00 52.13 ? 55  ARG A HD2  4  
ATOM 7230  H HD3  . ARG A 1 55  ? 11.621 -17.710 28.825 1.00 73.12 ? 55  ARG A HD3  4  
ATOM 7231  H HE   . ARG A 1 55  ? 12.896 -18.432 31.270 1.00 31.01 ? 55  ARG A HE   4  
ATOM 7232  H HH11 . ARG A 1 55  ? 11.298 -19.720 28.458 1.00 35.34 ? 55  ARG A HH11 4  
ATOM 7233  H HH12 . ARG A 1 55  ? 10.767 -21.162 29.260 1.00 54.22 ? 55  ARG A HH12 4  
ATOM 7234  H HH21 . ARG A 1 55  ? 12.203 -20.326 32.336 1.00 13.32 ? 55  ARG A HH21 4  
ATOM 7235  H HH22 . ARG A 1 55  ? 11.281 -21.505 31.466 1.00 43.33 ? 55  ARG A HH22 4  
ATOM 7236  N N    . GLU A 1 56  ? 11.803 -18.970 24.305 1.00 11.44 ? 56  GLU A N    4  
ATOM 7237  C CA   . GLU A 1 56  ? 10.625 -19.707 23.864 1.00 61.13 ? 56  GLU A CA   4  
ATOM 7238  C C    . GLU A 1 56  ? 10.998 -20.748 22.812 1.00 31.31 ? 56  GLU A C    4  
ATOM 7239  O O    . GLU A 1 56  ? 10.800 -21.946 23.013 1.00 24.03 ? 56  GLU A O    4  
ATOM 7240  C CB   . GLU A 1 56  ? 9.577  -18.747 23.297 1.00 3.33  ? 56  GLU A CB   4  
ATOM 7241  C CG   . GLU A 1 56  ? 8.299  -19.436 22.849 1.00 2.54  ? 56  GLU A CG   4  
ATOM 7242  C CD   . GLU A 1 56  ? 7.255  -18.458 22.345 1.00 3.15  ? 56  GLU A CD   4  
ATOM 7243  O OE1  . GLU A 1 56  ? 7.500  -17.811 21.306 1.00 70.43 ? 56  GLU A OE1  4  
ATOM 7244  O OE2  . GLU A 1 56  ? 6.193  -18.340 22.992 1.00 40.13 ? 56  GLU A OE2  4  
ATOM 7245  H H    . GLU A 1 56  ? 12.063 -18.154 23.829 1.00 51.31 ? 56  GLU A H    4  
ATOM 7246  H HA   . GLU A 1 56  ? 10.209 -20.213 24.722 1.00 45.01 ? 56  GLU A HA   4  
ATOM 7247  H HB2  . GLU A 1 56  ? 9.324  -18.021 24.056 1.00 42.21 ? 56  GLU A HB2  4  
ATOM 7248  H HB3  . GLU A 1 56  ? 10.001 -18.232 22.447 1.00 33.42 ? 56  GLU A HB3  4  
ATOM 7249  H HG2  . GLU A 1 56  ? 8.537  -20.126 22.054 1.00 40.21 ? 56  GLU A HG2  4  
ATOM 7250  H HG3  . GLU A 1 56  ? 7.887  -19.980 23.686 1.00 71.41 ? 56  GLU A HG3  4  
ATOM 7251  N N    . GLU A 1 57  ? 11.537 -20.281 21.690 1.00 23.14 ? 57  GLU A N    4  
ATOM 7252  C CA   . GLU A 1 57  ? 11.936 -21.172 20.607 1.00 41.42 ? 57  GLU A CA   4  
ATOM 7253  C C    . GLU A 1 57  ? 13.250 -21.875 20.936 1.00 35.23 ? 57  GLU A C    4  
ATOM 7254  O O    . GLU A 1 57  ? 13.296 -23.098 21.063 1.00 34.42 ? 57  GLU A O    4  
ATOM 7255  C CB   . GLU A 1 57  ? 12.078 -20.389 19.300 1.00 41.12 ? 57  GLU A CB   4  
ATOM 7256  C CG   . GLU A 1 57  ? 11.268 -20.968 18.152 1.00 33.14 ? 57  GLU A CG   4  
ATOM 7257  C CD   . GLU A 1 57  ? 11.987 -20.867 16.821 1.00 15.00 ? 57  GLU A CD   4  
ATOM 7258  O OE1  . GLU A 1 57  ? 12.945 -20.073 16.722 1.00 1.15  ? 57  GLU A OE1  4  
ATOM 7259  O OE2  . GLU A 1 57  ? 11.590 -21.583 15.878 1.00 50.14 ? 57  GLU A OE2  4  
ATOM 7260  H H    . GLU A 1 57  ? 11.669 -19.315 21.589 1.00 24.52 ? 57  GLU A H    4  
ATOM 7261  H HA   . GLU A 1 57  ? 11.163 -21.916 20.488 1.00 43.24 ? 57  GLU A HA   4  
ATOM 7262  H HB2  . GLU A 1 57  ? 11.754 -19.372 19.466 1.00 75.22 ? 57  GLU A HB2  4  
ATOM 7263  H HB3  . GLU A 1 57  ? 13.119 -20.382 19.010 1.00 15.01 ? 57  GLU A HB3  4  
ATOM 7264  H HG2  . GLU A 1 57  ? 11.069 -22.009 18.358 1.00 30.23 ? 57  GLU A HG2  4  
ATOM 7265  H HG3  . GLU A 1 57  ? 10.333 -20.432 18.082 1.00 51.42 ? 57  GLU A HG3  4  
ATOM 7266  N N    . MET A 1 58  ? 14.315 -21.093 21.073 1.00 41.32 ? 58  MET A N    4  
ATOM 7267  C CA   . MET A 1 58  ? 15.629 -21.640 21.388 1.00 24.21 ? 58  MET A CA   4  
ATOM 7268  C C    . MET A 1 58  ? 15.622 -22.318 22.754 1.00 24.35 ? 58  MET A C    4  
ATOM 7269  O O    . MET A 1 58  ? 16.387 -23.251 23.000 1.00 24.31 ? 58  MET A O    4  
ATOM 7270  C CB   . MET A 1 58  ? 16.686 -20.534 21.360 1.00 63.41 ? 58  MET A CB   4  
ATOM 7271  C CG   . MET A 1 58  ? 17.352 -20.364 20.004 1.00 73.22 ? 58  MET A CG   4  
ATOM 7272  S SD   . MET A 1 58  ? 19.152 -20.397 20.104 1.00 13.55 ? 58  MET A SD   4  
ATOM 7273  C CE   . MET A 1 58  ? 19.592 -19.674 18.526 1.00 61.54 ? 58  MET A CE   4  
ATOM 7274  H H    . MET A 1 58  ? 14.216 -20.124 20.960 1.00 73.21 ? 58  MET A H    4  
ATOM 7275  H HA   . MET A 1 58  ? 15.871 -22.376 20.635 1.00 12.35 ? 58  MET A HA   4  
ATOM 7276  H HB2  . MET A 1 58  ? 16.218 -19.599 21.627 1.00 5.23  ? 58  MET A HB2  4  
ATOM 7277  H HB3  . MET A 1 58  ? 17.452 -20.765 22.086 1.00 71.45 ? 58  MET A HB3  4  
ATOM 7278  H HG2  . MET A 1 58  ? 17.028 -21.165 19.355 1.00 12.43 ? 58  MET A HG2  4  
ATOM 7279  H HG3  . MET A 1 58  ? 17.045 -19.418 19.584 1.00 12.54 ? 58  MET A HG3  4  
ATOM 7280  H HE1  . MET A 1 58  ? 19.935 -18.662 18.676 1.00 51.52 ? 58  MET A HE1  4  
ATOM 7281  H HE2  . MET A 1 58  ? 20.379 -20.257 18.071 1.00 61.44 ? 58  MET A HE2  4  
ATOM 7282  H HE3  . MET A 1 58  ? 18.727 -19.670 17.879 1.00 53.54 ? 58  MET A HE3  4  
ATOM 7283  N N    . LYS A 1 59  ? 14.754 -21.843 23.641 1.00 22.52 ? 59  LYS A N    4  
ATOM 7284  C CA   . LYS A 1 59  ? 14.646 -22.404 24.983 1.00 44.11 ? 59  LYS A CA   4  
ATOM 7285  C C    . LYS A 1 59  ? 16.019 -22.512 25.639 1.00 21.22 ? 59  LYS A C    4  
ATOM 7286  O O    . LYS A 1 59  ? 16.335 -23.518 26.276 1.00 3.21  ? 59  LYS A O    4  
ATOM 7287  C CB   . LYS A 1 59  ? 13.984 -23.783 24.930 1.00 3.44  ? 59  LYS A CB   4  
ATOM 7288  C CG   . LYS A 1 59  ? 12.517 -23.738 24.540 1.00 20.24 ? 59  LYS A CG   4  
ATOM 7289  C CD   . LYS A 1 59  ? 11.699 -24.744 25.333 1.00 53.03 ? 59  LYS A CD   4  
ATOM 7290  C CE   . LYS A 1 59  ? 11.476 -24.278 26.763 1.00 1.13  ? 59  LYS A CE   4  
ATOM 7291  N NZ   . LYS A 1 59  ? 10.751 -22.978 26.817 1.00 72.43 ? 59  LYS A NZ   4  
ATOM 7292  H H    . LYS A 1 59  ? 14.171 -21.098 23.386 1.00 14.23 ? 59  LYS A H    4  
ATOM 7293  H HA   . LYS A 1 59  ? 14.031 -21.740 25.571 1.00 32.41 ? 59  LYS A HA   4  
ATOM 7294  H HB2  . LYS A 1 59  ? 14.509 -24.393 24.210 1.00 35.21 ? 59  LYS A HB2  4  
ATOM 7295  H HB3  . LYS A 1 59  ? 14.062 -24.243 25.905 1.00 63.44 ? 59  LYS A HB3  4  
ATOM 7296  H HG2  . LYS A 1 59  ? 12.133 -22.747 24.732 1.00 73.33 ? 59  LYS A HG2  4  
ATOM 7297  H HG3  . LYS A 1 59  ? 12.427 -23.964 23.487 1.00 31.23 ? 59  LYS A HG3  4  
ATOM 7298  H HD2  . LYS A 1 59  ? 10.739 -24.871 24.854 1.00 21.22 ? 59  LYS A HD2  4  
ATOM 7299  H HD3  . LYS A 1 59  ? 12.223 -25.689 25.349 1.00 43.15 ? 59  LYS A HD3  4  
ATOM 7300  H HE2  . LYS A 1 59  ? 10.898 -25.025 27.285 1.00 11.35 ? 59  LYS A HE2  4  
ATOM 7301  H HE3  . LYS A 1 59  ? 12.436 -24.165 27.244 1.00 3.35  ? 59  LYS A HE3  4  
ATOM 7302  H HZ1  . LYS A 1 59  ? 10.015 -23.010 27.551 1.00 31.32 ? 59  LYS A HZ1  4  
ATOM 7303  H HZ2  . LYS A 1 59  ? 10.301 -22.782 25.900 1.00 71.31 ? 59  LYS A HZ2  4  
ATOM 7304  H HZ3  . LYS A 1 59  ? 11.413 -22.208 27.038 1.00 42.13 ? 59  LYS A HZ3  4  
ATOM 7305  N N    . CYS A 1 60  ? 16.829 -21.471 25.481 1.00 20.31 ? 60  CYS A N    4  
ATOM 7306  C CA   . CYS A 1 60  ? 18.168 -21.450 26.059 1.00 10.44 ? 60  CYS A CA   4  
ATOM 7307  C C    . CYS A 1 60  ? 18.422 -20.137 26.794 1.00 72.31 ? 60  CYS A C    4  
ATOM 7308  O O    . CYS A 1 60  ? 17.546 -19.275 26.866 1.00 71.12 ? 60  CYS A O    4  
ATOM 7309  C CB   . CYS A 1 60  ? 19.221 -21.649 24.968 1.00 34.10 ? 60  CYS A CB   4  
ATOM 7310  S SG   . CYS A 1 60  ? 19.237 -23.310 24.253 1.00 2.30  ? 60  CYS A SG   4  
ATOM 7311  H H    . CYS A 1 60  ? 16.520 -20.699 24.963 1.00 42.11 ? 60  CYS A H    4  
ATOM 7312  H HA   . CYS A 1 60  ? 18.236 -22.262 26.766 1.00 20.52 ? 60  CYS A HA   4  
ATOM 7313  H HB2  . CYS A 1 60  ? 19.035 -20.949 24.167 1.00 74.14 ? 60  CYS A HB2  4  
ATOM 7314  H HB3  . CYS A 1 60  ? 20.199 -21.459 25.383 1.00 1.42  ? 60  CYS A HB3  4  
ATOM 7315  H HG   . CYS A 1 60  ? 19.476 -23.193 22.956 1.00 73.54 ? 60  CYS A HG   4  
ATOM 7316  N N    . ASP A 1 61  ? 19.625 -19.994 27.339 1.00 14.32 ? 61  ASP A N    4  
ATOM 7317  C CA   . ASP A 1 61  ? 19.994 -18.787 28.069 1.00 10.34 ? 61  ASP A CA   4  
ATOM 7318  C C    . ASP A 1 61  ? 20.743 -17.813 27.166 1.00 44.35 ? 61  ASP A C    4  
ATOM 7319  O O    . ASP A 1 61  ? 21.566 -17.024 27.632 1.00 5.01  ? 61  ASP A O    4  
ATOM 7320  C CB   . ASP A 1 61  ? 20.855 -19.142 29.282 1.00 23.12 ? 61  ASP A CB   4  
ATOM 7321  C CG   . ASP A 1 61  ? 20.024 -19.520 30.492 1.00 34.40 ? 61  ASP A CG   4  
ATOM 7322  O OD1  . ASP A 1 61  ? 19.183 -20.436 30.372 1.00 54.04 ? 61  ASP A OD1  4  
ATOM 7323  O OD2  . ASP A 1 61  ? 20.214 -18.902 31.560 1.00 44.44 ? 61  ASP A OD2  4  
ATOM 7324  H H    . ASP A 1 61  ? 20.280 -20.717 27.248 1.00 42.23 ? 61  ASP A H    4  
ATOM 7325  H HA   . ASP A 1 61  ? 19.085 -18.314 28.411 1.00 62.52 ? 61  ASP A HA   4  
ATOM 7326  H HB2  . ASP A 1 61  ? 21.492 -19.978 29.031 1.00 0.00  ? 61  ASP A HB2  4  
ATOM 7327  H HB3  . ASP A 1 61  ? 21.469 -18.292 29.541 1.00 23.10 ? 61  ASP A HB3  4  
ATOM 7328  N N    . LEU A 1 62  ? 20.454 -17.874 25.870 1.00 3.34  ? 62  LEU A N    4  
ATOM 7329  C CA   . LEU A 1 62  ? 21.102 -16.998 24.900 1.00 54.31 ? 62  LEU A CA   4  
ATOM 7330  C C    . LEU A 1 62  ? 21.041 -15.543 25.354 1.00 54.21 ? 62  LEU A C    4  
ATOM 7331  O O    . LEU A 1 62  ? 19.960 -14.999 25.583 1.00 11.14 ? 62  LEU A O    4  
ATOM 7332  C CB   . LEU A 1 62  ? 20.439 -17.144 23.529 1.00 34.42 ? 62  LEU A CB   4  
ATOM 7333  C CG   . LEU A 1 62  ? 21.358 -17.561 22.380 1.00 35.33 ? 62  LEU A CG   4  
ATOM 7334  C CD1  . LEU A 1 62  ? 20.619 -17.489 21.053 1.00 72.51 ? 62  LEU A CD1  4  
ATOM 7335  C CD2  . LEU A 1 62  ? 22.602 -16.686 22.348 1.00 20.13 ? 62  LEU A CD2  4  
ATOM 7336  H H    . LEU A 1 62  ? 19.790 -18.523 25.558 1.00 1.43  ? 62  LEU A H    4  
ATOM 7337  H HA   . LEU A 1 62  ? 22.137 -17.295 24.824 1.00 72.42 ? 62  LEU A HA   4  
ATOM 7338  H HB2  . LEU A 1 62  ? 19.661 -17.887 23.616 1.00 34.11 ? 62  LEU A HB2  4  
ATOM 7339  H HB3  . LEU A 1 62  ? 19.998 -16.192 23.272 1.00 15.35 ? 62  LEU A HB3  4  
ATOM 7340  H HG   . LEU A 1 62  ? 21.671 -18.585 22.532 1.00 63.00 ? 62  LEU A HG   4  
ATOM 7341  H HD11 . LEU A 1 62  ? 20.794 -16.528 20.595 1.00 14.44 ? 62  LEU A HD11 4  
ATOM 7342  H HD12 . LEU A 1 62  ? 19.560 -17.621 21.223 1.00 44.44 ? 62  LEU A HD12 4  
ATOM 7343  H HD13 . LEU A 1 62  ? 20.978 -18.271 20.399 1.00 54.32 ? 62  LEU A HD13 4  
ATOM 7344  H HD21 . LEU A 1 62  ? 23.152 -16.877 21.439 1.00 42.34 ? 62  LEU A HD21 4  
ATOM 7345  H HD22 . LEU A 1 62  ? 23.225 -16.916 23.201 1.00 43.55 ? 62  LEU A HD22 4  
ATOM 7346  H HD23 . LEU A 1 62  ? 22.312 -15.647 22.383 1.00 50.41 ? 62  LEU A HD23 4  
ATOM 7347  N N    . ILE A 1 63  ? 22.207 -14.918 25.479 1.00 34.22 ? 63  ILE A N    4  
ATOM 7348  C CA   . ILE A 1 63  ? 22.285 -13.525 25.902 1.00 31.52 ? 63  ILE A CA   4  
ATOM 7349  C C    . ILE A 1 63  ? 22.408 -12.593 24.702 1.00 10.42 ? 63  ILE A C    4  
ATOM 7350  O O    . ILE A 1 63  ? 22.998 -12.950 23.682 1.00 11.34 ? 63  ILE A O    4  
ATOM 7351  C CB   . ILE A 1 63  ? 23.479 -13.290 26.846 1.00 61.12 ? 63  ILE A CB   4  
ATOM 7352  C CG1  . ILE A 1 63  ? 23.501 -14.349 27.950 1.00 12.33 ? 63  ILE A CG1  4  
ATOM 7353  C CG2  . ILE A 1 63  ? 23.414 -11.893 27.445 1.00 74.13 ? 63  ILE A CG2  4  
ATOM 7354  C CD1  . ILE A 1 63  ? 24.355 -15.552 27.617 1.00 12.03 ? 63  ILE A CD1  4  
ATOM 7355  H H    . ILE A 1 63  ? 23.033 -15.405 25.282 1.00 64.12 ? 63  ILE A H    4  
ATOM 7356  H HA   . ILE A 1 63  ? 21.377 -13.288 26.437 1.00 33.44 ? 63  ILE A HA   4  
ATOM 7357  H HB   . ILE A 1 63  ? 24.387 -13.365 26.267 1.00 71.20 ? 63  ILE A HB   4  
ATOM 7358  H HG12 . ILE A 1 63  ? 23.888 -13.908 28.855 1.00 22.02 ? 63  ILE A HG12 4  
ATOM 7359  H HG13 . ILE A 1 63  ? 22.493 -14.695 28.126 1.00 15.14 ? 63  ILE A HG13 4  
ATOM 7360  H HG21 . ILE A 1 63  ? 24.127 -11.814 28.252 1.00 52.21 ? 63  ILE A HG21 4  
ATOM 7361  H HG22 . ILE A 1 63  ? 23.650 -11.164 26.684 1.00 31.40 ? 63  ILE A HG22 4  
ATOM 7362  H HG23 . ILE A 1 63  ? 22.419 -11.710 27.823 1.00 4.34  ? 63  ILE A HG23 4  
ATOM 7363  H HD11 . ILE A 1 63  ? 23.812 -16.456 27.854 1.00 45.53 ? 63  ILE A HD11 4  
ATOM 7364  H HD12 . ILE A 1 63  ? 24.598 -15.542 26.566 1.00 42.43 ? 63  ILE A HD12 4  
ATOM 7365  H HD13 . ILE A 1 63  ? 25.266 -15.518 28.198 1.00 71.14 ? 63  ILE A HD13 4  
ATOM 7366  N N    . VAL A 1 64  ? 21.848 -11.394 24.832 1.00 44.23 ? 64  VAL A N    4  
ATOM 7367  C CA   . VAL A 1 64  ? 21.898 -10.407 23.759 1.00 33.23 ? 64  VAL A CA   4  
ATOM 7368  C C    . VAL A 1 64  ? 22.726 -9.194  24.167 1.00 55.44 ? 64  VAL A C    4  
ATOM 7369  O O    . VAL A 1 64  ? 22.813 -8.857  25.347 1.00 43.45 ? 64  VAL A O    4  
ATOM 7370  C CB   . VAL A 1 64  ? 20.485 -9.941  23.360 1.00 0.13  ? 64  VAL A CB   4  
ATOM 7371  C CG1  . VAL A 1 64  ? 19.841 -9.157  24.494 1.00 62.21 ? 64  VAL A CG1  4  
ATOM 7372  C CG2  . VAL A 1 64  ? 20.539 -9.108  22.089 1.00 52.24 ? 64  VAL A CG2  4  
ATOM 7373  H H    . VAL A 1 64  ? 21.392 -11.167 25.669 1.00 62.22 ? 64  VAL A H    4  
ATOM 7374  H HA   . VAL A 1 64  ? 22.357 -10.872 22.899 1.00 50.12 ? 64  VAL A HA   4  
ATOM 7375  H HB   . VAL A 1 64  ? 19.880 -10.815 23.168 1.00 43.12 ? 64  VAL A HB   4  
ATOM 7376  H HG11 . VAL A 1 64  ? 18.767 -9.250  24.430 1.00 11.22 ? 64  VAL A HG11 4  
ATOM 7377  H HG12 . VAL A 1 64  ? 20.182 -9.548  25.441 1.00 21.34 ? 64  VAL A HG12 4  
ATOM 7378  H HG13 . VAL A 1 64  ? 20.117 -8.116  24.414 1.00 62.04 ? 64  VAL A HG13 4  
ATOM 7379  H HG21 . VAL A 1 64  ? 20.761 -8.082  22.341 1.00 51.44 ? 64  VAL A HG21 4  
ATOM 7380  H HG22 . VAL A 1 64  ? 21.310 -9.493  21.437 1.00 31.43 ? 64  VAL A HG22 4  
ATOM 7381  H HG23 . VAL A 1 64  ? 19.585 -9.157  21.585 1.00 60.12 ? 64  VAL A HG23 4  
ATOM 7382  N N    . GLY A 1 65  ? 23.332 -8.539  23.180 1.00 32.35 ? 65  GLY A N    4  
ATOM 7383  C CA   . GLY A 1 65  ? 24.145 -7.369  23.456 1.00 31.43 ? 65  GLY A CA   4  
ATOM 7384  C C    . GLY A 1 65  ? 23.502 -6.088  22.965 1.00 11.40 ? 65  GLY A C    4  
ATOM 7385  O O    . GLY A 1 65  ? 22.698 -5.478  23.671 1.00 62.11 ? 65  GLY A O    4  
ATOM 7386  H H    . GLY A 1 65  ? 23.226 -8.854  22.258 1.00 1.21  ? 65  GLY A H    4  
ATOM 7387  H HA2  . GLY A 1 65  ? 24.301 -7.296  24.522 1.00 30.12 ? 65  GLY A HA2  4  
ATOM 7388  H HA3  . GLY A 1 65  ? 25.102 -7.488  22.970 1.00 50.43 ? 65  GLY A HA3  4  
ATOM 7389  N N    . ASP A 1 66  ? 23.857 -5.676  21.753 1.00 61.52 ? 66  ASP A N    4  
ATOM 7390  C CA   . ASP A 1 66  ? 23.310 -4.458  21.168 1.00 74.03 ? 66  ASP A CA   4  
ATOM 7391  C C    . ASP A 1 66  ? 23.058 -4.638  19.674 1.00 34.10 ? 66  ASP A C    4  
ATOM 7392  O O    . ASP A 1 66  ? 23.391 -5.673  19.097 1.00 23.43 ? 66  ASP A O    4  
ATOM 7393  C CB   . ASP A 1 66  ? 24.261 -3.283  21.399 1.00 25.41 ? 66  ASP A CB   4  
ATOM 7394  C CG   . ASP A 1 66  ? 23.849 -2.428  22.581 1.00 53.24 ? 66  ASP A CG   4  
ATOM 7395  O OD1  . ASP A 1 66  ? 24.377 -2.654  23.689 1.00 12.33 ? 66  ASP A OD1  4  
ATOM 7396  O OD2  . ASP A 1 66  ? 22.997 -1.533  22.397 1.00 40.12 ? 66  ASP A OD2  4  
ATOM 7397  H H    . ASP A 1 66  ? 24.503 -6.206  21.239 1.00 54.34 ? 66  ASP A H    4  
ATOM 7398  H HA   . ASP A 1 66  ? 22.370 -4.249  21.656 1.00 73.12 ? 66  ASP A HA   4  
ATOM 7399  H HB2  . ASP A 1 66  ? 25.255 -3.665  21.585 1.00 42.35 ? 66  ASP A HB2  4  
ATOM 7400  H HB3  . ASP A 1 66  ? 24.278 -2.662  20.516 1.00 74.33 ? 66  ASP A HB3  4  
ATOM 7401  N N    . LYS A 1 67  ? 22.466 -3.624  19.053 1.00 53.34 ? 67  LYS A N    4  
ATOM 7402  C CA   . LYS A 1 67  ? 22.168 -3.668  17.626 1.00 63.41 ? 67  LYS A CA   4  
ATOM 7403  C C    . LYS A 1 67  ? 23.451 -3.633  16.801 1.00 1.44  ? 67  LYS A C    4  
ATOM 7404  O O    . LYS A 1 67  ? 24.362 -2.854  17.085 1.00 32.41 ? 67  LYS A O    4  
ATOM 7405  C CB   . LYS A 1 67  ? 21.265 -2.496  17.235 1.00 24.22 ? 67  LYS A CB   4  
ATOM 7406  C CG   . LYS A 1 67  ? 20.878 -2.490  15.767 1.00 73.24 ? 67  LYS A CG   4  
ATOM 7407  C CD   . LYS A 1 67  ? 19.613 -3.295  15.521 1.00 74.04 ? 67  LYS A CD   4  
ATOM 7408  C CE   . LYS A 1 67  ? 18.824 -2.747  14.341 1.00 31.01 ? 67  LYS A CE   4  
ATOM 7409  N NZ   . LYS A 1 67  ? 18.215 -1.423  14.648 1.00 31.21 ? 67  LYS A NZ   4  
ATOM 7410  H H    . LYS A 1 67  ? 22.223 -2.824  19.567 1.00 64.45 ? 67  LYS A H    4  
ATOM 7411  H HA   . LYS A 1 67  ? 21.650 -4.594  17.424 1.00 43.32 ? 67  LYS A HA   4  
ATOM 7412  H HB2  . LYS A 1 67  ? 20.362 -2.542  17.825 1.00 55.45 ? 67  LYS A HB2  4  
ATOM 7413  H HB3  . LYS A 1 67  ? 21.781 -1.572  17.453 1.00 22.04 ? 67  LYS A HB3  4  
ATOM 7414  H HG2  . LYS A 1 67  ? 20.710 -1.471  15.452 1.00 51.11 ? 67  LYS A HG2  4  
ATOM 7415  H HG3  . LYS A 1 67  ? 21.684 -2.919  15.189 1.00 24.01 ? 67  LYS A HG3  4  
ATOM 7416  H HD2  . LYS A 1 67  ? 19.883 -4.320  15.313 1.00 15.23 ? 67  LYS A HD2  4  
ATOM 7417  H HD3  . LYS A 1 67  ? 18.994 -3.256  16.406 1.00 54.21 ? 67  LYS A HD3  4  
ATOM 7418  H HE2  . LYS A 1 67  ? 19.489 -2.641  13.498 1.00 4.42  ? 67  LYS A HE2  4  
ATOM 7419  H HE3  . LYS A 1 67  ? 18.039 -3.446  14.094 1.00 70.41 ? 67  LYS A HE3  4  
ATOM 7420  H HZ1  . LYS A 1 67  ? 17.340 -1.297  14.099 1.00 5.31  ? 67  LYS A HZ1  4  
ATOM 7421  H HZ2  . LYS A 1 67  ? 18.877 -0.660  14.404 1.00 43.11 ? 67  LYS A HZ2  4  
ATOM 7422  H HZ3  . LYS A 1 67  ? 17.988 -1.360  15.661 1.00 70.31 ? 67  LYS A HZ3  4  
ATOM 7423  N N    . VAL A 1 68  ? 23.516 -4.479  15.778 1.00 15.03 ? 68  VAL A N    4  
ATOM 7424  C CA   . VAL A 1 68  ? 24.686 -4.542  14.911 1.00 73.11 ? 68  VAL A CA   4  
ATOM 7425  C C    . VAL A 1 68  ? 24.523 -3.629  13.701 1.00 74.32 ? 68  VAL A C    4  
ATOM 7426  O O    . VAL A 1 68  ? 25.408 -2.832  13.388 1.00 35.03 ? 68  VAL A O    4  
ATOM 7427  C CB   . VAL A 1 68  ? 24.947 -5.980  14.424 1.00 13.11 ? 68  VAL A CB   4  
ATOM 7428  C CG1  . VAL A 1 68  ? 26.253 -6.052  13.648 1.00 72.21 ? 68  VAL A CG1  4  
ATOM 7429  C CG2  . VAL A 1 68  ? 24.961 -6.945  15.600 1.00 64.44 ? 68  VAL A CG2  4  
ATOM 7430  H H    . VAL A 1 68  ? 22.758 -5.075  15.602 1.00 14.34 ? 68  VAL A H    4  
ATOM 7431  H HA   . VAL A 1 68  ? 25.543 -4.217  15.482 1.00 10.33 ? 68  VAL A HA   4  
ATOM 7432  H HB   . VAL A 1 68  ? 24.143 -6.265  13.761 1.00 63.30 ? 68  VAL A HB   4  
ATOM 7433  H HG11 . VAL A 1 68  ? 26.123 -6.688  12.785 1.00 62.35 ? 68  VAL A HG11 4  
ATOM 7434  H HG12 . VAL A 1 68  ? 26.537 -5.061  13.327 1.00 54.31 ? 68  VAL A HG12 4  
ATOM 7435  H HG13 . VAL A 1 68  ? 27.026 -6.461  14.282 1.00 51.20 ? 68  VAL A HG13 4  
ATOM 7436  H HG21 . VAL A 1 68  ? 25.716 -7.700  15.435 1.00 3.23  ? 68  VAL A HG21 4  
ATOM 7437  H HG22 . VAL A 1 68  ? 25.185 -6.404  16.508 1.00 70.52 ? 68  VAL A HG22 4  
ATOM 7438  H HG23 . VAL A 1 68  ? 23.994 -7.417  15.691 1.00 43.11 ? 68  VAL A HG23 4  
ATOM 7439  N N    . ILE A 1 69  ? 23.386 -3.751  13.024 1.00 71.23 ? 69  ILE A N    4  
ATOM 7440  C CA   . ILE A 1 69  ? 23.106 -2.936  11.848 1.00 2.44  ? 69  ILE A CA   4  
ATOM 7441  C C    . ILE A 1 69  ? 21.694 -3.185  11.330 1.00 11.40 ? 69  ILE A C    4  
ATOM 7442  O O    . ILE A 1 69  ? 21.146 -4.277  11.485 1.00 4.24  ? 69  ILE A O    4  
ATOM 7443  C CB   . ILE A 1 69  ? 24.113 -3.215  10.717 1.00 51.21 ? 69  ILE A CB   4  
ATOM 7444  C CG1  . ILE A 1 69  ? 23.961 -2.178  9.602  1.00 12.00 ? 69  ILE A CG1  4  
ATOM 7445  C CG2  . ILE A 1 69  ? 23.918 -4.621  10.170 1.00 64.11 ? 69  ILE A CG2  4  
ATOM 7446  C CD1  . ILE A 1 69  ? 25.194 -2.035  8.738  1.00 52.24 ? 69  ILE A CD1  4  
ATOM 7447  H H    . ILE A 1 69  ? 22.719 -4.404  13.322 1.00 64.30 ? 69  ILE A H    4  
ATOM 7448  H HA   . ILE A 1 69  ? 23.195 -1.897  12.135 1.00 64.54 ? 69  ILE A HA   4  
ATOM 7449  H HB   . ILE A 1 69  ? 25.109 -3.149  11.127 1.00 50.40 ? 69  ILE A HB   4  
ATOM 7450  H HG12 . ILE A 1 69  ? 23.140 -2.463  8.963  1.00 30.12 ? 69  ILE A HG12 4  
ATOM 7451  H HG13 . ILE A 1 69  ? 23.750 -1.214  10.043 1.00 22.43 ? 69  ILE A HG13 4  
ATOM 7452  H HG21 . ILE A 1 69  ? 24.752 -4.878  9.534  1.00 65.42 ? 69  ILE A HG21 4  
ATOM 7453  H HG22 . ILE A 1 69  ? 23.863 -5.321  10.990 1.00 60.31 ? 69  ILE A HG22 4  
ATOM 7454  H HG23 . ILE A 1 69  ? 23.004 -4.662  9.598  1.00 34.13 ? 69  ILE A HG23 4  
ATOM 7455  H HD11 . ILE A 1 69  ? 25.063 -2.600  7.827  1.00 62.42 ? 69  ILE A HD11 4  
ATOM 7456  H HD12 . ILE A 1 69  ? 25.347 -0.994  8.497  1.00 11.33 ? 69  ILE A HD12 4  
ATOM 7457  H HD13 . ILE A 1 69  ? 26.054 -2.411  9.273  1.00 1.40  ? 69  ILE A HD13 4  
ATOM 7458  N N    . THR A 1 70  ? 21.108 -2.164  10.711 1.00 61.32 ? 70  THR A N    4  
ATOM 7459  C CA   . THR A 1 70  ? 19.760 -2.272  10.168 1.00 13.22 ? 70  THR A CA   4  
ATOM 7460  C C    . THR A 1 70  ? 19.782 -2.309  8.644  1.00 34.15 ? 70  THR A C    4  
ATOM 7461  O O    . THR A 1 70  ? 19.713 -1.271  7.986  1.00 3.40  ? 70  THR A O    4  
ATOM 7462  C CB   . THR A 1 70  ? 18.874 -1.099  10.629 1.00 34.21 ? 70  THR A CB   4  
ATOM 7463  O OG1  . THR A 1 70  ? 19.049 -0.875  12.032 1.00 12.34 ? 70  THR A OG1  4  
ATOM 7464  C CG2  . THR A 1 70  ? 17.408 -1.380  10.334 1.00 32.25 ? 70  THR A CG2  4  
ATOM 7465  H H    . THR A 1 70  ? 21.596 -1.319  10.618 1.00 34.32 ? 70  THR A H    4  
ATOM 7466  H HA   . THR A 1 70  ? 19.325 -3.190  10.535 1.00 32.21 ? 70  THR A HA   4  
ATOM 7467  H HB   . THR A 1 70  ? 19.170 -0.211  10.090 1.00 11.52 ? 70  THR A HB   4  
ATOM 7468  H HG1  . THR A 1 70  ? 18.747 0.009   12.255 1.00 14.14 ? 70  THR A HG1  4  
ATOM 7469  H HG21 . THR A 1 70  ? 16.834 -0.475  10.469 1.00 74.43 ? 70  THR A HG21 4  
ATOM 7470  H HG22 . THR A 1 70  ? 17.045 -2.141  11.009 1.00 14.02 ? 70  THR A HG22 4  
ATOM 7471  H HG23 . THR A 1 70  ? 17.305 -1.723  9.316  1.00 22.30 ? 70  THR A HG23 4  
ATOM 7472  N N    . THR A 1 71  ? 19.877 -3.513  8.088  1.00 55.33 ? 71  THR A N    4  
ATOM 7473  C CA   . THR A 1 71  ? 19.908 -3.685  6.641  1.00 73.31 ? 71  THR A CA   4  
ATOM 7474  C C    . THR A 1 71  ? 18.515 -3.971  6.091  1.00 30.21 ? 71  THR A C    4  
ATOM 7475  O O    . THR A 1 71  ? 17.847 -4.908  6.526  1.00 31.34 ? 71  THR A O    4  
ATOM 7476  C CB   . THR A 1 71  ? 20.854 -4.830  6.232  1.00 73.10 ? 71  THR A CB   4  
ATOM 7477  O OG1  . THR A 1 71  ? 21.889 -4.983  7.210  1.00 73.24 ? 71  THR A OG1  4  
ATOM 7478  C CG2  . THR A 1 71  ? 21.473 -4.560  4.869  1.00 54.21 ? 71  THR A CG2  4  
ATOM 7479  H H    . THR A 1 71  ? 19.927 -4.303  8.665  1.00 5.44  ? 71  THR A H    4  
ATOM 7480  H HA   . THR A 1 71  ? 20.276 -2.768  6.204  1.00 72.55 ? 71  THR A HA   4  
ATOM 7481  H HB   . THR A 1 71  ? 20.283 -5.746  6.177  1.00 52.04 ? 71  THR A HB   4  
ATOM 7482  H HG1  . THR A 1 71  ? 21.861 -5.874  7.568  1.00 45.21 ? 71  THR A HG1  4  
ATOM 7483  H HG21 . THR A 1 71  ? 21.816 -3.537  4.826  1.00 53.34 ? 71  THR A HG21 4  
ATOM 7484  H HG22 . THR A 1 71  ? 20.734 -4.725  4.099  1.00 14.10 ? 71  THR A HG22 4  
ATOM 7485  H HG23 . THR A 1 71  ? 22.308 -5.226  4.715  1.00 40.00 ? 71  THR A HG23 4  
ATOM 7486  N N    . GLU A 1 72  ? 18.084 -3.158  5.132  1.00 51.11 ? 72  GLU A N    4  
ATOM 7487  C CA   . GLU A 1 72  ? 16.769 -3.325  4.523  1.00 24.03 ? 72  GLU A CA   4  
ATOM 7488  C C    . GLU A 1 72  ? 16.872 -3.333  3.001  1.00 71.42 ? 72  GLU A C    4  
ATOM 7489  O O    . GLU A 1 72  ? 17.645 -2.574  2.415  1.00 34.21 ? 72  GLU A O    4  
ATOM 7490  C CB   . GLU A 1 72  ? 15.827 -2.207  4.976  1.00 65.42 ? 72  GLU A CB   4  
ATOM 7491  C CG   . GLU A 1 72  ? 15.416 -2.312  6.435  1.00 40.42 ? 72  GLU A CG   4  
ATOM 7492  C CD   . GLU A 1 72  ? 15.190 -0.956  7.076  1.00 43.14 ? 72  GLU A CD   4  
ATOM 7493  O OE1  . GLU A 1 72  ? 14.782 -0.020  6.357  1.00 35.11 ? 72  GLU A OE1  4  
ATOM 7494  O OE2  . GLU A 1 72  ? 15.422 -0.831  8.296  1.00 25.54 ? 72  GLU A OE2  4  
ATOM 7495  H H    . GLU A 1 72  ? 18.663 -2.429  4.827  1.00 11.51 ? 72  GLU A H    4  
ATOM 7496  H HA   . GLU A 1 72  ? 16.371 -4.273  4.850  1.00 33.43 ? 72  GLU A HA   4  
ATOM 7497  H HB2  . GLU A 1 72  ? 16.319 -1.257  4.828  1.00 11.13 ? 72  GLU A HB2  4  
ATOM 7498  H HB3  . GLU A 1 72  ? 14.935 -2.238  4.369  1.00 74.40 ? 72  GLU A HB3  4  
ATOM 7499  H HG2  . GLU A 1 72  ? 14.500 -2.879  6.498  1.00 74.14 ? 72  GLU A HG2  4  
ATOM 7500  H HG3  . GLU A 1 72  ? 16.194 -2.826  6.979  1.00 4.33  ? 72  GLU A HG3  4  
ATOM 7501  N N    . HIS A 1 73  ? 16.087 -4.198  2.365  1.00 22.14 ? 73  HIS A N    4  
ATOM 7502  C CA   . HIS A 1 73  ? 16.089 -4.306  0.911  1.00 70.22 ? 73  HIS A CA   4  
ATOM 7503  C C    . HIS A 1 73  ? 14.673 -4.186  0.355  1.00 1.04  ? 73  HIS A C    4  
ATOM 7504  O O    . HIS A 1 73  ? 13.771 -4.912  0.770  1.00 34.31 ? 73  HIS A O    4  
ATOM 7505  C CB   . HIS A 1 73  ? 16.708 -5.636  0.478  1.00 50.51 ? 73  HIS A CB   4  
ATOM 7506  C CG   . HIS A 1 73  ? 18.037 -5.912  1.111  1.00 13.02 ? 73  HIS A CG   4  
ATOM 7507  N ND1  . HIS A 1 73  ? 19.225 -5.883  0.411  1.00 14.15 ? 73  HIS A ND1  4  
ATOM 7508  C CD2  . HIS A 1 73  ? 18.361 -6.223  2.388  1.00 5.40  ? 73  HIS A CD2  4  
ATOM 7509  C CE1  . HIS A 1 73  ? 20.222 -6.165  1.230  1.00 22.31 ? 73  HIS A CE1  4  
ATOM 7510  N NE2  . HIS A 1 73  ? 19.725 -6.375  2.436  1.00 63.13 ? 73  HIS A NE2  4  
ATOM 7511  H H    . HIS A 1 73  ? 15.493 -4.777  2.887  1.00 10.41 ? 73  HIS A H    4  
ATOM 7512  H HA   . HIS A 1 73  ? 16.686 -3.497  0.519  1.00 52.31 ? 73  HIS A HA   4  
ATOM 7513  H HB2  . HIS A 1 73  ? 16.040 -6.440  0.746  1.00 75.52 ? 73  HIS A HB2  4  
ATOM 7514  H HB3  . HIS A 1 73  ? 16.845 -5.629  -0.594 1.00 21.41 ? 73  HIS A HB3  4  
ATOM 7515  H HD1  . HIS A 1 73  ? 19.322 -5.686  -0.543 1.00 74.32 ? 73  HIS A HD1  4  
ATOM 7516  H HD2  . HIS A 1 73  ? 17.675 -6.331  3.217  1.00 64.05 ? 73  HIS A HD2  4  
ATOM 7517  H HE1  . HIS A 1 73  ? 21.267 -6.216  0.960  1.00 15.35 ? 73  HIS A HE1  4  
ATOM 7518  N N    . GLU A 1 74  ? 14.487 -3.264  -0.584 1.00 2.20  ? 74  GLU A N    4  
ATOM 7519  C CA   . GLU A 1 74  ? 13.180 -3.048  -1.194 1.00 65.31 ? 74  GLU A CA   4  
ATOM 7520  C C    . GLU A 1 74  ? 12.871 -4.138  -2.216 1.00 72.50 ? 74  GLU A C    4  
ATOM 7521  O O    . GLU A 1 74  ? 13.685 -4.433  -3.092 1.00 32.14 ? 74  GLU A O    4  
ATOM 7522  C CB   . GLU A 1 74  ? 13.127 -1.674  -1.865 1.00 73.44 ? 74  GLU A CB   4  
ATOM 7523  C CG   . GLU A 1 74  ? 11.820 -1.403  -2.593 1.00 24.14 ? 74  GLU A CG   4  
ATOM 7524  C CD   . GLU A 1 74  ? 11.733 0.013   -3.127 1.00 5.42  ? 74  GLU A CD   4  
ATOM 7525  O OE1  . GLU A 1 74  ? 11.465 0.177   -4.335 1.00 64.13 ? 74  GLU A OE1  4  
ATOM 7526  O OE2  . GLU A 1 74  ? 11.934 0.959   -2.335 1.00 75.44 ? 74  GLU A OE2  4  
ATOM 7527  H H    . GLU A 1 74  ? 15.246 -2.715  -0.873 1.00 23.51 ? 74  GLU A H    4  
ATOM 7528  H HA   . GLU A 1 74  ? 12.439 -3.085  -0.411 1.00 33.03 ? 74  GLU A HA   4  
ATOM 7529  H HB2  . GLU A 1 74  ? 13.260 -0.913  -1.111 1.00 44.02 ? 74  GLU A HB2  4  
ATOM 7530  H HB3  . GLU A 1 74  ? 13.933 -1.605  -2.580 1.00 61.25 ? 74  GLU A HB3  4  
ATOM 7531  H HG2  . GLU A 1 74  ? 11.735 -2.090  -3.421 1.00 41.34 ? 74  GLU A HG2  4  
ATOM 7532  H HG3  . GLU A 1 74  ? 11.001 -1.565  -1.907 1.00 44.42 ? 74  GLU A HG3  4  
ATOM 7533  N N    . TYR A 1 75  ? 11.689 -4.734  -2.097 1.00 43.22 ? 75  TYR A N    4  
ATOM 7534  C CA   . TYR A 1 75  ? 11.272 -5.793  -3.008 1.00 23.41 ? 75  TYR A CA   4  
ATOM 7535  C C    . TYR A 1 75  ? 9.965  -5.430  -3.705 1.00 12.52 ? 75  TYR A C    4  
ATOM 7536  O O    . TYR A 1 75  ? 9.319  -4.439  -3.360 1.00 63.53 ? 75  TYR A O    4  
ATOM 7537  C CB   . TYR A 1 75  ? 11.109 -7.112  -2.249 1.00 42.44 ? 75  TYR A CB   4  
ATOM 7538  C CG   . TYR A 1 75  ? 12.305 -8.029  -2.366 1.00 61.42 ? 75  TYR A CG   4  
ATOM 7539  C CD1  . TYR A 1 75  ? 12.717 -8.512  -3.602 1.00 23.30 ? 75  TYR A CD1  4  
ATOM 7540  C CD2  . TYR A 1 75  ? 13.024 -8.413  -1.240 1.00 54.23 ? 75  TYR A CD2  4  
ATOM 7541  C CE1  . TYR A 1 75  ? 13.809 -9.352  -3.713 1.00 52.40 ? 75  TYR A CE1  4  
ATOM 7542  C CE2  . TYR A 1 75  ? 14.117 -9.251  -1.342 1.00 44.50 ? 75  TYR A CE2  4  
ATOM 7543  C CZ   . TYR A 1 75  ? 14.506 -9.718  -2.580 1.00 53.34 ? 75  TYR A CZ   4  
ATOM 7544  O OH   . TYR A 1 75  ? 15.594 -10.552 -2.687 1.00 25.40 ? 75  TYR A OH   4  
ATOM 7545  H H    . TYR A 1 75  ? 11.083 -4.455  -1.379 1.00 64.51 ? 75  TYR A H    4  
ATOM 7546  H HA   . TYR A 1 75  ? 12.044 -5.912  -3.754 1.00 61.03 ? 75  TYR A HA   4  
ATOM 7547  H HB2  . TYR A 1 75  ? 10.955 -6.900  -1.203 1.00 24.14 ? 75  TYR A HB2  4  
ATOM 7548  H HB3  . TYR A 1 75  ? 10.248 -7.637  -2.636 1.00 23.20 ? 75  TYR A HB3  4  
ATOM 7549  H HD1  . TYR A 1 75  ? 12.169 -8.223  -4.487 1.00 63.22 ? 75  TYR A HD1  4  
ATOM 7550  H HD2  . TYR A 1 75  ? 12.717 -8.045  -0.272 1.00 20.34 ? 75  TYR A HD2  4  
ATOM 7551  H HE1  . TYR A 1 75  ? 14.113 -9.717  -4.683 1.00 24.14 ? 75  TYR A HE1  4  
ATOM 7552  H HE2  . TYR A 1 75  ? 14.663 -9.538  -0.455 1.00 44.34 ? 75  TYR A HE2  4  
ATOM 7553  H HH   . TYR A 1 75  ? 15.764 -10.740 -3.613 1.00 71.32 ? 75  TYR A HH   4  
ATOM 7554  N N    . ASP A 1 76  ? 9.581  -6.238  -4.686 1.00 53.15 ? 76  ASP A N    4  
ATOM 7555  C CA   . ASP A 1 76  ? 8.350  -6.004  -5.432 1.00 55.22 ? 76  ASP A CA   4  
ATOM 7556  C C    . ASP A 1 76  ? 7.147  -6.576  -4.688 1.00 53.34 ? 76  ASP A C    4  
ATOM 7557  O O    . ASP A 1 76  ? 6.086  -5.953  -4.631 1.00 30.25 ? 76  ASP A O    4  
ATOM 7558  C CB   . ASP A 1 76  ? 8.446  -6.626  -6.826 1.00 21.10 ? 76  ASP A CB   4  
ATOM 7559  C CG   . ASP A 1 76  ? 8.986  -8.042  -6.792 1.00 32.45 ? 76  ASP A CG   4  
ATOM 7560  O OD1  . ASP A 1 76  ? 8.170  -8.989  -6.795 1.00 5.33  ? 76  ASP A OD1  4  
ATOM 7561  O OD2  . ASP A 1 76  ? 10.223 -8.205  -6.762 1.00 44.43 ? 76  ASP A OD2  4  
ATOM 7562  H H    . ASP A 1 76  ? 10.138 -7.011  -4.915 1.00 23.23 ? 76  ASP A H    4  
ATOM 7563  H HA   . ASP A 1 76  ? 8.220  -4.937  -5.533 1.00 5.33  ? 76  ASP A HA   4  
ATOM 7564  H HB2  . ASP A 1 76  ? 7.463  -6.646  -7.273 1.00 73.41 ? 76  ASP A HB2  4  
ATOM 7565  H HB3  . ASP A 1 76  ? 9.103  -6.024  -7.437 1.00 75.30 ? 76  ASP A HB3  4  
ATOM 7566  N N    . PHE A 1 77  ? 7.319  -7.765  -4.121 1.00 72.24 ? 77  PHE A N    4  
ATOM 7567  C CA   . PHE A 1 77  ? 6.247  -8.422  -3.383 1.00 31.50 ? 77  PHE A CA   4  
ATOM 7568  C C    . PHE A 1 77  ? 6.148  -7.872  -1.963 1.00 73.32 ? 77  PHE A C    4  
ATOM 7569  O O    . PHE A 1 77  ? 5.102  -7.964  -1.322 1.00 11.22 ? 77  PHE A O    4  
ATOM 7570  C CB   . PHE A 1 77  ? 6.480  -9.934  -3.341 1.00 61.11 ? 77  PHE A CB   4  
ATOM 7571  C CG   . PHE A 1 77  ? 7.843  -10.317 -2.839 1.00 40.32 ? 77  PHE A CG   4  
ATOM 7572  C CD1  . PHE A 1 77  ? 8.143  -10.248 -1.488 1.00 51.42 ? 77  PHE A CD1  4  
ATOM 7573  C CD2  . PHE A 1 77  ? 8.824  -10.746 -3.718 1.00 42.02 ? 77  PHE A CD2  4  
ATOM 7574  C CE1  . PHE A 1 77  ? 9.397  -10.598 -1.024 1.00 75.30 ? 77  PHE A CE1  4  
ATOM 7575  C CE2  . PHE A 1 77  ? 10.080 -11.098 -3.260 1.00 34.52 ? 77  PHE A CE2  4  
ATOM 7576  C CZ   . PHE A 1 77  ? 10.366 -11.025 -1.911 1.00 33.44 ? 77  PHE A CZ   4  
ATOM 7577  H H    . PHE A 1 77  ? 8.188  -8.212  -4.202 1.00 52.13 ? 77  PHE A H    4  
ATOM 7578  H HA   . PHE A 1 77  ? 5.320  -8.224  -3.899 1.00 1.13  ? 77  PHE A HA   4  
ATOM 7579  H HB2  . PHE A 1 77  ? 5.748  -10.386 -2.689 1.00 21.11 ? 77  PHE A HB2  4  
ATOM 7580  H HB3  . PHE A 1 77  ? 6.366  -10.336 -4.336 1.00 65.15 ? 77  PHE A HB3  4  
ATOM 7581  H HD1  . PHE A 1 77  ? 7.386  -9.915  -0.793 1.00 52.24 ? 77  PHE A HD1  4  
ATOM 7582  H HD2  . PHE A 1 77  ? 8.601  -10.804 -4.775 1.00 1.25  ? 77  PHE A HD2  4  
ATOM 7583  H HE1  . PHE A 1 77  ? 9.618  -10.541 0.031  1.00 14.44 ? 77  PHE A HE1  4  
ATOM 7584  H HE2  . PHE A 1 77  ? 10.835 -11.432 -3.956 1.00 12.00 ? 77  PHE A HE2  4  
ATOM 7585  H HZ   . PHE A 1 77  ? 11.346 -11.300 -1.550 1.00 51.44 ? 77  PHE A HZ   4  
ATOM 7586  N N    . GLY A 1 78  ? 7.246  -7.300  -1.478 1.00 71.43 ? 78  GLY A N    4  
ATOM 7587  C CA   . GLY A 1 78  ? 7.263  -6.744  -0.138 1.00 32.41 ? 78  GLY A CA   4  
ATOM 7588  C C    . GLY A 1 78  ? 8.670  -6.531  0.383  1.00 10.44 ? 78  GLY A C    4  
ATOM 7589  O O    . GLY A 1 78  ? 9.481  -7.457  0.398  1.00 60.13 ? 78  GLY A O    4  
ATOM 7590  H H    . GLY A 1 78  ? 8.051  -7.256  -2.035 1.00 42.13 ? 78  GLY A H    4  
ATOM 7591  H HA2  . GLY A 1 78  ? 6.745  -5.797  -0.146 1.00 42.25 ? 78  GLY A HA2  4  
ATOM 7592  H HA3  . GLY A 1 78  ? 6.744  -7.420  0.526  1.00 23.43 ? 78  GLY A HA3  4  
ATOM 7593  N N    . ILE A 1 79  ? 8.961  -5.307  0.811  1.00 2.21  ? 79  ILE A N    4  
ATOM 7594  C CA   . ILE A 1 79  ? 10.280 -4.975  1.335  1.00 43.12 ? 79  ILE A CA   4  
ATOM 7595  C C    . ILE A 1 79  ? 10.683 -5.928  2.454  1.00 22.55 ? 79  ILE A C    4  
ATOM 7596  O O    . ILE A 1 79  ? 9.850  -6.347  3.258  1.00 73.30 ? 79  ILE A O    4  
ATOM 7597  C CB   . ILE A 1 79  ? 10.328 -3.530  1.865  1.00 44.44 ? 79  ILE A CB   4  
ATOM 7598  C CG1  . ILE A 1 79  ? 9.929  -2.546  0.763  1.00 43.23 ? 79  ILE A CG1  4  
ATOM 7599  C CG2  . ILE A 1 79  ? 11.717 -3.205  2.394  1.00 64.40 ? 79  ILE A CG2  4  
ATOM 7600  C CD1  . ILE A 1 79  ? 10.183 -1.099  1.124  1.00 42.15 ? 79  ILE A CD1  4  
ATOM 7601  H H    . ILE A 1 79  ? 8.272  -4.611  0.774  1.00 25.03 ? 79  ILE A H    4  
ATOM 7602  H HA   . ILE A 1 79  ? 10.992 -5.065  0.526  1.00 12.35 ? 79  ILE A HA   4  
ATOM 7603  H HB   . ILE A 1 79  ? 9.629  -3.446  2.682  1.00 22.14 ? 79  ILE A HB   4  
ATOM 7604  H HG12 . ILE A 1 79  ? 10.492 -2.768  -0.130 1.00 54.25 ? 79  ILE A HG12 4  
ATOM 7605  H HG13 . ILE A 1 79  ? 8.875  -2.657  0.556  1.00 34.11 ? 79  ILE A HG13 4  
ATOM 7606  H HG21 . ILE A 1 79  ? 11.996 -3.933  3.142  1.00 64.34 ? 79  ILE A HG21 4  
ATOM 7607  H HG22 . ILE A 1 79  ? 12.428 -3.235  1.582  1.00 73.05 ? 79  ILE A HG22 4  
ATOM 7608  H HG23 . ILE A 1 79  ? 11.714 -2.220  2.834  1.00 2.15  ? 79  ILE A HG23 4  
ATOM 7609  H HD11 . ILE A 1 79  ? 9.691  -0.868  2.057  1.00 61.51 ? 79  ILE A HD11 4  
ATOM 7610  H HD12 . ILE A 1 79  ? 11.245 -0.933  1.225  1.00 61.53 ? 79  ILE A HD12 4  
ATOM 7611  H HD13 . ILE A 1 79  ? 9.792  -0.460  0.344  1.00 2.05  ? 79  ILE A HD13 4  
ATOM 7612  N N    . VAL A 1 80  ? 11.968 -6.267  2.503  1.00 52.04 ? 80  VAL A N    4  
ATOM 7613  C CA   . VAL A 1 80  ? 12.483 -7.169  3.526  1.00 51.02 ? 80  VAL A CA   4  
ATOM 7614  C C    . VAL A 1 80  ? 13.456 -6.450  4.453  1.00 41.31 ? 80  VAL A C    4  
ATOM 7615  O O    . VAL A 1 80  ? 14.465 -5.903  4.007  1.00 23.41 ? 80  VAL A O    4  
ATOM 7616  C CB   . VAL A 1 80  ? 13.192 -8.384  2.898  1.00 52.32 ? 80  VAL A CB   4  
ATOM 7617  C CG1  . VAL A 1 80  ? 14.306 -7.930  1.967  1.00 1.43  ? 80  VAL A CG1  4  
ATOM 7618  C CG2  . VAL A 1 80  ? 13.733 -9.303  3.982  1.00 72.40 ? 80  VAL A CG2  4  
ATOM 7619  H H    . VAL A 1 80  ? 12.584 -5.901  1.834  1.00 11.44 ? 80  VAL A H    4  
ATOM 7620  H HA   . VAL A 1 80  ? 11.646 -7.528  4.107  1.00 53.13 ? 80  VAL A HA   4  
ATOM 7621  H HB   . VAL A 1 80  ? 12.469 -8.935  2.315  1.00 72.20 ? 80  VAL A HB   4  
ATOM 7622  H HG11 . VAL A 1 80  ? 14.657 -8.772  1.389  1.00 40.31 ? 80  VAL A HG11 4  
ATOM 7623  H HG12 . VAL A 1 80  ? 13.931 -7.165  1.302  1.00 24.43 ? 80  VAL A HG12 4  
ATOM 7624  H HG13 . VAL A 1 80  ? 15.122 -7.530  2.552  1.00 62.44 ? 80  VAL A HG13 4  
ATOM 7625  H HG21 . VAL A 1 80  ? 14.494 -8.785  4.546  1.00 62.24 ? 80  VAL A HG21 4  
ATOM 7626  H HG22 . VAL A 1 80  ? 12.929 -9.592  4.644  1.00 61.21 ? 80  VAL A HG22 4  
ATOM 7627  H HG23 . VAL A 1 80  ? 14.158 -10.185 3.527  1.00 24.42 ? 80  VAL A HG23 4  
ATOM 7628  N N    . ARG A 1 81  ? 13.146 -6.454  5.745  1.00 24.13 ? 81  ARG A N    4  
ATOM 7629  C CA   . ARG A 1 81  ? 13.994 -5.801  6.736  1.00 35.32 ? 81  ARG A CA   4  
ATOM 7630  C C    . ARG A 1 81  ? 14.708 -6.833  7.605  1.00 13.40 ? 81  ARG A C    4  
ATOM 7631  O O    . ARG A 1 81  ? 14.092 -7.478  8.454  1.00 33.40 ? 81  ARG A O    4  
ATOM 7632  C CB   . ARG A 1 81  ? 13.160 -4.868  7.615  1.00 13.45 ? 81  ARG A CB   4  
ATOM 7633  C CG   . ARG A 1 81  ? 12.132 -4.058  6.841  1.00 23.12 ? 81  ARG A CG   4  
ATOM 7634  C CD   . ARG A 1 81  ? 11.368 -3.111  7.753  1.00 54.14 ? 81  ARG A CD   4  
ATOM 7635  N NE   . ARG A 1 81  ? 11.974 -1.783  7.795  1.00 24.20 ? 81  ARG A NE   4  
ATOM 7636  C CZ   . ARG A 1 81  ? 11.357 -0.708  8.271  1.00 53.20 ? 81  ARG A CZ   4  
ATOM 7637  N NH1  . ARG A 1 81  ? 10.121 -0.803  8.743  1.00 64.21 ? 81  ARG A NH1  4  
ATOM 7638  N NH2  . ARG A 1 81  ? 11.975 0.466   8.276  1.00 41.21 ? 81  ARG A NH2  4  
ATOM 7639  H H    . ARG A 1 81  ? 12.328 -6.906  6.040  1.00 63.53 ? 81  ARG A H    4  
ATOM 7640  H HA   . ARG A 1 81  ? 14.733 -5.219  6.208  1.00 4.41  ? 81  ARG A HA   4  
ATOM 7641  H HB2  . ARG A 1 81  ? 12.638 -5.458  8.354  1.00 34.20 ? 81  ARG A HB2  4  
ATOM 7642  H HB3  . ARG A 1 81  ? 13.822 -4.180  8.119  1.00 25.20 ? 81  ARG A HB3  4  
ATOM 7643  H HG2  . ARG A 1 81  ? 12.640 -3.479  6.084  1.00 61.32 ? 81  ARG A HG2  4  
ATOM 7644  H HG3  . ARG A 1 81  ? 11.434 -4.735  6.372  1.00 30.01 ? 81  ARG A HG3  4  
ATOM 7645  H HD2  . ARG A 1 81  ? 10.355 -3.022  7.389  1.00 51.22 ? 81  ARG A HD2  4  
ATOM 7646  H HD3  . ARG A 1 81  ? 11.356 -3.524  8.750  1.00 5.23  ? 81  ARG A HD3  4  
ATOM 7647  H HE   . ARG A 1 81  ? 12.887 -1.690  7.451  1.00 11.03 ? 81  ARG A HE   4  
ATOM 7648  H HH11 . ARG A 1 81  ? 9.653  -1.687  8.741  1.00 4.33  ? 81  ARG A HH11 4  
ATOM 7649  H HH12 . ARG A 1 81  ? 9.659  0.008   9.102  1.00 71.12 ? 81  ARG A HH12 4  
ATOM 7650  H HH21 . ARG A 1 81  ? 12.906 0.542   7.921  1.00 25.02 ? 81  ARG A HH21 4  
ATOM 7651  H HH22 . ARG A 1 81  ? 11.510 1.275   8.634  1.00 35.21 ? 81  ARG A HH22 4  
ATOM 7652  N N    . LEU A 1 82  ? 16.009 -6.982  7.387  1.00 65.42 ? 82  LEU A N    4  
ATOM 7653  C CA   . LEU A 1 82  ? 16.808 -7.936  8.149  1.00 3.44  ? 82  LEU A CA   4  
ATOM 7654  C C    . LEU A 1 82  ? 17.708 -7.216  9.149  1.00 13.40 ? 82  LEU A C    4  
ATOM 7655  O O    . LEU A 1 82  ? 18.366 -6.231  8.812  1.00 65.11 ? 82  LEU A O    4  
ATOM 7656  C CB   . LEU A 1 82  ? 17.657 -8.790  7.206  1.00 53.11 ? 82  LEU A CB   4  
ATOM 7657  C CG   . LEU A 1 82  ? 17.972 -10.208 7.684  1.00 14.45 ? 82  LEU A CG   4  
ATOM 7658  C CD1  . LEU A 1 82  ? 18.821 -10.169 8.946  1.00 75.03 ? 82  LEU A CD1  4  
ATOM 7659  C CD2  . LEU A 1 82  ? 16.687 -10.986 7.928  1.00 72.02 ? 82  LEU A CD2  4  
ATOM 7660  H H    . LEU A 1 82  ? 16.445 -6.440  6.697  1.00 13.21 ? 82  LEU A H    4  
ATOM 7661  H HA   . LEU A 1 82  ? 16.130 -8.578  8.691  1.00 11.42 ? 82  LEU A HA   4  
ATOM 7662  H HB2  . LEU A 1 82  ? 17.130 -8.867  6.267  1.00 65.40 ? 82  LEU A HB2  4  
ATOM 7663  H HB3  . LEU A 1 82  ? 18.595 -8.276  7.050  1.00 72.35 ? 82  LEU A HB3  4  
ATOM 7664  H HG   . LEU A 1 82  ? 18.536 -10.722 6.919  1.00 73.32 ? 82  LEU A HG   4  
ATOM 7665  H HD11 . LEU A 1 82  ? 19.366 -9.238  8.984  1.00 34.13 ? 82  LEU A HD11 4  
ATOM 7666  H HD12 . LEU A 1 82  ? 19.517 -10.994 8.936  1.00 62.11 ? 82  LEU A HD12 4  
ATOM 7667  H HD13 . LEU A 1 82  ? 18.181 -10.249 9.813  1.00 51.25 ? 82  LEU A HD13 4  
ATOM 7668  H HD21 . LEU A 1 82  ? 16.924 -12.025 8.101  1.00 73.53 ? 82  LEU A HD21 4  
ATOM 7669  H HD22 . LEU A 1 82  ? 16.046 -10.902 7.062  1.00 71.30 ? 82  LEU A HD22 4  
ATOM 7670  H HD23 . LEU A 1 82  ? 16.180 -10.583 8.792  1.00 61.20 ? 82  LEU A HD23 4  
ATOM 7671  N N    . THR A 1 83  ? 17.732 -7.714  10.381 1.00 25.12 ? 83  THR A N    4  
ATOM 7672  C CA   . THR A 1 83  ? 18.552 -7.120  11.430 1.00 54.31 ? 83  THR A CA   4  
ATOM 7673  C C    . THR A 1 83  ? 19.339 -8.186  12.183 1.00 11.33 ? 83  THR A C    4  
ATOM 7674  O O    . THR A 1 83  ? 18.960 -9.358  12.199 1.00 3.52  ? 83  THR A O    4  
ATOM 7675  C CB   . THR A 1 83  ? 17.692 -6.328  12.433 1.00 11.31 ? 83  THR A CB   4  
ATOM 7676  O OG1  . THR A 1 83  ? 18.534 -5.565  13.305 1.00 20.51 ? 83  THR A OG1  4  
ATOM 7677  C CG2  . THR A 1 83  ? 16.818 -7.264  13.254 1.00 0.32  ? 83  THR A CG2  4  
ATOM 7678  H H    . THR A 1 83  ? 17.185 -8.500  10.589 1.00 65.34 ? 83  THR A H    4  
ATOM 7679  H HA   . THR A 1 83  ? 19.246 -6.436  10.964 1.00 55.54 ? 83  THR A HA   4  
ATOM 7680  H HB   . THR A 1 83  ? 17.053 -5.653  11.882 1.00 55.10 ? 83  THR A HB   4  
ATOM 7681  H HG1  . THR A 1 83  ? 19.174 -5.075  12.784 1.00 63.12 ? 83  THR A HG1  4  
ATOM 7682  H HG21 . THR A 1 83  ? 16.823 -8.247  12.807 1.00 43.55 ? 83  THR A HG21 4  
ATOM 7683  H HG22 . THR A 1 83  ? 15.807 -6.884  13.278 1.00 24.11 ? 83  THR A HG22 4  
ATOM 7684  H HG23 . THR A 1 83  ? 17.204 -7.325  14.261 1.00 74.14 ? 83  THR A HG23 4  
ATOM 7685  N N    . THR A 1 84  ? 20.437 -7.773  12.808 1.00 1.44  ? 84  THR A N    4  
ATOM 7686  C CA   . THR A 1 84  ? 21.278 -8.692  13.564 1.00 63.33 ? 84  THR A CA   4  
ATOM 7687  C C    . THR A 1 84  ? 21.594 -8.138  14.948 1.00 3.31  ? 84  THR A C    4  
ATOM 7688  O O    . THR A 1 84  ? 21.765 -6.930  15.120 1.00 73.53 ? 84  THR A O    4  
ATOM 7689  C CB   . THR A 1 84  ? 22.599 -8.981  12.825 1.00 31.22 ? 84  THR A CB   4  
ATOM 7690  O OG1  . THR A 1 84  ? 23.130 -7.769  12.279 1.00 2.32  ? 84  THR A OG1  4  
ATOM 7691  C CG2  . THR A 1 84  ? 22.385 -9.994  11.711 1.00 63.32 ? 84  THR A CG2  4  
ATOM 7692  H H    . THR A 1 84  ? 20.687 -6.826  12.759 1.00 74.32 ? 84  THR A H    4  
ATOM 7693  H HA   . THR A 1 84  ? 20.740 -9.623  13.673 1.00 5.13  ? 84  THR A HA   4  
ATOM 7694  H HB   . THR A 1 84  ? 23.307 -9.390  13.532 1.00 1.51  ? 84  THR A HB   4  
ATOM 7695  H HG1  . THR A 1 84  ? 22.783 -7.637  11.394 1.00 62.45 ? 84  THR A HG1  4  
ATOM 7696  H HG21 . THR A 1 84  ? 23.213 -9.948  11.019 1.00 60.24 ? 84  THR A HG21 4  
ATOM 7697  H HG22 . THR A 1 84  ? 21.467 -9.768  11.190 1.00 51.12 ? 84  THR A HG22 4  
ATOM 7698  H HG23 . THR A 1 84  ? 22.325 -10.986 12.133 1.00 13.12 ? 84  THR A HG23 4  
ATOM 7699  N N    . TYR A 1 85  ? 21.672 -9.026  15.932 1.00 32.25 ? 85  TYR A N    4  
ATOM 7700  C CA   . TYR A 1 85  ? 21.966 -8.625  17.303 1.00 52.30 ? 85  TYR A CA   4  
ATOM 7701  C C    . TYR A 1 85  ? 23.059 -9.502  17.905 1.00 62.00 ? 85  TYR A C    4  
ATOM 7702  O O    . TYR A 1 85  ? 22.956 -10.729 17.910 1.00 15.10 ? 85  TYR A O    4  
ATOM 7703  C CB   . TYR A 1 85  ? 20.703 -8.703  18.162 1.00 74.51 ? 85  TYR A CB   4  
ATOM 7704  C CG   . TYR A 1 85  ? 19.883 -7.433  18.152 1.00 42.23 ? 85  TYR A CG   4  
ATOM 7705  C CD1  . TYR A 1 85  ? 18.697 -7.353  17.433 1.00 60.23 ? 85  TYR A CD1  4  
ATOM 7706  C CD2  . TYR A 1 85  ? 20.295 -6.312  18.862 1.00 0.21  ? 85  TYR A CD2  4  
ATOM 7707  C CE1  . TYR A 1 85  ? 17.946 -6.194  17.420 1.00 32.01 ? 85  TYR A CE1  4  
ATOM 7708  C CE2  . TYR A 1 85  ? 19.549 -5.149  18.856 1.00 4.23  ? 85  TYR A CE2  4  
ATOM 7709  C CZ   . TYR A 1 85  ? 18.376 -5.095  18.133 1.00 10.35 ? 85  TYR A CZ   4  
ATOM 7710  O OH   . TYR A 1 85  ? 17.630 -3.939  18.125 1.00 53.45 ? 85  TYR A OH   4  
ATOM 7711  H H    . TYR A 1 85  ? 21.526 -9.975  15.733 1.00 2.45  ? 85  TYR A H    4  
ATOM 7712  H HA   . TYR A 1 85  ? 22.312 -7.602  17.282 1.00 53.41 ? 85  TYR A HA   4  
ATOM 7713  H HB2  . TYR A 1 85  ? 20.077 -9.504  17.798 1.00 40.45 ? 85  TYR A HB2  4  
ATOM 7714  H HB3  . TYR A 1 85  ? 20.983 -8.909  19.185 1.00 62.45 ? 85  TYR A HB3  4  
ATOM 7715  H HD1  . TYR A 1 85  ? 18.363 -8.216  16.875 1.00 32.44 ? 85  TYR A HD1  4  
ATOM 7716  H HD2  . TYR A 1 85  ? 21.215 -6.357  19.427 1.00 33.23 ? 85  TYR A HD2  4  
ATOM 7717  H HE1  . TYR A 1 85  ? 17.027 -6.152  16.855 1.00 53.45 ? 85  TYR A HE1  4  
ATOM 7718  H HE2  . TYR A 1 85  ? 19.886 -4.288  19.415 1.00 51.54 ? 85  TYR A HE2  4  
ATOM 7719  H HH   . TYR A 1 85  ? 16.710 -4.151  18.298 1.00 15.51 ? 85  TYR A HH   4  
ATOM 7720  N N    . LYS A 1 86  ? 24.108 -8.864  18.413 1.00 40.31 ? 86  LYS A N    4  
ATOM 7721  C CA   . LYS A 1 86  ? 25.222 -9.583  19.020 1.00 14.10 ? 86  LYS A CA   4  
ATOM 7722  C C    . LYS A 1 86  ? 24.735 -10.487 20.148 1.00 20.00 ? 86  LYS A C    4  
ATOM 7723  O O    . LYS A 1 86  ? 23.931 -10.074 20.985 1.00 43.43 ? 86  LYS A O    4  
ATOM 7724  C CB   . LYS A 1 86  ? 26.262 -8.596  19.556 1.00 75.14 ? 86  LYS A CB   4  
ATOM 7725  C CG   . LYS A 1 86  ? 27.617 -8.714  18.880 1.00 54.24 ? 86  LYS A CG   4  
ATOM 7726  C CD   . LYS A 1 86  ? 27.715 -7.805  17.666 1.00 70.33 ? 86  LYS A CD   4  
ATOM 7727  C CE   . LYS A 1 86  ? 29.157 -7.630  17.216 1.00 64.31 ? 86  LYS A CE   4  
ATOM 7728  N NZ   . LYS A 1 86  ? 29.758 -6.378  17.754 1.00 62.41 ? 86  LYS A NZ   4  
ATOM 7729  H H    . LYS A 1 86  ? 24.133 -7.884  18.379 1.00 3.13  ? 86  LYS A H    4  
ATOM 7730  H HA   . LYS A 1 86  ? 25.678 -10.194 18.256 1.00 32.12 ? 86  LYS A HA   4  
ATOM 7731  H HB2  . LYS A 1 86  ? 25.895 -7.591  19.409 1.00 43.32 ? 86  LYS A HB2  4  
ATOM 7732  H HB3  . LYS A 1 86  ? 26.394 -8.771  20.614 1.00 42.43 ? 86  LYS A HB3  4  
ATOM 7733  H HG2  . LYS A 1 86  ? 28.386 -8.438  19.585 1.00 21.23 ? 86  LYS A HG2  4  
ATOM 7734  H HG3  . LYS A 1 86  ? 27.764 -9.737  18.565 1.00 71.31 ? 86  LYS A HG3  4  
ATOM 7735  H HD2  . LYS A 1 86  ? 27.147 -8.238  16.855 1.00 23.35 ? 86  LYS A HD2  4  
ATOM 7736  H HD3  . LYS A 1 86  ? 27.305 -6.837  17.917 1.00 24.14 ? 86  LYS A HD3  4  
ATOM 7737  H HE2  . LYS A 1 86  ? 29.734 -8.474  17.563 1.00 72.01 ? 86  LYS A HE2  4  
ATOM 7738  H HE3  . LYS A 1 86  ? 29.182 -7.597  16.137 1.00 44.23 ? 86  LYS A HE3  4  
ATOM 7739  H HZ1  . LYS A 1 86  ? 30.351 -6.594  18.581 1.00 43.13 ? 86  LYS A HZ1  4  
ATOM 7740  H HZ2  . LYS A 1 86  ? 29.009 -5.718  18.042 1.00 12.41 ? 86  LYS A HZ2  4  
ATOM 7741  H HZ3  . LYS A 1 86  ? 30.347 -5.923  17.027 1.00 33.34 ? 86  LYS A HZ3  4  
ATOM 7742  N N    . CYS A 1 87  ? 25.228 -11.720 20.165 1.00 34.55 ? 87  CYS A N    4  
ATOM 7743  C CA   . CYS A 1 87  ? 24.843 -12.683 21.192 1.00 41.11 ? 87  CYS A CA   4  
ATOM 7744  C C    . CYS A 1 87  ? 26.074 -13.286 21.861 1.00 43.34 ? 87  CYS A C    4  
ATOM 7745  O O    . CYS A 1 87  ? 27.146 -13.363 21.259 1.00 4.34  ? 87  CYS A O    4  
ATOM 7746  C CB   . CYS A 1 87  ? 23.983 -13.792 20.584 1.00 25.10 ? 87  CYS A CB   4  
ATOM 7747  S SG   . CYS A 1 87  ? 22.442 -13.208 19.840 1.00 4.14  ? 87  CYS A SG   4  
ATOM 7748  H H    . CYS A 1 87  ? 25.865 -11.991 19.472 1.00 73.43 ? 87  CYS A H    4  
ATOM 7749  H HA   . CYS A 1 87  ? 24.265 -12.158 21.937 1.00 73.20 ? 87  CYS A HA   4  
ATOM 7750  H HB2  . CYS A 1 87  ? 24.549 -14.294 19.813 1.00 24.53 ? 87  CYS A HB2  4  
ATOM 7751  H HB3  . CYS A 1 87  ? 23.729 -14.503 21.356 1.00 71.44 ? 87  CYS A HB3  4  
ATOM 7752  H HG   . CYS A 1 87  ? 21.456 -13.966 20.295 1.00 3.13  ? 87  CYS A HG   4  
ATOM 7753  N N    . THR A 1 88  ? 25.914 -13.711 23.110 1.00 63.21 ? 88  THR A N    4  
ATOM 7754  C CA   . THR A 1 88  ? 27.013 -14.304 23.862 1.00 72.31 ? 88  THR A CA   4  
ATOM 7755  C C    . THR A 1 88  ? 26.832 -15.811 24.003 1.00 33.34 ? 88  THR A C    4  
ATOM 7756  O O    . THR A 1 88  ? 25.774 -16.353 23.678 1.00 65.20 ? 88  THR A O    4  
ATOM 7757  C CB   . THR A 1 88  ? 27.135 -13.680 25.264 1.00 4.55  ? 88  THR A CB   4  
ATOM 7758  O OG1  . THR A 1 88  ? 26.547 -12.374 25.272 1.00 31.14 ? 88  THR A OG1  4  
ATOM 7759  C CG2  . THR A 1 88  ? 28.593 -13.587 25.690 1.00 10.21 ? 88  THR A CG2  4  
ATOM 7760  H H    . THR A 1 88  ? 25.036 -13.623 23.535 1.00 11.40 ? 88  THR A H    4  
ATOM 7761  H HA   . THR A 1 88  ? 27.929 -14.111 23.323 1.00 51.50 ? 88  THR A HA   4  
ATOM 7762  H HB   . THR A 1 88  ? 26.609 -14.308 25.969 1.00 2.30  ? 88  THR A HB   4  
ATOM 7763  H HG1  . THR A 1 88  ? 27.099 -11.771 24.770 1.00 45.24 ? 88  THR A HG1  4  
ATOM 7764  H HG21 . THR A 1 88  ? 28.769 -12.634 26.168 1.00 73.32 ? 88  THR A HG21 4  
ATOM 7765  H HG22 . THR A 1 88  ? 29.228 -13.677 24.821 1.00 10.14 ? 88  THR A HG22 4  
ATOM 7766  H HG23 . THR A 1 88  ? 28.816 -14.383 26.384 1.00 63.33 ? 88  THR A HG23 4  
ATOM 7767  N N    . LEU A 1 89  ? 27.868 -16.484 24.491 1.00 3.32  ? 89  LEU A N    4  
ATOM 7768  C CA   . LEU A 1 89  ? 27.823 -17.930 24.677 1.00 43.01 ? 89  LEU A CA   4  
ATOM 7769  C C    . LEU A 1 89  ? 27.360 -18.284 26.086 1.00 10.24 ? 89  LEU A C    4  
ATOM 7770  O O    . LEU A 1 89  ? 27.594 -17.534 27.033 1.00 35.35 ? 89  LEU A O    4  
ATOM 7771  C CB   . LEU A 1 89  ? 29.200 -18.541 24.412 1.00 63.12 ? 89  LEU A CB   4  
ATOM 7772  C CG   . LEU A 1 89  ? 29.373 -20.006 24.815 1.00 5.23  ? 89  LEU A CG   4  
ATOM 7773  C CD1  . LEU A 1 89  ? 28.556 -20.910 23.906 1.00 34.14 ? 89  LEU A CD1  4  
ATOM 7774  C CD2  . LEU A 1 89  ? 30.843 -20.399 24.779 1.00 2.21  ? 89  LEU A CD2  4  
ATOM 7775  H H    . LEU A 1 89  ? 28.684 -15.997 24.733 1.00 74.35 ? 89  LEU A H    4  
ATOM 7776  H HA   . LEU A 1 89  ? 27.117 -18.333 23.967 1.00 73.22 ? 89  LEU A HA   4  
ATOM 7777  H HB2  . LEU A 1 89  ? 29.398 -18.464 23.354 1.00 71.32 ? 89  LEU A HB2  4  
ATOM 7778  H HB3  . LEU A 1 89  ? 29.930 -17.958 24.956 1.00 61.41 ? 89  LEU A HB3  4  
ATOM 7779  H HG   . LEU A 1 89  ? 29.016 -20.139 25.827 1.00 14.31 ? 89  LEU A HG   4  
ATOM 7780  H HD11 . LEU A 1 89  ? 27.770 -21.380 24.479 1.00 61.04 ? 89  LEU A HD11 4  
ATOM 7781  H HD12 . LEU A 1 89  ? 29.196 -21.669 23.483 1.00 23.41 ? 89  LEU A HD12 4  
ATOM 7782  H HD13 . LEU A 1 89  ? 28.121 -20.323 23.111 1.00 15.52 ? 89  LEU A HD13 4  
ATOM 7783  H HD21 . LEU A 1 89  ? 31.047 -21.100 25.574 1.00 23.44 ? 89  LEU A HD21 4  
