data_5X22
# 
_entry.id   5X22 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5X22         
WWPDB D_1300002805 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5X21 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5X22 
_pdbx_database_status.recvd_initial_deposition_date   2017-01-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhang, Y.'   1 ? 
'Ebright, R.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            169 
_citation.language                  ? 
_citation.page_first                1240 
_citation.page_last                 1248.e23 
_citation.title                     'Antibacterial Nucleoside-Analog Inhibitor of Bacterial RNA Polymerase.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2017.05.042 
_citation.pdbx_database_id_PubMed   28622509 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Maffioli, S.I.'  1  ? 
primary 'Zhang, Y.'       2  ? 
primary 'Degen, D.'       3  ? 
primary 'Carzaniga, T.'   4  ? 
primary 'Del Gatto, G.'   5  ? 
primary 'Serina, S.'      6  ? 
primary 'Monciardini, P.' 7  ? 
primary 'Mazzetti, C.'    8  ? 
primary 'Guglierame, P.'  9  ? 
primary 'Candiani, G.'    10 ? 
primary 'Chiriac, A.I.'   11 ? 
primary 'Facchetti, G.'   12 ? 
primary 'Kaltofen, P.'    13 ? 
primary 'Sahl, H.G.'      14 ? 
primary 'Deho, G.'        15 ? 
primary 'Donadio, S.'     16 ? 
primary 'Ebright, R.H.'   17 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   98.360 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5X22 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     186.410 
_cell.length_a_esd                 ? 
_cell.length_b                     104.320 
_cell.length_b_esd                 ? 
_cell.length_c                     297.290 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5X22 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed RNA polymerase subunit alpha'                                         35056.164  4  2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase subunit beta'                                          125436.539 2  2.7.7.6 ? ? ? 
3  polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 2  2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase subunit omega'                                         11533.316  2  2.7.7.6 ? ? ? 
5  polymer     man 'RNA polymerase sigma factor SigA'                                                  50739.371  2  ?       ? ? ? 
6  polymer     syn 'promoter DNA template strand'                                                      6480.172   2  ?       ? ? ? 
7  polymer     syn 'promoter DNA nontemplate strand'                                                   8421.432   2  ?       ? ? ? 
8  polymer     syn 
;RNA (5'-R(*GP*A)-3')
;
629.454    2  ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                                     24.305     12 ?       ? ? ? 
10 non-polymer syn 'ZINC ION'                                                                          65.409     4  ?       ? ? ? 
11 non-polymer syn "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]methyl}phosphoryl]cytidine" 481.184    2  ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
5 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLALEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
;MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLALEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
;
F,P     ? 
6 polydeoxyribonucleotide no no 
;(DC)(DC)(DT)(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)
(DG)
;
CCTGCATCCGTGAGTCGAGGG G,Q     ? 
7 polydeoxyribonucleotide no no 
;(DT)(DA)(DT)(DA)(DA)(DT)(DG)(DG)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)(DA)(DG)(DG)
;
TATAATGGGAGCTGTCACGGATGCAGG H,R     ? 
8 polyribonucleotide      no no GA GA I,S     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    MET n 
5 2    GLY n 
5 3    SER n 
5 4    SER n 
5 5    HIS n 
5 6    HIS n 
5 7    HIS n 
5 8    HIS n 
5 9    HIS n 
5 10   HIS n 
5 11   SER n 
5 12   SER n 
5 13   GLY n 
5 14   LEU n 
5 15   VAL n 
5 16   PRO n 
5 17   ARG n 
5 18   GLY n 
5 19   SER n 
5 20   HIS n 
5 21   MET n 
5 22   LYS n 
5 23   LYS n 
5 24   SER n 
5 25   LYS n 
5 26   ARG n 
5 27   LYS n 
5 28   ASN n 
5 29   ALA n 
5 30   GLN n 
5 31   ALA n 
5 32   GLN n 
5 33   GLU n 
5 34   ALA n 
5 35   GLN n 
5 36   GLU n 
5 37   THR n 
5 38   GLU n 
5 39   VAL n 
5 40   LEU n 
5 41   VAL n 
5 42   GLN n 
5 43   GLU n 
5 44   GLU n 
5 45   ALA n 
5 46   GLU n 
5 47   GLU n 
5 48   LEU n 
5 49   PRO n 
5 50   GLU n 
5 51   PHE n 
5 52   PRO n 
5 53   GLU n 
5 54   GLY n 
5 55   GLU n 
5 56   PRO n 
5 57   ASP n 
5 58   PRO n 
5 59   ASP n 
5 60   LEU n 
5 61   GLU n 
5 62   ASP n 
5 63   PRO n 
5 64   ASP n 
5 65   LEU n 
5 66   ALA n 
5 67   LEU n 
5 68   GLU n 
5 69   ASP n 
5 70   ASP n 
5 71   LEU n 
5 72   LEU n 
5 73   ASP n 
5 74   LEU n 
5 75   PRO n 
5 76   GLU n 
5 77   GLU n 
5 78   GLY n 
5 79   GLU n 
5 80   GLY n 
5 81   LEU n 
5 82   ASP n 
5 83   LEU n 
5 84   GLU n 
5 85   GLU n 
5 86   GLU n 
5 87   GLU n 
5 88   GLU n 
5 89   ASP n 
5 90   LEU n 
5 91   PRO n 
5 92   ILE n 
5 93   PRO n 
5 94   LYS n 
5 95   ILE n 
5 96   SER n 
5 97   THR n 
5 98   SER n 
5 99   ASP n 
5 100  PRO n 
5 101  VAL n 
5 102  ARG n 
5 103  GLN n 
5 104  TYR n 
5 105  LEU n 
5 106  HIS n 
5 107  GLU n 
5 108  ILE n 
5 109  GLY n 
5 110  GLN n 
5 111  VAL n 
5 112  PRO n 
5 113  LEU n 
5 114  LEU n 
5 115  THR n 
5 116  LEU n 
5 117  GLU n 
5 118  GLU n 
5 119  GLU n 
5 120  VAL n 
5 121  GLU n 
5 122  LEU n 
5 123  ALA n 
5 124  ARG n 
5 125  LYS n 
5 126  VAL n 
5 127  GLU n 
5 128  GLU n 
5 129  GLY n 
5 130  MET n 
5 131  GLU n 
5 132  ALA n 
5 133  ILE n 
5 134  LYS n 
5 135  LYS n 
5 136  LEU n 
5 137  SER n 
5 138  GLU n 
5 139  ILE n 
5 140  THR n 
5 141  GLY n 
5 142  LEU n 
5 143  ASP n 
5 144  PRO n 
5 145  ASP n 
5 146  LEU n 
5 147  ILE n 
5 148  ARG n 
5 149  GLU n 
5 150  VAL n 
5 151  VAL n 
5 152  ARG n 
5 153  ALA n 
5 154  LYS n 
5 155  ILE n 
5 156  LEU n 
5 157  GLY n 
5 158  SER n 
5 159  ALA n 
5 160  ARG n 
5 161  VAL n 
5 162  ARG n 
5 163  HIS n 
5 164  ILE n 
5 165  PRO n 
5 166  GLY n 
5 167  LEU n 
5 168  LYS n 
5 169  GLU n 
5 170  THR n 
5 171  LEU n 
5 172  ASP n 
5 173  PRO n 
5 174  LYS n 
5 175  THR n 
5 176  VAL n 
5 177  GLU n 
5 178  GLU n 
5 179  ILE n 
5 180  ASP n 
5 181  GLN n 
5 182  LYS n 
5 183  LEU n 
5 184  LYS n 
5 185  SER n 
5 186  LEU n 
5 187  PRO n 
5 188  LYS n 
5 189  GLU n 
5 190  HIS n 
5 191  LYS n 
5 192  ARG n 
5 193  TYR n 
5 194  LEU n 
5 195  HIS n 
5 196  ILE n 
5 197  ALA n 
5 198  ARG n 
5 199  GLU n 
5 200  GLY n 
5 201  GLU n 
5 202  ALA n 
5 203  ALA n 
5 204  ARG n 
5 205  GLN n 
5 206  HIS n 
5 207  LEU n 
5 208  ILE n 
5 209  GLU n 
5 210  ALA n 
5 211  ASN n 
5 212  LEU n 
5 213  ARG n 
5 214  LEU n 
5 215  VAL n 
5 216  VAL n 
5 217  SER n 
5 218  ILE n 
5 219  ALA n 
5 220  LYS n 
5 221  LYS n 
5 222  TYR n 
5 223  THR n 
5 224  GLY n 
5 225  ARG n 
5 226  GLY n 
5 227  LEU n 
5 228  SER n 
5 229  PHE n 
5 230  LEU n 
5 231  ASP n 
5 232  LEU n 
5 233  ILE n 
5 234  GLN n 
5 235  GLU n 
5 236  GLY n 
5 237  ASN n 
5 238  GLN n 
5 239  GLY n 
5 240  LEU n 
5 241  ILE n 
5 242  ARG n 
5 243  ALA n 
5 244  VAL n 
5 245  GLU n 
5 246  LYS n 
5 247  PHE n 
5 248  GLU n 
5 249  TYR n 
5 250  LYS n 
5 251  ARG n 
5 252  ARG n 
5 253  PHE n 
5 254  LYS n 
5 255  PHE n 
5 256  SER n 
5 257  THR n 
5 258  TYR n 
5 259  ALA n 
5 260  THR n 
5 261  TRP n 
5 262  TRP n 
5 263  ILE n 
5 264  ARG n 
5 265  GLN n 
5 266  ALA n 
5 267  ILE n 
5 268  ASN n 
5 269  ARG n 
5 270  ALA n 
5 271  ILE n 
5 272  ALA n 
5 273  ASP n 
5 274  GLN n 
5 275  ALA n 
5 276  ARG n 
5 277  THR n 
5 278  ILE n 
5 279  ARG n 
5 280  ILE n 
5 281  PRO n 
5 282  VAL n 
5 283  HIS n 
5 284  MET n 
5 285  VAL n 
5 286  GLU n 
5 287  THR n 
5 288  ILE n 
5 289  ASN n 
5 290  LYS n 
5 291  LEU n 
5 292  SER n 
5 293  ARG n 
5 294  THR n 
5 295  ALA n 
5 296  ARG n 
5 297  GLN n 
5 298  LEU n 
5 299  GLN n 
5 300  GLN n 
5 301  GLU n 
5 302  LEU n 
5 303  GLY n 
5 304  ARG n 
5 305  GLU n 
5 306  PRO n 
5 307  THR n 
5 308  TYR n 
5 309  GLU n 
5 310  GLU n 
5 311  ILE n 
5 312  ALA n 
5 313  GLU n 
5 314  ALA n 
5 315  MET n 
5 316  GLY n 
5 317  PRO n 
5 318  GLY n 
5 319  TRP n 
5 320  ASP n 
5 321  ALA n 
5 322  LYS n 
5 323  ARG n 
5 324  VAL n 
5 325  GLU n 
5 326  GLU n 
5 327  THR n 
5 328  LEU n 
5 329  LYS n 
5 330  ILE n 
5 331  ALA n 
5 332  GLN n 
5 333  GLU n 
5 334  PRO n 
5 335  VAL n 
5 336  SER n 
5 337  LEU n 
5 338  GLU n 
5 339  THR n 
5 340  PRO n 
5 341  ILE n 
5 342  GLY n 
5 343  ASP n 
5 344  GLU n 
5 345  LYS n 
5 346  ASP n 
5 347  SER n 
5 348  PHE n 
5 349  TYR n 
5 350  GLY n 
5 351  ASP n 
5 352  PHE n 
5 353  ILE n 
5 354  PRO n 
5 355  ASP n 
5 356  GLU n 
5 357  HIS n 
5 358  LEU n 
5 359  PRO n 
5 360  SER n 
5 361  PRO n 
5 362  VAL n 
5 363  ASP n 
5 364  ALA n 
5 365  ALA n 
5 366  THR n 
5 367  GLN n 
5 368  SER n 
5 369  LEU n 
5 370  LEU n 
5 371  SER n 
5 372  GLU n 
5 373  GLU n 
5 374  LEU n 
5 375  GLU n 
5 376  LYS n 
5 377  ALA n 
5 378  LEU n 
5 379  SER n 
5 380  LYS n 
5 381  LEU n 
5 382  SER n 
5 383  GLU n 
5 384  ARG n 
5 385  GLU n 
5 386  ALA n 
5 387  MET n 
5 388  VAL n 
5 389  LEU n 
5 390  LYS n 
5 391  LEU n 
5 392  ARG n 
5 393  LYS n 
5 394  GLY n 
5 395  LEU n 
5 396  ILE n 
5 397  ASP n 
5 398  GLY n 
5 399  ARG n 
5 400  GLU n 
5 401  HIS n 
5 402  THR n 
5 403  LEU n 
5 404  GLU n 
5 405  GLU n 
5 406  VAL n 
5 407  GLY n 
5 408  ALA n 
5 409  PHE n 
5 410  PHE n 
5 411  GLY n 
5 412  VAL n 
5 413  THR n 
5 414  ARG n 
5 415  GLU n 
5 416  ARG n 
5 417  ILE n 
5 418  ARG n 
5 419  GLN n 
5 420  ILE n 
5 421  GLU n 
5 422  ASN n 
5 423  LYS n 
5 424  ALA n 
5 425  LEU n 
5 426  ARG n 
5 427  LYS n 
5 428  LEU n 
5 429  LYS n 
5 430  TYR n 
5 431  HIS n 
5 432  GLU n 
5 433  SER n 
5 434  ARG n 
5 435  THR n 
5 436  ARG n 
5 437  LYS n 
5 438  LEU n 
5 439  ARG n 
5 440  ASP n 
5 441  PHE n 
5 442  LEU n 
5 443  ASP n 
6 1    DC  n 
6 2    DC  n 
6 3    DT  n 
6 4    DG  n 
6 5    DC  n 
6 6    DA  n 
6 7    DT  n 
6 8    DC  n 
6 9    DC  n 
6 10   DG  n 
6 11   DT  n 
6 12   DG  n 
6 13   DA  n 
6 14   DG  n 
6 15   DT  n 
6 16   DC  n 
6 17   DG  n 
6 18   DA  n 
6 19   DG  n 
6 20   DG  n 
6 21   DG  n 
7 1    DT  n 
7 2    DA  n 
7 3    DT  n 
7 4    DA  n 
7 5    DA  n 
7 6    DT  n 
7 7    DG  n 
7 8    DG  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
7 25   DA  n 
7 26   DG  n 
7 27   DG  n 
8 1    G   n 
8 2    A   n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 315 ? ? rpoA                   ? ?                                ? ? ? ? 
'Thermus thermophilus'                                         274    ? ? ? ? ? ? ? ? 'Thermus thermophilus' 274    ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ?       ? ? ? ?      ? ? 
5 1 sample 'Biological sequence' 1 443 ? ? 'sigA, rpoD, TT_C0164' ? 'HB27 / ATCC BAA-163 / DSM 7039' ? ? ? ? 
'Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)' 262724 ? ? ? ? ? ? ? ? 'Escherichia coli'     469008 ? ? ? ? ? ? 
'BL21 (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET28a ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)'     300852 ? ? 'HB8 / ATCC 27634 / DSM 579'     ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)'     300852 ? ? 'HB8 / ATCC 27634 / DSM 579'     ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)' 262724 ? ? 'HB27 / ATCC BAA-163 / DSM 7039' ? ? 
? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 21 'Thermus thermophilus' ? 274 ? 
7 1 sample 1 27 'Thermus thermophilus' ? 274 ? 
8 1 sample 1 2  'Thermus thermophilus' ? 274 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THETH Q9Z9H6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8 Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8 Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET2 Q72ID6 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 UNP SIGA_THET2 Q72L95 ? 5 
;MKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLALEDDLLDLPEEGEGLDLEEEEEDLPIPKISTSDP
VRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEID
QKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYAT
WWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETP
IGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQI
ENKALRKLKYHESRTRKLRDFLD
;
1 
6 PDB 5X22       5X22   ? 6 ? 1 
7 PDB 5X22       5X22   ? 7 ? 1 
8 PDB 5X22       5X22   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5X22 A 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
2  1 5X22 B 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
3  2 5X22 C 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
4  3 5X22 D 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
5  4 5X22 E 1  ? 99   ? Q72ID6 1 ? 99   ? 1 99   
6  5 5X22 F 21 ? 443  ? Q72L95 1 ? 423  ? 1 423  
7  6 5X22 G 1  ? 21   ? 5X22   1 ? 21   ? 1 21   
8  7 5X22 H 1  ? 27   ? 5X22   1 ? 27   ? 1 27   
9  8 5X22 I 1  ? 2    ? 5X22   1 ? 2    ? 1 2    
10 1 5X22 K 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
11 1 5X22 L 1  ? 315  ? Q9Z9H6 1 ? 315  ? 1 315  
12 2 5X22 M 1  ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
13 3 5X22 N 1  ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
14 4 5X22 O 1  ? 99   ? Q72ID6 1 ? 99   ? 1 99   
15 5 5X22 P 21 ? 443  ? Q72L95 1 ? 423  ? 1 423  
16 6 5X22 Q 1  ? 21   ? 5X22   1 ? 21   ? 1 21   
17 7 5X22 R 1  ? 27   ? 5X22   1 ? 27   ? 1 27   
18 8 5X22 S 1  ? 2    ? 5X22   1 ? 2    ? 1 2    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
6  5X22 MET F 1  ? UNP Q72L95 ? ? 'initiating methionine' -19 1  
6  5X22 GLY F 2  ? UNP Q72L95 ? ? 'expression tag'        -18 2  
6  5X22 SER F 3  ? UNP Q72L95 ? ? 'expression tag'        -17 3  
6  5X22 SER F 4  ? UNP Q72L95 ? ? 'expression tag'        -16 4  
6  5X22 HIS F 5  ? UNP Q72L95 ? ? 'expression tag'        -15 5  
6  5X22 HIS F 6  ? UNP Q72L95 ? ? 'expression tag'        -14 6  
6  5X22 HIS F 7  ? UNP Q72L95 ? ? 'expression tag'        -13 7  
6  5X22 HIS F 8  ? UNP Q72L95 ? ? 'expression tag'        -12 8  
6  5X22 HIS F 9  ? UNP Q72L95 ? ? 'expression tag'        -11 9  
6  5X22 HIS F 10 ? UNP Q72L95 ? ? 'expression tag'        -10 10 
6  5X22 SER F 11 ? UNP Q72L95 ? ? 'expression tag'        -9  11 
6  5X22 SER F 12 ? UNP Q72L95 ? ? 'expression tag'        -8  12 
6  5X22 GLY F 13 ? UNP Q72L95 ? ? 'expression tag'        -7  13 
6  5X22 LEU F 14 ? UNP Q72L95 ? ? 'expression tag'        -6  14 
6  5X22 VAL F 15 ? UNP Q72L95 ? ? 'expression tag'        -5  15 
6  5X22 PRO F 16 ? UNP Q72L95 ? ? 'expression tag'        -4  16 
6  5X22 ARG F 17 ? UNP Q72L95 ? ? 'expression tag'        -3  17 
6  5X22 GLY F 18 ? UNP Q72L95 ? ? 'expression tag'        -2  18 
6  5X22 SER F 19 ? UNP Q72L95 ? ? 'expression tag'        -1  19 
6  5X22 HIS F 20 ? UNP Q72L95 ? ? 'expression tag'        0   20 
15 5X22 MET P 1  ? UNP Q72L95 ? ? 'initiating methionine' -19 21 
15 5X22 GLY P 2  ? UNP Q72L95 ? ? 'expression tag'        -18 22 
15 5X22 SER P 3  ? UNP Q72L95 ? ? 'expression tag'        -17 23 
15 5X22 SER P 4  ? UNP Q72L95 ? ? 'expression tag'        -16 24 
15 5X22 HIS P 5  ? UNP Q72L95 ? ? 'expression tag'        -15 25 
15 5X22 HIS P 6  ? UNP Q72L95 ? ? 'expression tag'        -14 26 
15 5X22 HIS P 7  ? UNP Q72L95 ? ? 'expression tag'        -13 27 
15 5X22 HIS P 8  ? UNP Q72L95 ? ? 'expression tag'        -12 28 
15 5X22 HIS P 9  ? UNP Q72L95 ? ? 'expression tag'        -11 29 
15 5X22 HIS P 10 ? UNP Q72L95 ? ? 'expression tag'        -10 30 
15 5X22 SER P 11 ? UNP Q72L95 ? ? 'expression tag'        -9  31 
15 5X22 SER P 12 ? UNP Q72L95 ? ? 'expression tag'        -8  32 
15 5X22 GLY P 13 ? UNP Q72L95 ? ? 'expression tag'        -7  33 
15 5X22 LEU P 14 ? UNP Q72L95 ? ? 'expression tag'        -6  34 
15 5X22 VAL P 15 ? UNP Q72L95 ? ? 'expression tag'        -5  35 
15 5X22 PRO P 16 ? UNP Q72L95 ? ? 'expression tag'        -4  36 
15 5X22 ARG P 17 ? UNP Q72L95 ? ? 'expression tag'        -3  37 
15 5X22 GLY P 18 ? UNP Q72L95 ? ? 'expression tag'        -2  38 
15 5X22 SER P 19 ? UNP Q72L95 ? ? 'expression tag'        -1  39 
15 5X22 HIS P 20 ? UNP Q72L95 ? ? 'expression tag'        0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2TM non-polymer         . "5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]methyl}phosphoryl]cytidine" CMPcPP 
'C10 H18 N3 O13 P3' 481.184 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                                                        ?      
'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                                                             ?      'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                            ?      
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                          ?      'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                     ?      'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                            ?      
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                ?      
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                 ?      
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                ?      
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                        ?      
'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                                                        ?      
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                                                           ?      
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                     ?      'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                             ?      'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                           ?      
'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                          ?      'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                             ?      'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                              ?      
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                          ?      
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                     ?      'Mg 2' 24.305 
PHE 'L-peptide linking' y PHENYLALANINE                                                                       ?      'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                             ?      'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                              ?      'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                           ?      'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                          ?      
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                            ?      'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                              ?      'C5 H11 N O2' 
117.146 
ZN  non-polymer         . 'ZINC ION'                                                                          ?      'Zn 2' 65.409 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5X22 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.81 
_exptl_crystal.description                 rod 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris-HCl, pH 8.7, 200 mM potassium chloride, 50 mM magnesium chloride, 10% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-04-02 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_synchrotron_site       CHESS 
# 
_reflns.B_iso_Wilson_estimate            66.480 
_reflns.entry_id                         5X22 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.3330 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       158249 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.300 
_reflns.pdbx_Rmerge_I_obs                0.197 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         7.656 
_reflns.pdbx_netI_over_sigmaI            7.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.068 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.350 3.410  ? ? ? ? ? ? ? 89.100  ? ? ? ? ?     ? ? ? ? ? ? ? ? 5.300 ? 0.950 ? ? ? ? ? 1  1 ? ? 
3.410 3.470  ? ? ? ? ? ? ? 89.900  ? ? ? ? 0.877 ? ? ? ? ? ? ? ? 5.300 ? 0.975 ? ? ? ? ? 2  1 ? ? 
3.470 3.540  ? ? ? ? ? ? ? 90.000  ? ? ? ? 0.762 ? ? ? ? ? ? ? ? 5.300 ? 0.979 ? ? ? ? ? 3  1 ? ? 
3.540 3.610  ? ? ? ? ? ? ? 89.800  ? ? ? ? 0.649 ? ? ? ? ? ? ? ? 5.300 ? 1.000 ? ? ? ? ? 4  1 ? ? 
3.610 3.690  ? ? ? ? ? ? ? 91.000  ? ? ? ? 0.538 ? ? ? ? ? ? ? ? 5.300 ? 1.013 ? ? ? ? ? 5  1 ? ? 
3.690 3.770  ? ? ? ? ? ? ? 90.900  ? ? ? ? 0.438 ? ? ? ? ? ? ? ? 5.300 ? 1.016 ? ? ? ? ? 6  1 ? ? 
3.770 3.870  ? ? ? ? ? ? ? 92.400  ? ? ? ? 0.402 ? ? ? ? ? ? ? ? 5.200 ? 1.046 ? ? ? ? ? 7  1 ? ? 
3.870 3.970  ? ? ? ? ? ? ? 93.400  ? ? ? ? 0.330 ? ? ? ? ? ? ? ? 5.200 ? 1.076 ? ? ? ? ? 8  1 ? ? 
3.970 4.090  ? ? ? ? ? ? ? 94.600  ? ? ? ? 0.277 ? ? ? ? ? ? ? ? 5.200 ? 1.096 ? ? ? ? ? 9  1 ? ? 
4.090 4.220  ? ? ? ? ? ? ? 96.000  ? ? ? ? 0.241 ? ? ? ? ? ? ? ? 5.200 ? 1.114 ? ? ? ? ? 10 1 ? ? 
4.220 4.370  ? ? ? ? ? ? ? 97.500  ? ? ? ? 0.208 ? ? ? ? ? ? ? ? 5.100 ? 1.119 ? ? ? ? ? 11 1 ? ? 
4.370 4.550  ? ? ? ? ? ? ? 98.800  ? ? ? ? 0.188 ? ? ? ? ? ? ? ? 5.200 ? 1.134 ? ? ? ? ? 12 1 ? ? 
4.550 4.750  ? ? ? ? ? ? ? 99.200  ? ? ? ? 0.178 ? ? ? ? ? ? ? ? 5.300 ? 1.161 ? ? ? ? ? 13 1 ? ? 
4.750 5.000  ? ? ? ? ? ? ? 99.500  ? ? ? ? 0.170 ? ? ? ? ? ? ? ? 5.400 ? 1.151 ? ? ? ? ? 14 1 ? ? 
5.000 5.320  ? ? ? ? ? ? ? 99.900  ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 5.500 ? 1.119 ? ? ? ? ? 15 1 ? ? 
5.320 5.730  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.170 ? ? ? ? ? ? ? ? 5.600 ? 1.132 ? ? ? ? ? 16 1 ? ? 
5.730 6.300  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.163 ? ? ? ? ? ? ? ? 5.600 ? 1.120 ? ? ? ? ? 17 1 ? ? 
6.300 7.210  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.147 ? ? ? ? ? ? ? ? 5.600 ? 1.074 ? ? ? ? ? 18 1 ? ? 
7.210 9.080  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 5.600 ? 1.020 ? ? ? ? ? 19 1 ? ? 
9.080 50.000 ? ? ? ? ? ? ? 99.400  ? ? ? ? 0.120 ? ? ? ? ? ? ? ? 5.400 ? 1.033 ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                182.030 
_refine.B_iso_mean                               41.9200 
_refine.B_iso_min                                3.790 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5X22 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.350 
_refine.ls_d_res_low                             49.0220 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     147764 
_refine.ls_number_reflns_R_free                  7382 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    89.2600 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2100 
_refine.ls_R_factor_R_free                       0.2503 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2079 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4G7H 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.3900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4100 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.350 
_refine_hist.d_res_low                        49.0220 
_refine_hist.pdbx_number_atoms_ligand         218 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               57005 
_refine_hist.pdbx_number_residues_total       7024 
_refine_hist.pdbx_B_iso_mean_ligand           18.85 
_refine_hist.pdbx_number_atoms_protein        54818 
_refine_hist.pdbx_number_atoms_nucleic_acid   1969 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 58116 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.761  ? 78958 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.058  ? 8890  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 10008 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.339 ? 22560 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.35    3.3709  . . 29  485  9.0000   . . . 0.3352 . 0.2810 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3709  3.4106  . . 75  1516 30.0000  . . . 0.3292 . 0.2778 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4106  3.4522  . . 143 2906 55.0000  . . . 0.2942 . 0.2882 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4522  3.4959  . . 211 3981 77.0000  . . . 0.3426 . 0.2869 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4959  3.5419  . . 249 4671 90.0000  . . . 0.3548 . 0.2728 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5419  3.5904  . . 252 4724 90.0000  . . . 0.3183 . 0.2602 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5904  3.6416  . . 252 4641 91.0000  . . . 0.3206 . 0.2615 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6416  3.6960  . . 250 4772 91.0000  . . . 0.2995 . 0.2524 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6960  3.7537  . . 255 4768 91.0000  . . . 0.2767 . 0.2506 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7537  3.8152  . . 244 4809 92.0000  . . . 0.3012 . 0.2529 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8152  3.8810  . . 253 4824 92.0000  . . . 0.3066 . 0.2369 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8810  3.9515  . . 261 4859 94.0000  . . . 0.2795 . 0.2294 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9515  4.0275  . . 263 4947 94.0000  . . . 0.2847 . 0.2203 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0275  4.1097  . . 261 4938 95.0000  . . . 0.2596 . 0.2140 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1097  4.1990  . . 263 5065 96.0000  . . . 0.2652 . 0.2082 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1990  4.2966  . . 266 5061 97.0000  . . . 0.2251 . 0.2078 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2966  4.4040  . . 269 5139 98.0000  . . . 0.2505 . 0.1963 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4040  4.5230  . . 273 5201 99.0000  . . . 0.2381 . 0.1919 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5230  4.6560  . . 271 5182 99.0000  . . . 0.2309 . 0.1891 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6560  4.8061  . . 273 5178 99.0000  . . . 0.2235 . 0.1899 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8061  4.9777  . . 277 5284 100.0000 . . . 0.2456 . 0.1863 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9777  5.1768  . . 274 5213 100.0000 . . . 0.2425 . 0.1878 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1768  5.4122  . . 274 5204 100.0000 . . . 0.2213 . 0.1901 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4122  5.6971  . . 278 5277 100.0000 . . . 0.2195 . 0.1973 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.6971  6.0534  . . 277 5276 100.0000 . . . 0.2595 . 0.2007 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.0534  6.5198  . . 279 5274 100.0000 . . . 0.2167 . 0.2002 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.5198  7.1741  . . 278 5289 100.0000 . . . 0.2386 . 0.1898 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.1741  8.2081  . . 279 5297 100.0000 . . . 0.1932 . 0.1685 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.2081  10.3254 . . 280 5336 100.0000 . . . 0.1954 . 0.1560 . . . . . . . . . . 
'X-RAY DIFFRACTION' 10.3254 49.022  . . 273 5265 96.0000  . . . 0.2250 . 0.2053 . . . . . . . . . . 
# 
_struct.entry_id                     5X22 
_struct.title                        
'Crystal structure of Thermus thermophilus transcription initiation complex with GpA and CMPcPP' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega, RNA polymerase sigma factor SigA/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5X22 
_struct_keywords.text            'Transcription, RNA polymerase, primer-dependent initiation, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 6  ? 
H  N N 7  ? 
I  N N 8  ? 
J  N N 1  ? 
K  N N 1  ? 
L  N N 2  ? 
M  N N 3  ? 
N  N N 4  ? 
O  N N 5  ? 
P  N N 6  ? 
Q  N N 7  ? 
R  N N 8  ? 
S  N N 9  ? 
T  N N 10 ? 
U  N N 10 ? 
V  N N 9  ? 
W  N N 9  ? 
X  N N 9  ? 
Y  N N 9  ? 
Z  N N 11 ? 
AA N N 9  ? 
BA N N 9  ? 
CA N N 10 ? 
DA N N 10 ? 
EA N N 9  ? 
FA N N 9  ? 
GA N N 9  ? 
HA N N 9  ? 
IA N N 11 ? 
JA N N 9  ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? GLU A 84   ? ASP A 74   GLU A 84   1 ? 11 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? THR A 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   AA6 TYR A 224  ? SER A 226  ? TYR A 224  SER A 226  5 ? 3  
HELX_P HELX_P7   AA7 GLY B 31   ? SER B 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P8   AA8 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P9   AA9 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P10  AB1 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P11  AB2 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P12  AB3 TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P13  AB4 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P14  AB5 GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P15  AB6 PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P16  AB7 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  AB8 ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P18  AB9 GLU C 216  ? LEU C 221  ? GLU C 216  LEU C 221  1 ? 6  
HELX_P HELX_P19  AC1 ASP C 223  ? ALA C 228  ? ASP C 223  ALA C 228  1 ? 6  
HELX_P HELX_P20  AC2 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  AC3 LYS C 249  ? ALA C 262  ? LYS C 249  ALA C 262  1 ? 14 
HELX_P HELX_P22  AC4 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P23  AC5 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P24  AC6 THR C 335  ? MET C 361  ? THR C 335  MET C 361  1 ? 27 
HELX_P HELX_P25  AC7 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P26  AC8 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 399  ? ARG C 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P28  AD1 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P29  AD2 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P30  AD3 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P31  AD4 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P32  AD5 SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P33  AD6 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P34  AD7 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P35  AD8 ASP C 554  ? GLN C 565  ? ASP C 554  GLN C 565  1 ? 12 
HELX_P HELX_P36  AD9 LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P37  AE1 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P38  AE2 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  1 ? 6  
HELX_P HELX_P39  AE3 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P40  AE4 ASN C 872  ? LEU C 874  ? ASN C 872  LEU C 874  5 ? 3  
HELX_P HELX_P41  AE5 GLY C 875  ? MET C 880  ? GLY C 875  MET C 880  1 ? 6  
HELX_P HELX_P42  AE6 LEU C 882  ? LEU C 897  ? LEU C 882  LEU C 897  1 ? 16 
HELX_P HELX_P43  AE7 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P44  AE8 ASP C 937  ? LEU C 950  ? ASP C 937  LEU C 950  1 ? 14 
HELX_P HELX_P45  AE9 THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P46  AF1 MET C 1000 ? MET C 1005 ? MET C 1000 MET C 1005 1 ? 6  
HELX_P HELX_P47  AF2 GLY C 1033 ? GLY C 1044 ? GLY C 1033 GLY C 1044 1 ? 12 
HELX_P HELX_P48  AF3 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P49  AF4 ASP C 1059 ? LYS C 1072 ? ASP C 1059 LYS C 1072 1 ? 14 
HELX_P HELX_P50  AF5 PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P51  AF6 SER D 14   ? SER D 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P52  AF7 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P53  AF8 ILE D 102  ? VAL D 105  ? ILE D 102  VAL D 105  5 ? 4  
HELX_P HELX_P54  AF9 SER D 110  ? LEU D 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P55  AG1 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P56  AG2 THR D 154  ? GLY D 164  ? THR D 154  GLY D 164  1 ? 11 
HELX_P HELX_P57  AG3 ASP D 372  ? GLU D 376  ? ASP D 372  GLU D 376  5 ? 5  
HELX_P HELX_P58  AG4 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P59  AG5 MET D 456  ? GLU D 467  ? MET D 456  GLU D 467  1 ? 12 
HELX_P HELX_P60  AG6 ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P61  AG7 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P62  AG8 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P63  AG9 SER D 538  ? GLN D 560  ? SER D 538  GLN D 560  1 ? 23 
HELX_P HELX_P64  AH1 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P65  AH2 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P66  AH3 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P67  AH4 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P68  AH5 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P69  AH6 ASN D 669  ? LEU D 677  ? ASN D 669  LEU D 677  1 ? 9  
HELX_P HELX_P70  AH7 ARG D 679  ? ILE D 683  ? ARG D 679  ILE D 683  5 ? 5  
HELX_P HELX_P71  AH8 ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P72  AH9 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P73  AI1 HIS D 729  ? LEU D 731  ? HIS D 729  LEU D 731  5 ? 3  
HELX_P HELX_P74  AI2 VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P75  AI3 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P76  AI4 ARG D 783  ? GLN D 794  ? ARG D 783  GLN D 794  1 ? 12 
HELX_P HELX_P77  AI5 THR D 808  ? ARG D 818  ? THR D 808  ARG D 818  1 ? 11 
HELX_P HELX_P78  AI6 SER D 835  ? TYR D 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P79  AI7 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P80  AI8 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P81  AI9 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P82  AJ1 GLU D 907  ? GLY D 946  ? GLU D 907  GLY D 946  1 ? 40 
HELX_P HELX_P83  AJ2 ASN D 1018 ? GLY D 1027 ? ASN D 1018 GLY D 1027 1 ? 10 
HELX_P HELX_P84  AJ3 ASN D 1031 ? CYS D 1039 ? ASN D 1031 CYS D 1039 1 ? 9  
HELX_P HELX_P85  AJ4 THR D 1066 ? HIS D 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P86  AJ5 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P87  AJ6 SER D 1167 ? GLY D 1181 ? SER D 1167 GLY D 1181 1 ? 15 
HELX_P HELX_P88  AJ7 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P89  AJ8 ALA D 1220 ? MET D 1238 ? ALA D 1220 MET D 1238 1 ? 19 
HELX_P HELX_P90  AJ9 ASP D 1251 ? GLU D 1264 ? ASP D 1251 GLU D 1264 1 ? 14 
HELX_P HELX_P91  AK1 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P92  AK2 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P93  AK3 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P94  AK4 LYS D 1397 ? GLU D 1410 ? LYS D 1397 GLU D 1410 1 ? 14 
HELX_P HELX_P95  AK5 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P96  AK6 SER D 1433 ? ALA D 1438 ? SER D 1433 ALA D 1438 1 ? 6  
HELX_P HELX_P97  AK7 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P98  AK8 GLY D 1461 ? LEU D 1468 ? GLY D 1461 LEU D 1468 1 ? 8  
HELX_P HELX_P99  AK9 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P100 AL1 GLN D 1489 ? ALA D 1502 ? GLN D 1489 ALA D 1502 1 ? 14 
HELX_P HELX_P101 AL2 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P102 AL3 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P103 AL4 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P104 AL5 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
HELX_P HELX_P105 AL6 ASP F 99   ? GLY F 109  ? ASP F 79   GLY F 89   1 ? 11 
HELX_P HELX_P106 AL7 THR F 115  ? GLY F 141  ? THR F 95   GLY F 121  1 ? 27 
HELX_P HELX_P107 AL8 ASP F 143  ? GLY F 157  ? ASP F 123  GLY F 137  1 ? 15 
HELX_P HELX_P108 AL9 ASP F 172  ? SER F 185  ? ASP F 152  SER F 165  1 ? 14 
HELX_P HELX_P109 AM1 PRO F 187  ? ASN F 211  ? PRO F 167  ASN F 191  1 ? 25 
HELX_P HELX_P110 AM2 ASN F 211  ? LYS F 220  ? ASN F 191  LYS F 200  1 ? 10 
HELX_P HELX_P111 AM3 SER F 228  ? PHE F 247  ? SER F 208  PHE F 227  1 ? 20 
HELX_P HELX_P112 AM4 GLU F 248  ? ARG F 252  ? GLU F 228  ARG F 232  5 ? 5  
HELX_P HELX_P113 AM5 LYS F 254  ? ALA F 275  ? LYS F 234  ALA F 255  1 ? 22 
HELX_P HELX_P114 AM6 PRO F 281  ? GLY F 303  ? PRO F 261  GLY F 283  1 ? 23 
HELX_P HELX_P115 AM7 THR F 307  ? GLY F 316  ? THR F 287  GLY F 296  1 ? 10 
HELX_P HELX_P116 AM8 ASP F 320  ? ALA F 331  ? ASP F 300  ALA F 311  1 ? 12 
HELX_P HELX_P117 AM9 GLY F 350  ? ILE F 353  ? GLY F 330  ILE F 333  5 ? 4  
HELX_P HELX_P118 AN1 SER F 360  ? ALA F 377  ? SER F 340  ALA F 357  1 ? 18 
HELX_P HELX_P119 AN2 SER F 382  ? LYS F 393  ? SER F 362  LYS F 373  1 ? 12 
HELX_P HELX_P120 AN3 ILE F 420  ? ARG F 436  ? ILE F 400  ARG F 416  1 ? 17 
HELX_P HELX_P121 AN4 LYS F 437  ? ASP F 443  ? LYS F 417  ASP F 423  5 ? 7  
HELX_P HELX_P122 AN5 GLY J 31   ? SER J 47   ? GLY K 31   SER K 47   1 ? 17 
HELX_P HELX_P123 AN6 ASP J 74   ? LYS J 83   ? ASP K 74   LYS K 83   1 ? 10 
HELX_P HELX_P124 AN7 ARG J 112  ? PHE J 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P125 AN8 PRO J 152  ? GLY J 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P126 AN9 THR J 206  ? TYR J 224  ? THR K 206  TYR K 224  1 ? 19 
HELX_P HELX_P127 AO1 GLY K 31   ? SER K 47   ? GLY L 31   SER L 47   1 ? 17 
HELX_P HELX_P128 AO2 ASP K 74   ? GLU K 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P129 AO3 PRO K 152  ? GLY K 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P130 AO4 THR K 206  ? THR K 223  ? THR L 206  THR L 223  1 ? 18 
HELX_P HELX_P131 AO5 TYR K 224  ? SER K 226  ? TYR L 224  SER L 226  5 ? 3  
HELX_P HELX_P132 AO6 THR L 19   ? GLN L 31   ? THR M 19   GLN M 31   1 ? 13 
HELX_P HELX_P133 AO7 PRO L 35   ? ARG L 39   ? PRO M 35   ARG M 39   5 ? 5  
HELX_P HELX_P134 AO8 GLY L 43   ? PHE L 52   ? GLY M 43   PHE M 52   1 ? 10 
HELX_P HELX_P135 AO9 PRO L 79   ? ASP L 87   ? PRO M 79   ASP M 87   1 ? 9  
HELX_P HELX_P136 AP1 LEU L 193  ? LEU L 200  ? LEU M 193  LEU M 200  1 ? 8  
HELX_P HELX_P137 AP2 ASP L 203  ? GLY L 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P138 AP3 LEU L 217  ? LEU L 221  ? LEU M 217  LEU M 221  5 ? 5  
HELX_P HELX_P139 AP4 ASP L 223  ? ALA L 228  ? ASP M 223  ALA M 228  1 ? 6  
HELX_P HELX_P140 AP5 ARG L 230  ? ARG L 243  ? ARG M 230  ARG M 243  1 ? 14 
HELX_P HELX_P141 AP6 LYS L 249  ? ALA L 262  ? LYS M 249  ALA M 262  1 ? 14 
HELX_P HELX_P142 AP7 GLY L 270  ? GLY L 282  ? GLY M 270  GLY M 282  1 ? 13 
HELX_P HELX_P143 AP8 VAL L 302  ? GLY L 316  ? VAL M 302  GLY M 316  1 ? 15 
HELX_P HELX_P144 AP9 THR L 335  ? MET L 361  ? THR M 335  MET M 361  1 ? 27 
HELX_P HELX_P145 AQ1 THR L 368  ? VAL L 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P146 AQ2 SER L 375  ? SER L 389  ? SER M 375  SER M 389  1 ? 15 
HELX_P HELX_P147 AQ3 ASN L 399  ? ARG L 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P148 AQ4 GLY L 424  ? ASP L 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P149 AQ5 HIS L 431  ? TYR L 435  ? HIS M 431  TYR M 435  5 ? 5  
HELX_P HELX_P150 AQ6 THR L 487  ? ASP L 492  ? THR M 487  ASP M 492  1 ? 6  
HELX_P HELX_P151 AQ7 SER L 535  ? PHE L 540  ? SER M 535  PHE M 540  5 ? 6  
HELX_P HELX_P152 AQ8 ASN L 543  ? ILE L 547  ? ASN M 543  ILE M 547  5 ? 5  
HELX_P HELX_P153 AQ9 PHE L 549  ? ASP L 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P154 AR1 ASP L 554  ? GLN L 565  ? ASP M 554  GLN M 565  1 ? 12 
HELX_P HELX_P155 AR2 LEU L 583  ? SER L 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P156 AR3 GLU L 692  ? ARG L 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P157 AR4 SER L 730  ? ARG L 735  ? SER M 730  ARG M 735  1 ? 6  
HELX_P HELX_P158 AR5 THR L 768  ? GLY L 779  ? THR M 768  GLY M 779  1 ? 12 
HELX_P HELX_P159 AR6 ASN L 872  ? LEU L 874  ? ASN M 872  LEU M 874  5 ? 3  
HELX_P HELX_P160 AR7 GLY L 875  ? MET L 880  ? GLY M 875  MET M 880  1 ? 6  
HELX_P HELX_P161 AR8 LEU L 882  ? LEU L 897  ? LEU M 882  LEU M 897  1 ? 16 
HELX_P HELX_P162 AR9 LYS L 910  ? GLU L 932  ? LYS M 910  GLU M 932  1 ? 23 
HELX_P HELX_P163 AS1 ASP L 937  ? GLY L 951  ? ASP M 937  GLY M 951  1 ? 15 
HELX_P HELX_P164 AS2 THR L 958  ? LEU L 968  ? THR M 958  LEU M 968  1 ? 11 
HELX_P HELX_P165 AS3 MET L 1000 ? MET L 1005 ? MET M 1000 MET M 1005 1 ? 6  
HELX_P HELX_P166 AS4 GLY L 1033 ? GLY L 1044 ? GLY M 1033 GLY M 1044 1 ? 12 
HELX_P HELX_P167 AS5 ALA L 1045 ? THR L 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P168 AS6 ASP L 1059 ? GLY L 1073 ? ASP M 1059 GLY M 1073 1 ? 15 
HELX_P HELX_P169 AS7 PRO L 1082 ? LEU L 1095 ? PRO M 1082 LEU M 1095 1 ? 14 
HELX_P HELX_P170 AS8 SER M 14   ? TRP M 21   ? SER N 14   TRP N 21   1 ? 8  
HELX_P HELX_P171 AS9 ASP M 46   ? GLY M 51   ? ASP N 46   GLY N 51   1 ? 6  
HELX_P HELX_P172 AT1 ARG M 65   ? GLU M 69   ? ARG N 65   GLU N 69   5 ? 5  
HELX_P HELX_P173 AT2 LYS M 82   ? TYR M 88   ? LYS N 82   TYR N 88   5 ? 7  
HELX_P HELX_P174 AT3 ILE M 102  ? ASP M 107  ? ILE N 102  ASP N 107  1 ? 6  
HELX_P HELX_P175 AT4 SER M 110  ? ASP M 117  ? SER N 110  ASP N 117  1 ? 8  
HELX_P HELX_P176 AT5 SER M 119  ? TYR M 128  ? SER N 119  TYR N 128  1 ? 10 
HELX_P HELX_P177 AT6 THR M 154  ? GLY M 164  ? THR N 154  GLY N 164  1 ? 11 
HELX_P HELX_P178 AT7 ASP M 372  ? GLU M 376  ? ASP N 372  GLU N 376  5 ? 5  
HELX_P HELX_P179 AT8 ASP M 423  ? LYS M 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P180 AT9 GLY M 457  ? GLU M 467  ? GLY N 457  GLU N 467  1 ? 11 
HELX_P HELX_P181 AU1 ASP M 469  ? MET M 481  ? ASP N 469  MET N 481  1 ? 13 
HELX_P HELX_P182 AU2 SER M 485  ? GLY M 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P183 AU3 ARG M 508  ? TRP M 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P184 AU4 PRO M 521  ? ARG M 525  ? PRO N 521  ARG N 525  5 ? 5  
HELX_P HELX_P185 AU5 SER M 538  ? GLN M 560  ? SER N 538  GLN N 560  1 ? 23 
HELX_P HELX_P186 AU6 PRO M 563  ? ASP M 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P187 AU7 SER M 602  ? SER M 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P188 AU8 GLY M 612  ? LEU M 618  ? GLY N 612  LEU N 618  1 ? 7  
HELX_P HELX_P189 AU9 LYS M 646  ? PHE M 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P190 AV1 PHE M 653  ? LYS M 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P191 AV2 ASN M 669  ? ARG M 679  ? ASN N 669  ARG N 679  1 ? 11 
HELX_P HELX_P192 AV3 GLN M 680  ? ILE M 683  ? GLN N 680  ILE N 683  5 ? 4  
HELX_P HELX_P193 AV4 LYS M 684  ? ILE M 695  ? LYS N 684  ILE N 695  1 ? 12 
HELX_P HELX_P194 AV5 HIS M 709  ? LEU M 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P195 AV6 VAL M 732  ? ASN M 737  ? VAL N 732  ASN N 737  1 ? 6  
HELX_P HELX_P196 AV7 SER M 752  ? GLN M 762  ? SER N 752  GLN N 762  1 ? 11 
HELX_P HELX_P197 AV8 LEU M 764  ? ASN M 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P198 AV9 ARG M 783  ? GLN M 794  ? ARG N 783  GLN N 794  1 ? 12 
HELX_P HELX_P199 AW1 THR M 808  ? ARG M 818  ? THR N 808  ARG N 818  1 ? 11 
HELX_P HELX_P200 AW2 VAL M 836  ? TYR M 841  ? VAL N 836  TYR N 841  1 ? 6  
HELX_P HELX_P201 AW3 ASN M 845  ? HIS M 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P202 AW4 SER M 876  ? GLU M 891  ? SER N 876  GLU N 891  1 ? 16 
HELX_P HELX_P203 AW5 ASP M 892  ? ILE M 900  ? ASP N 892  ILE N 900  1 ? 9  
HELX_P HELX_P204 AW6 GLU M 907  ? GLY M 946  ? GLU N 907  GLY N 946  1 ? 40 
HELX_P HELX_P205 AW7 GLU M 958  ? MET M 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P206 AW8 THR M 984  ? ASN M 1014 ? THR N 984  ASN N 1014 1 ? 31 
HELX_P HELX_P207 AW9 ASN M 1018 ? SER M 1026 ? ASN N 1018 SER N 1026 1 ? 9  
HELX_P HELX_P208 AX1 ASN M 1031 ? GLY M 1040 ? ASN N 1031 GLY N 1040 1 ? 10 
HELX_P HELX_P209 AX2 THR M 1066 ? HIS M 1103 ? THR N 1066 HIS N 1103 1 ? 38 
HELX_P HELX_P210 AX3 LYS M 1136 ? TYR M 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P211 AX4 SER M 1167 ? ALA M 1180 ? SER N 1167 ALA N 1180 1 ? 14 
HELX_P HELX_P212 AX5 GLN M 1202 ? GLY M 1206 ? GLN N 1202 GLY N 1206 1 ? 5  
HELX_P HELX_P213 AX6 ALA M 1220 ? MET M 1238 ? ALA N 1220 MET N 1238 1 ? 19 
HELX_P HELX_P214 AX7 ASP M 1251 ? GLU M 1264 ? ASP N 1251 GLU N 1264 1 ? 14 
HELX_P HELX_P215 AX8 ASP M 1331 ? LYS M 1339 ? ASP N 1331 LYS N 1339 1 ? 9  
HELX_P HELX_P216 AX9 GLY M 1340 ? GLN M 1359 ? GLY N 1340 GLN N 1359 1 ? 20 
HELX_P HELX_P217 AY1 HIS M 1364 ? MET M 1376 ? HIS N 1364 MET N 1376 1 ? 13 
HELX_P HELX_P218 AY2 LYS M 1397 ? GLY M 1411 ? LYS N 1397 GLY N 1411 1 ? 15 
HELX_P HELX_P219 AY3 GLY M 1423 ? SER M 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P220 AY4 SER M 1433 ? SER M 1439 ? SER N 1433 SER N 1439 1 ? 7  
HELX_P HELX_P221 AY5 ASN M 1442 ? GLY M 1454 ? ASN N 1442 GLY N 1454 1 ? 13 
HELX_P HELX_P222 AY6 GLY M 1461 ? GLY M 1469 ? GLY N 1461 GLY N 1469 1 ? 9  
HELX_P HELX_P223 AY7 ALA M 1474 ? SER M 1478 ? ALA N 1474 SER N 1478 5 ? 5  
HELX_P HELX_P224 AY8 GLN M 1489 ? LYS M 1500 ? GLN N 1489 LYS N 1500 1 ? 12 
HELX_P HELX_P225 AY9 GLY N 5    ? VAL N 13   ? GLY O 5    VAL O 13   1 ? 9  
HELX_P HELX_P226 AZ1 SER N 15   ? HIS N 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P227 AZ2 ASN N 59   ? GLY N 71   ? ASN O 59   GLY O 71   1 ? 13 
HELX_P HELX_P228 AZ3 PRO N 81   ? TYR N 93   ? PRO O 81   TYR O 93   1 ? 13 
HELX_P HELX_P229 AZ4 ASP O 99   ? GLN O 110  ? ASP P 79   GLN P 90   1 ? 12 
HELX_P HELX_P230 AZ5 THR O 115  ? GLY O 141  ? THR P 95   GLY P 121  1 ? 27 
HELX_P HELX_P231 AZ6 ASP O 143  ? GLY O 157  ? ASP P 123  GLY P 137  1 ? 15 
HELX_P HELX_P232 AZ7 ASP O 172  ? LYS O 184  ? ASP P 152  LYS P 164  1 ? 13 
HELX_P HELX_P233 AZ8 PRO O 187  ? ASN O 211  ? PRO P 167  ASN P 191  1 ? 25 
HELX_P HELX_P234 AZ9 ASN O 211  ? LYS O 220  ? ASN P 191  LYS P 200  1 ? 10 
HELX_P HELX_P235 BA1 LYS O 221  ? THR O 223  ? LYS P 201  THR P 203  5 ? 3  
HELX_P HELX_P236 BA2 SER O 228  ? PHE O 247  ? SER P 208  PHE P 227  1 ? 20 
HELX_P HELX_P237 BA3 GLU O 248  ? ARG O 252  ? GLU P 228  ARG P 232  5 ? 5  
HELX_P HELX_P238 BA4 LYS O 254  ? ALA O 275  ? LYS P 234  ALA P 255  1 ? 22 
HELX_P HELX_P239 BA5 PRO O 281  ? GLY O 303  ? PRO P 261  GLY P 283  1 ? 23 
HELX_P HELX_P240 BA6 THR O 307  ? MET O 315  ? THR P 287  MET P 295  1 ? 9  
HELX_P HELX_P241 BA7 ASP O 320  ? ALA O 331  ? ASP P 300  ALA P 311  1 ? 12 
HELX_P HELX_P242 BA8 GLY O 350  ? ILE O 353  ? GLY P 330  ILE P 333  5 ? 4  
HELX_P HELX_P243 BA9 SER O 360  ? LEU O 378  ? SER P 340  LEU P 358  1 ? 19 
HELX_P HELX_P244 BB1 SER O 379  ? LEU O 381  ? SER P 359  LEU P 361  5 ? 3  
HELX_P HELX_P245 BB2 SER O 382  ? LYS O 393  ? SER P 362  LYS P 373  1 ? 12 
HELX_P HELX_P246 BB3 THR O 402  ? GLY O 411  ? THR P 382  GLY P 391  1 ? 10 
HELX_P HELX_P247 BB4 THR O 413  ? ARG O 436  ? THR P 393  ARG P 416  1 ? 24 
HELX_P HELX_P248 BB5 LYS O 437  ? ASP O 443  ? LYS P 417  ASP P 423  5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? D  CYS 60   SG    ? ? ? 1_555 D  CYS 76 SG  ? ? D CYS 60   D CYS 76   1_555 ? ? ? ? ? ? ?            2.034 ? 
metalc1  metalc ? ? B  ASP 183  OD1   ? ? ? 1_555 S  MG  .  MG  ? ? B ASP 183  B MG  2001 1_555 ? ? ? ? ? ? ?            2.169 ? 
metalc2  metalc ? ? B  ASP 191  OD1   ? ? ? 1_555 S  MG  .  MG  ? ? B ASP 191  B MG  2001 1_555 ? ? ? ? ? ? ?            2.119 ? 
metalc3  metalc ? ? B  LEU 192  O     ? ? ? 1_555 S  MG  .  MG  ? ? B LEU 192  B MG  2001 1_555 ? ? ? ? ? ? ?            2.952 ? 
metalc4  metalc ? ? B  ASP 193  OD1   ? ? ? 1_555 S  MG  .  MG  ? ? B ASP 193  B MG  2001 1_555 ? ? ? ? ? ? ?            2.168 ? 
metalc5  metalc ? ? D  CYS 58   SG    ? ? ? 1_555 U  ZN  .  ZN  ? ? D CYS 58   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.274 ? 
metalc6  metalc ? ? D  CYS 60   SG    ? ? ? 1_555 U  ZN  .  ZN  ? ? D CYS 60   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc7  metalc ? ? D  CYS 73   SG    ? ? ? 1_555 U  ZN  .  ZN  ? ? D CYS 73   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.290 ? 
metalc8  metalc ? ? D  CYS 76   SG    ? ? ? 1_555 U  ZN  .  ZN  ? ? D CYS 76   D ZN  2002 1_555 ? ? ? ? ? ? ?            2.276 ? 
metalc9  metalc ? ? D  ASP 739  OD1   ? ? ? 1_555 V  MG  .  MG  ? ? D ASP 739  D MG  2003 1_555 ? ? ? ? ? ? ?            2.030 ? 
metalc10 metalc ? ? D  ASP 739  OD2   ? ? ? 1_555 W  MG  .  MG  B ? D ASP 739  D MG  2004 1_555 ? ? ? ? ? ? ?            2.089 ? 
metalc11 metalc ? ? D  ASP 741  OD1   ? ? ? 1_555 V  MG  .  MG  ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.095 ? 
metalc12 metalc ? ? D  ASP 741  OD2   ? ? ? 1_555 V  MG  .  MG  ? ? D ASP 741  D MG  2003 1_555 ? ? ? ? ? ? ?            2.892 ? 
metalc13 metalc ? ? D  ASP 743  OD1   ? ? ? 1_555 V  MG  .  MG  ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.073 ? 
metalc14 metalc ? ? D  ASP 743  OD2   ? ? ? 1_555 V  MG  .  MG  ? ? D ASP 743  D MG  2003 1_555 ? ? ? ? ? ? ?            2.755 ? 
metalc15 metalc ? ? D  LYS 840  O     ? ? ? 1_555 X  MG  .  MG  ? ? D LYS 840  D MG  2005 1_555 ? ? ? ? ? ? ?            2.020 ? 
metalc16 metalc ? ? D  TRP 897  O     ? ? ? 1_555 Y  MG  .  MG  ? ? D TRP 897  D MG  2006 1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc17 metalc ? ? D  ILE 900  O     ? ? ? 1_555 Y  MG  .  MG  ? ? D ILE 900  D MG  2006 1_555 ? ? ? ? ? ? ?            2.386 ? 
metalc18 metalc ? ? D  CYS 1112 SG    ? ? ? 1_555 T  ZN  .  ZN  ? ? D CYS 1112 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc19 metalc ? ? D  CYS 1194 SG    ? ? ? 1_555 T  ZN  .  ZN  ? ? D CYS 1194 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.331 ? 
metalc20 metalc ? ? D  CYS 1201 SG    ? ? ? 1_555 T  ZN  .  ZN  ? ? D CYS 1201 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc21 metalc ? ? D  CYS 1204 SG    ? ? ? 1_555 T  ZN  .  ZN  ? ? D CYS 1204 D ZN  2001 1_555 ? ? ? ? ? ? ?            2.258 ? 
metalc22 metalc ? ? F  ALA 312  O     ? ? ? 1_555 AA MG  .  MG  ? ? F ALA 292  F MG  2001 1_555 ? ? ? ? ? ? ?            2.168 ? 
metalc23 metalc ? ? F  TRP 319  O     ? ? ? 1_555 AA MG  .  MG  ? ? F TRP 299  F MG  2001 1_555 ? ? ? ? ? ? ?            2.258 ? 
metalc24 metalc ? ? I  A   2    "O3'" ? ? ? 1_555 V  MG  .  MG  ? ? I A   2    D MG  2003 1_555 ? ? ? ? ? ? ?            1.821 ? 
metalc25 metalc ? ? K  ASP 183  OD1   ? ? ? 1_555 BA MG  .  MG  ? ? L ASP 183  L MG  2001 1_555 ? ? ? ? ? ? ?            2.200 ? 
metalc26 metalc ? ? K  ASP 191  OD1   ? ? ? 1_555 BA MG  .  MG  ? ? L ASP 191  L MG  2001 1_555 ? ? ? ? ? ? ?            2.109 ? 
metalc27 metalc ? ? K  ASP 193  OD1   ? ? ? 1_555 BA MG  .  MG  ? ? L ASP 193  L MG  2001 1_555 ? ? ? ? ? ? ?            2.207 ? 
metalc28 metalc ? ? M  CYS 58   SG    ? ? ? 1_555 DA ZN  .  ZN  ? ? N CYS 58   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc29 metalc ? ? M  CYS 60   SG    ? ? ? 1_555 DA ZN  .  ZN  ? ? N CYS 60   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.282 ? 
metalc30 metalc ? ? M  CYS 73   SG    ? ? ? 1_555 DA ZN  .  ZN  ? ? N CYS 73   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc31 metalc ? ? M  CYS 76   SG    ? ? ? 1_555 DA ZN  .  ZN  ? ? N CYS 76   N ZN  2002 1_555 ? ? ? ? ? ? ?            2.251 ? 
metalc32 metalc ? ? M  ASP 739  OD1   ? ? ? 1_555 EA MG  .  MG  ? ? N ASP 739  N MG  2003 1_555 ? ? ? ? ? ? ?            2.015 ? 
metalc33 metalc ? ? M  ASP 739  OD2   ? ? ? 1_555 FA MG  .  MG  B ? N ASP 739  N MG  2004 1_555 ? ? ? ? ? ? ?            2.107 ? 
metalc34 metalc ? ? M  ASP 741  OD1   ? ? ? 1_555 EA MG  .  MG  ? ? N ASP 741  N MG  2003 1_555 ? ? ? ? ? ? ?            2.106 ? 
metalc35 metalc ? ? M  ASP 741  OD2   ? ? ? 1_555 EA MG  .  MG  ? ? N ASP 741  N MG  2003 1_555 ? ? ? ? ? ? ?            2.826 ? 
metalc36 metalc ? ? M  ASP 743  OD1   ? ? ? 1_555 EA MG  .  MG  ? ? N ASP 743  N MG  2003 1_555 ? ? ? ? ? ? ?            2.118 ? 
metalc37 metalc ? ? M  ASP 743  OD2   ? ? ? 1_555 EA MG  .  MG  ? ? N ASP 743  N MG  2003 1_555 ? ? ? ? ? ? ?            2.772 ? 
metalc38 metalc ? ? M  LYS 840  O     ? ? ? 1_555 GA MG  .  MG  ? ? N LYS 840  N MG  2005 1_555 ? ? ? ? ? ? ?            2.146 ? 
metalc39 metalc ? ? M  TRP 897  O     ? ? ? 1_555 HA MG  .  MG  ? ? N TRP 897  N MG  2006 1_555 ? ? ? ? ? ? ?            2.478 ? 
metalc40 metalc ? ? M  GLU 898  O     ? ? ? 1_555 HA MG  .  MG  ? ? N GLU 898  N MG  2006 1_555 ? ? ? ? ? ? ?            2.937 ? 
metalc41 metalc ? ? M  ILE 900  O     ? ? ? 1_555 HA MG  .  MG  ? ? N ILE 900  N MG  2006 1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc42 metalc ? ? M  CYS 1112 SG    ? ? ? 1_555 CA ZN  .  ZN  ? ? N CYS 1112 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.230 ? 
metalc43 metalc ? ? M  CYS 1194 SG    ? ? ? 1_555 CA ZN  .  ZN  ? ? N CYS 1194 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc44 metalc ? ? M  CYS 1201 SG    ? ? ? 1_555 CA ZN  .  ZN  ? ? N CYS 1201 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.229 ? 
metalc45 metalc ? ? M  CYS 1204 SG    ? ? ? 1_555 CA ZN  .  ZN  ? ? N CYS 1204 N ZN  2001 1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc46 metalc ? ? O  ALA 312  O     ? ? ? 1_555 JA MG  .  MG  ? ? P ALA 292  P MG  2001 1_555 ? ? ? ? ? ? ?            2.353 ? 
metalc47 metalc ? ? O  GLY 316  O     ? ? ? 1_555 JA MG  .  MG  ? ? P GLY 296  P MG  2001 1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc48 metalc ? ? O  TRP 319  O     ? ? ? 1_555 JA MG  .  MG  ? ? P TRP 299  P MG  2001 1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc49 metalc ? ? R  A   2    "O3'" ? ? ? 1_555 EA MG  .  MG  ? ? S A   2    N MG  2003 1_555 ? ? ? ? ? ? ?            1.831 ? 
metalc50 metalc ? ? W  MG  .    MG    A ? ? 1_555 Z  2TM .  O1B A ? D MG  2004 D 2TM 2007 1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc51 metalc ? ? W  MG  .    MG    A ? ? 1_555 Z  2TM .  O1G A ? D MG  2004 D 2TM 2007 1_555 ? ? ? ? ? ? ?            2.256 ? 
metalc52 metalc ? ? W  MG  .    MG    B ? ? 1_555 Z  2TM .  O1G B ? D MG  2004 D 2TM 2007 1_555 ? ? ? ? ? ? ?            2.105 ? 
metalc53 metalc ? ? W  MG  .    MG    B ? ? 1_555 Z  2TM .  O1B B ? D MG  2004 D 2TM 2007 1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc54 metalc ? ? FA MG  .    MG    A ? ? 1_555 IA 2TM .  O2G A ? N MG  2004 N 2TM 2007 1_555 ? ? ? ? ? ? ?            2.079 ? 
metalc55 metalc ? ? FA MG  .    MG    A ? ? 1_555 IA 2TM .  O2B A ? N MG  2004 N 2TM 2007 1_555 ? ? ? ? ? ? ?            2.382 ? 
metalc56 metalc ? ? FA MG  .    MG    B ? ? 1_555 IA 2TM .  O2G B ? N MG  2004 N 2TM 2007 1_555 ? ? ? ? ? ? ?            2.154 ? 
metalc57 metalc ? ? FA MG  .    MG    B ? ? 1_555 IA 2TM .  O2B B ? N MG  2004 N 2TM 2007 1_555 ? ? ? ? ? ? ?            2.147 ? 
hydrog1  hydrog ? ? G  DC  1    N4    ? ? ? 1_555 H  DG  26 O6  ? ? G DC  1    H DG  26   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog2  hydrog ? ? G  DC  1    O2    ? ? ? 1_555 H  DG  27 N2  ? ? G DC  1    H DG  27   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog3  hydrog ? ? G  DC  2    O2    ? ? ? 1_555 H  DG  26 N2  ? ? G DC  2    H DG  26   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog4  hydrog ? ? G  DT  3    N3    ? ? ? 1_555 H  DA  25 N1  ? ? G DT  3    H DA  25   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog5  hydrog ? ? G  DG  4    N1    ? ? ? 1_555 H  DC  24 N3  ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G  DG  4    N2    ? ? ? 1_555 H  DC  24 O2  ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G  DG  4    O6    ? ? ? 1_555 H  DC  24 N4  ? ? G DG  4    H DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G  DC  5    N3    ? ? ? 1_555 H  DG  23 N1  ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G  DC  5    N4    ? ? ? 1_555 H  DG  23 O6  ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G  DC  5    O2    ? ? ? 1_555 H  DG  23 N2  ? ? G DC  5    H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G  DA  6    N1    ? ? ? 1_555 H  DT  22 N3  ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G  DA  6    N6    ? ? ? 1_555 H  DT  22 O4  ? ? G DA  6    H DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G  DT  7    N3    ? ? ? 1_555 H  DA  21 N1  ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G  DT  7    O4    ? ? ? 1_555 H  DA  21 N6  ? ? G DT  7    H DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G  DC  8    N3    ? ? ? 1_555 H  DG  20 N1  ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G  DC  8    N4    ? ? ? 1_555 H  DG  20 O6  ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G  DC  8    O2    ? ? ? 1_555 H  DG  20 N2  ? ? G DC  8    H DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G  DC  9    N3    ? ? ? 1_555 H  DG  19 N1  ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G  DC  9    N4    ? ? ? 1_555 H  DG  19 O6  ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G  DC  9    O2    ? ? ? 1_555 H  DG  19 N2  ? ? G DC  9    H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G  DG  10   N1    ? ? ? 1_555 H  DC  18 N3  ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G  DG  10   N2    ? ? ? 1_555 H  DC  18 O2  ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G  DG  10   O6    ? ? ? 1_555 H  DC  18 N4  ? ? G DG  10   H DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? G  DT  11   N3    ? ? ? 1_555 H  DA  17 N1  ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G  DT  11   O4    ? ? ? 1_555 H  DA  17 N6  ? ? G DT  11   H DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G  DG  12   N1    ? ? ? 1_555 H  DC  16 N3  ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? G  DG  12   N2    ? ? ? 1_555 H  DC  16 O2  ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? G  DG  12   O6    ? ? ? 1_555 H  DC  16 N4  ? ? G DG  12   H DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? G  DA  13   N1    ? ? ? 1_555 H  DT  15 N3  ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? G  DA  13   N6    ? ? ? 1_555 H  DT  15 O4  ? ? G DA  13   H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? G  DT  15   N3    ? ? ? 1_555 I  A   2  N1  ? ? G DT  15   I A   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? G  DT  15   O4    ? ? ? 1_555 I  A   2  N6  ? ? G DT  15   I A   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? G  DC  16   N3    ? ? ? 1_555 I  G   1  N1  ? ? G DC  16   I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? G  DC  16   N4    ? ? ? 1_555 I  G   1  O6  ? ? G DC  16   I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? G  DC  16   O2    ? ? ? 1_555 I  G   1  N2  ? ? G DC  16   I G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? P  DG  4    N1    ? ? ? 1_555 Q  DC  24 N3  ? ? Q DG  4    R DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? P  DG  4    N2    ? ? ? 1_555 Q  DC  24 O2  ? ? Q DG  4    R DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? P  DG  4    O6    ? ? ? 1_555 Q  DC  24 N4  ? ? Q DG  4    R DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? P  DC  5    N3    ? ? ? 1_555 Q  DG  23 N1  ? ? Q DC  5    R DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? P  DC  5    N4    ? ? ? 1_555 Q  DG  23 O6  ? ? Q DC  5    R DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? P  DC  5    O2    ? ? ? 1_555 Q  DG  23 N2  ? ? Q DC  5    R DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? P  DA  6    N1    ? ? ? 1_555 Q  DT  22 N3  ? ? Q DA  6    R DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? P  DA  6    N6    ? ? ? 1_555 Q  DT  22 O4  ? ? Q DA  6    R DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? P  DT  7    N3    ? ? ? 1_555 Q  DA  21 N1  ? ? Q DT  7    R DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? P  DT  7    O4    ? ? ? 1_555 Q  DA  21 N6  ? ? Q DT  7    R DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? P  DC  8    N3    ? ? ? 1_555 Q  DG  20 N1  ? ? Q DC  8    R DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? P  DC  8    N4    ? ? ? 1_555 Q  DG  20 O6  ? ? Q DC  8    R DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? P  DC  8    O2    ? ? ? 1_555 Q  DG  20 N2  ? ? Q DC  8    R DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? P  DC  9    N3    ? ? ? 1_555 Q  DG  19 N1  ? ? Q DC  9    R DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? P  DC  9    N4    ? ? ? 1_555 Q  DG  19 O6  ? ? Q DC  9    R DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? P  DC  9    O2    ? ? ? 1_555 Q  DG  19 N2  ? ? Q DC  9    R DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? P  DG  10   N1    ? ? ? 1_555 Q  DC  18 N3  ? ? Q DG  10   R DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? P  DG  10   N2    ? ? ? 1_555 Q  DC  18 O2  ? ? Q DG  10   R DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? P  DG  10   O6    ? ? ? 1_555 Q  DC  18 N4  ? ? Q DG  10   R DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? P  DT  11   N3    ? ? ? 1_555 Q  DA  17 N1  ? ? Q DT  11   R DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? P  DT  11   O4    ? ? ? 1_555 Q  DA  17 N6  ? ? Q DT  11   R DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? P  DG  12   N1    ? ? ? 1_555 Q  DC  16 N3  ? ? Q DG  12   R DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? P  DG  12   N2    ? ? ? 1_555 Q  DC  16 O2  ? ? Q DG  12   R DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? P  DG  12   O6    ? ? ? 1_555 Q  DC  16 N4  ? ? Q DG  12   R DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? P  DA  13   N1    ? ? ? 1_555 Q  DT  15 N3  ? ? Q DA  13   R DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? P  DA  13   N6    ? ? ? 1_555 Q  DT  15 O4  ? ? Q DA  13   R DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? P  DT  15   N3    ? ? ? 1_555 R  A   2  N1  ? ? Q DT  15   S A   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? P  DT  15   O4    ? ? ? 1_555 R  A   2  N6  ? ? Q DT  15   S A   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? P  DC  16   N3    ? ? ? 1_555 R  G   1  N1  ? ? Q DC  16   S G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? P  DC  16   N4    ? ? ? 1_555 R  G   1  O6  ? ? Q DC  16   S G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? P  DC  16   O2    ? ? ? 1_555 R  G   1  N2  ? ? Q DC  16   S G   1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -11.45 
2  ALA 8   B . ? ALA 8   B PRO 9   B ? PRO 9   B 1 -25.31 
3  GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -9.69  
4  PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 0.68   
5  VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -7.27  
6  ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 0.19   
7  GLU 26  J . ? GLU 26  K PRO 27  J ? PRO 27  K 1 -11.50 
8  ALA 8   K . ? ALA 8   L PRO 9   K ? PRO 9   L 1 -26.92 
9  GLU 26  K . ? GLU 26  L PRO 27  K ? PRO 27  L 1 -10.44 
10 PHE 52  L . ? PHE 52  M PRO 53  L ? PRO 53  M 1 -1.79  
11 VAL 108 M . ? VAL 108 N PRO 109 M ? PRO 109 N 1 -5.38  
12 ALA 705 M . ? ALA 705 N PRO 706 M ? PRO 706 N 1 -1.81  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 4 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 4 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 5 ? 
AD8 ? 4 ? 
AD9 ? 3 ? 
AE1 ? 3 ? 
AE2 ? 4 ? 
AE3 ? 3 ? 
AE4 ? 4 ? 
AE5 ? 2 ? 
AE6 ? 3 ? 
AE7 ? 3 ? 
AE8 ? 3 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 3 ? 
AF5 ? 3 ? 
AF6 ? 2 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 4 ? 
AG1 ? 4 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 2 ? 
AG5 ? 4 ? 
AG6 ? 4 ? 
AG7 ? 2 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 3 ? 
AH2 ? 3 ? 
AH3 ? 3 ? 
AH4 ? 4 ? 
AH5 ? 5 ? 
AH6 ? 2 ? 
AH7 ? 3 ? 
AH8 ? 6 ? 
AH9 ? 2 ? 
AI1 ? 3 ? 
AI2 ? 4 ? 
AI3 ? 2 ? 
AI4 ? 2 ? 
AI5 ? 8 ? 
AI6 ? 4 ? 
AI7 ? 3 ? 
AI8 ? 2 ? 
AI9 ? 8 ? 
AJ1 ? 2 ? 
AJ2 ? 4 ? 
AJ3 ? 3 ? 
AJ4 ? 3 ? 
AJ5 ? 2 ? 
AJ6 ? 5 ? 
AJ7 ? 4 ? 
AJ8 ? 2 ? 
AJ9 ? 3 ? 
AK1 ? 3 ? 
AK2 ? 4 ? 
AK3 ? 3 ? 
AK4 ? 4 ? 
AK5 ? 2 ? 
AK6 ? 3 ? 
AK7 ? 3 ? 
AK8 ? 3 ? 
AK9 ? 2 ? 
AL1 ? 2 ? 
AL2 ? 2 ? 
AL3 ? 2 ? 
AL4 ? 4 ? 
AL5 ? 3 ? 
AL6 ? 2 ? 
AL7 ? 2 ? 
AL8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? parallel      
AE7 1 2 ? parallel      
AE7 2 3 ? anti-parallel 
AE8 1 2 ? parallel      
AE8 2 3 ? anti-parallel 
AE9 1 2 ? parallel      
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? parallel      
AH1 2 3 ? parallel      
AH2 1 2 ? anti-parallel 
AH2 2 3 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? parallel      
AH4 3 4 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? anti-parallel 
AH5 4 5 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? parallel      
AH8 4 5 ? anti-parallel 
AH8 5 6 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI5 4 5 ? parallel      
AI5 5 6 ? anti-parallel 
AI5 6 7 ? parallel      
AI5 7 8 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AI9 4 5 ? anti-parallel 
AI9 5 6 ? parallel      
AI9 6 7 ? anti-parallel 
AI9 7 8 ? parallel      
AJ1 1 2 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ2 3 4 ? anti-parallel 
AJ3 1 2 ? parallel      
AJ3 2 3 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ6 4 5 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ7 2 3 ? anti-parallel 
AJ7 3 4 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ9 1 2 ? anti-parallel 
AJ9 2 3 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK1 2 3 ? anti-parallel 
AK2 1 2 ? anti-parallel 
AK2 2 3 ? anti-parallel 
AK2 3 4 ? anti-parallel 
AK3 1 2 ? anti-parallel 
AK3 2 3 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK4 2 3 ? anti-parallel 
AK4 3 4 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK6 1 2 ? anti-parallel 
AK6 2 3 ? parallel      
AK7 1 2 ? parallel      
AK7 2 3 ? anti-parallel 
AK8 1 2 ? parallel      
AK8 2 3 ? anti-parallel 
AK9 1 2 ? parallel      
AL1 1 2 ? anti-parallel 
AL2 1 2 ? anti-parallel 
AL3 1 2 ? anti-parallel 
AL4 1 2 ? anti-parallel 
AL4 2 3 ? anti-parallel 
AL4 3 4 ? anti-parallel 
AL5 1 2 ? anti-parallel 
AL5 2 3 ? anti-parallel 
AL6 1 2 ? anti-parallel 
AL7 1 2 ? anti-parallel 
AL8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 ARG A 189  ? THR A 201  ? ARG A 189  THR A 201  
AA1 4 VAL A 174  ? LEU A 186  ? VAL A 174  LEU A 186  
AA2 1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
AA2 2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
AA4 2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? GLY B 147  ? ARG B 137  GLY B 147  
AA7 3 GLY B 50   ? ILE B 58   ? GLY B 50   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 GLU B 108  ? LYS B 110  ? GLU B 108  LYS B 110  
AA9 2 HIS B 128  ? THR B 131  ? HIS B 128  THR B 131  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
AB2 2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 LEU C 64   ? LEU C 73   ? LEU C 64   LEU C 73   
AB3 2 GLN C 91   ? HIS C 102  ? GLN C 91   HIS C 102  
AB3 3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB6 4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
AB6 5 LYS C 190  ? PRO C 192  ? LYS C 190  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? ASP C 533  ? PHE C 531  ASP C 533  
AB9 4 THR C 495  ? ALA C 497  ? THR C 495  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLN C 670  ? ILE C 676  ? GLN C 670  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 SER C 702  ? ARG C 713  ? SER C 702  ARG C 713  
AC7 2 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 3 GLY C 798  ? ARG C 807  ? GLY C 798  ARG C 807  
AC7 4 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
AC8 2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
AC8 3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 GLN C 1030 ? PHE C 1032 ? GLN C 1030 PHE C 1032 
AD2 2 LYS D 621  ? VAL D 623  ? LYS D 621  VAL D 623  
AD3 1 PRO C 1108 ? VAL C 1109 ? PRO C 1108 VAL C 1109 
AD3 2 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 3 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 4 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 GLY D 91   ? ALA D 100  ? GLY D 91   ALA D 100  
AD4 2 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD7 3 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD7 4 THR D 330  ? ARG D 346  ? THR D 330  ARG D 346  
AD7 5 ARG D 318  ? GLU D 327  ? ARG D 318  GLU D 327  
AD8 1 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 2 GLY D 201  ? PRO D 226  ? GLY D 201  PRO D 226  
AD8 3 GLY D 383  ? VAL D 396  ? GLY D 383  VAL D 396  
AD8 4 ARG D 360  ? VAL D 361  ? ARG D 360  VAL D 361  
AD9 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AD9 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AD9 3 TYR D 249  ? ARG D 252  ? TYR D 249  ARG D 252  
AE1 1 ILE D 241  ? GLU D 244  ? ILE D 241  GLU D 244  
AE1 2 PRO D 303  ? ARG D 312  ? PRO D 303  ARG D 312  
AE1 3 VAL D 286  ? PRO D 290  ? VAL D 286  PRO D 290  
AE2 1 PRO D 278  ? LEU D 284  ? PRO D 278  LEU D 284  
AE2 2 ALA D 268  ? ARG D 273  ? ALA D 268  ARG D 273  
AE2 3 GLY D 257  ? GLU D 263  ? GLY D 257  GLU D 263  
AE2 4 ILE D 297  ? VAL D 298  ? ILE D 297  VAL D 298  
AE3 1 ASN D 352  ? VAL D 353  ? ASN D 352  VAL D 353  
AE3 2 LYS D 366  ? ALA D 369  ? LYS D 366  ALA D 369  
AE3 3 VAL D 377  ? ILE D 378  ? VAL D 377  ILE D 378  
AE4 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AE4 2 VAL D 443  ? GLU D 448  ? VAL D 443  GLU D 448  
AE4 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AE4 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE5 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE5 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE6 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE6 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE6 3 VAL F 335  ? SER F 336  ? VAL F 315  SER F 316  
AE7 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE7 2 ILE D 827  ? VAL D 829  ? ILE D 827  VAL D 829  
AE7 3 ARG D 832  ? THR D 834  ? ARG D 832  THR D 834  
AE8 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE8 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE8 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AE9 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AE9 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AF1 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AF1 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AF2 1 PHE D 1123 ? PRO D 1125 ? PHE D 1123 PRO D 1125 
AF2 2 LEU D 1132 ? LEU D 1134 ? LEU D 1132 LEU D 1134 
AF3 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AF3 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AF4 1 VAL D 1280 ? GLU D 1285 ? VAL D 1280 GLU D 1285 
AF4 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AF4 3 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AF5 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF5 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF5 3 ALA D 1416 ? LEU D 1420 ? ALA D 1416 LEU D 1420 
AF6 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF6 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF7 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF7 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
AF8 1 PRO F 340  ? ILE F 341  ? PRO F 320  ILE F 321  
AF8 2 SER F 347  ? PHE F 348  ? SER F 327  PHE F 328  
AF9 1 VAL J 10   ? GLN J 16   ? VAL K 10   GLN K 16   
AF9 2 TYR J 20   ? LEU J 28   ? TYR K 20   LEU K 28   
AF9 3 ARG J 189  ? THR J 201  ? ARG K 189  THR K 201  
AF9 4 VAL J 174  ? LEU J 186  ? VAL K 174  LEU K 186  
AG1 1 THR J 96   ? GLU J 104  ? THR K 96   GLU K 104  
AG1 2 ARG J 137  ? GLY J 147  ? ARG K 137  GLY K 147  
AG1 3 GLY J 50   ? ILE J 58   ? GLY K 50   ILE K 58   
AG1 4 ILE J 165  ? PRO J 166  ? ILE K 165  PRO K 166  
AG2 1 VAL J 87   ? PHE J 89   ? VAL K 87   PHE K 89   
AG2 2 VAL J 120  ? ILE J 122  ? VAL K 120  ILE K 122  
AG3 1 LYS J 107  ? LYS J 110  ? LYS K 107  LYS K 110  
AG3 2 HIS J 128  ? LEU J 132  ? HIS K 128  LEU K 132  
AG4 1 TYR J 150  ? VAL J 151  ? TYR K 150  VAL K 151  
AG4 2 ALA J 169  ? VAL J 170  ? ALA K 169  VAL K 170  
AG5 1 VAL K 10   ? GLN K 16   ? VAL L 10   GLN L 16   
AG5 2 TYR K 20   ? LEU K 28   ? TYR L 20   LEU L 28   
AG5 3 ARG K 189  ? THR K 201  ? ARG L 189  THR L 201  
AG5 4 VAL K 174  ? LEU K 186  ? VAL L 174  LEU L 186  
AG6 1 THR K 96   ? GLU K 104  ? THR L 96   GLU L 104  
AG6 2 ARG K 137  ? GLY K 147  ? ARG L 137  GLY L 147  
AG6 3 GLY K 50   ? ILE K 58   ? GLY L 50   ILE L 58   
AG6 4 ILE K 165  ? PRO K 166  ? ILE L 165  PRO L 166  
AG7 1 VAL K 87   ? PHE K 89   ? VAL L 87   PHE L 89   
AG7 2 VAL K 120  ? ILE K 122  ? VAL L 120  ILE L 122  
AG8 1 LYS K 107  ? LYS K 110  ? LYS L 107  LYS L 110  
AG8 2 HIS K 128  ? LEU K 132  ? HIS L 128  LEU L 132  
AG9 1 TYR K 150  ? VAL K 151  ? TYR L 150  VAL L 151  
AG9 2 ALA K 169  ? VAL K 170  ? ALA L 169  VAL L 170  
AH1 1 GLU L 2    ? ARG L 5    ? GLU M 2    ARG M 5    
AH1 2 GLN L 899  ? ILE L 902  ? GLN M 899  ILE M 902  
AH1 3 VAL L 579  ? MET L 580  ? VAL M 579  MET M 580  
AH2 1 LEU L 64   ? LEU L 73   ? LEU M 64   LEU M 73   
AH2 2 GLN L 91   ? HIS L 102  ? GLN M 91   HIS M 102  
AH2 3 ILE L 108  ? PRO L 119  ? ILE M 108  PRO M 119  
AH3 1 PHE L 127  ? ILE L 129  ? PHE M 127  ILE M 129  
AH3 2 ALA L 132  ? ILE L 136  ? ALA M 132  ILE M 136  
AH3 3 SER L 392  ? PHE L 394  ? SER M 392  PHE M 394  
AH4 1 ARG L 331  ? ARG L 334  ? ARG M 331  ARG M 334  
AH4 2 SER L 138  ? ARG L 142  ? SER M 138  ARG M 142  
AH4 3 ARG L 409  ? SER L 411  ? ARG M 409  SER M 411  
AH4 4 ILE L 452  ? SER L 454  ? ILE M 452  SER M 454  
AH5 1 GLY L 145  ? PRO L 150  ? GLY M 145  PRO M 150  
AH5 2 TYR L 158  ? ILE L 163  ? TYR M 158  ILE M 163  
AH5 3 ILE L 172  ? VAL L 176  ? ILE M 172  VAL M 176  
AH5 4 VAL L 182  ? VAL L 186  ? VAL M 182  VAL M 186  
AH5 5 LYS L 190  ? PRO L 192  ? LYS M 190  PRO M 192  
AH6 1 ALA L 291  ? GLU L 294  ? ALA M 291  GLU M 294  
AH6 2 GLU L 297  ? ASP L 300  ? GLU M 297  ASP M 300  
AH7 1 ARG L 460  ? VAL L 461  ? ARG M 460  VAL M 461  
AH7 2 ILE L 467  ? VAL L 475  ? ILE M 467  VAL M 475  
AH7 3 VAL L 478  ? MET L 486  ? VAL M 478  MET M 486  
AH8 1 ARG L 460  ? VAL L 461  ? ARG M 460  VAL M 461  
AH8 2 ILE L 467  ? VAL L 475  ? ILE M 467  VAL M 475  
AH8 3 PHE L 531  ? ASP L 533  ? PHE M 531  ASP M 533  
AH8 4 THR L 495  ? ALA L 497  ? THR M 495  ALA M 497  
AH8 5 VAL L 513  ? ARG L 517  ? VAL M 513  ARG M 517  
AH8 6 GLU L 520  ? VAL L 524  ? GLU M 520  VAL M 524  
AH9 1 LEU L 503  ? GLU L 504  ? LEU M 503  GLU M 504  
AH9 2 ARG L 507  ? ILE L 508  ? ARG M 507  ILE M 508  
AI1 1 LEU L 595  ? TYR L 596  ? LEU M 595  TYR M 596  
AI1 2 LEU L 654  ? ASP L 657  ? LEU M 654  ASP M 657  
AI1 3 ARG L 640  ? PRO L 641  ? ARG M 640  PRO M 641  
AI2 1 LEU L 620  ? PRO L 624  ? LEU M 620  PRO M 624  
AI2 2 ARG L 610  ? TYR L 615  ? ARG M 610  TYR M 615  
AI2 3 GLY L 601  ? VAL L 606  ? GLY M 601  VAL M 606  
AI2 4 ARG L 648  ? VAL L 649  ? ARG M 648  VAL M 649  
AI3 1 TYR L 629  ? ARG L 630  ? TYR M 629  ARG M 630  
AI3 2 ALA L 636  ? LEU L 637  ? ALA M 636  LEU M 637  
AI4 1 SER L 661  ? GLU L 662  ? SER M 661  GLU M 662  
AI4 2 PHE L 665  ? LEU L 666  ? PHE M 665  LEU M 666  
AI5 1 LYS L 971  ? VAL L 972  ? LYS M 971  VAL M 972  
AI5 2 ILE L 987  ? LYS L 996  ? ILE M 987  LYS M 996  
AI5 3 LYS L 838  ? ALA L 840  ? LYS M 838  ALA M 840  
AI5 4 LYS L 846  ? LEU L 853  ? LYS M 846  LEU M 853  
AI5 5 ILE L 688  ? SER L 691  ? ILE M 688  SER M 691  
AI5 6 VAL L 869  ? LEU L 871  ? VAL M 869  LEU M 871  
AI5 7 GLN L 670  ? ILE L 676  ? GLN M 670  ILE M 676  
AI5 8 ILE L 987  ? LYS L 996  ? ILE M 987  LYS M 996  
AI6 1 SER L 702  ? ARG L 713  ? SER M 702  ARG M 713  
AI6 2 VAL L 819  ? ARG L 831  ? VAL M 819  ARG M 831  
AI6 3 GLY L 798  ? ARG L 807  ? GLY M 798  ARG M 807  
AI6 4 GLU L 748  ? VAL L 749  ? GLU M 748  VAL M 749  
AI7 1 ARG L 721  ? ILE L 722  ? ARG M 721  ILE M 722  
AI7 2 ARG L 758  ? PHE L 761  ? ARG M 758  PHE M 761  
AI7 3 VAL L 785  ? ASP L 787  ? VAL M 785  ASP M 787  
AI8 1 ILE L 754  ? VAL L 756  ? ILE M 754  VAL M 756  
AI8 2 LEU L 790  ? ARG L 791  ? LEU M 790  ARG M 791  
AI9 1 HIS L 1006 ? ARG L 1008 ? HIS M 1006 ARG M 1008 
AI9 2 SER M 626  ? VAL M 633  ? SER N 626  VAL N 633  
AI9 3 GLN M 744  ? HIS M 748  ? GLN N 744  HIS N 748  
AI9 4 VAL M 700  ? ASN M 703  ? VAL N 700  ASN N 703  
AI9 5 ILE M 713  ? VAL M 721  ? ILE N 713  VAL N 721  
AI9 6 GLN M 641  ? PRO M 645  ? GLN N 641  PRO N 645  
AI9 7 ILE M 726  ? LEU M 728  ? ILE N 726  LEU N 728  
AI9 8 SER M 626  ? VAL M 633  ? SER N 626  VAL N 633  
AJ1 1 ARG L 1031 ? PHE L 1032 ? ARG M 1031 PHE M 1032 
AJ1 2 LYS M 621  ? ARG M 622  ? LYS N 621  ARG N 622  
AJ2 1 PRO L 1108 ? VAL L 1109 ? PRO M 1108 VAL M 1109 
AJ2 2 LEU L 1097 ? LEU L 1102 ? LEU M 1097 LEU M 1102 
AJ2 3 LYS M 7    ? LEU M 12   ? LYS N 7    LEU N 12   
AJ2 4 LYS M 1456 ? ASP M 1457 ? LYS N 1456 ASP N 1457 
AJ3 1 SER M 22   ? GLU M 25   ? SER N 22   GLU N 25   
AJ3 2 MET M 90   ? ALA M 100  ? MET N 90   ALA N 100  
AJ3 3 ILE M 513  ? VAL M 519  ? ILE N 513  VAL N 519  
AJ4 1 LEU M 152  ? LEU M 153  ? LEU N 152  LEU N 153  
AJ4 2 TYR M 132  ? ASP M 136  ? TYR N 132  ASP N 136  
AJ4 3 ASP M 453  ? ARG M 455  ? ASP N 453  ARG N 455  
AJ5 1 ILE M 141  ? LEU M 142  ? ILE N 141  LEU N 142  
AJ5 2 VAL M 145  ? PRO M 146  ? VAL N 145  PRO N 146  
AJ6 1 GLN M 166  ? PRO M 170  ? GLN N 166  PRO N 170  
AJ6 2 GLY M 383  ? VAL M 396  ? GLY N 383  VAL N 396  
AJ6 3 GLY M 201  ? PRO M 226  ? GLY N 201  PRO N 226  
AJ6 4 THR M 330  ? ARG M 346  ? THR N 330  ARG N 346  
AJ6 5 VAL M 317  ? GLU M 327  ? VAL N 317  GLU N 327  
AJ7 1 GLU M 184  ? VAL M 185  ? GLU N 184  VAL N 185  
AJ7 2 GLY M 201  ? PRO M 226  ? GLY N 201  PRO N 226  
AJ7 3 GLY M 383  ? VAL M 396  ? GLY N 383  VAL N 396  
AJ7 4 ARG M 360  ? VAL M 361  ? ARG N 360  VAL N 361  
AJ8 1 GLU M 190  ? ALA M 192  ? GLU N 190  ALA N 192  
AJ8 2 VAL M 195  ? VAL M 196  ? VAL N 195  VAL N 196  
AJ9 1 ILE M 241  ? GLU M 244  ? ILE N 241  GLU N 244  
AJ9 2 PRO M 303  ? ARG M 312  ? PRO N 303  ARG N 312  
AJ9 3 TYR M 249  ? ARG M 252  ? TYR N 249  ARG N 252  
AK1 1 ILE M 241  ? GLU M 244  ? ILE N 241  GLU N 244  
AK1 2 PRO M 303  ? ARG M 312  ? PRO N 303  ARG N 312  
AK1 3 VAL M 286  ? PRO M 290  ? VAL N 286  PRO N 290  
AK2 1 PRO M 278  ? LEU M 284  ? PRO N 278  LEU N 284  
AK2 2 ALA M 268  ? ARG M 273  ? ALA N 268  ARG N 273  
AK2 3 GLY M 257  ? GLU M 263  ? GLY N 257  GLU N 263  
AK2 4 ILE M 297  ? VAL M 298  ? ILE N 297  VAL N 298  
AK3 1 ASN M 352  ? VAL M 353  ? ASN N 352  VAL N 353  
AK3 2 LYS M 366  ? ALA M 369  ? LYS N 366  ALA N 369  
AK3 3 VAL M 377  ? ILE M 378  ? VAL N 377  ILE N 378  
AK4 1 ALA M 398  ? PRO M 402  ? ALA N 398  PRO N 402  
AK4 2 VAL M 443  ? GLU M 448  ? VAL N 443  GLU N 448  
AK4 3 GLY M 433  ? ASP M 438  ? GLY N 433  ASP N 438  
AK4 4 ARG M 414  ? VAL M 415  ? ARG N 414  VAL N 415  
AK5 1 VAL M 420  ? ALA M 422  ? VAL N 420  ALA N 422  
AK5 2 VAL M 427  ? LYS M 428  ? VAL N 427  LYS N 428  
AK6 1 MET M 527  ? GLN M 529  ? MET N 527  GLN N 529  
AK6 2 PHE M 535  ? THR M 537  ? PHE N 535  THR N 537  
AK6 3 VAL O 335  ? SER O 336  ? VAL P 315  SER P 316  
AK7 1 GLU M 805  ? PHE M 806  ? GLU N 805  PHE N 806  
AK7 2 PRO M 826  ? VAL M 829  ? PRO N 826  VAL N 829  
AK7 3 ARG M 832  ? SER M 835  ? ARG N 832  SER N 835  
AK8 1 VAL M 842  ? PHE M 843  ? VAL N 842  PHE N 843  
AK8 2 VAL M 864  ? TYR M 868  ? VAL N 864  TYR N 868  
AK8 3 LYS M 871  ? THR M 875  ? LYS N 871  THR N 875  
AK9 1 VAL M 1106 ? GLU M 1109 ? VAL N 1106 GLU N 1109 
AK9 2 GLY M 1199 ? CYS M 1201 ? GLY N 1199 CYS N 1201 
AL1 1 ILE M 1118 ? PRO M 1121 ? ILE N 1118 PRO N 1121 
AL1 2 GLU M 1185 ? VAL M 1188 ? GLU N 1185 VAL N 1188 
AL2 1 PHE M 1123 ? PRO M 1125 ? PHE N 1123 PRO N 1125 
AL2 2 LEU M 1132 ? LEU M 1134 ? LEU N 1132 LEU N 1134 
AL3 1 VAL M 1153 ? VAL M 1155 ? VAL N 1153 VAL N 1155 
AL3 2 VAL M 1158 ? LEU M 1160 ? VAL N 1158 LEU N 1160 
AL4 1 SER M 1300 ? LEU M 1305 ? SER N 1300 LEU N 1305 
AL4 2 LEU M 1290 ? GLU M 1295 ? LEU N 1290 GLU N 1295 
AL4 3 GLY M 1279 ? GLU M 1285 ? GLY N 1279 GLU N 1285 
AL4 4 TYR M 1318 ? VAL M 1319 ? TYR N 1318 VAL N 1319 
AL5 1 VAL M 1394 ? GLU M 1396 ? VAL N 1394 GLU N 1396 
AL5 2 TYR M 1378 ? ASP M 1383 ? TYR N 1378 ASP N 1383 
AL5 3 ALA M 1416 ? LEU M 1420 ? ALA N 1416 LEU N 1420 
AL6 1 GLN M 1485 ? ASP M 1488 ? GLN N 1485 ASP N 1488 
AL6 2 LEU N 73   ? GLY N 76   ? LEU O 73   GLY O 76   
AL7 1 LYS N 47   ? GLN N 49   ? LYS O 47   GLN O 49   
AL7 2 LEU N 54   ? ASP N 56   ? LEU O 54   ASP O 56   
AL8 1 PRO O 340  ? ILE O 341  ? PRO P 320  ILE P 321  
AL8 2 SER O 347  ? PHE O 348  ? SER P 327  PHE P 328  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 10   ? N VAL A 10   O GLU A 26   ? O GLU A 26   
AA1 2 3 N GLY A 21   ? N GLY A 21   O ILE A 199  ? O ILE A 199  
AA1 3 4 O TRP A 200  ? O TRP A 200  N ARG A 176  ? N ARG A 176  
AA2 1 2 N VAL A 97   ? N VAL A 97   O VAL A 144  ? O VAL A 144  
AA2 2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ILE A 129  ? O ILE A 129  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N VAL B 10   ? N VAL B 10   O GLU B 26   ? O GLU B 26   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O TRP B 200  ? O TRP B 200  N ARG B 176  ? N ARG B 176  
AA7 1 2 N VAL B 97   ? N VAL B 97   O VAL B 144  ? O VAL B 144  
AA7 2 3 O GLY B 147  ? O GLY B 147  N GLY B 50   ? N GLY B 50   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N VAL B 109  ? N VAL B 109  O ILE B 129  ? O ILE B 129  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N GLU C 2    ? N GLU C 2    O ARG C 900  ? O ARG C 900  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 2 3 N LEU C 94   ? N LEU C 94   O GLY C 116  ? O GLY C 116  
AB4 1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N SER C 138  ? N SER C 138  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N GLY C 145  ? N GLY C 145  O ILE C 163  ? O ILE C 163  
AB6 2 3 N ALA C 160  ? N ALA C 160  O LEU C 174  ? O LEU C 174  
AB6 3 4 N GLU C 175  ? N GLU C 175  O SER C 183  ? O SER C 183  
AB6 4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
AB7 1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N VAL C 475  ? N VAL C 475  O VAL C 478  ? O VAL C 478  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N VAL C 513  ? N VAL C 513  O VAL C 524  ? O VAL C 524  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O VAL C 621  ? O VAL C 621  N VAL C 613  ? N VAL C 613  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O VAL C 848  ? O VAL C 848  N ILE C 688  ? N ILE C 688  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 674  ? N VAL C 674  O GLY C 990  ? O GLY C 990  
AC7 1 2 N ILE C 710  ? N ILE C 710  O VAL C 823  ? O VAL C 823  
AC7 2 3 O ALA C 828  ? O ALA C 828  N ILE C 799  ? N ILE C 799  
AC7 3 4 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
AC8 2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N VAL C 756  ? N VAL C 756  O LEU C 790  ? O LEU C 790  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD1 3 4 O ALA D 746  ? O ALA D 746  N ASN D 703  ? N ASN D 703  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N CYS D 642  ? N CYS D 642  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O ILE D 726  ? O ILE D 726  N VAL D 632  ? N VAL D 632  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 O VAL C 1109 ? O VAL C 1109 N THR C 1101 ? N THR C 1101 
AD3 2 3 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AD3 3 4 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N ASP D 136  ? N ASP D 136  O ASP D 453  ? O ASP D 453  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N TYR D 169  ? N TYR D 169  O ILE D 393  ? O ILE D 393  
AD7 2 3 O GLU D 389  ? O GLU D 389  N ARG D 209  ? N ARG D 209  
AD7 3 4 N LYS D 217  ? N LYS D 217  O TRP D 339  ? O TRP D 339  
AD7 4 5 O THR D 334  ? O THR D 334  N GLU D 323  ? N GLU D 323  
AD8 1 2 N VAL D 185  ? N VAL D 185  O GLY D 201  ? O GLY D 201  
AD8 2 3 N ARG D 209  ? N ARG D 209  O GLU D 389  ? O GLU D 389  
AD8 3 4 O GLY D 383  ? O GLY D 383  N VAL D 361  ? N VAL D 361  
AD9 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AD9 2 3 O ALA D 307  ? O ALA D 307  N TYR D 249  ? N TYR D 249  
AE1 1 2 N LEU D 242  ? N LEU D 242  O LEU D 311  ? O LEU D 311  
AE1 2 3 O GLU D 306  ? O GLU D 306  N THR D 289  ? N THR D 289  
AE2 1 2 O TYR D 282  ? O TYR D 282  N LEU D 270  ? N LEU D 270  
AE2 2 3 O VAL D 271  ? O VAL D 271  N GLU D 260  ? N GLU D 260  
AE2 3 4 N GLY D 257  ? N GLY D 257  O VAL D 298  ? O VAL D 298  
AE3 1 2 N ASN D 352  ? N ASN D 352  O ALA D 369  ? O ALA D 369  
AE3 2 3 N ILE D 367  ? N ILE D 367  O VAL D 377  ? O VAL D 377  
AE4 1 2 N ARG D 399  ? N ARG D 399  O VAL D 446  ? O VAL D 446  
AE4 2 3 O ARG D 445  ? O ARG D 445  N GLU D 436  ? N GLU D 436  
AE4 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE5 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE6 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE6 2 3 N PHE D 535  ? N PHE D 535  O VAL F 335  ? O VAL F 315  
AE7 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE7 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE8 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE8 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AE9 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AF1 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AF2 1 2 N GLN D 1124 ? N GLN D 1124 O ARG D 1133 ? O ARG D 1133 
AF3 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AF4 1 2 N GLU D 1284 ? N GLU D 1284 O SER D 1291 ? O SER D 1291 
AF4 2 3 N VAL D 1292 ? N VAL D 1292 O TYR D 1303 ? O TYR D 1303 
AF5 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF5 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AF6 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF7 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
AF8 1 2 N ILE F 341  ? N ILE F 321  O SER F 347  ? O SER F 327  
AF9 1 2 N ARG J 14   ? N ARG K 14   O GLU J 22   ? O GLU K 22   
AF9 2 3 N GLY J 21   ? N GLY K 21   O ILE J 199  ? O ILE K 199  
AF9 3 4 O TRP J 200  ? O TRP K 200  N ARG J 176  ? N ARG K 176  
AG1 1 2 N VAL J 97   ? N VAL K 97   O VAL J 144  ? O VAL K 144  
AG1 2 3 O ARG J 143  ? O ARG K 143  N SER J 55   ? N SER K 55   
AG1 3 4 N VAL J 56   ? N VAL K 56   O ILE J 165  ? O ILE K 165  
AG2 1 2 N ARG J 88   ? N ARG K 88   O GLU J 121  ? O GLU K 121  
AG3 1 2 N LYS J 107  ? N LYS K 107  O LEU J 132  ? O LEU K 132  
AG4 1 2 N VAL J 151  ? N VAL K 151  O ALA J 169  ? O ALA K 169  
AG5 1 2 N VAL K 10   ? N VAL L 10   O GLU K 26   ? O GLU L 26   
AG5 2 3 N LEU K 28   ? N LEU L 28   O ASP K 193  ? O ASP L 193  
AG5 3 4 O ARG K 198  ? O ARG L 198  N ALA K 178  ? N ALA L 178  
AG6 1 2 N VAL K 97   ? N VAL L 97   O VAL K 144  ? O VAL L 144  
AG6 2 3 O GLU K 141  ? O GLU L 141  N TYR K 57   ? N TYR L 57   
AG6 3 4 N VAL K 56   ? N VAL L 56   O ILE K 165  ? O ILE L 165  
AG7 1 2 N ARG K 88   ? N ARG L 88   O GLU K 121  ? O GLU L 121  
AG8 1 2 N VAL K 109  ? N VAL L 109  O ILE K 129  ? O ILE L 129  
AG9 1 2 N VAL K 151  ? N VAL L 151  O ALA K 169  ? O ALA L 169  
AH1 1 2 N LYS L 4    ? N LYS M 4    O ARG L 900  ? O ARG M 900  
AH1 2 3 O TYR L 901  ? O TYR M 901  N MET L 580  ? N MET M 580  
AH2 1 2 N VAL L 65   ? N VAL M 65   O ILE L 101  ? O ILE M 101  
AH2 2 3 N LEU L 94   ? N LEU M 94   O GLY L 116  ? O GLY M 116  
AH3 1 2 N PHE L 127  ? N PHE M 127  O ARG L 134  ? O ARG M 134  
AH3 2 3 N VAL L 135  ? N VAL M 135  O GLN L 393  ? O GLN M 393  
AH4 1 2 O ARG L 334  ? O ARG M 334  N GLN L 139  ? N GLN M 139  
AH4 2 3 N SER L 138  ? N SER M 138  O SER L 411  ? O SER M 411  
AH4 3 4 N ILE L 410  ? N ILE M 410  O THR L 453  ? O THR M 453  
AH5 1 2 N THR L 149  ? N THR M 149  O ILE L 159  ? O ILE M 159  
AH5 2 3 N ALA L 160  ? N ALA M 160  O LEU L 174  ? O LEU M 174  
AH5 3 4 N GLU L 175  ? N GLU M 175  O SER L 183  ? O SER M 183  
AH5 4 5 N MET L 184  ? N MET M 184  O PHE L 191  ? O PHE M 191  
AH6 1 2 N ARG L 292  ? N ARG M 292  O LYS L 299  ? O LYS M 299  
AH7 1 2 N ARG L 460  ? N ARG M 460  O ARG L 468  ? O ARG M 468  
AH7 2 3 N VAL L 475  ? N VAL M 475  O VAL L 478  ? O VAL M 478  
AH8 1 2 N ARG L 460  ? N ARG M 460  O ARG L 468  ? O ARG M 468  
AH8 2 3 N ARG L 472  ? N ARG M 472  O MET L 532  ? O MET M 532  
AH8 3 4 O PHE L 531  ? O PHE M 531  N ALA L 497  ? N ALA M 497  
AH8 4 5 N ILE L 496  ? N ILE M 496  O ARG L 516  ? O ARG M 516  
AH8 5 6 N VAL L 513  ? N VAL M 513  O VAL L 524  ? O VAL M 524  
AH9 1 2 N GLU L 504  ? N GLU M 504  O ARG L 507  ? O ARG M 507  
AI1 1 2 N LEU L 595  ? N LEU M 595  O LEU L 655  ? O LEU M 655  
AI1 2 3 O ASP L 657  ? O ASP M 657  N ARG L 640  ? N ARG M 640  
AI2 1 2 O VAL L 621  ? O VAL M 621  N VAL L 613  ? N VAL M 613  
AI2 2 3 O ARG L 614  ? O ARG M 614  N GLU L 602  ? N GLU M 602  
AI2 3 4 N GLY L 601  ? N GLY M 601  O VAL L 649  ? O VAL M 649  
AI3 1 2 N TYR L 629  ? N TYR M 629  O LEU L 637  ? O LEU M 637  
AI4 1 2 N GLU L 662  ? N GLU M 662  O PHE L 665  ? O PHE M 665  
AI5 1 2 N VAL L 972  ? N VAL M 972  O ILE L 987  ? O ILE M 987  
AI5 2 3 O MET L 995  ? O MET M 995  N ALA L 840  ? N ALA M 840  
AI5 3 4 N LEU L 839  ? N LEU M 839  O GLY L 847  ? O GLY M 847  
AI5 4 5 O VAL L 848  ? O VAL M 848  N ILE L 688  ? N ILE M 688  
AI5 5 6 N VAL L 689  ? N VAL M 689  O ILE L 870  ? O ILE M 870  
AI5 6 7 O VAL L 869  ? O VAL M 869  N ALA L 675  ? N ALA M 675  
AI5 7 8 N VAL L 674  ? N VAL M 674  O GLY L 990  ? O GLY M 990  
AI6 1 2 N ALA L 712  ? N ALA M 712  O GLU L 821  ? O GLU M 821  
AI6 2 3 O ALA L 828  ? O ALA M 828  N ILE L 799  ? N ILE M 799  
AI6 3 4 O GLY L 798  ? O GLY M 798  N VAL L 749  ? N VAL M 749  
AI7 1 2 N ARG L 721  ? N ARG M 721  O THR L 759  ? O THR M 759  
AI7 2 3 N SER L 760  ? N SER M 760  O LYS L 786  ? O LYS M 786  
AI8 1 2 N LEU L 755  ? N LEU M 755  O LEU L 790  ? O LEU M 790  
AI9 1 2 N HIS L 1006 ? N HIS M 1006 O ARG M 628  ? O ARG N 628  
AI9 2 3 N SER M 629  ? N SER N 629  O MET M 745  ? O MET N 745  
AI9 3 4 O ALA M 746  ? O ALA N 746  N ASN M 703  ? N ASN N 703  
AI9 4 5 N LEU M 702  ? N LEU N 702  O GLN M 714  ? O GLN N 714  
AI9 5 6 O VAL M 719  ? O VAL N 719  N CYS M 642  ? N CYS N 642  
AI9 6 7 N GLY M 643  ? N GLY N 643  O GLN M 727  ? O GLN N 727  
AI9 7 8 O LEU M 728  ? O LEU N 728  N VAL M 632  ? N VAL N 632  
AJ1 1 2 N PHE L 1032 ? N PHE M 1032 O LYS M 621  ? O LYS N 621  
AJ2 1 2 O VAL L 1109 ? O VAL M 1109 N THR L 1101 ? N THR M 1101 
AJ2 2 3 N GLN L 1100 ? N GLN M 1100 O ARG M 9    ? O ARG N 9    
AJ2 3 4 N VAL M 8    ? N VAL N 8    O ASP M 1457 ? O ASP N 1457 
AJ3 1 2 N TYR M 23   ? N TYR N 23   O MET M 90   ? O MET N 90   
AJ3 2 3 N ALA M 99   ? N ALA N 99   O LEU M 514  ? O LEU N 514  
AJ4 1 2 O LEU M 153  ? O LEU N 153  N TYR M 132  ? N TYR N 132  
AJ4 2 3 N ASP M 136  ? N ASP N 136  O ASP M 453  ? O ASP N 453  
AJ5 1 2 N LEU M 142  ? N LEU N 142  O VAL M 145  ? O VAL N 145  
AJ6 1 2 N TYR M 169  ? N TYR N 169  O ILE M 393  ? O ILE N 393  
AJ6 2 3 O GLU M 389  ? O GLU N 389  N ARG M 209  ? N ARG N 209  
AJ6 3 4 N VAL M 213  ? N VAL N 213  O LYS M 343  ? O LYS N 343  
AJ6 4 5 O THR M 334  ? O THR N 334  N GLU M 323  ? N GLU N 323  
AJ7 1 2 N VAL M 185  ? N VAL N 185  O GLY M 201  ? O GLY N 201  
AJ7 2 3 N ARG M 209  ? N ARG N 209  O GLU M 389  ? O GLU N 389  
AJ7 3 4 O GLY M 383  ? O GLY N 383  N VAL M 361  ? N VAL N 361  
AJ8 1 2 N ALA M 192  ? N ALA N 192  O VAL M 195  ? O VAL N 195  
AJ9 1 2 N ALA M 243  ? N ALA N 243  O LEU M 311  ? O LEU N 311  
AJ9 2 3 O ALA M 307  ? O ALA N 307  N TYR M 249  ? N TYR N 249  
AK1 1 2 N ALA M 243  ? N ALA N 243  O LEU M 311  ? O LEU N 311  
AK1 2 3 O GLU M 306  ? O GLU N 306  N THR M 289  ? N THR N 289  
AK2 1 2 O LEU M 284  ? O LEU N 284  N ALA M 268  ? N ALA N 268  
AK2 2 3 O VAL M 271  ? O VAL N 271  N GLU M 260  ? N GLU N 260  
AK2 3 4 N GLY M 257  ? N GLY N 257  O VAL M 298  ? O VAL N 298  
AK3 1 2 N ASN M 352  ? N ASN N 352  O ALA M 369  ? O ALA N 369  
AK3 2 3 N VAL M 368  ? N VAL N 368  O VAL M 377  ? O VAL N 377  
AK4 1 2 N TYR M 401  ? N TYR N 401  O VAL M 444  ? O VAL N 444  
AK4 2 3 O ARG M 445  ? O ARG N 445  N GLU M 436  ? N GLU N 436  
AK4 3 4 O GLY M 433  ? O GLY N 433  N VAL M 415  ? N VAL N 415  
AK5 1 2 N ALA M 422  ? N ALA N 422  O VAL M 427  ? O VAL N 427  
AK6 1 2 N VAL M 528  ? N VAL N 528  O ALA M 536  ? O ALA N 536  
AK6 2 3 N PHE M 535  ? N PHE N 535  O VAL O 335  ? O VAL P 315  
AK7 1 2 N PHE M 806  ? N PHE N 806  O LYS M 828  ? O LYS N 828  
AK7 2 3 N ILE M 827  ? N ILE N 827  O THR M 834  ? O THR N 834  
AK8 1 2 N PHE M 843  ? N PHE N 843  O THR M 865  ? O THR N 865  
AK8 2 3 N VAL M 866  ? N VAL N 866  O LEU M 873  ? O LEU N 873  
AK9 1 2 N VAL M 1106 ? N VAL N 1106 O VAL M 1200 ? O VAL N 1200 
AL1 1 2 N VAL M 1120 ? N VAL N 1120 O VAL M 1186 ? O VAL N 1186 
AL2 1 2 N GLN M 1124 ? N GLN N 1124 O ARG M 1133 ? O ARG N 1133 
AL3 1 2 N VAL M 1153 ? N VAL N 1153 O LEU M 1160 ? O LEU N 1160 
AL4 1 2 O TYR M 1303 ? O TYR N 1303 N VAL M 1292 ? N VAL N 1292 
AL4 2 3 O SER M 1291 ? O SER N 1291 N GLU M 1284 ? N GLU N 1284 
AL4 3 4 N GLY M 1279 ? N GLY N 1279 O VAL M 1319 ? O VAL N 1319 
AL5 1 2 O LEU M 1395 ? O LEU N 1395 N VAL M 1379 ? N VAL N 1379 
AL5 2 3 N GLU M 1380 ? N GLU N 1380 O LYS M 1418 ? O LYS N 1418 
AL6 1 2 N GLN M 1485 ? N GLN N 1485 O GLY N 76   ? O GLY O 76   
AL7 1 2 N MET N 48   ? N MET O 48   O PHE N 55   ? O PHE O 55   
AL8 1 2 N ILE O 341  ? N ILE P 321  O SER O 347  ? O SER P 327  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MG  2001 ? 4  'binding site for residue MG B 2001'  
AC2 Software D ZN  2001 ? 4  'binding site for residue ZN D 2001'  
AC3 Software D ZN  2002 ? 4  'binding site for residue ZN D 2002'  
AC4 Software D MG  2003 ? 4  'binding site for residue MG D 2003'  
AC5 Software D MG  2004 ? 2  'binding site for residue MG D 2004'  
AC6 Software D MG  2005 ? 2  'binding site for residue MG D 2005'  
AC7 Software D MG  2006 ? 3  'binding site for residue MG D 2006'  
AC8 Software D 2TM 2007 ? 15 'binding site for residue 2TM D 2007' 
AC9 Software F MG  2001 ? 3  'binding site for residue MG F 2001'  
AD1 Software L MG  2001 ? 4  'binding site for residue MG L 2001'  
AD2 Software N ZN  2001 ? 4  'binding site for residue ZN N 2001'  
AD3 Software N ZN  2002 ? 4  'binding site for residue ZN N 2002'  
AD4 Software N MG  2003 ? 4  'binding site for residue MG N 2003'  
AD5 Software N MG  2004 ? 3  'binding site for residue MG N 2004'  
AD6 Software N MG  2005 ? 2  'binding site for residue MG N 2005'  
AD7 Software N MG  2006 ? 3  'binding site for residue MG N 2006'  
AD8 Software N 2TM 2007 ? 13 'binding site for residue 2TM N 2007' 
AD9 Software P MG  2001 ? 3  'binding site for residue MG P 2001'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP B  183  ? ASP B 183  . ? 1_555 ? 
2  AC1 4  ASP B  191  ? ASP B 191  . ? 1_555 ? 
3  AC1 4  LEU B  192  ? LEU B 192  . ? 1_555 ? 
4  AC1 4  ASP B  193  ? ASP B 193  . ? 1_555 ? 
5  AC2 4  CYS D  1112 ? CYS D 1112 . ? 1_555 ? 
6  AC2 4  CYS D  1194 ? CYS D 1194 . ? 1_555 ? 
7  AC2 4  CYS D  1201 ? CYS D 1201 . ? 1_555 ? 
8  AC2 4  CYS D  1204 ? CYS D 1204 . ? 1_555 ? 
9  AC3 4  CYS D  58   ? CYS D 58   . ? 1_555 ? 
10 AC3 4  CYS D  60   ? CYS D 60   . ? 1_555 ? 
11 AC3 4  CYS D  73   ? CYS D 73   . ? 1_555 ? 
12 AC3 4  CYS D  76   ? CYS D 76   . ? 1_555 ? 
13 AC4 4  ASP D  739  ? ASP D 739  . ? 1_555 ? 
14 AC4 4  ASP D  741  ? ASP D 741  . ? 1_555 ? 
15 AC4 4  ASP D  743  ? ASP D 743  . ? 1_555 ? 
16 AC4 4  A   I  2    ? A   I 2    . ? 1_555 ? 
17 AC5 2  ASP D  739  ? ASP D 739  . ? 1_555 ? 
18 AC5 2  2TM Z  .    ? 2TM D 2007 . ? 1_555 ? 
19 AC6 2  ASP B  168  ? ASP B 168  . ? 1_555 ? 
20 AC6 2  LYS D  840  ? LYS D 840  . ? 1_555 ? 
21 AC7 3  TRP D  897  ? TRP D 897  . ? 1_555 ? 
22 AC7 3  GLU D  898  ? GLU D 898  . ? 1_555 ? 
23 AC7 3  ILE D  900  ? ILE D 900  . ? 1_555 ? 
24 AC8 15 ARG C  557  ? ARG C 557  . ? 1_555 ? 
25 AC8 15 ARG C  879  ? ARG C 879  . ? 1_555 ? 
26 AC8 15 ARG D  704  ? ARG D 704  . ? 1_555 ? 
27 AC8 15 PRO D  706  ? PRO D 706  . ? 1_555 ? 
28 AC8 15 ASN D  737  ? ASN D 737  . ? 1_555 ? 
29 AC8 15 ASP D  739  ? ASP D 739  . ? 1_555 ? 
30 AC8 15 ARG D  783  ? ARG D 783  . ? 1_555 ? 
31 AC8 15 ARG D  1029 ? ARG D 1029 . ? 1_555 ? 
32 AC8 15 GLN D  1235 ? GLN D 1235 . ? 1_555 ? 
33 AC8 15 MET D  1238 ? MET D 1238 . ? 1_555 ? 
34 AC8 15 ARG D  1239 ? ARG D 1239 . ? 1_555 ? 
35 AC8 15 THR D  1240 ? THR D 1240 . ? 1_555 ? 
36 AC8 15 MG  W  .    ? MG  D 2004 . ? 1_555 ? 
37 AC8 15 DG  G  14   ? DG  G 14   . ? 1_555 ? 
38 AC8 15 A   I  2    ? A   I 2    . ? 1_555 ? 
39 AC9 3  ALA F  312  ? ALA F 292  . ? 1_555 ? 
40 AC9 3  GLY F  316  ? GLY F 296  . ? 1_555 ? 
41 AC9 3  TRP F  319  ? TRP F 299  . ? 1_555 ? 
42 AD1 4  ASP K  183  ? ASP L 183  . ? 1_555 ? 
43 AD1 4  ASP K  191  ? ASP L 191  . ? 1_555 ? 
44 AD1 4  LEU K  192  ? LEU L 192  . ? 1_555 ? 
45 AD1 4  ASP K  193  ? ASP L 193  . ? 1_555 ? 
46 AD2 4  CYS M  1112 ? CYS N 1112 . ? 1_555 ? 
47 AD2 4  CYS M  1194 ? CYS N 1194 . ? 1_555 ? 
48 AD2 4  CYS M  1201 ? CYS N 1201 . ? 1_555 ? 
49 AD2 4  CYS M  1204 ? CYS N 1204 . ? 1_555 ? 
50 AD3 4  CYS M  58   ? CYS N 58   . ? 1_555 ? 
51 AD3 4  CYS M  60   ? CYS N 60   . ? 1_555 ? 
52 AD3 4  CYS M  73   ? CYS N 73   . ? 1_555 ? 
53 AD3 4  CYS M  76   ? CYS N 76   . ? 1_555 ? 
54 AD4 4  ASP M  739  ? ASP N 739  . ? 1_555 ? 
55 AD4 4  ASP M  741  ? ASP N 741  . ? 1_555 ? 
56 AD4 4  ASP M  743  ? ASP N 743  . ? 1_555 ? 
57 AD4 4  A   R  2    ? A   S 2    . ? 1_555 ? 
58 AD5 3  ARG L  879  ? ARG M 879  . ? 1_555 ? 
59 AD5 3  ASP M  739  ? ASP N 739  . ? 1_555 ? 
60 AD5 3  2TM IA .    ? 2TM N 2007 . ? 1_555 ? 
61 AD6 2  ASP K  168  ? ASP L 168  . ? 1_555 ? 
62 AD6 2  LYS M  840  ? LYS N 840  . ? 1_555 ? 
63 AD7 3  TRP M  897  ? TRP N 897  . ? 1_555 ? 
64 AD7 3  GLU M  898  ? GLU N 898  . ? 1_555 ? 
65 AD7 3  ILE M  900  ? ILE N 900  . ? 1_555 ? 
66 AD8 13 ARG L  557  ? ARG M 557  . ? 1_555 ? 
67 AD8 13 ARG L  879  ? ARG M 879  . ? 1_555 ? 
68 AD8 13 ARG M  704  ? ARG N 704  . ? 1_555 ? 
69 AD8 13 PRO M  706  ? PRO N 706  . ? 1_555 ? 
70 AD8 13 ASN M  737  ? ASN N 737  . ? 1_555 ? 
71 AD8 13 ASP M  739  ? ASP N 739  . ? 1_555 ? 
72 AD8 13 ARG M  1029 ? ARG N 1029 . ? 1_555 ? 
73 AD8 13 GLN M  1235 ? GLN N 1235 . ? 1_555 ? 
74 AD8 13 MET M  1238 ? MET N 1238 . ? 1_555 ? 
75 AD8 13 ARG M  1239 ? ARG N 1239 . ? 1_555 ? 
76 AD8 13 MG  FA .    ? MG  N 2004 . ? 1_555 ? 
77 AD8 13 DG  P  14   ? DG  Q 14   . ? 1_555 ? 
78 AD8 13 A   R  2    ? A   S 2    . ? 1_555 ? 
79 AD9 3  ALA O  312  ? ALA P 292  . ? 1_555 ? 
80 AD9 3  GLY O  316  ? GLY P 296  . ? 1_555 ? 
81 AD9 3  TRP O  319  ? TRP P 299  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5X22 
_atom_sites.fract_transf_matrix[1][1]   0.005365 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000788 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009586 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003400 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1  4    ? 30.489  16.915  145.111  1.00 75.97  ? 4    SER A N     1 
ATOM   2     C  CA    . SER A  1  4    ? 30.390  15.906  144.061  1.00 79.41  ? 4    SER A CA    1 
ATOM   3     C  C     . SER A  1  4    ? 31.400  16.158  142.944  1.00 74.12  ? 4    SER A C     1 
ATOM   4     O  O     . SER A  1  4    ? 31.170  15.794  141.791  1.00 70.60  ? 4    SER A O     1 
ATOM   5     C  CB    . SER A  1  4    ? 28.973  15.864  143.489  1.00 79.19  ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A  1  4    ? 28.862  14.876  142.480  1.00 72.25  ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A  1  5    ? 32.517  16.785  143.297  1.00 74.88  ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A  1  5    ? 33.590  17.062  142.349  1.00 67.70  ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A  1  5    ? 34.855  16.331  142.782  1.00 65.61  ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A  1  5    ? 35.155  16.250  143.973  1.00 68.83  ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A  1  5    ? 33.849  18.570  142.270  1.00 64.35  ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A  1  5    ? 35.181  18.967  141.641  1.00 64.46  ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A  1  5    ? 35.013  19.467  140.213  1.00 66.37  ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A  1  5    ? 36.341  19.940  139.632  1.00 61.36  ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A  1  5    ? 36.945  21.052  140.421  1.00 51.91  ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A  1  6    ? 35.595  15.795  141.817  1.00 63.20  ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A  1  6    ? 36.833  15.092  142.122  1.00 61.33  ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A  1  6    ? 37.919  16.097  142.485  1.00 59.20  ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A  1  6    ? 38.226  16.998  141.706  1.00 60.67  ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A  1  6    ? 37.282  14.256  140.920  1.00 63.41  ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A  1  6    ? 37.730  12.812  141.171  1.00 58.84  ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A  1  6    ? 38.793  12.745  142.258  1.00 56.03  ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A  1  6    ? 36.543  11.936  141.530  1.00 57.68  ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A  1  7    ? 38.496  15.943  143.673  1.00 57.41  ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A  1  7    ? 39.615  16.781  144.089  1.00 54.37  ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A  1  7    ? 40.902  16.288  143.435  1.00 49.63  ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A  1  7    ? 40.883  15.328  142.666  1.00 50.82  ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A  1  7    ? 39.753  16.785  145.614  1.00 53.69  ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A  1  7    ? 38.697  17.608  146.340  1.00 59.61  ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A  1  7    ? 38.841  19.092  146.032  1.00 63.33  ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A  1  7    ? 37.847  19.928  146.826  1.00 59.53  ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A  1  7    ? 37.970  21.378  146.511  1.00 56.49  ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A  1  8    ? 42.014  16.952  143.739  1.00 46.58  ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A  1  8    ? 43.315  16.583  143.187  1.00 44.14  ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A  1  8    ? 43.642  15.117  143.460  1.00 46.58  ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A  1  8    ? 43.402  14.620  144.560  1.00 52.67  ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A  1  8    ? 44.403  17.483  143.750  1.00 45.44  ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A  1  9    ? 44.179  14.415  142.450  1.00 45.79  ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A  1  9    ? 44.499  12.991  142.570  1.00 42.81  ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A  1  9    ? 45.928  12.738  143.045  1.00 40.03  ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A  1  9    ? 46.702  13.676  143.238  1.00 35.94  ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A  1  9    ? 44.337  12.487  141.135  1.00 43.23  ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A  1  9    ? 44.581  13.706  140.258  1.00 43.79  ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A  1  9    ? 44.555  14.942  141.128  1.00 45.08  ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A  1  10   ? 46.262  11.463  143.218  1.00 38.91  ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A  1  10   ? 47.603  11.049  143.599  1.00 39.73  ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A  1  10   ? 48.440  10.724  142.364  1.00 39.51  ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A  1  10   ? 47.952  10.120  141.389  1.00 40.42  ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A  1  10   ? 47.593  9.851   144.590  1.00 38.95  ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A  1  10   ? 47.055  8.591   143.928  1.00 41.42  ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A  1  10   ? 48.988  9.604   145.149  1.00 44.47  ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A  1  11   ? 49.695  11.165  142.421  1.00 39.95  ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A  1  11   ? 50.671  10.991  141.357  1.00 41.37  ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A  1  11   ? 51.788  10.076  141.852  1.00 41.68  ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A  1  11   ? 52.585  10.460  142.708  1.00 46.88  ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A  1  11   ? 51.246  12.358  140.970  1.00 44.95  ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A  1  11   ? 52.214  12.320  139.817  1.00 45.88  ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A  1  11   ? 53.122  13.351  139.634  1.00 46.72  ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A  1  11   ? 52.204  11.276  138.905  1.00 44.46  ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A  1  11   ? 54.013  13.333  138.579  1.00 42.56  ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A  1  11   ? 53.094  11.254  137.845  1.00 43.97  ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A  1  11   ? 53.998  12.286  137.682  1.00 41.84  ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A  1  12   ? 51.843  8.867   141.305  1.00 38.03  ? 12   THR A N     1 
ATOM   64    C  CA    . THR A  1  12   ? 52.861  7.894   141.671  1.00 35.19  ? 12   THR A CA    1 
ATOM   65    C  C     . THR A  1  12   ? 53.911  7.807   140.570  1.00 37.04  ? 12   THR A C     1 
ATOM   66    O  O     . THR A  1  12   ? 53.583  7.862   139.385  1.00 37.91  ? 12   THR A O     1 
ATOM   67    C  CB    . THR A  1  12   ? 52.243  6.501   141.897  1.00 32.46  ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A  1  12   ? 51.142  6.605   142.809  1.00 36.55  ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1  12   ? 53.276  5.536   142.461  1.00 31.02  ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A  1  13   ? 55.175  7.686   140.966  1.00 38.62  ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A  1  13   ? 56.275  7.583   140.014  1.00 32.02  ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A  1  13   ? 57.106  6.332   140.282  1.00 32.53  ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A  1  13   ? 57.551  6.108   141.407  1.00 38.29  ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A  1  13   ? 57.196  8.817   140.086  1.00 30.09  ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1  13   ? 58.362  8.664   139.128  1.00 31.22  ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1  13   ? 56.414  10.088  139.785  1.00 35.33  ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A  1  14   ? 57.301  5.511   139.254  1.00 32.13  ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A  1  14   ? 58.148  4.327   139.374  1.00 34.91  ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A  1  14   ? 59.186  4.294   138.256  1.00 37.32  ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A  1  14   ? 58.836  4.147   137.093  1.00 39.42  ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A  1  14   ? 57.299  3.053   139.342  1.00 32.95  ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A  1  14   ? 56.317  2.927   140.499  1.00 37.83  ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A  1  14   ? 55.596  1.587   140.475  1.00 40.62  ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A  1  14   ? 54.666  1.475   139.355  1.00 43.18  ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A  1  14   ? 53.350  1.637   139.458  1.00 45.03  ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A  1  14   ? 52.803  1.915   140.634  1.00 41.56  ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A  1  14   ? 52.579  1.515   138.386  1.00 45.24  ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A  1  15   ? 60.464  4.414   138.604  1.00 40.75  ? 15   THR A N     1 
ATOM   89    C  CA    . THR A  1  15   ? 61.509  4.507   137.587  1.00 41.24  ? 15   THR A CA    1 
ATOM   90    C  C     . THR A  1  15   ? 62.531  3.371   137.651  1.00 41.80  ? 15   THR A C     1 
ATOM   91    O  O     . THR A  1  15   ? 62.824  2.840   138.722  1.00 37.89  ? 15   THR A O     1 
ATOM   92    C  CB    . THR A  1  15   ? 62.268  5.850   137.679  1.00 39.01  ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A  1  15   ? 63.097  5.856   138.848  1.00 43.29  ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A  1  15   ? 61.294  7.016   137.743  1.00 33.65  ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A  1  16   ? 63.060  3.003   136.487  1.00 46.12  ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A  1  16   ? 64.210  2.114   136.404  1.00 44.95  ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A  1  16   ? 65.259  2.805   135.551  1.00 42.61  ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A  1  16   ? 65.071  2.976   134.345  1.00 43.68  ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A  1  16   ? 63.826  0.785   135.756  1.00 41.14  ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A  1  16   ? 62.618  0.106   136.373  1.00 48.30  ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A  1  16   ? 62.150  -1.086  135.560  1.00 54.93  ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A  1  16   ? 62.750  -1.427  134.541  1.00 47.58  ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A  1  16   ? 61.073  -1.724  136.006  1.00 61.85  ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A  1  17   ? 66.364  3.196   136.177  1.00 45.84  ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A  1  17   ? 67.424  3.904   135.484  1.00 47.80  ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A  1  17   ? 66.931  5.191   134.849  1.00 42.69  ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A  1  17   ? 65.902  5.737   135.248  1.00 40.50  ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A  1  18   ? 67.669  5.673   133.854  1.00 41.61  ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A  1  18   ? 67.264  6.852   133.099  1.00 46.50  ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A  1  18   ? 66.501  6.423   131.850  1.00 49.39  ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A  1  18   ? 66.047  7.257   131.065  1.00 46.35  ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A  1  18   ? 68.491  7.667   132.688  1.00 39.92  ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A  1  18   ? 69.387  8.085   133.839  1.00 37.28  ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A  1  18   ? 70.647  8.765   133.329  1.00 36.70  ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A  1  18   ? 70.340  9.902   132.469  1.00 40.24  ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A  1  18   ? 70.142  11.140  132.911  1.00 45.57  ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A  1  18   ? 70.222  11.402  134.208  1.00 48.87  ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A  1  18   ? 69.867  12.117  132.057  1.00 45.05  ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A  1  19   ? 66.379  5.112   131.668  1.00 46.68  ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A  1  19   ? 65.800  4.550   130.452  1.00 46.56  ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A  1  19   ? 64.271  4.537   130.418  1.00 40.37  ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A  1  19   ? 63.667  4.861   129.396  1.00 40.28  ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A  1  19   ? 66.329  3.129   130.225  1.00 51.91  ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A  1  19   ? 67.847  2.995   130.288  1.00 53.06  ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A  1  19   ? 68.549  3.554   129.060  1.00 54.36  ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A  1  19   ? 67.860  4.029   128.133  1.00 53.26  ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A  1  19   ? 69.798  3.512   129.022  1.00 54.61  ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A  1  20   ? 63.648  4.164   131.532  1.00 34.90  ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A  1  20   ? 62.222  3.855   131.530  1.00 31.18  ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A  1  20   ? 61.506  4.321   132.792  1.00 34.67  ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A  1  20   ? 62.102  4.388   133.866  1.00 37.49  ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A  1  20   ? 62.031  2.347   131.346  1.00 32.37  ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A  1  20   ? 60.621  1.849   131.568  1.00 37.02  ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A  1  20   ? 60.292  1.118   132.704  1.00 41.25  ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A  1  20   ? 59.619  2.104   130.642  1.00 35.42  ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A  1  20   ? 59.005  0.655   132.909  1.00 39.26  ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A  1  20   ? 58.330  1.647   130.840  1.00 35.50  ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A  1  20   ? 58.028  0.923   131.973  1.00 37.31  ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A  1  20   ? 56.746  0.466   132.165  1.00 39.38  ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A  1  21   ? 60.222  4.644   132.657  1.00 35.38  ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A  1  21   ? 59.421  5.024   133.807  1.00 32.40  ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A  1  21   ? 57.928  4.801   133.648  1.00 33.76  ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A  1  21   ? 57.404  4.766   132.536  1.00 33.95  ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A  1  22   ? 57.245  4.652   134.779  1.00 34.07  ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A  1  22   ? 55.795  4.528   134.828  1.00 29.56  ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A  1  22   ? 55.251  5.640   135.707  1.00 29.77  ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A  1  22   ? 55.777  5.898   136.791  1.00 34.06  ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A  1  22   ? 55.381  3.179   135.416  1.00 29.83  ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A  1  22   ? 56.050  1.984   134.776  1.00 31.57  ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A  1  22   ? 55.487  0.668   135.274  1.00 39.97  ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A  1  22   ? 54.531  0.696   136.078  1.00 43.94  ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A  1  22   ? 55.999  -0.394  134.862  1.00 43.53  ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A  1  23   ? 54.197  6.298   135.243  1.00 30.59  ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A  1  23   ? 53.613  7.412   135.977  1.00 32.31  ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A  1  23   ? 52.115  7.196   136.145  1.00 36.45  ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A  1  23   ? 51.370  7.209   135.172  1.00 39.51  ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A  1  23   ? 53.875  8.729   135.240  1.00 31.07  ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A  1  23   ? 55.333  9.001   134.979  1.00 31.84  ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A  1  23   ? 56.058  9.831   135.818  1.00 33.95  ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A  1  23   ? 55.978  8.428   133.895  1.00 32.10  ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A  1  23   ? 57.397  10.083  135.580  1.00 33.01  ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A  1  23   ? 57.316  8.674   133.654  1.00 31.05  ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A  1  23   ? 58.026  9.503   134.497  1.00 32.79  ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A  1  24   ? 51.671  7.007   137.382  1.00 36.52  ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A  1  24   ? 50.261  6.751   137.639  1.00 31.85  ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A  1  24   ? 49.567  7.996   138.184  1.00 33.44  ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A  1  24   ? 50.121  8.713   139.009  1.00 39.76  ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A  1  24   ? 50.077  5.580   138.620  1.00 34.42  ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A  1  24   ? 48.608  5.210   138.738  1.00 41.54  ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A  1  24   ? 50.892  4.380   138.163  1.00 34.38  ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A  1  25   ? 48.359  8.259   137.702  1.00 31.85  ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A  1  25   ? 47.566  9.374   138.190  1.00 35.67  ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A  1  25   ? 46.162  8.859   138.479  1.00 40.58  ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A  1  25   ? 45.449  8.445   137.555  1.00 40.56  ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A  1  25   ? 47.512  10.466  137.123  1.00 31.24  ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A  1  25   ? 47.295  11.909  137.572  1.00 32.50  ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A  1  25   ? 48.525  12.424  138.298  1.00 34.27  ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A  1  25   ? 46.961  12.791  136.380  1.00 33.05  ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A  1  26   ? 45.771  8.851   139.754  1.00 43.44  ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A  1  26   ? 44.430  8.361   140.107  1.00 44.36  ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A  1  26   ? 43.823  9.010   141.351  1.00 42.49  ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A  1  26   ? 44.547  9.426   142.241  1.00 40.83  ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A  1  26   ? 44.442  6.838   140.278  1.00 41.75  ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A  1  26   ? 45.215  6.346   141.489  1.00 44.41  ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A  1  26   ? 44.868  4.915   141.854  1.00 51.51  ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A  1  26   ? 43.747  4.472   141.526  1.00 44.19  ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A  1  26   ? 45.716  4.232   142.467  1.00 63.07  ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A  1  27   ? 42.484  9.071   141.434  1.00 42.11  ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A  1  27   ? 41.480  8.806   140.400  1.00 40.50  ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A  1  27   ? 41.273  10.014  139.492  1.00 40.48  ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A  1  27   ? 41.538  11.146  139.900  1.00 37.54  ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A  1  27   ? 40.216  8.539   141.215  1.00 38.48  ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A  1  27   ? 40.380  9.393   142.411  1.00 43.77  ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A  1  27   ? 41.854  9.388   142.728  1.00 45.43  ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A  1  28   ? 40.800  9.768   138.276  1.00 38.43  ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A  1  28   ? 40.417  10.837  137.366  1.00 33.12  ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A  1  28   ? 38.960  10.647  136.974  1.00 34.85  ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A  1  28   ? 38.443  9.532   137.028  1.00 37.14  ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A  1  28   ? 41.302  10.821  136.122  1.00 32.58  ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A  1  28   ? 42.791  11.081  136.353  1.00 33.67  ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A  1  28   ? 43.588  10.758  135.104  1.00 35.78  ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A  1  28   ? 43.020  12.522  136.776  1.00 35.51  ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A  1  29   ? 38.296  11.731  136.587  1.00 35.67  ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A  1  29   ? 36.916  11.644  136.127  1.00 38.51  ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A  1  29   ? 36.856  10.748  134.898  1.00 36.91  ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A  1  29   ? 37.825  10.659  134.145  1.00 34.96  ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A  1  29   ? 36.361  13.034  135.805  1.00 44.90  ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A  1  29   ? 36.058  13.889  137.030  1.00 51.12  ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A  1  29   ? 34.831  13.413  137.791  1.00 62.47  ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A  1  29   ? 34.048  12.618  137.229  1.00 61.42  ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A  1  29   ? 34.649  13.836  138.952  1.00 67.02  ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A  1  30   ? 35.725  10.074  134.709  1.00 38.48  ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A  1  30   ? 35.588  9.098   133.634  1.00 38.18  ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A  1  30   ? 35.870  9.718   132.269  1.00 37.81  ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A  1  30   ? 35.249  10.709  131.884  1.00 38.97  ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A  1  30   ? 34.188  8.482   133.649  1.00 44.09  ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A  1  30   ? 34.034  7.272   132.741  1.00 50.64  ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A  1  30   ? 32.572  6.900   132.551  1.00 50.31  ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A  1  30   ? 31.845  7.930   131.814  1.00 49.44  ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A  1  30   ? 31.795  8.002   130.488  1.00 49.95  ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A  1  30   ? 32.430  7.103   129.748  1.00 47.19  ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A  1  30   ? 31.110  8.974   129.900  1.00 47.10  ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A  1  31   ? 36.808  9.123   131.540  1.00 34.16  ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A  1  31   ? 37.166  9.610   130.223  1.00 32.15  ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A  1  31   ? 38.450  10.416  130.188  1.00 28.59  ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A  1  31   ? 39.052  10.578  129.129  1.00 29.36  ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A  1  32   ? 38.878  10.920  131.342  1.00 27.75  ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A  1  32   ? 40.072  11.762  131.402  1.00 26.41  ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A  1  32   ? 41.373  10.989  131.233  1.00 26.29  ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A  1  32   ? 42.431  11.585  131.019  1.00 26.17  ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A  1  32   ? 40.106  12.574  132.694  1.00 29.15  ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A  1  32   ? 39.481  13.927  132.567  1.00 30.71  ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A  1  32   ? 38.122  14.092  132.758  1.00 32.38  ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A  1  32   ? 40.250  15.033  132.244  1.00 30.36  ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A  1  32   ? 37.542  15.334  132.638  1.00 34.56  ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A  1  32   ? 39.673  16.283  132.123  1.00 32.08  ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A  1  32   ? 38.316  16.433  132.320  1.00 33.93  ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A  1  33   ? 41.294  9.667   131.335  1.00 26.72  ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A  1  33   ? 42.449  8.821   131.109  1.00 27.63  ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A  1  33   ? 42.995  9.018   129.709  1.00 27.36  ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A  1  33   ? 44.202  9.157   129.514  1.00 26.82  ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A  1  34   ? 42.096  9.043   128.731  1.00 26.13  ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A  1  34   ? 42.476  9.274   127.344  1.00 24.78  ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A  1  34   ? 42.766  10.754  127.111  1.00 24.73  ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A  1  34   ? 43.726  11.108  126.419  1.00 26.84  ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A  1  34   ? 41.367  8.816   126.380  1.00 22.66  ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A  1  34   ? 41.801  9.009   124.935  1.00 22.87  ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A  1  34   ? 41.006  7.363   126.644  1.00 24.52  ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A  1  35   ? 41.931  11.605  127.704  1.00 23.29  ? 35   THR A N     1 
ATOM   250   C  CA    . THR A  1  35   ? 42.035  13.055  127.557  1.00 22.71  ? 35   THR A CA    1 
ATOM   251   C  C     . THR A  1  35   ? 43.416  13.579  127.938  1.00 22.28  ? 35   THR A C     1 
ATOM   252   O  O     . THR A  1  35   ? 43.965  14.446  127.263  1.00 19.92  ? 35   THR A O     1 
ATOM   253   C  CB    . THR A  1  35   ? 40.964  13.780  128.398  1.00 23.64  ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A  1  35   ? 39.662  13.332  128.002  1.00 23.43  ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A  1  35   ? 41.053  15.288  128.210  1.00 23.20  ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A  1  36   ? 43.963  13.073  129.038  1.00 24.21  ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A  1  36   ? 45.345  13.377  129.399  1.00 26.22  ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A  1  36   ? 46.342  12.483  128.663  1.00 27.24  ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A  1  36   ? 47.408  12.937  128.241  1.00 23.58  ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A  1  36   ? 45.550  13.267  130.911  1.00 27.86  ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A  1  36   ? 44.894  14.364  131.751  1.00 28.98  ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A  1  36   ? 45.239  14.193  133.220  1.00 36.12  ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A  1  36   ? 45.321  15.735  131.254  1.00 28.30  ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A  1  37   ? 45.980  11.212  128.512  1.00 27.92  ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A  1  37   ? 46.882  10.199  127.993  1.00 27.37  ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A  1  37   ? 47.402  10.420  126.586  1.00 25.28  ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A  1  37   ? 48.612  10.445  126.367  1.00 25.40  ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A  1  38   ? 46.496  10.581  125.627  1.00 23.59  ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A  1  38   ? 46.912  10.725  124.231  1.00 25.27  ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A  1  38   ? 47.710  11.991  123.867  1.00 25.78  ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A  1  38   ? 48.706  11.891  123.149  1.00 27.36  ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A  1  38   ? 45.734  10.533  123.270  1.00 26.34  ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A  1  38   ? 46.089  9.642   122.094  1.00 25.27  ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A  1  38   ? 46.709  8.591   122.262  1.00 23.11  ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A  1  38   ? 45.702  10.061  120.896  1.00 26.59  ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A  1  39   ? 47.277  13.178  124.340  1.00 23.21  ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A  1  39   ? 48.037  14.387  124.000  1.00 22.39  ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A  1  39   ? 49.465  14.322  124.510  1.00 24.21  ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A  1  39   ? 50.382  14.770  123.823  1.00 25.97  ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A  1  39   ? 47.285  15.493  124.740  1.00 19.98  ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A  1  39   ? 45.926  14.978  124.886  1.00 22.46  ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A  1  39   ? 46.058  13.509  125.095  1.00 23.24  ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A  1  40   ? 49.647  13.773  125.705  1.00 23.36  ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A  1  40   ? 50.983  13.612  126.255  1.00 24.12  ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A  1  40   ? 51.792  12.659  125.389  1.00 22.55  ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A  1  40   ? 52.961  12.908  125.117  1.00 25.59  ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A  1  40   ? 50.925  13.124  127.702  1.00 26.79  ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A  1  40   ? 50.424  14.169  128.702  1.00 26.46  ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A  1  40   ? 50.448  13.620  130.119  1.00 29.03  ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A  1  40   ? 51.250  15.444  128.598  1.00 22.05  ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A  1  41   ? 51.158  11.580  124.940  1.00 20.94  ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A  1  41   ? 51.823  10.614  124.073  1.00 22.98  ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A  1  41   ? 52.279  11.252  122.763  1.00 23.76  ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A  1  41   ? 53.425  11.080  122.344  1.00 23.51  ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A  1  41   ? 50.908  9.424   123.782  1.00 22.23  ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A  1  41   ? 51.510  8.416   122.818  1.00 20.97  ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A  1  41   ? 50.643  7.178   122.679  1.00 24.34  ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A  1  41   ? 51.277  6.174   121.829  1.00 25.43  ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A  1  41   ? 51.136  6.116   120.509  1.00 25.80  ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A  1  41   ? 50.375  7.004   119.882  1.00 24.76  ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A  1  41   ? 51.754  5.170   119.816  1.00 25.20  ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A  1  42   ? 51.377  11.993  122.126  1.00 24.16  ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A  1  42   ? 51.667  12.640  120.851  1.00 23.01  ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A  1  42   ? 52.827  13.620  120.970  1.00 22.11  ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A  1  42   ? 53.723  13.640  120.127  1.00 23.42  ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A  1  42   ? 50.426  13.359  120.319  1.00 22.29  ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A  1  42   ? 49.288  12.428  119.938  1.00 24.03  ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A  1  42   ? 48.082  13.207  119.439  1.00 26.69  ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A  1  42   ? 48.407  14.041  118.286  1.00 26.30  ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A  1  42   ? 48.395  13.612  117.028  1.00 25.75  ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A  1  42   ? 48.077  12.353  116.760  1.00 24.26  ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A  1  42   ? 48.705  14.440  116.039  1.00 26.48  ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A  1  43   ? 52.806  14.427  122.024  1.00 22.50  ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A  1  43   ? 53.854  15.411  122.254  1.00 24.45  ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A  1  43   ? 55.175  14.732  122.612  1.00 24.50  ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A  1  43   ? 56.241  15.154  122.163  1.00 26.78  ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A  1  43   ? 53.451  16.412  123.356  1.00 24.79  ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A  1  43   ? 52.201  17.186  122.934  1.00 22.62  ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A  1  43   ? 54.588  17.377  123.653  1.00 26.31  ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A  1  43   ? 51.643  18.077  124.013  1.00 24.14  ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A  1  44   ? 55.095  13.671  123.410  1.00 22.66  ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A  1  44   ? 56.282  12.928  123.819  1.00 24.10  ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A  1  44   ? 57.034  12.332  122.634  1.00 25.75  ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A  1  44   ? 58.266  12.322  122.608  1.00 28.72  ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A  1  44   ? 55.912  11.831  124.816  1.00 21.57  ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A  1  44   ? 55.760  12.281  126.270  1.00 22.36  ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A  1  44   ? 55.052  11.211  127.075  1.00 22.24  ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A  1  44   ? 57.116  12.604  126.874  1.00 26.16  ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A  1  45   ? 56.293  11.838  121.652  1.00 23.70  ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A  1  45   ? 56.909  11.231  120.478  1.00 22.63  ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A  1  45   ? 57.472  12.276  119.513  1.00 23.03  ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A  1  45   ? 58.609  12.165  119.058  1.00 23.38  ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A  1  45   ? 55.897  10.329  119.766  1.00 20.77  ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A  1  45   ? 55.417  9.133   120.599  1.00 17.75  ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A  1  45   ? 54.336  8.347   119.873  1.00 16.46  ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A  1  45   ? 56.592  8.236   120.946  1.00 19.79  ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A  1  46   ? 56.662  13.280  119.198  1.00 24.45  ? 46   SER A N     1 
ATOM   338   C  CA    . SER A  1  46   ? 57.036  14.318  118.238  1.00 27.96  ? 46   SER A CA    1 
ATOM   339   C  C     . SER A  1  46   ? 57.915  15.465  118.754  1.00 28.85  ? 46   SER A C     1 
ATOM   340   O  O     . SER A  1  46   ? 58.888  15.853  118.101  1.00 28.69  ? 46   SER A O     1 
ATOM   341   C  CB    . SER A  1  46   ? 55.778  14.903  117.592  1.00 28.99  ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A  1  46   ? 54.833  15.295  118.571  1.00 24.86  ? 46   SER A OG    1 
ATOM   343   N  N     . SER A  1  47   ? 57.549  16.029  119.901  1.00 26.96  ? 47   SER A N     1 
ATOM   344   C  CA    . SER A  1  47   ? 58.060  17.346  120.286  1.00 27.01  ? 47   SER A CA    1 
ATOM   345   C  C     . SER A  1  47   ? 59.229  17.427  121.276  1.00 25.99  ? 47   SER A C     1 
ATOM   346   O  O     . SER A  1  47   ? 59.707  18.523  121.564  1.00 22.86  ? 47   SER A O     1 
ATOM   347   C  CB    . SER A  1  47   ? 56.904  18.227  120.763  1.00 28.33  ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A  1  47   ? 55.910  18.315  119.757  1.00 30.62  ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A  1  48   ? 59.697  16.292  121.786  1.00 27.15  ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A  1  48   ? 60.744  16.309  122.809  1.00 29.39  ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A  1  48   ? 62.144  16.525  122.229  1.00 34.48  ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A  1  48   ? 62.609  15.739  121.400  1.00 36.16  ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A  1  48   ? 60.723  15.031  123.670  1.00 28.42  ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A  1  48   ? 59.338  14.830  124.282  1.00 28.10  ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A  1  48   ? 61.768  15.111  124.766  1.00 27.65  ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A  1  48   ? 58.884  15.978  125.153  1.00 30.13  ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A  1  49   ? 62.815  17.605  122.664  1.00 32.63  ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A  1  49   ? 64.184  17.932  122.246  1.00 30.26  ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A  1  49   ? 65.179  16.856  122.675  1.00 32.42  ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A  1  49   ? 64.960  16.182  123.680  1.00 32.82  ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A  1  49   ? 64.469  19.242  122.987  1.00 28.21  ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A  1  49   ? 63.118  19.829  123.253  1.00 28.60  ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A  1  49   ? 62.247  18.646  123.536  1.00 29.78  ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A  1  50   ? 66.262  16.708  121.920  1.00 36.16  ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A  1  50   ? 67.255  15.684  122.191  1.00 38.63  ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A  1  50   ? 68.500  15.885  121.351  1.00 39.84  ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A  1  50   ? 68.719  16.966  120.804  1.00 38.15  ? 50   GLY A O     1 
ATOM   368   N  N     . THR A  1  51   ? 69.325  14.847  121.253  1.00 39.72  ? 51   THR A N     1 
ATOM   369   C  CA    . THR A  1  51   ? 70.566  14.939  120.492  1.00 41.09  ? 51   THR A CA    1 
ATOM   370   C  C     . THR A  1  51   ? 70.726  13.804  119.484  1.00 40.81  ? 51   THR A C     1 
ATOM   371   O  O     . THR A  1  51   ? 70.286  12.676  119.720  1.00 38.59  ? 51   THR A O     1 
ATOM   372   C  CB    . THR A  1  51   ? 71.793  14.965  121.419  1.00 43.49  ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A  1  51   ? 71.738  13.845  122.311  1.00 47.53  ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A  1  51   ? 71.826  16.258  122.228  1.00 44.54  ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A  1  52   ? 71.361  14.120  118.359  1.00 37.68  ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A  1  52   ? 71.620  13.144  117.308  1.00 34.88  ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A  1  52   ? 72.844  13.560  116.498  1.00 33.36  ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A  1  52   ? 73.222  14.733  116.496  1.00 31.49  ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A  1  52   ? 70.410  13.009  116.405  1.00 38.16  ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A  1  53   ? 73.460  12.605  115.804  1.00 33.20  ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A  1  53   ? 74.646  12.908  115.014  1.00 30.47  ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A  1  53   ? 74.221  13.550  113.706  1.00 32.63  ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A  1  53   ? 73.571  12.912  112.879  1.00 36.73  ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A  1  53   ? 75.427  11.629  114.676  1.00 26.63  ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A  1  53   ? 76.600  11.951  113.769  1.00 31.60  ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A  1  53   ? 75.895  10.937  115.944  1.00 29.67  ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A  1  54   ? 74.596  14.811  113.516  1.00 34.61  ? 54   THR A N     1 
ATOM   388   C  CA    . THR A  1  54   ? 74.211  15.530  112.306  1.00 35.03  ? 54   THR A CA    1 
ATOM   389   C  C     . THR A  1  54   ? 75.263  15.525  111.200  1.00 36.23  ? 54   THR A C     1 
ATOM   390   O  O     . THR A  1  54   ? 74.963  15.895  110.064  1.00 39.11  ? 54   THR A O     1 
ATOM   391   C  CB    . THR A  1  54   ? 73.810  16.989  112.608  1.00 33.46  ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A  1  54   ? 74.940  17.708  113.117  1.00 33.60  ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A  1  54   ? 72.680  17.033  113.623  1.00 34.40  ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A  1  55   ? 76.486  15.108  111.515  1.00 35.58  ? 55   SER A N     1 
ATOM   395   C  CA    . SER A  1  55   ? 77.527  15.090  110.485  1.00 36.24  ? 55   SER A CA    1 
ATOM   396   C  C     . SER A  1  55   ? 78.644  14.090  110.762  1.00 36.96  ? 55   SER A C     1 
ATOM   397   O  O     . SER A  1  55   ? 78.897  13.732  111.910  1.00 43.12  ? 55   SER A O     1 