ATOM 7784  H HD22 . LEU A 1 89  ? 31.455 -19.518 24.911 1.00 54.31 ? 89  LEU A HD22 4  
ATOM 7785  H HD23 . LEU A 1 89  ? 31.070 -20.856 23.828 1.00 61.32 ? 89  LEU A HD23 4  
ATOM 7786  N N    . ASN A 1 90  ? 26.704 -19.432 26.217 1.00 32.22 ? 90  ASN A N    4  
ATOM 7787  C CA   . ASN A 1 90  ? 26.209 -19.887 27.512 1.00 42.33 ? 90  ASN A CA   4  
ATOM 7788  C C    . ASN A 1 90  ? 26.429 -21.387 27.682 1.00 5.32  ? 90  ASN A C    4  
ATOM 7789  O O    . ASN A 1 90  ? 26.820 -22.079 26.742 1.00 21.11 ? 90  ASN A O    4  
ATOM 7790  C CB   . ASN A 1 90  ? 24.722 -19.559 27.656 1.00 13.44 ? 90  ASN A CB   4  
ATOM 7791  C CG   . ASN A 1 90  ? 23.881 -20.192 26.565 1.00 42.25 ? 90  ASN A CG   4  
ATOM 7792  O OD1  . ASN A 1 90  ? 24.131 -19.988 25.376 1.00 24.34 ? 90  ASN A OD1  4  
ATOM 7793  N ND2  . ASN A 1 90  ? 22.877 -20.964 26.964 1.00 65.34 ? 90  ASN A ND2  4  
ATOM 7794  H H    . ASN A 1 90  ? 26.548 -19.987 25.425 1.00 61.23 ? 90  ASN A H    4  
ATOM 7795  H HA   . ASN A 1 90  ? 26.760 -19.364 28.279 1.00 22.10 ? 90  ASN A HA   4  
ATOM 7796  H HB2  . ASN A 1 90  ? 24.370 -19.923 28.611 1.00 3.30  ? 90  ASN A HB2  4  
ATOM 7797  H HB3  . ASN A 1 90  ? 24.589 -18.488 27.613 1.00 20.10 ? 90  ASN A HB3  4  
ATOM 7798  H HD21 . ASN A 1 90  ? 22.737 -21.081 27.927 1.00 63.03 ? 90  ASN A HD21 4  
ATOM 7799  H HD22 . ASN A 1 90  ? 22.318 -21.387 26.279 1.00 44.34 ? 90  ASN A HD22 4  
ATOM 7800  N N    . LYS A 1 91  ? 26.176 -21.883 28.888 1.00 32.03 ? 91  LYS A N    4  
ATOM 7801  C CA   . LYS A 1 91  ? 26.344 -23.301 29.184 1.00 52.04 ? 91  LYS A CA   4  
ATOM 7802  C C    . LYS A 1 91  ? 25.627 -24.161 28.148 1.00 61.13 ? 91  LYS A C    4  
ATOM 7803  O O    . LYS A 1 91  ? 26.130 -25.208 27.743 1.00 64.42 ? 91  LYS A O    4  
ATOM 7804  C CB   . LYS A 1 91  ? 25.811 -23.618 30.583 1.00 73.44 ? 91  LYS A CB   4  
ATOM 7805  C CG   . LYS A 1 91  ? 24.489 -22.941 30.898 1.00 54.51 ? 91  LYS A CG   4  
ATOM 7806  C CD   . LYS A 1 91  ? 24.668 -21.801 31.887 1.00 30.11 ? 91  LYS A CD   4  
ATOM 7807  C CE   . LYS A 1 91  ? 23.497 -20.831 31.839 1.00 62.53 ? 91  LYS A CE   4  
ATOM 7808  N NZ   . LYS A 1 91  ? 23.821 -19.610 31.050 1.00 33.24 ? 91  LYS A NZ   4  
ATOM 7809  H H    . LYS A 1 91  ? 25.867 -21.280 29.598 1.00 73.53 ? 91  LYS A H    4  
ATOM 7810  H HA   . LYS A 1 91  ? 27.400 -23.524 29.151 1.00 55.22 ? 91  LYS A HA   4  
ATOM 7811  H HB2  . LYS A 1 91  ? 25.674 -24.686 30.669 1.00 73.22 ? 91  LYS A HB2  4  
ATOM 7812  H HB3  . LYS A 1 91  ? 26.539 -23.297 31.314 1.00 60.45 ? 91  LYS A HB3  4  
ATOM 7813  H HG2  . LYS A 1 91  ? 24.069 -22.547 29.984 1.00 2.30  ? 91  LYS A HG2  4  
ATOM 7814  H HG3  . LYS A 1 91  ? 23.813 -23.670 31.321 1.00 14.14 ? 91  LYS A HG3  4  
ATOM 7815  H HD2  . LYS A 1 91  ? 24.741 -22.209 32.884 1.00 24.41 ? 91  LYS A HD2  4  
ATOM 7816  H HD3  . LYS A 1 91  ? 25.577 -21.267 31.647 1.00 73.31 ? 91  LYS A HD3  4  
ATOM 7817  H HE2  . LYS A 1 91  ? 22.653 -21.329 31.386 1.00 43.33 ? 91  LYS A HE2  4  
ATOM 7818  H HE3  . LYS A 1 91  ? 23.245 -20.542 32.848 1.00 11.11 ? 91  LYS A HE3  4  
ATOM 7819  H HZ1  . LYS A 1 91  ? 23.254 -19.588 30.178 1.00 4.12  ? 91  LYS A HZ1  4  
ATOM 7820  H HZ2  . LYS A 1 91  ? 24.829 -19.606 30.796 1.00 52.04 ? 91  LYS A HZ2  4  
ATOM 7821  H HZ3  . LYS A 1 91  ? 23.612 -18.758 31.609 1.00 75.31 ? 91  LYS A HZ3  4  
ATOM 7822  N N    . GLU A 1 92  ? 24.451 -23.711 27.723 1.00 52.44 ? 92  GLU A N    4  
ATOM 7823  C CA   . GLU A 1 92  ? 23.667 -24.440 26.733 1.00 35.11 ? 92  GLU A CA   4  
ATOM 7824  C C    . GLU A 1 92  ? 23.893 -23.874 25.334 1.00 23.12 ? 92  GLU A C    4  
ATOM 7825  O O    . GLU A 1 92  ? 24.070 -22.667 25.161 1.00 30.35 ? 92  GLU A O    4  
ATOM 7826  C CB   . GLU A 1 92  ? 22.178 -24.380 27.084 1.00 25.33 ? 92  GLU A CB   4  
ATOM 7827  C CG   . GLU A 1 92  ? 21.448 -25.694 26.865 1.00 71.34 ? 92  GLU A CG   4  
ATOM 7828  C CD   . GLU A 1 92  ? 21.558 -26.629 28.053 1.00 23.14 ? 92  GLU A CD   4  
ATOM 7829  O OE1  . GLU A 1 92  ? 22.411 -27.540 28.015 1.00 24.14 ? 92  GLU A OE1  4  
ATOM 7830  O OE2  . GLU A 1 92  ? 20.791 -26.449 29.022 1.00 10.22 ? 92  GLU A OE2  4  
ATOM 7831  H H    . GLU A 1 92  ? 24.102 -22.869 28.083 1.00 3.31  ? 92  GLU A H    4  
ATOM 7832  H HA   . GLU A 1 92  ? 23.989 -25.470 26.748 1.00 21.11 ? 92  GLU A HA   4  
ATOM 7833  H HB2  . GLU A 1 92  ? 22.077 -24.105 28.124 1.00 51.43 ? 92  GLU A HB2  4  
ATOM 7834  H HB3  . GLU A 1 92  ? 21.707 -23.624 26.473 1.00 23.44 ? 92  GLU A HB3  4  
ATOM 7835  H HG2  . GLU A 1 92  ? 20.404 -25.486 26.686 1.00 13.43 ? 92  GLU A HG2  4  
ATOM 7836  H HG3  . GLU A 1 92  ? 21.869 -26.185 25.999 1.00 15.01 ? 92  GLU A HG3  4  
ATOM 7837  N N    . LEU A 1 93  ? 23.888 -24.754 24.339 1.00 53.53 ? 93  LEU A N    4  
ATOM 7838  C CA   . LEU A 1 93  ? 24.093 -24.343 22.954 1.00 62.00 ? 93  LEU A CA   4  
ATOM 7839  C C    . LEU A 1 93  ? 22.767 -23.995 22.287 1.00 55.24 ? 93  LEU A C    4  
ATOM 7840  O O    . LEU A 1 93  ? 21.696 -24.423 22.718 1.00 54.33 ? 93  LEU A O    4  
ATOM 7841  C CB   . LEU A 1 93  ? 24.795 -25.454 22.171 1.00 50.12 ? 93  LEU A CB   4  
ATOM 7842  C CG   . LEU A 1 93  ? 26.319 -25.498 22.288 1.00 50.11 ? 93  LEU A CG   4  
ATOM 7843  C CD1  . LEU A 1 93  ? 26.789 -26.909 22.606 1.00 45.33 ? 93  LEU A CD1  4  
ATOM 7844  C CD2  . LEU A 1 93  ? 26.967 -24.994 21.007 1.00 50.43 ? 93  LEU A CD2  4  
ATOM 7845  H H    . LEU A 1 93  ? 23.742 -25.701 24.538 1.00 31.43 ? 93  LEU A H    4  
ATOM 7846  H HA   . LEU A 1 93  ? 24.721 -23.465 22.959 1.00 45.23 ? 93  LEU A HA   4  
ATOM 7847  H HB2  . LEU A 1 93  ? 24.409 -26.399 22.521 1.00 64.25 ? 93  LEU A HB2  4  
ATOM 7848  H HB3  . LEU A 1 93  ? 24.546 -25.329 21.127 1.00 73.44 ? 93  LEU A HB3  4  
ATOM 7849  H HG   . LEU A 1 93  ? 26.630 -24.852 23.098 1.00 63.43 ? 93  LEU A HG   4  
ATOM 7850  H HD11 . LEU A 1 93  ? 26.136 -27.348 23.344 1.00 60.21 ? 93  LEU A HD11 4  
ATOM 7851  H HD12 . LEU A 1 93  ? 27.797 -26.873 22.992 1.00 23.52 ? 93  LEU A HD12 4  
ATOM 7852  H HD13 . LEU A 1 93  ? 26.770 -27.506 21.706 1.00 43.23 ? 93  LEU A HD13 4  
ATOM 7853  H HD21 . LEU A 1 93  ? 26.917 -23.915 20.979 1.00 71.00 ? 93  LEU A HD21 4  
ATOM 7854  H HD22 . LEU A 1 93  ? 26.443 -25.400 20.154 1.00 74.11 ? 93  LEU A HD22 4  
ATOM 7855  H HD23 . LEU A 1 93  ? 28.000 -25.307 20.978 1.00 32.21 ? 93  LEU A HD23 4  
ATOM 7856  N N    . PRO A 1 94  ? 22.837 -23.201 21.208 1.00 70.24 ? 94  PRO A N    4  
ATOM 7857  C CA   . PRO A 1 94  ? 21.651 -22.780 20.456 1.00 70.32 ? 94  PRO A CA   4  
ATOM 7858  C C    . PRO A 1 94  ? 21.012 -23.933 19.688 1.00 42.40 ? 94  PRO A C    4  
ATOM 7859  O O    . PRO A 1 94  ? 21.703 -24.832 19.208 1.00 23.15 ? 94  PRO A O    4  
ATOM 7860  C CB   . PRO A 1 94  ? 22.200 -21.731 19.486 1.00 12.31 ? 94  PRO A CB   4  
ATOM 7861  C CG   . PRO A 1 94  ? 23.637 -22.085 19.319 1.00 42.53 ? 94  PRO A CG   4  
ATOM 7862  C CD   . PRO A 1 94  ? 24.080 -22.654 20.638 1.00 32.21 ? 94  PRO A CD   4  
ATOM 7863  H HA   . PRO A 1 94  ? 20.913 -22.326 21.101 1.00 60.13 ? 94  PRO A HA   4  
ATOM 7864  H HB2  . PRO A 1 94  ? 21.666 -21.789 18.548 1.00 33.51 ? 94  PRO A HB2  4  
ATOM 7865  H HB3  . PRO A 1 94  ? 22.083 -20.746 19.912 1.00 10.32 ? 94  PRO A HB3  4  
ATOM 7866  H HG2  . PRO A 1 94  ? 23.746 -22.821 18.537 1.00 14.20 ? 94  PRO A HG2  4  
ATOM 7867  H HG3  . PRO A 1 94  ? 24.208 -21.198 19.083 1.00 31.42 ? 94  PRO A HG3  4  
ATOM 7868  H HD2  . PRO A 1 94  ? 24.811 -23.435 20.486 1.00 14.41 ? 94  PRO A HD2  4  
ATOM 7869  H HD3  . PRO A 1 94  ? 24.482 -21.876 21.269 1.00 3.43  ? 94  PRO A HD3  4  
ATOM 7870  N N    . THR A 1 95  ? 19.688 -23.900 19.574 1.00 40.20 ? 95  THR A N    4  
ATOM 7871  C CA   . THR A 1 95  ? 18.956 -24.942 18.865 1.00 50.40 ? 95  THR A CA   4  
ATOM 7872  C C    . THR A 1 95  ? 18.926 -24.669 17.365 1.00 22.34 ? 95  THR A C    4  
ATOM 7873  O O    . THR A 1 95  ? 19.153 -23.542 16.924 1.00 3.11  ? 95  THR A O    4  
ATOM 7874  C CB   . THR A 1 95  ? 17.510 -25.063 19.382 1.00 61.31 ? 95  THR A CB   4  
ATOM 7875  O OG1  . THR A 1 95  ? 16.986 -26.359 19.071 1.00 22.23 ? 95  THR A OG1  4  
ATOM 7876  C CG2  . THR A 1 95  ? 16.623 -23.991 18.767 1.00 63.45 ? 95  THR A CG2  4  
ATOM 7877  H H    . THR A 1 95  ? 19.193 -23.157 19.978 1.00 51.23 ? 95  THR A H    4  
ATOM 7878  H HA   . THR A 1 95  ? 19.459 -25.881 19.041 1.00 62.44 ? 95  THR A HA   4  
ATOM 7879  H HB   . THR A 1 95  ? 17.515 -24.933 20.455 1.00 63.13 ? 95  THR A HB   4  
ATOM 7880  H HG1  . THR A 1 95  ? 16.619 -26.755 19.866 1.00 61.05 ? 95  THR A HG1  4  
ATOM 7881  H HG21 . THR A 1 95  ? 16.361 -24.276 17.758 1.00 5.11  ? 95  THR A HG21 4  
ATOM 7882  H HG22 . THR A 1 95  ? 17.154 -23.051 18.749 1.00 23.33 ? 95  THR A HG22 4  
ATOM 7883  H HG23 . THR A 1 95  ? 15.725 -23.887 19.355 1.00 14.33 ? 95  THR A HG23 4  
ATOM 7884  N N    . LEU A 1 96  ? 18.644 -25.707 16.586 1.00 63.31 ? 96  LEU A N    4  
ATOM 7885  C CA   . LEU A 1 96  ? 18.584 -25.580 15.134 1.00 52.31 ? 96  LEU A CA   4  
ATOM 7886  C C    . LEU A 1 96  ? 19.933 -25.146 14.569 1.00 74.12 ? 96  LEU A C    4  
ATOM 7887  O O    . LEU A 1 96  ? 20.023 -24.686 13.430 1.00 74.42 ? 96  LEU A O    4  
ATOM 7888  C CB   . LEU A 1 96  ? 17.503 -24.573 14.735 1.00 5.23  ? 96  LEU A CB   4  
ATOM 7889  C CG   . LEU A 1 96  ? 17.981 -23.144 14.475 1.00 41.24 ? 96  LEU A CG   4  
ATOM 7890  C CD1  . LEU A 1 96  ? 17.877 -22.808 12.995 1.00 1.10  ? 96  LEU A CD1  4  
ATOM 7891  C CD2  . LEU A 1 96  ? 17.179 -22.153 15.306 1.00 61.30 ? 96  LEU A CD2  4  
ATOM 7892  H H    . LEU A 1 96  ? 18.473 -26.581 16.995 1.00 14.53 ? 96  LEU A H    4  
ATOM 7893  H HA   . LEU A 1 96  ? 18.331 -26.547 14.727 1.00 73.23 ? 96  LEU A HA   4  
ATOM 7894  H HB2  . LEU A 1 96  ? 17.032 -24.933 13.834 1.00 21.20 ? 96  LEU A HB2  4  
ATOM 7895  H HB3  . LEU A 1 96  ? 16.774 -24.539 15.532 1.00 1.22  ? 96  LEU A HB3  4  
ATOM 7896  H HG   . LEU A 1 96  ? 19.020 -23.060 14.763 1.00 10.00 ? 96  LEU A HG   4  
ATOM 7897  H HD11 . LEU A 1 96  ? 17.797 -23.720 12.424 1.00 72.14 ? 96  LEU A HD11 4  
ATOM 7898  H HD12 . LEU A 1 96  ? 18.759 -22.266 12.686 1.00 13.12 ? 96  LEU A HD12 4  
ATOM 7899  H HD13 . LEU A 1 96  ? 17.002 -22.198 12.825 1.00 1.43  ? 96  LEU A HD13 4  
ATOM 7900  H HD21 . LEU A 1 96  ? 16.200 -22.026 14.868 1.00 61.20 ? 96  LEU A HD21 4  
ATOM 7901  H HD22 . LEU A 1 96  ? 17.691 -21.202 15.325 1.00 11.01 ? 96  LEU A HD22 4  
ATOM 7902  H HD23 . LEU A 1 96  ? 17.077 -22.528 16.313 1.00 22.44 ? 96  LEU A HD23 4  
ATOM 7903  N N    . THR A 1 97  ? 20.981 -25.297 15.372 1.00 63.21 ? 97  THR A N    4  
ATOM 7904  C CA   . THR A 1 97  ? 22.326 -24.923 14.952 1.00 13.51 ? 97  THR A CA   4  
ATOM 7905  C C    . THR A 1 97  ? 22.962 -26.018 14.104 1.00 3.14  ? 97  THR A C    4  
ATOM 7906  O O    . THR A 1 97  ? 23.755 -25.738 13.206 1.00 54.44 ? 97  THR A O    4  
ATOM 7907  C CB   . THR A 1 97  ? 23.233 -24.634 16.163 1.00 34.23 ? 97  THR A CB   4  
ATOM 7908  O OG1  . THR A 1 97  ? 24.482 -24.091 15.722 1.00 55.52 ? 97  THR A OG1  4  
ATOM 7909  C CG2  . THR A 1 97  ? 23.481 -25.902 16.967 1.00 1.41  ? 97  THR A CG2  4  
ATOM 7910  H H    . THR A 1 97  ? 20.846 -25.669 16.268 1.00 33.13 ? 97  THR A H    4  
ATOM 7911  H HA   . THR A 1 97  ? 22.252 -24.021 14.362 1.00 54.15 ? 97  THR A HA   4  
ATOM 7912  H HB   . THR A 1 97  ? 22.739 -23.913 16.799 1.00 24.04 ? 97  THR A HB   4  
ATOM 7913  H HG1  . THR A 1 97  ? 24.735 -23.364 16.296 1.00 4.02  ? 97  THR A HG1  4  
ATOM 7914  H HG21 . THR A 1 97  ? 22.536 -26.329 17.267 1.00 72.12 ? 97  THR A HG21 4  
ATOM 7915  H HG22 . THR A 1 97  ? 24.063 -25.663 17.845 1.00 40.22 ? 97  THR A HG22 4  
ATOM 7916  H HG23 . THR A 1 97  ? 24.021 -26.612 16.360 1.00 73.43 ? 97  THR A HG23 4  
ATOM 7917  N N    . GLU A 1 98  ? 22.610 -27.266 14.396 1.00 31.15 ? 98  GLU A N    4  
ATOM 7918  C CA   . GLU A 1 98  ? 23.148 -28.403 13.660 1.00 62.43 ? 98  GLU A CA   4  
ATOM 7919  C C    . GLU A 1 98  ? 22.388 -28.615 12.353 1.00 0.45  ? 98  GLU A C    4  
ATOM 7920  O O    . GLU A 1 98  ? 22.688 -29.532 11.589 1.00 42.13 ? 98  GLU A O    4  
ATOM 7921  C CB   . GLU A 1 98  ? 23.079 -29.671 14.513 1.00 22.44 ? 98  GLU A CB   4  
ATOM 7922  C CG   . GLU A 1 98  ? 21.696 -29.951 15.077 1.00 61.32 ? 98  GLU A CG   4  
ATOM 7923  C CD   . GLU A 1 98  ? 21.318 -31.417 14.994 1.00 70.35 ? 98  GLU A CD   4  
ATOM 7924  O OE1  . GLU A 1 98  ? 22.074 -32.257 15.526 1.00 15.31 ? 98  GLU A OE1  4  
ATOM 7925  O OE2  . GLU A 1 98  ? 20.266 -31.725 14.395 1.00 15.25 ? 98  GLU A OE2  4  
ATOM 7926  H H    . GLU A 1 98  ? 21.974 -27.426 15.125 1.00 54.45 ? 98  GLU A H    4  
ATOM 7927  H HA   . GLU A 1 98  ? 24.181 -28.191 13.430 1.00 4.04  ? 98  GLU A HA   4  
ATOM 7928  H HB2  . GLU A 1 98  ? 23.377 -30.515 13.908 1.00 32.03 ? 98  GLU A HB2  4  
ATOM 7929  H HB3  . GLU A 1 98  ? 23.768 -29.572 15.339 1.00 12.05 ? 98  GLU A HB3  4  
ATOM 7930  H HG2  . GLU A 1 98  ? 21.675 -29.649 16.113 1.00 44.50 ? 98  GLU A HG2  4  
ATOM 7931  H HG3  . GLU A 1 98  ? 20.971 -29.375 14.520 1.00 23.42 ? 98  GLU A HG3  4  
ATOM 7932  N N    . HIS A 1 99  ? 21.401 -27.759 12.105 1.00 64.12 ? 99  HIS A N    4  
ATOM 7933  C CA   . HIS A 1 99  ? 20.597 -27.851 10.891 1.00 23.23 ? 99  HIS A CA   4  
ATOM 7934  C C    . HIS A 1 99  ? 21.475 -28.150 9.680  1.00 72.14 ? 99  HIS A C    4  
ATOM 7935  O O    . HIS A 1 99  ? 21.107 -28.944 8.814  1.00 54.05 ? 99  HIS A O    4  
ATOM 7936  C CB   . HIS A 1 99  ? 19.824 -26.552 10.667 1.00 14.32 ? 99  HIS A CB   4  
ATOM 7937  C CG   . HIS A 1 99  ? 18.337 -26.734 10.658 1.00 10.44 ? 99  HIS A CG   4  
ATOM 7938  N ND1  . HIS A 1 99  ? 17.653 -27.392 11.659 1.00 44.30 ? 99  HIS A ND1  4  
ATOM 7939  C CD2  . HIS A 1 99  ? 17.402 -26.338 9.764  1.00 52.54 ? 99  HIS A CD2  4  
ATOM 7940  C CE1  . HIS A 1 99  ? 16.362 -27.394 11.379 1.00 23.11 ? 99  HIS A CE1  4  
ATOM 7941  N NE2  . HIS A 1 99  ? 16.183 -26.760 10.234 1.00 30.23 ? 99  HIS A NE2  4  
ATOM 7942  H H    . HIS A 1 99  ? 21.210 -27.049 12.752 1.00 21.24 ? 99  HIS A H    4  
ATOM 7943  H HA   . HIS A 1 99  ? 19.895 -28.661 11.020 1.00 52.43 ? 99  HIS A HA   4  
ATOM 7944  H HB2  . HIS A 1 99  ? 20.067 -25.855 11.456 1.00 43.25 ? 99  HIS A HB2  4  
ATOM 7945  H HB3  . HIS A 1 99  ? 20.112 -26.128 9.716  1.00 4.42  ? 99  HIS A HB3  4  
ATOM 7946  H HD1  . HIS A 1 99  ? 18.055 -27.798 12.455 1.00 40.03 ? 99  HIS A HD1  4  
ATOM 7947  H HD2  . HIS A 1 99  ? 17.580 -25.791 8.848  1.00 3.43  ? 99  HIS A HD2  4  
ATOM 7948  H HE1  . HIS A 1 99  ? 15.585 -27.838 11.983 1.00 2.21  ? 99  HIS A HE1  4  
ATOM 7949  N N    . LYS A 1 100 ? 22.637 -27.509 9.624  1.00 1.31  ? 100 LYS A N    4  
ATOM 7950  C CA   . LYS A 1 100 ? 23.568 -27.705 8.519  1.00 22.34 ? 100 LYS A CA   4  
ATOM 7951  C C    . LYS A 1 100 ? 24.734 -28.594 8.942  1.00 73.12 ? 100 LYS A C    4  
ATOM 7952  O O    . LYS A 1 100 ? 24.945 -29.667 8.377  1.00 50.04 ? 100 LYS A O    4  
ATOM 7953  C CB   . LYS A 1 100 ? 24.095 -26.357 8.023  1.00 0.13  ? 100 LYS A CB   4  
ATOM 7954  C CG   . LYS A 1 100 ? 25.195 -26.479 6.983  1.00 71.11 ? 100 LYS A CG   4  
ATOM 7955  C CD   . LYS A 1 100 ? 24.823 -25.768 5.692  1.00 22.53 ? 100 LYS A CD   4  
ATOM 7956  C CE   . LYS A 1 100 ? 25.439 -24.380 5.623  1.00 5.44  ? 100 LYS A CE   4  
ATOM 7957  N NZ   . LYS A 1 100 ? 25.646 -23.934 4.218  1.00 43.43 ? 100 LYS A NZ   4  
ATOM 7958  H H    . LYS A 1 100 ? 22.875 -26.888 10.345 1.00 1.11  ? 100 LYS A H    4  
ATOM 7959  H HA   . LYS A 1 100 ? 23.033 -28.191 7.717  1.00 4.51  ? 100 LYS A HA   4  
ATOM 7960  H HB2  . LYS A 1 100 ? 23.277 -25.802 7.588  1.00 33.23 ? 100 LYS A HB2  4  
ATOM 7961  H HB3  . LYS A 1 100 ? 24.485 -25.804 8.866  1.00 64.41 ? 100 LYS A HB3  4  
ATOM 7962  H HG2  . LYS A 1 100 ? 26.100 -26.040 7.375  1.00 11.44 ? 100 LYS A HG2  4  
ATOM 7963  H HG3  . LYS A 1 100 ? 25.363 -27.526 6.771  1.00 1.35  ? 100 LYS A HG3  4  
ATOM 7964  H HD2  . LYS A 1 100 ? 25.180 -26.350 4.855  1.00 2.03  ? 100 LYS A HD2  4  
ATOM 7965  H HD3  . LYS A 1 100 ? 23.747 -25.679 5.638  1.00 44.30 ? 100 LYS A HD3  4  
ATOM 7966  H HE2  . LYS A 1 100 ? 24.781 -23.683 6.120  1.00 64.02 ? 100 LYS A HE2  4  
ATOM 7967  H HE3  . LYS A 1 100 ? 26.393 -24.398 6.130  1.00 11.35 ? 100 LYS A HE3  4  
ATOM 7968  H HZ1  . LYS A 1 100 ? 24.735 -23.675 3.788  1.00 62.24 ? 100 LYS A HZ1  4  
ATOM 7969  H HZ2  . LYS A 1 100 ? 26.075 -24.699 3.660  1.00 43.14 ? 100 LYS A HZ2  4  
ATOM 7970  H HZ3  . LYS A 1 100 ? 26.276 -23.106 4.194  1.00 70.50 ? 100 LYS A HZ3  4  
ATOM 7971  N N    . SER A 1 101 ? 25.486 -28.141 9.940  1.00 61.25 ? 101 SER A N    4  
ATOM 7972  C CA   . SER A 1 101 ? 26.632 -28.895 10.436 1.00 53.30 ? 101 SER A CA   4  
ATOM 7973  C C    . SER A 1 101 ? 27.379 -28.105 11.506 1.00 42.41 ? 101 SER A C    4  
ATOM 7974  O O    . SER A 1 101 ? 26.976 -27.000 11.872 1.00 20.45 ? 101 SER A O    4  
ATOM 7975  C CB   . SER A 1 101 ? 27.579 -29.240 9.286  1.00 42.15 ? 101 SER A CB   4  
ATOM 7976  O OG   . SER A 1 101 ? 27.701 -28.155 8.382  1.00 3.23  ? 101 SER A OG   4  
ATOM 7977  H H    . SER A 1 101 ? 25.267 -27.278 10.350 1.00 72.34 ? 101 SER A H    4  
ATOM 7978  H HA   . SER A 1 101 ? 26.262 -29.810 10.874 1.00 51.05 ? 101 SER A HA   4  
ATOM 7979  H HB2  . SER A 1 101 ? 28.555 -29.473 9.684  1.00 40.53 ? 101 SER A HB2  4  
ATOM 7980  H HB3  . SER A 1 101 ? 27.195 -30.097 8.751  1.00 53.50 ? 101 SER A HB3  4  
ATOM 7981  H HG   . SER A 1 101 ? 27.707 -28.487 7.482  1.00 52.24 ? 101 SER A HG   4  
ATOM 7982  N N    . ILE A 1 102 ? 28.470 -28.679 12.002 1.00 12.43 ? 102 ILE A N    4  
ATOM 7983  C CA   . ILE A 1 102 ? 29.275 -28.029 13.029 1.00 14.51 ? 102 ILE A CA   4  
ATOM 7984  C C    . ILE A 1 102 ? 30.518 -27.384 12.427 1.00 41.35 ? 102 ILE A C    4  
ATOM 7985  O O    . ILE A 1 102 ? 31.501 -28.063 12.135 1.00 65.25 ? 102 ILE A O    4  
ATOM 7986  C CB   . ILE A 1 102 ? 29.705 -29.025 14.122 1.00 40.12 ? 102 ILE A CB   4  
ATOM 7987  C CG1  . ILE A 1 102 ? 28.498 -29.445 14.963 1.00 22.42 ? 102 ILE A CG1  4  
ATOM 7988  C CG2  . ILE A 1 102 ? 30.784 -28.412 15.002 1.00 32.12 ? 102 ILE A CG2  4  
ATOM 7989  C CD1  . ILE A 1 102 ? 28.192 -30.924 14.883 1.00 33.52 ? 102 ILE A CD1  4  
ATOM 7990  H H    . ILE A 1 102 ? 28.740 -29.560 11.670 1.00 50.43 ? 102 ILE A H    4  
ATOM 7991  H HA   . ILE A 1 102 ? 28.670 -27.260 13.489 1.00 42.22 ? 102 ILE A HA   4  
ATOM 7992  H HB   . ILE A 1 102 ? 30.120 -29.897 13.640 1.00 50.35 ? 102 ILE A HB   4  
ATOM 7993  H HG12 . ILE A 1 102 ? 28.685 -29.202 15.997 1.00 44.50 ? 102 ILE A HG12 4  
ATOM 7994  H HG13 . ILE A 1 102 ? 27.626 -28.906 14.623 1.00 41.04 ? 102 ILE A HG13 4  
ATOM 7995  H HG21 . ILE A 1 102 ? 31.752 -28.777 14.692 1.00 32.21 ? 102 ILE A HG21 4  
ATOM 7996  H HG22 . ILE A 1 102 ? 30.758 -27.337 14.906 1.00 2.05  ? 102 ILE A HG22 4  
ATOM 7997  H HG23 . ILE A 1 102 ? 30.608 -28.687 16.031 1.00 1.33  ? 102 ILE A HG23 4  
ATOM 7998  H HD11 . ILE A 1 102 ? 29.073 -31.490 15.148 1.00 71.02 ? 102 ILE A HD11 4  
ATOM 7999  H HD12 . ILE A 1 102 ? 27.390 -31.164 15.566 1.00 64.13 ? 102 ILE A HD12 4  
ATOM 8000  H HD13 . ILE A 1 102 ? 27.893 -31.176 13.875 1.00 21.05 ? 102 ILE A HD13 4  
ATOM 8001  N N    . GLU A 1 103 ? 30.467 -26.068 12.245 1.00 11.31 ? 103 GLU A N    4  
ATOM 8002  C CA   . GLU A 1 103 ? 31.590 -25.331 11.678 1.00 24.21 ? 103 GLU A CA   4  
ATOM 8003  C C    . GLU A 1 103 ? 31.752 -23.976 12.360 1.00 51.51 ? 103 GLU A C    4  
ATOM 8004  O O    . GLU A 1 103 ? 30.860 -23.129 12.300 1.00 44.10 ? 103 GLU A O    4  
ATOM 8005  C CB   . GLU A 1 103 ? 31.394 -25.137 10.173 1.00 24.20 ? 103 GLU A CB   4  
ATOM 8006  C CG   . GLU A 1 103 ? 30.422 -26.126 9.553  1.00 34.44 ? 103 GLU A CG   4  
ATOM 8007  C CD   . GLU A 1 103 ? 30.348 -26.005 8.044  1.00 43.23 ? 103 GLU A CD   4  
ATOM 8008  O OE1  . GLU A 1 103 ? 29.244 -25.742 7.523  1.00 33.43 ? 103 GLU A OE1  4  
ATOM 8009  O OE2  . GLU A 1 103 ? 31.394 -26.172 7.383  1.00 65.10 ? 103 GLU A OE2  4  
ATOM 8010  H H    . GLU A 1 103 ? 29.655 -25.581 12.498 1.00 73.23 ? 103 GLU A H    4  
ATOM 8011  H HA   . GLU A 1 103 ? 32.485 -25.912 11.843 1.00 20.31 ? 103 GLU A HA   4  
ATOM 8012  H HB2  . GLU A 1 103 ? 31.022 -24.139 9.996  1.00 5.33  ? 103 GLU A HB2  4  
ATOM 8013  H HB3  . GLU A 1 103 ? 32.349 -25.248 9.681  1.00 5.21  ? 103 GLU A HB3  4  
ATOM 8014  H HG2  . GLU A 1 103 ? 30.738 -27.128 9.803  1.00 3.13  ? 103 GLU A HG2  4  
ATOM 8015  H HG3  . GLU A 1 103 ? 29.438 -25.949 9.962  1.00 11.35 ? 103 GLU A HG3  4  
ATOM 8016  N N    . TRP A 1 104 ? 32.894 -23.778 13.008 1.00 64.54 ? 104 TRP A N    4  
ATOM 8017  C CA   . TRP A 1 104 ? 33.173 -22.526 13.702 1.00 61.32 ? 104 TRP A CA   4  
ATOM 8018  C C    . TRP A 1 104 ? 34.385 -21.826 13.096 1.00 33.33 ? 104 TRP A C    4  
ATOM 8019  O O    . TRP A 1 104 ? 35.527 -22.211 13.349 1.00 21.20 ? 104 TRP A O    4  
ATOM 8020  C CB   . TRP A 1 104 ? 33.410 -22.786 15.190 1.00 32.33 ? 104 TRP A CB   4  
ATOM 8021  C CG   . TRP A 1 104 ? 32.542 -23.873 15.749 1.00 52.10 ? 104 TRP A CG   4  
ATOM 8022  C CD1  . TRP A 1 104 ? 32.947 -24.947 16.488 1.00 22.23 ? 104 TRP A CD1  4  
ATOM 8023  C CD2  . TRP A 1 104 ? 31.122 -23.991 15.611 1.00 34.22 ? 104 TRP A CD2  4  
ATOM 8024  N NE1  . TRP A 1 104 ? 31.865 -25.726 16.818 1.00 34.25 ? 104 TRP A NE1  4  
ATOM 8025  C CE2  . TRP A 1 104 ? 30.733 -25.161 16.293 1.00 11.10 ? 104 TRP A CE2  4  
ATOM 8026  C CE3  . TRP A 1 104 ? 30.140 -23.222 14.980 1.00 23.02 ? 104 TRP A CE3  4  
ATOM 8027  C CZ2  . TRP A 1 104 ? 29.406 -25.578 16.359 1.00 41.31 ? 104 TRP A CZ2  4  
ATOM 8028  C CZ3  . TRP A 1 104 ? 28.824 -23.637 15.046 1.00 31.22 ? 104 TRP A CZ3  4  
ATOM 8029  C CH2  . TRP A 1 104 ? 28.466 -24.806 15.732 1.00 42.40 ? 104 TRP A CH2  4  
ATOM 8030  H H    . TRP A 1 104 ? 33.567 -24.492 13.020 1.00 51.33 ? 104 TRP A H    4  
ATOM 8031  H HA   . TRP A 1 104 ? 32.310 -21.887 13.590 1.00 35.21 ? 104 TRP A HA   4  
ATOM 8032  H HB2  . TRP A 1 104 ? 34.440 -23.073 15.340 1.00 0.41  ? 104 TRP A HB2  4  
ATOM 8033  H HB3  . TRP A 1 104 ? 33.208 -21.880 15.743 1.00 51.01 ? 104 TRP A HB3  4  
ATOM 8034  H HD1  . TRP A 1 104 ? 33.972 -25.144 16.764 1.00 41.33 ? 104 TRP A HD1  4  
ATOM 8035  H HE1  . TRP A 1 104 ? 31.898 -26.552 17.346 1.00 11.22 ? 104 TRP A HE1  4  
ATOM 8036  H HE3  . TRP A 1 104 ? 30.396 -22.318 14.447 1.00 63.42 ? 104 TRP A HE3  4  
ATOM 8037  H HZ2  . TRP A 1 104 ? 29.114 -26.475 16.884 1.00 23.51 ? 104 TRP A HZ2  4  
ATOM 8038  H HZ3  . TRP A 1 104 ? 28.052 -23.056 14.564 1.00 13.30 ? 104 TRP A HZ3  4  
ATOM 8039  H HH2  . TRP A 1 104 ? 27.426 -25.092 15.757 1.00 1.24  ? 104 TRP A HH2  4  
ATOM 8040  N N    . LEU A 1 105 ? 34.129 -20.797 12.297 1.00 42.25 ? 105 LEU A N    4  
ATOM 8041  C CA   . LEU A 1 105 ? 35.200 -20.042 11.655 1.00 62.31 ? 105 LEU A CA   4  
ATOM 8042  C C    . LEU A 1 105 ? 35.588 -18.828 12.492 1.00 10.32 ? 105 LEU A C    4  
ATOM 8043  O O    . LEU A 1 105 ? 34.752 -18.245 13.183 1.00 22.33 ? 105 LEU A O    4  
ATOM 8044  C CB   . LEU A 1 105 ? 34.769 -19.596 10.257 1.00 43.42 ? 105 LEU A CB   4  
ATOM 8045  C CG   . LEU A 1 105 ? 34.850 -20.657 9.159  1.00 54.44 ? 105 LEU A CG   4  
ATOM 8046  C CD1  . LEU A 1 105 ? 36.267 -21.194 9.039  1.00 60.43 ? 105 LEU A CD1  4  
ATOM 8047  C CD2  . LEU A 1 105 ? 33.870 -21.787 9.437  1.00 71.32 ? 105 LEU A CD2  4  
ATOM 8048  H H    . LEU A 1 105 ? 33.199 -20.537 12.133 1.00 31.11 ? 105 LEU A H    4  
ATOM 8049  H HA   . LEU A 1 105 ? 36.058 -20.693 11.568 1.00 54.13 ? 105 LEU A HA   4  
ATOM 8050  H HB2  . LEU A 1 105 ? 33.745 -19.260 10.318 1.00 64.21 ? 105 LEU A HB2  4  
ATOM 8051  H HB3  . LEU A 1 105 ? 35.401 -18.768 9.966  1.00 73.03 ? 105 LEU A HB3  4  
ATOM 8052  H HG   . LEU A 1 105 ? 34.583 -20.207 8.212  1.00 13.11 ? 105 LEU A HG   4  
ATOM 8053  H HD11 . LEU A 1 105 ? 36.347 -21.802 8.150  1.00 24.23 ? 105 LEU A HD11 4  
ATOM 8054  H HD12 . LEU A 1 105 ? 36.499 -21.793 9.907  1.00 64.21 ? 105 LEU A HD12 4  
ATOM 8055  H HD13 . LEU A 1 105 ? 36.961 -20.369 8.975  1.00 11.11 ? 105 LEU A HD13 4  
ATOM 8056  H HD21 . LEU A 1 105 ? 34.351 -22.538 10.045 1.00 24.45 ? 105 LEU A HD21 4  
ATOM 8057  H HD22 . LEU A 1 105 ? 33.555 -22.229 8.502  1.00 3.13  ? 105 LEU A HD22 4  
ATOM 8058  H HD23 . LEU A 1 105 ? 33.009 -21.397 9.959  1.00 22.33 ? 105 LEU A HD23 4  
ATOM 8059  N N    . SER A 1 106 ? 36.860 -18.450 12.424 1.00 45.14 ? 106 SER A N    4  
ATOM 8060  C CA   . SER A 1 106 ? 37.360 -17.305 13.177 1.00 74.24 ? 106 SER A CA   4  
ATOM 8061  C C    . SER A 1 106 ? 36.768 -16.004 12.643 1.00 63.13 ? 106 SER A C    4  
ATOM 8062  O O    . SER A 1 106 ? 35.992 -16.009 11.687 1.00 40.31 ? 106 SER A O    4  
ATOM 8063  C CB   . SER A 1 106 ? 38.887 -17.250 13.109 1.00 60.22 ? 106 SER A CB   4  
ATOM 8064  O OG   . SER A 1 106 ? 39.415 -16.445 14.149 1.00 60.41 ? 106 SER A OG   4  
ATOM 8065  H H    . SER A 1 106 ? 37.479 -18.955 11.855 1.00 53.13 ? 106 SER A H    4  
ATOM 8066  H HA   . SER A 1 106 ? 37.058 -17.428 14.206 1.00 73.50 ? 106 SER A HA   4  
ATOM 8067  H HB2  . SER A 1 106 ? 39.285 -18.249 13.205 1.00 3.32  ? 106 SER A HB2  4  
ATOM 8068  H HB3  . SER A 1 106 ? 39.188 -16.833 12.159 1.00 55.34 ? 106 SER A HB3  4  
ATOM 8069  H HG   . SER A 1 106 ? 39.958 -16.986 14.728 1.00 54.31 ? 106 SER A HG   4  
ATOM 8070  N N    . ILE A 1 107 ? 37.141 -14.892 13.267 1.00 23.12 ? 107 ILE A N    4  
ATOM 8071  C CA   . ILE A 1 107 ? 36.649 -13.583 12.855 1.00 23.50 ? 107 ILE A CA   4  
ATOM 8072  C C    . ILE A 1 107 ? 37.293 -13.142 11.545 1.00 53.01 ? 107 ILE A C    4  
ATOM 8073  O O    . ILE A 1 107 ? 36.749 -12.305 10.826 1.00 71.02 ? 107 ILE A O    4  
ATOM 8074  C CB   . ILE A 1 107 ? 36.919 -12.516 13.932 1.00 41.13 ? 107 ILE A CB   4  
ATOM 8075  C CG1  . ILE A 1 107 ? 36.395 -12.986 15.290 1.00 24.52 ? 107 ILE A CG1  4  
ATOM 8076  C CG2  . ILE A 1 107 ? 36.277 -11.194 13.539 1.00 12.34 ? 107 ILE A CG2  4  
ATOM 8077  C CD1  . ILE A 1 107 ? 36.624 -11.989 16.404 1.00 24.45 ? 107 ILE A CD1  4  
ATOM 8078  H H    . ILE A 1 107 ? 37.762 -14.953 14.022 1.00 24.23 ? 107 ILE A H    4  
ATOM 8079  H HA   . ILE A 1 107 ? 35.581 -13.659 12.712 1.00 60.45 ? 107 ILE A HA   4  
ATOM 8080  H HB   . ILE A 1 107 ? 37.986 -12.365 13.998 1.00 53.33 ? 107 ILE A HB   4  
ATOM 8081  H HG12 . ILE A 1 107 ? 35.334 -13.164 15.218 1.00 61.20 ? 107 ILE A HG12 4  
ATOM 8082  H HG13 . ILE A 1 107 ? 36.893 -13.907 15.560 1.00 51.11 ? 107 ILE A HG13 4  
ATOM 8083  H HG21 . ILE A 1 107 ? 36.469 -10.458 14.307 1.00 65.34 ? 107 ILE A HG21 4  
ATOM 8084  H HG22 . ILE A 1 107 ? 36.695 -10.854 12.604 1.00 62.42 ? 107 ILE A HG22 4  
ATOM 8085  H HG23 . ILE A 1 107 ? 35.211 -11.329 13.430 1.00 64.20 ? 107 ILE A HG23 4  
ATOM 8086  H HD11 . ILE A 1 107 ? 37.678 -11.760 16.472 1.00 54.10 ? 107 ILE A HD11 4  
ATOM 8087  H HD12 . ILE A 1 107 ? 36.070 -11.086 16.199 1.00 24.05 ? 107 ILE A HD12 4  
ATOM 8088  H HD13 . ILE A 1 107 ? 36.289 -12.413 17.341 1.00 53.35 ? 107 ILE A HD13 4  
ATOM 8089  N N    . ASN A 1 108 ? 38.454 -13.713 11.240 1.00 11.54 ? 108 ASN A N    4  
ATOM 8090  C CA   . ASN A 1 108 ? 39.172 -13.379 10.015 1.00 15.25 ? 108 ASN A CA   4  
ATOM 8091  C C    . ASN A 1 108 ? 38.870 -14.392 8.915  1.00 11.32 ? 108 ASN A C    4  
ATOM 8092  O O    . ASN A 1 108 ? 39.563 -14.444 7.900  1.00 23.40 ? 108 ASN A O    4  
ATOM 8093  C CB   . ASN A 1 108 ? 40.678 -13.329 10.280 1.00 72.25 ? 108 ASN A CB   4  
ATOM 8094  C CG   . ASN A 1 108 ? 41.005 -12.803 11.663 1.00 1.54  ? 108 ASN A CG   4  
ATOM 8095  O OD1  . ASN A 1 108 ? 41.275 -11.614 11.840 1.00 70.43 ? 108 ASN A OD1  4  
ATOM 8096  N ND2  . ASN A 1 108 ? 40.983 -13.687 12.654 1.00 72.24 ? 108 ASN A ND2  4  
ATOM 8097  H H    . ASN A 1 108 ? 38.838 -14.373 11.854 1.00 34.30 ? 108 ASN A H    4  
ATOM 8098  H HA   . ASN A 1 108 ? 38.839 -12.404 9.692  1.00 5.21  ? 108 ASN A HA   4  
ATOM 8099  H HB2  . ASN A 1 108 ? 41.086 -14.325 10.189 1.00 31.50 ? 108 ASN A HB2  4  
ATOM 8100  H HB3  . ASN A 1 108 ? 41.145 -12.686 9.549  1.00 14.43 ? 108 ASN A HB3  4  
ATOM 8101  H HD21 . ASN A 1 108 ? 40.760 -14.617 12.439 1.00 74.20 ? 108 ASN A HD21 4  
ATOM 8102  H HD22 . ASN A 1 108 ? 41.190 -13.374 13.559 1.00 51.44 ? 108 ASN A HD22 4  
ATOM 8103  N N    . GLU A 1 109 ? 37.830 -15.193 9.125  1.00 63.30 ? 109 GLU A N    4  
ATOM 8104  C CA   . GLU A 1 109 ? 37.437 -16.205 8.151  1.00 44.44 ? 109 GLU A CA   4  
ATOM 8105  C C    . GLU A 1 109 ? 35.998 -15.988 7.692  1.00 42.01 ? 109 GLU A C    4  
ATOM 8106  O O    . GLU A 1 109 ? 35.622 -16.378 6.586  1.00 73.11 ? 109 GLU A O    4  
ATOM 8107  C CB   . GLU A 1 109 ? 37.589 -17.605 8.747  1.00 32.42 ? 109 GLU A CB   4  
ATOM 8108  C CG   . GLU A 1 109 ? 39.033 -18.015 8.979  1.00 24.41 ? 109 GLU A CG   4  
ATOM 8109  C CD   . GLU A 1 109 ? 39.832 -18.091 7.692  1.00 1.04  ? 109 GLU A CD   4  
ATOM 8110  O OE1  . GLU A 1 109 ? 39.221 -18.312 6.626  1.00 0.41  ? 109 GLU A OE1  4  
ATOM 8111  O OE2  . GLU A 1 109 ? 41.069 -17.929 7.752  1.00 21.14 ? 109 GLU A OE2  4  
ATOM 8112  H H    . GLU A 1 109 ? 37.316 -15.103 9.954  1.00 1.13  ? 109 GLU A H    4  
ATOM 8113  H HA   . GLU A 1 109 ? 38.092 -16.114 7.297  1.00 71.50 ? 109 GLU A HA   4  
ATOM 8114  H HB2  . GLU A 1 109 ? 37.070 -17.639 9.694  1.00 51.41 ? 109 GLU A HB2  4  
ATOM 8115  H HB3  . GLU A 1 109 ? 37.138 -18.320 8.075  1.00 74.12 ? 109 GLU A HB3  4  
ATOM 8116  H HG2  . GLU A 1 109 ? 39.499 -17.292 9.632  1.00 62.23 ? 109 GLU A HG2  4  
ATOM 8117  H HG3  . GLU A 1 109 ? 39.047 -18.986 9.452  1.00 62.52 ? 109 GLU A HG3  4  
ATOM 8118  N N    . LEU A 1 110 ? 35.198 -15.364 8.549  1.00 31.23 ? 110 LEU A N    4  
ATOM 8119  C CA   . LEU A 1 110 ? 33.799 -15.095 8.234  1.00 63.43 ? 110 LEU A CA   4  
ATOM 8120  C C    . LEU A 1 110 ? 33.661 -14.503 6.835  1.00 72.11 ? 110 LEU A C    4  
ATOM 8121  O O    . LEU A 1 110 ? 32.689 -14.773 6.129  1.00 12.11 ? 110 LEU A O    4  
ATOM 8122  C CB   . LEU A 1 110 ? 33.197 -14.141 9.266  1.00 4.41  ? 110 LEU A CB   4  
ATOM 8123  C CG   . LEU A 1 110 ? 34.041 -12.915 9.619  1.00 22.33 ? 110 LEU A CG   4  
ATOM 8124  C CD1  . LEU A 1 110 ? 33.780 -11.786 8.635  1.00 3.30  ? 110 LEU A CD1  4  
ATOM 8125  C CD2  . LEU A 1 110 ? 33.753 -12.462 11.043 1.00 2.20  ? 110 LEU A CD2  4  
ATOM 8126  H H    . LEU A 1 110 ? 35.555 -15.077 9.415  1.00 31.22 ? 110 LEU A H    4  
ATOM 8127  H HA   . LEU A 1 110 ? 33.266 -16.034 8.269  1.00 54.53 ? 110 LEU A HA   4  
ATOM 8128  H HB2  . LEU A 1 110 ? 32.252 -13.791 8.881  1.00 11.21 ? 110 LEU A HB2  4  
ATOM 8129  H HB3  . LEU A 1 110 ? 33.029 -14.701 10.175 1.00 40.11 ? 110 LEU A HB3  4  
ATOM 8130  H HG   . LEU A 1 110 ? 35.089 -13.177 9.556  1.00 15.01 ? 110 LEU A HG   4  
ATOM 8131  H HD11 . LEU A 1 110 ? 33.166 -12.149 7.825  1.00 1.21  ? 110 LEU A HD11 4  
ATOM 8132  H HD12 . LEU A 1 110 ? 34.720 -11.427 8.242  1.00 51.14 ? 110 LEU A HD12 4  
ATOM 8133  H HD13 . LEU A 1 110 ? 33.270 -10.979 9.141  1.00 45.44 ? 110 LEU A HD13 4  
ATOM 8134  H HD21 . LEU A 1 110 ? 34.526 -11.779 11.366 1.00 35.51 ? 110 LEU A HD21 4  
ATOM 8135  H HD22 . LEU A 1 110 ? 33.735 -13.321 11.698 1.00 63.12 ? 110 LEU A HD22 4  
ATOM 8136  H HD23 . LEU A 1 110 ? 32.796 -11.964 11.075 1.00 13.33 ? 110 LEU A HD23 4  
ATOM 8137  N N    . ASP A 1 111 ? 34.640 -13.697 6.440  1.00 11.10 ? 111 ASP A N    4  
ATOM 8138  C CA   . ASP A 1 111 ? 34.629 -13.069 5.124  1.00 43.21 ? 111 ASP A CA   4  
ATOM 8139  C C    . ASP A 1 111 ? 34.443 -14.111 4.026  1.00 73.12 ? 111 ASP A C    4  
ATOM 8140  O O    . ASP A 1 111 ? 33.590 -13.961 3.151  1.00 73.23 ? 111 ASP A O    4  
ATOM 8141  C CB   . ASP A 1 111 ? 35.928 -12.295 4.894  1.00 4.22  ? 111 ASP A CB   4  
ATOM 8142  C CG   . ASP A 1 111 ? 35.832 -11.337 3.723  1.00 1.43  ? 111 ASP A CG   4  
ATOM 8143  O OD1  . ASP A 1 111 ? 36.887 -10.843 3.273  1.00 72.23 ? 111 ASP A OD1  4  
ATOM 8144  O OD2  . ASP A 1 111 ? 34.702 -11.079 3.258  1.00 72.50 ? 111 ASP A OD2  4  
ATOM 8145  H H    . ASP A 1 111 ? 35.388 -13.520 7.048  1.00 24.41 ? 111 ASP A H    4  
ATOM 8146  H HA   . ASP A 1 111 ? 33.800 -12.379 5.092  1.00 12.24 ? 111 ASP A HA   4  
ATOM 8147  H HB2  . ASP A 1 111 ? 36.163 -11.726 5.782  1.00 11.02 ? 111 ASP A HB2  4  
ATOM 8148  H HB3  . ASP A 1 111 ? 36.727 -12.995 4.699  1.00 61.13 ? 111 ASP A HB3  4  
ATOM 8149  N N    . LYS A 1 112 ? 35.247 -15.168 4.077  1.00 12.32 ? 112 LYS A N    4  
ATOM 8150  C CA   . LYS A 1 112 ? 35.171 -16.236 3.088  1.00 63.11 ? 112 LYS A CA   4  
ATOM 8151  C C    . LYS A 1 112 ? 33.830 -16.959 3.169  1.00 45.33 ? 112 LYS A C    4  
ATOM 8152  O O    . LYS A 1 112 ? 33.440 -17.670 2.242  1.00 41.12 ? 112 LYS A O    4  
ATOM 8153  C CB   . LYS A 1 112 ? 36.313 -17.233 3.296  1.00 65.22 ? 112 LYS A CB   4  
ATOM 8154  C CG   . LYS A 1 112 ? 36.224 -18.456 2.399  1.00 2.11  ? 112 LYS A CG   4  
ATOM 8155  C CD   . LYS A 1 112 ? 35.533 -19.613 3.101  1.00 53.31 ? 112 LYS A CD   4  
ATOM 8156  C CE   . LYS A 1 112 ? 36.336 -20.100 4.297  1.00 3.51  ? 112 LYS A CE   4  
ATOM 8157  N NZ   . LYS A 1 112 ? 37.772 -20.302 3.956  1.00 54.32 ? 112 LYS A NZ   4  
ATOM 8158  H H    . LYS A 1 112 ? 35.907 -15.231 4.799  1.00 1.25  ? 112 LYS A H    4  
ATOM 8159  H HA   . LYS A 1 112 ? 35.268 -15.790 2.110  1.00 52.13 ? 112 LYS A HA   4  
ATOM 8160  H HB2  . LYS A 1 112 ? 37.251 -16.735 3.098  1.00 50.24 ? 112 LYS A HB2  4  
ATOM 8161  H HB3  . LYS A 1 112 ? 36.303 -17.565 4.324  1.00 74.30 ? 112 LYS A HB3  4  
ATOM 8162  H HG2  . LYS A 1 112 ? 35.664 -18.201 1.512  1.00 51.40 ? 112 LYS A HG2  4  
ATOM 8163  H HG3  . LYS A 1 112 ? 37.223 -18.761 2.121  1.00 41.30 ? 112 LYS A HG3  4  
ATOM 8164  H HD2  . LYS A 1 112 ? 34.562 -19.287 3.443  1.00 54.32 ? 112 LYS A HD2  4  
ATOM 8165  H HD3  . LYS A 1 112 ? 35.415 -20.428 2.401  1.00 31.22 ? 112 LYS A HD3  4  
ATOM 8166  H HE2  . LYS A 1 112 ? 36.263 -19.367 5.086  1.00 55.10 ? 112 LYS A HE2  4  
ATOM 8167  H HE3  . LYS A 1 112 ? 35.920 -21.037 4.636  1.00 0.42  ? 112 LYS A HE3  4  
ATOM 8168  H HZ1  . LYS A 1 112 ? 38.295 -19.411 4.074  1.00 45.24 ? 112 LYS A HZ1  4  
ATOM 8169  H HZ2  . LYS A 1 112 ? 37.863 -20.616 2.969  1.00 64.40 ? 112 LYS A HZ2  4  
ATOM 8170  H HZ3  . LYS A 1 112 ? 38.189 -21.022 4.579  1.00 62.14 ? 112 LYS A HZ3  4  
ATOM 8171  N N    . LEU A 1 113 ? 33.129 -16.771 4.281  1.00 32.40 ? 113 LEU A N    4  
ATOM 8172  C CA   . LEU A 1 113 ? 31.830 -17.404 4.482  1.00 20.51 ? 113 LEU A CA   4  
ATOM 8173  C C    . LEU A 1 113 ? 30.707 -16.531 3.931  1.00 64.32 ? 113 LEU A C    4  
ATOM 8174  O O    . LEU A 1 113 ? 29.669 -16.362 4.568  1.00 21.44 ? 113 LEU A O    4  
ATOM 8175  C CB   . LEU A 1 113 ? 31.597 -17.675 5.970  1.00 63.14 ? 113 LEU A CB   4  
ATOM 8176  C CG   . LEU A 1 113 ? 32.754 -18.335 6.721  1.00 61.44 ? 113 LEU A CG   4  
ATOM 8177  C CD1  . LEU A 1 113 ? 32.242 -19.069 7.951  1.00 44.33 ? 113 LEU A CD1  4  
ATOM 8178  C CD2  . LEU A 1 113 ? 33.510 -19.288 5.805  1.00 14.14 ? 113 LEU A CD2  4  
ATOM 8179  H H    . LEU A 1 113 ? 33.492 -16.194 4.984  1.00 13.12 ? 113 LEU A H    4  
ATOM 8180  H HA   . LEU A 1 113 ? 31.834 -18.344 3.950  1.00 55.12 ? 113 LEU A HA   4  
ATOM 8181  H HB2  . LEU A 1 113 ? 31.388 -16.731 6.449  1.00 65.04 ? 113 LEU A HB2  4  
ATOM 8182  H HB3  . LEU A 1 113 ? 30.734 -18.320 6.056  1.00 2.24  ? 113 LEU A HB3  4  
ATOM 8183  H HG   . LEU A 1 113 ? 33.443 -17.571 7.051  1.00 4.33  ? 113 LEU A HG   4  
ATOM 8184  H HD11 . LEU A 1 113 ? 31.163 -19.073 7.944  1.00 1.23  ? 113 LEU A HD11 4  
ATOM 8185  H HD12 . LEU A 1 113 ? 32.595 -18.569 8.841  1.00 44.35 ? 113 LEU A HD12 4  
ATOM 8186  H HD13 . LEU A 1 113 ? 32.607 -20.086 7.941  1.00 1.51  ? 113 LEU A HD13 4  
ATOM 8187  H HD21 . LEU A 1 113 ? 34.378 -18.787 5.403  1.00 30.14 ? 113 LEU A HD21 4  
ATOM 8188  H HD22 . LEU A 1 113 ? 32.865 -19.596 4.995  1.00 14.11 ? 113 LEU A HD22 4  
ATOM 8189  H HD23 . LEU A 1 113 ? 33.822 -20.155 6.367  1.00 32.35 ? 113 LEU A HD23 4  
ATOM 8190  N N    . ASN A 1 114 ? 30.923 -15.980 2.741  1.00 64.33 ? 114 ASN A N    4  
ATOM 8191  C CA   . ASN A 1 114 ? 29.929 -15.126 2.102  1.00 11.33 ? 114 ASN A CA   4  
ATOM 8192  C C    . ASN A 1 114 ? 28.528 -15.443 2.617  1.00 61.12 ? 114 ASN A C    4  
ATOM 8193  O O    . ASN A 1 114 ? 27.978 -16.507 2.332  1.00 54.42 ? 114 ASN A O    4  
ATOM 8194  C CB   . ASN A 1 114 ? 29.978 -15.298 0.583  1.00 74.32 ? 114 ASN A CB   4  
ATOM 8195  C CG   . ASN A 1 114 ? 29.749 -13.993 -0.155 1.00 24.20 ? 114 ASN A CG   4  
ATOM 8196  O OD1  . ASN A 1 114 ? 28.725 -13.335 0.028  1.00 43.23 ? 114 ASN A OD1  4  
ATOM 8197  N ND2  . ASN A 1 114 ? 30.706 -13.613 -0.994 1.00 73.35 ? 114 ASN A ND2  4  
ATOM 8198  H H    . ASN A 1 114 ? 31.772 -16.152 2.281  1.00 74.02 ? 114 ASN A H    4  
ATOM 8199  H HA   . ASN A 1 114 ? 30.166 -14.101 2.347  1.00 23.40 ? 114 ASN A HA   4  
ATOM 8200  H HB2  . ASN A 1 114 ? 30.947 -15.684 0.301  1.00 11.33 ? 114 ASN A HB2  4  
ATOM 8201  H HB3  . ASN A 1 114 ? 29.214 -16.000 0.281  1.00 4.22  ? 114 ASN A HB3  4  
ATOM 8202  H HD21 . ASN A 1 114 ? 31.494 -14.188 -1.090 1.00 31.24 ? 114 ASN A HD21 4  
ATOM 8203  H HD22 . ASN A 1 114 ? 30.584 -12.773 -1.484 1.00 62.21 ? 114 ASN A HD22 4  
ATOM 8204  N N    . TRP A 1 115 ? 27.958 -14.514 3.375  1.00 51.32 ? 115 TRP A N    4  
ATOM 8205  C CA   . TRP A 1 115 ? 26.621 -14.694 3.929  1.00 73.03 ? 115 TRP A CA   4  
ATOM 8206  C C    . TRP A 1 115 ? 25.587 -13.917 3.120  1.00 23.43 ? 115 TRP A C    4  
ATOM 8207  O O    . TRP A 1 115 ? 25.892 -13.389 2.051  1.00 34.23 ? 115 TRP A O    4  
ATOM 8208  C CB   . TRP A 1 115 ? 26.587 -14.244 5.390  1.00 13.40 ? 115 TRP A CB   4  
ATOM 8209  C CG   . TRP A 1 115 ? 27.849 -14.552 6.136  1.00 4.02  ? 115 TRP A CG   4  
ATOM 8210  C CD1  . TRP A 1 115 ? 29.061 -13.941 5.984  1.00 3.01  ? 115 TRP A CD1  4  
ATOM 8211  C CD2  . TRP A 1 115 ? 28.024 -15.548 7.150  1.00 65.24 ? 115 TRP A CD2  4  
ATOM 8212  N NE1  . TRP A 1 115 ? 29.979 -14.497 6.842  1.00 63.41 ? 115 TRP A NE1  4  
ATOM 8213  C CE2  . TRP A 1 115 ? 29.368 -15.485 7.568  1.00 10.24 ? 115 TRP A CE2  4  
ATOM 8214  C CE3  . TRP A 1 115 ? 27.177 -16.486 7.745  1.00 11.14 ? 115 TRP A CE3  4  
ATOM 8215  C CZ2  . TRP A 1 115 ? 29.881 -16.324 8.554  1.00 75.43 ? 115 TRP A CZ2  4  
ATOM 8216  C CZ3  . TRP A 1 115 ? 27.687 -17.319 8.723  1.00 43.31 ? 115 TRP A CZ3  4  
ATOM 8217  C CH2  . TRP A 1 115 ? 29.028 -17.233 9.120  1.00 64.12 ? 115 TRP A CH2  4  
ATOM 8218  H H    . TRP A 1 115 ? 28.447 -13.686 3.567  1.00 64.21 ? 115 TRP A H    4  
ATOM 8219  H HA   . TRP A 1 115 ? 26.382 -15.746 3.880  1.00 20.32 ? 115 TRP A HA   4  
ATOM 8220  H HB2  . TRP A 1 115 ? 26.430 -13.176 5.428  1.00 74.12 ? 115 TRP A HB2  4  
ATOM 8221  H HB3  . TRP A 1 115 ? 25.771 -14.742 5.894  1.00 51.05 ? 115 TRP A HB3  4  
ATOM 8222  H HD1  . TRP A 1 115 ? 29.255 -13.141 5.287  1.00 43.35 ? 115 TRP A HD1  4  
ATOM 8223  H HE1  . TRP A 1 115 ? 30.919 -14.229 6.921  1.00 31.04 ? 115 TRP A HE1  4  
ATOM 8224  H HE3  . TRP A 1 115 ? 26.140 -16.567 7.453  1.00 63.00 ? 115 TRP A HE3  4  
ATOM 8225  H HZ2  . TRP A 1 115 ? 30.912 -16.270 8.871  1.00 73.30 ? 115 TRP A HZ2  4  
ATOM 8226  H HZ3  . TRP A 1 115 ? 27.047 -18.050 9.194  1.00 23.13 ? 115 TRP A HZ3  4  
ATOM 8227  H HH2  . TRP A 1 115 ? 29.384 -17.904 9.887  1.00 51.42 ? 115 TRP A HH2  4  
ATOM 8228  N N    . ALA A 1 116 ? 24.365 -13.852 3.638  1.00 50.13 ? 116 ALA A N    4  
ATOM 8229  C CA   . ALA A 1 116 ? 23.288 -13.138 2.964  1.00 14.52 ? 116 ALA A CA   4  
ATOM 8230  C C    . ALA A 1 116 ? 23.685 -11.695 2.671  1.00 12.32 ? 116 ALA A C    4  
ATOM 8231  O O    . ALA A 1 116 ? 24.670 -11.177 3.198  1.00 31.42 ? 116 ALA A O    4  
ATOM 8232  C CB   . ALA A 1 116 ? 22.021 -13.178 3.806  1.00 52.31 ? 116 ALA A CB   4  
ATOM 8233  H H    . ALA A 1 116 ? 24.184 -14.293 4.493  1.00 31.44 ? 116 ALA A H    4  
ATOM 8234  H HA   . ALA A 1 116 ? 23.086 -13.642 2.030  1.00 52.41 ? 116 ALA A HA   4  
ATOM 8235  H HB1  . ALA A 1 116 ? 21.353 -13.932 3.414  1.00 4.25  ? 116 ALA A HB1  4  
ATOM 8236  H HB2  . ALA A 1 116 ? 22.275 -13.417 4.828  1.00 41.33 ? 116 ALA A HB2  4  
ATOM 8237  H HB3  . ALA A 1 116 ? 21.535 -12.214 3.771  1.00 2.02  ? 116 ALA A HB3  4  
ATOM 8238  N N    . PRO A 1 117 ? 22.902 -11.028 1.810  1.00 41.10 ? 117 PRO A N    4  
ATOM 8239  C CA   . PRO A 1 117 ? 23.153 -9.635  1.427  1.00 30.24 ? 117 PRO A CA   4  
ATOM 8240  C C    . PRO A 1 117 ? 22.889 -8.663  2.572  1.00 0.01  ? 117 PRO A C    4  
ATOM 8241  O O    . PRO A 1 117 ? 23.440 -7.563  2.604  1.00 24.35 ? 117 PRO A O    4  
ATOM 8242  C CB   . PRO A 1 117 ? 22.163 -9.397  0.285  1.00 74.33 ? 117 PRO A CB   4  
ATOM 8243  C CG   . PRO A 1 117 ? 21.064 -10.373 0.527  1.00 74.54 ? 117 PRO A CG   4  
ATOM 8244  C CD   . PRO A 1 117 ? 21.711 -11.582 1.144  1.00 44.02 ? 117 PRO A CD   4  
ATOM 8245  H HA   . PRO A 1 117 ? 24.162 -9.499  1.066  1.00 12.40 ? 117 PRO A HA   4  
ATOM 8246  H HB2  . PRO A 1 117 ? 21.803 -8.379  0.323  1.00 40.41 ? 117 PRO A HB2  4  
ATOM 8247  H HB3  . PRO A 1 117 ? 22.649 -9.578  -0.662 1.00 4.11  ? 117 PRO A HB3  4  
ATOM 8248  H HG2  . PRO A 1 117 ? 20.338 -9.949  1.204  1.00 24.52 ? 117 PRO A HG2  4  
ATOM 8249  H HG3  . PRO A 1 117 ? 20.595 -10.637 -0.410 1.00 32.31 ? 117 PRO A HG3  4  
ATOM 8250  H HD2  . PRO A 1 117 ? 21.047 -12.041 1.861  1.00 62.53 ? 117 PRO A HD2  4  
ATOM 8251  H HD3  . PRO A 1 117 ? 21.993 -12.291 0.379  1.00 2.13  ? 117 PRO A HD3  4  
ATOM 8252  N N    . ALA A 1 118 ? 22.043 -9.076  3.510  1.00 72.11 ? 118 ALA A N    4  
ATOM 8253  C CA   . ALA A 1 118 ? 21.708 -8.242  4.658  1.00 61.33 ? 118 ALA A CA   4  
ATOM 8254  C C    . ALA A 1 118 ? 22.656 -8.506  5.823  1.00 50.12 ? 118 ALA A C    4  
ATOM 8255  O O    . ALA A 1 118 ? 22.894 -7.628  6.653  1.00 72.23 ? 118 ALA A O    4  
ATOM 8256  C CB   . ALA A 1 118 ? 20.267 -8.483  5.082  1.00 10.24 ? 118 ALA A CB   4  
ATOM 8257  H H    . ALA A 1 118 ? 21.635 -9.963  3.429  1.00 61.35 ? 118 ALA A H    4  
ATOM 8258  H HA   . ALA A 1 118 ? 21.801 -7.208  4.358  1.00 63.34 ? 118 ALA A HA   4  
ATOM 8259  H HB1  . ALA A 1 118 ? 19.782 -9.124  4.361  1.00 63.33 ? 118 ALA A HB1  4  
ATOM 8260  H HB2  . ALA A 1 118 ? 20.252 -8.956  6.053  1.00 61.03 ? 118 ALA A HB2  4  
ATOM 8261  H HB3  . ALA A 1 118 ? 19.745 -7.539  5.133  1.00 32.14 ? 118 ALA A HB3  4  
ATOM 8262  N N    . ASP A 1 119 ? 23.194 -9.719  5.879  1.00 74.31 ? 119 ASP A N    4  
ATOM 8263  C CA   . ASP A 1 119 ? 24.116 -10.098 6.943  1.00 62.32 ? 119 ASP A CA   4  
ATOM 8264  C C    . ASP A 1 119 ? 25.556 -9.776  6.554  1.00 13.11 ? 119 ASP A C    4  
ATOM 8265  O O    . ASP A 1 119 ? 26.405 -9.545  7.416  1.00 54.23 ? 119 ASP A O    4  
ATOM 8266  C CB   . ASP A 1 119 ? 23.981 -11.589 7.257  1.00 64.12 ? 119 ASP A CB   4  
ATOM 8267  C CG   . ASP A 1 119 ? 22.789 -11.888 8.144  1.00 71.31 ? 119 ASP A CG   4  
ATOM 8268  O OD1  . ASP A 1 119 ? 21.732 -12.279 7.605  1.00 25.21 ? 119 ASP A OD1  4  
ATOM 8269  O OD2  . ASP A 1 119 ? 22.912 -11.731 9.377  1.00 53.22 ? 119 ASP A OD2  4  
ATOM 8270  H H    . ASP A 1 119 ? 22.965 -10.376 5.188  1.00 40.23 ? 119 ASP A H    4  
ATOM 8271  H HA   . ASP A 1 119 ? 23.859 -9.530  7.823  1.00 14.34 ? 119 ASP A HA   4  
ATOM 8272  H HB2  . ASP A 1 119 ? 23.865 -12.136 6.332  1.00 32.15 ? 119 ASP A HB2  4  
ATOM 8273  H HB3  . ASP A 1 119 ? 24.876 -11.927 7.760  1.00 55.41 ? 119 ASP A HB3  4  
ATOM 8274  N N    . ILE A 1 120 ? 25.823 -9.763  5.253  1.00 61.24 ? 120 ILE A N    4  
ATOM 8275  C CA   . ILE A 1 120 ? 27.160 -9.469  4.751  1.00 75.34 ? 120 ILE A CA   4  
ATOM 8276  C C    . ILE A 1 120 ? 27.749 -8.244  5.441  1.00 53.33 ? 120 ILE A C    4  
ATOM 8277  O O    . ILE A 1 120 ? 28.831 -8.290  6.025  1.00 23.13 ? 120 ILE A O    4  
ATOM 8278  C CB   . ILE A 1 120 ? 27.150 -9.233  3.229  1.00 51.42 ? 120 ILE A CB   4  
ATOM 8279  C CG1  . ILE A 1 120 ? 27.358 -10.553 2.484  1.00 10.11 ? 120 ILE A CG1  4  
ATOM 8280  C CG2  . ILE A 1 120 ? 28.223 -8.226  2.843  1.00 52.54 ? 120 ILE A CG2  4  
ATOM 8281  C CD1  . ILE A 1 120 ? 26.703 -10.587 1.121  1.00 60.40 ? 120 ILE A CD1  4  
ATOM 8282  H H    . ILE A 1 120 ? 25.104 -9.955  4.615  1.00 25.30 ? 120 ILE A H    4  
ATOM 8283  H HA   . ILE A 1 120 ? 27.788 -10.323 4.958  1.00 24.11 ? 120 ILE A HA   4  
ATOM 8284  H HB   . ILE A 1 120 ? 26.190 -8.822  2.957  1.00 12.50 ? 120 ILE A HB   4  
ATOM 8285  H HG12 . ILE A 1 120 ? 28.415 -10.720 2.348  1.00 52.52 ? 120 ILE A HG12 4  
ATOM 8286  H HG13 . ILE A 1 120 ? 26.944 -11.359 3.073  1.00 54.42 ? 120 ILE A HG13 4  
ATOM 8287  H HG21 . ILE A 1 120 ? 27.890 -7.230  3.096  1.00 12.13 ? 120 ILE A HG21 4  
ATOM 8288  H HG22 . ILE A 1 120 ? 29.133 -8.447  3.379  1.00 44.03 ? 120 ILE A HG22 4  
ATOM 8289  H HG23 . ILE A 1 120 ? 28.406 -8.284  1.780  1.00 24.04 ? 120 ILE A HG23 4  
ATOM 8290  H HD11 . ILE A 1 120 ? 26.407 -9.588  0.838  1.00 72.11 ? 120 ILE A HD11 4  
ATOM 8291  H HD12 . ILE A 1 120 ? 27.401 -10.976 0.395  1.00 21.43 ? 120 ILE A HD12 4  
ATOM 8292  H HD13 . ILE A 1 120 ? 25.830 -11.224 1.157  1.00 1.33  ? 120 ILE A HD13 4  
ATOM 8293  N N    . PRO A 1 121 ? 27.020 -7.120  5.374  1.00 11.31 ? 121 PRO A N    4  
ATOM 8294  C CA   . PRO A 1 121 ? 27.449 -5.860  5.989  1.00 23.21 ? 121 PRO A CA   4  
ATOM 8295  C C    . PRO A 1 121 ? 27.406 -5.915  7.512  1.00 0.54  ? 121 PRO A C    4  
ATOM 8296  O O    . PRO A 1 121 ? 28.132 -5.187  8.190  1.00 70.44 ? 121 PRO A O    4  
ATOM 8297  C CB   . PRO A 1 121 ? 26.434 -4.843  5.461  1.00 21.52 ? 121 PRO A CB   4  
ATOM 8298  C CG   . PRO A 1 121 ? 25.220 -5.648  5.147  1.00 23.13 ? 121 PRO A CG   4  
ATOM 8299  C CD   . PRO A 1 121 ? 25.720 -6.992  4.694  1.00 42.12 ? 121 PRO A CD   4  
ATOM 8300  H HA   . PRO A 1 121 ? 28.442 -5.580  5.668  1.00 30.21 ? 121 PRO A HA   4  
ATOM 8301  H HB2  . PRO A 1 121 ? 26.232 -4.104  6.223  1.00 5.51  ? 121 PRO A HB2  4  
ATOM 8302  H HB3  . PRO A 1 121 ? 26.827 -4.362  4.579  1.00 42.33 ? 121 PRO A HB3  4  
ATOM 8303  H HG2  . PRO A 1 121 ? 24.611 -5.754  6.032  1.00 53.33 ? 121 PRO A HG2  4  
ATOM 8304  H HG3  . PRO A 1 121 ? 24.659 -5.172  4.357  1.00 14.44 ? 121 PRO A HG3  4  
ATOM 8305  H HD2  . PRO A 1 121 ? 25.042 -7.772  5.007  1.00 24.13 ? 121 PRO A HD2  4  
ATOM 8306  H HD3  . PRO A 1 121 ? 25.844 -7.006  3.621  1.00 43.10 ? 121 PRO A HD3  4  
ATOM 8307  N N    . ALA A 1 122 ? 26.551 -6.781  8.045  1.00 73.21 ? 122 ALA A N    4  
ATOM 8308  C CA   . ALA A 1 122 ? 26.415 -6.932  9.488  1.00 0.24  ? 122 ALA A CA   4  
ATOM 8309  C C    . ALA A 1 122 ? 27.573 -7.737  10.068 1.00 44.14 ? 122 ALA A C    4  
ATOM 8310  O O    . ALA A 1 122 ? 27.961 -7.545  11.220 1.00 32.12 ? 122 ALA A O    4  
ATOM 8311  C CB   . ALA A 1 122 ? 25.088 -7.594  9.827  1.00 32.05 ? 122 ALA A CB   4  
ATOM 8312  H H    . ALA A 1 122 ? 25.999 -7.333  7.453  1.00 71.32 ? 122 ALA A H    4  
ATOM 8313  H HA   . ALA A 1 122 ? 26.420 -5.945  9.929  1.00 71.12 ? 122 ALA A HA   4  
ATOM 8314  H HB1  . ALA A 1 122 ? 25.250 -8.644  10.025 1.00 5.32  ? 122 ALA A HB1  4  
ATOM 8315  H HB2  . ALA A 1 122 ? 24.664 -7.124  10.702 1.00 3.23  ? 122 ALA A HB2  4  
ATOM 8316  H HB3  . ALA A 1 122 ? 24.409 -7.485  8.995  1.00 33.32 ? 122 ALA A HB3  4  
ATOM 8317  N N    . VAL A 1 123 ? 28.122 -8.640  9.261  1.00 45.52 ? 123 VAL A N    4  
ATOM 8318  C CA   . VAL A 1 123 ? 29.237 -9.474  9.693  1.00 1.14  ? 123 VAL A CA   4  
ATOM 8319  C C    . VAL A 1 123 ? 30.568 -8.753  9.508  1.00 74.03 ? 123 VAL A C    4  
ATOM 8320  O O    . VAL A 1 123 ? 31.489 -8.913  10.307 1.00 34.13 ? 123 VAL A O    4  
ATOM 8321  C CB   . VAL A 1 123 ? 29.275 -10.805 8.920  1.00 71.31 ? 123 VAL A CB   4  
ATOM 8322  C CG1  . VAL A 1 123 ? 30.576 -11.544 9.192  1.00 62.42 ? 123 VAL A CG1  4  
ATOM 8323  C CG2  . VAL A 1 123 ? 28.076 -11.667 9.285  1.00 21.54 ? 123 VAL A CG2  4  
ATOM 8324  H H    . VAL A 1 123 ? 27.770 -8.746  8.353  1.00 71.32 ? 123 VAL A H    4  
ATOM 8325  H HA   . VAL A 1 123 ? 29.102 -9.695  10.742 1.00 14.22 ? 123 VAL A HA   4  
ATOM 8326  H HB   . VAL A 1 123 ? 29.225 -10.586 7.863  1.00 22.14 ? 123 VAL A HB   4  
ATOM 8327  H HG11 . VAL A 1 123 ? 31.242 -11.422 8.350  1.00 72.11 ? 123 VAL A HG11 4  
ATOM 8328  H HG12 . VAL A 1 123 ? 31.040 -11.142 10.081 1.00 60.34 ? 123 VAL A HG12 4  
ATOM 8329  H HG13 . VAL A 1 123 ? 30.370 -12.595 9.337  1.00 52.33 ? 123 VAL A HG13 4  
ATOM 8330  H HG21 . VAL A 1 123 ? 27.303 -11.541 8.543  1.00 54.42 ? 123 VAL A HG21 4  
ATOM 8331  H HG22 . VAL A 1 123 ? 28.375 -12.705 9.319  1.00 23.25 ? 123 VAL A HG22 4  
ATOM 8332  H HG23 . VAL A 1 123 ? 27.700 -11.370 10.253 1.00 74.03 ? 123 VAL A HG23 4  
ATOM 8333  N N    . ASN A 1 124 ? 30.660 -7.958  8.447  1.00 45.13 ? 124 ASN A N    4  
ATOM 8334  C CA   . ASN A 1 124 ? 31.879 -7.211  8.155  1.00 21.54 ? 124 ASN A CA   4  
ATOM 8335  C C    . ASN A 1 124 ? 32.234 -6.278  9.309  1.00 50.24 ? 124 ASN A C    4  
ATOM 8336  O O    . ASN A 1 124 ? 33.380 -6.232  9.755  1.00 24.44 ? 124 ASN A O    4  