ATOM   398   C  CB    . SER A  1  55   ? 78.104  16.495  110.277  1.00 37.08  ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A  1  55   ? 78.960  16.537  109.149  1.00 34.13  ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A  1  56   ? 79.306  13.635  109.702  1.00 35.27  ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A  1  56   ? 80.436  12.721  109.835  1.00 35.53  ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A  1  56   ? 81.559  13.074  108.865  1.00 40.99  ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A  1  56   ? 81.331  13.217  107.664  1.00 40.83  ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A  1  56   ? 80.022  11.253  109.573  1.00 35.54  ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A  1  56   ? 81.239  10.342  109.597  1.00 36.57  ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A  1  56   ? 78.995  10.787  110.588  1.00 37.58  ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A  1  57   ? 82.773  13.217  109.389  1.00 43.98  ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A  1  57   ? 83.951  13.340  108.538  1.00 45.54  ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A  1  57   ? 84.922  12.201  108.811  1.00 46.61  ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A  1  57   ? 85.232  11.903  109.961  1.00 46.68  ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A  1  57   ? 84.653  14.683  108.739  1.00 46.01  ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A  1  57   ? 86.000  14.761  108.050  1.00 53.33  ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A  1  57   ? 86.090  14.924  106.673  1.00 56.27  ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A  1  57   ? 87.182  14.666  108.776  1.00 56.22  ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A  1  57   ? 87.318  14.992  106.038  1.00 59.72  ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A  1  57   ? 88.415  14.733  108.150  1.00 59.78  ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A  1  57   ? 88.476  14.896  106.781  1.00 63.68  ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A  1  57   ? 89.700  14.964  106.154  1.00 66.84  ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A  1  58   ? 85.396  11.559  107.751  1.00 46.08  ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A  1  58   ? 86.375  10.491  107.886  1.00 44.83  ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A  1  58   ? 87.574  10.790  106.998  1.00 48.88  ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A  1  58   ? 87.412  11.217  105.856  1.00 51.06  ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A  1  58   ? 85.779  9.124   107.503  1.00 41.39  ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A  1  58   ? 84.477  8.876   108.267  1.00 39.17  ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A  1  58   ? 86.777  8.008   107.776  1.00 43.43  ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A  1  58   ? 83.830  7.547   107.956  1.00 39.21  ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A  1  59   ? 88.774  10.580  107.529  1.00 52.29  ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A  1  59   ? 89.993  10.820  106.765  1.00 56.39  ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A  1  59   ? 90.067  9.880   105.566  1.00 55.87  ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A  1  59   ? 89.750  8.694   105.677  1.00 51.94  ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A  1  59   ? 91.232  10.653  107.648  1.00 63.70  ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A  1  59   ? 92.543  10.973  106.939  1.00 69.52  ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A  1  59   ? 93.764  10.690  107.796  1.00 68.70  ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A  1  59   ? 93.653  10.761  109.039  1.00 67.16  ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A  1  59   ? 94.834  10.393  107.223  1.00 61.99  ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A  1  60   ? 90.478  10.430  104.425  1.00 58.47  ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A  1  60   ? 90.600  9.682   103.173  1.00 59.20  ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A  1  60   ? 89.265  9.122   102.678  1.00 53.78  ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A  1  60   ? 89.220  8.059   102.059  1.00 54.67  ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A  1  60   ? 91.649  8.569   103.293  1.00 65.09  ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A  1  60   ? 93.042  9.108   103.568  1.00 68.82  ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A  1  60   ? 93.341  10.234  103.118  1.00 68.54  ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A  1  60   ? 93.836  8.407   104.231  1.00 69.74  ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A  1  61   ? 88.182  9.843   102.956  1.00 50.52  ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A  1  61   ? 86.861  9.472   102.458  1.00 44.34  ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A  1  61   ? 86.167  10.675  101.828  1.00 44.78  ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A  1  61   ? 85.884  11.668  102.499  1.00 43.00  ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A  1  61   ? 85.969  8.884   103.566  1.00 43.26  ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A  1  61   ? 84.532  8.781   103.087  1.00 37.77  ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A  1  61   ? 86.489  7.520   103.997  1.00 48.09  ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A  1  62   ? 85.913  10.582  100.527  1.00 47.43  ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A  1  62   ? 85.300  11.676  99.781   1.00 47.39  ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A  1  62   ? 83.775  11.730  99.903   1.00 44.34  ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A  1  62   ? 83.193  12.812  99.997   1.00 42.63  ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A  1  62   ? 85.725  11.622  98.311   1.00 44.56  ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A  1  62   ? 87.236  11.691  98.078   1.00 44.50  ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A  1  62   ? 87.559  11.758  96.593   1.00 45.49  ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A  1  62   ? 87.832  12.879  98.816   1.00 46.97  ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A  1  63   ? 83.131  10.566  99.896   1.00 40.25  ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A  1  63   ? 81.672  10.515  99.949   1.00 36.43  ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A  1  63   ? 81.120  9.333   100.751  1.00 37.57  ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A  1  63   ? 81.874  8.506   101.262  1.00 39.35  ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A  1  63   ? 81.087  10.526  98.533   1.00 37.29  ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A  1  63   ? 81.668  9.485   97.626   1.00 37.66  ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A  1  63   ? 81.379  8.143   97.750   1.00 35.95  ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A  1  63   ? 82.517  9.591   96.576   1.00 33.60  ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A  1  63   ? 82.027  7.466   96.818   1.00 33.58  ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A  1  63   ? 82.725  8.322   96.092   1.00 32.41  ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A  1  64   ? 79.795  9.268   100.847  1.00 35.63  ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A  1  64   ? 79.110  8.264   101.659  1.00 35.73  ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A  1  64   ? 79.199  6.866   101.050  1.00 33.95  ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A  1  64   ? 79.080  5.859   101.749  1.00 30.91  ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A  1  64   ? 77.642  8.666   101.843  1.00 36.55  ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A  1  64   ? 76.827  7.753   102.751  1.00 45.51  ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A  1  64   ? 75.372  8.180   102.850  1.00 56.53  ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A  1  64   ? 75.017  9.221   102.255  1.00 63.64  ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A  1  64   ? 74.584  7.477   103.519  1.00 49.53  ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A  1  65   ? 79.424  6.813   99.744   1.00 34.67  ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A  1  65   ? 79.384  5.558   99.005   1.00 37.79  ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A  1  65   ? 80.747  4.871   98.922   1.00 39.16  ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A  1  65   ? 80.906  3.871   98.224   1.00 38.02  ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A  1  65   ? 78.785  5.788   97.617   1.00 34.42  ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A  1  65   ? 77.428  6.436   97.651   1.00 30.19  ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A  1  65   ? 77.275  7.783   97.364   1.00 29.19  ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A  1  65   ? 76.307  5.699   97.993   1.00 26.05  ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A  1  65   ? 76.027  8.378   97.403   1.00 25.26  ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A  1  65   ? 75.059  6.287   98.035   1.00 23.44  ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A  1  65   ? 74.918  7.627   97.740   1.00 24.62  ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A  1  66   ? 81.728  5.424   99.629   1.00 36.85  ? 66   SER A N     1 
ATOM   490   C  CA    . SER A  1  66   ? 83.078  4.870   99.637   1.00 37.01  ? 66   SER A CA    1 
ATOM   491   C  C     . SER A  1  66   ? 83.203  3.648   100.547  1.00 34.45  ? 66   SER A C     1 
ATOM   492   O  O     . SER A  1  66   ? 82.240  3.235   101.195  1.00 33.13  ? 66   SER A O     1 
ATOM   493   C  CB    . SER A  1  66   ? 84.083  5.934   100.084  1.00 38.64  ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A  1  66   ? 83.888  7.156   99.394   1.00 37.94  ? 66   SER A OG    1 
ATOM   495   N  N     . THR A  1  67   ? 84.404  3.077   100.579  1.00 38.37  ? 67   THR A N     1 
ATOM   496   C  CA    . THR A  1  67   ? 84.754  2.012   101.515  1.00 43.93  ? 67   THR A CA    1 
ATOM   497   C  C     . THR A  1  67   ? 86.150  2.281   102.067  1.00 49.99  ? 67   THR A C     1 
ATOM   498   O  O     . THR A  1  67   ? 87.019  2.787   101.355  1.00 52.93  ? 67   THR A O     1 
ATOM   499   C  CB    . THR A  1  67   ? 84.745  0.621   100.849  1.00 41.63  ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A  1  67   ? 85.564  0.645   99.675   1.00 48.08  ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A  1  67   ? 83.330  0.210   100.470  1.00 38.93  ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A  1  68   ? 86.365  1.945   103.334  1.00 49.65  ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A  1  68   ? 87.653  2.192   103.974  1.00 54.52  ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A  1  68   ? 88.486  0.917   104.054  1.00 55.88  ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A  1  68   ? 88.021  -0.100  104.570  1.00 55.49  ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A  1  68   ? 87.482  2.767   105.394  1.00 56.02  ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A  1  68   ? 86.496  3.936   105.386  1.00 53.80  ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A  1  68   ? 88.828  3.201   105.960  1.00 56.56  ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A  1  68   ? 86.225  4.515   106.758  1.00 46.66  ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A  1  69   ? 89.722  0.967   103.532  1.00 53.50  ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A  1  69   ? 90.643  -0.173  103.597  1.00 48.25  ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A  1  69   ? 90.930  -0.575  105.040  1.00 48.49  ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A  1  69   ? 91.245  0.283   105.865  1.00 47.81  ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A  1  69   ? 91.915  0.371   102.942  1.00 48.19  ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A  1  69   ? 91.443  1.468   102.052  1.00 49.60  ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A  1  69   ? 90.294  2.096   102.777  1.00 51.71  ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A  1  70   ? 90.818  -1.866  105.334  1.00 50.87  ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A  1  70   ? 91.063  -2.369  106.673  1.00 53.64  ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A  1  70   ? 89.822  -2.367  107.545  1.00 54.76  ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A  1  70   ? 89.878  -2.729  108.720  1.00 59.36  ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A  1  71   ? 88.696  -1.954  106.970  1.00 52.35  ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A  1  71   ? 87.436  -1.902  107.702  1.00 46.04  ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A  1  71   ? 86.390  -2.804  107.050  1.00 47.11  ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A  1  71   ? 86.188  -2.756  105.837  1.00 50.67  ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A  1  71   ? 86.891  -0.464  107.776  1.00 44.79  ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A  1  71   ? 85.638  -0.414  108.633  1.00 45.59  ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A  1  71   ? 87.951  0.477   108.326  1.00 44.63  ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A  1  72   ? 85.731  -3.627  107.860  1.00 42.92  ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A  1  72   ? 84.707  -4.544  107.366  1.00 42.94  ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A  1  72   ? 83.495  -3.813  106.794  1.00 47.63  ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A  1  72   ? 83.044  -4.107  105.685  1.00 49.14  ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A  1  72   ? 84.263  -5.497  108.478  1.00 40.73  ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A  1  72   ? 82.855  -6.042  108.302  1.00 39.85  ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A  1  72   ? 82.845  -7.554  108.217  1.00 36.92  ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A  1  72   ? 81.954  -8.156  109.289  1.00 39.45  ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A  1  72   ? 81.823  -9.630  109.134  1.00 42.36  ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A  1  73   ? 82.969  -2.860  107.556  1.00 49.10  ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A  1  73   ? 81.781  -2.125  107.141  1.00 48.41  ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A  1  73   ? 82.112  -1.077  106.086  1.00 42.50  ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A  1  73   ? 83.226  -0.556  106.041  1.00 41.11  ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A  1  73   ? 81.114  -1.448  108.346  1.00 47.41  ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A  1  73   ? 80.586  -2.404  109.411  1.00 48.65  ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A  1  73   ? 81.650  -2.833  110.404  1.00 51.51  ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A  1  73   ? 82.806  -2.381  110.272  1.00 53.48  ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A  1  73   ? 81.328  -3.620  111.320  1.00 51.87  ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A  1  74   ? 81.138  -0.776  105.233  1.00 40.97  ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A  1  74   ? 81.257  0.341   104.306  1.00 41.23  ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A  1  74   ? 80.919  1.627   105.051  1.00 36.18  ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A  1  74   ? 80.547  1.584   106.222  1.00 40.11  ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A  1  74   ? 80.314  0.145   103.119  1.00 44.93  ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A  1  74   ? 78.935  -0.323  103.544  1.00 47.86  ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A  1  74   ? 78.062  0.536   103.788  1.00 48.03  ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A  1  74   ? 78.724  -1.552  103.638  1.00 49.46  ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A  1  75   ? 81.031  2.768   104.378  1.00 31.64  ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A  1  75   ? 80.782  4.052   105.029  1.00 33.52  ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A  1  75   ? 79.312  4.206   105.411  1.00 35.94  ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A  1  75   ? 78.987  4.726   106.482  1.00 34.68  ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A  1  75   ? 81.219  5.237   104.145  1.00 34.85  ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A  1  75   ? 80.916  6.561   104.833  1.00 29.92  ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A  1  75   ? 82.698  5.135   103.820  1.00 39.76  ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A  1  76   ? 78.430  3.738   104.533  1.00 38.67  ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A  1  76   ? 76.994  3.813   104.770  1.00 36.91  ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A  1  76   ? 76.599  3.076   106.046  1.00 36.89  ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A  1  76   ? 75.881  3.619   106.884  1.00 41.70  ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A  1  76   ? 76.194  3.240   103.585  1.00 37.96  ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A  1  76   ? 74.701  3.318   103.864  1.00 36.67  ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A  1  76   ? 76.542  3.980   102.304  1.00 34.12  ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A  1  77   ? 77.078  1.844   106.192  1.00 33.90  ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A  1  77   ? 76.769  1.037   107.369  1.00 33.97  ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A  1  77   ? 77.322  1.671   108.642  1.00 34.49  ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A  1  77   ? 76.671  1.655   109.691  1.00 34.51  ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A  1  77   ? 77.316  -0.383  107.208  1.00 37.95  ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A  1  77   ? 76.974  -1.311  108.362  1.00 40.85  ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A  1  77   ? 77.422  -2.739  108.115  1.00 50.65  ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A  1  77   ? 77.087  -3.618  108.938  1.00 49.03  ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A  1  77   ? 78.109  -2.983  107.100  1.00 51.08  ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A  1  78   ? 78.524  2.229   108.541  1.00 35.43  ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A  1  78   ? 79.153  2.918   109.662  1.00 33.11  ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A  1  78   ? 78.303  4.100   110.112  1.00 30.44  ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A  1  78   ? 78.076  4.293   111.307  1.00 32.64  ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A  1  78   ? 80.577  3.397   109.307  1.00 32.65  ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A  1  78   ? 81.536  2.206   109.244  1.00 34.91  ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A  1  78   ? 81.077  4.409   110.323  1.00 33.81  ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A  1  78   ? 82.964  2.587   108.921  1.00 34.98  ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A  1  79   ? 77.824  4.880   109.149  1.00 30.38  ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A  1  79   ? 76.950  6.010   109.445  1.00 30.29  ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A  1  79   ? 75.635  5.539   110.067  1.00 33.27  ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A  1  79   ? 75.121  6.159   111.004  1.00 36.61  ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A  1  79   ? 76.688  6.863   108.188  1.00 27.71  ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1  79   ? 77.973  7.578   107.767  1.00 32.09  ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1  79   ? 75.590  7.878   108.442  1.00 27.95  ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1  79   ? 77.803  8.512   106.593  1.00 36.94  ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A  1  80   ? 75.106  4.429   109.556  1.00 32.32  ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A  1  80   ? 73.897  3.828   110.114  1.00 32.72  ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A  1  80   ? 74.093  3.451   111.579  1.00 34.15  ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A  1  80   ? 73.188  3.617   112.397  1.00 35.97  ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A  1  80   ? 73.474  2.595   109.313  1.00 34.24  ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A  1  80   ? 72.894  2.823   107.916  1.00 32.12  ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A  1  80   ? 72.336  1.523   107.359  1.00 29.87  ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A  1  80   ? 71.825  3.905   107.941  1.00 29.66  ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A  1  81   ? 75.277  2.939   111.904  1.00 34.87  ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A  1  81   ? 75.618  2.639   113.290  1.00 35.00  ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A  1  81   ? 75.755  3.910   114.120  1.00 30.83  ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A  1  81   ? 75.366  3.947   115.287  1.00 31.70  ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A  1  81   ? 76.902  1.811   113.365  1.00 32.50  ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A  1  81   ? 76.709  0.392   112.870  1.00 35.33  ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A  1  81   ? 75.644  -0.199  113.045  1.00 34.54  ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A  1  81   ? 77.741  -0.164  112.246  1.00 40.79  ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A  1  82   ? 76.303  4.953   113.504  1.00 30.44  ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A  1  82   ? 76.484  6.240   114.168  1.00 31.54  ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A  1  82   ? 75.153  6.923   114.465  1.00 33.33  ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A  1  82   ? 75.070  7.776   115.347  1.00 35.98  ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A  1  82   ? 77.370  7.162   113.326  1.00 32.39  ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A  1  82   ? 78.871  6.867   113.339  1.00 32.84  ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A  1  82   ? 79.571  7.607   112.214  1.00 35.43  ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A  1  82   ? 79.472  7.247   114.681  1.00 30.87  ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A  1  83   ? 74.114  6.552   113.723  1.00 35.01  ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A  1  83   ? 72.783  7.099   113.972  1.00 36.21  ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A  1  83   ? 72.179  6.545   115.261  1.00 39.18  ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A  1  83   ? 71.317  7.175   115.872  1.00 48.78  ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A  1  83   ? 71.850  6.841   112.785  1.00 33.06  ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A  1  83   ? 72.168  7.684   111.559  1.00 35.40  ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A  1  83   ? 71.270  7.333   110.382  1.00 38.48  ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A  1  83   ? 69.810  7.637   110.676  1.00 38.72  ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A  1  83   ? 68.943  7.368   109.493  1.00 36.70  ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A  1  84   ? 72.643  5.370   115.677  1.00 37.01  ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A  1  84   ? 72.140  4.735   116.892  1.00 41.45  ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A  1  84   ? 72.840  5.246   118.150  1.00 41.72  ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A  1  84   ? 72.523  4.821   119.262  1.00 40.79  ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A  1  84   ? 72.269  3.213   116.799  1.00 45.84  ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A  1  84   ? 71.271  2.562   115.854  1.00 58.81  ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A  1  84   ? 71.309  1.046   115.919  1.00 78.08  ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A  1  84   ? 70.310  0.408   115.524  1.00 84.10  ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A  1  84   ? 72.338  0.492   116.363  1.00 74.87  ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A  1  85   ? 73.789  6.159   117.966  1.00 41.01  ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A  1  85   ? 74.563  6.705   119.076  1.00 38.35  ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A  1  85   ? 73.751  7.694   119.906  1.00 39.53  ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A  1  85   ? 73.202  8.660   119.375  1.00 38.61  ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A  1  85   ? 75.829  7.386   118.554  1.00 33.77  ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A  1  85   ? 76.767  7.966   119.611  1.00 34.44  ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A  1  85   ? 77.347  6.853   120.470  1.00 38.99  ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A  1  85   ? 77.872  8.784   118.961  1.00 34.62  ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A  1  86   ? 73.684  7.449   121.211  1.00 40.01  ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A  1  86   ? 72.968  8.335   122.120  1.00 38.06  ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A  1  86   ? 73.949  9.209   122.891  1.00 37.17  ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A  1  86   ? 74.694  8.721   123.739  1.00 38.05  ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A  1  86   ? 72.108  7.542   123.121  1.00 38.75  ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A  1  86   ? 71.344  8.491   124.032  1.00 39.54  ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A  1  86   ? 71.151  6.619   122.384  1.00 41.08  ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A  1  87   ? 73.942  10.503  122.591  1.00 38.09  ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A  1  87   ? 74.861  11.440  123.224  1.00 39.27  ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A  1  87   ? 74.124  12.371  124.180  1.00 41.86  ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A  1  87   ? 73.123  12.983  123.815  1.00 42.63  ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A  1  87   ? 75.626  12.272  122.175  1.00 41.76  ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A  1  87   ? 76.464  13.345  122.851  1.00 44.52  ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A  1  87   ? 76.499  11.370  121.315  1.00 38.85  ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A  1  88   ? 74.627  12.469  125.406  1.00 47.71  ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A  1  88   ? 74.006  13.297  126.432  1.00 50.01  ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A  1  88   ? 74.839  14.537  126.747  1.00 48.71  ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A  1  88   ? 76.010  14.433  127.125  1.00 49.38  ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A  1  88   ? 73.783  12.481  127.707  1.00 48.48  ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A  1  88   ? 73.287  13.296  128.890  1.00 52.02  ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A  1  88   ? 73.291  12.472  130.167  1.00 51.72  ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A  1  88   ? 72.923  13.268  131.334  1.00 50.20  ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A  1  88   ? 72.943  12.814  132.583  1.00 48.10  ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A  1  88   ? 73.314  11.565  132.830  1.00 46.54  ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A  1  88   ? 72.592  13.607  133.585  1.00 45.63  ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A  1  89   ? 74.227  15.707  126.588  1.00 48.29  ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A  1  89   ? 74.870  16.971  126.931  1.00 54.87  ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A  1  89   ? 74.560  17.347  128.375  1.00 60.12  ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A  1  89   ? 73.395  17.490  128.750  1.00 62.81  ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A  1  89   ? 74.400  18.097  126.005  1.00 52.45  ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A  1  89   ? 74.901  17.981  124.593  1.00 50.01  ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A  1  89   ? 75.824  17.010  124.242  1.00 48.12  ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A  1  89   ? 74.452  18.856  123.618  1.00 49.21  ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A  1  89   ? 76.281  16.908  122.942  1.00 47.07  ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A  1  89   ? 74.907  18.761  122.318  1.00 46.90  ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A  1  89   ? 75.823  17.786  121.979  1.00 46.21  ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A  1  90   ? 75.603  17.508  129.182  1.00 57.44  ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A  1  90   ? 75.429  17.878  130.581  1.00 51.30  ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A  1  90   ? 75.205  19.378  130.742  1.00 50.90  ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A  1  90   ? 74.716  19.831  131.775  1.00 56.18  ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A  1  90   ? 76.626  17.423  131.422  1.00 50.48  ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A  1  90   ? 76.679  15.944  131.814  1.00 52.25  ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A  1  90   ? 75.336  15.497  132.369  1.00 50.77  ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A  1  90   ? 77.090  15.064  130.643  1.00 53.09  ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A  1  91   ? 75.563  20.143  129.715  1.00 49.68  ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A  1  91   ? 75.409  21.593  129.750  1.00 54.87  ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A  1  91   ? 74.224  22.054  128.902  1.00 56.83  ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A  1  91   ? 74.243  21.913  127.679  1.00 56.76  ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A  1  91   ? 76.698  22.271  129.276  1.00 57.85  ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A  1  91   ? 76.791  23.725  129.706  1.00 52.63  ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A  1  91   ? 75.779  24.392  129.919  1.00 53.42  ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A  1  91   ? 78.016  24.222  129.834  1.00 44.58  ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A  1  92   ? 73.180  22.591  129.558  1.00 56.16  ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A  1  92   ? 71.972  23.122  128.915  1.00 56.15  ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A  1  92   ? 72.278  24.093  127.778  1.00 55.28  ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A  1  92   ? 71.589  24.085  126.760  1.00 56.99  ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A  1  92   ? 71.276  23.881  130.048  1.00 53.79  ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A  1  92   ? 71.820  23.314  131.319  1.00 54.45  ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A  1  92   ? 73.009  22.451  131.014  1.00 55.30  ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A  1  93   ? 73.302  24.918  127.954  1.00 55.04  ? 93   SER A N     1 
ATOM   703   C  CA    . SER A  1  93   ? 73.634  25.945  126.974  1.00 57.83  ? 93   SER A CA    1 
ATOM   704   C  C     . SER A  1  93   ? 74.387  25.399  125.757  1.00 60.37  ? 93   SER A C     1 
ATOM   705   O  O     . SER A  1  93   ? 74.518  26.086  124.741  1.00 61.60  ? 93   SER A O     1 
ATOM   706   C  CB    . SER A  1  93   ? 74.458  27.054  127.636  1.00 67.77  ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A  1  93   ? 73.755  27.651  128.714  1.00 83.76  ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A  1  94   ? 74.888  24.172  125.862  1.00 60.09  ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A  1  94   ? 75.751  23.623  124.825  1.00 57.65  ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A  1  94   ? 74.905  23.091  123.675  1.00 55.76  ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A  1  94   ? 74.166  22.120  123.838  1.00 55.17  ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A  1  94   ? 76.593  22.500  125.432  1.00 52.91  ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A  1  94   ? 77.393  21.563  124.537  1.00 49.95  ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A  1  94   ? 78.476  22.331  123.804  1.00 50.51  ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A  1  94   ? 77.991  20.468  125.398  1.00 49.49  ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A  1  95   ? 75.017  23.729  122.512  1.00 54.56  ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A  1  95   ? 74.209  23.347  121.355  1.00 53.44  ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A  1  95   ? 74.831  22.314  120.412  1.00 48.80  ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A  1  95   ? 74.114  21.649  119.666  1.00 46.74  ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A  1  95   ? 73.832  24.594  120.545  1.00 51.96  ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A  1  95   ? 73.168  25.708  121.346  1.00 55.68  ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A  1  95   ? 71.708  25.430  121.655  1.00 56.94  ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1  95   ? 71.217  24.318  121.458  1.00 55.94  ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1  95   ? 71.002  26.448  122.136  1.00 57.78  ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A  1  96   ? 76.153  22.175  120.443  1.00 46.06  ? 96   THR A N     1 
ATOM   726   C  CA    . THR A  1  96   ? 76.830  21.289  119.498  1.00 44.36  ? 96   THR A CA    1 
ATOM   727   C  C     . THR A  1  96   ? 78.181  20.785  120.001  1.00 45.53  ? 96   THR A C     1 
ATOM   728   O  O     . THR A  1  96   ? 78.904  21.506  120.691  1.00 45.85  ? 96   THR A O     1 
ATOM   729   C  CB    . THR A  1  96   ? 77.012  21.966  118.123  1.00 43.88  ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A  1  96   ? 77.920  21.195  117.326  1.00 44.05  ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A  1  96   ? 77.563  23.372  118.290  1.00 42.75  ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A  1  97   ? 78.526  19.552  119.638  1.00 44.55  ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A  1  97   ? 79.808  18.961  120.023  1.00 41.65  ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A  1  97   ? 80.374  18.106  118.891  1.00 42.67  ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A  1  97   ? 79.642  17.350  118.250  1.00 42.94  ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A  1  97   ? 79.685  18.074  121.292  1.00 41.43  ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  97   ? 81.026  17.447  121.644  1.00 44.61  ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  97   ? 79.174  18.874  122.467  1.00 44.53  ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A  1  98   ? 81.674  18.229  118.646  1.00 41.31  ? 98   THR A N     1 
ATOM   740   C  CA    . THR A  1  98   ? 82.353  17.352  117.701  1.00 39.39  ? 98   THR A CA    1 
ATOM   741   C  C     . THR A  1  98   ? 83.145  16.283  118.448  1.00 38.06  ? 98   THR A C     1 
ATOM   742   O  O     . THR A  1  98   ? 84.143  16.581  119.106  1.00 39.92  ? 98   THR A O     1 
ATOM   743   C  CB    . THR A  1  98   ? 83.303  18.135  116.778  1.00 39.06  ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A  1  98   ? 82.559  19.111  116.038  1.00 39.67  ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A  1  98   ? 83.995  17.190  115.808  1.00 38.16  ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A  1  99   ? 82.690  15.038  118.350  1.00 35.81  ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A  1  99   ? 83.384  13.920  118.978  1.00 36.51  ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A  1  99   ? 84.488  13.407  118.061  1.00 41.61  ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A  1  99   ? 84.312  13.338  116.846  1.00 46.73  ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A  1  99   ? 82.408  12.787  119.314  1.00 36.05  ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A  1  99   ? 81.572  12.879  120.595  1.00 37.89  ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A  1  99   ? 80.580  14.031  120.547  1.00 35.47  ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A  1  99   ? 80.852  11.563  120.847  1.00 37.23  ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A  1  100  ? 85.626  13.047  118.646  1.00 45.62  ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A  1  100  ? 86.776  12.593  117.871  1.00 41.68  ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A  1  100  ? 87.061  11.117  118.126  1.00 47.31  ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A  1  100  ? 87.027  10.661  119.268  1.00 52.61  ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A  1  100  ? 88.008  13.428  118.222  1.00 37.97  ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A  1  100  ? 87.816  14.947  118.209  1.00 39.42  ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A  1  100  ? 89.068  15.656  118.703  1.00 45.97  ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A  1  100  ? 87.436  15.432  116.820  1.00 41.56  ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A  1  101  ? 87.340  10.373  117.059  1.00 47.81  ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A  1  101  ? 87.674  8.958   117.187  1.00 47.62  ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A  1  101  ? 88.899  8.617   116.349  1.00 49.18  ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A  1  101  ? 88.925  8.864   115.149  1.00 50.87  ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A  1  101  ? 86.486  8.081   116.777  1.00 46.10  ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A  1  101  ? 86.574  6.577   117.060  1.00 44.78  ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A  1  101  ? 85.198  6.028   117.391  1.00 44.53  ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A  1  101  ? 87.172  5.811   115.887  1.00 46.96  ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A  1  102  ? 89.918  8.059   116.988  1.00 53.48  ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A  1  102  ? 91.101  7.613   116.267  1.00 56.49  ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A  1  102  ? 91.491  6.217   116.736  1.00 62.04  ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A  1  102  ? 91.856  6.026   117.897  1.00 72.21  ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A  1  102  ? 92.251  8.597   116.483  1.00 59.31  ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A  1  102  ? 93.310  8.578   115.395  1.00 63.08  ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A  1  102  ? 94.187  9.818   115.473  1.00 66.31  ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A  1  102  ? 93.342  11.082  115.408  1.00 59.44  ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A  1  102  ? 94.160  12.317  115.544  1.00 55.14  ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A  1  103  ? 91.418  5.244   115.834  1.00 56.78  ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A  1  103  ? 91.705  3.860   116.200  1.00 59.56  ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A  1  103  ? 92.348  3.091   115.053  1.00 62.01  ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A  1  103  ? 92.269  3.503   113.896  1.00 65.56  ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A  1  103  ? 90.436  3.161   116.666  1.00 55.32  ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A  1  104  ? 92.987  1.973   115.382  1.00 65.04  ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A  1  104  ? 93.643  1.141   114.379  1.00 68.79  ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A  1  104  ? 93.898  -0.272  114.891  1.00 65.66  ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A  1  104  ? 93.465  -0.636  115.984  1.00 64.25  ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A  1  104  ? 94.958  1.779   113.926  1.00 72.47  ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A  1  104  ? 95.949  2.036   115.048  1.00 79.32  ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A  1  104  ? 97.242  2.657   114.551  1.00 89.19  ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A  1  104  ? 98.155  2.869   115.376  1.00 93.79  ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A  1  104  ? 97.343  2.932   113.336  1.00 86.27  ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A  1  105  ? 94.603  -1.064  114.089  1.00 65.67  ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A  1  105  ? 94.932  -2.429  114.455  1.00 66.84  ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A  1  105  ? 93.717  -3.334  114.514  1.00 66.93  ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A  1  105  ? 92.613  -2.922  114.161  1.00 69.55  ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A  1  106  ? 93.913  -4.578  114.972  1.00 65.31  ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A  1  106  ? 92.831  -5.562  115.049  1.00 65.32  ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A  1  106  ? 91.990  -5.394  116.310  1.00 68.81  ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A  1  106  ? 92.182  -6.125  117.281  1.00 76.18  ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A  1  106  ? 93.578  -6.898  115.079  1.00 67.77  ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A  1  106  ? 94.980  -6.573  115.546  1.00 73.29  ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A  1  106  ? 95.158  -5.081  115.573  1.00 69.62  ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A  1  107  ? 91.070  -4.435  116.285  1.00 66.55  ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A  1  107  ? 90.181  -4.186  117.413  1.00 66.42  ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A  1  107  ? 88.774  -3.885  116.914  1.00 58.35  ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A  1  107  ? 88.599  -3.366  115.812  1.00 58.62  ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A  1  107  ? 90.692  -3.006  118.244  1.00 67.25  ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A  1  107  ? 90.782  -1.696  117.469  1.00 62.80  ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A  1  107  ? 91.246  -0.547  118.352  1.00 63.37  ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A  1  107  ? 90.227  -0.226  119.432  1.00 54.94  ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A  1  107  ? 90.646  0.947   120.248  1.00 46.64  ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A  1  108  ? 87.771  -4.204  117.724  1.00 54.77  ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A  1  108  ? 86.406  -3.831  117.390  1.00 50.50  ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A  1  108  ? 86.102  -2.488  118.031  1.00 48.45  ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A  1  108  ? 85.981  -2.376  119.251  1.00 53.47  ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A  1  108  ? 85.415  -4.890  117.870  1.00 47.89  ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A  1  108  ? 85.562  -6.232  117.175  1.00 51.84  ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A  1  108  ? 84.507  -7.229  117.611  1.00 60.65  ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A  1  108  ? 83.730  -6.909  118.536  1.00 57.36  ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A  1  108  ? 84.453  -8.332  117.026  1.00 66.73  ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A  1  109  ? 85.970  -1.470  117.192  1.00 46.18  ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A  1  109  ? 85.761  -0.114  117.664  1.00 47.69  ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A  1  109  ? 84.311  0.102   118.059  1.00 45.76  ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A  1  109  ? 83.393  0.006   117.224  1.00 48.97  ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A  1  109  ? 86.159  0.925   116.596  1.00 44.54  ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A  1  109  ? 85.893  2.337   117.097  1.00 40.44  ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A  1  109  ? 87.621  0.763   116.215  1.00 49.94  ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A  1  110  ? 84.139  0.406   119.344  1.00 43.41  ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A  1  110  ? 82.849  0.686   119.956  1.00 42.84  ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A  1  110  ? 82.700  2.187   120.183  1.00 43.44  ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A  1  110  ? 83.566  2.973   119.797  1.00 44.27  ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A  1  110  ? 82.731  -0.048  121.294  1.00 41.10  ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A  1  110  ? 83.035  -1.537  121.224  1.00 41.54  ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A  1  110  ? 81.959  -2.293  120.464  1.00 44.41  ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A  1  110  ? 82.250  -3.787  120.439  1.00 43.75  ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A  1  110  ? 81.200  -4.557  119.714  1.00 44.85  ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A  1  111  ? 81.601  2.581   120.817  1.00 45.56  ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A  1  111  ? 81.337  3.990   121.088  1.00 49.98  ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A  1  111  ? 82.163  4.520   122.260  1.00 54.08  ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A  1  111  ? 82.210  5.726   122.501  1.00 53.08  ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A  1  111  ? 79.852  4.210   121.341  1.00 51.87  ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A  1  112  ? 82.815  3.615   122.983  1.00 55.52  ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A  1  112  ? 83.616  3.986   124.145  1.00 49.54  ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A  1  112  ? 84.926  4.637   123.719  1.00 50.97  ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A  1  112  ? 85.507  5.432   124.458  1.00 52.52  ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A  1  112  ? 83.923  2.745   124.982  1.00 47.94  ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A  1  112  ? 83.782  2.937   126.481  1.00 53.88  ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A  1  112  ? 84.218  1.681   127.218  1.00 61.20  ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A  1  112  ? 84.078  0.490   126.382  1.00 62.08  ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A  1  112  ? 83.000  -0.287  126.353  1.00 59.28  ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A  1  112  ? 81.955  -0.004  127.119  1.00 59.41  ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A  1  112  ? 82.967  -1.348  125.558  1.00 54.56  ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A  1  113  ? 85.380  4.295   122.518  1.00 48.53  ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A  1  113  ? 86.693  4.708   122.034  1.00 46.35  ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A  1  113  ? 86.780  6.185   121.647  1.00 48.49  ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A  1  113  ? 87.861  6.684   121.333  1.00 52.10  ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A  1  113  ? 87.124  3.823   120.864  1.00 49.71  ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A  1  113  ? 87.299  2.371   121.269  1.00 51.02  ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A  1  113  ? 88.459  1.922   121.392  1.00 57.03  ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A  1  113  ? 86.278  1.681   121.473  1.00 48.21  ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A  1  114  ? 85.646  6.879   121.662  1.00 47.53  ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A  1  114  ? 85.639  8.317   121.416  1.00 48.75  ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A  1  114  ? 86.400  9.051   122.514  1.00 50.35  ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A  1  114  ? 86.269  8.724   123.693  1.00 51.76  ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A  1  114  ? 84.209  8.853   121.342  1.00 50.21  ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A  1  114  ? 83.523  8.579   120.036  1.00 51.22  ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A  1  114  ? 82.660  7.505   119.903  1.00 51.50  ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A  1  114  ? 83.740  9.400   118.941  1.00 45.77  ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A  1  114  ? 82.025  7.254   118.704  1.00 46.17  ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A  1  114  ? 83.109  9.152   117.738  1.00 46.32  ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A  1  114  ? 82.250  8.078   117.619  1.00 47.09  ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A  1  115  ? 87.199  10.038  122.120  1.00 51.53  ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A  1  115  ? 87.933  10.850  123.083  1.00 55.45  ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A  1  115  ? 86.963  11.662  123.932  1.00 55.71  ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A  1  115  ? 86.188  12.457  123.402  1.00 54.90  ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A  1  115  ? 88.923  11.775  122.373  1.00 54.45  ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A  1  115  ? 90.091  11.086  121.664  1.00 59.02  ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A  1  115  ? 91.041  12.113  121.064  1.00 56.65  ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A  1  115  ? 90.827  10.156  122.620  1.00 58.98  ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A  1  116  ? 87.003  11.452  125.257  1.00 53.13  ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A  1  116  ? 86.091  12.086  126.217  1.00 54.72  ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A  1  116  ? 86.102  13.611  126.135  1.00 56.38  ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A  1  116  ? 87.161  14.219  125.978  1.00 54.98  ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A  1  116  ? 86.642  11.628  127.570  1.00 55.31  ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A  1  116  ? 87.340  10.347  127.275  1.00 49.22  ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A  1  116  ? 87.946  10.534  125.919  1.00 48.70  ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A  1  117  ? 84.921  14.214  126.234  1.00 53.08  ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A  1  117  ? 84.785  15.665  126.213  1.00 51.80  ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A  1  117  ? 84.050  16.114  127.475  1.00 55.64  ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A  1  117  ? 83.208  15.383  128.001  1.00 53.23  ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A  1  117  ? 84.017  16.141  124.957  1.00 51.08  ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A  1  117  ? 84.037  17.661  124.848  1.00 47.40  ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A  1  117  ? 84.612  15.519  123.703  1.00 50.97  ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A  1  118  ? 84.382  17.306  127.963  1.00 57.51  ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A  1  118  ? 83.747  17.859  129.155  1.00 55.30  ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A  1  118  ? 82.247  18.051  128.955  1.00 55.73  ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A  1  118  ? 81.810  18.544  127.914  1.00 55.83  ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A  1  118  ? 84.404  19.176  129.540  1.00 57.04  ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A  1  119  ? 81.473  17.650  129.961  1.00 57.77  ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A  1  119  ? 80.013  17.764  129.944  1.00 62.45  ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A  1  119  ? 79.355  16.982  128.807  1.00 61.91  ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A  1  119  ? 78.251  17.316  128.375  1.00 64.15  ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A  1  119  ? 79.575  19.233  129.900  1.00 62.53  ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A  1  119  ? 80.058  20.023  131.099  1.00 64.99  ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A  1  119  ? 80.248  19.417  132.175  1.00 68.76  ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A  1  119  ? 80.247  21.251  130.965  1.00 63.36  ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A  1  120  ? 80.032  15.944  128.326  1.00 56.13  ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A  1  120  ? 79.478  15.085  127.284  1.00 48.63  ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A  1  120  ? 79.578  13.620  127.689  1.00 45.80  ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A  1  120  ? 80.676  13.083  127.839  1.00 45.22  ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A  1  120  ? 80.200  15.281  125.938  1.00 51.03  ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A  1  120  ? 79.655  14.310  124.902  1.00 52.31  ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A  1  120  ? 80.054  16.716  125.455  1.00 50.71  ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A  1  121  ? 78.430  12.973  127.859  1.00 45.29  ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A  1  121  ? 78.405  11.580  128.291  1.00 46.59  ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A  1  121  ? 77.789  10.668  127.238  1.00 46.45  ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A  1  121  ? 76.721  10.959  126.703  1.00 44.66  ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A  1  121  ? 77.640  11.442  129.609  1.00 52.55  ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A  1  121  ? 77.552  10.014  130.126  1.00 56.06  ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A  1  121  ? 76.680  9.892   131.361  1.00 57.96  ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A  1  121  ? 76.076  10.907  131.770  1.00 54.05  ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A  1  121  ? 76.597  8.779   131.921  1.00 62.06  ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A  1  122  ? 78.467  9.563   126.945  1.00 46.80  ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A  1  122  ? 77.960  8.589   125.985  1.00 47.62  ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A  1  122  ? 77.125  7.532   126.702  1.00 46.66  ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A  1  122  ? 77.626  6.808   127.562  1.00 51.76  ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A  1  122  ? 79.100  7.922   125.180  1.00 44.27  ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A  1  122  ? 79.652  8.886   124.122  1.00 39.11  ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A  1  122  ? 78.607  6.654   124.501  1.00 45.31  ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A  1  122  ? 80.617  9.927   124.655  1.00 42.62  ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A  1  123  ? 75.847  7.455   126.343  1.00 41.93  ? 123  MET A N     1 
ATOM   933   C  CA    . MET A  1  123  ? 74.898  6.594   127.044  1.00 44.37  ? 123  MET A CA    1 
ATOM   934   C  C     . MET A  1  123  ? 74.998  5.121   126.652  1.00 46.23  ? 123  MET A C     1 
ATOM   935   O  O     . MET A  1  123  ? 74.648  4.239   127.437  1.00 45.52  ? 123  MET A O     1 
ATOM   936   C  CB    . MET A  1  123  ? 73.468  7.099   126.837  1.00 44.74  ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A  1  123  ? 73.231  8.507   127.356  1.00 45.30  ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A  1  123  ? 73.591  8.661   129.115  1.00 47.53  ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A  1  123  ? 72.509  7.404   129.794  1.00 46.96  ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A  1  124  ? 75.466  4.856   125.437  1.00 48.75  ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A  1  124  ? 75.632  3.481   124.974  1.00 51.52  ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A  1  124  ? 77.040  3.197   124.451  1.00 54.62  ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A  1  124  ? 77.262  3.145   123.242  1.00 58.49  ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A  1  124  ? 74.572  3.123   123.924  1.00 46.13  ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A  1  124  ? 74.475  4.151   122.810  1.00 42.11  ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A  1  124  ? 74.820  5.319   122.992  1.00 42.64  ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A  1  124  ? 73.999  3.719   121.648  1.00 40.69  ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A  1  125  ? 77.999  3.013   125.371  1.00 51.40  ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A  1  125  ? 79.402  2.766   125.020  1.00 51.97  ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A  1  125  ? 79.626  1.393   124.388  1.00 53.07  ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A  1  125  ? 80.633  1.195   123.708  1.00 53.20  ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A  1  125  ? 80.113  2.848   126.372  1.00 55.26  ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A  1  125  ? 79.078  2.441   127.356  1.00 53.18  ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A  1  125  ? 77.785  2.990   126.828  1.00 49.02  ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A  1  126  ? 78.702  0.463   124.606  1.00 54.06  ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A  1  126  ? 78.838  -0.887  124.067  1.00 58.69  ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A  1  126  ? 78.366  -0.979  122.618  1.00 58.00  ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A  1  126  ? 78.434  -2.044  122.002  1.00 54.84  ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A  1  126  ? 78.082  -1.900  124.931  1.00 64.77  ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A  1  126  ? 78.778  -2.175  126.250  1.00 69.18  ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A  1  126  ? 78.755  -3.339  126.704  1.00 66.20  ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A  1  126  ? 79.348  -1.227  126.831  1.00 71.10  ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A  1  127  ? 77.886  0.140   122.084  1.00 56.39  ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A  1  127  ? 77.432  0.203   120.700  1.00 52.92  ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A  1  127  ? 78.576  -0.085  119.741  1.00 48.50  ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A  1  127  ? 79.621  0.561   119.800  1.00 46.06  ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A  1  127  ? 76.851  1.584   120.398  1.00 50.28  ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A  1  127  ? 76.599  1.909   118.924  1.00 42.83  ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A  1  127  ? 75.464  1.060   118.369  1.00 47.46  ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A  1  127  ? 76.313  3.391   118.744  1.00 37.17  ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A  1  128  ? 78.373  -1.052  118.852  1.00 49.30  ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A  1  128  ? 79.388  -1.395  117.865  1.00 48.17  ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A  1  128  ? 79.434  -0.354  116.754  1.00 44.64  ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A  1  128  ? 78.399  0.041   116.215  1.00 47.29  ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A  1  128  ? 79.123  -2.782  117.273  1.00 48.27  ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A  1  128  ? 80.086  -3.171  116.194  1.00 50.94  ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A  1  128  ? 81.300  -3.768  116.459  1.00 53.24  ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A  1  128  ? 80.016  -3.043  114.847  1.00 53.21  ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A  1  128  ? 81.935  -3.994  115.322  1.00 52.35  ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A  1  128  ? 81.178  -3.563  114.330  1.00 50.88  ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A  1  129  ? 80.639  0.091   116.419  1.00 41.12  ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A  1  129  ? 80.822  1.001   115.296  1.00 43.96  ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A  1  129  ? 81.487  0.294   114.120  1.00 44.86  ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A  1  129  ? 80.888  0.173   113.051  1.00 46.90  ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A  1  129  ? 81.602  2.276   115.681  1.00 40.74  ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A  1  129  ? 80.699  3.226   116.466  1.00 38.39  ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A  1  129  ? 82.127  2.985   114.438  1.00 37.43  ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A  1  129  ? 81.257  4.621   116.592  1.00 41.97  ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A  1  130  ? 82.716  -0.179  114.302  1.00 43.57  ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A  1  130  ? 83.408  -0.796  113.170  1.00 42.54  ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A  1  130  ? 84.300  -1.970  113.548  1.00 47.06  ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A  1  130  ? 84.786  -2.052  114.666  1.00 57.57  ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A  1  130  ? 84.207  0.253   112.402  1.00 41.58  ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A  1  131  ? 84.508  -2.884  112.607  1.00 42.45  ? 131  THR A N     1 
ATOM   995   C  CA    . THR A  1  131  ? 85.460  -3.968  112.809  1.00 45.23  ? 131  THR A CA    1 
ATOM   996   C  C     . THR A  1  131  ? 86.719  -3.689  111.994  1.00 46.18  ? 131  THR A C     1 
ATOM   997   O  O     . THR A  1  131  ? 86.673  -3.633  110.766  1.00 49.85  ? 131  THR A O     1 
ATOM   998   C  CB    . THR A  1  131  ? 84.868  -5.336  112.417  1.00 46.24  ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A  1  131  ? 83.686  -5.586  113.189  1.00 43.09  ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A  1  131  ? 85.878  -6.449  112.669  1.00 43.80  ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A  1  132  ? 87.841  -3.507  112.683  1.00 48.87  ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A  1  132  ? 89.086  -3.128  112.022  1.00 51.55  ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A  1  132  ? 90.055  -4.294  111.836  1.00 55.98  ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A  1  132  ? 90.120  -5.211  112.655  1.00 52.25  ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A  1  132  ? 89.770  -1.964  112.747  1.00 50.58  ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A  1  132  ? 89.356  -0.559  112.297  1.00 48.37  ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A  1  132  ? 87.912  -0.257  112.669  1.00 49.83  ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A  1  132  ? 90.290  0.493   112.871  1.00 55.98  ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A  1  133  ? 90.800  -4.239  110.738  1.00 62.93  ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A  1  133  ? 91.712  -5.302  110.346  1.00 68.50  ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A  1  133  ? 93.148  -4.898  110.665  1.00 70.28  ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A  1  133  ? 93.393  -3.809  111.185  1.00 70.28  ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A  1  133  ? 91.568  -5.546  108.844  1.00 74.13  ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A  1  133  ? 91.875  -6.954  108.373  1.00 73.72  ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A  1  133  ? 91.713  -7.097  106.872  1.00 63.64  ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A  1  133  ? 91.866  -6.086  106.155  1.00 59.41  ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A  1  133  ? 91.421  -8.217  106.410  1.00 60.06  ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A  1  134  ? 94.096  -5.774  110.350  1.00 70.66  ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A  1  134  ? 95.508  -5.443  110.480  1.00 74.24  ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A  1  134  ? 95.885  -4.402  109.435  1.00 72.24  ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A  1  134  ? 95.674  -4.606  108.240  1.00 70.12  ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A  1  134  ? 96.371  -6.694  110.306  1.00 80.62  ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A  1  134  ? 96.432  -7.593  111.531  1.00 90.25  ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A  1  134  ? 97.367  -7.061  112.603  1.00 96.40  ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A  1  134  ? 97.423  -7.663  113.696  1.00 94.73  ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A  1  134  ? 98.051  -6.046  112.351  1.00 93.80  ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A  1  135  ? 96.443  -3.285  109.889  1.00 72.24  ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A  1  135  ? 96.811  -2.204  108.993  1.00 69.80  ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A  1  135  ? 95.664  -1.245  108.741  1.00 69.24  ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A  1  135  ? 95.858  -0.166  108.179  1.00 64.45  ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A  1  136  ? 94.462  -1.641  109.152  1.00 69.24  ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A  1  136  ? 93.290  -0.800  108.999  1.00 63.63  ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A  1  136  ? 93.291  0.367   109.967  1.00 64.41  ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A  1  136  ? 93.577  0.199   111.152  1.00 68.79  ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A  1  137  ? 92.965  1.552   109.463  1.00 62.84  ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A  1  137  ? 92.945  2.756   110.286  1.00 64.71  ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A  1  137  ? 91.627  3.508   110.157  1.00 65.65  ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A  1  137  ? 91.148  3.757   109.051  1.00 68.89  ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A  1  137  ? 94.103  3.681   109.912  1.00 70.06  ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A  1  137  ? 95.251  3.678   110.904  1.00 72.27  ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A  1  137  ? 96.407  4.540   110.421  1.00 78.48  ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A  1  137  ? 96.998  4.016   109.193  1.00 88.11  ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A  1  137  ? 96.749  4.492   107.977  1.00 88.61  ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A  1  137  ? 95.919  5.515   107.818  1.00 84.04  ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A  1  137  ? 97.333  3.947   106.918  1.00 90.12  ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A  1  138  ? 91.049  3.874   111.297  1.00 61.70  ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1  138  ? 89.807  4.635   111.315  1.00 55.51  ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1  138  ? 89.981  5.961   112.050  1.00 52.79  ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A  1  138  ? 90.278  5.990   113.248  1.00 59.19  ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1  138  ? 88.683  3.819   111.957  1.00 54.09  ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1  138  ? 87.292  4.453   111.906  1.00 51.42  ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1  138  ? 86.865  4.682   110.464  1.00 51.46  ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1  138  ? 86.279  3.586   112.635  1.00 48.56  ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A  1  139  ? 89.802  7.055   111.319  1.00 50.61  ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A  1  139  ? 89.876  8.391   111.893  1.00 52.93  ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A  1  139  ? 88.617  9.183   111.554  1.00 55.54  ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A  1  139  ? 88.371  9.506   110.391  1.00 56.87  ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A  1  139  ? 91.121  9.120   111.382  1.00 49.83  ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A  1  139  ? 91.289  10.496  111.997  1.00 57.50  ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A  1  139  ? 90.694  10.808  113.029  1.00 57.97  ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A  1  139  ? 92.110  11.328  111.366  1.00 60.12  ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A  1  140  ? 87.825  9.496   112.576  1.00 52.98  ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A  1  140  ? 86.542  10.160  112.384  1.00 47.84  ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A  1  140  ? 86.353  11.375  113.283  1.00 45.25  ? 140  MET A C     1 
ATOM   1065  O  O     . MET A  1  140  ? 86.901  11.449  114.384  1.00 47.90  ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A  1  140  ? 85.389  9.188   112.643  1.00 45.32  ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A  1  140  ? 85.399  7.935   111.793  1.00 53.06  ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A  1  140  ? 83.933  6.933   112.105  1.00 69.07  ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A  1  140  ? 83.995  6.794   113.889  1.00 59.03  ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A  1  141  ? 85.563  12.322  112.791  1.00 43.51  ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A  1  141  ? 85.064  13.429  113.588  1.00 41.33  ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A  1  141  ? 83.562  13.505  113.346  1.00 42.51  ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A  1  141  ? 83.123  13.771  112.226  1.00 46.38  ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A  1  141  ? 85.724  14.740  113.163  1.00 39.53  ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A  1  141  ? 87.242  14.717  113.184  1.00 43.53  ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A  1  141  ? 87.849  16.039  112.756  1.00 51.08  ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A  1  141  ? 87.083  16.989  112.489  1.00 49.01  ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A  1  141  ? 89.093  16.128  112.686  1.00 53.69  ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A  1  142  ? 82.773  13.265  114.387  1.00 36.40  ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A  1  142  ? 81.322  13.269  114.235  1.00 34.02  ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A  1  142  ? 80.668  14.469  114.919  1.00 35.91  ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A  1  142  ? 80.855  14.705  116.113  1.00 40.11  ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A  1  142  ? 80.681  11.940  114.712  1.00 35.83  ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A  1  142  ? 81.139  10.789  113.829  1.00 41.63  ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A  1  142  ? 81.022  11.656  116.162  1.00 42.18  ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A  1  143  ? 79.917  15.240  114.141  1.00 35.84  ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A  1  143  ? 79.206  16.389  114.678  1.00 33.74  ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A  1  143  ? 77.829  15.994  115.190  1.00 35.72  ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A  1  143  ? 76.979  15.513  114.427  1.00 39.11  ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A  1  143  ? 79.081  17.502  113.638  1.00 31.78  ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A  1  143  ? 78.081  18.570  114.037  1.00 32.97  ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A  1  143  ? 78.189  19.810  113.177  1.00 33.41  ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A  1  143  ? 77.203  20.813  113.567  1.00 36.22  ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A  1  143  ? 77.246  22.086  113.194  1.00 38.86  ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A  1  143  ? 78.234  22.519  112.423  1.00 40.60  ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A  1  143  ? 76.304  22.929  113.596  1.00 37.65  ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A  1  144  ? 77.632  16.214  116.489  1.00 34.62  ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A  1  144  ? 76.386  15.914  117.181  1.00 33.64  ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A  1  144  ? 75.752  17.209  117.680  1.00 37.21  ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A  1  144  ? 76.410  18.010  118.348  1.00 41.19  ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A  1  144  ? 76.640  14.997  118.391  1.00 32.11  ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A  1  144  ? 75.347  14.731  119.144  1.00 35.04  ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A  1  144  ? 77.286  13.696  117.943  1.00 32.52  ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A  1  145  ? 74.475  17.408  117.361  1.00 36.73  ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A  1  145  ? 73.780  18.651  117.692  1.00 39.39  ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A  1  145  ? 72.544  18.448  118.562  1.00 40.39  ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A  1  145  ? 72.009  17.343  118.661  1.00 37.06  ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A  1  145  ? 73.361  19.388  116.416  1.00 38.00  ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A  1  145  ? 74.508  20.124  115.757  1.00 41.48  ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A  1  145  ? 74.268  21.214  115.196  1.00 41.72  ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A  1  145  ? 75.647  19.615  115.793  1.00 43.70  ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A  1  146  ? 72.104  19.530  119.198  1.00 45.53  ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A  1  146  ? 70.798  19.564  119.840  1.00 45.22  ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A  1  146  ? 69.753  19.896  118.787  1.00 44.26  ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A  1  146  ? 69.986  20.735  117.916  1.00 45.13  ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A  1  146  ? 70.753  20.619  120.947  1.00 49.33  ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A  1  146  ? 71.319  20.174  122.283  1.00 55.07  ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A  1  146  ? 70.921  21.148  123.384  1.00 53.67  ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A  1  146  ? 71.459  20.760  124.685  1.00 56.46  ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A  1  146  ? 70.877  19.890  125.505  1.00 60.89  ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A  1  146  ? 69.736  19.309  125.159  1.00 63.02  ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A  1  146  ? 71.439  19.598  126.671  1.00 59.61  ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A  1  147  ? 68.603  19.240  118.868  1.00 40.83  ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A  1  147  ? 67.528  19.486  117.927  1.00 37.67  ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A  1  147  ? 66.248  18.789  118.332  1.00 36.90  ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A  1  147  ? 66.194  18.118  119.363  1.00 36.52  ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A  1  148  ? 65.214  18.944  117.513  1.00 36.28  ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A  1  148  ? 63.919  18.345  117.800  1.00 35.19  ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A  1  148  ? 63.317  17.723  116.540  1.00 34.61  ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A  1  148  ? 63.445  18.267  115.443  1.00 34.14  ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A  1  148  ? 62.951  19.384  118.419  1.00 32.93  ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A  1  148  ? 62.807  20.596  117.508  1.00 33.61  ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A  1  148  ? 61.595  18.759  118.721  1.00 33.21  ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A  1  149  ? 62.681  16.567  116.700  1.00 35.34  ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A  1  149  ? 62.011  15.912  115.593  1.00 39.05  ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A  1  149  ? 62.957  15.183  114.660  1.00 36.37  ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A  1  149  ? 64.037  14.750  115.063  1.00 37.74  ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A  1  150  ? 62.543  15.049  113.405  1.00 32.52  ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A  1  150  ? 63.321  14.321  112.412  1.00 32.97  ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A  1  150  ? 63.719  15.239  111.263  1.00 31.72  ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A  1  150  ? 62.870  15.689  110.494  1.00 32.59  ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A  1  150  ? 62.512  13.128  111.892  1.00 34.92  ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A  1  150  ? 63.151  12.377  110.744  1.00 35.73  ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A  1  150  ? 64.126  11.415  110.973  1.00 38.46  ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A  1  150  ? 62.763  12.615  109.431  1.00 35.56  ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A  1  150  ? 64.707  10.721  109.925  1.00 40.19  ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A  1  150  ? 63.339  11.928  108.377  1.00 36.00  ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A  1  150  ? 64.309  10.982  108.629  1.00 37.86  ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A  1  150  ? 64.884  10.295  107.584  1.00 35.56  ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A  1  151  ? 65.013  15.517  111.156  1.00 32.41  ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A  1  151  ? 65.528  16.353  110.079  1.00 35.24  ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A  1  151  ? 66.445  15.548  109.164  1.00 39.81  ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A  1  151  ? 67.548  15.174  109.563  1.00 40.61  ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A  1  151  ? 66.297  17.568  110.624  1.00 30.35  ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A  1  151  ? 66.831  18.411  109.478  1.00 33.90  ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A  1  151  ? 65.399  18.396  111.525  1.00 30.23  ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A  1  152  ? 65.985  15.276  107.932  1.00 39.78  ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A  1  152  ? 66.751  14.504  106.947  1.00 42.07  ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A  1  152  ? 68.054  15.200  106.565  1.00 40.41  ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A  1  152  ? 68.148  16.422  106.670  1.00 38.56  ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A  1  152  ? 65.810  14.452  105.738  1.00 44.49  ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A  1  152  ? 64.449  14.664  106.304  1.00 36.01  ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A  1  152  ? 64.647  15.630  107.430  1.00 39.13  ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A  1  153  ? 69.041  14.424  106.126  1.00 39.03  ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A  1  153  ? 70.343  14.967  105.751  1.00 40.25  ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A  1  153  ? 70.229  15.925  104.573  1.00 38.28  ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A  1  153  ? 71.021  16.856  104.437  1.00 37.80  ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A  1  153  ? 71.309  13.843  105.423  1.00 43.94  ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A  1  154  ? 69.228  15.698  103.731  1.00 40.36  ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A  1  154  ? 69.024  16.513  102.542  1.00 41.04  ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A  1  154  ? 68.239  17.766  102.902  1.00 41.41  ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A  1  154  ? 67.925  18.588  102.041  1.00 41.69  ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A  1  154  ? 68.293  15.716  101.459  1.00 41.89  ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A  1  154  ? 69.018  14.450  101.006  1.00 46.96  ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A  1  154  ? 68.820  13.281  101.958  1.00 58.61  ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A  1  154  ? 67.967  13.388  102.866  1.00 59.03  ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A  1  154  ? 69.518  12.256  101.801  1.00 56.97  ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A  1  155  ? 67.922  17.898  104.186  1.00 41.81  ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A  1  155  ? 67.213  19.067  104.692  1.00 42.93  ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A  1  155  ? 68.180  20.062  105.333  1.00 41.32  ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A  1  155  ? 68.296  21.201  104.880  1.00 40.25  ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A  1  155  ? 66.113  18.656  105.676  1.00 42.43  ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A  1  155  ? 64.885  19.550  105.627  1.00 39.94  ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A  1  155  ? 64.409  19.716  104.193  1.00 42.17  ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A  1  155  ? 63.257  20.698  104.091  1.00 51.73  ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A  1  155  ? 62.870  20.932  102.672  1.00 51.47  ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A  1  156  ? 68.863  19.634  106.393  1.00 40.16  ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A  1  156  ? 69.810  20.503  107.093  1.00 39.57  ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A  1  156  ? 71.101  20.750  106.307  1.00 40.82  ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A  1  156  ? 71.621  21.866  106.300  1.00 38.02  ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A  1  156  ? 70.121  19.969  108.498  1.00 38.84  ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A  1  156  ? 70.761  18.614  108.510  1.00 38.73  ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A  1  156  ? 72.096  18.417  108.229  1.00 40.89  ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A  1  156  ? 70.250  17.391  108.783  1.00 40.88  ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A  1  156  ? 72.378  17.130  108.320  1.00 40.76  ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A  1  156  ? 71.276  16.485  108.656  1.00 42.35  ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A  1  157  ? 71.609  19.709  105.651  1.00 42.33  ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A  1  157  ? 72.810  19.814  104.837  1.00 43.98  ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A  1  157  ? 74.031  20.358  105.559  1.00 46.27  ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A  1  157  ? 74.761  21.187  105.016  1.00 50.11  ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A  1  158  ? 74.258  19.884  106.780  1.00 46.76  ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A  1  158  ? 75.345  20.386  107.618  1.00 47.99  ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A  1  158  ? 76.712  19.813  107.240  1.00 50.64  ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A  1  158  ? 76.902  18.595  107.213  1.00 47.89  ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A  1  158  ? 75.072  20.107  109.110  1.00 43.82  ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A  1  158  ? 73.832  20.872  109.577  1.00 42.33  ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A  1  158  ? 76.278  20.484  109.955  1.00 47.03  ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A  1  158  ? 73.485  20.636  111.033  1.00 44.37  ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A  1  159  ? 77.657  20.704  106.950  1.00 52.03  ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A  1  159  ? 79.028  20.312  106.636  1.00 54.43  ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A  1  159  ? 80.042  21.160  107.401  1.00 58.77  ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A  1  159  ? 80.109  22.375  107.217  1.00 62.11  ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A  1  159  ? 79.290  20.440  105.134  1.00 53.62  ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A  1  159  ? 78.645  19.360  104.287  1.00 50.36  ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A  1  159  ? 78.871  19.634  102.810  1.00 48.54  ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A  1  159  ? 78.809  18.356  101.993  1.00 52.39  ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A  1  159  ? 79.007  18.627  100.543  1.00 58.77  ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A  1  160  ? 80.833  20.517  108.253  1.00 58.00  ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A  1  160  ? 81.890  21.214  108.979  1.00 62.25  ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A  1  160  ? 83.094  21.472  108.077  1.00 62.70  ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A  1  160  ? 83.756  22.505  108.187  1.00 60.02  ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A  1  160  ? 82.303  20.428  110.225  1.00 63.54  ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A  1  160  ? 81.339  20.622  111.379  1.00 57.89  ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A  1  160  ? 80.230  21.146  111.141  1.00 53.59  ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A  1  160  ? 81.689  20.254  112.521  1.00 53.41  ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A  1  161  ? 83.370  20.526  107.185  1.00 63.45  ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A  1  161  ? 84.406  20.700  106.173  1.00 61.27  ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A  1  161  ? 83.953  20.122  104.834  1.00 61.62  ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A  1  161  ? 82.811  19.686  104.695  1.00 64.06  ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A  1  161  ? 85.735  20.087  106.627  1.00 64.03  ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A  1  161  ? 85.663  18.625  107.030  1.00 61.61  ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A  1  161  ? 86.959  18.187  107.699  1.00 62.68  ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A  1  161  ? 87.204  18.912  108.944  1.00 66.49  ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A  1  161  ? 88.283  18.751  109.705  1.00 65.40  ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A  1  161  ? 89.226  17.890  109.349  1.00 63.36  ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A  1  161  ? 88.420  19.454  110.822  1.00 57.03  ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A  1  162  ? 84.850  20.120  103.854  1.00 61.90  ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A  1  162  ? 84.488  19.783  102.478  1.00 62.82  ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A  1  162  ? 84.075  18.320  102.285  1.00 59.03  ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A  1  162  ? 83.138  18.026  101.539  1.00 59.36  ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A  1  162  ? 85.628  20.137  101.496  1.00 64.80  ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A  1  162  ? 86.171  21.538  101.791  1.00 61.20  ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A  1  162  ? 85.148  20.037  100.054  1.00 62.22  ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A  1  162  ? 85.140  22.641  101.655  1.00 59.99  ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A  1  163  ? 84.765  17.408  102.960  1.00 55.79  ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A  1  163  ? 84.495  15.981  102.797  1.00 57.53  ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A  1  163  ? 83.486  15.424  103.800  1.00 51.88  ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A  1  163  ? 83.224  14.221  103.824  1.00 45.44  ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A  1  163  ? 85.794  15.173  102.845  1.00 60.70  ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A  1  163  ? 86.645  15.364  101.604  1.00 59.92  ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A  1  163  ? 86.131  15.649  100.521  1.00 54.89  ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A  1  163  ? 87.955  15.205  101.756  1.00 61.62  ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A  1  164  ? 82.930  16.302  104.627  1.00 53.11  ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A  1  164  ? 81.944  15.896  105.624  1.00 51.75  ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A  1  164  ? 80.677  15.344  104.973  1.00 48.47  ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A  1  164  ? 80.227  15.847  103.943  1.00 50.37  ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A  1  164  ? 81.607  17.063  106.543  1.00 52.90  ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A  1  165  ? 80.109  14.308  105.583  1.00 44.64  ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A  1  165  ? 78.881  13.695  105.091  1.00 42.35  ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A  1  165  ? 77.697  14.045  105.985  1.00 41.54  ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A  1  165  ? 77.667  13.659  107.154  1.00 44.27  ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A  1  165  ? 79.002  12.163  105.049  1.00 41.09  ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A  1  165  ? 80.235  11.742  104.249  1.00 39.79  ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A  1  165  ? 77.734  11.544  104.475  1.00 41.99  ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A  1  165  ? 80.548  10.265  104.352  1.00 37.72  ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A  1  166  ? 76.713  14.777  105.439  1.00 39.17  ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A  1  166  ? 75.511  15.121  106.203  1.00 38.61  ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A  1  166  ? 74.735  13.859  106.551  1.00 40.81  ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A  1  166  ? 74.602  12.974  105.705  1.00 39.46  ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A  1  166  ? 74.704  15.979  105.222  1.00 39.25  ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A  1  166  ? 75.692  16.451  104.210  1.00 39.56  ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A  1  166  ? 76.680  15.339  104.080  1.00 43.35  ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A  1  167  ? 74.240  13.777  107.781  1.00 37.69  ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A  1  167  ? 73.538  12.586  108.240  1.00 37.92  ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A  1  167  ? 72.117  12.930  108.666  1.00 38.08  ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A  1  167  ? 71.875  13.997  109.232  1.00 34.43  ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A  1  167  ? 74.276  11.929  109.424  1.00 38.95  ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A  1  167  ? 73.622  10.607  109.804  1.00 38.23  ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A  1  167  ? 75.741  11.720  109.082  1.00 37.87  ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A  1  168  ? 71.180  12.031  108.376  1.00 44.16  ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A  1  168  ? 69.812  12.174  108.852  1.00 44.23  ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A  1  168  ? 69.821  12.138  110.372  1.00 42.42  ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A  1  168  ? 70.345  11.203  110.980  1.00 39.34  ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A  1  168  ? 68.930  11.045  108.315  1.00 44.44  ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A  1  168  ? 68.931  10.972  106.800  1.00 50.04  ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A  1  168  ? 68.749  12.023  106.149  1.00 43.58  ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A  1  168  ? 69.120  9.861   106.260  1.00 55.63  ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A  1  169  ? 69.239  13.161  110.984  1.00 42.18  ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A  1  169  ? 69.234  13.266  112.432  1.00 35.43  ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A  1  169  ? 67.861  12.945  112.993  1.00 35.98  ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A  1  169  ? 66.887  13.643  112.713  1.00 37.01  ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A  1  169  ? 69.671  14.658  112.861  1.00 35.06  ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A  1  170  ? 67.783  11.885  113.787  1.00 36.79  ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A  1  170  ? 66.568  11.613  114.529  1.00 37.35  ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A  1  170  ? 66.842  12.106  115.939  1.00 40.93  ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A  1  170  ? 67.560  11.465  116.708  1.00 45.82  ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A  1  170  ? 66.257  10.107  114.560  1.00 35.91  ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A  1  170  ? 64.877  9.858   115.141  1.00 35.44  ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A  1  170  ? 66.370  9.511   113.166  1.00 34.31  ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A  1  171  ? 66.249  13.245  116.278  1.00 36.42  ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A  1  171  ? 66.602  13.943  117.506  1.00 39.18  ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A  1  171  ? 65.920  13.377  118.742  1.00 39.85  ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A  1  171  ? 66.547  13.243  119.793  1.00 39.58  ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A  1  171  ? 66.314  15.441  117.379  1.00 36.45  ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A  1  171  ? 67.337  16.191  116.572  1.00 36.19  ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A  1  171  ? 68.659  16.243  116.981  1.00 35.18  ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A  1  171  ? 66.973  16.860  115.416  1.00 36.59  ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A  1  171  ? 69.601  16.939  116.246  1.00 33.44  ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A  1  171  ? 67.910  17.559  114.677  1.00 31.38  ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A  1  171  ? 69.225  17.598  115.093  1.00 30.08  ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A  1  172  ? 64.641  13.038  118.602  1.00 38.63  ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A  1  172  ? 63.804  12.684  119.744  1.00 37.46  ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A  1  172  ? 64.388  11.562  120.594  1.00 37.68  ? 172  SER A C     1 
ATOM   1314  O  O     . SER A  1  172  ? 64.616  10.454  120.108  1.00 39.27  ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A  1  172  ? 62.396  12.309  119.283  1.00 38.02  ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A  1  172  ? 61.585  11.952  120.389  1.00 34.45  ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A  1  173  ? 64.643  11.865  121.874  1.00 36.48  ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A  1  173  ? 65.184  10.931  122.865  1.00 37.20  ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A  1  173  ? 64.172  9.868   123.279  1.00 34.60  ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A  1  173  ? 64.561  8.818   123.792  1.00 33.36  ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A  1  173  ? 65.510  11.839  124.052  1.00 38.03  ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A  1  173  ? 64.566  12.974  123.915  1.00 34.13  ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A  1  173  ? 64.432  13.207  122.444  1.00 32.21  ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A  1  174  ? 62.889  10.137  123.059  1.00 33.57  ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A  1  174  ? 61.851  9.208   123.479  1.00 31.64  ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A  1  174  ? 61.714  8.062   122.487  1.00 30.74  ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A  1  174  ? 61.359  8.272   121.327  1.00 31.72  ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A  1  174  ? 60.492  9.913   123.596  1.00 27.94  ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A  1  174  ? 59.417  8.910   123.950  1.00 23.37  ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A  1  174  ? 60.557  11.028  124.628  1.00 30.26  ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A  1  175  ? 61.992  6.848   122.952  1.00 30.47  ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A  1  175  ? 61.894  5.666   122.102  1.00 29.90  ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A  1  175  ? 60.478  5.101   121.981  1.00 26.62  ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A  1  175  ? 60.040  4.749   120.887  1.00 23.67  ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A  1  175  ? 62.885  4.587   122.551  1.00 29.97  ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A  1  175  ? 64.338  5.016   122.409  1.00 37.54  ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A  1  175  ? 65.249  3.846   122.067  1.00 46.20  ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A  1  175  ? 66.588  4.298   121.692  1.00 51.15  ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A  1  175  ? 66.942  4.648   120.458  1.00 48.84  ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A  1  175  ? 66.057  4.597   119.470  1.00 43.12  ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A  1  175  ? 68.181  5.049   120.210  1.00 47.01  ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A  1  176  ? 59.760  5.013   123.097  1.00 27.84  ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A  1  176  ? 58.399  4.477   123.051  1.00 24.93  ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A  1  176  ? 57.493  5.061   124.132  1.00 27.04  ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A  1  176  ? 57.927  5.295   125.253  1.00 29.04  ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A  1  176  ? 58.429  2.948   123.145  1.00 26.15  ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A  1  176  ? 57.073  2.279   122.983  1.00 28.06  ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A  1  176  ? 57.218  0.896   122.365  1.00 32.81  ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A  1  176  ? 58.009  -0.002  123.199  1.00 36.01  ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A  1  176  ? 57.521  -1.072  123.817  1.00 43.32  ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A  1  176  ? 56.239  -1.388  123.687  1.00 42.03  ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A  1  176  ? 58.315  -1.833  124.560  1.00 43.30  ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A  1  177  ? 56.229  5.292   123.792  1.00 26.24  ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A  1  177  ? 55.259  5.771   124.771  1.00 23.71  ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A  1  177  ? 53.965  4.980   124.697  1.00 23.70  ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A  1  177  ? 53.345  4.879   123.639  1.00 25.91  ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A  1  177  ? 54.924  7.263   124.585  1.00 21.90  ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A  1  177  ? 53.759  7.655   125.478  1.00 22.30  ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A  1  177  ? 56.128  8.122   124.895  1.00 23.51  ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A  1  178  ? 53.562  4.416   125.828  1.00 24.70  ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A  1  178  ? 52.279  3.737   125.915  1.00 24.68  ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A  1  178  ? 51.509  4.310   127.090  1.00 27.44  ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A  1  178  ? 52.099  4.888   127.996  1.00 30.47  ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A  1  178  ? 52.477  2.245   126.090  1.00 24.57  ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A  1  179  ? 50.191  4.171   127.071  1.00 25.58  ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A  1  179  ? 49.399  4.552   128.229  1.00 23.56  ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A  1  179  ? 48.173  3.664   128.358  1.00 27.31  ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A  1  179  ? 47.572  3.263   127.361  1.00 27.76  ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A  1  179  ? 49.030  6.041   128.203  1.00 22.99  ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A  1  179  ? 47.893  6.378   127.283  1.00 25.30  ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A  1  179  ? 46.623  6.603   127.788  1.00 26.17  ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A  1  179  ? 48.093  6.485   125.918  1.00 29.01  ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A  1  179  ? 45.572  6.920   126.948  1.00 25.42  ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A  1  179  ? 47.045  6.802   125.071  1.00 26.59  ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A  1  179  ? 45.784  7.019   125.588  1.00 25.26  ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A  1  180  ? 47.820  3.350   129.599  1.00 31.98  ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A  1  180  ? 46.727  2.434   129.881  1.00 32.50  ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A  1  180  ? 45.788  3.019   130.928  1.00 29.72  ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A  1  180  ? 46.229  3.561   131.944  1.00 30.16  ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A  1  180  ? 47.280  1.086   130.344  1.00 30.07  ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A  1  180  ? 46.229  0.012   130.538  1.00 33.61  ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A  1  180  ? 46.813  -1.382  130.453  1.00 39.99  ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A  1  180  ? 47.890  -1.582  129.892  1.00 44.04  ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A  1  180  ? 46.103  -2.357  131.010  1.00 41.95  ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A  1  181  ? 44.490  2.913   130.667  1.00 26.97  ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A  1  181  ? 43.481  3.425   131.582  1.00 27.51  ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A  1  181  ? 42.773  2.281   132.294  1.00 31.05  ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A  1  181  ? 42.031  1.516   131.679  1.00 29.55  ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A  1  181  ? 42.443  4.283   130.847  1.00 25.61  ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A  1  181  ? 41.416  4.822   131.828  1.00 32.27  ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A  1  181  ? 43.131  5.417   130.110  1.00 24.16  ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A  1  182  ? 43.003  2.174   133.598  1.00 33.56  ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A  1  182  ? 42.442  1.085   134.387  1.00 33.89  ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A  1  182  ? 41.293  1.583   135.253  1.00 36.94  ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A  1  182  ? 41.282  2.736   135.673  1.00 37.96  ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A  1  182  ? 43.527  0.444   135.255  1.00 38.76  ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A  1  182  ? 44.633  -0.231  134.458  1.00 39.59  ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A  1  182  ? 45.769  -0.724  135.332  1.00 45.66  ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A  1  182  ? 46.519  -1.618  134.886  1.00 44.49  ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A  1  182  ? 45.915  -0.216  136.464  1.00 51.19  ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A  1  183  ? 40.316  0.718   135.506  1.00 37.93  ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A  1  183  ? 39.157  1.113   136.299  1.00 39.90  ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A  1  183  ? 39.504  1.252   137.779  1.00 38.28  ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A  1  183  ? 40.199  0.410   138.348  1.00 35.15  ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A  1  183  ? 38.001  0.129   136.107  1.00 41.48  ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A  1  183  ? 36.660  0.720   136.507  1.00 46.78  ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A  1  183  ? 36.496  1.955   136.398  1.00 43.87  ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A  1  183  ? 35.769  -0.048  136.928  1.00 48.59  ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A  1  184  ? 39.019  2.328   138.391  1.00 40.54  ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A  1  184  ? 39.228  2.576   139.813  1.00 42.04  ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A  1  184  ? 37.986  3.214   140.430  1.00 46.57  ? 184  THR A C     1 
ATOM   1412  O  O     . THR A  1  184  ? 37.094  3.680   139.715  1.00 45.75  ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A  1  184  ? 40.456  3.477   140.064  1.00 40.10  ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A  1  184  ? 40.689  3.597   141.473  1.00 40.26  ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A  1  184  ? 40.238  4.862   139.473  1.00 41.75  ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A  1  185  ? 37.927  3.222   141.758  1.00 50.39  ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A  1  185  ? 36.793  3.791   142.477  1.00 50.69  ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A  1  185  ? 37.256  4.597   143.686  1.00 52.94  ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A  1  185  ? 38.270  4.279   144.310  1.00 52.81  ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A  1  185  ? 35.839  2.683   142.928  1.00 52.37  ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A  1  185  ? 36.463  1.691   143.901  1.00 59.88  ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A  1  185  ? 35.478  0.611   144.334  1.00 67.74  ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A  1  185  ? 34.320  1.161   145.034  1.00 69.22  ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A  1  185  ? 33.119  1.314   144.486  1.00 70.49  ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A  1  185  ? 32.913  0.953   143.227  1.00 67.52  ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A  1  185  ? 32.122  1.824   145.197  1.00 71.88  ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A  1  186  ? 36.515  5.653   144.003  1.00 52.95  ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A  1  186  ? 36.762  6.425   145.213  1.00 54.70  ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A  1  186  ? 35.452  6.672   145.946  1.00 60.78  ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A  1  186  ? 34.566  7.359   145.435  1.00 63.25  ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A  1  186  ? 37.434  7.756   144.879  1.00 51.55  ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A  1  186  ? 37.712  8.662   146.080  1.00 55.59  ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A  1  186  ? 38.652  7.979   147.060  1.00 59.64  ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A  1  186  ? 38.282  9.999   145.631  1.00 59.80  ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A  1  187  ? 35.339  6.121   147.149  1.00 60.11  ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A  1  187  ? 34.115  6.233   147.918  1.00 66.19  ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A  1  187  ? 32.927  5.635   147.187  1.00 68.05  ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A  1  187  ? 32.955  4.470   146.785  1.00 63.37  ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A  1  188  ? 31.883  6.438   147.012  1.00 71.13  ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A  1  188  ? 30.664  5.988   146.346  1.00 73.55  ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A  1  188  ? 30.704  6.202   144.833  1.00 69.32  ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A  1  188  ? 29.840  5.707   144.108  1.00 63.11  ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A  1  188  ? 29.439  6.690   146.940  1.00 75.20  ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A  1  188  ? 29.249  6.466   148.434  1.00 73.05  ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A  1  188  ? 28.928  5.023   148.780  1.00 78.09  ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A  1  188  ? 28.409  4.273   147.953  1.00 80.27  ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A  1  188  ? 29.240  4.627   150.009  1.00 78.27  ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A  1  189  ? 31.703  6.942   144.360  1.00 66.99  ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A  1  189  ? 31.850  7.182   142.928  1.00 59.88  ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A  1  189  ? 32.406  5.956   142.206  1.00 59.62  ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A  1  189  ? 33.412  5.378   142.618  1.00 61.93  ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A  1  189  ? 32.719  8.415   142.659  1.00 53.47  ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A  1  189  ? 31.932  9.718   142.572  1.00 53.24  ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A  1  189  ? 32.794  10.866  142.062  1.00 52.65  ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A  1  189  ? 33.715  11.363  143.080  1.00 62.33  ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A  1  189  ? 33.507  12.457  143.806  1.00 70.68  ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A  1  189  ? 34.399  12.836  144.711  1.00 71.91  ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A  1  189  ? 32.408  13.176  143.624  1.00 71.88  ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A  1  190  ? 31.742  5.574   141.120  1.00 59.92  ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A  1  190  ? 32.109  4.381   140.367  1.00 59.38  ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A  1  190  ? 32.509  4.737   138.941  1.00 57.67  ? 190  THR A C     1 
ATOM   1462  O  O     . THR A  1  190  ? 32.174  5.816   138.446  1.00 55.19  ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A  1  190  ? 30.956  3.364   140.326  1.00 61.89  ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A  1  190  ? 29.795  3.980   139.756  1.00 65.00  ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A  1  190  ? 30.626  2.882   141.727  1.00 67.43  ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A  1  191  ? 33.232  3.825   138.296  1.00 55.78  ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A  1  191  ? 33.748  4.033   136.945  1.00 55.72  ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A  1  191  ? 34.643  5.266   136.897  1.00 50.50  ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A  1  191  ? 34.313  6.262   136.252  1.00 46.11  ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A  1  191  ? 32.604  4.153   135.928  1.00 60.29  ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A  1  191  ? 33.072  3.978   134.489  1.00 62.61  ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A  1  191  ? 34.288  4.101   134.225  1.00 59.44  ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A  1  191  ? 32.215  3.719   133.616  1.00 60.06  ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A  1  192  ? 35.777  5.192   137.587  1.00 48.43  ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A  1  192  ? 36.753  6.273   137.559  1.00 43.29  ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A  1  192  ? 38.010  5.828   136.824  1.00 38.79  ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A  1  192  ? 38.334  4.642   136.788  1.00 39.25  ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A  1  192  ? 37.095  6.747   138.973  1.00 41.35  ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A  1  192  ? 35.964  7.408   139.759  1.00 40.97  ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A  1  192  ? 36.483  7.942   141.082  1.00 45.20  ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A  1  192  ? 35.327  8.519   138.942  1.00 42.79  ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A  1  193  ? 38.706  6.785   136.222  1.00 37.65  ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A  1  193  ? 39.896  6.480   135.440  1.00 39.67  ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A  1  193  ? 41.172  6.496   136.277  1.00 36.55  ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A  1  193  ? 41.384  7.384   137.102  1.00 36.24  ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A  1  193  ? 40.030  7.450   134.261  1.00 39.17  ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A  1  193  ? 39.033  7.165   133.150  1.00 36.04  ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A  1  193  ? 39.225  7.689   132.032  1.00 31.18  ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A  1  193  ? 38.064  6.414   133.390  1.00 43.15  ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A  1  194  ? 42.015  5.495   136.053  1.00 33.18  ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A  1  194  ? 43.348  5.449   136.629  1.00 34.16  ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A  1  194  ? 44.330  5.456   135.471  1.00 33.31  ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A  1  194  ? 44.409  4.484   134.715  1.00 34.80  ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A  1  194  ? 43.521  4.175   137.455  1.00 39.83  ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A  1  194  ? 44.950  3.883   137.883  1.00 39.38  ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A  1  194  ? 45.032  2.545   138.602  1.00 39.79  ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A  1  194  ? 46.453  2.227   139.030  1.00 42.16  ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A  1  194  ? 46.532  0.910   139.718  1.00 49.01  ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A  1  195  ? 45.074  6.548   135.325  1.00 30.39  ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A  1  195  ? 45.916  6.718   134.145  1.00 29.09  ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A  1  195  ? 47.361  6.307   134.381  1.00 31.80  ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A  1  195  ? 48.057  6.910   135.189  1.00 33.92  ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A  1  195  ? 45.869  8.165   133.652  1.00 26.96  ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A  1  195  ? 46.799  8.471   132.477  1.00 26.79  ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A  1  195  ? 46.486  7.564   131.296  1.00 27.31  ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A  1  195  ? 46.702  9.934   132.075  1.00 26.49  ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A  1  196  ? 47.818  5.288   133.662  1.00 31.02  ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A  1  196  ? 49.214  4.882   133.760  1.00 32.16  ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A  1  196  ? 49.960  5.215   132.473  1.00 32.67  ? 196  THR A C     1 
ATOM   1510  O  O     . THR A  1  196  ? 49.563  4.798   131.389  1.00 33.27  ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A  1  196  ? 49.361  3.385   134.073  1.00 34.25  ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A  1  196  ? 48.391  2.999   135.055  1.00 35.31  ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A  1  196  ? 50.758  3.097   134.602  1.00 34.92  ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A  1  197  ? 51.043  5.973   132.605  1.00 31.65  ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A  1  197  ? 51.816  6.435   131.462  1.00 29.37  ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A  1  197  ? 53.207  5.810   131.483  1.00 32.02  ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A  1  197  ? 54.019  6.112   132.357  1.00 35.40  ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A  1  197  ? 51.927  7.962   131.489  1.00 26.52  ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A  1  197  ? 51.718  8.724   130.179  1.00 26.03  ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A  1  197  ? 51.811  10.223  130.416  1.00 23.45  ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A  1  197  ? 52.721  8.288   129.125  1.00 32.54  ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A  1  198  ? 53.476  4.938   130.518  1.00 29.47  ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A  1  198  ? 54.767  4.266   130.426  1.00 30.37  ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A  1  198  ? 55.646  4.884   129.341  1.00 29.45  ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A  1  198  ? 55.246  4.979   128.176  1.00 30.89  ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A  1  198  ? 54.572  2.770   130.178  1.00 27.38  ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A  1  198  ? 53.532  2.143   131.090  1.00 30.57  ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A  1  198  ? 53.722  0.646   131.207  1.00 32.24  ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A  1  198  ? 53.802  0.001   129.903  1.00 34.07  ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A  1  198  ? 53.908  -1.310  129.727  1.00 36.66  ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A  1  198  ? 53.977  -1.815  128.503  1.00 38.94  ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A  1  198  ? 53.945  -2.118  130.778  1.00 37.93  ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A  1  199  ? 56.846  5.301   129.739  1.00 29.39  ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  199  ? 57.760  6.009   128.849  1.00 29.55  ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  199  ? 59.151  5.372   128.794  1.00 30.78  ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  199  ? 59.844  5.273   129.812  1.00 34.09  ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  199  ? 57.915  7.485   129.269  1.00 28.16  ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  199  ? 56.554  8.182   129.297  1.00 24.77  ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  199  ? 58.871  8.211   128.336  1.00 28.25  ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  199  ? 56.606  9.582   129.861  1.00 26.22  ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A  1  200  ? 59.541  4.942   127.596  1.00 28.70  ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A  1  200  ? 60.886  4.452   127.318  1.00 28.38  ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A  1  200  ? 61.683  5.507   126.562  1.00 29.01  ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A  1  200  ? 61.291  5.919   125.463  1.00 32.05  ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A  1  200  ? 60.838  3.199   126.443  1.00 27.56  ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A  1  200  ? 60.257  1.981   127.078  1.00 26.78  ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A  1  200  ? 60.940  0.971   127.689  1.00 25.42  ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A  1  200  ? 58.875  1.620   127.132  1.00 29.66  ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A  1  200  ? 60.068  0.009   128.133  1.00 26.33  ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A  1  200  ? 58.790  0.384   127.802  1.00 29.07  ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A  1  200  ? 57.695  2.225   126.685  1.00 30.86  ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A  1  200  ? 57.578  -0.257  128.039  1.00 31.89  ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A  1  200  ? 56.492  1.587   126.920  1.00 31.50  ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A  1  200  ? 56.442  0.359   127.590  1.00 32.35  ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A  1  201  ? 62.805  5.928   127.140  1.00 31.57  ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A  1  201  ? 63.730  6.834   126.465  1.00 35.70  ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A  1  201  ? 65.088  6.161   126.280  1.00 38.54  ? 201  THR A C     1 
ATOM   1558  O  O     . THR A  1  201  ? 65.275  5.006   126.666  1.00 36.95  ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A  1  201  ? 63.921  8.149   127.243  1.00 35.73  ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A  1  201  ? 64.649  7.893   128.451  1.00 40.66  ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A  1  201  ? 62.575  8.771   127.581  1.00 35.63  ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A  1  202  ? 66.033  6.886   125.687  1.00 39.18  ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A  1  202  ? 67.356  6.336   125.403  1.00 44.95  ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A  1  202  ? 68.382  6.647   126.492  1.00 46.49  ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A  1  202  ? 69.525  6.191   126.430  1.00 44.12  ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A  1  202  ? 67.862  6.836   124.047  1.00 47.64  ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A  1  202  ? 67.756  8.345   123.901  1.00 45.93  ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A  1  202  ? 67.684  9.048   124.932  1.00 41.54  ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A  1  202  ? 67.746  8.830   122.750  1.00 48.64  ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A  1  203  ? 67.970  7.424   127.487  1.00 44.01  ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A  1  203  ? 68.856  7.786   128.575  1.00 40.72  ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A  1  203  ? 69.403  9.194   128.455  1.00 40.55  ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A  1  203  ? 69.897  9.751   129.435  1.00 45.80  ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A  1  204  ? 69.324  9.767   127.256  1.00 40.60  ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A  1  204  ? 69.773  11.139  127.031  1.00 44.51  ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A  1  204  ? 68.989  12.087  127.932  1.00 41.39  ? 204  SER A C     1 
ATOM   1577  O  O     . SER A  1  204  ? 69.566  12.927  128.623  1.00 42.73  ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A  1  204  ? 69.603  11.533  125.562  1.00 45.56  ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A  1  204  ? 70.053  12.857  125.330  1.00 43.48  ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A  1  205  ? 67.668  11.946  127.912  1.00 37.91  ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A  1  205  ? 66.813  12.599  128.894  1.00 40.82  ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A  1  205  ? 65.953  11.532  129.571  1.00 42.17  ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A  1  205  ? 65.540  10.557  128.938  1.00 40.74  ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A  1  205  ? 65.948  13.736  128.275  1.00 40.07  ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A  1  205  ? 66.433  14.080  126.874  1.00 38.28  ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A  1  205  ? 64.467  13.372  128.263  1.00 37.45  ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A  1  206  ? 65.717  11.700  130.867  1.00 42.19  ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A  1  206  ? 64.969  10.716  131.637  1.00 40.33  ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A  1  206  ? 63.484  10.814  131.305  1.00 38.88  ? 206  THR A C     1 
ATOM   1590  O  O     . THR A  1  206  ? 63.018  11.869  130.874  1.00 38.91  ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A  1  206  ? 65.178  10.926  133.147  1.00 41.70  ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A  1  206  ? 64.331  11.986  133.606  1.00 45.16  ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A  1  206  ? 66.631  11.268  133.438  1.00 41.76  ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A  1  207  ? 62.737  9.711   131.489  1.00 37.37  ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A  1  207  ? 61.294  9.714   131.224  1.00 37.03  ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A  1  207  ? 60.565  10.813  131.992  1.00 36.87  ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A  1  207  ? 59.621  11.406  131.465  1.00 36.05  ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A  1  207  ? 60.850  8.337   131.723  1.00 33.49  ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A  1  207  ? 62.051  7.485   131.554  1.00 33.58  ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A  1  207  ? 63.219  8.370   131.867  1.00 35.80  ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A  1  208  ? 61.004  11.082  133.217  1.00 36.00  ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  208  ? 60.415  12.143  134.027  1.00 39.91  ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  208  ? 60.616  13.509  133.375  1.00 37.85  ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  208  ? 59.671  14.295  133.246  1.00 36.87  ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  208  ? 61.012  12.137  135.435  1.00 38.22  ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  208  ? 60.547  13.268  136.354  1.00 36.89  ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  208  ? 59.036  13.227  136.530  1.00 36.43  ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  208  ? 61.253  13.195  137.700  1.00 39.74  ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A  1  209  ? 61.853  13.782  132.969  1.00 36.22  ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A  1  209  ? 62.189  15.025  132.284  1.00 37.62  ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A  1  209  ? 61.341  15.186  131.029  1.00 35.82  ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A  1  209  ? 60.780  16.253  130.775  1.00 36.41  ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A  1  209  ? 63.675  15.050  131.912  1.00 45.80  ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A  1  209  ? 64.630  15.087  133.099  1.00 49.26  ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A  1  209  ? 66.084  14.947  132.681  1.00 48.06  ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A  1  209  ? 66.955  14.843  133.572  1.00 47.14  ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A  1  209  ? 66.356  14.939  131.462  1.00 43.86  ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A  1  210  ? 61.248  14.110  130.253  1.00 35.34  ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A  1  210  ? 60.464  14.105  129.025  1.00 35.88  ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A  1  210  ? 59.004  14.444  129.305  1.00 35.21  ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A  1  210  ? 58.403  15.267  128.610  1.00 34.41  ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A  1  210  ? 60.575  12.754  128.333  1.00 33.32  ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A  1  211  ? 58.444  13.808  130.329  1.00 34.68  ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A  1  211  ? 57.059  14.049  130.718  1.00 31.14  ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A  1  211  ? 56.841  15.509  131.091  1.00 30.23  ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A  1  211  ? 55.893  16.139  130.624  1.00 31.83  ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A  1  211  ? 56.659  13.144  131.884  1.00 31.12  ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A  1  211  ? 55.258  13.374  132.457  1.00 29.01  ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A  1  211  ? 54.193  13.172  131.391  1.00 25.90  ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A  1  211  ? 55.010  12.460  133.646  1.00 33.39  ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A  1  212  ? 57.726  16.042  131.926  1.00 30.82  ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A  1  212  ? 57.625  17.435  132.349  1.00 30.14  ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A  1  212  ? 57.701  18.413  131.179  1.00 33.60  ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A  1  212  ? 56.919  19.365  131.104  1.00 35.12  ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A  1  212  ? 58.697  17.756  133.391  1.00 31.65  ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A  1  212  ? 58.512  16.967  134.673  1.00 36.42  ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A  1  212  ? 57.399  16.847  135.186  1.00 37.98  ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A  1  212  ? 59.604  16.416  135.192  1.00 38.63  ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A  1  213  ? 58.637  18.169  130.264  1.00 37.03  ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A  1  213  ? 58.772  18.998  129.069  1.00 36.25  ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A  1  213  ? 57.515  18.920  128.208  1.00 33.40  ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A  1  213  ? 57.090  19.915  127.618  1.00 31.92  ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A  1  213  ? 59.994  18.576  128.251  1.00 31.17  ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A  1  213  ? 61.317  18.767  128.971  1.00 34.26  ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A  1  213  ? 62.504  18.360  128.122  1.00 41.15  ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A  1  213  ? 62.560  18.660  126.929  1.00 41.24  ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A  1  213  ? 63.458  17.665  128.731  1.00 44.75  ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A  1  214  ? 56.922  17.731  128.151  1.00 32.50  ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A  1  214  ? 55.708  17.507  127.375  1.00 31.47  ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A  1  214  ? 54.529  18.291  127.946  1.00 31.29  ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A  1  214  ? 53.835  19.008  127.218  1.00 30.20  ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A  1  214  ? 55.383  16.022  127.321  1.00 28.87  ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A  1  215  ? 54.309  18.146  129.251  1.00 32.18  ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A  1  215  ? 53.238  18.862  129.938  1.00 30.57  ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A  1  215  ? 53.429  20.363  129.774  1.00 30.37  ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A  1  215  ? 52.472  21.100  129.518  1.00 30.00  ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A  1  215  ? 53.189  18.511  131.438  1.00 27.85  ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A  1  215  ? 52.106  19.315  132.138  1.00 32.13  ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A  1  215  ? 52.952  17.022  131.631  1.00 27.07  ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A  1  216  ? 54.677  20.804  129.910  1.00 31.62  ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A  1  216  ? 55.023  22.203  129.692  1.00 35.04  ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A  1  216  ? 54.618  22.667  128.296  1.00 37.53  ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A  1  216  ? 54.007  23.724  128.142  1.00 36.82  ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A  1  216  ? 56.521  22.429  129.913  1.00 34.18  ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A  1  216  ? 57.027  23.789  129.448  1.00 40.24  ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A  1  216  ? 56.367  24.953  130.171  1.00 42.77  ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A  1  216  ? 55.874  24.762  131.304  1.00 43.32  ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A  1  216  ? 56.342  26.065  129.602  1.00 42.18  ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A  1  217  ? 54.957  21.869  127.285  1.00 37.70  ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A  1  217  ? 54.585  22.175  125.906  1.00 34.37  ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A  1  217  ? 53.073  22.306  125.751  1.00 34.32  ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A  1  217  ? 52.584  23.269  125.156  1.00 34.27  ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A  1  217  ? 55.107  21.105  124.926  1.00 29.31  ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A  1  217  ? 56.623  21.217  124.776  1.00 31.17  ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A  1  217  ? 54.446  21.251  123.566  1.00 27.51  ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A  1  217  ? 57.217  20.181  123.852  1.00 33.34  ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A  1  218  ? 52.338  21.342  126.298  1.00 32.57  ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A  1  218  ? 50.882  21.338  126.181  1.00 30.82  ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A  1  218  ? 50.250  22.563  126.835  1.00 33.30  ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A  1  218  ? 49.372  23.202  126.253  1.00 34.23  ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A  1  218  ? 50.291  20.057  126.775  1.00 29.34  ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A  1  218  ? 48.777  19.892  126.624  1.00 27.56  ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A  1  218  ? 48.350  20.074  125.177  1.00 25.57  ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A  1  218  ? 48.337  18.533  127.138  1.00 28.26  ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A  1  219  ? 50.704  22.888  128.041  1.00 34.83  ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A  1  219  ? 50.195  24.048  128.769  1.00 37.45  ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A  1  219  ? 50.510  25.331  127.999  1.00 36.23  ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A  1  219  ? 49.658  26.217  127.848  1.00 32.92  ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A  1  219  ? 50.801  24.087  130.177  1.00 39.54  ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A  1  219  ? 50.118  25.036  131.155  1.00 42.03  ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A  1  219  ? 50.801  26.392  131.175  1.00 42.83  ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A  1  219  ? 52.241  26.262  131.370  1.00 37.17  ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A  1  219  ? 53.103  27.265  131.247  1.00 39.71  ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A  1  219  ? 52.671  28.478  130.927  1.00 40.32  ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A  1  219  ? 54.397  27.055  131.441  1.00 42.71  ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A  1  220  ? 51.742  25.409  127.504  1.00 35.65  ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A  1  220  ? 52.198  26.543  126.712  1.00 39.03  ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A  1  220  ? 51.347  26.710  125.456  1.00 41.07  ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A  1  220  ? 51.135  27.827  124.982  1.00 42.05  ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A  1  220  ? 53.672  26.366  126.341  1.00 42.41  ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A  1  220  ? 54.275  27.523  125.564  1.00 49.15  ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A  1  220  ? 55.759  27.338  125.315  1.00 58.22  ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A  1  220  ? 56.421  26.667  126.136  1.00 52.67  ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A  1  220  ? 56.263  27.857  124.296  1.00 67.03  ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A  1  221  ? 50.860  25.595  124.921  1.00 40.41  ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A  1  221  ? 49.954  25.635  123.778  1.00 39.24  ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A  1  221  ? 48.555  26.068  124.203  1.00 34.82  ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A  1  221  ? 47.833  26.702  123.435  1.00 33.49  ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A  1  221  ? 49.907  24.281  123.064  1.00 36.58  ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A  1  221  ? 50.866  24.169  121.920  1.00 34.55  ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A  1  221  ? 52.227  24.044  122.096  1.00 38.09  ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A  1  221  ? 50.659  24.172  120.581  1.00 33.68  ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A  1  221  ? 52.817  23.970  120.916  1.00 36.75  ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A  1  221  ? 51.888  24.046  119.981  1.00 35.58  ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A  1  222  ? 48.177  25.725  125.430  1.00 34.77  ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A  1  222  ? 46.897  26.163  125.972  1.00 36.44  ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A  1  222  ? 46.900  27.672  126.181  1.00 41.26  ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A  1  222  ? 45.849  28.313  126.169  1.00 41.40  ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A  1  222  ? 46.588  25.447  127.287  1.00 30.61  ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A  1  222  ? 46.336  23.945  127.175  1.00 29.38  ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A  1  222  ? 45.954  23.366  128.524  1.00 31.89  ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A  1  222  ? 45.260  23.665  126.140  1.00 29.71  ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A  1  223  ? 48.092  28.233  126.367  1.00 42.01  ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A  1  223  ? 48.248  29.678  126.512  1.00 40.80  ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A  1  223  ? 47.761  30.420  125.268  1.00 43.12  ? 223  THR A C     1 
ATOM   1726  O  O     . THR A  1  223  ? 47.351  31.576  125.340  1.00 46.19  ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A  1  223  ? 49.723  30.057  126.759  1.00 44.04  ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A  1  223  ? 50.292  29.168  127.728  1.00 49.49  ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A  1  223  ? 49.842  31.493  127.254  1.00 47.23  ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A  1  224  ? 47.793  29.736  124.130  1.00 43.21  ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A  1  224  ? 47.501  30.358  122.842  1.00 44.38  ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A  1  224  ? 46.021  30.700  122.655  1.00 43.59  ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A  1  224  ? 45.645  31.370  121.693  1.00 47.19  ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A  1  224  ? 47.991  29.458  121.708  1.00 42.48  ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A  1  224  ? 49.483  29.191  121.740  1.00 44.04  ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A  1  224  ? 50.355  30.077  122.363  1.00 44.18  ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A  1  224  ? 50.019  28.058  121.142  1.00 44.55  ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A  1  224  ? 51.718  29.839  122.393  1.00 48.05  ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A  1  224  ? 51.381  27.811  121.167  1.00 44.81  ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A  1  224  ? 52.225  28.705  121.794  1.00 49.60  ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A  1  224  ? 53.581  28.463  121.822  1.00 50.58  ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A  1  225  ? 45.188  30.246  123.583  1.00 41.27  ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A  1  225  ? 43.757  30.522  123.537  1.00 42.81  ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A  1  225  ? 43.419  31.812  124.285  1.00 52.27  ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A  1  225  ? 42.249  32.149  124.470  1.00 52.29  ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A  1  225  ? 42.961  29.340  124.097  1.00 42.86  ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A  1  225  ? 43.000  28.114  123.225  1.00 41.90  ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A  1  225  ? 43.948  27.125  123.433  1.00 38.45  ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A  1  225  ? 42.087  27.953  122.195  1.00 41.74  ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A  1  225  ? 43.984  25.997  122.629  1.00 34.87  ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A  1  225  ? 42.118  26.829  121.388  1.00 37.17  ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A  1  225  ? 43.068  25.850  121.606  1.00 33.81  ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A  1  226  ? 44.458  32.527  124.709  1.00 56.06  ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A  1  226  ? 44.303  33.721  125.536  1.00 60.70  ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A  1  226  ? 43.741  34.919  124.772  1.00 65.21  ? 226  SER A C     1 
ATOM   1756  O  O     . SER A  1  226  ? 42.623  35.357  125.040  1.00 63.92  ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A  1  226  ? 45.645  34.104  126.168  1.00 64.13  ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A  1  226  ? 46.637  34.311  125.173  1.00 60.91  ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A  1  227  ? 44.518  35.445  123.830  1.00 65.55  ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A  1  227  ? 44.142  36.661  123.110  1.00 65.90  ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A  1  227  ? 43.287  36.391  121.875  1.00 67.11  ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A  1  227  ? 43.777  35.837  120.891  1.00 66.36  ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A  1  227  ? 45.397  37.444  122.706  1.00 67.24  ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A  1  227  ? 45.073  38.719  121.946  1.00 72.75  ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A  1  227  ? 44.046  39.354  122.187  1.00 76.86  ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A  1  227  ? 45.949  39.099  121.021  1.00 64.95  ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A  1  228  ? 42.005  36.794  121.917  1.00 66.19  ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A  1  228  ? 41.123  36.601  120.762  1.00 61.14  ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A  1  228  ? 41.367  37.664  119.699  1.00 64.92  ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A  1  228  ? 42.181  38.565  119.901  1.00 64.74  ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A  1  228  ? 39.717  36.786  121.353  1.00 57.86  ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A  1  228  ? 39.897  36.815  122.849  1.00 63.02  ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A  1  228  ? 41.275  37.341  123.069  1.00 65.35  ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A  1  229  ? 40.662  37.555  118.579  1.00 67.13  ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A  1  229  ? 40.751  38.538  117.508  1.00 71.18  ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A  1  229  ? 39.394  38.623  116.822  1.00 75.78  ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A  1  229  ? 38.721  37.607  116.640  1.00 70.70  ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A  1  229  ? 41.828  38.134  116.495  1.00 68.10  ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A  1  229  ? 42.634  39.292  115.917  1.00 69.42  ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A  1  229  ? 43.763  39.735  116.832  1.00 70.99  ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A  1  229  ? 44.018  39.118  117.865  1.00 68.27  ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A  1  229  ? 44.447  40.808  116.451  1.00 71.80  ? 229  GLN A NE2   1 
ATOM   1783  N  N     . ALA A  1  230  ? 38.988  39.831  116.447  1.00 84.77  ? 230  ALA A N     1 
ATOM   1784  C  CA    . ALA A  1  230  ? 37.726  40.007  115.741  1.00 90.49  ? 230  ALA A CA    1 
ATOM   1785  C  C     . ALA A  1  230  ? 37.839  39.413  114.343  1.00 92.63  ? 230  ALA A C     1 
ATOM   1786  O  O     . ALA A  1  230  ? 38.826  39.642  113.644  1.00 95.10  ? 230  ALA A O     1 
ATOM   1787  C  CB    . ALA A  1  230  ? 37.357  41.482  115.668  1.00 93.87  ? 230  ALA A CB    1 
ATOM   1788  N  N     . ALA A  1  231  ? 36.831  38.650  113.933  1.00 89.48  ? 231  ALA A N     1 
ATOM   1789  C  CA    . ALA A  1  231  ? 36.847  38.061  112.601  1.00 95.82  ? 231  ALA A CA    1 
ATOM   1790  C  C     . ALA A  1  231  ? 36.474  39.131  111.583  1.00 109.99 ? 231  ALA A C     1 
ATOM   1791  O  O     . ALA A  1  231  ? 35.381  39.696  111.629  1.00 110.38 ? 231  ALA A O     1 
ATOM   1792  C  CB    . ALA A  1  231  ? 35.892  36.879  112.522  1.00 84.07  ? 231  ALA A CB    1 
ATOM   1793  N  N     . ALA A  1  232  ? 37.394  39.397  110.661  1.00 115.01 ? 232  ALA A N     1 
ATOM   1794  C  CA    . ALA A  1  232  ? 37.260  40.509  109.726  1.00 116.79 ? 232  ALA A CA    1 
ATOM   1795  C  C     . ALA A  1  232  ? 36.552  40.090  108.445  1.00 121.39 ? 232  ALA A C     1 
ATOM   1796  O  O     . ALA A  1  232  ? 36.416  40.884  107.514  1.00 121.36 ? 232  ALA A O     1 
ATOM   1797  C  CB    . ALA A  1  232  ? 38.628  41.103  109.411  1.00 111.88 ? 232  ALA A CB    1 
ATOM   1798  N  N     . VAL A  1  233  ? 36.111  38.836  108.404  1.00 124.21 ? 233  VAL A N     1 
ATOM   1799  C  CA    . VAL A  1  233  ? 35.383  38.307  107.255  1.00 131.06 ? 233  VAL A CA    1 
ATOM   1800  C  C     . VAL A  1  233  ? 34.112  39.115  106.990  1.00 128.95 ? 233  VAL A C     1 
ATOM   1801  O  O     . VAL A  1  233  ? 33.728  39.327  105.840  1.00 126.30 ? 233  VAL A O     1 
ATOM   1802  C  CB    . VAL A  1  233  ? 35.016  36.824  107.460  1.00 127.93 ? 233  VAL A CB    1 
ATOM   1803  C  CG1   . VAL A  1  233  ? 34.503  36.217  106.162  1.00 123.90 ? 233  VAL A CG1   1 
ATOM   1804  C  CG2   . VAL A  1  233  ? 36.221  36.049  107.972  1.00 118.39 ? 233  VAL A CG2   1 
ATOM   1805  N  N     . ALA A  1  234  ? 33.466  39.568  108.060  1.00 125.93 ? 234  ALA A N     1 
ATOM   1806  C  CA    . ALA A  1  234  ? 32.263  40.383  107.931  1.00 121.37 ? 234  ALA A CA    1 
ATOM   1807  C  C     . ALA A  1  234  ? 32.610  41.831  107.596  1.00 118.20 ? 234  ALA A C     1 
ATOM   1808  O  O     . ALA A  1  234  ? 33.108  42.573  108.442  1.00 114.20 ? 234  ALA A O     1 
ATOM   1809  C  CB    . ALA A  1  234  ? 31.433  40.315  109.203  1.00 114.96 ? 234  ALA A CB    1 
ATOM   1810  N  N     . LEU B  1  6    ? 59.379  29.299  115.998  1.00 70.54  ? 6    LEU B N     1 
ATOM   1811  C  CA    . LEU B  1  6    ? 58.047  29.557  115.459  1.00 79.60  ? 6    LEU B CA    1 
ATOM   1812  C  C     . LEU B  1  6    ? 57.260  30.556  116.307  1.00 80.96  ? 6    LEU B C     1 
ATOM   1813  O  O     . LEU B  1  6    ? 56.722  30.206  117.360  1.00 73.97  ? 6    LEU B O     1 
ATOM   1814  C  CB    . LEU B  1  6    ? 57.260  28.248  115.321  1.00 81.28  ? 6    LEU B CB    1 
ATOM   1815  C  CG    . LEU B  1  6    ? 55.767  28.345  114.985  1.00 76.20  ? 6    LEU B CG    1 
ATOM   1816  C  CD1   . LEU B  1  6    ? 55.453  27.695  113.644  1.00 66.77  ? 6    LEU B CD1   1 
ATOM   1817  C  CD2   . LEU B  1  6    ? 54.930  27.721  116.094  1.00 72.65  ? 6    LEU B CD2   1 
ATOM   1818  N  N     . LYS B  1  7    ? 57.202  31.804  115.848  1.00 83.75  ? 7    LYS B N     1 
ATOM   1819  C  CA    . LYS B  1  7    ? 56.337  32.803  116.466  1.00 79.02  ? 7    LYS B CA    1 
ATOM   1820  C  C     . LYS B  1  7    ? 54.910  32.548  116.009  1.00 72.23  ? 7    LYS B C     1 
ATOM   1821  O  O     . LYS B  1  7    ? 54.651  32.448  114.807  1.00 68.59  ? 7    LYS B O     1 
ATOM   1822  C  CB    . LYS B  1  7    ? 56.756  34.217  116.069  1.00 77.09  ? 7    LYS B CB    1 
ATOM   1823  C  CG    . LYS B  1  7    ? 58.087  34.673  116.639  1.00 71.05  ? 7    LYS B CG    1 
ATOM   1824  C  CD    . LYS B  1  7    ? 58.374  36.130  116.293  1.00 69.56  ? 7    LYS B CD    1 
ATOM   1825  C  CE    . LYS B  1  7    ? 58.597  36.332  114.795  1.00 71.26  ? 7    LYS B CE    1 
ATOM   1826  N  NZ    . LYS B  1  7    ? 57.337  36.513  114.016  1.00 65.59  ? 7    LYS B NZ    1 
ATOM   1827  N  N     . ALA B  1  8    ? 53.988  32.469  116.965  1.00 66.27  ? 8    ALA B N     1 
ATOM   1828  C  CA    . ALA B  1  8    ? 52.635  31.998  116.691  1.00 64.62  ? 8    ALA B CA    1 
ATOM   1829  C  C     . ALA B  1  8    ? 51.800  32.022  117.966  1.00 56.94  ? 8    ALA B C     1 
ATOM   1830  O  O     . ALA B  1  8    ? 52.306  32.370  119.033  1.00 58.69  ? 8    ALA B O     1 
ATOM   1831  C  CB    . ALA B  1  8    ? 52.694  30.568  116.138  1.00 65.32  ? 8    ALA B CB    1 
ATOM   1832  N  N     . PRO B  1  9    ? 50.504  31.686  117.857  1.00 52.31  ? 9    PRO B N     1 
ATOM   1833  C  CA    . PRO B  1  9    ? 49.586  31.752  116.716  1.00 46.58  ? 9    PRO B CA    1 
ATOM   1834  C  C     . PRO B  1  9    ? 48.684  32.980  116.757  1.00 44.52  ? 9    PRO B C     1 
ATOM   1835  O  O     . PRO B  1  9    ? 48.784  33.809  117.663  1.00 48.72  ? 9    PRO B O     1 
ATOM   1836  C  CB    . PRO B  1  9    ? 48.761  30.471  116.864  1.00 48.92  ? 9    PRO B CB    1 
ATOM   1837  C  CG    . PRO B  1  9    ? 48.878  30.085  118.325  1.00 53.33  ? 9    PRO B CG    1 
ATOM   1838  C  CD    . PRO B  1  9    ? 49.863  31.012  118.993  1.00 54.18  ? 9    PRO B CD    1 
ATOM   1839  N  N     . VAL B  1  10   ? 47.802  33.077  115.770  1.00 40.86  ? 10   VAL B N     1 
ATOM   1840  C  CA    . VAL B  1  10   ? 46.648  33.956  115.846  1.00 41.59  ? 10   VAL B CA    1 
ATOM   1841  C  C     . VAL B  1  10   ? 45.418  33.127  116.215  1.00 44.24  ? 10   VAL B C     1 
ATOM   1842  O  O     . VAL B  1  10   ? 45.235  31.985  115.741  1.00 46.05  ? 10   VAL B O     1 
ATOM   1843  C  CB    . VAL B  1  10   ? 46.405  34.748  114.533  1.00 48.61  ? 10   VAL B CB    1 
ATOM   1844  C  CG1   . VAL B  1  10   ? 46.017  33.820  113.388  1.00 50.46  ? 10   VAL B CG1   1 
ATOM   1845  C  CG2   . VAL B  1  10   ? 45.332  35.809  114.743  1.00 53.39  ? 10   VAL B CG2   1 
ATOM   1846  N  N     . PHE B  1  11   ? 44.607  33.706  117.095  1.00 44.72  ? 11   PHE B N     1 
ATOM   1847  C  CA    . PHE B  1  11   ? 43.360  33.116  117.550  1.00 47.32  ? 11   PHE B CA    1 
ATOM   1848  C  C     . PHE B  1  11   ? 42.210  33.992  117.064  1.00 46.52  ? 11   PHE B C     1 
ATOM   1849  O  O     . PHE B  1  11   ? 42.042  35.119  117.523  1.00 54.14  ? 11   PHE B O     1 
ATOM   1850  C  CB    . PHE B  1  11   ? 43.356  33.035  119.080  1.00 47.37  ? 11   PHE B CB    1 
ATOM   1851  C  CG    . PHE B  1  11   ? 42.149  32.343  119.660  1.00 49.22  ? 11   PHE B CG    1 
ATOM   1852  C  CD1   . PHE B  1  11   ? 41.388  31.469  118.899  1.00 47.25  ? 11   PHE B CD1   1 
ATOM   1853  C  CD2   . PHE B  1  11   ? 41.776  32.575  120.975  1.00 53.23  ? 11   PHE B CD2   1 
ATOM   1854  C  CE1   . PHE B  1  11   ? 40.279  30.839  119.440  1.00 45.18  ? 11   PHE B CE1   1 
ATOM   1855  C  CE2   . PHE B  1  11   ? 40.668  31.948  121.520  1.00 50.39  ? 11   PHE B CE2   1 
ATOM   1856  C  CZ    . PHE B  1  11   ? 39.920  31.080  120.752  1.00 45.71  ? 11   PHE B CZ    1 
ATOM   1857  N  N     . THR B  1  12   ? 41.423  33.468  116.132  1.00 43.75  ? 12   THR B N     1 
ATOM   1858  C  CA    . THR B  1  12   ? 40.303  34.200  115.558  1.00 44.16  ? 12   THR B CA    1 
ATOM   1859  C  C     . THR B  1  12   ? 38.979  33.679  116.108  1.00 43.32  ? 12   THR B C     1 
ATOM   1860  O  O     . THR B  1  12   ? 38.770  32.471  116.202  1.00 43.86  ? 12   THR B O     1 
ATOM   1861  C  CB    . THR B  1  12   ? 40.291  34.073  114.025  1.00 50.16  ? 12   THR B CB    1 
ATOM   1862  O  OG1   . THR B  1  12   ? 41.587  34.398  113.506  1.00 52.82  ? 12   THR B OG1   1 
ATOM   1863  C  CG2   . THR B  1  12   ? 39.251  35.003  113.416  1.00 60.94  ? 12   THR B CG2   1 
ATOM   1864  N  N     . VAL B  1  13   ? 38.089  34.598  116.466  1.00 47.01  ? 13   VAL B N     1 
ATOM   1865  C  CA    . VAL B  1  13   ? 36.791  34.237  117.023  1.00 47.67  ? 13   VAL B CA    1 
ATOM   1866  C  C     . VAL B  1  13   ? 35.653  34.819  116.189  1.00 52.18  ? 13   VAL B C     1 
ATOM   1867  O  O     . VAL B  1  13   ? 35.646  36.010  115.882  1.00 61.63  ? 13   VAL B O     1 
ATOM   1868  C  CB    . VAL B  1  13   ? 36.648  34.737  118.471  1.00 47.77  ? 13   VAL B CB    1 
ATOM   1869  C  CG1   . VAL B  1  13   ? 35.276  34.383  119.020  1.00 47.64  ? 13   VAL B CG1   1 
ATOM   1870  C  CG2   . VAL B  1  13   ? 37.750  34.155  119.347  1.00 47.99  ? 13   VAL B CG2   1 
ATOM   1871  N  N     . ARG B  1  14   ? 34.697  33.974  115.815  1.00 50.14  ? 14   ARG B N     1 
ATOM   1872  C  CA    . ARG B  1  14   ? 33.523  34.434  115.079  1.00 53.53  ? 14   ARG B CA    1 
ATOM   1873  C  C     . ARG B  1  14   ? 32.250  33.854  115.693  1.00 52.39  ? 14   ARG B C     1 
ATOM   1874  O  O     . ARG B  1  14   ? 32.044  32.645  115.665  1.00 50.44  ? 14   ARG B O     1 
ATOM   1875  C  CB    . ARG B  1  14   ? 33.644  34.038  113.607  1.00 52.81  ? 14   ARG B CB    1 
ATOM   1876  C  CG    . ARG B  1  14   ? 32.408  34.298  112.764  1.00 56.68  ? 14   ARG B CG    1 
ATOM   1877  C  CD    . ARG B  1  14   ? 32.681  34.012  111.289  1.00 67.11  ? 14   ARG B CD    1 
ATOM   1878  N  NE    . ARG B  1  14   ? 33.451  32.783  111.098  1.00 73.51  ? 14   ARG B NE    1 
ATOM   1879  C  CZ    . ARG B  1  14   ? 34.719  32.747  110.697  1.00 74.03  ? 14   ARG B CZ    1 
ATOM   1880  N  NH1   . ARG B  1  14   ? 35.366  33.874  110.433  1.00 76.92  ? 14   ARG B NH1   1 
ATOM   1881  N  NH2   . ARG B  1  14   ? 35.340  31.583  110.556  1.00 64.79  ? 14   ARG B NH2   1 
ATOM   1882  N  N     . THR B  1  15   ? 31.393  34.717  116.234  1.00 58.25  ? 15   THR B N     1 
ATOM   1883  C  CA    . THR B  1  15   ? 30.225  34.257  116.985  1.00 54.08  ? 15   THR B CA    1 
ATOM   1884  C  C     . THR B  1  15   ? 28.900  34.778  116.435  1.00 52.81  ? 15   THR B C     1 
ATOM   1885  O  O     . THR B  1  15   ? 28.841  35.846  115.826  1.00 57.22  ? 15   THR B O     1 
ATOM   1886  C  CB    . THR B  1  15   ? 30.307  34.679  118.469  1.00 50.11  ? 15   THR B CB    1 
ATOM   1887  O  OG1   . THR B  1  15   ? 30.120  36.096  118.578  1.00 42.30  ? 15   THR B OG1   1 
ATOM   1888  C  CG2   . THR B  1  15   ? 31.653  34.299  119.067  1.00 51.89  ? 15   THR B CG2   1 
ATOM   1889  N  N     . GLN B  1  16   ? 27.839  34.007  116.656  1.00 51.55  ? 16   GLN B N     1 
ATOM   1890  C  CA    . GLN B  1  16   ? 26.480  34.479  116.429  1.00 52.01  ? 16   GLN B CA    1 
ATOM   1891  C  C     . GLN B  1  16   ? 25.670  34.226  117.693  1.00 51.19  ? 16   GLN B C     1 
ATOM   1892  O  O     . GLN B  1  16   ? 25.410  33.076  118.051  1.00 50.39  ? 16   GLN B O     1 
ATOM   1893  C  CB    . GLN B  1  16   ? 25.839  33.753  115.246  1.00 51.49  ? 16   GLN B CB    1 
ATOM   1894  C  CG    . GLN B  1  16   ? 26.582  33.910  113.930  1.00 55.32  ? 16   GLN B CG    1 
ATOM   1895  C  CD    . GLN B  1  16   ? 25.928  33.134  112.803  1.00 53.98  ? 16   GLN B CD    1 
ATOM   1896  O  OE1   . GLN B  1  16   ? 24.883  32.509  112.991  1.00 46.78  ? 16   GLN B OE1   1 
ATOM   1897  N  NE2   . GLN B  1  16   ? 26.540  33.169  111.624  1.00 49.75  ? 16   GLN B NE2   1 
ATOM   1898  N  N     . GLY B  1  17   ? 25.270  35.303  118.360  1.00 49.65  ? 17   GLY B N     1 
ATOM   1899  C  CA    . GLY B  1  17   ? 24.533  35.201  119.606  1.00 45.09  ? 17   GLY B CA    1 
ATOM   1900  C  C     . GLY B  1  17   ? 25.307  34.452  120.675  1.00 42.52  ? 17   GLY B C     1 
ATOM   1901  O  O     . GLY B  1  17   ? 26.534  34.371  120.627  1.00 39.73  ? 17   GLY B O     1 
ATOM   1902  N  N     . ARG B  1  18   ? 24.581  33.905  121.644  1.00 42.60  ? 18   ARG B N     1 
ATOM   1903  C  CA    . ARG B  1  18   ? 25.184  33.109  122.705  1.00 45.03  ? 18   ARG B CA    1 
ATOM   1904  C  C     . ARG B  1  18   ? 25.117  31.624  122.357  1.00 45.45  ? 18   ARG B C     1 
ATOM   1905  O  O     . ARG B  1  18   ? 25.569  30.772  123.122  1.00 44.69  ? 18   ARG B O     1 
ATOM   1906  C  CB    . ARG B  1  18   ? 24.460  33.362  124.031  1.00 47.22  ? 18   ARG B CB    1 
ATOM   1907  C  CG    . ARG B  1  18   ? 24.481  34.814  124.493  1.00 43.41  ? 18   ARG B CG    1 
ATOM   1908  C  CD    . ARG B  1  18   ? 23.611  35.022  125.726  1.00 37.28  ? 18   ARG B CD    1 
ATOM   1909  N  NE    . ARG B  1  18   ? 23.993  34.142  126.827  1.00 38.90  ? 18   ARG B NE    1 
ATOM   1910  C  CZ    . ARG B  1  18   ? 24.937  34.428  127.718  1.00 48.33  ? 18   ARG B CZ    1 
ATOM   1911  N  NH1   . ARG B  1  18   ? 25.219  33.567  128.688  1.00 49.51  ? 18   ARG B NH1   1 
ATOM   1912  N  NH2   . ARG B  1  18   ? 25.601  35.573  127.640  1.00 45.99  ? 18   ARG B NH2   1 
ATOM   1913  N  N     . GLU B  1  19   ? 24.527  31.325  121.204  1.00 45.32  ? 19   GLU B N     1 
ATOM   1914  C  CA    . GLU B  1  19   ? 24.293  29.947  120.784  1.00 44.00  ? 19   GLU B CA    1 
ATOM   1915  C  C     . GLU B  1  19   ? 25.508  29.237  120.185  1.00 41.43  ? 19   GLU B C     1 
ATOM   1916  O  O     . GLU B  1  19   ? 25.816  28.104  120.554  1.00 41.09  ? 19   GLU B O     1 
ATOM   1917  C  CB    . GLU B  1  19   ? 23.136  29.895  119.781  1.00 51.39  ? 19   GLU B CB    1 
ATOM   1918  C  CG    . GLU B  1  19   ? 21.830  30.497  120.284  1.00 58.24  ? 19   GLU B CG    1 
ATOM   1919  C  CD    . GLU B  1  19   ? 21.086  29.583  121.241  1.00 58.23  ? 19   GLU B CD    1 
ATOM   1920  O  OE1   . GLU B  1  19   ? 19.974  29.956  121.674  1.00 59.44  ? 19   GLU B OE1   1 
ATOM   1921  O  OE2   . GLU B  1  19   ? 21.607  28.492  121.557  1.00 57.62  ? 19   GLU B OE2   1 
ATOM   1922  N  N     . TYR B  1  20   ? 26.196  29.908  119.266  1.00 38.39  ? 20   TYR B N     1 
ATOM   1923  C  CA    . TYR B  1  20   ? 27.161  29.238  118.395  1.00 38.60  ? 20   TYR B CA    1 
ATOM   1924  C  C     . TYR B  1  20   ? 28.450  30.032  118.208  1.00 37.72  ? 20   TYR B C     1 
ATOM   1925  O  O     . TYR B  1  20   ? 28.441  31.262  118.247  1.00 41.20  ? 20   TYR B O     1 
ATOM   1926  C  CB    . TYR B  1  20   ? 26.504  28.978  117.036  1.00 37.88  ? 20   TYR B CB    1 
ATOM   1927  C  CG    . TYR B  1  20   ? 27.427  28.467  115.953  1.00 33.64  ? 20   TYR B CG    1 
ATOM   1928  C  CD1   . TYR B  1  20   ? 27.860  29.302  114.931  1.00 35.12  ? 20   TYR B CD1   1 
ATOM   1929  C  CD2   . TYR B  1  20   ? 27.852  27.147  115.943  1.00 33.97  ? 20   TYR B CD2   1 
ATOM   1930  C  CE1   . TYR B  1  20   ? 28.697  28.836  113.933  1.00 35.34  ? 20   TYR B CE1   1 
ATOM   1931  C  CE2   . TYR B  1  20   ? 28.688  26.674  114.951  1.00 35.48  ? 20   TYR B CE2   1 
ATOM   1932  C  CZ    . TYR B  1  20   ? 29.107  27.521  113.949  1.00 36.52  ? 20   TYR B CZ    1 
ATOM   1933  O  OH    . TYR B  1  20   ? 29.938  27.042  112.963  1.00 38.41  ? 20   TYR B OH    1 
ATOM   1934  N  N     . GLY B  1  21   ? 29.561  29.326  118.003  1.00 34.50  ? 21   GLY B N     1 