ATOM 8337  C CB   . ASN A 1 124 ? 31.712 -6.406  6.865  1.00 24.12 ? 124 ASN A CB   4  
ATOM 8338  C CG   . ASN A 1 124 ? 31.968 -7.241  5.625  1.00 21.13 ? 124 ASN A CG   4  
ATOM 8339  O OD1  . ASN A 1 124 ? 32.931 -8.006  5.566  1.00 42.41 ? 124 ASN A OD1  4  
ATOM 8340  N ND2  . ASN A 1 124 ? 31.104 -7.098  4.627  1.00 0.32  ? 124 ASN A ND2  4  
ATOM 8341  H H    . ASN A 1 124 ? 29.892 -7.871  7.845  1.00 33.11 ? 124 ASN A H    4  
ATOM 8342  H HA   . ASN A 1 124 ? 32.680 -7.923  8.024  1.00 61.20 ? 124 ASN A HA   4  
ATOM 8343  H HB2  . ASN A 1 124 ? 30.704 -6.022  6.815  1.00 33.43 ? 124 ASN A HB2  4  
ATOM 8344  H HB3  . ASN A 1 124 ? 32.408 -5.580  6.871  1.00 74.13 ? 124 ASN A HB3  4  
ATOM 8345  H HD21 . ASN A 1 124 ? 30.360 -6.470  4.745  1.00 63.13 ? 124 ASN A HD21 4  
ATOM 8346  H HD22 . ASN A 1 124 ? 31.245 -7.626  3.814  1.00 41.01 ? 124 ASN A HD22 4  
ATOM 8347  N N    . LYS A 1 125 ? 31.242 -5.534  9.787  1.00 22.32 ? 125 LYS A N    4  
ATOM 8348  C CA   . LYS A 1 125 ? 31.447 -4.602  10.890 1.00 63.42 ? 125 LYS A CA   4  
ATOM 8349  C C    . LYS A 1 125 ? 32.062 -5.310  12.093 1.00 32.12 ? 125 LYS A C    4  
ATOM 8350  O O    . LYS A 1 125 ? 32.816 -4.710  12.859 1.00 3.11  ? 125 LYS A O    4  
ATOM 8351  C CB   . LYS A 1 125 ? 30.120 -3.953  11.289 1.00 23.24 ? 125 LYS A CB   4  
ATOM 8352  C CG   . LYS A 1 125 ? 29.197 -4.881  12.061 1.00 43.43 ? 125 LYS A CG   4  
ATOM 8353  C CD   . LYS A 1 125 ? 29.343 -4.691  13.561 1.00 1.12  ? 125 LYS A CD   4  
ATOM 8354  C CE   . LYS A 1 125 ? 28.596 -3.457  14.042 1.00 15.42 ? 125 LYS A CE   4  
ATOM 8355  N NZ   . LYS A 1 125 ? 29.518 -2.318  14.307 1.00 12.15 ? 125 LYS A NZ   4  
ATOM 8356  H H    . LYS A 1 125 ? 30.350 -5.615  9.389  1.00 14.13 ? 125 LYS A H    4  
ATOM 8357  H HA   . LYS A 1 125 ? 32.127 -3.834  10.553 1.00 20.51 ? 125 LYS A HA   4  
ATOM 8358  H HB2  . LYS A 1 125 ? 30.327 -3.090  11.905 1.00 35.44 ? 125 LYS A HB2  4  
ATOM 8359  H HB3  . LYS A 1 125 ? 29.607 -3.631  10.395 1.00 70.45 ? 125 LYS A HB3  4  
ATOM 8360  H HG2  . LYS A 1 125 ? 28.176 -4.672  11.780 1.00 34.31 ? 125 LYS A HG2  4  
ATOM 8361  H HG3  . LYS A 1 125 ? 29.440 -5.904  11.811 1.00 13.01 ? 125 LYS A HG3  4  
ATOM 8362  H HD2  . LYS A 1 125 ? 28.944 -5.558  14.066 1.00 63.43 ? 125 LYS A HD2  4  
ATOM 8363  H HD3  . LYS A 1 125 ? 30.391 -4.583  13.801 1.00 4.35  ? 125 LYS A HD3  4  
ATOM 8364  H HE2  . LYS A 1 125 ? 27.885 -3.164  13.284 1.00 20.14 ? 125 LYS A HE2  4  
ATOM 8365  H HE3  . LYS A 1 125 ? 28.070 -3.703  14.953 1.00 54.32 ? 125 LYS A HE3  4  
ATOM 8366  H HZ1  . LYS A 1 125 ? 30.481 -2.671  14.481 1.00 35.32 ? 125 LYS A HZ1  4  
ATOM 8367  H HZ2  . LYS A 1 125 ? 29.199 -1.788  15.143 1.00 5.44  ? 125 LYS A HZ2  4  
ATOM 8368  H HZ3  . LYS A 1 125 ? 29.538 -1.676  13.490 1.00 72.04 ? 125 LYS A HZ3  4  
ATOM 8369  N N    . ILE A 1 126 ? 31.735 -6.588  12.252 1.00 22.24 ? 126 ILE A N    4  
ATOM 8370  C CA   . ILE A 1 126 ? 32.258 -7.377  13.361 1.00 33.21 ? 126 ILE A CA   4  
ATOM 8371  C C    . ILE A 1 126 ? 33.779 -7.468  13.303 1.00 52.15 ? 126 ILE A C    4  
ATOM 8372  O O    . ILE A 1 126 ? 34.459 -7.319  14.317 1.00 10.12 ? 126 ILE A O    4  
ATOM 8373  C CB   . ILE A 1 126 ? 31.669 -8.801  13.366 1.00 45.55 ? 126 ILE A CB   4  
ATOM 8374  C CG1  . ILE A 1 126 ? 30.143 -8.745  13.279 1.00 31.35 ? 126 ILE A CG1  4  
ATOM 8375  C CG2  . ILE A 1 126 ? 32.108 -9.551  14.614 1.00 22.01 ? 126 ILE A CG2  4  
ATOM 8376  C CD1  . ILE A 1 126 ? 29.484 -10.105 13.346 1.00 63.43 ? 126 ILE A CD1  4  
ATOM 8377  H H    . ILE A 1 126 ? 31.129 -7.011  11.609 1.00 44.32 ? 126 ILE A H    4  
ATOM 8378  H HA   . ILE A 1 126 ? 31.972 -6.888  14.281 1.00 20.24 ? 126 ILE A HA   4  
ATOM 8379  H HB   . ILE A 1 126 ? 32.053 -9.327  12.505 1.00 73.01 ? 126 ILE A HB   4  
ATOM 8380  H HG12 . ILE A 1 126 ? 29.764 -8.154  14.098 1.00 55.45 ? 126 ILE A HG12 4  
ATOM 8381  H HG13 . ILE A 1 126 ? 29.859 -8.283  12.345 1.00 62.43 ? 126 ILE A HG13 4  
ATOM 8382  H HG21 . ILE A 1 126 ? 32.319 -10.580 14.360 1.00 12.43 ? 126 ILE A HG21 4  
ATOM 8383  H HG22 . ILE A 1 126 ? 32.998 -9.091  15.016 1.00 45.02 ? 126 ILE A HG22 4  
ATOM 8384  H HG23 . ILE A 1 126 ? 31.320 -9.516  15.351 1.00 23.11 ? 126 ILE A HG23 4  
ATOM 8385  H HD11 . ILE A 1 126 ? 30.211 -10.869 13.112 1.00 72.54 ? 126 ILE A HD11 4  
ATOM 8386  H HD12 . ILE A 1 126 ? 29.095 -10.270 14.339 1.00 10.40 ? 126 ILE A HD12 4  
ATOM 8387  H HD13 . ILE A 1 126 ? 28.675 -10.149 12.631 1.00 41.54 ? 126 ILE A HD13 4  
ATOM 8388  N N    . MET A 1 127 ? 34.306 -7.712  12.107 1.00 11.41 ? 127 MET A N    4  
ATOM 8389  C CA   . MET A 1 127 ? 35.748 -7.819  11.916 1.00 74.05 ? 127 MET A CA   4  
ATOM 8390  C C    . MET A 1 127 ? 36.468 -6.619  12.523 1.00 75.13 ? 127 MET A C    4  
ATOM 8391  O O    . MET A 1 127 ? 37.586 -6.741  13.025 1.00 55.04 ? 127 MET A O    4  
ATOM 8392  C CB   . MET A 1 127 ? 36.079 -7.927  10.426 1.00 70.21 ? 127 MET A CB   4  
ATOM 8393  C CG   . MET A 1 127 ? 36.241 -9.359  9.942  1.00 71.02 ? 127 MET A CG   4  
ATOM 8394  S SD   . MET A 1 127 ? 37.949 -9.764  9.530  1.00 71.10 ? 127 MET A SD   4  
ATOM 8395  C CE   . MET A 1 127 ? 38.797 -9.191  11.000 1.00 53.10 ? 127 MET A CE   4  
ATOM 8396  H H    . MET A 1 127 ? 33.712 -7.821  11.335 1.00 21.10 ? 127 MET A H    4  
ATOM 8397  H HA   . MET A 1 127 ? 36.082 -8.716  12.416 1.00 40.55 ? 127 MET A HA   4  
ATOM 8398  H HB2  . MET A 1 127 ? 35.285 -7.466  9.858  1.00 1.41  ? 127 MET A HB2  4  
ATOM 8399  H HB3  . MET A 1 127 ? 37.001 -7.399  10.235 1.00 65.52 ? 127 MET A HB3  4  
ATOM 8400  H HG2  . MET A 1 127 ? 35.905 -10.029 10.720 1.00 42.53 ? 127 MET A HG2  4  
ATOM 8401  H HG3  . MET A 1 127 ? 35.630 -9.498  9.062  1.00 12.22 ? 127 MET A HG3  4  
ATOM 8402  H HE1  . MET A 1 127 ? 38.891 -8.116  10.965 1.00 13.43 ? 127 MET A HE1  4  
ATOM 8403  H HE2  . MET A 1 127 ? 38.231 -9.475  11.875 1.00 2.10  ? 127 MET A HE2  4  
ATOM 8404  H HE3  . MET A 1 127 ? 39.780 -9.637  11.045 1.00 34.12 ? 127 MET A HE3  4  
ATOM 8405  N N    . THR A 1 128 ? 35.820 -5.459  12.474 1.00 41.13 ? 128 THR A N    4  
ATOM 8406  C CA   . THR A 1 128 ? 36.399 -4.237  13.017 1.00 1.03  ? 128 THR A CA   4  
ATOM 8407  C C    . THR A 1 128 ? 36.897 -4.451  14.442 1.00 22.00 ? 128 THR A C    4  
ATOM 8408  O O    . THR A 1 128 ? 37.891 -3.857  14.857 1.00 45.30 ? 128 THR A O    4  
ATOM 8409  C CB   . THR A 1 128 ? 35.381 -3.081  13.010 1.00 60.13 ? 128 THR A CB   4  
ATOM 8410  O OG1  . THR A 1 128 ? 34.729 -3.011  11.737 1.00 51.02 ? 128 THR A OG1  4  
ATOM 8411  C CG2  . THR A 1 128 ? 36.065 -1.756  13.309 1.00 51.54 ? 128 THR A CG2  4  
ATOM 8412  H H    . THR A 1 128 ? 34.932 -5.426  12.061 1.00 50.41 ? 128 THR A H    4  
ATOM 8413  H HA   . THR A 1 128 ? 37.235 -3.957  12.392 1.00 33.02 ? 128 THR A HA   4  
ATOM 8414  H HB   . THR A 1 128 ? 34.641 -3.268  13.775 1.00 62.20 ? 128 THR A HB   4  
ATOM 8415  H HG1  . THR A 1 128 ? 34.049 -2.333  11.762 1.00 20.23 ? 128 THR A HG1  4  
ATOM 8416  H HG21 . THR A 1 128 ? 36.513 -1.370  12.405 1.00 41.22 ? 128 THR A HG21 4  
ATOM 8417  H HG22 . THR A 1 128 ? 36.831 -1.906  14.055 1.00 52.12 ? 128 THR A HG22 4  
ATOM 8418  H HG23 . THR A 1 128 ? 35.336 -1.050  13.678 1.00 71.13 ? 128 THR A HG23 4  
ATOM 8419  N N    . GLU A 1 129 ? 36.200 -5.304  15.186 1.00 71.10 ? 129 GLU A N    4  
ATOM 8420  C CA   . GLU A 1 129 ? 36.573 -5.596  16.565 1.00 11.41 ? 129 GLU A CA   4  
ATOM 8421  C C    . GLU A 1 129 ? 37.976 -6.191  16.635 1.00 62.11 ? 129 GLU A C    4  
ATOM 8422  O O    . GLU A 1 129 ? 38.762 -5.854  17.519 1.00 2.22  ? 129 GLU A O    4  
ATOM 8423  C CB   . GLU A 1 129 ? 35.566 -6.559  17.196 1.00 20.53 ? 129 GLU A CB   4  
ATOM 8424  C CG   . GLU A 1 129 ? 35.758 -6.747  18.692 1.00 64.32 ? 129 GLU A CG   4  
ATOM 8425  C CD   . GLU A 1 129 ? 34.831 -5.873  19.514 1.00 61.14 ? 129 GLU A CD   4  
ATOM 8426  O OE1  . GLU A 1 129 ? 34.053 -6.425  20.319 1.00 25.35 ? 129 GLU A OE1  4  
ATOM 8427  O OE2  . GLU A 1 129 ? 34.884 -4.636  19.350 1.00 12.14 ? 129 GLU A OE2  4  
ATOM 8428  H H    . GLU A 1 129 ? 35.416 -5.747  14.799 1.00 63.05 ? 129 GLU A H    4  
ATOM 8429  H HA   . GLU A 1 129 ? 36.561 -4.667  17.115 1.00 4.12  ? 129 GLU A HA   4  
ATOM 8430  H HB2  . GLU A 1 129 ? 34.569 -6.181  17.027 1.00 73.33 ? 129 GLU A HB2  4  
ATOM 8431  H HB3  . GLU A 1 129 ? 35.661 -7.524  16.719 1.00 44.52 ? 129 GLU A HB3  4  
ATOM 8432  H HG2  . GLU A 1 129 ? 35.567 -7.781  18.940 1.00 50.44 ? 129 GLU A HG2  4  
ATOM 8433  H HG3  . GLU A 1 129 ? 36.779 -6.501  18.944 1.00 2.03  ? 129 GLU A HG3  4  
ATOM 8434  N N    . GLY A 1 130 ? 38.283 -7.080  15.695 1.00 20.31 ? 130 GLY A N    4  
ATOM 8435  C CA   . GLY A 1 130 ? 39.590 -7.710  15.668 1.00 44.53 ? 130 GLY A CA   4  
ATOM 8436  C C    . GLY A 1 130 ? 39.930 -8.283  14.306 1.00 14.21 ? 130 GLY A C    4  
ATOM 8437  O O    . GLY A 1 130 ? 40.804 -9.141  14.187 1.00 41.22 ? 130 GLY A O    4  
ATOM 8438  H H    . GLY A 1 130 ? 37.616 -7.311  15.015 1.00 40.22 ? 130 GLY A H    4  
ATOM 8439  H HA2  . GLY A 1 130 ? 40.337 -6.976  15.934 1.00 14.01 ? 130 GLY A HA2  4  
ATOM 8440  H HA3  . GLY A 1 130 ? 39.608 -8.507  16.396 1.00 64.43 ? 130 GLY A HA3  4  
ATOM 8441  N N    . MET A 1 1   ? 2.523  1.374   2.134  1.00 72.11 ? 1   MET A N    5  
ATOM 8442  C CA   . MET A 1 1   ? 2.621  1.471   0.682  1.00 33.31 ? 1   MET A CA   5  
ATOM 8443  C C    . MET A 1 1   ? 2.734  0.086   0.051  1.00 4.44  ? 1   MET A C    5  
ATOM 8444  O O    . MET A 1 1   ? 2.186  -0.165  -1.022 1.00 31.33 ? 1   MET A O    5  
ATOM 8445  C CB   . MET A 1 1   ? 3.827  2.325   0.287  1.00 72.34 ? 1   MET A CB   5  
ATOM 8446  C CG   . MET A 1 1   ? 5.152  1.776   0.791  1.00 74.22 ? 1   MET A CG   5  
ATOM 8447  S SD   . MET A 1 1   ? 6.528  2.902   0.495  1.00 50.42 ? 1   MET A SD   5  
ATOM 8448  C CE   . MET A 1 1   ? 7.358  2.075   -0.860 1.00 32.35 ? 1   MET A CE   5  
ATOM 8449  H H1   . MET A 1 1   ? 3.020  2.010   2.689  1.00 14.45 ? 1   MET A H1   5  
ATOM 8450  H HA   . MET A 1 1   ? 1.721  1.945   0.321  1.00 51.34 ? 1   MET A HA   5  
ATOM 8451  H HB2  . MET A 1 1   ? 3.873  2.384   -0.790 1.00 50.55 ? 1   MET A HB2  5  
ATOM 8452  H HB3  . MET A 1 1   ? 3.697  3.318   0.689  1.00 4.32  ? 1   MET A HB3  5  
ATOM 8453  H HG2  . MET A 1 1   ? 5.072  1.599   1.853  1.00 4.21  ? 1   MET A HG2  5  
ATOM 8454  H HG3  . MET A 1 1   ? 5.353  0.842   0.287  1.00 43.11 ? 1   MET A HG3  5  
ATOM 8455  H HE1  . MET A 1 1   ? 8.030  1.327   -0.467 1.00 24.34 ? 1   MET A HE1  5  
ATOM 8456  H HE2  . MET A 1 1   ? 6.624  1.601   -1.495 1.00 43.22 ? 1   MET A HE2  5  
ATOM 8457  H HE3  . MET A 1 1   ? 7.919  2.798   -1.433 1.00 42.02 ? 1   MET A HE3  5  
ATOM 8458  N N    . LYS A 1 2   ? 3.450  -0.808  0.724  1.00 30.42 ? 2   LYS A N    5  
ATOM 8459  C CA   . LYS A 1 2   ? 3.635  -2.168  0.231  1.00 44.11 ? 2   LYS A CA   5  
ATOM 8460  C C    . LYS A 1 2   ? 3.799  -3.149  1.388  1.00 52.25 ? 2   LYS A C    5  
ATOM 8461  O O    . LYS A 1 2   ? 3.851  -2.750  2.551  1.00 4.21  ? 2   LYS A O    5  
ATOM 8462  C CB   . LYS A 1 2   ? 4.858  -2.237  -0.687 1.00 31.10 ? 2   LYS A CB   5  
ATOM 8463  C CG   . LYS A 1 2   ? 4.555  -1.879  -2.132 1.00 11.04 ? 2   LYS A CG   5  
ATOM 8464  C CD   . LYS A 1 2   ? 3.569  -2.854  -2.753 1.00 31.12 ? 2   LYS A CD   5  
ATOM 8465  C CE   . LYS A 1 2   ? 3.524  -2.713  -4.267 1.00 12.25 ? 2   LYS A CE   5  
ATOM 8466  N NZ   . LYS A 1 2   ? 4.757  -3.244  -4.910 1.00 43.31 ? 2   LYS A NZ   5  
ATOM 8467  H H    . LYS A 1 2   ? 3.863  -0.548  1.575  1.00 61.03 ? 2   LYS A H    5  
ATOM 8468  H HA   . LYS A 1 2   ? 2.756  -2.439  -0.334 1.00 1.24  ? 2   LYS A HA   5  
ATOM 8469  H HB2  . LYS A 1 2   ? 5.609  -1.554  -0.318 1.00 51.15 ? 2   LYS A HB2  5  
ATOM 8470  H HB3  . LYS A 1 2   ? 5.255  -3.242  -0.663 1.00 12.11 ? 2   LYS A HB3  5  
ATOM 8471  H HG2  . LYS A 1 2   ? 4.132  -0.886  -2.166 1.00 4.20  ? 2   LYS A HG2  5  
ATOM 8472  H HG3  . LYS A 1 2   ? 5.475  -1.901  -2.699 1.00 13.22 ? 2   LYS A HG3  5  
ATOM 8473  H HD2  . LYS A 1 2   ? 3.868  -3.862  -2.506 1.00 11.25 ? 2   LYS A HD2  5  
ATOM 8474  H HD3  . LYS A 1 2   ? 2.584  -2.660  -2.352 1.00 73.42 ? 2   LYS A HD3  5  
ATOM 8475  H HE2  . LYS A 1 2   ? 2.670  -3.257  -4.641 1.00 2.05  ? 2   LYS A HE2  5  
ATOM 8476  H HE3  . LYS A 1 2   ? 3.420  -1.667  -4.514 1.00 43.42 ? 2   LYS A HE3  5  
ATOM 8477  H HZ1  . LYS A 1 2   ? 5.396  -3.634  -4.189 1.00 25.54 ? 2   LYS A HZ1  5  
ATOM 8478  H HZ2  . LYS A 1 2   ? 5.251  -2.483  -5.418 1.00 40.34 ? 2   LYS A HZ2  5  
ATOM 8479  H HZ3  . LYS A 1 2   ? 4.513  -3.996  -5.586 1.00 10.45 ? 2   LYS A HZ3  5  
ATOM 8480  N N    . LYS A 1 3   ? 3.880  -4.434  1.060  1.00 20.03 ? 3   LYS A N    5  
ATOM 8481  C CA   . LYS A 1 3   ? 4.041  -5.473  2.071  1.00 55.31 ? 3   LYS A CA   5  
ATOM 8482  C C    . LYS A 1 3   ? 5.477  -5.518  2.581  1.00 64.31 ? 3   LYS A C    5  
ATOM 8483  O O    . LYS A 1 3   ? 6.293  -6.305  2.099  1.00 11.15 ? 3   LYS A O    5  
ATOM 8484  C CB   . LYS A 1 3   ? 3.648  -6.836  1.497  1.00 22.23 ? 3   LYS A CB   5  
ATOM 8485  C CG   . LYS A 1 3   ? 3.623  -7.947  2.533  1.00 73.23 ? 3   LYS A CG   5  
ATOM 8486  C CD   . LYS A 1 3   ? 2.338  -7.925  3.343  1.00 14.52 ? 3   LYS A CD   5  
ATOM 8487  C CE   . LYS A 1 3   ? 1.242  -8.739  2.673  1.00 14.21 ? 3   LYS A CE   5  
ATOM 8488  N NZ   . LYS A 1 3   ? 0.017  -8.821  3.517  1.00 41.24 ? 3   LYS A NZ   5  
ATOM 8489  H H    . LYS A 1 3   ? 3.832  -4.690  0.115  1.00 73.40 ? 3   LYS A H    5  
ATOM 8490  H HA   . LYS A 1 3   ? 3.386  -5.237  2.896  1.00 53.10 ? 3   LYS A HA   5  
ATOM 8491  H HB2  . LYS A 1 3   ? 2.665  -6.759  1.058  1.00 34.00 ? 3   LYS A HB2  5  
ATOM 8492  H HB3  . LYS A 1 3   ? 4.357  -7.107  0.727  1.00 14.44 ? 3   LYS A HB3  5  
ATOM 8493  H HG2  . LYS A 1 3   ? 3.701  -8.899  2.028  1.00 13.15 ? 3   LYS A HG2  5  
ATOM 8494  H HG3  . LYS A 1 3   ? 4.462  -7.822  3.202  1.00 21.30 ? 3   LYS A HG3  5  
ATOM 8495  H HD2  . LYS A 1 3   ? 2.531  -8.339  4.321  1.00 25.32 ? 3   LYS A HD2  5  
ATOM 8496  H HD3  . LYS A 1 3   ? 2.004  -6.901  3.444  1.00 73.42 ? 3   LYS A HD3  5  
ATOM 8497  H HE2  . LYS A 1 3   ? 0.990  -8.274  1.732  1.00 13.24 ? 3   LYS A HE2  5  
ATOM 8498  H HE3  . LYS A 1 3   ? 1.612  -9.737  2.493  1.00 21.22 ? 3   LYS A HE3  5  
ATOM 8499  H HZ1  . LYS A 1 3   ? 0.134  -8.242  4.373  1.00 50.22 ? 3   LYS A HZ1  5  
ATOM 8500  H HZ2  . LYS A 1 3   ? -0.157 -9.806  3.800  1.00 65.24 ? 3   LYS A HZ2  5  
ATOM 8501  H HZ3  . LYS A 1 3   ? -0.807 -8.473  2.986  1.00 62.43 ? 3   LYS A HZ3  5  
ATOM 8502  N N    . VAL A 1 4   ? 5.781  -4.671  3.559  1.00 14.11 ? 4   VAL A N    5  
ATOM 8503  C CA   . VAL A 1 4   ? 7.118  -4.617  4.136  1.00 4.52  ? 4   VAL A CA   5  
ATOM 8504  C C    . VAL A 1 4   ? 7.433  -5.889  4.915  1.00 11.44 ? 4   VAL A C    5  
ATOM 8505  O O    . VAL A 1 4   ? 6.682  -6.283  5.808  1.00 22.12 ? 4   VAL A O    5  
ATOM 8506  C CB   . VAL A 1 4   ? 7.278  -3.403  5.071  1.00 54.42 ? 4   VAL A CB   5  
ATOM 8507  C CG1  . VAL A 1 4   ? 6.257  -3.458  6.197  1.00 31.23 ? 4   VAL A CG1  5  
ATOM 8508  C CG2  . VAL A 1 4   ? 8.693  -3.340  5.625  1.00 12.42 ? 4   VAL A CG2  5  
ATOM 8509  H H    . VAL A 1 4   ? 5.088  -4.068  3.901  1.00 34.44 ? 4   VAL A H    5  
ATOM 8510  H HA   . VAL A 1 4   ? 7.827  -4.517  3.327  1.00 3.21  ? 4   VAL A HA   5  
ATOM 8511  H HB   . VAL A 1 4   ? 7.098  -2.506  4.496  1.00 2.34  ? 4   VAL A HB   5  
ATOM 8512  H HG11 . VAL A 1 4   ? 5.324  -3.848  5.818  1.00 32.40 ? 4   VAL A HG11 5  
ATOM 8513  H HG12 . VAL A 1 4   ? 6.624  -4.100  6.985  1.00 72.34 ? 4   VAL A HG12 5  
ATOM 8514  H HG13 . VAL A 1 4   ? 6.098  -2.464  6.588  1.00 51.11 ? 4   VAL A HG13 5  
ATOM 8515  H HG21 . VAL A 1 4   ? 8.661  -3.427  6.701  1.00 3.30  ? 4   VAL A HG21 5  
ATOM 8516  H HG22 . VAL A 1 4   ? 9.277  -4.151  5.216  1.00 50.05 ? 4   VAL A HG22 5  
ATOM 8517  H HG23 . VAL A 1 4   ? 9.145  -2.398  5.353  1.00 41.23 ? 4   VAL A HG23 5  
ATOM 8518  N N    . ILE A 1 5   ? 8.547  -6.526  4.572  1.00 41.10 ? 5   ILE A N    5  
ATOM 8519  C CA   . ILE A 1 5   ? 8.962  -7.753  5.241  1.00 53.13 ? 5   ILE A CA   5  
ATOM 8520  C C    . ILE A 1 5   ? 9.828  -7.450  6.458  1.00 2.42  ? 5   ILE A C    5  
ATOM 8521  O O    . ILE A 1 5   ? 10.594 -6.487  6.463  1.00 0.23  ? 5   ILE A O    5  
ATOM 8522  C CB   . ILE A 1 5   ? 9.741  -8.678  4.287  1.00 4.33  ? 5   ILE A CB   5  
ATOM 8523  C CG1  . ILE A 1 5   ? 9.200  -8.551  2.862  1.00 15.21 ? 5   ILE A CG1  5  
ATOM 8524  C CG2  . ILE A 1 5   ? 9.660  -10.120 4.764  1.00 31.13 ? 5   ILE A CG2  5  
ATOM 8525  C CD1  . ILE A 1 5   ? 7.719  -8.840  2.750  1.00 20.44 ? 5   ILE A CD1  5  
ATOM 8526  H H    . ILE A 1 5   ? 9.104  -6.162  3.853  1.00 53.14 ? 5   ILE A H    5  
ATOM 8527  H HA   . ILE A 1 5   ? 8.072  -8.272  5.566  1.00 74.02 ? 5   ILE A HA   5  
ATOM 8528  H HB   . ILE A 1 5   ? 10.778 -8.378  4.299  1.00 61.12 ? 5   ILE A HB   5  
ATOM 8529  H HG12 . ILE A 1 5   ? 9.368  -7.546  2.508  1.00 71.23 ? 5   ILE A HG12 5  
ATOM 8530  H HG13 . ILE A 1 5   ? 9.724  -9.246  2.223  1.00 73.34 ? 5   ILE A HG13 5  
ATOM 8531  H HG21 . ILE A 1 5   ? 10.465 -10.316 5.457  1.00 63.23 ? 5   ILE A HG21 5  
ATOM 8532  H HG22 . ILE A 1 5   ? 8.714  -10.282 5.259  1.00 71.32 ? 5   ILE A HG22 5  
ATOM 8533  H HG23 . ILE A 1 5   ? 9.743  -10.785 3.918  1.00 51.22 ? 5   ILE A HG23 5  
ATOM 8534  H HD11 . ILE A 1 5   ? 7.391  -8.658  1.738  1.00 44.14 ? 5   ILE A HD11 5  
ATOM 8535  H HD12 . ILE A 1 5   ? 7.533  -9.872  3.010  1.00 52.51 ? 5   ILE A HD12 5  
ATOM 8536  H HD13 . ILE A 1 5   ? 7.174  -8.196  3.425  1.00 4.45  ? 5   ILE A HD13 5  
ATOM 8537  N N    . ASN A 1 6   ? 9.703  -8.280  7.489  1.00 54.53 ? 6   ASN A N    5  
ATOM 8538  C CA   . ASN A 1 6   ? 10.475 -8.101  8.713  1.00 64.05 ? 6   ASN A CA   5  
ATOM 8539  C C    . ASN A 1 6   ? 11.113 -9.416  9.150  1.00 34.43 ? 6   ASN A C    5  
ATOM 8540  O O    . ASN A 1 6   ? 10.416 -10.382 9.463  1.00 63.31 ? 6   ASN A O    5  
ATOM 8541  C CB   . ASN A 1 6   ? 9.582  -7.557  9.830  1.00 64.34 ? 6   ASN A CB   5  
ATOM 8542  C CG   . ASN A 1 6   ? 9.668  -6.049  9.956  1.00 41.53 ? 6   ASN A CG   5  
ATOM 8543  O OD1  . ASN A 1 6   ? 10.285 -5.379  9.127  1.00 61.33 ? 6   ASN A OD1  5  
ATOM 8544  N ND2  . ASN A 1 6   ? 9.048  -5.506  10.997 1.00 52.21 ? 6   ASN A ND2  5  
ATOM 8545  H H    . ASN A 1 6   ? 9.075  -9.030  7.425  1.00 1.41  ? 6   ASN A H    5  
ATOM 8546  H HA   . ASN A 1 6   ? 11.258 -7.386  8.509  1.00 52.41 ? 6   ASN A HA   5  
ATOM 8547  H HB2  . ASN A 1 6   ? 8.556  -7.824  9.624  1.00 70.14 ? 6   ASN A HB2  5  
ATOM 8548  H HB3  . ASN A 1 6   ? 9.883  -7.997  10.769 1.00 53.31 ? 6   ASN A HB3  5  
ATOM 8549  H HD21 . ASN A 1 6   ? 8.576  -6.101  11.617 1.00 41.32 ? 6   ASN A HD21 5  
ATOM 8550  H HD22 . ASN A 1 6   ? 9.087  -4.532  11.102 1.00 35.32 ? 6   ASN A HD22 5  
ATOM 8551  N N    . VAL A 1 7   ? 12.441 -9.446  9.171  1.00 64.14 ? 7   VAL A N    5  
ATOM 8552  C CA   . VAL A 1 7   ? 13.173 -10.642 9.572  1.00 43.44 ? 7   VAL A CA   5  
ATOM 8553  C C    . VAL A 1 7   ? 14.256 -10.307 10.592 1.00 53.02 ? 7   VAL A C    5  
ATOM 8554  O O    . VAL A 1 7   ? 14.905 -9.265  10.505 1.00 11.41 ? 7   VAL A O    5  
ATOM 8555  C CB   . VAL A 1 7   ? 13.823 -11.335 8.359  1.00 33.13 ? 7   VAL A CB   5  
ATOM 8556  C CG1  . VAL A 1 7   ? 12.773 -12.065 7.536  1.00 32.51 ? 7   VAL A CG1  5  
ATOM 8557  C CG2  . VAL A 1 7   ? 14.572 -10.323 7.506  1.00 64.42 ? 7   VAL A CG2  5  
ATOM 8558  H H    . VAL A 1 7   ? 12.941 -8.644  8.910  1.00 24.45 ? 7   VAL A H    5  
ATOM 8559  H HA   . VAL A 1 7   ? 12.470 -11.329 10.019 1.00 24.12 ? 7   VAL A HA   5  
ATOM 8560  H HB   . VAL A 1 7   ? 14.532 -12.063 8.724  1.00 5.01  ? 7   VAL A HB   5  
ATOM 8561  H HG11 . VAL A 1 7   ? 12.606 -11.533 6.611  1.00 3.33  ? 7   VAL A HG11 5  
ATOM 8562  H HG12 . VAL A 1 7   ? 13.117 -13.066 7.320  1.00 74.43 ? 7   VAL A HG12 5  
ATOM 8563  H HG13 . VAL A 1 7   ? 11.849 -12.115 8.093  1.00 12.54 ? 7   VAL A HG13 5  
ATOM 8564  H HG21 . VAL A 1 7   ? 13.865 -9.666  7.023  1.00 14.13 ? 7   VAL A HG21 5  
ATOM 8565  H HG22 . VAL A 1 7   ? 15.234 -9.742  8.133  1.00 74.45 ? 7   VAL A HG22 5  
ATOM 8566  H HG23 . VAL A 1 7   ? 15.151 -10.842 6.757  1.00 63.45 ? 7   VAL A HG23 5  
ATOM 8567  N N    . VAL A 1 8   ? 14.446 -11.199 11.559 1.00 14.10 ? 8   VAL A N    5  
ATOM 8568  C CA   . VAL A 1 8   ? 15.451 -11.000 12.596 1.00 11.41 ? 8   VAL A CA   5  
ATOM 8569  C C    . VAL A 1 8   ? 16.368 -12.212 12.713 1.00 40.24 ? 8   VAL A C    5  
ATOM 8570  O O    . VAL A 1 8   ? 15.937 -13.350 12.531 1.00 15.45 ? 8   VAL A O    5  
ATOM 8571  C CB   . VAL A 1 8   ? 14.799 -10.729 13.965 1.00 20.31 ? 8   VAL A CB   5  
ATOM 8572  C CG1  . VAL A 1 8   ? 14.135 -11.990 14.499 1.00 45.31 ? 8   VAL A CG1  5  
ATOM 8573  C CG2  . VAL A 1 8   ? 15.830 -10.201 14.951 1.00 64.51 ? 8   VAL A CG2  5  
ATOM 8574  H H    . VAL A 1 8   ? 13.897 -12.011 11.575 1.00 50.30 ? 8   VAL A H    5  
ATOM 8575  H HA   . VAL A 1 8   ? 16.043 -10.137 12.326 1.00 33.01 ? 8   VAL A HA   5  
ATOM 8576  H HB   . VAL A 1 8   ? 14.037 -9.975  13.836 1.00 73.24 ? 8   VAL A HB   5  
ATOM 8577  H HG11 . VAL A 1 8   ? 13.402 -12.339 13.787 1.00 62.11 ? 8   VAL A HG11 5  
ATOM 8578  H HG12 . VAL A 1 8   ? 14.884 -12.754 14.652 1.00 55.33 ? 8   VAL A HG12 5  
ATOM 8579  H HG13 . VAL A 1 8   ? 13.648 -11.770 15.437 1.00 1.34  ? 8   VAL A HG13 5  
ATOM 8580  H HG21 . VAL A 1 8   ? 16.666 -10.884 14.997 1.00 72.14 ? 8   VAL A HG21 5  
ATOM 8581  H HG22 . VAL A 1 8   ? 16.176 -9.231  14.626 1.00 43.13 ? 8   VAL A HG22 5  
ATOM 8582  H HG23 . VAL A 1 8   ? 15.382 -10.114 15.929 1.00 21.03 ? 8   VAL A HG23 5  
ATOM 8583  N N    . GLY A 1 9   ? 17.638 -11.960 13.017 1.00 14.30 ? 9   GLY A N    5  
ATOM 8584  C CA   . GLY A 1 9   ? 18.597 -13.040 13.153 1.00 35.41 ? 9   GLY A CA   5  
ATOM 8585  C C    . GLY A 1 9   ? 19.414 -12.934 14.425 1.00 15.25 ? 9   GLY A C    5  
ATOM 8586  O O    . GLY A 1 9   ? 19.318 -11.945 15.152 1.00 54.15 ? 9   GLY A O    5  
ATOM 8587  H H    . GLY A 1 9   ? 17.925 -11.032 13.150 1.00 23.22 ? 9   GLY A H    5  
ATOM 8588  H HA2  . GLY A 1 9   ? 18.065 -13.980 13.156 1.00 21.34 ? 9   GLY A HA2  5  
ATOM 8589  H HA3  . GLY A 1 9   ? 19.267 -13.020 12.306 1.00 32.32 ? 9   GLY A HA3  5  
ATOM 8590  N N    . ALA A 1 10  ? 20.218 -13.956 14.697 1.00 5.23  ? 10  ALA A N    5  
ATOM 8591  C CA   . ALA A 1 10  ? 21.056 -13.973 15.890 1.00 15.55 ? 10  ALA A CA   5  
ATOM 8592  C C    . ALA A 1 10  ? 22.477 -14.411 15.557 1.00 25.15 ? 10  ALA A C    5  
ATOM 8593  O O    . ALA A 1 10  ? 22.684 -15.315 14.747 1.00 4.11  ? 10  ALA A O    5  
ATOM 8594  C CB   . ALA A 1 10  ? 20.452 -14.888 16.946 1.00 42.24 ? 10  ALA A CB   5  
ATOM 8595  H H    . ALA A 1 10  ? 20.251 -14.716 14.080 1.00 41.22 ? 10  ALA A H    5  
ATOM 8596  H HA   . ALA A 1 10  ? 21.084 -12.970 16.293 1.00 54.14 ? 10  ALA A HA   5  
ATOM 8597  H HB1  . ALA A 1 10  ? 19.488 -15.239 16.607 1.00 22.32 ? 10  ALA A HB1  5  
ATOM 8598  H HB2  . ALA A 1 10  ? 21.107 -15.731 17.107 1.00 31.12 ? 10  ALA A HB2  5  
ATOM 8599  H HB3  . ALA A 1 10  ? 20.333 -14.342 17.869 1.00 14.14 ? 10  ALA A HB3  5  
ATOM 8600  N N    . ILE A 1 11  ? 23.453 -13.765 16.187 1.00 65.43 ? 11  ILE A N    5  
ATOM 8601  C CA   . ILE A 1 11  ? 24.856 -14.090 15.957 1.00 52.03 ? 11  ILE A CA   5  
ATOM 8602  C C    . ILE A 1 11  ? 25.536 -14.536 17.247 1.00 75.23 ? 11  ILE A C    5  
ATOM 8603  O O    . ILE A 1 11  ? 25.995 -13.710 18.036 1.00 54.00 ? 11  ILE A O    5  
ATOM 8604  C CB   . ILE A 1 11  ? 25.623 -12.889 15.374 1.00 4.41  ? 11  ILE A CB   5  
ATOM 8605  C CG1  . ILE A 1 11  ? 25.196 -11.596 16.072 1.00 50.44 ? 11  ILE A CG1  5  
ATOM 8606  C CG2  . ILE A 1 11  ? 25.392 -12.789 13.874 1.00 73.12 ? 11  ILE A CG2  5  
ATOM 8607  C CD1  . ILE A 1 11  ? 25.930 -10.370 15.575 1.00 41.12 ? 11  ILE A CD1  5  
ATOM 8608  H H    . ILE A 1 11  ? 23.225 -13.055 16.821 1.00 1.31  ? 11  ILE A H    5  
ATOM 8609  H HA   . ILE A 1 11  ? 24.897 -14.899 15.242 1.00 63.22 ? 11  ILE A HA   5  
ATOM 8610  H HB   . ILE A 1 11  ? 26.678 -13.048 15.541 1.00 34.05 ? 11  ILE A HB   5  
ATOM 8611  H HG12 . ILE A 1 11  ? 24.141 -11.438 15.910 1.00 64.13 ? 11  ILE A HG12 5  
ATOM 8612  H HG13 . ILE A 1 11  ? 25.383 -11.689 17.132 1.00 43.43 ? 11  ILE A HG13 5  
ATOM 8613  H HG21 . ILE A 1 11  ? 25.334 -13.782 13.452 1.00 14.30 ? 11  ILE A HG21 5  
ATOM 8614  H HG22 . ILE A 1 11  ? 24.466 -12.265 13.687 1.00 45.01 ? 11  ILE A HG22 5  
ATOM 8615  H HG23 . ILE A 1 11  ? 26.209 -12.251 13.418 1.00 62.32 ? 11  ILE A HG23 5  
ATOM 8616  H HD11 . ILE A 1 11  ? 26.024 -9.655  16.379 1.00 34.10 ? 11  ILE A HD11 5  
ATOM 8617  H HD12 . ILE A 1 11  ? 26.912 -10.654 15.228 1.00 40.42 ? 11  ILE A HD12 5  
ATOM 8618  H HD13 . ILE A 1 11  ? 25.376 -9.924  14.761 1.00 0.10  ? 11  ILE A HD13 5  
ATOM 8619  N N    . ILE A 1 12  ? 25.598 -15.847 17.453 1.00 34.23 ? 12  ILE A N    5  
ATOM 8620  C CA   . ILE A 1 12  ? 26.224 -16.403 18.646 1.00 22.21 ? 12  ILE A CA   5  
ATOM 8621  C C    . ILE A 1 12  ? 27.743 -16.425 18.510 1.00 71.00 ? 12  ILE A C    5  
ATOM 8622  O O    . ILE A 1 12  ? 28.285 -17.018 17.577 1.00 51.32 ? 12  ILE A O    5  
ATOM 8623  C CB   . ILE A 1 12  ? 25.725 -17.832 18.930 1.00 30.23 ? 12  ILE A CB   5  
ATOM 8624  C CG1  . ILE A 1 12  ? 24.223 -17.822 19.224 1.00 24.22 ? 12  ILE A CG1  5  
ATOM 8625  C CG2  . ILE A 1 12  ? 26.494 -18.440 20.094 1.00 71.44 ? 12  ILE A CG2  5  
ATOM 8626  C CD1  . ILE A 1 12  ? 23.365 -17.995 17.991 1.00 61.43 ? 12  ILE A CD1  5  
ATOM 8627  H H    . ILE A 1 12  ? 25.214 -16.455 16.788 1.00 52.14 ? 12  ILE A H    5  
ATOM 8628  H HA   . ILE A 1 12  ? 25.958 -15.777 19.485 1.00 14.31 ? 12  ILE A HA   5  
ATOM 8629  H HB   . ILE A 1 12  ? 25.909 -18.435 18.054 1.00 1.21  ? 12  ILE A HB   5  
ATOM 8630  H HG12 . ILE A 1 12  ? 23.991 -18.626 19.905 1.00 52.22 ? 12  ILE A HG12 5  
ATOM 8631  H HG13 . ILE A 1 12  ? 23.960 -16.880 19.683 1.00 45.11 ? 12  ILE A HG13 5  
ATOM 8632  H HG21 . ILE A 1 12  ? 27.352 -18.977 19.716 1.00 3.35  ? 12  ILE A HG21 5  
ATOM 8633  H HG22 . ILE A 1 12  ? 26.824 -17.655 20.756 1.00 3.41  ? 12  ILE A HG22 5  
ATOM 8634  H HG23 . ILE A 1 12  ? 25.853 -19.121 20.633 1.00 54.00 ? 12  ILE A HG23 5  
ATOM 8635  H HD11 . ILE A 1 12  ? 23.984 -17.926 17.108 1.00 20.33 ? 12  ILE A HD11 5  
ATOM 8636  H HD12 . ILE A 1 12  ? 22.883 -18.961 18.019 1.00 4.12  ? 12  ILE A HD12 5  
ATOM 8637  H HD13 . ILE A 1 12  ? 22.614 -17.219 17.964 1.00 74.24 ? 12  ILE A HD13 5  
ATOM 8638  N N    . PHE A 1 13  ? 28.425 -15.776 19.448 1.00 71.20 ? 13  PHE A N    5  
ATOM 8639  C CA   . PHE A 1 13  ? 29.882 -15.721 19.434 1.00 61.53 ? 13  PHE A CA   5  
ATOM 8640  C C    . PHE A 1 13  ? 30.471 -16.616 20.521 1.00 14.31 ? 13  PHE A C    5  
ATOM 8641  O O    . PHE A 1 13  ? 30.073 -16.541 21.684 1.00 72.54 ? 13  PHE A O    5  
ATOM 8642  C CB   . PHE A 1 13  ? 30.361 -14.281 19.627 1.00 24.33 ? 13  PHE A CB   5  
ATOM 8643  C CG   . PHE A 1 13  ? 30.207 -13.428 18.401 1.00 72.22 ? 13  PHE A CG   5  
ATOM 8644  C CD1  . PHE A 1 13  ? 28.971 -12.904 18.056 1.00 22.34 ? 13  PHE A CD1  5  
ATOM 8645  C CD2  . PHE A 1 13  ? 31.297 -13.151 17.592 1.00 0.50  ? 13  PHE A CD2  5  
ATOM 8646  C CE1  . PHE A 1 13  ? 28.825 -12.118 16.929 1.00 65.53 ? 13  PHE A CE1  5  
ATOM 8647  C CE2  . PHE A 1 13  ? 31.157 -12.365 16.463 1.00 25.14 ? 13  PHE A CE2  5  
ATOM 8648  C CZ   . PHE A 1 13  ? 29.920 -11.849 16.131 1.00 61.54 ? 13  PHE A CZ   5  
ATOM 8649  H H    . PHE A 1 13  ? 27.936 -15.323 20.167 1.00 42.32 ? 13  PHE A H    5  
ATOM 8650  H HA   . PHE A 1 13  ? 30.217 -16.077 18.472 1.00 72.14 ? 13  PHE A HA   5  
ATOM 8651  H HB2  . PHE A 1 13  ? 29.793 -13.824 20.423 1.00 54.03 ? 13  PHE A HB2  5  
ATOM 8652  H HB3  . PHE A 1 13  ? 31.407 -14.291 19.897 1.00 54.10 ? 13  PHE A HB3  5  
ATOM 8653  H HD1  . PHE A 1 13  ? 28.114 -13.115 18.680 1.00 13.44 ? 13  PHE A HD1  5  
ATOM 8654  H HD2  . PHE A 1 13  ? 32.265 -13.554 17.850 1.00 2.12  ? 13  PHE A HD2  5  
ATOM 8655  H HE1  . PHE A 1 13  ? 27.856 -11.717 16.672 1.00 64.14 ? 13  PHE A HE1  5  
ATOM 8656  H HE2  . PHE A 1 13  ? 32.015 -12.156 15.841 1.00 72.41 ? 13  PHE A HE2  5  
ATOM 8657  H HZ   . PHE A 1 13  ? 29.809 -11.235 15.250 1.00 74.34 ? 13  PHE A HZ   5  
ATOM 8658  N N    . SER A 1 14  ? 31.420 -17.461 20.134 1.00 62.33 ? 14  SER A N    5  
ATOM 8659  C CA   . SER A 1 14  ? 32.061 -18.374 21.074 1.00 42.44 ? 14  SER A CA   5  
ATOM 8660  C C    . SER A 1 14  ? 33.496 -18.671 20.649 1.00 1.01  ? 14  SER A C    5  
ATOM 8661  O O    . SER A 1 14  ? 33.737 -19.197 19.562 1.00 4.33  ? 14  SER A O    5  
ATOM 8662  C CB   . SER A 1 14  ? 31.267 -19.677 21.174 1.00 34.02 ? 14  SER A CB   5  
ATOM 8663  O OG   . SER A 1 14  ? 31.109 -20.278 19.901 1.00 64.24 ? 14  SER A OG   5  
ATOM 8664  H H    . SER A 1 14  ? 31.694 -17.473 19.193 1.00 63.34 ? 14  SER A H    5  
ATOM 8665  H HA   . SER A 1 14  ? 32.076 -17.895 22.042 1.00 63.54 ? 14  SER A HA   5  
ATOM 8666  H HB2  . SER A 1 14  ? 31.789 -20.365 21.822 1.00 53.14 ? 14  SER A HB2  5  
ATOM 8667  H HB3  . SER A 1 14  ? 30.289 -19.468 21.584 1.00 32.40 ? 14  SER A HB3  5  
ATOM 8668  H HG   . SER A 1 14  ? 30.178 -20.447 19.739 1.00 43.55 ? 14  SER A HG   5  
ATOM 8669  N N    . ASP A 1 15  ? 34.445 -18.331 21.515 1.00 52.45 ? 15  ASP A N    5  
ATOM 8670  C CA   . ASP A 1 15  ? 35.857 -18.561 21.231 1.00 34.43 ? 15  ASP A CA   5  
ATOM 8671  C C    . ASP A 1 15  ? 36.283 -17.830 19.962 1.00 11.13 ? 15  ASP A C    5  
ATOM 8672  O O    . ASP A 1 15  ? 37.120 -18.318 19.204 1.00 35.32 ? 15  ASP A O    5  
ATOM 8673  C CB   . ASP A 1 15  ? 36.132 -20.059 21.088 1.00 31.15 ? 15  ASP A CB   5  
ATOM 8674  C CG   . ASP A 1 15  ? 36.310 -20.745 22.428 1.00 32.55 ? 15  ASP A CG   5  
ATOM 8675  O OD1  . ASP A 1 15  ? 37.435 -20.710 22.968 1.00 2.31  ? 15  ASP A OD1  5  
ATOM 8676  O OD2  . ASP A 1 15  ? 35.324 -21.319 22.937 1.00 32.22 ? 15  ASP A OD2  5  
ATOM 8677  H H    . ASP A 1 15  ? 34.189 -17.915 22.365 1.00 43.23 ? 15  ASP A H    5  
ATOM 8678  H HA   . ASP A 1 15  ? 36.429 -18.177 22.062 1.00 34.44 ? 15  ASP A HA   5  
ATOM 8679  H HB2  . ASP A 1 15  ? 35.303 -20.524 20.575 1.00 53.44 ? 15  ASP A HB2  5  
ATOM 8680  H HB3  . ASP A 1 15  ? 37.033 -20.199 20.510 1.00 71.23 ? 15  ASP A HB3  5  
ATOM 8681  N N    . ASN A 1 16  ? 35.701 -16.657 19.738 1.00 55.52 ? 16  ASN A N    5  
ATOM 8682  C CA   . ASN A 1 16  ? 36.019 -15.858 18.560 1.00 60.25 ? 16  ASN A CA   5  
ATOM 8683  C C    . ASN A 1 16  ? 35.624 -16.593 17.282 1.00 42.31 ? 16  ASN A C    5  
ATOM 8684  O O    . ASN A 1 16  ? 36.346 -16.559 16.285 1.00 74.12 ? 16  ASN A O    5  
ATOM 8685  C CB   . ASN A 1 16  ? 37.513 -15.528 18.530 1.00 14.33 ? 16  ASN A CB   5  
ATOM 8686  C CG   . ASN A 1 16  ? 38.032 -15.078 19.882 1.00 31.34 ? 16  ASN A CG   5  
ATOM 8687  O OD1  . ASN A 1 16  ? 39.005 -15.627 20.400 1.00 40.04 ? 16  ASN A OD1  5  
ATOM 8688  N ND2  . ASN A 1 16  ? 37.383 -14.075 20.462 1.00 74.23 ? 16  ASN A ND2  5  
ATOM 8689  H H    . ASN A 1 16  ? 35.041 -16.319 20.379 1.00 33.42 ? 16  ASN A H    5  
ATOM 8690  H HA   . ASN A 1 16  ? 35.457 -14.939 18.621 1.00 50.53 ? 16  ASN A HA   5  
ATOM 8691  H HB2  . ASN A 1 16  ? 38.064 -16.407 18.229 1.00 53.42 ? 16  ASN A HB2  5  
ATOM 8692  H HB3  . ASN A 1 16  ? 37.687 -14.736 17.817 1.00 74.42 ? 16  ASN A HB3  5  
ATOM 8693  H HD21 . ASN A 1 16  ? 36.616 -13.686 19.991 1.00 33.41 ? 16  ASN A HD21 5  
ATOM 8694  H HD22 . ASN A 1 16  ? 37.698 -13.764 21.336 1.00 34.20 ? 16  ASN A HD22 5  
ATOM 8695  N N    . LYS A 1 17  ? 34.473 -17.256 17.319 1.00 43.32 ? 17  LYS A N    5  
ATOM 8696  C CA   . LYS A 1 17  ? 33.980 -17.997 16.165 1.00 73.35 ? 17  LYS A CA   5  
ATOM 8697  C C    . LYS A 1 17  ? 32.488 -17.753 15.958 1.00 23.00 ? 17  LYS A C    5  
ATOM 8698  O O    . LYS A 1 17  ? 31.772 -17.401 16.896 1.00 41.43 ? 17  LYS A O    5  
ATOM 8699  C CB   . LYS A 1 17  ? 34.242 -19.494 16.344 1.00 30.31 ? 17  LYS A CB   5  
ATOM 8700  C CG   . LYS A 1 17  ? 35.562 -19.956 15.752 1.00 43.21 ? 17  LYS A CG   5  
ATOM 8701  C CD   . LYS A 1 17  ? 36.580 -20.271 16.836 1.00 52.25 ? 17  LYS A CD   5  
ATOM 8702  C CE   . LYS A 1 17  ? 37.640 -21.241 16.339 1.00 65.30 ? 17  LYS A CE   5  
ATOM 8703  N NZ   . LYS A 1 17  ? 38.833 -21.263 17.230 1.00 21.25 ? 17  LYS A NZ   5  
ATOM 8704  H H    . LYS A 1 17  ? 33.942 -17.245 18.143 1.00 70.10 ? 17  LYS A H    5  
ATOM 8705  H HA   . LYS A 1 17  ? 34.513 -17.649 15.293 1.00 4.03  ? 17  LYS A HA   5  
ATOM 8706  H HB2  . LYS A 1 17  ? 34.245 -19.723 17.400 1.00 42.13 ? 17  LYS A HB2  5  
ATOM 8707  H HB3  . LYS A 1 17  ? 33.445 -20.047 15.867 1.00 0.14  ? 17  LYS A HB3  5  
ATOM 8708  H HG2  . LYS A 1 17  ? 35.392 -20.845 15.164 1.00 34.50 ? 17  LYS A HG2  5  
ATOM 8709  H HG3  . LYS A 1 17  ? 35.955 -19.173 15.118 1.00 22.32 ? 17  LYS A HG3  5  
ATOM 8710  H HD2  . LYS A 1 17  ? 37.062 -19.355 17.142 1.00 10.51 ? 17  LYS A HD2  5  
ATOM 8711  H HD3  . LYS A 1 17  ? 36.069 -20.711 17.680 1.00 14.12 ? 17  LYS A HD3  5  
ATOM 8712  H HE2  . LYS A 1 17  ? 37.213 -22.232 16.299 1.00 4.52  ? 17  LYS A HE2  5  
ATOM 8713  H HE3  . LYS A 1 17  ? 37.948 -20.942 15.348 1.00 52.22 ? 17  LYS A HE3  5  
ATOM 8714  H HZ1  . LYS A 1 17  ? 39.667 -20.909 16.720 1.00 62.55 ? 17  LYS A HZ1  5  
ATOM 8715  H HZ2  . LYS A 1 17  ? 39.023 -22.234 17.550 1.00 72.42 ? 17  LYS A HZ2  5  
ATOM 8716  H HZ3  . LYS A 1 17  ? 38.669 -20.662 18.063 1.00 54.24 ? 17  LYS A HZ3  5  
ATOM 8717  N N    . ILE A 1 18  ? 32.027 -17.944 14.727 1.00 41.44 ? 18  ILE A N    5  
ATOM 8718  C CA   . ILE A 1 18  ? 30.621 -17.746 14.399 1.00 34.31 ? 18  ILE A CA   5  
ATOM 8719  C C    . ILE A 1 18  ? 29.938 -19.073 14.083 1.00 3.13  ? 18  ILE A C    5  
ATOM 8720  O O    . ILE A 1 18  ? 30.567 -20.002 13.574 1.00 4.35  ? 18  ILE A O    5  
ATOM 8721  C CB   . ILE A 1 18  ? 30.450 -16.796 13.199 1.00 11.34 ? 18  ILE A CB   5  
ATOM 8722  C CG1  . ILE A 1 18  ? 31.211 -15.491 13.443 1.00 52.34 ? 18  ILE A CG1  5  
ATOM 8723  C CG2  . ILE A 1 18  ? 28.975 -16.517 12.950 1.00 2.22  ? 18  ILE A CG2  5  
ATOM 8724  C CD1  . ILE A 1 18  ? 32.651 -15.536 12.981 1.00 54.31 ? 18  ILE A CD1  5  
ATOM 8725  H H    . ILE A 1 18  ? 32.647 -18.224 14.022 1.00 62.40 ? 18  ILE A H    5  
ATOM 8726  H HA   . ILE A 1 18  ? 30.138 -17.301 15.257 1.00 2.13  ? 18  ILE A HA   5  
ATOM 8727  H HB   . ILE A 1 18  ? 30.853 -17.281 12.324 1.00 74.22 ? 18  ILE A HB   5  
ATOM 8728  H HG12 . ILE A 1 18  ? 30.718 -14.690 12.914 1.00 64.25 ? 18  ILE A HG12 5  
ATOM 8729  H HG13 . ILE A 1 18  ? 31.207 -15.273 14.501 1.00 44.21 ? 18  ILE A HG13 5  
ATOM 8730  H HG21 . ILE A 1 18  ? 28.429 -16.614 13.877 1.00 70.01 ? 18  ILE A HG21 5  
ATOM 8731  H HG22 . ILE A 1 18  ? 28.859 -15.514 12.568 1.00 15.34 ? 18  ILE A HG22 5  
ATOM 8732  H HG23 . ILE A 1 18  ? 28.591 -17.224 12.230 1.00 4.32  ? 18  ILE A HG23 5  
ATOM 8733  H HD11 . ILE A 1 18  ? 32.934 -14.570 12.588 1.00 35.31 ? 18  ILE A HD11 5  
ATOM 8734  H HD12 . ILE A 1 18  ? 33.289 -15.788 13.814 1.00 13.43 ? 18  ILE A HD12 5  
ATOM 8735  H HD13 . ILE A 1 18  ? 32.757 -16.283 12.208 1.00 62.05 ? 18  ILE A HD13 5  
ATOM 8736  N N    . LEU A 1 19  ? 28.647 -19.155 14.386 1.00 5.24  ? 19  LEU A N    5  
ATOM 8737  C CA   . LEU A 1 19  ? 27.878 -20.368 14.133 1.00 15.21 ? 19  LEU A CA   5  
ATOM 8738  C C    . LEU A 1 19  ? 27.126 -20.269 12.810 1.00 74.13 ? 19  LEU A C    5  
ATOM 8739  O O    . LEU A 1 19  ? 26.937 -19.177 12.272 1.00 75.42 ? 19  LEU A O    5  
ATOM 8740  C CB   . LEU A 1 19  ? 26.892 -20.617 15.276 1.00 75.43 ? 19  LEU A CB   5  
ATOM 8741  C CG   . LEU A 1 19  ? 25.532 -19.930 15.151 1.00 55.31 ? 19  LEU A CG   5  
ATOM 8742  C CD1  . LEU A 1 19  ? 24.601 -20.380 16.267 1.00 43.14 ? 19  LEU A CD1  5  
ATOM 8743  C CD2  . LEU A 1 19  ? 25.695 -18.417 15.168 1.00 2.13  ? 19  LEU A CD2  5  
ATOM 8744  H H    . LEU A 1 19  ? 28.201 -18.382 14.790 1.00 73.11 ? 19  LEU A H    5  
ATOM 8745  H HA   . LEU A 1 19  ? 28.570 -21.194 14.079 1.00 21.41 ? 19  LEU A HA   5  
ATOM 8746  H HB2  . LEU A 1 19  ? 26.720 -21.681 15.337 1.00 14.15 ? 19  LEU A HB2  5  
ATOM 8747  H HB3  . LEU A 1 19  ? 27.354 -20.275 16.191 1.00 73.31 ? 19  LEU A HB3  5  
ATOM 8748  H HG   . LEU A 1 19  ? 25.080 -20.207 14.208 1.00 30.33 ? 19  LEU A HG   5  
ATOM 8749  H HD11 . LEU A 1 19  ? 24.420 -21.440 16.178 1.00 23.33 ? 19  LEU A HD11 5  
ATOM 8750  H HD12 . LEU A 1 19  ? 23.665 -19.847 16.191 1.00 31.24 ? 19  LEU A HD12 5  
ATOM 8751  H HD13 . LEU A 1 19  ? 25.058 -20.170 17.223 1.00 64.23 ? 19  LEU A HD13 5  
ATOM 8752  H HD21 . LEU A 1 19  ? 26.293 -18.130 16.021 1.00 41.13 ? 19  LEU A HD21 5  
ATOM 8753  H HD22 . LEU A 1 19  ? 24.723 -17.950 15.237 1.00 20.53 ? 19  LEU A HD22 5  
ATOM 8754  H HD23 . LEU A 1 19  ? 26.185 -18.097 14.261 1.00 70.44 ? 19  LEU A HD23 5  
ATOM 8755  N N    . CYS A 1 20  ? 26.698 -21.415 12.292 1.00 55.12 ? 20  CYS A N    5  
ATOM 8756  C CA   . CYS A 1 20  ? 25.964 -21.458 11.032 1.00 43.35 ? 20  CYS A CA   5  
ATOM 8757  C C    . CYS A 1 20  ? 24.653 -22.220 11.191 1.00 61.30 ? 20  CYS A C    5  
ATOM 8758  O O    . CYS A 1 20  ? 24.593 -23.233 11.888 1.00 2.42  ? 20  CYS A O    5  
ATOM 8759  C CB   . CYS A 1 20  ? 26.818 -22.109 9.943  1.00 61.13 ? 20  CYS A CB   5  
ATOM 8760  S SG   . CYS A 1 20  ? 25.888 -22.608 8.475  1.00 74.31 ? 20  CYS A SG   5  
ATOM 8761  H H    . CYS A 1 20  ? 26.879 -22.252 12.767 1.00 31.52 ? 20  CYS A H    5  
ATOM 8762  H HA   . CYS A 1 20  ? 25.743 -20.441 10.743 1.00 35.45 ? 20  CYS A HA   5  
ATOM 8763  H HB2  . CYS A 1 20  ? 27.579 -21.411 9.626  1.00 0.24  ? 20  CYS A HB2  5  
ATOM 8764  H HB3  . CYS A 1 20  ? 27.294 -22.990 10.348 1.00 54.04 ? 20  CYS A HB3  5  
ATOM 8765  H HG   . CYS A 1 20  ? 24.964 -21.688 8.244  1.00 12.04 ? 20  CYS A HG   5  
ATOM 8766  N N    . ALA A 1 21  ? 23.604 -21.726 10.541 1.00 24.12 ? 21  ALA A N    5  
ATOM 8767  C CA   . ALA A 1 21  ? 22.294 -22.361 10.611 1.00 62.04 ? 21  ALA A CA   5  
ATOM 8768  C C    . ALA A 1 21  ? 21.474 -22.066 9.359  1.00 1.33  ? 21  ALA A C    5  
ATOM 8769  O O    . ALA A 1 21  ? 21.103 -20.920 9.106  1.00 31.04 ? 21  ALA A O    5  
ATOM 8770  C CB   . ALA A 1 21  ? 21.549 -21.899 11.854 1.00 52.42 ? 21  ALA A CB   5  
ATOM 8771  H H    . ALA A 1 21  ? 23.715 -20.916 10.001 1.00 20.13 ? 21  ALA A H    5  
ATOM 8772  H HA   . ALA A 1 21  ? 22.444 -23.428 10.687 1.00 62.41 ? 21  ALA A HA   5  
ATOM 8773  H HB1  . ALA A 1 21  ? 20.572 -21.532 11.571 1.00 5.05  ? 21  ALA A HB1  5  
ATOM 8774  H HB2  . ALA A 1 21  ? 21.439 -22.728 12.537 1.00 51.34 ? 21  ALA A HB2  5  
ATOM 8775  H HB3  . ALA A 1 21  ? 22.106 -21.108 12.334 1.00 54.34 ? 21  ALA A HB3  5  
ATOM 8776  N N    . GLN A 1 22  ? 21.196 -23.106 8.580  1.00 22.24 ? 22  GLN A N    5  
ATOM 8777  C CA   . GLN A 1 22  ? 20.421 -22.957 7.355  1.00 40.45 ? 22  GLN A CA   5  
ATOM 8778  C C    . GLN A 1 22  ? 18.939 -23.204 7.614  1.00 33.50 ? 22  GLN A C    5  
ATOM 8779  O O    . GLN A 1 22  ? 18.482 -24.348 7.620  1.00 45.10 ? 22  GLN A O    5  
ATOM 8780  C CB   . GLN A 1 22  ? 20.932 -23.921 6.282  1.00 15.24 ? 22  GLN A CB   5  
ATOM 8781  C CG   . GLN A 1 22  ? 20.790 -23.387 4.866  1.00 15.33 ? 22  GLN A CG   5  
ATOM 8782  C CD   . GLN A 1 22  ? 21.515 -24.240 3.845  1.00 24.21 ? 22  GLN A CD   5  
ATOM 8783  O OE1  . GLN A 1 22  ? 22.125 -25.254 4.187  1.00 2.20  ? 22  GLN A OE1  5  
ATOM 8784  N NE2  . GLN A 1 22  ? 21.453 -23.834 2.582  1.00 4.03  ? 22  GLN A NE2  5  
ATOM 8785  H H    . GLN A 1 22  ? 21.520 -23.994 8.836  1.00 61.53 ? 22  GLN A H    5  
ATOM 8786  H HA   . GLN A 1 22  ? 20.548 -21.943 7.004  1.00 33.51 ? 22  GLN A HA   5  
ATOM 8787  H HB2  . GLN A 1 22  ? 21.976 -24.123 6.465  1.00 23.21 ? 22  GLN A HB2  5  
ATOM 8788  H HB3  . GLN A 1 22  ? 20.377 -24.845 6.353  1.00 55.35 ? 22  GLN A HB3  5  
ATOM 8789  H HG2  . GLN A 1 22  ? 19.741 -23.359 4.609  1.00 60.11 ? 22  GLN A HG2  5  
ATOM 8790  H HG3  . GLN A 1 22  ? 21.194 -22.386 4.831  1.00 42.02 ? 22  GLN A HG3  5  
ATOM 8791  H HE21 . GLN A 1 22  ? 20.950 -23.016 2.384  1.00 62.11 ? 22  GLN A HE21 5  
ATOM 8792  H HE22 . GLN A 1 22  ? 21.914 -24.366 1.902  1.00 61.12 ? 22  GLN A HE22 5  
ATOM 8793  N N    . ARG A 1 23  ? 18.192 -22.126 7.829  1.00 62.15 ? 23  ARG A N    5  
ATOM 8794  C CA   . ARG A 1 23  ? 16.762 -22.227 8.090  1.00 35.13 ? 23  ARG A CA   5  
ATOM 8795  C C    . ARG A 1 23  ? 16.022 -22.768 6.870  1.00 64.30 ? 23  ARG A C    5  
ATOM 8796  O O    . ARG A 1 23  ? 15.513 -23.889 6.887  1.00 52.32 ? 23  ARG A O    5  
ATOM 8797  C CB   . ARG A 1 23  ? 16.195 -20.860 8.478  1.00 33.35 ? 23  ARG A CB   5  
ATOM 8798  C CG   . ARG A 1 23  ? 14.794 -20.926 9.064  1.00 13.12 ? 23  ARG A CG   5  
ATOM 8799  C CD   . ARG A 1 23  ? 14.825 -21.264 10.546 1.00 12.15 ? 23  ARG A CD   5  
ATOM 8800  N NE   . ARG A 1 23  ? 13.508 -21.134 11.165 1.00 23.32 ? 23  ARG A NE   5  
ATOM 8801  C CZ   . ARG A 1 23  ? 13.246 -21.492 12.418 1.00 45.55 ? 23  ARG A CZ   5  
ATOM 8802  N NH1  . ARG A 1 23  ? 14.206 -21.997 13.181 1.00 73.25 ? 23  ARG A NH1  5  
ATOM 8803  N NH2  . ARG A 1 23  ? 12.023 -21.343 12.909 1.00 10.22 ? 23  ARG A NH2  5  
ATOM 8804  H H    . ARG A 1 23  ? 18.613 -21.241 7.811  1.00 25.42 ? 23  ARG A H    5  
ATOM 8805  H HA   . ARG A 1 23  ? 16.622 -22.912 8.914  1.00 43.44 ? 23  ARG A HA   5  
ATOM 8806  H HB2  . ARG A 1 23  ? 16.847 -20.408 9.212  1.00 75.04 ? 23  ARG A HB2  5  
ATOM 8807  H HB3  . ARG A 1 23  ? 16.165 -20.234 7.600  1.00 41.22 ? 23  ARG A HB3  5  
ATOM 8808  H HG2  . ARG A 1 23  ? 14.314 -19.967 8.935  1.00 2.32  ? 23  ARG A HG2  5  
ATOM 8809  H HG3  . ARG A 1 23  ? 14.231 -21.685 8.542  1.00 32.21 ? 23  ARG A HG3  5  
ATOM 8810  H HD2  . ARG A 1 23  ? 15.168 -22.281 10.663 1.00 1.01  ? 23  ARG A HD2  5  
ATOM 8811  H HD3  . ARG A 1 23  ? 15.512 -20.593 11.040 1.00 22.43 ? 23  ARG A HD3  5  
ATOM 8812  H HE   . ARG A 1 23  ? 12.785 -20.763 10.619 1.00 12.12 ? 23  ARG A HE   5  
ATOM 8813  H HH11 . ARG A 1 23  ? 15.129 -22.109 12.813 1.00 33.41 ? 23  ARG A HH11 5  
ATOM 8814  H HH12 . ARG A 1 23  ? 14.006 -22.264 14.124 1.00 61.34 ? 23  ARG A HH12 5  
ATOM 8815  H HH21 . ARG A 1 23  ? 11.297 -20.962 12.337 1.00 4.20  ? 23  ARG A HH21 5  
ATOM 8816  H HH22 . ARG A 1 23  ? 11.827 -21.612 13.851 1.00 31.05 ? 23  ARG A HH22 5  
ATOM 8817  N N    . SER A 1 24  ? 15.968 -21.964 5.813  1.00 70.31 ? 24  SER A N    5  
ATOM 8818  C CA   . SER A 1 24  ? 15.288 -22.360 4.585  1.00 35.45 ? 24  SER A CA   5  
ATOM 8819  C C    . SER A 1 24  ? 15.516 -21.333 3.481  1.00 5.45  ? 24  SER A C    5  
ATOM 8820  O O    . SER A 1 24  ? 16.389 -20.472 3.592  1.00 64.53 ? 24  SER A O    5  
ATOM 8821  C CB   . SER A 1 24  ? 13.788 -22.527 4.840  1.00 62.34 ? 24  SER A CB   5  
ATOM 8822  O OG   . SER A 1 24  ? 13.185 -23.321 3.832  1.00 24.13 ? 24  SER A OG   5  
ATOM 8823  H H    . SER A 1 24  ? 16.394 -21.083 5.861  1.00 54.41 ? 24  SER A H    5  
ATOM 8824  H HA   . SER A 1 24  ? 15.698 -23.308 4.270  1.00 42.12 ? 24  SER A HA   5  
ATOM 8825  H HB2  . SER A 1 24  ? 13.639 -23.006 5.795  1.00 13.24 ? 24  SER A HB2  5  
ATOM 8826  H HB3  . SER A 1 24  ? 13.317 -21.555 4.846  1.00 74.22 ? 24  SER A HB3  5  
ATOM 8827  H HG   . SER A 1 24  ? 12.378 -23.713 4.174  1.00 64.44 ? 24  SER A HG   5  
ATOM 8828  N N    . GLU A 1 25  ? 14.725 -21.430 2.418  1.00 41.23 ? 25  GLU A N    5  
ATOM 8829  C CA   . GLU A 1 25  ? 14.842 -20.509 1.293  1.00 70.21 ? 25  GLU A CA   5  
ATOM 8830  C C    . GLU A 1 25  ? 14.137 -19.190 1.594  1.00 2.33  ? 25  GLU A C    5  
ATOM 8831  O O    . GLU A 1 25  ? 14.087 -18.293 0.753  1.00 41.45 ? 25  GLU A O    5  
ATOM 8832  C CB   . GLU A 1 25  ? 14.253 -21.137 0.028  1.00 63.21 ? 25  GLU A CB   5  
ATOM 8833  C CG   . GLU A 1 25  ? 15.304 -21.618 -0.959 1.00 1.51  ? 25  GLU A CG   5  
ATOM 8834  C CD   . GLU A 1 25  ? 15.605 -20.593 -2.036 1.00 32.04 ? 25  GLU A CD   5  
ATOM 8835  O OE1  . GLU A 1 25  ? 16.002 -19.463 -1.683 1.00 41.55 ? 25  GLU A OE1  5  
ATOM 8836  O OE2  . GLU A 1 25  ? 15.443 -20.921 -3.229 1.00 71.14 ? 25  GLU A OE2  5  
ATOM 8837  H H    . GLU A 1 25  ? 14.048 -22.137 2.388  1.00 34.24 ? 25  GLU A H    5  
ATOM 8838  H HA   . GLU A 1 25  ? 15.891 -20.314 1.132  1.00 64.13 ? 25  GLU A HA   5  
ATOM 8839  H HB2  . GLU A 1 25  ? 13.641 -21.981 0.311  1.00 65.25 ? 25  GLU A HB2  5  
ATOM 8840  H HB3  . GLU A 1 25  ? 13.633 -20.405 -0.467 1.00 40.24 ? 25  GLU A HB3  5  
ATOM 8841  H HG2  . GLU A 1 25  ? 16.216 -21.829 -0.420 1.00 54.22 ? 25  GLU A HG2  5  
ATOM 8842  H HG3  . GLU A 1 25  ? 14.949 -22.521 -1.432 1.00 21.53 ? 25  GLU A HG3  5  
ATOM 8843  N N    . LYS A 1 26  ? 13.593 -19.079 2.801  1.00 13.12 ? 26  LYS A N    5  
ATOM 8844  C CA   . LYS A 1 26  ? 12.891 -17.870 3.216  1.00 33.24 ? 26  LYS A CA   5  
ATOM 8845  C C    . LYS A 1 26  ? 13.875 -16.743 3.510  1.00 3.11  ? 26  LYS A C    5  
ATOM 8846  O O    . LYS A 1 26  ? 13.591 -15.574 3.249  1.00 30.41 ? 26  LYS A O    5  
ATOM 8847  C CB   . LYS A 1 26  ? 12.037 -18.152 4.455  1.00 51.42 ? 26  LYS A CB   5  
ATOM 8848  C CG   . LYS A 1 26  ? 10.993 -19.234 4.241  1.00 61.11 ? 26  LYS A CG   5  
ATOM 8849  C CD   . LYS A 1 26  ? 9.657  -18.850 4.855  1.00 24.03 ? 26  LYS A CD   5  
ATOM 8850  C CE   . LYS A 1 26  ? 8.581  -19.876 4.535  1.00 22.14 ? 26  LYS A CE   5  
ATOM 8851  N NZ   . LYS A 1 26  ? 8.989  -21.251 4.937  1.00 52.03 ? 26  LYS A NZ   5  
ATOM 8852  H H    . LYS A 1 26  ? 13.666 -19.829 3.429  1.00 54.20 ? 26  LYS A H    5  
ATOM 8853  H HA   . LYS A 1 26  ? 12.245 -17.566 2.406  1.00 24.41 ? 26  LYS A HA   5  
ATOM 8854  H HB2  . LYS A 1 26  ? 12.685 -18.460 5.262  1.00 61.02 ? 26  LYS A HB2  5  
ATOM 8855  H HB3  . LYS A 1 26  ? 11.528 -17.242 4.741  1.00 63.02 ? 26  LYS A HB3  5  
ATOM 8856  H HG2  . LYS A 1 26  ? 10.858 -19.387 3.180  1.00 24.35 ? 26  LYS A HG2  5  
ATOM 8857  H HG3  . LYS A 1 26  ? 11.339 -20.150 4.698  1.00 62.41 ? 26  LYS A HG3  5  
ATOM 8858  H HD2  . LYS A 1 26  ? 9.769  -18.785 5.927  1.00 23.04 ? 26  LYS A HD2  5  
ATOM 8859  H HD3  . LYS A 1 26  ? 9.354  -17.889 4.464  1.00 22.03 ? 26  LYS A HD3  5  
ATOM 8860  H HE2  . LYS A 1 26  ? 7.679  -19.609 5.064  1.00 50.22 ? 26  LYS A HE2  5  
ATOM 8861  H HE3  . LYS A 1 26  ? 8.393  -19.861 3.472  1.00 62.30 ? 26  LYS A HE3  5  
ATOM 8862  H HZ1  . LYS A 1 26  ? 9.437  -21.739 4.135  1.00 44.31 ? 26  LYS A HZ1  5  
ATOM 8863  H HZ2  . LYS A 1 26  ? 8.157  -21.797 5.238  1.00 55.22 ? 26  LYS A HZ2  5  
ATOM 8864  H HZ3  . LYS A 1 26  ? 9.666  -21.208 5.725  1.00 15.40 ? 26  LYS A HZ3  5  
ATOM 8865  N N    . MET A 1 27  ? 15.034 -17.102 4.053  1.00 0.10  ? 27  MET A N    5  
ATOM 8866  C CA   . MET A 1 27  ? 16.062 -16.120 4.379  1.00 15.23 ? 27  MET A CA   5  
ATOM 8867  C C    . MET A 1 27  ? 16.720 -15.581 3.113  1.00 22.13 ? 27  MET A C    5  
ATOM 8868  O O    . MET A 1 27  ? 16.309 -15.909 2.000  1.00 34.05 ? 27  MET A O    5  
ATOM 8869  C CB   . MET A 1 27  ? 17.119 -16.741 5.294  1.00 61.14 ? 27  MET A CB   5  
ATOM 8870  C CG   . MET A 1 27  ? 17.051 -16.242 6.728  1.00 61.40 ? 27  MET A CG   5  
ATOM 8871  S SD   . MET A 1 27  ? 17.323 -14.465 6.859  1.00 40.20 ? 27  MET A SD   5  
ATOM 8872  C CE   . MET A 1 27  ? 15.646 -13.883 7.100  1.00 44.42 ? 27  MET A CE   5  
ATOM 8873  H H    . MET A 1 27  ? 15.203 -18.049 4.238  1.00 22.41 ? 27  MET A H    5  
ATOM 8874  H HA   . MET A 1 27  ? 15.585 -15.302 4.899  1.00 71.21 ? 27  MET A HA   5  
ATOM 8875  H HB2  . MET A 1 27  ? 16.987 -17.813 5.301  1.00 11.41 ? 27  MET A HB2  5  
ATOM 8876  H HB3  . MET A 1 27  ? 18.098 -16.510 4.901  1.00 3.24  ? 27  MET A HB3  5  
ATOM 8877  H HG2  . MET A 1 27  ? 16.076 -16.473 7.130  1.00 54.13 ? 27  MET A HG2  5  
ATOM 8878  H HG3  . MET A 1 27  ? 17.806 -16.752 7.308  1.00 63.44 ? 27  MET A HG3  5  
ATOM 8879  H HE1  . MET A 1 27  ? 14.953 -14.603 6.692  1.00 51.24 ? 27  MET A HE1  5  
ATOM 8880  H HE2  . MET A 1 27  ? 15.457 -13.759 8.156  1.00 50.33 ? 27  MET A HE2  5  
ATOM 8881  H HE3  . MET A 1 27  ? 15.519 -12.935 6.597  1.00 41.12 ? 27  MET A HE3  5  
ATOM 8882  N N    . SER A 1 28  ? 17.744 -14.753 3.291  1.00 44.32 ? 28  SER A N    5  
ATOM 8883  C CA   . SER A 1 28  ? 18.457 -14.165 2.162  1.00 21.53 ? 28  SER A CA   5  
ATOM 8884  C C    . SER A 1 28  ? 19.656 -15.024 1.771  1.00 5.43  ? 28  SER A C    5  
ATOM 8885  O O    . SER A 1 28  ? 20.492 -15.363 2.610  1.00 0.13  ? 28  SER A O    5  
ATOM 8886  C CB   . SER A 1 28  ? 18.920 -12.748 2.506  1.00 71.31 ? 28  SER A CB   5  
ATOM 8887  O OG   . SER A 1 28  ? 17.814 -11.888 2.719  1.00 60.23 ? 28  SER A OG   5  
ATOM 8888  H H    . SER A 1 28  ? 18.026 -14.529 4.203  1.00 74.40 ? 28  SER A H    5  
ATOM 8889  H HA   . SER A 1 28  ? 17.775 -14.119 1.327  1.00 75.51 ? 28  SER A HA   5  
ATOM 8890  H HB2  . SER A 1 28  ? 19.518 -12.775 3.404  1.00 35.42 ? 28  SER A HB2  5  
ATOM 8891  H HB3  . SER A 1 28  ? 19.512 -12.359 1.691  1.00 45.33 ? 28  SER A HB3  5  
ATOM 8892  H HG   . SER A 1 28  ? 17.322 -11.790 1.900  1.00 3.11  ? 28  SER A HG   5  
ATOM 8893  N N    . LEU A 1 29  ? 19.735 -15.371 0.492  1.00 73.34 ? 29  LEU A N    5  
ATOM 8894  C CA   . LEU A 1 29  ? 20.832 -16.190 -0.013 1.00 74.20 ? 29  LEU A CA   5  
ATOM 8895  C C    . LEU A 1 29  ? 21.220 -17.264 0.999  1.00 54.25 ? 29  LEU A C    5  
ATOM 8896  O O    . LEU A 1 29  ? 22.386 -17.416 1.362  1.00 30.41 ? 29  LEU A O    5  
ATOM 8897  C CB   . LEU A 1 29  ? 22.043 -15.313 -0.333 1.00 63.23 ? 29  LEU A CB   5  
ATOM 8898  C CG   . LEU A 1 29  ? 21.918 -14.419 -1.568 1.00 34.54 ? 29  LEU A CG   5  
ATOM 8899  C CD1  . LEU A 1 29  ? 21.010 -13.234 -1.278 1.00 74.32 ? 29  LEU A CD1  5  
ATOM 8900  C CD2  . LEU A 1 29  ? 23.289 -13.944 -2.024 1.00 3.03  ? 29  LEU A CD2  5  
ATOM 8901  H H    . LEU A 1 29  ? 19.039 -15.071 -0.129 1.00 43.14 ? 29  LEU A H    5  
ATOM 8902  H HA   . LEU A 1 29  ? 20.496 -16.671 -0.920 1.00 32.34 ? 29  LEU A HA   5  
ATOM 8903  H HB2  . LEU A 1 29  ? 22.225 -14.676 0.519  1.00 71.33 ? 29  LEU A HB2  5  
ATOM 8904  H HB3  . LEU A 1 29  ? 22.893 -15.965 -0.481 1.00 34.33 ? 29  LEU A HB3  5  
ATOM 8905  H HG   . LEU A 1 29  ? 21.475 -14.989 -2.373 1.00 62.23 ? 29  LEU A HG   5  
ATOM 8906  H HD11 . LEU A 1 29  ? 20.010 -13.454 -1.622 1.00 44.14 ? 29  LEU A HD11 5  
ATOM 8907  H HD12 . LEU A 1 29  ? 21.384 -12.361 -1.791 1.00 55.35 ? 29  LEU A HD12 5  
ATOM 8908  H HD13 . LEU A 1 29  ? 20.992 -13.046 -0.215 1.00 33.14 ? 29  LEU A HD13 5  
ATOM 8909  H HD21 . LEU A 1 29  ? 23.204 -13.479 -2.995 1.00 30.12 ? 29  LEU A HD21 5  
ATOM 8910  H HD22 . LEU A 1 29  ? 23.960 -14.788 -2.087 1.00 23.52 ? 29  LEU A HD22 5  
ATOM 8911  H HD23 . LEU A 1 29  ? 23.676 -13.228 -1.314 1.00 43.02 ? 29  LEU A HD23 5  
ATOM 8912  N N    . PRO A 1 30  ? 20.220 -18.028 1.463  1.00 22.23 ? 30  PRO A N    5  
ATOM 8913  C CA   . PRO A 1 30  ? 20.433 -19.103 2.437  1.00 32.11 ? 30  PRO A CA   5  
ATOM 8914  C C    . PRO A 1 30  ? 21.190 -20.285 1.840  1.00 12.43 ? 30  PRO A C    5  
ATOM 8915  O O    . PRO A 1 30  ? 21.747 -21.109 2.566  1.00 34.25 ? 30  PRO A O    5  
ATOM 8916  C CB   . PRO A 1 30  ? 19.011 -19.519 2.823  1.00 50.23 ? 30  PRO A CB   5  
ATOM 8917  C CG   . PRO A 1 30  ? 18.174 -19.139 1.650  1.00 62.20 ? 30  PRO A CG   5  
ATOM 8918  C CD   . PRO A 1 30  ? 18.806 -17.902 1.074  1.00 72.34 ? 30  PRO A CD   5  
ATOM 8919  H HA   . PRO A 1 30  ? 20.956 -18.747 3.313  1.00 73.41 ? 30  PRO A HA   5  
ATOM 8920  H HB2  . PRO A 1 30  ? 18.981 -20.584 3.002  1.00 30.32 ? 30  PRO A HB2  5  
ATOM 8921  H HB3  . PRO A 1 30  ? 18.706 -18.989 3.713  1.00 61.32 ? 30  PRO A HB3  5  
ATOM 8922  H HG2  . PRO A 1 30  ? 18.179 -19.936 0.922  1.00 35.43 ? 30  PRO A HG2  5  
ATOM 8923  H HG3  . PRO A 1 30  ? 17.165 -18.929 1.972  1.00 1.23  ? 30  PRO A HG3  5  
ATOM 8924  H HD2  . PRO A 1 30  ? 18.701 -17.891 -0.001 1.00 64.02 ? 30  PRO A HD2  5  
ATOM 8925  H HD3  . PRO A 1 30  ? 18.365 -17.017 1.507  1.00 53.53 ? 30  PRO A HD3  5  
ATOM 8926  N N    . LEU A 1 31  ? 21.207 -20.361 0.514  1.00 23.02 ? 31  LEU A N    5  
ATOM 8927  C CA   . LEU A 1 31  ? 21.897 -21.442 -0.181 1.00 21.31 ? 31  LEU A CA   5  
ATOM 8928  C C    . LEU A 1 31  ? 23.360 -21.516 0.244  1.00 63.33 ? 31  LEU A C    5  
ATOM 8929  O O    . LEU A 1 31  ? 23.828 -22.552 0.715  1.00 64.55 ? 31  LEU A O    5  
ATOM 8930  C CB   . LEU A 1 31  ? 21.803 -21.244 -1.695 1.00 11.23 ? 31  LEU A CB   5  
ATOM 8931  C CG   . LEU A 1 31  ? 20.427 -20.853 -2.236 1.00 63.41 ? 31  LEU A CG   5  
ATOM 8932  C CD1  . LEU A 1 31  ? 20.440 -20.826 -3.757 1.00 2.24  ? 31  LEU A CD1  5  
ATOM 8933  C CD2  . LEU A 1 31  ? 19.362 -21.813 -1.727 1.00 72.33 ? 31  LEU A CD2  5  
ATOM 8934  H H    . LEU A 1 31  ? 20.746 -19.675 -0.011 1.00 12.32 ? 31  LEU A H    5  
ATOM 8935  H HA   . LEU A 1 31  ? 21.411 -22.369 0.083  1.00 33.45 ? 31  LEU A HA   5  
ATOM 8936  H HB2  . LEU A 1 31  ? 22.499 -20.467 -1.970 1.00 41.41 ? 31  LEU A HB2  5  
ATOM 8937  H HB3  . LEU A 1 31  ? 22.095 -22.171 -2.168 1.00 0.33  ? 31  LEU A HB3  5  
ATOM 8938  H HG   . LEU A 1 31  ? 20.178 -19.861 -1.887 1.00 45.40 ? 31  LEU A HG   5  
ATOM 8939  H HD11 . LEU A 1 31  ? 21.438 -20.606 -4.104 1.00 62.21 ? 31  LEU A HD11 5  
ATOM 8940  H HD12 . LEU A 1 31  ? 19.760 -20.064 -4.109 1.00 5.14  ? 31  LEU A HD12 5  
ATOM 8941  H HD13 . LEU A 1 31  ? 20.129 -21.788 -4.137 1.00 25.14 ? 31  LEU A HD13 5  
ATOM 8942  H HD21 . LEU A 1 31  ? 19.816 -22.766 -1.497 1.00 43.34 ? 31  LEU A HD21 5  
ATOM 8943  H HD22 . LEU A 1 31  ? 18.607 -21.949 -2.488 1.00 71.33 ? 31  LEU A HD22 5  
ATOM 8944  H HD23 . LEU A 1 31  ? 18.907 -21.407 -0.837 1.00 12.35 ? 31  LEU A HD23 5  
ATOM 8945  N N    . MET A 1 32  ? 24.077 -20.410 0.076  1.00 54.54 ? 32  MET A N    5  
ATOM 8946  C CA   . MET A 1 32  ? 25.486 -20.348 0.445  1.00 61.51 ? 32  MET A CA   5  
ATOM 8947  C C    . MET A 1 32  ? 25.651 -20.352 1.961  1.00 4.22  ? 32  MET A C    5  
ATOM 8948  O O    . MET A 1 32  ? 26.439 -21.125 2.507  1.00 13.21 ? 32  MET A O    5  
ATOM 8949  C CB   . MET A 1 32  ? 26.137 -19.097 -0.148 1.00 71.31 ? 32  MET A CB   5  
ATOM 8950  C CG   . MET A 1 32  ? 25.437 -17.805 0.241  1.00 32.52 ? 32  MET A CG   5  
ATOM 8951  S SD   . MET A 1 32  ? 25.893 -16.421 -0.820 1.00 73.23 ? 32  MET A SD   5  
ATOM 8952  C CE   . MET A 1 32  ? 25.404 -15.035 0.203  1.00 50.42 ? 32  MET A CE   5  
ATOM 8953  H H    . MET A 1 32  ? 23.648 -19.615 -0.305 1.00 13.41 ? 32  MET A H    5  
ATOM 8954  H HA   . MET A 1 32  ? 25.973 -21.223 0.039  1.00 14.25 ? 32  MET A HA   5  
ATOM 8955  H HB2  . MET A 1 32  ? 27.161 -19.043 0.191  1.00 35.22 ? 32  MET A HB2  5  
ATOM 8956  H HB3  . MET A 1 32  ? 26.127 -19.176 -1.225 1.00 74.10 ? 32  MET A HB3  5  
ATOM 8957  H HG2  . MET A 1 32  ? 24.370 -17.955 0.174  1.00 75.20 ? 32  MET A HG2  5  
ATOM 8958  H HG3  . MET A 1 32  ? 25.700 -17.563 1.260  1.00 5.30  ? 32  MET A HG3  5  
ATOM 8959  H HE1  . MET A 1 32  ? 25.311 -14.150 -0.410 1.00 33.22 ? 32  MET A HE1  5  
ATOM 8960  H HE2  . MET A 1 32  ? 24.455 -15.250 0.671  1.00 21.21 ? 32  MET A HE2  5  
ATOM 8961  H HE3  . MET A 1 32  ? 26.152 -14.868 0.964  1.00 24.11 ? 32  MET A HE3  5  
ATOM 8962  N N    . TRP A 1 33  ? 24.906 -19.484 2.635  1.00 55.32 ? 33  TRP A N    5  
ATOM 8963  C CA   . TRP A 1 33  ? 24.971 -19.387 4.089  1.00 75.13 ? 33  TRP A CA   5  
ATOM 8964  C C    . TRP A 1 33  ? 23.713 -18.731 4.647  1.00 11.44 ? 33  TRP A C    5  
ATOM 8965  O O    . TRP A 1 33  ? 22.997 -18.033 3.931  1.00 54.52 ? 33  TRP A O    5  
ATOM 8966  C CB   . TRP A 1 33  ? 26.207 -18.593 4.513  1.00 52.42 ? 33  TRP A CB   5  
ATOM 8967  C CG   . TRP A 1 33  ? 27.497 -19.279 4.179  1.00 10.42 ? 33  TRP A CG   5  
ATOM 8968  C CD1  . TRP A 1 33  ? 28.299 -19.036 3.101  1.00 61.23 ? 33  TRP A CD1  5  
ATOM 8969  C CD2  . TRP A 1 33  ? 28.132 -20.321 4.928  1.00 1.50  ? 33  TRP A CD2  5  
ATOM 8970  N NE1  . TRP A 1 33  ? 29.395 -19.865 3.134  1.00 13.21 ? 33  TRP A NE1  5  
ATOM 8971  C CE2  . TRP A 1 33  ? 29.316 -20.662 4.246  1.00 43.45 ? 33  TRP A CE2  5  
ATOM 8972  C CE3  . TRP A 1 33  ? 27.817 -20.997 6.109  1.00 22.05 ? 33  TRP A CE3  5  
ATOM 8973  C CZ2  . TRP A 1 33  ? 30.182 -21.650 4.706  1.00 4.43  ? 33  TRP A CZ2  5  
ATOM 8974  C CZ3  . TRP A 1 33  ? 28.678 -21.978 6.565  1.00 14.53 ? 33  TRP A CZ3  5  
ATOM 8975  C CH2  . TRP A 1 33  ? 29.849 -22.296 5.866  1.00 42.15 ? 33  TRP A CH2  5  
ATOM 8976  H H    . TRP A 1 33  ? 24.296 -18.893 2.143  1.00 24.52 ? 33  TRP A H    5  
ATOM 8977  H HA   . TRP A 1 33  ? 25.045 -20.390 4.484  1.00 41.44 ? 33  TRP A HA   5  
ATOM 8978  H HB2  . TRP A 1 33  ? 26.200 -17.635 4.015  1.00 41.25 ? 33  TRP A HB2  5  
ATOM 8979  H HB3  . TRP A 1 33  ? 26.177 -18.438 5.582  1.00 61.52 ? 33  TRP A HB3  5  
ATOM 8980  H HD1  . TRP A 1 33  ? 28.089 -18.300 2.340  1.00 2.33  ? 33  TRP A HD1  5  
ATOM 8981  H HE1  . TRP A 1 33  ? 30.116 -19.881 2.470  1.00 10.22 ? 33  TRP A HE1  5  
ATOM 8982  H HE3  . TRP A 1 33  ? 26.919 -20.766 6.663  1.00 50.11 ? 33  TRP A HE3  5  
ATOM 8983  H HZ2  . TRP A 1 33  ? 31.089 -21.906 4.179  1.00 65.04 ? 33  TRP A HZ2  5  
ATOM 8984  H HZ3  . TRP A 1 33  ? 28.450 -22.511 7.476  1.00 24.53 ? 33  TRP A HZ3  5  
ATOM 8985  H HH2  . TRP A 1 33  ? 30.492 -23.069 6.258  1.00 13.32 ? 33  TRP A HH2  5  
ATOM 8986  N N    . GLU A 1 34  ? 23.451 -18.959 5.931  1.00 61.34 ? 34  GLU A N    5  
ATOM 8987  C CA   . GLU A 1 34  ? 22.278 -18.389 6.584  1.00 65.34 ? 34  GLU A CA   5  
ATOM 8988  C C    . GLU A 1 34  ? 22.423 -18.440 8.102  1.00 74.51 ? 34  GLU A C    5  
ATOM 8989  O O    . GLU A 1 34  ? 23.122 -19.298 8.642  1.00 74.32 ? 34  GLU A O    5  
ATOM 8990  C CB   . GLU A 1 34  ? 21.014 -19.137 6.155  1.00 64.32 ? 34  GLU A CB   5  
ATOM 8991  C CG   . GLU A 1 34  ? 19.755 -18.290 6.217  1.00 11.32 ? 34  GLU A CG   5  
ATOM 8992  C CD   . GLU A 1 34  ? 18.565 -19.053 6.765  1.00 13.12 ? 34  GLU A CD   5  
ATOM 8993  O OE1  . GLU A 1 34  ? 18.272 -18.910 7.971  1.00 74.34 ? 34  GLU A OE1  5  
ATOM 8994  O OE2  . GLU A 1 34  ? 17.926 -19.793 5.988  1.00 41.24 ? 34  GLU A OE2  5  
ATOM 8995  H H    . GLU A 1 34  ? 24.060 -19.525 6.450  1.00 42.33 ? 34  GLU A H    5  
ATOM 8996  H HA   . GLU A 1 34  ? 22.197 -17.358 6.277  1.00 55.35 ? 34  GLU A HA   5  
ATOM 8997  H HB2  . GLU A 1 34  ? 21.142 -19.483 5.139  1.00 12.44 ? 34  GLU A HB2  5  
ATOM 8998  H HB3  . GLU A 1 34  ? 20.880 -19.992 6.801  1.00 1.15  ? 34  GLU A HB3  5  
ATOM 8999  H HG2  . GLU A 1 34  ? 19.941 -17.438 6.854  1.00 13.11 ? 34  GLU A HG2  5  
ATOM 9000  H HG3  . GLU A 1 34  ? 19.517 -17.948 5.221  1.00 52.52 ? 34  GLU A HG3  5  
ATOM 9001  N N    . PHE A 1 35  ? 21.757 -17.515 8.785  1.00 33.30 ? 35  PHE A N    5  
ATOM 9002  C CA   . PHE A 1 35  ? 21.811 -17.453 10.241 1.00 42.01 ? 35  PHE A CA   5  
ATOM 9003  C C    . PHE A 1 35  ? 20.532 -18.013 10.857 1.00 4.54  ? 35  PHE A C    5  
ATOM 9004  O O    . PHE A 1 35  ? 19.495 -18.124 10.204 1.00 41.13 ? 35  PHE A O    5  
ATOM 9005  C CB   . PHE A 1 35  ? 22.025 -16.010 10.703 1.00 33.12 ? 35  PHE A CB   5  
ATOM 9006  C CG   . PHE A 1 35  ? 23.472 -15.635 10.849 1.00 32.45 ? 35  PHE A CG   5  
ATOM 9007  C CD1  . PHE A 1 35  ? 23.956 -14.461 10.296 1.00 23.12 ? 35  PHE A CD1  5  
ATOM 9008  C CD2  . PHE A 1 35  ? 24.347 -16.457 11.541 1.00 64.14 ? 35  PHE A CD2  5  
ATOM 9009  C CE1  . PHE A 1 35  ? 25.288 -14.114 10.429 1.00 74.52 ? 35  PHE A CE1  5  
ATOM 9010  C CE2  . PHE A 1 35  ? 25.680 -16.115 11.677 1.00 72.52 ? 35  PHE A CE2  5  
ATOM 9011  C CZ   . PHE A 1 35  ? 26.150 -14.942 11.121 1.00 42.01 ? 35  PHE A CZ   5  
ATOM 9012  H H    . PHE A 1 35  ? 21.216 -16.858 8.298  1.00 62.20 ? 35  PHE A H    5  
ATOM 9013  H HA   . PHE A 1 35  ? 22.646 -18.054 10.567 1.00 43.45 ? 35  PHE A HA   5  
ATOM 9014  H HB2  . PHE A 1 35  ? 21.580 -15.340 9.983  1.00 1.54  ? 35  PHE A HB2  5  
ATOM 9015  H HB3  . PHE A 1 35  ? 21.546 -15.872 11.661 1.00 22.30 ? 35  PHE A HB3  5  
ATOM 9016  H HD1  . PHE A 1 35  ? 23.283 -13.812 9.756  1.00 71.34 ? 35  PHE A HD1  5  
ATOM 9017  H HD2  . PHE A 1 35  ? 23.980 -17.376 11.976 1.00 1.24  ? 35  PHE A HD2  5  
ATOM 9018  H HE1  . PHE A 1 35  ? 25.653 -13.196 9.993  1.00 31.34 ? 35  PHE A HE1  5  
ATOM 9019  H HE2  . PHE A 1 35  ? 26.351 -16.765 12.219 1.00 42.13 ? 35  PHE A HE2  5  
ATOM 9020  H HZ   . PHE A 1 35  ? 27.191 -14.673 11.226 1.00 73.55 ? 35  PHE A HZ   5  
ATOM 9021  N N    . PRO A 1 36  ? 20.607 -18.374 12.147 1.00 70.11 ? 36  PRO A N    5  
ATOM 9022  C CA   . PRO A 1 36  ? 19.465 -18.928 12.881 1.00 64.31 ? 36  PRO A CA   5  
ATOM 9023  C C    . PRO A 1 36  ? 18.379 -17.889 13.134 1.00 51.23 ? 36  PRO A C    5  
ATOM 9024  O O    . PRO A 1 36  ? 18.660 -16.696 13.242 1.00 24.14 ? 36  PRO A O    5  
ATOM 9025  C CB   . PRO A 1 36  ? 20.084 -19.388 14.204 1.00 74.24 ? 36  PRO A CB   5  
ATOM 9026  C CG   . PRO A 1 36  ? 21.292 -18.534 14.374 1.00 2.11  ? 36  PRO A CG   5  
ATOM 9027  C CD   . PRO A 1 36  ? 21.811 -18.269 12.988 1.00 62.32 ? 36  PRO A CD   5  
ATOM 9028  H HA   . PRO A 1 36  ? 19.038 -19.777 12.367 1.00 13.12 ? 36  PRO A HA   5  
ATOM 9029  H HB2  . PRO A 1 36  ? 19.376 -19.237 15.006 1.00 34.34 ? 36  PRO A HB2  5  
ATOM 9030  H HB3  . PRO A 1 36  ? 20.345 -20.434 14.139 1.00 44.54 ? 36  PRO A HB3  5  
ATOM 9031  H HG2  . PRO A 1 36  ? 21.022 -17.607 14.857 1.00 74.15 ? 36  PRO A HG2  5  
ATOM 9032  H HG3  . PRO A 1 36  ? 22.034 -19.060 14.957 1.00 14.34 ? 36  PRO A HG3  5  
ATOM 9033  H HD2  . PRO A 1 36  ? 22.239 -17.279 12.928 1.00 73.45 ? 36  PRO A HD2  5  
ATOM 9034  H HD3  . PRO A 1 36  ? 22.541 -19.015 12.709 1.00 21.25 ? 36  PRO A HD3  5  
ATOM 9035  N N    . GLY A 1 37  ? 17.135 -18.350 13.227 1.00 41.33 ? 37  GLY A N    5  
ATOM 9036  C CA   . GLY A 1 37  ? 16.025 -17.446 13.466 1.00 21.25 ? 37  GLY A CA   5  
ATOM 9037  C C    . GLY A 1 37  ? 14.882 -17.661 12.494 1.00 3.11  ? 37  GLY A C    5  
ATOM 9038  O O    . GLY A 1 37  ? 14.507 -18.797 12.207 1.00 2.11  ? 37  GLY A O    5  
ATOM 9039  H H    . GLY A 1 37  ? 16.970 -19.311 13.132 1.00 70.23 ? 37  GLY A H    5  
ATOM 9040  H HA2  . GLY A 1 37  ? 15.662 -17.598 14.472 1.00 61.21 ? 37  GLY A HA2  5  
ATOM 9041  H HA3  . GLY A 1 37  ? 16.377 -16.429 13.371 1.00 32.24 ? 37  GLY A HA3  5  
ATOM 9042  N N    . GLY A 1 38  ? 14.325 -16.565 11.986 1.00 23.43 ? 38  GLY A N    5  
ATOM 9043  C CA   . GLY A 1 38  ? 13.223 -16.661 11.048 1.00 53.25 ? 38  GLY A CA   5  
ATOM 9044  C C    . GLY A 1 38  ? 12.636 -15.306 10.703 1.00 35.44 ? 38  GLY A C    5  
ATOM 9045  O O    . GLY A 1 38  ? 13.334 -14.428 10.197 1.00 64.42 ? 38  GLY A O    5  
ATOM 9046  H H    . GLY A 1 38  ? 14.666 -15.685 12.251 1.00 31.44 ? 38  GLY A H    5  
ATOM 9047  H HA2  . GLY A 1 38  ? 13.576 -17.130 10.141 1.00 15.41 ? 38  GLY A HA2  5  
ATOM 9048  H HA3  . GLY A 1 38  ? 12.448 -17.276 11.481 1.00 21.22 ? 38  GLY A HA3  5  
ATOM 9049  N N    . LYS A 1 39  ? 11.347 -15.135 10.977 1.00 34.31 ? 39  LYS A N    5  
ATOM 9050  C CA   . LYS A 1 39  ? 10.664 -13.879 10.693 1.00 11.43 ? 39  LYS A CA   5  
ATOM 9051  C C    . LYS A 1 39  ? 10.198 -13.209 11.982 1.00 23.24 ? 39  LYS A C    5  
ATOM 9052  O O    . LYS A 1 39  ? 10.335 -13.770 13.070 1.00 62.24 ? 39  LYS A O    5  
ATOM 9053  C CB   . LYS A 1 39  ? 9.467  -14.122 9.771  1.00 10.52 ? 39  LYS A CB   5  
ATOM 9054  C CG   . LYS A 1 39  ? 8.285  -14.773 10.468 1.00 70.23 ? 39  LYS A CG   5  
ATOM 9055  C CD   . LYS A 1 39  ? 7.224  -15.212 9.472  1.00 20.25 ? 39  LYS A CD   5  
ATOM 9056  C CE   . LYS A 1 39  ? 6.073  -15.927 10.164 1.00 52.42 ? 39  LYS A CE   5  
ATOM 9057  N NZ   . LYS A 1 39  ? 5.304  -15.010 11.050 1.00 33.14 ? 39  LYS A NZ   5  
ATOM 9058  H H    . LYS A 1 39  ? 10.842 -15.873 11.381 1.00 10.21 ? 39  LYS A H    5  
ATOM 9059  H HA   . LYS A 1 39  ? 11.364 -13.226 10.195 1.00 4.54  ? 39  LYS A HA   5  
ATOM 9060  H HB2  . LYS A 1 39  ? 9.142  -13.175 9.366  1.00 41.42 ? 39  LYS A HB2  5  
ATOM 9061  H HB3  . LYS A 1 39  ? 9.778  -14.763 8.959  1.00 31.22 ? 39  LYS A HB3  5  
ATOM 9062  H HG2  . LYS A 1 39  ? 8.632  -15.639 11.013 1.00 50.45 ? 39  LYS A HG2  5  
ATOM 9063  H HG3  . LYS A 1 39  ? 7.848  -14.063 11.156 1.00 64.41 ? 39  LYS A HG3  5  
ATOM 9064  H HD2  . LYS A 1 39  ? 6.838  -14.342 8.963  1.00 43.21 ? 39  LYS A HD2  5  
ATOM 9065  H HD3  . LYS A 1 39  ? 7.673  -15.883 8.754  1.00 71.15 ? 39  LYS A HD3  5  
ATOM 9066  H HE2  . LYS A 1 39  ? 5.410  -16.326 9.411  1.00 2.34  ? 39  LYS A HE2  5  
ATOM 9067  H HE3  . LYS A 1 39  ? 6.473  -16.736 10.757 1.00 50.23 ? 39  LYS A HE3  5  
ATOM 9068  H HZ1  . LYS A 1 39  ? 5.952  -14.499 11.684 1.00 74.40 ? 39  LYS A HZ1  5  
ATOM 9069  H HZ2  . LYS A 1 39  ? 4.630  -15.553 11.627 1.00 53.10 ? 39  LYS A HZ2  5  
ATOM 9070  H HZ3  . LYS A 1 39  ? 4.777  -14.319 10.480 1.00 42.35 ? 39  LYS A HZ3  5  
ATOM 9071  N N    . VAL A 1 40  ? 9.646  -12.007 11.854 1.00 41.24 ? 40  VAL A N    5  
ATOM 9072  C CA   . VAL A 1 40  ? 9.158  -11.262 13.008 1.00 33.20 ? 40  VAL A CA   5  
ATOM 9073  C C    . VAL A 1 40  ? 7.730  -10.778 12.785 1.00 15.43 ? 40  VAL A C    5  
ATOM 9074  O O    . VAL A 1 40  ? 7.346  -10.439 11.666 1.00 64.41 ? 40  VAL A O    5  
ATOM 9075  C CB   . VAL A 1 40  ? 10.057 -10.050 13.316 1.00 63.41 ? 40  VAL A CB   5  
ATOM 9076  C CG1  . VAL A 1 40  ? 9.573  -9.329  14.564 1.00 32.03 ? 40  VAL A CG1  5  
ATOM 9077  C CG2  . VAL A 1 40  ? 11.506 -10.489 13.471 1.00 13.45 ? 40  VAL A CG2  5  
ATOM 9078  H H    . VAL A 1 40  ? 9.565  -11.612 10.961 1.00 54.44 ? 40  VAL A H    5  
ATOM 9079  H HA   . VAL A 1 40  ? 9.174  -11.923 13.863 1.00 43.32 ? 40  VAL A HA   5  
ATOM 9080  H HB   . VAL A 1 40  ? 9.998  -9.364  12.484 1.00 3.54  ? 40  VAL A HB   5  
ATOM 9081  H HG11 . VAL A 1 40  ? 8.893  -8.539  14.282 1.00 52.32 ? 40  VAL A HG11 5  
ATOM 9082  H HG12 . VAL A 1 40  ? 9.064  -10.029 15.211 1.00 65.32 ? 40  VAL A HG12 5  
ATOM 9083  H HG13 . VAL A 1 40  ? 10.419 -8.906  15.086 1.00 55.51 ? 40  VAL A HG13 5  
ATOM 9084  H HG21 . VAL A 1 40  ? 11.555 -11.567 13.483 1.00 65.15 ? 40  VAL A HG21 5  
ATOM 9085  H HG22 . VAL A 1 40  ? 12.088 -10.110 12.644 1.00 72.14 ? 40  VAL A HG22 5  
ATOM 9086  H HG23 . VAL A 1 40  ? 11.902 -10.100 14.397 1.00 4.33  ? 40  VAL A HG23 5  
ATOM 9087  N N    . GLU A 1 41  ? 6.947  -10.746 13.859 1.00 33.32 ? 41  GLU A N    5  
ATOM 9088  C CA   . GLU A 1 41  ? 5.560  -10.303 13.780 1.00 12.11 ? 41  GLU A CA   5  
ATOM 9089  C C    . GLU A 1 41  ? 5.481  -8.828  13.396 1.00 62.23 ? 41  GLU A C    5  
ATOM 9090  O O    . GLU A 1 41  ? 6.285  -8.013  13.848 1.00 43.10 ? 41  GLU A O    5  
ATOM 9091  C CB   . GLU A 1 41  ? 4.851  -10.531 15.117 1.00 70.33 ? 41  GLU A CB   5  
ATOM 9092  C CG   . GLU A 1 41  ? 3.776  -11.603 15.060 1.00 33.40 ? 41  GLU A CG   5  
ATOM 9093  C CD   . GLU A 1 41  ? 2.742  -11.452 16.159 1.00 2.22  ? 41  GLU A CD   5  
ATOM 9094  O OE1  . GLU A 1 41  ? 2.136  -12.472 16.548 1.00 63.52 ? 41  GLU A OE1  5  
ATOM 9095  O OE2  . GLU A 1 41  ? 2.539  -10.313 16.630 1.00 20.55 ? 41  GLU A OE2  5  
ATOM 9096  H H    . GLU A 1 41  ? 7.310  -11.028 14.724 1.00 30.45 ? 41  GLU A H    5  
ATOM 9097  H HA   . GLU A 1 41  ? 5.068  -10.888 13.018 1.00 54.32 ? 41  GLU A HA   5  
ATOM 9098  H HB2  . GLU A 1 41  ? 5.584  -10.824 15.854 1.00 40.20 ? 41  GLU A HB2  5  
ATOM 9099  H HB3  . GLU A 1 41  ? 4.390  -9.606  15.428 1.00 2.54  ? 41  GLU A HB3  5  
ATOM 9100  H HG2  . GLU A 1 41  ? 3.275  -11.543 14.106 1.00 52.25 ? 41  GLU A HG2  5  
ATOM 9101  H HG3  . GLU A 1 41  ? 4.245  -12.571 15.158 1.00 31.31 ? 41  GLU A HG3  5  
ATOM 9102  N N    . LYS A 1 42  ? 4.507  -8.493  12.557 1.00 13.42 ? 42  LYS A N    5  
ATOM 9103  C CA   . LYS A 1 42  ? 4.320  -7.117  12.111 1.00 65.01 ? 42  LYS A CA   5  
ATOM 9104  C C    . LYS A 1 42  ? 4.214  -6.169  13.301 1.00 54.32 ? 42  LYS A C    5  
ATOM 9105  O O    . LYS A 1 42  ? 4.668  -5.027  13.239 1.00 35.00 ? 42  LYS A O    5  
ATOM 9106  C CB   . LYS A 1 42  ? 3.065  -7.006  11.243 1.00 61.33 ? 42  LYS A CB   5  
ATOM 9107  C CG   . LYS A 1 42  ? 1.838  -7.654  11.862 1.00 44.33 ? 42  LYS A CG   5  
ATOM 9108  C CD   . LYS A 1 42  ? 1.452  -8.929  11.131 1.00 4.12  ? 42  LYS A CD   5  
ATOM 9109  C CE   . LYS A 1 42  ? -0.052 -9.151  11.155 1.00 31.33 ? 42  LYS A CE   5  
ATOM 9110  N NZ   . LYS A 1 42  ? -0.685 -8.806  9.852  1.00 23.21 ? 42  LYS A NZ   5  
ATOM 9111  H H    . LYS A 1 42  ? 3.897  -9.188  12.231 1.00 53.31 ? 42  LYS A H    5  
ATOM 9112  H HA   . LYS A 1 42  ? 5.181  -6.840  11.521 1.00 22.13 ? 42  LYS A HA   5  
ATOM 9113  H HB2  . LYS A 1 42  ? 2.849  -5.962  11.075 1.00 42.53 ? 42  LYS A HB2  5  
ATOM 9114  H HB3  . LYS A 1 42  ? 3.257  -7.483  10.292 1.00 55.21 ? 42  LYS A HB3  5  
ATOM 9115  H HG2  . LYS A 1 42  ? 2.050  -7.893  12.893 1.00 3.32  ? 42  LYS A HG2  5  
ATOM 9116  H HG3  . LYS A 1 42  ? 1.013  -6.958  11.814 1.00 53.14 ? 42  LYS A HG3  5  
ATOM 9117  H HD2  . LYS A 1 42  ? 1.778  -8.858  10.104 1.00 12.00 ? 42  LYS A HD2  5  
ATOM 9118  H HD3  . LYS A 1 42  ? 1.939  -9.768  11.608 1.00 43.00 ? 42  LYS A HD3  5  
ATOM 9119  H HE2  . LYS A 1 42  ? -0.246 -10.190 11.376 1.00 42.22 ? 42  LYS A HE2  5  
ATOM 9120  H HE3  . LYS A 1 42  ? -0.482 -8.533  11.929 1.00 3.25  ? 42  LYS A HE3  5  
ATOM 9121  H HZ1  . LYS A 1 42  ? -0.044 -9.049  9.069  1.00 13.41 ? 42  LYS A HZ1  5  
ATOM 9122  H HZ2  . LYS A 1 42  ? -0.891 -7.788  9.813  1.00 4.35  ? 42  LYS A HZ2  5  
ATOM 9123  H HZ3  . LYS A 1 42  ? -1.573 -9.333  9.735  1.00 33.52 ? 42  LYS A HZ3  5  
ATOM 9124  N N    . ASN A 1 43  ? 3.612  -6.651  14.384 1.00 52.55 ? 43  ASN A N    5  
ATOM 9125  C CA   . ASN A 1 43  ? 3.447  -5.845  15.588 1.00 33.33 ? 43  ASN A CA   5  
ATOM 9126  C C    . ASN A 1 43  ? 4.422  -6.287  16.675 1.00 11.54 ? 43  ASN A C    5  
ATOM 9127  O O    . ASN A 1 43  ? 4.085  -6.294  17.859 1.00 72.02 ? 43  ASN A O    5  
ATOM 9128  C CB   . ASN A 1 43  ? 2.010  -5.950  16.103 1.00 12.35 ? 43  ASN A CB   5  
ATOM 9129  C CG   . ASN A 1 43  ? 1.018  -5.248  15.196 1.00 73.53 ? 43  ASN A CG   5  
ATOM 9130  O OD1  . ASN A 1 43  ? 1.364  -4.295  14.498 1.00 62.43 ? 43  ASN A OD1  5  
ATOM 9131  N ND2  . ASN A 1 43  ? -0.224 -5.719  15.202 1.00 52.42 ? 43  ASN A ND2  5  
ATOM 9132  H H    . ASN A 1 43  ? 3.270  -7.569  14.372 1.00 24.03 ? 43  ASN A H    5  
ATOM 9133  H HA   . ASN A 1 43  ? 3.654  -4.818  15.331 1.00 55.52 ? 43  ASN A HA   5  
ATOM 9134  H HB2  . ASN A 1 43  ? 1.733  -6.992  16.170 1.00 14.33 ? 43  ASN A HB2  5  
ATOM 9135  H HB3  . ASN A 1 43  ? 1.952  -5.502  17.084 1.00 35.22 ? 43  ASN A HB3  5  
ATOM 9136  H HD21 . ASN A 1 43  ? -0.428 -6.481  15.783 1.00 13.34 ? 43  ASN A HD21 5  
ATOM 9137  H HD22 . ASN A 1 43  ? -0.886 -5.284  14.624 1.00 62.32 ? 43  ASN A HD22 5  
ATOM 9138  N N    . GLU A 1 44  ? 5.632  -6.653  16.264 1.00 11.23 ? 44  GLU A N    5  
ATOM 9139  C CA   . GLU A 1 44  ? 6.656  -7.095  17.204 1.00 74.43 ? 44  GLU A CA   5  
ATOM 9140  C C    . GLU A 1 44  ? 8.033  -6.587  16.787 1.00 13.22 ? 44  GLU A C    5  
ATOM 9141  O O    . GLU A 1 44  ? 8.404  -6.654  15.615 1.00 25.30 ? 44  GLU A O    5  
ATOM 9142  C CB   . GLU A 1 44  ? 6.670  -8.623  17.294 1.00 11.35 ? 44  GLU A CB   5  
ATOM 9143  C CG   . GLU A 1 44  ? 7.066  -9.147  18.664 1.00 20.44 ? 44  GLU A CG   5  
ATOM 9144  C CD   . GLU A 1 44  ? 6.293  -10.391 19.059 1.00 62.04 ? 44  GLU A CD   5  
ATOM 9145  O OE1  . GLU A 1 44  ? 5.517  -10.323 20.034 1.00 34.30 ? 44  GLU A OE1  5  
ATOM 9146  O OE2  . GLU A 1 44  ? 6.465  -11.432 18.391 1.00 63.32 ? 44  GLU A OE2  5  
ATOM 9147  H H    . GLU A 1 44  ? 5.841  -6.625  15.307 1.00 33.23 ? 44  GLU A H    5  
ATOM 9148  H HA   . GLU A 1 44  ? 6.413  -6.689  18.174 1.00 44.21 ? 44  GLU A HA   5  
ATOM 9149  H HB2  . GLU A 1 44  ? 5.683  -8.995  17.060 1.00 3.44  ? 44  GLU A HB2  5  
ATOM 9150  H HB3  . GLU A 1 44  ? 7.371  -9.007  16.569 1.00 60.54 ? 44  GLU A HB3  5  
ATOM 9151  H HG2  . GLU A 1 44  ? 8.119  -9.385  18.654 1.00 21.11 ? 44  GLU A HG2  5  
ATOM 9152  H HG3  . GLU A 1 44  ? 6.879  -8.377  19.398 1.00 23.45 ? 44  GLU A HG3  5  
ATOM 9153  N N    . THR A 1 45  ? 8.787  -6.076  17.756 1.00 34.40 ? 45  THR A N    5  
ATOM 9154  C CA   . THR A 1 45  ? 10.121 -5.554  17.491 1.00 24.52 ? 45  THR A CA   5  
ATOM 9155  C C    . THR A 1 45  ? 11.104 -6.682  17.197 1.00 2.11  ? 45  THR A C    5  
ATOM 9156  O O    . THR A 1 45  ? 10.863 -7.835  17.551 1.00 74.54 ? 45  THR A O    5  
ATOM 9157  C CB   . THR A 1 45  ? 10.647 -4.727  18.680 1.00 61.44 ? 45  THR A CB   5  
ATOM 9158  O OG1  . THR A 1 45  ? 9.553  -4.120  19.376 1.00 21.52 ? 45  THR A OG1  5  
ATOM 9159  C CG2  . THR A 1 45  ? 11.612 -3.652  18.205 1.00 3.43  ? 45  THR A CG2  5  
ATOM 9160  H H    . THR A 1 45  ? 8.435  -6.050  18.670 1.00 31.22 ? 45  THR A H    5  
ATOM 9161  H HA   . THR A 1 45  ? 10.061 -4.908  16.628 1.00 44.40 ? 45  THR A HA   5  
ATOM 9162  H HB   . THR A 1 45  ? 11.172 -5.389  19.355 1.00 54.43 ? 45  THR A HB   5  
ATOM 9163  H HG1  . THR A 1 45  ? 9.891  -3.577  20.092 1.00 24.01 ? 45  THR A HG1  5  
ATOM 9164  H HG21 . THR A 1 45  ? 12.588 -4.087  18.048 1.00 70.12 ? 45  THR A HG21 5  
ATOM 9165  H HG22 . THR A 1 45  ? 11.681 -2.875  18.952 1.00 12.22 ? 45  THR A HG22 5  
ATOM 9166  H HG23 . THR A 1 45  ? 11.253 -3.230  17.279 1.00 42.42 ? 45  THR A HG23 5  
ATOM 9167  N N    . GLU A 1 46  ? 12.213 -6.340  16.549 1.00 62.03 ? 46  GLU A N    5  
ATOM 9168  C CA   . GLU A 1 46  ? 13.232 -7.325  16.207 1.00 24.55 ? 46  GLU A CA   5  
ATOM 9169  C C    . GLU A 1 46  ? 13.725 -8.053  17.455 1.00 2.12  ? 46  GLU A C    5  
ATOM 9170  O O    . GLU A 1 46  ? 13.633 -9.277  17.552 1.00 52.23 ? 46  GLU A O    5  
ATOM 9171  C CB   . GLU A 1 46  ? 14.409 -6.651  15.499 1.00 10.21 ? 46  GLU A CB   5  
ATOM 9172  C CG   . GLU A 1 46  ? 14.218 -6.513  13.998 1.00 15.41 ? 46  GLU A CG   5  
ATOM 9173  C CD   . GLU A 1 46  ? 12.821 -6.053  13.628 1.00 13.10 ? 46  GLU A CD   5  
ATOM 9174  O OE1  . GLU A 1 46  ? 12.600 -4.826  13.551 1.00 61.44 ? 46  GLU A OE1  5  
ATOM 9175  O OE2  . GLU A 1 46  ? 11.948 -6.921  13.416 1.00 41.25 ? 46  GLU A OE2  5  
ATOM 9176  H H    . GLU A 1 46  ? 12.349 -5.404  16.293 1.00 12.35 ? 46  GLU A H    5  
ATOM 9177  H HA   . GLU A 1 46  ? 12.787 -8.046  15.538 1.00 14.43 ? 46  GLU A HA   5  
ATOM 9178  H HB2  . GLU A 1 46  ? 14.547 -5.664  15.916 1.00 22.24 ? 46  GLU A HB2  5  
ATOM 9179  H HB3  . GLU A 1 46  ? 15.301 -7.234  15.675 1.00 50.14 ? 46  GLU A HB3  5  
ATOM 9180  H HG2  . GLU A 1 46  ? 14.928 -5.792  13.622 1.00 2.22  ? 46  GLU A HG2  5  
ATOM 9181  H HG3  . GLU A 1 46  ? 14.400 -7.471  13.535 1.00 33.20 ? 46  GLU A HG3  5  
ATOM 9182  N N    . LYS A 1 47  ? 14.250 -7.291  18.409 1.00 52.33 ? 47  LYS A N    5  
ATOM 9183  C CA   . LYS A 1 47  ? 14.757 -7.860  19.651 1.00 2.04  ? 47  LYS A CA   5  
ATOM 9184  C C    . LYS A 1 47  ? 13.638 -8.537  20.436 1.00 24.24 ? 47  LYS A C    5  
ATOM 9185  O O    . LYS A 1 47  ? 13.760 -9.696  20.834 1.00 11.25 ? 47  LYS A O    5  
ATOM 9186  C CB   . LYS A 1 47  ? 15.408 -6.771  20.507 1.00 1.21  ? 47  LYS A CB   5  
ATOM 9187  C CG   . LYS A 1 47  ? 16.926 -6.807  20.486 1.00 24.24 ? 47  LYS A CG   5  
ATOM 9188  C CD   . LYS A 1 47  ? 17.480 -7.620  21.644 1.00 24.52 ? 47  LYS A CD   5  
ATOM 9189  C CE   . LYS A 1 47  ? 17.330 -9.114  21.398 1.00 4.04  ? 47  LYS A CE   5  
ATOM 9190  N NZ   . LYS A 1 47  ? 16.226 -9.701  22.207 1.00 24.03 ? 47  LYS A NZ   5  
ATOM 9191  H H    . LYS A 1 47  ? 14.296 -6.320  18.274 1.00 60.55 ? 47  LYS A H    5  
ATOM 9192  H HA   . LYS A 1 47  ? 15.502 -8.600  19.398 1.00 55.50 ? 47  LYS A HA   5  
ATOM 9193  H HB2  . LYS A 1 47  ? 15.087 -5.805  20.145 1.00 72.31 ? 47  LYS A HB2  5  
ATOM 9194  H HB3  . LYS A 1 47  ? 15.080 -6.889  21.530 1.00 70.42 ? 47  LYS A HB3  5  
ATOM 9195  H HG2  . LYS A 1 47  ? 17.254 -7.252  19.559 1.00 63.12 ? 47  LYS A HG2  5  
ATOM 9196  H HG3  . LYS A 1 47  ? 17.302 -5.796  20.556 1.00 65.31 ? 47  LYS A HG3  5  
ATOM 9197  H HD2  . LYS A 1 47  ? 18.529 -7.391  21.765 1.00 14.23 ? 47  LYS A HD2  5  
ATOM 9198  H HD3  . LYS A 1 47  ? 16.946 -7.357  22.546 1.00 32.20 ? 47  LYS A HD3  5  
ATOM 9199  H HE2  . LYS A 1 47  ? 17.123 -9.274  20.352 1.00 75.23 ? 47  LYS A HE2  5  
ATOM 9200  H HE3  . LYS A 1 47  ? 18.257 -9.603  21.660 1.00 31.34 ? 47  LYS A HE3  5  
ATOM 9201  H HZ1  . LYS A 1 47  ? 15.892 -9.010  22.909 1.00 31.23 ? 47  LYS A HZ1  5  
ATOM 9202  H HZ2  . LYS A 1 47  ? 16.561 -10.550 22.706 1.00 62.03 ? 47  LYS A HZ2  5  
ATOM 9203  H HZ3  . LYS A 1 47  ? 15.432 -9.965  21.590 1.00 1.22  ? 47  LYS A HZ3  5  
ATOM 9204  N N    . ASP A 1 48  ? 12.550 -7.808  20.654 1.00 14.12 ? 48  ASP A N    5  
ATOM 9205  C CA   . ASP A 1 48  ? 11.408 -8.339  21.389 1.00 32.44 ? 48  ASP A CA   5  
ATOM 9206  C C    . ASP A 1 48  ? 10.910 -9.636  20.758 1.00 43.35 ? 48  ASP A C    5  
ATOM 9207  O O    . ASP A 1 48  ? 10.308 -10.473 21.428 1.00 34.22 ? 48  ASP A O    5  
ATOM 9208  C CB   . ASP A 1 48  ? 10.277 -7.311  21.430 1.00 12.45 ? 48  ASP A CB   5  
ATOM 9209  C CG   . ASP A 1 48  ? 8.983  -7.894  21.964 1.00 51.44 ? 48  ASP A CG   5  
ATOM 9210  O OD1  . ASP A 1 48  ? 8.329  -8.661  21.226 1.00 2.01  ? 48  ASP A OD1  5  
ATOM 9211  O OD2  . ASP A 1 48  ? 8.624  -7.583  23.119 1.00 64.23 ? 48  ASP A OD2  5  
ATOM 9212  H H    . ASP A 1 48  ? 12.513 -6.890  20.312 1.00 74.24 ? 48  ASP A H    5  
ATOM 9213  H HA   . ASP A 1 48  ? 11.730 -8.546  22.399 1.00 64.44 ? 48  ASP A HA   5  
ATOM 9214  H HB2  . ASP A 1 48  ? 10.569 -6.489  22.068 1.00 2.12  ? 48  ASP A HB2  5  
ATOM 9215  H HB3  . ASP A 1 48  ? 10.100 -6.940  20.432 1.00 75.24 ? 48  ASP A HB3  5  
ATOM 9216  N N    . ALA A 1 49  ? 11.166 -9.793  19.463 1.00 60.11 ? 49  ALA A N    5  
ATOM 9217  C CA   . ALA A 1 49  ? 10.745 -10.987 18.741 1.00 61.32 ? 49  ALA A CA   5  
ATOM 9218  C C    . ALA A 1 49  ? 11.682 -12.157 19.021 1.00 23.20 ? 49  ALA A C    5  
ATOM 9219  O O    . ALA A 1 49  ? 11.256 -13.312 19.057 1.00 64.41 ? 49  ALA A O    5  
ATOM 9220  C CB   . ALA A 1 49  ? 10.681 -10.706 17.247 1.00 43.30 ? 49  ALA A CB   5  
ATOM 9221  H H    . ALA A 1 49  ? 11.651 -9.090  18.983 1.00 75.05 ? 49  ALA A H    5  
ATOM 9222  H HA   . ALA A 1 49  ? 9.751  -11.247 19.076 1.00 22.10 ? 49  ALA A HA   5  
ATOM 9223  H HB1  . ALA A 1 49  ? 9.974  -9.910  17.061 1.00 23.15 ? 49  ALA A HB1  5  
ATOM 9224  H HB2  . ALA A 1 49  ? 11.658 -10.409 16.895 1.00 70.53 ? 49  ALA A HB2  5  
ATOM 9225  H HB3  . ALA A 1 49  ? 10.365 -11.597 16.726 1.00 22.12 ? 49  ALA A HB3  5  
ATOM 9226  N N    . LEU A 1 50  ? 12.960 -11.851 19.218 1.00 31.43 ? 50  LEU A N    5  
ATOM 9227  C CA   . LEU A 1 50  ? 13.958 -12.878 19.495 1.00 65.21 ? 50  LEU A CA   5  
ATOM 9228  C C    . LEU A 1 50  ? 13.938 -13.275 20.968 1.00 61.05 ? 50  LEU A C    5  
ATOM 9229  O O    . LEU A 1 50  ? 13.941 -14.460 21.301 1.00 24.31 ? 50  LEU A O    5  
ATOM 9230  C CB   . LEU A 1 50  ? 15.352 -12.380 19.109 1.00 50.55 ? 50  LEU A CB   5  
ATOM 9231  C CG   . LEU A 1 50  ? 15.663 -12.349 17.612 1.00 53.44 ? 50  LEU A CG   5  
ATOM 9232  C CD1  . LEU A 1 50  ? 17.085 -11.866 17.371 1.00 13.25 ? 50  LEU A CD1  5  
ATOM 9233  C CD2  . LEU A 1 50  ? 15.453 -13.724 16.995 1.00 41.21 ? 50  LEU A CD2  5  
ATOM 9234  H H    . LEU A 1 50  ? 13.239 -10.913 19.177 1.00 23.44 ? 50  LEU A H    5  
ATOM 9235  H HA   . LEU A 1 50  ? 13.717 -13.745 18.898 1.00 53.24 ? 50  LEU A HA   5  
ATOM 9236  H HB2  . LEU A 1 50  ? 15.461 -11.376 19.489 1.00 2.24  ? 50  LEU A HB2  5  
ATOM 9237  H HB3  . LEU A 1 50  ? 16.077 -13.024 19.585 1.00 71.43 ? 50  LEU A HB3  5  
ATOM 9238  H HG   . LEU A 1 50  ? 14.989 -11.657 17.125 1.00 42.52 ? 50  LEU A HG   5  
ATOM 9239  H HD11 . LEU A 1 50  ? 17.088 -10.791 17.275 1.00 3.32  ? 50  LEU A HD11 5  
ATOM 9240  H HD12 . LEU A 1 50  ? 17.467 -12.310 16.464 1.00 1.14  ? 50  LEU A HD12 5  
ATOM 9241  H HD13 . LEU A 1 50  ? 17.709 -12.156 18.204 1.00 15.54 ? 50  LEU A HD13 5  
ATOM 9242  H HD21 . LEU A 1 50  ? 14.405 -13.862 16.772 1.00 44.23 ? 50  LEU A HD21 5  
ATOM 9243  H HD22 . LEU A 1 50  ? 15.776 -14.484 17.692 1.00 55.20 ? 50  LEU A HD22 5  
ATOM 9244  H HD23 . LEU A 1 50  ? 16.029 -13.802 16.085 1.00 53.43 ? 50  LEU A HD23 5  
ATOM 9245  N N    . ILE A 1 51  ? 13.915 -12.276 21.844 1.00 60.43 ? 51  ILE A N    5  
ATOM 9246  C CA   . ILE A 1 51  ? 13.890 -12.522 23.280 1.00 5.43  ? 51  ILE A CA   5  
ATOM 9247  C C    . ILE A 1 51  ? 12.784 -13.503 23.652 1.00 53.33 ? 51  ILE A C    5  
ATOM 9248  O O    . ILE A 1 51  ? 12.937 -14.308 24.570 1.00 72.41 ? 51  ILE A O    5  
ATOM 9249  C CB   . ILE A 1 51  ? 13.690 -11.215 24.071 1.00 33.31 ? 51  ILE A CB   5  
ATOM 9250  C CG1  . ILE A 1 51  ? 13.890 -11.464 25.567 1.00 2.55  ? 51  ILE A CG1  5  
ATOM 9251  C CG2  . ILE A 1 51  ? 12.306 -10.642 23.804 1.00 30.14 ? 51  ILE A CG2  5  
ATOM 9252  C CD1  . ILE A 1 51  ? 14.574 -10.320 26.283 1.00 24.03 ? 51  ILE A CD1  5  
ATOM 9253  H H    . ILE A 1 51  ? 13.914 -11.353 21.516 1.00 34.03 ? 51  ILE A H    5  
ATOM 9254  H HA   . ILE A 1 51  ? 14.843 -12.947 23.562 1.00 42.32 ? 51  ILE A HA   5  
ATOM 9255  H HB   . ILE A 1 51  ? 14.422 -10.499 23.731 1.00 55.20 ? 51  ILE A HB   5  
ATOM 9256  H HG12 . ILE A 1 51  ? 12.929 -11.618 26.032 1.00 3.55  ? 51  ILE A HG12 5  
ATOM 9257  H HG13 . ILE A 1 51  ? 14.496 -12.349 25.700 1.00 54.31 ? 51  ILE A HG13 5  
ATOM 9258  H HG21 . ILE A 1 51  ? 11.559 -11.283 24.250 1.00 41.24 ? 51  ILE A HG21 5  
ATOM 9259  H HG22 . ILE A 1 51  ? 12.236 -9.655  24.237 1.00 62.33 ? 51  ILE A HG22 5  
ATOM 9260  H HG23 . ILE A 1 51  ? 12.140 -10.582 22.739 1.00 0.24  ? 51  ILE A HG23 5  
ATOM 9261  H HD11 . ILE A 1 51  ? 15.353 -10.709 26.923 1.00 72.31 ? 51  ILE A HD11 5  
ATOM 9262  H HD12 . ILE A 1 51  ? 15.006 -9.647  25.558 1.00 71.11 ? 51  ILE A HD12 5  
ATOM 9263  H HD13 . ILE A 1 51  ? 13.851 -9.786  26.883 1.00 73.50 ? 51  ILE A HD13 5  
ATOM 9264  N N    . ARG A 1 52  ? 11.670 -13.430 22.931 1.00 74.03 ? 52  ARG A N    5  
ATOM 9265  C CA   . ARG A 1 52  ? 10.537 -14.312 23.184 1.00 71.21 ? 52  ARG A CA   5  
ATOM 9266  C C    . ARG A 1 52  ? 10.728 -15.656 22.486 1.00 14.22 ? 52  ARG A C    5  
ATOM 9267  O O    . ARG A 1 52  ? 10.467 -16.709 23.066 1.00 21.14 ? 52  ARG A O    5  
ATOM 9268  C CB   . ARG A 1 52  ? 9.238  -13.659 22.709 1.00 51.43 ? 52  ARG A CB   5  
ATOM 9269  C CG   . ARG A 1 52  ? 8.733  -12.563 23.634 1.00 62.41 ? 52  ARG A CG   5  
ATOM 9270  C CD   . ARG A 1 52  ? 8.314  -13.124 24.984 1.00 3.00  ? 52  ARG A CD   5  
ATOM 9271  N NE   . ARG A 1 52  ? 6.883  -12.962 25.223 1.00 33.43 ? 52  ARG A NE   5  
ATOM 9272  C CZ   . ARG A 1 52  ? 6.315  -13.117 26.414 1.00 35.20 ? 52  ARG A CZ   5  
ATOM 9273  N NH1  . ARG A 1 52  ? 7.053  -13.435 27.468 1.00 30.43 ? 52  ARG A NH1  5  
ATOM 9274  N NH2  . ARG A 1 52  ? 5.005  -12.953 26.552 1.00 20.21 ? 52  ARG A NH2  5  
ATOM 9275  H H    . ARG A 1 52  ? 11.607 -12.767 22.212 1.00 44.32 ? 52  ARG A H    5  
ATOM 9276  H HA   . ARG A 1 52  ? 10.477 -14.478 24.249 1.00 21.30 ? 52  ARG A HA   5  
ATOM 9277  H HB2  . ARG A 1 52  ? 9.402  -13.227 21.732 1.00 12.12 ? 52  ARG A HB2  5  
ATOM 9278  H HB3  . ARG A 1 52  ? 8.474  -14.417 22.634 1.00 32.42 ? 52  ARG A HB3  5  
ATOM 9279  H HG2  . ARG A 1 52  ? 9.522  -11.841 23.786 1.00 71.33 ? 52  ARG A HG2  5  
ATOM 9280  H HG3  . ARG A 1 52  ? 7.884  -12.081 23.175 1.00 54.53 ? 52  ARG A HG3  5  
ATOM 9281  H HD2  . ARG A 1 52  ? 8.558  -14.175 25.014 1.00 72.54 ? 52  ARG A HD2  5  
ATOM 9282  H HD3  . ARG A 1 52  ? 8.860  -12.606 25.759 1.00 62.35 ? 52  ARG A HD3  5  
ATOM 9283  H HE   . ARG A 1 52  ? 6.318  -12.727 24.458 1.00 23.20 ? 52  ARG A HE   5  
ATOM 9284  H HH11 . ARG A 1 52  ? 8.040  -13.559 27.367 1.00 0.44  ? 52  ARG A HH11 5  
ATOM 9285  H HH12 . ARG A 1 52  ? 6.623  -13.550 28.364 1.00 32.20 ? 52  ARG A HH12 5  
ATOM 9286  H HH21 . ARG A 1 52  ? 4.445  -12.713 25.760 1.00 62.13 ? 52  ARG A HH21 5  
ATOM 9287  H HH22 . ARG A 1 52  ? 4.578  -13.070 27.448 1.00 25.03 ? 52  ARG A HH22 5  
ATOM 9288  N N    . GLU A 1 53  ? 11.183 -15.609 21.238 1.00 22.42 ? 53  GLU A N    5  
ATOM 9289  C CA   . GLU A 1 53  ? 11.407 -16.823 20.462 1.00 60.32 ? 53  GLU A CA   5  
ATOM 9290  C C    . GLU A 1 53  ? 12.477 -17.695 21.112 1.00 65.21 ? 53  GLU A C    5  
ATOM 9291  O O    . GLU A 1 53  ? 12.217 -18.838 21.490 1.00 52.22 ? 53  GLU A O    5  
ATOM 9292  C CB   . GLU A 1 53  ? 11.820 -16.471 19.031 1.00 31.41 ? 53  GLU A CB   5  
ATOM 9293  C CG   . GLU A 1 53  ? 11.588 -17.596 18.036 1.00 33.35 ? 53  GLU A CG   5  
ATOM 9294  C CD   . GLU A 1 53  ? 11.801 -17.158 16.600 1.00 33.44 ? 53  GLU A CD   5  
ATOM 9295  O OE1  . GLU A 1 53  ? 12.972 -17.059 16.179 1.00 42.02 ? 53  GLU A OE1  5  
ATOM 9296  O OE2  . GLU A 1 53  ? 10.797 -16.915 15.899 1.00 61.14 ? 53  GLU A OE2  5  
ATOM 9297  H H    . GLU A 1 53  ? 11.372 -14.739 20.830 1.00 5.10  ? 53  GLU A H    5  
ATOM 9298  H HA   . GLU A 1 53  ? 10.479 -17.375 20.433 1.00 4.44  ? 53  GLU A HA   5  
ATOM 9299  H HB2  . GLU A 1 53  ? 11.255 -15.610 18.708 1.00 52.43 ? 53  GLU A HB2  5  
ATOM 9300  H HB3  . GLU A 1 53  ? 12.871 -16.224 19.024 1.00 63.23 ? 53  GLU A HB3  5  
ATOM 9301  H HG2  . GLU A 1 53  ? 12.273 -18.401 18.256 1.00 32.33 ? 53  GLU A HG2  5  
ATOM 9302  H HG3  . GLU A 1 53  ? 10.573 -17.950 18.143 1.00 53.12 ? 53  GLU A HG3  5  
ATOM 9303  N N    . ILE A 1 54  ? 13.682 -17.148 21.238 1.00 53.02 ? 54  ILE A N    5  
ATOM 9304  C CA   . ILE A 1 54  ? 14.791 -17.875 21.842 1.00 1.01  ? 54  ILE A CA   5  
ATOM 9305  C C    . ILE A 1 54  ? 14.359 -18.564 23.132 1.00 4.54  ? 54  ILE A C    5  
ATOM 9306  O O    . ILE A 1 54  ? 14.908 -19.600 23.508 1.00 14.34 ? 54  ILE A O    5  
ATOM 9307  C CB   . ILE A 1 54  ? 15.978 -16.941 22.144 1.00 21.21 ? 54  ILE A CB   5  
ATOM 9308  C CG1  . ILE A 1 54  ? 16.478 -16.283 20.857 1.00 55.45 ? 54  ILE A CG1  5  
ATOM 9309  C CG2  . ILE A 1 54  ? 17.101 -17.714 22.820 1.00 12.45 ? 54  ILE A CG2  5  
ATOM 9310  C CD1  . ILE A 1 54  ? 17.569 -15.260 21.085 1.00 55.02 ? 54  ILE A CD1  5  
ATOM 9311  H H    . ILE A 1 54  ? 13.827 -16.234 20.917 1.00 2.35  ? 54  ILE A H    5  
ATOM 9312  H HA   . ILE A 1 54  ? 15.120 -18.626 21.138 1.00 32.13 ? 54  ILE A HA   5  
ATOM 9313  H HB   . ILE A 1 54  ? 15.640 -16.175 22.825 1.00 42.34 ? 54  ILE A HB   5  
ATOM 9314  H HG12 . ILE A 1 54  ? 16.869 -17.043 20.199 1.00 54.30 ? 54  ILE A HG12 5  
ATOM 9315  H HG13 . ILE A 1 54  ? 15.650 -15.784 20.372 1.00 64.10 ? 54  ILE A HG13 5  
ATOM 9316  H HG21 . ILE A 1 54  ? 17.886 -17.030 23.107 1.00 1.33  ? 54  ILE A HG21 5  
ATOM 9317  H HG22 . ILE A 1 54  ? 16.717 -18.209 23.700 1.00 65.02 ? 54  ILE A HG22 5  
ATOM 9318  H HG23 . ILE A 1 54  ? 17.496 -18.449 22.136 1.00 51.33 ? 54  ILE A HG23 5  
ATOM 9319  H HD11 . ILE A 1 54  ? 18.458 -15.556 20.549 1.00 23.41 ? 54  ILE A HD11 5  
ATOM 9320  H HD12 . ILE A 1 54  ? 17.238 -14.295 20.731 1.00 63.35 ? 54  ILE A HD12 5  
ATOM 9321  H HD13 . ILE A 1 54  ? 17.789 -15.199 22.141 1.00 62.00 ? 54  ILE A HD13 5  
ATOM 9322  N N    . ARG A 1 55  ? 13.372 -17.982 23.806 1.00 43.55 ? 55  ARG A N    5  
ATOM 9323  C CA   . ARG A 1 55  ? 12.866 -18.539 25.054 1.00 71.33 ? 55  ARG A CA   5  
ATOM 9324  C C    . ARG A 1 55  ? 12.568 -20.028 24.903 1.00 64.34 ? 55  ARG A C    5  
ATOM 9325  O O    . ARG A 1 55  ? 13.222 -20.867 25.522 1.00 33.01 ? 55  ARG A O    5  
ATOM 9326  C CB   . ARG A 1 55  ? 11.602 -17.798 25.493 1.00 40.21 ? 55  ARG A CB   5  
ATOM 9327  C CG   . ARG A 1 55  ? 11.229 -18.038 26.947 1.00 42.23 ? 55  ARG A CG   5  
ATOM 9328  C CD   . ARG A 1 55  ? 11.984 -17.102 27.877 1.00 4.33  ? 55  ARG A CD   5  
ATOM 9329  N NE   . ARG A 1 55  ? 13.273 -17.656 28.284 1.00 70.23 ? 55  ARG A NE   5  
ATOM 9330  C CZ   . ARG A 1 55  ? 14.110 -17.040 29.110 1.00 4.23  ? 55  ARG A CZ   5  
ATOM 9331  N NH1  . ARG A 1 55  ? 13.796 -15.855 29.616 1.00 21.21 ? 55  ARG A NH1  5  
ATOM 9332  N NH2  . ARG A 1 55  ? 15.265 -17.609 29.433 1.00 51.20 ? 55  ARG A NH2  5  
ATOM 9333  H H    . ARG A 1 55  ? 12.975 -17.157 23.455 1.00 44.20 ? 55  ARG A H    5  
ATOM 9334  H HA   . ARG A 1 55  ? 13.628 -18.411 25.808 1.00 60.33 ? 55  ARG A HA   5  
ATOM 9335  H HB2  . ARG A 1 55  ? 11.754 -16.737 25.354 1.00 72.54 ? 55  ARG A HB2  5  
ATOM 9336  H HB3  . ARG A 1 55  ? 10.778 -18.119 24.875 1.00 74.44 ? 55  ARG A HB3  5  
ATOM 9337  H HG2  . ARG A 1 55  ? 10.169 -17.871 27.069 1.00 2.12  ? 55  ARG A HG2  5  
ATOM 9338  H HG3  . ARG A 1 55  ? 11.467 -19.059 27.206 1.00 43.43 ? 55  ARG A HG3  5  
ATOM 9339  H HD2  . ARG A 1 55  ? 12.152 -16.165 27.366 1.00 34.33 ? 55  ARG A HD2  5  
ATOM 9340  H HD3  . ARG A 1 55  ? 11.383 -16.929 28.757 1.00 23.04 ? 55  ARG A HD3  5  
ATOM 9341  H HE   . ARG A 1 55  ? 13.525 -18.531 27.922 1.00 42.23 ? 55  ARG A HE   5  
ATOM 9342  H HH11 . ARG A 1 55  ? 12.926 -15.425 29.375 1.00 4.35  ? 55  ARG A HH11 5  
ATOM 9343  H HH12 . ARG A 1 55  ? 14.428 -15.394 30.239 1.00 10.23 ? 55  ARG A HH12 5  
ATOM 9344  H HH21 . ARG A 1 55  ? 15.505 -18.502 29.054 1.00 42.21 ? 55  ARG A HH21 5  
ATOM 9345  H HH22 . ARG A 1 55  ? 15.894 -17.144 30.055 1.00 64.21 ? 55  ARG A HH22 5  
ATOM 9346  N N    . GLU A 1 56  ? 11.578 -20.348 24.076 1.00 51.35 ? 56  GLU A N    5  
ATOM 9347  C CA   . GLU A 1 56  ? 11.194 -21.735 23.845 1.00 74.31 ? 56  GLU A CA   5  
ATOM 9348  C C    . GLU A 1 56  ? 11.893 -22.295 22.610 1.00 60.53 ? 56  GLU A C    5  
ATOM 9349  O O    . GLU A 1 56  ? 12.276 -23.464 22.578 1.00 25.20 ? 56  GLU A O    5  
ATOM 9350  C CB   . GLU A 1 56  ? 9.677  -21.847 23.680 1.00 35.11 ? 56  GLU A CB   5  
ATOM 9351  C CG   . GLU A 1 56  ? 9.137  -23.244 23.939 1.00 44.21 ? 56  GLU A CG   5  
ATOM 9352  C CD   . GLU A 1 56  ? 7.625  -23.310 23.854 1.00 32.32 ? 56  GLU A CD   5  
ATOM 9353  O OE1  . GLU A 1 56  ? 7.081  -23.082 22.754 1.00 60.24 ? 56  GLU A OE1  5  
ATOM 9354  O OE2  . GLU A 1 56  ? 6.985  -23.591 24.890 1.00 41.05 ? 56  GLU A OE2  5  
ATOM 9355  H H    . GLU A 1 56  ? 11.094 -19.634 23.610 1.00 1.22  ? 56  GLU A H    5  
ATOM 9356  H HA   . GLU A 1 56  ? 11.496 -22.311 24.707 1.00 51.23 ? 56  GLU A HA   5  
ATOM 9357  H HB2  . GLU A 1 56  ? 9.200  -21.166 24.370 1.00 43.33 ? 56  GLU A HB2  5  
ATOM 9358  H HB3  . GLU A 1 56  ? 9.415  -21.564 22.671 1.00 32.50 ? 56  GLU A HB3  5  
ATOM 9359  H HG2  . GLU A 1 56  ? 9.553  -23.918 23.205 1.00 24.24 ? 56  GLU A HG2  5  
ATOM 9360  H HG3  . GLU A 1 56  ? 9.442  -23.556 24.927 1.00 61.21 ? 56  GLU A HG3  5  
ATOM 9361  N N    . GLU A 1 57  ? 12.054 -21.452 21.595 1.00 63.23 ? 57  GLU A N    5  
ATOM 9362  C CA   . GLU A 1 57  ? 12.706 -21.864 20.357 1.00 40.42 ? 57  GLU A CA   5  
ATOM 9363  C C    . GLU A 1 57  ? 14.073 -22.480 20.640 1.00 31.04 ? 57  GLU A C    5  
ATOM 9364  O O    . GLU A 1 57  ? 14.409 -23.540 20.113 1.00 51.33 ? 57  GLU A O    5  
ATOM 9365  C CB   . GLU A 1 57  ? 12.859 -20.669 19.413 1.00 1.34  ? 57  GLU A CB   5  
ATOM 9366  C CG   . GLU A 1 57  ? 12.928 -21.057 17.946 1.00 45.30 ? 57  GLU A CG   5  
ATOM 9367  C CD   . GLU A 1 57  ? 11.776 -21.947 17.523 1.00 64.21 ? 57  GLU A CD   5  
ATOM 9368  O OE1  . GLU A 1 57  ? 12.023 -22.927 16.789 1.00 24.32 ? 57  GLU A OE1  5  
ATOM 9369  O OE2  . GLU A 1 57  ? 10.629 -21.664 17.925 1.00 75.42 ? 57  GLU A OE2  5  
ATOM 9370  H H    . GLU A 1 57  ? 11.727 -20.533 21.680 1.00 1.52  ? 57  GLU A H    5  
ATOM 9371  H HA   . GLU A 1 57  ? 12.081 -22.606 19.884 1.00 41.11 ? 57  GLU A HA   5  
ATOM 9372  H HB2  . GLU A 1 57  ? 12.017 -20.007 19.550 1.00 14.25 ? 57  GLU A HB2  5  
ATOM 9373  H HB3  . GLU A 1 57  ? 13.766 -20.139 19.667 1.00 33.52 ? 57  GLU A HB3  5  
ATOM 9374  H HG2  . GLU A 1 57  ? 12.907 -20.158 17.348 1.00 60.23 ? 57  GLU A HG2  5  
ATOM 9375  H HG3  . GLU A 1 57  ? 13.855 -21.583 17.769 1.00 31.25 ? 57  GLU A HG3  5  
ATOM 9376  N N    . MET A 1 58  ? 14.857 -21.808 21.477 1.00 14.40 ? 58  MET A N    5  
ATOM 9377  C CA   . MET A 1 58  ? 16.187 -22.289 21.831 1.00 34.25 ? 58  MET A CA   5  
ATOM 9378  C C    . MET A 1 58  ? 16.161 -23.024 23.168 1.00 14.42 ? 58  MET A C    5  
ATOM 9379  O O    . MET A 1 58  ? 16.949 -23.940 23.400 1.00 30.33 ? 58  MET A O    5  
ATOM 9380  C CB   . MET A 1 58  ? 17.174 -21.123 21.896 1.00 3.34  ? 58  MET A CB   5  
ATOM 9381  C CG   . MET A 1 58  ? 17.874 -20.845 20.576 1.00 42.11 ? 58  MET A CG   5  
ATOM 9382  S SD   . MET A 1 58  ? 19.469 -20.031 20.793 1.00 73.33 ? 58  MET A SD   5  
ATOM 9383  C CE   . MET A 1 58  ? 19.862 -19.600 19.099 1.00 33.13 ? 58  MET A CE   5  
ATOM 9384  H H    . MET A 1 58  ? 14.533 -20.968 21.866 1.00 22.33 ? 58  MET A H    5  
ATOM 9385  H HA   . MET A 1 58  ? 16.506 -22.977 21.063 1.00 55.34 ? 58  MET A HA   5  
ATOM 9386  H HB2  . MET A 1 58  ? 16.641 -20.231 22.191 1.00 22.11 ? 58  MET A HB2  5  
ATOM 9387  H HB3  . MET A 1 58  ? 17.927 -21.344 22.638 1.00 22.20 ? 58  MET A HB3  5  
ATOM 9388  H HG2  . MET A 1 58  ? 18.032 -21.782 20.063 1.00 53.23 ? 58  MET A HG2  5  
ATOM 9389  H HG3  . MET A 1 58  ? 17.240 -20.210 19.975 1.00 31.11 ? 58  MET A HG3  5  
ATOM 9390  H HE1  . MET A 1 58  ? 20.890 -19.275 19.040 1.00 70.43 ? 58  MET A HE1  5  
ATOM 9391  H HE2  . MET A 1 58  ? 19.719 -20.463 18.466 1.00 24.21 ? 58  MET A HE2  5  
ATOM 9392  H HE3  . MET A 1 58  ? 19.212 -18.801 18.772 1.00 62.34 ? 58  MET A HE3  5  
ATOM 9393  N N    . LYS A 1 59  ? 15.250 -22.615 24.045 1.00 13.10 ? 59  LYS A N    5  
ATOM 9394  C CA   . LYS A 1 59  ? 15.120 -23.234 25.359 1.00 74.13 ? 59  LYS A CA   5  
ATOM 9395  C C    . LYS A 1 59  ? 16.347 -22.948 26.219 1.00 74.43 ? 59  LYS A C    5  
ATOM 9396  O O    . LYS A 1 59  ? 16.741 -23.771 27.046 1.00 4.11  ? 59  LYS A O    5  
ATOM 9397  C CB   . LYS A 1 59  ? 14.924 -24.745 25.216 1.00 63.20 ? 59  LYS A CB   5  
ATOM 9398  C CG   . LYS A 1 59  ? 13.926 -25.130 24.138 1.00 34.33 ? 59  LYS A CG   5  
ATOM 9399  C CD   . LYS A 1 59  ? 13.769 -26.638 24.036 1.00 31.24 ? 59  LYS A CD   5  
ATOM 9400  C CE   . LYS A 1 59  ? 13.179 -27.225 25.310 1.00 42.40 ? 59  LYS A CE   5  
ATOM 9401  N NZ   . LYS A 1 59  ? 12.813 -28.658 25.143 1.00 64.41 ? 59  LYS A NZ   5  
ATOM 9402  H H    . LYS A 1 59  ? 14.649 -21.879 23.802 1.00 40.20 ? 59  LYS A H    5  
ATOM 9403  H HA   . LYS A 1 59  ? 14.251 -22.811 25.840 1.00 20.22 ? 59  LYS A HA   5  
ATOM 9404  H HB2  . LYS A 1 59  ? 15.875 -25.198 24.975 1.00 12.21 ? 59  LYS A HB2  5  
ATOM 9405  H HB3  . LYS A 1 59  ? 14.575 -25.141 26.159 1.00 62.52 ? 59  LYS A HB3  5  
ATOM 9406  H HG2  . LYS A 1 59  ? 12.967 -24.695 24.377 1.00 54.15 ? 59  LYS A HG2  5  
ATOM 9407  H HG3  . LYS A 1 59  ? 14.270 -24.748 23.188 1.00 64.22 ? 59  LYS A HG3  5  
ATOM 9408  H HD2  . LYS A 1 59  ? 13.113 -26.869 23.210 1.00 13.53 ? 59  LYS A HD2  5  
ATOM 9409  H HD3  . LYS A 1 59  ? 14.739 -27.081 23.862 1.00 23.30 ? 59  LYS A HD3  5  
ATOM 9410  H HE2  . LYS A 1 59  ? 13.907 -27.138 26.102 1.00 45.34 ? 59  LYS A HE2  5  
ATOM 9411  H HE3  . LYS A 1 59  ? 12.294 -26.664 25.572 1.00 20.13 ? 59  LYS A HE3  5  
ATOM 9412  H HZ1  . LYS A 1 59  ? 13.455 -29.258 25.701 1.00 13.20 ? 59  LYS A HZ1  5  
ATOM 9413  H HZ2  . LYS A 1 59  ? 12.886 -28.931 24.142 1.00 33.32 ? 59  LYS A HZ2  5  
ATOM 9414  H HZ3  . LYS A 1 59  ? 11.838 -28.818 25.465 1.00 31.54 ? 59  LYS A HZ3  5  
ATOM 9415  N N    . CYS A 1 60  ? 16.944 -21.779 26.019 1.00 61.12 ? 60  CYS A N    5  
ATOM 9416  C CA   . CYS A 1 60  ? 18.126 -21.385 26.777 1.00 43.00 ? 60  CYS A CA   5  
ATOM 9417  C C    . CYS A 1 60  ? 18.006 -19.944 27.261 1.00 2.41  ? 60  CYS A C    5  
ATOM 9418  O O    . CYS A 1 60  ? 16.959 -19.313 27.111 1.00 65.00 ? 60  CYS A O    5  
ATOM 9419  C CB   . CYS A 1 60  ? 19.383 -21.545 25.921 1.00 25.20 ? 60  CYS A CB   5  
ATOM 9420  S SG   . CYS A 1 60  ? 19.523 -23.155 25.109 1.00 44.42 ? 60  CYS A SG   5  
ATOM 9421  H H    . CYS A 1 60  ? 16.583 -21.166 25.345 1.00 13.22 ? 60  CYS A H    5  
ATOM 9422  H HA   . CYS A 1 60  ? 18.200 -22.035 27.635 1.00 2.05  ? 60  CYS A HA   5  
ATOM 9423  H HB2  . CYS A 1 60  ? 19.384 -20.788 25.151 1.00 63.24 ? 60  CYS A HB2  5  
ATOM 9424  H HB3  . CYS A 1 60  ? 20.254 -21.414 26.546 1.00 43.00 ? 60  CYS A HB3  5  
ATOM 9425  H HG   . CYS A 1 60  ? 19.197 -24.087 25.991 1.00 54.14 ? 60  CYS A HG   5  
ATOM 9426  N N    . ASP A 1 61  ? 19.084 -19.429 27.843 1.00 35.15 ? 61  ASP A N    5  
ATOM 9427  C CA   . ASP A 1 61  ? 19.099 -18.062 28.351 1.00 41.13 ? 61  ASP A CA   5  
ATOM 9428  C C    . ASP A 1 61  ? 19.945 -17.160 27.457 1.00 70.40 ? 61  ASP A C    5  
ATOM 9429  O O    . ASP A 1 61  ? 20.543 -16.190 27.924 1.00 61.01 ? 61  ASP A O    5  
ATOM 9430  C CB   . ASP A 1 61  ? 19.638 -18.032 29.782 1.00 72.41 ? 61  ASP A CB   5  
ATOM 9431  C CG   . ASP A 1 61  ? 18.863 -18.946 30.711 1.00 12.21 ? 61  ASP A CG   5  
ATOM 9432  O OD1  . ASP A 1 61  ? 18.981 -20.181 30.564 1.00 12.43 ? 61  ASP A OD1  5  
ATOM 9433  O OD2  . ASP A 1 61  ? 18.139 -18.426 31.586 1.00 60.03 ? 61  ASP A OD2  5  
ATOM 9434  H H    . ASP A 1 61  ? 19.888 -19.982 27.934 1.00 41.12 ? 61  ASP A H    5  
ATOM 9435  H HA   . ASP A 1 61  ? 18.083 -17.697 28.351 1.00 43.43 ? 61  ASP A HA   5  
ATOM 9436  H HB2  . ASP A 1 61  ? 20.671 -18.347 29.777 1.00 22.44 ? 61  ASP A HB2  5  
ATOM 9437  H HB3  . ASP A 1 61  ? 19.575 -17.024 30.162 1.00 12.45 ? 61  ASP A HB3  5  
ATOM 9438  N N    . LEU A 1 62  ? 19.992 -17.487 26.170 1.00 34.43 ? 62  LEU A N    5  
ATOM 9439  C CA   . LEU A 1 62  ? 20.765 -16.708 25.210 1.00 4.12  ? 62  LEU A CA   5  
ATOM 9440  C C    . LEU A 1 62  ? 20.582 -15.213 25.449 1.00 4.45  ? 62  LEU A C    5  
ATOM 9441  O O    . LEU A 1 62  ? 19.513 -14.659 25.190 1.00 5.12  ? 62  LEU A O    5  
ATOM 9442  C CB   . LEU A 1 62  ? 20.348 -17.062 23.782 1.00 65.22 ? 62  LEU A CB   5  
ATOM 9443  C CG   . LEU A 1 62  ? 21.484 -17.219 22.770 1.00 5.23  ? 62  LEU A CG   5  
ATOM 9444  C CD1  . LEU A 1 62  ? 22.155 -18.575 22.926 1.00 34.00 ? 62  LEU A CD1  5  