ATOM   1935  C  CA    . GLY B  1  21   ? 30.817  29.996  117.714  1.00 33.79  ? 21   GLY B CA    1 
ATOM   1936  C  C     . GLY B  1  21   ? 31.829  29.185  116.925  1.00 33.09  ? 21   GLY B C     1 
ATOM   1937  O  O     . GLY B  1  21   ? 31.836  27.953  116.968  1.00 35.38  ? 21   GLY B O     1 
ATOM   1938  N  N     . GLU B  1  22   ? 32.699  29.900  116.214  1.00 36.75  ? 22   GLU B N     1 
ATOM   1939  C  CA    . GLU B  1  22   ? 33.784  29.305  115.440  1.00 37.71  ? 22   GLU B CA    1 
ATOM   1940  C  C     . GLU B  1  22   ? 35.112  29.891  115.894  1.00 37.68  ? 22   GLU B C     1 
ATOM   1941  O  O     . GLU B  1  22   ? 35.275  31.112  115.961  1.00 44.49  ? 22   GLU B O     1 
ATOM   1942  C  CB    . GLU B  1  22   ? 33.606  29.569  113.944  1.00 44.55  ? 22   GLU B CB    1 
ATOM   1943  C  CG    . GLU B  1  22   ? 32.361  28.962  113.339  1.00 44.09  ? 22   GLU B CG    1 
ATOM   1944  C  CD    . GLU B  1  22   ? 32.398  28.950  111.822  1.00 51.90  ? 22   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B  1  22   ? 33.502  29.087  111.251  1.00 53.08  ? 22   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B  1  22   ? 31.324  28.805  111.202  1.00 52.77  ? 22   GLU B OE2   1 
ATOM   1947  N  N     . PHE B  1  23   ? 36.064  29.016  116.191  1.00 33.57  ? 23   PHE B N     1 
ATOM   1948  C  CA    . PHE B  1  23   ? 37.333  29.433  116.765  1.00 38.18  ? 23   PHE B CA    1 
ATOM   1949  C  C     . PHE B  1  23   ? 38.496  28.867  115.965  1.00 35.09  ? 23   PHE B C     1 
ATOM   1950  O  O     . PHE B  1  23   ? 38.695  27.657  115.921  1.00 34.21  ? 23   PHE B O     1 
ATOM   1951  C  CB    . PHE B  1  23   ? 37.424  28.976  118.226  1.00 38.48  ? 23   PHE B CB    1 
ATOM   1952  C  CG    . PHE B  1  23   ? 36.275  29.441  119.078  1.00 38.77  ? 23   PHE B CG    1 
ATOM   1953  C  CD1   . PHE B  1  23   ? 36.385  30.586  119.848  1.00 42.07  ? 23   PHE B CD1   1 
ATOM   1954  C  CD2   . PHE B  1  23   ? 35.082  28.735  119.104  1.00 35.65  ? 23   PHE B CD2   1 
ATOM   1955  C  CE1   . PHE B  1  23   ? 35.328  31.018  120.629  1.00 42.40  ? 23   PHE B CE1   1 
ATOM   1956  C  CE2   . PHE B  1  23   ? 34.022  29.163  119.880  1.00 36.89  ? 23   PHE B CE2   1 
ATOM   1957  C  CZ    . PHE B  1  23   ? 34.145  30.305  120.644  1.00 38.97  ? 23   PHE B CZ    1 
ATOM   1958  N  N     . VAL B  1  24   ? 39.267  29.746  115.337  1.00 34.85  ? 24   VAL B N     1 
ATOM   1959  C  CA    . VAL B  1  24   ? 40.400  29.315  114.531  1.00 35.87  ? 24   VAL B CA    1 
ATOM   1960  C  C     . VAL B  1  24   ? 41.710  29.589  115.259  1.00 36.56  ? 24   VAL B C     1 
ATOM   1961  O  O     . VAL B  1  24   ? 41.897  30.656  115.832  1.00 39.37  ? 24   VAL B O     1 
ATOM   1962  C  CB    . VAL B  1  24   ? 40.418  30.027  113.166  1.00 39.61  ? 24   VAL B CB    1 
ATOM   1963  C  CG1   . VAL B  1  24   ? 41.505  29.444  112.276  1.00 38.68  ? 24   VAL B CG1   1 
ATOM   1964  C  CG2   . VAL B  1  24   ? 39.058  29.916  112.492  1.00 41.55  ? 24   VAL B CG2   1 
ATOM   1965  N  N     . LEU B  1  25   ? 42.612  28.616  115.250  1.00 35.11  ? 25   LEU B N     1 
ATOM   1966  C  CA    . LEU B  1  25   ? 43.936  28.809  115.818  1.00 36.22  ? 25   LEU B CA    1 
ATOM   1967  C  C     . LEU B  1  25   ? 44.967  28.417  114.771  1.00 39.59  ? 25   LEU B C     1 
ATOM   1968  O  O     . LEU B  1  25   ? 45.067  27.237  114.407  1.00 41.73  ? 25   LEU B O     1 
ATOM   1969  C  CB    . LEU B  1  25   ? 44.103  27.942  117.065  1.00 33.78  ? 25   LEU B CB    1 
ATOM   1970  C  CG    . LEU B  1  25   ? 45.217  28.323  118.038  1.00 31.86  ? 25   LEU B CG    1 
ATOM   1971  C  CD1   . LEU B  1  25   ? 44.883  29.635  118.726  1.00 37.76  ? 25   LEU B CD1   1 
ATOM   1972  C  CD2   . LEU B  1  25   ? 45.438  27.218  119.059  1.00 31.29  ? 25   LEU B CD2   1 
ATOM   1973  N  N     . GLU B  1  26   ? 45.710  29.399  114.261  1.00 41.40  ? 26   GLU B N     1 
ATOM   1974  C  CA    . GLU B  1  26   ? 46.732  29.096  113.252  1.00 42.70  ? 26   GLU B CA    1 
ATOM   1975  C  C     . GLU B  1  26   ? 47.921  30.053  113.270  1.00 43.79  ? 26   GLU B C     1 
ATOM   1976  O  O     . GLU B  1  26   ? 47.770  31.206  113.634  1.00 48.72  ? 26   GLU B O     1 
ATOM   1977  C  CB    . GLU B  1  26   ? 46.110  29.072  111.853  1.00 45.93  ? 26   GLU B CB    1 
ATOM   1978  C  CG    . GLU B  1  26   ? 45.500  30.392  111.416  1.00 48.65  ? 26   GLU B CG    1 
ATOM   1979  C  CD    . GLU B  1  26   ? 45.177  30.416  109.934  1.00 55.03  ? 26   GLU B CD    1 
ATOM   1980  O  OE1   . GLU B  1  26   ? 45.786  29.626  109.181  1.00 53.52  ? 26   GLU B OE1   1 
ATOM   1981  O  OE2   . GLU B  1  26   ? 44.313  31.220  109.524  1.00 58.71  ? 26   GLU B OE2   1 
ATOM   1982  N  N     . PRO B  1  27   ? 49.106  29.591  112.841  1.00 43.42  ? 27   PRO B N     1 
ATOM   1983  C  CA    . PRO B  1  27   ? 49.504  28.218  112.518  1.00 44.64  ? 27   PRO B CA    1 
ATOM   1984  C  C     . PRO B  1  27   ? 49.876  27.420  113.763  1.00 44.57  ? 27   PRO B C     1 
ATOM   1985  O  O     . PRO B  1  27   ? 50.223  28.003  114.792  1.00 45.79  ? 27   PRO B O     1 
ATOM   1986  C  CB    . PRO B  1  27   ? 50.740  28.419  111.643  1.00 47.54  ? 27   PRO B CB    1 
ATOM   1987  C  CG    . PRO B  1  27   ? 51.344  29.667  112.163  1.00 50.21  ? 27   PRO B CG    1 
ATOM   1988  C  CD    . PRO B  1  27   ? 50.191  30.549  112.562  1.00 47.06  ? 27   PRO B CD    1 
ATOM   1989  N  N     . LEU B  1  28   ? 49.809  26.098  113.661  1.00 41.40  ? 28   LEU B N     1 
ATOM   1990  C  CA    . LEU B  1  28   ? 50.288  25.216  114.716  1.00 37.83  ? 28   LEU B CA    1 
ATOM   1991  C  C     . LEU B  1  28   ? 51.320  24.265  114.125  1.00 37.69  ? 28   LEU B C     1 
ATOM   1992  O  O     . LEU B  1  28   ? 51.296  23.990  112.927  1.00 38.02  ? 28   LEU B O     1 
ATOM   1993  C  CB    . LEU B  1  28   ? 49.128  24.426  115.326  1.00 38.71  ? 28   LEU B CB    1 
ATOM   1994  C  CG    . LEU B  1  28   ? 48.025  25.229  116.019  1.00 37.79  ? 28   LEU B CG    1 
ATOM   1995  C  CD1   . LEU B  1  28   ? 46.828  24.343  116.332  1.00 30.90  ? 28   LEU B CD1   1 
ATOM   1996  C  CD2   . LEU B  1  28   ? 48.551  25.886  117.287  1.00 39.05  ? 28   LEU B CD2   1 
ATOM   1997  N  N     . GLU B  1  29   ? 52.225  23.767  114.961  1.00 39.47  ? 29   GLU B N     1 
ATOM   1998  C  CA    . GLU B  1  29   ? 53.220  22.802  114.507  1.00 39.21  ? 29   GLU B CA    1 
ATOM   1999  C  C     . GLU B  1  29   ? 52.521  21.509  114.084  1.00 40.22  ? 29   GLU B C     1 
ATOM   2000  O  O     . GLU B  1  29   ? 51.413  21.224  114.538  1.00 40.26  ? 29   GLU B O     1 
ATOM   2001  C  CB    . GLU B  1  29   ? 54.251  22.535  115.607  1.00 39.25  ? 29   GLU B CB    1 
ATOM   2002  C  CG    . GLU B  1  29   ? 55.478  21.762  115.145  1.00 50.27  ? 29   GLU B CG    1 
ATOM   2003  C  CD    . GLU B  1  29   ? 56.177  22.423  113.968  1.00 65.37  ? 29   GLU B CD    1 
ATOM   2004  O  OE1   . GLU B  1  29   ? 56.609  21.697  113.047  1.00 58.86  ? 29   GLU B OE1   1 
ATOM   2005  O  OE2   . GLU B  1  29   ? 56.299  23.666  113.966  1.00 72.56  ? 29   GLU B OE2   1 
ATOM   2006  N  N     . ARG B  1  30   ? 53.163  20.742  113.207  1.00 38.92  ? 30   ARG B N     1 
ATOM   2007  C  CA    . ARG B  1  30   ? 52.552  19.542  112.639  1.00 38.59  ? 30   ARG B CA    1 
ATOM   2008  C  C     . ARG B  1  30   ? 52.093  18.558  113.712  1.00 36.72  ? 30   ARG B C     1 
ATOM   2009  O  O     . ARG B  1  30   ? 52.874  18.150  114.571  1.00 36.31  ? 30   ARG B O     1 
ATOM   2010  C  CB    . ARG B  1  30   ? 53.533  18.846  111.693  1.00 41.95  ? 30   ARG B CB    1 
ATOM   2011  C  CG    . ARG B  1  30   ? 52.970  17.608  111.011  1.00 42.46  ? 30   ARG B CG    1 
ATOM   2012  C  CD    . ARG B  1  30   ? 54.075  16.745  110.413  1.00 41.05  ? 30   ARG B CD    1 
ATOM   2013  N  NE    . ARG B  1  30   ? 54.863  16.073  111.444  1.00 42.42  ? 30   ARG B NE    1 
ATOM   2014  C  CZ    . ARG B  1  30   ? 55.890  15.266  111.196  1.00 41.84  ? 30   ARG B CZ    1 
ATOM   2015  N  NH1   . ARG B  1  30   ? 56.263  15.027  109.946  1.00 38.05  ? 30   ARG B NH1   1 
ATOM   2016  N  NH2   . ARG B  1  30   ? 56.546  14.697  112.198  1.00 46.52  ? 30   ARG B NH2   1 
ATOM   2017  N  N     . GLY B  1  31   ? 50.819  18.182  113.651  1.00 35.98  ? 31   GLY B N     1 
ATOM   2018  C  CA    . GLY B  1  31   ? 50.262  17.218  114.582  1.00 35.46  ? 31   GLY B CA    1 
ATOM   2019  C  C     . GLY B  1  31   ? 49.537  17.833  115.766  1.00 32.35  ? 31   GLY B C     1 
ATOM   2020  O  O     . GLY B  1  31   ? 48.729  17.167  116.414  1.00 27.20  ? 31   GLY B O     1 
ATOM   2021  N  N     . PHE B  1  32   ? 49.818  19.102  116.049  1.00 34.87  ? 32   PHE B N     1 
ATOM   2022  C  CA    . PHE B  1  32   ? 49.252  19.766  117.224  1.00 32.85  ? 32   PHE B CA    1 
ATOM   2023  C  C     . PHE B  1  32   ? 47.786  20.152  117.065  1.00 30.62  ? 32   PHE B C     1 
ATOM   2024  O  O     . PHE B  1  32   ? 47.114  20.466  118.050  1.00 30.62  ? 32   PHE B O     1 
ATOM   2025  C  CB    . PHE B  1  32   ? 50.085  20.988  117.624  1.00 30.26  ? 32   PHE B CB    1 
ATOM   2026  C  CG    . PHE B  1  32   ? 51.189  20.674  118.592  1.00 33.37  ? 32   PHE B CG    1 
ATOM   2027  C  CD1   . PHE B  1  32   ? 52.409  20.201  118.139  1.00 33.14  ? 32   PHE B CD1   1 
ATOM   2028  C  CD2   . PHE B  1  32   ? 51.004  20.843  119.955  1.00 33.58  ? 32   PHE B CD2   1 
ATOM   2029  C  CE1   . PHE B  1  32   ? 53.424  19.906  119.026  1.00 29.41  ? 32   PHE B CE1   1 
ATOM   2030  C  CE2   . PHE B  1  32   ? 52.020  20.549  120.848  1.00 31.36  ? 32   PHE B CE2   1 
ATOM   2031  C  CZ    . PHE B  1  32   ? 53.231  20.080  120.382  1.00 29.03  ? 32   PHE B CZ    1 
ATOM   2032  N  N     . GLY B  1  33   ? 47.297  20.129  115.829  1.00 29.18  ? 33   GLY B N     1 
ATOM   2033  C  CA    . GLY B  1  33   ? 45.905  20.434  115.554  1.00 26.69  ? 33   GLY B CA    1 
ATOM   2034  C  C     . GLY B  1  33   ? 44.969  19.494  116.289  1.00 25.32  ? 33   GLY B C     1 
ATOM   2035  O  O     . GLY B  1  33   ? 44.050  19.933  116.978  1.00 23.62  ? 33   GLY B O     1 
ATOM   2036  N  N     . VAL B  1  34   ? 45.210  18.195  116.143  1.00 27.30  ? 34   VAL B N     1 
ATOM   2037  C  CA    . VAL B  1  34   ? 44.401  17.184  116.816  1.00 25.56  ? 34   VAL B CA    1 
ATOM   2038  C  C     . VAL B  1  34   ? 44.808  17.057  118.284  1.00 25.80  ? 34   VAL B C     1 
ATOM   2039  O  O     . VAL B  1  34   ? 43.972  16.772  119.149  1.00 26.53  ? 34   VAL B O     1 
ATOM   2040  C  CB    . VAL B  1  34   ? 44.482  15.813  116.086  1.00 23.78  ? 34   VAL B CB    1 
ATOM   2041  C  CG1   . VAL B  1  34   ? 45.393  15.910  114.868  1.00 24.82  ? 34   VAL B CG1   1 
ATOM   2042  C  CG2   . VAL B  1  34   ? 44.947  14.702  117.023  1.00 22.68  ? 34   VAL B CG2   1 
ATOM   2043  N  N     . THR B  1  35   ? 46.090  17.292  118.556  1.00 26.04  ? 35   THR B N     1 
ATOM   2044  C  CA    . THR B  1  35   ? 46.626  17.225  119.912  1.00 25.49  ? 35   THR B CA    1 
ATOM   2045  C  C     . THR B  1  35   ? 45.903  18.205  120.829  1.00 23.26  ? 35   THR B C     1 
ATOM   2046  O  O     . THR B  1  35   ? 45.608  17.889  121.979  1.00 22.81  ? 35   THR B O     1 
ATOM   2047  C  CB    . THR B  1  35   ? 48.145  17.507  119.933  1.00 27.22  ? 35   THR B CB    1 
ATOM   2048  O  OG1   . THR B  1  35   ? 48.827  16.526  119.142  1.00 25.17  ? 35   THR B OG1   1 
ATOM   2049  C  CG2   . THR B  1  35   ? 48.686  17.463  121.355  1.00 27.18  ? 35   THR B CG2   1 
ATOM   2050  N  N     . LEU B  1  36   ? 45.630  19.401  120.319  1.00 23.75  ? 36   LEU B N     1 
ATOM   2051  C  CA    . LEU B  1  36   ? 44.806  20.365  121.040  1.00 21.71  ? 36   LEU B CA    1 
ATOM   2052  C  C     . LEU B  1  36   ? 43.316  20.083  120.866  1.00 23.23  ? 36   LEU B C     1 
ATOM   2053  O  O     . LEU B  1  36   ? 42.540  20.194  121.813  1.00 24.39  ? 36   LEU B O     1 
ATOM   2054  C  CB    . LEU B  1  36   ? 45.124  21.789  120.589  1.00 21.85  ? 36   LEU B CB    1 
ATOM   2055  C  CG    . LEU B  1  36   ? 46.524  22.290  120.935  1.00 25.67  ? 36   LEU B CG    1 
ATOM   2056  C  CD1   . LEU B  1  36   ? 46.706  23.725  120.472  1.00 31.21  ? 36   LEU B CD1   1 
ATOM   2057  C  CD2   . LEU B  1  36   ? 46.769  22.166  122.429  1.00 25.41  ? 36   LEU B CD2   1 
ATOM   2058  N  N     . GLY B  1  37   ? 42.929  19.718  119.647  1.00 27.24  ? 37   GLY B N     1 
ATOM   2059  C  CA    . GLY B  1  37   ? 41.530  19.565  119.285  1.00 26.22  ? 37   GLY B CA    1 
ATOM   2060  C  C     . GLY B  1  37   ? 40.749  18.517  120.055  1.00 23.78  ? 37   GLY B C     1 
ATOM   2061  O  O     . GLY B  1  37   ? 39.705  18.822  120.633  1.00 22.69  ? 37   GLY B O     1 
ATOM   2062  N  N     . ASN B  1  38   ? 41.245  17.283  120.058  1.00 23.20  ? 38   ASN B N     1 
ATOM   2063  C  CA    . ASN B  1  38   ? 40.562  16.181  120.741  1.00 22.99  ? 38   ASN B CA    1 
ATOM   2064  C  C     . ASN B  1  38   ? 40.266  16.369  122.238  1.00 24.80  ? 38   ASN B C     1 
ATOM   2065  O  O     . ASN B  1  38   ? 39.138  16.125  122.668  1.00 25.29  ? 38   ASN B O     1 
ATOM   2066  C  CB    . ASN B  1  38   ? 41.278  14.848  120.495  1.00 23.38  ? 38   ASN B CB    1 
ATOM   2067  C  CG    . ASN B  1  38   ? 40.902  14.226  119.168  1.00 28.53  ? 38   ASN B CG    1 
ATOM   2068  O  OD1   . ASN B  1  38   ? 39.788  14.411  118.680  1.00 32.37  ? 38   ASN B OD1   1 
ATOM   2069  N  ND2   . ASN B  1  38   ? 41.829  13.480  118.577  1.00 29.49  ? 38   ASN B ND2   1 
ATOM   2070  N  N     . PRO B  1  39   ? 41.268  16.788  123.036  1.00 24.60  ? 39   PRO B N     1 
ATOM   2071  C  CA    . PRO B  1  39   ? 41.012  16.936  124.474  1.00 23.36  ? 39   PRO B CA    1 
ATOM   2072  C  C     . PRO B  1  39   ? 39.924  17.954  124.773  1.00 23.25  ? 39   PRO B C     1 
ATOM   2073  O  O     . PRO B  1  39   ? 39.034  17.676  125.575  1.00 24.64  ? 39   PRO B O     1 
ATOM   2074  C  CB    . PRO B  1  39   ? 42.344  17.460  125.016  1.00 25.62  ? 39   PRO B CB    1 
ATOM   2075  C  CG    . PRO B  1  39   ? 43.343  17.048  124.029  1.00 25.01  ? 39   PRO B CG    1 
ATOM   2076  C  CD    . PRO B  1  39   ? 42.668  17.102  122.706  1.00 24.45  ? 39   PRO B CD    1 
ATOM   2077  N  N     . LEU B  1  40   ? 39.998  19.112  124.125  1.00 23.14  ? 40   LEU B N     1 
ATOM   2078  C  CA    . LEU B  1  40   ? 39.023  20.172  124.341  1.00 25.09  ? 40   LEU B CA    1 
ATOM   2079  C  C     . LEU B  1  40   ? 37.613  19.683  124.036  1.00 25.97  ? 40   LEU B C     1 
ATOM   2080  O  O     . LEU B  1  40   ? 36.668  20.017  124.748  1.00 25.26  ? 40   LEU B O     1 
ATOM   2081  C  CB    . LEU B  1  40   ? 39.360  21.399  123.493  1.00 23.36  ? 40   LEU B CB    1 
ATOM   2082  C  CG    . LEU B  1  40   ? 40.712  22.051  123.792  1.00 23.04  ? 40   LEU B CG    1 
ATOM   2083  C  CD1   . LEU B  1  40   ? 40.879  23.341  123.007  1.00 24.38  ? 40   LEU B CD1   1 
ATOM   2084  C  CD2   . LEU B  1  40   ? 40.871  22.300  125.283  1.00 28.31  ? 40   LEU B CD2   1 
ATOM   2085  N  N     . ARG B  1  41   ? 37.483  18.876  122.987  1.00 25.54  ? 41   ARG B N     1 
ATOM   2086  C  CA    . ARG B  1  41   ? 36.194  18.301  122.619  1.00 24.93  ? 41   ARG B CA    1 
ATOM   2087  C  C     . ARG B  1  41   ? 35.661  17.370  123.702  1.00 24.77  ? 41   ARG B C     1 
ATOM   2088  O  O     . ARG B  1  41   ? 34.494  17.458  124.085  1.00 27.96  ? 41   ARG B O     1 
ATOM   2089  C  CB    . ARG B  1  41   ? 36.293  17.544  121.294  1.00 27.14  ? 41   ARG B CB    1 
ATOM   2090  C  CG    . ARG B  1  41   ? 35.016  16.809  120.931  1.00 25.93  ? 41   ARG B CG    1 
ATOM   2091  C  CD    . ARG B  1  41   ? 35.136  16.075  119.611  1.00 27.74  ? 41   ARG B CD    1 
ATOM   2092  N  NE    . ARG B  1  41   ? 33.882  15.418  119.259  1.00 30.24  ? 41   ARG B NE    1 
ATOM   2093  C  CZ    . ARG B  1  41   ? 33.535  14.205  119.675  1.00 31.75  ? 41   ARG B CZ    1 
ATOM   2094  N  NH1   . ARG B  1  41   ? 34.353  13.514  120.459  1.00 28.45  ? 41   ARG B NH1   1 
ATOM   2095  N  NH2   . ARG B  1  41   ? 32.372  13.682  119.309  1.00 33.08  ? 41   ARG B NH2   1 
ATOM   2096  N  N     . ARG B  1  42   ? 36.519  16.477  124.187  1.00 22.43  ? 42   ARG B N     1 
ATOM   2097  C  CA    . ARG B  1  42   ? 36.139  15.546  125.242  1.00 22.53  ? 42   ARG B CA    1 
ATOM   2098  C  C     . ARG B  1  42   ? 35.739  16.308  126.498  1.00 24.11  ? 42   ARG B C     1 
ATOM   2099  O  O     . ARG B  1  42   ? 34.753  15.974  127.156  1.00 23.61  ? 42   ARG B O     1 
ATOM   2100  C  CB    . ARG B  1  42   ? 37.291  14.592  125.558  1.00 19.54  ? 42   ARG B CB    1 
ATOM   2101  C  CG    . ARG B  1  42   ? 37.724  13.733  124.386  1.00 19.24  ? 42   ARG B CG    1 
ATOM   2102  C  CD    . ARG B  1  42   ? 38.937  12.892  124.743  1.00 21.45  ? 42   ARG B CD    1 
ATOM   2103  N  NE    . ARG B  1  42   ? 38.641  11.927  125.796  1.00 18.58  ? 42   ARG B NE    1 
ATOM   2104  C  CZ    . ARG B  1  42   ? 38.251  10.678  125.571  1.00 19.66  ? 42   ARG B CZ    1 
ATOM   2105  N  NH1   . ARG B  1  42   ? 38.111  10.240  124.328  1.00 19.71  ? 42   ARG B NH1   1 
ATOM   2106  N  NH2   . ARG B  1  42   ? 38.001  9.866   126.588  1.00 23.02  ? 42   ARG B NH2   1 
ATOM   2107  N  N     . ILE B  1  43   ? 36.511  17.340  126.817  1.00 22.97  ? 43   ILE B N     1 
ATOM   2108  C  CA    . ILE B  1  43   ? 36.243  18.168  127.981  1.00 23.43  ? 43   ILE B CA    1 
ATOM   2109  C  C     . ILE B  1  43   ? 34.950  18.961  127.821  1.00 25.16  ? 43   ILE B C     1 
ATOM   2110  O  O     . ILE B  1  43   ? 34.123  18.996  128.731  1.00 28.53  ? 43   ILE B O     1 
ATOM   2111  C  CB    . ILE B  1  43   ? 37.410  19.128  128.256  1.00 24.75  ? 43   ILE B CB    1 
ATOM   2112  C  CG1   . ILE B  1  43   ? 38.661  18.335  128.640  1.00 28.14  ? 43   ILE B CG1   1 
ATOM   2113  C  CG2   . ILE B  1  43   ? 37.047  20.109  129.356  1.00 26.70  ? 43   ILE B CG2   1 
ATOM   2114  C  CD1   . ILE B  1  43   ? 39.899  19.187  128.789  1.00 31.04  ? 43   ILE B CD1   1 
ATOM   2115  N  N     . LEU B  1  44   ? 34.777  19.586  126.661  1.00 24.36  ? 44   LEU B N     1 
ATOM   2116  C  CA    . LEU B  1  44   ? 33.585  20.387  126.389  1.00 24.70  ? 44   LEU B CA    1 
ATOM   2117  C  C     . LEU B  1  44   ? 32.295  19.572  126.449  1.00 25.80  ? 44   LEU B C     1 
ATOM   2118  O  O     . LEU B  1  44   ? 31.247  20.084  126.837  1.00 28.47  ? 44   LEU B O     1 
ATOM   2119  C  CB    . LEU B  1  44   ? 33.705  21.086  125.034  1.00 23.82  ? 44   LEU B CB    1 
ATOM   2120  C  CG    . LEU B  1  44   ? 34.550  22.358  125.032  1.00 23.87  ? 44   LEU B CG    1 
ATOM   2121  C  CD1   . LEU B  1  44   ? 34.857  22.787  123.611  1.00 24.53  ? 44   LEU B CD1   1 
ATOM   2122  C  CD2   . LEU B  1  44   ? 33.823  23.458  125.781  1.00 27.12  ? 44   LEU B CD2   1 
ATOM   2123  N  N     . LEU B  1  45   ? 32.372  18.308  126.050  1.00 24.83  ? 45   LEU B N     1 
ATOM   2124  C  CA    . LEU B  1  45   ? 31.210  17.429  126.104  1.00 28.16  ? 45   LEU B CA    1 
ATOM   2125  C  C     . LEU B  1  45   ? 30.947  16.883  127.511  1.00 29.05  ? 45   LEU B C     1 
ATOM   2126  O  O     . LEU B  1  45   ? 29.811  16.890  127.986  1.00 29.31  ? 45   LEU B O     1 
ATOM   2127  C  CB    . LEU B  1  45   ? 31.359  16.290  125.094  1.00 26.89  ? 45   LEU B CB    1 
ATOM   2128  C  CG    . LEU B  1  45   ? 31.321  16.716  123.629  1.00 24.27  ? 45   LEU B CG    1 
ATOM   2129  C  CD1   . LEU B  1  45   ? 31.467  15.520  122.699  1.00 24.12  ? 45   LEU B CD1   1 
ATOM   2130  C  CD2   . LEU B  1  45   ? 30.040  17.484  123.314  1.00 25.61  ? 45   LEU B CD2   1 
ATOM   2131  N  N     . SER B  1  46   ? 31.997  16.384  128.156  1.00 27.78  ? 46   SER B N     1 
ATOM   2132  C  CA    . SER B  1  46   ? 31.880  15.804  129.492  1.00 28.30  ? 46   SER B CA    1 
ATOM   2133  C  C     . SER B  1  46   ? 31.922  16.768  130.688  1.00 27.37  ? 46   SER B C     1 
ATOM   2134  O  O     . SER B  1  46   ? 31.120  16.648  131.618  1.00 31.23  ? 46   SER B O     1 
ATOM   2135  C  CB    . SER B  1  46   ? 32.948  14.716  129.680  1.00 32.14  ? 46   SER B CB    1 
ATOM   2136  O  OG    . SER B  1  46   ? 34.227  15.186  129.296  1.00 32.99  ? 46   SER B OG    1 
ATOM   2137  N  N     . SER B  1  47   ? 32.862  17.706  130.677  1.00 25.94  ? 47   SER B N     1 
ATOM   2138  C  CA    . SER B  1  47   ? 33.218  18.417  131.911  1.00 27.26  ? 47   SER B CA    1 
ATOM   2139  C  C     . SER B  1  47   ? 32.656  19.818  132.176  1.00 25.77  ? 47   SER B C     1 
ATOM   2140  O  O     . SER B  1  47   ? 32.914  20.387  133.235  1.00 24.32  ? 47   SER B O     1 
ATOM   2141  C  CB    . SER B  1  47   ? 34.735  18.410  132.101  1.00 26.54  ? 47   SER B CB    1 
ATOM   2142  O  OG    . SER B  1  47   ? 35.173  17.097  132.390  1.00 27.85  ? 47   SER B OG    1 
ATOM   2143  N  N     . ILE B  1  48   ? 31.891  20.372  131.244  1.00 26.56  ? 48   ILE B N     1 
ATOM   2144  C  CA    . ILE B  1  48   ? 31.380  21.727  131.427  1.00 27.46  ? 48   ILE B CA    1 
ATOM   2145  C  C     . ILE B  1  48   ? 30.114  21.748  132.284  1.00 33.86  ? 48   ILE B C     1 
ATOM   2146  O  O     . ILE B  1  48   ? 29.101  21.146  131.921  1.00 36.33  ? 48   ILE B O     1 
ATOM   2147  C  CB    . ILE B  1  48   ? 31.135  22.435  130.086  1.00 26.83  ? 48   ILE B CB    1 
ATOM   2148  C  CG1   . ILE B  1  48   ? 32.413  22.430  129.250  1.00 27.60  ? 48   ILE B CG1   1 
ATOM   2149  C  CG2   . ILE B  1  48   ? 30.695  23.863  130.316  1.00 30.67  ? 48   ILE B CG2   1 
ATOM   2150  C  CD1   . ILE B  1  48   ? 33.570  23.147  129.910  1.00 29.72  ? 48   ILE B CD1   1 
ATOM   2151  N  N     . PRO B  1  49   ? 30.179  22.441  133.434  1.00 33.89  ? 49   PRO B N     1 
ATOM   2152  C  CA    . PRO B  1  49   ? 29.088  22.552  134.410  1.00 32.89  ? 49   PRO B CA    1 
ATOM   2153  C  C     . PRO B  1  49   ? 27.815  23.128  133.797  1.00 33.76  ? 49   PRO B C     1 
ATOM   2154  O  O     . PRO B  1  49   ? 27.872  24.142  133.102  1.00 35.50  ? 49   PRO B O     1 
ATOM   2155  C  CB    . PRO B  1  49   ? 29.655  23.521  135.452  1.00 33.52  ? 49   PRO B CB    1 
ATOM   2156  C  CG    . PRO B  1  49   ? 31.134  23.373  135.336  1.00 31.81  ? 49   PRO B CG    1 
ATOM   2157  C  CD    . PRO B  1  49   ? 31.385  23.163  133.877  1.00 32.48  ? 49   PRO B CD    1 
ATOM   2158  N  N     . GLY B  1  50   ? 26.680  22.488  134.061  1.00 33.01  ? 50   GLY B N     1 
ATOM   2159  C  CA    . GLY B  1  50   ? 25.412  22.920  133.506  1.00 33.79  ? 50   GLY B CA    1 
ATOM   2160  C  C     . GLY B  1  50   ? 24.240  22.429  134.330  1.00 36.85  ? 50   GLY B C     1 
ATOM   2161  O  O     . GLY B  1  50   ? 24.423  21.871  135.411  1.00 40.84  ? 50   GLY B O     1 
ATOM   2162  N  N     . THR B  1  51   ? 23.031  22.640  133.820  1.00 36.75  ? 51   THR B N     1 
ATOM   2163  C  CA    . THR B  1  51   ? 21.820  22.273  134.548  1.00 37.50  ? 51   THR B CA    1 
ATOM   2164  C  C     . THR B  1  51   ? 20.882  21.410  133.711  1.00 35.17  ? 51   THR B C     1 
ATOM   2165  O  O     . THR B  1  51   ? 20.867  21.501  132.483  1.00 38.85  ? 51   THR B O     1 
ATOM   2166  C  CB    . THR B  1  51   ? 21.058  23.517  135.033  1.00 41.42  ? 51   THR B CB    1 
ATOM   2167  O  OG1   . THR B  1  51   ? 20.880  24.425  133.939  1.00 47.02  ? 51   THR B OG1   1 
ATOM   2168  C  CG2   . THR B  1  51   ? 21.828  24.218  136.141  1.00 46.63  ? 51   THR B CG2   1 
ATOM   2169  N  N     . ALA B  1  52   ? 20.097  20.574  134.386  1.00 32.34  ? 52   ALA B N     1 
ATOM   2170  C  CA    . ALA B  1  52   ? 19.181  19.667  133.703  1.00 35.65  ? 52   ALA B CA    1 
ATOM   2171  C  C     . ALA B  1  52   ? 17.982  19.305  134.566  1.00 34.02  ? 52   ALA B C     1 
ATOM   2172  O  O     . ALA B  1  52   ? 18.018  19.448  135.786  1.00 37.38  ? 52   ALA B O     1 
ATOM   2173  C  CB    . ALA B  1  52   ? 19.908  18.406  133.287  1.00 37.46  ? 52   ALA B CB    1 
ATOM   2174  N  N     . VAL B  1  53   ? 16.931  18.806  133.924  1.00 30.05  ? 53   VAL B N     1 
ATOM   2175  C  CA    . VAL B  1  53   ? 15.760  18.339  134.646  1.00 34.44  ? 53   VAL B CA    1 
ATOM   2176  C  C     . VAL B  1  53   ? 15.974  16.862  134.912  1.00 36.86  ? 53   VAL B C     1 
ATOM   2177  O  O     . VAL B  1  53   ? 15.953  16.046  133.990  1.00 37.59  ? 53   VAL B O     1 
ATOM   2178  C  CB    . VAL B  1  53   ? 14.478  18.503  133.810  1.00 35.56  ? 53   VAL B CB    1 
ATOM   2179  C  CG1   . VAL B  1  53   ? 13.286  17.897  134.538  1.00 37.62  ? 53   VAL B CG1   1 
ATOM   2180  C  CG2   . VAL B  1  53   ? 14.231  19.970  133.494  1.00 32.84  ? 53   VAL B CG2   1 
ATOM   2181  N  N     . THR B  1  54   ? 16.214  16.525  136.174  1.00 35.57  ? 54   THR B N     1 
ATOM   2182  C  CA    . THR B  1  54   ? 16.529  15.150  136.535  1.00 35.92  ? 54   THR B CA    1 
ATOM   2183  C  C     . THR B  1  54   ? 15.344  14.301  136.999  1.00 34.22  ? 54   THR B C     1 
ATOM   2184  O  O     . THR B  1  54   ? 15.446  13.078  137.059  1.00 35.35  ? 54   THR B O     1 
ATOM   2185  C  CB    . THR B  1  54   ? 17.600  15.126  137.634  1.00 34.94  ? 54   THR B CB    1 
ATOM   2186  O  OG1   . THR B  1  54   ? 17.186  15.973  138.710  1.00 40.35  ? 54   THR B OG1   1 
ATOM   2187  C  CG2   . THR B  1  54   ? 18.924  15.638  137.095  1.00 37.21  ? 54   THR B CG2   1 
ATOM   2188  N  N     . SER B  1  55   ? 14.222  14.939  137.317  1.00 35.64  ? 55   SER B N     1 
ATOM   2189  C  CA    . SER B  1  55   ? 13.056  14.208  137.808  1.00 38.23  ? 55   SER B CA    1 
ATOM   2190  C  C     . SER B  1  55   ? 11.752  14.962  137.564  1.00 40.94  ? 55   SER B C     1 
ATOM   2191  O  O     . SER B  1  55   ? 11.733  16.189  137.562  1.00 40.44  ? 55   SER B O     1 
ATOM   2192  C  CB    . SER B  1  55   ? 13.212  13.883  139.295  1.00 42.14  ? 55   SER B CB    1 
ATOM   2193  O  OG    . SER B  1  55   ? 12.153  13.056  139.747  1.00 48.68  ? 55   SER B OG    1 
ATOM   2194  N  N     . VAL B  1  56   ? 10.662  14.228  137.367  1.00 43.02  ? 56   VAL B N     1 
ATOM   2195  C  CA    . VAL B  1  56   ? 9.359   14.853  137.154  1.00 47.03  ? 56   VAL B CA    1 
ATOM   2196  C  C     . VAL B  1  56   ? 8.246   14.126  137.904  1.00 50.36  ? 56   VAL B C     1 
ATOM   2197  O  O     . VAL B  1  56   ? 8.115   12.906  137.801  1.00 51.22  ? 56   VAL B O     1 
ATOM   2198  C  CB    . VAL B  1  56   ? 8.991   14.910  135.652  1.00 47.33  ? 56   VAL B CB    1 
ATOM   2199  C  CG1   . VAL B  1  56   ? 7.554   15.373  135.467  1.00 46.84  ? 56   VAL B CG1   1 
ATOM   2200  C  CG2   . VAL B  1  56   ? 9.941   15.826  134.902  1.00 48.68  ? 56   VAL B CG2   1 
ATOM   2201  N  N     . TYR B  1  57   ? 7.451   14.876  138.663  1.00 50.69  ? 57   TYR B N     1 
ATOM   2202  C  CA    . TYR B  1  57   ? 6.245   14.322  139.271  1.00 52.26  ? 57   TYR B CA    1 
ATOM   2203  C  C     . TYR B  1  57   ? 4.999   14.976  138.692  1.00 50.74  ? 57   TYR B C     1 
ATOM   2204  O  O     . TYR B  1  57   ? 4.892   16.200  138.658  1.00 50.25  ? 57   TYR B O     1 
ATOM   2205  C  CB    . TYR B  1  57   ? 6.252   14.488  140.791  1.00 57.15  ? 57   TYR B CB    1 
ATOM   2206  C  CG    . TYR B  1  57   ? 4.921   14.146  141.426  1.00 58.67  ? 57   TYR B CG    1 
ATOM   2207  C  CD1   . TYR B  1  57   ? 4.499   12.826  141.532  1.00 61.25  ? 57   TYR B CD1   1 
ATOM   2208  C  CD2   . TYR B  1  57   ? 4.081   15.142  141.912  1.00 55.05  ? 57   TYR B CD2   1 
ATOM   2209  C  CE1   . TYR B  1  57   ? 3.282   12.507  142.106  1.00 61.53  ? 57   TYR B CE1   1 
ATOM   2210  C  CE2   . TYR B  1  57   ? 2.862   14.831  142.487  1.00 59.85  ? 57   TYR B CE2   1 
ATOM   2211  C  CZ    . TYR B  1  57   ? 2.468   13.512  142.581  1.00 61.96  ? 57   TYR B CZ    1 
ATOM   2212  O  OH    . TYR B  1  57   ? 1.257   13.194  143.152  1.00 62.92  ? 57   TYR B OH    1 
ATOM   2213  N  N     . ILE B  1  58   ? 4.059   14.154  138.239  1.00 50.52  ? 58   ILE B N     1 
ATOM   2214  C  CA    . ILE B  1  58   ? 2.796   14.652  137.710  1.00 54.13  ? 58   ILE B CA    1 
ATOM   2215  C  C     . ILE B  1  58   ? 1.632   13.980  138.429  1.00 58.52  ? 58   ILE B C     1 
ATOM   2216  O  O     . ILE B  1  58   ? 1.625   12.761  138.603  1.00 59.37  ? 58   ILE B O     1 
ATOM   2217  C  CB    . ILE B  1  58   ? 2.670   14.393  136.197  1.00 53.16  ? 58   ILE B CB    1 
ATOM   2218  C  CG1   . ILE B  1  58   ? 3.905   14.911  135.458  1.00 55.09  ? 58   ILE B CG1   1 
ATOM   2219  C  CG2   . ILE B  1  58   ? 1.414   15.050  135.649  1.00 55.79  ? 58   ILE B CG2   1 
ATOM   2220  C  CD1   . ILE B  1  58   ? 3.896   14.616  133.974  1.00 53.64  ? 58   ILE B CD1   1 
ATOM   2221  N  N     . GLU B  1  59   ? 0.656   14.781  138.849  1.00 61.97  ? 59   GLU B N     1 
ATOM   2222  C  CA    . GLU B  1  59   ? -0.508  14.265  139.562  1.00 64.75  ? 59   GLU B CA    1 
ATOM   2223  C  C     . GLU B  1  59   ? -1.289  13.260  138.725  1.00 61.35  ? 59   GLU B C     1 
ATOM   2224  O  O     . GLU B  1  59   ? -1.482  13.455  137.524  1.00 57.79  ? 59   GLU B O     1 
ATOM   2225  C  CB    . GLU B  1  59   ? -1.429  15.405  140.000  1.00 68.15  ? 59   GLU B CB    1 
ATOM   2226  C  CG    . GLU B  1  59   ? -0.904  16.214  141.173  1.00 69.90  ? 59   GLU B CG    1 
ATOM   2227  C  CD    . GLU B  1  59   ? -1.935  17.183  141.719  1.00 78.59  ? 59   GLU B CD    1 
ATOM   2228  O  OE1   . GLU B  1  59   ? -1.752  17.666  142.857  1.00 85.48  ? 59   GLU B OE1   1 
ATOM   2229  O  OE2   . GLU B  1  59   ? -2.927  17.462  141.012  1.00 75.47  ? 59   GLU B OE2   1 
ATOM   2230  N  N     . ASP B  1  60   ? -1.726  12.185  139.376  1.00 61.57  ? 60   ASP B N     1 
ATOM   2231  C  CA    . ASP B  1  60   ? -2.493  11.121  138.731  1.00 69.17  ? 60   ASP B CA    1 
ATOM   2232  C  C     . ASP B  1  60   ? -1.748  10.484  137.556  1.00 68.10  ? 60   ASP B C     1 
ATOM   2233  O  O     . ASP B  1  60   ? -2.367  9.992   136.612  1.00 69.48  ? 60   ASP B O     1 
ATOM   2234  C  CB    . ASP B  1  60   ? -3.873  11.626  138.292  1.00 75.77  ? 60   ASP B CB    1 
ATOM   2235  C  CG    . ASP B  1  60   ? -4.721  12.098  139.460  1.00 77.41  ? 60   ASP B CG    1 
ATOM   2236  O  OD1   . ASP B  1  60   ? -4.550  11.563  140.576  1.00 76.88  ? 60   ASP B OD1   1 
ATOM   2237  O  OD2   . ASP B  1  60   ? -5.559  13.004  139.263  1.00 74.92  ? 60   ASP B OD2   1 
ATOM   2238  N  N     . VAL B  1  61   ? -0.419  10.502  137.621  1.00 64.24  ? 61   VAL B N     1 
ATOM   2239  C  CA    . VAL B  1  61   ? 0.412   9.853   136.612  1.00 60.01  ? 61   VAL B CA    1 
ATOM   2240  C  C     . VAL B  1  61   ? 1.372   8.873   137.275  1.00 56.21  ? 61   VAL B C     1 
ATOM   2241  O  O     . VAL B  1  61   ? 2.261   9.269   138.029  1.00 56.01  ? 61   VAL B O     1 
ATOM   2242  C  CB    . VAL B  1  61   ? 1.209   10.874  135.783  1.00 56.88  ? 61   VAL B CB    1 
ATOM   2243  C  CG1   . VAL B  1  61   ? 2.238   10.162  134.922  1.00 59.38  ? 61   VAL B CG1   1 
ATOM   2244  C  CG2   . VAL B  1  61   ? 0.270   11.701  134.923  1.00 59.37  ? 61   VAL B CG2   1 
ATOM   2245  N  N     . LEU B  1  62   ? 1.179   7.589   136.995  1.00 58.00  ? 62   LEU B N     1 
ATOM   2246  C  CA    . LEU B  1  62   ? 1.957   6.540   137.648  1.00 63.97  ? 62   LEU B CA    1 
ATOM   2247  C  C     . LEU B  1  62   ? 3.338   6.298   137.034  1.00 64.22  ? 62   LEU B C     1 
ATOM   2248  O  O     . LEU B  1  62   ? 4.319   6.126   137.759  1.00 62.95  ? 62   LEU B O     1 
ATOM   2249  C  CB    . LEU B  1  62   ? 1.151   5.239   137.714  1.00 65.71  ? 62   LEU B CB    1 
ATOM   2250  C  CG    . LEU B  1  62   ? -0.188  5.358   138.450  1.00 61.62  ? 62   LEU B CG    1 
ATOM   2251  C  CD1   . LEU B  1  62   ? -0.829  3.991   138.649  1.00 58.12  ? 62   LEU B CD1   1 
ATOM   2252  C  CD2   . LEU B  1  62   ? -0.014  6.078   139.782  1.00 55.26  ? 62   LEU B CD2   1 
ATOM   2253  N  N     . HIS B  1  63   ? 3.420   6.286   135.706  1.00 62.27  ? 63   HIS B N     1 
ATOM   2254  C  CA    . HIS B  1  63   ? 4.695   6.018   135.041  1.00 61.80  ? 63   HIS B CA    1 
ATOM   2255  C  C     . HIS B  1  63   ? 4.957   6.858   133.787  1.00 61.43  ? 63   HIS B C     1 
ATOM   2256  O  O     . HIS B  1  63   ? 4.129   7.674   133.379  1.00 58.10  ? 63   HIS B O     1 
ATOM   2257  C  CB    . HIS B  1  63   ? 4.844   4.522   134.735  1.00 63.19  ? 63   HIS B CB    1 
ATOM   2258  C  CG    . HIS B  1  63   ? 3.652   3.918   134.059  1.00 65.61  ? 63   HIS B CG    1 
ATOM   2259  N  ND1   . HIS B  1  63   ? 3.388   4.093   132.718  1.00 65.91  ? 63   HIS B ND1   1 
ATOM   2260  C  CD2   . HIS B  1  63   ? 2.656   3.136   134.539  1.00 65.41  ? 63   HIS B CD2   1 
ATOM   2261  C  CE1   . HIS B  1  63   ? 2.280   3.447   132.401  1.00 65.66  ? 63   HIS B CE1   1 
ATOM   2262  N  NE2   . HIS B  1  63   ? 1.816   2.858   133.489  1.00 68.23  ? 63   HIS B NE2   1 
ATOM   2263  N  N     . GLU B  1  64   ? 6.125   6.638   133.189  1.00 63.51  ? 64   GLU B N     1 
ATOM   2264  C  CA    . GLU B  1  64   ? 6.616   7.432   132.063  1.00 60.44  ? 64   GLU B CA    1 
ATOM   2265  C  C     . GLU B  1  64   ? 5.792   7.228   130.796  1.00 56.62  ? 64   GLU B C     1 
ATOM   2266  O  O     . GLU B  1  64   ? 5.647   8.138   129.980  1.00 57.31  ? 64   GLU B O     1 
ATOM   2267  C  CB    . GLU B  1  64   ? 8.086   7.081   131.798  1.00 62.28  ? 64   GLU B CB    1 
ATOM   2268  C  CG    . GLU B  1  64   ? 8.731   7.810   130.629  1.00 63.01  ? 64   GLU B CG    1 
ATOM   2269  C  CD    . GLU B  1  64   ? 10.219  7.526   130.518  1.00 67.24  ? 64   GLU B CD    1 
ATOM   2270  O  OE1   . GLU B  1  64   ? 10.892  8.175   129.689  1.00 70.68  ? 64   GLU B OE1   1 
ATOM   2271  O  OE2   . GLU B  1  64   ? 10.714  6.653   131.262  1.00 67.16  ? 64   GLU B OE2   1 
ATOM   2272  N  N     . PHE B  1  65   ? 5.243   6.031   130.646  1.00 56.33  ? 65   PHE B N     1 
ATOM   2273  C  CA    . PHE B  1  65   ? 4.546   5.651   129.426  1.00 60.12  ? 65   PHE B CA    1 
ATOM   2274  C  C     . PHE B  1  65   ? 3.043   5.919   129.497  1.00 63.88  ? 65   PHE B C     1 
ATOM   2275  O  O     . PHE B  1  65   ? 2.290   5.534   128.602  1.00 65.36  ? 65   PHE B O     1 
ATOM   2276  C  CB    . PHE B  1  65   ? 4.844   4.190   129.090  1.00 60.94  ? 65   PHE B CB    1 
ATOM   2277  C  CG    . PHE B  1  65   ? 6.313   3.894   128.973  1.00 62.09  ? 65   PHE B CG    1 
ATOM   2278  C  CD1   . PHE B  1  65   ? 6.984   4.122   127.783  1.00 58.95  ? 65   PHE B CD1   1 
ATOM   2279  C  CD2   . PHE B  1  65   ? 7.028   3.409   130.057  1.00 66.53  ? 65   PHE B CD2   1 
ATOM   2280  C  CE1   . PHE B  1  65   ? 8.336   3.860   127.671  1.00 58.64  ? 65   PHE B CE1   1 
ATOM   2281  C  CE2   . PHE B  1  65   ? 8.383   3.145   129.952  1.00 65.01  ? 65   PHE B CE2   1 
ATOM   2282  C  CZ    . PHE B  1  65   ? 9.037   3.371   128.757  1.00 63.57  ? 65   PHE B CZ    1 
ATOM   2283  N  N     . SER B  1  66   ? 2.616   6.573   130.573  1.00 65.20  ? 66   SER B N     1 
ATOM   2284  C  CA    . SER B  1  66   ? 1.210   6.907   130.771  1.00 64.89  ? 66   SER B CA    1 
ATOM   2285  C  C     . SER B  1  66   ? 0.748   8.026   129.838  1.00 65.93  ? 66   SER B C     1 
ATOM   2286  O  O     . SER B  1  66   ? 1.521   8.537   129.024  1.00 62.33  ? 66   SER B O     1 
ATOM   2287  C  CB    . SER B  1  66   ? 0.963   7.326   132.223  1.00 64.01  ? 66   SER B CB    1 
ATOM   2288  O  OG    . SER B  1  66   ? 1.505   6.386   133.134  1.00 65.34  ? 66   SER B OG    1 
ATOM   2289  N  N     . THR B  1  67   ? -0.522  8.398   129.970  1.00 69.55  ? 67   THR B N     1 
ATOM   2290  C  CA    . THR B  1  67   ? -1.103  9.498   129.206  1.00 67.51  ? 67   THR B CA    1 
ATOM   2291  C  C     . THR B  1  67   ? -2.040  10.317  130.091  1.00 64.21  ? 67   THR B C     1 
ATOM   2292  O  O     . THR B  1  67   ? -2.693  9.778   130.986  1.00 63.92  ? 67   THR B O     1 
ATOM   2293  C  CB    . THR B  1  67   ? -1.874  8.990   127.972  1.00 62.36  ? 67   THR B CB    1 
ATOM   2294  O  OG1   . THR B  1  67   ? -2.578  10.080  127.364  1.00 65.54  ? 67   THR B OG1   1 
ATOM   2295  C  CG2   . THR B  1  67   ? -2.869  7.908   128.370  1.00 53.73  ? 67   THR B CG2   1 
ATOM   2296  N  N     . ILE B  1  68   ? -2.103  11.621  129.841  1.00 58.93  ? 68   ILE B N     1 
ATOM   2297  C  CA    . ILE B  1  68   ? -2.928  12.506  130.654  1.00 62.55  ? 68   ILE B CA    1 
ATOM   2298  C  C     . ILE B  1  68   ? -4.177  12.973  129.911  1.00 67.72  ? 68   ILE B C     1 
ATOM   2299  O  O     . ILE B  1  68   ? -4.078  13.592  128.850  1.00 65.46  ? 68   ILE B O     1 
ATOM   2300  C  CB    . ILE B  1  68   ? -2.136  13.739  131.129  1.00 59.94  ? 68   ILE B CB    1 
ATOM   2301  C  CG1   . ILE B  1  68   ? -0.791  13.312  131.721  1.00 54.00  ? 68   ILE B CG1   1 
ATOM   2302  C  CG2   . ILE B  1  68   ? -2.948  14.535  132.141  1.00 60.68  ? 68   ILE B CG2   1 
ATOM   2303  C  CD1   . ILE B  1  68   ? 0.043   14.464  132.236  1.00 48.81  ? 68   ILE B CD1   1 
ATOM   2304  N  N     . PRO B  1  69   ? -5.359  12.669  130.470  1.00 69.19  ? 69   PRO B N     1 
ATOM   2305  C  CA    . PRO B  1  69   ? -6.644  13.109  129.916  1.00 65.28  ? 69   PRO B CA    1 
ATOM   2306  C  C     . PRO B  1  69   ? -6.756  14.630  129.914  1.00 63.47  ? 69   PRO B C     1 
ATOM   2307  O  O     . PRO B  1  69   ? -6.383  15.274  130.895  1.00 64.82  ? 69   PRO B O     1 
ATOM   2308  C  CB    . PRO B  1  69   ? -7.666  12.512  130.889  1.00 63.91  ? 69   PRO B CB    1 
ATOM   2309  C  CG    . PRO B  1  69   ? -6.964  11.361  131.522  1.00 63.46  ? 69   PRO B CG    1 
ATOM   2310  C  CD    . PRO B  1  69   ? -5.536  11.793  131.640  1.00 65.56  ? 69   PRO B CD    1 
ATOM   2311  N  N     . GLY B  1  70   ? -7.262  15.191  128.821  1.00 58.74  ? 70   GLY B N     1 
ATOM   2312  C  CA    . GLY B  1  70   ? -7.397  16.631  128.698  1.00 69.06  ? 70   GLY B CA    1 
ATOM   2313  C  C     . GLY B  1  70   ? -6.139  17.283  128.155  1.00 71.08  ? 70   GLY B C     1 
ATOM   2314  O  O     . GLY B  1  70   ? -6.114  18.484  127.886  1.00 69.49  ? 70   GLY B O     1 
ATOM   2315  N  N     . VAL B  1  71   ? -5.090  16.482  127.998  1.00 69.20  ? 71   VAL B N     1 
ATOM   2316  C  CA    . VAL B  1  71   ? -3.830  16.961  127.446  1.00 63.20  ? 71   VAL B CA    1 
ATOM   2317  C  C     . VAL B  1  71   ? -3.545  16.263  126.120  1.00 63.42  ? 71   VAL B C     1 
ATOM   2318  O  O     . VAL B  1  71   ? -3.656  15.039  126.019  1.00 63.72  ? 71   VAL B O     1 
ATOM   2319  C  CB    . VAL B  1  71   ? -2.660  16.715  128.420  1.00 59.42  ? 71   VAL B CB    1 
ATOM   2320  C  CG1   . VAL B  1  71   ? -1.363  17.258  127.844  1.00 56.33  ? 71   VAL B CG1   1 
ATOM   2321  C  CG2   . VAL B  1  71   ? -2.951  17.351  129.770  1.00 62.11  ? 71   VAL B CG2   1 
ATOM   2322  N  N     . LYS B  1  72   ? -3.192  17.045  125.104  1.00 62.84  ? 72   LYS B N     1 
ATOM   2323  C  CA    . LYS B  1  72   ? -2.868  16.497  123.790  1.00 60.95  ? 72   LYS B CA    1 
ATOM   2324  C  C     . LYS B  1  72   ? -1.681  15.537  123.850  1.00 59.23  ? 72   LYS B C     1 
ATOM   2325  O  O     . LYS B  1  72   ? -1.771  14.399  123.388  1.00 54.65  ? 72   LYS B O     1 
ATOM   2326  C  CB    . LYS B  1  72   ? -2.584  17.621  122.788  1.00 63.42  ? 72   LYS B CB    1 
ATOM   2327  C  CG    . LYS B  1  72   ? -1.766  17.176  121.580  1.00 66.95  ? 72   LYS B CG    1 
ATOM   2328  C  CD    . LYS B  1  72   ? -2.486  17.442  120.266  1.00 72.31  ? 72   LYS B CD    1 
ATOM   2329  C  CE    . LYS B  1  72   ? -1.960  18.694  119.579  1.00 68.79  ? 72   LYS B CE    1 
ATOM   2330  N  NZ    . LYS B  1  72   ? -2.561  18.875  118.226  1.00 64.00  ? 72   LYS B NZ    1 
ATOM   2331  N  N     . GLU B  1  73   ? -0.575  16.000  124.424  1.00 58.10  ? 73   GLU B N     1 
ATOM   2332  C  CA    . GLU B  1  73   ? 0.638   15.196  124.505  1.00 51.94  ? 73   GLU B CA    1 
ATOM   2333  C  C     . GLU B  1  73   ? 0.560   14.171  125.626  1.00 51.14  ? 73   GLU B C     1 
ATOM   2334  O  O     . GLU B  1  73   ? -0.073  14.407  126.654  1.00 53.55  ? 73   GLU B O     1 
ATOM   2335  C  CB    . GLU B  1  73   ? 1.867   16.084  124.717  1.00 49.22  ? 73   GLU B CB    1 
ATOM   2336  C  CG    . GLU B  1  73   ? 2.079   17.138  123.646  1.00 52.26  ? 73   GLU B CG    1 
ATOM   2337  C  CD    . GLU B  1  73   ? 1.374   18.439  123.963  1.00 54.49  ? 73   GLU B CD    1 
ATOM   2338  O  OE1   . GLU B  1  73   ? 0.699   18.511  125.011  1.00 55.81  ? 73   GLU B OE1   1 
ATOM   2339  O  OE2   . GLU B  1  73   ? 1.497   19.392  123.164  1.00 56.18  ? 73   GLU B OE2   1 
ATOM   2340  N  N     . ASP B  1  74   ? 1.207   13.030  125.418  1.00 53.49  ? 74   ASP B N     1 
ATOM   2341  C  CA    . ASP B  1  74   ? 1.333   12.022  126.461  1.00 54.41  ? 74   ASP B CA    1 
ATOM   2342  C  C     . ASP B  1  74   ? 2.488   12.397  127.381  1.00 53.83  ? 74   ASP B C     1 
ATOM   2343  O  O     . ASP B  1  74   ? 3.144   13.420  127.174  1.00 50.42  ? 74   ASP B O     1 
ATOM   2344  C  CB    . ASP B  1  74   ? 1.556   10.636  125.851  1.00 56.59  ? 74   ASP B CB    1 
ATOM   2345  C  CG    . ASP B  1  74   ? 2.720   10.606  124.877  1.00 56.54  ? 74   ASP B CG    1 
ATOM   2346  O  OD1   . ASP B  1  74   ? 3.111   11.684  124.380  1.00 58.09  ? 74   ASP B OD1   1 
ATOM   2347  O  OD2   . ASP B  1  74   ? 3.240   9.503   124.602  1.00 53.37  ? 74   ASP B OD2   1 
ATOM   2348  N  N     . VAL B  1  75   ? 2.734   11.571  128.393  1.00 54.09  ? 75   VAL B N     1 
ATOM   2349  C  CA    . VAL B  1  75   ? 3.779   11.851  129.374  1.00 52.79  ? 75   VAL B CA    1 
ATOM   2350  C  C     . VAL B  1  75   ? 5.157   11.931  128.720  1.00 50.57  ? 75   VAL B C     1 
ATOM   2351  O  O     . VAL B  1  75   ? 5.969   12.793  129.064  1.00 50.46  ? 75   VAL B O     1 
ATOM   2352  C  CB    . VAL B  1  75   ? 3.791   10.791  130.496  1.00 53.53  ? 75   VAL B CB    1 
ATOM   2353  C  CG1   . VAL B  1  75   ? 4.912   11.069  131.487  1.00 52.21  ? 75   VAL B CG1   1 
ATOM   2354  C  CG2   . VAL B  1  75   ? 2.448   10.759  131.206  1.00 55.68  ? 75   VAL B CG2   1 
ATOM   2355  N  N     . VAL B  1  76   ? 5.401   11.041  127.763  1.00 48.85  ? 76   VAL B N     1 
ATOM   2356  C  CA    . VAL B  1  76   ? 6.681   10.969  127.065  1.00 46.43  ? 76   VAL B CA    1 
ATOM   2357  C  C     . VAL B  1  76   ? 7.063   12.296  126.409  1.00 42.34  ? 76   VAL B C     1 
ATOM   2358  O  O     . VAL B  1  76   ? 8.156   12.822  126.639  1.00 39.95  ? 76   VAL B O     1 
ATOM   2359  C  CB    . VAL B  1  76   ? 6.659   9.866   125.990  1.00 46.54  ? 76   VAL B CB    1 
ATOM   2360  C  CG1   . VAL B  1  76   ? 8.027   9.728   125.341  1.00 43.91  ? 76   VAL B CG1   1 
ATOM   2361  C  CG2   . VAL B  1  76   ? 6.214   8.544   126.599  1.00 47.74  ? 76   VAL B CG2   1 
ATOM   2362  N  N     . GLU B  1  77   ? 6.153   12.831  125.599  1.00 41.38  ? 77   GLU B N     1 
ATOM   2363  C  CA    . GLU B  1  77   ? 6.379   14.092  124.901  1.00 43.86  ? 77   GLU B CA    1 
ATOM   2364  C  C     . GLU B  1  77   ? 6.656   15.225  125.884  1.00 44.42  ? 77   GLU B C     1 
ATOM   2365  O  O     . GLU B  1  77   ? 7.548   16.050  125.664  1.00 43.55  ? 77   GLU B O     1 
ATOM   2366  C  CB    . GLU B  1  77   ? 5.172   14.441  124.028  1.00 44.12  ? 77   GLU B CB    1 
ATOM   2367  C  CG    . GLU B  1  77   ? 5.346   15.702  123.190  1.00 47.00  ? 77   GLU B CG    1 
ATOM   2368  C  CD    . GLU B  1  77   ? 6.239   15.493  121.980  1.00 46.54  ? 77   GLU B CD    1 
ATOM   2369  O  OE1   . GLU B  1  77   ? 6.663   16.501  121.376  1.00 42.52  ? 77   GLU B OE1   1 
ATOM   2370  O  OE2   . GLU B  1  77   ? 6.510   14.325  121.627  1.00 49.17  ? 77   GLU B OE2   1 
ATOM   2371  N  N     . ILE B  1  78   ? 5.884   15.255  126.966  1.00 43.49  ? 78   ILE B N     1 
ATOM   2372  C  CA    . ILE B  1  78   ? 6.068   16.244  128.021  1.00 42.72  ? 78   ILE B CA    1 
ATOM   2373  C  C     . ILE B  1  78   ? 7.481   16.158  128.583  1.00 39.54  ? 78   ILE B C     1 
ATOM   2374  O  O     . ILE B  1  78   ? 8.159   17.174  128.752  1.00 40.36  ? 78   ILE B O     1 
ATOM   2375  C  CB    . ILE B  1  78   ? 5.049   16.048  129.158  1.00 46.16  ? 78   ILE B CB    1 
ATOM   2376  C  CG1   . ILE B  1  78   ? 3.625   16.241  128.631  1.00 45.86  ? 78   ILE B CG1   1 
ATOM   2377  C  CG2   . ILE B  1  78   ? 5.328   17.012  130.300  1.00 47.45  ? 78   ILE B CG2   1 
ATOM   2378  C  CD1   . ILE B  1  78   ? 2.553   16.030  129.675  1.00 46.40  ? 78   ILE B CD1   1 
ATOM   2379  N  N     . ILE B  1  79   ? 7.922   14.935  128.857  1.00 39.80  ? 79   ILE B N     1 
ATOM   2380  C  CA    . ILE B  1  79   ? 9.266   14.698  129.365  1.00 41.18  ? 79   ILE B CA    1 
ATOM   2381  C  C     . ILE B  1  79   ? 10.330  15.193  128.387  1.00 39.35  ? 79   ILE B C     1 
ATOM   2382  O  O     . ILE B  1  79   ? 11.308  15.815  128.796  1.00 38.64  ? 79   ILE B O     1 
ATOM   2383  C  CB    . ILE B  1  79   ? 9.490   13.205  129.689  1.00 42.36  ? 79   ILE B CB    1 
ATOM   2384  C  CG1   . ILE B  1  79   ? 8.593   12.784  130.854  1.00 42.15  ? 79   ILE B CG1   1 
ATOM   2385  C  CG2   . ILE B  1  79   ? 10.951  12.930  130.023  1.00 39.91  ? 79   ILE B CG2   1 
ATOM   2386  C  CD1   . ILE B  1  79   ? 8.760   11.345  131.267  1.00 46.78  ? 79   ILE B CD1   1 
ATOM   2387  N  N     . LEU B  1  80   ? 10.132  14.932  127.098  1.00 38.42  ? 80   LEU B N     1 
ATOM   2388  C  CA    . LEU B  1  80   ? 11.074  15.396  126.077  1.00 36.80  ? 80   LEU B CA    1 
ATOM   2389  C  C     . LEU B  1  80   ? 11.171  16.925  126.050  1.00 38.01  ? 80   LEU B C     1 
ATOM   2390  O  O     . LEU B  1  80   ? 12.270  17.502  126.102  1.00 37.69  ? 80   LEU B O     1 
ATOM   2391  C  CB    . LEU B  1  80   ? 10.676  14.858  124.702  1.00 36.23  ? 80   LEU B CB    1 
ATOM   2392  C  CG    . LEU B  1  80   ? 10.674  13.333  124.571  1.00 35.65  ? 80   LEU B CG    1 
ATOM   2393  C  CD1   . LEU B  1  80   ? 10.215  12.898  123.186  1.00 33.67  ? 80   LEU B CD1   1 
ATOM   2394  C  CD2   . LEU B  1  80   ? 12.051  12.765  124.892  1.00 33.41  ? 80   LEU B CD2   1 
ATOM   2395  N  N     . ASN B  1  81   ? 10.015  17.576  125.974  1.00 38.86  ? 81   ASN B N     1 
ATOM   2396  C  CA    . ASN B  1  81   ? 9.956   19.031  126.050  1.00 39.61  ? 81   ASN B CA    1 
ATOM   2397  C  C     . ASN B  1  81   ? 10.674  19.557  127.289  1.00 37.08  ? 81   ASN B C     1 
ATOM   2398  O  O     . ASN B  1  81   ? 11.366  20.572  127.232  1.00 36.98  ? 81   ASN B O     1 
ATOM   2399  C  CB    . ASN B  1  81   ? 8.506   19.516  126.025  1.00 40.65  ? 81   ASN B CB    1 
ATOM   2400  C  CG    . ASN B  1  81   ? 7.857   19.346  124.664  1.00 46.55  ? 81   ASN B CG    1 
ATOM   2401  O  OD1   . ASN B  1  81   ? 8.508   19.495  123.629  1.00 49.28  ? 81   ASN B OD1   1 
ATOM   2402  N  ND2   . ASN B  1  81   ? 6.566   19.032  124.658  1.00 46.81  ? 81   ASN B ND2   1 
ATOM   2403  N  N     . LEU B  1  82   ? 10.517  18.848  128.402  1.00 36.69  ? 82   LEU B N     1 
ATOM   2404  C  CA    . LEU B  1  82   ? 11.192  19.213  129.642  1.00 39.46  ? 82   LEU B CA    1 
ATOM   2405  C  C     . LEU B  1  82   ? 12.703  19.032  129.529  1.00 36.65  ? 82   LEU B C     1 
ATOM   2406  O  O     . LEU B  1  82   ? 13.471  19.760  130.157  1.00 35.11  ? 82   LEU B O     1 
ATOM   2407  C  CB    . LEU B  1  82   ? 10.635  18.405  130.815  1.00 40.92  ? 82   LEU B CB    1 
ATOM   2408  C  CG    . LEU B  1  82   ? 9.240   18.833  131.276  1.00 38.84  ? 82   LEU B CG    1 
ATOM   2409  C  CD1   . LEU B  1  82   ? 8.648   17.811  132.227  1.00 39.53  ? 82   LEU B CD1   1 
ATOM   2410  C  CD2   . LEU B  1  82   ? 9.294   20.208  131.926  1.00 37.51  ? 82   LEU B CD2   1 
ATOM   2411  N  N     . LYS B  1  83   ? 13.128  18.059  128.728  1.00 36.37  ? 83   LYS B N     1 
ATOM   2412  C  CA    . LYS B  1  83   ? 14.546  17.887  128.449  1.00 37.48  ? 83   LYS B CA    1 
ATOM   2413  C  C     . LYS B  1  83   ? 15.037  19.096  127.676  1.00 37.66  ? 83   LYS B C     1 
ATOM   2414  O  O     . LYS B  1  83   ? 16.193  19.497  127.803  1.00 34.64  ? 83   LYS B O     1 
ATOM   2415  C  CB    . LYS B  1  83   ? 14.804  16.625  127.624  1.00 35.67  ? 83   LYS B CB    1 
ATOM   2416  C  CG    . LYS B  1  83   ? 14.615  15.321  128.365  1.00 33.35  ? 83   LYS B CG    1 
ATOM   2417  C  CD    . LYS B  1  83   ? 14.942  14.152  127.455  1.00 33.78  ? 83   LYS B CD    1 
ATOM   2418  C  CE    . LYS B  1  83   ? 14.686  12.821  128.136  1.00 38.56  ? 83   LYS B CE    1 
ATOM   2419  N  NZ    . LYS B  1  83   ? 14.935  11.683  127.207  1.00 39.60  ? 83   LYS B NZ    1 
ATOM   2420  N  N     . GLU B  1  84   ? 14.147  19.688  126.886  1.00 37.96  ? 84   GLU B N     1 
ATOM   2421  C  CA    . GLU B  1  84   ? 14.532  20.840  126.072  1.00 41.58  ? 84   GLU B CA    1 
ATOM   2422  C  C     . GLU B  1  84   ? 14.559  22.156  126.856  1.00 39.30  ? 84   GLU B C     1 
ATOM   2423  O  O     . GLU B  1  84   ? 14.904  23.206  126.310  1.00 36.31  ? 84   GLU B O     1 
ATOM   2424  C  CB    . GLU B  1  84   ? 13.628  20.968  124.843  1.00 42.99  ? 84   GLU B CB    1 
ATOM   2425  C  CG    . GLU B  1  84   ? 13.923  19.951  123.751  1.00 42.70  ? 84   GLU B CG    1 
ATOM   2426  C  CD    . GLU B  1  84   ? 13.090  20.178  122.506  1.00 47.86  ? 84   GLU B CD    1 
ATOM   2427  O  OE1   . GLU B  1  84   ? 12.097  20.932  122.587  1.00 54.23  ? 84   GLU B OE1   1 
ATOM   2428  O  OE2   . GLU B  1  84   ? 13.429  19.606  121.447  1.00 43.24  ? 84   GLU B OE2   1 
ATOM   2429  N  N     . LEU B  1  85   ? 14.205  22.094  128.136  1.00 38.52  ? 85   LEU B N     1 
ATOM   2430  C  CA    . LEU B  1  85   ? 14.207  23.280  128.986  1.00 37.13  ? 85   LEU B CA    1 
ATOM   2431  C  C     . LEU B  1  85   ? 15.628  23.714  129.335  1.00 38.00  ? 85   LEU B C     1 
ATOM   2432  O  O     . LEU B  1  85   ? 16.427  22.914  129.821  1.00 39.02  ? 85   LEU B O     1 
ATOM   2433  C  CB    . LEU B  1  85   ? 13.407  23.021  130.265  1.00 31.74  ? 85   LEU B CB    1 
ATOM   2434  C  CG    . LEU B  1  85   ? 13.206  24.203  131.216  1.00 28.65  ? 85   LEU B CG    1 
ATOM   2435  C  CD1   . LEU B  1  85   ? 12.405  25.305  130.545  1.00 33.29  ? 85   LEU B CD1   1 
ATOM   2436  C  CD2   . LEU B  1  85   ? 12.523  23.751  132.495  1.00 29.15  ? 85   LEU B CD2   1 
ATOM   2437  N  N     . VAL B  1  86   ? 15.939  24.982  129.082  1.00 39.07  ? 86   VAL B N     1 
ATOM   2438  C  CA    . VAL B  1  86   ? 17.245  25.534  129.433  1.00 39.55  ? 86   VAL B CA    1 
ATOM   2439  C  C     . VAL B  1  86   ? 17.141  26.443  130.653  1.00 38.70  ? 86   VAL B C     1 
ATOM   2440  O  O     . VAL B  1  86   ? 16.588  27.539  130.577  1.00 42.96  ? 86   VAL B O     1 
ATOM   2441  C  CB    . VAL B  1  86   ? 17.856  26.334  128.268  1.00 37.89  ? 86   VAL B CB    1 
ATOM   2442  C  CG1   . VAL B  1  86   ? 19.217  26.890  128.662  1.00 38.91  ? 86   VAL B CG1   1 
ATOM   2443  C  CG2   . VAL B  1  86   ? 17.969  25.463  127.029  1.00 39.70  ? 86   VAL B CG2   1 
ATOM   2444  N  N     . VAL B  1  87   ? 17.689  25.988  131.775  1.00 37.53  ? 87   VAL B N     1 
ATOM   2445  C  CA    . VAL B  1  87   ? 17.614  26.743  133.021  1.00 41.33  ? 87   VAL B CA    1 
ATOM   2446  C  C     . VAL B  1  87   ? 18.994  27.221  133.465  1.00 41.56  ? 87   VAL B C     1 
ATOM   2447  O  O     . VAL B  1  87   ? 19.956  26.455  133.480  1.00 42.12  ? 87   VAL B O     1 
ATOM   2448  C  CB    . VAL B  1  87   ? 16.949  25.914  134.142  1.00 39.36  ? 87   VAL B CB    1 
ATOM   2449  C  CG1   . VAL B  1  87   ? 17.018  26.649  135.472  1.00 43.83  ? 87   VAL B CG1   1 
ATOM   2450  C  CG2   . VAL B  1  87   ? 15.507  25.600  133.779  1.00 33.17  ? 87   VAL B CG2   1 
ATOM   2451  N  N     . ARG B  1  88   ? 19.080  28.498  133.817  1.00 42.58  ? 88   ARG B N     1 
ATOM   2452  C  CA    . ARG B  1  88   ? 20.336  29.108  134.225  1.00 49.84  ? 88   ARG B CA    1 
ATOM   2453  C  C     . ARG B  1  88   ? 20.293  29.541  135.688  1.00 55.48  ? 88   ARG B C     1 
ATOM   2454  O  O     . ARG B  1  88   ? 19.467  30.370  136.075  1.00 55.78  ? 88   ARG B O     1 
ATOM   2455  C  CB    . ARG B  1  88   ? 20.640  30.311  133.332  1.00 52.47  ? 88   ARG B CB    1 
ATOM   2456  C  CG    . ARG B  1  88   ? 21.842  31.128  133.759  1.00 54.91  ? 88   ARG B CG    1 
ATOM   2457  C  CD    . ARG B  1  88   ? 21.996  32.344  132.865  1.00 63.73  ? 88   ARG B CD    1 
ATOM   2458  N  NE    . ARG B  1  88   ? 23.114  33.190  133.268  1.00 76.94  ? 88   ARG B NE    1 
ATOM   2459  C  CZ    . ARG B  1  88   ? 23.433  34.335  132.673  1.00 84.44  ? 88   ARG B CZ    1 
ATOM   2460  N  NH1   . ARG B  1  88   ? 22.715  34.773  131.647  1.00 79.73  ? 88   ARG B NH1   1 
ATOM   2461  N  NH2   . ARG B  1  88   ? 24.468  35.043  133.105  1.00 87.85  ? 88   ARG B NH2   1 
ATOM   2462  N  N     . PHE B  1  89   ? 21.184  28.973  136.496  1.00 55.45  ? 89   PHE B N     1 
ATOM   2463  C  CA    . PHE B  1  89   ? 21.291  29.347  137.902  1.00 51.82  ? 89   PHE B CA    1 
ATOM   2464  C  C     . PHE B  1  89   ? 22.144  30.601  138.045  1.00 57.01  ? 89   PHE B C     1 
ATOM   2465  O  O     . PHE B  1  89   ? 23.294  30.632  137.608  1.00 59.96  ? 89   PHE B O     1 
ATOM   2466  C  CB    . PHE B  1  89   ? 21.905  28.212  138.727  1.00 49.34  ? 89   PHE B CB    1 
ATOM   2467  C  CG    . PHE B  1  89   ? 21.013  27.009  138.877  1.00 47.73  ? 89   PHE B CG    1 
ATOM   2468  C  CD1   . PHE B  1  89   ? 19.689  27.049  138.473  1.00 50.72  ? 89   PHE B CD1   1 
ATOM   2469  C  CD2   . PHE B  1  89   ? 21.502  25.839  139.434  1.00 47.52  ? 89   PHE B CD2   1 
ATOM   2470  C  CE1   . PHE B  1  89   ? 18.871  25.940  138.614  1.00 48.02  ? 89   PHE B CE1   1 
ATOM   2471  C  CE2   . PHE B  1  89   ? 20.689  24.728  139.579  1.00 46.35  ? 89   PHE B CE2   1 
ATOM   2472  C  CZ    . PHE B  1  89   ? 19.373  24.779  139.168  1.00 43.14  ? 89   PHE B CZ    1 
ATOM   2473  N  N     . LEU B  1  90   ? 21.579  31.636  138.657  1.00 57.62  ? 90   LEU B N     1 
ATOM   2474  C  CA    . LEU B  1  90   ? 22.305  32.885  138.855  1.00 59.88  ? 90   LEU B CA    1 
ATOM   2475  C  C     . LEU B  1  90   ? 23.290  32.774  140.010  1.00 63.72  ? 90   LEU B C     1 
ATOM   2476  O  O     . LEU B  1  90   ? 24.371  33.359  139.973  1.00 67.39  ? 90   LEU B O     1 
ATOM   2477  C  CB    . LEU B  1  90   ? 21.341  34.049  139.103  1.00 57.50  ? 90   LEU B CB    1 
ATOM   2478  C  CG    . LEU B  1  90   ? 20.582  34.622  137.903  1.00 63.14  ? 90   LEU B CG    1 
ATOM   2479  C  CD1   . LEU B  1  90   ? 21.520  34.823  136.719  1.00 67.66  ? 90   LEU B CD1   1 
ATOM   2480  C  CD2   . LEU B  1  90   ? 19.411  33.735  137.516  1.00 60.47  ? 90   LEU B CD2   1 
ATOM   2481  N  N     . ASN B  1  91   ? 22.907  32.016  141.033  1.00 63.79  ? 91   ASN B N     1 
ATOM   2482  C  CA    . ASN B  1  91   ? 23.712  31.884  142.243  1.00 64.20  ? 91   ASN B CA    1 
ATOM   2483  C  C     . ASN B  1  91   ? 24.720  30.742  142.125  1.00 62.31  ? 91   ASN B C     1 
ATOM   2484  O  O     . ASN B  1  91   ? 24.330  29.584  141.971  1.00 60.45  ? 91   ASN B O     1 
ATOM   2485  C  CB    . ASN B  1  91   ? 22.801  31.669  143.455  1.00 65.63  ? 91   ASN B CB    1 
ATOM   2486  C  CG    . ASN B  1  91   ? 23.557  31.698  144.769  1.00 69.85  ? 91   ASN B CG    1 
ATOM   2487  O  OD1   . ASN B  1  91   ? 24.701  32.197  144.793  1.00 74.03  ? 91   ASN B OD1   1 
ATOM   2488  N  ND2   . ASN B  1  91   ? 22.998  31.230  145.782  1.00 68.45  ? 91   ASN B ND2   1 
ATOM   2489  N  N     . PRO B  1  92   ? 26.023  31.075  142.185  1.00 63.74  ? 92   PRO B N     1 
ATOM   2490  C  CA    . PRO B  1  92   ? 27.134  30.119  142.103  1.00 61.25  ? 92   PRO B CA    1 
ATOM   2491  C  C     . PRO B  1  92   ? 26.967  28.932  143.044  1.00 59.71  ? 92   PRO B C     1 
ATOM   2492  O  O     . PRO B  1  92   ? 27.351  27.816  142.704  1.00 59.82  ? 92   PRO B O     1 
ATOM   2493  C  CB    . PRO B  1  92   ? 28.343  30.941  142.561  1.00 57.76  ? 92   PRO B CB    1 
ATOM   2494  C  CG    . PRO B  1  92   ? 27.945  32.376  142.450  1.00 56.39  ? 92   PRO B CG    1 
ATOM   2495  C  CD    . PRO B  1  92   ? 26.491  32.469  142.105  1.00 60.10  ? 92   PRO B CD    1 
ATOM   2496  N  N     . SER B  1  93   ? 26.394  29.178  144.215  1.00 58.51  ? 93   SER B N     1 
ATOM   2497  C  CA    . SER B  1  93   ? 26.308  28.160  145.252  1.00 59.11  ? 93   SER B CA    1 
ATOM   2498  C  C     . SER B  1  93   ? 25.122  27.207  145.082  1.00 60.76  ? 93   SER B C     1 
ATOM   2499  O  O     . SER B  1  93   ? 25.064  26.161  145.731  1.00 61.25  ? 93   SER B O     1 
ATOM   2500  C  CB    . SER B  1  93   ? 26.235  28.829  146.626  1.00 60.81  ? 93   SER B CB    1 
ATOM   2501  O  OG    . SER B  1  93   ? 27.289  29.762  146.799  1.00 65.40  ? 93   SER B OG    1 
ATOM   2502  N  N     . LEU B  1  94   ? 24.184  27.557  144.208  1.00 56.72  ? 94   LEU B N     1 
ATOM   2503  C  CA    . LEU B  1  94   ? 22.919  26.832  144.144  1.00 52.90  ? 94   LEU B CA    1 
ATOM   2504  C  C     . LEU B  1  94   ? 23.055  25.521  143.380  1.00 52.15  ? 94   LEU B C     1 
ATOM   2505  O  O     . LEU B  1  94   ? 23.341  25.510  142.184  1.00 54.97  ? 94   LEU B O     1 
ATOM   2506  C  CB    . LEU B  1  94   ? 21.855  27.717  143.493  1.00 52.75  ? 94   LEU B CB    1 
ATOM   2507  C  CG    . LEU B  1  94   ? 20.526  27.088  143.082  1.00 48.01  ? 94   LEU B CG    1 
ATOM   2508  C  CD1   . LEU B  1  94   ? 19.840  26.446  144.273  1.00 42.99  ? 94   LEU B CD1   1 
ATOM   2509  C  CD2   . LEU B  1  94   ? 19.644  28.153  142.458  1.00 53.21  ? 94   LEU B CD2   1 
ATOM   2510  N  N     . GLN B  1  95   ? 22.851  24.415  144.092  1.00 50.74  ? 95   GLN B N     1 
ATOM   2511  C  CA    . GLN B  1  95   ? 22.946  23.079  143.510  1.00 46.28  ? 95   GLN B CA    1 
ATOM   2512  C  C     . GLN B  1  95   ? 21.667  22.585  142.832  1.00 45.56  ? 95   GLN B C     1 
ATOM   2513  O  O     . GLN B  1  95   ? 21.724  21.977  141.765  1.00 50.09  ? 95   GLN B O     1 
ATOM   2514  C  CB    . GLN B  1  95   ? 23.414  22.068  144.560  1.00 50.25  ? 95   GLN B CB    1 
ATOM   2515  C  CG    . GLN B  1  95   ? 24.645  22.500  145.351  1.00 52.26  ? 95   GLN B CG    1 
ATOM   2516  C  CD    . GLN B  1  95   ? 25.934  22.458  144.550  1.00 57.35  ? 95   GLN B CD    1 
ATOM   2517  O  OE1   . GLN B  1  95   ? 25.932  22.184  143.350  1.00 61.24  ? 95   GLN B OE1   1 
ATOM   2518  N  NE2   . GLN B  1  95   ? 27.049  22.729  145.219  1.00 58.30  ? 95   GLN B NE2   1 
ATOM   2519  N  N     . THR B  1  96   ? 20.519  22.828  143.459  1.00 44.55  ? 96   THR B N     1 
ATOM   2520  C  CA    . THR B  1  96   ? 19.259  22.276  142.960  1.00 44.90  ? 96   THR B CA    1 
ATOM   2521  C  C     . THR B  1  96   ? 18.025  23.120  143.290  1.00 44.53  ? 96   THR B C     1 
ATOM   2522  O  O     . THR B  1  96   ? 17.975  23.793  144.317  1.00 46.24  ? 96   THR B O     1 
ATOM   2523  C  CB    . THR B  1  96   ? 19.042  20.840  143.480  1.00 44.89  ? 96   THR B CB    1 
ATOM   2524  O  OG1   . THR B  1  96   ? 17.697  20.425  143.210  1.00 43.47  ? 96   THR B OG1   1 
ATOM   2525  C  CG2   . THR B  1  96   ? 19.298  20.774  144.977  1.00 52.33  ? 96   THR B CG2   1 
ATOM   2526  N  N     . VAL B  1  97   ? 17.034  23.076  142.401  1.00 43.08  ? 97   VAL B N     1 
ATOM   2527  C  CA    . VAL B  1  97   ? 15.778  23.803  142.580  1.00 42.11  ? 97   VAL B CA    1 
ATOM   2528  C  C     . VAL B  1  97   ? 14.608  22.908  142.188  1.00 41.08  ? 97   VAL B C     1 
ATOM   2529  O  O     . VAL B  1  97   ? 14.732  22.077  141.291  1.00 39.09  ? 97   VAL B O     1 
ATOM   2530  C  CB    . VAL B  1  97   ? 15.720  25.076  141.701  1.00 40.52  ? 97   VAL B CB    1 
ATOM   2531  C  CG1   . VAL B  1  97   ? 14.533  25.945  142.088  1.00 40.44  ? 97   VAL B CG1   1 
ATOM   2532  C  CG2   . VAL B  1  97   ? 17.002  25.872  141.816  1.00 43.95  ? 97   VAL B CG2   1 
ATOM   2533  N  N     . THR B  1  98   ? 13.473  23.075  142.861  1.00 45.46  ? 98   THR B N     1 
ATOM   2534  C  CA    . THR B  1  98   ? 12.250  22.385  142.469  1.00 47.88  ? 98   THR B CA    1 
ATOM   2535  C  C     . THR B  1  98   ? 11.238  23.381  141.911  1.00 43.83  ? 98   THR B C     1 
ATOM   2536  O  O     . THR B  1  98   ? 10.734  24.239  142.635  1.00 45.36  ? 98   THR B O     1 
ATOM   2537  C  CB    . THR B  1  98   ? 11.617  21.619  143.646  1.00 54.05  ? 98   THR B CB    1 
ATOM   2538  O  OG1   . THR B  1  98   ? 12.540  20.636  144.134  1.00 57.12  ? 98   THR B OG1   1 
ATOM   2539  C  CG2   . THR B  1  98   ? 10.336  20.927  143.201  1.00 51.44  ? 98   THR B CG2   1 
ATOM   2540  N  N     . LEU B  1  99   ? 10.950  23.267  140.618  1.00 42.02  ? 99   LEU B N     1 
ATOM   2541  C  CA    . LEU B  1  99   ? 9.999   24.161  139.966  1.00 45.99  ? 99   LEU B CA    1 
ATOM   2542  C  C     . LEU B  1  99   ? 8.592   23.573  139.972  1.00 49.06  ? 99   LEU B C     1 
ATOM   2543  O  O     . LEU B  1  99   ? 8.404   22.387  139.706  1.00 47.24  ? 99   LEU B O     1 
ATOM   2544  C  CB    . LEU B  1  99   ? 10.431  24.455  138.526  1.00 47.29  ? 99   LEU B CB    1 
ATOM   2545  C  CG    . LEU B  1  99   ? 11.402  25.608  138.263  1.00 41.50  ? 99   LEU B CG    1 
ATOM   2546  C  CD1   . LEU B  1  99   ? 12.752  25.369  138.920  1.00 39.75  ? 99   LEU B CD1   1 
ATOM   2547  C  CD2   . LEU B  1  99   ? 11.563  25.821  136.764  1.00 40.55  ? 99   LEU B CD2   1 
ATOM   2548  N  N     . LEU B  1  100  ? 7.604   24.410  140.274  1.00 51.86  ? 100  LEU B N     1 
ATOM   2549  C  CA    . LEU B  1  100  ? 6.213   23.975  140.291  1.00 51.27  ? 100  LEU B CA    1 
ATOM   2550  C  C     . LEU B  1  100  ? 5.434   24.596  139.139  1.00 53.02  ? 100  LEU B C     1 
ATOM   2551  O  O     . LEU B  1  100  ? 5.571   25.786  138.855  1.00 55.16  ? 100  LEU B O     1 
ATOM   2552  C  CB    . LEU B  1  100  ? 5.538   24.345  141.617  1.00 53.82  ? 100  LEU B CB    1 
ATOM   2553  C  CG    . LEU B  1  100  ? 6.100   23.781  142.925  1.00 52.60  ? 100  LEU B CG    1 
ATOM   2554  C  CD1   . LEU B  1  100  ? 7.192   24.681  143.490  1.00 51.87  ? 100  LEU B CD1   1 
ATOM   2555  C  CD2   . LEU B  1  100  ? 4.984   23.581  143.940  1.00 51.52  ? 100  LEU B CD2   1 
ATOM   2556  N  N     . LEU B  1  101  ? 4.615   23.785  138.478  1.00 52.37  ? 101  LEU B N     1 
ATOM   2557  C  CA    . LEU B  1  101  ? 3.739   24.285  137.428  1.00 57.03  ? 101  LEU B CA    1 
ATOM   2558  C  C     . LEU B  1  101  ? 2.302   23.828  137.653  1.00 59.17  ? 101  LEU B C     1 
ATOM   2559  O  O     . LEU B  1  101  ? 2.015   22.627  137.709  1.00 57.81  ? 101  LEU B O     1 
ATOM   2560  C  CB    . LEU B  1  101  ? 4.230   23.852  136.044  1.00 59.54  ? 101  LEU B CB    1 
ATOM   2561  C  CG    . LEU B  1  101  ? 3.523   24.502  134.850  1.00 59.77  ? 101  LEU B CG    1 
ATOM   2562  C  CD1   . LEU B  1  101  ? 4.522   24.830  133.755  1.00 59.88  ? 101  LEU B CD1   1 
ATOM   2563  C  CD2   . LEU B  1  101  ? 2.411   23.611  134.305  1.00 60.52  ? 101  LEU B CD2   1 
ATOM   2564  N  N     . LYS B  1  102  ? 1.406   24.801  137.782  1.00 62.17  ? 102  LYS B N     1 
ATOM   2565  C  CA    . LYS B  1  102  ? -0.017  24.530  137.937  1.00 65.24  ? 102  LYS B CA    1 
ATOM   2566  C  C     . LYS B  1  102  ? -0.830  25.296  136.907  1.00 63.15  ? 102  LYS B C     1 
ATOM   2567  O  O     . LYS B  1  102  ? -0.839  26.528  136.893  1.00 61.10  ? 102  LYS B O     1 
ATOM   2568  C  CB    . LYS B  1  102  ? -0.485  24.883  139.350  1.00 67.93  ? 102  LYS B CB    1 
ATOM   2569  C  CG    . LYS B  1  102  ? -0.103  23.845  140.384  1.00 67.39  ? 102  LYS B CG    1 
ATOM   2570  C  CD    . LYS B  1  102  ? 0.048   24.455  141.761  1.00 65.64  ? 102  LYS B CD    1 
ATOM   2571  C  CE    . LYS B  1  102  ? 1.272   23.883  142.454  1.00 64.07  ? 102  LYS B CE    1 
ATOM   2572  N  NZ    . LYS B  1  102  ? 1.524   24.526  143.769  1.00 57.38  ? 102  LYS B NZ    1 
ATOM   2573  N  N     . ALA B  1  103  ? -1.508  24.554  136.039  1.00 63.43  ? 103  ALA B N     1 
ATOM   2574  C  CA    . ALA B  1  103  ? -2.346  25.158  135.014  1.00 62.70  ? 103  ALA B CA    1 
ATOM   2575  C  C     . ALA B  1  103  ? -3.518  24.242  134.705  1.00 66.31  ? 103  ALA B C     1 
ATOM   2576  O  O     . ALA B  1  103  ? -3.495  23.063  135.047  1.00 66.02  ? 103  ALA B O     1 
ATOM   2577  C  CB    . ALA B  1  103  ? -1.535  25.431  133.759  1.00 58.27  ? 103  ALA B CB    1 
ATOM   2578  N  N     . GLU B  1  104  ? -4.548  24.789  134.068  1.00 67.87  ? 104  GLU B N     1 
ATOM   2579  C  CA    . GLU B  1  104  ? -5.711  23.997  133.685  1.00 73.88  ? 104  GLU B CA    1 
ATOM   2580  C  C     . GLU B  1  104  ? -6.526  24.693  132.603  1.00 70.93  ? 104  GLU B C     1 
ATOM   2581  O  O     . GLU B  1  104  ? -6.135  25.744  132.096  1.00 67.18  ? 104  GLU B O     1 
ATOM   2582  C  CB    . GLU B  1  104  ? -6.590  23.694  134.903  1.00 80.96  ? 104  GLU B CB    1 
ATOM   2583  C  CG    . GLU B  1  104  ? -7.108  24.925  135.629  1.00 83.04  ? 104  GLU B CG    1 
ATOM   2584  C  CD    . GLU B  1  104  ? -7.965  24.574  136.830  1.00 82.25  ? 104  GLU B CD    1 
ATOM   2585  O  OE1   . GLU B  1  104  ? -8.481  25.504  137.483  1.00 89.21  ? 104  GLU B OE1   1 
ATOM   2586  O  OE2   . GLU B  1  104  ? -8.123  23.368  137.120  1.00 77.37  ? 104  GLU B OE2   1 
ATOM   2587  N  N     . GLY B  1  105  ? -7.661  24.096  132.255  1.00 71.64  ? 105  GLY B N     1 
ATOM   2588  C  CA    . GLY B  1  105  ? -8.521  24.641  131.222  1.00 70.84  ? 105  GLY B CA    1 
ATOM   2589  C  C     . GLY B  1  105  ? -7.899  24.515  129.846  1.00 75.61  ? 105  GLY B C     1 
ATOM   2590  O  O     . GLY B  1  105  ? -6.874  23.854  129.683  1.00 79.76  ? 105  GLY B O     1 
ATOM   2591  N  N     . PRO B  1  106  ? -8.516  25.157  128.844  1.00 76.24  ? 106  PRO B N     1 
ATOM   2592  C  CA    . PRO B  1  106  ? -8.058  25.122  127.453  1.00 78.87  ? 106  PRO B CA    1 
ATOM   2593  C  C     . PRO B  1  106  ? -6.950  26.137  127.186  1.00 79.18  ? 106  PRO B C     1 
ATOM   2594  O  O     . PRO B  1  106  ? -7.226  27.229  126.690  1.00 79.52  ? 106  PRO B O     1 
ATOM   2595  C  CB    . PRO B  1  106  ? -9.318  25.482  126.660  1.00 78.08  ? 106  PRO B CB    1 
ATOM   2596  C  CG    . PRO B  1  106  ? -10.237 26.179  127.643  1.00 79.26  ? 106  PRO B CG    1 
ATOM   2597  C  CD    . PRO B  1  106  ? -9.657  26.069  129.025  1.00 76.56  ? 106  PRO B CD    1 
ATOM   2598  N  N     . LYS B  1  107  ? -5.712  25.777  127.511  1.00 75.72  ? 107  LYS B N     1 
ATOM   2599  C  CA    . LYS B  1  107  ? -4.591  26.702  127.370  1.00 71.26  ? 107  LYS B CA    1 
ATOM   2600  C  C     . LYS B  1  107  ? -3.319  25.979  126.939  1.00 69.82  ? 107  LYS B C     1 
ATOM   2601  O  O     . LYS B  1  107  ? -3.123  24.807  127.258  1.00 67.46  ? 107  LYS B O     1 
ATOM   2602  C  CB    . LYS B  1  107  ? -4.354  27.442  128.691  1.00 69.55  ? 107  LYS B CB    1 
ATOM   2603  C  CG    . LYS B  1  107  ? -3.341  28.577  128.618  1.00 69.63  ? 107  LYS B CG    1 
ATOM   2604  C  CD    . LYS B  1  107  ? -3.198  29.279  129.960  1.00 69.19  ? 107  LYS B CD    1 
ATOM   2605  C  CE    . LYS B  1  107  ? -2.213  30.433  129.878  1.00 67.00  ? 107  LYS B CE    1 
ATOM   2606  N  NZ    . LYS B  1  107  ? -2.097  31.139  131.181  1.00 62.87  ? 107  LYS B NZ    1 
ATOM   2607  N  N     . GLU B  1  108  ? -2.460  26.681  126.206  1.00 67.41  ? 108  GLU B N     1 
ATOM   2608  C  CA    . GLU B  1  108  ? -1.171  26.128  125.815  1.00 64.23  ? 108  GLU B CA    1 
ATOM   2609  C  C     . GLU B  1  108  ? -0.117  26.544  126.831  1.00 63.86  ? 108  GLU B C     1 
ATOM   2610  O  O     . GLU B  1  108  ? 0.248   27.716  126.926  1.00 64.95  ? 108  GLU B O     1 
ATOM   2611  C  CB    . GLU B  1  108  ? -0.775  26.594  124.413  1.00 68.73  ? 108  GLU B CB    1 
ATOM   2612  C  CG    . GLU B  1  108  ? -1.741  26.168  123.315  1.00 73.83  ? 108  GLU B CG    1 
ATOM   2613  C  CD    . GLU B  1  108  ? -1.233  26.505  121.925  1.00 74.48  ? 108  GLU B CD    1 
ATOM   2614  O  OE1   . GLU B  1  108  ? -0.242  27.259  121.820  1.00 74.13  ? 108  GLU B OE1   1 
ATOM   2615  O  OE2   . GLU B  1  108  ? -1.823  26.014  120.939  1.00 69.70  ? 108  GLU B OE2   1 
ATOM   2616  N  N     . VAL B  1  109  ? 0.370   25.562  127.581  1.00 63.04  ? 109  VAL B N     1 
ATOM   2617  C  CA    . VAL B  1  109  ? 1.336   25.788  128.646  1.00 59.91  ? 109  VAL B CA    1 
ATOM   2618  C  C     . VAL B  1  109  ? 2.773   25.796  128.136  1.00 55.27  ? 109  VAL B C     1 
ATOM   2619  O  O     . VAL B  1  109  ? 3.289   24.780  127.639  1.00 55.29  ? 109  VAL B O     1 
ATOM   2620  C  CB    . VAL B  1  109  ? 1.212   24.720  129.748  1.00 57.36  ? 109  VAL B CB    1 
ATOM   2621  C  CG1   . VAL B  1  109  ? 2.236   24.970  130.838  1.00 57.63  ? 109  VAL B CG1   1 
ATOM   2622  C  CG2   . VAL B  1  109  ? -0.194  24.710  130.329  1.00 63.38  ? 109  VAL B CG2   1 
ATOM   2623  N  N     . LYS B  1  110  ? 3.402   26.960  128.288  1.00 52.40  ? 110  LYS B N     1 
ATOM   2624  C  CA    . LYS B  1  110  ? 4.797   27.183  127.940  1.00 50.30  ? 110  LYS B CA    1 
ATOM   2625  C  C     . LYS B  1  110  ? 5.679   27.077  129.180  1.00 50.76  ? 110  LYS B C     1 
ATOM   2626  O  O     . LYS B  1  110  ? 5.219   26.676  130.248  1.00 51.57  ? 110  LYS B O     1 
ATOM   2627  C  CB    . LYS B  1  110  ? 4.966   28.563  127.301  1.00 51.89  ? 110  LYS B CB    1 
ATOM   2628  C  CG    . LYS B  1  110  ? 4.152   28.769  126.032  1.00 56.09  ? 110  LYS B CG    1 
ATOM   2629  C  CD    . LYS B  1  110  ? 4.639   27.866  124.910  1.00 56.84  ? 110  LYS B CD    1 
ATOM   2630  C  CE    . LYS B  1  110  ? 3.851   28.091  123.628  1.00 60.35  ? 110  LYS B CE    1 
ATOM   2631  N  NZ    . LYS B  1  110  ? 2.406   27.771  123.793  1.00 61.42  ? 110  LYS B NZ    1 
ATOM   2632  N  N     . ALA B  1  111  ? 6.949   27.437  129.028  1.00 53.72  ? 111  ALA B N     1 
ATOM   2633  C  CA    . ALA B  1  111  ? 7.900   27.401  130.135  1.00 57.27  ? 111  ALA B CA    1 
ATOM   2634  C  C     . ALA B  1  111  ? 7.789   28.630  131.034  1.00 60.08  ? 111  ALA B C     1 
ATOM   2635  O  O     . ALA B  1  111  ? 8.331   28.652  132.138  1.00 60.67  ? 111  ALA B O     1 
ATOM   2636  C  CB    . ALA B  1  111  ? 9.322   27.257  129.608  1.00 52.68  ? 111  ALA B CB    1 
ATOM   2637  N  N     . ARG B  1  112  ? 7.084   29.650  130.558  1.00 59.42  ? 112  ARG B N     1 
ATOM   2638  C  CA    . ARG B  1  112  ? 6.916   30.883  131.316  1.00 58.68  ? 112  ARG B CA    1 
ATOM   2639  C  C     . ARG B  1  112  ? 5.950   30.674  132.477  1.00 56.84  ? 112  ARG B C     1 
ATOM   2640  O  O     . ARG B  1  112  ? 5.973   31.413  133.462  1.00 54.08  ? 112  ARG B O     1 
ATOM   2641  C  CB    . ARG B  1  112  ? 6.394   31.993  130.405  1.00 59.75  ? 112  ARG B CB    1 
ATOM   2642  C  CG    . ARG B  1  112  ? 7.096   33.329  130.575  1.00 59.75  ? 112  ARG B CG    1 
ATOM   2643  C  CD    . ARG B  1  112  ? 6.407   34.404  129.752  1.00 64.83  ? 112  ARG B CD    1 
ATOM   2644  N  NE    . ARG B  1  112  ? 5.840   33.859  128.521  1.00 67.72  ? 112  ARG B NE    1 
ATOM   2645  C  CZ    . ARG B  1  112  ? 6.493   33.775  127.367  1.00 65.65  ? 112  ARG B CZ    1 
ATOM   2646  N  NH1   . ARG B  1  112  ? 7.745   34.204  127.278  1.00 63.14  ? 112  ARG B NH1   1 
ATOM   2647  N  NH2   . ARG B  1  112  ? 5.893   33.263  126.300  1.00 60.49  ? 112  ARG B NH2   1 
ATOM   2648  N  N     . ASP B  1  113  ? 5.106   29.654  132.354  1.00 59.28  ? 113  ASP B N     1 
ATOM   2649  C  CA    . ASP B  1  113  ? 4.047   29.393  133.325  1.00 64.03  ? 113  ASP B CA    1 
ATOM   2650  C  C     . ASP B  1  113  ? 4.565   28.815  134.642  1.00 62.74  ? 113  ASP B C     1 
ATOM   2651  O  O     . ASP B  1  113  ? 3.810   28.676  135.605  1.00 59.02  ? 113  ASP B O     1 
ATOM   2652  C  CB    . ASP B  1  113  ? 2.993   28.466  132.716  1.00 65.08  ? 113  ASP B CB    1 
ATOM   2653  C  CG    . ASP B  1  113  ? 2.382   29.035  131.447  1.00 68.80  ? 113  ASP B CG    1 
ATOM   2654  O  OD1   . ASP B  1  113  ? 1.248   29.556  131.511  1.00 70.95  ? 113  ASP B OD1   1 
ATOM   2655  O  OD2   . ASP B  1  113  ? 3.041   28.968  130.387  1.00 67.14  ? 113  ASP B OD2   1 
ATOM   2656  N  N     . PHE B  1  114  ? 5.850   28.473  134.677  1.00 64.77  ? 114  PHE B N     1 
ATOM   2657  C  CA    . PHE B  1  114  ? 6.481   28.006  135.905  1.00 60.55  ? 114  PHE B CA    1 
ATOM   2658  C  C     . PHE B  1  114  ? 6.578   29.147  136.907  1.00 58.59  ? 114  PHE B C     1 
ATOM   2659  O  O     . PHE B  1  114  ? 6.945   30.265  136.547  1.00 61.75  ? 114  PHE B O     1 
ATOM   2660  C  CB    . PHE B  1  114  ? 7.878   27.447  135.622  1.00 60.65  ? 114  PHE B CB    1 
ATOM   2661  C  CG    . PHE B  1  114  ? 7.873   26.074  135.011  1.00 62.10  ? 114  PHE B CG    1 
ATOM   2662  C  CD1   . PHE B  1  114  ? 7.726   24.949  135.807  1.00 57.77  ? 114  PHE B CD1   1 
ATOM   2663  C  CD2   . PHE B  1  114  ? 8.023   25.907  133.644  1.00 62.35  ? 114  PHE B CD2   1 
ATOM   2664  C  CE1   . PHE B  1  114  ? 7.723   23.684  135.250  1.00 55.97  ? 114  PHE B CE1   1 
ATOM   2665  C  CE2   . PHE B  1  114  ? 8.022   24.643  133.082  1.00 61.17  ? 114  PHE B CE2   1 
ATOM   2666  C  CZ    . PHE B  1  114  ? 7.871   23.530  133.886  1.00 59.10  ? 114  PHE B CZ    1 
ATOM   2667  N  N     . LEU B  1  115  ? 6.242   28.864  138.162  1.00 58.41  ? 115  LEU B N     1 
ATOM   2668  C  CA    . LEU B  1  115  ? 6.327   29.867  139.218  1.00 60.73  ? 115  LEU B CA    1 
ATOM   2669  C  C     . LEU B  1  115  ? 7.771   30.314  139.423  1.00 53.91  ? 115  LEU B C     1 
ATOM   2670  O  O     . LEU B  1  115  ? 8.648   29.489  139.679  1.00 55.03  ? 115  LEU B O     1 
ATOM   2671  C  CB    . LEU B  1  115  ? 5.741   29.328  140.524  1.00 65.87  ? 115  LEU B CB    1 
ATOM   2672  C  CG    . LEU B  1  115  ? 4.236   29.052  140.516  1.00 67.05  ? 115  LEU B CG    1 
ATOM   2673  C  CD1   . LEU B  1  115  ? 3.774   28.527  141.869  1.00 67.17  ? 115  LEU B CD1   1 
ATOM   2674  C  CD2   . LEU B  1  115  ? 3.465   30.306  140.129  1.00 62.23  ? 115  LEU B CD2   1 
ATOM   2675  N  N     . PRO B  1  116  ? 8.017   31.628  139.303  1.00 48.48  ? 116  PRO B N     1 
ATOM   2676  C  CA    . PRO B  1  116  ? 9.356   32.223  139.381  1.00 52.24  ? 116  PRO B CA    1 
ATOM   2677  C  C     . PRO B  1  116  ? 10.092  31.857  140.666  1.00 48.94  ? 116  PRO B C     1 
ATOM   2678  O  O     . PRO B  1  116  ? 9.482   31.801  141.734  1.00 45.98  ? 116  PRO B O     1 
ATOM   2679  C  CB    . PRO B  1  116  ? 9.069   33.727  139.347  1.00 54.37  ? 116  PRO B CB    1 
ATOM   2680  C  CG    . PRO B  1  116  ? 7.772   33.842  138.627  1.00 49.03  ? 116  PRO B CG    1 
ATOM   2681  C  CD    . PRO B  1  116  ? 6.979   32.643  139.054  1.00 47.84  ? 116  PRO B CD    1 
ATOM   2682  N  N     . VAL B  1  117  ? 11.392  31.606  140.551  1.00 49.04  ? 117  VAL B N     1 
ATOM   2683  C  CA    . VAL B  1  117  ? 12.214  31.242  141.699  1.00 50.26  ? 117  VAL B CA    1 
ATOM   2684  C  C     . VAL B  1  117  ? 13.394  32.203  141.820  1.00 50.55  ? 117  VAL B C     1 
ATOM   2685  O  O     . VAL B  1  117  ? 13.903  32.700  140.815  1.00 47.53  ? 117  VAL B O     1 
ATOM   2686  C  CB    . VAL B  1  117  ? 12.740  29.795  141.576  1.00 47.49  ? 117  VAL B CB    1 
ATOM   2687  C  CG1   . VAL B  1  117  ? 13.396  29.349  142.874  1.00 47.51  ? 117  VAL B CG1   1 
ATOM   2688  C  CG2   . VAL B  1  117  ? 11.610  28.848  141.204  1.00 48.72  ? 117  VAL B CG2   1 
ATOM   2689  N  N     . ALA B  1  118  ? 13.817  32.469  143.053  1.00 51.53  ? 118  ALA B N     1 
ATOM   2690  C  CA    . ALA B  1  118  ? 14.943  33.360  143.307  1.00 58.45  ? 118  ALA B CA    1 
ATOM   2691  C  C     . ALA B  1  118  ? 16.234  32.815  142.706  1.00 56.46  ? 118  ALA B C     1 
ATOM   2692  O  O     . ALA B  1  118  ? 16.558  31.639  142.877  1.00 56.20  ? 118  ALA B O     1 
ATOM   2693  C  CB    . ALA B  1  118  ? 15.109  33.591  144.802  1.00 64.21  ? 118  ALA B CB    1 
ATOM   2694  N  N     . ASP B  1  119  ? 16.957  33.681  142.000  1.00 58.03  ? 119  ASP B N     1 
ATOM   2695  C  CA    . ASP B  1  119  ? 18.225  33.331  141.358  1.00 62.93  ? 119  ASP B CA    1 
ATOM   2696  C  C     . ASP B  1  119  ? 18.101  32.182  140.355  1.00 58.91  ? 119  ASP B C     1 
ATOM   2697  O  O     . ASP B  1  119  ? 19.061  31.447  140.118  1.00 57.55  ? 119  ASP B O     1 
ATOM   2698  C  CB    . ASP B  1  119  ? 19.303  33.019  142.402  1.00 66.92  ? 119  ASP B CB    1 
ATOM   2699  C  CG    . ASP B  1  119  ? 19.642  34.218  143.268  1.00 67.76  ? 119  ASP B CG    1 
ATOM   2700  O  OD1   . ASP B  1  119  ? 19.505  35.362  142.784  1.00 61.78  ? 119  ASP B OD1   1 
ATOM   2701  O  OD2   . ASP B  1  119  ? 20.048  34.016  144.432  1.00 69.53  ? 119  ASP B OD2   1 
ATOM   2702  N  N     . VAL B  1  120  ? 16.918  32.037  139.767  1.00 55.89  ? 120  VAL B N     1 
ATOM   2703  C  CA    . VAL B  1  120  ? 16.685  31.021  138.747  1.00 53.49  ? 120  VAL B CA    1 
ATOM   2704  C  C     . VAL B  1  120  ? 16.103  31.659  137.494  1.00 56.60  ? 120  VAL B C     1 
ATOM   2705  O  O     . VAL B  1  120  ? 15.015  32.235  137.528  1.00 60.80  ? 120  VAL B O     1 
ATOM   2706  C  CB    . VAL B  1  120  ? 15.726  29.922  139.242  1.00 52.72  ? 120  VAL B CB    1 
ATOM   2707  C  CG1   . VAL B  1  120  ? 15.429  28.936  138.124  1.00 49.94  ? 120  VAL B CG1   1 
ATOM   2708  C  CG2   . VAL B  1  120  ? 16.314  29.207  140.446  1.00 54.30  ? 120  VAL B CG2   1 
ATOM   2709  N  N     . GLU B  1  121  ? 16.831  31.556  136.388  1.00 57.04  ? 121  GLU B N     1 
ATOM   2710  C  CA    . GLU B  1  121  ? 16.408  32.177  135.139  1.00 57.87  ? 121  GLU B CA    1 