ATOM 9445  C CD2  . LEU A 1 62  ? 20.964 -17.039 21.352 1.00 41.33 ? 62  LEU A CD2  5  
ATOM 9446  H H    . LEU A 1 62  ? 19.494 -18.271 25.857 1.00 24.34 ? 62  LEU A H    5  
ATOM 9447  H HA   . LEU A 1 62  ? 21.807 -16.957 25.345 1.00 45.23 ? 62  LEU A HA   5  
ATOM 9448  H HB2  . LEU A 1 62  ? 19.807 -17.995 23.817 1.00 13.22 ? 62  LEU A HB2  5  
ATOM 9449  H HB3  . LEU A 1 62  ? 19.693 -16.280 23.426 1.00 73.10 ? 62  LEU A HB3  5  
ATOM 9450  H HG   . LEU A 1 62  ? 22.229 -16.456 22.954 1.00 60.33 ? 62  LEU A HG   5  
ATOM 9451  H HD11 . LEU A 1 62  ? 22.940 -18.506 23.663 1.00 1.21  ? 62  LEU A HD11 5  
ATOM 9452  H HD12 . LEU A 1 62  ? 22.575 -18.880 21.979 1.00 2.51  ? 62  LEU A HD12 5  
ATOM 9453  H HD13 . LEU A 1 62  ? 21.423 -19.303 23.245 1.00 23.23 ? 62  LEU A HD13 5  
ATOM 9454  H HD21 . LEU A 1 62  ? 19.884 -17.033 21.363 1.00 1.00  ? 62  LEU A HD21 5  
ATOM 9455  H HD22 . LEU A 1 62  ? 21.313 -17.854 20.734 1.00 1.22  ? 62  LEU A HD22 5  
ATOM 9456  H HD23 . LEU A 1 62  ? 21.325 -16.103 20.952 1.00 43.01 ? 62  LEU A HD23 5  
ATOM 9457  N N    . ILE A 1 63  ? 21.632 -14.565 25.943 1.00 2.12  ? 63  ILE A N    5  
ATOM 9458  C CA   . ILE A 1 63  ? 21.588 -13.133 26.214 1.00 71.32 ? 63  ILE A CA   5  
ATOM 9459  C C    . ILE A 1 63  ? 21.987 -12.328 24.982 1.00 74.34 ? 63  ILE A C    5  
ATOM 9460  O O    . ILE A 1 63  ? 22.772 -12.789 24.153 1.00 74.21 ? 63  ILE A O    5  
ATOM 9461  C CB   . ILE A 1 63  ? 22.514 -12.753 27.384 1.00 43.52 ? 63  ILE A CB   5  
ATOM 9462  C CG1  . ILE A 1 63  ? 22.278 -13.684 28.574 1.00 30.31 ? 63  ILE A CG1  5  
ATOM 9463  C CG2  . ILE A 1 63  ? 22.290 -11.303 27.786 1.00 3.45  ? 63  ILE A CG2  5  
ATOM 9464  C CD1  . ILE A 1 63  ? 23.261 -14.832 28.648 1.00 51.32 ? 63  ILE A CD1  5  
ATOM 9465  H H    . ILE A 1 63  ? 22.456 -15.061 26.129 1.00 21.21 ? 63  ILE A H    5  
ATOM 9466  H HA   . ILE A 1 63  ? 20.574 -12.877 26.486 1.00 71.04 ? 63  ILE A HA   5  
ATOM 9467  H HB   . ILE A 1 63  ? 23.536 -12.855 27.053 1.00 63.34 ? 63  ILE A HB   5  
ATOM 9468  H HG12 . ILE A 1 63  ? 22.361 -13.118 29.488 1.00 33.34 ? 63  ILE A HG12 5  
ATOM 9469  H HG13 . ILE A 1 63  ? 21.284 -14.102 28.503 1.00 51.12 ? 63  ILE A HG13 5  
ATOM 9470  H HG21 . ILE A 1 63  ? 22.918 -10.661 27.185 1.00 32.13 ? 63  ILE A HG21 5  
ATOM 9471  H HG22 . ILE A 1 63  ? 21.255 -11.042 27.629 1.00 53.41 ? 63  ILE A HG22 5  
ATOM 9472  H HG23 . ILE A 1 63  ? 22.540 -11.176 28.829 1.00 14.41 ? 63  ILE A HG23 5  
ATOM 9473  H HD11 . ILE A 1 63  ? 23.981 -14.640 29.429 1.00 1.34  ? 63  ILE A HD11 5  
ATOM 9474  H HD12 . ILE A 1 63  ? 22.731 -15.747 28.862 1.00 30.41 ? 63  ILE A HD12 5  
ATOM 9475  H HD13 . ILE A 1 63  ? 23.775 -14.927 27.702 1.00 52.52 ? 63  ILE A HD13 5  
ATOM 9476  N N    . VAL A 1 64  ? 21.441 -11.121 24.868 1.00 23.31 ? 64  VAL A N    5  
ATOM 9477  C CA   . VAL A 1 64  ? 21.742 -10.250 23.739 1.00 41.34 ? 64  VAL A CA   5  
ATOM 9478  C C    . VAL A 1 64  ? 22.524 -9.020  24.186 1.00 23.13 ? 64  VAL A C    5  
ATOM 9479  O O    . VAL A 1 64  ? 22.361 -8.542  25.308 1.00 25.43 ? 64  VAL A O    5  
ATOM 9480  C CB   . VAL A 1 64  ? 20.456 -9.794  23.023 1.00 24.32 ? 64  VAL A CB   5  
ATOM 9481  C CG1  . VAL A 1 64  ? 19.596 -8.953  23.954 1.00 25.11 ? 64  VAL A CG1  5  
ATOM 9482  C CG2  . VAL A 1 64  ? 20.796 -9.024  21.756 1.00 5.34  ? 64  VAL A CG2  5  
ATOM 9483  H H    . VAL A 1 64  ? 20.823 -10.809 25.561 1.00 74.20 ? 64  VAL A H    5  
ATOM 9484  H HA   . VAL A 1 64  ? 22.341 -10.809 23.035 1.00 25.42 ? 64  VAL A HA   5  
ATOM 9485  H HB   . VAL A 1 64  ? 19.893 -10.673 22.745 1.00 40.23 ? 64  VAL A HB   5  
ATOM 9486  H HG11 . VAL A 1 64  ? 19.880 -7.915  23.865 1.00 2.42  ? 64  VAL A HG11 5  
ATOM 9487  H HG12 . VAL A 1 64  ? 18.556 -9.068  23.686 1.00 44.32 ? 64  VAL A HG12 5  
ATOM 9488  H HG13 . VAL A 1 64  ? 19.744 -9.280  24.973 1.00 11.41 ? 64  VAL A HG13 5  
ATOM 9489  H HG21 . VAL A 1 64  ? 21.805 -9.260  21.452 1.00 60.41 ? 64  VAL A HG21 5  
ATOM 9490  H HG22 . VAL A 1 64  ? 20.109 -9.301  20.970 1.00 10.13 ? 64  VAL A HG22 5  
ATOM 9491  H HG23 . VAL A 1 64  ? 20.716 -7.964  21.947 1.00 45.13 ? 64  VAL A HG23 5  
ATOM 9492  N N    . GLY A 1 65  ? 23.375 -8.511  23.300 1.00 72.21 ? 65  GLY A N    5  
ATOM 9493  C CA   . GLY A 1 65  ? 24.170 -7.341  23.622 1.00 11.31 ? 65  GLY A CA   5  
ATOM 9494  C C    . GLY A 1 65  ? 23.546 -6.057  23.111 1.00 70.30 ? 65  GLY A C    5  
ATOM 9495  O O    . GLY A 1 65  ? 22.777 -5.408  23.820 1.00 42.41 ? 65  GLY A O    5  
ATOM 9496  H H    . GLY A 1 65  ? 23.463 -8.934  22.420 1.00 21.11 ? 65  GLY A H    5  
ATOM 9497  H HA2  . GLY A 1 65  ? 24.276 -7.275  24.695 1.00 70.13 ? 65  GLY A HA2  5  
ATOM 9498  H HA3  . GLY A 1 65  ? 25.149 -7.452  23.180 1.00 61.12 ? 65  GLY A HA3  5  
ATOM 9499  N N    . ASP A 1 66  ? 23.878 -5.690  21.878 1.00 21.13 ? 66  ASP A N    5  
ATOM 9500  C CA   . ASP A 1 66  ? 23.345 -4.475  21.273 1.00 64.02 ? 66  ASP A CA   5  
ATOM 9501  C C    . ASP A 1 66  ? 23.012 -4.702  19.802 1.00 72.23 ? 66  ASP A C    5  
ATOM 9502  O O    . ASP A 1 66  ? 23.217 -5.793  19.269 1.00 55.05 ? 66  ASP A O    5  
ATOM 9503  C CB   . ASP A 1 66  ? 24.349 -3.329  21.410 1.00 70.00 ? 66  ASP A CB   5  
ATOM 9504  C CG   . ASP A 1 66  ? 24.040 -2.427  22.589 1.00 64.21 ? 66  ASP A CG   5  
ATOM 9505  O OD1  . ASP A 1 66  ? 24.771 -2.501  23.599 1.00 34.30 ? 66  ASP A OD1  5  
ATOM 9506  O OD2  . ASP A 1 66  ? 23.068 -1.648  22.502 1.00 42.02 ? 66  ASP A OD2  5  
ATOM 9507  H H    . ASP A 1 66  ? 24.496 -6.250  21.363 1.00 71.02 ? 66  ASP A H    5  
ATOM 9508  H HA   . ASP A 1 66  ? 22.439 -4.213  21.798 1.00 44.51 ? 66  ASP A HA   5  
ATOM 9509  H HB2  . ASP A 1 66  ? 25.339 -3.740  21.545 1.00 70.22 ? 66  ASP A HB2  5  
ATOM 9510  H HB3  . ASP A 1 66  ? 24.331 -2.733  20.509 1.00 35.42 ? 66  ASP A HB3  5  
ATOM 9511  N N    . LYS A 1 67  ? 22.496 -3.665  19.150 1.00 34.54 ? 67  LYS A N    5  
ATOM 9512  C CA   . LYS A 1 67  ? 22.133 -3.750  17.741 1.00 61.33 ? 67  LYS A CA   5  
ATOM 9513  C C    . LYS A 1 67  ? 23.378 -3.792  16.860 1.00 0.43  ? 67  LYS A C    5  
ATOM 9514  O O    . LYS A 1 67  ? 24.352 -3.081  17.111 1.00 55.23 ? 67  LYS A O    5  
ATOM 9515  C CB   . LYS A 1 67  ? 21.256 -2.560  17.346 1.00 34.20 ? 67  LYS A CB   5  
ATOM 9516  C CG   . LYS A 1 67  ? 20.834 -2.573  15.887 1.00 73.00 ? 67  LYS A CG   5  
ATOM 9517  C CD   . LYS A 1 67  ? 19.645 -3.491  15.658 1.00 31.33 ? 67  LYS A CD   5  
ATOM 9518  C CE   . LYS A 1 67  ? 19.142 -3.406  14.225 1.00 23.02 ? 67  LYS A CE   5  
ATOM 9519  N NZ   . LYS A 1 67  ? 18.172 -2.291  14.043 1.00 33.33 ? 67  LYS A NZ   5  
ATOM 9520  H H    . LYS A 1 67  ? 22.356 -2.822  19.630 1.00 52.50 ? 67  LYS A H    5  
ATOM 9521  H HA   . LYS A 1 67  ? 21.574 -4.662  17.596 1.00 22.42 ? 67  LYS A HA   5  
ATOM 9522  H HB2  . LYS A 1 67  ? 20.365 -2.567  17.957 1.00 51.21 ? 67  LYS A HB2  5  
ATOM 9523  H HB3  . LYS A 1 67  ? 21.803 -1.647  17.533 1.00 71.43 ? 67  LYS A HB3  5  
ATOM 9524  H HG2  . LYS A 1 67  ? 20.563 -1.571  15.591 1.00 15.51 ? 67  LYS A HG2  5  
ATOM 9525  H HG3  . LYS A 1 67  ? 21.663 -2.916  15.285 1.00 62.11 ? 67  LYS A HG3  5  
ATOM 9526  H HD2  . LYS A 1 67  ? 19.942 -4.509  15.863 1.00 2.03  ? 67  LYS A HD2  5  
ATOM 9527  H HD3  . LYS A 1 67  ? 18.846 -3.206  16.328 1.00 3.44  ? 67  LYS A HD3  5  
ATOM 9528  H HE2  . LYS A 1 67  ? 19.986 -3.248  13.571 1.00 74.04 ? 67  LYS A HE2  5  
ATOM 9529  H HE3  . LYS A 1 67  ? 18.659 -4.338  13.971 1.00 2.02  ? 67  LYS A HE3  5  
ATOM 9530  H HZ1  . LYS A 1 67  ? 17.937 -1.869  14.964 1.00 0.52  ? 67  LYS A HZ1  5  
ATOM 9531  H HZ2  . LYS A 1 67  ? 17.298 -2.646  13.605 1.00 21.21 ? 67  LYS A HZ2  5  
ATOM 9532  H HZ3  . LYS A 1 67  ? 18.581 -1.557  13.431 1.00 71.32 ? 67  LYS A HZ3  5  
ATOM 9533  N N    . VAL A 1 68  ? 23.340 -4.627  15.827 1.00 35.54 ? 68  VAL A N    5  
ATOM 9534  C CA   . VAL A 1 68  ? 24.464 -4.759  14.908 1.00 34.22 ? 68  VAL A CA   5  
ATOM 9535  C C    . VAL A 1 68  ? 24.385 -3.724  13.792 1.00 1.52  ? 68  VAL A C    5  
ATOM 9536  O O    . VAL A 1 68  ? 25.255 -2.861  13.670 1.00 65.00 ? 68  VAL A O    5  
ATOM 9537  C CB   . VAL A 1 68  ? 24.517 -6.167  14.285 1.00 52.43 ? 68  VAL A CB   5  
ATOM 9538  C CG1  . VAL A 1 68  ? 25.665 -6.268  13.292 1.00 12.00 ? 68  VAL A CG1  5  
ATOM 9539  C CG2  . VAL A 1 68  ? 24.644 -7.225  15.370 1.00 63.12 ? 68  VAL A CG2  5  
ATOM 9540  H H    . VAL A 1 68  ? 22.536 -5.168  15.680 1.00 55.13 ? 68  VAL A H    5  
ATOM 9541  H HA   . VAL A 1 68  ? 25.374 -4.602  15.469 1.00 74.02 ? 68  VAL A HA   5  
ATOM 9542  H HB   . VAL A 1 68  ? 23.593 -6.337  13.751 1.00 21.25 ? 68  VAL A HB   5  
ATOM 9543  H HG11 . VAL A 1 68  ? 25.751 -7.287  12.945 1.00 72.24 ? 68  VAL A HG11 5  
ATOM 9544  H HG12 . VAL A 1 68  ? 25.474 -5.615  12.453 1.00 44.01 ? 68  VAL A HG12 5  
ATOM 9545  H HG13 . VAL A 1 68  ? 26.585 -5.975  13.775 1.00 2.43  ? 68  VAL A HG13 5  
ATOM 9546  H HG21 . VAL A 1 68  ? 24.419 -6.785  16.330 1.00 50.55 ? 68  VAL A HG21 5  
ATOM 9547  H HG22 . VAL A 1 68  ? 23.951 -8.030  15.172 1.00 50.23 ? 68  VAL A HG22 5  
ATOM 9548  H HG23 . VAL A 1 68  ? 25.652 -7.613  15.379 1.00 50.24 ? 68  VAL A HG23 5  
ATOM 9549  N N    . ILE A 1 69  ? 23.337 -3.814  12.981 1.00 71.42 ? 69  ILE A N    5  
ATOM 9550  C CA   . ILE A 1 69  ? 23.144 -2.884  11.876 1.00 41.04 ? 69  ILE A CA   5  
ATOM 9551  C C    . ILE A 1 69  ? 21.819 -3.140  11.166 1.00 33.12 ? 69  ILE A C    5  
ATOM 9552  O O    . ILE A 1 69  ? 21.292 -4.253  11.192 1.00 63.20 ? 69  ILE A O    5  
ATOM 9553  C CB   . ILE A 1 69  ? 24.289 -2.982  10.851 1.00 64.24 ? 69  ILE A CB   5  
ATOM 9554  C CG1  . ILE A 1 69  ? 24.248 -1.791  9.891  1.00 1.14  ? 69  ILE A CG1  5  
ATOM 9555  C CG2  . ILE A 1 69  ? 24.201 -4.292  10.082 1.00 41.25 ? 69  ILE A CG2  5  
ATOM 9556  C CD1  . ILE A 1 69  ? 25.609 -1.393  9.363  1.00 14.02 ? 69  ILE A CD1  5  
ATOM 9557  H H    . ILE A 1 69  ? 22.677 -4.523  13.129 1.00 23.45 ? 69  ILE A H    5  
ATOM 9558  H HA   . ILE A 1 69  ? 23.135 -1.882  12.281 1.00 24.41 ? 69  ILE A HA   5  
ATOM 9559  H HB   . ILE A 1 69  ? 25.225 -2.970  11.388 1.00 64.51 ? 69  ILE A HB   5  
ATOM 9560  H HG12 . ILE A 1 69  ? 23.624 -2.038  9.047  1.00 65.11 ? 69  ILE A HG12 5  
ATOM 9561  H HG13 . ILE A 1 69  ? 23.829 -0.938  10.406 1.00 33.41 ? 69  ILE A HG13 5  
ATOM 9562  H HG21 . ILE A 1 69  ? 24.065 -5.108  10.775 1.00 23.25 ? 69  ILE A HG21 5  
ATOM 9563  H HG22 . ILE A 1 69  ? 23.362 -4.254  9.403  1.00 62.31 ? 69  ILE A HG22 5  
ATOM 9564  H HG23 . ILE A 1 69  ? 25.112 -4.443  9.521  1.00 15.05 ? 69  ILE A HG23 5  
ATOM 9565  H HD11 . ILE A 1 69  ? 25.622 -0.331  9.166  1.00 23.13 ? 69  ILE A HD11 5  
ATOM 9566  H HD12 . ILE A 1 69  ? 26.364 -1.634  10.095 1.00 23.32 ? 69  ILE A HD12 5  
ATOM 9567  H HD13 . ILE A 1 69  ? 25.810 -1.930  8.447  1.00 22.34 ? 69  ILE A HD13 5  
ATOM 9568  N N    . THR A 1 70  ? 21.284 -2.102  10.530 1.00 34.35 ? 70  THR A N    5  
ATOM 9569  C CA   . THR A 1 70  ? 20.020 -2.214  9.813  1.00 61.32 ? 70  THR A CA   5  
ATOM 9570  C C    . THR A 1 70  ? 20.243 -2.217  8.305  1.00 53.12 ? 70  THR A C    5  
ATOM 9571  O O    . THR A 1 70  ? 20.977 -1.384  7.773  1.00 3.41  ? 70  THR A O    5  
ATOM 9572  C CB   . THR A 1 70  ? 19.063 -1.063  10.177 1.00 23.41 ? 70  THR A CB   5  
ATOM 9573  O OG1  . THR A 1 70  ? 19.017 -0.896  11.598 1.00 31.25 ? 70  THR A OG1  5  
ATOM 9574  C CG2  . THR A 1 70  ? 17.663 -1.335  9.647  1.00 24.44 ? 70  THR A CG2  5  
ATOM 9575  H H    . THR A 1 70  ? 21.751 -1.241  10.546 1.00 32.01 ? 70  THR A H    5  
ATOM 9576  H HA   . THR A 1 70  ? 19.555 -3.146  10.100 1.00 32.01 ? 70  THR A HA   5  
ATOM 9577  H HB   . THR A 1 70  ? 19.432 -0.153  9.727  1.00 50.22 ? 70  THR A HB   5  
ATOM 9578  H HG1  . THR A 1 70  ? 19.580 -0.161  11.853 1.00 64.41 ? 70  THR A HG1  5  
ATOM 9579  H HG21 . THR A 1 70  ? 16.975 -1.421  10.476 1.00 65.45 ? 70  THR A HG21 5  
ATOM 9580  H HG22 . THR A 1 70  ? 17.665 -2.256  9.083  1.00 53.00 ? 70  THR A HG22 5  
ATOM 9581  H HG23 . THR A 1 70  ? 17.356 -0.521  9.008  1.00 25.42 ? 70  THR A HG23 5  
ATOM 9582  N N    . THR A 1 71  ? 19.603 -3.159  7.618  1.00 2.13  ? 71  THR A N    5  
ATOM 9583  C CA   . THR A 1 71  ? 19.732 -3.270  6.171  1.00 73.11 ? 71  THR A CA   5  
ATOM 9584  C C    . THR A 1 71  ? 18.367 -3.420  5.508  1.00 44.24 ? 71  THR A C    5  
ATOM 9585  O O    . THR A 1 71  ? 17.421 -3.912  6.120  1.00 33.31 ? 71  THR A O    5  
ATOM 9586  C CB   . THR A 1 71  ? 20.616 -4.468  5.776  1.00 41.21 ? 71  THR A CB   5  
ATOM 9587  O OG1  . THR A 1 71  ? 21.421 -4.871  6.890  1.00 74.14 ? 71  THR A OG1  5  
ATOM 9588  C CG2  . THR A 1 71  ? 21.512 -4.114  4.598  1.00 10.14 ? 71  THR A CG2  5  
ATOM 9589  H H    . THR A 1 71  ? 19.032 -3.794  8.099  1.00 61.04 ? 71  THR A H    5  
ATOM 9590  H HA   . THR A 1 71  ? 20.201 -2.367  5.807  1.00 21.44 ? 71  THR A HA   5  
ATOM 9591  H HB   . THR A 1 71  ? 19.976 -5.289  5.488  1.00 73.22 ? 71  THR A HB   5  
ATOM 9592  H HG1  . THR A 1 71  ? 21.957 -4.130  7.182  1.00 62.30 ? 71  THR A HG1  5  
ATOM 9593  H HG21 . THR A 1 71  ? 22.336 -4.810  4.551  1.00 71.43 ? 71  THR A HG21 5  
ATOM 9594  H HG22 . THR A 1 71  ? 21.894 -3.112  4.725  1.00 1.14  ? 71  THR A HG22 5  
ATOM 9595  H HG23 . THR A 1 71  ? 20.942 -4.169  3.684  1.00 54.44 ? 71  THR A HG23 5  
ATOM 9596  N N    . GLU A 1 72  ? 18.275 -2.992  4.252  1.00 33.22 ? 72  GLU A N    5  
ATOM 9597  C CA   . GLU A 1 72  ? 17.025 -3.079  3.507  1.00 75.43 ? 72  GLU A CA   5  
ATOM 9598  C C    . GLU A 1 72  ? 17.291 -3.322  2.024  1.00 41.11 ? 72  GLU A C    5  
ATOM 9599  O O    . GLU A 1 72  ? 18.288 -2.851  1.476  1.00 63.13 ? 72  GLU A O    5  
ATOM 9600  C CB   . GLU A 1 72  ? 16.207 -1.798  3.686  1.00 23.33 ? 72  GLU A CB   5  
ATOM 9601  C CG   . GLU A 1 72  ? 15.960 -1.433  5.140  1.00 35.33 ? 72  GLU A CG   5  
ATOM 9602  C CD   . GLU A 1 72  ? 15.259 -0.098  5.295  1.00 14.42 ? 72  GLU A CD   5  
ATOM 9603  O OE1  . GLU A 1 72  ? 14.255 0.132   4.588  1.00 3.12  ? 72  GLU A OE1  5  
ATOM 9604  O OE2  . GLU A 1 72  ? 15.714 0.718   6.124  1.00 31.13 ? 72  GLU A OE2  5  
ATOM 9605  H H    . GLU A 1 72  ? 19.065 -2.609  3.818  1.00 51.12 ? 72  GLU A H    5  
ATOM 9606  H HA   . GLU A 1 72  ? 16.461 -3.912  3.900  1.00 65.43 ? 72  GLU A HA   5  
ATOM 9607  H HB2  . GLU A 1 72  ? 16.733 -0.981  3.216  1.00 45.14 ? 72  GLU A HB2  5  
ATOM 9608  H HB3  . GLU A 1 72  ? 15.251 -1.925  3.201  1.00 32.42 ? 72  GLU A HB3  5  
ATOM 9609  H HG2  . GLU A 1 72  ? 15.346 -2.199  5.591  1.00 54.31 ? 72  GLU A HG2  5  
ATOM 9610  H HG3  . GLU A 1 72  ? 16.909 -1.387  5.653  1.00 11.34 ? 72  GLU A HG3  5  
ATOM 9611  N N    . HIS A 1 73  ? 16.393 -4.061  1.380  1.00 13.51 ? 73  HIS A N    5  
ATOM 9612  C CA   . HIS A 1 73  ? 16.530 -4.366  -0.039 1.00 61.34 ? 73  HIS A CA   5  
ATOM 9613  C C    . HIS A 1 73  ? 15.162 -4.482  -0.705 1.00 61.21 ? 73  HIS A C    5  
ATOM 9614  O O    . HIS A 1 73  ? 14.176 -4.835  -0.059 1.00 70.55 ? 73  HIS A O    5  
ATOM 9615  C CB   . HIS A 1 73  ? 17.314 -5.665  -0.229 1.00 43.04 ? 73  HIS A CB   5  
ATOM 9616  C CG   . HIS A 1 73  ? 18.626 -5.684  0.494  1.00 34.10 ? 73  HIS A CG   5  
ATOM 9617  N ND1  . HIS A 1 73  ? 19.829 -5.416  -0.123 1.00 3.44  ? 73  HIS A ND1  5  
ATOM 9618  C CD2  . HIS A 1 73  ? 18.918 -5.940  1.791  1.00 74.23 ? 73  HIS A CD2  5  
ATOM 9619  C CE1  . HIS A 1 73  ? 20.805 -5.507  0.763  1.00 23.50 ? 73  HIS A CE1  5  
ATOM 9620  N NE2  . HIS A 1 73  ? 20.279 -5.824  1.932  1.00 34.31 ? 73  HIS A NE2  5  
ATOM 9621  H H    . HIS A 1 73  ? 15.619 -4.407  1.871  1.00 22.53 ? 73  HIS A H    5  
ATOM 9622  H HA   . HIS A 1 73  ? 17.074 -3.557  -0.502 1.00 10.31 ? 73  HIS A HA   5  
ATOM 9623  H HB2  . HIS A 1 73  ? 16.723 -6.492  0.135  1.00 13.44 ? 73  HIS A HB2  5  
ATOM 9624  H HB3  . HIS A 1 73  ? 17.513 -5.807  -1.282 1.00 30.40 ? 73  HIS A HB3  5  
ATOM 9625  H HD1  . HIS A 1 73  ? 19.950 -5.193  -1.069 1.00 4.22  ? 73  HIS A HD1  5  
ATOM 9626  H HD2  . HIS A 1 73  ? 18.212 -6.190  2.570  1.00 34.14 ? 73  HIS A HD2  5  
ATOM 9627  H HE1  . HIS A 1 73  ? 21.855 -5.350  0.566  1.00 41.02 ? 73  HIS A HE1  5  
ATOM 9628  N N    . GLU A 1 74  ? 15.111 -4.181  -1.999 1.00 24.40 ? 74  GLU A N    5  
ATOM 9629  C CA   . GLU A 1 74  ? 13.864 -4.251  -2.750 1.00 53.34 ? 74  GLU A CA   5  
ATOM 9630  C C    . GLU A 1 74  ? 13.506 -5.697  -3.080 1.00 25.33 ? 74  GLU A C    5  
ATOM 9631  O O    . GLU A 1 74  ? 14.360 -6.479  -3.500 1.00 3.33  ? 74  GLU A O    5  
ATOM 9632  C CB   . GLU A 1 74  ? 13.973 -3.435  -4.040 1.00 41.40 ? 74  GLU A CB   5  
ATOM 9633  C CG   . GLU A 1 74  ? 14.785 -4.119  -5.126 1.00 65.14 ? 74  GLU A CG   5  
ATOM 9634  C CD   . GLU A 1 74  ? 14.882 -3.290  -6.392 1.00 70.15 ? 74  GLU A CD   5  
ATOM 9635  O OE1  . GLU A 1 74  ? 15.961 -3.292  -7.021 1.00 43.20 ? 74  GLU A OE1  5  
ATOM 9636  O OE2  . GLU A 1 74  ? 13.879 -2.640  -6.755 1.00 3.05  ? 74  GLU A OE2  5  
ATOM 9637  H H    . GLU A 1 74  ? 15.932 -3.906  -2.459 1.00 31.14 ? 74  GLU A H    5  
ATOM 9638  H HA   . GLU A 1 74  ? 13.082 -3.831  -2.135 1.00 43.11 ? 74  GLU A HA   5  
ATOM 9639  H HB2  . GLU A 1 74  ? 12.979 -3.253  -4.422 1.00 44.33 ? 74  GLU A HB2  5  
ATOM 9640  H HB3  . GLU A 1 74  ? 14.440 -2.488  -3.813 1.00 43.44 ? 74  GLU A HB3  5  
ATOM 9641  H HG2  . GLU A 1 74  ? 15.783 -4.297  -4.754 1.00 43.31 ? 74  GLU A HG2  5  
ATOM 9642  H HG3  . GLU A 1 74  ? 14.319 -5.063  -5.366 1.00 73.13 ? 74  GLU A HG3  5  
ATOM 9643  N N    . TYR A 1 75  ? 12.240 -6.046  -2.885 1.00 73.35 ? 75  TYR A N    5  
ATOM 9644  C CA   . TYR A 1 75  ? 11.769 -7.399  -3.158 1.00 62.15 ? 75  TYR A CA   5  
ATOM 9645  C C    . TYR A 1 75  ? 10.769 -7.406  -4.310 1.00 55.11 ? 75  TYR A C    5  
ATOM 9646  O O    . TYR A 1 75  ? 10.606 -6.407  -5.012 1.00 33.43 ? 75  TYR A O    5  
ATOM 9647  C CB   . TYR A 1 75  ? 11.128 -8.001  -1.907 1.00 55.31 ? 75  TYR A CB   5  
ATOM 9648  C CG   . TYR A 1 75  ? 11.730 -9.325  -1.495 1.00 11.24 ? 75  TYR A CG   5  
ATOM 9649  C CD1  . TYR A 1 75  ? 11.069 -10.520 -1.749 1.00 72.32 ? 75  TYR A CD1  5  
ATOM 9650  C CD2  . TYR A 1 75  ? 12.959 -9.381  -0.850 1.00 2.43  ? 75  TYR A CD2  5  
ATOM 9651  C CE1  . TYR A 1 75  ? 11.615 -11.732 -1.374 1.00 32.54 ? 75  TYR A CE1  5  
ATOM 9652  C CE2  . TYR A 1 75  ? 13.513 -10.588 -0.472 1.00 24.31 ? 75  TYR A CE2  5  
ATOM 9653  C CZ   . TYR A 1 75  ? 12.837 -11.761 -0.736 1.00 24.32 ? 75  TYR A CZ   5  
ATOM 9654  O OH   . TYR A 1 75  ? 13.386 -12.966 -0.360 1.00 35.13 ? 75  TYR A OH   5  
ATOM 9655  H H    . TYR A 1 75  ? 11.606 -5.379  -2.549 1.00 32.11 ? 75  TYR A H    5  
ATOM 9656  H HA   . TYR A 1 75  ? 12.624 -7.998  -3.436 1.00 22.00 ? 75  TYR A HA   5  
ATOM 9657  H HB2  . TYR A 1 75  ? 11.245 -7.313  -1.084 1.00 45.12 ? 75  TYR A HB2  5  
ATOM 9658  H HB3  . TYR A 1 75  ? 10.075 -8.158  -2.091 1.00 13.32 ? 75  TYR A HB3  5  
ATOM 9659  H HD1  . TYR A 1 75  ? 10.111 -10.495 -2.249 1.00 43.50 ? 75  TYR A HD1  5  
ATOM 9660  H HD2  . TYR A 1 75  ? 13.486 -8.460  -0.644 1.00 52.21 ? 75  TYR A HD2  5  
ATOM 9661  H HE1  . TYR A 1 75  ? 11.086 -12.651 -1.580 1.00 61.32 ? 75  TYR A HE1  5  
ATOM 9662  H HE2  . TYR A 1 75  ? 14.470 -10.611 0.028  1.00 25.00 ? 75  TYR A HE2  5  
ATOM 9663  H HH   . TYR A 1 75  ? 14.336 -12.870 -0.268 1.00 24.14 ? 75  TYR A HH   5  
ATOM 9664  N N    . ASP A 1 76  ? 10.100 -8.539  -4.498 1.00 4.43  ? 76  ASP A N    5  
ATOM 9665  C CA   . ASP A 1 76  ? 9.114  -8.677  -5.563 1.00 14.24 ? 76  ASP A CA   5  
ATOM 9666  C C    . ASP A 1 76  ? 8.088  -7.549  -5.503 1.00 31.22 ? 76  ASP A C    5  
ATOM 9667  O O    . ASP A 1 76  ? 7.874  -6.838  -6.485 1.00 10.24 ? 76  ASP A O    5  
ATOM 9668  C CB   . ASP A 1 76  ? 8.409  -10.030 -5.461 1.00 74.30 ? 76  ASP A CB   5  
ATOM 9669  C CG   . ASP A 1 76  ? 8.955  -11.043 -6.448 1.00 21.33 ? 76  ASP A CG   5  
ATOM 9670  O OD1  . ASP A 1 76  ? 9.291  -12.167 -6.020 1.00 24.45 ? 76  ASP A OD1  5  
ATOM 9671  O OD2  . ASP A 1 76  ? 9.046  -10.712 -7.648 1.00 73.32 ? 76  ASP A OD2  5  
ATOM 9672  H H    . ASP A 1 76  ? 10.274 -9.300  -3.905 1.00 44.12 ? 76  ASP A H    5  
ATOM 9673  H HA   . ASP A 1 76  ? 9.635  -8.623  -6.507 1.00 14.25 ? 76  ASP A HA   5  
ATOM 9674  H HB2  . ASP A 1 76  ? 8.538  -10.422 -4.463 1.00 31.44 ? 76  ASP A HB2  5  
ATOM 9675  H HB3  . ASP A 1 76  ? 7.355  -9.896  -5.657 1.00 0.52  ? 76  ASP A HB3  5  
ATOM 9676  N N    . PHE A 1 77  ? 7.455  -7.392  -4.345 1.00 24.54 ? 77  PHE A N    5  
ATOM 9677  C CA   . PHE A 1 77  ? 6.450  -6.353  -4.157 1.00 42.21 ? 77  PHE A CA   5  
ATOM 9678  C C    . PHE A 1 77  ? 6.723  -5.555  -2.885 1.00 63.41 ? 77  PHE A C    5  
ATOM 9679  O O    . PHE A 1 77  ? 6.287  -4.413  -2.750 1.00 4.11  ? 77  PHE A O    5  
ATOM 9680  C CB   . PHE A 1 77  ? 5.052  -6.971  -4.095 1.00 11.12 ? 77  PHE A CB   5  
ATOM 9681  C CG   . PHE A 1 77  ? 4.737  -7.860  -5.263 1.00 60.34 ? 77  PHE A CG   5  
ATOM 9682  C CD1  . PHE A 1 77  ? 4.363  -9.180  -5.066 1.00 10.32 ? 77  PHE A CD1  5  
ATOM 9683  C CD2  . PHE A 1 77  ? 4.816  -7.377  -6.560 1.00 34.04 ? 77  PHE A CD2  5  
ATOM 9684  C CE1  . PHE A 1 77  ? 4.072  -10.001 -6.139 1.00 41.20 ? 77  PHE A CE1  5  
ATOM 9685  C CE2  . PHE A 1 77  ? 4.526  -8.193  -7.637 1.00 35.24 ? 77  PHE A CE2  5  
ATOM 9686  C CZ   . PHE A 1 77  ? 4.155  -9.507  -7.426 1.00 54.02 ? 77  PHE A CZ   5  
ATOM 9687  H H    . PHE A 1 77  ? 7.669  -7.991  -3.598 1.00 64.12 ? 77  PHE A H    5  
ATOM 9688  H HA   . PHE A 1 77  ? 6.502  -5.686  -5.004 1.00 23.01 ? 77  PHE A HA   5  
ATOM 9689  H HB2  . PHE A 1 77  ? 4.968  -7.563  -3.196 1.00 15.21 ? 77  PHE A HB2  5  
ATOM 9690  H HB3  . PHE A 1 77  ? 4.318  -6.180  -4.070 1.00 54.05 ? 77  PHE A HB3  5  
ATOM 9691  H HD1  . PHE A 1 77  ? 4.298  -9.567  -4.059 1.00 25.24 ? 77  PHE A HD1  5  
ATOM 9692  H HD2  . PHE A 1 77  ? 5.107  -6.350  -6.726 1.00 34.30 ? 77  PHE A HD2  5  
ATOM 9693  H HE1  . PHE A 1 77  ? 3.782  -11.027 -5.971 1.00 25.44 ? 77  PHE A HE1  5  
ATOM 9694  H HE2  . PHE A 1 77  ? 4.591  -7.805  -8.642 1.00 50.20 ? 77  PHE A HE2  5  
ATOM 9695  H HZ   . PHE A 1 77  ? 3.927  -10.146 -8.266 1.00 22.51 ? 77  PHE A HZ   5  
ATOM 9696  N N    . GLY A 1 78  ? 7.448  -6.168  -1.954 1.00 3.22  ? 78  GLY A N    5  
ATOM 9697  C CA   . GLY A 1 78  ? 7.767  -5.502  -0.705 1.00 11.44 ? 78  GLY A CA   5  
ATOM 9698  C C    . GLY A 1 78  ? 9.256  -5.282  -0.528 1.00 23.53 ? 78  GLY A C    5  
ATOM 9699  O O    . GLY A 1 78  ? 10.022 -5.371  -1.488 1.00 54.24 ? 78  GLY A O    5  
ATOM 9700  H H    . GLY A 1 78  ? 7.769  -7.080  -2.116 1.00 44.55 ? 78  GLY A H    5  
ATOM 9701  H HA2  . GLY A 1 78  ? 7.267  -4.545  -0.682 1.00 45.51 ? 78  GLY A HA2  5  
ATOM 9702  H HA3  . GLY A 1 78  ? 7.404  -6.105  0.115  1.00 70.04 ? 78  GLY A HA3  5  
ATOM 9703  N N    . ILE A 1 79  ? 9.668  -4.994  0.702  1.00 24.52 ? 79  ILE A N    5  
ATOM 9704  C CA   . ILE A 1 79  ? 11.076 -4.761  1.001  1.00 71.53 ? 79  ILE A CA   5  
ATOM 9705  C C    . ILE A 1 79  ? 11.544 -5.635  2.160  1.00 60.25 ? 79  ILE A C    5  
ATOM 9706  O O    . ILE A 1 79  ? 10.888 -5.711  3.198  1.00 20.25 ? 79  ILE A O    5  
ATOM 9707  C CB   . ILE A 1 79  ? 11.341 -3.284  1.347  1.00 60.34 ? 79  ILE A CB   5  
ATOM 9708  C CG1  . ILE A 1 79  ? 11.485 -2.456  0.068  1.00 62.40 ? 79  ILE A CG1  5  
ATOM 9709  C CG2  . ILE A 1 79  ? 12.588 -3.158  2.209  1.00 13.14 ? 79  ILE A CG2  5  
ATOM 9710  C CD1  . ILE A 1 79  ? 10.210 -2.366  -0.741 1.00 31.35 ? 79  ILE A CD1  5  
ATOM 9711  H H    . ILE A 1 79  ? 9.010  -4.938  1.426  1.00 65.11 ? 79  ILE A H    5  
ATOM 9712  H HA   . ILE A 1 79  ? 11.649 -5.013  0.120  1.00 42.31 ? 79  ILE A HA   5  
ATOM 9713  H HB   . ILE A 1 79  ? 10.501 -2.914  1.914  1.00 71.21 ? 79  ILE A HB   5  
ATOM 9714  H HG12 . ILE A 1 79  ? 11.784 -1.453  0.328  1.00 60.22 ? 79  ILE A HG12 5  
ATOM 9715  H HG13 . ILE A 1 79  ? 12.245 -2.903  -0.557 1.00 73.33 ? 79  ILE A HG13 5  
ATOM 9716  H HG21 . ILE A 1 79  ? 13.372 -3.779  1.802  1.00 33.21 ? 79  ILE A HG21 5  
ATOM 9717  H HG22 . ILE A 1 79  ? 12.914 -2.129  2.220  1.00 4.15  ? 79  ILE A HG22 5  
ATOM 9718  H HG23 . ILE A 1 79  ? 12.363 -3.476  3.216  1.00 11.33 ? 79  ILE A HG23 5  
ATOM 9719  H HD11 . ILE A 1 79  ? 10.242 -3.086  -1.545 1.00 73.02 ? 79  ILE A HD11 5  
ATOM 9720  H HD12 . ILE A 1 79  ? 9.364  -2.574  -0.103 1.00 73.05 ? 79  ILE A HD12 5  
ATOM 9721  H HD13 . ILE A 1 79  ? 10.115 -1.372  -1.152 1.00 54.33 ? 79  ILE A HD13 5  
ATOM 9722  N N    . VAL A 1 80  ? 12.684 -6.293  1.975  1.00 45.33 ? 80  VAL A N    5  
ATOM 9723  C CA   . VAL A 1 80  ? 13.243 -7.159  3.006  1.00 61.33 ? 80  VAL A CA   5  
ATOM 9724  C C    . VAL A 1 80  ? 14.243 -6.405  3.875  1.00 35.04 ? 80  VAL A C    5  
ATOM 9725  O O    . VAL A 1 80  ? 15.153 -5.751  3.367  1.00 2.33  ? 80  VAL A O    5  
ATOM 9726  C CB   . VAL A 1 80  ? 13.939 -8.387  2.390  1.00 64.42 ? 80  VAL A CB   5  
ATOM 9727  C CG1  . VAL A 1 80  ? 15.091 -7.956  1.495  1.00 2.41  ? 80  VAL A CG1  5  
ATOM 9728  C CG2  . VAL A 1 80  ? 14.426 -9.327  3.483  1.00 73.24 ? 80  VAL A CG2  5  
ATOM 9729  H H    . VAL A 1 80  ? 13.162 -6.192  1.125  1.00 50.20 ? 80  VAL A H    5  
ATOM 9730  H HA   . VAL A 1 80  ? 12.430 -7.506  3.627  1.00 60.43 ? 80  VAL A HA   5  
ATOM 9731  H HB   . VAL A 1 80  ? 13.220 -8.917  1.783  1.00 41.14 ? 80  VAL A HB   5  
ATOM 9732  H HG11 . VAL A 1 80  ? 15.486 -8.817  0.977  1.00 41.15 ? 80  VAL A HG11 5  
ATOM 9733  H HG12 . VAL A 1 80  ? 14.737 -7.232  0.776  1.00 50.32 ? 80  VAL A HG12 5  
ATOM 9734  H HG13 . VAL A 1 80  ? 15.869 -7.512  2.099  1.00 22.32 ? 80  VAL A HG13 5  
ATOM 9735  H HG21 . VAL A 1 80  ? 14.841 -10.217 3.033  1.00 44.52 ? 80  VAL A HG21 5  
ATOM 9736  H HG22 . VAL A 1 80  ? 15.185 -8.833  4.071  1.00 23.24 ? 80  VAL A HG22 5  
ATOM 9737  H HG23 . VAL A 1 80  ? 13.597 -9.599  4.120  1.00 43.24 ? 80  VAL A HG23 5  
ATOM 9738  N N    . ARG A 1 81  ? 14.066 -6.501  5.189  1.00 23.41 ? 81  ARG A N    5  
ATOM 9739  C CA   . ARG A 1 81  ? 14.953 -5.827  6.130  1.00 35.53 ? 81  ARG A CA   5  
ATOM 9740  C C    . ARG A 1 81  ? 15.579 -6.827  7.099  1.00 54.14 ? 81  ARG A C    5  
ATOM 9741  O O    . ARG A 1 81  ? 14.880 -7.464  7.889  1.00 40.55 ? 81  ARG A O    5  
ATOM 9742  C CB   . ARG A 1 81  ? 14.185 -4.758  6.910  1.00 62.01 ? 81  ARG A CB   5  
ATOM 9743  C CG   . ARG A 1 81  ? 13.213 -3.962  6.055  1.00 12.43 ? 81  ARG A CG   5  
ATOM 9744  C CD   . ARG A 1 81  ? 12.421 -2.968  6.891  1.00 32.53 ? 81  ARG A CD   5  
ATOM 9745  N NE   . ARG A 1 81  ? 13.253 -1.867  7.368  1.00 64.34 ? 81  ARG A NE   5  
ATOM 9746  C CZ   . ARG A 1 81  ? 12.783 -0.836  8.060  1.00 35.23 ? 81  ARG A CZ   5  
ATOM 9747  N NH1  . ARG A 1 81  ? 11.492 -0.766  8.356  1.00 20.02 ? 81  ARG A NH1  5  
ATOM 9748  N NH2  . ARG A 1 81  ? 13.603 0.127   8.459  1.00 43.22 ? 81  ARG A NH2  5  
ATOM 9749  H H    . ARG A 1 81  ? 13.322 -7.038  5.534  1.00 40.11 ? 81  ARG A H    5  
ATOM 9750  H HA   . ARG A 1 81  ? 15.739 -5.352  5.564  1.00 61.35 ? 81  ARG A HA   5  
ATOM 9751  H HB2  . ARG A 1 81  ? 13.626 -5.237  7.701  1.00 43.24 ? 81  ARG A HB2  5  
ATOM 9752  H HB3  . ARG A 1 81  ? 14.894 -4.070  7.346  1.00 32.44 ? 81  ARG A HB3  5  
ATOM 9753  H HG2  . ARG A 1 81  ? 13.768 -3.420  5.304  1.00 63.01 ? 81  ARG A HG2  5  
ATOM 9754  H HG3  . ARG A 1 81  ? 12.527 -4.644  5.577  1.00 73.25 ? 81  ARG A HG3  5  
ATOM 9755  H HD2  . ARG A 1 81  ? 11.621 -2.567  6.287  1.00 11.03 ? 81  ARG A HD2  5  
ATOM 9756  H HD3  . ARG A 1 81  ? 12.004 -3.487  7.742  1.00 51.31 ? 81  ARG A HD3  5  
ATOM 9757  H HE   . ARG A 1 81  ? 14.210 -1.899  7.160  1.00 2.00  ? 81  ARG A HE   5  
ATOM 9758  H HH11 . ARG A 1 81  ? 10.871 -1.491  8.058  1.00 25.01 ? 81  ARG A HH11 5  
ATOM 9759  H HH12 . ARG A 1 81  ? 11.140 0.011   8.879  1.00 62.11 ? 81  ARG A HH12 5  
ATOM 9760  H HH21 . ARG A 1 81  ? 14.577 0.078   8.238  1.00 72.42 ? 81  ARG A HH21 5  
ATOM 9761  H HH22 . ARG A 1 81  ? 13.248 0.903   8.980  1.00 61.32 ? 81  ARG A HH22 5  
ATOM 9762  N N    . LEU A 1 82  ? 16.899 -6.960  7.032  1.00 74.25 ? 82  LEU A N    5  
ATOM 9763  C CA   . LEU A 1 82  ? 17.620 -7.883  7.902  1.00 53.42 ? 82  LEU A CA   5  
ATOM 9764  C C    . LEU A 1 82  ? 18.170 -7.158  9.126  1.00 23.31 ? 82  LEU A C    5  
ATOM 9765  O O    . LEU A 1 82  ? 18.783 -6.097  9.010  1.00 44.40 ? 82  LEU A O    5  
ATOM 9766  C CB   . LEU A 1 82  ? 18.761 -8.552  7.134  1.00 5.55  ? 82  LEU A CB   5  
ATOM 9767  C CG   . LEU A 1 82  ? 19.149 -9.956  7.598  1.00 71.44 ? 82  LEU A CG   5  
ATOM 9768  C CD1  . LEU A 1 82  ? 19.655 -9.925  9.031  1.00 22.13 ? 82  LEU A CD1  5  
ATOM 9769  C CD2  . LEU A 1 82  ? 17.967 -10.906 7.468  1.00 14.41 ? 82  LEU A CD2  5  
ATOM 9770  H H    . LEU A 1 82  ? 17.401 -6.426  6.382  1.00 22.10 ? 82  LEU A H    5  
ATOM 9771  H HA   . LEU A 1 82  ? 16.924 -8.641  8.230  1.00 42.25 ? 82  LEU A HA   5  
ATOM 9772  H HB2  . LEU A 1 82  ? 18.471 -8.614  6.097  1.00 34.12 ? 82  LEU A HB2  5  
ATOM 9773  H HB3  . LEU A 1 82  ? 19.634 -7.920  7.225  1.00 51.15 ? 82  LEU A HB3  5  
ATOM 9774  H HG   . LEU A 1 82  ? 19.948 -10.328 6.970  1.00 15.13 ? 82  LEU A HG   5  
ATOM 9775  H HD11 . LEU A 1 82  ? 18.816 -9.953  9.710  1.00 63.51 ? 82  LEU A HD11 5  
ATOM 9776  H HD12 . LEU A 1 82  ? 20.220 -9.019  9.194  1.00 55.20 ? 82  LEU A HD12 5  
ATOM 9777  H HD13 . LEU A 1 82  ? 20.291 -10.781 9.207  1.00 13.22 ? 82  LEU A HD13 5  
ATOM 9778  H HD21 . LEU A 1 82  ? 18.321 -11.926 7.484  1.00 1.45  ? 82  LEU A HD21 5  
ATOM 9779  H HD22 . LEU A 1 82  ? 17.455 -10.718 6.535  1.00 15.54 ? 82  LEU A HD22 5  
ATOM 9780  H HD23 . LEU A 1 82  ? 17.286 -10.747 8.291  1.00 21.34 ? 82  LEU A HD23 5  
ATOM 9781  N N    . THR A 1 83  ? 17.949 -7.740  10.301 1.00 64.42 ? 83  THR A N    5  
ATOM 9782  C CA   . THR A 1 83  ? 18.424 -7.152  11.547 1.00 51.33 ? 83  THR A CA   5  
ATOM 9783  C C    . THR A 1 83  ? 19.091 -8.199  12.431 1.00 72.22 ? 83  THR A C    5  
ATOM 9784  O O    . THR A 1 83  ? 18.465 -9.183  12.827 1.00 73.24 ? 83  THR A O    5  
ATOM 9785  C CB   . THR A 1 83  ? 17.273 -6.492  12.330 1.00 24.14 ? 83  THR A CB   5  
ATOM 9786  O OG1  . THR A 1 83  ? 17.186 -5.103  11.995 1.00 14.20 ? 83  THR A OG1  5  
ATOM 9787  C CG2  . THR A 1 83  ? 17.482 -6.645  13.829 1.00 3.04  ? 83  THR A CG2  5  
ATOM 9788  H H    . THR A 1 83  ? 17.454 -8.586  10.329 1.00 45.35 ? 83  THR A H    5  
ATOM 9789  H HA   . THR A 1 83  ? 19.148 -6.388  11.301 1.00 72.55 ? 83  THR A HA   5  
ATOM 9790  H HB   . THR A 1 83  ? 16.348 -6.979  12.059 1.00 33.43 ? 83  THR A HB   5  
ATOM 9791  H HG1  . THR A 1 83  ? 16.634 -4.652  12.639 1.00 22.24 ? 83  THR A HG1  5  
ATOM 9792  H HG21 . THR A 1 83  ? 16.790 -6.005  14.357 1.00 61.34 ? 83  THR A HG21 5  
ATOM 9793  H HG22 . THR A 1 83  ? 18.494 -6.366  14.082 1.00 65.20 ? 83  THR A HG22 5  
ATOM 9794  H HG23 . THR A 1 83  ? 17.310 -7.672  14.113 1.00 21.24 ? 83  THR A HG23 5  
ATOM 9795  N N    . THR A 1 84  ? 20.366 -7.982  12.739 1.00 73.21 ? 84  THR A N    5  
ATOM 9796  C CA   . THR A 1 84  ? 21.118 -8.908  13.576 1.00 11.13 ? 84  THR A CA   5  
ATOM 9797  C C    . THR A 1 84  ? 21.445 -8.284  14.928 1.00 23.43 ? 84  THR A C    5  
ATOM 9798  O O    . THR A 1 84  ? 21.525 -7.062  15.056 1.00 32.44 ? 84  THR A O    5  
ATOM 9799  C CB   . THR A 1 84  ? 22.428 -9.345  12.894 1.00 2.53  ? 84  THR A CB   5  
ATOM 9800  O OG1  . THR A 1 84  ? 23.135 -8.197  12.410 1.00 13.24 ? 84  THR A OG1  5  
ATOM 9801  C CG2  . THR A 1 84  ? 22.147 -10.297 11.742 1.00 42.44 ? 84  THR A CG2  5  
ATOM 9802  H H    . THR A 1 84  ? 20.810 -7.180  12.393 1.00 11.03 ? 84  THR A H    5  
ATOM 9803  H HA   . THR A 1 84  ? 20.508 -9.786  13.734 1.00 45.14 ? 84  THR A HA   5  
ATOM 9804  H HB   . THR A 1 84  ? 23.042 -9.855  13.622 1.00 23.42 ? 84  THR A HB   5  
ATOM 9805  H HG1  . THR A 1 84  ? 22.769 -7.929  11.564 1.00 53.01 ? 84  THR A HG1  5  
ATOM 9806  H HG21 . THR A 1 84  ? 22.714 -9.990  10.875 1.00 50.00 ? 84  THR A HG21 5  
ATOM 9807  H HG22 . THR A 1 84  ? 21.093 -10.278 11.508 1.00 1.50  ? 84  THR A HG22 5  
ATOM 9808  H HG23 . THR A 1 84  ? 22.435 -11.298 12.024 1.00 45.21 ? 84  THR A HG23 5  
ATOM 9809  N N    . TYR A 1 85  ? 21.635 -9.131  15.934 1.00 0.23  ? 85  TYR A N    5  
ATOM 9810  C CA   . TYR A 1 85  ? 21.952 -8.662  17.278 1.00 64.10 ? 85  TYR A CA   5  
ATOM 9811  C C    . TYR A 1 85  ? 23.065 -9.501  17.899 1.00 61.10 ? 85  TYR A C    5  
ATOM 9812  O O    . TYR A 1 85  ? 23.004 -10.731 17.903 1.00 51.21 ? 85  TYR A O    5  
ATOM 9813  C CB   . TYR A 1 85  ? 20.707 -8.710  18.165 1.00 41.31 ? 85  TYR A CB   5  
ATOM 9814  C CG   . TYR A 1 85  ? 19.965 -7.394  18.238 1.00 25.15 ? 85  TYR A CG   5  
ATOM 9815  C CD1  . TYR A 1 85  ? 18.911 -7.120  17.376 1.00 0.41  ? 85  TYR A CD1  5  
ATOM 9816  C CD2  . TYR A 1 85  ? 20.320 -6.425  19.169 1.00 35.43 ? 85  TYR A CD2  5  
ATOM 9817  C CE1  . TYR A 1 85  ? 18.231 -5.919  17.439 1.00 11.20 ? 85  TYR A CE1  5  
ATOM 9818  C CE2  . TYR A 1 85  ? 19.644 -5.222  19.240 1.00 21.54 ? 85  TYR A CE2  5  
ATOM 9819  C CZ   . TYR A 1 85  ? 18.601 -4.974  18.373 1.00 12.21 ? 85  TYR A CZ   5  
ATOM 9820  O OH   . TYR A 1 85  ? 17.926 -3.776  18.440 1.00 65.11 ? 85  TYR A OH   5  
ATOM 9821  H H    . TYR A 1 85  ? 21.558 -10.094 15.770 1.00 3.12  ? 85  TYR A H    5  
ATOM 9822  H HA   . TYR A 1 85  ? 22.289 -7.639  17.201 1.00 11.54 ? 85  TYR A HA   5  
ATOM 9823  H HB2  . TYR A 1 85  ? 20.026 -9.452  17.778 1.00 22.22 ? 85  TYR A HB2  5  
ATOM 9824  H HB3  . TYR A 1 85  ? 20.998 -8.983  19.168 1.00 25.24 ? 85  TYR A HB3  5  
ATOM 9825  H HD1  . TYR A 1 85  ? 18.624 -7.862  16.645 1.00 15.15 ? 85  TYR A HD1  5  
ATOM 9826  H HD2  . TYR A 1 85  ? 21.138 -6.623  19.847 1.00 74.42 ? 85  TYR A HD2  5  
ATOM 9827  H HE1  . TYR A 1 85  ? 17.414 -5.724  16.760 1.00 13.43 ? 85  TYR A HE1  5  
ATOM 9828  H HE2  . TYR A 1 85  ? 19.934 -4.482  19.971 1.00 30.24 ? 85  TYR A HE2  5  
ATOM 9829  H HH   . TYR A 1 85  ? 16.981 -3.941  18.442 1.00 33.32 ? 85  TYR A HH   5  
ATOM 9830  N N    . LYS A 1 86  ? 24.082 -8.827  18.424 1.00 4.14  ? 86  LYS A N    5  
ATOM 9831  C CA   . LYS A 1 86  ? 25.210 -9.507  19.051 1.00 73.21 ? 86  LYS A CA   5  
ATOM 9832  C C    . LYS A 1 86  ? 24.736 -10.426 20.173 1.00 52.52 ? 86  LYS A C    5  
ATOM 9833  O O    . LYS A 1 86  ? 24.026 -9.995  21.082 1.00 12.53 ? 86  LYS A O    5  
ATOM 9834  C CB   . LYS A 1 86  ? 26.207 -8.485  19.601 1.00 11.00 ? 86  LYS A CB   5  
ATOM 9835  C CG   . LYS A 1 86  ? 27.627 -8.692  19.104 1.00 61.40 ? 86  LYS A CG   5  
ATOM 9836  C CD   . LYS A 1 86  ? 27.936 -7.803  17.911 1.00 31.22 ? 86  LYS A CD   5  
ATOM 9837  C CE   . LYS A 1 86  ? 29.249 -8.194  17.250 1.00 53.22 ? 86  LYS A CE   5  
ATOM 9838  N NZ   . LYS A 1 86  ? 30.363 -7.291  17.652 1.00 33.25 ? 86  LYS A NZ   5  
ATOM 9839  H H    . LYS A 1 86  ? 24.074 -7.847  18.391 1.00 42.22 ? 86  LYS A H    5  
ATOM 9840  H HA   . LYS A 1 86  ? 25.698 -10.104 18.296 1.00 44.23 ? 86  LYS A HA   5  
ATOM 9841  H HB2  . LYS A 1 86  ? 25.887 -7.495  19.310 1.00 31.34 ? 86  LYS A HB2  5  
ATOM 9842  H HB3  . LYS A 1 86  ? 26.212 -8.550  20.680 1.00 44.13 ? 86  LYS A HB3  5  
ATOM 9843  H HG2  . LYS A 1 86  ? 28.316 -8.458  19.902 1.00 61.02 ? 86  LYS A HG2  5  
ATOM 9844  H HG3  . LYS A 1 86  ? 27.749 -9.726  18.812 1.00 3.13  ? 86  LYS A HG3  5  
ATOM 9845  H HD2  . LYS A 1 86  ? 27.140 -7.897  17.188 1.00 52.44 ? 86  LYS A HD2  5  
ATOM 9846  H HD3  . LYS A 1 86  ? 28.002 -6.777  18.246 1.00 64.44 ? 86  LYS A HD3  5  
ATOM 9847  H HE2  . LYS A 1 86  ? 29.494 -9.205  17.537 1.00 44.33 ? 86  LYS A HE2  5  
ATOM 9848  H HE3  . LYS A 1 86  ? 29.125 -8.144  16.178 1.00 4.30  ? 86  LYS A HE3  5  
ATOM 9849  H HZ1  . LYS A 1 86  ? 31.034 -7.179  16.866 1.00 73.45 ? 86  LYS A HZ1  5  
ATOM 9850  H HZ2  . LYS A 1 86  ? 30.868 -7.690  18.469 1.00 12.44 ? 86  LYS A HZ2  5  
ATOM 9851  H HZ3  . LYS A 1 86  ? 29.989 -6.356  17.911 1.00 3.14  ? 86  LYS A HZ3  5  
ATOM 9852  N N    . CYS A 1 87  ? 25.134 -11.691 20.103 1.00 54.10 ? 87  CYS A N    5  
ATOM 9853  C CA   . CYS A 1 87  ? 24.750 -12.670 21.114 1.00 53.02 ? 87  CYS A CA   5  
ATOM 9854  C C    . CYS A 1 87  ? 25.980 -13.243 21.811 1.00 54.52 ? 87  CYS A C    5  
ATOM 9855  O O    . CYS A 1 87  ? 27.036 -13.402 21.199 1.00 62.43 ? 87  CYS A O    5  
ATOM 9856  C CB   . CYS A 1 87  ? 23.937 -13.799 20.478 1.00 42.22 ? 87  CYS A CB   5  
ATOM 9857  S SG   . CYS A 1 87  ? 22.433 -13.245 19.641 1.00 43.23 ? 87  CYS A SG   5  
ATOM 9858  H H    . CYS A 1 87  ? 25.698 -11.975 19.354 1.00 44.51 ? 87  CYS A H    5  
ATOM 9859  H HA   . CYS A 1 87  ? 24.138 -12.166 21.846 1.00 31.15 ? 87  CYS A HA   5  
ATOM 9860  H HB2  . CYS A 1 87  ? 24.550 -14.307 19.748 1.00 44.52 ? 87  CYS A HB2  5  
ATOM 9861  H HB3  . CYS A 1 87  ? 23.648 -14.501 21.246 1.00 41.33 ? 87  CYS A HB3  5  
ATOM 9862  H HG   . CYS A 1 87  ? 21.481 -13.120 20.552 1.00 32.22 ? 87  CYS A HG   5  
ATOM 9863  N N    . THR A 1 88  ? 25.836 -13.549 23.097 1.00 50.34 ? 88  THR A N    5  
ATOM 9864  C CA   . THR A 1 88  ? 26.935 -14.101 23.878 1.00 3.53  ? 88  THR A CA   5  
ATOM 9865  C C    . THR A 1 88  ? 26.743 -15.593 24.120 1.00 32.22 ? 88  THR A C    5  
ATOM 9866  O O    . THR A 1 88  ? 25.616 -16.069 24.268 1.00 41.51 ? 88  THR A O    5  
ATOM 9867  C CB   . THR A 1 88  ? 27.074 -13.386 25.236 1.00 53.33 ? 88  THR A CB   5  
ATOM 9868  O OG1  . THR A 1 88  ? 27.050 -11.967 25.047 1.00 41.53 ? 88  THR A OG1  5  
ATOM 9869  C CG2  . THR A 1 88  ? 28.366 -13.788 25.930 1.00 31.50 ? 88  THR A CG2  5  
ATOM 9870  H H    . THR A 1 88  ? 24.969 -13.398 23.529 1.00 64.44 ? 88  THR A H    5  
ATOM 9871  H HA   . THR A 1 88  ? 27.849 -13.951 23.321 1.00 12.43 ? 88  THR A HA   5  
ATOM 9872  H HB   . THR A 1 88  ? 26.241 -13.672 25.863 1.00 42.25 ? 88  THR A HB   5  
ATOM 9873  H HG1  . THR A 1 88  ? 27.527 -11.742 24.244 1.00 62.40 ? 88  THR A HG1  5  
ATOM 9874  H HG21 . THR A 1 88  ? 28.748 -12.951 26.494 1.00 11.52 ? 88  THR A HG21 5  
ATOM 9875  H HG22 . THR A 1 88  ? 29.094 -14.087 25.190 1.00 10.25 ? 88  THR A HG22 5  
ATOM 9876  H HG23 . THR A 1 88  ? 28.173 -14.614 26.599 1.00 54.34 ? 88  THR A HG23 5  
ATOM 9877  N N    . LEU A 1 89  ? 27.848 -16.329 24.160 1.00 4.43  ? 89  LEU A N    5  
ATOM 9878  C CA   . LEU A 1 89  ? 27.801 -17.769 24.385 1.00 24.15 ? 89  LEU A CA   5  
ATOM 9879  C C    . LEU A 1 89  ? 27.515 -18.082 25.851 1.00 71.24 ? 89  LEU A C    5  
ATOM 9880  O O    . LEU A 1 89  ? 28.349 -17.841 26.722 1.00 44.24 ? 89  LEU A O    5  
ATOM 9881  C CB   . LEU A 1 89  ? 29.122 -18.415 23.963 1.00 3.41  ? 89  LEU A CB   5  
ATOM 9882  C CG   . LEU A 1 89  ? 29.277 -19.901 24.288 1.00 42.24 ? 89  LEU A CG   5  
ATOM 9883  C CD1  . LEU A 1 89  ? 28.480 -20.747 23.308 1.00 75.14 ? 89  LEU A CD1  5  
ATOM 9884  C CD2  . LEU A 1 89  ? 30.745 -20.301 24.269 1.00 43.25 ? 89  LEU A CD2  5  
ATOM 9885  H H    . LEU A 1 89  ? 28.717 -15.894 24.036 1.00 43.42 ? 89  LEU A H    5  
ATOM 9886  H HA   . LEU A 1 89  ? 27.003 -18.173 23.781 1.00 61.02 ? 89  LEU A HA   5  
ATOM 9887  H HB2  . LEU A 1 89  ? 29.221 -18.298 22.895 1.00 54.32 ? 89  LEU A HB2  5  
ATOM 9888  H HB3  . LEU A 1 89  ? 29.923 -17.882 24.457 1.00 54.10 ? 89  LEU A HB3  5  
ATOM 9889  H HG   . LEU A 1 89  ? 28.891 -20.088 25.280 1.00 24.23 ? 89  LEU A HG   5  
ATOM 9890  H HD11 . LEU A 1 89  ? 27.431 -20.700 23.561 1.00 4.22  ? 89  LEU A HD11 5  
ATOM 9891  H HD12 . LEU A 1 89  ? 28.817 -21.772 23.359 1.00 13.35 ? 89  LEU A HD12 5  
ATOM 9892  H HD13 . LEU A 1 89  ? 28.626 -20.371 22.305 1.00 14.15 ? 89  LEU A HD13 5  
ATOM 9893  H HD21 . LEU A 1 89  ? 31.322 -19.529 23.780 1.00 12.25 ? 89  LEU A HD21 5  
ATOM 9894  H HD22 . LEU A 1 89  ? 30.858 -21.230 23.729 1.00 42.25 ? 89  LEU A HD22 5  
ATOM 9895  H HD23 . LEU A 1 89  ? 31.097 -20.427 25.281 1.00 20.35 ? 89  LEU A HD23 5  
ATOM 9896  N N    . ASN A 1 90  ? 26.330 -18.623 26.114 1.00 72.20 ? 90  ASN A N    5  
ATOM 9897  C CA   . ASN A 1 90  ? 25.934 -18.971 27.474 1.00 72.23 ? 90  ASN A CA   5  
ATOM 9898  C C    . ASN A 1 90  ? 26.329 -20.407 27.805 1.00 73.34 ? 90  ASN A C    5  
ATOM 9899  O O    . ASN A 1 90  ? 26.958 -21.092 26.998 1.00 42.33 ? 90  ASN A O    5  
ATOM 9900  C CB   . ASN A 1 90  ? 24.424 -18.792 27.649 1.00 24.22 ? 90  ASN A CB   5  
ATOM 9901  C CG   . ASN A 1 90  ? 23.625 -19.645 26.683 1.00 31.34 ? 90  ASN A CG   5  
ATOM 9902  O OD1  . ASN A 1 90  ? 23.853 -19.613 25.474 1.00 22.31 ? 90  ASN A OD1  5  
ATOM 9903  N ND2  . ASN A 1 90  ? 22.681 -20.414 27.215 1.00 42.23 ? 90  ASN A ND2  5  
ATOM 9904  H H    . ASN A 1 90  ? 25.707 -18.792 25.377 1.00 75.12 ? 90  ASN A H    5  
ATOM 9905  H HA   . ASN A 1 90  ? 26.447 -18.304 28.149 1.00 23.14 ? 90  ASN A HA   5  
ATOM 9906  H HB2  . ASN A 1 90  ? 24.150 -19.070 28.657 1.00 52.15 ? 90  ASN A HB2  5  
ATOM 9907  H HB3  . ASN A 1 90  ? 24.169 -17.757 27.483 1.00 13.43 ? 90  ASN A HB3  5  
ATOM 9908  H HD21 . ASN A 1 90  ? 22.555 -20.388 28.186 1.00 2.24  ? 90  ASN A HD21 5  
ATOM 9909  H HD22 . ASN A 1 90  ? 22.150 -20.976 26.613 1.00 13.02 ? 90  ASN A HD22 5  
ATOM 9910  N N    . LYS A 1 91  ? 25.954 -20.858 28.997 1.00 61.20 ? 91  LYS A N    5  
ATOM 9911  C CA   . LYS A 1 91  ? 26.266 -22.213 29.436 1.00 64.22 ? 91  LYS A CA   5  
ATOM 9912  C C    . LYS A 1 91  ? 25.631 -23.245 28.509 1.00 20.14 ? 91  LYS A C    5  
ATOM 9913  O O    . LYS A 1 91  ? 26.217 -24.293 28.239 1.00 51.33 ? 91  LYS A O    5  
ATOM 9914  C CB   . LYS A 1 91  ? 25.780 -22.432 30.870 1.00 13.32 ? 91  LYS A CB   5  
ATOM 9915  C CG   . LYS A 1 91  ? 26.410 -21.485 31.877 1.00 22.52 ? 91  LYS A CG   5  
ATOM 9916  C CD   . LYS A 1 91  ? 27.920 -21.652 31.930 1.00 73.12 ? 91  LYS A CD   5  
ATOM 9917  C CE   . LYS A 1 91  ? 28.482 -21.220 33.276 1.00 75.24 ? 91  LYS A CE   5  
ATOM 9918  N NZ   . LYS A 1 91  ? 28.123 -22.177 34.359 1.00 23.10 ? 91  LYS A NZ   5  
ATOM 9919  H H    . LYS A 1 91  ? 25.454 -20.265 29.597 1.00 40.13 ? 91  LYS A H    5  
ATOM 9920  H HA   . LYS A 1 91  ? 27.339 -22.333 29.406 1.00 12.43 ? 91  LYS A HA   5  
ATOM 9921  H HB2  . LYS A 1 91  ? 24.709 -22.294 30.899 1.00 11.22 ? 91  LYS A HB2  5  
ATOM 9922  H HB3  . LYS A 1 91  ? 26.012 -23.445 31.166 1.00 53.13 ? 91  LYS A HB3  5  
ATOM 9923  H HG2  . LYS A 1 91  ? 26.181 -20.469 31.595 1.00 51.31 ? 91  LYS A HG2  5  
ATOM 9924  H HG3  . LYS A 1 91  ? 26.000 -21.691 32.856 1.00 41.41 ? 91  LYS A HG3  5  
ATOM 9925  H HD2  . LYS A 1 91  ? 28.165 -22.691 31.767 1.00 34.21 ? 91  LYS A HD2  5  
ATOM 9926  H HD3  . LYS A 1 91  ? 28.367 -21.049 31.152 1.00 10.13 ? 91  LYS A HD3  5  
ATOM 9927  H HE2  . LYS A 1 91  ? 29.556 -21.161 33.200 1.00 24.31 ? 91  LYS A HE2  5  
ATOM 9928  H HE3  . LYS A 1 91  ? 28.084 -20.246 33.521 1.00 61.41 ? 91  LYS A HE3  5  
ATOM 9929  H HZ1  . LYS A 1 91  ? 28.397 -23.143 34.087 1.00 72.01 ? 91  LYS A HZ1  5  
ATOM 9930  H HZ2  . LYS A 1 91  ? 27.098 -22.155 34.531 1.00 40.22 ? 91  LYS A HZ2  5  
ATOM 9931  H HZ3  . LYS A 1 91  ? 28.617 -21.923 35.238 1.00 1.12  ? 91  LYS A HZ3  5  
ATOM 9932  N N    . GLU A 1 92  ? 24.431 -22.940 28.026 1.00 73.40 ? 92  GLU A N    5  
ATOM 9933  C CA   . GLU A 1 92  ? 23.718 -23.842 27.129 1.00 34.53 ? 92  GLU A CA   5  
ATOM 9934  C C    . GLU A 1 92  ? 23.972 -23.473 25.671 1.00 64.53 ? 92  GLU A C    5  
ATOM 9935  O O    . GLU A 1 92  ? 23.942 -22.299 25.301 1.00 2.21  ? 92  GLU A O    5  
ATOM 9936  C CB   . GLU A 1 92  ? 22.216 -23.806 27.421 1.00 0.23  ? 92  GLU A CB   5  
ATOM 9937  C CG   . GLU A 1 92  ? 21.811 -24.629 28.633 1.00 42.04 ? 92  GLU A CG   5  
ATOM 9938  C CD   . GLU A 1 92  ? 20.309 -24.803 28.744 1.00 61.31 ? 92  GLU A CD   5  
ATOM 9939  O OE1  . GLU A 1 92  ? 19.726 -24.305 29.730 1.00 41.34 ? 92  GLU A OE1  5  
ATOM 9940  O OE2  . GLU A 1 92  ? 19.717 -25.438 27.846 1.00 14.25 ? 92  GLU A OE2  5  
ATOM 9941  H H    . GLU A 1 92  ? 24.015 -22.090 28.279 1.00 41.34 ? 92  GLU A H    5  
ATOM 9942  H HA   . GLU A 1 92  ? 24.084 -24.842 27.304 1.00 24.53 ? 92  GLU A HA   5  
ATOM 9943  H HB2  . GLU A 1 92  ? 21.920 -22.781 27.592 1.00 35.41 ? 92  GLU A HB2  5  
ATOM 9944  H HB3  . GLU A 1 92  ? 21.685 -24.186 26.561 1.00 43.32 ? 92  GLU A HB3  5  
ATOM 9945  H HG2  . GLU A 1 92  ? 22.267 -25.605 28.557 1.00 34.11 ? 92  GLU A HG2  5  
ATOM 9946  H HG3  . GLU A 1 92  ? 22.169 -24.134 29.524 1.00 74.42 ? 92  GLU A HG3  5  
ATOM 9947  N N    . LEU A 1 93  ? 24.224 -24.484 24.846 1.00 32.33 ? 93  LEU A N    5  
ATOM 9948  C CA   . LEU A 1 93  ? 24.485 -24.268 23.427 1.00 13.34 ? 93  LEU A CA   5  
ATOM 9949  C C    . LEU A 1 93  ? 23.217 -23.829 22.701 1.00 31.24 ? 93  LEU A C    5  
ATOM 9950  O O    . LEU A 1 93  ? 22.098 -24.113 23.129 1.00 73.35 ? 93  LEU A O    5  
ATOM 9951  C CB   . LEU A 1 93  ? 25.036 -25.544 22.789 1.00 32.04 ? 93  LEU A CB   5  
ATOM 9952  C CG   . LEU A 1 93  ? 23.996 -26.557 22.308 1.00 42.32 ? 93  LEU A CG   5  
ATOM 9953  C CD1  . LEU A 1 93  ? 24.674 -27.732 21.621 1.00 22.34 ? 93  LEU A CD1  5  
ATOM 9954  C CD2  . LEU A 1 93  ? 23.141 -27.037 23.471 1.00 13.11 ? 93  LEU A CD2  5  
ATOM 9955  H H    . LEU A 1 93  ? 24.234 -25.398 25.199 1.00 64.21 ? 93  LEU A H    5  
ATOM 9956  H HA   . LEU A 1 93  ? 25.223 -23.484 23.342 1.00 21.42 ? 93  LEU A HA   5  
ATOM 9957  H HB2  . LEU A 1 93  ? 25.635 -25.256 21.939 1.00 23.45 ? 93  LEU A HB2  5  
ATOM 9958  H HB3  . LEU A 1 93  ? 25.663 -26.034 23.521 1.00 72.23 ? 93  LEU A HB3  5  
ATOM 9959  H HG   . LEU A 1 93  ? 23.346 -26.080 21.587 1.00 34.24 ? 93  LEU A HG   5  
ATOM 9960  H HD11 . LEU A 1 93  ? 25.536 -27.381 21.075 1.00 61.54 ? 93  LEU A HD11 5  
ATOM 9961  H HD12 . LEU A 1 93  ? 23.980 -28.199 20.939 1.00 61.44 ? 93  LEU A HD12 5  
ATOM 9962  H HD13 . LEU A 1 93  ? 24.987 -28.451 22.365 1.00 75.55 ? 93  LEU A HD13 5  
ATOM 9963  H HD21 . LEU A 1 93  ? 22.658 -26.190 23.936 1.00 3.11  ? 93  LEU A HD21 5  
ATOM 9964  H HD22 . LEU A 1 93  ? 23.767 -27.537 24.196 1.00 51.11 ? 93  LEU A HD22 5  
ATOM 9965  H HD23 . LEU A 1 93  ? 22.391 -27.724 23.107 1.00 2.42  ? 93  LEU A HD23 5  
ATOM 9966  N N    . PRO A 1 94  ? 23.394 -23.122 21.576 1.00 40.33 ? 94  PRO A N    5  
ATOM 9967  C CA   . PRO A 1 94  ? 22.276 -22.631 20.765 1.00 73.43 ? 94  PRO A CA   5  
ATOM 9968  C C    . PRO A 1 94  ? 21.535 -23.760 20.055 1.00 24.02 ? 94  PRO A C    5  
ATOM 9969  O O    . PRO A 1 94  ? 22.117 -24.801 19.747 1.00 52.13 ? 94  PRO A O    5  
ATOM 9970  C CB   . PRO A 1 94  ? 22.953 -21.712 19.745 1.00 21.31 ? 94  PRO A CB   5  
ATOM 9971  C CG   . PRO A 1 94  ? 24.348 -22.224 19.642 1.00 63.20 ? 94  PRO A CG   5  
ATOM 9972  C CD   . PRO A 1 94  ? 24.700 -22.747 21.008 1.00 52.44 ? 94  PRO A CD   5  
ATOM 9973  H HA   . PRO A 1 94  ? 21.576 -22.060 21.358 1.00 61.45 ? 94  PRO A HA   5  
ATOM 9974  H HB2  . PRO A 1 94  ? 22.436 -21.778 18.798 1.00 21.30 ? 94  PRO A HB2  5  
ATOM 9975  H HB3  . PRO A 1 94  ? 22.932 -20.694 20.103 1.00 71.00 ? 94  PRO A HB3  5  
ATOM 9976  H HG2  . PRO A 1 94  ? 24.395 -23.019 18.913 1.00 1.20  ? 94  PRO A HG2  5  
ATOM 9977  H HG3  . PRO A 1 94  ? 25.014 -21.420 19.366 1.00 64.10 ? 94  PRO A HG3  5  
ATOM 9978  H HD2  . PRO A 1 94  ? 25.347 -23.607 20.927 1.00 21.23 ? 94  PRO A HD2  5  
ATOM 9979  H HD3  . PRO A 1 94  ? 25.169 -21.973 21.598 1.00 35.32 ? 94  PRO A HD3  5  
ATOM 9980  N N    . THR A 1 95  ? 20.248 -23.548 19.798 1.00 4.21  ? 95  THR A N    5  
ATOM 9981  C CA   . THR A 1 95  ? 19.428 -24.547 19.126 1.00 64.55 ? 95  THR A CA   5  
ATOM 9982  C C    . THR A 1 95  ? 19.292 -24.237 17.639 1.00 22.32 ? 95  THR A C    5  
ATOM 9983  O O    . THR A 1 95  ? 19.501 -23.102 17.210 1.00 54.22 ? 95  THR A O    5  
ATOM 9984  C CB   . THR A 1 95  ? 18.024 -24.635 19.751 1.00 55.10 ? 95  THR A CB   5  
ATOM 9985  O OG1  . THR A 1 95  ? 18.120 -24.592 21.179 1.00 35.11 ? 95  THR A OG1  5  
ATOM 9986  C CG2  . THR A 1 95  ? 17.319 -25.914 19.323 1.00 3.41  ? 95  THR A CG2  5  
ATOM 9987  H H    . THR A 1 95  ? 19.842 -22.698 20.069 1.00 71.24 ? 95  THR A H    5  
ATOM 9988  H HA   . THR A 1 95  ? 19.911 -25.507 19.240 1.00 22.15 ? 95  THR A HA   5  
ATOM 9989  H HB   . THR A 1 95  ? 17.442 -23.790 19.411 1.00 14.03 ? 95  THR A HB   5  
ATOM 9990  H HG1  . THR A 1 95  ? 18.944 -24.999 21.457 1.00 52.12 ? 95  THR A HG1  5  
ATOM 9991  H HG21 . THR A 1 95  ? 17.038 -25.839 18.283 1.00 62.20 ? 95  THR A HG21 5  
ATOM 9992  H HG22 . THR A 1 95  ? 16.435 -26.056 19.926 1.00 71.50 ? 95  THR A HG22 5  
ATOM 9993  H HG23 . THR A 1 95  ? 17.985 -26.753 19.456 1.00 4.43  ? 95  THR A HG23 5  
ATOM 9994  N N    . LEU A 1 96  ? 18.941 -25.252 16.858 1.00 73.43 ? 96  LEU A N    5  
ATOM 9995  C CA   . LEU A 1 96  ? 18.776 -25.088 15.418 1.00 55.33 ? 96  LEU A CA   5  
ATOM 9996  C C    . LEU A 1 96  ? 20.100 -24.720 14.756 1.00 12.02 ? 96  LEU A C    5  
ATOM 9997  O O    . LEU A 1 96  ? 20.132 -24.288 13.603 1.00 22.22 ? 96  LEU A O    5  
ATOM 9998  C CB   . LEU A 1 96  ? 17.729 -24.011 15.124 1.00 4.13  ? 96  LEU A CB   5  
ATOM 9999  C CG   . LEU A 1 96  ? 18.272 -22.615 14.815 1.00 15.02 ? 96  LEU A CG   5  
ATOM 10000 C CD1  . LEU A 1 96  ? 18.101 -22.291 13.339 1.00 11.22 ? 96  LEU A CD1  5  
ATOM 10001 C CD2  . LEU A 1 96  ? 17.577 -21.570 15.676 1.00 32.33 ? 96  LEU A CD2  5  
ATOM 10002 H H    . LEU A 1 96  ? 18.788 -26.134 17.257 1.00 4.44  ? 96  LEU A H    5  
ATOM 10003 H HA   . LEU A 1 96  ? 18.434 -26.029 15.014 1.00 63.23 ? 96  LEU A HA   5  
ATOM 10004 H HB2  . LEU A 1 96  ? 17.150 -24.336 14.274 1.00 31.00 ? 96  LEU A HB2  5  
ATOM 10005 H HB3  . LEU A 1 96  ? 17.085 -23.933 15.988 1.00 10.15 ? 96  LEU A HB3  5  
ATOM 10006 H HG   . LEU A 1 96  ? 19.328 -22.588 15.042 1.00 5.32  ? 96  LEU A HG   5  
ATOM 10007 H HD11 . LEU A 1 96  ? 17.262 -21.624 13.212 1.00 51.21 ? 96  LEU A HD11 5  
ATOM 10008 H HD12 . LEU A 1 96  ? 17.923 -23.203 12.789 1.00 53.33 ? 96  LEU A HD12 5  
ATOM 10009 H HD13 . LEU A 1 96  ? 18.998 -21.817 12.969 1.00 42.22 ? 96  LEU A HD13 5  
ATOM 10010 H HD21 . LEU A 1 96  ? 18.226 -21.287 16.492 1.00 41.04 ? 96  LEU A HD21 5  
ATOM 10011 H HD22 . LEU A 1 96  ? 16.660 -21.983 16.073 1.00 42.40 ? 96  LEU A HD22 5  
ATOM 10012 H HD23 . LEU A 1 96  ? 17.351 -20.701 15.076 1.00 25.34 ? 96  LEU A HD23 5  
ATOM 10013 N N    . THR A 1 97  ? 21.192 -24.896 15.493 1.00 45.22 ? 97  THR A N    5  
ATOM 10014 C CA   . THR A 1 97  ? 22.520 -24.584 14.978 1.00 13.30 ? 97  THR A CA   5  
ATOM 10015 C C    . THR A 1 97  ? 23.038 -25.702 14.081 1.00 42.54 ? 97  THR A C    5  
ATOM 10016 O O    . THR A 1 97  ? 23.766 -25.451 13.120 1.00 31.25 ? 97  THR A O    5  
ATOM 10017 C CB   . THR A 1 97  ? 23.525 -24.351 16.121 1.00 3.44  ? 97  THR A CB   5  
ATOM 10018 O OG1  . THR A 1 97  ? 24.782 -23.919 15.588 1.00 1.20  ? 97  THR A OG1  5  
ATOM 10019 C CG2  . THR A 1 97  ? 23.723 -25.621 16.935 1.00 4.41  ? 97  THR A CG2  5  
ATOM 10020 H H    . THR A 1 97  ? 21.102 -25.243 16.405 1.00 70.13 ? 97  THR A H    5  
ATOM 10021 H HA   . THR A 1 97  ? 22.448 -23.674 14.399 1.00 34.41 ? 97  THR A HA   5  
ATOM 10022 H HB   . THR A 1 97  ? 23.135 -23.581 16.772 1.00 3.10  ? 97  THR A HB   5  
ATOM 10023 H HG1  . THR A 1 97  ? 25.265 -23.431 16.260 1.00 35.31 ? 97  THR A HG1  5  
ATOM 10024 H HG21 . THR A 1 97  ? 24.070 -25.363 17.925 1.00 33.52 ? 97  THR A HG21 5  
ATOM 10025 H HG22 . THR A 1 97  ? 24.455 -26.249 16.449 1.00 1.23  ? 97  THR A HG22 5  
ATOM 10026 H HG23 . THR A 1 97  ? 22.786 -26.150 17.009 1.00 73.45 ? 97  THR A HG23 5  
ATOM 10027 N N    . GLU A 1 98  ? 22.658 -26.935 14.400 1.00 50.24 ? 98  GLU A N    5  
ATOM 10028 C CA   . GLU A 1 98  ? 23.086 -28.091 13.621 1.00 52.14 ? 98  GLU A CA   5  
ATOM 10029 C C    . GLU A 1 98  ? 22.222 -28.257 12.374 1.00 53.22 ? 98  GLU A C    5  
ATOM 10030 O O    . GLU A 1 98  ? 22.422 -29.181 11.584 1.00 10.54 ? 98  GLU A O    5  
ATOM 10031 C CB   . GLU A 1 98  ? 23.020 -29.360 14.472 1.00 24.34 ? 98  GLU A CB   5  
ATOM 10032 C CG   . GLU A 1 98  ? 21.677 -29.570 15.150 1.00 74.23 ? 98  GLU A CG   5  
ATOM 10033 C CD   . GLU A 1 98  ? 21.218 -31.015 15.101 1.00 3.14  ? 98  GLU A CD   5  
ATOM 10034 O OE1  . GLU A 1 98  ? 22.080 -31.914 15.199 1.00 42.43 ? 98  GLU A OE1  5  
ATOM 10035 O OE2  . GLU A 1 98  ? 19.999 -31.247 14.966 1.00 11.10 ? 98  GLU A OE2  5  
ATOM 10036 H H    . GLU A 1 98  ? 22.077 -27.070 15.177 1.00 71.31 ? 98  GLU A H    5  
ATOM 10037 H HA   . GLU A 1 98  ? 24.108 -27.925 13.316 1.00 61.52 ? 98  GLU A HA   5  
ATOM 10038 H HB2  . GLU A 1 98  ? 23.220 -30.214 13.841 1.00 10.33 ? 98  GLU A HB2  5  
ATOM 10039 H HB3  . GLU A 1 98  ? 23.781 -29.305 15.238 1.00 55.23 ? 98  GLU A HB3  5  
ATOM 10040 H HG2  . GLU A 1 98  ? 21.758 -29.269 16.183 1.00 32.14 ? 98  GLU A HG2  5  
ATOM 10041 H HG3  . GLU A 1 98  ? 20.938 -28.957 14.654 1.00 4.13  ? 98  GLU A HG3  5  
ATOM 10042 N N    . HIS A 1 99  ? 21.259 -27.356 12.204 1.00 45.34 ? 99  HIS A N    5  
ATOM 10043 C CA   . HIS A 1 99  ? 20.364 -27.401 11.053 1.00 30.42 ? 99  HIS A CA   5  
ATOM 10044 C C    . HIS A 1 99  ? 21.136 -27.721 9.776  1.00 12.43 ? 99  HIS A C    5  
ATOM 10045 O O    . HIS A 1 99  ? 20.655 -28.458 8.916  1.00 63.24 ? 99  HIS A O    5  
ATOM 10046 C CB   . HIS A 1 99  ? 19.629 -26.070 10.899 1.00 12.32 ? 99  HIS A CB   5  
ATOM 10047 C CG   . HIS A 1 99  ? 18.167 -26.153 11.212 1.00 14.04 ? 99  HIS A CG   5  
ATOM 10048 N ND1  . HIS A 1 99  ? 17.656 -26.947 12.217 1.00 23.34 ? 99  HIS A ND1  5  
ATOM 10049 C CD2  . HIS A 1 99  ? 17.104 -25.534 10.648 1.00 75.03 ? 99  HIS A CD2  5  
ATOM 10050 C CE1  . HIS A 1 99  ? 16.342 -26.815 12.256 1.00 5.21  ? 99  HIS A CE1  5  
ATOM 10051 N NE2  . HIS A 1 99  ? 15.982 -25.962 11.314 1.00 72.20 ? 99  HIS A NE2  5  
ATOM 10052 H H    . HIS A 1 99  ? 21.149 -26.643 12.867 1.00 25.21 ? 99  HIS A H    5  
ATOM 10053 H HA   . HIS A 1 99  ? 19.641 -28.184 11.227 1.00 51.23 ? 99  HIS A HA   5  
ATOM 10054 H HB2  . HIS A 1 99  ? 20.070 -25.344 11.566 1.00 14.52 ? 99  HIS A HB2  5  
ATOM 10055 H HB3  . HIS A 1 99  ? 19.732 -25.725 9.880  1.00 13.44 ? 99  HIS A HB3  5  
ATOM 10056 H HD1  . HIS A 1 99  ? 18.179 -27.524 12.812 1.00 1.34  ? 99  HIS A HD1  5  
ATOM 10057 H HD2  . HIS A 1 99  ? 17.131 -24.833 9.825  1.00 64.31 ? 99  HIS A HD2  5  
ATOM 10058 H HE1  . HIS A 1 99  ? 15.676 -27.317 12.941 1.00 2.04  ? 99  HIS A HE1  5  
ATOM 10059 N N    . LYS A 1 100 ? 22.335 -27.160 9.660  1.00 54.34 ? 100 LYS A N    5  
ATOM 10060 C CA   . LYS A 1 100 ? 23.174 -27.384 8.489  1.00 61.12 ? 100 LYS A CA   5  
ATOM 10061 C C    . LYS A 1 100 ? 24.335 -28.316 8.822  1.00 0.31  ? 100 LYS A C    5  
ATOM 10062 O O    . LYS A 1 100 ? 24.476 -29.384 8.228  1.00 62.24 ? 100 LYS A O    5  
ATOM 10063 C CB   . LYS A 1 100 ? 23.711 -26.053 7.958  1.00 51.12 ? 100 LYS A CB   5  
ATOM 10064 C CG   . LYS A 1 100 ? 24.192 -26.122 6.519  1.00 52.52 ? 100 LYS A CG   5  
ATOM 10065 C CD   . LYS A 1 100 ? 24.945 -24.863 6.122  1.00 41.01 ? 100 LYS A CD   5  
ATOM 10066 C CE   . LYS A 1 100 ? 25.324 -24.881 4.649  1.00 71.20 ? 100 LYS A CE   5  
ATOM 10067 N NZ   . LYS A 1 100 ? 25.738 -23.535 4.166  1.00 1.20  ? 100 LYS A NZ   5  
ATOM 10068 H H    . LYS A 1 100 ? 22.663 -26.581 10.380 1.00 45.23 ? 100 LYS A H    5  
ATOM 10069 H HA   . LYS A 1 100 ? 22.565 -27.846 7.727  1.00 33.22 ? 100 LYS A HA   5  
ATOM 10070 H HB2  . LYS A 1 100 ? 22.927 -25.312 8.019  1.00 71.43 ? 100 LYS A HB2  5  
ATOM 10071 H HB3  . LYS A 1 100 ? 24.539 -25.740 8.577  1.00 11.44 ? 100 LYS A HB3  5  
ATOM 10072 H HG2  . LYS A 1 100 ? 24.849 -26.971 6.408  1.00 21.24 ? 100 LYS A HG2  5  
ATOM 10073 H HG3  . LYS A 1 100 ? 23.337 -26.239 5.868  1.00 14.43 ? 100 LYS A HG3  5  
ATOM 10074 H HD2  . LYS A 1 100 ? 24.318 -24.004 6.310  1.00 62.01 ? 100 LYS A HD2  5  
ATOM 10075 H HD3  . LYS A 1 100 ? 25.846 -24.791 6.716  1.00 55.44 ? 100 LYS A HD3  5  
ATOM 10076 H HE2  . LYS A 1 100 ? 26.142 -25.571 4.510  1.00 72.44 ? 100 LYS A HE2  5  
ATOM 10077 H HE3  . LYS A 1 100 ? 24.471 -25.213 4.076  1.00 60.53 ? 100 LYS A HE3  5  
ATOM 10078 H HZ1  . LYS A 1 100 ? 26.774 -23.488 4.085  1.00 0.42  ? 100 LYS A HZ1  5  
ATOM 10079 H HZ2  . LYS A 1 100 ? 25.420 -22.803 4.833  1.00 43.23 ? 100 LYS A HZ2  5  
ATOM 10080 H HZ3  . LYS A 1 100 ? 25.319 -23.345 3.233  1.00 1.15  ? 100 LYS A HZ3  5  
ATOM 10081 N N    . SER A 1 101 ? 25.163 -27.904 9.777  1.00 12.02 ? 101 SER A N    5  
ATOM 10082 C CA   . SER A 1 101 ? 26.313 -28.701 10.188 1.00 72.01 ? 101 SER A CA   5  
ATOM 10083 C C    . SER A 1 101 ? 27.116 -27.980 11.266 1.00 44.02 ? 101 SER A C    5  
ATOM 10084 O O    . SER A 1 101 ? 26.695 -26.943 11.780 1.00 23.40 ? 101 SER A O    5  
ATOM 10085 C CB   . SER A 1 101 ? 27.208 -29.002 8.984  1.00 13.20 ? 101 SER A CB   5  
ATOM 10086 O OG   . SER A 1 101 ? 27.367 -30.398 8.803  1.00 74.21 ? 101 SER A OG   5  
ATOM 10087 H H    . SER A 1 101 ? 24.997 -27.042 10.214 1.00 23.21 ? 101 SER A H    5  
ATOM 10088 H HA   . SER A 1 101 ? 25.944 -29.632 10.593 1.00 54.44 ? 101 SER A HA   5  
ATOM 10089 H HB2  . SER A 1 101 ? 26.762 -28.584 8.094  1.00 20.21 ? 101 SER A HB2  5  
ATOM 10090 H HB3  . SER A 1 101 ? 28.180 -28.558 9.142  1.00 21.12 ? 101 SER A HB3  5  
ATOM 10091 H HG   . SER A 1 101 ? 27.084 -30.641 7.918  1.00 3.30  ? 101 SER A HG   5  
ATOM 10092 N N    . ILE A 1 102 ? 28.275 -28.536 11.602 1.00 21.34 ? 102 ILE A N    5  
ATOM 10093 C CA   . ILE A 1 102 ? 29.139 -27.947 12.618 1.00 53.41 ? 102 ILE A CA   5  
ATOM 10094 C C    . ILE A 1 102 ? 30.388 -27.338 11.991 1.00 65.21 ? 102 ILE A C    5  
ATOM 10095 O O    . ILE A 1 102 ? 31.319 -28.053 11.620 1.00 10.21 ? 102 ILE A O    5  
ATOM 10096 C CB   . ILE A 1 102 ? 29.561 -28.988 13.671 1.00 2.22  ? 102 ILE A CB   5  
ATOM 10097 C CG1  . ILE A 1 102 ? 28.385 -29.321 14.591 1.00 71.30 ? 102 ILE A CG1  5  
ATOM 10098 C CG2  . ILE A 1 102 ? 30.743 -28.474 14.479 1.00 4.23  ? 102 ILE A CG2  5  
ATOM 10099 C CD1  . ILE A 1 102 ? 28.186 -30.806 14.803 1.00 13.31 ? 102 ILE A CD1  5  
ATOM 10100 H H    . ILE A 1 102 ? 28.556 -29.362 11.157 1.00 63.31 ? 102 ILE A H    5  
ATOM 10101 H HA   . ILE A 1 102 ? 28.582 -27.166 13.116 1.00 51.22 ? 102 ILE A HA   5  
ATOM 10102 H HB   . ILE A 1 102 ? 29.871 -29.884 13.155 1.00 10.33 ? 102 ILE A HB   5  
ATOM 10103 H HG12 . ILE A 1 102 ? 28.550 -28.868 15.556 1.00 64.33 ? 102 ILE A HG12 5  
ATOM 10104 H HG13 . ILE A 1 102 ? 27.477 -28.922 14.161 1.00 4.13  ? 102 ILE A HG13 5  
ATOM 10105 H HG21 . ILE A 1 102 ? 30.765 -27.395 14.439 1.00 14.34 ? 102 ILE A HG21 5  
ATOM 10106 H HG22 . ILE A 1 102 ? 30.643 -28.793 15.506 1.00 61.22 ? 102 ILE A HG22 5  
ATOM 10107 H HG23 . ILE A 1 102 ? 31.660 -28.868 14.067 1.00 1.51  ? 102 ILE A HG23 5  
ATOM 10108 H HD11 . ILE A 1 102 ? 27.182 -30.988 15.158 1.00 52.34 ? 102 ILE A HD11 5  
ATOM 10109 H HD12 . ILE A 1 102 ? 28.339 -31.327 13.870 1.00 23.05 ? 102 ILE A HD12 5  
ATOM 10110 H HD13 . ILE A 1 102 ? 28.895 -31.163 15.536 1.00 42.21 ? 102 ILE A HD13 5  
ATOM 10111 N N    . GLU A 1 103 ? 30.402 -26.014 11.878 1.00 43.35 ? 103 GLU A N    5  
ATOM 10112 C CA   . GLU A 1 103 ? 31.539 -25.309 11.296 1.00 30.32 ? 103 GLU A CA   5  
ATOM 10113 C C    . GLU A 1 103 ? 31.762 -23.970 11.992 1.00 44.53 ? 103 GLU A C    5  
ATOM 10114 O O    . GLU A 1 103 ? 30.897 -23.094 11.967 1.00 4.04  ? 103 GLU A O    5  
ATOM 10115 C CB   . GLU A 1 103 ? 31.319 -25.088 9.798  1.00 34.32 ? 103 GLU A CB   5  
ATOM 10116 C CG   . GLU A 1 103 ? 30.329 -26.061 9.179  1.00 40.34 ? 103 GLU A CG   5  
ATOM 10117 C CD   . GLU A 1 103 ? 30.241 -25.922 7.671  1.00 12.02 ? 103 GLU A CD   5  
ATOM 10118 O OE1  . GLU A 1 103 ? 29.175 -25.500 7.175  1.00 65.41 ? 103 GLU A OE1  5  
ATOM 10119 O OE2  . GLU A 1 103 ? 31.238 -26.235 6.988  1.00 63.21 ? 103 GLU A OE2  5  
ATOM 10120 H H    . GLU A 1 103 ? 29.630 -25.499 12.191 1.00 1.45  ? 103 GLU A H    5  
ATOM 10121 H HA   . GLU A 1 103 ? 32.416 -25.924 11.435 1.00 52.54 ? 103 GLU A HA   5  
ATOM 10122 H HB2  . GLU A 1 103 ? 30.950 -24.085 9.645  1.00 42.40 ? 103 GLU A HB2  5  
ATOM 10123 H HB3  . GLU A 1 103 ? 32.264 -25.196 9.288  1.00 24.41 ? 103 GLU A HB3  5  
ATOM 10124 H HG2  . GLU A 1 103 ? 30.638 -27.068 9.414  1.00 31.03 ? 103 GLU A HG2  5  
ATOM 10125 H HG3  . GLU A 1 103 ? 29.352 -25.877 9.600  1.00 34.32 ? 103 GLU A HG3  5  
ATOM 10126 N N    . TRP A 1 104 ? 32.927 -23.818 12.611 1.00 65.42 ? 104 TRP A N    5  
ATOM 10127 C CA   . TRP A 1 104 ? 33.265 -22.586 13.314 1.00 11.10 ? 104 TRP A CA   5  
ATOM 10128 C C    . TRP A 1 104 ? 34.486 -21.920 12.689 1.00 12.44 ? 104 TRP A C    5  
ATOM 10129 O O    . TRP A 1 104 ? 35.592 -22.460 12.735 1.00 12.24 ? 104 TRP A O    5  
ATOM 10130 C CB   . TRP A 1 104 ? 33.527 -22.874 14.793 1.00 15.23 ? 104 TRP A CB   5  
ATOM 10131 C CG   . TRP A 1 104 ? 32.677 -23.979 15.343 1.00 75.33 ? 104 TRP A CG   5  
ATOM 10132 C CD1  . TRP A 1 104 ? 33.105 -25.078 16.031 1.00 3.02  ? 104 TRP A CD1  5  
ATOM 10133 C CD2  . TRP A 1 104 ? 31.253 -24.093 15.248 1.00 75.44 ? 104 TRP A CD2  5  
ATOM 10134 N NE1  . TRP A 1 104 ? 32.034 -25.868 16.370 1.00 75.41 ? 104 TRP A NE1  5  
ATOM 10135 C CE2  . TRP A 1 104 ? 30.886 -25.286 15.902 1.00 54.15 ? 104 TRP A CE2  5  
ATOM 10136 C CE3  . TRP A 1 104 ? 30.252 -23.304 14.676 1.00 54.42 ? 104 TRP A CE3  5  
ATOM 10137 C CZ2  . TRP A 1 104 ? 29.561 -25.705 15.997 1.00 64.34 ? 104 TRP A CZ2  5  
ATOM 10138 C CZ3  . TRP A 1 104 ? 28.938 -23.721 14.771 1.00 72.32 ? 104 TRP A CZ3  5  
ATOM 10139 C CH2  . TRP A 1 104 ? 28.602 -24.913 15.428 1.00 51.44 ? 104 TRP A CH2  5  
ATOM 10140 H H    . TRP A 1 104 ? 33.577 -24.553 12.595 1.00 54.10 ? 104 TRP A H    5  
ATOM 10141 H HA   . TRP A 1 104 ? 32.422 -21.916 13.231 1.00 74.34 ? 104 TRP A HA   5  
ATOM 10142 H HB2  . TRP A 1 104 ? 34.561 -23.154 14.922 1.00 43.23 ? 104 TRP A HB2  5  
ATOM 10143 H HB3  . TRP A 1 104 ? 33.325 -21.981 15.367 1.00 1.31  ? 104 TRP A HB3  5  
ATOM 10144 H HD1  . TRP A 1 104 ? 34.139 -25.283 16.266 1.00 75.32 ? 104 TRP A HD1  5  
ATOM 10145 H HE1  . TRP A 1 104 ? 32.084 -26.712 16.868 1.00 54.53 ? 104 TRP A HE1  5  
ATOM 10146 H HE3  . TRP A 1 104 ? 30.490 -22.382 14.166 1.00 65.15 ? 104 TRP A HE3  5  
ATOM 10147 H HZ2  . TRP A 1 104 ? 29.286 -26.621 16.500 1.00 4.41  ? 104 TRP A HZ2  5  
ATOM 10148 H HZ3  . TRP A 1 104 ? 28.151 -23.124 14.334 1.00 34.14 ? 104 TRP A HZ3  5  
ATOM 10149 H HH2  . TRP A 1 104 ? 27.563 -25.200 15.477 1.00 1.04  ? 104 TRP A HH2  5  
ATOM 10150 N N    . LEU A 1 105 ? 34.279 -20.744 12.106 1.00 22.11 ? 105 LEU A N    5  
ATOM 10151 C CA   . LEU A 1 105 ? 35.364 -20.003 11.472 1.00 23.50 ? 105 LEU A CA   5  
ATOM 10152 C C    . LEU A 1 105 ? 35.803 -18.830 12.342 1.00 44.24 ? 105 LEU A C    5  
ATOM 10153 O O    . LEU A 1 105 ? 35.046 -18.352 13.186 1.00 32.53 ? 105 LEU A O    5  
ATOM 10154 C CB   . LEU A 1 105 ? 34.927 -19.498 10.096 1.00 22.00 ? 105 LEU A CB   5  
ATOM 10155 C CG   . LEU A 1 105 ? 34.807 -20.557 8.999  1.00 15.33 ? 105 LEU A CG   5  
ATOM 10156 C CD1  . LEU A 1 105 ? 36.090 -21.366 8.895  1.00 33.23 ? 105 LEU A CD1  5  
ATOM 10157 C CD2  . LEU A 1 105 ? 33.618 -21.469 9.267  1.00 24.02 ? 105 LEU A CD2  5  
ATOM 10158 H H    . LEU A 1 105 ? 33.376 -20.364 12.101 1.00 22.43 ? 105 LEU A H    5  
ATOM 10159 H HA   . LEU A 1 105 ? 36.199 -20.678 11.350 1.00 12.24 ? 105 LEU A HA   5  
ATOM 10160 H HB2  . LEU A 1 105 ? 33.963 -19.027 10.208 1.00 51.20 ? 105 LEU A HB2  5  
ATOM 10161 H HB3  . LEU A 1 105 ? 35.649 -18.763 9.770  1.00 64.01 ? 105 LEU A HB3  5  
ATOM 10162 H HG   . LEU A 1 105 ? 34.645 -20.065 8.050  1.00 74.33 ? 105 LEU A HG   5  
ATOM 10163 H HD11 . LEU A 1 105 ? 36.025 -22.036 8.052  1.00 61.35 ? 105 LEU A HD11 5  
ATOM 10164 H HD12 . LEU A 1 105 ? 36.228 -21.939 9.800  1.00 2.03  ? 105 LEU A HD12 5  
ATOM 10165 H HD13 . LEU A 1 105 ? 36.927 -20.697 8.762  1.00 63.25 ? 105 LEU A HD13 5  
ATOM 10166 H HD21 . LEU A 1 105 ? 33.974 -22.435 9.595  1.00 54.20 ? 105 LEU A HD21 5  
ATOM 10167 H HD22 . LEU A 1 105 ? 33.043 -21.586 8.360  1.00 31.12 ? 105 LEU A HD22 5  
ATOM 10168 H HD23 . LEU A 1 105 ? 32.997 -21.034 10.035 1.00 34.02 ? 105 LEU A HD23 5  
ATOM 10169 N N    . SER A 1 106 ? 37.031 -18.368 12.127 1.00 2.13  ? 106 SER A N    5  
ATOM 10170 C CA   . SER A 1 106 ? 37.572 -17.251 12.893 1.00 41.34 ? 106 SER A CA   5  
ATOM 10171 C C    . SER A 1 106 ? 36.960 -15.931 12.434 1.00 52.24 ? 106 SER A C    5  
ATOM 10172 O O    . SER A 1 106 ? 36.219 -15.886 11.451 1.00 34.53 ? 106 SER A O    5  
ATOM 10173 C CB   . SER A 1 106 ? 39.094 -17.197 12.750 1.00 44.31 ? 106 SER A CB   5  
ATOM 10174 O OG   . SER A 1 106 ? 39.471 -16.857 11.427 1.00 52.42 ? 106 SER A OG   5  
ATOM 10175 H H    . SER A 1 106 ? 37.587 -18.791 11.440 1.00 44.34 ? 106 SER A H    5  
ATOM 10176 H HA   . SER A 1 106 ? 37.322 -17.408 13.931 1.00 32.31 ? 106 SER A HA   5  
ATOM 10177 H HB2  . SER A 1 106 ? 39.491 -16.455 13.426 1.00 13.40 ? 106 SER A HB2  5  
ATOM 10178 H HB3  . SER A 1 106 ? 39.510 -18.164 12.993 1.00 43.12 ? 106 SER A HB3  5  
ATOM 10179 H HG   . SER A 1 106 ? 39.237 -15.942 11.252 1.00 35.21 ? 106 SER A HG   5  
ATOM 10180 N N    . ILE A 1 107 ? 37.275 -14.858 13.152 1.00 62.34 ? 107 ILE A N    5  
ATOM 10181 C CA   . ILE A 1 107 ? 36.758 -13.537 12.818 1.00 34.12 ? 107 ILE A CA   5  
ATOM 10182 C C    . ILE A 1 107 ? 37.434 -12.981 11.570 1.00 55.15 ? 107 ILE A C    5  
ATOM 10183 O O    . ILE A 1 107 ? 36.869 -12.143 10.867 1.00 24.31 ? 107 ILE A O    5  
ATOM 10184 C CB   . ILE A 1 107 ? 36.955 -12.545 13.980 1.00 60.51 ? 107 ILE A CB   5  
ATOM 10185 C CG1  . ILE A 1 107 ? 36.241 -13.049 15.236 1.00 23.31 ? 107 ILE A CG1  5  
ATOM 10186 C CG2  . ILE A 1 107 ? 36.444 -11.166 13.591 1.00 24.03 ? 107 ILE A CG2  5  
ATOM 10187 C CD1  . ILE A 1 107 ? 36.376 -12.119 16.421 1.00 31.35 ? 107 ILE A CD1  5  
ATOM 10188 H H    . ILE A 1 107 ? 37.871 -14.958 13.923 1.00 13.32 ? 107 ILE A H    5  
ATOM 10189 H HA   . ILE A 1 107 ? 35.698 -13.633 12.629 1.00 41.42 ? 107 ILE A HA   5  
ATOM 10190 H HB   . ILE A 1 107 ? 38.012 -12.468 14.182 1.00 43.22 ? 107 ILE A HB   5  
ATOM 10191 H HG12 . ILE A 1 107 ? 35.190 -13.165 15.024 1.00 43.24 ? 107 ILE A HG12 5  
ATOM 10192 H HG13 . ILE A 1 107 ? 36.655 -14.007 15.516 1.00 22.32 ? 107 ILE A HG13 5  
ATOM 10193 H HG21 . ILE A 1 107 ? 36.588 -10.484 14.416 1.00 3.50  ? 107 ILE A HG21 5  
ATOM 10194 H HG22 . ILE A 1 107 ? 36.991 -10.810 12.731 1.00 12.30 ? 107 ILE A HG22 5  
ATOM 10195 H HG23 . ILE A 1 107 ? 35.393 -11.225 13.352 1.00 44.00 ? 107 ILE A HG23 5  
ATOM 10196 H HD11 . ILE A 1 107 ? 37.421 -11.989 16.661 1.00 60.13 ? 107 ILE A HD11 5  
ATOM 10197 H HD12 . ILE A 1 107 ? 35.939 -11.162 16.180 1.00 33.35 ? 107 ILE A HD12 5  
ATOM 10198 H HD13 . ILE A 1 107 ? 35.863 -12.545 17.273 1.00 43.25 ? 107 ILE A HD13 5  
ATOM 10199 N N    . ASN A 1 108 ? 38.645 -13.455 11.299 1.00 44.45 ? 108 ASN A N    5  
ATOM 10200 C CA   . ASN A 1 108 ? 39.399 -13.006 10.133 1.00 14.42 ? 108 ASN A CA   5  
ATOM 10201 C C    . ASN A 1 108 ? 39.217 -13.968 8.964  1.00 75.52 ? 108 ASN A C    5  
ATOM 10202 O O    . ASN A 1 108 ? 39.883 -13.846 7.937  1.00 4.20  ? 108 ASN A O    5  
ATOM 10203 C CB   . ASN A 1 108 ? 40.884 -12.879 10.478 1.00 71.13 ? 108 ASN A CB   5  
ATOM 10204 C CG   . ASN A 1 108 ? 41.399 -14.071 11.262 1.00 42.44 ? 108 ASN A CG   5  
ATOM 10205 O OD1  . ASN A 1 108 ? 41.855 -15.058 10.684 1.00 11.31 ? 108 ASN A OD1  5  
ATOM 10206 N ND2  . ASN A 1 108 ? 41.329 -13.983 12.585 1.00 74.32 ? 108 ASN A ND2  5  
ATOM 10207 H H    . ASN A 1 108 ? 39.043 -14.122 11.896 1.00 1.44  ? 108 ASN A H    5  
ATOM 10208 H HA   . ASN A 1 108 ? 39.020 -12.036 9.848  1.00 45.51 ? 108 ASN A HA   5  
ATOM 10209 H HB2  . ASN A 1 108 ? 41.454 -12.801 9.563  1.00 11.12 ? 108 ASN A HB2  5  
ATOM 10210 H HB3  . ASN A 1 108 ? 41.036 -11.989 11.069 1.00 0.20  ? 108 ASN A HB3  5  
ATOM 10211 H HD21 . ASN A 1 108 ? 40.953 -13.167 12.976 1.00 44.51 ? 108 ASN A HD21 5  
ATOM 10212 H HD22 . ASN A 1 108 ? 41.655 -14.739 13.116 1.00 24.12 ? 108 ASN A HD22 5  
ATOM 10213 N N    . GLU A 1 109 ? 38.309 -14.925 9.128  1.00 35.50 ? 109 GLU A N    5  
ATOM 10214 C CA   . GLU A 1 109 ? 38.039 -15.909 8.086  1.00 63.12 ? 109 GLU A CA   5  
ATOM 10215 C C    . GLU A 1 109 ? 36.543 -16.007 7.803  1.00 11.33 ? 109 GLU A C    5  
ATOM 10216 O O    . GLU A 1 109 ? 36.116 -16.728 6.901  1.00 35.31 ? 109 GLU A O    5  
ATOM 10217 C CB   . GLU A 1 109 ? 38.583 -17.280 8.495  1.00 52.25 ? 109 GLU A CB   5  
ATOM 10218 C CG   . GLU A 1 109 ? 40.099 -17.335 8.571  1.00 63.35 ? 109 GLU A CG   5  
ATOM 10219 C CD   . GLU A 1 109 ? 40.740 -17.646 7.231  1.00 14.45 ? 109 GLU A CD   5  
ATOM 10220 O OE1  . GLU A 1 109 ? 41.412 -18.692 7.123  1.00 5.21  ? 109 GLU A OE1  5  
ATOM 10221 O OE2  . GLU A 1 109 ? 40.567 -16.841 6.292  1.00 70.44 ? 109 GLU A OE2  5  
ATOM 10222 H H    . GLU A 1 109 ? 37.809 -14.971 9.970  1.00 73.34 ? 109 GLU A H    5  
ATOM 10223 H HA   . GLU A 1 109 ? 38.543 -15.586 7.187  1.00 34.21 ? 109 GLU A HA   5  
ATOM 10224 H HB2  . GLU A 1 109 ? 38.184 -17.537 9.465  1.00 62.12 ? 109 GLU A HB2  5  
ATOM 10225 H HB3  . GLU A 1 109 ? 38.253 -18.014 7.774  1.00 14.50 ? 109 GLU A HB3  5  
ATOM 10226 H HG2  . GLU A 1 109 ? 40.465 -16.379 8.914  1.00 61.31 ? 109 GLU A HG2  5  
ATOM 10227 H HG3  . GLU A 1 109 ? 40.384 -18.103 9.276  1.00 51.55 ? 109 GLU A HG3  5  
ATOM 10228 N N    . LEU A 1 110 ? 35.751 -15.276 8.581  1.00 63.41 ? 110 LEU A N    5  
ATOM 10229 C CA   . LEU A 1 110 ? 34.302 -15.280 8.416  1.00 52.02 ? 110 LEU A CA   5  
ATOM 10230 C C    . LEU A 1 110 ? 33.915 -14.904 6.989  1.00 63.10 ? 110 LEU A C    5  
ATOM 10231 O O    . LEU A 1 110 ? 32.841 -15.268 6.510  1.00 63.33 ? 110 LEU A O    5  
ATOM 10232 C CB   . LEU A 1 110 ? 33.654 -14.309 9.404  1.00 32.15 ? 110 LEU A CB   5  
ATOM 10233 C CG   . LEU A 1 110 ? 34.257 -12.905 9.460  1.00 63.30 ? 110 LEU A CG   5  
ATOM 10234 C CD1  . LEU A 1 110 ? 33.800 -12.080 8.267  1.00 63.30 ? 110 LEU A CD1  5  
ATOM 10235 C CD2  . LEU A 1 110 ? 33.883 -12.215 10.763 1.00 15.22 ? 110 LEU A CD2  5  
ATOM 10236 H H    . LEU A 1 110 ? 36.150 -14.721 9.283  1.00 72.23 ? 110 LEU A H    5  
ATOM 10237 H HA   . LEU A 1 110 ? 33.948 -16.279 8.621  1.00 73.35 ? 110 LEU A HA   5  
ATOM 10238 H HB2  . LEU A 1 110 ? 32.613 -14.211 9.137  1.00 11.02 ? 110 LEU A HB2  5  
ATOM 10239 H HB3  . LEU A 1 110 ? 33.731 -14.743 10.391 1.00 10.14 ? 110 LEU A HB3  5  
ATOM 10240 H HG   . LEU A 1 110 ? 35.335 -12.982 9.419  1.00 42.21 ? 110 LEU A HG   5  
ATOM 10241 H HD11 . LEU A 1 110 ? 34.587 -12.048 7.529  1.00 4.00  ? 110 LEU A HD11 5  
ATOM 10242 H HD12 . LEU A 1 110 ? 33.569 -11.076 8.591  1.00 20.40 ? 110 LEU A HD12 5  
ATOM 10243 H HD13 . LEU A 1 110 ? 32.919 -12.531 7.835  1.00 54.54 ? 110 LEU A HD13 5  
ATOM 10244 H HD21 . LEU A 1 110 ? 34.672 -12.359 11.486 1.00 32.03 ? 110 LEU A HD21 5  
ATOM 10245 H HD22 . LEU A 1 110 ? 32.964 -12.638 11.144 1.00 62.32 ? 110 LEU A HD22 5  
ATOM 10246 H HD23 . LEU A 1 110 ? 33.746 -11.159 10.585 1.00 51.33 ? 110 LEU A HD23 5  
ATOM 10247 N N    . ASP A 1 111 ? 34.798 -14.176 6.315  1.00 43.41 ? 111 ASP A N    5  
ATOM 10248 C CA   . ASP A 1 111 ? 34.551 -13.753 4.941  1.00 23.02 ? 111 ASP A CA   5  
ATOM 10249 C C    . ASP A 1 111 ? 34.240 -14.952 4.051  1.00 35.45 ? 111 ASP A C    5  
ATOM 10250 O O    . ASP A 1 111 ? 33.486 -14.842 3.084  1.00 61.41 ? 111 ASP A O    5  
ATOM 10251 C CB   . ASP A 1 111 ? 35.762 -12.996 4.392  1.00 33.14 ? 111 ASP A CB   5  
ATOM 10252 C CG   . ASP A 1 111 ? 35.509 -12.423 3.012  1.00 61.44 ? 111 ASP A CG   5  
ATOM 10253 O OD1  . ASP A 1 111 ? 36.464 -12.366 2.210  1.00 65.02 ? 111 ASP A OD1  5  
ATOM 10254 O OD2  . ASP A 1 111 ? 34.356 -12.032 2.733  1.00 2.31  ? 111 ASP A OD2  5  
ATOM 10255 H H    . ASP A 1 111 ? 35.637 -13.916 6.752  1.00 72.34 ? 111 ASP A H    5  
ATOM 10256 H HA   . ASP A 1 111 ? 33.697 -13.093 4.946  1.00 43.32 ? 111 ASP A HA   5  
ATOM 10257 H HB2  . ASP A 1 111 ? 36.002 -12.182 5.061  1.00 44.03 ? 111 ASP A HB2  5  
ATOM 10258 H HB3  . ASP A 1 111 ? 36.604 -13.670 4.335  1.00 73.12 ? 111 ASP A HB3  5  
ATOM 10259 N N    . LYS A 1 112 ? 34.825 -16.098 4.385  1.00 51.33 ? 112 LYS A N    5  
ATOM 10260 C CA   . LYS A 1 112 ? 34.611 -17.319 3.617  1.00 15.31 ? 112 LYS A CA   5  
ATOM 10261 C C    . LYS A 1 112 ? 33.156 -17.770 3.708  1.00 63.22 ? 112 LYS A C    5  
ATOM 10262 O O    . LYS A 1 112 ? 32.697 -18.583 2.905  1.00 72.51 ? 112 LYS A O    5  
ATOM 10263 C CB   . LYS A 1 112 ? 35.533 -18.431 4.121  1.00 42.12 ? 112 LYS A CB   5  
ATOM 10264 C CG   . LYS A 1 112 ? 35.052 -19.086 5.404  1.00 3.42  ? 112 LYS A CG   5  
ATOM 10265 C CD   . LYS A 1 112 ? 34.240 -20.338 5.121  1.00 70.13 ? 112 LYS A CD   5  
ATOM 10266 C CE   . LYS A 1 112 ? 34.849 -21.561 5.789  1.00 3.24  ? 112 LYS A CE   5  
ATOM 10267 N NZ   . LYS A 1 112 ? 34.739 -22.774 4.933  1.00 31.10 ? 112 LYS A NZ   5  
ATOM 10268 H H    . LYS A 1 112 ? 35.415 -16.123 5.167  1.00 4.42  ? 112 LYS A H    5  
ATOM 10269 H HA   . LYS A 1 112 ? 34.846 -17.107 2.585  1.00 34.40 ? 112 LYS A HA   5  
ATOM 10270 H HB2  . LYS A 1 112 ? 35.608 -19.193 3.359  1.00 44.52 ? 112 LYS A HB2  5  
ATOM 10271 H HB3  . LYS A 1 112 ? 36.514 -18.015 4.300  1.00 43.34 ? 112 LYS A HB3  5  
ATOM 10272 H HG2  . LYS A 1 112 ? 35.909 -19.354 6.004  1.00 2.41  ? 112 LYS A HG2  5  
ATOM 10273 H HG3  . LYS A 1 112 ? 34.436 -18.383 5.947  1.00 40.11 ? 112 LYS A HG3  5  
ATOM 10274 H HD2  . LYS A 1 112 ? 33.237 -20.199 5.496  1.00 20.11 ? 112 LYS A HD2  5  
ATOM 10275 H HD3  . LYS A 1 112 ? 34.207 -20.501 4.053  1.00 61.33 ? 112 LYS A HD3  5  
ATOM 10276 H HE2  . LYS A 1 112 ? 35.892 -21.364 5.988  1.00 72.43 ? 112 LYS A HE2  5  
ATOM 10277 H HE3  . LYS A 1 112 ? 34.333 -21.740 6.721  1.00 2.21  ? 112 LYS A HE3  5  
ATOM 10278 H HZ1  . LYS A 1 112 ? 35.068 -22.562 3.969  1.00 23.14 ? 112 LYS A HZ1  5  
ATOM 10279 H HZ2  . LYS A 1 112 ? 33.749 -23.090 4.887  1.00 43.01 ? 112 LYS A HZ2  5  
ATOM 10280 H HZ3  . LYS A 1 112 ? 35.319 -23.543 5.325  1.00 2.32  ? 112 LYS A HZ3  5  
ATOM 10281 N N    . LEU A 1 113 ? 32.436 -17.237 4.689  1.00 43.04 ? 113 LEU A N    5  
ATOM 10282 C CA   . LEU A 1 113 ? 31.033 -17.584 4.883  1.00 12.02 ? 113 LEU A CA   5  
ATOM 10283 C C    . LEU A 1 113 ? 30.123 -16.598 4.158  1.00 75.00 ? 113 LEU A C    5  
ATOM 10284 O O    . LEU A 1 113 ? 29.078 -16.206 4.676  1.00 31.21 ? 113 LEU A O    5  
ATOM 10285 C CB   . LEU A 1 113 ? 30.694 -17.606 6.375  1.00 45.32 ? 113 LEU A CB   5  
ATOM 10286 C CG   . LEU A 1 113 ? 31.547 -18.532 7.243  1.00 1.30  ? 113 LEU A CG   5  
ATOM 10287 C CD1  . LEU A 1 113 ? 31.996 -17.815 8.507  1.00 15.02 ? 113 LEU A CD1  5  
ATOM 10288 C CD2  . LEU A 1 113 ? 30.776 -19.797 7.590  1.00 1.11  ? 113 LEU A CD2  5  
ATOM 10289 H H    . LEU A 1 113 ? 32.857 -16.595 5.297  1.00 43.32 ? 113 LEU A H    5  
ATOM 10290 H HA   . LEU A 1 113 ? 30.875 -18.570 4.472  1.00 23.02 ? 113 LEU A HA   5  
ATOM 10291 H HB2  . LEU A 1 113 ? 30.806 -16.602 6.754  1.00 44.41 ? 113 LEU A HB2  5  
ATOM 10292 H HB3  . LEU A 1 113 ? 29.663 -17.914 6.475  1.00 42.53 ? 113 LEU A HB3  5  
ATOM 10293 H HG   . LEU A 1 113 ? 32.432 -18.819 6.691  1.00 13.32 ? 113 LEU A HG   5  
ATOM 10294 H HD11 . LEU A 1 113 ? 33.007 -18.106 8.747  1.00 72.44 ? 113 LEU A HD11 5  
ATOM 10295 H HD12 . LEU A 1 113 ? 31.341 -18.082 9.324  1.00 51.24 ? 113 LEU A HD12 5  
ATOM 10296 H HD13 . LEU A 1 113 ? 31.956 -16.747 8.349  1.00 73.13 ? 113 LEU A HD13 5  
ATOM 10297 H HD21 . LEU A 1 113 ? 30.688 -19.881 8.663  1.00 14.02 ? 113 LEU A HD21 5  
ATOM 10298 H HD22 . LEU A 1 113 ? 31.304 -20.657 7.204  1.00 31.21 ? 113 LEU A HD22 5  
ATOM 10299 H HD23 . LEU A 1 113 ? 29.791 -19.751 7.150  1.00 43.53 ? 113 LEU A HD23 5  
ATOM 10300 N N    . ASN A 1 114 ? 30.526 -16.203 2.955  1.00 41.21 ? 114 ASN A N    5  
ATOM 10301 C CA   . ASN A 1 114 ? 29.746 -15.264 2.157  1.00 12.23 ? 114 ASN A CA   5  
ATOM 10302 C C    . ASN A 1 114 ? 28.279 -15.283 2.575  1.00 13.25 ? 114 ASN A C    5  
ATOM 10303 O O    . ASN A 1 114 ? 27.536 -16.200 2.227  1.00 35.34 ? 114 ASN A O    5  
ATOM 10304 C CB   . ASN A 1 114 ? 29.868 -15.601 0.670  1.00 61.21 ? 114 ASN A CB   5  
ATOM 10305 C CG   . ASN A 1 114 ? 29.855 -14.364 -0.207 1.00 10.23 ? 114 ASN A CG   5  
ATOM 10306 O OD1  . ASN A 1 114 ? 30.803 -14.105 -0.949 1.00 34.13 ? 114 ASN A OD1  5  
ATOM 10307 N ND2  . ASN A 1 114 ? 28.777 -13.592 -0.124 1.00 45.03 ? 114 ASN A ND2  5  
ATOM 10308 H H    . ASN A 1 114 ? 31.369 -16.550 2.595  1.00 73.41 ? 114 ASN A H    5  
ATOM 10309 H HA   . ASN A 1 114 ? 30.144 -14.275 2.327  1.00 53.43 ? 114 ASN A HA   5  
ATOM 10310 H HB2  . ASN A 1 114 ? 30.796 -16.128 0.502  1.00 43.23 ? 114 ASN A HB2  5  
ATOM 10311 H HB3  . ASN A 1 114 ? 29.042 -16.234 0.381  1.00 45.10 ? 114 ASN A HB3  5  
ATOM 10312 H HD21 . ASN A 1 114 ? 28.061 -13.860 0.489  1.00 62.22 ? 114 ASN A HD21 5  
ATOM 10313 H HD22 . ASN A 1 114 ? 28.742 -12.786 -0.681 1.00 4.05  ? 114 ASN A HD22 5  
ATOM 10314 N N    . TRP A 1 115 ? 27.869 -14.264 3.323  1.00 64.30 ? 115 TRP A N    5  
ATOM 10315 C CA   . TRP A 1 115 ? 26.491 -14.164 3.788  1.00 13.43 ? 115 TRP A CA   5  
ATOM 10316 C C    . TRP A 1 115 ? 25.661 -13.296 2.848  1.00 32.32 ? 115 TRP A C    5  
ATOM 10317 O O    . TRP A 1 115 ? 26.194 -12.676 1.929  1.00 51.12 ? 115 TRP A O    5  
ATOM 10318 C CB   . TRP A 1 115 ? 26.450 -13.586 5.204  1.00 34.32 ? 115 TRP A CB   5  
ATOM 10319 C CG   . TRP A 1 115 ? 27.599 -14.027 6.059  1.00 42.01 ? 115 TRP A CG   5  
ATOM 10320 C CD1  . TRP A 1 115 ? 28.881 -13.557 6.014  1.00 32.43 ? 115 TRP A CD1  5  
ATOM 10321 C CD2  . TRP A 1 115 ? 27.571 -15.026 7.084  1.00 64.32 ? 115 TRP A CD2  5  
ATOM 10322 N NE1  . TRP A 1 115 ? 29.651 -14.205 6.950  1.00 45.32 ? 115 TRP A NE1  5  
ATOM 10323 C CE2  . TRP A 1 115 ? 28.872 -15.110 7.620  1.00 55.15 ? 115 TRP A CE2  5  
ATOM 10324 C CE3  . TRP A 1 115 ? 26.575 -15.857 7.603  1.00 74.04 ? 115 TRP A CE3  5  
ATOM 10325 C CZ2  . TRP A 1 115 ? 29.198 -15.992 8.646  1.00 11.23 ? 115 TRP A CZ2  5  
ATOM 10326 C CZ3  . TRP A 1 115 ? 26.900 -16.732 8.621  1.00 2.04  ? 115 TRP A CZ3  5  
ATOM 10327 C CH2  . TRP A 1 115 ? 28.202 -16.793 9.135  1.00 24.51 ? 115 TRP A CH2  5  
ATOM 10328 H H    . TRP A 1 115 ? 28.509 -13.563 3.568  1.00 21.01 ? 115 TRP A H    5  
ATOM 10329 H HA   . TRP A 1 115 ? 26.073 -15.160 3.803  1.00 2.41  ? 115 TRP A HA   5  
ATOM 10330 H HB2  . TRP A 1 115 ? 26.470 -12.508 5.148  1.00 64.44 ? 115 TRP A HB2  5  
ATOM 10331 H HB3  . TRP A 1 115 ? 25.535 -13.900 5.686  1.00 21.44 ? 115 TRP A HB3  5  
ATOM 10332 H HD1  . TRP A 1 115 ? 29.224 -12.791 5.336  1.00 2.05  ? 115 TRP A HD1  5  
ATOM 10333 H HE1  . TRP A 1 115 ? 30.605 -14.043 7.112  1.00 52.31 ? 115 TRP A HE1  5  
ATOM 10334 H HE3  . TRP A 1 115 ? 25.565 -15.824 7.220  1.00 61.21 ? 115 TRP A HE3  5  
ATOM 10335 H HZ2  . TRP A 1 115 ? 30.197 -16.051 9.053  1.00 12.34 ? 115 TRP A HZ2  5  
ATOM 10336 H HZ3  . TRP A 1 115 ? 26.143 -17.382 9.035  1.00 70.25 ? 115 TRP A HZ3  5  
ATOM 10337 H HH2  . TRP A 1 115 ? 28.412 -17.492 9.931  1.00 55.15 ? 115 TRP A HH2  5  
ATOM 10338 N N    . ALA A 1 116 ? 24.354 -13.258 3.085  1.00 53.31 ? 116 ALA A N    5  
ATOM 10339 C CA   . ALA A 1 116 ? 23.451 -12.464 2.260  1.00 21.20 ? 116 ALA A CA   5  
ATOM 10340 C C    . ALA A 1 116 ? 23.938 -11.024 2.142  1.00 24.10 ? 116 ALA A C    5  
ATOM 10341 O O    . ALA A 1 116 ? 24.840 -10.588 2.858  1.00 14.43 ? 116 ALA A O    5  
ATOM 10342 C CB   . ALA A 1 116 ? 22.042 -12.501 2.833  1.00 22.52 ? 116 ALA A CB   5  
ATOM 10343 H H    . ALA A 1 116 ? 23.988 -13.774 3.833  1.00 70.00 ? 116 ALA A H    5  
ATOM 10344 H HA   . ALA A 1 116 ? 23.424 -12.906 1.274  1.00 21.44 ? 116 ALA A HA   5  
ATOM 10345 H HB1  . ALA A 1 116 ? 22.075 -12.888 3.842  1.00 51.23 ? 116 ALA A HB1  5  
ATOM 10346 H HB2  . ALA A 1 116 ? 21.631 -11.503 2.843  1.00 62.01 ? 116 ALA A HB2  5  
ATOM 10347 H HB3  . ALA A 1 116 ? 21.422 -13.141 2.223  1.00 43.44 ? 116 ALA A HB3  5  
ATOM 10348 N N    . PRO A 1 117 ? 23.331 -10.267 1.217  1.00 54.13 ? 117 PRO A N    5  
ATOM 10349 C CA   . PRO A 1 117 ? 23.687 -8.864  0.983  1.00 32.21 ? 117 PRO A CA   5  
ATOM 10350 C C    . PRO A 1 117 ? 23.270 -7.960  2.138  1.00 31.22 ? 117 PRO A C    5  
ATOM 10351 O O    . PRO A 1 117 ? 23.756 -6.837  2.266  1.00 13.20 ? 117 PRO A O    5  
ATOM 10352 C CB   . PRO A 1 117 ? 22.907 -8.506  -0.284 1.00 73.44 ? 117 PRO A CB   5  
ATOM 10353 C CG   . PRO A 1 117 ? 21.751 -9.447  -0.296 1.00 43.31 ? 117 PRO A CG   5  
ATOM 10354 C CD   . PRO A 1 117 ? 22.248 -10.722 0.327  1.00 5.55  ? 117 PRO A CD   5  
ATOM 10355 H HA   . PRO A 1 117 ? 24.745 -8.749  0.801  1.00 3.31  ? 117 PRO A HA   5  
ATOM 10356 H HB2  . PRO A 1 117 ? 22.579 -7.478  -0.230 1.00 44.42 ? 117 PRO A HB2  5  
ATOM 10357 H HB3  . PRO A 1 117 ? 23.537 -8.645  -1.150 1.00 54.52 ? 117 PRO A HB3  5  
ATOM 10358 H HG2  . PRO A 1 117 ? 20.939 -9.037  0.284  1.00 33.33 ? 117 PRO A HG2  5  
ATOM 10359 H HG3  . PRO A 1 117 ? 21.435 -9.626  -1.313 1.00 72.11 ? 117 PRO A HG3  5  
ATOM 10360 H HD2  . PRO A 1 117 ? 21.460 -11.198 0.892  1.00 64.15 ? 117 PRO A HD2  5  
ATOM 10361 H HD3  . PRO A 1 117 ? 22.629 -11.389 -0.431 1.00 71.43 ? 117 PRO A HD3  5  
ATOM 10362 N N    . ALA A 1 118 ? 22.368 -8.458  2.977  1.00 34.13 ? 118 ALA A N    5  
ATOM 10363 C CA   . ALA A 1 118 ? 21.888 -7.696  4.123  1.00 15.13 ? 118 ALA A CA   5  
ATOM 10364 C C    . ALA A 1 118 ? 22.751 -7.952  5.354  1.00 61.13 ? 118 ALA A C    5  
ATOM 10365 O O    . ALA A 1 118 ? 22.889 -7.086  6.218  1.00 21.52 ? 118 ALA A O    5  
ATOM 10366 C CB   . ALA A 1 118 ? 20.434 -8.040  4.415  1.00 65.11 ? 118 ALA A CB   5  
ATOM 10367 H H    . ALA A 1 118 ? 22.017 -9.360  2.823  1.00 45.04 ? 118 ALA A H    5  
ATOM 10368 H HA   . ALA A 1 118 ? 21.940 -6.646  3.872  1.00 73.34 ? 118 ALA A HA   5  
ATOM 10369 H HB1  . ALA A 1 118 ? 20.394 -8.868  5.108  1.00 13.10 ? 118 ALA A HB1  5  
ATOM 10370 H HB2  . ALA A 1 118 ? 19.942 -7.183  4.848  1.00 14.31 ? 118 ALA A HB2  5  
ATOM 10371 H HB3  . ALA A 1 118 ? 19.939 -8.315  3.496  1.00 34.00 ? 118 ALA A HB3  5  
ATOM 10372 N N    . ASP A 1 119 ? 23.330 -9.146  5.426  1.00 15.24 ? 119 ASP A N    5  
ATOM 10373 C CA   . ASP A 1 119 ? 24.180 -9.516  6.552  1.00 43.25 ? 119 ASP A CA   5  
ATOM 10374 C C    . ASP A 1 119 ? 25.647 -9.236  6.239  1.00 50.11 ? 119 ASP A C    5  
ATOM 10375 O O    . ASP A 1 119 ? 26.462 -9.058  7.145  1.00 53.22 ? 119 ASP A O    5  
ATOM 10376 C CB   . ASP A 1 119 ? 23.993 -10.994 6.896  1.00 74.21 ? 119 ASP A CB   5  
ATOM 10377 C CG   . ASP A 1 119 ? 22.533 -11.370 7.057  1.00 32.13 ? 119 ASP A CG   5  
ATOM 10378 O OD1  . ASP A 1 119 ? 21.795 -11.331 6.050  1.00 13.54 ? 119 ASP A OD1  5  
ATOM 10379 O OD2  . ASP A 1 119 ? 22.129 -11.705 8.190  1.00 14.12 ? 119 ASP A OD2  5  
ATOM 10380 H H    . ASP A 1 119 ? 23.181 -9.793  4.706  1.00 63.54 ? 119 ASP A H    5  
ATOM 10381 H HA   . ASP A 1 119 ? 23.886 -8.918  7.401  1.00 50.23 ? 119 ASP A HA   5  
ATOM 10382 H HB2  . ASP A 1 119 ? 24.415 -11.598 6.106  1.00 40.24 ? 119 ASP A HB2  5  
ATOM 10383 H HB3  . ASP A 1 119 ? 24.506 -11.209 7.821  1.00 30.54 ? 119 ASP A HB3  5  
ATOM 10384 N N    . ILE A 1 120 ? 25.976 -9.200  4.952  1.00 52.30 ? 120 ILE A N    5  
ATOM 10385 C CA   . ILE A 1 120 ? 27.344 -8.942  4.521  1.00 51.44 ? 120 ILE A CA   5  
ATOM 10386 C C    . ILE A 1 120 ? 27.945 -7.761  5.275  1.00 12.33 ? 120 ILE A C    5  
ATOM 10387 O O    . ILE A 1 120 ? 28.998 -7.865  5.904  1.00 1.13  ? 120 ILE A O    5  
ATOM 10388 C CB   . ILE A 1 120 ? 27.414 -8.659  3.008  1.00 15.13 ? 120 ILE A CB   5  
ATOM 10389 C CG1  . ILE A 1 120 ? 27.606 -9.963  2.232  1.00 63.12 ? 120 ILE A CG1  5  
ATOM 10390 C CG2  . ILE A 1 120 ? 28.540 -7.683  2.703  1.00 1.02  ? 120 ILE A CG2  5  
ATOM 10391 C CD1  . ILE A 1 120 ? 27.039 -9.921  0.830  1.00 32.52 ? 120 ILE A CD1  5  
ATOM 10392 H H    . ILE A 1 120 ? 25.282 -9.349  4.277  1.00 72.32 ? 120 ILE A H    5  
ATOM 10393 H HA   . ILE A 1 120 ? 27.931 -9.825  4.729  1.00 51.41 ? 120 ILE A HA   5  
ATOM 10394 H HB   . ILE A 1 120 ? 26.483 -8.203  2.707  1.00 40.23 ? 120 ILE A HB   5  
ATOM 10395 H HG12 . ILE A 1 120 ? 28.661 -10.177 2.156  1.00 74.22 ? 120 ILE A HG12 5  
ATOM 10396 H HG13 . ILE A 1 120 ? 27.118 -10.766 2.765  1.00 74.02 ? 120 ILE A HG13 5  
ATOM 10397 H HG21 . ILE A 1 120 ? 28.233 -6.683  2.972  1.00 33.11 ? 120 ILE A HG21 5  
ATOM 10398 H HG22 . ILE A 1 120 ? 29.416 -7.955  3.273  1.00 14.04 ? 120 ILE A HG22 5  
ATOM 10399 H HG23 . ILE A 1 120 ? 28.771 -7.717  1.649  1.00 21.42 ? 120 ILE A HG23 5  
ATOM 10400 H HD11 . ILE A 1 120 ? 27.752 -10.346 0.140  1.00 45.04 ? 120 ILE A HD11 5  
ATOM 10401 H HD12 . ILE A 1 120 ? 26.121 -10.489 0.796  1.00 63.13 ? 120 ILE A HD12 5  
ATOM 10402 H HD13 . ILE A 1 120 ? 26.838 -8.896  0.554  1.00 61.23 ? 120 ILE A HD13 5  
ATOM 10403 N N    . PRO A 1 121 ? 27.260 -6.609  5.214  1.00 33.14 ? 121 PRO A N    5  
ATOM 10404 C CA   . PRO A 1 121 ? 27.706 -5.386  5.888  1.00 34.14 ? 121 PRO A CA   5  
ATOM 10405 C C    . PRO A 1 121 ? 27.593 -5.486  7.406  1.00 71.52 ? 121 PRO A C    5  
ATOM 10406 O O    . PRO A 1 121 ? 28.207 -4.709  8.136  1.00 63.41 ? 121 PRO A O    5  
ATOM 10407 C CB   . PRO A 1 121 ? 26.751 -4.317  5.351  1.00 42.21 ? 121 PRO A CB   5  
ATOM 10408 C CG   . PRO A 1 121 ? 25.525 -5.066  4.959  1.00 71.24 ? 121 PRO A CG   5  
ATOM 10409 C CD   . PRO A 1 121 ? 25.997 -6.413  4.483  1.00 13.52 ? 121 PRO A CD   5  
ATOM 10410 H HA   . PRO A 1 121 ? 28.721 -5.133  5.620  1.00 53.31 ? 121 PRO A HA   5  
ATOM 10411 H HB2  . PRO A 1 121 ? 26.542 -3.594  6.127  1.00 22.23 ? 121 PRO A HB2  5  
ATOM 10412 H HB3  . PRO A 1 121 ? 27.200 -3.822  4.503  1.00 72.45 ? 121 PRO A HB3  5  
ATOM 10413 H HG2  . PRO A 1 121 ? 24.873 -5.177  5.812  1.00 44.01 ? 121 PRO A HG2  5  
ATOM 10414 H HG3  . PRO A 1 121 ? 25.016 -4.545  4.161  1.00 10.03 ? 121 PRO A HG3  5  
ATOM 10415 H HD2  . PRO A 1 121 ? 25.279 -7.177  4.741  1.00 13.23 ? 121 PRO A HD2  5  
ATOM 10416 H HD3  . PRO A 1 121 ? 26.168 -6.398  3.417  1.00 53.52 ? 121 PRO A HD3  5  
ATOM 10417 N N    . ALA A 1 122 ? 26.804 -6.449  7.874  1.00 45.44 ? 122 ALA A N    5  
ATOM 10418 C CA   . ALA A 1 122 ? 26.614 -6.652  9.304  1.00 13.24 ? 122 ALA A CA   5  
ATOM 10419 C C    . ALA A 1 122 ? 27.714 -7.533  9.885  1.00 23.12 ? 122 ALA A C    5  
ATOM 10420 O O    . ALA A 1 122 ? 28.016 -7.463  11.077 1.00 74.02 ? 122 ALA A O    5  
ATOM 10421 C CB   . ALA A 1 122 ? 25.247 -7.265  9.573  1.00 42.31 ? 122 ALA A CB   5  
ATOM 10422 H H    . ALA A 1 122 ? 26.341 -7.037  7.241  1.00 2.44  ? 122 ALA A H    5  
ATOM 10423 H HA   . ALA A 1 122 ? 26.648 -5.685  9.786  1.00 25.23 ? 122 ALA A HA   5  
ATOM 10424 H HB1  . ALA A 1 122 ? 24.876 -6.911  10.524 1.00 71.31 ? 122 ALA A HB1  5  
ATOM 10425 H HB2  . ALA A 1 122 ? 24.563 -6.976  8.789  1.00 41.10 ? 122 ALA A HB2  5  
ATOM 10426 H HB3  . ALA A 1 122 ? 25.334 -8.341  9.597  1.00 2.44  ? 122 ALA A HB3  5  
ATOM 10427 N N    . VAL A 1 123 ? 28.311 -8.363  9.036  1.00 62.40 ? 123 VAL A N    5  
ATOM 10428 C CA   . VAL A 1 123 ? 29.379 -9.259  9.465  1.00 0.42  ? 123 VAL A CA   5  
ATOM 10429 C C    . VAL A 1 123 ? 30.724 -8.541  9.484  1.00 13.42 ? 123 VAL A C    5  
ATOM 10430 O O    . VAL A 1 123 ? 31.573 -8.814  10.332 1.00 54.33 ? 123 VAL A O    5  
ATOM 10431 C CB   . VAL A 1 123 ? 29.481 -10.491 8.547  1.00 33.45 ? 123 VAL A CB   5  
ATOM 10432 C CG1  . VAL A 1 123 ? 30.767 -11.256 8.820  1.00 2.33  ? 123 VAL A CG1  5  
ATOM 10433 C CG2  . VAL A 1 123 ? 28.268 -11.391 8.728  1.00 33.34 ? 123 VAL A CG2  5  
ATOM 10434 H H    . VAL A 1 123 ? 28.027 -8.374  8.098  1.00 2.52  ? 123 VAL A H    5  
ATOM 10435 H HA   . VAL A 1 123 ? 29.149 -9.598  10.465 1.00 52.03 ? 123 VAL A HA   5  
ATOM 10436 H HB   . VAL A 1 123 ? 29.501 -10.151 7.522  1.00 33.45 ? 123 VAL A HB   5  
ATOM 10437 H HG11 . VAL A 1 123 ? 31.613 -10.657 8.515  1.00 72.13 ? 123 VAL A HG11 5  
ATOM 10438 H HG12 . VAL A 1 123 ? 30.841 -11.473 9.876  1.00 54.41 ? 123 VAL A HG12 5  
ATOM 10439 H HG13 . VAL A 1 123 ? 30.762 -12.180 8.262  1.00 75.40 ? 123 VAL A HG13 5  
ATOM 10440 H HG21 . VAL A 1 123 ? 28.584 -12.424 8.737  1.00 43.42 ? 123 VAL A HG21 5  
ATOM 10441 H HG22 . VAL A 1 123 ? 27.781 -11.157 9.664  1.00 1.33  ? 123 VAL A HG22 5  
ATOM 10442 H HG23 . VAL A 1 123 ? 27.576 -11.233 7.914  1.00 4.33  ? 123 VAL A HG23 5  
ATOM 10443 N N    . ASN A 1 124 ? 30.910 -7.620  8.544  1.00 63.23 ? 124 ASN A N    5  
ATOM 10444 C CA   . ASN A 1 124 ? 32.153 -6.862  8.452  1.00 14.22 ? 124 ASN A CA   5  
ATOM 10445 C C    . ASN A 1 124 ? 32.419 -6.096  9.744  1.00 11.15 ? 124 ASN A C    5  
ATOM 10446 O O    . ASN A 1 124 ? 33.539 -6.089  10.256 1.00 51.43 ? 124 ASN A O    5  
ATOM 10447 C CB   . ASN A 1 124 ? 32.095 -5.889  7.272  1.00 21.34 ? 124 ASN A CB   5  
ATOM 10448 C CG   . ASN A 1 124 ? 32.601 -6.511  5.985  1.00 33.51 ? 124 ASN A CG   5  
ATOM 10449 O OD1  . ASN A 1 124 ? 33.648 -6.126  5.466  1.00 63.01 ? 124 ASN A OD1  5  
ATOM 10450 N ND2  . ASN A 1 124 ? 31.856 -7.479  5.464  1.00 72.35 ? 124 ASN A ND2  5  
ATOM 10451 H H    . ASN A 1 124 ? 30.196 -7.447  7.896  1.00 51.14 ? 124 ASN A H    5  
ATOM 10452 H HA   . ASN A 1 124 ? 32.958 -7.563  8.290  1.00 15.24 ? 124 ASN A HA   5  
ATOM 10453 H HB2  . ASN A 1 124 ? 31.072 -5.577  7.121  1.00 70.02 ? 124 ASN A HB2  5  
ATOM 10454 H HB3  . ASN A 1 124 ? 32.702 -5.025  7.496  1.00 52.32 ? 124 ASN A HB3  5  
ATOM 10455 H HD21 . ASN A 1 124 ? 31.033 -7.734  5.932  1.00 64.33 ? 124 ASN A HD21 5  
ATOM 10456 H HD22 . ASN A 1 124 ? 32.160 -7.899  4.632  1.00 74.41 ? 124 ASN A HD22 5  
ATOM 10457 N N    . LYS A 1 125 ? 31.381 -5.452  10.269 1.00 65.14 ? 125 LYS A N    5  
ATOM 10458 C CA   . LYS A 1 125 ? 31.501 -4.684  11.502 1.00 32.23 ? 125 LYS A CA   5  
ATOM 10459 C C    . LYS A 1 125 ? 32.155 -5.517  12.600 1.00 10.33 ? 125 LYS A C    5  
ATOM 10460 O O    . LYS A 1 125 ? 32.861 -4.985  13.458 1.00 54.20 ? 125 LYS A O    5  
ATOM 10461 C CB   . LYS A 1 125 ? 30.123 -4.204  11.964 1.00 72.41 ? 125 LYS A CB   5  
ATOM 10462 C CG   . LYS A 1 125 ? 29.261 -5.307  12.554 1.00 22.14 ? 125 LYS A CG   5  
ATOM 10463 C CD   . LYS A 1 125 ? 29.337 -5.322  14.072 1.00 53.50 ? 125 LYS A CD   5  
ATOM 10464 C CE   . LYS A 1 125 ? 28.555 -4.167  14.680 1.00 74.31 ? 125 LYS A CE   5  
ATOM 10465 N NZ   . LYS A 1 125 ? 29.455 -3.107  15.212 1.00 35.02 ? 125 LYS A NZ   5  
ATOM 10466 H H    . LYS A 1 125 ? 30.513 -5.495  9.815  1.00 63.43 ? 125 LYS A H    5  
ATOM 10467 H HA   . LYS A 1 125 ? 32.122 -3.825  11.300 1.00 63.33 ? 125 LYS A HA   5  
ATOM 10468 H HB2  . LYS A 1 125 ? 30.254 -3.438  12.714 1.00 62.23 ? 125 LYS A HB2  5  
ATOM 10469 H HB3  . LYS A 1 125 ? 29.600 -3.782  11.118 1.00 70.12 ? 125 LYS A HB3  5  
ATOM 10470 H HG2  . LYS A 1 125 ? 28.235 -5.148  12.257 1.00 22.14 ? 125 LYS A HG2  5  
ATOM 10471 H HG3  . LYS A 1 125 ? 29.604 -6.260  12.177 1.00 73.22 ? 125 LYS A HG3  5  
ATOM 10472 H HD2  . LYS A 1 125 ? 28.925 -6.251  14.436 1.00 60.34 ? 125 LYS A HD2  5  
ATOM 10473 H HD3  . LYS A 1 125 ? 30.372 -5.242  14.373 1.00 52.10 ? 125 LYS A HD3  5  
ATOM 10474 H HE2  . LYS A 1 125 ? 27.919 -3.740  13.919 1.00 4.14  ? 125 LYS A HE2  5  
ATOM 10475 H HE3  . LYS A 1 125 ? 27.945 -4.548  15.486 1.00 73.21 ? 125 LYS A HE3  5  
ATOM 10476 H HZ1  . LYS A 1 125 ? 29.047 -2.694  16.076 1.00 45.34 ? 125 LYS A HZ1  5  
ATOM 10477 H HZ2  . LYS A 1 125 ? 29.577 -2.354  14.506 1.00 74.04 ? 125 LYS A HZ2  5  
ATOM 10478 H HZ3  . LYS A 1 125 ? 30.386 -3.509  15.439 1.00 22.41 ? 125 LYS A HZ3  5  
ATOM 10479 N N    . ILE A 1 126 ? 31.917 -6.823  12.567 1.00 63.53 ? 126 ILE A N    5  
ATOM 10480 C CA   . ILE A 1 126 ? 32.486 -7.729  13.558 1.00 50.43 ? 126 ILE A CA   5  
ATOM 10481 C C    . ILE A 1 126 ? 34.010 -7.682  13.534 1.00 60.30 ? 126 ILE A C    5  
ATOM 10482 O O    . ILE A 1 126 ? 34.654 -7.573  14.577 1.00 71.20 ? 126 ILE A O    5  
ATOM 10483 C CB   . ILE A 1 126 ? 32.024 -9.179  13.326 1.00 70.42 ? 126 ILE A CB   5  
ATOM 10484 C CG1  . ILE A 1 126 ? 30.496 -9.259  13.337 1.00 20.14 ? 126 ILE A CG1  5  
ATOM 10485 C CG2  . ILE A 1 126 ? 32.616 -10.099 14.383 1.00 31.13 ? 126 ILE A CG2  5  
ATOM 10486 C CD1  . ILE A 1 126 ? 29.954 -10.543 12.750 1.00 35.45 ? 126 ILE A CD1  5  
ATOM 10487 H H    . ILE A 1 126 ? 31.347 -7.188  11.858 1.00 12.44 ? 126 ILE A H    5  
ATOM 10488 H HA   . ILE A 1 126 ? 32.142 -7.414  14.532 1.00 10.24 ? 126 ILE A HA   5  
ATOM 10489 H HB   . ILE A 1 126 ? 32.387 -9.499  12.361 1.00 32.31 ? 126 ILE A HB   5  
ATOM 10490 H HG12 . ILE A 1 126 ? 30.146 -9.186  14.355 1.00 73.22 ? 126 ILE A HG12 5  
ATOM 10491 H HG13 . ILE A 1 126 ? 30.096 -8.436  12.763 1.00 11.23 ? 126 ILE A HG13 5  
ATOM 10492 H HG21 . ILE A 1 126 ? 32.237 -9.820  15.356 1.00 45.04 ? 126 ILE A HG21 5  
ATOM 10493 H HG22 . ILE A 1 126 ? 32.337 -11.120 14.169 1.00 52.20 ? 126 ILE A HG22 5  
ATOM 10494 H HG23 . ILE A 1 126 ? 33.692 -10.011 14.377 1.00 52.54 ? 126 ILE A HG23 5  
ATOM 10495 H HD11 . ILE A 1 126 ? 28.874 -10.525 12.778 1.00 0.42  ? 126 ILE A HD11 5  
ATOM 10496 H HD12 . ILE A 1 126 ? 30.287 -10.642 11.729 1.00 52.25 ? 126 ILE A HD12 5  
ATOM 10497 H HD13 . ILE A 1 126 ? 30.313 -11.383 13.328 1.00 13.04 ? 126 ILE A HD13 5  
ATOM 10498 N N    . MET A 1 127 ? 34.580 -7.764  12.336 1.00 24.44 ? 127 MET A N    5  
ATOM 10499 C CA   . MET A 1 127 ? 36.030 -7.729  12.177 1.00 55.34 ? 127 MET A CA   5  
ATOM 10500 C C    . MET A 1 127 ? 36.627 -6.525  12.899 1.00 54.14 ? 127 MET A C    5  
ATOM 10501 O O    . MET A 1 127 ? 37.732 -6.596  13.438 1.00 74.12 ? 127 MET A O    5  
ATOM 10502 C CB   . MET A 1 127 ? 36.399 -7.683  10.693 1.00 65.22 ? 127 MET A CB   5  
ATOM 10503 C CG   . MET A 1 127 ? 36.702 -9.050  10.100 1.00 52.23 ? 127 MET A CG   5  
ATOM 10504 S SD   . MET A 1 127 ? 38.462 -9.305  9.806  1.00 63.41 ? 127 MET A SD   5  
ATOM 10505 C CE   . MET A 1 127 ? 39.127 -8.996  11.440 1.00 13.12 ? 127 MET A CE   5  
ATOM 10506 H H    . MET A 1 127 ? 34.014 -7.850  11.541 1.00 62.10 ? 127 MET A H    5  
ATOM 10507 H HA   . MET A 1 127 ? 36.433 -8.631  12.611 1.00 12.13 ? 127 MET A HA   5  
ATOM 10508 H HB2  . MET A 1 127 ? 35.578 -7.249  10.142 1.00 21.43 ? 127 MET A HB2  5  
ATOM 10509 H HB3  . MET A 1 127 ? 37.273 -7.061  10.570 1.00 3.33  ? 127 MET A HB3  5  
ATOM 10510 H HG2  . MET A 1 127 ? 36.352 -9.810  10.782 1.00 12.45 ? 127 MET A HG2  5  
ATOM 10511 H HG3  . MET A 1 127 ? 36.176 -9.143  9.161  1.00 64.12 ? 127 MET A HG3  5  
ATOM 10512 H HE1  . MET A 1 127 ? 40.160 -9.306  11.473 1.00 25.45 ? 127 MET A HE1  5  
ATOM 10513 H HE2  . MET A 1 127 ? 39.060 -7.941  11.662 1.00 62.04 ? 127 MET A HE2  5  
ATOM 10514 H HE3  . MET A 1 127 ? 38.559 -9.554  12.171 1.00 63.33 ? 127 MET A HE3  5  
ATOM 10515 N N    . THR A 1 128 ? 35.889 -5.419  12.905 1.00 2.34  ? 128 THR A N    5  
ATOM 10516 C CA   . THR A 1 128 ? 36.347 -4.199  13.560 1.00 75.34 ? 128 THR A CA   5  
ATOM 10517 C C    . THR A 1 128 ? 36.786 -4.476  14.993 1.00 41.03 ? 128 THR A C    5  
ATOM 10518 O O    . THR A 1 128 ? 37.719 -3.851  15.497 1.00 55.24 ? 128 THR A O    5  
ATOM 10519 C CB   . THR A 1 128 ? 35.246 -3.121  13.571 1.00 22.52 ? 128 THR A CB   5  
ATOM 10520 O OG1  . THR A 1 128 ? 34.661 -3.005  12.270 1.00 75.23 ? 128 THR A OG1  5  
ATOM 10521 C CG2  . THR A 1 128 ? 35.811 -1.776  14.001 1.00 42.13 ? 128 THR A CG2  5  
ATOM 10522 H H    . THR A 1 128 ? 35.017 -5.424  12.458 1.00 22.24 ? 128 THR A H    5  
ATOM 10523 H HA   . THR A 1 128 ? 37.189 -3.818  13.002 1.00 44.41 ? 128 THR A HA   5  
ATOM 10524 H HB   . THR A 1 128 ? 34.482 -3.416  14.276 1.00 22.24 ? 128 THR A HB   5  
ATOM 10525 H HG1  . THR A 1 128 ? 35.303 -2.632  11.662 1.00 64.25 ? 128 THR A HG1  5  
ATOM 10526 H HG21 . THR A 1 128 ? 36.626 -1.502  13.347 1.00 60.32 ? 128 THR A HG21 5  
ATOM 10527 H HG22 . THR A 1 128 ? 36.172 -1.845  15.016 1.00 14.43 ? 128 THR A HG22 5  
ATOM 10528 H HG23 . THR A 1 128 ? 35.037 -1.026  13.943 1.00 32.02 ? 128 THR A HG23 5  
ATOM 10529 N N    . GLU A 1 129 ? 36.109 -5.417  15.643 1.00 0.15  ? 129 GLU A N    5  
ATOM 10530 C CA   . GLU A 1 129 ? 36.431 -5.775  17.020 1.00 63.33 ? 129 GLU A CA   5  
ATOM 10531 C C    . GLU A 1 129 ? 37.864 -6.289  17.127 1.00 43.31 ? 129 GLU A C    5  
ATOM 10532 O O    . GLU A 1 129 ? 38.575 -5.984  18.084 1.00 54.41 ? 129 GLU A O    5  
ATOM 10533 C CB   . GLU A 1 129 ? 35.458 -6.837  17.535 1.00 74.20 ? 129 GLU A CB   5  
ATOM 10534 C CG   . GLU A 1 129 ? 35.714 -7.251  18.974 1.00 1.03  ? 129 GLU A CG   5  
ATOM 10535 C CD   . GLU A 1 129 ? 35.815 -6.065  19.913 1.00 10.43 ? 129 GLU A CD   5  
ATOM 10536 O OE1  . GLU A 1 129 ? 34.758 -5.533  20.312 1.00 34.14 ? 129 GLU A OE1  5  
ATOM 10537 O OE2  . GLU A 1 129 ? 36.950 -5.668  20.249 1.00 43.53 ? 129 GLU A OE2  5  
ATOM 10538 H H    . GLU A 1 129 ? 35.376 -5.880  15.188 1.00 74.22 ? 129 GLU A H    5  
ATOM 10539 H HA   . GLU A 1 129 ? 36.334 -4.887  17.625 1.00 12.02 ? 129 GLU A HA   5  
ATOM 10540 H HB2  . GLU A 1 129 ? 34.452 -6.450  17.467 1.00 52.41 ? 129 GLU A HB2  5  
ATOM 10541 H HB3  . GLU A 1 129 ? 35.538 -7.715  16.911 1.00 42.23 ? 129 GLU A HB3  5  
ATOM 10542 H HG2  . GLU A 1 129 ? 34.903 -7.883  19.304 1.00 41.02 ? 129 GLU A HG2  5  
ATOM 10543 H HG3  . GLU A 1 129 ? 36.640 -7.805  19.017 1.00 44.24 ? 129 GLU A HG3  5  
ATOM 10544 N N    . GLY A 1 130 ? 38.282 -7.072  16.137 1.00 41.54 ? 130 GLY A N    5  
ATOM 10545 C CA   . GLY A 1 130 ? 39.627 -7.616  16.138 1.00 4.23  ? 130 GLY A CA   5  
ATOM 10546 C C    . GLY A 1 130 ? 40.668 -6.590  15.736 1.00 63.02 ? 130 GLY A C    5  
ATOM 10547 O O    . GLY A 1 130 ? 41.745 -6.523  16.329 1.00 71.03 ? 130 GLY A O    5  
ATOM 10548 H H    . GLY A 1 130 ? 37.672 -7.281  15.399 1.00 73.21 ? 130 GLY A H    5  
ATOM 10549 H HA2  . GLY A 1 130 ? 39.857 -7.976  17.130 1.00 72.41 ? 130 GLY A HA2  5  
ATOM 10550 H HA3  . GLY A 1 130 ? 39.669 -8.444  15.446 1.00 20.23 ? 130 GLY A HA3  5  
ATOM 10551 N N    . MET A 1 1   ? 3.572  1.920   1.448  1.00 25.12 ? 1   MET A N    6  
ATOM 10552 C CA   . MET A 1 1   ? 4.554  1.021   0.853  1.00 22.30 ? 1   MET A CA   6  