ATOM   2711  C  C     . GLU B  1  121  ? 16.015  31.132  134.105  1.00 52.68  ? 121  GLU B C     1 
ATOM   2712  O  O     . GLU B  1  121  ? 16.710  30.136  133.924  1.00 52.39  ? 121  GLU B O     1 
ATOM   2713  C  CB    . GLU B  1  121  ? 17.526  33.062  134.584  1.00 59.00  ? 121  GLU B CB    1 
ATOM   2714  C  CG    . GLU B  1  121  ? 17.186  33.768  133.283  1.00 62.30  ? 121  GLU B CG    1 
ATOM   2715  C  CD    . GLU B  1  121  ? 18.342  34.595  132.754  1.00 75.40  ? 121  GLU B CD    1 
ATOM   2716  O  OE1   . GLU B  1  121  ? 18.193  35.211  131.678  1.00 76.75  ? 121  GLU B OE1   1 
ATOM   2717  O  OE2   . GLU B  1  121  ? 19.402  34.627  133.417  1.00 79.55  ? 121  GLU B OE2   1 
ATOM   2718  N  N     . ILE B  1  122  ? 14.893  31.359  133.431  1.00 49.00  ? 122  ILE B N     1 
ATOM   2719  C  CA    . ILE B  1  122  ? 14.492  30.499  132.327  1.00 48.80  ? 122  ILE B CA    1 
ATOM   2720  C  C     . ILE B  1  122  ? 14.904  31.138  131.004  1.00 49.48  ? 122  ILE B C     1 
ATOM   2721  O  O     . ILE B  1  122  ? 14.370  32.175  130.610  1.00 51.29  ? 122  ILE B O     1 
ATOM   2722  C  CB    . ILE B  1  122  ? 12.979  30.217  132.348  1.00 49.10  ? 122  ILE B CB    1 
ATOM   2723  C  CG1   . ILE B  1  122  ? 12.602  29.471  133.630  1.00 46.66  ? 122  ILE B CG1   1 
ATOM   2724  C  CG2   . ILE B  1  122  ? 12.568  29.415  131.123  1.00 48.98  ? 122  ILE B CG2   1 
ATOM   2725  C  CD1   . ILE B  1  122  ? 11.135  29.119  133.732  1.00 47.79  ? 122  ILE B CD1   1 
ATOM   2726  N  N     . MET B  1  123  ? 15.861  30.511  130.326  1.00 47.83  ? 123  MET B N     1 
ATOM   2727  C  CA    . MET B  1  123  ? 16.452  31.076  129.117  1.00 46.40  ? 123  MET B CA    1 
ATOM   2728  C  C     . MET B  1  123  ? 15.488  31.077  127.936  1.00 44.38  ? 123  MET B C     1 
ATOM   2729  O  O     . MET B  1  123  ? 15.517  31.981  127.102  1.00 45.71  ? 123  MET B O     1 
ATOM   2730  C  CB    . MET B  1  123  ? 17.732  30.322  128.747  1.00 45.43  ? 123  MET B CB    1 
ATOM   2731  C  CG    . MET B  1  123  ? 18.842  30.439  129.779  1.00 45.63  ? 123  MET B CG    1 
ATOM   2732  S  SD    . MET B  1  123  ? 19.365  32.145  130.035  1.00 54.88  ? 123  MET B SD    1 
ATOM   2733  C  CE    . MET B  1  123  ? 19.846  32.604  128.372  1.00 52.12  ? 123  MET B CE    1 
ATOM   2734  N  N     . ASN B  1  124  ? 14.636  30.060  127.869  1.00 41.07  ? 124  ASN B N     1 
ATOM   2735  C  CA    . ASN B  1  124  ? 13.668  29.947  126.785  1.00 42.93  ? 124  ASN B CA    1 
ATOM   2736  C  C     . ASN B  1  124  ? 12.240  29.806  127.300  1.00 49.90  ? 124  ASN B C     1 
ATOM   2737  O  O     . ASN B  1  124  ? 11.657  28.724  127.238  1.00 54.81  ? 124  ASN B O     1 
ATOM   2738  C  CB    . ASN B  1  124  ? 14.021  28.769  125.875  1.00 45.70  ? 124  ASN B CB    1 
ATOM   2739  C  CG    . ASN B  1  124  ? 14.291  27.492  126.651  1.00 46.69  ? 124  ASN B CG    1 
ATOM   2740  O  OD1   . ASN B  1  124  ? 14.816  27.529  127.764  1.00 46.21  ? 124  ASN B OD1   1 
ATOM   2741  N  ND2   . ASN B  1  124  ? 13.928  26.355  126.068  1.00 44.91  ? 124  ASN B ND2   1 
ATOM   2742  N  N     . PRO B  1  125  ? 11.664  30.908  127.803  1.00 49.15  ? 125  PRO B N     1 
ATOM   2743  C  CA    . PRO B  1  125  ? 10.318  30.874  128.384  1.00 51.75  ? 125  PRO B CA    1 
ATOM   2744  C  C     . PRO B  1  125  ? 9.249   30.577  127.337  1.00 56.11  ? 125  PRO B C     1 
ATOM   2745  O  O     . PRO B  1  125  ? 8.139   30.178  127.689  1.00 56.88  ? 125  PRO B O     1 
ATOM   2746  C  CB    . PRO B  1  125  ? 10.142  32.293  128.928  1.00 52.49  ? 125  PRO B CB    1 
ATOM   2747  C  CG    . PRO B  1  125  ? 11.022  33.130  128.069  1.00 50.46  ? 125  PRO B CG    1 
ATOM   2748  C  CD    . PRO B  1  125  ? 12.217  32.274  127.772  1.00 47.33  ? 125  PRO B CD    1 
ATOM   2749  N  N     . ASP B  1  126  ? 9.589   30.765  126.065  1.00 55.82  ? 126  ASP B N     1 
ATOM   2750  C  CA    . ASP B  1  126  ? 8.646   30.541  124.977  1.00 55.76  ? 126  ASP B CA    1 
ATOM   2751  C  C     . ASP B  1  126  ? 8.585   29.072  124.572  1.00 52.35  ? 126  ASP B C     1 
ATOM   2752  O  O     . ASP B  1  126  ? 7.805   28.695  123.697  1.00 53.94  ? 126  ASP B O     1 
ATOM   2753  C  CB    . ASP B  1  126  ? 9.005   31.405  123.765  1.00 59.46  ? 126  ASP B CB    1 
ATOM   2754  C  CG    . ASP B  1  126  ? 8.831   32.888  124.034  1.00 68.32  ? 126  ASP B CG    1 
ATOM   2755  O  OD1   . ASP B  1  126  ? 8.445   33.622  123.099  1.00 71.60  ? 126  ASP B OD1   1 
ATOM   2756  O  OD2   . ASP B  1  126  ? 9.081   33.321  125.179  1.00 68.53  ? 126  ASP B OD2   1 
ATOM   2757  N  N     . LEU B  1  127  ? 9.410   28.247  125.210  1.00 46.35  ? 127  LEU B N     1 
ATOM   2758  C  CA    . LEU B  1  127  ? 9.422   26.816  124.933  1.00 45.88  ? 127  LEU B CA    1 
ATOM   2759  C  C     . LEU B  1  127  ? 8.087   26.178  125.293  1.00 46.92  ? 127  LEU B C     1 
ATOM   2760  O  O     . LEU B  1  127  ? 7.545   26.416  126.370  1.00 50.78  ? 127  LEU B O     1 
ATOM   2761  C  CB    . LEU B  1  127  ? 10.550  26.125  125.702  1.00 44.76  ? 127  LEU B CB    1 
ATOM   2762  C  CG    . LEU B  1  127  ? 10.534  24.594  125.669  1.00 46.94  ? 127  LEU B CG    1 
ATOM   2763  C  CD1   . LEU B  1  127  ? 10.760  24.068  124.257  1.00 45.76  ? 127  LEU B CD1   1 
ATOM   2764  C  CD2   . LEU B  1  127  ? 11.562  24.025  126.628  1.00 42.72  ? 127  LEU B CD2   1 
ATOM   2765  N  N     . HIS B  1  128  ? 7.560   25.367  124.382  1.00 46.58  ? 128  HIS B N     1 
ATOM   2766  C  CA    . HIS B  1  128  ? 6.295   24.683  124.610  1.00 49.22  ? 128  HIS B CA    1 
ATOM   2767  C  C     . HIS B  1  128  ? 6.464   23.506  125.566  1.00 49.32  ? 128  HIS B C     1 
ATOM   2768  O  O     . HIS B  1  128  ? 7.411   22.728  125.449  1.00 48.37  ? 128  HIS B O     1 
ATOM   2769  C  CB    . HIS B  1  128  ? 5.702   24.205  123.283  1.00 55.22  ? 128  HIS B CB    1 
ATOM   2770  C  CG    . HIS B  1  128  ? 4.398   23.484  123.427  1.00 56.66  ? 128  HIS B CG    1 
ATOM   2771  N  ND1   . HIS B  1  128  ? 3.212   24.135  123.687  1.00 56.73  ? 128  HIS B ND1   1 
ATOM   2772  C  CD2   . HIS B  1  128  ? 4.094   22.166  123.348  1.00 55.60  ? 128  HIS B CD2   1 
ATOM   2773  C  CE1   . HIS B  1  128  ? 2.233   23.251  123.761  1.00 57.67  ? 128  HIS B CE1   1 
ATOM   2774  N  NE2   . HIS B  1  128  ? 2.742   22.049  123.559  1.00 54.34  ? 128  HIS B NE2   1 
ATOM   2775  N  N     . ILE B  1  129  ? 5.541   23.388  126.515  1.00 50.50  ? 129  ILE B N     1 
ATOM   2776  C  CA    . ILE B  1  129  ? 5.522   22.258  127.439  1.00 49.29  ? 129  ILE B CA    1 
ATOM   2777  C  C     . ILE B  1  129  ? 4.358   21.326  127.105  1.00 51.19  ? 129  ILE B C     1 
ATOM   2778  O  O     . ILE B  1  129  ? 4.572   20.160  126.776  1.00 51.30  ? 129  ILE B O     1 
ATOM   2779  C  CB    . ILE B  1  129  ? 5.493   22.690  128.929  1.00 49.53  ? 129  ILE B CB    1 
ATOM   2780  C  CG1   . ILE B  1  129  ? 6.912   22.930  129.451  1.00 49.09  ? 129  ILE B CG1   1 
ATOM   2781  C  CG2   . ILE B  1  129  ? 4.867   21.608  129.794  1.00 51.65  ? 129  ILE B CG2   1 
ATOM   2782  C  CD1   . ILE B  1  129  ? 7.653   24.063  128.784  1.00 50.72  ? 129  ILE B CD1   1 
ATOM   2783  N  N     . ALA B  1  130  ? 3.128   21.828  127.187  1.00 54.81  ? 130  ALA B N     1 
ATOM   2784  C  CA    . ALA B  1  130  ? 1.979   20.973  126.882  1.00 56.18  ? 130  ALA B CA    1 
ATOM   2785  C  C     . ALA B  1  130  ? 0.784   21.744  126.330  1.00 59.66  ? 130  ALA B C     1 
ATOM   2786  O  O     . ALA B  1  130  ? 0.657   22.938  126.554  1.00 60.42  ? 130  ALA B O     1 
ATOM   2787  C  CB    . ALA B  1  130  ? 1.573   20.172  128.115  1.00 54.15  ? 130  ALA B CB    1 
ATOM   2788  N  N     . THR B  1  131  ? -0.088  21.059  125.597  1.00 58.09  ? 131  THR B N     1 
ATOM   2789  C  CA    . THR B  1  131  ? -1.327  21.673  125.128  1.00 60.55  ? 131  THR B CA    1 
ATOM   2790  C  C     . THR B  1  131  ? -2.523  21.115  125.893  1.00 66.15  ? 131  THR B C     1 
ATOM   2791  O  O     . THR B  1  131  ? -2.838  19.929  125.790  1.00 63.18  ? 131  THR B O     1 
ATOM   2792  C  CB    . THR B  1  131  ? -1.545  21.470  123.613  1.00 61.40  ? 131  THR B CB    1 
ATOM   2793  O  OG1   . THR B  1  131  ? -0.873  20.282  123.185  1.00 64.37  ? 131  THR B OG1   1 
ATOM   2794  C  CG2   . THR B  1  131  ? -1.003  22.654  122.830  1.00 58.41  ? 131  THR B CG2   1 
ATOM   2795  N  N     . LEU B  1  132  ? -3.184  21.975  126.663  1.00 71.37  ? 132  LEU B N     1 
ATOM   2796  C  CA    . LEU B  1  132  ? -4.313  21.557  127.489  1.00 70.18  ? 132  LEU B CA    1 
ATOM   2797  C  C     . LEU B  1  132  ? -5.661  21.927  126.874  1.00 69.05  ? 132  LEU B C     1 
ATOM   2798  O  O     . LEU B  1  132  ? -5.867  23.060  126.432  1.00 65.60  ? 132  LEU B O     1 
ATOM   2799  C  CB    . LEU B  1  132  ? -4.200  22.138  128.903  1.00 66.49  ? 132  LEU B CB    1 
ATOM   2800  C  CG    . LEU B  1  132  ? -3.396  21.342  129.936  1.00 64.24  ? 132  LEU B CG    1 
ATOM   2801  C  CD1   . LEU B  1  132  ? -1.918  21.293  129.577  1.00 64.32  ? 132  LEU B CD1   1 
ATOM   2802  C  CD2   . LEU B  1  132  ? -3.592  21.924  131.327  1.00 65.59  ? 132  LEU B CD2   1 
ATOM   2803  N  N     . GLU B  1  133  ? -6.572  20.958  126.861  1.00 70.56  ? 133  GLU B N     1 
ATOM   2804  C  CA    . GLU B  1  133  ? -7.903  21.136  126.290  1.00 73.62  ? 133  GLU B CA    1 
ATOM   2805  C  C     . GLU B  1  133  ? -8.914  21.530  127.361  1.00 78.89  ? 133  GLU B C     1 
ATOM   2806  O  O     . GLU B  1  133  ? -8.548  21.804  128.504  1.00 80.09  ? 133  GLU B O     1 
ATOM   2807  C  CB    . GLU B  1  133  ? -8.369  19.844  125.617  1.00 72.70  ? 133  GLU B CB    1 
ATOM   2808  C  CG    . GLU B  1  133  ? -7.378  19.249  124.635  1.00 75.05  ? 133  GLU B CG    1 
ATOM   2809  C  CD    . GLU B  1  133  ? -7.868  17.941  124.041  1.00 81.37  ? 133  GLU B CD    1 
ATOM   2810  O  OE1   . GLU B  1  133  ? -9.038  17.578  124.288  1.00 79.78  ? 133  GLU B OE1   1 
ATOM   2811  O  OE2   . GLU B  1  133  ? -7.085  17.276  123.331  1.00 81.61  ? 133  GLU B OE2   1 
ATOM   2812  N  N     . GLU B  1  134  ? -10.187 21.555  126.979  1.00 80.52  ? 134  GLU B N     1 
ATOM   2813  C  CA    . GLU B  1  134  ? -11.270 21.837  127.915  1.00 80.45  ? 134  GLU B CA    1 
ATOM   2814  C  C     . GLU B  1  134  ? -11.341 20.772  129.004  1.00 77.98  ? 134  GLU B C     1 
ATOM   2815  O  O     . GLU B  1  134  ? -11.386 19.577  128.713  1.00 73.44  ? 134  GLU B O     1 
ATOM   2816  C  CB    . GLU B  1  134  ? -12.609 21.912  127.176  1.00 82.00  ? 134  GLU B CB    1 
ATOM   2817  C  CG    . GLU B  1  134  ? -12.788 23.153  126.312  1.00 91.94  ? 134  GLU B CG    1 
ATOM   2818  C  CD    . GLU B  1  134  ? -13.175 24.381  127.118  1.00 95.79  ? 134  GLU B CD    1 
ATOM   2819  O  OE1   . GLU B  1  134  ? -13.280 25.474  126.522  1.00 95.36  ? 134  GLU B OE1   1 
ATOM   2820  O  OE2   . GLU B  1  134  ? -13.379 24.255  128.344  1.00 95.04  ? 134  GLU B OE2   1 
ATOM   2821  N  N     . GLY B  1  135  ? -11.345 21.213  130.258  1.00 77.79  ? 135  GLY B N     1 
ATOM   2822  C  CA    . GLY B  1  135  ? -11.434 20.304  131.386  1.00 76.58  ? 135  GLY B CA    1 
ATOM   2823  C  C     . GLY B  1  135  ? -10.099 19.697  131.771  1.00 82.76  ? 135  GLY B C     1 
ATOM   2824  O  O     . GLY B  1  135  ? -9.976  19.063  132.819  1.00 84.94  ? 135  GLY B O     1 
ATOM   2825  N  N     . GLY B  1  136  ? -9.095  19.890  130.921  1.00 82.69  ? 136  GLY B N     1 
ATOM   2826  C  CA    . GLY B  1  136  ? -7.769  19.354  131.166  1.00 79.64  ? 136  GLY B CA    1 
ATOM   2827  C  C     . GLY B  1  136  ? -7.048  20.071  132.290  1.00 75.75  ? 136  GLY B C     1 
ATOM   2828  O  O     . GLY B  1  136  ? -7.069  21.300  132.370  1.00 69.04  ? 136  GLY B O     1 
ATOM   2829  N  N     . ARG B  1  137  ? -6.405  19.299  133.159  1.00 74.33  ? 137  ARG B N     1 
ATOM   2830  C  CA    . ARG B  1  137  ? -5.693  19.858  134.302  1.00 75.17  ? 137  ARG B CA    1 
ATOM   2831  C  C     . ARG B  1  137  ? -4.267  19.326  134.391  1.00 67.89  ? 137  ARG B C     1 
ATOM   2832  O  O     . ARG B  1  137  ? -4.033  18.124  134.265  1.00 66.75  ? 137  ARG B O     1 
ATOM   2833  C  CB    . ARG B  1  137  ? -6.447  19.559  135.598  1.00 83.39  ? 137  ARG B CB    1 
ATOM   2834  C  CG    . ARG B  1  137  ? -7.725  20.363  135.780  1.00 87.58  ? 137  ARG B CG    1 
ATOM   2835  C  CD    . ARG B  1  137  ? -8.503  19.883  136.994  1.00 96.62  ? 137  ARG B CD    1 
ATOM   2836  N  NE    . ARG B  1  137  ? -7.619  19.529  138.101  1.00 101.07 ? 137  ARG B NE    1 
ATOM   2837  C  CZ    . ARG B  1  137  ? -7.202  20.381  139.031  1.00 96.71  ? 137  ARG B CZ    1 
ATOM   2838  N  NH1   . ARG B  1  137  ? -7.589  21.650  138.995  1.00 91.55  ? 137  ARG B NH1   1 
ATOM   2839  N  NH2   . ARG B  1  137  ? -6.396  19.965  139.999  1.00 88.46  ? 137  ARG B NH2   1 
ATOM   2840  N  N     . LEU B  1  138  ? -3.319  20.231  134.611  1.00 67.20  ? 138  LEU B N     1 
ATOM   2841  C  CA    . LEU B  1  138  ? -1.913  19.864  134.729  1.00 69.39  ? 138  LEU B CA    1 
ATOM   2842  C  C     . LEU B  1  138  ? -1.273  20.429  135.998  1.00 70.47  ? 138  LEU B C     1 
ATOM   2843  O  O     . LEU B  1  138  ? -1.166  21.648  136.174  1.00 68.89  ? 138  LEU B O     1 
ATOM   2844  C  CB    . LEU B  1  138  ? -1.128  20.326  133.498  1.00 70.00  ? 138  LEU B CB    1 
ATOM   2845  C  CG    . LEU B  1  138  ? 0.324   19.851  133.421  1.00 65.42  ? 138  LEU B CG    1 
ATOM   2846  C  CD1   . LEU B  1  138  ? 0.382   18.336  133.292  1.00 61.98  ? 138  LEU B CD1   1 
ATOM   2847  C  CD2   . LEU B  1  138  ? 1.057   20.522  132.269  1.00 57.44  ? 138  LEU B CD2   1 
ATOM   2848  N  N     . ASN B  1  139  ? -0.854  19.523  136.877  1.00 66.81  ? 139  ASN B N     1 
ATOM   2849  C  CA    . ASN B  1  139  ? -0.129  19.875  138.090  1.00 69.65  ? 139  ASN B CA    1 
ATOM   2850  C  C     . ASN B  1  139  ? 1.155   19.061  138.127  1.00 63.94  ? 139  ASN B C     1 
ATOM   2851  O  O     . ASN B  1  139  ? 1.111   17.834  138.225  1.00 59.27  ? 139  ASN B O     1 
ATOM   2852  C  CB    . ASN B  1  139  ? -0.984  19.568  139.325  1.00 76.75  ? 139  ASN B CB    1 
ATOM   2853  C  CG    . ASN B  1  139  ? -0.374  20.094  140.622  1.00 75.79  ? 139  ASN B CG    1 
ATOM   2854  O  OD1   . ASN B  1  139  ? -0.946  20.968  141.274  1.00 74.15  ? 139  ASN B OD1   1 
ATOM   2855  N  ND2   . ASN B  1  139  ? 0.773   19.547  141.012  1.00 69.40  ? 139  ASN B ND2   1 
ATOM   2856  N  N     . MET B  1  140  ? 2.299   19.733  138.048  1.00 62.92  ? 140  MET B N     1 
ATOM   2857  C  CA    . MET B  1  140  ? 3.568   19.012  138.033  1.00 57.40  ? 140  MET B CA    1 
ATOM   2858  C  C     . MET B  1  140  ? 4.694   19.721  138.777  1.00 51.29  ? 140  MET B C     1 
ATOM   2859  O  O     . MET B  1  140  ? 4.677   20.938  138.952  1.00 49.99  ? 140  MET B O     1 
ATOM   2860  C  CB    . MET B  1  140  ? 4.004   18.714  136.596  1.00 55.23  ? 140  MET B CB    1 
ATOM   2861  C  CG    . MET B  1  140  ? 4.367   19.948  135.791  1.00 59.97  ? 140  MET B CG    1 
ATOM   2862  S  SD    . MET B  1  140  ? 5.228   19.537  134.263  1.00 64.88  ? 140  MET B SD    1 
ATOM   2863  C  CE    . MET B  1  140  ? 4.086   18.360  133.546  1.00 59.57  ? 140  MET B CE    1 
ATOM   2864  N  N     . GLU B  1  141  ? 5.674   18.936  139.214  1.00 46.48  ? 141  GLU B N     1 
ATOM   2865  C  CA    . GLU B  1  141  ? 6.872   19.470  139.843  1.00 47.50  ? 141  GLU B CA    1 
ATOM   2866  C  C     . GLU B  1  141  ? 8.099   18.872  139.172  1.00 45.12  ? 141  GLU B C     1 
ATOM   2867  O  O     . GLU B  1  141  ? 8.226   17.651  139.065  1.00 42.76  ? 141  GLU B O     1 
ATOM   2868  C  CB    . GLU B  1  141  ? 6.888   19.159  141.342  1.00 55.39  ? 141  GLU B CB    1 
ATOM   2869  C  CG    . GLU B  1  141  ? 5.770   19.820  142.135  1.00 63.63  ? 141  GLU B CG    1 
ATOM   2870  C  CD    . GLU B  1  141  ? 5.816   19.475  143.615  1.00 70.04  ? 141  GLU B CD    1 
ATOM   2871  O  OE1   . GLU B  1  141  ? 6.835   18.908  144.065  1.00 70.88  ? 141  GLU B OE1   1 
ATOM   2872  O  OE2   . GLU B  1  141  ? 4.831   19.768  144.327  1.00 67.32  ? 141  GLU B OE2   1 
ATOM   2873  N  N     . VAL B  1  142  ? 8.997   19.735  138.709  1.00 43.69  ? 142  VAL B N     1 
ATOM   2874  C  CA    . VAL B  1  142  ? 10.216  19.276  138.057  1.00 42.99  ? 142  VAL B CA    1 
ATOM   2875  C  C     . VAL B  1  142  ? 11.461  19.599  138.883  1.00 42.37  ? 142  VAL B C     1 
ATOM   2876  O  O     . VAL B  1  142  ? 11.601  20.696  139.428  1.00 41.45  ? 142  VAL B O     1 
ATOM   2877  C  CB    . VAL B  1  142  ? 10.351  19.835  136.620  1.00 45.08  ? 142  VAL B CB    1 
ATOM   2878  C  CG1   . VAL B  1  142  ? 9.216   19.321  135.745  1.00 44.08  ? 142  VAL B CG1   1 
ATOM   2879  C  CG2   . VAL B  1  142  ? 10.373  21.355  136.627  1.00 47.99  ? 142  VAL B CG2   1 
ATOM   2880  N  N     . ARG B  1  143  ? 12.352  18.619  138.976  1.00 42.35  ? 143  ARG B N     1 
ATOM   2881  C  CA    . ARG B  1  143  ? 13.583  18.735  139.746  1.00 40.16  ? 143  ARG B CA    1 
ATOM   2882  C  C     . ARG B  1  143  ? 14.744  19.129  138.838  1.00 40.00  ? 143  ARG B C     1 
ATOM   2883  O  O     . ARG B  1  143  ? 15.069  18.417  137.888  1.00 41.21  ? 143  ARG B O     1 
ATOM   2884  C  CB    . ARG B  1  143  ? 13.881  17.405  140.440  1.00 39.62  ? 143  ARG B CB    1 
ATOM   2885  C  CG    . ARG B  1  143  ? 15.255  17.310  141.080  1.00 44.98  ? 143  ARG B CG    1 
ATOM   2886  C  CD    . ARG B  1  143  ? 15.268  17.864  142.495  1.00 52.14  ? 143  ARG B CD    1 
ATOM   2887  N  NE    . ARG B  1  143  ? 16.580  17.711  143.121  1.00 50.22  ? 143  ARG B NE    1 
ATOM   2888  C  CZ    . ARG B  1  143  ? 16.994  16.603  143.729  1.00 49.59  ? 143  ARG B CZ    1 
ATOM   2889  N  NH1   . ARG B  1  143  ? 16.199  15.543  143.794  1.00 50.04  ? 143  ARG B NH1   1 
ATOM   2890  N  NH2   . ARG B  1  143  ? 18.203  16.554  144.270  1.00 46.89  ? 143  ARG B NH2   1 
ATOM   2891  N  N     . VAL B  1  144  ? 15.366  20.265  139.133  1.00 37.58  ? 144  VAL B N     1 
ATOM   2892  C  CA    . VAL B  1  144  ? 16.456  20.778  138.311  1.00 38.02  ? 144  VAL B CA    1 
ATOM   2893  C  C     . VAL B  1  144  ? 17.766  20.841  139.091  1.00 41.74  ? 144  VAL B C     1 
ATOM   2894  O  O     . VAL B  1  144  ? 17.868  21.547  140.092  1.00 42.95  ? 144  VAL B O     1 
ATOM   2895  C  CB    . VAL B  1  144  ? 16.125  22.177  137.760  1.00 39.50  ? 144  VAL B CB    1 
ATOM   2896  C  CG1   . VAL B  1  144  ? 17.311  22.742  136.991  1.00 41.46  ? 144  VAL B CG1   1 
ATOM   2897  C  CG2   . VAL B  1  144  ? 14.882  22.118  136.882  1.00 37.87  ? 144  VAL B CG2   1 
ATOM   2898  N  N     . ASP B  1  145  ? 18.771  20.111  138.619  1.00 39.59  ? 145  ASP B N     1 
ATOM   2899  C  CA    . ASP B  1  145  ? 20.045  20.018  139.325  1.00 39.45  ? 145  ASP B CA    1 
ATOM   2900  C  C     . ASP B  1  145  ? 21.220  20.541  138.512  1.00 39.08  ? 145  ASP B C     1 
ATOM   2901  O  O     . ASP B  1  145  ? 21.166  20.610  137.285  1.00 40.11  ? 145  ASP B O     1 
ATOM   2902  C  CB    . ASP B  1  145  ? 20.326  18.569  139.728  1.00 46.50  ? 145  ASP B CB    1 
ATOM   2903  C  CG    . ASP B  1  145  ? 19.547  18.142  140.952  1.00 56.19  ? 145  ASP B CG    1 
ATOM   2904  O  OD1   . ASP B  1  145  ? 18.377  17.735  140.800  1.00 52.59  ? 145  ASP B OD1   1 
ATOM   2905  O  OD2   . ASP B  1  145  ? 20.110  18.204  142.066  1.00 59.69  ? 145  ASP B OD2   1 
ATOM   2906  N  N     . ARG B  1  146  ? 22.284  20.909  139.217  1.00 40.30  ? 146  ARG B N     1 
ATOM   2907  C  CA    . ARG B  1  146  ? 23.549  21.256  138.588  1.00 41.29  ? 146  ARG B CA    1 
ATOM   2908  C  C     . ARG B  1  146  ? 24.386  19.992  138.435  1.00 44.41  ? 146  ARG B C     1 
ATOM   2909  O  O     . ARG B  1  146  ? 24.491  19.195  139.367  1.00 45.55  ? 146  ARG B O     1 
ATOM   2910  C  CB    . ARG B  1  146  ? 24.300  22.284  139.437  1.00 43.76  ? 146  ARG B CB    1 
ATOM   2911  C  CG    . ARG B  1  146  ? 25.741  22.516  139.013  1.00 44.92  ? 146  ARG B CG    1 
ATOM   2912  C  CD    . ARG B  1  146  ? 25.982  23.976  138.675  1.00 55.99  ? 146  ARG B CD    1 
ATOM   2913  N  NE    . ARG B  1  146  ? 25.773  24.849  139.827  1.00 61.78  ? 146  ARG B NE    1 
ATOM   2914  C  CZ    . ARG B  1  146  ? 25.765  26.177  139.767  1.00 62.34  ? 146  ARG B CZ    1 
ATOM   2915  N  NH1   . ARG B  1  146  ? 25.948  26.792  138.606  1.00 62.92  ? 146  ARG B NH1   1 
ATOM   2916  N  NH2   . ARG B  1  146  ? 25.569  26.891  140.867  1.00 60.39  ? 146  ARG B NH2   1 
ATOM   2917  N  N     . GLY B  1  147  ? 24.975  19.806  137.258  1.00 42.65  ? 147  GLY B N     1 
ATOM   2918  C  CA    . GLY B  1  147  ? 25.795  18.636  137.004  1.00 39.97  ? 147  GLY B CA    1 
ATOM   2919  C  C     . GLY B  1  147  ? 26.628  18.756  135.744  1.00 36.40  ? 147  GLY B C     1 
ATOM   2920  O  O     . GLY B  1  147  ? 26.655  19.807  135.102  1.00 35.19  ? 147  GLY B O     1 
ATOM   2921  N  N     . VAL B  1  148  ? 27.309  17.672  135.390  1.00 34.29  ? 148  VAL B N     1 
ATOM   2922  C  CA    . VAL B  1  148  ? 28.172  17.657  134.216  1.00 33.20  ? 148  VAL B CA    1 
ATOM   2923  C  C     . VAL B  1  148  ? 27.917  16.429  133.352  1.00 34.49  ? 148  VAL B C     1 
ATOM   2924  O  O     . VAL B  1  148  ? 27.494  15.384  133.848  1.00 37.29  ? 148  VAL B O     1 
ATOM   2925  C  CB    . VAL B  1  148  ? 29.661  17.680  134.612  1.00 31.46  ? 148  VAL B CB    1 
ATOM   2926  C  CG1   . VAL B  1  148  ? 30.033  19.026  135.215  1.00 35.22  ? 148  VAL B CG1   1 
ATOM   2927  C  CG2   . VAL B  1  148  ? 29.968  16.550  135.582  1.00 33.91  ? 148  VAL B CG2   1 
ATOM   2928  N  N     . GLY B  1  149  ? 28.174  16.564  132.055  1.00 31.89  ? 149  GLY B N     1 
ATOM   2929  C  CA    . GLY B  1  149  ? 28.046  15.453  131.132  1.00 28.76  ? 149  GLY B CA    1 
ATOM   2930  C  C     . GLY B  1  149  ? 26.608  15.065  130.861  1.00 29.77  ? 149  GLY B C     1 
ATOM   2931  O  O     . GLY B  1  149  ? 25.703  15.896  130.942  1.00 34.16  ? 149  GLY B O     1 
ATOM   2932  N  N     . TYR B  1  150  ? 26.402  13.795  130.529  1.00 27.75  ? 150  TYR B N     1 
ATOM   2933  C  CA    . TYR B  1  150  ? 25.072  13.275  130.236  1.00 28.54  ? 150  TYR B CA    1 
ATOM   2934  C  C     . TYR B  1  150  ? 24.818  12.025  131.065  1.00 32.32  ? 150  TYR B C     1 
ATOM   2935  O  O     . TYR B  1  150  ? 25.475  11.002  130.876  1.00 36.46  ? 150  TYR B O     1 
ATOM   2936  C  CB    . TYR B  1  150  ? 24.954  12.952  128.744  1.00 27.01  ? 150  TYR B CB    1 
ATOM   2937  C  CG    . TYR B  1  150  ? 23.608  12.410  128.316  1.00 27.35  ? 150  TYR B CG    1 
ATOM   2938  C  CD1   . TYR B  1  150  ? 22.606  13.260  127.866  1.00 26.88  ? 150  TYR B CD1   1 
ATOM   2939  C  CD2   . TYR B  1  150  ? 23.344  11.045  128.342  1.00 28.56  ? 150  TYR B CD2   1 
ATOM   2940  C  CE1   . TYR B  1  150  ? 21.378  12.769  127.466  1.00 26.44  ? 150  TYR B CE1   1 
ATOM   2941  C  CE2   . TYR B  1  150  ? 22.118  10.546  127.946  1.00 28.75  ? 150  TYR B CE2   1 
ATOM   2942  C  CZ    . TYR B  1  150  ? 21.139  11.413  127.508  1.00 27.27  ? 150  TYR B CZ    1 
ATOM   2943  O  OH    . TYR B  1  150  ? 19.916  10.924  127.110  1.00 30.19  ? 150  TYR B OH    1 
ATOM   2944  N  N     . VAL B  1  151  ? 23.859  12.105  131.980  1.00 32.69  ? 151  VAL B N     1 
ATOM   2945  C  CA    . VAL B  1  151  ? 23.543  10.974  132.843  1.00 33.39  ? 151  VAL B CA    1 
ATOM   2946  C  C     . VAL B  1  151  ? 22.139  10.438  132.580  1.00 34.87  ? 151  VAL B C     1 
ATOM   2947  O  O     . VAL B  1  151  ? 21.153  11.144  132.793  1.00 35.09  ? 151  VAL B O     1 
ATOM   2948  C  CB    . VAL B  1  151  ? 23.676  11.343  134.330  1.00 31.96  ? 151  VAL B CB    1 
ATOM   2949  C  CG1   . VAL B  1  151  ? 23.298  10.158  135.204  1.00 35.39  ? 151  VAL B CG1   1 
ATOM   2950  C  CG2   . VAL B  1  151  ? 25.094  11.805  134.632  1.00 33.36  ? 151  VAL B CG2   1 
ATOM   2951  N  N     . PRO B  1  152  ? 22.049  9.184   132.108  1.00 33.48  ? 152  PRO B N     1 
ATOM   2952  C  CA    . PRO B  1  152  ? 20.770  8.514   131.849  1.00 32.89  ? 152  PRO B CA    1 
ATOM   2953  C  C     . PRO B  1  152  ? 19.938  8.415   133.120  1.00 38.18  ? 152  PRO B C     1 
ATOM   2954  O  O     . PRO B  1  152  ? 20.489  8.495   134.217  1.00 42.11  ? 152  PRO B O     1 
ATOM   2955  C  CB    . PRO B  1  152  ? 21.194  7.115   131.394  1.00 30.85  ? 152  PRO B CB    1 
ATOM   2956  C  CG    . PRO B  1  152  ? 22.577  7.286   130.880  1.00 32.64  ? 152  PRO B CG    1 
ATOM   2957  C  CD    . PRO B  1  152  ? 23.197  8.335   131.748  1.00 31.42  ? 152  PRO B CD    1 
ATOM   2958  N  N     . ALA B  1  153  ? 18.629  8.246   132.968  1.00 39.35  ? 153  ALA B N     1 
ATOM   2959  C  CA    . ALA B  1  153  ? 17.718  8.212   134.106  1.00 39.04  ? 153  ALA B CA    1 
ATOM   2960  C  C     . ALA B  1  153  ? 18.033  7.065   135.056  1.00 40.95  ? 153  ALA B C     1 
ATOM   2961  O  O     . ALA B  1  153  ? 17.960  7.215   136.275  1.00 42.07  ? 153  ALA B O     1 
ATOM   2962  C  CB    . ALA B  1  153  ? 16.279  8.115   133.624  1.00 41.84  ? 153  ALA B CB    1 
ATOM   2963  N  N     . GLU B  1  154  ? 18.394  5.922   134.488  1.00 42.13  ? 154  GLU B N     1 
ATOM   2964  C  CA    . GLU B  1  154  ? 18.604  4.716   135.274  1.00 44.05  ? 154  GLU B CA    1 
ATOM   2965  C  C     . GLU B  1  154  ? 19.864  4.797   136.139  1.00 46.99  ? 154  GLU B C     1 
ATOM   2966  O  O     . GLU B  1  154  ? 19.994  4.072   137.124  1.00 50.83  ? 154  GLU B O     1 
ATOM   2967  C  CB    . GLU B  1  154  ? 18.665  3.494   134.350  1.00 46.75  ? 154  GLU B CB    1 
ATOM   2968  C  CG    . GLU B  1  154  ? 18.146  3.741   132.928  1.00 55.53  ? 154  GLU B CG    1 
ATOM   2969  C  CD    . GLU B  1  154  ? 16.629  3.851   132.841  1.00 60.69  ? 154  GLU B CD    1 
ATOM   2970  O  OE1   . GLU B  1  154  ? 16.113  4.065   131.720  1.00 50.96  ? 154  GLU B OE1   1 
ATOM   2971  O  OE2   . GLU B  1  154  ? 15.951  3.721   133.883  1.00 66.54  ? 154  GLU B OE2   1 
ATOM   2972  N  N     . LYS B  1  155  ? 20.793  5.672   135.763  1.00 45.64  ? 155  LYS B N     1 
ATOM   2973  C  CA    . LYS B  1  155  ? 22.055  5.805   136.491  1.00 42.55  ? 155  LYS B CA    1 
ATOM   2974  C  C     . LYS B  1  155  ? 21.979  6.671   137.754  1.00 42.61  ? 155  LYS B C     1 
ATOM   2975  O  O     . LYS B  1  155  ? 22.535  6.306   138.791  1.00 46.92  ? 155  LYS B O     1 
ATOM   2976  C  CB    . LYS B  1  155  ? 23.172  6.283   135.560  1.00 42.18  ? 155  LYS B CB    1 
ATOM   2977  C  CG    . LYS B  1  155  ? 23.489  5.289   134.451  1.00 49.03  ? 155  LYS B CG    1 
ATOM   2978  C  CD    . LYS B  1  155  ? 23.673  3.885   135.021  1.00 49.37  ? 155  LYS B CD    1 
ATOM   2979  C  CE    . LYS B  1  155  ? 23.661  2.821   133.931  1.00 50.58  ? 155  LYS B CE    1 
ATOM   2980  N  NZ    . LYS B  1  155  ? 24.764  3.009   132.950  1.00 56.36  ? 155  LYS B NZ    1 
ATOM   2981  N  N     . HIS B  1  156  ? 21.304  7.814   137.673  1.00 43.07  ? 156  HIS B N     1 
ATOM   2982  C  CA    . HIS B  1  156  ? 21.136  8.662   138.854  1.00 43.93  ? 156  HIS B CA    1 
ATOM   2983  C  C     . HIS B  1  156  ? 20.003  8.164   139.752  1.00 48.47  ? 156  HIS B C     1 
ATOM   2984  O  O     . HIS B  1  156  ? 20.140  8.134   140.977  1.00 44.60  ? 156  HIS B O     1 
ATOM   2985  C  CB    . HIS B  1  156  ? 20.928  10.131  138.467  1.00 40.87  ? 156  HIS B CB    1 
ATOM   2986  C  CG    . HIS B  1  156  ? 19.678  10.384  137.683  1.00 40.74  ? 156  HIS B CG    1 
ATOM   2987  N  ND1   . HIS B  1  156  ? 18.445  10.547  138.277  1.00 43.87  ? 156  HIS B ND1   1 
ATOM   2988  C  CD2   . HIS B  1  156  ? 19.472  10.509  136.351  1.00 38.75  ? 156  HIS B CD2   1 
ATOM   2989  C  CE1   . HIS B  1  156  ? 17.533  10.756  137.344  1.00 41.71  ? 156  HIS B CE1   1 
ATOM   2990  N  NE2   . HIS B  1  156  ? 18.131  10.740  136.167  1.00 38.40  ? 156  HIS B NE2   1 
ATOM   2991  N  N     . GLY B  1  157  ? 18.893  7.776   139.127  1.00 50.56  ? 157  GLY B N     1 
ATOM   2992  C  CA    . GLY B  1  157  ? 17.752  7.197   139.817  1.00 50.39  ? 157  GLY B CA    1 
ATOM   2993  C  C     . GLY B  1  157  ? 17.256  7.951   141.036  1.00 54.38  ? 157  GLY B C     1 
ATOM   2994  O  O     . GLY B  1  157  ? 16.998  7.348   142.077  1.00 57.88  ? 157  GLY B O     1 
ATOM   2995  N  N     . ILE B  1  158  ? 17.122  9.267   140.918  1.00 50.62  ? 158  ILE B N     1 
ATOM   2996  C  CA    . ILE B  1  158  ? 16.685  10.067  142.055  1.00 48.52  ? 158  ILE B CA    1 
ATOM   2997  C  C     . ILE B  1  158  ? 15.162  10.117  142.165  1.00 51.65  ? 158  ILE B C     1 
ATOM   2998  O  O     . ILE B  1  158  ? 14.452  10.202  141.160  1.00 46.62  ? 158  ILE B O     1 
ATOM   2999  C  CB    . ILE B  1  158  ? 17.280  11.494  142.028  1.00 40.03  ? 158  ILE B CB    1 
ATOM   3000  C  CG1   . ILE B  1  158  ? 16.649  12.334  140.919  1.00 37.66  ? 158  ILE B CG1   1 
ATOM   3001  C  CG2   . ILE B  1  158  ? 18.793  11.439  141.861  1.00 37.73  ? 158  ILE B CG2   1 
ATOM   3002  C  CD1   . ILE B  1  158  ? 16.986  13.795  141.019  1.00 42.13  ? 158  ILE B CD1   1 
ATOM   3003  N  N     . LYS B  1  159  ? 14.669  10.031  143.396  1.00 54.51  ? 159  LYS B N     1 
ATOM   3004  C  CA    . LYS B  1  159  ? 13.238  10.122  143.659  1.00 56.24  ? 159  LYS B CA    1 
ATOM   3005  C  C     . LYS B  1  159  ? 12.947  11.023  144.856  1.00 55.91  ? 159  LYS B C     1 
ATOM   3006  O  O     . LYS B  1  159  ? 13.376  10.742  145.975  1.00 53.68  ? 159  LYS B O     1 
ATOM   3007  C  CB    . LYS B  1  159  ? 12.651  8.729   143.901  1.00 54.77  ? 159  LYS B CB    1 
ATOM   3008  C  CG    . LYS B  1  159  ? 12.444  7.899   142.640  1.00 59.49  ? 159  LYS B CG    1 
ATOM   3009  C  CD    . LYS B  1  159  ? 11.881  6.525   142.982  1.00 66.48  ? 159  LYS B CD    1 
ATOM   3010  C  CE    . LYS B  1  159  ? 10.696  6.162   142.096  1.00 65.28  ? 159  LYS B CE    1 
ATOM   3011  N  NZ    . LYS B  1  159  ? 11.065  6.050   140.657  1.00 63.90  ? 159  LYS B NZ    1 
ATOM   3012  N  N     . ASP B  1  160  ? 12.221  12.109  144.612  1.00 57.11  ? 160  ASP B N     1 
ATOM   3013  C  CA    . ASP B  1  160  ? 11.757  12.973  145.690  1.00 59.60  ? 160  ASP B CA    1 
ATOM   3014  C  C     . ASP B  1  160  ? 10.516  12.373  146.339  1.00 58.93  ? 160  ASP B C     1 
ATOM   3015  O  O     . ASP B  1  160  ? 10.320  12.481  147.550  1.00 61.15  ? 160  ASP B O     1 
ATOM   3016  C  CB    . ASP B  1  160  ? 11.465  14.382  145.171  1.00 66.68  ? 160  ASP B CB    1 
ATOM   3017  C  CG    . ASP B  1  160  ? 12.722  15.217  145.012  1.00 65.61  ? 160  ASP B CG    1 
ATOM   3018  O  OD1   . ASP B  1  160  ? 13.830  14.646  145.101  1.00 64.89  ? 160  ASP B OD1   1 
ATOM   3019  O  OD2   . ASP B  1  160  ? 12.602  16.442  144.796  1.00 61.23  ? 160  ASP B OD2   1 
ATOM   3020  N  N     . ARG B  1  161  ? 9.682   11.740  145.520  1.00 56.05  ? 161  ARG B N     1 
ATOM   3021  C  CA    . ARG B  1  161  ? 8.498   11.044  146.011  1.00 56.37  ? 161  ARG B CA    1 
ATOM   3022  C  C     . ARG B  1  161  ? 8.235   9.768   145.213  1.00 55.27  ? 161  ARG B C     1 
ATOM   3023  O  O     . ARG B  1  161  ? 8.974   9.445   144.284  1.00 59.56  ? 161  ARG B O     1 
ATOM   3024  C  CB    . ARG B  1  161  ? 7.276   11.963  145.988  1.00 58.78  ? 161  ARG B CB    1 
ATOM   3025  C  CG    . ARG B  1  161  ? 6.914   12.498  144.619  1.00 57.40  ? 161  ARG B CG    1 
ATOM   3026  C  CD    . ARG B  1  161  ? 5.825   13.549  144.735  1.00 60.94  ? 161  ARG B CD    1 
ATOM   3027  N  NE    . ARG B  1  161  ? 6.257   14.686  145.543  1.00 60.09  ? 161  ARG B NE    1 
ATOM   3028  C  CZ    . ARG B  1  161  ? 5.471   15.702  145.883  1.00 62.66  ? 161  ARG B CZ    1 
ATOM   3029  N  NH1   . ARG B  1  161  ? 4.204   15.725  145.490  1.00 61.91  ? 161  ARG B NH1   1 
ATOM   3030  N  NH2   . ARG B  1  161  ? 5.950   16.695  146.620  1.00 59.89  ? 161  ARG B NH2   1 
ATOM   3031  N  N     . ILE B  1  162  ? 7.177   9.053   145.578  1.00 54.51  ? 162  ILE B N     1 
ATOM   3032  C  CA    . ILE B  1  162  ? 6.921   7.720   145.036  1.00 62.83  ? 162  ILE B CA    1 
ATOM   3033  C  C     . ILE B  1  162  ? 6.598   7.692   143.536  1.00 63.97  ? 162  ILE B C     1 
ATOM   3034  O  O     . ILE B  1  162  ? 7.101   6.837   142.804  1.00 61.80  ? 162  ILE B O     1 
ATOM   3035  C  CB    . ILE B  1  162  ? 5.816   6.987   145.845  1.00 64.33  ? 162  ILE B CB    1 
ATOM   3036  C  CG1   . ILE B  1  162  ? 5.516   5.612   145.238  1.00 66.85  ? 162  ILE B CG1   1 
ATOM   3037  C  CG2   . ILE B  1  162  ? 4.554   7.838   145.943  1.00 57.41  ? 162  ILE B CG2   1 
ATOM   3038  C  CD1   . ILE B  1  162  ? 6.699   4.663   145.249  1.00 60.98  ? 162  ILE B CD1   1 
ATOM   3039  N  N     . ASN B  1  163  ? 5.775   8.629   143.077  1.00 60.98  ? 163  ASN B N     1 
ATOM   3040  C  CA    . ASN B  1  163  ? 5.313   8.613   141.692  1.00 60.42  ? 163  ASN B CA    1 
ATOM   3041  C  C     . ASN B  1  163  ? 6.203   9.397   140.730  1.00 59.09  ? 163  ASN B C     1 
ATOM   3042  O  O     . ASN B  1  163  ? 5.887   9.520   139.547  1.00 57.24  ? 163  ASN B O     1 
ATOM   3043  C  CB    . ASN B  1  163  ? 3.867   9.104   141.601  1.00 64.58  ? 163  ASN B CB    1 
ATOM   3044  C  CG    . ASN B  1  163  ? 2.886   8.147   142.252  1.00 71.74  ? 163  ASN B CG    1 
ATOM   3045  O  OD1   . ASN B  1  163  ? 3.091   6.933   142.248  1.00 71.71  ? 163  ASN B OD1   1 
ATOM   3046  N  ND2   . ASN B  1  163  ? 1.813   8.691   142.815  1.00 72.08  ? 163  ASN B ND2   1 
ATOM   3047  N  N     . ALA B  1  164  ? 7.310   9.924   141.244  1.00 58.28  ? 164  ALA B N     1 
ATOM   3048  C  CA    . ALA B  1  164  ? 8.248   10.692  140.431  1.00 54.40  ? 164  ALA B CA    1 
ATOM   3049  C  C     . ALA B  1  164  ? 8.840   9.857   139.296  1.00 52.96  ? 164  ALA B C     1 
ATOM   3050  O  O     . ALA B  1  164  ? 9.202   8.697   139.491  1.00 53.88  ? 164  ALA B O     1 
ATOM   3051  C  CB    . ALA B  1  164  ? 9.358   11.268  141.302  1.00 52.43  ? 164  ALA B CB    1 
ATOM   3052  N  N     . ILE B  1  165  ? 8.931   10.457  138.113  1.00 50.45  ? 165  ILE B N     1 
ATOM   3053  C  CA    . ILE B  1  165  ? 9.523   9.798   136.953  1.00 46.18  ? 165  ILE B CA    1 
ATOM   3054  C  C     . ILE B  1  165  ? 10.928  10.328  136.702  1.00 47.12  ? 165  ILE B C     1 
ATOM   3055  O  O     . ILE B  1  165  ? 11.108  11.526  136.475  1.00 45.26  ? 165  ILE B O     1 
ATOM   3056  C  CB    . ILE B  1  165  ? 8.685   10.030  135.684  1.00 44.99  ? 165  ILE B CB    1 
ATOM   3057  C  CG1   . ILE B  1  165  ? 7.247   9.556   135.895  1.00 49.58  ? 165  ILE B CG1   1 
ATOM   3058  C  CG2   . ILE B  1  165  ? 9.313   9.319   134.497  1.00 48.70  ? 165  ILE B CG2   1 
ATOM   3059  C  CD1   . ILE B  1  165  ? 6.322   9.907   134.753  1.00 48.51  ? 165  ILE B CD1   1 
ATOM   3060  N  N     . PRO B  1  166  ? 11.931  9.436   136.741  1.00 47.49  ? 166  PRO B N     1 
ATOM   3061  C  CA    . PRO B  1  166  ? 13.322  9.826   136.492  1.00 40.85  ? 166  PRO B CA    1 
ATOM   3062  C  C     . PRO B  1  166  ? 13.498  10.264  135.047  1.00 40.11  ? 166  PRO B C     1 
ATOM   3063  O  O     . PRO B  1  166  ? 12.996  9.599   134.141  1.00 40.82  ? 166  PRO B O     1 
ATOM   3064  C  CB    . PRO B  1  166  ? 14.103  8.529   136.740  1.00 40.69  ? 166  PRO B CB    1 
ATOM   3065  C  CG    . PRO B  1  166  ? 13.181  7.654   137.529  1.00 45.83  ? 166  PRO B CG    1 
ATOM   3066  C  CD    . PRO B  1  166  ? 11.809  8.002   137.052  1.00 47.11  ? 166  PRO B CD    1 
ATOM   3067  N  N     . VAL B  1  167  ? 14.202  11.371  134.836  1.00 40.43  ? 167  VAL B N     1 
ATOM   3068  C  CA    . VAL B  1  167  ? 14.382  11.915  133.496  1.00 43.98  ? 167  VAL B CA    1 
ATOM   3069  C  C     . VAL B  1  167  ? 15.847  11.881  133.083  1.00 41.24  ? 167  VAL B C     1 
ATOM   3070  O  O     . VAL B  1  167  ? 16.729  12.183  133.890  1.00 39.71  ? 167  VAL B O     1 
ATOM   3071  C  CB    . VAL B  1  167  ? 13.870  13.366  133.415  1.00 41.50  ? 167  VAL B CB    1 
ATOM   3072  C  CG1   . VAL B  1  167  ? 13.982  13.899  131.994  1.00 39.49  ? 167  VAL B CG1   1 
ATOM   3073  C  CG2   . VAL B  1  167  ? 12.435  13.441  133.901  1.00 45.05  ? 167  VAL B CG2   1 
ATOM   3074  N  N     . ASP B  1  168  ? 16.102  11.503  131.832  1.00 39.86  ? 168  ASP B N     1 
ATOM   3075  C  CA    . ASP B  1  168  ? 17.449  11.555  131.286  1.00 35.42  ? 168  ASP B CA    1 
ATOM   3076  C  C     . ASP B  1  168  ? 17.924  12.995  131.381  1.00 34.62  ? 168  ASP B C     1 
ATOM   3077  O  O     . ASP B  1  168  ? 17.277  13.911  130.873  1.00 34.22  ? 168  ASP B O     1 
ATOM   3078  C  CB    . ASP B  1  168  ? 17.457  11.091  129.829  1.00 33.47  ? 168  ASP B CB    1 
ATOM   3079  C  CG    . ASP B  1  168  ? 16.822  9.723   129.649  1.00 38.93  ? 168  ASP B CG    1 
ATOM   3080  O  OD1   . ASP B  1  168  ? 17.157  8.802   130.422  1.00 43.87  ? 168  ASP B OD1   1 
ATOM   3081  O  OD2   . ASP B  1  168  ? 15.981  9.569   128.738  1.00 40.80  ? 168  ASP B OD2   1 
ATOM   3082  N  N     . ALA B  1  169  ? 19.059  13.190  132.039  1.00 32.41  ? 169  ALA B N     1 
ATOM   3083  C  CA    . ALA B  1  169  ? 19.525  14.531  132.347  1.00 34.43  ? 169  ALA B CA    1 
ATOM   3084  C  C     . ALA B  1  169  ? 20.610  14.975  131.387  1.00 33.56  ? 169  ALA B C     1 
ATOM   3085  O  O     . ALA B  1  169  ? 21.687  14.381  131.340  1.00 32.99  ? 169  ALA B O     1 
ATOM   3086  C  CB    . ALA B  1  169  ? 20.033  14.595  133.778  1.00 35.24  ? 169  ALA B CB    1 
ATOM   3087  N  N     . VAL B  1  170  ? 20.335  16.031  130.630  1.00 36.23  ? 170  VAL B N     1 
ATOM   3088  C  CA    . VAL B  1  170  ? 21.375  16.609  129.805  1.00 36.47  ? 170  VAL B CA    1 
ATOM   3089  C  C     . VAL B  1  170  ? 21.876  17.822  130.564  1.00 35.17  ? 170  VAL B C     1 
ATOM   3090  O  O     . VAL B  1  170  ? 21.266  18.892  130.534  1.00 35.00  ? 170  VAL B O     1 
ATOM   3091  C  CB    . VAL B  1  170  ? 20.805  17.075  128.452  1.00 34.24  ? 170  VAL B CB    1 
ATOM   3092  C  CG1   . VAL B  1  170  ? 21.918  17.558  127.540  1.00 36.74  ? 170  VAL B CG1   1 
ATOM   3093  C  CG2   . VAL B  1  170  ? 20.014  15.956  127.791  1.00 32.25  ? 170  VAL B CG2   1 
ATOM   3094  N  N     . PHE B  1  171  ? 23.022  17.656  131.211  1.00 32.10  ? 171  PHE B N     1 
ATOM   3095  C  CA    . PHE B  1  171  ? 23.593  18.713  132.025  1.00 36.29  ? 171  PHE B CA    1 
ATOM   3096  C  C     . PHE B  1  171  ? 24.361  19.671  131.139  1.00 38.94  ? 171  PHE B C     1 
ATOM   3097  O  O     . PHE B  1  171  ? 24.291  20.888  131.309  1.00 39.96  ? 171  PHE B O     1 
ATOM   3098  C  CB    . PHE B  1  171  ? 24.509  18.135  133.106  1.00 39.23  ? 171  PHE B CB    1 
ATOM   3099  C  CG    . PHE B  1  171  ? 23.777  17.415  134.209  1.00 41.39  ? 171  PHE B CG    1 
ATOM   3100  C  CD1   . PHE B  1  171  ? 22.967  18.110  135.093  1.00 41.94  ? 171  PHE B CD1   1 
ATOM   3101  C  CD2   . PHE B  1  171  ? 23.916  16.045  134.374  1.00 40.11  ? 171  PHE B CD2   1 
ATOM   3102  C  CE1   . PHE B  1  171  ? 22.300  17.452  136.112  1.00 39.20  ? 171  PHE B CE1   1 
ATOM   3103  C  CE2   . PHE B  1  171  ? 23.252  15.382  135.391  1.00 35.93  ? 171  PHE B CE2   1 
ATOM   3104  C  CZ    . PHE B  1  171  ? 22.444  16.086  136.261  1.00 35.58  ? 171  PHE B CZ    1 
ATOM   3105  N  N     . SER B  1  172  ? 25.082  19.095  130.182  1.00 38.09  ? 172  SER B N     1 
ATOM   3106  C  CA    . SER B  1  172  ? 25.995  19.839  129.329  1.00 37.76  ? 172  SER B CA    1 
ATOM   3107  C  C     . SER B  1  172  ? 25.313  21.004  128.630  1.00 36.67  ? 172  SER B C     1 
ATOM   3108  O  O     . SER B  1  172  ? 24.355  20.814  127.881  1.00 36.94  ? 172  SER B O     1 
ATOM   3109  C  CB    . SER B  1  172  ? 26.618  18.904  128.289  1.00 36.99  ? 172  SER B CB    1 
ATOM   3110  O  OG    . SER B  1  172  ? 27.431  19.623  127.377  1.00 38.53  ? 172  SER B OG    1 
ATOM   3111  N  N     . PRO B  1  173  ? 25.804  22.223  128.891  1.00 35.39  ? 173  PRO B N     1 
ATOM   3112  C  CA    . PRO B  1  173  ? 25.365  23.430  128.188  1.00 36.89  ? 173  PRO B CA    1 
ATOM   3113  C  C     . PRO B  1  173  ? 25.869  23.399  126.754  1.00 37.04  ? 173  PRO B C     1 
ATOM   3114  O  O     . PRO B  1  173  ? 25.357  24.115  125.896  1.00 38.78  ? 173  PRO B O     1 
ATOM   3115  C  CB    . PRO B  1  173  ? 26.048  24.553  128.969  1.00 37.62  ? 173  PRO B CB    1 
ATOM   3116  C  CG    . PRO B  1  173  ? 27.252  23.918  129.551  1.00 36.17  ? 173  PRO B CG    1 
ATOM   3117  C  CD    . PRO B  1  173  ? 26.847  22.515  129.889  1.00 33.97  ? 173  PRO B CD    1 
ATOM   3118  N  N     . VAL B  1  174  ? 26.871  22.562  126.503  1.00 34.51  ? 174  VAL B N     1 
ATOM   3119  C  CA    . VAL B  1  174  ? 27.399  22.392  125.162  1.00 32.85  ? 174  VAL B CA    1 
ATOM   3120  C  C     . VAL B  1  174  ? 26.557  21.366  124.418  1.00 33.07  ? 174  VAL B C     1 
ATOM   3121  O  O     . VAL B  1  174  ? 26.510  20.194  124.796  1.00 30.99  ? 174  VAL B O     1 
ATOM   3122  C  CB    . VAL B  1  174  ? 28.856  21.904  125.194  1.00 32.08  ? 174  VAL B CB    1 
ATOM   3123  C  CG1   . VAL B  1  174  ? 29.328  21.574  123.795  1.00 32.96  ? 174  VAL B CG1   1 
ATOM   3124  C  CG2   . VAL B  1  174  ? 29.756  22.950  125.833  1.00 30.93  ? 174  VAL B CG2   1 
ATOM   3125  N  N     . ARG B  1  175  ? 25.895  21.812  123.357  1.00 33.65  ? 175  ARG B N     1 
ATOM   3126  C  CA    . ARG B  1  175  ? 25.047  20.931  122.566  1.00 32.13  ? 175  ARG B CA    1 
ATOM   3127  C  C     . ARG B  1  175  ? 25.848  20.100  121.570  1.00 32.37  ? 175  ARG B C     1 
ATOM   3128  O  O     . ARG B  1  175  ? 25.568  18.916  121.382  1.00 33.85  ? 175  ARG B O     1 
ATOM   3129  C  CB    . ARG B  1  175  ? 23.946  21.721  121.856  1.00 39.13  ? 175  ARG B CB    1 
ATOM   3130  C  CG    . ARG B  1  175  ? 22.908  22.302  122.804  1.00 42.49  ? 175  ARG B CG    1 
ATOM   3131  C  CD    . ARG B  1  175  ? 21.611  22.621  122.081  1.00 49.81  ? 175  ARG B CD    1 
ATOM   3132  N  NE    . ARG B  1  175  ? 20.555  23.021  123.007  1.00 53.90  ? 175  ARG B NE    1 
ATOM   3133  C  CZ    . ARG B  1  175  ? 19.804  22.168  123.698  1.00 55.09  ? 175  ARG B CZ    1 
ATOM   3134  N  NH1   . ARG B  1  175  ? 19.993  20.861  123.574  1.00 46.84  ? 175  ARG B NH1   1 
ATOM   3135  N  NH2   . ARG B  1  175  ? 18.865  22.623  124.517  1.00 52.62  ? 175  ARG B NH2   1 
ATOM   3136  N  N     . ARG B  1  176  ? 26.833  20.719  120.925  1.00 32.51  ? 176  ARG B N     1 
ATOM   3137  C  CA    . ARG B  1  176  ? 27.686  19.982  119.992  1.00 27.15  ? 176  ARG B CA    1 
ATOM   3138  C  C     . ARG B  1  176  ? 29.098  20.550  119.880  1.00 25.28  ? 176  ARG B C     1 
ATOM   3139  O  O     . ARG B  1  176  ? 29.294  21.759  119.940  1.00 30.19  ? 176  ARG B O     1 
ATOM   3140  C  CB    . ARG B  1  176  ? 27.034  19.913  118.608  1.00 28.09  ? 176  ARG B CB    1 
ATOM   3141  C  CG    . ARG B  1  176  ? 27.881  19.211  117.558  1.00 31.84  ? 176  ARG B CG    1 
ATOM   3142  C  CD    . ARG B  1  176  ? 27.025  18.572  116.486  1.00 35.74  ? 176  ARG B CD    1 
ATOM   3143  N  NE    . ARG B  1  176  ? 26.561  19.527  115.485  1.00 31.55  ? 176  ARG B NE    1 
ATOM   3144  C  CZ    . ARG B  1  176  ? 27.011  19.572  114.236  1.00 30.84  ? 176  ARG B CZ    1 
ATOM   3145  N  NH1   . ARG B  1  176  ? 27.936  18.711  113.832  1.00 29.68  ? 176  ARG B NH1   1 
ATOM   3146  N  NH2   . ARG B  1  176  ? 26.535  20.473  113.389  1.00 31.29  ? 176  ARG B NH2   1 
ATOM   3147  N  N     . VAL B  1  177  ? 30.081  19.672  119.719  1.00 22.27  ? 177  VAL B N     1 
ATOM   3148  C  CA    . VAL B  1  177  ? 31.435  20.103  119.398  1.00 25.93  ? 177  VAL B CA    1 
ATOM   3149  C  C     . VAL B  1  177  ? 31.940  19.399  118.148  1.00 30.60  ? 177  VAL B C     1 
ATOM   3150  O  O     . VAL B  1  177  ? 31.952  18.169  118.079  1.00 32.08  ? 177  VAL B O     1 
ATOM   3151  C  CB    . VAL B  1  177  ? 32.423  19.823  120.543  1.00 26.97  ? 177  VAL B CB    1 
ATOM   3152  C  CG1   . VAL B  1  177  ? 33.845  20.116  120.091  1.00 24.60  ? 177  VAL B CG1   1 
ATOM   3153  C  CG2   . VAL B  1  177  ? 32.074  20.649  121.761  1.00 28.78  ? 177  VAL B CG2   1 
ATOM   3154  N  N     . ALA B  1  178  ? 32.351  20.183  117.159  1.00 31.19  ? 178  ALA B N     1 
ATOM   3155  C  CA    . ALA B  1  178  ? 32.990  19.627  115.974  1.00 30.13  ? 178  ALA B CA    1 
ATOM   3156  C  C     . ALA B  1  178  ? 34.335  20.308  115.793  1.00 28.35  ? 178  ALA B C     1 
ATOM   3157  O  O     . ALA B  1  178  ? 34.511  21.444  116.219  1.00 29.06  ? 178  ALA B O     1 
ATOM   3158  C  CB    . ALA B  1  178  ? 32.115  19.833  114.750  1.00 24.95  ? 178  ALA B CB    1 
ATOM   3159  N  N     . PHE B  1  179  ? 35.297  19.618  115.193  1.00 26.40  ? 179  PHE B N     1 
ATOM   3160  C  CA    . PHE B  1  179  ? 36.572  20.261  114.894  1.00 28.99  ? 179  PHE B CA    1 
ATOM   3161  C  C     . PHE B  1  179  ? 37.257  19.688  113.659  1.00 30.82  ? 179  PHE B C     1 
ATOM   3162  O  O     . PHE B  1  179  ? 37.182  18.488  113.390  1.00 32.82  ? 179  PHE B O     1 
ATOM   3163  C  CB    . PHE B  1  179  ? 37.508  20.239  116.109  1.00 26.93  ? 179  PHE B CB    1 
ATOM   3164  C  CG    . PHE B  1  179  ? 38.334  18.992  116.225  1.00 26.31  ? 179  PHE B CG    1 
ATOM   3165  C  CD1   . PHE B  1  179  ? 39.668  18.992  115.850  1.00 26.19  ? 179  PHE B CD1   1 
ATOM   3166  C  CD2   . PHE B  1  179  ? 37.783  17.824  116.721  1.00 27.52  ? 179  PHE B CD2   1 
ATOM   3167  C  CE1   . PHE B  1  179  ? 40.434  17.848  115.960  1.00 25.91  ? 179  PHE B CE1   1 
ATOM   3168  C  CE2   . PHE B  1  179  ? 38.545  16.676  116.832  1.00 29.86  ? 179  PHE B CE2   1 
ATOM   3169  C  CZ    . PHE B  1  179  ? 39.872  16.689  116.452  1.00 26.20  ? 179  PHE B CZ    1 
ATOM   3170  N  N     . GLN B  1  180  ? 37.925  20.558  112.910  1.00 28.52  ? 180  GLN B N     1 
ATOM   3171  C  CA    . GLN B  1  180  ? 38.646  20.130  111.720  1.00 31.61  ? 180  GLN B CA    1 
ATOM   3172  C  C     . GLN B  1  180  ? 40.048  20.727  111.669  1.00 33.31  ? 180  GLN B C     1 
ATOM   3173  O  O     . GLN B  1  180  ? 40.237  21.929  111.869  1.00 33.45  ? 180  GLN B O     1 
ATOM   3174  C  CB    . GLN B  1  180  ? 37.863  20.483  110.453  1.00 36.70  ? 180  GLN B CB    1 
ATOM   3175  C  CG    . GLN B  1  180  ? 38.589  20.132  109.162  1.00 42.62  ? 180  GLN B CG    1 
ATOM   3176  C  CD    . GLN B  1  180  ? 37.653  20.017  107.975  1.00 46.49  ? 180  GLN B CD    1 
ATOM   3177  O  OE1   . GLN B  1  180  ? 36.442  19.860  108.138  1.00 49.44  ? 180  GLN B OE1   1 
ATOM   3178  N  NE2   . GLN B  1  180  ? 38.211  20.093  106.771  1.00 47.12  ? 180  GLN B NE2   1 
ATOM   3179  N  N     . VAL B  1  181  ? 41.030  19.871  111.410  1.00 31.46  ? 181  VAL B N     1 
ATOM   3180  C  CA    . VAL B  1  181  ? 42.410  20.308  111.279  1.00 31.96  ? 181  VAL B CA    1 
ATOM   3181  C  C     . VAL B  1  181  ? 42.774  20.369  109.804  1.00 36.68  ? 181  VAL B C     1 
ATOM   3182  O  O     . VAL B  1  181  ? 42.873  19.340  109.137  1.00 39.35  ? 181  VAL B O     1 
ATOM   3183  C  CB    . VAL B  1  181  ? 43.375  19.351  111.998  1.00 30.17  ? 181  VAL B CB    1 
ATOM   3184  C  CG1   . VAL B  1  181  ? 44.809  19.839  111.862  1.00 32.11  ? 181  VAL B CG1   1 
ATOM   3185  C  CG2   . VAL B  1  181  ? 42.992  19.219  113.460  1.00 30.49  ? 181  VAL B CG2   1 
ATOM   3186  N  N     . GLU B  1  182  ? 42.965  21.582  109.297  1.00 41.24  ? 182  GLU B N     1 
ATOM   3187  C  CA    . GLU B  1  182  ? 43.300  21.768  107.891  1.00 39.95  ? 182  GLU B CA    1 
ATOM   3188  C  C     . GLU B  1  182  ? 44.790  22.021  107.729  1.00 41.35  ? 182  GLU B C     1 
ATOM   3189  O  O     . GLU B  1  182  ? 45.395  22.738  108.524  1.00 42.03  ? 182  GLU B O     1 
ATOM   3190  C  CB    . GLU B  1  182  ? 42.499  22.928  107.297  1.00 44.90  ? 182  GLU B CB    1 
ATOM   3191  C  CG    . GLU B  1  182  ? 40.999  22.680  107.234  1.00 51.28  ? 182  GLU B CG    1 
ATOM   3192  C  CD    . GLU B  1  182  ? 40.219  23.922  106.844  1.00 57.13  ? 182  GLU B CD    1 
ATOM   3193  O  OE1   . GLU B  1  182  ? 39.012  23.800  106.548  1.00 55.91  ? 182  GLU B OE1   1 
ATOM   3194  O  OE2   . GLU B  1  182  ? 40.813  25.021  106.839  1.00 55.35  ? 182  GLU B OE2   1 
ATOM   3195  N  N     . ASP B  1  183  ? 45.382  21.426  106.700  1.00 45.89  ? 183  ASP B N     1 
ATOM   3196  C  CA    . ASP B  1  183  ? 46.804  21.606  106.452  1.00 46.27  ? 183  ASP B CA    1 
ATOM   3197  C  C     . ASP B  1  183  ? 47.069  23.004  105.906  1.00 44.75  ? 183  ASP B C     1 
ATOM   3198  O  O     . ASP B  1  183  ? 46.412  23.450  104.967  1.00 42.43  ? 183  ASP B O     1 
ATOM   3199  C  CB    . ASP B  1  183  ? 47.326  20.543  105.485  1.00 50.80  ? 183  ASP B CB    1 
ATOM   3200  C  CG    . ASP B  1  183  ? 48.780  20.193  105.738  1.00 61.38  ? 183  ASP B CG    1 
ATOM   3201  O  OD1   . ASP B  1  183  ? 49.199  20.216  106.917  1.00 66.04  ? 183  ASP B OD1   1 
ATOM   3202  O  OD2   . ASP B  1  183  ? 49.503  19.896  104.763  1.00 60.55  ? 183  ASP B OD2   1 
ATOM   3203  N  N     . THR B  1  184  ? 48.029  23.695  106.509  1.00 46.99  ? 184  THR B N     1 
ATOM   3204  C  CA    . THR B  1  184  ? 48.363  25.052  106.103  1.00 49.66  ? 184  THR B CA    1 
ATOM   3205  C  C     . THR B  1  184  ? 49.871  25.271  106.057  1.00 53.61  ? 184  THR B C     1 
ATOM   3206  O  O     . THR B  1  184  ? 50.650  24.488  106.619  1.00 54.94  ? 184  THR B O     1 
ATOM   3207  C  CB    . THR B  1  184  ? 47.729  26.096  107.043  1.00 50.48  ? 184  THR B CB    1 
ATOM   3208  O  OG1   . THR B  1  184  ? 48.005  27.413  106.551  1.00 57.49  ? 184  THR B OG1   1 
ATOM   3209  C  CG2   . THR B  1  184  ? 48.288  25.958  108.452  1.00 46.75  ? 184  THR B CG2   1 
ATOM   3210  N  N     . ARG B  1  185  ? 50.266  26.349  105.386  1.00 55.42  ? 185  ARG B N     1 
ATOM   3211  C  CA    . ARG B  1  185  ? 51.669  26.696  105.212  1.00 60.81  ? 185  ARG B CA    1 
ATOM   3212  C  C     . ARG B  1  185  ? 51.930  28.127  105.673  1.00 62.01  ? 185  ARG B C     1 
ATOM   3213  O  O     . ARG B  1  185  ? 51.048  28.986  105.604  1.00 57.49  ? 185  ARG B O     1 
ATOM   3214  C  CB    . ARG B  1  185  ? 52.068  26.553  103.741  1.00 67.77  ? 185  ARG B CB    1 
ATOM   3215  C  CG    . ARG B  1  185  ? 51.454  27.612  102.829  1.00 69.42  ? 185  ARG B CG    1 
ATOM   3216  C  CD    . ARG B  1  185  ? 51.977  27.506  101.403  1.00 72.81  ? 185  ARG B CD    1 
ATOM   3217  N  NE    . ARG B  1  185  ? 51.621  28.673  100.600  1.00 72.14  ? 185  ARG B NE    1 
ATOM   3218  C  CZ    . ARG B  1  185  ? 52.395  29.744  100.454  1.00 73.44  ? 185  ARG B CZ    1 
ATOM   3219  N  NH1   . ARG B  1  185  ? 53.575  29.798  101.059  1.00 73.89  ? 185  ARG B NH1   1 
ATOM   3220  N  NH2   . ARG B  1  185  ? 51.992  30.762  99.704   1.00 66.44  ? 185  ARG B NH2   1 
ATOM   3221  N  N     . LEU B  1  186  ? 53.140  28.371  106.163  1.00 65.38  ? 186  LEU B N     1 
ATOM   3222  C  CA    . LEU B  1  186  ? 53.585  29.724  106.467  1.00 69.97  ? 186  LEU B CA    1 
ATOM   3223  C  C     . LEU B  1  186  ? 54.988  29.928  105.914  1.00 75.62  ? 186  LEU B C     1 
ATOM   3224  O  O     . LEU B  1  186  ? 55.942  29.311  106.385  1.00 74.41  ? 186  LEU B O     1 
ATOM   3225  C  CB    . LEU B  1  186  ? 53.572  29.963  107.977  1.00 66.13  ? 186  LEU B CB    1 
ATOM   3226  C  CG    . LEU B  1  186  ? 53.957  31.362  108.463  1.00 64.36  ? 186  LEU B CG    1 
ATOM   3227  C  CD1   . LEU B  1  186  ? 52.997  32.411  107.922  1.00 55.76  ? 186  LEU B CD1   1 
ATOM   3228  C  CD2   . LEU B  1  186  ? 54.003  31.406  109.983  1.00 59.98  ? 186  LEU B CD2   1 
ATOM   3229  N  N     . GLY B  1  187  ? 55.119  30.812  104.931  1.00 78.35  ? 187  GLY B N     1 
ATOM   3230  C  CA    . GLY B  1  187  ? 56.401  31.026  104.286  1.00 88.23  ? 187  GLY B CA    1 
ATOM   3231  C  C     . GLY B  1  187  ? 56.906  29.757  103.624  1.00 86.69  ? 187  GLY B C     1 
ATOM   3232  O  O     . GLY B  1  187  ? 56.232  29.177  102.768  1.00 75.13  ? 187  GLY B O     1 
ATOM   3233  N  N     . GLN B  1  188  ? 58.104  29.332  104.019  1.00 89.69  ? 188  GLN B N     1 
ATOM   3234  C  CA    . GLN B  1  188  ? 58.687  28.096  103.512  1.00 88.96  ? 188  GLN B CA    1 
ATOM   3235  C  C     . GLN B  1  188  ? 58.285  26.902  104.375  1.00 82.42  ? 188  GLN B C     1 
ATOM   3236  O  O     . GLN B  1  188  ? 58.553  25.753  104.020  1.00 76.91  ? 188  GLN B O     1 
ATOM   3237  C  CB    . GLN B  1  188  ? 60.213  28.203  103.422  1.00 86.36  ? 188  GLN B CB    1 
ATOM   3238  C  CG    . GLN B  1  188  ? 60.838  27.303  102.359  1.00 83.75  ? 188  GLN B CG    1 
ATOM   3239  C  CD    . GLN B  1  188  ? 60.359  27.643  100.957  1.00 82.65  ? 188  GLN B CD    1 
ATOM   3240  O  OE1   . GLN B  1  188  ? 59.993  28.784  100.675  1.00 78.90  ? 188  GLN B OE1   1 
ATOM   3241  N  NE2   . GLN B  1  188  ? 60.352  26.649  100.075  1.00 76.94  ? 188  GLN B NE2   1 
ATOM   3242  N  N     . ARG B  1  189  ? 57.646  27.173  105.508  1.00 79.47  ? 189  ARG B N     1 
ATOM   3243  C  CA    . ARG B  1  189  ? 57.055  26.103  106.297  1.00 74.58  ? 189  ARG B CA    1 
ATOM   3244  C  C     . ARG B  1  189  ? 55.852  25.559  105.539  1.00 69.69  ? 189  ARG B C     1 
ATOM   3245  O  O     . ARG B  1  189  ? 54.923  26.296  105.208  1.00 62.69  ? 189  ARG B O     1 
ATOM   3246  C  CB    . ARG B  1  189  ? 56.641  26.596  107.685  1.00 74.17  ? 189  ARG B CB    1 
ATOM   3247  C  CG    . ARG B  1  189  ? 57.785  26.724  108.681  1.00 73.56  ? 189  ARG B CG    1 
ATOM   3248  C  CD    . ARG B  1  189  ? 58.311  25.360  109.104  1.00 77.47  ? 189  ARG B CD    1 
ATOM   3249  N  NE    . ARG B  1  189  ? 59.340  25.465  110.137  1.00 87.07  ? 189  ARG B NE    1 
ATOM   3250  C  CZ    . ARG B  1  189  ? 59.097  25.421  111.443  1.00 81.77  ? 189  ARG B CZ    1 
ATOM   3251  N  NH1   . ARG B  1  189  ? 60.096  25.526  112.309  1.00 78.47  ? 189  ARG B NH1   1 
ATOM   3252  N  NH2   . ARG B  1  189  ? 57.855  25.271  111.884  1.00 78.66  ? 189  ARG B NH2   1 
ATOM   3253  N  N     . THR B  1  190  ? 55.874  24.260  105.276  1.00 72.02  ? 190  THR B N     1 
ATOM   3254  C  CA    . THR B  1  190  ? 54.878  23.633  104.415  1.00 73.74  ? 190  THR B CA    1 
ATOM   3255  C  C     . THR B  1  190  ? 53.819  22.889  105.216  1.00 64.80  ? 190  THR B C     1 
ATOM   3256  O  O     . THR B  1  190  ? 52.628  23.194  105.127  1.00 58.94  ? 190  THR B O     1 
ATOM   3257  C  CB    . THR B  1  190  ? 55.531  22.708  103.375  1.00 71.07  ? 190  THR B CB    1 
ATOM   3258  O  OG1   . THR B  1  190  ? 56.323  21.714  104.037  1.00 73.50  ? 190  THR B OG1   1 
ATOM   3259  C  CG2   . THR B  1  190  ? 56.422  23.522  102.453  1.00 67.54  ? 190  THR B CG2   1 
ATOM   3260  N  N     . ASP B  1  191  ? 54.255  21.909  105.997  1.00 59.00  ? 191  ASP B N     1 
ATOM   3261  C  CA    . ASP B  1  191  ? 53.323  21.137  106.790  1.00 54.67  ? 191  ASP B CA    1 
ATOM   3262  C  C     . ASP B  1  191  ? 53.168  21.851  108.122  1.00 52.31  ? 191  ASP B C     1 
ATOM   3263  O  O     . ASP B  1  191  ? 54.066  21.832  108.963  1.00 51.41  ? 191  ASP B O     1 
ATOM   3264  C  CB    . ASP B  1  191  ? 53.890  19.733  107.017  1.00 57.31  ? 191  ASP B CB    1 
ATOM   3265  C  CG    . ASP B  1  191  ? 52.851  18.746  107.529  1.00 65.21  ? 191  ASP B CG    1 
ATOM   3266  O  OD1   . ASP B  1  191  ? 51.837  19.182  108.113  1.00 67.18  ? 191  ASP B OD1   1 
ATOM   3267  O  OD2   . ASP B  1  191  ? 53.055  17.525  107.348  1.00 62.42  ? 191  ASP B OD2   1 
ATOM   3268  N  N     . LEU B  1  192  ? 52.005  22.468  108.304  1.00 52.59  ? 192  LEU B N     1 
ATOM   3269  C  CA    . LEU B  1  192  ? 51.637  23.094  109.564  1.00 49.39  ? 192  LEU B CA    1 
ATOM   3270  C  C     . LEU B  1  192  ? 50.150  22.860  109.742  1.00 47.01  ? 192  LEU B C     1 
ATOM   3271  O  O     . LEU B  1  192  ? 49.439  22.608  108.772  1.00 46.79  ? 192  LEU B O     1 
ATOM   3272  C  CB    . LEU B  1  192  ? 51.945  24.593  109.556  1.00 43.18  ? 192  LEU B CB    1 
ATOM   3273  C  CG    . LEU B  1  192  ? 53.408  25.038  109.630  1.00 48.03  ? 192  LEU B CG    1 
ATOM   3274  C  CD1   . LEU B  1  192  ? 53.494  26.556  109.691  1.00 56.29  ? 192  LEU B CD1   1 
ATOM   3275  C  CD2   . LEU B  1  192  ? 54.119  24.412  110.822  1.00 50.04  ? 192  LEU B CD2   1 
ATOM   3276  N  N     . ASP B  1  193  ? 49.675  22.930  110.977  1.00 43.21  ? 193  ASP B N     1 
ATOM   3277  C  CA    . ASP B  1  193  ? 48.276  22.633  111.241  1.00 39.63  ? 193  ASP B CA    1 
ATOM   3278  C  C     . ASP B  1  193  ? 47.465  23.890  111.537  1.00 36.38  ? 193  ASP B C     1 
ATOM   3279  O  O     . ASP B  1  193  ? 47.942  24.819  112.187  1.00 38.36  ? 193  ASP B O     1 
ATOM   3280  C  CB    . ASP B  1  193  ? 48.150  21.615  112.379  1.00 42.60  ? 193  ASP B CB    1 
ATOM   3281  C  CG    . ASP B  1  193  ? 48.610  20.221  111.972  1.00 43.46  ? 193  ASP B CG    1 
ATOM   3282  O  OD1   . ASP B  1  193  ? 49.281  20.086  110.922  1.00 52.48  ? 193  ASP B OD1   1 
ATOM   3283  O  OD2   . ASP B  1  193  ? 48.301  19.259  112.706  1.00 35.33  ? 193  ASP B OD2   1 
ATOM   3284  N  N     . LYS B  1  194  ? 46.237  23.909  111.034  1.00 33.10  ? 194  LYS B N     1 
ATOM   3285  C  CA    . LYS B  1  194  ? 45.308  24.995  111.299  1.00 34.11  ? 194  LYS B CA    1 
ATOM   3286  C  C     . LYS B  1  194  ? 44.079  24.413  111.979  1.00 35.41  ? 194  LYS B C     1 
ATOM   3287  O  O     . LYS B  1  194  ? 43.371  23.587  111.394  1.00 38.35  ? 194  LYS B O     1 
ATOM   3288  C  CB    . LYS B  1  194  ? 44.914  25.686  109.995  1.00 38.45  ? 194  LYS B CB    1 
ATOM   3289  C  CG    . LYS B  1  194  ? 43.814  26.723  110.140  1.00 37.45  ? 194  LYS B CG    1 
ATOM   3290  C  CD    . LYS B  1  194  ? 43.460  27.328  108.792  1.00 40.31  ? 194  LYS B CD    1 
ATOM   3291  C  CE    . LYS B  1  194  ? 42.392  28.397  108.927  1.00 42.58  ? 194  LYS B CE    1 
ATOM   3292  N  NZ    . LYS B  1  194  ? 42.074  29.028  107.618  1.00 46.44  ? 194  LYS B NZ    1 
ATOM   3293  N  N     . LEU B  1  195  ? 43.828  24.832  113.216  1.00 34.05  ? 195  LEU B N     1 
ATOM   3294  C  CA    . LEU B  1  195  ? 42.748  24.232  113.992  1.00 32.25  ? 195  LEU B CA    1 
ATOM   3295  C  C     . LEU B  1  195  ? 41.448  25.022  113.895  1.00 32.06  ? 195  LEU B C     1 
ATOM   3296  O  O     . LEU B  1  195  ? 41.416  26.216  114.178  1.00 32.61  ? 195  LEU B O     1 
ATOM   3297  C  CB    . LEU B  1  195  ? 43.161  24.066  115.457  1.00 31.56  ? 195  LEU B CB    1 
ATOM   3298  C  CG    . LEU B  1  195  ? 42.112  23.462  116.394  1.00 29.54  ? 195  LEU B CG    1 
ATOM   3299  C  CD1   . LEU B  1  195  ? 41.596  22.135  115.858  1.00 27.89  ? 195  LEU B CD1   1 
ATOM   3300  C  CD2   . LEU B  1  195  ? 42.692  23.286  117.786  1.00 31.86  ? 195  LEU B CD2   1 
ATOM   3301  N  N     . THR B  1  196  ? 40.378  24.346  113.487  1.00 31.22  ? 196  THR B N     1 
ATOM   3302  C  CA    . THR B  1  196  ? 39.057  24.964  113.448  1.00 31.65  ? 196  THR B CA    1 
ATOM   3303  C  C     . THR B  1  196  ? 38.137  24.278  114.451  1.00 31.60  ? 196  THR B C     1 
ATOM   3304  O  O     . THR B  1  196  ? 37.938  23.066  114.393  1.00 33.49  ? 196  THR B O     1 
ATOM   3305  C  CB    . THR B  1  196  ? 38.427  24.890  112.047  1.00 35.35  ? 196  THR B CB    1 
ATOM   3306  O  OG1   . THR B  1  196  ? 39.363  25.366  111.071  1.00 38.98  ? 196  THR B OG1   1 
ATOM   3307  C  CG2   . THR B  1  196  ? 37.161  25.734  111.988  1.00 34.24  ? 196  THR B CG2   1 
ATOM   3308  N  N     . LEU B  1  197  ? 37.588  25.062  115.373  1.00 29.48  ? 197  LEU B N     1 
ATOM   3309  C  CA    . LEU B  1  197  ? 36.796  24.530  116.472  1.00 26.48  ? 197  LEU B CA    1 
ATOM   3310  C  C     . LEU B  1  197  ? 35.393  25.130  116.470  1.00 27.45  ? 197  LEU B C     1 
ATOM   3311  O  O     . LEU B  1  197  ? 35.217  26.314  116.740  1.00 32.22  ? 197  LEU B O     1 
ATOM   3312  C  CB    . LEU B  1  197  ? 37.510  24.832  117.791  1.00 27.40  ? 197  LEU B CB    1 
ATOM   3313  C  CG    . LEU B  1  197  ? 37.189  24.020  119.043  1.00 24.33  ? 197  LEU B CG    1 
ATOM   3314  C  CD1   . LEU B  1  197  ? 36.886  22.585  118.683  1.00 26.83  ? 197  LEU B CD1   1 
ATOM   3315  C  CD2   . LEU B  1  197  ? 38.369  24.084  119.999  1.00 21.85  ? 197  LEU B CD2   1 
ATOM   3316  N  N     . ARG B  1  198  ? 34.396  24.303  116.175  1.00 24.50  ? 198  ARG B N     1 
ATOM   3317  C  CA    . ARG B  1  198  ? 33.009  24.748  116.110  1.00 23.78  ? 198  ARG B CA    1 
ATOM   3318  C  C     . ARG B  1  198  ? 32.233  24.282  117.336  1.00 26.84  ? 198  ARG B C     1 
ATOM   3319  O  O     . ARG B  1  198  ? 32.206  23.084  117.649  1.00 29.00  ? 198  ARG B O     1 
ATOM   3320  C  CB    . ARG B  1  198  ? 32.340  24.218  114.841  1.00 26.67  ? 198  ARG B CB    1 
ATOM   3321  C  CG    . ARG B  1  198  ? 33.034  24.616  113.548  1.00 29.00  ? 198  ARG B CG    1 
ATOM   3322  C  CD    . ARG B  1  198  ? 32.423  23.892  112.353  1.00 33.26  ? 198  ARG B CD    1 
ATOM   3323  N  NE    . ARG B  1  198  ? 31.020  24.247  112.151  1.00 36.98  ? 198  ARG B NE    1 
ATOM   3324  C  CZ    . ARG B  1  198  ? 30.211  23.639  111.288  1.00 35.23  ? 198  ARG B CZ    1 
ATOM   3325  N  NH1   . ARG B  1  198  ? 28.948  24.030  111.169  1.00 31.92  ? 198  ARG B NH1   1 
ATOM   3326  N  NH2   . ARG B  1  198  ? 30.663  22.637  110.545  1.00 33.19  ? 198  ARG B NH2   1 
ATOM   3327  N  N     . ILE B  1  199  ? 31.597  25.231  118.022  1.00 28.06  ? 199  ILE B N     1 
ATOM   3328  C  CA    . ILE B  1  199  ? 30.880  24.933  119.262  1.00 26.59  ? 199  ILE B CA    1 
ATOM   3329  C  C     . ILE B  1  199  ? 29.430  25.428  119.272  1.00 26.42  ? 199  ILE B C     1 
ATOM   3330  O  O     . ILE B  1  199  ? 29.157  26.610  119.039  1.00 27.99  ? 199  ILE B O     1 
ATOM   3331  C  CB    . ILE B  1  199  ? 31.609  25.516  120.493  1.00 25.30  ? 199  ILE B CB    1 
ATOM   3332  C  CG1   . ILE B  1  199  ? 33.058  25.027  120.545  1.00 23.55  ? 199  ILE B CG1   1 
ATOM   3333  C  CG2   . ILE B  1  199  ? 30.877  25.142  121.769  1.00 26.08  ? 199  ILE B CG2   1 
ATOM   3334  C  CD1   . ILE B  1  199  ? 33.875  25.656  121.650  1.00 21.87  ? 199  ILE B CD1   1 
ATOM   3335  N  N     . TRP B  1  200  ? 28.512  24.503  119.546  1.00 26.03  ? 200  TRP B N     1 
ATOM   3336  C  CA    . TRP B  1  200  ? 27.095  24.804  119.716  1.00 30.52  ? 200  TRP B CA    1 
ATOM   3337  C  C     . TRP B  1  200  ? 26.692  24.647  121.176  1.00 32.41  ? 200  TRP B C     1 
ATOM   3338  O  O     . TRP B  1  200  ? 26.821  23.557  121.745  1.00 30.96  ? 200  TRP B O     1 
ATOM   3339  C  CB    . TRP B  1  200  ? 26.234  23.843  118.895  1.00 31.59  ? 200  TRP B CB    1 
ATOM   3340  C  CG    . TRP B  1  200  ? 26.286  24.029  117.416  1.00 29.98  ? 200  TRP B CG    1 
ATOM   3341  C  CD1   . TRP B  1  200  ? 25.408  24.736  116.648  1.00 26.45  ? 200  TRP B CD1   1 
ATOM   3342  C  CD2   . TRP B  1  200  ? 27.250  23.473  116.516  1.00 30.85  ? 200  TRP B CD2   1 
ATOM   3343  N  NE1   . TRP B  1  200  ? 25.772  24.664  115.327  1.00 28.49  ? 200  TRP B NE1   1 
ATOM   3344  C  CE2   . TRP B  1  200  ? 26.900  23.894  115.219  1.00 29.35  ? 200  TRP B CE2   1 
ATOM   3345  C  CE3   . TRP B  1  200  ? 28.379  22.665  116.683  1.00 29.61  ? 200  TRP B CE3   1 
ATOM   3346  C  CZ2   . TRP B  1  200  ? 27.639  23.536  114.094  1.00 28.87  ? 200  TRP B CZ2   1 
ATOM   3347  C  CZ3   . TRP B  1  200  ? 29.111  22.310  115.566  1.00 29.50  ? 200  TRP B CZ3   1 
ATOM   3348  C  CH2   . TRP B  1  200  ? 28.738  22.745  114.288  1.00 30.34  ? 200  TRP B CH2   1 
ATOM   3349  N  N     . THR B  1  201  ? 26.187  25.726  121.770  1.00 37.09  ? 201  THR B N     1 
ATOM   3350  C  CA    . THR B  1  201  ? 25.675  25.690  123.137  1.00 36.92  ? 201  THR B CA    1 
ATOM   3351  C  C     . THR B  1  201  ? 24.195  26.066  123.178  1.00 41.86  ? 201  THR B C     1 
ATOM   3352  O  O     . THR B  1  201  ? 23.596  26.372  122.147  1.00 41.70  ? 201  THR B O     1 
ATOM   3353  C  CB    . THR B  1  201  ? 26.448  26.645  124.060  1.00 36.19  ? 201  THR B CB    1 
ATOM   3354  O  OG1   . THR B  1  201  ? 26.058  27.999  123.795  1.00 36.25  ? 201  THR B OG1   1 
ATOM   3355  C  CG2   . THR B  1  201  ? 27.948  26.498  123.856  1.00 38.85  ? 201  THR B CG2   1 
ATOM   3356  N  N     . ASP B  1  202  ? 23.613  26.043  124.375  1.00 44.29  ? 202  ASP B N     1 
ATOM   3357  C  CA    . ASP B  1  202  ? 22.189  26.332  124.544  1.00 45.01  ? 202  ASP B CA    1 
ATOM   3358  C  C     . ASP B  1  202  ? 21.885  27.776  124.952  1.00 45.17  ? 202  ASP B C     1 
ATOM   3359  O  O     . ASP B  1  202  ? 20.722  28.156  125.086  1.00 46.12  ? 202  ASP B O     1 
ATOM   3360  C  CB    . ASP B  1  202  ? 21.552  25.358  125.542  1.00 45.94  ? 202  ASP B CB    1 
ATOM   3361  C  CG    . ASP B  1  202  ? 22.299  25.298  126.864  1.00 50.54  ? 202  ASP B CG    1 
ATOM   3362  O  OD1   . ASP B  1  202  ? 23.024  26.260  127.194  1.00 50.06  ? 202  ASP B OD1   1 
ATOM   3363  O  OD2   . ASP B  1  202  ? 22.154  24.283  127.579  1.00 54.28  ? 202  ASP B OD2   1 
ATOM   3364  N  N     . GLY B  1  203  ? 22.927  28.574  125.155  1.00 44.38  ? 203  GLY B N     1 
ATOM   3365  C  CA    . GLY B  1  203  ? 22.739  29.962  125.534  1.00 46.00  ? 203  GLY B CA    1 
ATOM   3366  C  C     . GLY B  1  203  ? 22.955  30.235  127.010  1.00 47.51  ? 203  GLY B C     1 
ATOM   3367  O  O     . GLY B  1  203  ? 23.148  31.384  127.408  1.00 48.24  ? 203  GLY B O     1 
ATOM   3368  N  N     . SER B  1  204  ? 22.909  29.186  127.827  1.00 47.41  ? 204  SER B N     1 
ATOM   3369  C  CA    . SER B  1  204  ? 23.207  29.320  129.250  1.00 46.16  ? 204  SER B CA    1 
ATOM   3370  C  C     . SER B  1  204  ? 24.684  29.654  129.420  1.00 46.17  ? 204  SER B C     1 
ATOM   3371  O  O     . SER B  1  204  ? 25.053  30.527  130.206  1.00 52.28  ? 204  SER B O     1 
ATOM   3372  C  CB    . SER B  1  204  ? 22.865  28.034  130.002  1.00 42.53  ? 204  SER B CB    1 
ATOM   3373  O  OG    . SER B  1  204  ? 23.720  26.973  129.615  1.00 43.99  ? 204  SER B OG    1 
ATOM   3374  N  N     . VAL B  1  205  ? 25.522  28.946  128.672  1.00 41.96  ? 205  VAL B N     1 
ATOM   3375  C  CA    . VAL B  1  205  ? 26.946  29.240  128.605  1.00 39.87  ? 205  VAL B CA    1 
ATOM   3376  C  C     . VAL B  1  205  ? 27.304  29.530  127.155  1.00 40.96  ? 205  VAL B C     1 
ATOM   3377  O  O     . VAL B  1  205  ? 26.942  28.768  126.264  1.00 40.51  ? 205  VAL B O     1 
ATOM   3378  C  CB    . VAL B  1  205  ? 27.789  28.052  129.103  1.00 36.98  ? 205  VAL B CB    1 
ATOM   3379  C  CG1   . VAL B  1  205  ? 29.273  28.348  128.949  1.00 35.57  ? 205  VAL B CG1   1 
ATOM   3380  C  CG2   . VAL B  1  205  ? 27.449  27.727  130.549  1.00 37.81  ? 205  VAL B CG2   1 
ATOM   3381  N  N     . THR B  1  206  ? 27.999  30.637  126.912  1.00 40.43  ? 206  THR B N     1 
ATOM   3382  C  CA    . THR B  1  206  ? 28.402  30.987  125.554  1.00 40.10  ? 206  THR B CA    1 
ATOM   3383  C  C     . THR B  1  206  ? 29.533  30.068  125.097  1.00 41.93  ? 206  THR B C     1 
ATOM   3384  O  O     . THR B  1  206  ? 30.281  29.550  125.929  1.00 41.26  ? 206  THR B O     1 
ATOM   3385  C  CB    . THR B  1  206  ? 28.856  32.458  125.456  1.00 36.85  ? 206  THR B CB    1 
ATOM   3386  O  OG1   . THR B  1  206  ? 30.249  32.558  125.777  1.00 36.93  ? 206  THR B OG1   1 
ATOM   3387  C  CG2   . THR B  1  206  ? 28.045  33.330  126.399  1.00 41.37  ? 206  THR B CG2   1 
ATOM   3388  N  N     . PRO B  1  207  ? 29.649  29.848  123.775  1.00 38.27  ? 207  PRO B N     1 
ATOM   3389  C  CA    . PRO B  1  207  ? 30.717  29.017  123.205  1.00 36.40  ? 207  PRO B CA    1 
ATOM   3390  C  C     . PRO B  1  207  ? 32.112  29.438  123.662  1.00 37.29  ? 207  PRO B C     1 
ATOM   3391  O  O     . PRO B  1  207  ? 32.931  28.577  123.992  1.00 37.55  ? 207  PRO B O     1 
ATOM   3392  C  CB    . PRO B  1  207  ? 30.562  29.249  121.702  1.00 35.75  ? 207  PRO B CB    1 
ATOM   3393  C  CG    . PRO B  1  207  ? 29.112  29.501  121.529  1.00 36.13  ? 207  PRO B CG    1 
ATOM   3394  C  CD    . PRO B  1  207  ? 28.689  30.279  122.743  1.00 37.06  ? 207  PRO B CD    1 
ATOM   3395  N  N     . LEU B  1  208  ? 32.375  30.741  123.685  1.00 35.97  ? 208  LEU B N     1 
ATOM   3396  C  CA    . LEU B  1  208  ? 33.669  31.248  124.128  1.00 36.11  ? 208  LEU B CA    1 
ATOM   3397  C  C     . LEU B  1  208  ? 33.921  30.901  125.593  1.00 34.31  ? 208  LEU B C     1 
ATOM   3398  O  O     . LEU B  1  208  ? 34.980  30.371  125.942  1.00 33.33  ? 208  LEU B O     1 
ATOM   3399  C  CB    . LEU B  1  208  ? 33.760  32.760  123.913  1.00 37.16  ? 208  LEU B CB    1 
ATOM   3400  C  CG    . LEU B  1  208  ? 35.064  33.428  124.358  1.00 38.70  ? 208  LEU B CG    1 
ATOM   3401  C  CD1   . LEU B  1  208  ? 36.264  32.768  123.696  1.00 38.20  ? 208  LEU B CD1   1 
ATOM   3402  C  CD2   . LEU B  1  208  ? 35.037  34.917  124.052  1.00 41.46  ? 208  LEU B CD2   1 
ATOM   3403  N  N     . GLU B  1  209  ? 32.940  31.202  126.440  1.00 33.34  ? 209  GLU B N     1 
ATOM   3404  C  CA    . GLU B  1  209  ? 33.013  30.878  127.861  1.00 32.54  ? 209  GLU B CA    1 
ATOM   3405  C  C     . GLU B  1  209  ? 33.273  29.391  128.060  1.00 34.85  ? 209  GLU B C     1 
ATOM   3406  O  O     . GLU B  1  209  ? 34.130  29.002  128.856  1.00 36.58  ? 209  GLU B O     1 
ATOM   3407  C  CB    . GLU B  1  209  ? 31.716  31.275  128.571  1.00 35.28  ? 209  GLU B CB    1 
ATOM   3408  C  CG    . GLU B  1  209  ? 31.487  32.776  128.680  1.00 39.49  ? 209  GLU B CG    1 
ATOM   3409  C  CD    . GLU B  1  209  ? 30.130  33.116  129.270  1.00 42.46  ? 209  GLU B CD    1 
ATOM   3410  O  OE1   . GLU B  1  209  ? 29.774  34.314  129.302  1.00 41.30  ? 209  GLU B OE1   1 
ATOM   3411  O  OE2   . GLU B  1  209  ? 29.416  32.186  129.701  1.00 43.34  ? 209  GLU B OE2   1 
ATOM   3412  N  N     . ALA B  1  210  ? 32.533  28.568  127.322  1.00 34.45  ? 210  ALA B N     1 
ATOM   3413  C  CA    . ALA B  1  210  ? 32.678  27.119  127.395  1.00 33.89  ? 210  ALA B CA    1 
ATOM   3414  C  C     . ALA B  1  210  ? 34.096  26.681  127.040  1.00 32.71  ? 210  ALA B C     1 
ATOM   3415  O  O     . ALA B  1  210  ? 34.710  25.891  127.762  1.00 33.92  ? 210  ALA B O     1 
ATOM   3416  C  CB    . ALA B  1  210  ? 31.667  26.442  126.482  1.00 32.62  ? 210  ALA B CB    1 
ATOM   3417  N  N     . LEU B  1  211  ? 34.610  27.202  125.929  1.00 30.84  ? 211  LEU B N     1 
ATOM   3418  C  CA    . LEU B  1  211  ? 35.970  26.904  125.489  1.00 30.78  ? 211  LEU B CA    1 
ATOM   3419  C  C     . LEU B  1  211  ? 36.997  27.276  126.558  1.00 32.89  ? 211  LEU B C     1 
ATOM   3420  O  O     . LEU B  1  211  ? 37.928  26.512  126.835  1.00 31.72  ? 211  LEU B O     1 
ATOM   3421  C  CB    . LEU B  1  211  ? 36.277  27.634  124.179  1.00 31.14  ? 211  LEU B CB    1 
ATOM   3422  C  CG    . LEU B  1  211  ? 37.707  27.540  123.638  1.00 31.40  ? 211  LEU B CG    1 
ATOM   3423  C  CD1   . LEU B  1  211  ? 38.131  26.090  123.461  1.00 28.58  ? 211  LEU B CD1   1 
ATOM   3424  C  CD2   . LEU B  1  211  ? 37.832  28.301  122.325  1.00 33.08  ? 211  LEU B CD2   1 
ATOM   3425  N  N     . ASN B  1  212  ? 36.819  28.448  127.160  1.00 34.80  ? 212  ASN B N     1 
ATOM   3426  C  CA    . ASN B  1  212  ? 37.716  28.900  128.220  1.00 35.09  ? 212  ASN B CA    1 
ATOM   3427  C  C     . ASN B  1  212  ? 37.669  28.000  129.456  1.00 34.57  ? 212  ASN B C     1 
ATOM   3428  O  O     . ASN B  1  212  ? 38.704  27.711  130.068  1.00 34.61  ? 212  ASN B O     1 
ATOM   3429  C  CB    . ASN B  1  212  ? 37.423  30.355  128.594  1.00 34.28  ? 212  ASN B CB    1 
ATOM   3430  C  CG    . ASN B  1  212  ? 37.765  31.324  127.476  1.00 32.52  ? 212  ASN B CG    1 
ATOM   3431  O  OD1   . ASN B  1  212  ? 36.903  32.050  126.982  1.00 32.35  ? 212  ASN B OD1   1 
ATOM   3432  N  ND2   . ASN B  1  212  ? 39.031  31.337  127.071  1.00 29.45  ? 212  ASN B ND2   1 
ATOM   3433  N  N     . GLN B  1  213  ? 36.468  27.555  129.818  1.00 32.64  ? 213  GLN B N     1 
ATOM   3434  C  CA    . GLN B  1  213  ? 36.312  26.622  130.927  1.00 33.62  ? 213  GLN B CA    1 
ATOM   3435  C  C     . GLN B  1  213  ? 37.016  25.311  130.604  1.00 31.33  ? 213  GLN B C     1 
ATOM   3436  O  O     . GLN B  1  213  ? 37.601  24.674  131.482  1.00 31.33  ? 213  GLN B O     1 
ATOM   3437  C  CB    . GLN B  1  213  ? 34.833  26.364  131.221  1.00 32.04  ? 213  GLN B CB    1 
ATOM   3438  C  CG    . GLN B  1  213  ? 34.063  27.591  131.677  1.00 33.53  ? 213  GLN B CG    1 
ATOM   3439  C  CD    . GLN B  1  213  ? 32.626  27.274  132.041  1.00 36.15  ? 213  GLN B CD    1 
ATOM   3440  O  OE1   . GLN B  1  213  ? 32.345  26.258  132.678  1.00 38.23  ? 213  GLN B OE1   1 
ATOM   3441  N  NE2   . GLN B  1  213  ? 31.706  28.142  131.634  1.00 33.18  ? 213  GLN B NE2   1 
ATOM   3442  N  N     . ALA B  1  214  ? 36.966  24.923  129.334  1.00 28.90  ? 214  ALA B N     1 
ATOM   3443  C  CA    . ALA B  1  214  ? 37.601  23.692  128.882  1.00 29.26  ? 214  ALA B CA    1 
ATOM   3444  C  C     . ALA B  1  214  ? 39.124  23.768  128.979  1.00 32.32  ? 214  ALA B C     1 
ATOM   3445  O  O     . ALA B  1  214  ? 39.765  22.863  129.525  1.00 32.19  ? 214  ALA B O     1 
ATOM   3446  C  CB    . ALA B  1  214  ? 37.171  23.364  127.461  1.00 29.70  ? 214  ALA B CB    1 
ATOM   3447  N  N     . VAL B  1  215  ? 39.702  24.846  128.453  1.00 31.15  ? 215  VAL B N     1 
ATOM   3448  C  CA    . VAL B  1  215  ? 41.152  25.011  128.512  1.00 29.74  ? 215  VAL B CA    1 
ATOM   3449  C  C     . VAL B  1  215  ? 41.623  25.158  129.961  1.00 34.48  ? 215  VAL B C     1 
ATOM   3450  O  O     . VAL B  1  215  ? 42.704  24.682  130.322  1.00 36.44  ? 215  VAL B O     1 
ATOM   3451  C  CB    . VAL B  1  215  ? 41.659  26.186  127.632  1.00 27.19  ? 215  VAL B CB    1 
ATOM   3452  C  CG1   . VAL B  1  215  ? 41.211  25.998  126.193  1.00 30.44  ? 215  VAL B CG1   1 
ATOM   3453  C  CG2   . VAL B  1  215  ? 41.182  27.524  128.164  1.00 30.50  ? 215  VAL B CG2   1 
ATOM   3454  N  N     . GLU B  1  216  ? 40.797  25.794  130.790  1.00 33.23  ? 216  GLU B N     1 
ATOM   3455  C  CA    . GLU B  1  216  ? 41.093  25.913  132.214  1.00 36.40  ? 216  GLU B CA    1 
ATOM   3456  C  C     . GLU B  1  216  ? 41.138  24.538  132.877  1.00 35.19  ? 216  GLU B C     1 
ATOM   3457  O  O     . GLU B  1  216  ? 42.084  24.219  133.604  1.00 38.43  ? 216  GLU B O     1 
ATOM   3458  C  CB    . GLU B  1  216  ? 40.062  26.808  132.908  1.00 38.65  ? 216  GLU B CB    1 
ATOM   3459  C  CG    . GLU B  1  216  ? 40.115  26.770  134.435  1.00 47.23  ? 216  GLU B CG    1 
ATOM   3460  C  CD    . GLU B  1  216  ? 41.393  27.366  135.011  1.00 51.16  ? 216  GLU B CD    1 
ATOM   3461  O  OE1   . GLU B  1  216  ? 41.711  27.067  136.182  1.00 50.48  ? 216  GLU B OE1   1 
ATOM   3462  O  OE2   . GLU B  1  216  ? 42.073  28.138  134.302  1.00 48.98  ? 216  GLU B OE2   1 
ATOM   3463  N  N     . ILE B  1  217  ? 40.113  23.731  132.618  1.00 29.51  ? 217  ILE B N     1 
ATOM   3464  C  CA    . ILE B  1  217  ? 40.047  22.371  133.146  1.00 29.47  ? 217  ILE B CA    1 
ATOM   3465  C  C     . ILE B  1  217  ? 41.263  21.550  132.723  1.00 32.96  ? 217  ILE B C     1 
ATOM   3466  O  O     . ILE B  1  217  ? 41.883  20.869  133.545  1.00 32.75  ? 217  ILE B O     1 
ATOM   3467  C  CB    . ILE B  1  217  ? 38.756  21.656  132.701  1.00 27.33  ? 217  ILE B CB    1 
ATOM   3468  C  CG1   . ILE B  1  217  ? 37.550  22.227  133.449  1.00 28.88  ? 217  ILE B CG1   1 
ATOM   3469  C  CG2   . ILE B  1  217  ? 38.855  20.159  132.945  1.00 27.00  ? 217  ILE B CG2   1 
ATOM   3470  C  CD1   . ILE B  1  217  ? 36.226  21.646  133.010  1.00 28.19  ? 217  ILE B CD1   1 
ATOM   3471  N  N     . LEU B  1  218  ? 41.608  21.630  131.441  1.00 34.86  ? 218  LEU B N     1 
ATOM   3472  C  CA    . LEU B  1  218  ? 42.764  20.902  130.926  1.00 34.73  ? 218  LEU B CA    1 
ATOM   3473  C  C     . LEU B  1  218  ? 44.058  21.336  131.614  1.00 35.51  ? 218  LEU B C     1 
ATOM   3474  O  O     . LEU B  1  218  ? 44.869  20.496  132.006  1.00 34.92  ? 218  LEU B O     1 
ATOM   3475  C  CB    . LEU B  1  218  ? 42.887  21.070  129.411  1.00 29.84  ? 218  LEU B CB    1 
ATOM   3476  C  CG    . LEU B  1  218  ? 44.009  20.264  128.754  1.00 29.84  ? 218  LEU B CG    1 
ATOM   3477  C  CD1   . LEU B  1  218  ? 43.917  18.797  129.141  1.00 27.93  ? 218  LEU B CD1   1 
ATOM   3478  C  CD2   . LEU B  1  218  ? 43.962  20.420  127.245  1.00 34.81  ? 218  LEU B CD2   1 
ATOM   3479  N  N     . ARG B  1  219  ? 44.242  22.645  131.763  1.00 34.69  ? 219  ARG B N     1 
ATOM   3480  C  CA    . ARG B  1  219  ? 45.438  23.177  132.410  1.00 34.57  ? 219  ARG B CA    1 
ATOM   3481  C  C     . ARG B  1  219  ? 45.550  22.692  133.855  1.00 37.58  ? 219  ARG B C     1 
ATOM   3482  O  O     . ARG B  1  219  ? 46.603  22.197  134.286  1.00 36.40  ? 219  ARG B O     1 
ATOM   3483  C  CB    . ARG B  1  219  ? 45.426  24.705  132.375  1.00 35.62  ? 219  ARG B CB    1 
ATOM   3484  C  CG    . ARG B  1  219  ? 46.713  25.343  132.868  1.00 43.44  ? 219  ARG B CG    1 
ATOM   3485  C  CD    . ARG B  1  219  ? 46.497  26.803  133.217  1.00 45.09  ? 219  ARG B CD    1 
ATOM   3486  N  NE    . ARG B  1  219  ? 45.430  26.960  134.202  1.00 47.35  ? 219  ARG B NE    1 