ATOM 10553 C C    . MET A 1 1   ? 3.992  -0.392  0.727  1.00 11.35 ? 1   MET A C    6  
ATOM 10554 O O    . MET A 1 1   ? 2.817  -0.630  1.007  1.00 73.45 ? 1   MET A O    6  
ATOM 10555 C CB   . MET A 1 1   ? 5.833  1.000   1.692  1.00 3.20  ? 1   MET A CB   6  
ATOM 10556 C CG   . MET A 1 1   ? 6.510  2.357   1.802  1.00 13.12 ? 1   MET A CG   6  
ATOM 10557 S SD   . MET A 1 1   ? 7.310  2.861   0.267  1.00 20.10 ? 1   MET A SD   6  
ATOM 10558 C CE   . MET A 1 1   ? 8.672  3.837   0.900  1.00 53.32 ? 1   MET A CE   6  
ATOM 10559 H H1   . MET A 1 1   ? 3.277  1.762   2.369  1.00 11.12 ? 1   MET A H1   6  
ATOM 10560 H HA   . MET A 1 1   ? 4.788  1.392   -0.134 1.00 34.34 ? 1   MET A HA   6  
ATOM 10561 H HB2  . MET A 1 1   ? 5.591  0.661   2.688  1.00 21.20 ? 1   MET A HB2  6  
ATOM 10562 H HB3  . MET A 1 1   ? 6.532  0.309   1.245  1.00 45.31 ? 1   MET A HB3  6  
ATOM 10563 H HG2  . MET A 1 1   ? 5.766  3.096   2.062  1.00 30.53 ? 1   MET A HG2  6  
ATOM 10564 H HG3  . MET A 1 1   ? 7.255  2.310   2.582  1.00 32.34 ? 1   MET A HG3  6  
ATOM 10565 H HE1  . MET A 1 1   ? 8.453  4.148   1.911  1.00 52.35 ? 1   MET A HE1  6  
ATOM 10566 H HE2  . MET A 1 1   ? 9.574  3.244   0.893  1.00 33.50 ? 1   MET A HE2  6  
ATOM 10567 H HE3  . MET A 1 1   ? 8.809  4.709   0.277  1.00 41.24 ? 1   MET A HE3  6  
ATOM 10568 N N    . LYS A 1 2   ? 4.838  -1.325  0.306  1.00 61.34 ? 2   LYS A N    6  
ATOM 10569 C CA   . LYS A 1 2   ? 4.427  -2.715  0.144  1.00 54.33 ? 2   LYS A CA   6  
ATOM 10570 C C    . LYS A 1 2   ? 4.470  -3.454  1.477  1.00 25.02 ? 2   LYS A C    6  
ATOM 10571 O O    . LYS A 1 2   ? 4.694  -2.850  2.527  1.00 74.32 ? 2   LYS A O    6  
ATOM 10572 C CB   . LYS A 1 2   ? 5.328  -3.420  -0.872 1.00 51.14 ? 2   LYS A CB   6  
ATOM 10573 C CG   . LYS A 1 2   ? 5.168  -2.900  -2.291 1.00 21.43 ? 2   LYS A CG   6  
ATOM 10574 C CD   . LYS A 1 2   ? 6.042  -1.682  -2.540 1.00 73.52 ? 2   LYS A CD   6  
ATOM 10575 C CE   . LYS A 1 2   ? 5.990  -1.248  -3.997 1.00 71.40 ? 2   LYS A CE   6  
ATOM 10576 N NZ   . LYS A 1 2   ? 7.153  -1.764  -4.771 1.00 2.50  ? 2   LYS A NZ   6  
ATOM 10577 H H    . LYS A 1 2   ? 5.763  -1.073  0.099  1.00 60.52 ? 2   LYS A H    6  
ATOM 10578 H HA   . LYS A 1 2   ? 3.412  -2.720  -0.224 1.00 13.53 ? 2   LYS A HA   6  
ATOM 10579 H HB2  . LYS A 1 2   ? 6.358  -3.286  -0.576 1.00 12.00 ? 2   LYS A HB2  6  
ATOM 10580 H HB3  . LYS A 1 2   ? 5.096  -4.475  -0.870 1.00 32.32 ? 2   LYS A HB3  6  
ATOM 10581 H HG2  . LYS A 1 2   ? 5.449  -3.679  -2.984 1.00 21.53 ? 2   LYS A HG2  6  
ATOM 10582 H HG3  . LYS A 1 2   ? 4.134  -2.629  -2.451 1.00 21.43 ? 2   LYS A HG3  6  
ATOM 10583 H HD2  . LYS A 1 2   ? 5.695  -0.868  -1.921 1.00 72.34 ? 2   LYS A HD2  6  
ATOM 10584 H HD3  . LYS A 1 2   ? 7.063  -1.924  -2.281 1.00 41.25 ? 2   LYS A HD3  6  
ATOM 10585 H HE2  . LYS A 1 2   ? 5.080  -1.624  -4.439 1.00 32.11 ? 2   LYS A HE2  6  
ATOM 10586 H HE3  . LYS A 1 2   ? 5.991  -0.169  -4.037 1.00 72.15 ? 2   LYS A HE3  6  
ATOM 10587 H HZ1  . LYS A 1 2   ? 7.849  -2.192  -4.127 1.00 51.31 ? 2   LYS A HZ1  6  
ATOM 10588 H HZ2  . LYS A 1 2   ? 7.610  -0.986  -5.289 1.00 61.30 ? 2   LYS A HZ2  6  
ATOM 10589 H HZ3  . LYS A 1 2   ? 6.839  -2.483  -5.453 1.00 12.12 ? 2   LYS A HZ3  6  
ATOM 10590 N N    . LYS A 1 3   ? 4.258  -4.765  1.429  1.00 15.31 ? 3   LYS A N    6  
ATOM 10591 C CA   . LYS A 1 3   ? 4.275  -5.588  2.632  1.00 3.14  ? 3   LYS A CA   6  
ATOM 10592 C C    . LYS A 1 3   ? 5.626  -5.496  3.335  1.00 43.24 ? 3   LYS A C    6  
ATOM 10593 O O    . LYS A 1 3   ? 6.571  -6.202  2.981  1.00 54.24 ? 3   LYS A O    6  
ATOM 10594 C CB   . LYS A 1 3   ? 3.969  -7.046  2.282  1.00 12.23 ? 3   LYS A CB   6  
ATOM 10595 C CG   . LYS A 1 3   ? 3.760  -7.932  3.498  1.00 61.21 ? 3   LYS A CG   6  
ATOM 10596 C CD   . LYS A 1 3   ? 3.592  -9.390  3.103  1.00 44.10 ? 3   LYS A CD   6  
ATOM 10597 C CE   . LYS A 1 3   ? 3.714  -10.311 4.307  1.00 32.11 ? 3   LYS A CE   6  
ATOM 10598 N NZ   . LYS A 1 3   ? 3.083  -11.637 4.057  1.00 11.32 ? 3   LYS A NZ   6  
ATOM 10599 H H    . LYS A 1 3   ? 4.085  -5.189  0.562  1.00 31.21 ? 3   LYS A H    6  
ATOM 10600 H HA   . LYS A 1 3   ? 3.511  -5.218  3.299  1.00 72.13 ? 3   LYS A HA   6  
ATOM 10601 H HB2  . LYS A 1 3   ? 3.072  -7.078  1.681  1.00 65.33 ? 3   LYS A HB2  6  
ATOM 10602 H HB3  . LYS A 1 3   ? 4.792  -7.446  1.708  1.00 21.22 ? 3   LYS A HB3  6  
ATOM 10603 H HG2  . LYS A 1 3   ? 4.617  -7.843  4.149  1.00 62.33 ? 3   LYS A HG2  6  
ATOM 10604 H HG3  . LYS A 1 3   ? 2.873  -7.606  4.022  1.00 74.13 ? 3   LYS A HG3  6  
ATOM 10605 H HD2  . LYS A 1 3   ? 2.617  -9.524  2.659  1.00 44.24 ? 3   LYS A HD2  6  
ATOM 10606 H HD3  . LYS A 1 3   ? 4.357  -9.649  2.384  1.00 75.13 ? 3   LYS A HD3  6  
ATOM 10607 H HE2  . LYS A 1 3   ? 4.760  -10.456 4.529  1.00 71.21 ? 3   LYS A HE2  6  
ATOM 10608 H HE3  . LYS A 1 3   ? 3.228  -9.844  5.151  1.00 23.23 ? 3   LYS A HE3  6  
ATOM 10609 H HZ1  . LYS A 1 3   ? 2.468  -11.587 3.220  1.00 73.01 ? 3   LYS A HZ1  6  
ATOM 10610 H HZ2  . LYS A 1 3   ? 2.510  -11.920 4.877  1.00 22.15 ? 3   LYS A HZ2  6  
ATOM 10611 H HZ3  . LYS A 1 3   ? 3.816  -12.356 3.894  1.00 75.31 ? 3   LYS A HZ3  6  
ATOM 10612 N N    . VAL A 1 4   ? 5.711  -4.622  4.333  1.00 70.21 ? 4   VAL A N    6  
ATOM 10613 C CA   . VAL A 1 4   ? 6.946  -4.440  5.087  1.00 53.03 ? 4   VAL A CA   6  
ATOM 10614 C C    . VAL A 1 4   ? 7.266  -5.674  5.923  1.00 43.13 ? 4   VAL A C    6  
ATOM 10615 O O    . VAL A 1 4   ? 6.667  -5.895  6.975  1.00 24.45 ? 4   VAL A O    6  
ATOM 10616 C CB   . VAL A 1 4   ? 6.861  -3.213  6.014  1.00 43.01 ? 4   VAL A CB   6  
ATOM 10617 C CG1  . VAL A 1 4   ? 8.146  -3.058  6.813  1.00 43.11 ? 4   VAL A CG1  6  
ATOM 10618 C CG2  . VAL A 1 4   ? 6.570  -1.956  5.208  1.00 12.03 ? 4   VAL A CG2  6  
ATOM 10619 H H    . VAL A 1 4   ? 4.924  -4.088  4.569  1.00 50.15 ? 4   VAL A H    6  
ATOM 10620 H HA   . VAL A 1 4   ? 7.747  -4.277  4.381  1.00 60.03 ? 4   VAL A HA   6  
ATOM 10621 H HB   . VAL A 1 4   ? 6.048  -3.367  6.708  1.00 3.12  ? 4   VAL A HB   6  
ATOM 10622 H HG11 . VAL A 1 4   ? 8.844  -3.831  6.525  1.00 1.41  ? 4   VAL A HG11 6  
ATOM 10623 H HG12 . VAL A 1 4   ? 8.579  -2.088  6.615  1.00 60.21 ? 4   VAL A HG12 6  
ATOM 10624 H HG13 . VAL A 1 4   ? 7.927  -3.146  7.867  1.00 64.41 ? 4   VAL A HG13 6  
ATOM 10625 H HG21 . VAL A 1 4   ? 5.674  -2.104  4.624  1.00 12.41 ? 4   VAL A HG21 6  
ATOM 10626 H HG22 . VAL A 1 4   ? 6.428  -1.122  5.880  1.00 13.13 ? 4   VAL A HG22 6  
ATOM 10627 H HG23 . VAL A 1 4   ? 7.400  -1.749  4.549  1.00 31.44 ? 4   VAL A HG23 6  
ATOM 10628 N N    . ILE A 1 5   ? 8.215  -6.474  5.447  1.00 12.31 ? 5   ILE A N    6  
ATOM 10629 C CA   . ILE A 1 5   ? 8.616  -7.685  6.152  1.00 43.22 ? 5   ILE A CA   6  
ATOM 10630 C C    . ILE A 1 5   ? 9.633  -7.373  7.245  1.00 35.33 ? 5   ILE A C    6  
ATOM 10631 O O    . ILE A 1 5   ? 10.736 -6.907  6.966  1.00 0.32  ? 5   ILE A O    6  
ATOM 10632 C CB   . ILE A 1 5   ? 9.219  -8.724  5.188  1.00 53.34 ? 5   ILE A CB   6  
ATOM 10633 C CG1  . ILE A 1 5   ? 8.488  -8.688  3.844  1.00 70.42 ? 5   ILE A CG1  6  
ATOM 10634 C CG2  . ILE A 1 5   ? 9.149  -10.116 5.798  1.00 4.40  ? 5   ILE A CG2  6  
ATOM 10635 C CD1  . ILE A 1 5   ? 6.993  -8.886  3.963  1.00 0.05  ? 5   ILE A CD1  6  
ATOM 10636 H H    . ILE A 1 5   ? 8.655  -6.243  4.603  1.00 65.50 ? 5   ILE A H    6  
ATOM 10637 H HA   . ILE A 1 5   ? 7.735  -8.113  6.606  1.00 34.51 ? 5   ILE A HA   6  
ATOM 10638 H HB   . ILE A 1 5   ? 10.258 -8.477  5.031  1.00 15.21 ? 5   ILE A HB   6  
ATOM 10639 H HG12 . ILE A 1 5   ? 8.659  -7.733  3.373  1.00 70.30 ? 5   ILE A HG12 6  
ATOM 10640 H HG13 . ILE A 1 5   ? 8.877  -9.472  3.210  1.00 24.33 ? 5   ILE A HG13 6  
ATOM 10641 H HG21 . ILE A 1 5   ? 9.357  -10.853 5.037  1.00 72.13 ? 5   ILE A HG21 6  
ATOM 10642 H HG22 . ILE A 1 5   ? 9.881  -10.199 6.587  1.00 3.23  ? 5   ILE A HG22 6  
ATOM 10643 H HG23 . ILE A 1 5   ? 8.162  -10.283 6.202  1.00 25.02 ? 5   ILE A HG23 6  
ATOM 10644 H HD11 . ILE A 1 5   ? 6.537  -8.787  2.989  1.00 2.14  ? 5   ILE A HD11 6  
ATOM 10645 H HD12 . ILE A 1 5   ? 6.790  -9.870  4.359  1.00 52.41 ? 5   ILE A HD12 6  
ATOM 10646 H HD13 . ILE A 1 5   ? 6.584  -8.139  4.629  1.00 74.22 ? 5   ILE A HD13 6  
ATOM 10647 N N    . ASN A 1 6   ? 9.252  -7.637  8.491  1.00 3.43  ? 6   ASN A N    6  
ATOM 10648 C CA   . ASN A 1 6   ? 10.131 -7.386  9.628  1.00 42.42 ? 6   ASN A CA   6  
ATOM 10649 C C    . ASN A 1 6   ? 10.651 -8.695  10.213 1.00 21.10 ? 6   ASN A C    6  
ATOM 10650 O O    . ASN A 1 6   ? 9.933  -9.399  10.923 1.00 11.34 ? 6   ASN A O    6  
ATOM 10651 C CB   . ASN A 1 6   ? 9.391  -6.591  10.705 1.00 2.55  ? 6   ASN A CB   6  
ATOM 10652 C CG   . ASN A 1 6   ? 9.709  -5.109  10.651 1.00 54.40 ? 6   ASN A CG   6  
ATOM 10653 O OD1  . ASN A 1 6   ? 10.360 -4.636  9.719  1.00 14.22 ? 6   ASN A OD1  6  
ATOM 10654 N ND2  . ASN A 1 6   ? 9.249  -4.368  11.653 1.00 72.03 ? 6   ASN A ND2  6  
ATOM 10655 H H    . ASN A 1 6   ? 8.360  -8.008  8.651  1.00 74.13 ? 6   ASN A H    6  
ATOM 10656 H HA   . ASN A 1 6   ? 10.970 -6.804  9.276  1.00 53.21 ? 6   ASN A HA   6  
ATOM 10657 H HB2  . ASN A 1 6   ? 8.327  -6.716  10.570 1.00 72.14 ? 6   ASN A HB2  6  
ATOM 10658 H HB3  . ASN A 1 6   ? 9.673  -6.965  11.678 1.00 35.11 ? 6   ASN A HB3  6  
ATOM 10659 H HD21 . ASN A 1 6   ? 8.738  -4.813  12.361 1.00 14.21 ? 6   ASN A HD21 6  
ATOM 10660 H HD22 . ASN A 1 6   ? 9.439  -3.407  11.642 1.00 12.33 ? 6   ASN A HD22 6  
ATOM 10661 N N    . VAL A 1 7   ? 11.905 -9.016  9.910  1.00 41.20 ? 7   VAL A N    6  
ATOM 10662 C CA   . VAL A 1 7   ? 12.523 -10.239 10.407 1.00 74.51 ? 7   VAL A CA   6  
ATOM 10663 C C    . VAL A 1 7   ? 13.822 -9.939  11.145 1.00 44.34 ? 7   VAL A C    6  
ATOM 10664 O O    . VAL A 1 7   ? 14.456 -8.908  10.914 1.00 35.34 ? 7   VAL A O    6  
ATOM 10665 C CB   . VAL A 1 7   ? 12.812 -11.227 9.261  1.00 22.32 ? 7   VAL A CB   6  
ATOM 10666 C CG1  . VAL A 1 7   ? 11.524 -11.876 8.777  1.00 43.54 ? 7   VAL A CG1  6  
ATOM 10667 C CG2  . VAL A 1 7   ? 13.527 -10.522 8.118  1.00 32.33 ? 7   VAL A CG2  6  
ATOM 10668 H H    . VAL A 1 7   ? 12.428 -8.415  9.339  1.00 15.52 ? 7   VAL A H    6  
ATOM 10669 H HA   . VAL A 1 7   ? 11.831 -10.708 11.092 1.00 21.11 ? 7   VAL A HA   6  
ATOM 10670 H HB   . VAL A 1 7   ? 13.460 -12.005 9.638  1.00 4.43  ? 7   VAL A HB   6  
ATOM 10671 H HG11 . VAL A 1 7   ? 10.735 -11.684 9.489  1.00 41.12 ? 7   VAL A HG11 6  
ATOM 10672 H HG12 . VAL A 1 7   ? 11.252 -11.463 7.816  1.00 4.21  ? 7   VAL A HG12 6  
ATOM 10673 H HG13 . VAL A 1 7   ? 11.672 -12.941 8.682  1.00 34.41 ? 7   VAL A HG13 6  
ATOM 10674 H HG21 . VAL A 1 7   ? 13.658 -11.211 7.297  1.00 22.44 ? 7   VAL A HG21 6  
ATOM 10675 H HG22 . VAL A 1 7   ? 12.936 -9.679  7.789  1.00 24.23 ? 7   VAL A HG22 6  
ATOM 10676 H HG23 . VAL A 1 7   ? 14.492 -10.175 8.456  1.00 71.41 ? 7   VAL A HG23 6  
ATOM 10677 N N    . VAL A 1 8   ? 14.216 -10.846 12.033 1.00 11.10 ? 8   VAL A N    6  
ATOM 10678 C CA   . VAL A 1 8   ? 15.442 -10.679 12.804 1.00 32.13 ? 8   VAL A CA   6  
ATOM 10679 C C    . VAL A 1 8   ? 16.253 -11.969 12.833 1.00 62.54 ? 8   VAL A C    6  
ATOM 10680 O O    . VAL A 1 8   ? 15.696 -13.066 12.816 1.00 32.12 ? 8   VAL A O    6  
ATOM 10681 C CB   . VAL A 1 8   ? 15.140 -10.243 14.251 1.00 62.54 ? 8   VAL A CB   6  
ATOM 10682 C CG1  . VAL A 1 8   ? 14.675 -8.796  14.286 1.00 15.13 ? 8   VAL A CG1  6  
ATOM 10683 C CG2  . VAL A 1 8   ? 14.102 -11.162 14.878 1.00 50.35 ? 8   VAL A CG2  6  
ATOM 10684 H H    . VAL A 1 8   ? 13.669 -11.647 12.172 1.00 11.14 ? 8   VAL A H    6  
ATOM 10685 H HA   . VAL A 1 8   ? 16.030 -9.905  12.333 1.00 63.31 ? 8   VAL A HA   6  
ATOM 10686 H HB   . VAL A 1 8   ? 16.051 -10.320 14.826 1.00 44.55 ? 8   VAL A HB   6  
ATOM 10687 H HG11 . VAL A 1 8   ? 15.529 -8.141  14.197 1.00 71.02 ? 8   VAL A HG11 6  
ATOM 10688 H HG12 . VAL A 1 8   ? 13.994 -8.616  13.467 1.00 11.11 ? 8   VAL A HG12 6  
ATOM 10689 H HG13 . VAL A 1 8   ? 14.171 -8.603  15.222 1.00 31.02 ? 8   VAL A HG13 6  
ATOM 10690 H HG21 . VAL A 1 8   ? 14.519 -12.151 14.990 1.00 30.31 ? 8   VAL A HG21 6  
ATOM 10691 H HG22 . VAL A 1 8   ? 13.820 -10.778 15.847 1.00 12.23 ? 8   VAL A HG22 6  
ATOM 10692 H HG23 . VAL A 1 8   ? 13.231 -11.208 14.242 1.00 55.23 ? 8   VAL A HG23 6  
ATOM 10693 N N    . GLY A 1 9   ? 17.575 -11.830 12.876 1.00 71.43 ? 9   GLY A N    6  
ATOM 10694 C CA   . GLY A 1 9   ? 18.443 -12.993 12.906 1.00 35.31 ? 9   GLY A CA   6  
ATOM 10695 C C    . GLY A 1 9   ? 19.125 -13.173 14.248 1.00 52.23 ? 9   GLY A C    6  
ATOM 10696 O O    . GLY A 1 9   ? 18.642 -12.683 15.268 1.00 54.32 ? 9   GLY A O    6  
ATOM 10697 H H    . GLY A 1 9   ? 17.964 -10.931 12.887 1.00 51.21 ? 9   GLY A H    6  
ATOM 10698 H HA2  . GLY A 1 9   ? 17.854 -13.873 12.692 1.00 25.33 ? 9   GLY A HA2  6  
ATOM 10699 H HA3  . GLY A 1 9   ? 19.199 -12.884 12.143 1.00 51.23 ? 9   GLY A HA3  6  
ATOM 10700 N N    . ALA A 1 10  ? 20.251 -13.879 14.247 1.00 13.14 ? 10  ALA A N    6  
ATOM 10701 C CA   . ALA A 1 10  ? 21.000 -14.122 15.474 1.00 45.43 ? 10  ALA A CA   6  
ATOM 10702 C C    . ALA A 1 10  ? 22.422 -14.579 15.166 1.00 4.13  ? 10  ALA A C    6  
ATOM 10703 O O    . ALA A 1 10  ? 22.635 -15.453 14.326 1.00 70.32 ? 10  ALA A O    6  
ATOM 10704 C CB   . ALA A 1 10  ? 20.286 -15.154 16.333 1.00 2.14  ? 10  ALA A CB   6  
ATOM 10705 H H    . ALA A 1 10  ? 20.586 -14.244 13.402 1.00 13.12 ? 10  ALA A H    6  
ATOM 10706 H HA   . ALA A 1 10  ? 21.043 -13.195 16.028 1.00 50.11 ? 10  ALA A HA   6  
ATOM 10707 H HB1  . ALA A 1 10  ? 20.978 -15.559 17.057 1.00 65.50 ? 10  ALA A HB1  6  
ATOM 10708 H HB2  . ALA A 1 10  ? 19.461 -14.685 16.848 1.00 51.33 ? 10  ALA A HB2  6  
ATOM 10709 H HB3  . ALA A 1 10  ? 19.914 -15.950 15.705 1.00 3.45  ? 10  ALA A HB3  6  
ATOM 10710 N N    . ILE A 1 11  ? 23.392 -13.982 15.851 1.00 31.25 ? 11  ILE A N    6  
ATOM 10711 C CA   . ILE A 1 11  ? 24.793 -14.329 15.651 1.00 23.21 ? 11  ILE A CA   6  
ATOM 10712 C C    . ILE A 1 11  ? 25.436 -14.794 16.954 1.00 42.25 ? 11  ILE A C    6  
ATOM 10713 O O    . ILE A 1 11  ? 25.908 -13.981 17.749 1.00 12.21 ? 11  ILE A O    6  
ATOM 10714 C CB   . ILE A 1 11  ? 25.594 -13.138 15.093 1.00 61.02 ? 11  ILE A CB   6  
ATOM 10715 C CG1  . ILE A 1 11  ? 25.184 -11.844 15.799 1.00 24.12 ? 11  ILE A CG1  6  
ATOM 10716 C CG2  . ILE A 1 11  ? 25.385 -13.017 13.591 1.00 42.13 ? 11  ILE A CG2  6  
ATOM 10717 C CD1  . ILE A 1 11  ? 25.949 -10.628 15.325 1.00 64.41 ? 11  ILE A CD1  6  
ATOM 10718 H H    . ILE A 1 11  ? 23.159 -13.293 16.508 1.00 42.14 ? 11  ILE A H    6  
ATOM 10719 H HA   . ILE A 1 11  ? 24.837 -15.135 14.933 1.00 63.32 ? 11  ILE A HA   6  
ATOM 10720 H HB   . ILE A 1 11  ? 26.642 -13.322 15.273 1.00 42.34 ? 11  ILE A HB   6  
ATOM 10721 H HG12 . ILE A 1 11  ? 24.135 -11.663 15.626 1.00 23.32 ? 11  ILE A HG12 6  
ATOM 10722 H HG13 . ILE A 1 11  ? 25.357 -11.952 16.860 1.00 34.34 ? 11  ILE A HG13 6  
ATOM 10723 H HG21 . ILE A 1 11  ? 24.748 -13.820 13.250 1.00 3.10  ? 11  ILE A HG21 6  
ATOM 10724 H HG22 . ILE A 1 11  ? 24.918 -12.069 13.368 1.00 22.30 ? 11  ILE A HG22 6  
ATOM 10725 H HG23 . ILE A 1 11  ? 26.339 -13.076 13.088 1.00 12.24 ? 11  ILE A HG23 6  
ATOM 10726 H HD11 . ILE A 1 11  ? 25.375 -10.114 14.568 1.00 5.03  ? 11  ILE A HD11 6  
ATOM 10727 H HD12 . ILE A 1 11  ? 26.125 -9.965  16.158 1.00 30.12 ? 11  ILE A HD12 6  
ATOM 10728 H HD13 . ILE A 1 11  ? 26.896 -10.940 14.907 1.00 3.42  ? 11  ILE A HD13 6  
ATOM 10729 N N    . ILE A 1 12  ? 25.453 -16.106 17.164 1.00 52.43 ? 12  ILE A N    6  
ATOM 10730 C CA   . ILE A 1 12  ? 26.041 -16.678 18.368 1.00 33.52 ? 12  ILE A CA   6  
ATOM 10731 C C    . ILE A 1 12  ? 27.564 -16.683 18.288 1.00 75.42 ? 12  ILE A C    6  
ATOM 10732 O O    . ILE A 1 12  ? 28.144 -17.195 17.330 1.00 33.20 ? 12  ILE A O    6  
ATOM 10733 C CB   . ILE A 1 12  ? 25.546 -18.117 18.607 1.00 72.22 ? 12  ILE A CB   6  
ATOM 10734 C CG1  . ILE A 1 12  ? 24.044 -18.121 18.901 1.00 23.03 ? 12  ILE A CG1  6  
ATOM 10735 C CG2  . ILE A 1 12  ? 26.317 -18.760 19.750 1.00 10.20 ? 12  ILE A CG2  6  
ATOM 10736 C CD1  . ILE A 1 12  ? 23.184 -18.077 17.658 1.00 65.54 ? 12  ILE A CD1  6  
ATOM 10737 H H    . ILE A 1 12  ? 25.061 -16.702 16.493 1.00 62.35 ? 12  ILE A H    6  
ATOM 10738 H HA   . ILE A 1 12  ? 25.737 -16.071 19.208 1.00 1.44  ? 12  ILE A HA   6  
ATOM 10739 H HB   . ILE A 1 12  ? 25.731 -18.691 17.712 1.00 64.11 ? 12  ILE A HB   6  
ATOM 10740 H HG12 . ILE A 1 12  ? 23.793 -19.017 19.446 1.00 31.14 ? 12  ILE A HG12 6  
ATOM 10741 H HG13 . ILE A 1 12  ? 23.801 -17.258 19.504 1.00 3.21  ? 12  ILE A HG13 6  
ATOM 10742 H HG21 . ILE A 1 12  ? 26.458 -18.037 20.540 1.00 45.11 ? 12  ILE A HG21 6  
ATOM 10743 H HG22 . ILE A 1 12  ? 25.760 -19.603 20.130 1.00 12.35 ? 12  ILE A HG22 6  
ATOM 10744 H HG23 . ILE A 1 12  ? 27.279 -19.095 19.392 1.00 33.23 ? 12  ILE A HG23 6  
ATOM 10745 H HD11 . ILE A 1 12  ? 22.164 -18.317 17.917 1.00 54.34 ? 12  ILE A HD11 6  
ATOM 10746 H HD12 . ILE A 1 12  ? 23.225 -17.089 17.225 1.00 23.24 ? 12  ILE A HD12 6  
ATOM 10747 H HD13 . ILE A 1 12  ? 23.551 -18.799 16.941 1.00 3.32  ? 12  ILE A HD13 6  
ATOM 10748 N N    . PHE A 1 13  ? 28.206 -16.112 19.301 1.00 51.30 ? 13  PHE A N    6  
ATOM 10749 C CA   . PHE A 1 13  ? 29.662 -16.051 19.346 1.00 42.30 ? 13  PHE A CA   6  
ATOM 10750 C C    . PHE A 1 13  ? 30.206 -16.885 20.502 1.00 70.10 ? 13  PHE A C    6  
ATOM 10751 O O    . PHE A 1 13  ? 29.780 -16.731 21.647 1.00 64.33 ? 13  PHE A O    6  
ATOM 10752 C CB   . PHE A 1 13  ? 30.129 -14.600 19.485 1.00 31.23 ? 13  PHE A CB   6  
ATOM 10753 C CG   . PHE A 1 13  ? 30.129 -13.843 18.188 1.00 71.30 ? 13  PHE A CG   6  
ATOM 10754 C CD1  . PHE A 1 13  ? 28.968 -13.254 17.715 1.00 52.52 ? 13  PHE A CD1  6  
ATOM 10755 C CD2  . PHE A 1 13  ? 31.290 -13.721 17.442 1.00 40.10 ? 13  PHE A CD2  6  
ATOM 10756 C CE1  . PHE A 1 13  ? 28.965 -12.557 16.521 1.00 60.20 ? 13  PHE A CE1  6  
ATOM 10757 C CE2  . PHE A 1 13  ? 31.293 -13.025 16.248 1.00 65.35 ? 13  PHE A CE2  6  
ATOM 10758 C CZ   . PHE A 1 13  ? 30.129 -12.442 15.787 1.00 5.11  ? 13  PHE A CZ   6  
ATOM 10759 H H    . PHE A 1 13  ? 27.688 -15.721 20.036 1.00 52.22 ? 13  PHE A H    6  
ATOM 10760 H HA   . PHE A 1 13  ? 30.039 -16.454 18.419 1.00 53.45 ? 13  PHE A HA   6  
ATOM 10761 H HB2  . PHE A 1 13  ? 29.474 -14.083 20.170 1.00 23.14 ? 13  PHE A HB2  6  
ATOM 10762 H HB3  . PHE A 1 13  ? 31.135 -14.590 19.877 1.00 13.43 ? 13  PHE A HB3  6  
ATOM 10763 H HD1  . PHE A 1 13  ? 28.057 -13.342 18.288 1.00 14.20 ? 13  PHE A HD1  6  
ATOM 10764 H HD2  . PHE A 1 13  ? 32.202 -14.177 17.802 1.00 72.12 ? 13  PHE A HD2  6  
ATOM 10765 H HE1  . PHE A 1 13  ? 28.054 -12.102 16.163 1.00 13.43 ? 13  PHE A HE1  6  
ATOM 10766 H HE2  . PHE A 1 13  ? 32.206 -12.937 15.676 1.00 32.35 ? 13  PHE A HE2  6  
ATOM 10767 H HZ   . PHE A 1 13  ? 30.130 -11.899 14.854 1.00 53.40 ? 13  PHE A HZ   6  
ATOM 10768 N N    . SER A 1 14  ? 31.149 -17.769 20.193 1.00 21.43 ? 14  SER A N    6  
ATOM 10769 C CA   . SER A 1 14  ? 31.749 -18.632 21.205 1.00 53.14 ? 14  SER A CA   6  
ATOM 10770 C C    . SER A 1 14  ? 33.208 -18.927 20.871 1.00 1.43  ? 14  SER A C    6  
ATOM 10771 O O    . SER A 1 14  ? 33.548 -19.216 19.724 1.00 21.10 ? 14  SER A O    6  
ATOM 10772 C CB   . SER A 1 14  ? 30.965 -19.941 21.318 1.00 24.23 ? 14  SER A CB   6  
ATOM 10773 O OG   . SER A 1 14  ? 30.572 -20.412 20.041 1.00 34.41 ? 14  SER A OG   6  
ATOM 10774 H H    . SER A 1 14  ? 31.447 -17.845 19.262 1.00 34.13 ? 14  SER A H    6  
ATOM 10775 H HA   . SER A 1 14  ? 31.705 -18.113 22.151 1.00 64.23 ? 14  SER A HA   6  
ATOM 10776 H HB2  . SER A 1 14  ? 31.585 -20.689 21.789 1.00 43.10 ? 14  SER A HB2  6  
ATOM 10777 H HB3  . SER A 1 14  ? 30.081 -19.777 21.917 1.00 20.41 ? 14  SER A HB3  6  
ATOM 10778 H HG   . SER A 1 14  ? 30.027 -21.197 20.143 1.00 44.42 ? 14  SER A HG   6  
ATOM 10779 N N    . ASP A 1 15  ? 34.066 -18.850 21.883 1.00 61.44 ? 15  ASP A N    6  
ATOM 10780 C CA   . ASP A 1 15  ? 35.489 -19.110 21.699 1.00 44.42 ? 15  ASP A CA   6  
ATOM 10781 C C    . ASP A 1 15  ? 36.048 -18.284 20.544 1.00 14.52 ? 15  ASP A C    6  
ATOM 10782 O O    . ASP A 1 15  ? 36.922 -18.739 19.809 1.00 44.33 ? 15  ASP A O    6  
ATOM 10783 C CB   . ASP A 1 15  ? 35.729 -20.598 21.440 1.00 3.12  ? 15  ASP A CB   6  
ATOM 10784 C CG   . ASP A 1 15  ? 35.715 -21.417 22.716 1.00 54.11 ? 15  ASP A CG   6  
ATOM 10785 O OD1  . ASP A 1 15  ? 36.802 -21.647 23.285 1.00 32.31 ? 15  ASP A OD1  6  
ATOM 10786 O OD2  . ASP A 1 15  ? 34.616 -21.828 23.145 1.00 71.34 ? 15  ASP A OD2  6  
ATOM 10787 H H    . ASP A 1 15  ? 33.734 -18.615 22.774 1.00 2.14  ? 15  ASP A H    6  
ATOM 10788 H HA   . ASP A 1 15  ? 35.998 -18.825 22.607 1.00 23.03 ? 15  ASP A HA   6  
ATOM 10789 H HB2  . ASP A 1 15  ? 34.956 -20.972 20.785 1.00 32.24 ? 15  ASP A HB2  6  
ATOM 10790 H HB3  . ASP A 1 15  ? 36.690 -20.723 20.964 1.00 64.42 ? 15  ASP A HB3  6  
ATOM 10791 N N    . ASN A 1 16  ? 35.534 -17.067 20.391 1.00 23.12 ? 16  ASN A N    6  
ATOM 10792 C CA   . ASN A 1 16  ? 35.980 -16.178 19.325 1.00 45.12 ? 16  ASN A CA   6  
ATOM 10793 C C    . ASN A 1 16  ? 35.661 -16.769 17.955 1.00 43.42 ? 16  ASN A C    6  
ATOM 10794 O O    . ASN A 1 16  ? 36.435 -16.624 17.008 1.00 24.43 ? 16  ASN A O    6  
ATOM 10795 C CB   . ASN A 1 16  ? 37.484 -15.919 19.443 1.00 32.45 ? 16  ASN A CB   6  
ATOM 10796 C CG   . ASN A 1 16  ? 37.891 -15.512 20.846 1.00 4.21  ? 16  ASN A CG   6  
ATOM 10797 O OD1  . ASN A 1 16  ? 37.115 -14.894 21.575 1.00 22.34 ? 16  ASN A OD1  6  
ATOM 10798 N ND2  . ASN A 1 16  ? 39.115 -15.856 21.230 1.00 20.41 ? 16  ASN A ND2  6  
ATOM 10799 H H    . ASN A 1 16  ? 34.839 -16.760 21.010 1.00 71.13 ? 16  ASN A H    6  
ATOM 10800 H HA   . ASN A 1 16  ? 35.454 -15.242 19.432 1.00 13.30 ? 16  ASN A HA   6  
ATOM 10801 H HB2  . ASN A 1 16  ? 38.020 -16.820 19.181 1.00 35.24 ? 16  ASN A HB2  6  
ATOM 10802 H HB3  . ASN A 1 16  ? 37.762 -15.129 18.763 1.00 43.10 ? 16  ASN A HB3  6  
ATOM 10803 H HD21 . ASN A 1 16  ? 39.679 -16.347 20.596 1.00 34.40 ? 16  ASN A HD21 6  
ATOM 10804 H HD22 . ASN A 1 16  ? 39.404 -15.606 22.132 1.00 22.04 ? 16  ASN A HD22 6  
ATOM 10805 N N    . LYS A 1 17  ? 34.515 -17.434 17.856 1.00 44.11 ? 17  LYS A N    6  
ATOM 10806 C CA   . LYS A 1 17  ? 34.091 -18.045 16.602 1.00 31.52 ? 17  LYS A CA   6  
ATOM 10807 C C    . LYS A 1 17  ? 32.619 -17.756 16.326 1.00 0.53  ? 17  LYS A C    6  
ATOM 10808 O O    . LYS A 1 17  ? 31.949 -17.092 17.118 1.00 34.32 ? 17  LYS A O    6  
ATOM 10809 C CB   . LYS A 1 17  ? 34.325 -19.557 16.644 1.00 71.35 ? 17  LYS A CB   6  
ATOM 10810 C CG   . LYS A 1 17  ? 35.670 -19.980 16.079 1.00 21.21 ? 17  LYS A CG   6  
ATOM 10811 C CD   . LYS A 1 17  ? 36.700 -20.176 17.179 1.00 34.33 ? 17  LYS A CD   6  
ATOM 10812 C CE   . LYS A 1 17  ? 37.908 -20.954 16.680 1.00 52.30 ? 17  LYS A CE   6  
ATOM 10813 N NZ   . LYS A 1 17  ? 37.755 -22.418 16.901 1.00 72.52 ? 17  LYS A NZ   6  
ATOM 10814 H H    . LYS A 1 17  ? 33.940 -17.515 18.646 1.00 2.20  ? 17  LYS A H    6  
ATOM 10815 H HA   . LYS A 1 17  ? 34.684 -17.619 15.808 1.00 64.44 ? 17  LYS A HA   6  
ATOM 10816 H HB2  . LYS A 1 17  ? 34.267 -19.890 17.669 1.00 23.52 ? 17  LYS A HB2  6  
ATOM 10817 H HB3  . LYS A 1 17  ? 33.549 -20.045 16.071 1.00 33.25 ? 17  LYS A HB3  6  
ATOM 10818 H HG2  . LYS A 1 17  ? 35.550 -20.910 15.544 1.00 74.30 ? 17  LYS A HG2  6  
ATOM 10819 H HG3  . LYS A 1 17  ? 36.022 -19.216 15.401 1.00 2.42  ? 17  LYS A HG3  6  
ATOM 10820 H HD2  . LYS A 1 17  ? 37.028 -19.209 17.530 1.00 61.11 ? 17  LYS A HD2  6  
ATOM 10821 H HD3  . LYS A 1 17  ? 36.244 -20.721 17.994 1.00 14.32 ? 17  LYS A HD3  6  
ATOM 10822 H HE2  . LYS A 1 17  ? 38.027 -20.768 15.624 1.00 64.23 ? 17  LYS A HE2  6  
ATOM 10823 H HE3  . LYS A 1 17  ? 38.785 -20.608 17.208 1.00 74.34 ? 17  LYS A HE3  6  
ATOM 10824 H HZ1  . LYS A 1 17  ? 38.648 -22.907 16.686 1.00 75.01 ? 17  LYS A HZ1  6  
ATOM 10825 H HZ2  . LYS A 1 17  ? 37.009 -22.797 16.283 1.00 14.22 ? 17  LYS A HZ2  6  
ATOM 10826 H HZ3  . LYS A 1 17  ? 37.499 -22.606 17.891 1.00 32.00 ? 17  LYS A HZ3  6  
ATOM 10827 N N    . ILE A 1 18  ? 32.123 -18.257 15.201 1.00 72.44 ? 18  ILE A N    6  
ATOM 10828 C CA   . ILE A 1 18  ? 30.730 -18.054 14.823 1.00 53.11 ? 18  ILE A CA   6  
ATOM 10829 C C    . ILE A 1 18  ? 30.097 -19.353 14.337 1.00 74.15 ? 18  ILE A C    6  
ATOM 10830 O O    . ILE A 1 18  ? 30.782 -20.233 13.813 1.00 52.41 ? 18  ILE A O    6  
ATOM 10831 C CB   . ILE A 1 18  ? 30.595 -16.986 13.721 1.00 63.41 ? 18  ILE A CB   6  
ATOM 10832 C CG1  . ILE A 1 18  ? 31.381 -15.730 14.099 1.00 5.55  ? 18  ILE A CG1  6  
ATOM 10833 C CG2  . ILE A 1 18  ? 29.130 -16.650 13.485 1.00 64.52 ? 18  ILE A CG2  6  
ATOM 10834 C CD1  . ILE A 1 18  ? 31.389 -14.673 13.017 1.00 3.11  ? 18  ILE A CD1  6  
ATOM 10835 H H    . ILE A 1 18  ? 32.707 -18.777 14.611 1.00 70.34 ? 18  ILE A H    6  
ATOM 10836 H HA   . ILE A 1 18  ? 30.195 -17.710 15.697 1.00 73.15 ? 18  ILE A HA   6  
ATOM 10837 H HB   . ILE A 1 18  ? 30.999 -17.393 12.806 1.00 14.21 ? 18  ILE A HB   6  
ATOM 10838 H HG12 . ILE A 1 18  ? 30.946 -15.293 14.985 1.00 65.33 ? 18  ILE A HG12 6  
ATOM 10839 H HG13 . ILE A 1 18  ? 32.406 -16.003 14.304 1.00 24.45 ? 18  ILE A HG13 6  
ATOM 10840 H HG21 . ILE A 1 18  ? 28.658 -16.416 14.428 1.00 64.24 ? 18  ILE A HG21 6  
ATOM 10841 H HG22 . ILE A 1 18  ? 29.059 -15.798 12.826 1.00 73.21 ? 18  ILE A HG22 6  
ATOM 10842 H HG23 . ILE A 1 18  ? 28.635 -17.497 13.034 1.00 34.14 ? 18  ILE A HG23 6  
ATOM 10843 H HD11 . ILE A 1 18  ? 31.436 -15.149 12.049 1.00 73.12 ? 18  ILE A HD11 6  
ATOM 10844 H HD12 . ILE A 1 18  ? 30.490 -14.080 13.085 1.00 33.22 ? 18  ILE A HD12 6  
ATOM 10845 H HD13 . ILE A 1 18  ? 32.252 -14.034 13.144 1.00 14.14 ? 18  ILE A HD13 6  
ATOM 10846 N N    . LEU A 1 19  ? 28.785 -19.467 14.511 1.00 14.11 ? 19  LEU A N    6  
ATOM 10847 C CA   . LEU A 1 19  ? 28.057 -20.658 14.088 1.00 20.51 ? 19  LEU A CA   6  
ATOM 10848 C C    . LEU A 1 19  ? 27.354 -20.423 12.755 1.00 43.20 ? 19  LEU A C    6  
ATOM 10849 O O    . LEU A 1 19  ? 27.162 -19.280 12.337 1.00 73.40 ? 19  LEU A O    6  
ATOM 10850 C CB   . LEU A 1 19  ? 27.035 -21.060 15.153 1.00 74.44 ? 19  LEU A CB   6  
ATOM 10851 C CG   . LEU A 1 19  ? 25.654 -20.414 15.035 1.00 11.10 ? 19  LEU A CG   6  
ATOM 10852 C CD1  . LEU A 1 19  ? 24.719 -20.953 16.107 1.00 61.25 ? 19  LEU A CD1  6  
ATOM 10853 C CD2  . LEU A 1 19  ? 25.764 -18.899 15.134 1.00 60.42 ? 19  LEU A CD2  6  
ATOM 10854 H H    . LEU A 1 19  ? 28.293 -18.733 14.934 1.00 33.01 ? 19  LEU A H    6  
ATOM 10855 H HA   . LEU A 1 19  ? 28.773 -21.458 13.968 1.00 74.13 ? 19  LEU A HA   6  
ATOM 10856 H HB2  . LEU A 1 19  ? 26.904 -22.130 15.098 1.00 22.23 ? 19  LEU A HB2  6  
ATOM 10857 H HB3  . LEU A 1 19  ? 27.443 -20.798 16.118 1.00 1.31  ? 19  LEU A HB3  6  
ATOM 10858 H HG   . LEU A 1 19  ? 25.230 -20.657 14.070 1.00 24.22 ? 19  LEU A HG   6  
ATOM 10859 H HD11 . LEU A 1 19  ? 24.808 -20.351 16.998 1.00 22.31 ? 19  LEU A HD11 6  
ATOM 10860 H HD12 . LEU A 1 19  ? 24.984 -21.975 16.334 1.00 71.20 ? 19  LEU A HD12 6  
ATOM 10861 H HD13 . LEU A 1 19  ? 23.701 -20.917 15.747 1.00 30.11 ? 19  LEU A HD13 6  
ATOM 10862 H HD21 . LEU A 1 19  ? 26.051 -18.497 14.174 1.00 50.43 ? 19  LEU A HD21 6  
ATOM 10863 H HD22 . LEU A 1 19  ? 26.511 -18.640 15.870 1.00 33.15 ? 19  LEU A HD22 6  
ATOM 10864 H HD23 . LEU A 1 19  ? 24.810 -18.488 15.427 1.00 51.52 ? 19  LEU A HD23 6  
ATOM 10865 N N    . CYS A 1 20  ? 26.972 -21.509 12.094 1.00 70.44 ? 20  CYS A N    6  
ATOM 10866 C CA   . CYS A 1 20  ? 26.289 -21.421 10.808 1.00 74.11 ? 20  CYS A CA   6  
ATOM 10867 C C    . CYS A 1 20  ? 25.107 -22.384 10.753 1.00 11.21 ? 20  CYS A C    6  
ATOM 10868 O O    . CYS A 1 20  ? 25.193 -23.515 11.229 1.00 71.52 ? 20  CYS A O    6  
ATOM 10869 C CB   . CYS A 1 20  ? 27.262 -21.724 9.668  1.00 50.32 ? 20  CYS A CB   6  
ATOM 10870 S SG   . CYS A 1 20  ? 26.459 -22.138 8.102  1.00 74.51 ? 20  CYS A SG   6  
ATOM 10871 H H    . CYS A 1 20  ? 27.154 -22.392 12.478 1.00 34.51 ? 20  CYS A H    6  
ATOM 10872 H HA   . CYS A 1 20  ? 25.921 -20.412 10.698 1.00 73.53 ? 20  CYS A HA   6  
ATOM 10873 H HB2  . CYS A 1 20  ? 27.885 -20.858 9.497  1.00 22.22 ? 20  CYS A HB2  6  
ATOM 10874 H HB3  . CYS A 1 20  ? 27.886 -22.558 9.950  1.00 64.43 ? 20  CYS A HB3  6  
ATOM 10875 H HG   . CYS A 1 20  ? 25.760 -23.249 8.283  1.00 54.41 ? 20  CYS A HG   6  
ATOM 10876 N N    . ALA A 1 21  ? 24.004 -21.926 10.171 1.00 54.41 ? 21  ALA A N    6  
ATOM 10877 C CA   . ALA A 1 21  ? 22.805 -22.746 10.054 1.00 54.04 ? 21  ALA A CA   6  
ATOM 10878 C C    . ALA A 1 21  ? 22.118 -22.525 8.710  1.00 34.32 ? 21  ALA A C    6  
ATOM 10879 O O    . ALA A 1 21  ? 22.114 -21.414 8.181  1.00 73.54 ? 21  ALA A O    6  
ATOM 10880 C CB   . ALA A 1 21  ? 21.845 -22.444 11.195 1.00 31.32 ? 21  ALA A CB   6  
ATOM 10881 H H    . ALA A 1 21  ? 23.997 -21.015 9.811  1.00 55.55 ? 21  ALA A H    6  
ATOM 10882 H HA   . ALA A 1 21  ? 23.101 -23.783 10.129 1.00 14.52 ? 21  ALA A HA   6  
ATOM 10883 H HB1  . ALA A 1 21  ? 22.049 -21.457 11.584 1.00 20.35 ? 21  ALA A HB1  6  
ATOM 10884 H HB2  . ALA A 1 21  ? 20.829 -22.485 10.832 1.00 61.54 ? 21  ALA A HB2  6  
ATOM 10885 H HB3  . ALA A 1 21  ? 21.977 -23.175 11.979 1.00 63.11 ? 21  ALA A HB3  6  
ATOM 10886 N N    . GLN A 1 22  ? 21.539 -23.590 8.165  1.00 73.22 ? 22  GLN A N    6  
ATOM 10887 C CA   . GLN A 1 22  ? 20.850 -23.512 6.882  1.00 41.30 ? 22  GLN A CA   6  
ATOM 10888 C C    . GLN A 1 22  ? 19.347 -23.700 7.059  1.00 50.44 ? 22  GLN A C    6  
ATOM 10889 O O    . GLN A 1 22  ? 18.875 -24.811 7.299  1.00 14.34 ? 22  GLN A O    6  
ATOM 10890 C CB   . GLN A 1 22  ? 21.398 -24.567 5.920  1.00 44.45 ? 22  GLN A CB   6  
ATOM 10891 C CG   . GLN A 1 22  ? 20.503 -24.817 4.717  1.00 71.01 ? 22  GLN A CG   6  
ATOM 10892 C CD   . GLN A 1 22  ? 21.289 -25.116 3.456  1.00 43.42 ? 22  GLN A CD   6  
ATOM 10893 O OE1  . GLN A 1 22  ? 22.394 -25.657 3.513  1.00 72.14 ? 22  GLN A OE1  6  
ATOM 10894 N NE2  . GLN A 1 22  ? 20.723 -24.763 2.307  1.00 22.34 ? 22  GLN A NE2  6  
ATOM 10895 H H    . GLN A 1 22  ? 21.576 -24.448 8.636  1.00 71.23 ? 22  GLN A H    6  
ATOM 10896 H HA   . GLN A 1 22  ? 21.031 -22.531 6.468  1.00 24.31 ? 22  GLN A HA   6  
ATOM 10897 H HB2  . GLN A 1 22  ? 22.364 -24.243 5.561  1.00 1.33  ? 22  GLN A HB2  6  
ATOM 10898 H HB3  . GLN A 1 22  ? 21.515 -25.498 6.454  1.00 43.12 ? 22  GLN A HB3  6  
ATOM 10899 H HG2  . GLN A 1 22  ? 19.862 -25.660 4.930  1.00 0.45  ? 22  GLN A HG2  6  
ATOM 10900 H HG3  . GLN A 1 22  ? 19.897 -23.939 4.547  1.00 71.41 ? 22  GLN A HG3  6  
ATOM 10901 H HE21 . GLN A 1 22  ? 19.842 -24.335 2.339  1.00 53.22 ? 22  GLN A HE21 6  
ATOM 10902 H HE22 . GLN A 1 22  ? 21.210 -24.944 1.477  1.00 14.41 ? 22  GLN A HE22 6  
ATOM 10903 N N    . ARG A 1 23  ? 18.601 -22.607 6.938  1.00 53.43 ? 23  ARG A N    6  
ATOM 10904 C CA   . ARG A 1 23  ? 17.151 -22.651 7.086  1.00 70.14 ? 23  ARG A CA   6  
ATOM 10905 C C    . ARG A 1 23  ? 16.488 -23.144 5.802  1.00 4.24  ? 23  ARG A C    6  
ATOM 10906 O O    . ARG A 1 23  ? 16.034 -24.285 5.725  1.00 34.04 ? 23  ARG A O    6  
ATOM 10907 C CB   . ARG A 1 23  ? 16.612 -21.267 7.452  1.00 73.22 ? 23  ARG A CB   6  
ATOM 10908 C CG   . ARG A 1 23  ? 15.104 -21.231 7.638  1.00 14.11 ? 23  ARG A CG   6  
ATOM 10909 C CD   . ARG A 1 23  ? 14.404 -20.667 6.411  1.00 22.12 ? 23  ARG A CD   6  
ATOM 10910 N NE   . ARG A 1 23  ? 13.489 -19.582 6.753  1.00 13.15 ? 23  ARG A NE   6  
ATOM 10911 C CZ   . ARG A 1 23  ? 12.337 -19.765 7.390  1.00 4.13  ? 23  ARG A CZ   6  
ATOM 10912 N NH1  . ARG A 1 23  ? 11.963 -20.984 7.753  1.00 60.13 ? 23  ARG A NH1  6  
ATOM 10913 N NH2  . ARG A 1 23  ? 11.558 -18.727 7.666  1.00 2.05  ? 23  ARG A NH2  6  
ATOM 10914 H H    . ARG A 1 23  ? 19.035 -21.750 6.745  1.00 3.51  ? 23  ARG A H    6  
ATOM 10915 H HA   . ARG A 1 23  ? 16.920 -23.341 7.884  1.00 52.53 ? 23  ARG A HA   6  
ATOM 10916 H HB2  . ARG A 1 23  ? 17.074 -20.946 8.374  1.00 52.33 ? 23  ARG A HB2  6  
ATOM 10917 H HB3  . ARG A 1 23  ? 16.872 -20.573 6.667  1.00 64.41 ? 23  ARG A HB3  6  
ATOM 10918 H HG2  . ARG A 1 23  ? 14.747 -22.236 7.812  1.00 43.42 ? 23  ARG A HG2  6  
ATOM 10919 H HG3  . ARG A 1 23  ? 14.871 -20.612 8.491  1.00 13.44 ? 23  ARG A HG3  6  
ATOM 10920 H HD2  . ARG A 1 23  ? 15.151 -20.292 5.728  1.00 64.54 ? 23  ARG A HD2  6  
ATOM 10921 H HD3  . ARG A 1 23  ? 13.846 -21.460 5.935  1.00 5.25  ? 23  ARG A HD3  6  
ATOM 10922 H HE   . ARG A 1 23  ? 13.746 -18.673 6.495  1.00 52.30 ? 23  ARG A HE   6  
ATOM 10923 H HH11 . ARG A 1 23  ? 12.549 -21.768 7.547  1.00 54.11 ? 23  ARG A HH11 6  
ATOM 10924 H HH12 . ARG A 1 23  ? 11.096 -21.119 8.233  1.00 22.13 ? 23  ARG A HH12 6  
ATOM 10925 H HH21 . ARG A 1 23  ? 11.837 -17.806 7.395  1.00 23.41 ? 23  ARG A HH21 6  
ATOM 10926 H HH22 . ARG A 1 23  ? 10.692 -18.866 8.146  1.00 42.34 ? 23  ARG A HH22 6  
ATOM 10927 N N    . SER A 1 24  ? 16.437 -22.275 4.798  1.00 63.14 ? 24  SER A N    6  
ATOM 10928 C CA   . SER A 1 24  ? 15.827 -22.620 3.519  1.00 34.02 ? 24  SER A CA   6  
ATOM 10929 C C    . SER A 1 24  ? 16.338 -21.708 2.409  1.00 45.42 ? 24  SER A C    6  
ATOM 10930 O O    . SER A 1 24  ? 16.661 -20.544 2.647  1.00 61.21 ? 24  SER A O    6  
ATOM 10931 C CB   . SER A 1 24  ? 14.303 -22.521 3.615  1.00 51.24 ? 24  SER A CB   6  
ATOM 10932 O OG   . SER A 1 24  ? 13.792 -23.426 4.578  1.00 2.53  ? 24  SER A OG   6  
ATOM 10933 H H    . SER A 1 24  ? 16.817 -21.380 4.920  1.00 4.14  ? 24  SER A H    6  
ATOM 10934 H HA   . SER A 1 24  ? 16.099 -23.639 3.286  1.00 14.31 ? 24  SER A HA   6  
ATOM 10935 H HB2  . SER A 1 24  ? 14.027 -21.517 3.899  1.00 2.14  ? 24  SER A HB2  6  
ATOM 10936 H HB3  . SER A 1 24  ? 13.869 -22.754 2.653  1.00 31.41 ? 24  SER A HB3  6  
ATOM 10937 H HG   . SER A 1 24  ? 13.547 -24.248 4.148  1.00 43.23 ? 24  SER A HG   6  
ATOM 10938 N N    . GLU A 1 25  ? 16.410 -22.245 1.195  1.00 33.41 ? 25  GLU A N    6  
ATOM 10939 C CA   . GLU A 1 25  ? 16.883 -21.480 0.048  1.00 62.02 ? 25  GLU A CA   6  
ATOM 10940 C C    . GLU A 1 25  ? 15.751 -20.659 -0.563 1.00 61.23 ? 25  GLU A C    6  
ATOM 10941 O O    . GLU A 1 25  ? 15.944 -19.954 -1.554 1.00 63.41 ? 25  GLU A O    6  
ATOM 10942 C CB   . GLU A 1 25  ? 17.477 -22.416 -1.008 1.00 13.54 ? 25  GLU A CB   6  
ATOM 10943 C CG   . GLU A 1 25  ? 16.492 -23.449 -1.528 1.00 52.21 ? 25  GLU A CG   6  
ATOM 10944 C CD   . GLU A 1 25  ? 17.118 -24.400 -2.529 1.00 44.55 ? 25  GLU A CD   6  
ATOM 10945 O OE1  . GLU A 1 25  ? 17.987 -25.200 -2.123 1.00 43.34 ? 25  GLU A OE1  6  
ATOM 10946 O OE2  . GLU A 1 25  ? 16.741 -24.344 -3.718 1.00 53.43 ? 25  GLU A OE2  6  
ATOM 10947 H H    . GLU A 1 25  ? 16.138 -23.178 1.069  1.00 61.34 ? 25  GLU A H    6  
ATOM 10948 H HA   . GLU A 1 25  ? 17.654 -20.807 0.393  1.00 35.30 ? 25  GLU A HA   6  
ATOM 10949 H HB2  . GLU A 1 25  ? 17.822 -21.824 -1.843 1.00 13.23 ? 25  GLU A HB2  6  
ATOM 10950 H HB3  . GLU A 1 25  ? 18.318 -22.937 -0.576 1.00 3.01  ? 25  GLU A HB3  6  
ATOM 10951 H HG2  . GLU A 1 25  ? 16.119 -24.024 -0.694 1.00 55.10 ? 25  GLU A HG2  6  
ATOM 10952 H HG3  . GLU A 1 25  ? 15.670 -22.936 -2.006 1.00 44.42 ? 25  GLU A HG3  6  
ATOM 10953 N N    . LYS A 1 26  ? 14.569 -20.756 0.035  1.00 74.23 ? 26  LYS A N    6  
ATOM 10954 C CA   . LYS A 1 26  ? 13.404 -20.023 -0.448 1.00 61.42 ? 26  LYS A CA   6  
ATOM 10955 C C    . LYS A 1 26  ? 13.478 -18.555 -0.041 1.00 31.20 ? 26  LYS A C    6  
ATOM 10956 O O    . LYS A 1 26  ? 13.186 -17.665 -0.839 1.00 4.00  ? 26  LYS A O    6  
ATOM 10957 C CB   . LYS A 1 26  ? 12.119 -20.651 0.097  1.00 40.24 ? 26  LYS A CB   6  
ATOM 10958 C CG   . LYS A 1 26  ? 11.799 -22.006 -0.511 1.00 14.51 ? 26  LYS A CG   6  
ATOM 10959 C CD   . LYS A 1 26  ? 10.304 -22.185 -0.716 1.00 33.22 ? 26  LYS A CD   6  
ATOM 10960 C CE   . LYS A 1 26  ? 9.915  -23.656 -0.725 1.00 43.24 ? 26  LYS A CE   6  
ATOM 10961 N NZ   . LYS A 1 26  ? 8.509  -23.861 -0.281 1.00 11.10 ? 26  LYS A NZ   6  
ATOM 10962 H H    . LYS A 1 26  ? 14.477 -21.335 0.821  1.00 11.42 ? 26  LYS A H    6  
ATOM 10963 H HA   . LYS A 1 26  ? 13.396 -20.086 -1.526 1.00 3.32  ? 26  LYS A HA   6  
ATOM 10964 H HB2  . LYS A 1 26  ? 12.217 -20.773 1.165  1.00 2.13  ? 26  LYS A HB2  6  
ATOM 10965 H HB3  . LYS A 1 26  ? 11.293 -19.984 -0.106 1.00 61.35 ? 26  LYS A HB3  6  
ATOM 10966 H HG2  . LYS A 1 26  ? 12.294 -22.088 -1.467 1.00 3.23  ? 26  LYS A HG2  6  
ATOM 10967 H HG3  . LYS A 1 26  ? 12.158 -22.781 0.151  1.00 11.31 ? 26  LYS A HG3  6  
ATOM 10968 H HD2  . LYS A 1 26  ? 9.777  -21.691 0.087  1.00 51.12 ? 26  LYS A HD2  6  
ATOM 10969 H HD3  . LYS A 1 26  ? 10.023 -21.741 -1.660 1.00 72.34 ? 26  LYS A HD3  6  
ATOM 10970 H HE2  . LYS A 1 26  ? 10.026 -24.037 -1.729 1.00 31.32 ? 26  LYS A HE2  6  
ATOM 10971 H HE3  . LYS A 1 26  ? 10.576 -24.193 -0.061 1.00 71.32 ? 26  LYS A HE3  6  
ATOM 10972 H HZ1  . LYS A 1 26  ? 7.859  -23.735 -1.083 1.00 61.44 ? 26  LYS A HZ1  6  
ATOM 10973 H HZ2  . LYS A 1 26  ? 8.264  -23.173 0.459  1.00 1.22  ? 26  LYS A HZ2  6  
ATOM 10974 H HZ3  . LYS A 1 26  ? 8.391  -24.821 0.100  1.00 32.13 ? 26  LYS A HZ3  6  
ATOM 10975 N N    . MET A 1 27  ? 13.871 -18.310 1.205  1.00 74.42 ? 27  MET A N    6  
ATOM 10976 C CA   . MET A 1 27  ? 13.985 -16.949 1.716  1.00 21.51 ? 27  MET A CA   6  
ATOM 10977 C C    . MET A 1 27  ? 15.385 -16.394 1.475  1.00 22.22 ? 27  MET A C    6  
ATOM 10978 O O    . MET A 1 27  ? 15.592 -15.571 0.584  1.00 53.13 ? 27  MET A O    6  
ATOM 10979 C CB   . MET A 1 27  ? 13.660 -16.914 3.211  1.00 70.33 ? 27  MET A CB   6  
ATOM 10980 C CG   . MET A 1 27  ? 12.201 -16.609 3.508  1.00 10.32 ? 27  MET A CG   6  
ATOM 10981 S SD   . MET A 1 27  ? 11.839 -14.843 3.469  1.00 3.33  ? 27  MET A SD   6  
ATOM 10982 C CE   . MET A 1 27  ? 12.803 -14.269 4.865  1.00 4.24  ? 27  MET A CE   6  
ATOM 10983 H H    . MET A 1 27  ? 14.090 -19.062 1.795  1.00 75.15 ? 27  MET A H    6  
ATOM 10984 H HA   . MET A 1 27  ? 13.271 -16.336 1.187  1.00 23.02 ? 27  MET A HA   6  
ATOM 10985 H HB2  . MET A 1 27  ? 13.899 -17.875 3.642  1.00 44.22 ? 27  MET A HB2  6  
ATOM 10986 H HB3  . MET A 1 27  ? 14.267 -16.156 3.682  1.00 41.44 ? 27  MET A HB3  6  
ATOM 10987 H HG2  . MET A 1 27  ? 11.585 -17.103 2.772  1.00 65.43 ? 27  MET A HG2  6  
ATOM 10988 H HG3  . MET A 1 27  ? 11.961 -16.990 4.490  1.00 71.24 ? 27  MET A HG3  6  
ATOM 10989 H HE1  . MET A 1 27  ? 12.599 -14.891 5.724  1.00 3.02  ? 27  MET A HE1  6  
ATOM 10990 H HE2  . MET A 1 27  ? 13.854 -14.323 4.623  1.00 4.32  ? 27  MET A HE2  6  
ATOM 10991 H HE3  . MET A 1 27  ? 12.537 -13.246 5.090  1.00 20.13 ? 27  MET A HE3  6  
ATOM 10992 N N    . SER A 1 28  ? 16.344 -16.850 2.276  1.00 54.14 ? 28  SER A N    6  
ATOM 10993 C CA   . SER A 1 28  ? 17.724 -16.395 2.152  1.00 75.24 ? 28  SER A CA   6  
ATOM 10994 C C    . SER A 1 28  ? 18.547 -17.378 1.325  1.00 23.44 ? 28  SER A C    6  
ATOM 10995 O O    . SER A 1 28  ? 17.999 -18.225 0.618  1.00 3.20  ? 28  SER A O    6  
ATOM 10996 C CB   . SER A 1 28  ? 18.352 -16.222 3.536  1.00 62.54 ? 28  SER A CB   6  
ATOM 10997 O OG   . SER A 1 28  ? 17.439 -15.625 4.440  1.00 40.25 ? 28  SER A OG   6  
ATOM 10998 H H    . SER A 1 28  ? 16.116 -17.506 2.968  1.00 42.23 ? 28  SER A H    6  
ATOM 10999 H HA   . SER A 1 28  ? 17.714 -15.440 1.648  1.00 12.12 ? 28  SER A HA   6  
ATOM 11000 H HB2  . SER A 1 28  ? 18.640 -17.189 3.920  1.00 5.24  ? 28  SER A HB2  6  
ATOM 11001 H HB3  . SER A 1 28  ? 19.226 -15.592 3.455  1.00 53.32 ? 28  SER A HB3  6  
ATOM 11002 H HG   . SER A 1 28  ? 17.901 -14.985 4.986  1.00 44.34 ? 28  SER A HG   6  
ATOM 11003 N N    . LEU A 1 29  ? 19.867 -17.260 1.420  1.00 20.22 ? 29  LEU A N    6  
ATOM 11004 C CA   . LEU A 1 29  ? 20.769 -18.138 0.682  1.00 13.02 ? 29  LEU A CA   6  
ATOM 11005 C C    . LEU A 1 29  ? 21.648 -18.941 1.635  1.00 32.33 ? 29  LEU A C    6  
ATOM 11006 O O    . LEU A 1 29  ? 22.873 -18.815 1.645  1.00 75.23 ? 29  LEU A O    6  
ATOM 11007 C CB   . LEU A 1 29  ? 21.643 -17.320 -0.269 1.00 44.32 ? 29  LEU A CB   6  
ATOM 11008 C CG   . LEU A 1 29  ? 21.927 -15.878 0.153  1.00 44.31 ? 29  LEU A CG   6  
ATOM 11009 C CD1  . LEU A 1 29  ? 23.287 -15.429 -0.361 1.00 55.11 ? 29  LEU A CD1  6  
ATOM 11010 C CD2  . LEU A 1 29  ? 20.832 -14.949 -0.350 1.00 73.20 ? 29  LEU A CD2  6  
ATOM 11011 H H    . LEU A 1 29  ? 20.245 -16.567 2.000  1.00 41.12 ? 29  LEU A H    6  
ATOM 11012 H HA   . LEU A 1 29  ? 20.166 -18.823 0.105  1.00 55.43 ? 29  LEU A HA   6  
ATOM 11013 H HB2  . LEU A 1 29  ? 22.590 -17.828 -0.367 1.00 44.12 ? 29  LEU A HB2  6  
ATOM 11014 H HB3  . LEU A 1 29  ? 21.150 -17.293 -1.230 1.00 71.24 ? 29  LEU A HB3  6  
ATOM 11015 H HG   . LEU A 1 29  ? 21.945 -15.822 1.233  1.00 74.13 ? 29  LEU A HG   6  
ATOM 11016 H HD11 . LEU A 1 29  ? 23.544 -15.997 -1.242 1.00 32.20 ? 29  LEU A HD11 6  
ATOM 11017 H HD12 . LEU A 1 29  ? 24.032 -15.592 0.403  1.00 0.21  ? 29  LEU A HD12 6  
ATOM 11018 H HD13 . LEU A 1 29  ? 23.249 -14.378 -0.608 1.00 54.11 ? 29  LEU A HD13 6  
ATOM 11019 H HD21 . LEU A 1 29  ? 20.064 -15.531 -0.838 1.00 54.21 ? 29  LEU A HD21 6  
ATOM 11020 H HD22 . LEU A 1 29  ? 21.252 -14.245 -1.054 1.00 34.12 ? 29  LEU A HD22 6  
ATOM 11021 H HD23 . LEU A 1 29  ? 20.403 -14.414 0.484  1.00 40.42 ? 29  LEU A HD23 6  
ATOM 11022 N N    . PRO A 1 30  ? 21.010 -19.789 2.456  1.00 63.41 ? 30  PRO A N    6  
ATOM 11023 C CA   . PRO A 1 30  ? 21.715 -20.632 3.426  1.00 22.42 ? 30  PRO A CA   6  
ATOM 11024 C C    . PRO A 1 30  ? 22.525 -21.736 2.755  1.00 71.43 ? 30  PRO A C    6  
ATOM 11025 O O    . PRO A 1 30  ? 23.273 -22.460 3.413  1.00 5.43  ? 30  PRO A O    6  
ATOM 11026 C CB   . PRO A 1 30  ? 20.583 -21.233 4.263  1.00 72.23 ? 30  PRO A CB   6  
ATOM 11027 C CG   . PRO A 1 30  ? 19.395 -21.211 3.364  1.00 61.53 ? 30  PRO A CG   6  
ATOM 11028 C CD   . PRO A 1 30  ? 19.552 -19.991 2.499  1.00 23.23 ? 30  PRO A CD   6  
ATOM 11029 H HA   . PRO A 1 30  ? 22.364 -20.048 4.062  1.00 12.12 ? 30  PRO A HA   6  
ATOM 11030 H HB2  . PRO A 1 30  ? 20.842 -22.242 4.552  1.00 11.02 ? 30  PRO A HB2  6  
ATOM 11031 H HB3  . PRO A 1 30  ? 20.422 -20.630 5.144  1.00 70.14 ? 30  PRO A HB3  6  
ATOM 11032 H HG2  . PRO A 1 30  ? 19.379 -22.103 2.755  1.00 12.31 ? 30  PRO A HG2  6  
ATOM 11033 H HG3  . PRO A 1 30  ? 18.492 -21.140 3.951  1.00 33.13 ? 30  PRO A HG3  6  
ATOM 11034 H HD2  . PRO A 1 30  ? 19.159 -20.176 1.511  1.00 51.23 ? 30  PRO A HD2  6  
ATOM 11035 H HD3  . PRO A 1 30  ? 19.060 -19.143 2.951  1.00 13.30 ? 30  PRO A HD3  6  
ATOM 11036 N N    . LEU A 1 31  ? 22.371 -21.861 1.441  1.00 10.11 ? 31  LEU A N    6  
ATOM 11037 C CA   . LEU A 1 31  ? 23.089 -22.877 0.680  1.00 72.24 ? 31  LEU A CA   6  
ATOM 11038 C C    . LEU A 1 31  ? 24.571 -22.883 1.041  1.00 34.34 ? 31  LEU A C    6  
ATOM 11039 O O    . LEU A 1 31  ? 25.212 -23.934 1.055  1.00 51.53 ? 31  LEU A O    6  
ATOM 11040 C CB   . LEU A 1 31  ? 22.920 -22.633 -0.821 1.00 15.31 ? 31  LEU A CB   6  
ATOM 11041 C CG   . LEU A 1 31  ? 21.482 -22.622 -1.341 1.00 53.41 ? 31  LEU A CG   6  
ATOM 11042 C CD1  . LEU A 1 31  ? 21.168 -21.295 -2.015 1.00 43.14 ? 31  LEU A CD1  6  
ATOM 11043 C CD2  . LEU A 1 31  ? 21.254 -23.778 -2.304 1.00 32.15 ? 31  LEU A CD2  6  
ATOM 11044 H H    . LEU A 1 31  ? 21.761 -21.256 0.971  1.00 14.43 ? 31  LEU A H    6  
ATOM 11045 H HA   . LEU A 1 31  ? 22.666 -23.839 0.929  1.00 14.35 ? 31  LEU A HA   6  
ATOM 11046 H HB2  . LEU A 1 31  ? 23.362 -21.676 -1.052 1.00 11.11 ? 31  LEU A HB2  6  
ATOM 11047 H HB3  . LEU A 1 31  ? 23.456 -23.411 -1.345 1.00 30.35 ? 31  LEU A HB3  6  
ATOM 11048 H HG   . LEU A 1 31  ? 20.803 -22.740 -0.508 1.00 21.24 ? 31  LEU A HG   6  
ATOM 11049 H HD11 . LEU A 1 31  ? 21.754 -21.202 -2.917 1.00 64.20 ? 31  LEU A HD11 6  
ATOM 11050 H HD12 . LEU A 1 31  ? 21.410 -20.484 -1.344 1.00 35.20 ? 31  LEU A HD12 6  
ATOM 11051 H HD13 . LEU A 1 31  ? 20.117 -21.256 -2.263 1.00 24.44 ? 31  LEU A HD13 6  
ATOM 11052 H HD21 . LEU A 1 31  ? 21.685 -23.537 -3.264 1.00 54.40 ? 31  LEU A HD21 6  
ATOM 11053 H HD22 . LEU A 1 31  ? 20.193 -23.948 -2.417 1.00 52.45 ? 31  LEU A HD22 6  
ATOM 11054 H HD23 . LEU A 1 31  ? 21.721 -24.669 -1.912 1.00 65.25 ? 31  LEU A HD23 6  
ATOM 11055 N N    . MET A 1 32  ? 25.107 -21.704 1.336  1.00 3.22  ? 32  MET A N    6  
ATOM 11056 C CA   . MET A 1 32  ? 26.513 -21.574 1.702  1.00 60.21 ? 32  MET A CA   6  
ATOM 11057 C C    . MET A 1 32  ? 26.658 -21.092 3.142  1.00 60.21 ? 32  MET A C    6  
ATOM 11058 O O    . MET A 1 32  ? 27.474 -21.614 3.901  1.00 21.14 ? 32  MET A O    6  
ATOM 11059 C CB   . MET A 1 32  ? 27.222 -20.605 0.754  1.00 74.04 ? 32  MET A CB   6  
ATOM 11060 C CG   . MET A 1 32  ? 26.469 -19.301 0.544  1.00 61.03 ? 32  MET A CG   6  
ATOM 11061 S SD   . MET A 1 32  ? 27.286 -18.210 -0.637 1.00 31.11 ? 32  MET A SD   6  
ATOM 11062 C CE   . MET A 1 32  ? 26.384 -16.686 -0.370 1.00 12.03 ? 32  MET A CE   6  
ATOM 11063 H H    . MET A 1 32  ? 24.545 -20.901 1.308  1.00 22.33 ? 32  MET A H    6  
ATOM 11064 H HA   . MET A 1 32  ? 26.969 -22.549 1.613  1.00 3.41  ? 32  MET A HA   6  
ATOM 11065 H HB2  . MET A 1 32  ? 28.196 -20.373 1.157  1.00 13.42 ? 32  MET A HB2  6  
ATOM 11066 H HB3  . MET A 1 32  ? 27.343 -21.083 -0.207 1.00 22.42 ? 32  MET A HB3  6  
ATOM 11067 H HG2  . MET A 1 32  ? 25.479 -19.527 0.177  1.00 12.22 ? 32  MET A HG2  6  
ATOM 11068 H HG3  . MET A 1 32  ? 26.392 -18.790 1.492  1.00 53.00 ? 32  MET A HG3  6  
ATOM 11069 H HE1  . MET A 1 32  ? 25.571 -16.620 -1.078 1.00 10.34 ? 32  MET A HE1  6  
ATOM 11070 H HE2  . MET A 1 32  ? 25.988 -16.674 0.635  1.00 2.41  ? 32  MET A HE2  6  
ATOM 11071 H HE3  . MET A 1 32  ? 27.049 -15.846 -0.506 1.00 3.33  ? 32  MET A HE3  6  
ATOM 11072 N N    . TRP A 1 33  ? 25.862 -20.095 3.510  1.00 43.32 ? 33  TRP A N    6  
ATOM 11073 C CA   . TRP A 1 33  ? 25.903 -19.543 4.859  1.00 1.42  ? 33  TRP A CA   6  
ATOM 11074 C C    . TRP A 1 33  ? 24.587 -18.855 5.206  1.00 43.20 ? 33  TRP A C    6  
ATOM 11075 O O    . TRP A 1 33  ? 23.889 -18.353 4.326  1.00 40.11 ? 33  TRP A O    6  
ATOM 11076 C CB   . TRP A 1 33  ? 27.061 -18.552 4.992  1.00 21.24 ? 33  TRP A CB   6  
ATOM 11077 C CG   . TRP A 1 33  ? 28.408 -19.186 4.817  1.00 31.12 ? 33  TRP A CG   6  
ATOM 11078 C CD1  . TRP A 1 33  ? 29.147 -19.236 3.670  1.00 61.40 ? 33  TRP A CD1  6  
ATOM 11079 C CD2  . TRP A 1 33  ? 29.174 -19.861 5.821  1.00 62.34 ? 33  TRP A CD2  6  
ATOM 11080 N NE1  . TRP A 1 33  ? 30.327 -19.902 3.900  1.00 71.33 ? 33  TRP A NE1  6  
ATOM 11081 C CE2  . TRP A 1 33  ? 30.368 -20.295 5.211  1.00 0.14  ? 33  TRP A CE2  6  
ATOM 11082 C CE3  . TRP A 1 33  ? 28.969 -20.140 7.174  1.00 3.05  ? 33  TRP A CE3  6  
ATOM 11083 C CZ2  . TRP A 1 33  ? 31.350 -20.992 5.911  1.00 74.24 ? 33  TRP A CZ2  6  
ATOM 11084 C CZ3  . TRP A 1 33  ? 29.944 -20.832 7.867  1.00 63.40 ? 33  TRP A CZ3  6  
ATOM 11085 C CH2  . TRP A 1 33  ? 31.123 -21.251 7.235  1.00 74.50 ? 33  TRP A CH2  6  
ATOM 11086 H H    . TRP A 1 33  ? 25.232 -19.720 2.859  1.00 62.12 ? 33  TRP A H    6  
ATOM 11087 H HA   . TRP A 1 33  ? 26.060 -20.361 5.546  1.00 3.25  ? 33  TRP A HA   6  
ATOM 11088 H HB2  . TRP A 1 33  ? 26.956 -17.782 4.244  1.00 54.44 ? 33  TRP A HB2  6  
ATOM 11089 H HB3  . TRP A 1 33  ? 27.029 -18.102 5.974  1.00 32.11 ? 33  TRP A HB3  6  
ATOM 11090 H HD1  . TRP A 1 33  ? 28.836 -18.812 2.727  1.00 22.44 ? 33  TRP A HD1  6  
ATOM 11091 H HE1  . TRP A 1 33  ? 31.026 -20.067 3.232  1.00 31.54 ? 33  TRP A HE1  6  
ATOM 11092 H HE3  . TRP A 1 33  ? 28.068 -19.825 7.679  1.00 32.32 ? 33  TRP A HE3  6  
ATOM 11093 H HZ2  . TRP A 1 33  ? 32.263 -21.321 5.438  1.00 64.52 ? 33  TRP A HZ2  6  
ATOM 11094 H HZ3  . TRP A 1 33  ? 29.803 -21.057 8.914  1.00 22.40 ? 33  TRP A HZ3  6  
ATOM 11095 H HH2  . TRP A 1 33  ? 31.857 -21.790 7.815  1.00 55.43 ? 33  TRP A HH2  6  
ATOM 11096 N N    . GLU A 1 34  ? 24.256 -18.836 6.493  1.00 14.42 ? 34  GLU A N    6  
ATOM 11097 C CA   . GLU A 1 34  ? 23.022 -18.209 6.954  1.00 22.12 ? 34  GLU A CA   6  
ATOM 11098 C C    . GLU A 1 34  ? 22.883 -18.332 8.469  1.00 51.41 ? 34  GLU A C    6  
ATOM 11099 O O    . GLU A 1 34  ? 23.340 -19.305 9.069  1.00 75.02 ? 34  GLU A O    6  
ATOM 11100 C CB   . GLU A 1 34  ? 21.813 -18.846 6.267  1.00 53.23 ? 34  GLU A CB   6  
ATOM 11101 C CG   . GLU A 1 34  ? 20.483 -18.454 6.889  1.00 71.31 ? 34  GLU A CG   6  
ATOM 11102 C CD   . GLU A 1 34  ? 20.223 -16.962 6.818  1.00 34.15 ? 34  GLU A CD   6  
ATOM 11103 O OE1  . GLU A 1 34  ? 20.990 -16.259 6.128  1.00 0.34  ? 34  GLU A OE1  6  
ATOM 11104 O OE2  . GLU A 1 34  ? 19.253 -16.498 7.453  1.00 54.11 ? 34  GLU A OE2  6  
ATOM 11105 H H    . GLU A 1 34  ? 24.854 -19.253 7.148  1.00 52.24 ? 34  GLU A H    6  
ATOM 11106 H HA   . GLU A 1 34  ? 23.064 -17.163 6.692  1.00 12.33 ? 34  GLU A HA   6  
ATOM 11107 H HB2  . GLU A 1 34  ? 21.804 -18.546 5.229  1.00 11.42 ? 34  GLU A HB2  6  
ATOM 11108 H HB3  . GLU A 1 34  ? 21.908 -19.920 6.320  1.00 64.31 ? 34  GLU A HB3  6  
ATOM 11109 H HG2  . GLU A 1 34  ? 19.690 -18.967 6.366  1.00 60.35 ? 34  GLU A HG2  6  
ATOM 11110 H HG3  . GLU A 1 34  ? 20.482 -18.756 7.926  1.00 64.51 ? 34  GLU A HG3  6  
ATOM 11111 N N    . PHE A 1 35  ? 22.249 -17.337 9.081  1.00 5.23  ? 35  PHE A N    6  
ATOM 11112 C CA   . PHE A 1 35  ? 22.051 -17.331 10.526 1.00 71.31 ? 35  PHE A CA   6  
ATOM 11113 C C    . PHE A 1 35  ? 20.604 -17.665 10.877 1.00 30.13 ? 35  PHE A C    6  
ATOM 11114 O O    . PHE A 1 35  ? 19.684 -17.468 10.083 1.00 64.44 ? 35  PHE A O    6  
ATOM 11115 C CB   . PHE A 1 35  ? 22.427 -15.968 11.109 1.00 45.54 ? 35  PHE A CB   6  
ATOM 11116 C CG   . PHE A 1 35  ? 23.910 -15.747 11.210 1.00 72.53 ? 35  PHE A CG   6  
ATOM 11117 C CD1  . PHE A 1 35  ? 24.530 -14.762 10.458 1.00 21.34 ? 35  PHE A CD1  6  
ATOM 11118 C CD2  . PHE A 1 35  ? 24.683 -16.525 12.056 1.00 31.45 ? 35  PHE A CD2  6  
ATOM 11119 C CE1  . PHE A 1 35  ? 25.894 -14.558 10.549 1.00 30.40 ? 35  PHE A CE1  6  
ATOM 11120 C CE2  . PHE A 1 35  ? 26.047 -16.326 12.152 1.00 43.24 ? 35  PHE A CE2  6  
ATOM 11121 C CZ   . PHE A 1 35  ? 26.653 -15.340 11.398 1.00 64.24 ? 35  PHE A CZ   6  
ATOM 11122 H H    . PHE A 1 35  ? 21.908 -16.588 8.549  1.00 51.14 ? 35  PHE A H    6  
ATOM 11123 H HA   . PHE A 1 35  ? 22.695 -18.085 10.951 1.00 21.21 ? 35  PHE A HA   6  
ATOM 11124 H HB2  . PHE A 1 35  ? 22.019 -15.190 10.480 1.00 24.41 ? 35  PHE A HB2  6  
ATOM 11125 H HB3  . PHE A 1 35  ? 22.009 -15.880 12.100 1.00 62.00 ? 35  PHE A HB3  6  
ATOM 11126 H HD1  . PHE A 1 35  ? 23.938 -14.149 9.795  1.00 34.32 ? 35  PHE A HD1  6  
ATOM 11127 H HD2  . PHE A 1 35  ? 24.209 -17.297 12.647 1.00 3.04  ? 35  PHE A HD2  6  
ATOM 11128 H HE1  . PHE A 1 35  ? 26.365 -13.787 9.959  1.00 45.04 ? 35  PHE A HE1  6  
ATOM 11129 H HE2  . PHE A 1 35  ? 26.638 -16.939 12.816 1.00 12.01 ? 35  PHE A HE2  6  
ATOM 11130 H HZ   . PHE A 1 35  ? 27.719 -15.183 11.470 1.00 61.02 ? 35  PHE A HZ   6  
ATOM 11131 N N    . PRO A 1 36  ? 20.396 -18.183 12.097 1.00 63.21 ? 36  PRO A N    6  
ATOM 11132 C CA   . PRO A 1 36  ? 19.064 -18.556 12.582 1.00 2.33  ? 36  PRO A CA   6  
ATOM 11133 C C    . PRO A 1 36  ? 18.181 -17.340 12.841 1.00 75.21 ? 36  PRO A C    6  
ATOM 11134 O O    . PRO A 1 36  ? 18.640 -16.327 13.367 1.00 72.32 ? 36  PRO A O    6  
ATOM 11135 C CB   . PRO A 1 36  ? 19.357 -19.292 13.892 1.00 60.21 ? 36  PRO A CB   6  
ATOM 11136 C CG   . PRO A 1 36  ? 20.668 -18.750 14.346 1.00 21.14 ? 36  PRO A CG   6  
ATOM 11137 C CD   . PRO A 1 36  ? 21.446 -18.445 13.096 1.00 12.21 ? 36  PRO A CD   6  
ATOM 11138 H HA   . PRO A 1 36  ? 18.564 -19.223 11.896 1.00 62.41 ? 36  PRO A HA   6  
ATOM 11139 H HB2  . PRO A 1 36  ? 18.574 -19.085 14.607 1.00 35.22 ? 36  PRO A HB2  6  
ATOM 11140 H HB3  . PRO A 1 36  ? 19.412 -20.354 13.707 1.00 20.52 ? 36  PRO A HB3  6  
ATOM 11141 H HG2  . PRO A 1 36  ? 20.514 -17.850 14.921 1.00 12.23 ? 36  PRO A HG2  6  
ATOM 11142 H HG3  . PRO A 1 36  ? 21.186 -19.491 14.938 1.00 50.41 ? 36  PRO A HG3  6  
ATOM 11143 H HD2  . PRO A 1 36  ? 22.066 -17.573 13.241 1.00 2.21  ? 36  PRO A HD2  6  
ATOM 11144 H HD3  . PRO A 1 36  ? 22.047 -19.295 12.809 1.00 43.41 ? 36  PRO A HD3  6  
ATOM 11145 N N    . GLY A 1 37  ? 16.909 -17.448 12.468 1.00 71.42 ? 37  GLY A N    6  
ATOM 11146 C CA   . GLY A 1 37  ? 15.981 -16.351 12.668 1.00 1.41  ? 37  GLY A CA   6  
ATOM 11147 C C    . GLY A 1 37  ? 14.541 -16.756 12.423 1.00 23.33 ? 37  GLY A C    6  
ATOM 11148 O O    . GLY A 1 37  ? 14.265 -17.895 12.050 1.00 71.50 ? 37  GLY A O    6  
ATOM 11149 H H    . GLY A 1 37  ? 16.598 -18.280 12.053 1.00 22.41 ? 37  GLY A H    6  
ATOM 11150 H HA2  . GLY A 1 37  ? 16.076 -15.994 13.683 1.00 42.22 ? 37  GLY A HA2  6  
ATOM 11151 H HA3  . GLY A 1 37  ? 16.237 -15.550 11.990 1.00 3.31  ? 37  GLY A HA3  6  
ATOM 11152 N N    . GLY A 1 38  ? 13.620 -15.821 12.636 1.00 60.23 ? 38  GLY A N    6  
ATOM 11153 C CA   . GLY A 1 38  ? 12.212 -16.107 12.432 1.00 31.54 ? 38  GLY A CA   6  
ATOM 11154 C C    . GLY A 1 38  ? 11.453 -14.919 11.877 1.00 11.31 ? 38  GLY A C    6  
ATOM 11155 O O    . GLY A 1 38  ? 11.695 -14.490 10.749 1.00 51.52 ? 38  GLY A O    6  
ATOM 11156 H H    . GLY A 1 38  ? 13.899 -14.930 12.933 1.00 51.21 ? 38  GLY A H    6  
ATOM 11157 H HA2  . GLY A 1 38  ? 12.120 -16.934 11.744 1.00 75.02 ? 38  GLY A HA2  6  
ATOM 11158 H HA3  . GLY A 1 38  ? 11.774 -16.389 13.378 1.00 35.55 ? 38  GLY A HA3  6  
ATOM 11159 N N    . LYS A 1 39  ? 10.530 -14.385 12.670 1.00 21.13 ? 39  LYS A N    6  
ATOM 11160 C CA   . LYS A 1 39  ? 9.732  -13.239 12.253 1.00 53.33 ? 39  LYS A CA   6  
ATOM 11161 C C    . LYS A 1 39  ? 9.536  -12.262 13.408 1.00 30.10 ? 39  LYS A C    6  
ATOM 11162 O O    . LYS A 1 39  ? 9.778  -12.600 14.567 1.00 14.40 ? 39  LYS A O    6  
ATOM 11163 C CB   . LYS A 1 39  ? 8.371  -13.703 11.727 1.00 4.32  ? 39  LYS A CB   6  
ATOM 11164 C CG   . LYS A 1 39  ? 7.413  -14.139 12.822 1.00 50.22 ? 39  LYS A CG   6  
ATOM 11165 C CD   . LYS A 1 39  ? 6.067  -14.553 12.252 1.00 54.51 ? 39  LYS A CD   6  
ATOM 11166 C CE   . LYS A 1 39  ? 6.188  -15.791 11.377 1.00 3.12  ? 39  LYS A CE   6  
ATOM 11167 N NZ   . LYS A 1 39  ? 4.859  -16.394 11.082 1.00 23.41 ? 39  LYS A NZ   6  
ATOM 11168 H H    . LYS A 1 39  ? 10.383 -14.772 13.560 1.00 51.45 ? 39  LYS A H    6  
ATOM 11169 H HA   . LYS A 1 39  ? 10.263 -12.736 11.458 1.00 33.25 ? 39  LYS A HA   6  
ATOM 11170 H HB2  . LYS A 1 39  ? 7.915  -12.892 11.180 1.00 53.54 ? 39  LYS A HB2  6  
ATOM 11171 H HB3  . LYS A 1 39  ? 8.523  -14.537 11.057 1.00 23.15 ? 39  LYS A HB3  6  
ATOM 11172 H HG2  . LYS A 1 39  ? 7.841  -14.978 13.350 1.00 43.22 ? 39  LYS A HG2  6  
ATOM 11173 H HG3  . LYS A 1 39  ? 7.266  -13.316 13.508 1.00 61.44 ? 39  LYS A HG3  6  
ATOM 11174 H HD2  . LYS A 1 39  ? 5.391  -14.766 13.067 1.00 73.35 ? 39  LYS A HD2  6  
ATOM 11175 H HD3  . LYS A 1 39  ? 5.672  -13.740 11.658 1.00 31.20 ? 39  LYS A HD3  6  
ATOM 11176 H HE2  . LYS A 1 39  ? 6.663  -15.514 10.448 1.00 33.22 ? 39  LYS A HE2  6  
ATOM 11177 H HE3  . LYS A 1 39  ? 6.799  -16.519 11.890 1.00 21.02 ? 39  LYS A HE3  6  
ATOM 11178 H HZ1  . LYS A 1 39  ? 4.521  -16.076 10.151 1.00 3.24  ? 39  LYS A HZ1  6  
ATOM 11179 H HZ2  . LYS A 1 39  ? 4.169  -16.109 11.805 1.00 12.21 ? 39  LYS A HZ2  6  
ATOM 11180 H HZ3  . LYS A 1 39  ? 4.931  -17.432 11.077 1.00 51.33 ? 39  LYS A HZ3  6  
ATOM 11181 N N    . VAL A 1 40  ? 9.095  -11.050 13.085 1.00 64.44 ? 40  VAL A N    6  
ATOM 11182 C CA   . VAL A 1 40  ? 8.865  -10.026 14.096 1.00 55.22 ? 40  VAL A CA   6  
ATOM 11183 C C    . VAL A 1 40  ? 7.470  -9.424  13.960 1.00 23.13 ? 40  VAL A C    6  
ATOM 11184 O O    . VAL A 1 40  ? 6.963  -9.253  12.852 1.00 32.44 ? 40  VAL A O    6  
ATOM 11185 C CB   . VAL A 1 40  ? 9.910  -8.898  14.001 1.00 34.33 ? 40  VAL A CB   6  
ATOM 11186 C CG1  . VAL A 1 40  ? 9.623  -7.817  15.032 1.00 44.22 ? 40  VAL A CG1  6  
ATOM 11187 C CG2  . VAL A 1 40  ? 11.313 -9.457  14.179 1.00 63.32 ? 40  VAL A CG2  6  
ATOM 11188 H H    . VAL A 1 40  ? 8.921  -10.841 12.143 1.00 13.14 ? 40  VAL A H    6  
ATOM 11189 H HA   . VAL A 1 40  ? 8.953  -10.490 15.068 1.00 41.44 ? 40  VAL A HA   6  
ATOM 11190 H HB   . VAL A 1 40  ? 9.843  -8.455  13.019 1.00 41.23 ? 40  VAL A HB   6  
ATOM 11191 H HG11 . VAL A 1 40  ? 10.555 -7.460  15.447 1.00 53.02 ? 40  VAL A HG11 6  
ATOM 11192 H HG12 . VAL A 1 40  ? 9.101  -6.998  14.559 1.00 0.12  ? 40  VAL A HG12 6  
ATOM 11193 H HG13 . VAL A 1 40  ? 9.012  -8.226  15.822 1.00 34.13 ? 40  VAL A HG13 6  
ATOM 11194 H HG21 . VAL A 1 40  ? 11.865 -9.342  13.258 1.00 72.23 ? 40  VAL A HG21 6  
ATOM 11195 H HG22 . VAL A 1 40  ? 11.818 -8.921  14.970 1.00 54.14 ? 40  VAL A HG22 6  
ATOM 11196 H HG23 . VAL A 1 40  ? 11.254 -10.504 14.436 1.00 65.45 ? 40  VAL A HG23 6  
ATOM 11197 N N    . GLU A 1 41  ? 6.857  -9.104  15.095 1.00 33.34 ? 41  GLU A N    6  
ATOM 11198 C CA   . GLU A 1 41  ? 5.520  -8.522  15.103 1.00 41.54 ? 41  GLU A CA   6  
ATOM 11199 C C    . GLU A 1 41  ? 5.580  -7.019  14.842 1.00 62.11 ? 41  GLU A C    6  
ATOM 11200 O O    . GLU A 1 41  ? 6.632  -6.395  14.981 1.00 1.40  ? 41  GLU A O    6  
ATOM 11201 C CB   . GLU A 1 41  ? 4.829  -8.791  16.441 1.00 3.21  ? 41  GLU A CB   6  
ATOM 11202 C CG   . GLU A 1 41  ? 4.038  -10.087 16.467 1.00 35.34 ? 41  GLU A CG   6  
ATOM 11203 C CD   . GLU A 1 41  ? 4.913  -11.309 16.267 1.00 34.42 ? 41  GLU A CD   6  
ATOM 11204 O OE1  . GLU A 1 41  ? 4.463  -12.256 15.587 1.00 15.45 ? 41  GLU A OE1  6  
ATOM 11205 O OE2  . GLU A 1 41  ? 6.046  -11.320 16.790 1.00 65.10 ? 41  GLU A OE2  6  
ATOM 11206 H H    . GLU A 1 41  ? 7.313  -9.264  15.948 1.00 62.54 ? 41  GLU A H    6  
ATOM 11207 H HA   . GLU A 1 41  ? 4.950  -8.989  14.314 1.00 43.12 ? 41  GLU A HA   6  
ATOM 11208 H HB2  . GLU A 1 41  ? 5.579  -8.835  17.217 1.00 2.42  ? 41  GLU A HB2  6  
ATOM 11209 H HB3  . GLU A 1 41  ? 4.153  -7.976  16.653 1.00 74.11 ? 41  GLU A HB3  6  
ATOM 11210 H HG2  . GLU A 1 41  ? 3.541  -10.172 17.422 1.00 2.15  ? 41  GLU A HG2  6  
ATOM 11211 H HG3  . GLU A 1 41  ? 3.298  -10.059 15.680 1.00 5.03  ? 41  GLU A HG3  6  
ATOM 11212 N N    . LYS A 1 42  ? 4.444  -6.445  14.462 1.00 11.32 ? 42  LYS A N    6  
ATOM 11213 C CA   . LYS A 1 42  ? 4.365  -5.016  14.182 1.00 14.11 ? 42  LYS A CA   6  
ATOM 11214 C C    . LYS A 1 42  ? 4.463  -4.203  15.469 1.00 52.11 ? 42  LYS A C    6  
ATOM 11215 O O    . LYS A 1 42  ? 5.014  -3.103  15.479 1.00 71.14 ? 42  LYS A O    6  
ATOM 11216 C CB   . LYS A 1 42  ? 3.056  -4.689  13.458 1.00 24.14 ? 42  LYS A CB   6  
ATOM 11217 C CG   . LYS A 1 42  ? 1.821  -5.219  14.166 1.00 41.12 ? 42  LYS A CG   6  
ATOM 11218 C CD   . LYS A 1 42  ? 1.122  -6.288  13.342 1.00 1.52  ? 42  LYS A CD   6  
ATOM 11219 C CE   . LYS A 1 42  ? -0.309 -6.503  13.809 1.00 74.32 ? 42  LYS A CE   6  
ATOM 11220 N NZ   . LYS A 1 42  ? -0.428 -7.687  14.705 1.00 53.22 ? 42  LYS A NZ   6  
ATOM 11221 H H    . LYS A 1 42  ? 3.638  -6.995  14.369 1.00 71.51 ? 42  LYS A H    6  
ATOM 11222 H HA   . LYS A 1 42  ? 5.194  -4.757  13.542 1.00 5.34  ? 42  LYS A HA   6  
ATOM 11223 H HB2  . LYS A 1 42  ? 2.965  -3.616  13.373 1.00 74.31 ? 42  LYS A HB2  6  
ATOM 11224 H HB3  . LYS A 1 42  ? 3.090  -5.119  12.468 1.00 41.15 ? 42  LYS A HB3  6  
ATOM 11225 H HG2  . LYS A 1 42  ? 2.115  -5.645  15.114 1.00 71.05 ? 42  LYS A HG2  6  
ATOM 11226 H HG3  . LYS A 1 42  ? 1.135  -4.401  14.334 1.00 41.30 ? 42  LYS A HG3  6  
ATOM 11227 H HD2  . LYS A 1 42  ? 1.109  -5.981  12.307 1.00 53.21 ? 42  LYS A HD2  6  
ATOM 11228 H HD3  . LYS A 1 42  ? 1.667  -7.216  13.437 1.00 34.43 ? 42  LYS A HD3  6  
ATOM 11229 H HE2  . LYS A 1 42  ? -0.637 -5.624  14.342 1.00 24.35 ? 42  LYS A HE2  6  
ATOM 11230 H HE3  . LYS A 1 42  ? -0.937 -6.653  12.943 1.00 74.20 ? 42  LYS A HE3  6  
ATOM 11231 H HZ1  . LYS A 1 42  ? -0.139 -8.548  14.199 1.00 60.24 ? 42  LYS A HZ1  6  
ATOM 11232 H HZ2  . LYS A 1 42  ? -1.413 -7.798  15.021 1.00 63.33 ? 42  LYS A HZ2  6  
ATOM 11233 H HZ3  . LYS A 1 42  ? 0.181  -7.566  15.539 1.00 72.41 ? 42  LYS A HZ3  6  
ATOM 11234 N N    . ASN A 1 43  ? 3.926  -4.753  16.553 1.00 12.33 ? 43  ASN A N    6  
ATOM 11235 C CA   . ASN A 1 43  ? 3.954  -4.078  17.846 1.00 22.21 ? 43  ASN A CA   6  
ATOM 11236 C C    . ASN A 1 43  ? 5.290  -4.302  18.547 1.00 25.23 ? 43  ASN A C    6  
ATOM 11237 O O    . ASN A 1 43  ? 5.813  -3.406  19.209 1.00 35.04 ? 43  ASN A O    6  
ATOM 11238 C CB   . ASN A 1 43  ? 2.811  -4.579  18.731 1.00 12.31 ? 43  ASN A CB   6  
ATOM 11239 C CG   . ASN A 1 43  ? 1.556  -3.740  18.584 1.00 2.54  ? 43  ASN A CG   6  
ATOM 11240 O OD1  . ASN A 1 43  ? 1.588  -2.520  18.753 1.00 22.54 ? 43  ASN A OD1  6  
ATOM 11241 N ND2  . ASN A 1 43  ? 0.443  -4.391  18.269 1.00 53.53 ? 43  ASN A ND2  6  
ATOM 11242 H H    . ASN A 1 43  ? 3.500  -5.633  16.483 1.00 50.52 ? 43  ASN A H    6  
ATOM 11243 H HA   . ASN A 1 43  ? 3.825  -3.021  17.671 1.00 45.31 ? 43  ASN A HA   6  
ATOM 11244 H HB2  . ASN A 1 43  ? 2.573  -5.597  18.460 1.00 60.03 ? 43  ASN A HB2  6  
ATOM 11245 H HB3  . ASN A 1 43  ? 3.123  -4.549  19.764 1.00 22.30 ? 43  ASN A HB3  6  
ATOM 11246 H HD21 . ASN A 1 43  ? 0.492  -5.362  18.150 1.00 61.24 ? 43  ASN A HD21 6  
ATOM 11247 H HD22 . ASN A 1 43  ? -0.383 -3.872  18.167 1.00 62.40 ? 43  ASN A HD22 6  
ATOM 11248 N N    . GLU A 1 44  ? 5.838  -5.504  18.396 1.00 70.11 ? 44  GLU A N    6  
ATOM 11249 C CA   . GLU A 1 44  ? 7.113  -5.845  19.015 1.00 23.40 ? 44  GLU A CA   6  
ATOM 11250 C C    . GLU A 1 44  ? 8.276  -5.233  18.239 1.00 11.12 ? 44  GLU A C    6  
ATOM 11251 O O    . GLU A 1 44  ? 8.158  -4.940  17.049 1.00 51.31 ? 44  GLU A O    6  
ATOM 11252 C CB   . GLU A 1 44  ? 7.279  -7.365  19.089 1.00 3.30  ? 44  GLU A CB   6  
ATOM 11253 C CG   . GLU A 1 44  ? 6.248  -8.047  19.971 1.00 32.44 ? 44  GLU A CG   6  
ATOM 11254 C CD   . GLU A 1 44  ? 5.992  -7.293  21.261 1.00 3.54  ? 44  GLU A CD   6  
ATOM 11255 O OE1  . GLU A 1 44  ? 6.967  -7.015  21.990 1.00 25.02 ? 44  GLU A OE1  6  
ATOM 11256 O OE2  . GLU A 1 44  ? 4.816  -6.979  21.542 1.00 63.23 ? 44  GLU A OE2  6  
ATOM 11257 H H    . GLU A 1 44  ? 5.373  -6.177  17.856 1.00 42.11 ? 44  GLU A H    6  
ATOM 11258 H HA   . GLU A 1 44  ? 7.114  -5.443  20.017 1.00 74.51 ? 44  GLU A HA   6  
ATOM 11259 H HB2  . GLU A 1 44  ? 7.198  -7.773  18.092 1.00 15.34 ? 44  GLU A HB2  6  
ATOM 11260 H HB3  . GLU A 1 44  ? 8.261  -7.588  19.480 1.00 31.40 ? 44  GLU A HB3  6  
ATOM 11261 H HG2  . GLU A 1 44  ? 5.319  -8.122  19.426 1.00 11.31 ? 44  GLU A HG2  6  
ATOM 11262 H HG3  . GLU A 1 44  ? 6.601  -9.039  20.215 1.00 11.43 ? 44  GLU A HG3  6  
ATOM 11263 N N    . THR A 1 45  ? 9.400  -5.041  18.923 1.00 62.35 ? 45  THR A N    6  
ATOM 11264 C CA   . THR A 1 45  ? 10.584 -4.462  18.300 1.00 72.42 ? 45  THR A CA   6  
ATOM 11265 C C    . THR A 1 45  ? 11.595 -5.542  17.930 1.00 35.25 ? 45  THR A C    6  
ATOM 11266 O O    . THR A 1 45  ? 11.407 -6.716  18.250 1.00 54.44 ? 45  THR A O    6  
ATOM 11267 C CB   . THR A 1 45  ? 11.262 -3.436  19.227 1.00 33.33 ? 45  THR A CB   6  
ATOM 11268 O OG1  . THR A 1 45  ? 10.340 -3.000  20.232 1.00 33.44 ? 45  THR A OG1  6  
ATOM 11269 C CG2  . THR A 1 45  ? 11.760 -2.237  18.435 1.00 64.30 ? 45  THR A CG2  6  
ATOM 11270 H H    . THR A 1 45  ? 9.432  -5.295  19.868 1.00 24.24 ? 45  THR A H    6  
ATOM 11271 H HA   . THR A 1 45  ? 10.272 -3.952  17.400 1.00 34.11 ? 45  THR A HA   6  
ATOM 11272 H HB   . THR A 1 45  ? 12.107 -3.910  19.706 1.00 41.21 ? 45  THR A HB   6  
ATOM 11273 H HG1  . THR A 1 45  ? 9.506  -2.761  19.820 1.00 42.40 ? 45  THR A HG1  6  
ATOM 11274 H HG21 . THR A 1 45  ? 11.757 -1.361  19.067 1.00 60.51 ? 45  THR A HG21 6  
ATOM 11275 H HG22 . THR A 1 45  ? 11.113 -2.072  17.587 1.00 61.03 ? 45  THR A HG22 6  
ATOM 11276 H HG23 . THR A 1 45  ? 12.765 -2.427  18.090 1.00 64.54 ? 45  THR A HG23 6  
ATOM 11277 N N    . GLU A 1 46  ? 12.667 -5.137  17.257 1.00 73.31 ? 46  GLU A N    6  
ATOM 11278 C CA   . GLU A 1 46  ? 13.707 -6.072  16.845 1.00 61.24 ? 46  GLU A CA   6  
ATOM 11279 C C    . GLU A 1 46  ? 14.232 -6.863  18.039 1.00 24.12 ? 46  GLU A C    6  
ATOM 11280 O O    . GLU A 1 46  ? 14.562 -8.043  17.921 1.00 61.42 ? 46  GLU A O    6  
ATOM 11281 C CB   . GLU A 1 46  ? 14.858 -5.324  16.169 1.00 52.42 ? 46  GLU A CB   6  
ATOM 11282 C CG   . GLU A 1 46  ? 14.520 -4.816  14.777 1.00 34.11 ? 46  GLU A CG   6  
ATOM 11283 C CD   . GLU A 1 46  ? 13.641 -3.580  14.804 1.00 24.22 ? 46  GLU A CD   6  
ATOM 11284 O OE1  . GLU A 1 46  ? 14.157 -2.493  15.136 1.00 10.52 ? 46  GLU A OE1  6  
ATOM 11285 O OE2  . GLU A 1 46  ? 12.438 -3.701  14.493 1.00 60.52 ? 46  GLU A OE2  6  
ATOM 11286 H H    . GLU A 1 46  ? 12.760 -4.188  17.032 1.00 70.23 ? 46  GLU A H    6  
ATOM 11287 H HA   . GLU A 1 46  ? 13.272 -6.760  16.136 1.00 63.53 ? 46  GLU A HA   6  
ATOM 11288 H HB2  . GLU A 1 46  ? 15.130 -4.478  16.782 1.00 5.51  ? 46  GLU A HB2  6  
ATOM 11289 H HB3  . GLU A 1 46  ? 15.706 -5.988  16.090 1.00 11.24 ? 46  GLU A HB3  6  
ATOM 11290 H HG2  . GLU A 1 46  ? 15.438 -4.575  14.263 1.00 72.03 ? 46  GLU A HG2  6  
ATOM 11291 H HG3  . GLU A 1 46  ? 14.001 -5.596  14.239 1.00 24.43 ? 46  GLU A HG3  6  
ATOM 11292 N N    . LYS A 1 47  ? 14.308 -6.204  19.190 1.00 1.04  ? 47  LYS A N    6  
ATOM 11293 C CA   . LYS A 1 47  ? 14.792 -6.843  20.408 1.00 22.22 ? 47  LYS A CA   6  
ATOM 11294 C C    . LYS A 1 47  ? 13.717 -7.736  21.019 1.00 74.04 ? 47  LYS A C    6  
ATOM 11295 O O    . LYS A 1 47  ? 13.922 -8.936  21.201 1.00 65.14 ? 47  LYS A O    6  
ATOM 11296 C CB   . LYS A 1 47  ? 15.230 -5.786  21.425 1.00 55.15 ? 47  LYS A CB   6  
ATOM 11297 C CG   . LYS A 1 47  ? 16.715 -5.472  21.375 1.00 52.13 ? 47  LYS A CG   6  
ATOM 11298 C CD   . LYS A 1 47  ? 17.547 -6.624  21.913 1.00 54.02 ? 47  LYS A CD   6  
ATOM 11299 C CE   . LYS A 1 47  ? 17.297 -6.846  23.397 1.00 45.22 ? 47  LYS A CE   6  
ATOM 11300 N NZ   . LYS A 1 47  ? 16.308 -7.933  23.637 1.00 42.42 ? 47  LYS A NZ   6  
ATOM 11301 H H    . LYS A 1 47  ? 14.030 -5.264  19.222 1.00 44.00 ? 47  LYS A H    6  
ATOM 11302 H HA   . LYS A 1 47  ? 15.644 -7.453  20.147 1.00 53.01 ? 47  LYS A HA   6  
ATOM 11303 H HB2  . LYS A 1 47  ? 14.683 -4.874  21.235 1.00 43.33 ? 47  LYS A HB2  6  
ATOM 11304 H HB3  . LYS A 1 47  ? 14.991 -6.138  22.418 1.00 73.22 ? 47  LYS A HB3  6  
ATOM 11305 H HG2  . LYS A 1 47  ? 17.000 -5.284  20.350 1.00 32.31 ? 47  LYS A HG2  6  
ATOM 11306 H HG3  . LYS A 1 47  ? 16.907 -4.591  21.971 1.00 64.30 ? 47  LYS A HG3  6  
ATOM 11307 H HD2  . LYS A 1 47  ? 17.287 -7.525  21.377 1.00 22.14 ? 47  LYS A HD2  6  
ATOM 11308 H HD3  . LYS A 1 47  ? 18.594 -6.402  21.762 1.00 54.14 ? 47  LYS A HD3  6  
ATOM 11309 H HE2  . LYS A 1 47  ? 18.231 -7.110  23.870 1.00 51.43 ? 47  LYS A HE2  6  
ATOM 11310 H HE3  . LYS A 1 47  ? 16.923 -5.928  23.826 1.00 21.35 ? 47  LYS A HE3  6  
ATOM 11311 H HZ1  . LYS A 1 47  ? 16.768 -8.736  24.111 1.00 3.23  ? 47  LYS A HZ1  6  
ATOM 11312 H HZ2  . LYS A 1 47  ? 15.911 -8.260  22.733 1.00 31.03 ? 47  LYS A HZ2  6  
ATOM 11313 H HZ3  . LYS A 1 47  ? 15.534 -7.585  24.238 1.00 22.32 ? 47  LYS A HZ3  6  
ATOM 11314 N N    . ASP A 1 48  ? 12.570 -7.143  21.331 1.00 34.33 ? 48  ASP A N    6  
ATOM 11315 C CA   . ASP A 1 48  ? 11.461 -7.886  21.919 1.00 55.22 ? 48  ASP A CA   6  
ATOM 11316 C C    . ASP A 1 48  ? 11.111 -9.103  21.069 1.00 73.24 ? 48  ASP A C    6  
ATOM 11317 O O    . ASP A 1 48  ? 10.607 -10.104 21.578 1.00 55.24 ? 48  ASP A O    6  
ATOM 11318 C CB   . ASP A 1 48  ? 10.235 -6.982  22.067 1.00 64.34 ? 48  ASP A CB   6  
ATOM 11319 C CG   . ASP A 1 48  ? 10.589 -5.611  22.606 1.00 4.53  ? 48  ASP A CG   6  
ATOM 11320 O OD1  . ASP A 1 48  ? 11.587 -5.505  23.350 1.00 34.42 ? 48  ASP A OD1  6  
ATOM 11321 O OD2  . ASP A 1 48  ? 9.869  -4.642  22.286 1.00 74.24 ? 48  ASP A OD2  6  
ATOM 11322 H H    . ASP A 1 48  ? 12.466 -6.183  21.162 1.00 21.22 ? 48  ASP A H    6  
ATOM 11323 H HA   . ASP A 1 48  ? 11.768 -8.222  22.897 1.00 21.43 ? 48  ASP A HA   6  
ATOM 11324 H HB2  . ASP A 1 48  ? 9.769  -6.859  21.100 1.00 15.41 ? 48  ASP A HB2  6  
ATOM 11325 H HB3  . ASP A 1 48  ? 9.534  -7.446  22.744 1.00 33.20 ? 48  ASP A HB3  6  
ATOM 11326 N N    . ALA A 1 49  ? 11.381 -9.010  19.771 1.00 52.52 ? 49  ALA A N    6  
ATOM 11327 C CA   . ALA A 1 49  ? 11.096 -10.103 18.850 1.00 35.12 ? 49  ALA A CA   6  
ATOM 11328 C C    . ALA A 1 49  ? 12.140 -11.208 18.970 1.00 52.12 ? 49  ALA A C    6  
ATOM 11329 O O    . ALA A 1 49  ? 11.834 -12.387 18.790 1.00 61.55 ? 49  ALA A O    6  
ATOM 11330 C CB   . ALA A 1 49  ? 11.032 -9.587  17.420 1.00 2.55  ? 49  ALA A CB   6  
ATOM 11331 H H    . ALA A 1 49  ? 11.783 -8.186  19.425 1.00 52.15 ? 49  ALA A H    6  
ATOM 11332 H HA   . ALA A 1 49  ? 10.126 -10.509 19.104 1.00 45.53 ? 49  ALA A HA   6  
ATOM 11333 H HB1  . ALA A 1 49  ? 11.770 -8.808  17.287 1.00 73.41 ? 49  ALA A HB1  6  
ATOM 11334 H HB2  . ALA A 1 49  ? 11.235 -10.397 16.736 1.00 11.40 ? 49  ALA A HB2  6  
ATOM 11335 H HB3  . ALA A 1 49  ? 10.048 -9.187  17.226 1.00 61.44 ? 49  ALA A HB3  6  
ATOM 11336 N N    . LEU A 1 50  ? 13.373 -10.819 19.274 1.00 21.31 ? 50  LEU A N    6  
ATOM 11337 C CA   . LEU A 1 50  ? 14.464 -11.777 19.417 1.00 32.42 ? 50  LEU A CA   6  
ATOM 11338 C C    . LEU A 1 50  ? 14.443 -12.424 20.799 1.00 72.05 ? 50  LEU A C    6  
ATOM 11339 O O    . LEU A 1 50  ? 14.521 -13.647 20.923 1.00 12.44 ? 50  LEU A O    6  
ATOM 11340 C CB   . LEU A 1 50  ? 15.809 -11.087 19.185 1.00 30.20 ? 50  LEU A CB   6  
ATOM 11341 C CG   . LEU A 1 50  ? 16.178 -10.809 17.727 1.00 11.14 ? 50  LEU A CG   6  
ATOM 11342 C CD1  . LEU A 1 50  ? 17.456 -9.989  17.648 1.00 50.45 ? 50  LEU A CD1  6  
ATOM 11343 C CD2  . LEU A 1 50  ? 16.330 -12.113 16.957 1.00 14.44 ? 50  LEU A CD2  6  
ATOM 11344 H H    . LEU A 1 50  ? 13.556 -9.866  19.406 1.00 53.11 ? 50  LEU A H    6  
ATOM 11345 H HA   . LEU A 1 50  ? 14.329 -12.546 18.671 1.00 63.20 ? 50  LEU A HA   6  
ATOM 11346 H HB2  . LEU A 1 50  ? 15.791 -10.143 19.707 1.00 15.02 ? 50  LEU A HB2  6  
ATOM 11347 H HB3  . LEU A 1 50  ? 16.580 -11.716 19.608 1.00 13.33 ? 50  LEU A HB3  6  
ATOM 11348 H HG   . LEU A 1 50  ? 15.385 -10.237 17.265 1.00 3.40  ? 50  LEU A HG   6  
ATOM 11349 H HD11 . LEU A 1 50  ? 18.234 -10.478 18.214 1.00 53.11 ? 50  LEU A HD11 6  
ATOM 11350 H HD12 . LEU A 1 50  ? 17.278 -9.005  18.055 1.00 2.45  ? 50  LEU A HD12 6  
ATOM 11351 H HD13 . LEU A 1 50  ? 17.763 -9.900  16.615 1.00 14.15 ? 50  LEU A HD13 6  
ATOM 11352 H HD21 . LEU A 1 50  ? 16.587 -11.896 15.931 1.00 31.01 ? 50  LEU A HD21 6  
ATOM 11353 H HD22 . LEU A 1 50  ? 15.398 -12.659 16.987 1.00 12.32 ? 50  LEU A HD22 6  
ATOM 11354 H HD23 . LEU A 1 50  ? 17.111 -12.707 17.407 1.00 72.30 ? 50  LEU A HD23 6  
ATOM 11355 N N    . ILE A 1 51  ? 14.335 -11.596 21.832 1.00 21.01 ? 51  ILE A N    6  
ATOM 11356 C CA   . ILE A 1 51  ? 14.300 -12.088 23.204 1.00 43.22 ? 51  ILE A CA   6  
ATOM 11357 C C    . ILE A 1 51  ? 13.268 -13.199 23.363 1.00 2.14  ? 51  ILE A C    6  
ATOM 11358 O O    . ILE A 1 51  ? 13.443 -14.111 24.171 1.00 22.14 ? 51  ILE A O    6  
ATOM 11359 C CB   . ILE A 1 51  ? 13.979 -10.957 24.199 1.00 30.31 ? 51  ILE A CB   6  
ATOM 11360 C CG1  . ILE A 1 51  ? 14.294 -11.402 25.629 1.00 74.22 ? 51  ILE A CG1  6  
ATOM 11361 C CG2  . ILE A 1 51  ? 12.520 -10.542 24.077 1.00 64.34 ? 51  ILE A CG2  6  
ATOM 11362 C CD1  . ILE A 1 51  ? 14.259 -10.273 26.635 1.00 42.14 ? 51  ILE A CD1  6  
ATOM 11363 H H    . ILE A 1 51  ? 14.277 -10.632 21.668 1.00 12.12 ? 51  ILE A H    6  
ATOM 11364 H HA   . ILE A 1 51  ? 15.278 -12.482 23.441 1.00 31.20 ? 51  ILE A HA   6  
ATOM 11365 H HB   . ILE A 1 51  ? 14.593 -10.105 23.952 1.00 52.24 ? 51  ILE A HB   6  
ATOM 11366 H HG12 . ILE A 1 51  ? 13.571 -12.142 25.936 1.00 1.44  ? 51  ILE A HG12 6  
ATOM 11367 H HG13 . ILE A 1 51  ? 15.282 -11.839 25.653 1.00 53.24 ? 51  ILE A HG13 6  
ATOM 11368 H HG21 . ILE A 1 51  ? 12.177 -10.728 23.070 1.00 73.53 ? 51  ILE A HG21 6  
ATOM 11369 H HG22 . ILE A 1 51  ? 11.924 -11.115 24.771 1.00 42.10 ? 51  ILE A HG22 6  
ATOM 11370 H HG23 . ILE A 1 51  ? 12.425 -9.491  24.301 1.00 11.30 ? 51  ILE A HG23 6  
ATOM 11371 H HD11 . ILE A 1 51  ? 13.241 -9.939  26.766 1.00 13.53 ? 51  ILE A HD11 6  
ATOM 11372 H HD12 . ILE A 1 51  ? 14.651 -10.619 27.579 1.00 34.11 ? 51  ILE A HD12 6  
ATOM 11373 H HD13 . ILE A 1 51  ? 14.863 -9.452  26.274 1.00 14.23 ? 51  ILE A HD13 6  
ATOM 11374 N N    . ARG A 1 52  ? 12.193 -13.117 22.586 1.00 1.45  ? 52  ARG A N    6  
ATOM 11375 C CA   . ARG A 1 52  ? 11.133 -14.116 22.641 1.00 53.40 ? 52  ARG A CA   6  
ATOM 11376 C C    . ARG A 1 52  ? 11.484 -15.329 21.785 1.00 3.11  ? 52  ARG A C    6  
ATOM 11377 O O    . ARG A 1 52  ? 11.476 -16.462 22.265 1.00 2.22  ? 52  ARG A O    6  
ATOM 11378 C CB   . ARG A 1 52  ? 9.809  -13.511 22.169 1.00 71.41 ? 52  ARG A CB   6  
ATOM 11379 C CG   . ARG A 1 52  ? 8.846  -13.194 23.301 1.00 20.24 ? 52  ARG A CG   6  
ATOM 11380 C CD   . ARG A 1 52  ? 9.330  -12.015 24.130 1.00 2.14  ? 52  ARG A CD   6  
ATOM 11381 N NE   . ARG A 1 52  ? 8.221  -11.260 24.707 1.00 4.45  ? 52  ARG A NE   6  
ATOM 11382 C CZ   . ARG A 1 52  ? 7.387  -10.515 23.990 1.00 21.32 ? 52  ARG A CZ   6  
ATOM 11383 N NH1  . ARG A 1 52  ? 7.535  -10.427 22.676 1.00 70.45 ? 52  ARG A NH1  6  
ATOM 11384 N NH2  . ARG A 1 52  ? 6.402  -9.857  24.588 1.00 71.31 ? 52  ARG A NH2  6  
ATOM 11385 H H    . ARG A 1 52  ? 12.111 -12.366 21.962 1.00 15.41 ? 52  ARG A H    6  
ATOM 11386 H HA   . ARG A 1 52  ? 11.028 -14.432 23.668 1.00 73.42 ? 52  ARG A HA   6  
ATOM 11387 H HB2  . ARG A 1 52  ? 10.015 -12.596 21.634 1.00 13.10 ? 52  ARG A HB2  6  
ATOM 11388 H HB3  . ARG A 1 52  ? 9.327  -14.209 21.500 1.00 1.15  ? 52  ARG A HB3  6  
ATOM 11389 H HG2  . ARG A 1 52  ? 7.880  -12.953 22.883 1.00 32.42 ? 52  ARG A HG2  6  
ATOM 11390 H HG3  . ARG A 1 52  ? 8.758  -14.061 23.940 1.00 44.41 ? 52  ARG A HG3  6  
ATOM 11391 H HD2  . ARG A 1 52  ? 9.955  -12.386 24.929 1.00 13.23 ? 52  ARG A HD2  6  
ATOM 11392 H HD3  . ARG A 1 52  ? 9.909  -11.360 23.496 1.00 14.11 ? 52  ARG A HD3  6  
ATOM 11393 H HE   . ARG A 1 52  ? 8.094  -11.310 25.677 1.00 32.43 ? 52  ARG A HE   6  
ATOM 11394 H HH11 . ARG A 1 52  ? 8.276  -10.923 22.222 1.00 12.04 ? 52  ARG A HH11 6  
ATOM 11395 H HH12 . ARG A 1 52  ? 6.905  -9.867  22.138 1.00 74.25 ? 52  ARG A HH12 6  
ATOM 11396 H HH21 . ARG A 1 52  ? 6.287  -9.921  25.579 1.00 62.43 ? 52  ARG A HH21 6  
ATOM 11397 H HH22 . ARG A 1 52  ? 5.775  -9.297  24.047 1.00 32.44 ? 52  ARG A HH22 6  
ATOM 11398 N N    . GLU A 1 53  ? 11.792 -15.082 20.515 1.00 32.15 ? 53  GLU A N    6  
ATOM 11399 C CA   . GLU A 1 53  ? 12.145 -16.155 19.593 1.00 33.02 ? 53  GLU A CA   6  
ATOM 11400 C C    . GLU A 1 53  ? 13.260 -17.023 20.169 1.00 10.22 ? 53  GLU A C    6  
ATOM 11401 O O    . GLU A 1 53  ? 13.150 -18.249 20.208 1.00 15.42 ? 53  GLU A O    6  
ATOM 11402 C CB   . GLU A 1 53  ? 12.578 -15.576 18.245 1.00 65.52 ? 53  GLU A CB   6  
ATOM 11403 C CG   . GLU A 1 53  ? 13.203 -16.603 17.315 1.00 43.23 ? 53  GLU A CG   6  
ATOM 11404 C CD   . GLU A 1 53  ? 13.666 -15.997 16.004 1.00 3.11  ? 53  GLU A CD   6  
ATOM 11405 O OE1  . GLU A 1 53  ? 13.138 -14.931 15.625 1.00 52.14 ? 53  GLU A OE1  6  
ATOM 11406 O OE2  . GLU A 1 53  ? 14.556 -16.588 15.358 1.00 23.21 ? 53  GLU A OE2  6  
ATOM 11407 H H    . GLU A 1 53  ? 11.781 -14.157 20.192 1.00 74.34 ? 53  GLU A H    6  
ATOM 11408 H HA   . GLU A 1 53  ? 11.268 -16.768 19.446 1.00 1.42  ? 53  GLU A HA   6  
ATOM 11409 H HB2  . GLU A 1 53  ? 11.715 -15.154 17.753 1.00 14.22 ? 53  GLU A HB2  6  
ATOM 11410 H HB3  . GLU A 1 53  ? 13.301 -14.793 18.419 1.00 1.11  ? 53  GLU A HB3  6  
ATOM 11411 H HG2  . GLU A 1 53  ? 14.055 -17.047 17.809 1.00 54.52 ? 53  GLU A HG2  6  
ATOM 11412 H HG3  . GLU A 1 53  ? 12.472 -17.369 17.102 1.00 64.11 ? 53  GLU A HG3  6  
ATOM 11413 N N    . ILE A 1 54  ? 14.333 -16.378 20.614 1.00 1.03  ? 54  ILE A N    6  
ATOM 11414 C CA   . ILE A 1 54  ? 15.468 -17.090 21.188 1.00 20.04 ? 54  ILE A CA   6  
ATOM 11415 C C    . ILE A 1 54  ? 15.014 -18.072 22.263 1.00 63.31 ? 54  ILE A C    6  
ATOM 11416 O O    . ILE A 1 54  ? 15.641 -19.110 22.474 1.00 64.51 ? 54  ILE A O    6  
ATOM 11417 C CB   . ILE A 1 54  ? 16.493 -16.116 21.799 1.00 62.21 ? 54  ILE A CB   6  
ATOM 11418 C CG1  . ILE A 1 54  ? 17.068 -15.201 20.716 1.00 71.24 ? 54  ILE A CG1  6  
ATOM 11419 C CG2  . ILE A 1 54  ? 17.606 -16.886 22.495 1.00 73.03 ? 54  ILE A CG2  6  
ATOM 11420 C CD1  . ILE A 1 54  ? 17.754 -13.971 21.266 1.00 45.32 ? 54  ILE A CD1  6  
ATOM 11421 H H    . ILE A 1 54  ? 14.362 -15.400 20.556 1.00 31.50 ? 54  ILE A H    6  
ATOM 11422 H HA   . ILE A 1 54  ? 15.952 -17.640 20.394 1.00 3.13  ? 54  ILE A HA   6  
ATOM 11423 H HB   . ILE A 1 54  ? 15.988 -15.514 22.538 1.00 1.23  ? 54  ILE A HB   6  
ATOM 11424 H HG12 . ILE A 1 54  ? 17.791 -15.752 20.134 1.00 13.45 ? 54  ILE A HG12 6  
ATOM 11425 H HG13 . ILE A 1 54  ? 16.266 -14.874 20.069 1.00 4.12  ? 54  ILE A HG13 6  
ATOM 11426 H HG21 . ILE A 1 54  ? 17.185 -17.491 23.284 1.00 22.23 ? 54  ILE A HG21 6  
ATOM 11427 H HG22 . ILE A 1 54  ? 18.103 -17.524 21.780 1.00 41.13 ? 54  ILE A HG22 6  
ATOM 11428 H HG23 . ILE A 1 54  ? 18.317 -16.191 22.914 1.00 3.10  ? 54  ILE A HG23 6  
ATOM 11429 H HD11 . ILE A 1 54  ? 17.320 -13.711 22.220 1.00 74.52 ? 54  ILE A HD11 6  
ATOM 11430 H HD12 . ILE A 1 54  ? 18.808 -14.171 21.392 1.00 74.34 ? 54  ILE A HD12 6  
ATOM 11431 H HD13 . ILE A 1 54  ? 17.625 -13.148 20.577 1.00 72.10 ? 54  ILE A HD13 6  
ATOM 11432 N N    . ARG A 1 55  ? 13.920 -17.738 22.938 1.00 14.13 ? 55  ARG A N    6  
ATOM 11433 C CA   . ARG A 1 55  ? 13.381 -18.591 23.991 1.00 51.21 ? 55  ARG A CA   6  
ATOM 11434 C C    . ARG A 1 55  ? 12.358 -19.572 23.425 1.00 0.25  ? 55  ARG A C    6  
ATOM 11435 O O    . ARG A 1 55  ? 12.160 -20.658 23.969 1.00 61.02 ? 55  ARG A O    6  
ATOM 11436 C CB   . ARG A 1 55  ? 12.736 -17.740 25.086 1.00 11.32 ? 55  ARG A CB   6  
ATOM 11437 C CG   . ARG A 1 55  ? 12.496 -18.496 26.383 1.00 40.41 ? 55  ARG A CG   6  
ATOM 11438 C CD   . ARG A 1 55  ? 12.268 -17.545 27.548 1.00 72.12 ? 55  ARG A CD   6  
ATOM 11439 N NE   . ARG A 1 55  ? 13.496 -17.292 28.297 1.00 70.25 ? 55  ARG A NE   6  
ATOM 11440 C CZ   . ARG A 1 55  ? 13.633 -16.302 29.171 1.00 51.52 ? 55  ARG A CZ   6  
ATOM 11441 N NH1  . ARG A 1 55  ? 12.623 -15.475 29.405 1.00 33.42 ? 55  ARG A NH1  6  
ATOM 11442 N NH2  . ARG A 1 55  ? 14.782 -16.136 29.813 1.00 21.01 ? 55  ARG A NH2  6  
ATOM 11443 H H    . ARG A 1 55  ? 13.464 -16.897 22.724 1.00 34.23 ? 55  ARG A H    6  
ATOM 11444 H HA   . ARG A 1 55  ? 14.201 -19.150 24.417 1.00 15.43 ? 55  ARG A HA   6  
ATOM 11445 H HB2  . ARG A 1 55  ? 13.380 -16.899 25.299 1.00 21.23 ? 55  ARG A HB2  6  
ATOM 11446 H HB3  . ARG A 1 55  ? 11.786 -17.373 24.728 1.00 70.04 ? 55  ARG A HB3  6  
ATOM 11447 H HG2  . ARG A 1 55  ? 11.624 -19.122 26.268 1.00 54.23 ? 55  ARG A HG2  6  
ATOM 11448 H HG3  . ARG A 1 55  ? 13.358 -19.111 26.595 1.00 52.34 ? 55  ARG A HG3  6  
ATOM 11449 H HD2  . ARG A 1 55  ? 11.893 -16.608 27.163 1.00 62.43 ? 55  ARG A HD2  6  
ATOM 11450 H HD3  . ARG A 1 55  ? 11.535 -17.980 28.211 1.00 4.13  ? 55  ARG A HD3  6  
ATOM 11451 H HE   . ARG A 1 55  ? 14.255 -17.891 28.139 1.00 41.23 ? 55  ARG A HE   6  
ATOM 11452 H HH11 . ARG A 1 55  ? 11.755 -15.598 28.923 1.00 23.44 ? 55  ARG A HH11 6  
ATOM 11453 H HH12 . ARG A 1 55  ? 12.728 -14.731 30.065 1.00 40.01 ? 55  ARG A HH12 6  
ATOM 11454 H HH21 . ARG A 1 55  ? 15.546 -16.757 29.639 1.00 12.02 ? 55  ARG A HH21 6  
ATOM 11455 H HH22 . ARG A 1 55  ? 14.884 -15.390 30.471 1.00 63.34 ? 55  ARG A HH22 6  
ATOM 11456 N N    . GLU A 1 56  ? 11.711 -19.180 22.332 1.00 3.01  ? 56  GLU A N    6  
ATOM 11457 C CA   . GLU A 1 56  ? 10.708 -20.025 21.695 1.00 40.22 ? 56  GLU A CA   6  
ATOM 11458 C C    . GLU A 1 56  ? 11.347 -20.934 20.649 1.00 41.20 ? 56  GLU A C    6  
ATOM 11459 O O    . GLU A 1 56  ? 11.303 -22.158 20.767 1.00 44.15 ? 56  GLU A O    6  
ATOM 11460 C CB   . GLU A 1 56  ? 9.623  -19.164 21.044 1.00 63.11 ? 56  GLU A CB   6  
ATOM 11461 C CG   . GLU A 1 56  ? 8.210  -19.635 21.345 1.00 64.22 ? 56  GLU A CG   6  
ATOM 11462 C CD   . GLU A 1 56  ? 7.895  -19.625 22.828 1.00 43.20 ? 56  GLU A CD   6  
ATOM 11463 O OE1  . GLU A 1 56  ? 8.145  -18.589 23.480 1.00 40.14 ? 56  GLU A OE1  6  
ATOM 11464 O OE2  . GLU A 1 56  ? 7.400  -20.652 23.337 1.00 13.41 ? 56  GLU A OE2  6  
ATOM 11465 H H    . GLU A 1 56  ? 11.913 -18.302 21.946 1.00 61.44 ? 56  GLU A H    6  
ATOM 11466 H HA   . GLU A 1 56  ? 10.257 -20.638 22.460 1.00 73.32 ? 56  GLU A HA   6  
ATOM 11467 H HB2  . GLU A 1 56  ? 9.726  -18.149 21.398 1.00 55.32 ? 56  GLU A HB2  6  
ATOM 11468 H HB3  . GLU A 1 56  ? 9.764  -19.178 19.973 1.00 23.22 ? 56  GLU A HB3  6  
ATOM 11469 H HG2  . GLU A 1 56  ? 7.512  -18.984 20.840 1.00 63.52 ? 56  GLU A HG2  6  
ATOM 11470 H HG3  . GLU A 1 56  ? 8.094  -20.643 20.974 1.00 40.00 ? 56  GLU A HG3  6  
ATOM 11471 N N    . GLU A 1 57  ? 11.939 -20.325 19.626 1.00 4.35  ? 57  GLU A N    6  
ATOM 11472 C CA   . GLU A 1 57  ? 12.586 -21.079 18.559 1.00 30.23 ? 57  GLU A CA   6  
ATOM 11473 C C    . GLU A 1 57  ? 13.856 -21.757 19.065 1.00 44.13 ? 57  GLU A C    6  
ATOM 11474 O O    . GLU A 1 57  ? 13.962 -22.983 19.062 1.00 55.03 ? 57  GLU A O    6  
ATOM 11475 C CB   . GLU A 1 57  ? 12.919 -20.159 17.383 1.00 1.23  ? 57  GLU A CB   6  
ATOM 11476 C CG   . GLU A 1 57  ? 11.829 -20.102 16.327 1.00 73.44 ? 57  GLU A CG   6  
ATOM 11477 C CD   . GLU A 1 57  ? 11.709 -21.395 15.542 1.00 2.51  ? 57  GLU A CD   6  
ATOM 11478 O OE1  . GLU A 1 57  ? 12.449 -21.555 14.549 1.00 61.32 ? 57  GLU A OE1  6  
ATOM 11479 O OE2  . GLU A 1 57  ? 10.876 -22.244 15.921 1.00 65.33 ? 57  GLU A OE2  6  
ATOM 11480 H H    . GLU A 1 57  ? 11.941 -19.346 19.589 1.00 50.53 ? 57  GLU A H    6  
ATOM 11481 H HA   . GLU A 1 57  ? 11.896 -21.839 18.225 1.00 32.02 ? 57  GLU A HA   6  
ATOM 11482 H HB2  . GLU A 1 57  ? 13.081 -19.159 17.759 1.00 73.04 ? 57  GLU A HB2  6  
ATOM 11483 H HB3  . GLU A 1 57  ? 13.827 -20.508 16.915 1.00 62.43 ? 57  GLU A HB3  6  
ATOM 11484 H HG2  . GLU A 1 57  ? 10.885 -19.906 16.812 1.00 54.51 ? 57  GLU A HG2  6  
ATOM 11485 H HG3  . GLU A 1 57  ? 12.053 -19.300 15.639 1.00 73.21 ? 57  GLU A HG3  6  
ATOM 11486 N N    . MET A 1 58  ? 14.819 -20.949 19.498 1.00 52.05 ? 58  MET A N    6  
ATOM 11487 C CA   . MET A 1 58  ? 16.082 -21.470 20.007 1.00 61.14 ? 58  MET A CA   6  
ATOM 11488 C C    . MET A 1 58  ? 15.862 -22.281 21.280 1.00 42.31 ? 58  MET A C    6  
ATOM 11489 O O    . MET A 1 58  ? 16.377 -23.391 21.419 1.00 50.55 ? 58  MET A O    6  
ATOM 11490 C CB   . MET A 1 58  ? 17.058 -20.324 20.280 1.00 61.12 ? 58  MET A CB   6  
ATOM 11491 C CG   . MET A 1 58  ? 17.980 -20.019 19.110 1.00 31.13 ? 58  MET A CG   6  
ATOM 11492 S SD   . MET A 1 58  ? 17.081 -19.728 17.575 1.00 72.13 ? 58  MET A SD   6  
ATOM 11493 C CE   . MET A 1 58  ? 17.831 -18.197 17.028 1.00 44.51 ? 58  MET A CE   6  
ATOM 11494 H H    . MET A 1 58  ? 14.676 -19.980 19.475 1.00 5.52  ? 58  MET A H    6  
ATOM 11495 H HA   . MET A 1 58  ? 16.502 -22.116 19.251 1.00 63.24 ? 58  MET A HA   6  
ATOM 11496 H HB2  . MET A 1 58  ? 16.493 -19.432 20.507 1.00 22.52 ? 58  MET A HB2  6  
ATOM 11497 H HB3  . MET A 1 58  ? 17.668 -20.582 21.133 1.00 41.42 ? 58  MET A HB3  6  
ATOM 11498 H HG2  . MET A 1 58  ? 18.558 -19.137 19.344 1.00 34.34 ? 58  MET A HG2  6  
ATOM 11499 H HG3  . MET A 1 58  ? 18.647 -20.856 18.968 1.00 31.52 ? 58  MET A HG3  6  
ATOM 11500 H HE1  . MET A 1 58  ? 18.818 -18.398 16.638 1.00 71.25 ? 58  MET A HE1  6  
ATOM 11501 H HE2  . MET A 1 58  ? 17.222 -17.753 16.255 1.00 72.35 ? 58  MET A HE2  6  
ATOM 11502 H HE3  . MET A 1 58  ? 17.907 -17.515 17.863 1.00 50.12 ? 58  MET A HE3  6  
ATOM 11503 N N    . LYS A 1 59  ? 15.095 -21.719 22.208 1.00 32.51 ? 59  LYS A N    6  
ATOM 11504 C CA   . LYS A 1 59  ? 14.805 -22.390 23.470 1.00 4.22  ? 59  LYS A CA   6  
ATOM 11505 C C    . LYS A 1 59  ? 16.067 -22.524 24.317 1.00 41.31 ? 59  LYS A C    6  
ATOM 11506 O O    . LYS A 1 59  ? 16.347 -23.590 24.866 1.00 63.02 ? 59  LYS A O    6  
ATOM 11507 C CB   . LYS A 1 59  ? 14.204 -23.773 23.211 1.00 55.34 ? 59  LYS A CB   6  
ATOM 11508 C CG   . LYS A 1 59  ? 13.101 -23.770 22.166 1.00 14.33 ? 59  LYS A CG   6  
ATOM 11509 C CD   . LYS A 1 59  ? 12.679 -25.182 21.796 1.00 3.12  ? 59  LYS A CD   6  
ATOM 11510 C CE   . LYS A 1 59  ? 12.149 -25.940 23.004 1.00 52.34 ? 59  LYS A CE   6  
ATOM 11511 N NZ   . LYS A 1 59  ? 11.700 -27.313 22.643 1.00 32.11 ? 59  LYS A NZ   6  
ATOM 11512 H H    . LYS A 1 59  ? 14.713 -20.832 22.040 1.00 75.25 ? 59  LYS A H    6  
ATOM 11513 H HA   . LYS A 1 59  ? 14.088 -21.789 24.008 1.00 75.21 ? 59  LYS A HA   6  
ATOM 11514 H HB2  . LYS A 1 59  ? 14.987 -24.436 22.875 1.00 41.23 ? 59  LYS A HB2  6  
ATOM 11515 H HB3  . LYS A 1 59  ? 13.794 -24.153 24.135 1.00 13.14 ? 59  LYS A HB3  6  
ATOM 11516 H HG2  . LYS A 1 59  ? 12.245 -23.242 22.561 1.00 71.22 ? 59  LYS A HG2  6  
ATOM 11517 H HG3  . LYS A 1 59  ? 13.459 -23.266 21.279 1.00 33.43 ? 59  LYS A HG3  6  
ATOM 11518 H HD2  . LYS A 1 59  ? 11.903 -25.132 21.047 1.00 30.33 ? 59  LYS A HD2  6  
ATOM 11519 H HD3  . LYS A 1 59  ? 13.534 -25.710 21.397 1.00 33.33 ? 59  LYS A HD3  6  
ATOM 11520 H HE2  . LYS A 1 59  ? 12.933 -26.009 23.742 1.00 51.12 ? 59  LYS A HE2  6  
ATOM 11521 H HE3  . LYS A 1 59  ? 11.313 -25.394 23.416 1.00 3.41  ? 59  LYS A HE3  6  
ATOM 11522 H HZ1  . LYS A 1 59  ? 11.709 -27.432 21.610 1.00 52.22 ? 59  LYS A HZ1  6  
ATOM 11523 H HZ2  . LYS A 1 59  ? 10.733 -27.476 22.991 1.00 44.23 ? 59  LYS A HZ2  6  
ATOM 11524 H HZ3  . LYS A 1 59  ? 12.333 -28.020 23.068 1.00 4.53  ? 59  LYS A HZ3  6  
ATOM 11525 N N    . CYS A 1 60  ? 16.823 -21.436 24.420 1.00 61.34 ? 60  CYS A N    6  
ATOM 11526 C CA   . CYS A 1 60  ? 18.055 -21.433 25.201 1.00 41.44 ? 60  CYS A CA   6  
ATOM 11527 C C    . CYS A 1 60  ? 18.197 -20.133 25.986 1.00 12.01 ? 60  CYS A C    6  
ATOM 11528 O O    . CYS A 1 60  ? 17.319 -19.271 25.944 1.00 74.24 ? 60  CYS A O    6  
ATOM 11529 C CB   . CYS A 1 60  ? 19.265 -21.624 24.285 1.00 53.34 ? 60  CYS A CB   6  
ATOM 11530 S SG   . CYS A 1 60  ? 19.096 -22.991 23.114 1.00 34.30 ? 60  CYS A SG   6  
ATOM 11531 H H    . CYS A 1 60  ? 16.547 -20.616 23.959 1.00 24.31 ? 60  CYS A H    6  
ATOM 11532 H HA   . CYS A 1 60  ? 18.008 -22.256 25.897 1.00 74.13 ? 60  CYS A HA   6  
ATOM 11533 H HB2  . CYS A 1 60  ? 19.420 -20.720 23.713 1.00 23.50 ? 60  CYS A HB2  6  
ATOM 11534 H HB3  . CYS A 1 60  ? 20.139 -21.813 24.890 1.00 74.30 ? 60  CYS A HB3  6  
ATOM 11535 H HG   . CYS A 1 60  ? 19.041 -22.480 21.894 1.00 61.04 ? 60  CYS A HG   6  
ATOM 11536 N N    . ASP A 1 61  ? 19.307 -20.000 26.704 1.00 51.34 ? 61  ASP A N    6  
ATOM 11537 C CA   . ASP A 1 61  ? 19.564 -18.805 27.500 1.00 72.31 ? 61  ASP A CA   6  
ATOM 11538 C C    . ASP A 1 61  ? 20.456 -17.828 26.741 1.00 1.11  ? 61  ASP A C    6  
ATOM 11539 O O    . ASP A 1 61  ? 21.203 -17.056 27.344 1.00 23.31 ? 61  ASP A O    6  
ATOM 11540 C CB   . ASP A 1 61  ? 20.217 -19.184 28.830 1.00 33.01 ? 61  ASP A CB   6  
ATOM 11541 C CG   . ASP A 1 61  ? 20.248 -18.027 29.810 1.00 64.34 ? 61  ASP A CG   6  
ATOM 11542 O OD1  . ASP A 1 61  ? 19.656 -16.972 29.501 1.00 44.41 ? 61  ASP A OD1  6  
ATOM 11543 O OD2  . ASP A 1 61  ? 20.864 -18.178 30.885 1.00 3.22  ? 61  ASP A OD2  6  
ATOM 11544 H H    . ASP A 1 61  ? 19.970 -20.722 26.697 1.00 51.21 ? 61  ASP A H    6  
ATOM 11545 H HA   . ASP A 1 61  ? 18.616 -18.328 27.698 1.00 72.43 ? 61  ASP A HA   6  
ATOM 11546 H HB2  . ASP A 1 61  ? 19.662 -19.995 29.278 1.00 34.42 ? 61  ASP A HB2  6  
ATOM 11547 H HB3  . ASP A 1 61  ? 21.231 -19.505 28.647 1.00 64.50 ? 61  ASP A HB3  6  
ATOM 11548 N N    . LEU A 1 62  ? 20.374 -17.867 25.416 1.00 42.32 ? 62  LEU A N    6  
ATOM 11549 C CA   . LEU A 1 62  ? 21.175 -16.985 24.574 1.00 61.04 ? 62  LEU A CA   6  
ATOM 11550 C C    . LEU A 1 62  ? 21.070 -15.538 25.045 1.00 72.21 ? 62  LEU A C    6  
ATOM 11551 O O    . LEU A 1 62  ? 19.972 -14.994 25.170 1.00 21.30 ? 62  LEU A O    6  
ATOM 11552 C CB   . LEU A 1 62  ? 20.725 -17.092 23.116 1.00 71.54 ? 62  LEU A CB   6  
ATOM 11553 C CG   . LEU A 1 62  ? 21.812 -17.455 22.103 1.00 54.34 ? 62  LEU A CG   6  
ATOM 11554 C CD1  . LEU A 1 62  ? 22.224 -18.910 22.260 1.00 4.20  ? 62  LEU A CD1  6  
ATOM 11555 C CD2  . LEU A 1 62  ? 21.330 -17.185 20.685 1.00 73.55 ? 62  LEU A CD2  6  
ATOM 11556 H H    . LEU A 1 62  ? 19.761 -18.503 24.993 1.00 50.34 ? 62  LEU A H    6  
ATOM 11557 H HA   . LEU A 1 62  ? 22.205 -17.301 24.648 1.00 31.22 ? 62  LEU A HA   6  
ATOM 11558 H HB2  . LEU A 1 62  ? 19.957 -17.849 23.062 1.00 64.14 ? 62  LEU A HB2  6  
ATOM 11559 H HB3  . LEU A 1 62  ? 20.308 -16.138 22.828 1.00 52.20 ? 62  LEU A HB3  6  
ATOM 11560 H HG   . LEU A 1 62  ? 22.683 -16.840 22.283 1.00 14.22 ? 62  LEU A HG   6  
ATOM 11561 H HD11 . LEU A 1 62  ? 23.145 -19.083 21.723 1.00 55.01 ? 62  LEU A HD11 6  
ATOM 11562 H HD12 . LEU A 1 62  ? 21.450 -19.549 21.863 1.00 53.34 ? 62  LEU A HD12 6  
ATOM 11563 H HD13 . LEU A 1 62  ? 22.371 -19.131 23.307 1.00 32.12 ? 62  LEU A HD13 6  
ATOM 11564 H HD21 . LEU A 1 62  ? 21.907 -16.380 20.256 1.00 51.43 ? 62  LEU A HD21 6  
ATOM 11565 H HD22 . LEU A 1 62  ? 20.286 -16.908 20.706 1.00 75.53 ? 62  LEU A HD22 6  
ATOM 11566 H HD23 . LEU A 1 62  ? 21.455 -18.076 20.087 1.00 54.02 ? 62  LEU A HD23 6  
ATOM 11567 N N    . ILE A 1 63  ? 22.218 -14.920 25.303 1.00 75.33 ? 63  ILE A N    6  
ATOM 11568 C CA   . ILE A 1 63  ? 22.254 -13.536 25.757 1.00 50.34 ? 63  ILE A CA   6  
ATOM 11569 C C    . ILE A 1 63  ? 22.374 -12.574 24.579 1.00 25.22 ? 63  ILE A C    6  
ATOM 11570 O O    . ILE A 1 63  ? 23.071 -12.854 23.604 1.00 65.12 ? 63  ILE A O    6  
ATOM 11571 C CB   . ILE A 1 63  ? 23.426 -13.292 26.726 1.00 14.21 ? 63  ILE A CB   6  
ATOM 11572 C CG1  . ILE A 1 63  ? 23.298 -14.198 27.952 1.00 4.15  ? 63  ILE A CG1  6  
ATOM 11573 C CG2  . ILE A 1 63  ? 23.472 -11.830 27.144 1.00 51.54 ? 63  ILE A CG2  6  
ATOM 11574 C CD1  . ILE A 1 63  ? 24.630 -14.630 28.525 1.00 61.52 ? 63  ILE A CD1  6  
ATOM 11575 H H    . ILE A 1 63  ? 23.060 -15.407 25.184 1.00 15.10 ? 63  ILE A H    6  
ATOM 11576 H HA   . ILE A 1 63  ? 21.331 -13.333 26.281 1.00 40.34 ? 63  ILE A HA   6  
ATOM 11577 H HB   . ILE A 1 63  ? 24.345 -13.523 26.210 1.00 32.11 ? 63  ILE A HB   6  
ATOM 11578 H HG12 . ILE A 1 63  ? 22.760 -13.673 28.726 1.00 45.00 ? 63  ILE A HG12 6  
ATOM 11579 H HG13 . ILE A 1 63  ? 22.750 -15.087 27.678 1.00 35.20 ? 63  ILE A HG13 6  
ATOM 11580 H HG21 . ILE A 1 63  ? 23.761 -11.223 26.298 1.00 11.21 ? 63  ILE A HG21 6  
ATOM 11581 H HG22 . ILE A 1 63  ? 22.496 -11.523 27.488 1.00 33.03 ? 63  ILE A HG22 6  
ATOM 11582 H HG23 . ILE A 1 63  ? 24.191 -11.705 27.939 1.00 11.51 ? 63  ILE A HG23 6  
ATOM 11583 H HD11 . ILE A 1 63  ? 25.088 -15.354 27.866 1.00 14.12 ? 63  ILE A HD11 6  
ATOM 11584 H HD12 . ILE A 1 63  ? 25.277 -13.772 28.623 1.00 53.44 ? 63  ILE A HD12 6  
ATOM 11585 H HD13 . ILE A 1 63  ? 24.476 -15.077 29.497 1.00 71.23 ? 63  ILE A HD13 6  
ATOM 11586 N N    . VAL A 1 64  ? 21.692 -11.438 24.678 1.00 53.11 ? 64  VAL A N    6  
ATOM 11587 C CA   . VAL A 1 64  ? 21.724 -10.432 23.623 1.00 61.45 ? 64  VAL A CA   6  
ATOM 11588 C C    . VAL A 1 64  ? 22.665 -9.288  23.983 1.00 54.13 ? 64  VAL A C    6  
ATOM 11589 O O    . VAL A 1 64  ? 22.853 -8.971  25.156 1.00 30.24 ? 64  VAL A O    6  
ATOM 11590 C CB   . VAL A 1 64  ? 20.320 -9.862  23.348 1.00 42.41 ? 64  VAL A CB   6  
ATOM 11591 C CG1  . VAL A 1 64  ? 19.818 -9.077  24.550 1.00 1.41  ? 64  VAL A CG1  6  
ATOM 11592 C CG2  . VAL A 1 64  ? 20.334 -8.991  22.100 1.00 22.04 ? 64  VAL A CG2  6  
ATOM 11593 H H    . VAL A 1 64  ? 21.154 -11.272 25.480 1.00 52.40 ? 64  VAL A H    6  
ATOM 11594 H HA   . VAL A 1 64  ? 22.080 -10.907 22.720 1.00 73.34 ? 64  VAL A HA   6  
ATOM 11595 H HB   . VAL A 1 64  ? 19.645 -10.687 23.178 1.00 71.25 ? 64  VAL A HB   6  
ATOM 11596 H HG11 . VAL A 1 64  ? 20.332 -9.412  25.439 1.00 60.51 ? 64  VAL A HG11 6  
ATOM 11597 H HG12 . VAL A 1 64  ? 20.008 -8.024  24.398 1.00 25.35 ? 64  VAL A HG12 6  
ATOM 11598 H HG13 . VAL A 1 64  ? 18.756 -9.238  24.667 1.00 44.41 ? 64  VAL A HG13 6  
ATOM 11599 H HG21 . VAL A 1 64  ? 20.836 -8.060  22.318 1.00 53.11 ? 64  VAL A HG21 6  
ATOM 11600 H HG22 . VAL A 1 64  ? 20.858 -9.505  21.308 1.00 62.33 ? 64  VAL A HG22 6  
ATOM 11601 H HG23 . VAL A 1 64  ? 19.320 -8.790  21.790 1.00 72.34 ? 64  VAL A HG23 6  
ATOM 11602 N N    . GLY A 1 65  ? 23.253 -8.670  22.963 1.00 3.43  ? 65  GLY A N    6  
ATOM 11603 C CA   . GLY A 1 65  ? 24.167 -7.566  23.193 1.00 64.11 ? 65  GLY A CA   6  
ATOM 11604 C C    . GLY A 1 65  ? 23.608 -6.241  22.714 1.00 3.14  ? 65  GLY A C    6  
ATOM 11605 O O    . GLY A 1 65  ? 22.866 -5.576  23.437 1.00 50.41 ? 65  GLY A O    6  
ATOM 11606 H H    . GLY A 1 65  ? 23.065 -8.965  22.048 1.00 64.42 ? 65  GLY A H    6  
ATOM 11607 H HA2  . GLY A 1 65  ? 24.373 -7.498  24.251 1.00 42.54 ? 65  GLY A HA2  6  
ATOM 11608 H HA3  . GLY A 1 65  ? 25.091 -7.764  22.669 1.00 41.12 ? 65  GLY A HA3  6  
ATOM 11609 N N    . ASP A 1 66  ? 23.966 -5.856  21.494 1.00 0.35  ? 66  ASP A N    6  
ATOM 11610 C CA   . ASP A 1 66  ? 23.495 -4.600  20.920 1.00 25.43 ? 66  ASP A CA   6  
ATOM 11611 C C    . ASP A 1 66  ? 23.058 -4.796  19.472 1.00 43.41 ? 66  ASP A C    6  
ATOM 11612 O O    . ASP A 1 66  ? 23.221 -5.875  18.903 1.00 73.21 ? 66  ASP A O    6  
ATOM 11613 C CB   . ASP A 1 66  ? 24.592 -3.537  20.996 1.00 24.32 ? 66  ASP A CB   6  
ATOM 11614 C CG   . ASP A 1 66  ? 24.459 -2.654  22.221 1.00 22.55 ? 66  ASP A CG   6  
ATOM 11615 O OD1  . ASP A 1 66  ? 23.796 -3.080  23.190 1.00 13.15 ? 66  ASP A OD1  6  
ATOM 11616 O OD2  . ASP A 1 66  ? 25.019 -1.539  22.212 1.00 43.41 ? 66  ASP A OD2  6  
ATOM 11617 H H    . ASP A 1 66  ? 24.560 -6.430  20.967 1.00 4.30  ? 66  ASP A H    6  
ATOM 11618 H HA   . ASP A 1 66  ? 22.646 -4.269  21.498 1.00 33.50 ? 66  ASP A HA   6  
ATOM 11619 H HB2  . ASP A 1 66  ? 25.556 -4.025  21.030 1.00 32.01 ? 66  ASP A HB2  6  
ATOM 11620 H HB3  . ASP A 1 66  ? 24.540 -2.913  20.117 1.00 45.52 ? 66  ASP A HB3  6  
ATOM 11621 N N    . LYS A 1 67  ? 22.502 -3.744  18.881 1.00 53.15 ? 67  LYS A N    6  
ATOM 11622 C CA   . LYS A 1 67  ? 22.041 -3.798  17.498 1.00 15.03 ? 67  LYS A CA   6  
ATOM 11623 C C    . LYS A 1 67  ? 23.220 -3.813  16.531 1.00 1.54  ? 67  LYS A C    6  
ATOM 11624 O O    . LYS A 1 67  ? 24.079 -2.932  16.571 1.00 41.50 ? 67  LYS A O    6  
ATOM 11625 C CB   . LYS A 1 67  ? 21.133 -2.604  17.195 1.00 42.43 ? 67  LYS A CB   6  
ATOM 11626 C CG   . LYS A 1 67  ? 20.756 -2.484  15.728 1.00 12.34 ? 67  LYS A CG   6  
ATOM 11627 C CD   . LYS A 1 67  ? 19.961 -3.690  15.257 1.00 52.32 ? 67  LYS A CD   6  
ATOM 11628 C CE   . LYS A 1 67  ? 19.213 -3.394  13.965 1.00 25.34 ? 67  LYS A CE   6  
ATOM 11629 N NZ   . LYS A 1 67  ? 17.831 -2.905  14.224 1.00 10.00 ? 67  LYS A NZ   6  
ATOM 11630 H H    . LYS A 1 67  ? 22.399 -2.910  19.386 1.00 23.03 ? 67  LYS A H    6  
ATOM 11631 H HA   . LYS A 1 67  ? 21.476 -4.709  17.372 1.00 31.33 ? 67  LYS A HA   6  
ATOM 11632 H HB2  . LYS A 1 67  ? 20.226 -2.700  17.772 1.00 75.41 ? 67  LYS A HB2  6  
ATOM 11633 H HB3  . LYS A 1 67  ? 21.642 -1.697  17.489 1.00 13.31 ? 67  LYS A HB3  6  
ATOM 11634 H HG2  . LYS A 1 67  ? 20.157 -1.596  15.591 1.00 0.54  ? 67  LYS A HG2  6  
ATOM 11635 H HG3  . LYS A 1 67  ? 21.658 -2.406  15.139 1.00 25.00 ? 67  LYS A HG3  6  
ATOM 11636 H HD2  . LYS A 1 67  ? 20.639 -4.513  15.087 1.00 55.02 ? 67  LYS A HD2  6  
ATOM 11637 H HD3  . LYS A 1 67  ? 19.247 -3.961  16.022 1.00 51.21 ? 67  LYS A HD3  6  
ATOM 11638 H HE2  . LYS A 1 67  ? 19.756 -2.641  13.415 1.00 13.33 ? 67  LYS A HE2  6  
ATOM 11639 H HE3  . LYS A 1 67  ? 19.162 -4.300  13.380 1.00 70.24 ? 67  LYS A HE3  6  
ATOM 11640 H HZ1  . LYS A 1 67  ? 17.197 -3.205  13.456 1.00 14.12 ? 67  LYS A HZ1  6  
ATOM 11641 H HZ2  . LYS A 1 67  ? 17.824 -1.867  14.278 1.00 12.42 ? 67  LYS A HZ2  6  
ATOM 11642 H HZ3  . LYS A 1 67  ? 17.477 -3.291  15.122 1.00 2.05  ? 67  LYS A HZ3  6  
ATOM 11643 N N    . VAL A 1 68  ? 23.255 -4.818  15.662 1.00 11.14 ? 68  VAL A N    6  
ATOM 11644 C CA   . VAL A 1 68  ? 24.328 -4.945  14.683 1.00 33.33 ? 68  VAL A CA   6  
ATOM 11645 C C    . VAL A 1 68  ? 24.141 -3.964  13.532 1.00 15.41 ? 68  VAL A C    6  
ATOM 11646 O O    . VAL A 1 68  ? 24.975 -3.086  13.310 1.00 40.12 ? 68  VAL A O    6  
ATOM 11647 C CB   . VAL A 1 68  ? 24.403 -6.376  14.117 1.00 45.42 ? 68  VAL A CB   6  
ATOM 11648 C CG1  . VAL A 1 68  ? 25.512 -6.482  13.081 1.00 4.20  ? 68  VAL A CG1  6  
ATOM 11649 C CG2  . VAL A 1 68  ? 24.612 -7.382  15.238 1.00 30.12 ? 68  VAL A CG2  6  
ATOM 11650 H H    . VAL A 1 68  ? 22.541 -5.489  15.680 1.00 65.42 ? 68  VAL A H    6  
ATOM 11651 H HA   . VAL A 1 68  ? 25.262 -4.728  15.181 1.00 14.20 ? 68  VAL A HA   6  
ATOM 11652 H HB   . VAL A 1 68  ? 23.465 -6.599  13.631 1.00 50.20 ? 68  VAL A HB   6  
ATOM 11653 H HG11 . VAL A 1 68  ? 25.334 -5.769  12.289 1.00 3.12  ? 68  VAL A HG11 6  
ATOM 11654 H HG12 . VAL A 1 68  ? 26.463 -6.273  13.549 1.00 44.55 ? 68  VAL A HG12 6  
ATOM 11655 H HG13 . VAL A 1 68  ? 25.525 -7.480  12.669 1.00 23.20 ? 68  VAL A HG13 6  
ATOM 11656 H HG21 . VAL A 1 68  ? 25.620 -7.766  15.194 1.00 44.43 ? 68  VAL A HG21 6  
ATOM 11657 H HG22 . VAL A 1 68  ? 24.453 -6.898  16.191 1.00 32.21 ? 68  VAL A HG22 6  
ATOM 11658 H HG23 . VAL A 1 68  ? 23.911 -8.196  15.127 1.00 63.01 ? 68  VAL A HG23 6  
ATOM 11659 N N    . ILE A 1 69  ? 23.040 -4.118  12.803 1.00 2.34  ? 69  ILE A N    6  
ATOM 11660 C CA   . ILE A 1 69  ? 22.743 -3.244  1