ATOM   3487  C  CZ    . ARG B  1  219  ? 45.595  26.804  135.511  1.00 45.74  ? 219  ARG B CZ    1 
ATOM   3488  N  NH1   . ARG B  1  219  ? 46.787  26.485  135.998  1.00 43.91  ? 219  ARG B NH1   1 
ATOM   3489  N  NH2   . ARG B  1  219  ? 44.567  26.964  136.334  1.00 43.80  ? 219  ARG B NH2   1 
ATOM   3490  N  N     . GLU B  1  220  ? 44.454  22.834  134.597  1.00 39.55  ? 220  GLU B N     1 
ATOM   3491  C  CA    . GLU B  1  220  ? 44.406  22.386  135.985  1.00 40.77  ? 220  GLU B CA    1 
ATOM   3492  C  C     . GLU B  1  220  ? 44.679  20.888  136.086  1.00 39.60  ? 220  GLU B C     1 
ATOM   3493  O  O     . GLU B  1  220  ? 45.259  20.419  137.066  1.00 39.41  ? 220  GLU B O     1 
ATOM   3494  C  CB    . GLU B  1  220  ? 43.059  22.733  136.625  1.00 40.88  ? 220  GLU B CB    1 
ATOM   3495  C  CG    . GLU B  1  220  ? 42.947  22.323  138.086  1.00 49.57  ? 220  GLU B CG    1 
ATOM   3496  C  CD    . GLU B  1  220  ? 41.681  22.835  138.744  1.00 64.47  ? 220  GLU B CD    1 
ATOM   3497  O  OE1   . GLU B  1  220  ? 41.113  23.830  138.246  1.00 68.49  ? 220  GLU B OE1   1 
ATOM   3498  O  OE2   . GLU B  1  220  ? 41.255  22.241  139.759  1.00 58.42  ? 220  GLU B OE2   1 
ATOM   3499  N  N     . HIS B  1  221  ? 44.267  20.140  135.067  1.00 37.94  ? 221  HIS B N     1 
ATOM   3500  C  CA    . HIS B  1  221  ? 44.583  18.717  135.004  1.00 36.23  ? 221  HIS B CA    1 
ATOM   3501  C  C     . HIS B  1  221  ? 46.061  18.485  134.702  1.00 36.29  ? 221  HIS B C     1 
ATOM   3502  O  O     . HIS B  1  221  ? 46.624  17.456  135.077  1.00 32.88  ? 221  HIS B O     1 
ATOM   3503  C  CB    . HIS B  1  221  ? 43.712  18.007  133.967  1.00 34.02  ? 221  HIS B CB    1 
ATOM   3504  C  CG    . HIS B  1  221  ? 42.439  17.456  134.527  1.00 33.43  ? 221  HIS B CG    1 
ATOM   3505  N  ND1   . HIS B  1  221  ? 41.360  18.251  134.845  1.00 36.99  ? 221  HIS B ND1   1 
ATOM   3506  C  CD2   . HIS B  1  221  ? 42.077  16.189  134.834  1.00 34.83  ? 221  HIS B CD2   1 
ATOM   3507  C  CE1   . HIS B  1  221  ? 40.385  17.497  135.319  1.00 35.85  ? 221  HIS B CE1   1 
ATOM   3508  N  NE2   . HIS B  1  221  ? 40.794  16.241  135.323  1.00 36.10  ? 221  HIS B NE2   1 
ATOM   3509  N  N     . LEU B  1  222  ? 46.683  19.443  134.019  1.00 35.54  ? 222  LEU B N     1 
ATOM   3510  C  CA    . LEU B  1  222  ? 48.108  19.357  133.716  1.00 33.64  ? 222  LEU B CA    1 
ATOM   3511  C  C     . LEU B  1  222  ? 48.948  19.671  134.946  1.00 37.04  ? 222  LEU B C     1 
ATOM   3512  O  O     . LEU B  1  222  ? 50.098  19.242  135.049  1.00 36.68  ? 222  LEU B O     1 
ATOM   3513  C  CB    . LEU B  1  222  ? 48.483  20.300  132.573  1.00 30.28  ? 222  LEU B CB    1 
ATOM   3514  C  CG    . LEU B  1  222  ? 47.966  19.913  131.189  1.00 28.37  ? 222  LEU B CG    1 
ATOM   3515  C  CD1   . LEU B  1  222  ? 48.473  20.891  130.146  1.00 30.67  ? 222  LEU B CD1   1 
ATOM   3516  C  CD2   . LEU B  1  222  ? 48.379  18.492  130.848  1.00 25.61  ? 222  LEU B CD2   1 
ATOM   3517  N  N     . THR B  1  223  ? 48.370  20.422  135.878  1.00 38.98  ? 223  THR B N     1 
ATOM   3518  C  CA    . THR B  1  223  ? 49.075  20.756  137.115  1.00 38.93  ? 223  THR B CA    1 
ATOM   3519  C  C     . THR B  1  223  ? 49.289  19.548  138.035  1.00 38.19  ? 223  THR B C     1 
ATOM   3520  O  O     . THR B  1  223  ? 50.142  19.581  138.921  1.00 41.19  ? 223  THR B O     1 
ATOM   3521  C  CB    . THR B  1  223  ? 48.345  21.861  137.901  1.00 38.61  ? 223  THR B CB    1 
ATOM   3522  O  OG1   . THR B  1  223  ? 47.049  21.393  138.296  1.00 44.56  ? 223  THR B OG1   1 
ATOM   3523  C  CG2   . THR B  1  223  ? 48.193  23.110  137.047  1.00 37.10  ? 223  THR B CG2   1 
ATOM   3524  N  N     . TYR B  1  224  ? 48.520  18.485  137.816  1.00 36.52  ? 224  TYR B N     1 
ATOM   3525  C  CA    . TYR B  1  224  ? 48.554  17.301  138.677  1.00 35.34  ? 224  TYR B CA    1 
ATOM   3526  C  C     . TYR B  1  224  ? 49.863  16.511  138.600  1.00 37.46  ? 224  TYR B C     1 
ATOM   3527  O  O     . TYR B  1  224  ? 50.076  15.577  139.372  1.00 41.09  ? 224  TYR B O     1 
ATOM   3528  C  CB    . TYR B  1  224  ? 47.376  16.374  138.361  1.00 38.12  ? 224  TYR B CB    1 
ATOM   3529  C  CG    . TYR B  1  224  ? 46.014  16.973  138.642  1.00 39.51  ? 224  TYR B CG    1 
ATOM   3530  C  CD1   . TYR B  1  224  ? 45.852  17.968  139.598  1.00 38.71  ? 224  TYR B CD1   1 
ATOM   3531  C  CD2   . TYR B  1  224  ? 44.890  16.542  137.948  1.00 39.40  ? 224  TYR B CD2   1 
ATOM   3532  C  CE1   . TYR B  1  224  ? 44.606  18.517  139.855  1.00 42.94  ? 224  TYR B CE1   1 
ATOM   3533  C  CE2   . TYR B  1  224  ? 43.641  17.084  138.198  1.00 40.04  ? 224  TYR B CE2   1 
ATOM   3534  C  CZ    . TYR B  1  224  ? 43.505  18.071  139.153  1.00 42.30  ? 224  TYR B CZ    1 
ATOM   3535  O  OH    . TYR B  1  224  ? 42.264  18.613  139.404  1.00 39.63  ? 224  TYR B OH    1 
ATOM   3536  N  N     . PHE B  1  225  ? 50.729  16.879  137.664  1.00 38.93  ? 225  PHE B N     1 
ATOM   3537  C  CA    . PHE B  1  225  ? 51.988  16.166  137.460  1.00 43.17  ? 225  PHE B CA    1 
ATOM   3538  C  C     . PHE B  1  225  ? 53.151  16.737  138.278  1.00 48.94  ? 225  PHE B C     1 
ATOM   3539  O  O     . PHE B  1  225  ? 54.301  16.332  138.106  1.00 49.03  ? 225  PHE B O     1 
ATOM   3540  C  CB    . PHE B  1  225  ? 52.336  16.100  135.971  1.00 39.17  ? 225  PHE B CB    1 
ATOM   3541  C  CG    . PHE B  1  225  ? 51.473  15.146  135.193  1.00 34.69  ? 225  PHE B CG    1 
ATOM   3542  C  CD1   . PHE B  1  225  ? 50.365  15.598  134.493  1.00 34.76  ? 225  PHE B CD1   1 
ATOM   3543  C  CD2   . PHE B  1  225  ? 51.764  13.792  135.171  1.00 32.05  ? 225  PHE B CD2   1 
ATOM   3544  C  CE1   . PHE B  1  225  ? 49.568  14.717  133.781  1.00 31.51  ? 225  PHE B CE1   1 
ATOM   3545  C  CE2   . PHE B  1  225  ? 50.973  12.907  134.460  1.00 29.70  ? 225  PHE B CE2   1 
ATOM   3546  C  CZ    . PHE B  1  225  ? 49.874  13.370  133.765  1.00 28.10  ? 225  PHE B CZ    1 
ATOM   3547  N  N     . SER B  1  226  ? 52.844  17.687  139.157  1.00 51.30  ? 226  SER B N     1 
ATOM   3548  C  CA    . SER B  1  226  ? 53.864  18.356  139.965  1.00 57.98  ? 226  SER B CA    1 
ATOM   3549  C  C     . SER B  1  226  ? 54.426  17.510  141.118  1.00 63.06  ? 226  SER B C     1 
ATOM   3550  O  O     . SER B  1  226  ? 55.602  17.147  141.108  1.00 65.53  ? 226  SER B O     1 
ATOM   3551  C  CB    . SER B  1  226  ? 53.328  19.685  140.508  1.00 57.46  ? 226  SER B CB    1 
ATOM   3552  O  OG    . SER B  1  226  ? 52.989  20.568  139.454  1.00 62.43  ? 226  SER B OG    1 
ATOM   3553  N  N     . ASN B  1  227  ? 53.590  17.205  142.108  1.00 60.96  ? 227  ASN B N     1 
ATOM   3554  C  CA    . ASN B  1  227  ? 54.061  16.581  143.347  1.00 60.67  ? 227  ASN B CA    1 
ATOM   3555  C  C     . ASN B  1  227  ? 53.879  15.063  143.426  1.00 56.66  ? 227  ASN B C     1 
ATOM   3556  O  O     . ASN B  1  227  ? 52.753  14.572  143.511  1.00 57.24  ? 227  ASN B O     1 
ATOM   3557  C  CB    . ASN B  1  227  ? 53.389  17.243  144.555  1.00 62.43  ? 227  ASN B CB    1 
ATOM   3558  C  CG    . ASN B  1  227  ? 53.870  16.673  145.877  1.00 71.16  ? 227  ASN B CG    1 
ATOM   3559  O  OD1   . ASN B  1  227  ? 53.362  15.657  146.352  1.00 70.59  ? 227  ASN B OD1   1 
ATOM   3560  N  ND2   . ASN B  1  227  ? 54.852  17.333  146.482  1.00 76.63  ? 227  ASN B ND2   1 
ATOM   3561  N  N     . PRO B  1  228  ? 54.995  14.315  143.412  1.00 51.86  ? 228  PRO B N     1 
ATOM   3562  C  CA    . PRO B  1  228  ? 54.966  12.855  143.550  1.00 51.75  ? 228  PRO B CA    1 
ATOM   3563  C  C     . PRO B  1  228  ? 54.617  12.423  144.972  1.00 49.48  ? 228  PRO B C     1 
ATOM   3564  O  O     . PRO B  1  228  ? 54.869  11.270  145.329  1.00 43.58  ? 228  PRO B O     1 
ATOM   3565  C  CB    . PRO B  1  228  ? 56.406  12.441  143.218  1.00 49.17  ? 228  PRO B CB    1 
ATOM   3566  C  CG    . PRO B  1  228  ? 57.004  13.619  142.512  1.00 47.28  ? 228  PRO B CG    1 
ATOM   3567  C  CD    . PRO B  1  228  ? 56.351  14.809  143.130  1.00 50.69  ? 228  PRO B CD    1 
ATOM   3568  N  N     . MET C  2  1    ? 67.500  -15.467 114.883  1.00 52.55  ? 1    MET C N     1 
ATOM   3569  C  CA    . MET C  2  1    ? 66.210  -16.028 115.264  1.00 53.97  ? 1    MET C CA    1 
ATOM   3570  C  C     . MET C  2  1    ? 66.046  -17.438 114.705  1.00 57.40  ? 1    MET C C     1 
ATOM   3571  O  O     . MET C  2  1    ? 66.702  -17.809 113.730  1.00 60.28  ? 1    MET C O     1 
ATOM   3572  C  CB    . MET C  2  1    ? 65.068  -15.132 114.779  1.00 51.52  ? 1    MET C CB    1 
ATOM   3573  C  CG    . MET C  2  1    ? 64.758  -15.256 113.294  1.00 52.09  ? 1    MET C CG    1 
ATOM   3574  S  SD    . MET C  2  1    ? 64.971  -13.710 112.385  1.00 81.59  ? 1    MET C SD    1 
ATOM   3575  C  CE    . MET C  2  1    ? 66.755  -13.622 112.250  1.00 57.47  ? 1    MET C CE    1 
ATOM   3576  N  N     . GLU C  2  2    ? 65.171  -18.221 115.328  1.00 54.01  ? 2    GLU C N     1 
ATOM   3577  C  CA    . GLU C  2  2    ? 64.940  -19.599 114.908  1.00 57.76  ? 2    GLU C CA    1 
ATOM   3578  C  C     . GLU C  2  2    ? 64.099  -19.657 113.638  1.00 52.88  ? 2    GLU C C     1 
ATOM   3579  O  O     . GLU C  2  2    ? 63.196  -18.844 113.442  1.00 47.07  ? 2    GLU C O     1 
ATOM   3580  C  CB    . GLU C  2  2    ? 64.258  -20.393 116.026  1.00 55.53  ? 2    GLU C CB    1 
ATOM   3581  C  CG    . GLU C  2  2    ? 64.071  -21.869 115.713  1.00 59.92  ? 2    GLU C CG    1 
ATOM   3582  C  CD    . GLU C  2  2    ? 63.368  -22.616 116.824  1.00 71.36  ? 2    GLU C CD    1 
ATOM   3583  O  OE1   . GLU C  2  2    ? 63.983  -23.541 117.396  1.00 79.39  ? 2    GLU C OE1   1 
ATOM   3584  O  OE2   . GLU C  2  2    ? 62.202  -22.282 117.123  1.00 72.50  ? 2    GLU C OE2   1 
ATOM   3585  N  N     . ILE C  2  3    ? 64.409  -20.614 112.769  1.00 51.83  ? 3    ILE C N     1 
ATOM   3586  C  CA    . ILE C  2  3    ? 63.598  -20.848 111.585  1.00 45.02  ? 3    ILE C CA    1 
ATOM   3587  C  C     . ILE C  2  3    ? 62.851  -22.163 111.749  1.00 43.16  ? 3    ILE C C     1 
ATOM   3588  O  O     . ILE C  2  3    ? 63.447  -23.238 111.663  1.00 45.60  ? 3    ILE C O     1 
ATOM   3589  C  CB    . ILE C  2  3    ? 64.465  -20.932 110.311  1.00 37.77  ? 3    ILE C CB    1 
ATOM   3590  C  CG1   . ILE C  2  3    ? 65.545  -19.847 110.312  1.00 41.46  ? 3    ILE C CG1   1 
ATOM   3591  C  CG2   . ILE C  2  3    ? 63.599  -20.845 109.063  1.00 30.54  ? 3    ILE C CG2   1 
ATOM   3592  C  CD1   . ILE C  2  3    ? 65.010  -18.433 110.301  1.00 41.30  ? 3    ILE C CD1   1 
ATOM   3593  N  N     . LYS C  2  4    ? 61.545  -22.078 111.972  1.00 39.09  ? 4    LYS C N     1 
ATOM   3594  C  CA    . LYS C  2  4    ? 60.726  -23.273 112.113  1.00 39.37  ? 4    LYS C CA    1 
ATOM   3595  C  C     . LYS C  2  4    ? 60.025  -23.553 110.796  1.00 35.88  ? 4    LYS C C     1 
ATOM   3596  O  O     . LYS C  2  4    ? 59.364  -22.677 110.240  1.00 35.94  ? 4    LYS C O     1 
ATOM   3597  C  CB    . LYS C  2  4    ? 59.700  -23.107 113.234  1.00 41.92  ? 4    LYS C CB    1 
ATOM   3598  C  CG    . LYS C  2  4    ? 58.876  -24.361 113.500  1.00 48.18  ? 4    LYS C CG    1 
ATOM   3599  C  CD    . LYS C  2  4    ? 57.837  -24.130 114.589  1.00 49.21  ? 4    LYS C CD    1 
ATOM   3600  C  CE    . LYS C  2  4    ? 57.085  -25.411 114.917  1.00 47.21  ? 4    LYS C CE    1 
ATOM   3601  N  NZ    . LYS C  2  4    ? 56.479  -26.019 113.701  1.00 45.46  ? 4    LYS C NZ    1 
ATOM   3602  N  N     . ARG C  2  5    ? 60.164  -24.774 110.297  1.00 37.53  ? 5    ARG C N     1 
ATOM   3603  C  CA    . ARG C  2  5    ? 59.637  -25.098 108.978  1.00 38.67  ? 5    ARG C CA    1 
ATOM   3604  C  C     . ARG C  2  5    ? 58.570  -26.186 109.001  1.00 39.36  ? 5    ARG C C     1 
ATOM   3605  O  O     . ARG C  2  5    ? 58.463  -26.956 109.956  1.00 39.08  ? 5    ARG C O     1 
ATOM   3606  C  CB    . ARG C  2  5    ? 60.767  -25.473 108.019  1.00 36.96  ? 5    ARG C CB    1 
ATOM   3607  C  CG    . ARG C  2  5    ? 61.545  -26.711 108.408  1.00 40.70  ? 5    ARG C CG    1 
ATOM   3608  C  CD    . ARG C  2  5    ? 62.596  -27.008 107.357  1.00 43.04  ? 5    ARG C CD    1 
ATOM   3609  N  NE    . ARG C  2  5    ? 62.008  -27.077 106.021  1.00 42.26  ? 5    ARG C NE    1 
ATOM   3610  C  CZ    . ARG C  2  5    ? 62.636  -26.714 104.907  1.00 41.70  ? 5    ARG C CZ    1 
ATOM   3611  N  NH1   . ARG C  2  5    ? 63.878  -26.250 104.964  1.00 42.58  ? 5    ARG C NH1   1 
ATOM   3612  N  NH2   . ARG C  2  5    ? 62.022  -26.812 103.736  1.00 37.87  ? 5    ARG C NH2   1 
ATOM   3613  N  N     . PHE C  2  6    ? 57.775  -26.228 107.937  1.00 38.46  ? 6    PHE C N     1 
ATOM   3614  C  CA    . PHE C  2  6    ? 56.636  -27.129 107.867  1.00 41.14  ? 6    PHE C CA    1 
ATOM   3615  C  C     . PHE C  2  6    ? 56.717  -28.084 106.682  1.00 46.09  ? 6    PHE C C     1 
ATOM   3616  O  O     . PHE C  2  6    ? 57.701  -28.114 105.942  1.00 44.45  ? 6    PHE C O     1 
ATOM   3617  C  CB    . PHE C  2  6    ? 55.330  -26.336 107.753  1.00 42.14  ? 6    PHE C CB    1 
ATOM   3618  C  CG    . PHE C  2  6    ? 55.148  -25.287 108.813  1.00 39.16  ? 6    PHE C CG    1 
ATOM   3619  C  CD1   . PHE C  2  6    ? 54.469  -25.579 109.985  1.00 38.61  ? 6    PHE C CD1   1 
ATOM   3620  C  CD2   . PHE C  2  6    ? 55.630  -24.002 108.626  1.00 33.94  ? 6    PHE C CD2   1 
ATOM   3621  C  CE1   . PHE C  2  6    ? 54.290  -24.613 110.956  1.00 35.50  ? 6    PHE C CE1   1 
ATOM   3622  C  CE2   . PHE C  2  6    ? 55.455  -23.033 109.594  1.00 31.83  ? 6    PHE C CE2   1 
ATOM   3623  C  CZ    . PHE C  2  6    ? 54.784  -23.339 110.760  1.00 32.59  ? 6    PHE C CZ    1 
ATOM   3624  N  N     . GLY C  2  7    ? 55.650  -28.860 106.532  1.00 50.80  ? 7    GLY C N     1 
ATOM   3625  C  CA    . GLY C  2  7    ? 55.408  -29.708 105.380  1.00 53.57  ? 7    GLY C CA    1 
ATOM   3626  C  C     . GLY C  2  7    ? 55.755  -31.166 105.595  1.00 56.33  ? 7    GLY C C     1 
ATOM   3627  O  O     . GLY C  2  7    ? 56.746  -31.503 106.243  1.00 53.42  ? 7    GLY C O     1 
ATOM   3628  N  N     . ARG C  2  8    ? 54.916  -32.032 105.032  1.00 63.20  ? 8    ARG C N     1 
ATOM   3629  C  CA    . ARG C  2  8    ? 55.084  -33.478 105.145  1.00 67.87  ? 8    ARG C CA    1 
ATOM   3630  C  C     . ARG C  2  8    ? 55.665  -34.165 103.907  1.00 62.62  ? 8    ARG C C     1 
ATOM   3631  O  O     . ARG C  2  8    ? 55.868  -35.378 103.910  1.00 61.37  ? 8    ARG C O     1 
ATOM   3632  C  CB    . ARG C  2  8    ? 53.771  -34.129 105.588  1.00 73.46  ? 8    ARG C CB    1 
ATOM   3633  C  CG    . ARG C  2  8    ? 53.247  -33.532 106.885  1.00 75.35  ? 8    ARG C CG    1 
ATOM   3634  C  CD    . ARG C  2  8    ? 52.092  -34.316 107.469  1.00 88.45  ? 8    ARG C CD    1 
ATOM   3635  N  NE    . ARG C  2  8    ? 51.847  -33.922 108.854  1.00 99.45  ? 8    ARG C NE    1 
ATOM   3636  C  CZ    . ARG C  2  8    ? 50.911  -34.457 109.630  1.00 104.83 ? 8    ARG C CZ    1 
ATOM   3637  N  NH1   . ARG C  2  8    ? 50.122  -35.412 109.159  1.00 106.98 ? 8    ARG C NH1   1 
ATOM   3638  N  NH2   . ARG C  2  8    ? 50.764  -34.036 110.879  1.00 97.71  ? 8    ARG C NH2   1 
ATOM   3639  N  N     . ILE C  2  9    ? 55.919  -33.395 102.853  1.00 62.87  ? 9    ILE C N     1 
ATOM   3640  C  CA    . ILE C  2  9    ? 56.455  -33.956 101.616  1.00 62.55  ? 9    ILE C CA    1 
ATOM   3641  C  C     . ILE C  2  9    ? 57.973  -33.841 101.572  1.00 63.57  ? 9    ILE C C     1 
ATOM   3642  O  O     . ILE C  2  9    ? 58.530  -32.753 101.716  1.00 60.88  ? 9    ILE C O     1 
ATOM   3643  C  CB    . ILE C  2  9    ? 55.849  -33.286 100.364  1.00 63.70  ? 9    ILE C CB    1 
ATOM   3644  C  CG1   . ILE C  2  9    ? 54.342  -33.544 100.294  1.00 61.86  ? 9    ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C  2  9    ? 56.532  -33.795 99.100   1.00 57.69  ? 9    ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C  2  9    ? 53.689  -33.012 99.034   1.00 52.79  ? 9    ILE C CD1   1 
ATOM   3647  N  N     . ARG C  2  10   ? 58.636  -34.975 101.379  1.00 68.12  ? 10   ARG C N     1 
ATOM   3648  C  CA    . ARG C  2  10   ? 60.090  -35.013 101.313  1.00 69.28  ? 10   ARG C CA    1 
ATOM   3649  C  C     . ARG C  2  10   ? 60.556  -34.983 99.862   1.00 66.72  ? 10   ARG C C     1 
ATOM   3650  O  O     . ARG C  2  10   ? 60.302  -35.918 99.101   1.00 65.23  ? 10   ARG C O     1 
ATOM   3651  C  CB    . ARG C  2  10   ? 60.615  -36.265 102.022  1.00 70.42  ? 10   ARG C CB    1 
ATOM   3652  C  CG    . ARG C  2  10   ? 62.131  -36.399 102.045  1.00 74.62  ? 10   ARG C CG    1 
ATOM   3653  C  CD    . ARG C  2  10   ? 62.595  -37.552 101.165  1.00 80.74  ? 10   ARG C CD    1 
ATOM   3654  N  NE    . ARG C  2  10   ? 61.960  -38.815 101.537  1.00 82.78  ? 10   ARG C NE    1 
ATOM   3655  C  CZ    . ARG C  2  10   ? 62.206  -39.980 100.944  1.00 82.71  ? 10   ARG C CZ    1 
ATOM   3656  N  NH1   . ARG C  2  10   ? 61.580  -41.077 101.348  1.00 79.19  ? 10   ARG C NH1   1 
ATOM   3657  N  NH2   . ARG C  2  10   ? 63.078  -40.048 99.946   1.00 79.40  ? 10   ARG C NH2   1 
ATOM   3658  N  N     . GLU C  2  11   ? 61.239  -33.909 99.479   1.00 63.63  ? 11   GLU C N     1 
ATOM   3659  C  CA    . GLU C  2  11   ? 61.738  -33.787 98.115   1.00 61.32  ? 11   GLU C CA    1 
ATOM   3660  C  C     . GLU C  2  11   ? 62.950  -34.683 97.909   1.00 56.01  ? 11   GLU C C     1 
ATOM   3661  O  O     . GLU C  2  11   ? 63.966  -34.542 98.589   1.00 51.06  ? 11   GLU C O     1 
ATOM   3662  C  CB    . GLU C  2  11   ? 62.075  -32.331 97.787   1.00 61.77  ? 11   GLU C CB    1 
ATOM   3663  C  CG    . GLU C  2  11   ? 60.944  -31.592 97.092   1.00 61.58  ? 11   GLU C CG    1 
ATOM   3664  C  CD    . GLU C  2  11   ? 60.668  -30.226 97.689   1.00 64.15  ? 11   GLU C CD    1 
ATOM   3665  O  OE1   . GLU C  2  11   ? 61.635  -29.475 97.943   1.00 58.34  ? 11   GLU C OE1   1 
ATOM   3666  O  OE2   . GLU C  2  11   ? 59.479  -29.906 97.906   1.00 59.62  ? 11   GLU C OE2   1 
ATOM   3667  N  N     . VAL C  2  12   ? 62.833  -35.599 96.955   1.00 57.80  ? 12   VAL C N     1 
ATOM   3668  C  CA    . VAL C  2  12   ? 63.851  -36.615 96.729   1.00 59.40  ? 12   VAL C CA    1 
ATOM   3669  C  C     . VAL C  2  12   ? 65.096  -36.033 96.079   1.00 52.04  ? 12   VAL C C     1 
ATOM   3670  O  O     . VAL C  2  12   ? 66.217  -36.292 96.518   1.00 58.52  ? 12   VAL C O     1 
ATOM   3671  C  CB    . VAL C  2  12   ? 63.302  -37.769 95.875   1.00 60.88  ? 12   VAL C CB    1 
ATOM   3672  C  CG1   . VAL C  2  12   ? 64.431  -38.675 95.406   1.00 62.14  ? 12   VAL C CG1   1 
ATOM   3673  C  CG2   . VAL C  2  12   ? 62.274  -38.551 96.672   1.00 59.66  ? 12   VAL C CG2   1 
ATOM   3674  N  N     . ILE C  2  13   ? 64.897  -35.228 95.045   1.00 45.87  ? 13   ILE C N     1 
ATOM   3675  C  CA    . ILE C  2  13   ? 66.015  -34.604 94.361   1.00 44.16  ? 13   ILE C CA    1 
ATOM   3676  C  C     . ILE C  2  13   ? 65.973  -33.100 94.581   1.00 43.68  ? 13   ILE C C     1 
ATOM   3677  O  O     . ILE C  2  13   ? 64.901  -32.527 94.780   1.00 46.35  ? 13   ILE C O     1 
ATOM   3678  C  CB    . ILE C  2  13   ? 65.991  -34.915 92.853   1.00 43.22  ? 13   ILE C CB    1 
ATOM   3679  C  CG1   . ILE C  2  13   ? 64.726  -34.349 92.207   1.00 42.98  ? 13   ILE C CG1   1 
ATOM   3680  C  CG2   . ILE C  2  13   ? 66.073  -36.413 92.625   1.00 47.45  ? 13   ILE C CG2   1 
ATOM   3681  C  CD1   . ILE C  2  13   ? 64.645  -34.587 90.716   1.00 43.70  ? 13   ILE C CD1   1 
ATOM   3682  N  N     . PRO C  2  14   ? 67.147  -32.453 94.569   1.00 42.30  ? 14   PRO C N     1 
ATOM   3683  C  CA    . PRO C  2  14   ? 67.174  -30.995 94.693   1.00 43.63  ? 14   PRO C CA    1 
ATOM   3684  C  C     . PRO C  2  14   ? 66.842  -30.348 93.357   1.00 41.85  ? 14   PRO C C     1 
ATOM   3685  O  O     . PRO C  2  14   ? 66.626  -31.051 92.369   1.00 42.70  ? 14   PRO C O     1 
ATOM   3686  C  CB    . PRO C  2  14   ? 68.632  -30.712 95.059   1.00 40.79  ? 14   PRO C CB    1 
ATOM   3687  C  CG    . PRO C  2  14   ? 69.389  -31.813 94.406   1.00 40.60  ? 14   PRO C CG    1 
ATOM   3688  C  CD    . PRO C  2  14   ? 68.503  -33.028 94.506   1.00 43.66  ? 14   PRO C CD    1 
ATOM   3689  N  N     . LEU C  2  15   ? 66.799  -29.022 93.326   1.00 38.47  ? 15   LEU C N     1 
ATOM   3690  C  CA    . LEU C  2  15   ? 66.605  -28.318 92.071   1.00 35.75  ? 15   LEU C CA    1 
ATOM   3691  C  C     . LEU C  2  15   ? 67.849  -28.439 91.206   1.00 34.66  ? 15   LEU C C     1 
ATOM   3692  O  O     . LEU C  2  15   ? 68.965  -28.233 91.682   1.00 35.06  ? 15   LEU C O     1 
ATOM   3693  C  CB    . LEU C  2  15   ? 66.286  -26.843 92.312   1.00 37.40  ? 15   LEU C CB    1 
ATOM   3694  C  CG    . LEU C  2  15   ? 64.817  -26.485 92.530   1.00 34.20  ? 15   LEU C CG    1 
ATOM   3695  C  CD1   . LEU C  2  15   ? 64.631  -24.987 92.395   1.00 29.13  ? 15   LEU C CD1   1 
ATOM   3696  C  CD2   . LEU C  2  15   ? 63.934  -27.226 91.541   1.00 35.66  ? 15   LEU C CD2   1 
ATOM   3697  N  N     . PRO C  2  16   ? 67.658  -28.779 89.925   1.00 32.76  ? 16   PRO C N     1 
ATOM   3698  C  CA    . PRO C  2  16   ? 68.757  -28.790 88.955   1.00 35.75  ? 16   PRO C CA    1 
ATOM   3699  C  C     . PRO C  2  16   ? 69.321  -27.382 88.825   1.00 35.33  ? 16   PRO C C     1 
ATOM   3700  O  O     . PRO C  2  16   ? 68.622  -26.439 89.202   1.00 34.97  ? 16   PRO C O     1 
ATOM   3701  C  CB    . PRO C  2  16   ? 68.066  -29.211 87.654   1.00 40.29  ? 16   PRO C CB    1 
ATOM   3702  C  CG    . PRO C  2  16   ? 66.620  -28.873 87.858   1.00 36.58  ? 16   PRO C CG    1 
ATOM   3703  C  CD    . PRO C  2  16   ? 66.366  -29.118 89.307   1.00 31.40  ? 16   PRO C CD    1 
ATOM   3704  N  N     . PRO C  2  17   ? 70.560  -27.237 88.317   1.00 39.93  ? 17   PRO C N     1 
ATOM   3705  C  CA    . PRO C  2  17   ? 71.132  -25.895 88.163   1.00 39.55  ? 17   PRO C CA    1 
ATOM   3706  C  C     . PRO C  2  17   ? 70.172  -25.022 87.367   1.00 39.81  ? 17   PRO C C     1 
ATOM   3707  O  O     . PRO C  2  17   ? 69.733  -25.404 86.283   1.00 43.51  ? 17   PRO C O     1 
ATOM   3708  C  CB    . PRO C  2  17   ? 72.414  -26.153 87.367   1.00 38.85  ? 17   PRO C CB    1 
ATOM   3709  C  CG    . PRO C  2  17   ? 72.795  -27.552 87.725   1.00 41.97  ? 17   PRO C CG    1 
ATOM   3710  C  CD    . PRO C  2  17   ? 71.495  -28.292 87.884   1.00 42.90  ? 17   PRO C CD    1 
ATOM   3711  N  N     . LEU C  2  18   ? 69.846  -23.858 87.913   1.00 34.38  ? 18   LEU C N     1 
ATOM   3712  C  CA    . LEU C  2  18   ? 68.755  -23.058 87.380   1.00 30.44  ? 18   LEU C CA    1 
ATOM   3713  C  C     . LEU C  2  18   ? 69.129  -22.361 86.075   1.00 34.39  ? 18   LEU C C     1 
ATOM   3714  O  O     . LEU C  2  18   ? 68.267  -22.082 85.243   1.00 38.60  ? 18   LEU C O     1 
ATOM   3715  C  CB    . LEU C  2  18   ? 68.277  -22.050 88.427   1.00 28.75  ? 18   LEU C CB    1 
ATOM   3716  C  CG    . LEU C  2  18   ? 67.779  -22.666 89.738   1.00 28.07  ? 18   LEU C CG    1 
ATOM   3717  C  CD1   . LEU C  2  18   ? 67.424  -21.590 90.752   1.00 26.29  ? 18   LEU C CD1   1 
ATOM   3718  C  CD2   . LEU C  2  18   ? 66.589  -23.580 89.488   1.00 29.32  ? 18   LEU C CD2   1 
ATOM   3719  N  N     . THR C  2  19   ? 70.416  -22.088 85.897   1.00 34.28  ? 19   THR C N     1 
ATOM   3720  C  CA    . THR C  2  19   ? 70.894  -21.410 84.696   1.00 35.31  ? 19   THR C CA    1 
ATOM   3721  C  C     . THR C  2  19   ? 71.405  -22.370 83.618   1.00 38.25  ? 19   THR C C     1 
ATOM   3722  O  O     . THR C  2  19   ? 71.933  -21.931 82.596   1.00 41.01  ? 19   THR C O     1 
ATOM   3723  C  CB    . THR C  2  19   ? 71.991  -20.378 85.025   1.00 37.53  ? 19   THR C CB    1 
ATOM   3724  O  OG1   . THR C  2  19   ? 73.092  -21.036 85.663   1.00 42.69  ? 19   THR C OG1   1 
ATOM   3725  C  CG2   . THR C  2  19   ? 71.447  -19.290 85.947   1.00 36.62  ? 19   THR C CG2   1 
ATOM   3726  N  N     . GLU C  2  20   ? 71.260  -23.673 83.849   1.00 40.30  ? 20   GLU C N     1 
ATOM   3727  C  CA    . GLU C  2  20   ? 71.827  -24.679 82.946   1.00 43.21  ? 20   GLU C CA    1 
ATOM   3728  C  C     . GLU C  2  20   ? 71.258  -24.647 81.525   1.00 40.38  ? 20   GLU C C     1 
ATOM   3729  O  O     . GLU C  2  20   ? 71.910  -25.104 80.587   1.00 41.66  ? 20   GLU C O     1 
ATOM   3730  C  CB    . GLU C  2  20   ? 71.692  -26.090 83.531   1.00 42.25  ? 20   GLU C CB    1 
ATOM   3731  C  CG    . GLU C  2  20   ? 70.305  -26.695 83.408   1.00 41.47  ? 20   GLU C CG    1 
ATOM   3732  C  CD    . GLU C  2  20   ? 70.282  -28.168 83.771   1.00 49.98  ? 20   GLU C CD    1 
ATOM   3733  O  OE1   . GLU C  2  20   ? 71.340  -28.826 83.661   1.00 50.96  ? 20   GLU C OE1   1 
ATOM   3734  O  OE2   . GLU C  2  20   ? 69.209  -28.668 84.170   1.00 49.45  ? 20   GLU C OE2   1 
ATOM   3735  N  N     . ILE C  2  21   ? 70.054  -24.105 81.366   1.00 37.04  ? 21   ILE C N     1 
ATOM   3736  C  CA    . ILE C  2  21   ? 69.430  -24.004 80.048   1.00 34.89  ? 21   ILE C CA    1 
ATOM   3737  C  C     . ILE C  2  21   ? 70.259  -23.115 79.116   1.00 34.08  ? 21   ILE C C     1 
ATOM   3738  O  O     . ILE C  2  21   ? 70.205  -23.249 77.893   1.00 37.14  ? 21   ILE C O     1 
ATOM   3739  C  CB    . ILE C  2  21   ? 67.977  -23.479 80.147   1.00 33.61  ? 21   ILE C CB    1 
ATOM   3740  C  CG1   . ILE C  2  21   ? 67.270  -23.567 78.791   1.00 32.45  ? 21   ILE C CG1   1 
ATOM   3741  C  CG2   . ILE C  2  21   ? 67.952  -22.057 80.686   1.00 33.54  ? 21   ILE C CG2   1 
ATOM   3742  C  CD1   . ILE C  2  21   ? 65.864  -23.012 78.795   1.00 30.42  ? 21   ILE C CD1   1 
ATOM   3743  N  N     . GLN C  2  22   ? 71.042  -22.223 79.712   1.00 32.54  ? 22   GLN C N     1 
ATOM   3744  C  CA    . GLN C  2  22   ? 71.940  -21.346 78.972   1.00 34.37  ? 22   GLN C CA    1 
ATOM   3745  C  C     . GLN C  2  22   ? 73.331  -21.973 78.899   1.00 35.56  ? 22   GLN C C     1 
ATOM   3746  O  O     . GLN C  2  22   ? 73.849  -22.256 77.812   1.00 37.11  ? 22   GLN C O     1 
ATOM   3747  C  CB    . GLN C  2  22   ? 72.012  -19.974 79.645   1.00 33.42  ? 22   GLN C CB    1 
ATOM   3748  C  CG    . GLN C  2  22   ? 70.663  -19.283 79.809   1.00 29.33  ? 22   GLN C CG    1 
ATOM   3749  C  CD    . GLN C  2  22   ? 70.207  -18.567 78.550   1.00 28.22  ? 22   GLN C CD    1 
ATOM   3750  O  OE1   . GLN C  2  22   ? 70.833  -17.601 78.110   1.00 27.27  ? 22   GLN C OE1   1 
ATOM   3751  N  NE2   . GLN C  2  22   ? 69.112  -19.038 77.963   1.00 28.70  ? 22   GLN C NE2   1 
ATOM   3752  N  N     . VAL C  2  23   ? 73.926  -22.175 80.072   1.00 36.06  ? 23   VAL C N     1 
ATOM   3753  C  CA    . VAL C  2  23   ? 75.283  -22.700 80.201   1.00 39.31  ? 23   VAL C CA    1 
ATOM   3754  C  C     . VAL C  2  23   ? 75.511  -24.030 79.476   1.00 40.33  ? 23   VAL C C     1 
ATOM   3755  O  O     . VAL C  2  23   ? 76.395  -24.125 78.622   1.00 37.50  ? 23   VAL C O     1 
ATOM   3756  C  CB    . VAL C  2  23   ? 75.669  -22.870 81.688   1.00 42.90  ? 23   VAL C CB    1 
ATOM   3757  C  CG1   . VAL C  2  23   ? 77.051  -23.492 81.814   1.00 50.51  ? 23   VAL C CG1   1 
ATOM   3758  C  CG2   . VAL C  2  23   ? 75.609  -21.531 82.410   1.00 37.26  ? 23   VAL C CG2   1 
ATOM   3759  N  N     . GLU C  2  24   ? 74.717  -25.046 79.814   1.00 40.78  ? 24   GLU C N     1 
ATOM   3760  C  CA    . GLU C  2  24   ? 74.877  -26.372 79.215   1.00 38.86  ? 24   GLU C CA    1 
ATOM   3761  C  C     . GLU C  2  24   ? 74.709  -26.340 77.703   1.00 40.53  ? 24   GLU C C     1 
ATOM   3762  O  O     . GLU C  2  24   ? 75.446  -27.001 76.973   1.00 44.17  ? 24   GLU C O     1 
ATOM   3763  C  CB    . GLU C  2  24   ? 73.899  -27.377 79.827   1.00 38.76  ? 24   GLU C CB    1 
ATOM   3764  C  CG    . GLU C  2  24   ? 74.308  -27.872 81.200   1.00 53.53  ? 24   GLU C CG    1 
ATOM   3765  C  CD    . GLU C  2  24   ? 75.625  -28.627 81.174   1.00 70.07  ? 24   GLU C CD    1 
ATOM   3766  O  OE1   . GLU C  2  24   ? 76.385  -28.536 82.161   1.00 73.28  ? 24   GLU C OE1   1 
ATOM   3767  O  OE2   . GLU C  2  24   ? 75.898  -29.315 80.167   1.00 73.01  ? 24   GLU C OE2   1 
ATOM   3768  N  N     . SER C  2  25   ? 73.735  -25.563 77.244   1.00 40.93  ? 25   SER C N     1 
ATOM   3769  C  CA    . SER C  2  25   ? 73.481  -25.403 75.819   1.00 37.93  ? 25   SER C CA    1 
ATOM   3770  C  C     . SER C  2  25   ? 74.678  -24.799 75.090   1.00 36.83  ? 25   SER C C     1 
ATOM   3771  O  O     . SER C  2  25   ? 75.199  -25.389 74.140   1.00 41.92  ? 25   SER C O     1 
ATOM   3772  C  CB    . SER C  2  25   ? 72.247  -24.527 75.602   1.00 37.92  ? 25   SER C CB    1 
ATOM   3773  O  OG    . SER C  2  25   ? 72.113  -24.166 74.239   1.00 42.32  ? 25   SER C OG    1 
ATOM   3774  N  N     . TYR C  2  26   ? 75.114  -23.624 75.537   1.00 34.75  ? 26   TYR C N     1 
ATOM   3775  C  CA    . TYR C  2  26   ? 76.195  -22.919 74.856   1.00 32.75  ? 26   TYR C CA    1 
ATOM   3776  C  C     . TYR C  2  26   ? 77.506  -23.700 74.922   1.00 36.10  ? 26   TYR C C     1 
ATOM   3777  O  O     . TYR C  2  26   ? 78.285  -23.706 73.965   1.00 39.71  ? 26   TYR C O     1 
ATOM   3778  C  CB    . TYR C  2  26   ? 76.373  -21.515 75.434   1.00 30.19  ? 26   TYR C CB    1 
ATOM   3779  C  CG    . TYR C  2  26   ? 77.059  -20.550 74.496   1.00 26.03  ? 26   TYR C CG    1 
ATOM   3780  C  CD1   . TYR C  2  26   ? 76.471  -20.187 73.293   1.00 25.76  ? 26   TYR C CD1   1 
ATOM   3781  C  CD2   . TYR C  2  26   ? 78.289  -19.994 74.818   1.00 28.79  ? 26   TYR C CD2   1 
ATOM   3782  C  CE1   . TYR C  2  26   ? 77.092  -19.302 72.432   1.00 25.51  ? 26   TYR C CE1   1 
ATOM   3783  C  CE2   . TYR C  2  26   ? 78.916  -19.106 73.966   1.00 27.92  ? 26   TYR C CE2   1 
ATOM   3784  C  CZ    . TYR C  2  26   ? 78.314  -18.765 72.774   1.00 26.35  ? 26   TYR C CZ    1 
ATOM   3785  O  OH    . TYR C  2  26   ? 78.939  -17.882 71.924   1.00 29.47  ? 26   TYR C OH    1 
ATOM   3786  N  N     . ARG C  2  27   ? 77.742  -24.362 76.050   1.00 38.25  ? 27   ARG C N     1 
ATOM   3787  C  CA    . ARG C  2  27   ? 78.914  -25.218 76.199   1.00 42.05  ? 27   ARG C CA    1 
ATOM   3788  C  C     . ARG C  2  27   ? 78.840  -26.383 75.220   1.00 42.96  ? 27   ARG C C     1 
ATOM   3789  O  O     . ARG C  2  27   ? 79.844  -26.771 74.622   1.00 42.15  ? 27   ARG C O     1 
ATOM   3790  C  CB    . ARG C  2  27   ? 79.020  -25.739 77.633   1.00 44.49  ? 27   ARG C CB    1 
ATOM   3791  C  CG    . ARG C  2  27   ? 80.145  -26.734 77.855   1.00 43.43  ? 27   ARG C CG    1 
ATOM   3792  C  CD    . ARG C  2  27   ? 80.060  -27.340 79.245   1.00 51.38  ? 27   ARG C CD    1 
ATOM   3793  N  NE    . ARG C  2  27   ? 80.247  -28.787 79.219   1.00 65.83  ? 27   ARG C NE    1 
ATOM   3794  C  CZ    . ARG C  2  27   ? 79.288  -29.656 78.914   1.00 69.22  ? 27   ARG C CZ    1 
ATOM   3795  N  NH1   . ARG C  2  27   ? 79.543  -30.957 78.915   1.00 73.94  ? 27   ARG C NH1   1 
ATOM   3796  N  NH2   . ARG C  2  27   ? 78.072  -29.223 78.605   1.00 59.15  ? 27   ARG C NH2   1 
ATOM   3797  N  N     . ARG C  2  28   ? 77.638  -26.932 75.062   1.00 43.32  ? 28   ARG C N     1 
ATOM   3798  C  CA    . ARG C  2  28   ? 77.395  -28.021 74.122   1.00 43.60  ? 28   ARG C CA    1 
ATOM   3799  C  C     . ARG C  2  28   ? 77.668  -27.572 72.688   1.00 41.16  ? 28   ARG C C     1 
ATOM   3800  O  O     . ARG C  2  28   ? 78.149  -28.350 71.864   1.00 40.58  ? 28   ARG C O     1 
ATOM   3801  C  CB    . ARG C  2  28   ? 75.948  -28.506 74.249   1.00 39.96  ? 28   ARG C CB    1 
ATOM   3802  C  CG    . ARG C  2  28   ? 75.616  -29.756 73.457   1.00 42.39  ? 28   ARG C CG    1 
ATOM   3803  C  CD    . ARG C  2  28   ? 75.989  -31.009 74.226   1.00 52.82  ? 28   ARG C CD    1 
ATOM   3804  N  NE    . ARG C  2  28   ? 75.405  -32.207 73.628   1.00 75.63  ? 28   ARG C NE    1 
ATOM   3805  C  CZ    . ARG C  2  28   ? 76.007  -32.956 72.709   1.00 84.11  ? 28   ARG C CZ    1 
ATOM   3806  N  NH1   . ARG C  2  28   ? 77.220  -32.637 72.279   1.00 77.87  ? 28   ARG C NH1   1 
ATOM   3807  N  NH2   . ARG C  2  28   ? 75.397  -34.029 72.221   1.00 80.88  ? 28   ARG C NH2   1 
ATOM   3808  N  N     . ALA C  2  29   ? 77.361  -26.312 72.397   1.00 39.29  ? 29   ALA C N     1 
ATOM   3809  C  CA    . ALA C  2  29   ? 77.530  -25.777 71.048   1.00 37.37  ? 29   ALA C CA    1 
ATOM   3810  C  C     . ALA C  2  29   ? 78.977  -25.406 70.720   1.00 39.53  ? 29   ALA C C     1 
ATOM   3811  O  O     . ALA C  2  29   ? 79.414  -25.556 69.579   1.00 40.36  ? 29   ALA C O     1 
ATOM   3812  C  CB    . ALA C  2  29   ? 76.612  -24.582 70.832   1.00 39.18  ? 29   ALA C CB    1 
ATOM   3813  N  N     . LEU C  2  30   ? 79.710  -24.902 71.709   1.00 41.34  ? 30   LEU C N     1 
ATOM   3814  C  CA    . LEU C  2  30   ? 81.106  -24.516 71.488   1.00 41.21  ? 30   LEU C CA    1 
ATOM   3815  C  C     . LEU C  2  30   ? 82.096  -25.683 71.532   1.00 43.40  ? 30   LEU C C     1 
ATOM   3816  O  O     . LEU C  2  30   ? 82.985  -25.777 70.683   1.00 42.39  ? 30   LEU C O     1 
ATOM   3817  C  CB    . LEU C  2  30   ? 81.535  -23.430 72.476   1.00 40.42  ? 30   LEU C CB    1 
ATOM   3818  C  CG    . LEU C  2  30   ? 80.993  -22.025 72.208   1.00 35.79  ? 30   LEU C CG    1 
ATOM   3819  C  CD1   . LEU C  2  30   ? 81.676  -21.015 73.117   1.00 34.36  ? 30   LEU C CD1   1 
ATOM   3820  C  CD2   . LEU C  2  30   ? 81.174  -21.650 70.744   1.00 38.60  ? 30   LEU C CD2   1 
ATOM   3821  N  N     . GLN C  2  31   ? 81.933  -26.561 72.520   1.00 44.77  ? 31   GLN C N     1 
ATOM   3822  C  CA    . GLN C  2  31   ? 82.832  -27.701 72.727   1.00 46.61  ? 31   GLN C CA    1 
ATOM   3823  C  C     . GLN C  2  31   ? 84.309  -27.305 72.788   1.00 48.39  ? 31   GLN C C     1 
ATOM   3824  O  O     . GLN C  2  31   ? 85.140  -27.884 72.089   1.00 52.46  ? 31   GLN C O     1 
ATOM   3825  C  CB    . GLN C  2  31   ? 82.621  -28.764 71.644   1.00 42.80  ? 31   GLN C CB    1 
ATOM   3826  C  CG    . GLN C  2  31   ? 81.299  -29.502 71.741   1.00 41.31  ? 31   GLN C CG    1 
ATOM   3827  C  CD    . GLN C  2  31   ? 81.087  -30.456 70.585   1.00 42.98  ? 31   GLN C CD    1 
ATOM   3828  O  OE1   . GLN C  2  31   ? 80.771  -31.629 70.784   1.00 49.96  ? 31   GLN C OE1   1 
ATOM   3829  N  NE2   . GLN C  2  31   ? 81.260  -29.957 69.367   1.00 37.55  ? 31   GLN C NE2   1 
ATOM   3830  N  N     . ALA C  2  32   ? 84.630  -26.324 73.625   1.00 45.51  ? 32   ALA C N     1 
ATOM   3831  C  CA    . ALA C  2  32   ? 85.996  -25.816 73.717   1.00 45.98  ? 32   ALA C CA    1 
ATOM   3832  C  C     . ALA C  2  32   ? 86.912  -26.717 74.544   1.00 48.66  ? 32   ALA C C     1 
ATOM   3833  O  O     . ALA C  2  32   ? 88.123  -26.750 74.324   1.00 46.86  ? 32   ALA C O     1 
ATOM   3834  C  CB    . ALA C  2  32   ? 85.998  -24.399 74.275   1.00 48.37  ? 32   ALA C CB    1 
ATOM   3835  N  N     . ASP C  2  33   ? 86.332  -27.443 75.494   1.00 52.55  ? 33   ASP C N     1 
ATOM   3836  C  CA    . ASP C  2  33   ? 87.110  -28.312 76.374   1.00 57.81  ? 33   ASP C CA    1 
ATOM   3837  C  C     . ASP C  2  33   ? 87.188  -29.746 75.857   1.00 59.85  ? 33   ASP C C     1 
ATOM   3838  O  O     . ASP C  2  33   ? 87.761  -30.621 76.508   1.00 59.79  ? 33   ASP C O     1 
ATOM   3839  C  CB    . ASP C  2  33   ? 86.544  -28.287 77.796   1.00 62.36  ? 33   ASP C CB    1 
ATOM   3840  C  CG    . ASP C  2  33   ? 86.861  -26.996 78.526   1.00 67.57  ? 33   ASP C CG    1 
ATOM   3841  O  OD1   . ASP C  2  33   ? 87.190  -25.997 77.852   1.00 64.16  ? 33   ASP C OD1   1 
ATOM   3842  O  OD2   . ASP C  2  33   ? 86.782  -26.979 79.772   1.00 73.35  ? 33   ASP C OD2   1 
ATOM   3843  N  N     . VAL C  2  34   ? 86.601  -29.981 74.688   1.00 57.76  ? 34   VAL C N     1 
ATOM   3844  C  CA    . VAL C  2  34   ? 86.651  -31.289 74.047   1.00 50.77  ? 34   VAL C CA    1 
ATOM   3845  C  C     . VAL C  2  34   ? 87.716  -31.285 72.954   1.00 49.75  ? 34   VAL C C     1 
ATOM   3846  O  O     . VAL C  2  34   ? 87.740  -30.382 72.116   1.00 45.74  ? 34   VAL C O     1 
ATOM   3847  C  CB    . VAL C  2  34   ? 85.285  -31.663 73.434   1.00 49.54  ? 34   VAL C CB    1 
ATOM   3848  C  CG1   . VAL C  2  34   ? 85.289  -33.106 72.952   1.00 49.80  ? 34   VAL C CG1   1 
ATOM   3849  C  CG2   . VAL C  2  34   ? 84.172  -31.445 74.447   1.00 52.28  ? 34   VAL C CG2   1 
ATOM   3850  N  N     . PRO C  2  35   ? 88.615  -32.286 72.970   1.00 52.50  ? 35   PRO C N     1 
ATOM   3851  C  CA    . PRO C  2  35   ? 89.655  -32.409 71.940   1.00 47.54  ? 35   PRO C CA    1 
ATOM   3852  C  C     . PRO C  2  35   ? 89.051  -32.520 70.540   1.00 45.03  ? 35   PRO C C     1 
ATOM   3853  O  O     . PRO C  2  35   ? 88.106  -33.286 70.352   1.00 46.02  ? 35   PRO C O     1 
ATOM   3854  C  CB    . PRO C  2  35   ? 90.382  -33.706 72.323   1.00 48.32  ? 35   PRO C CB    1 
ATOM   3855  C  CG    . PRO C  2  35   ? 89.445  -34.433 73.236   1.00 46.91  ? 35   PRO C CG    1 
ATOM   3856  C  CD    . PRO C  2  35   ? 88.701  -33.365 73.968   1.00 53.20  ? 35   PRO C CD    1 
ATOM   3857  N  N     . PRO C  2  36   ? 89.601  -31.768 69.572   1.00 43.66  ? 36   PRO C N     1 
ATOM   3858  C  CA    . PRO C  2  36   ? 89.060  -31.591 68.217   1.00 45.72  ? 36   PRO C CA    1 
ATOM   3859  C  C     . PRO C  2  36   ? 88.656  -32.891 67.525   1.00 51.84  ? 36   PRO C C     1 
ATOM   3860  O  O     . PRO C  2  36   ? 87.700  -32.891 66.748   1.00 53.69  ? 36   PRO C O     1 
ATOM   3861  C  CB    . PRO C  2  36   ? 90.223  -30.939 67.466   1.00 41.72  ? 36   PRO C CB    1 
ATOM   3862  C  CG    . PRO C  2  36   ? 90.942  -30.172 68.511   1.00 46.48  ? 36   PRO C CG    1 
ATOM   3863  C  CD    . PRO C  2  36   ? 90.847  -31.004 69.764   1.00 50.09  ? 36   PRO C CD    1 
ATOM   3864  N  N     . GLU C  2  37   ? 89.368  -33.977 67.800   1.00 51.68  ? 37   GLU C N     1 
ATOM   3865  C  CA    . GLU C  2  37   ? 89.045  -35.262 67.191   1.00 52.17  ? 37   GLU C CA    1 
ATOM   3866  C  C     . GLU C  2  37   ? 87.884  -35.959 67.898   1.00 50.94  ? 37   GLU C C     1 
ATOM   3867  O  O     . GLU C  2  37   ? 87.219  -36.816 67.317   1.00 54.80  ? 37   GLU C O     1 
ATOM   3868  C  CB    . GLU C  2  37   ? 90.275  -36.175 67.154   1.00 53.54  ? 37   GLU C CB    1 
ATOM   3869  C  CG    . GLU C  2  37   ? 90.985  -36.346 68.490   1.00 55.90  ? 37   GLU C CG    1 
ATOM   3870  C  CD    . GLU C  2  37   ? 92.026  -35.269 68.744   1.00 54.16  ? 37   GLU C CD    1 
ATOM   3871  O  OE1   . GLU C  2  37   ? 92.264  -34.443 67.837   1.00 50.84  ? 37   GLU C OE1   1 
ATOM   3872  O  OE2   . GLU C  2  37   ? 92.607  -35.252 69.851   1.00 50.23  ? 37   GLU C OE2   1 
ATOM   3873  N  N     . LYS C  2  38   ? 87.643  -35.589 69.152   1.00 45.06  ? 38   LYS C N     1 
ATOM   3874  C  CA    . LYS C  2  38   ? 86.541  -36.170 69.911   1.00 51.16  ? 38   LYS C CA    1 
ATOM   3875  C  C     . LYS C  2  38   ? 85.282  -35.303 69.885   1.00 53.06  ? 38   LYS C C     1 
ATOM   3876  O  O     . LYS C  2  38   ? 84.269  -35.654 70.489   1.00 50.35  ? 38   LYS C O     1 
ATOM   3877  C  CB    . LYS C  2  38   ? 86.967  -36.464 71.352   1.00 53.12  ? 38   LYS C CB    1 
ATOM   3878  C  CG    . LYS C  2  38   ? 87.989  -37.583 71.467   1.00 56.62  ? 38   LYS C CG    1 
ATOM   3879  C  CD    . LYS C  2  38   ? 88.255  -37.953 72.916   1.00 55.35  ? 38   LYS C CD    1 
ATOM   3880  C  CE    . LYS C  2  38   ? 89.225  -39.120 73.011   1.00 55.35  ? 38   LYS C CE    1 
ATOM   3881  N  NZ    . LYS C  2  38   ? 89.488  -39.514 74.423   1.00 54.32  ? 38   LYS C NZ    1 
ATOM   3882  N  N     . ARG C  2  39   ? 85.354  -34.172 69.187   1.00 53.52  ? 39   ARG C N     1 
ATOM   3883  C  CA    . ARG C  2  39   ? 84.196  -33.297 69.028   1.00 50.61  ? 39   ARG C CA    1 
ATOM   3884  C  C     . ARG C  2  39   ? 83.105  -34.009 68.240   1.00 55.25  ? 39   ARG C C     1 
ATOM   3885  O  O     . ARG C  2  39   ? 83.397  -34.781 67.327   1.00 57.76  ? 39   ARG C O     1 
ATOM   3886  C  CB    . ARG C  2  39   ? 84.584  -32.005 68.305   1.00 44.58  ? 39   ARG C CB    1 
ATOM   3887  C  CG    . ARG C  2  39   ? 85.430  -31.042 69.120   1.00 42.47  ? 39   ARG C CG    1 
ATOM   3888  C  CD    . ARG C  2  39   ? 85.404  -29.654 68.499   1.00 40.07  ? 39   ARG C CD    1 
ATOM   3889  N  NE    . ARG C  2  39   ? 86.200  -28.685 69.246   1.00 37.22  ? 39   ARG C NE    1 
ATOM   3890  C  CZ    . ARG C  2  39   ? 87.300  -28.104 68.779   1.00 39.81  ? 39   ARG C CZ    1 
ATOM   3891  N  NH1   . ARG C  2  39   ? 87.737  -28.389 67.559   1.00 42.39  ? 39   ARG C NH1   1 
ATOM   3892  N  NH2   . ARG C  2  39   ? 87.963  -27.233 69.528   1.00 38.66  ? 39   ARG C NH2   1 
ATOM   3893  N  N     . GLU C  2  40   ? 81.850  -33.747 68.589   1.00 53.76  ? 40   GLU C N     1 
ATOM   3894  C  CA    . GLU C  2  40   ? 80.730  -34.386 67.907   1.00 57.15  ? 40   GLU C CA    1 
ATOM   3895  C  C     . GLU C  2  40   ? 80.149  -33.518 66.794   1.00 56.55  ? 40   GLU C C     1 
ATOM   3896  O  O     . GLU C  2  40   ? 80.668  -32.448 66.492   1.00 49.67  ? 40   GLU C O     1 
ATOM   3897  C  CB    . GLU C  2  40   ? 79.643  -34.790 68.903   1.00 56.00  ? 40   GLU C CB    1 
ATOM   3898  C  CG    . GLU C  2  40   ? 80.040  -35.954 69.794   1.00 64.22  ? 40   GLU C CG    1 
ATOM   3899  C  CD    . GLU C  2  40   ? 78.890  -36.452 70.642   1.00 88.39  ? 40   GLU C CD    1 
ATOM   3900  O  OE1   . GLU C  2  40   ? 77.787  -35.874 70.547   1.00 92.69  ? 40   GLU C OE1   1 
ATOM   3901  O  OE2   . GLU C  2  40   ? 79.090  -37.424 71.401   1.00 95.15  ? 40   GLU C OE2   1 
ATOM   3902  N  N     . ASN C  2  41   ? 79.051  -33.981 66.207   1.00 57.08  ? 41   ASN C N     1 
ATOM   3903  C  CA    . ASN C  2  41   ? 78.472  -33.356 65.020   1.00 52.33  ? 41   ASN C CA    1 
ATOM   3904  C  C     . ASN C  2  41   ? 77.477  -32.245 65.330   1.00 49.50  ? 41   ASN C C     1 
ATOM   3905  O  O     . ASN C  2  41   ? 76.693  -31.859 64.474   1.00 48.44  ? 41   ASN C O     1 
ATOM   3906  C  CB    . ASN C  2  41   ? 77.859  -34.391 64.075   1.00 60.44  ? 41   ASN C CB    1 
ATOM   3907  C  CG    . ASN C  2  41   ? 77.724  -33.869 62.652   1.00 64.82  ? 41   ASN C CG    1 
ATOM   3908  O  OD1   . ASN C  2  41   ? 78.236  -32.797 62.319   1.00 56.77  ? 41   ASN C OD1   1 
ATOM   3909  N  ND2   . ASN C  2  41   ? 77.037  -34.626 61.805   1.00 73.50  ? 41   ASN C ND2   1 
ATOM   3910  N  N     . VAL C  2  42   ? 77.445  -31.810 66.583   1.00 50.77  ? 42   VAL C N     1 
ATOM   3911  C  CA    . VAL C  2  42   ? 76.570  -30.717 66.991   1.00 41.39  ? 42   VAL C CA    1 
ATOM   3912  C  C     . VAL C  2  42   ? 77.321  -29.384 67.096   1.00 39.53  ? 42   VAL C C     1 
ATOM   3913  O  O     . VAL C  2  42   ? 78.517  -29.354 67.393   1.00 43.39  ? 42   VAL C O     1 
ATOM   3914  C  CB    . VAL C  2  42   ? 75.875  -31.027 68.332   1.00 43.17  ? 42   VAL C CB    1 
ATOM   3915  C  CG1   . VAL C  2  42   ? 75.202  -32.388 68.271   1.00 43.01  ? 42   VAL C CG1   1 
ATOM   3916  C  CG2   . VAL C  2  42   ? 76.874  -30.977 69.476   1.00 45.59  ? 42   VAL C CG2   1 
ATOM   3917  N  N     . GLY C  2  43   ? 76.623  -28.287 66.811   1.00 38.89  ? 43   GLY C N     1 
ATOM   3918  C  CA    . GLY C  2  43   ? 77.165  -26.952 67.008   1.00 40.51  ? 43   GLY C CA    1 
ATOM   3919  C  C     . GLY C  2  43   ? 77.913  -26.351 65.832   1.00 42.38  ? 43   GLY C C     1 
ATOM   3920  O  O     . GLY C  2  43   ? 77.630  -26.652 64.669   1.00 46.51  ? 43   GLY C O     1 
ATOM   3921  N  N     . ILE C  2  44   ? 78.869  -25.479 66.136   1.00 42.06  ? 44   ILE C N     1 
ATOM   3922  C  CA    . ILE C  2  44   ? 79.666  -24.853 65.088   1.00 44.99  ? 44   ILE C CA    1 
ATOM   3923  C  C     . ILE C  2  44   ? 80.504  -25.901 64.369   1.00 46.75  ? 44   ILE C C     1 
ATOM   3924  O  O     . ILE C  2  44   ? 80.898  -25.710 63.216   1.00 49.26  ? 44   ILE C O     1 
ATOM   3925  C  CB    . ILE C  2  44   ? 80.566  -23.722 65.626   1.00 43.69  ? 44   ILE C CB    1 
ATOM   3926  C  CG1   . ILE C  2  44   ? 81.422  -24.219 66.790   1.00 47.44  ? 44   ILE C CG1   1 
ATOM   3927  C  CG2   . ILE C  2  44   ? 79.724  -22.531 66.057   1.00 46.65  ? 44   ILE C CG2   1 
ATOM   3928  C  CD1   . ILE C  2  44   ? 82.296  -23.142 67.397   1.00 52.74  ? 44   ILE C CD1   1 
ATOM   3929  N  N     . GLN C  2  45   ? 80.766  -27.011 65.052   1.00 44.43  ? 45   GLN C N     1 
ATOM   3930  C  CA    . GLN C  2  45   ? 81.390  -28.157 64.411   1.00 47.69  ? 45   GLN C CA    1 
ATOM   3931  C  C     . GLN C  2  45   ? 80.482  -28.631 63.285   1.00 49.99  ? 45   GLN C C     1 
ATOM   3932  O  O     . GLN C  2  45   ? 80.929  -28.802 62.152   1.00 49.15  ? 45   GLN C O     1 
ATOM   3933  C  CB    . GLN C  2  45   ? 81.622  -29.287 65.413   1.00 48.44  ? 45   GLN C CB    1 
ATOM   3934  C  CG    . GLN C  2  45   ? 82.283  -30.516 64.808   1.00 48.23  ? 45   GLN C CG    1 
ATOM   3935  C  CD    . GLN C  2  45   ? 83.745  -30.300 64.475   1.00 51.42  ? 45   GLN C CD    1 
ATOM   3936  O  OE1   . GLN C  2  45   ? 84.513  -29.794 65.293   1.00 47.75  ? 45   GLN C OE1   1 
ATOM   3937  N  NE2   . GLN C  2  45   ? 84.138  -30.688 63.269   1.00 55.83  ? 45   GLN C NE2   1 
ATOM   3938  N  N     . ALA C  2  46   ? 79.203  -28.821 63.605   1.00 47.87  ? 46   ALA C N     1 
ATOM   3939  C  CA    . ALA C  2  46   ? 78.190  -29.199 62.620   1.00 47.98  ? 46   ALA C CA    1 
ATOM   3940  C  C     . ALA C  2  46   ? 78.151  -28.226 61.460   1.00 45.28  ? 46   ALA C C     1 
ATOM   3941  O  O     . ALA C  2  46   ? 78.052  -28.632 60.304   1.00 44.31  ? 46   ALA C O     1 
ATOM   3942  C  CB    . ALA C  2  46   ? 76.828  -29.243 63.261   1.00 52.89  ? 46   ALA C CB    1 
ATOM   3943  N  N     . ALA C  2  47   ? 78.195  -26.937 61.782   1.00 47.12  ? 47   ALA C N     1 
ATOM   3944  C  CA    . ALA C  2  47   ? 78.179  -25.901 60.757   1.00 50.07  ? 47   ALA C CA    1 
ATOM   3945  C  C     . ALA C  2  47   ? 79.363  -26.058 59.805   1.00 50.24  ? 47   ALA C C     1 
ATOM   3946  O  O     . ALA C  2  47   ? 79.203  -25.991 58.582   1.00 48.89  ? 47   ALA C O     1 
ATOM   3947  C  CB    . ALA C  2  47   ? 78.180  -24.523 61.395   1.00 49.34  ? 47   ALA C CB    1 
ATOM   3948  N  N     . PHE C  2  48   ? 80.547  -26.274 60.373   1.00 49.68  ? 48   PHE C N     1 
ATOM   3949  C  CA    . PHE C  2  48   ? 81.749  -26.506 59.577   1.00 46.94  ? 48   PHE C CA    1 
ATOM   3950  C  C     . PHE C  2  48   ? 81.617  -27.756 58.708   1.00 50.98  ? 48   PHE C C     1 
ATOM   3951  O  O     . PHE C  2  48   ? 82.076  -27.780 57.565   1.00 50.18  ? 48   PHE C O     1 
ATOM   3952  C  CB    . PHE C  2  48   ? 82.982  -26.630 60.476   1.00 42.70  ? 48   PHE C CB    1 
ATOM   3953  C  CG    . PHE C  2  48   ? 83.605  -25.313 60.847   1.00 39.77  ? 48   PHE C CG    1 
ATOM   3954  C  CD1   . PHE C  2  48   ? 83.630  -24.889 62.165   1.00 41.59  ? 48   PHE C CD1   1 
ATOM   3955  C  CD2   . PHE C  2  48   ? 84.173  -24.502 59.879   1.00 39.66  ? 48   PHE C CD2   1 
ATOM   3956  C  CE1   . PHE C  2  48   ? 84.206  -23.681 62.511   1.00 38.58  ? 48   PHE C CE1   1 
ATOM   3957  C  CE2   . PHE C  2  48   ? 84.751  -23.292 60.220   1.00 37.34  ? 48   PHE C CE2   1 
ATOM   3958  C  CZ    . PHE C  2  48   ? 84.766  -22.882 61.538   1.00 34.00  ? 48   PHE C CZ    1 
ATOM   3959  N  N     . ARG C  2  49   ? 80.987  -28.789 59.259   1.00 48.73  ? 49   ARG C N     1 
ATOM   3960  C  CA    . ARG C  2  49   ? 80.830  -30.060 58.558   1.00 51.85  ? 49   ARG C CA    1 
ATOM   3961  C  C     . ARG C  2  49   ? 79.835  -29.964 57.404   1.00 53.65  ? 49   ARG C C     1 
ATOM   3962  O  O     . ARG C  2  49   ? 79.989  -30.636 56.385   1.00 55.21  ? 49   ARG C O     1 
ATOM   3963  C  CB    . ARG C  2  49   ? 80.407  -31.159 59.537   1.00 53.69  ? 49   ARG C CB    1 
ATOM   3964  C  CG    . ARG C  2  49   ? 81.431  -31.440 60.630   1.00 59.06  ? 49   ARG C CG    1 
ATOM   3965  C  CD    . ARG C  2  49   ? 82.509  -32.411 60.175   1.00 60.79  ? 49   ARG C CD    1 
ATOM   3966  N  NE    . ARG C  2  49   ? 82.113  -33.798 60.403   1.00 64.48  ? 49   ARG C NE    1 
ATOM   3967  C  CZ    . ARG C  2  49   ? 81.507  -34.561 59.500   1.00 70.70  ? 49   ARG C CZ    1 
ATOM   3968  N  NH1   . ARG C  2  49   ? 81.229  -34.079 58.296   1.00 70.85  ? 49   ARG C NH1   1 
ATOM   3969  N  NH2   . ARG C  2  49   ? 81.181  -35.811 59.800   1.00 71.51  ? 49   ARG C NH2   1 
ATOM   3970  N  N     . GLU C  2  50   ? 78.812  -29.130 57.569   1.00 53.82  ? 50   GLU C N     1 
ATOM   3971  C  CA    . GLU C  2  50   ? 77.821  -28.923 56.519   1.00 53.45  ? 50   GLU C CA    1 
ATOM   3972  C  C     . GLU C  2  50   ? 78.360  -28.018 55.419   1.00 53.02  ? 50   GLU C C     1 
ATOM   3973  O  O     . GLU C  2  50   ? 78.190  -28.305 54.234   1.00 55.89  ? 50   GLU C O     1 
ATOM   3974  C  CB    . GLU C  2  50   ? 76.527  -28.334 57.087   1.00 57.33  ? 50   GLU C CB    1 
ATOM   3975  C  CG    . GLU C  2  50   ? 75.678  -29.314 57.884   1.00 62.71  ? 50   GLU C CG    1 
ATOM   3976  C  CD    . GLU C  2  50   ? 74.269  -28.797 58.128   1.00 65.62  ? 50   GLU C CD    1 
ATOM   3977  O  OE1   . GLU C  2  50   ? 73.597  -29.303 59.051   1.00 66.66  ? 50   GLU C OE1   1 
ATOM   3978  O  OE2   . GLU C  2  50   ? 73.832  -27.887 57.391   1.00 62.90  ? 50   GLU C OE2   1 
ATOM   3979  N  N     . THR C  2  51   ? 79.006  -26.924 55.815   1.00 53.33  ? 51   THR C N     1 
ATOM   3980  C  CA    . THR C  2  51   ? 79.520  -25.950 54.854   1.00 55.26  ? 51   THR C CA    1 
ATOM   3981  C  C     . THR C  2  51   ? 80.613  -26.535 53.956   1.00 56.91  ? 51   THR C C     1 
ATOM   3982  O  O     . THR C  2  51   ? 80.564  -26.395 52.734   1.00 57.76  ? 51   THR C O     1 
ATOM   3983  C  CB    . THR C  2  51   ? 80.049  -24.678 55.557   1.00 53.82  ? 51   THR C CB    1 
ATOM   3984  O  OG1   . THR C  2  51   ? 78.972  -24.023 56.240   1.00 53.92  ? 51   THR C OG1   1 
ATOM   3985  C  CG2   . THR C  2  51   ? 80.651  -23.718 54.544   1.00 49.48  ? 51   THR C CG2   1 
ATOM   3986  N  N     . PHE C  2  52   ? 81.596  -27.188 54.570   1.00 60.18  ? 52   PHE C N     1 
ATOM   3987  C  CA    . PHE C  2  52   ? 82.697  -27.807 53.837   1.00 56.62  ? 52   PHE C CA    1 
ATOM   3988  C  C     . PHE C  2  52   ? 82.363  -29.252 53.461   1.00 55.26  ? 52   PHE C C     1 
ATOM   3989  O  O     . PHE C  2  52   ? 81.555  -29.892 54.133   1.00 52.96  ? 52   PHE C O     1 
ATOM   3990  C  CB    . PHE C  2  52   ? 83.977  -27.751 54.674   1.00 50.62  ? 52   PHE C CB    1 
ATOM   3991  C  CG    . PHE C  2  52   ? 84.457  -26.355 54.950   1.00 49.53  ? 52   PHE C CG    1 
ATOM   3992  C  CD1   . PHE C  2  52   ? 85.295  -25.708 54.058   1.00 49.51  ? 52   PHE C CD1   1 
ATOM   3993  C  CD2   . PHE C  2  52   ? 84.069  -25.688 56.100   1.00 47.46  ? 52   PHE C CD2   1 
ATOM   3994  C  CE1   . PHE C  2  52   ? 85.738  -24.422 54.307   1.00 45.36  ? 52   PHE C CE1   1 
ATOM   3995  C  CE2   . PHE C  2  52   ? 84.508  -24.402 56.354   1.00 46.43  ? 52   PHE C CE2   1 
ATOM   3996  C  CZ    . PHE C  2  52   ? 85.344  -23.769 55.456   1.00 40.99  ? 52   PHE C CZ    1 
ATOM   3997  N  N     . PRO C  2  53   ? 82.990  -29.781 52.393   1.00 57.50  ? 53   PRO C N     1 
ATOM   3998  C  CA    . PRO C  2  53   ? 83.990  -29.162 51.513   1.00 56.28  ? 53   PRO C CA    1 
ATOM   3999  C  C     . PRO C  2  53   ? 83.400  -28.211 50.475   1.00 54.52  ? 53   PRO C C     1 
ATOM   4000  O  O     . PRO C  2  53   ? 82.256  -28.380 50.051   1.00 53.90  ? 53   PRO C O     1 
ATOM   4001  C  CB    . PRO C  2  53   ? 84.615  -30.367 50.810   1.00 55.69  ? 53   PRO C CB    1 
ATOM   4002  C  CG    . PRO C  2  53   ? 83.507  -31.350 50.737   1.00 54.77  ? 53   PRO C CG    1 
ATOM   4003  C  CD    . PRO C  2  53   ? 82.722  -31.179 52.010   1.00 54.74  ? 53   PRO C CD    1 
ATOM   4004  N  N     . ILE C  2  54   ? 84.195  -27.226 50.067   1.00 57.65  ? 54   ILE C N     1 
ATOM   4005  C  CA    . ILE C  2  54   ? 83.795  -26.266 49.044   1.00 62.31  ? 54   ILE C CA    1 
ATOM   4006  C  C     . ILE C  2  54   ? 84.478  -26.601 47.721   1.00 68.56  ? 54   ILE C C     1 
ATOM   4007  O  O     . ILE C  2  54   ? 85.702  -26.524 47.610   1.00 65.86  ? 54   ILE C O     1 
ATOM   4008  C  CB    . ILE C  2  54   ? 84.181  -24.832 49.449   1.00 55.96  ? 54   ILE C CB    1 
ATOM   4009  C  CG1   . ILE C  2  54   ? 83.673  -24.516 50.856   1.00 54.08  ? 54   ILE C CG1   1 
ATOM   4010  C  CG2   . ILE C  2  54   ? 83.641  -23.829 48.446   1.00 54.97  ? 54   ILE C CG2   1 
ATOM   4011  C  CD1   . ILE C  2  54   ? 84.111  -23.163 51.367   1.00 51.87  ? 54   ILE C CD1   1 
ATOM   4012  N  N     . GLU C  2  55   ? 83.688  -26.966 46.716   1.00 73.84  ? 55   GLU C N     1 
ATOM   4013  C  CA    . GLU C  2  55   ? 84.244  -27.408 45.442   1.00 75.33  ? 55   GLU C CA    1 
ATOM   4014  C  C     . GLU C  2  55   ? 84.176  -26.323 44.371   1.00 77.81  ? 55   GLU C C     1 
ATOM   4015  O  O     . GLU C  2  55   ? 83.639  -25.240 44.605   1.00 74.85  ? 55   GLU C O     1 
ATOM   4016  C  CB    . GLU C  2  55   ? 83.512  -28.660 44.956   1.00 71.36  ? 55   GLU C CB    1 
ATOM   4017  C  CG    . GLU C  2  55   ? 83.349  -29.728 46.023   1.00 68.47  ? 55   GLU C CG    1 
ATOM   4018  C  CD    . GLU C  2  55   ? 82.525  -30.905 45.545   1.00 74.22  ? 55   GLU C CD    1 
ATOM   4019  O  OE1   . GLU C  2  55   ? 82.050  -31.685 46.398   1.00 69.12  ? 55   GLU C OE1   1 
ATOM   4020  O  OE2   . GLU C  2  55   ? 82.353  -31.049 44.316   1.00 75.43  ? 55   GLU C OE2   1 
ATOM   4021  N  N     . GLU C  2  56   ? 84.717  -26.639 43.196   1.00 82.04  ? 56   GLU C N     1 
ATOM   4022  C  CA    . GLU C  2  56   ? 84.738  -25.725 42.054   1.00 84.43  ? 56   GLU C CA    1 
ATOM   4023  C  C     . GLU C  2  56   ? 85.289  -24.341 42.400   1.00 77.99  ? 56   GLU C C     1 
ATOM   4024  O  O     . GLU C  2  56   ? 85.185  -23.404 41.608   1.00 76.33  ? 56   GLU C O     1 
ATOM   4025  C  CB    . GLU C  2  56   ? 83.345  -25.610 41.432   1.00 88.62  ? 56   GLU C CB    1 
ATOM   4026  C  CG    . GLU C  2  56   ? 82.815  -26.920 40.871   1.00 88.39  ? 56   GLU C CG    1 
ATOM   4027  C  CD    . GLU C  2  56   ? 81.404  -26.796 40.335   1.00 99.30  ? 56   GLU C CD    1 
ATOM   4028  O  OE1   . GLU C  2  56   ? 81.220  -26.927 39.106   1.00 99.09  ? 56   GLU C OE1   1 
ATOM   4029  O  OE2   . GLU C  2  56   ? 80.478  -26.570 41.143   1.00 97.86  ? 56   GLU C OE2   1 
ATOM   4030  N  N     . GLY C  2  63   ? 89.527  -28.858 39.064   1.00 66.86  ? 63   GLY C N     1 
ATOM   4031  C  CA    . GLY C  2  63   ? 89.312  -27.698 39.909   1.00 67.55  ? 63   GLY C CA    1 
ATOM   4032  C  C     . GLY C  2  63   ? 89.857  -27.887 41.312   1.00 79.67  ? 63   GLY C C     1 
ATOM   4033  O  O     . GLY C  2  63   ? 90.525  -28.880 41.600   1.00 83.87  ? 63   GLY C O     1 
ATOM   4034  N  N     . LEU C  2  64   ? 89.562  -26.931 42.189   1.00 76.93  ? 64   LEU C N     1 
ATOM   4035  C  CA    . LEU C  2  64   ? 90.057  -26.959 43.562   1.00 70.75  ? 64   LEU C CA    1 
ATOM   4036  C  C     . LEU C  2  64   ? 88.990  -27.431 44.546   1.00 71.27  ? 64   LEU C C     1 
ATOM   4037  O  O     . LEU C  2  64   ? 87.803  -27.153 44.373   1.00 71.52  ? 64   LEU C O     1 
ATOM   4038  C  CB    . LEU C  2  64   ? 90.558  -25.574 43.980   1.00 65.27  ? 64   LEU C CB    1 
ATOM   4039  C  CG    . LEU C  2  64   ? 91.702  -24.958 43.174   1.00 71.49  ? 64   LEU C CG    1 
ATOM   4040  C  CD1   . LEU C  2  64   ? 92.037  -23.571 43.702   1.00 67.92  ? 64   LEU C CD1   1 
ATOM   4041  C  CD2   . LEU C  2  64   ? 92.923  -25.859 43.211   1.00 80.23  ? 64   LEU C CD2   1 
ATOM   4042  N  N     . VAL C  2  65   ? 89.422  -28.153 45.575   1.00 70.26  ? 65   VAL C N     1 
ATOM   4043  C  CA    . VAL C  2  65   ? 88.530  -28.561 46.654   1.00 64.53  ? 65   VAL C CA    1 
ATOM   4044  C  C     . VAL C  2  65   ? 89.090  -28.117 48.003   1.00 64.31  ? 65   VAL C C     1 
ATOM   4045  O  O     . VAL C  2  65   ? 90.138  -28.595 48.437   1.00 64.15  ? 65   VAL C O     1 
ATOM   4046  C  CB    . VAL C  2  65   ? 88.313  -30.089 46.669   1.00 59.93  ? 65   VAL C CB    1 
ATOM   4047  C  CG1   . VAL C  2  65   ? 87.504  -30.501 47.890   1.00 52.70  ? 65   VAL C CG1   1 
ATOM   4048  C  CG2   . VAL C  2  65   ? 87.626  -30.542 45.390   1.00 63.91  ? 65   VAL C CG2   1 
ATOM   4049  N  N     . LEU C  2  66   ? 88.386  -27.198 48.659   1.00 66.97  ? 66   LEU C N     1 
ATOM   4050  C  CA    . LEU C  2  66   ? 88.790  -26.704 49.972   1.00 62.50  ? 66   LEU C CA    1 
ATOM   4051  C  C     . LEU C  2  66   ? 88.003  -27.426 51.061   1.00 54.86  ? 66   LEU C C     1 
ATOM   4052  O  O     . LEU C  2  66   ? 86.773  -27.380 51.082   1.00 56.10  ? 66   LEU C O     1 
ATOM   4053  C  CB    . LEU C  2  66   ? 88.574  -25.190 50.065   1.00 56.73  ? 66   LEU C CB    1 
ATOM   4054  C  CG    . LEU C  2  66   ? 88.951  -24.491 51.373   1.00 50.93  ? 66   LEU C CG    1 
ATOM   4055  C  CD1   . LEU C  2  66   ? 90.406  -24.748 51.729   1.00 61.20  ? 66   LEU C CD1   1 
ATOM   4056  C  CD2   . LEU C  2  66   ? 88.684  -22.997 51.276   1.00 48.70  ? 66   LEU C CD2   1 
ATOM   4057  N  N     . ASP C  2  67   ? 88.714  -28.095 51.964   1.00 55.01  ? 67   ASP C N     1 
ATOM   4058  C  CA    . ASP C  2  67   ? 88.066  -28.944 52.959   1.00 61.31  ? 67   ASP C CA    1 
ATOM   4059  C  C     . ASP C  2  67   ? 88.347  -28.500 54.396   1.00 61.10  ? 67   ASP C C     1 
ATOM   4060  O  O     . ASP C  2  67   ? 89.325  -27.801 54.667   1.00 60.80  ? 67   ASP C O     1 
ATOM   4061  C  CB    . ASP C  2  67   ? 88.479  -30.407 52.760   1.00 59.32  ? 67   ASP C CB    1 
ATOM   4062  C  CG    . ASP C  2  67   ? 87.586  -31.377 53.516   1.00 58.45  ? 67   ASP C CG    1 
ATOM   4063  O  OD1   . ASP C  2  67   ? 86.425  -31.019 53.811   1.00 55.42  ? 67   ASP C OD1   1 
ATOM   4064  O  OD2   . ASP C  2  67   ? 88.044  -32.499 53.812   1.00 62.99  ? 67   ASP C OD2   1 
ATOM   4065  N  N     . PHE C  2  68   ? 87.473  -28.911 55.308   1.00 56.03  ? 68   PHE C N     1 
ATOM   4066  C  CA    . PHE C  2  68   ? 87.598  -28.568 56.718   1.00 53.19  ? 68   PHE C CA    1 
ATOM   4067  C  C     . PHE C  2  68   ? 88.369  -29.631 57.489   1.00 51.51  ? 68   PHE C C     1 
ATOM   4068  O  O     . PHE C  2  68   ? 87.952  -30.788 57.558   1.00 45.75  ? 68   PHE C O     1 
ATOM   4069  C  CB    . PHE C  2  68   ? 86.211  -28.374 57.338   1.00 55.66  ? 68   PHE C CB    1 
ATOM   4070  C  CG    . PHE C  2  68   ? 86.214  -28.323 58.841   1.00 51.14  ? 68   PHE C CG    1 
ATOM   4071  C  CD1   . PHE C  2  68   ? 86.555  -27.158 59.509   1.00 45.36  ? 68   PHE C CD1   1 
ATOM   4072  C  CD2   . PHE C  2  68   ? 85.859  -29.438 59.585   1.00 47.33  ? 68   PHE C CD2   1 
ATOM   4073  C  CE1   . PHE C  2  68   ? 86.553  -27.108 60.890   1.00 43.12  ? 68   PHE C CE1   1 
ATOM   4074  C  CE2   . PHE C  2  68   ? 85.856  -29.395 60.964   1.00 47.38  ? 68   PHE C CE2   1 
ATOM   4075  C  CZ    . PHE C  2  68   ? 86.201  -28.229 61.619   1.00 47.14  ? 68   PHE C CZ    1 
ATOM   4076  N  N     . LEU C  2  69   ? 89.494  -29.228 58.071   1.00 53.33  ? 69   LEU C N     1 
ATOM   4077  C  CA    . LEU C  2  69   ? 90.275  -30.122 58.917   1.00 53.00  ? 69   LEU C CA    1 
ATOM   4078  C  C     . LEU C  2  69   ? 89.848  -29.995 60.373   1.00 47.64  ? 69   LEU C C     1 
ATOM   4079  O  O     . LEU C  2  69   ? 89.320  -30.945 60.950   1.00 46.32  ? 69   LEU C O     1 
ATOM   4080  C  CB    . LEU C  2  69   ? 91.771  -29.853 58.762   1.00 56.24  ? 69   LEU C CB    1 
ATOM   4081  C  CG    . LEU C  2  69   ? 92.317  -30.146 57.365   1.00 61.88  ? 69   LEU C CG    1 
ATOM   4082  C  CD1   . LEU C  2  69   ? 93.792  -29.805 57.281   1.00 63.44  ? 69   LEU C CD1   1 
ATOM   4083  C  CD2   . LEU C  2  69   ? 92.074  -31.604 56.997   1.00 60.16  ? 69   LEU C CD2   1 
ATOM   4084  N  N     . GLU C  2  70   ? 90.070  -28.823 60.966   1.00 50.36  ? 70   GLU C N     1 
ATOM   4085  C  CA    . GLU C  2  70   ? 89.642  -28.603 62.350   1.00 50.07  ? 70   GLU C CA    1 
ATOM   4086  C  C     . GLU C  2  70   ? 89.452  -27.130 62.711   1.00 47.48  ? 70   GLU C C     1 
ATOM   4087  O  O     . GLU C  2  70   ? 89.561  -26.252 61.858   1.00 45.89  ? 70   GLU C O     1 
ATOM   4088  C  CB    . GLU C  2  70   ? 90.603  -29.280 63.335   1.00 52.88  ? 70   GLU C CB    1 
ATOM   4089  C  CG    . GLU C  2  70   ? 92.073  -28.950 63.118   1.00 58.87  ? 70   GLU C CG    1 
ATOM   4090  C  CD    . GLU C  2  70   ? 92.992  -29.769 64.009   1.00 58.69  ? 70   GLU C CD    1 
ATOM   4091  O  OE1   . GLU C  2  70   ? 94.225  -29.585 63.927   1.00 56.85  ? 70   GLU C OE1   1 
ATOM   4092  O  OE2   . GLU C  2  70   ? 92.481  -30.600 64.791   1.00 55.27  ? 70   GLU C OE2   1 
ATOM   4093  N  N     . TYR C  2  71   ? 89.144  -26.873 63.978   1.00 43.58  ? 71   TYR C N     1 
ATOM   4094  C  CA    . TYR C  2  71   ? 89.017  -25.507 64.473   1.00 44.51  ? 71   TYR C CA    1 
ATOM   4095  C  C     . TYR C  2  71   ? 89.392  -25.445 65.947   1.00 46.83  ? 71   TYR C C     1 
ATOM   4096  O  O     . TYR C  2  71   ? 89.397  -26.463 66.640   1.00 44.60  ? 71   TYR C O     1 
ATOM   4097  C  CB    . TYR C  2  71   ? 87.593  -24.979 64.276   1.00 44.70  ? 71   TYR C CB    1 
ATOM   4098  C  CG    . TYR C  2  71   ? 86.624  -25.394 65.364   1.00 44.11  ? 71   TYR C CG    1 
ATOM   4099  C  CD1   . TYR C  2  71   ? 86.339  -24.549 66.431   1.00 39.40  ? 71   TYR C CD1   1 
ATOM   4100  C  CD2   . TYR C  2  71   ? 85.996  -26.630 65.325   1.00 46.76  ? 71   TYR C CD2   1 
ATOM   4101  C  CE1   . TYR C  2  71   ? 85.458  -24.927 67.428   1.00 40.66  ? 71   TYR C CE1   1 
ATOM   4102  C  CE2   . TYR C  2  71   ? 85.110  -27.013 66.314   1.00 45.60  ? 71   TYR C CE2   1 
ATOM   4103  C  CZ    . TYR C  2  71   ? 84.846  -26.161 67.364   1.00 42.88  ? 71   TYR C CZ    1 
ATOM   4104  O  OH    . TYR C  2  71   ? 83.965  -26.548 68.350   1.00 39.03  ? 71   TYR C OH    1 
ATOM   4105  N  N     . ARG C  2  72   ? 89.697  -24.243 66.426   1.00 49.02  ? 72   ARG C N     1 
ATOM   4106  C  CA    . ARG C  2  72   ? 90.036  -24.048 67.830   1.00 52.54  ? 72   ARG C CA    1 
ATOM   4107  C  C     . ARG C  2  72   ? 89.604  -22.672 68.330   1.00 51.61  ? 72   ARG C C     1 
ATOM   4108  O  O     . ARG C  2  72   ? 89.496  -21.715 67.555   1.00 49.02  ? 72   ARG C O     1 
ATOM   4109  C  CB    . ARG C  2  72   ? 91.538  -24.237 68.056   1.00 48.76  ? 72   ARG C CB    1 
ATOM   4110  C  CG    . ARG C  2  72   ? 92.393  -23.111 67.502   1.00 45.57  ? 72   ARG C CG    1 
ATOM   4111  C  CD    . ARG C  2  72   ? 93.863  -23.331 67.811   1.00 45.35  ? 72   ARG C CD    1 
ATOM   4112  N  NE    . ARG C  2  72   ? 94.682  -22.198 67.393   1.00 43.75  ? 72   ARG C NE    1 
ATOM   4113  C  CZ    . ARG C  2  72   ? 95.019  -21.189 68.189   1.00 44.25  ? 72   ARG C CZ    1 
ATOM   4114  N  NH1   . ARG C  2  72   ? 94.609  -21.174 69.450   1.00 42.76  ? 72   ARG C NH1   1 
ATOM   4115  N  NH2   . ARG C  2  72   ? 95.768  -20.197 67.726   1.00 46.00  ? 72   ARG C NH2   1 
ATOM   4116  N  N     . LEU C  2  73   ? 89.354  -22.590 69.633   1.00 45.70  ? 73   LEU C N     1 
ATOM   4117  C  CA    . LEU C  2  73   ? 89.010  -21.333 70.281   1.00 44.17  ? 73   LEU C CA    1 
ATOM   4118  C  C     . LEU C  2  73   ? 90.131  -20.919 71.225   1.00 45.17  ? 73   LEU C C     1 
ATOM   4119  O  O     . LEU C  2  73   ? 90.548  -21.698 72.083   1.00 45.82  ? 73   LEU C O     1 
ATOM   4120  C  CB    . LEU C  2  73   ? 87.698  -21.473 71.053   1.00 44.06  ? 73   LEU C CB    1 
ATOM   4121  C  CG    . LEU C  2  73   ? 86.416  -21.515 70.222   1.00 40.09  ? 73   LEU C CG    1 
ATOM   4122  C  CD1   . LEU C  2  73   ? 85.242  -21.977 71.068   1.00 38.09  ? 73   LEU C CD1   1 
ATOM   4123  C  CD2   . LEU C  2  73   ? 86.138  -20.146 69.623   1.00 41.78  ? 73   LEU C CD2   1 
ATOM   4124  N  N     . GLY C  2  74   ? 90.618  -19.693 71.062   1.00 42.74  ? 74   GLY C N     1 
ATOM   4125  C  CA    . GLY C  2  74   ? 91.696  -19.188 71.893   1.00 43.90  ? 74   GLY C CA    1 
ATOM   4126  C  C     . GLY C  2  74   ? 91.210  -18.646 73.224   1.00 45.56  ? 74   GLY C C     1 
ATOM   4127  O  O     . GLY C  2  74   ? 90.057  -18.845 73.607   1.00 44.71  ? 74   GLY C O     1 
ATOM   4128  N  N     . GLU C  2  75   ? 92.100  -17.970 73.939   1.00 44.37  ? 75   GLU C N     1 
ATOM   4129  C  CA    . GLU C  2  75   ? 91.744  -17.339 75.202   1.00 42.01  ? 75   GLU C CA    1 
ATOM   4130  C  C     . GLU C  2  75   ? 91.260  -15.913 74.970   1.00 40.32  ? 75   GLU C C     1 
ATOM   4131  O  O     . GLU C  2  75   ? 91.697  -15.256 74.025   1.00 42.74  ? 75   GLU C O     1 
ATOM   4132  C  CB    . GLU C  2  75   ? 92.937  -17.353 76.159   1.00 42.61  ? 75   GLU C CB    1 
ATOM   4133  C  CG    . GLU C  2  75   ? 93.295  -18.741 76.646   1.00 46.95  ? 75   GLU C CG    1 
ATOM   4134  C  CD    . GLU C  2  75   ? 92.097  -19.468 77.223   1.00 55.03  ? 75   GLU C CD    1 
ATOM   4135  O  OE1   . GLU C  2  75   ? 91.712  -20.521 76.671   1.00 58.55  ? 75   GLU C OE1   1 
ATOM   4136  O  OE2   . GLU C  2  75   ? 91.536  -18.981 78.227   1.00 57.18  ? 75   GLU C OE2   1 
ATOM   4137  N  N     . PRO C  2  76   ? 90.344  -15.433 75.826   1.00 35.10  ? 76   PRO C N     1 
ATOM   4138  C  CA    . PRO C  2  76   ? 89.853  -14.057 75.711   1.00 34.11  ? 76   PRO C CA    1 
ATOM   4139  C  C     . PRO C  2  76   ? 90.987  -13.049 75.840   1.00 34.39  ? 76   PRO C C     1 
ATOM   4140  O  O     . PRO C  2  76   ? 91.750  -13.111 76.802   1.00 32.56  ? 76   PRO C O     1 
ATOM   4141  C  CB    . PRO C  2  76   ? 88.914  -13.922 76.912   1.00 37.53  ? 76   PRO C CB    1 
ATOM   4142  C  CG    . PRO C  2  76   ? 88.487  -15.310 77.220   1.00 38.38  ? 76   PRO C CG    1 
ATOM   4143  C  CD    . PRO C  2  76   ? 89.660  -16.180 76.896   1.00 38.15  ? 76   PRO C CD    1 
ATOM   4144  N  N     . PRO C  2  77   ? 91.092  -12.120 74.879   1.00 37.48  ? 77   PRO C N     1 
ATOM   4145  C  CA    . PRO C  2  77   ? 92.103  -11.058 74.926   1.00 39.80  ? 77   PRO C CA    1 
ATOM   4146  C  C     . PRO C  2  77   ? 91.828  -10.066 76.052   1.00 43.48  ? 77   PRO C C     1 
ATOM   4147  O  O     . PRO C  2  77   ? 92.720  -9.307  76.432   1.00 46.12  ? 77   PRO C O     1 
ATOM   4148  C  CB    . PRO C  2  77   ? 91.966  -10.378 73.558   1.00 40.77  ? 77   PRO C CB    1 
ATOM   4149  C  CG    . PRO C  2  77   ? 90.594  -10.720 73.092   1.00 42.03  ? 77   PRO C CG    1 
ATOM   4150  C  CD    . PRO C  2  77   ? 90.306  -12.084 73.635   1.00 40.83  ? 77   PRO C CD    1 
ATOM   4151  N  N     . PHE C  2  78   ? 90.604  -10.073 76.572   1.00 43.39  ? 78   PHE C N     1 
ATOM   4152  C  CA    . PHE C  2  78   ? 90.245  -9.231  77.708   1.00 44.54  ? 78   PHE C CA    1 
ATOM   4153  C  C     . PHE C  2  78   ? 89.319  -9.981  78.664   1.00 47.39  ? 78   PHE C C     1 
ATOM   4154  O  O     . PHE C  2  78   ? 88.479  -10.766 78.225   1.00 45.83  ? 78   PHE C O     1 
ATOM   4155  C  CB    . PHE C  2  78   ? 89.570  -7.942  77.230   1.00 47.33  ? 78   PHE C CB    1 
ATOM   4156  C  CG    . PHE C  2  78   ? 90.426  -7.106  76.321   1.00 48.15  ? 78   PHE C CG    1 
ATOM   4157  C  CD1   . PHE C  2  78   ? 90.246  -7.146  74.948   1.00 45.87  ? 78   PHE C CD1   1 
ATOM   4158  C  CD2   . PHE C  2  78   ? 91.411  -6.281  76.838   1.00 45.63  ? 78   PHE C CD2   1 
ATOM   4159  C  CE1   . PHE C  2  78   ? 91.032  -6.377  74.109   1.00 44.70  ? 78   PHE C CE1   1 
ATOM   4160  C  CE2   . PHE C  2  78   ? 92.200  -5.511  76.004   1.00 44.18  ? 78   PHE C CE2   1 
ATOM   4161  C  CZ    . PHE C  2  78   ? 92.010  -5.559  74.638   1.00 43.39  ? 78   PHE C CZ    1 
ATOM   4162  N  N     . PRO C  2  79   ? 89.478  -9.745  79.978   1.00 52.67  ? 79   PRO C N     1 
ATOM   4163  C  CA    . PRO C  2  79   ? 88.602  -10.324 81.004   1.00 46.69  ? 79   PRO C CA    1 
ATOM   4164  C  C     . PRO C  2  79   ? 87.243  -9.630  81.027   1.00 46.80  ? 79   PRO C C     1 
ATOM   4165  O  O     . PRO C  2  79   ? 87.108  -8.544  80.463   1.00 49.55  ? 79   PRO C O     1 
ATOM   4166  C  CB    . PRO C  2  79   ? 89.363  -10.055 82.303   1.00 44.08  ? 79   PRO C CB    1 
ATOM   4167  C  CG    . PRO C  2  79   ? 90.166  -8.839  82.015   1.00 49.49  ? 79   PRO C CG    1 
ATOM   4168  C  CD    . PRO C  2  79   ? 90.564  -8.944  80.570   1.00 49.22  ? 79   PRO C CD    1 
ATOM   4169  N  N     . GLN C  2  80   ? 86.258  -10.254 81.668   1.00 40.21  ? 80   GLN C N     1 
ATOM   4170  C  CA    . GLN C  2  80   ? 84.881  -9.759  81.666   1.00 39.06  ? 80   GLN C CA    1 
ATOM   4171  C  C     . GLN C  2  80   ? 84.740  -8.295  82.093   1.00 42.74  ? 80   GLN C C     1 
ATOM   4172  O  O     . GLN C  2  80   ? 84.104  -7.495  81.401   1.00 40.31  ? 80   GLN C O     1 
ATOM   4173  C  CB    . GLN C  2  80   ? 83.999  -10.652 82.543   1.00 32.55  ? 80   GLN C CB    1 
ATOM   4174  C  CG    . GLN C  2  80   ? 84.046  -12.123 82.163   1.00 31.95  ? 80   GLN C CG    1 
ATOM   4175  C  CD    . GLN C  2  80   ? 83.112  -12.978 82.996   1.00 33.01  ? 80   GLN C CD    1 
ATOM   4176  O  OE1   . GLN C  2  80   ? 82.287  -12.463 83.751   1.00 32.65  ? 80   GLN C OE1   1 
ATOM   4177  N  NE2   . GLN C  2  80   ? 83.238  -14.294 82.863   1.00 31.08  ? 80   GLN C NE2   1 
ATOM   4178  N  N     . ASP C  2  81   ? 85.339  -7.953  83.230   1.00 45.61  ? 81   ASP C N     1 
ATOM   4179  C  CA    . ASP C  2  81   ? 85.262  -6.597  83.771   1.00 46.67  ? 81   ASP C CA    1 
ATOM   4180  C  C     . ASP C  2  81   ? 85.819  -5.544  82.813   1.00 46.93  ? 81   ASP C C     1 
ATOM   4181  O  O     . ASP C  2  81   ? 85.207  -4.491  82.607   1.00 49.03  ? 81   ASP C O     1 
ATOM   4182  C  CB    . ASP C  2  81   ? 85.988  -6.521  85.117   1.00 53.69  ? 81   ASP C CB    1 
ATOM   4183  C  CG    . ASP C  2  81   ? 87.355  -7.183  85.081   1.00 63.26  ? 81   ASP C CG    1 
ATOM   4184  O  OD1   . ASP C  2  81   ? 88.315  -6.605  85.635   1.00 65.68  ? 81   ASP C OD1   1 
ATOM   4185  O  OD2   . ASP C  2  81   ? 87.467  -8.285  84.501   1.00 61.60  ? 81   ASP C OD2   1 
ATOM   4186  N  N     . GLU C  2  82   ? 86.976  -5.834  82.226   1.00 46.30  ? 82   GLU C N     1 
ATOM   4187  C  CA    . GLU C  2  82   ? 87.613  -4.907  81.297   1.00 51.10  ? 82   GLU C CA    1 
ATOM   4188  C  C     . GLU C  2  82   ? 86.770  -4.732  80.038   1.00 50.18  ? 82   GLU C C     1 
ATOM   4189  O  O     . GLU C  2  82   ? 86.749  -3.656  79.439   1.00 49.30  ? 82   GLU C O     1 
ATOM   4190  C  CB    . GLU C  2  82   ? 89.023  -5.377  80.936   1.00 56.51  ? 82   GLU C CB    1 
ATOM   4191  C  CG    . GLU C  2  82   ? 89.792  -4.398  80.059   1.00 60.27  ? 82   GLU C CG    1 
ATOM   4192  C  CD    . GLU C  2  82   ? 91.234  -4.814  79.839   1.00 65.72  ? 82   GLU C CD    1 
ATOM   4193  O  OE1   . GLU C  2  82   ? 91.660  -5.827  80.434   1.00 69.08  ? 82   GLU C OE1   1 
ATOM   4194  O  OE2   . GLU C  2  82   ? 91.941  -4.127  79.071   1.00 61.45  ? 82   GLU C OE2   1 
ATOM   4195  N  N     . CYS C  2  83   ? 86.077  -5.795  79.643   1.00 48.27  ? 83   CYS C N     1 
ATOM   4196  C  CA    . CYS C  2  83   ? 85.135  -5.714  78.535   1.00 46.89  ? 83   CYS C CA    1 
ATOM   4197  C  C     . CYS C  2  83   ? 83.996  -4.776  78.910   1.00 45.71  ? 83   CYS C C     1 
ATOM   4198  O  O     . CYS C  2  83   ? 83.592  -3.927  78.114   1.00 43.65  ? 83   CYS C O     1 
ATOM   4199  C  CB    . CYS C  2  83   ? 84.581  -7.097  78.183   1.00 44.55  ? 83   CYS C CB    1 
ATOM   4200  S  SG    . CYS C  2  83   ? 85.760  -8.210  77.382   1.00 57.41  ? 83   CYS C SG    1 
ATOM   4201  N  N     . ARG C  2  84   ? 83.492  -4.933  80.131   1.00 43.47  ? 84   ARG C N     1 
ATOM   4202  C  CA    . ARG C  2  84   ? 82.394  -4.104  80.623   1.00 42.06  ? 84   ARG C CA    1 
ATOM   4203  C  C     . ARG C  2  84   ? 82.754  -2.621  80.664   1.00 43.27  ? 84   ARG C C     1 
ATOM   4204  O  O     . ARG C  2  84   ? 81.931  -1.768  80.333   1.00 41.62  ? 84   ARG C O     1 
ATOM   4205  C  CB    . ARG C  2  84   ? 81.945  -4.564  82.012   1.00 40.17  ? 84   ARG C CB    1 
ATOM   4206  C  CG    . ARG C  2  84   ? 81.211  -5.891  82.024   1.00 34.67  ? 84   ARG C CG    1 
ATOM   4207  C  CD    . ARG C  2  84   ? 80.631  -6.181  83.396   1.00 29.89  ? 84   ARG C CD    1 
ATOM   4208  N  NE    . ARG C  2  84   ? 79.815  -7.390  83.394   1.00 29.56  ? 84   ARG C NE    1 
ATOM   4209  C  CZ    . ARG C  2  84   ? 80.258  -8.591  83.749   1.00 30.08  ? 84   ARG C CZ    1 
ATOM   4210  N  NH1   . ARG C  2  84   ? 81.514  -8.745  84.140   1.00 34.89  ? 84   ARG C NH1   1 
ATOM   4211  N  NH2   . ARG C  2  84   ? 79.444  -9.637  83.715   1.00 31.68  ? 84   ARG C NH2   1 
ATOM   4212  N  N     . GLU C  2  85   ? 83.982  -2.317  81.070   1.00 45.38  ? 85   GLU C N     1 
ATOM   4213  C  CA    . GLU C  2  85   ? 84.408  -0.925  81.187   1.00 47.87  ? 85   GLU C CA    1 
ATOM   4214  C  C     . GLU C  2  85   ? 84.753  -0.290  79.840   1.00 51.30  ? 85   GLU C C     1 
ATOM   4215  O  O     . GLU C  2  85   ? 84.388  0.856   79.573   1.00 53.41  ? 85   GLU C O     1 
ATOM   4216  C  CB    . GLU C  2  85   ? 85.600  -0.799  82.137   1.00 48.04  ? 85   GLU C CB    1 
ATOM   4217  C  CG    . GLU C  2  85   ? 86.127  0.622   82.262   1.00 51.29  ? 85   GLU C CG    1 
ATOM   4218  C  CD    . GLU C  2  85   ? 87.281  0.737   83.234   1.00 62.40  ? 85   GLU C CD    1 
ATOM   4219  O  OE1   . GLU C  2  85   ? 87.691  -0.300  83.797   1.00 64.28  ? 85   GLU C OE1   1 
ATOM   4220  O  OE2   . GLU C  2  85   ? 87.777  1.866   83.435   1.00 65.98  ? 85   GLU C OE2   1 
ATOM   4221  N  N     . LYS C  2  86   ? 85.453  -1.039  78.996   1.00 51.97  ? 86   LYS C N     1 
ATOM   4222  C  CA    . LYS C  2  86   ? 85.970  -0.501  77.738   1.00 51.08  ? 86   LYS C CA    1 
ATOM   4223  C  C     . LYS C  2  86   ? 85.018  -0.668  76.553   1.00 48.86  ? 86   LYS C C     1 
ATOM   4224  O  O     . LYS C  2  86   ? 85.391  -0.397  75.410   1.00 49.85  ? 86   LYS C O     1 
ATOM   4225  C  CB    . LYS C  2  86   ? 87.357  -1.073  77.429   1.00 53.46  ? 86   LYS C CB    1 
ATOM   4226  C  CG    . LYS C  2  86   ? 88.420  -0.613  78.420   1.00 55.56  ? 86   LYS C CG    1 
ATOM   4227  C  CD    . LYS C  2  86   ? 89.818  -1.051  78.020   1.00 55.85  ? 86   LYS C CD    1 
ATOM   4228  C  CE    . LYS C  2  86   ? 90.854  -0.488  78.983   1.00 57.51  ? 86   LYS C CE    1 
ATOM   4229  N  NZ    . LYS C  2  86   ? 92.242  -0.874  78.610   1.00 66.50  ? 86   LYS C NZ    1 
ATOM   4230  N  N     . ASP C  2  87   ? 83.805  -1.137  76.836   1.00 48.16  ? 87   ASP C N     1 
ATOM   4231  C  CA    . ASP C  2  87   ? 82.753  -1.286  75.828   1.00 45.94  ? 87   ASP C CA    1 
ATOM   4232  C  C     . ASP C  2  87   ? 83.108  -2.315  74.761   1.00 43.60  ? 87   ASP C C     1 
ATOM   4233  O  O     . ASP C  2  87   ? 82.772  -2.156  73.586   1.00 40.45  ? 87   ASP C O     1 
ATOM   4234  C  CB    . ASP C  2  87   ? 82.404  0.062   75.184   1.00 46.27  ? 87   ASP C CB    1 
ATOM   4235  C  CG    . ASP C  2  87   ? 81.659  0.986   76.130   1.00 50.98  ? 87   ASP C CG    1 
ATOM   4236  O  OD1   . ASP C  2  87   ? 81.656  0.720   77.351   1.00 51.42  ? 87   ASP C OD1   1 
ATOM   4237  O  OD2   . ASP C  2  87   ? 81.077  1.982   75.651   1.00 52.15  ? 87   ASP C OD2   1 
ATOM   4238  N  N     . LEU C  2  88   ? 83.785  -3.376  75.186   1.00 43.02  ? 88   LEU C N     1 
ATOM   4239  C  CA    . LEU C  2  88   ? 84.165  -4.449  74.283   1.00 40.68  ? 88   LEU C CA    1 
ATOM   4240  C  C     . LEU C  2  88   ? 83.258  -5.652  74.488   1.00 36.15  ? 88   LEU C C     1 
ATOM   4241  O  O     . LEU C  2  88   ? 82.382  -5.644  75.352   1.00 36.70  ? 88   LEU C O     1 
ATOM   4242  C  CB    . LEU C  2  88   ? 85.623  -4.845  74.518   1.00 47.78  ? 88   LEU C CB    1 
ATOM   4243  C  CG    . LEU C  2  88   ? 86.633  -3.694  74.490   1.00 51.00  ? 88   LEU C CG    1 
ATOM   4244  C  CD1   . LEU C  2  88   ? 88.042  -4.203  74.758   1.00 50.56  ? 88   LEU C CD1   1 
ATOM   4245  C  CD2   . LEU C  2  88   ? 86.567  -2.939  73.167   1.00 43.83  ? 88   LEU C CD2   1 
ATOM   4246  N  N     . THR C  2  89   ? 83.477  -6.691  73.693   1.00 34.79  ? 89   THR C N     1 
ATOM   4247  C  CA    . THR C  2  89   ? 82.692  -7.910  73.799   1.00 32.92  ? 89   THR C CA    1 
ATOM   4248  C  C     . THR C  2  89   ? 83.554  -9.026  74.373   1.00 31.84  ? 89   THR C C     1 
ATOM   4249  O  O     . THR C  2  89   ? 84.696  -9.214  73.956   1.00 35.42  ? 89   THR C O     1 
ATOM   4250  C  CB    . THR C  2  89   ? 82.124  -8.329  72.423   1.00 34.25  ? 89   THR C CB    1 
ATOM   4251  O  OG1   . THR C  2  89   ? 81.084  -7.422  72.036   1.00 32.15  ? 89   THR C OG1   1 
ATOM   4252  C  CG2   . THR C  2  89   ? 81.561  -9.744  72.465   1.00 35.20  ? 89   THR C CG2   1 
ATOM   4253  N  N     . TYR C  2  90   ? 83.013  -9.765  75.335   1.00 31.66  ? 90   TYR C N     1 
ATOM   4254  C  CA    . TYR C  2  90   ? 83.740  -10.890 75.894   1.00 33.05  ? 90   TYR C CA    1 
ATOM   4255  C  C     . TYR C  2  90   ? 83.628  -12.030 74.893   1.00 37.67  ? 90   TYR C C     1 
ATOM   4256  O  O     . TYR C  2  90   ? 82.535  -12.521 74.605   1.00 32.53  ? 90   TYR C O     1 
ATOM   4257  C  CB    . TYR C  2  90   ? 83.148  -11.284 77.246   1.00 32.61  ? 90   TYR C CB    1 
ATOM   4258  C  CG    . TYR C  2  90   ? 83.998  -12.246 78.042   1.00 35.11  ? 90   TYR C CG    1 
ATOM   4259  C  CD1   . TYR C  2  90   ? 85.215  -11.848 78.577   1.00 37.85  ? 90   TYR C CD1   1 
ATOM   4260  C  CD2   . TYR C  2  90   ? 83.574  -13.548 78.273   1.00 38.81  ? 90   TYR C CD2   1 
ATOM   4261  C  CE1   . TYR C  2  90   ? 85.994  -12.726 79.309   1.00 43.08  ? 90   TYR C CE1   1 
ATOM   4262  C  CE2   . TYR C  2  90   ? 84.344  -14.431 79.005   1.00 38.49  ? 90   TYR C CE2   1 
ATOM   4263  C  CZ    . TYR C  2  90   ? 85.552  -14.015 79.520   1.00 41.31  ? 90   TYR C CZ    1 
ATOM   4264  O  OH    . TYR C  2  90   ? 86.318  -14.895 80.249   1.00 44.46  ? 90   TYR C OH    1 
ATOM   4265  N  N     . GLN C  2  91   ? 84.775  -12.447 74.368   1.00 42.33  ? 91   GLN C N     1 
ATOM   4266  C  CA    . GLN C  2  91   ? 84.810  -13.334 73.215   1.00 39.65  ? 91   GLN C CA    1 
ATOM   4267  C  C     . GLN C  2  91   ? 86.134  -14.081 73.125   1.00 41.39  ? 91   GLN C C     1 
ATOM   4268  O  O     . GLN C  2  91   ? 87.121  -13.696 73.752   1.00 41.89  ? 91   GLN C O     1 
ATOM   4269  C  CB    . GLN C  2  91   ? 84.591  -12.523 71.936   1.00 34.69  ? 91   GLN C CB    1 
ATOM   4270  C  CG    . GLN C  2  91   ? 85.610  -11.413 71.737   1.00 34.27  ? 91   GLN C CG    1 
ATOM   4271  C  CD    . GLN C  2  91   ? 85.253  -10.492 70.588   1.00 38.85  ? 91   GLN C CD    1 
ATOM   4272  O  OE1   . GLN C  2  91   ? 84.259  -10.706 69.893   1.00 40.57  ? 91   GLN C OE1   1 
ATOM   4273  N  NE2   . GLN C  2  91   ? 86.064  -9.461  70.381   1.00 37.35  ? 91   GLN C NE2   1 
ATOM   4274  N  N     . ALA C  2  92   ? 86.148  -15.149 72.334   1.00 42.56  ? 92   ALA C N     1 
ATOM   4275  C  CA    . ALA C  2  92   ? 87.370  -15.901 72.090   1.00 40.31  ? 92   ALA C CA    1 
ATOM   4276  C  C     . ALA C  2  92   ? 87.657  -15.940 70.595   1.00 43.21  ? 92   ALA C C     1 
ATOM   4277  O  O     . ALA C  2  92   ? 86.737  -16.056 69.788   1.00 44.98  ? 92   ALA C O     1 
ATOM   4278  C  CB    . ALA C  2  92   ? 87.243  -17.313 72.642   1.00 36.86  ? 92   ALA C CB    1 
ATOM   4279  N  N     . PRO C  2  93   ? 88.940  -15.843 70.220   1.00 44.12  ? 93   PRO C N     1 
ATOM   4280  C  CA    . PRO C  2  93   ? 89.313  -15.917 68.804   1.00 44.13  ? 93   PRO C CA    1 
ATOM   4281  C  C     . PRO C  2  93   ? 89.038  -17.305 68.232   1.00 45.23  ? 93   PRO C C     1 
ATOM   4282  O  O     . PRO C  2  93   ? 89.303  -18.313 68.890   1.00 42.50  ? 93   PRO C O     1 
ATOM   4283  C  CB    . PRO C  2  93   ? 90.817  -15.629 68.823   1.00 44.38  ? 93   PRO C CB    1 
ATOM   4284  C  CG    . PRO C  2  93   ? 91.259  -15.998 70.198   1.00 46.39  ? 93   PRO C CG    1 
ATOM   4285  C  CD    . PRO C  2  93   ? 90.110  -15.647 71.092   1.00 46.78  ? 93   PRO C CD    1 
ATOM   4286  N  N     . LEU C  2  94   ? 88.499  -17.349 67.019   1.00 45.04  ? 94   LEU C N     1 
ATOM   4287  C  CA    . LEU C  2  94   ? 88.179  -18.612 66.369   1.00 43.21  ? 94   LEU C CA    1 
ATOM   4288  C  C     . LEU C  2  94   ? 89.113  -18.868 65.196   1.00 47.33  ? 94   LEU C C     1 
ATOM   4289  O  O     . LEU C  2  94   ? 89.047  -18.182 64.175   1.00 47.64  ? 94   LEU C O     1 
ATOM   4290  C  CB    . LEU C  2  94   ? 86.729  -18.611 65.885   1.00 43.24  ? 94   LEU C CB    1 
ATOM   4291  C  CG    . LEU C  2  94   ? 86.278  -19.861 65.127   1.00 41.28  ? 94   LEU C CG    1 
ATOM   4292  C  CD1   . LEU C  2  94   ? 86.281  -21.074 66.041   1.00 38.56  ? 94   LEU C CD1   1 
ATOM   4293  C  CD2   . LEU C  2  94   ? 84.906  -19.647 64.515   1.00 41.96  ? 94   LEU C CD2   1 
ATOM   4294  N  N     . TYR C  2  95   ? 89.983  -19.861 65.346   1.00 49.88  ? 95   TYR C N     1 
ATOM   4295  C  CA    . TYR C  2  95   ? 90.901  -20.231 64.278   1.00 46.87  ? 95   TYR C CA    1 
ATOM   4296  C  C     . TYR C  2  95   ? 90.413  -21.498 63.588   1.00 47.23  ? 95   TYR C C     1 
ATOM   4297  O  O     . TYR C  2  95   ? 89.833  -22.375 64.227   1.00 43.58  ? 95   TYR C O     1 
ATOM   4298  C  CB    . TYR C  2  95   ? 92.317  -20.432 64.823   1.00 44.22  ? 95   TYR C CB    1 
ATOM   4299  C  CG    . TYR C  2  95   ? 92.958  -19.170 65.359   1.00 41.94  ? 95   TYR C CG    1 
ATOM   4300  C  CD1   . TYR C  2  95   ? 92.980  -18.903 66.721   1.00 41.31  ? 95   TYR C CD1   1 
ATOM   4301  C  CD2   . TYR C  2  95   ? 93.542  -18.246 64.501   1.00 43.74  ? 95   TYR C CD2   1 
ATOM   4302  C  CE1   . TYR C  2  95   ? 93.567  -17.752 67.215   1.00 40.30  ? 95   TYR C CE1   1 
ATOM   4303  C  CE2   . TYR C  2  95   ? 94.132  -17.094 64.986   1.00 42.87  ? 95   TYR C CE2   1 
ATOM   4304  C  CZ    . TYR C  2  95   ? 94.140  -16.851 66.343   1.00 43.23  ? 95   TYR C CZ    1 
ATOM   4305  O  OH    . TYR C  2  95   ? 94.725  -15.704 66.828   1.00 45.02  ? 95   TYR C OH    1 
ATOM   4306  N  N     . ALA C  2  96   ? 90.636  -21.588 62.281   1.00 45.73  ? 96   ALA C N     1 
ATOM   4307  C  CA    . ALA C  2  96   ? 90.204  -22.757 61.526   1.00 47.84  ? 96   ALA C CA    1 
ATOM   4308  C  C     . ALA C  2  96   ? 91.305  -23.311 60.630   1.00 50.23  ? 96   ALA C C     1 
ATOM   4309  O  O     . ALA C  2  96   ? 91.810  -22.618 59.748   1.00 48.87  ? 96   ALA C O     1 
ATOM   4310  C  CB    . ALA C  2  96   ? 88.971  -22.430 60.704   1.00 49.93  ? 96   ALA C CB    1 
ATOM   4311  N  N     . ARG C  2  97   ? 91.664  -24.570 60.858   1.00 52.06  ? 97   ARG C N     1 
ATOM   4312  C  CA    . ARG C  2  97   ? 92.627  -25.253 60.009   1.00 54.81  ? 97   ARG C CA    1 
ATOM   4313  C  C     . ARG C  2  97   ? 91.909  -25.913 58.843   1.00 54.64  ? 97   ARG C C     1 
ATOM   4314  O  O     . ARG C  2  97   ? 91.090  -26.823 59.028   1.00 51.77  ? 97   ARG C O     1 
ATOM   4315  C  CB    . ARG C  2  97   ? 93.412  -26.300 60.800   1.00 58.17  ? 97   ARG C CB    1 
ATOM   4316  C  CG    . ARG C  2  97   ? 94.424  -25.719 61.775   1.00 61.80  ? 97   ARG C CG    1 
ATOM   4317  C  CD    . ARG C  2  97   ? 95.194  -26.821 62.480   1.00 67.57  ? 97   ARG C CD    1 
ATOM   4318  N  NE    . ARG C  2  97   ? 95.793  -27.755 61.531   1.00 74.98  ? 97   ARG C NE    1 
ATOM   4319  C  CZ    . ARG C  2  97   ? 96.495  -28.827 61.882   1.00 72.62  ? 97   ARG C CZ    1 
ATOM   4320  N  NH1   . ARG C  2  97   ? 97.004  -29.623 60.951   1.00 63.18  ? 97   ARG C NH1   1 
ATOM   4321  N  NH2   . ARG C  2  97   ? 96.688  -29.104 63.164   1.00 70.15  ? 97   ARG C NH2   1 
ATOM   4322  N  N     . LEU C  2  98   ? 92.231  -25.435 57.644   1.00 58.00  ? 98   LEU C N     1 
ATOM   4323  C  CA    . LEU C  2  98   ? 91.642  -25.917 56.405   1.00 61.66  ? 98   LEU C CA    1 
ATOM   4324  C  C     . LEU C  2  98   ? 92.756  -26.242 55.417   1.00 66.27  ? 98   LEU C C     1 
ATOM   4325  O  O     . LEU C  2  98   ? 93.889  -25.771 55.568   1.00 70.07  ? 98   LEU C O     1 
ATOM   4326  C  CB    . LEU C  2  98   ? 90.729  -24.849 55.801   1.00 62.38  ? 98   LEU C CB    1 
ATOM   4327  C  CG    . LEU C  2  98   ? 89.720  -24.161 56.722   1.00 58.48  ? 98   LEU C CG    1 
ATOM   4328  C  CD1   . LEU C  2  98   ? 89.010  -23.034 55.984   1.00 55.18  ? 98   LEU C CD1   1 
ATOM   4329  C  CD2   . LEU C  2  98   ? 88.719  -25.164 57.269   1.00 53.28  ? 98   LEU C CD2   1 
ATOM   4330  N  N     . GLN C  2  99   ? 92.434  -27.038 54.403   1.00 63.43  ? 99   GLN C N     1 
ATOM   4331  C  CA    . GLN C  2  99   ? 93.424  -27.419 53.402   1.00 66.97  ? 99   GLN C CA    1 
ATOM   4332  C  C     . GLN C  2  99   ? 92.911  -27.259 51.973   1.00 65.80  ? 99   GLN C C     1 
ATOM   4333  O  O     . GLN C  2  99   ? 91.828  -27.730 51.627   1.00 65.82  ? 99   GLN C O     1 
ATOM   4334  C  CB    . GLN C  2  99   ? 93.921  -28.850 53.640   1.00 66.45  ? 99   GLN C CB    1 
ATOM   4335  C  CG    . GLN C  2  99   ? 92.839  -29.916 53.590   1.00 60.91  ? 99   GLN C CG    1 
ATOM   4336  C  CD    . GLN C  2  99   ? 93.388  -31.310 53.812   1.00 62.87  ? 99   GLN C CD    1 
ATOM   4337  O  OE1   . GLN C  2  99   ? 94.489  -31.479 54.338   1.00 63.08  ? 99   GLN C OE1   1 
ATOM   4338  N  NE2   . GLN C  2  99   ? 92.622  -32.319 53.411   1.00 58.12  ? 99   GLN C NE2   1 
ATOM   4339  N  N     . LEU C  2  100  ? 93.704  -26.580 51.152   1.00 66.13  ? 100  LEU C N     1 
ATOM   4340  C  CA    . LEU C  2  100  ? 93.408  -26.415 49.739   1.00 61.23  ? 100  LEU C CA    1 
ATOM   4341  C  C     . LEU C  2  100  ? 93.977  -27.608 48.978   1.00 64.99  ? 100  LEU C C     1 
ATOM   4342  O  O     . LEU C  2  100  ? 95.173  -27.894 49.061   1.00 68.21  ? 100  LEU C O     1 
ATOM   4343  C  CB    . LEU C  2  100  ? 94.019  -25.110 49.224   1.00 57.29  ? 100  LEU C CB    1 
ATOM   4344  C  CG    . LEU C  2  100  ? 93.329  -24.373 48.073   1.00 64.28  ? 100  LEU C CG    1 
ATOM   4345  C  CD1   . LEU C  2  100  ? 93.980  -23.014 47.857   1.00 67.92  ? 100  LEU C CD1   1 
ATOM   4346  C  CD2   . LEU C  2  100  ? 93.356  -25.183 46.786   1.00 70.32  ? 100  LEU C CD2   1 
ATOM   4347  N  N     . ILE C  2  101  ? 93.113  -28.301 48.243   1.00 68.13  ? 101  ILE C N     1 
ATOM   4348  C  CA    . ILE C  2  101  ? 93.517  -29.482 47.487   1.00 69.44  ? 101  ILE C CA    1 
ATOM   4349  C  C     . ILE C  2  101  ? 93.216  -29.327 45.999   1.00 77.44  ? 101  ILE C C     1 
ATOM   4350  O  O     . ILE C  2  101  ? 92.078  -29.061 45.612   1.00 79.51  ? 101  ILE C O     1 
ATOM   4351  C  CB    . ILE C  2  101  ? 92.808  -30.750 48.004   1.00 61.70  ? 101  ILE C CB    1 
ATOM   4352  C  CG1   . ILE C  2  101  ? 93.163  -31.002 49.471   1.00 61.29  ? 101  ILE C CG1   1 
ATOM   4353  C  CG2   . ILE C  2  101  ? 93.176  -31.954 47.151   1.00 63.16  ? 101  ILE C CG2   1 
ATOM   4354  C  CD1   . ILE C  2  101  ? 92.548  -32.264 50.037   1.00 58.01  ? 101  ILE C CD1   1 
ATOM   4355  N  N     . HIS C  2  102  ? 94.240  -29.494 45.168   1.00 82.03  ? 102  HIS C N     1 
ATOM   4356  C  CA    . HIS C  2  102  ? 94.064  -29.453 43.721   1.00 89.80  ? 102  HIS C CA    1 
ATOM   4357  C  C     . HIS C  2  102  ? 93.747  -30.857 43.207   1.00 94.55  ? 102  HIS C C     1 
ATOM   4358  O  O     . HIS C  2  102  ? 94.436  -31.818 43.547   1.00 89.74  ? 102  HIS C O     1 
ATOM   4359  C  CB    . HIS C  2  102  ? 95.324  -28.908 43.043   1.00 85.82  ? 102  HIS C CB    1 
ATOM   4360  C  CG    . HIS C  2  102  ? 95.077  -28.314 41.690   1.00 91.13  ? 102  HIS C CG    1 
ATOM   4361  N  ND1   . HIS C  2  102  ? 94.418  -28.992 40.687   1.00 94.34  ? 102  HIS C ND1   1 
ATOM   4362  C  CD2   . HIS C  2  102  ? 95.407  -27.107 41.173   1.00 93.70  ? 102  HIS C CD2   1 
ATOM   4363  C  CE1   . HIS C  2  102  ? 94.348  -28.226 39.612   1.00 93.89  ? 102  HIS C CE1   1 
ATOM   4364  N  NE2   . HIS C  2  102  ? 94.941  -27.077 39.881   1.00 97.78  ? 102  HIS C NE2   1 
ATOM   4365  N  N     . LYS C  2  103  ? 92.697  -30.973 42.398   1.00 97.43  ? 103  LYS C N     1 
ATOM   4366  C  CA    . LYS C  2  103  ? 92.293  -32.265 41.846   1.00 97.82  ? 103  LYS C CA    1 
ATOM   4367  C  C     . LYS C  2  103  ? 93.313  -32.798 40.846   1.00 99.97  ? 103  LYS C C     1 
ATOM   4368  O  O     . LYS C  2  103  ? 93.731  -33.954 40.923   1.00 95.23  ? 103  LYS C O     1 
ATOM   4369  C  CB    . LYS C  2  103  ? 90.926  -32.161 41.168   1.00 93.05  ? 103  LYS C CB    1 
ATOM   4370  C  CG    . LYS C  2  103  ? 89.744  -32.152 42.118   1.00 84.47  ? 103  LYS C CG    1 
ATOM   4371  C  CD    . LYS C  2  103  ? 88.443  -32.284 41.345   1.00 77.01  ? 103  LYS C CD    1 
ATOM   4372  C  CE    . LYS C  2  103  ? 87.260  -32.491 42.272   1.00 74.40  ? 103  LYS C CE    1 
ATOM   4373  N  NZ    . LYS C  2  103  ? 86.005  -32.735 41.510   1.00 72.86  ? 103  LYS C NZ    1 
ATOM   4374  N  N     . ASP C  2  104  ? 93.710  -31.942 39.910   1.00 105.90 ? 104  ASP C N     1 
ATOM   4375  C  CA    . ASP C  2  104  ? 94.634  -32.328 38.852   1.00 108.38 ? 104  ASP C CA    1 
ATOM   4376  C  C     . ASP C  2  104  ? 96.049  -32.456 39.400   1.00 104.06 ? 104  ASP C C     1 
ATOM   4377  O  O     . ASP C  2  104  ? 96.630  -33.542 39.400   1.00 103.71 ? 104  ASP C O     1 
ATOM   4378  C  CB    . ASP C  2  104  ? 94.606  -31.298 37.721   1.00 109.38 ? 104  ASP C CB    1 
ATOM   4379  C  CG    . ASP C  2  104  ? 93.202  -31.024 37.215   1.00 114.44 ? 104  ASP C CG    1 
ATOM   4380  O  OD1   . ASP C  2  104  ? 92.364  -31.949 37.249   1.00 118.44 ? 104  ASP C OD1   1 
ATOM   4381  O  OD2   . ASP C  2  104  ? 92.937  -29.881 36.784   1.00 111.51 ? 104  ASP C OD2   1 
ATOM   4382  N  N     . THR C  2  105  ? 96.595  -31.333 39.858   1.00 103.49 ? 105  THR C N     1 
ATOM   4383  C  CA    . THR C  2  105  ? 97.945  -31.283 40.409   1.00 96.71  ? 105  THR C CA    1 
ATOM   4384  C  C     . THR C  2  105  ? 98.132  -32.270 41.561   1.00 91.26  ? 105  THR C C     1 
ATOM   4385  O  O     . THR C  2  105  ? 99.054  -33.083 41.547   1.00 88.89  ? 105  THR C O     1 
ATOM   4386  C  CB    . THR C  2  105  ? 98.295  -29.859 40.893   1.00 91.07  ? 105  THR C CB    1 
ATOM   4387  O  OG1   . THR C  2  105  ? 98.143  -28.932 39.809   1.00 84.32  ? 105  THR C OG1   1 
ATOM   4388  C  CG2   . THR C  2  105  ? 99.723  -29.802 41.405   1.00 84.62  ? 105  THR C CG2   1 
ATOM   4389  N  N     . GLY C  2  106  ? 97.247  -32.202 42.551   1.00 92.85  ? 106  GLY C N     1 
ATOM   4390  C  CA    . GLY C  2  106  ? 97.342  -33.065 43.714   1.00 89.85  ? 106  GLY C CA    1 
ATOM   4391  C  C     . GLY C  2  106  ? 98.027  -32.367 44.871   1.00 88.35  ? 106  GLY C C     1 
ATOM   4392  O  O     . GLY C  2  106  ? 98.091  -32.896 45.982   1.00 79.38  ? 106  GLY C O     1 
ATOM   4393  N  N     . LEU C  2  107  ? 98.541  -31.171 44.601   1.00 91.86  ? 107  LEU C N     1 
ATOM   4394  C  CA    . LEU C  2  107  ? 99.234  -30.374 45.606   1.00 84.43  ? 107  LEU C CA    1 
ATOM   4395  C  C     . LEU C  2  107  ? 98.296  -30.011 46.750   1.00 81.27  ? 107  LEU C C     1 
ATOM   4396  O  O     . LEU C  2  107  ? 97.208  -29.479 46.528   1.00 84.55  ? 107  LEU C O     1 
ATOM   4397  C  CB    . LEU C  2  107  ? 99.803  -29.103 44.971   1.00 84.48  ? 107  LEU C CB    1 
ATOM   4398  C  CG    . LEU C  2  107  ? 100.628 -28.176 45.864   1.00 87.52  ? 107  LEU C CG    1 
ATOM   4399  C  CD1   . LEU C  2  107  ? 101.885 -28.878 46.351   1.00 86.20  ? 107  LEU C CD1   1 
ATOM   4400  C  CD2   . LEU C  2  107  ? 100.979 -26.893 45.124   1.00 90.60  ? 107  LEU C CD2   1 
ATOM   4401  N  N     . ILE C  2  108  ? 98.724  -30.304 47.973   1.00 75.79  ? 108  ILE C N     1 
ATOM   4402  C  CA    . ILE C  2  108  ? 97.910  -30.036 49.153   1.00 72.79  ? 108  ILE C CA    1 
ATOM   4403  C  C     . ILE C  2  108  ? 98.541  -28.958 50.028   1.00 75.07  ? 108  ILE C C     1 
ATOM   4404  O  O     . ILE C  2  108  ? 99.580  -29.182 50.650   1.00 77.72  ? 108  ILE C O     1 
ATOM   4405  C  CB    . ILE C  2  108  ? 97.707  -31.313 49.990   1.00 70.07  ? 108  ILE C CB    1 
ATOM   4406  C  CG1   . ILE C  2  108  ? 97.113  -32.427 49.124   1.00 69.75  ? 108  ILE C CG1   1 
ATOM   4407  C  CG2   . ILE C  2  108  ? 96.822  -31.028 51.197   1.00 66.30  ? 108  ILE C CG2   1 
ATOM   4408  C  CD1   . ILE C  2  108  ? 96.922  -33.739 49.856   1.00 62.51  ? 108  ILE C CD1   1 
ATOM   4409  N  N     . LYS C  2  109  ? 97.905  -27.791 50.076   1.00 75.37  ? 109  LYS C N     1 
ATOM   4410  C  CA    . LYS C  2  109  ? 98.400  -26.682 50.888   1.00 74.74  ? 109  LYS C CA    1 
ATOM   4411  C  C     . LYS C  2  109  ? 97.524  -26.480 52.124   1.00 72.51  ? 109  LYS C C     1 
ATOM   4412  O  O     . LYS C  2  109  ? 96.388  -26.025 52.024   1.00 74.39  ? 109  LYS C O     1 
ATOM   4413  C  CB    . LYS C  2  109  ? 98.463  -25.396 50.056   1.00 65.73  ? 109  LYS C CB    1 
ATOM   4414  C  CG    . LYS C  2  109  ? 98.698  -24.125 50.861   1.00 68.14  ? 109  LYS C CG    1 
ATOM   4415  C  CD    . LYS C  2  109  ? 100.031 -24.148 51.591   1.00 67.24  ? 109  LYS C CD    1 
ATOM   4416  C  CE    . LYS C  2  109  ? 100.221 -22.882 52.412   1.00 69.10  ? 109  LYS C CE    1 
ATOM   4417  N  NZ    . LYS C  2  109  ? 101.516 -22.877 53.144   1.00 66.44  ? 109  LYS C NZ    1 
ATOM   4418  N  N     . GLU C  2  110  ? 98.069  -26.810 53.290   1.00 70.57  ? 110  GLU C N     1 
ATOM   4419  C  CA    . GLU C  2  110  ? 97.315  -26.754 54.539   1.00 66.42  ? 110  GLU C CA    1 
ATOM   4420  C  C     . GLU C  2  110  ? 97.661  -25.498 55.336   1.00 68.44  ? 110  GLU C C     1 
ATOM   4421  O  O     . GLU C  2  110  ? 98.822  -25.091 55.386   1.00 69.95  ? 110  GLU C O     1 
ATOM   4422  C  CB    . GLU C  2  110  ? 97.593  -28.008 55.368   1.00 63.61  ? 110  GLU C CB    1 
ATOM   4423  C  CG    . GLU C  2  110  ? 96.919  -28.035 56.724   1.00 63.56  ? 110  GLU C CG    1 
ATOM   4424  C  CD    . GLU C  2  110  ? 97.196  -29.320 57.477   1.00 71.24  ? 110  GLU C CD    1 
ATOM   4425  O  OE1   . GLU C  2  110  ? 96.849  -29.396 58.674   1.00 66.49  ? 110  GLU C OE1   1 
ATOM   4426  O  OE2   . GLU C  2  110  ? 97.756  -30.257 56.868   1.00 73.79  ? 110  GLU C OE2   1 
ATOM   4427  N  N     . ASP C  2  111  ? 96.655  -24.885 55.957   1.00 68.75  ? 111  ASP C N     1 
ATOM   4428  C  CA    . ASP C  2  111  ? 96.875  -23.639 56.689   1.00 66.64  ? 111  ASP C CA    1 
ATOM   4429  C  C     . ASP C  2  111  ? 95.814  -23.397 57.766   1.00 63.75  ? 111  ASP C C     1 
ATOM   4430  O  O     . ASP C  2  111  ? 94.730  -23.978 57.725   1.00 63.30  ? 111  ASP C O     1 
ATOM   4431  C  CB    . ASP C  2  111  ? 96.923  -22.461 55.708   1.00 66.14  ? 111  ASP C CB    1 
ATOM   4432  C  CG    . ASP C  2  111  ? 97.499  -21.201 56.328   1.00 67.41  ? 111  ASP C CG    1 
ATOM   4433  O  OD1   . ASP C  2  111  ? 97.323  -20.114 55.738   1.00 68.07  ? 111  ASP C OD1   1 
ATOM   4434  O  OD2   . ASP C  2  111  ? 98.124  -21.298 57.405   1.00 68.63  ? 111  ASP C OD2   1 
ATOM   4435  N  N     . GLU C  2  112  ? 96.138  -22.542 58.732   1.00 60.76  ? 112  GLU C N     1 
ATOM   4436  C  CA    . GLU C  2  112  ? 95.184  -22.144 59.763   1.00 54.50  ? 112  GLU C CA    1 
ATOM   4437  C  C     . GLU C  2  112  ? 94.831  -20.666 59.616   1.00 56.49  ? 112  GLU C C     1 
ATOM   4438  O  O     . GLU C  2  112  ? 95.674  -19.794 59.829   1.00 57.06  ? 112  GLU C O     1 
ATOM   4439  C  CB    . GLU C  2  112  ? 95.749  -22.407 61.161   1.00 51.07  ? 112  GLU C CB    1 
ATOM   4440  C  CG    . GLU C  2  112  ? 94.778  -22.081 62.289   1.00 51.16  ? 112  GLU C CG    1 
ATOM   4441  C  CD    . GLU C  2  112  ? 95.399  -22.225 63.668   1.00 51.23  ? 112  GLU C CD    1 
ATOM   4442  O  OE1   . GLU C  2  112  ? 96.249  -21.384 64.033   1.00 48.31  ? 112  GLU C OE1   1 
ATOM   4443  O  OE2   . GLU C  2  112  ? 95.035  -23.179 64.389   1.00 50.03  ? 112  GLU C OE2   1 
ATOM   4444  N  N     . VAL C  2  113  ? 93.583  -20.391 59.251   1.00 56.11  ? 113  VAL C N     1 
ATOM   4445  C  CA    . VAL C  2  113  ? 93.128  -19.020 59.038   1.00 57.65  ? 113  VAL C CA    1 
ATOM   4446  C  C     . VAL C  2  113  ? 92.251  -18.508 60.181   1.00 55.05  ? 113  VAL C C     1 
ATOM   4447  O  O     . VAL C  2  113  ? 91.469  -19.259 60.770   1.00 49.23  ? 113  VAL C O     1 
ATOM   4448  C  CB    . VAL C  2  113  ? 92.370  -18.876 57.701   1.00 58.44  ? 113  VAL C CB    1 
ATOM   4449  C  CG1   . VAL C  2  113  ? 93.330  -19.013 56.534   1.00 56.86  ? 113  VAL C CG1   1 
ATOM   4450  C  CG2   . VAL C  2  113  ? 91.255  -19.908 57.605   1.00 56.24  ? 113  VAL C CG2   1 
ATOM   4451  N  N     . PHE C  2  114  ? 92.390  -17.222 60.485   1.00 52.07  ? 114  PHE C N     1 
ATOM   4452  C  CA    . PHE C  2  114  ? 91.640  -16.595 61.567   1.00 50.87  ? 114  PHE C CA    1 
ATOM   4453  C  C     . PHE C  2  114  ? 90.274  -16.114 61.081   1.00 54.87  ? 114  PHE C C     1 
ATOM   4454  O  O     . PHE C  2  114  ? 90.185  -15.272 60.186   1.00 57.84  ? 114  PHE C O     1 
ATOM   4455  C  CB    . PHE C  2  114  ? 92.446  -15.435 62.154   1.00 48.99  ? 114  PHE C CB    1 
ATOM   4456  C  CG    . PHE C  2  114  ? 91.707  -14.642 63.189   1.00 49.06  ? 114  PHE C CG    1 
ATOM   4457  C  CD1   . PHE C  2  114  ? 91.421  -15.189 64.428   1.00 47.72  ? 114  PHE C CD1   1 
ATOM   4458  C  CD2   . PHE C  2  114  ? 91.311  -13.340 62.929   1.00 51.68  ? 114  PHE C CD2   1 
ATOM   4459  C  CE1   . PHE C  2  114  ? 90.745  -14.458 65.386   1.00 48.62  ? 114  PHE C CE1   1 
ATOM   4460  C  CE2   . PHE C  2  114  ? 90.636  -12.603 63.883   1.00 51.28  ? 114  PHE C CE2   1 
ATOM   4461  C  CZ    . PHE C  2  114  ? 90.354  -13.162 65.113   1.00 48.93  ? 114  PHE C CZ    1 
ATOM   4462  N  N     . LEU C  2  115  ? 89.214  -16.654 61.678   1.00 53.32  ? 115  LEU C N     1 
ATOM   4463  C  CA    . LEU C  2  115  ? 87.849  -16.378 61.232   1.00 50.20  ? 115  LEU C CA    1 
ATOM   4464  C  C     . LEU C  2  115  ? 87.146  -15.266 62.008   1.00 51.03  ? 115  LEU C C     1 
ATOM   4465  O  O     . LEU C  2  115  ? 85.990  -14.950 61.728   1.00 52.45  ? 115  LEU C O     1 
ATOM   4466  C  CB    . LEU C  2  115  ? 87.000  -17.649 61.308   1.00 46.31  ? 115  LEU C CB    1 
ATOM   4467  C  CG    . LEU C  2  115  ? 87.477  -18.868 60.523   1.00 40.91  ? 115  LEU C CG    1 
ATOM   4468  C  CD1   . LEU C  2  115  ? 86.403  -19.940 60.541   1.00 31.91  ? 115  LEU C CD1   1 
ATOM   4469  C  CD2   . LEU C  2  115  ? 87.838  -18.482 59.099   1.00 43.08  ? 115  LEU C CD2   1 
ATOM   4470  N  N     . GLY C  2  116  ? 87.835  -14.672 62.977   1.00 50.16  ? 116  GLY C N     1 
ATOM   4471  C  CA    . GLY C  2  116  ? 87.210  -13.699 63.856   1.00 46.73  ? 116  GLY C CA    1 
ATOM   4472  C  C     . GLY C  2  116  ? 86.917  -14.286 65.226   1.00 46.42  ? 116  GLY C C     1 
ATOM   4473  O  O     . GLY C  2  116  ? 87.380  -15.380 65.548   1.00 46.97  ? 116  GLY C O     1 
ATOM   4474  N  N     . HIS C  2  117  ? 86.148  -13.561 66.034   1.00 44.99  ? 117  HIS C N     1 
ATOM   4475  C  CA    . HIS C  2  117  ? 85.876  -13.979 67.407   1.00 40.62  ? 117  HIS C CA    1 
ATOM   4476  C  C     . HIS C  2  117  ? 84.428  -14.413 67.631   1.00 39.41  ? 117  HIS C C     1 
ATOM   4477  O  O     . HIS C  2  117  ? 83.500  -13.838 67.062   1.00 43.13  ? 117  HIS C O     1 
ATOM   4478  C  CB    . HIS C  2  117  ? 86.206  -12.847 68.381   1.00 41.16  ? 117  HIS C CB    1 
ATOM   4479  C  CG    . HIS C  2  117  ? 87.585  -12.286 68.224   1.00 43.42  ? 117  HIS C CG    1 
ATOM   4480  N  ND1   . HIS C  2  117  ? 88.617  -12.597 69.083   1.00 44.67  ? 117  HIS C ND1   1 
ATOM   4481  C  CD2   . HIS C  2  117  ? 88.098  -11.420 67.318   1.00 42.82  ? 117  HIS C CD2   1 
ATOM   4482  C  CE1   . HIS C  2  117  ? 89.708  -11.953 68.709   1.00 46.42  ? 117  HIS C CE1   1 
ATOM   4483  N  NE2   . HIS C  2  117  ? 89.420  -11.232 67.640   1.00 45.99  ? 117  HIS C NE2   1 
ATOM   4484  N  N     . ILE C  2  118  ? 84.245  -15.427 68.473   1.00 34.96  ? 118  ILE C N     1 
ATOM   4485  C  CA    . ILE C  2  118  ? 82.920  -15.829 68.932   1.00 34.59  ? 118  ILE C CA    1 
ATOM   4486  C  C     . ILE C  2  118  ? 82.716  -15.376 70.373   1.00 37.45  ? 118  ILE C C     1 
ATOM   4487  O  O     . ILE C  2  118  ? 83.511  -15.721 71.249   1.00 40.48  ? 118  ILE C O     1 
ATOM   4488  C  CB    . ILE C  2  118  ? 82.732  -17.354 68.877   1.00 31.96  ? 118  ILE C CB    1 
ATOM   4489  C  CG1   . ILE C  2  118  ? 82.720  -17.844 67.430   1.00 39.28  ? 118  ILE C CG1   1 
ATOM   4490  C  CG2   . ILE C  2  118  ? 81.443  -17.759 69.575   1.00 28.25  ? 118  ILE C CG2   1 
ATOM   4491  C  CD1   . ILE C  2  118  ? 82.443  -19.327 67.300   1.00 45.28  ? 118  ILE C CD1   1 
ATOM   4492  N  N     . PRO C  2  119  ? 81.653  -14.594 70.622   1.00 38.18  ? 119  PRO C N     1 
ATOM   4493  C  CA    . PRO C  2  119  ? 81.314  -14.115 71.966   1.00 37.01  ? 119  PRO C CA    1 
ATOM   4494  C  C     . PRO C  2  119  ? 81.181  -15.261 72.966   1.00 35.00  ? 119  PRO C C     1 
ATOM   4495  O  O     . PRO C  2  119  ? 80.562  -16.281 72.659   1.00 31.73  ? 119  PRO C O     1 
ATOM   4496  C  CB    . PRO C  2  119  ? 79.959  -13.435 71.757   1.00 32.53  ? 119  PRO C CB    1 
ATOM   4497  C  CG    . PRO C  2  119  ? 79.988  -12.989 70.341   1.00 31.33  ? 119  PRO C CG    1 
ATOM   4498  C  CD    . PRO C  2  119  ? 80.735  -14.061 69.601   1.00 36.19  ? 119  PRO C CD    1 
ATOM   4499  N  N     . LEU C  2  120  ? 81.765  -15.089 74.148   1.00 32.85  ? 120  LEU C N     1 
ATOM   4500  C  CA    . LEU C  2  120  ? 81.744  -16.127 75.170   1.00 32.58  ? 120  LEU C CA    1 
ATOM   4501  C  C     . LEU C  2  120  ? 80.676  -15.871 76.223   1.00 30.75  ? 120  LEU C C     1 
ATOM   4502  O  O     . LEU C  2  120  ? 80.435  -14.730 76.614   1.00 33.14  ? 120  LEU C O     1 
ATOM   4503  C  CB    . LEU C  2  120  ? 83.110  -16.236 75.846   1.00 34.74  ? 120  LEU C CB    1 
ATOM   4504  C  CG    . LEU C  2  120  ? 84.258  -16.739 74.975   1.00 39.58  ? 120  LEU C CG    1 
ATOM   4505  C  CD1   . LEU C  2  120  ? 85.547  -16.736 75.773   1.00 43.97  ? 120  LEU C CD1   1 
ATOM   4506  C  CD2   . LEU C  2  120  ? 83.956  -18.132 74.445   1.00 39.16  ? 120  LEU C CD2   1 
ATOM   4507  N  N     . MET C  2  121  ? 80.039  -16.944 76.680   1.00 29.24  ? 121  MET C N     1 
ATOM   4508  C  CA    . MET C  2  121  ? 79.060  -16.850 77.754   1.00 30.10  ? 121  MET C CA    1 
ATOM   4509  C  C     . MET C  2  121  ? 79.769  -16.859 79.103   1.00 34.78  ? 121  MET C C     1 
ATOM   4510  O  O     . MET C  2  121  ? 80.703  -17.633 79.318   1.00 33.19  ? 121  MET C O     1 
ATOM   4511  C  CB    . MET C  2  121  ? 78.060  -18.005 77.671   1.00 27.37  ? 121  MET C CB    1 
ATOM   4512  C  CG    . MET C  2  121  ? 77.096  -18.078 78.841   1.00 29.27  ? 121  MET C CG    1 
ATOM   4513  S  SD    . MET C  2  121  ? 75.929  -19.449 78.722   1.00 38.64  ? 121  MET C SD    1 
ATOM   4514  C  CE    . MET C  2  121  ? 74.877  -18.889 77.386   1.00 32.17  ? 121  MET C CE    1 
ATOM   4515  N  N     . THR C  2  122  ? 79.328  -15.991 80.008   1.00 35.83  ? 122  THR C N     1 
ATOM   4516  C  CA    . THR C  2  122  ? 79.922  -15.905 81.337   1.00 33.50  ? 122  THR C CA    1 
ATOM   4517  C  C     . THR C  2  122  ? 79.479  -17.070 82.218   1.00 32.63  ? 122  THR C C     1 
ATOM   4518  O  O     . THR C  2  122  ? 78.725  -17.941 81.783   1.00 30.54  ? 122  THR C O     1 
ATOM   4519  C  CB    . THR C  2  122  ? 79.577  -14.574 82.031   1.00 32.86  ? 122  THR C CB    1 
ATOM   4520  O  OG1   . THR C  2  122  ? 78.168  -14.513 82.285   1.00 33.97  ? 122  THR C OG1   1 
ATOM   4521  C  CG2   . THR C  2  122  ? 79.987  -13.396 81.157   1.00 29.44  ? 122  THR C CG2   1 
ATOM   4522  N  N     . GLU C  2  123  ? 79.955  -17.075 83.459   1.00 33.19  ? 123  GLU C N     1 
ATOM   4523  C  CA    . GLU C  2  123  ? 79.694  -18.171 84.384   1.00 33.61  ? 123  GLU C CA    1 
ATOM   4524  C  C     . GLU C  2  123  ? 78.212  -18.287 84.738   1.00 33.35  ? 123  GLU C C     1 
ATOM   4525  O  O     . GLU C  2  123  ? 77.698  -19.387 84.946   1.00 33.26  ? 123  GLU C O     1 
ATOM   4526  C  CB    . GLU C  2  123  ? 80.535  -17.995 85.651   1.00 39.61  ? 123  GLU C CB    1 
ATOM   4527  C  CG    . GLU C  2  123  ? 80.441  -19.146 86.641   1.00 51.46  ? 123  GLU C CG    1 
ATOM   4528  C  CD    . GLU C  2  123  ? 81.309  -18.934 87.871   1.00 55.17  ? 123  GLU C CD    1 
ATOM   4529  O  OE1   . GLU C  2  123  ? 81.026  -19.559 88.916   1.00 49.48  ? 123  GLU C OE1   1 
ATOM   4530  O  OE2   . GLU C  2  123  ? 82.276  -18.144 87.789   1.00 52.00  ? 123  GLU C OE2   1 
ATOM   4531  N  N     . ASP C  2  124  ? 77.528  -17.148 84.792   1.00 34.29  ? 124  ASP C N     1 
ATOM   4532  C  CA    . ASP C  2  124  ? 76.122  -17.110 85.187   1.00 34.11  ? 124  ASP C CA    1 
ATOM   4533  C  C     . ASP C  2  124  ? 75.168  -17.399 84.030   1.00 35.40  ? 124  ASP C C     1 
ATOM   4534  O  O     . ASP C  2  124  ? 73.984  -17.656 84.247   1.00 36.91  ? 124  ASP C O     1 
ATOM   4535  C  CB    . ASP C  2  124  ? 75.780  -15.759 85.815   1.00 36.97  ? 124  ASP C CB    1 
ATOM   4536  C  CG    . ASP C  2  124  ? 76.027  -14.599 84.871   1.00 40.61  ? 124  ASP C CG    1 
ATOM   4537  O  OD1   . ASP C  2  124  ? 77.138  -14.027 84.908   1.00 41.20  ? 124  ASP C OD1   1 
ATOM   4538  O  OD2   . ASP C  2  124  ? 75.112  -14.258 84.090   1.00 41.02  ? 124  ASP C OD2   1 
ATOM   4539  N  N     . GLY C  2  125  ? 75.684  -17.367 82.806   1.00 34.14  ? 125  GLY C N     1 
ATOM   4540  C  CA    . GLY C  2  125  ? 74.861  -17.639 81.641   1.00 31.85  ? 125  GLY C CA    1 
ATOM   4541  C  C     . GLY C  2  125  ? 74.517  -16.454 80.755   1.00 29.26  ? 125  GLY C C     1 
ATOM   4542  O  O     . GLY C  2  125  ? 73.762  -16.601 79.795   1.00 28.31  ? 125  GLY C O     1 
ATOM   4543  N  N     . SER C  2  126  ? 75.054  -15.279 81.067   1.00 29.07  ? 126  SER C N     1 
ATOM   4544  C  CA    . SER C  2  126  ? 74.839  -14.110 80.216   1.00 27.74  ? 126  SER C CA    1 
ATOM   4545  C  C     . SER C  2  126  ? 76.028  -13.862 79.286   1.00 26.88  ? 126  SER C C     1 
ATOM   4546  O  O     . SER C  2  126  ? 77.017  -14.592 79.320   1.00 29.00  ? 126  SER C O     1 
ATOM   4547  C  CB    . SER C  2  126  ? 74.545  -12.862 81.059   1.00 27.01  ? 126  SER C CB    1 
ATOM   4548  O  OG    . SER C  2  126  ? 75.698  -12.409 81.748   1.00 27.59  ? 126  SER C OG    1 
ATOM   4549  N  N     . PHE C  2  127  ? 75.920  -12.833 78.452   1.00 25.10  ? 127  PHE C N     1 
ATOM   4550  C  CA    . PHE C  2  127  ? 77.004  -12.442 77.558   1.00 24.28  ? 127  PHE C CA    1 
ATOM   4551  C  C     . PHE C  2  127  ? 77.367  -10.988 77.800   1.00 27.24  ? 127  PHE C C     1 
ATOM   4552  O  O     . PHE C  2  127  ? 76.588  -10.235 78.378   1.00 30.30  ? 127  PHE C O     1 
ATOM   4553  C  CB    . PHE C  2  127  ? 76.584  -12.590 76.096   1.00 25.46  ? 127  PHE C CB    1 
ATOM   4554  C  CG    . PHE C  2  127  ? 76.357  -14.006 75.663   1.00 27.88  ? 127  PHE C CG    1 
ATOM   4555  C  CD1   . PHE C  2  127  ? 75.139  -14.627 75.886   1.00 28.76  ? 127  PHE C CD1   1 
ATOM   4556  C  CD2   . PHE C  2  127  ? 77.355  -14.711 75.013   1.00 28.28  ? 127  PHE C CD2   1 
ATOM   4557  C  CE1   . PHE C  2  127  ? 74.925  -15.929 75.479   1.00 27.13  ? 127  PHE C CE1   1 
ATOM   4558  C  CE2   . PHE C  2  127  ? 77.148  -16.013 74.605   1.00 30.14  ? 127  PHE C CE2   1 
ATOM   4559  C  CZ    . PHE C  2  127  ? 75.931  -16.623 74.838   1.00 29.03  ? 127  PHE C CZ    1 
ATOM   4560  N  N     . ILE C  2  128  ? 78.555  -10.591 77.364   1.00 26.17  ? 128  ILE C N     1 
ATOM   4561  C  CA    . ILE C  2  128  ? 78.900  -9.178  77.332   1.00 28.22  ? 128  ILE C CA    1 
ATOM   4562  C  C     . ILE C  2  128  ? 79.114  -8.757  75.886   1.00 31.78  ? 128  ILE C C     1 
ATOM   4563  O  O     . ILE C  2  128  ? 80.102  -9.138  75.265   1.00 37.18  ? 128  ILE C O     1 
ATOM   4564  C  CB    . ILE C  2  128  ? 80.166  -8.881  78.154   1.00 27.05  ? 128  ILE C CB    1 
ATOM   4565  C  CG1   . ILE C  2  128  ? 79.989  -9.371  79.592   1.00 27.35  ? 128  ILE C CG1   1 
ATOM   4566  C  CG2   . ILE C  2  128  ? 80.483  -7.394  78.132   1.00 28.23  ? 128  ILE C CG2   1 
ATOM   4567  C  CD1   . ILE C  2  128  ? 81.224  -9.215  80.446   1.00 31.85  ? 128  ILE C CD1   1 
ATOM   4568  N  N     . ILE C  2  129  ? 78.187  -7.970  75.354   1.00 31.93  ? 129  ILE C N     1 
ATOM   4569  C  CA    . ILE C  2  129  ? 78.276  -7.527  73.970   1.00 29.16  ? 129  ILE C CA    1 
ATOM   4570  C  C     . ILE C  2  129  ? 78.375  -6.010  73.921   1.00 32.45  ? 129  ILE C C     1 
ATOM   4571  O  O     . ILE C  2  129  ? 77.434  -5.310  74.292   1.00 34.59  ? 129  ILE C O     1 
ATOM   4572  C  CB    . ILE C  2  129  ? 77.054  -7.975  73.150   1.00 27.75  ? 129  ILE C CB    1 
ATOM   4573  C  CG1   . ILE C  2  129  ? 76.679  -9.423  73.482   1.00 24.45  ? 129  ILE C CG1   1 
ATOM   4574  C  CG2   . ILE C  2  129  ? 77.322  -7.800  71.664   1.00 32.84  ? 129  ILE C CG2   1 
ATOM   4575  C  CD1   . ILE C  2  129  ? 77.736  -10.434 73.106   1.00 26.68  ? 129  ILE C CD1   1 
ATOM   4576  N  N     . ASN C  2  130  ? 79.521  -5.513  73.464   1.00 35.05  ? 130  ASN C N     1 
ATOM   4577  C  CA    . ASN C  2  130  ? 79.785  -4.076  73.411   1.00 36.46  ? 130  ASN C CA    1 
ATOM   4578  C  C     . ASN C  2  130  ? 79.667  -3.387  74.769   1.00 36.18  ? 130  ASN C C     1 
ATOM   4579  O  O     . ASN C  2  130  ? 79.148  -2.276  74.870   1.00 34.76  ? 130  ASN C O     1 
ATOM   4580  C  CB    . ASN C  2  130  ? 78.888  -3.390  72.376   1.00 36.32  ? 130  ASN C CB    1 
ATOM   4581  C  CG    . ASN C  2  130  ? 79.251  -3.765  70.955   1.00 43.82  ? 130  ASN C CG    1 
ATOM   4582  O  OD1   . ASN C  2  130  ? 80.418  -3.710  70.566   1.00 47.93  ? 130  ASN C OD1   1 
ATOM   4583  N  ND2   . ASN C  2  130  ? 78.252  -4.161  70.172   1.00 47.59  ? 130  ASN C ND2   1 
ATOM   4584  N  N     . GLY C  2  131  ? 80.143  -4.059  75.812   1.00 37.39  ? 131  GLY C N     1 
ATOM   4585  C  CA    . GLY C  2  131  ? 80.198  -3.472  77.138   1.00 37.56  ? 131  GLY C CA    1 
ATOM   4586  C  C     . GLY C  2  131  ? 78.946  -3.669  77.969   1.00 34.96  ? 131  GLY C C     1 
ATOM   4587  O  O     . GLY C  2  131  ? 78.955  -3.436  79.178   1.00 37.17  ? 131  GLY C O     1 
ATOM   4588  N  N     . ALA C  2  132  ? 77.866  -4.100  77.327   1.00 32.30  ? 132  ALA C N     1 
ATOM   4589  C  CA    . ALA C  2  132  ? 76.595  -4.274  78.018   1.00 32.58  ? 132  ALA C CA    1 
ATOM   4590  C  C     . ALA C  2  132  ? 76.251  -5.744  78.218   1.00 29.60  ? 132  ALA C C     1 
ATOM   4591  O  O     . ALA C  2  132  ? 76.406  -6.556  77.307   1.00 30.12  ? 132  ALA C O     1 
ATOM   4592  C  CB    . ALA C  2  132  ? 75.480  -3.570  77.261   1.00 36.71  ? 132  ALA C CB    1 
ATOM   4593  N  N     . ASP C  2  133  ? 75.783  -6.080  79.416   1.00 29.92  ? 133  ASP C N     1 
ATOM   4594  C  CA    . ASP C  2  133  ? 75.336  -7.436  79.706   1.00 32.30  ? 133  ASP C CA    1 
ATOM   4595  C  C     . ASP C  2  133  ? 74.059  -7.747  78.936   1.00 32.38  ? 133  ASP C C     1 
ATOM   4596  O  O     . ASP C  2  133  ? 73.103  -6.971  78.965   1.00 32.42  ? 133  ASP C O     1 
ATOM   4597  C  CB    . ASP C  2  133  ? 75.099  -7.625  81.206   1.00 37.27  ? 133  ASP C CB    1 
ATOM   4598  C  CG    . ASP C  2  133  ? 76.390  -7.723  81.996   1.00 40.96  ? 133  ASP C CG    1 
ATOM   4599  O  OD1   . ASP C  2  133  ? 77.349  -6.994  81.664   1.00 41.54  ? 133  ASP C OD1   1 
ATOM   4600  O  OD2   . ASP C  2  133  ? 76.445  -8.534  82.947   1.00 39.64  ? 133  ASP C OD2   1 
ATOM   4601  N  N     . ARG C  2  134  ? 74.053  -8.882  78.243   1.00 28.72  ? 134  ARG C N     1 
ATOM   4602  C  CA    . ARG C  2  134  ? 72.897  -9.302  77.461   1.00 26.10  ? 134  ARG C CA    1 
ATOM   4603  C  C     . ARG C  2  134  ? 72.529  -10.750 77.763   1.00 22.64  ? 134  ARG C C     1 
ATOM   4604  O  O     . ARG C  2  134  ? 73.343  -11.513 78.278   1.00 24.92  ? 134  ARG C O     1 
ATOM   4605  C  CB    . ARG C  2  134  ? 73.169  -9.127  75.964   1.00 24.97  ? 134  ARG C CB    1 
ATOM   4606  C  CG    . ARG C  2  134  ? 73.651  -7.735  75.579   1.00 29.18  ? 134  ARG C CG    1 
ATOM   4607  C  CD    . ARG C  2  134  ? 73.575  -7.505  74.079   1.00 29.33  ? 134  ARG C CD    1 
ATOM   4608  N  NE    . ARG C  2  134  ? 72.678  -6.402  73.749   1.00 30.47  ? 134  ARG C NE    1 
ATOM   4609  C  CZ    . ARG C  2  134  ? 71.375  -6.542  73.529   1.00 29.82  ? 134  ARG C CZ    1 
ATOM   4610  N  NH1   . ARG C  2  134  ? 70.815  -7.742  73.599   1.00 27.08  ? 134  ARG C NH1   1 
ATOM   4611  N  NH2   . ARG C  2  134  ? 70.632  -5.484  73.236   1.00 28.17  ? 134  ARG C NH2   1 
ATOM   4612  N  N     . VAL C  2  135  ? 71.292  -11.117 77.447   1.00 20.76  ? 135  VAL C N     1 
ATOM   4613  C  CA    . VAL C  2  135  ? 70.819  -12.482 77.628   1.00 20.92  ? 135  VAL C CA    1 
ATOM   4614  C  C     . VAL C  2  135  ? 70.103  -12.956 76.371   1.00 25.24  ? 135  VAL C C     1 
ATOM   4615  O  O     . VAL C  2  135  ? 69.245  -12.252 75.832   1.00 26.01  ? 135  VAL C O     1 
ATOM   4616  C  CB    . VAL C  2  135  ? 69.857  -12.595 78.825   1.00 21.59  ? 135  VAL C CB    1 
ATOM   4617  C  CG1   . VAL C  2  135  ? 69.226  -13.981 78.880   1.00 21.56  ? 135  VAL C CG1   1 
ATOM   4618  C  CG2   . VAL C  2  135  ? 70.584  -12.284 80.123   1.00 26.53  ? 135  VAL C CG2   1 
ATOM   4619  N  N     . ILE C  2  136  ? 70.464  -14.147 75.903   1.00 25.34  ? 136  ILE C N     1 
ATOM   4620  C  CA    . ILE C  2  136  ? 69.810  -14.740 74.746   1.00 23.38  ? 136  ILE C CA    1 
ATOM   4621  C  C     . ILE C  2  136  ? 68.629  -15.575 75.213   1.00 22.88  ? 136  ILE C C     1 
ATOM   4622  O  O     . ILE C  2  136  ? 68.800  -16.588 75.891   1.00 22.69  ? 136  ILE C O     1 
ATOM   4623  C  CB    . ILE C  2  136  ? 70.775  -15.632 73.949   1.00 21.80  ? 136  ILE C CB    1 
ATOM   4624  C  CG1   . ILE C  2  136  ? 71.966  -14.814 73.448   1.00 23.82  ? 136  ILE C CG1   1 
ATOM   4625  C  CG2   . ILE C  2  136  ? 70.054  -16.292 72.786   1.00 22.37  ? 136  ILE C CG2   1 
ATOM   4626  C  CD1   . ILE C  2  136  ? 71.589  -13.696 72.511   1.00 21.28  ? 136  ILE C CD1   1 
ATOM   4627  N  N     . VAL C  2  137  ? 67.429  -15.145 74.841   1.00 22.23  ? 137  VAL C N     1 
ATOM   4628  C  CA    . VAL C  2  137  ? 66.207  -15.789 75.304   1.00 25.75  ? 137  VAL C CA    1 
ATOM   4629  C  C     . VAL C  2  137  ? 65.854  -17.011 74.464   1.00 25.44  ? 137  VAL C C     1 
ATOM   4630  O  O     . VAL C  2  137  ? 65.762  -16.927 73.240   1.00 27.67  ? 137  VAL C O     1 
ATOM   4631  C  CB    . VAL C  2  137  ? 65.025  -14.803 75.303   1.00 27.72  ? 137  VAL C CB    1 
ATOM   4632  C  CG1   . VAL C  2  137  ? 63.734  -15.517 75.674   1.00 28.81  ? 137  VAL C CG1   1 
ATOM   4633  C  CG2   . VAL C  2  137  ? 65.302  -13.656 76.261   1.00 26.08  ? 137  VAL C CG2   1 
ATOM   4634  N  N     . SER C  2  138  ? 65.659  -18.143 75.135   1.00 21.62  ? 138  SER C N     1 
ATOM   4635  C  CA    . SER C  2  138  ? 65.324  -19.395 74.465   1.00 24.60  ? 138  SER C CA    1 
ATOM   4636  C  C     . SER C  2  138  ? 63.987  -19.295 73.736   1.00 25.49  ? 138  SER C C     1 
ATOM   4637  O  O     . SER C  2  138  ? 63.040  -18.696 74.245   1.00 26.07  ? 138  SER C O     1 
ATOM   4638  C  CB    . SER C  2  138  ? 65.295  -20.541 75.476   1.00 26.80  ? 138  SER C CB    1 
ATOM   4639  O  OG    . SER C  2  138  ? 66.526  -20.627 76.174   1.00 31.31  ? 138  SER C OG    1 
ATOM   4640  N  N     . GLN C  2  139  ? 63.915  -19.887 72.545   1.00 24.91  ? 139  GLN C N     1 
ATOM   4641  C  CA    . GLN C  2  139  ? 62.742  -19.732 71.685   1.00 25.04  ? 139  GLN C CA    1 
ATOM   4642  C  C     . GLN C  2  139  ? 61.986  -21.033 71.425   1.00 25.64  ? 139  GLN C C     1 
ATOM   4643  O  O     . GLN C  2  139  ? 62.504  -21.937 70.779   1.00 29.21  ? 139  GLN C O     1 
ATOM   4644  C  CB    . GLN C  2  139  ? 63.144  -19.108 70.345   1.00 25.01  ? 139  GLN C CB    1 
ATOM   4645  C  CG    . GLN C  2  139  ? 62.002  -19.018 69.341   1.00 25.81  ? 139  GLN C CG    1 
ATOM   4646  C  CD    . GLN C  2  139  ? 62.447  -18.524 67.977   1.00 29.94  ? 139  GLN C CD    1 
ATOM   4647  O  OE1   . GLN C  2  139  ? 63.353  -19.087 67.362   1.00 32.78  ? 139  GLN C OE1   1 
ATOM   4648  N  NE2   . GLN C  2  139  ? 61.808  -17.464 67.496   1.00 32.09  ? 139  GLN C NE2   1 
ATOM   4649  N  N     . ILE C  2  140  ? 60.750  -21.115 71.905   1.00 25.03  ? 140  ILE C N     1 
ATOM   4650  C  CA    . ILE C  2  140  ? 59.908  -22.276 71.632   1.00 23.13  ? 140  ILE C CA    1 
ATOM   4651  C  C     . ILE C  2  140  ? 59.319  -22.200 70.224   1.00 26.39  ? 140  ILE C C     1 
ATOM   4652  O  O     . ILE C  2  140  ? 58.980  -21.119 69.739   1.00 28.77  ? 140  ILE C O     1 
ATOM   4653  C  CB    . ILE C  2  140  ? 58.770  -22.417 72.674   1.00 21.76  ? 140  ILE C CB    1 
ATOM   4654  C  CG1   . ILE C  2  140  ? 58.039  -23.751 72.505   1.00 22.76  ? 140  ILE C CG1   1 
ATOM   4655  C  CG2   . ILE C  2  140  ? 57.800  -21.245 72.590   1.00 21.67  ? 140  ILE C CG2   1 
ATOM   4656  C  CD1   . ILE C  2  140  ? 57.009  -24.021 73.578   1.00 20.83  ? 140  ILE C CD1   1 
ATOM   4657  N  N     . HIS C  2  141  ? 59.222  -23.348 69.559   1.00 27.44  ? 141  HIS C N     1 
ATOM   4658  C  CA    . HIS C  2  141  ? 58.565  -23.415 68.257   1.00 28.84  ? 141  HIS C CA    1 
ATOM   4659  C  C     . HIS C  2  141  ? 58.043  -24.820 67.971   1.00 32.32  ? 141  HIS C C     1 
ATOM   4660  O  O     . HIS C  2  141  ? 58.222  -25.734 68.778   1.00 29.77  ? 141  HIS C O     1 
ATOM   4661  C  CB    . HIS C  2  141  ? 59.507  -22.949 67.139   1.00 31.48  ? 141  HIS C CB    1 
ATOM   4662  C  CG    . HIS C  2  141  ? 60.651  -23.880 66.872   1.00 32.02  ? 141  HIS C CG    1 
ATOM   4663  N  ND1   . HIS C  2  141  ? 61.324  -23.901 65.669   1.00 34.44  ? 141  HIS C ND1   1 
ATOM   4664  C  CD2   . HIS C  2  141  ? 61.245  -24.815 67.652   1.00 32.49  ? 141  HIS C CD2   1 
ATOM   4665  C  CE1   . HIS C  2  141  ? 62.279  -24.814 65.717   1.00 34.81  ? 141  HIS C CE1   1 
ATOM   4666  N  NE2   . HIS C  2  141  ? 62.253  -25.381 66.909   1.00 33.81  ? 141  HIS C NE2   1 
ATOM   4667  N  N     . ARG C  2  142  ? 57.395  -24.988 66.822   1.00 37.25  ? 142  ARG C N     1 
ATOM   4668  C  CA    . ARG C  2  142  ? 56.911  -26.300 66.415   1.00 37.25  ? 142  ARG C CA    1 
ATOM   4669  C  C     . ARG C  2  142  ? 58.083  -27.187 66.031   1.00 34.56  ? 142  ARG C C     1 
ATOM   4670  O  O     . ARG C  2  142  ? 58.882  -26.832 65.163   1.00 32.13  ? 142  ARG C O     1 
ATOM   4671  C  CB    . ARG C  2  142  ? 55.952  -26.185 65.230   1.00 37.54  ? 142  ARG C CB    1 
ATOM   4672  C  CG    . ARG C  2  142  ? 54.654  -25.462 65.529   1.00 43.01  ? 142  ARG C CG    1 
ATOM   4673  C  CD    . ARG C  2  142  ? 53.740  -25.492 64.317   1.00 45.06  ? 142  ARG C CD    1 
ATOM   4674  N  NE    . ARG C  2  142  ? 53.341  -26.854 63.975   1.00 46.36  ? 142  ARG C NE    1 
ATOM   4675  C  CZ    . ARG C  2  142  ? 52.838  -27.210 62.797   1.00 46.48  ? 142  ARG C CZ    1 
ATOM   4676  N  NH1   . ARG C  2  142  ? 52.682  -26.304 61.841   1.00 45.37  ? 142  ARG C NH1   1 
ATOM   4677  N  NH2   . ARG C  2  142  ? 52.500  -28.473 62.574   1.00 43.41  ? 142  ARG C NH2   1 
ATOM   4678  N  N     . SER C  2  143  ? 58.183  -28.342 66.676   1.00 35.46  ? 143  SER C N     1 
ATOM   4679  C  CA    . SER C  2  143  ? 59.233  -29.294 66.350   1.00 38.88  ? 143  SER C CA    1 
ATOM   4680  C  C     . SER C  2  143  ? 59.002  -29.842 64.951   1.00 38.68  ? 143  SER C C     1 
ATOM   4681  O  O     . SER C  2  143  ? 57.910  -30.308 64.642   1.00 38.74  ? 143  SER C O     1 
ATOM   4682  C  CB    . SER C  2  143  ? 59.261  -30.438 67.364   1.00 37.90  ? 143  SER C CB    1 
ATOM   4683  O  OG    . SER C  2  143  ? 60.259  -31.387 67.032   1.00 37.67  ? 143  SER C OG    1 
ATOM   4684  N  N     . PRO C  2  144  ? 60.032  -29.775 64.095   1.00 39.06  ? 144  PRO C N     1 
ATOM   4685  C  CA    . PRO C  2  144  ? 59.947  -30.301 62.730   1.00 42.62  ? 144  PRO C CA    1 
ATOM   4686  C  C     . PRO C  2  144  ? 59.587  -31.784 62.708   1.00 38.66  ? 144  PRO C C     1 
ATOM   4687  O  O     . PRO C  2  144  ? 59.796  -32.492 63.693   1.00 39.05  ? 144  PRO C O     1 
ATOM   4688  C  CB    . PRO C  2  144  ? 61.365  -30.093 62.195   1.00 45.87  ? 144  PRO C CB    1 
ATOM   4689  C  CG    . PRO C  2  144  ? 61.872  -28.926 62.954   1.00 42.34  ? 144  PRO C CG    1 
ATOM   4690  C  CD    . PRO C  2  144  ? 61.306  -29.078 64.336   1.00 39.14  ? 144  PRO C CD    1 
ATOM   4691  N  N     . GLY C  2  145  ? 59.031  -32.238 61.592   1.00 37.59  ? 145  GLY C N     1 
ATOM   4692  C  CA    . GLY C  2  145  ? 58.635  -33.625 61.451   1.00 43.89  ? 145  GLY C CA    1 
ATOM   4693  C  C     . GLY C  2  145  ? 57.488  -33.784 60.475   1.00 44.92  ? 145  GLY C C     1 
ATOM   4694  O  O     . GLY C  2  145  ? 57.274  -32.940 59.605   1.00 39.01  ? 145  GLY C O     1 
ATOM   4695  N  N     . VAL C  2  146  ? 56.750  -34.878 60.617   1.00 46.03  ? 146  VAL C N     1 
ATOM   4696  C  CA    . VAL C  2  146  ? 55.575  -35.111 59.793   1.00 47.63  ? 146  VAL C CA    1 
ATOM   4697  C  C     . VAL C  2  146  ? 54.333  -35.165 60.672   1.00 50.38  ? 146  VAL C C     1 
ATOM   4698  O  O     . VAL C  2  146  ? 54.211  -36.037 61.535   1.00 47.61  ? 146  VAL C O     1 
ATOM   4699  C  CB    . VAL C  2  146  ? 55.698  -36.413 58.982   1.00 50.02  ? 146  VAL C CB    1 
ATOM   4700  C  CG1   . VAL C  2  146  ? 54.407  -36.691 58.228   1.00 56.13  ? 146  VAL C CG1   1 
ATOM   4701  C  CG2   . VAL C  2  146  ? 56.875  -36.329 58.020   1.00 43.35  ? 146  VAL C CG2   1 
ATOM   4702  N  N     . TYR C  2  147  ? 53.417  -34.226 60.454   1.00 52.01  ? 147  TYR C N     1 
ATOM   4703  C  CA    . TYR C  2  147  ? 52.209  -34.138 61.271   1.00 50.38  ? 147  TYR C CA    1 
ATOM   4704  C  C     . TYR C  2  147  ? 50.950  -34.336 60.439   1.00 51.25  ? 147  TYR C C     1 
ATOM   4705  O  O     . TYR C  2  147  ? 50.955  -34.123 59.231   1.00 51.53  ? 147  TYR C O     1 
ATOM   4706  C  CB    . TYR C  2  147  ? 52.146  -32.794 61.996   1.00 49.91  ? 147  TYR C CB    1 
ATOM   4707  C  CG    . TYR C  2  147  ? 53.313  -32.543 62.919   1.00 47.49  ? 147  TYR C CG    1 
ATOM   4708  C  CD1   . TYR C  2  147  ? 54.420  -31.826 62.489   1.00 42.05  ? 147  TYR C CD1   1 
ATOM   4709  C  CD2   . TYR C  2  147  ? 53.308  -33.026 64.221   1.00 45.44  ? 147  TYR C CD2   1 
ATOM   4710  C  CE1   . TYR C  2  147  ? 55.489  -31.596 63.329   1.00 42.37  ? 147  TYR C CE1   1 
ATOM   4711  C  CE2   . TYR C  2  147  ? 54.374  -32.800 65.070   1.00 42.89  ? 147  TYR C CE2   1 
ATOM   4712  C  CZ    . TYR C  2  147  ? 55.462  -32.084 64.620   1.00 41.61  ? 147  TYR C CZ    1 
ATOM   4713  O  OH    . TYR C  2  147  ? 56.528  -31.857 65.461   1.00 35.82  ? 147  TYR C OH    1 
ATOM   4714  N  N     . PHE C  2  148  ? 49.871  -34.749 61.092   1.00 49.86  ? 148  PHE C N     1 
ATOM   4715  C  CA    . PHE C  2  148  ? 48.613  -34.977 60.395   1.00 52.92  ? 148  PHE C CA    1 
ATOM   4716  C  C     . PHE C  2  148  ? 47.463  -34.259 61.086   1.00 54.84  ? 148  PHE C C     1 
ATOM   4717  O  O     . PHE C  2  148  ? 47.103  -34.589 62.217   1.00 53.63  ? 148  PHE C O     1 
ATOM   4718  C  CB    . PHE C  2  148  ? 48.332  -36.477 60.290   1.00 56.21  ? 148  PHE C CB    1 
ATOM   4719  C  CG    . PHE C  2  148  ? 49.423  -37.245 59.605   1.00 54.99  ? 148  PHE C CG    1 
ATOM   4720  C  CD1   . PHE C  2  148  ? 50.472  -37.782 60.333   1.00 58.84  ? 148  PHE C CD1   1 
ATOM   4721  C  CD2   . PHE C  2  148  ? 49.409  -37.418 58.231   1.00 55.72  ? 148  PHE C CD2   1 
ATOM   4722  C  CE1   . PHE C  2  148  ? 51.483  -38.482 59.704   1.00 62.63  ? 148  PHE C CE1   1 
ATOM   4723  C  CE2   . PHE C  2  148  ? 50.416  -38.119 57.597   1.00 57.39  ? 148  PHE C CE2   1 
ATOM   4724  C  CZ    . PHE C  2  148  ? 51.454  -38.653 58.334   1.00 61.10  ? 148  PHE C CZ    1 
ATOM   4725  N  N     . THR C  2  149  ? 46.880  -33.284 60.396   1.00 53.97  ? 149  THR C N     1 
ATOM   4726  C  CA    . THR C  2  149  ? 45.821  -32.477 60.993   1.00 57.78  ? 149  THR C CA    1 
ATOM   4727  C  C     . THR C  2  149  ? 44.543  -32.520 60.164   1.00 58.79  ? 149  THR C C     1 
ATOM   4728  O  O     . THR C  2  149  ? 44.598  -32.492 58.940   1.00 61.09  ? 149  THR C O     1 
ATOM   4729  C  CB    . THR C  2  149  ? 46.268  -31.011 61.161   1.00 61.60  ? 149  THR C CB    1 
ATOM   4730  O  OG1   . THR C  2  149  ? 45.128  -30.190 61.444   1.00 67.38  ? 149  THR C OG1   1 
ATOM   4731  C  CG2   . THR C  2  149  ? 46.949  -30.507 59.893   1.00 53.52  ? 149  THR C CG2   1 
ATOM   4732  N  N     . PRO C  2  150  ? 43.382  -32.577 60.837   1.00 59.67  ? 150  PRO C N     1 
ATOM   4733  C  CA    . PRO C  2  150  ? 42.090  -32.641 60.145   1.00 60.76  ? 150  PRO C CA    1 
ATOM   4734  C  C     . PRO C  2  150  ? 41.842  -31.419 59.265   1.00 64.72  ? 150  PRO C C     1 
ATOM   4735  O  O     . PRO C  2  150  ? 42.097  -30.291 59.690   1.00 62.76  ? 150  PRO C O     1 
ATOM   4736  C  CB    . PRO C  2  150  ? 41.080  -32.674 61.295   1.00 56.99  ? 150  PRO C CB    1 
ATOM   4737  C  CG    . PRO C  2  150  ? 41.838  -33.237 62.445   1.00 57.84  ? 150  PRO C CG    1 
ATOM   4738  C  CD    . PRO C  2  150  ? 43.230  -32.700 62.297   1.00 61.63  ? 150  PRO C CD    1 
ATOM   4739  N  N     . ASP C  2  151  ? 41.359  -31.652 58.048   1.00 67.72  ? 151  ASP C N     1 
ATOM   4740  C  CA    . ASP C  2  151  ? 41.031  -30.569 57.129   1.00 67.64  ? 151  ASP C CA    1 
ATOM   4741  C  C     . ASP C  2  151  ? 39.852  -29.786 57.694   1.00 70.67  ? 151  ASP C C     1 
ATOM   4742  O  O     . ASP C  2  151  ? 38.763  -30.337 57.867   1.00 68.32  ? 151  ASP C O     1 
ATOM   4743  C  CB    . ASP C  2  151  ? 40.685  -31.132 55.746   1.00 68.04  ? 151  ASP C CB    1 
ATOM   4744  C  CG    . ASP C  2  151  ? 40.759  -30.084 54.644   1.00 70.37  ? 151  ASP C CG    1 
ATOM   4745  O  OD1   . ASP C  2  151  ? 40.567  -28.885 54.932   1.00 73.05  ? 151  ASP C OD1   1 
ATOM   4746  O  OD2   . ASP C  2  151  ? 41.006  -30.464 53.479   1.00 69.73  ? 151  ASP C OD2   1 
ATOM   4747  N  N     . PRO C  2  152  ? 40.071  -28.495 57.993   1.00 70.62  ? 152  PRO C N     1 
ATOM   4748  C  CA    . PRO C  2  152  ? 39.038  -27.632 58.578   1.00 73.71  ? 152  PRO C CA    1 
ATOM   4749  C  C     . PRO C  2  152  ? 37.772  -27.560 57.723   1.00 75.17  ? 152  PRO C C     1 
ATOM   4750  O  O     . PRO C  2  152  ? 36.667  -27.533 58.265   1.00 77.57  ? 152  PRO C O     1 
ATOM   4751  C  CB    . PRO C  2  152  ? 39.723  -26.259 58.648   1.00 71.97  ? 152  PRO C CB    1 
ATOM   4752  C  CG    . PRO C  2  152  ? 40.882  -26.347 57.702   1.00 65.52  ? 152  PRO C CG    1 
ATOM   4753  C  CD    . PRO C  2  152  ? 41.331  -27.768 57.770   1.00 63.93  ? 152  PRO C CD    1 
ATOM   4754  N  N     . ALA C  2  153  ? 37.936  -27.527 56.405   1.00 70.98  ? 153  ALA C N     1 
ATOM   4755  C  CA    . ALA C  2  153  ? 36.796  -27.481 55.494   1.00 67.84  ? 153  ALA C CA    1 
ATOM   4756  C  C     . ALA C  2  153  ? 36.136  -28.848 55.311   1.00 69.57  ? 153  ALA C C     1 
ATOM   4757  O  O     . ALA C  2  153  ? 34.912  -28.972 55.370   1.00 66.27  ? 153  ALA C O     1 
ATOM   4758  C  CB    . ALA C  2  153  ? 37.218  -26.910 54.148   1.00 65.16  ? 153  ALA C CB    1 
ATOM   4759  N  N     . ARG C  2  154  ? 36.956  -29.872 55.097   1.00 72.29  ? 154  ARG C N     1 
ATOM   4760  C  CA    . ARG C  2  154  ? 36.455  -31.202 54.766   1.00 70.60  ? 154  ARG C CA    1 
ATOM   4761  C  C     . ARG C  2  154  ? 36.490  -32.147 55.966   1.00 69.57  ? 154  ARG C C     1 
ATOM   4762  O  O     . ARG C  2  154  ? 37.563  -32.494 56.458   1.00 71.02  ? 154  ARG C O     1 
ATOM   4763  C  CB    . ARG C  2  154  ? 37.252  -31.780 53.595   1.00 71.29  ? 154  ARG C CB    1 
ATOM   4764  C  CG    . ARG C  2  154  ? 37.252  -30.874 52.371   1.00 70.17  ? 154  ARG C CG    1 
ATOM   4765  C  CD    . ARG C  2  154  ? 38.311  -31.277 51.356   1.00 73.39  ? 154  ARG C CD    1 
ATOM   4766  N  NE    . ARG C  2  154  ? 38.124  -32.637 50.860   1.00 79.97  ? 154  ARG C NE    1 
ATOM   4767  C  CZ    . ARG C  2  154  ? 37.204  -32.987 49.967   1.00 84.94  ? 154  ARG C CZ    1 
ATOM   4768  N  NH1   . ARG C  2  154  ? 36.370  -32.079 49.478   1.00 78.84  ? 154  ARG C NH1   1 
ATOM   4769  N  NH2   . ARG C  2  154  ? 37.110  -34.250 49.570   1.00 87.52  ? 154  ARG C NH2   1 
ATOM   4770  N  N     . PRO C  2  155  ? 35.304  -32.566 56.435   1.00 70.75  ? 155  PRO C N     1 
ATOM   4771  C  CA    . PRO C  2  155  ? 35.123  -33.388 57.639   1.00 75.67  ? 155  PRO C CA    1 
ATOM   4772  C  C     . PRO C  2  155  ? 35.862  -34.729 57.625   1.00 77.60  ? 155  PRO C C     1 
ATOM   4773  O  O     . PRO C  2  155  ? 36.478  -35.089 58.628   1.00 79.41  ? 155  PRO C O     1 
ATOM   4774  C  CB    . PRO C  2  155  ? 33.610  -33.632 57.667   1.00 67.64  ? 155  PRO C CB    1 
ATOM   4775  C  CG    . PRO C  2  155  ? 33.031  -32.482 56.926   1.00 66.80  ? 155  PRO C CG    1 
ATOM   4776  C  CD    . PRO C  2  155  ? 34.014  -32.184 55.835   1.00 66.32  ? 155  PRO C CD    1 
ATOM   4777  N  N     . GLY C  2  156  ? 35.801  -35.456 56.513   1.00 75.45  ? 156  GLY C N     1 
ATOM   4778  C  CA    . GLY C  2  156  ? 36.329  -36.809 56.470   1.00 76.18  ? 156  GLY C CA    1 
ATOM   4779  C  C     . GLY C  2  156  ? 37.723  -36.960 55.889   1.00 75.04  ? 156  GLY C C     1 
ATOM   4780  O  O     . GLY C  2  156  ? 38.176  -38.078 55.638   1.00 72.28  ? 156  GLY C O     1 
ATOM   4781  N  N     . ARG C  2  157  ? 38.412  -35.843 55.681   1.00 71.88  ? 157  ARG C N     1 
ATOM   4782  C  CA    . ARG C  2  157  ? 39.737  -35.873 55.071   1.00 69.26  ? 157  ARG C CA    1 
ATOM   4783  C  C     . ARG C  2  157  ? 40.796  -35.249 55.974   1.00 66.93  ? 157  ARG C C     1 
ATOM   4784  O  O     . ARG C  2  157  ? 40.475  -34.502 56.899   1.00 69.58  ? 157  ARG C O     1 
ATOM   4785  C  CB    . ARG C  2  157  ? 39.716  -35.175 53.709   1.00 71.61  ? 157  ARG C CB    1 
ATOM   4786  C  CG    . ARG C  2  157  ? 38.722  -35.780 52.730   1.00 76.53  ? 157  ARG C CG    1 
ATOM   4787  C  CD    . ARG C  2  157  ? 39.037  -37.243 52.456   1.00 77.27  ? 157  ARG C CD    1 
ATOM   4788  N  NE    . ARG C  2  157  ? 37.950  -37.918 51.751   1.00 79.26  ? 157  ARG C NE    1 
ATOM   4789  C  CZ    . ARG C  2  157  ? 37.818  -37.951 50.429   1.00 84.24  ? 157  ARG C CZ    1 
ATOM   4790  N  NH1   . ARG C  2  157  ? 38.708  -37.344 49.654   1.00 78.15  ? 157  ARG C NH1   1 
ATOM   4791  N  NH2   . ARG C  2  157  ? 36.795  -38.591 49.879   1.00 83.58  ? 157  ARG C NH2   1 
ATOM   4792  N  N     . TYR C  2  158  ? 42.059  -35.565 55.705   1.00 64.99  ? 158  TYR C N     1 
ATOM   4793  C  CA    . TYR C  2  158  ? 43.159  -35.075 56.528   1.00 60.89  ? 158  TYR C CA    1 
ATOM   4794  C  C     . TYR C  2  158  ? 44.279  -34.449 55.704   1.00 59.65  ? 158  TYR C C     1 
ATOM   4795  O  O     . TYR C  2  158  ? 44.387  -34.679 54.499   1.00 63.86  ? 158  TYR C O     1 
ATOM   4796  C  CB    . TYR C  2  158  ? 43.721  -36.201 57.397   1.00 58.60  ? 158  TYR C CB    1 
ATOM   4797  C  CG    . TYR C  2  158  ? 42.723  -36.768 58.378   1.00 63.24  ? 158  TYR C CG    1 
ATOM   4798  C  CD1   . TYR C  2  158  ? 42.577  -36.219 59.644   1.00 63.55  ? 158  TYR C CD1   1 
ATOM   4799  C  CD2   . TYR C  2  158  ? 41.924  -37.851 58.037   1.00 65.88  ? 158  TYR C CD2   1 
ATOM   4800  C  CE1   . TYR C  2  158  ? 41.665  -36.733 60.544   1.00 68.28  ? 158  TYR C CE1   1 
ATOM   4801  C  CE2   . TYR C  2  158  ? 41.008  -38.373 58.931   1.00 67.68  ? 158  TYR C CE2   1 
ATOM   4802  C  CZ    . TYR C  2  158  ? 40.884  -37.810 60.183   1.00 71.22  ? 158  TYR C CZ    1 
ATOM   4803  O  OH    . TYR C  2  158  ? 39.974  -38.325 61.078   1.00 77.47  ? 158  TYR C OH    1 
ATOM   4804  N  N     . ILE C  2  159  ? 45.111  -33.659 56.373   1.00 56.53  ? 159  ILE C N     1 
ATOM   4805  C  CA    . ILE C  2  159  ? 46.240  -32.991 55.743   1.00 56.52  ? 159  ILE C CA    1 
ATOM   4806  C  C     . ILE C  2  159  ? 47.550  -33.463 56.361   1.00 59.37  ? 159  ILE C C     1 
ATOM   4807  O  O     . ILE C  2  159  ? 47.734  -33.398 57.583   1.00 59.44  ? 159  ILE C O     1 
ATOM   4808  C  CB    . ILE C  2  159  ? 46.160  -31.461 55.908   1.00 57.33  ? 159  ILE C CB    1 
ATOM   4809  C  CG1   . ILE C  2  159  ? 44.780  -30.943 55.501   1.00 61.98  ? 159  ILE C CG1   1 
ATOM   4810  C  CG2   . ILE C  2  159  ? 47.253  -30.778 55.097   1.00 57.68  ? 159  ILE C CG2   1 
ATOM   4811  C  CD1   . ILE C  2  159  ? 44.479  -31.105 54.036   1.00 70.10  ? 159  ILE C CD1   1 
ATOM   4812  N  N     . ALA C  2  160  ? 48.452  -33.942 55.511   1.00 57.39  ? 160  ALA C N     1 
ATOM   4813  C  CA    . ALA C  2  160  ? 49.790  -34.316 55.943   1.00 51.42  ? 160  ALA C CA    1 
ATOM   4814  C  C     . ALA C  2  160  ? 50.723  -33.129 55.753   1.00 51.34  ? 160  ALA C C     1 
ATOM   4815  O  O     . ALA C  2  160  ? 50.640  -32.417 54.755   1.00 52.57  ? 160  ALA C O     1 
ATOM   4816  C  CB    . ALA C  2  160  ? 50.286  -35.515 55.157   1.00 52.70  ? 160  ALA C CB    1 
ATOM   4817  N  N     . SER C  2  161  ? 51.607  -32.915 56.718   1.00 49.64  ? 161  SER C N     1 
ATOM   4818  C  CA    . SER C  2  161  ? 52.508  -31.774 56.683   1.00 49.58  ? 161  SER C CA    1 
ATOM   4819  C  C     . SER C  2  161  ? 53.938  -32.212 56.963   1.00 47.21  ? 161  SER C C     1 
ATOM   4820  O  O     . SER C  2  161  ? 54.211  -32.867 57.973   1.00 49.08  ? 161  SER C O     1 
ATOM   4821  C  CB    . SER C  2  161  ? 52.072  -30.722 57.705   1.00 53.43  ? 161  SER C CB    1 
ATOM   4822  O  OG    . SER C  2  161  ? 50.708  -30.373 57.533   1.00 52.41  ? 161  SER C OG    1 
ATOM   4823  N  N     . ILE C  2  162  ? 54.844  -31.847 56.060   1.00 46.75  ? 162  ILE C N     1 
ATOM   4824  C  CA    . ILE C  2  162  ? 56.259  -32.154 56.224   1.00 49.79  ? 162  ILE C CA    1 
ATOM   4825  C  C     . ILE C  2  162  ? 57.040  -30.876 56.505   1.00 48.89  ? 162  ILE C C     1 
ATOM   4826  O  O     . ILE C  2  162  ? 57.237  -30.041 55.621   1.00 51.67  ? 162  ILE C O     1 
ATOM   4827  C  CB    . ILE C  2  162  ? 56.829  -32.835 54.969   1.00 50.48  ? 162  ILE C CB    1 
ATOM   4828  C  CG1   . ILE C  2  162  ? 56.114  -34.166 54.719   1.00 54.34  ? 162  ILE C CG1   1 
ATOM   4829  C  CG2   . ILE C  2  162  ? 58.323  -33.050 55.115   1.00 46.53  ? 162  ILE C CG2   1 
ATOM   4830  C  CD1   . ILE C  2  162  ? 56.539  -34.865 53.447   1.00 53.70  ? 162  ILE C CD1   1 
ATOM   4831  N  N     . ILE C  2  163  ? 57.483  -30.735 57.750   1.00 45.19  ? 163  ILE C N     1 
ATOM   4832  C  CA    . ILE C  2  163  ? 58.125  -29.512 58.217   1.00 47.29  ? 163  ILE C CA    1 
ATOM   4833  C  C     . ILE C  2  163  ? 59.595  -29.706 58.582   1.00 44.71  ? 163  ILE C C     1 
ATOM   4834  O  O     . ILE C  2  163  ? 59.924  -30.552 59.411   1.00 41.17  ? 163  ILE C O     1 
ATOM   4835  C  CB    . ILE C  2  163  ? 57.377  -28.920 59.425   1.00 51.60  ? 163  ILE C CB    1 
ATOM   4836  C  CG1   . ILE C  2  163  ? 55.879  -28.820 59.127   1.00 52.19  ? 163  ILE C CG1   1 
ATOM   4837  C  CG2   . ILE C  2  163  ? 57.949  -27.561 59.788   1.00 53.56  ? 163  ILE C CG2   1 
ATOM   4838  C  CD1   . ILE C  2  163  ? 55.046  -28.429 60.322   1.00 50.84  ? 163  ILE C CD1   1 
ATOM   4839  N  N     . PRO C  2  164  ? 60.486  -28.938 57.940   1.00 48.97  ? 164  PRO C N     1 
ATOM   4840  C  CA    . PRO C  2  164  ? 61.900  -28.889 58.324   1.00 48.70  ? 164  PRO C CA    1 
ATOM   4841  C  C     . PRO C  2  164  ? 62.147  -27.830 59.391   1.00 46.21  ? 164  PRO C C     1 
ATOM   4842  O  O     . PRO C  2  164  ? 61.200  -27.222 59.887   1.00 43.03  ? 164  PRO C O     1 
ATOM   4843  C  CB    . PRO C  2  164  ? 62.587  -28.481 57.024   1.00 49.99  ? 164  PRO C CB    1 
ATOM   4844  C  CG    . PRO C  2  164  ? 61.587  -27.621 56.354   1.00 49.24  ? 164  PRO C CG    1 
ATOM   4845  C  CD    . PRO C  2  164  ? 60.228  -28.167 56.711   1.00 52.70  ? 164  PRO C CD    1 
ATOM   4846  N  N     . LEU C  2  165  ? 63.410  -27.619 59.743   1.00 49.35  ? 165  LEU C N     1 
ATOM   4847  C  CA    . LEU C  2  165  ? 63.776  -26.531 60.640   1.00 50.31  ? 165  LEU C CA    1 
ATOM   4848  C  C     . LEU C  2  165  ? 63.551  -25.198 59.927   1.00 52.58  ? 165  LEU C C     1 
ATOM   4849  O  O     . LEU C  2  165  ? 63.485  -25.156 58.698   1.00 52.47  ? 165  LEU C O     1 
ATOM   4850  C  CB    . LEU C  2  165  ? 65.241  -26.656 61.063   1.00 49.91  ? 165  LEU C CB    1 
ATOM   4851  C  CG    . LEU C  2  165  ? 65.691  -27.791 61.979   1.00 54.26  ? 165  LEU C CG    1 
ATOM   4852  C  CD1   . LEU C  2  165  ? 67.210  -27.852 62.004   1.00 58.71  ? 165  LEU C CD1   1 
ATOM   4853  C  CD2   . LEU C  2  165  ? 65.146  -27.586 63.379   1.00 48.56  ? 165  LEU C CD2   1 
ATOM   4854  N  N     . PRO C  2  166  ? 63.413  -24.105 60.697   1.00 54.10  ? 166  PRO C N     1 
ATOM   4855  C  CA    . PRO C  2  166  ? 63.245  -22.763 60.123   1.00 57.31  ? 166  PRO C CA    1 
ATOM   4856  C  C     . PRO C  2  166  ? 64.382  -22.349 59.186   1.00 55.72  ? 166  PRO C C     1 
ATOM   4857  O  O     . PRO C  2  166  ? 65.556  -22.481 59.537   1.00 56.35  ? 166  PRO C O     1 
ATOM   4858  C  CB    . PRO C  2  166  ? 63.225  -21.862 61.359   1.00 54.83  ? 166  PRO C CB    1 
ATOM   4859  C  CG    . PRO C  2  166  ? 62.661  -22.729 62.427   1.00 49.19  ? 166  PRO C CG    1 
ATOM   4860  C  CD    . PRO C  2  166  ? 63.205  -24.104 62.157   1.00 49.37  ? 166  PRO C CD    1 
ATOM   4861  N  N     . LYS C  2  167  ? 64.008  -21.863 58.002   1.00 58.88  ? 167  LYS C N     1 
ATOM   4862  C  CA    . LYS C  2  167  ? 64.938  -21.433 56.952   1.00 62.00  ? 167  LYS C CA    1 
ATOM   4863  C  C     . LYS C  2  167  ? 65.866  -22.565 56.518   1.00 59.46  ? 167  LYS C C     1 
ATOM   4864  O  O     . LYS C  2  167  ? 66.934  -22.340 55.945   1.00 56.22  ? 167  LYS C O     1 
ATOM   4865  C  CB    . LYS C  2  167  ? 65.746  -20.215 57.408   1.00 59.26  ? 167  LYS C CB    1 
ATOM   4866  C  CG    . LYS C  2  167  ? 64.892  -19.111 58.010   1.00 62.60  ? 167  LYS C CG    1 
ATOM   4867  C  CD    . LYS C  2  167  ? 65.195  -17.761 57.389   1.00 69.55  ? 167  LYS C CD    1 
ATOM   4868  C  CE    . LYS C  2  167  ? 64.358  -16.670 58.032   1.00 74.56  ? 167  LYS C CE    1 
ATOM   4869  N  NZ    . LYS C  2  167  ? 64.709  -15.334 57.489   1.00 84.52  ? 167  LYS C NZ    1 
ATOM   4870  N  N     . ARG C  2  168  ? 65.436  -23.784 56.813   1.00 59.48  ? 168  ARG C N     1 
ATOM   4871  C  CA    . ARG C  2  168  ? 66.121  -25.007 56.415   1.00 60.46  ? 168  ARG C CA    1 
ATOM   4872  C  C     . ARG C  2  168  ? 65.503  -25.646 55.172   1.00 58.28  ? 168  ARG C C     1 
ATOM   4873  O  O     . ARG C  2  168  ? 65.753  -26.810 54.872   1.00 58.16  ? 168  ARG C O     1 
ATOM   4874  C  CB    . ARG C  2  168  ? 66.306  -25.968 57.590   1.00 59.66  ? 168  ARG C CB    1 
ATOM   4875  C  CG    . ARG C  2  168  ? 67.249  -25.406 58.659   1.00 59.50  ? 168  ARG C CG    1 
ATOM   4876  C  CD    . ARG C  2  168  ? 68.711  -25.767 58.421   1.00 59.56  ? 168  ARG C CD    1 
ATOM   4877  N  NE    . ARG C  2  168  ? 69.286  -25.123 57.243   1.00 56.65  ? 168  ARG C NE    1 
ATOM   4878  C  CZ    . ARG C  2  168  ? 70.481  -25.423 56.746   1.00 60.62  ? 168  ARG C CZ    1 
ATOM   4879  N  NH1   . ARG C  2  168  ? 71.221  -26.361 57.322   1.00 61.34  ? 168  ARG C NH1   1 
ATOM   4880  N  NH2   . ARG C  2  168  ? 70.935  -24.792 55.671   1.00 63.09  ? 168  ARG C NH2   1 
ATOM   4881  N  N     . GLY C  2  169  ? 64.663  -24.879 54.483   1.00 60.77  ? 169  GLY C N     1 
ATOM   4882  C  CA    . GLY C  2  169  ? 63.896  -25.374 53.353   1.00 62.19  ? 169  GLY C CA    1 
ATOM   4883  C  C     . GLY C  2  169  ? 62.392  -25.375 53.563   1.00 61.03  ? 169  GLY C C     1 
ATOM   4884  O  O     . GLY C  2  169  ? 61.913  -25.121 54.666   1.00 66.04  ? 169  GLY C O     1 
ATOM   4885  N  N     . PRO C  2  170  ? 61.639  -25.617 52.477   1.00 54.76  ? 170  PRO C N     1 
ATOM   4886  C  CA    . PRO C  2  170  ? 60.195  -25.367 52.370   1.00 60.53  ? 170  PRO C CA    1 
ATOM   4887  C  C     . PRO C  2  170  ? 59.289  -26.372 53.082   1.00 61.73  ? 170  PRO C C     1 
ATOM   4888  O  O     . PRO C  2  170  ? 59.650  -27.537 53.262   1.00 56.02  ? 170  PRO C O     1 
ATOM   4889  C  CB    . PRO C  2  170  ? 59.954  -25.446 50.862   1.00 56.67  ? 170  PRO C CB    1 
ATOM   4890  C  CG    . PRO C  2  170  ? 60.962  -26.432 50.393   1.00 51.80  ? 170  PRO C CG    1 
ATOM   4891  C  CD    . PRO C  2  170  ? 62.186  -26.195 51.236   1.00 49.37  ? 170  PRO C CD    1 
ATOM   4892  N  N     . TRP C  2  171  ? 58.107  -25.902 53.475   1.00 60.67  ? 171  TRP C N     1 
ATOM   4893  C  CA    . TRP C  2  171  ? 57.073  -26.768 54.028   1.00 56.20  ? 171  TRP C CA    1 
ATOM   4894  C  C     . TRP C  2  171  ? 56.352  -27.472 52.886   1.00 55.59  ? 171  TRP C C     1 
ATOM   4895  O  O     . TRP C  2  171  ? 56.224  -26.923 51.791   1.00 55.61  ? 171  TRP C O     1 
ATOM   4896  C  CB    . TRP C  2  171  ? 56.068  -25.967 54.861   1.00 60.38  ? 171  TRP C CB    1 
ATOM   4897  C  CG    . TRP C  2  171  ? 56.634  -25.361 56.114   1.00 66.69  ? 171  TRP C CG    1 
ATOM   4898  C  CD1   . TRP C  2  171  ? 57.894  -24.867 56.294   1.00 70.35  ? 171  TRP C CD1   1 
ATOM   4899  C  CD2   . TRP C  2  171  ? 55.958  -25.194 57.368   1.00 69.31  ? 171  TRP C CD2   1 
ATOM   4900  N  NE1   . TRP C  2  171  ? 58.041  -24.398 57.576   1.00 71.20  ? 171  TRP C NE1   1 
ATOM   4901  C  CE2   . TRP C  2  171  ? 56.867  -24.588 58.256   1.00 69.75  ? 171  TRP C CE2   1 
ATOM   4902  C  CE3   . TRP C  2  171  ? 54.670  -25.494 57.822   1.00 70.88  ? 171  TRP C CE3   1 
ATOM   4903  C  CZ2   . TRP C  2  171  ? 56.531  -24.276 59.572   1.00 66.29  ? 171  TRP C CZ2   1 
ATOM   4904  C  CZ3   . TRP C  2  171  ? 54.339  -25.185 59.131   1.00 68.70  ? 171  TRP C CZ3   1 
ATOM   4905  C  CH2   . TRP C  2  171  ? 55.265  -24.583 59.989   1.00 60.55  ? 171  TRP C CH2   1 
ATOM   4906  N  N     . ILE C  2  172  ? 55.882  -28.688 53.141   1.00 54.00  ? 172  ILE C N     1 
ATOM   4907  C  CA    . ILE C  2  172  ? 55.245  -29.493 52.105   1.00 53.82  ? 172  ILE C CA    1 
ATOM   4908  C  C     . ILE C  2  172  ? 53.914  -30.061 52.576   1.00 55.77  ? 172  ILE C C     1 
ATOM   4909  O  O     . ILE C  2  172  ? 53.851  -30.737 53.604   1.00 52.17  ? 172  ILE C O     1 
ATOM   4910  C  CB    . ILE C  2  172  ? 56.154  -30.653 51.674   1.00 54.57  ? 172  ILE C CB    1 
ATOM   4911  C  CG1   . ILE C  2  172  ? 57.404  -30.111 50.985   1.00 55.36  ? 172  ILE C CG1   1 
ATOM   4912  C  CG2   . ILE C  2  172  ? 55.406  -31.608 50.760   1.00 57.64  ? 172  ILE C CG2   1 
ATOM   4913  C  CD1   . ILE C  2  172  ? 58.291  -31.178 50.430   1.00 56.01  ? 172  ILE C CD1   1 
ATOM   4914  N  N     . ASP C  2  173  ? 52.850  -29.795 51.821   1.00 60.31  ? 173  ASP C N     1 
ATOM   4915  C  CA    . ASP C  2  173  ? 51.525  -30.272 52.224   1.00 58.43  ? 173  ASP C CA    1 
ATOM   4916  C  C     . ASP C  2  173  ? 50.943  -31.342 51.300   1.00 57.01  ? 173  ASP C C     1 
ATOM   4917  O  O     . ASP C  2  173  ? 50.799  -31.129 50.101   1.00 58.24  ? 173  ASP C O     1 
ATOM   4918  C  CB    . ASP C  2  173  ? 50.544  -29.103 52.371   1.00 63.85  ? 173  ASP C CB    1 
ATOM   4919  C  CG    . ASP C  2  173  ? 50.575  -28.483 53.759   1.00 63.28  ? 173  ASP C CG    1 
ATOM   4920  O  OD1   . ASP C  2  173  ? 51.649  -28.492 54.397   1.00 65.74  ? 173  ASP C OD1   1 
ATOM   4921  O  OD2   . ASP C  2  173  ? 49.521  -27.990 54.214   1.00 62.59  ? 173  ASP C OD2   1 
ATOM   4922  N  N     . LEU C  2  174  ? 50.605  -32.492 51.873   1.00 54.77  ? 174  LEU C N     1 
ATOM   4923  C  CA    . LEU C  2  174  ? 49.981  -33.575 51.120   1.00 58.62  ? 174  LEU C CA    1 
ATOM   4924  C  C     . LEU C  2  174  ? 48.497  -33.677 51.457   1.00 60.15  ? 174  LEU C C     1 
ATOM   4925  O  O     . LEU C  2  174  ? 48.124  -33.811 52.624   1.00 61.70  ? 174  LEU C O     1 
ATOM   4926  C  CB    . LEU C  2  174  ? 50.686  -34.903 51.396   1.00 54.69  ? 174  LEU C CB    1 
ATOM   4927  C  CG    . LEU C  2  174  ? 51.799  -35.317 50.427   1.00 58.44  ? 174  LEU C CG    1 
ATOM   4928  C  CD1   . LEU C  2  174  ? 52.771  -34.176 50.151   1.00 53.07  ? 174  LEU C CD1   1 
ATOM   4929  C  CD2   . LEU C  2  174  ? 52.536  -36.541 50.953   1.00 63.50  ? 174  LEU C CD2   1 
ATOM   4930  N  N     . GLU C  2  175  ? 47.657  -33.619 50.428   1.00 65.40  ? 175  GLU C N     1 
ATOM   4931  C  CA    . GLU C  2  175  ? 46.211  -33.550 50.616   1.00 69.14  ? 175  GLU C CA    1 
ATOM   4932  C  C     . GLU C  2  175  ? 45.488  -34.543 49.707   1.00 67.47  ? 175  GLU C C     1 
ATOM   4933  O  O     . GLU C  2  175  ? 46.001  -34.915 48.655   1.00 64.36  ? 175  GLU C O     1 
ATOM   4934  C  CB    . GLU C  2  175  ? 45.726  -32.121 50.334   1.00 68.67  ? 175  GLU C CB    1 
ATOM   4935  C  CG    . GLU C  2  175  ? 44.240  -31.874 50.572   1.00 69.57  ? 175  GLU C CG    1 
ATOM   4936  C  CD    . GLU C  2  175  ? 43.847  -30.421 50.359   1.00 74.91  ? 175  GLU C CD    1 
ATOM   4937  O  OE1   . GLU C  2  175  ? 44.667  -29.654 49.811   1.00 73.14  ? 175  GLU C OE1   1 
ATOM   4938  O  OE2   . GLU C  2  175  ? 42.719  -30.046 50.742   1.00 76.65  ? 175  GLU C OE2   1 
ATOM   4939  N  N     . VAL C  2  176  ? 44.303  -34.981 50.122   1.00 67.99  ? 176  VAL C N     1 
ATOM   4940  C  CA    . VAL C  2  176  ? 43.454  -35.788 49.255   1.00 68.57  ? 176  VAL C CA    1 
ATOM   4941  C  C     . VAL C  2  176  ? 42.351  -34.908 48.672   1.00 75.81  ? 176  VAL C C     1 
ATOM   4942  O  O     . VAL C  2  176  ? 41.434  -34.490 49.380   1.00 76.62  ? 176  VAL C O     1 
ATOM   4943  C  CB    . VAL C  2  176  ? 42.828  -36.973 50.011   1.00 65.34  ? 176  VAL C CB    1 
ATOM   4944  C  CG1   . VAL C  2  176  ? 41.991  -37.820 49.067   1.00 69.29  ? 176  VAL C CG1   1 
ATOM   4945  C  CG2   . VAL C  2  176  ? 43.911  -37.816 50.663   1.00 58.76  ? 176  VAL C CG2   1 
ATOM   4946  N  N     . GLU C  2  177  ? 42.449  -34.637 47.374   1.00 77.54  ? 177  GLU C N     1 
ATOM   4947  C  CA    . GLU C  2  177  ? 41.536  -33.726 46.692   1.00 76.62  ? 177  GLU C CA    1 
ATOM   4948  C  C     . GLU C  2  177  ? 40.146  -34.347 46.536   1.00 82.31  ? 177  GLU C C     1 
ATOM   4949  O  O     . GLU C  2  177  ? 40.012  -35.572 46.539   1.00 85.23  ? 177  GLU C O     1 
ATOM   4950  C  CB    . GLU C  2  177  ? 42.117  -33.340 45.325   1.00 72.31  ? 177  GLU C CB    1 
ATOM   4951  C  CG    . GLU C  2  177  ? 42.201  -31.839 45.062   1.00 73.83  ? 177  GLU C CG    1 
ATOM   4952  C  CD    . GLU C  2  177  ? 42.993  -31.091 46.121   1.00 75.15  ? 177  GLU C CD    1 
ATOM   4953  O  OE1   . GLU C  2  177  ? 42.656  -29.920 46.400   1.00 73.73  ? 177  GLU C OE1   1 
ATOM   4954  O  OE2   . GLU C  2  177  ? 43.957  -31.666 46.668   1.00 74.55  ? 177  GLU C OE2   1 
ATOM   4955  N  N     . PRO C  2  178  ? 39.106  -33.500 46.424   1.00 79.64  ? 178  PRO C N     1 
ATOM   4956  C  CA    . PRO C  2  178  ? 37.731  -33.959 46.191   1.00 79.30  ? 178  PRO C CA    1 
ATOM   4957  C  C     . PRO C  2  178  ? 37.616  -34.945 45.029   1.00 82.39  ? 178  PRO C C     1 
ATOM   4958  O  O     . PRO C  2  178  ? 36.896  -35.937 45.141   1.00 81.95  ? 178  PRO C O     1 
ATOM   4959  C  CB    . PRO C  2  178  ? 36.997  -32.665 45.841   1.00 79.32  ? 178  PRO C CB    1 
ATOM   4960  C  CG    . PRO C  2  178  ? 37.715  -31.622 46.608   1.00 74.53  ? 178  PRO C CG    1 
ATOM   4961  C  CD    . PRO C  2  178  ? 39.158  -32.048 46.678   1.00 75.73  ? 178  PRO C CD    1 
ATOM   4962  N  N     . ASN C  2  179  ? 38.323  -34.676 43.935   1.00 83.16  ? 179  ASN C N     1 
ATOM   4963  C  CA    . ASN C  2  179  ? 38.276  -35.545 42.762   1.00 82.28  ? 179  ASN C CA    1 
ATOM   4964  C  C     . ASN C  2  179  ? 39.021  -36.862 42.973   1.00 82.76  ? 179  ASN C C     1 
ATOM   4965  O  O     . ASN C  2  179  ? 38.967  -37.760 42.133   1.00 82.16  ? 179  ASN C O     1 
ATOM   4966  C  CB    . ASN C  2  179  ? 38.805  -34.821 41.522   1.00 78.39  ? 179  ASN C CB    1 
ATOM   4967  C  CG    . ASN C  2  179  ? 40.279  -34.491 41.624   1.00 75.09  ? 179  ASN C CG    1 
ATOM   4968  O  OD1   . ASN C  2  179  ? 41.132  -35.301 41.266   1.00 71.30  ? 179  ASN C OD1   1 
ATOM   4969  N  ND2   . ASN C  2  179  ? 40.586  -33.294 42.109   1.00 75.62  ? 179  ASN C ND2   1 
ATOM   4970  N  N     . GLY C  2  180  ? 39.716  -36.969 44.101   1.00 81.89  ? 180  GLY C N     1 
ATOM   4971  C  CA    . GLY C  2  180  ? 40.366  -38.208 44.482   1.00 78.18  ? 180  GLY C CA    1 
ATOM   4972  C  C     . GLY C  2  180  ? 41.874  -38.226 44.327   1.00 78.25  ? 180  GLY C C     1 
ATOM   4973  O  O     . GLY C  2  180  ? 42.545  -39.043 44.954   1.00 78.60  ? 180  GLY C O     1 
ATOM   4974  N  N     . VAL C  2  181  ? 42.415  -37.324 43.513   1.00 77.59  ? 181  VAL C N     1 
ATOM   4975  C  CA    . VAL C  2  181  ? 43.859  -37.286 43.292   1.00 76.35  ? 181  VAL C CA    1 
ATOM   4976  C  C     . VAL C  2  181  ? 44.580  -36.723 44.519   1.00 75.98  ? 181  VAL C C     1 
ATOM   4977  O  O     . VAL C  2  181  ? 44.047  -35.871 45.230   1.00 76.27  ? 181  VAL C O     1 
ATOM   4978  C  CB    . VAL C  2  181  ? 44.237  -36.486 42.015   1.00 70.02  ? 181  VAL C CB    1 
ATOM   4979  C  CG1   . VAL C  2  181  ? 44.114  -34.987 42.250   1.00 68.67  ? 181  VAL C CG1   1 
ATOM   4980  C  CG2   . VAL C  2  181  ? 45.647  -36.840 41.554   1.00 68.65  ? 181  VAL C CG2   1 
ATOM   4981  N  N     . VAL C  2  182  ? 45.784  -37.223 44.780   1.00 72.92  ? 182  VAL C N     1 
ATOM   4982  C  CA    . VAL C  2  182  ? 46.584  -36.723 45.890   1.00 65.08  ? 182  VAL C CA    1 
ATOM   4983  C  C     . VAL C  2  182  ? 47.444  -35.547 45.437   1.00 66.48  ? 182  VAL C C     1 
ATOM   4984  O  O     . VAL C  2  182  ? 48.197  -35.648 44.467   1.00 67.84  ? 182  VAL C O     1 
ATOM   4985  C  CB    . VAL C  2  182  ? 47.461  -37.830 46.511   1.00 60.66  ? 182  VAL C CB    1 
ATOM   4986  C  CG1   . VAL C  2  182  ? 48.119  -38.663 45.427   1.00 69.11  ? 182  VAL C CG1   1 
ATOM   4987  C  CG2   . VAL C  2  182  ? 48.498  -37.228 47.446   1.00 61.33  ? 182  VAL C CG2   1 
ATOM   4988  N  N     . SER C  2  183  ? 47.320  -34.429 46.144   1.00 66.99  ? 183  SER C N     1 
ATOM   4989  C  CA    . SER C  2  183  ? 47.993  -33.197 45.758   1.00 68.10  ? 183  SER C CA    1 
ATOM   4990  C  C     . SER C  2  183  ? 49.102  -32.815 46.730   1.00 63.80  ? 183  SER C C     1 
ATOM   4991  O  O     . SER C  2  183  ? 49.057  -33.147 47.916   1.00 62.10  ? 183  SER C O     1 
ATOM   4992  C  CB    . SER C  2  183  ? 46.990  -32.048 45.644   1.00 68.89  ? 183  SER C CB    1 
ATOM   4993  O  OG    . SER C  2  183  ? 46.483  -31.689 46.917   1.00 65.91  ? 183  SER C OG    1 
ATOM   4994  N  N     . MET C  2  184  ? 50.095  -32.110 46.203   1.00 65.46  ? 184  MET C N     1 
ATOM   4995  C  CA    . MET C  2  184  ? 51.250  -31.686 46.975   1.00 65.06  ? 184  MET C CA    1 
ATOM   4996  C  C     . MET C  2  184  ? 51.483  -30.191 46.787   1.00 64.34  ? 184  MET C C     1 
ATOM   4997  O  O     . MET C  2  184  ? 51.501  -29.689 45.659   1.00 64.50  ? 184  MET C O     1 
ATOM   4998  C  CB    . MET C  2  184  ? 52.482  -32.480 46.541   1.00 67.28  ? 184  MET C CB    1 
ATOM   4999  C  CG    . MET C  2  184  ? 53.784  -32.062 47.197   1.00 63.99  ? 184  MET C CG    1 
ATOM   5000  S  SD    . MET C  2  184  ? 55.119  -33.145 46.657   1.00 71.51  ? 184  MET C SD    1 
ATOM   5001  C  CE    . MET C  2  184  ? 56.540  -32.377 47.423   1.00 58.66  ? 184  MET C CE    1 
ATOM   5002  N  N     . LYS C  2  185  ? 51.645  -29.488 47.904   1.00 60.50  ? 185  LYS C N     1 
ATOM   5003  C  CA    . LYS C  2  185  ? 51.892  -28.055 47.895   1.00 60.59  ? 185  LYS C CA    1 
ATOM   5004  C  C     . LYS C  2  185  ? 53.304  -27.755 48.375   1.00 59.90  ? 185  LYS C C     1 
ATOM   5005  O  O     . LYS C  2  185  ? 53.686  -28.124 49.496   1.00 63.47  ? 185  LYS C O     1 
ATOM   5006  C  CB    . LYS C  2  185  ? 50.880  -27.322 48.781   1.00 63.41  ? 185  LYS C CB    1 
ATOM   5007  C  CG    . LYS C  2  185  ? 51.112  -25.817 48.865   1.00 65.23  ? 185  LYS C CG    1 
ATOM   5008  C  CD    . LYS C  2  185  ? 50.391  -25.200 50.058   1.00 65.61  ? 185  LYS C CD    1 
ATOM   5009  C  CE    . LYS C  2  185  ? 48.881  -25.299 49.918   1.00 61.67  ? 185  LYS C CE    1 
ATOM   5010  N  NZ    . LYS C  2  185  ? 48.377  -24.500 48.768   1.00 57.98  ? 185  LYS C NZ    1 
ATOM   5011  N  N     . VAL C  2  186  ? 54.072  -27.104 47.503   1.00 56.28  ? 186  VAL C N     1 
ATOM   5012  C  CA    . VAL C  2  186  ? 55.412  -26.617 47.810   1.00 57.64  ? 186  VAL C CA    1 
ATOM   5013  C  C     . VAL C  2  186  ? 55.570  -25.215 47.238   1.00 63.47  ? 186  VAL C C     1 
ATOM   5014  O  O     . VAL C  2  186  ? 55.371  -25.009 46.040   1.00 67.44  ? 186  VAL C O     1 
ATOM   5015  C  CB    . VAL C  2  186  ? 56.496  -27.506 47.184   1.00 55.95  ? 186  VAL C CB    1 
ATOM   5016  C  CG1   . VAL C  2  186  ? 57.873  -26.896 47.397   1.00 51.56  ? 186  VAL C CG1   1 
ATOM   5017  C  CG2   . VAL C  2  186  ? 56.438  -28.896 47.768   1.00 59.44  ? 186  VAL C CG2   1 
ATOM   5018  N  N     . ASN C  2  187  ? 55.935  -24.261 48.092   1.00 65.30  ? 187  ASN C N     1 
ATOM   5019  C  CA    . ASN C  2  187  ? 56.061  -22.858 47.694   1.00 65.38  ? 187  ASN C CA    1 
ATOM   5020  C  C     . ASN C  2  187  ? 54.794  -22.322 47.030   1.00 68.98  ? 187  ASN C C     1 
ATOM   5021  O  O     . ASN C  2  187  ? 54.858  -21.660 45.993   1.00 63.93  ? 187  ASN C O     1 
ATOM   5022  C  CB    . ASN C  2  187  ? 57.275  -22.648 46.782   1.00 62.58  ? 187  ASN C CB    1 
ATOM   5023  C  CG    . ASN C  2  187  ? 58.585  -23.004 47.460   1.00 67.02  ? 187  ASN C CG    1 
ATOM   5024  O  OD1   . ASN C  2  187  ? 59.365  -23.807 46.946   1.00 67.39  ? 187  ASN C OD1   1 
ATOM   5025  N  ND2   . ASN C  2  187  ? 58.835  -22.404 48.619   1.00 61.51  ? 187  ASN C ND2   1 
ATOM   5026  N  N     . LYS C  2  188  ? 53.650  -22.629 47.638   1.00 74.99  ? 188  LYS C N     1 
ATOM   5027  C  CA    . LYS C  2  188  ? 52.340  -22.192 47.153   1.00 71.86  ? 188  LYS C CA    1 
ATOM   5028  C  C     . LYS C  2  188  ? 52.024  -22.666 45.732   1.00 72.09  ? 188  LYS C C     1 
ATOM   5029  O  O     . LYS C  2  188  ? 51.429  -21.932 44.943   1.00 71.85  ? 188  LYS C O     1 
ATOM   5030  C  CB    . LYS C  2  188  ? 52.197  -20.668 47.261   1.00 76.39  ? 188  LYS C CB    1 
ATOM   5031  C  CG    . LYS C  2  188  ? 52.301  -20.134 48.683   1.00 74.03  ? 188  LYS C CG    1 
ATOM   5032  C  CD    . LYS C  2  188  ? 52.188  -18.616 48.720   1.00 71.87  ? 188  LYS C CD    1 
ATOM   5033  C  CE    . LYS C  2  188  ? 53.308  -17.955 47.931   1.00 69.21  ? 188  LYS C CE    1 
ATOM   5034  N  NZ    . LYS C  2  188  ? 54.653  -18.319 48.458   1.00 67.58  ? 188  LYS C NZ    1 
ATOM   5035  N  N     . ARG C  2  189  ? 52.426  -23.893 45.413   1.00 73.99  ? 189  ARG C N     1 
ATOM   5036  C  CA    . ARG C  2  189  ? 52.105  -24.499 44.122   1.00 67.31  ? 189  ARG C CA    1 
ATOM   5037  C  C     . ARG C  2  189  ? 51.636  -25.945 44.277   1.00 66.43  ? 189  ARG C C     1 
ATOM   5038  O  O     . ARG C  2  189  ? 52.361  -26.791 44.801   1.00 64.88  ? 189  ARG C O     1 
ATOM   5039  C  CB    . ARG C  2  189  ? 53.303  -24.431 43.172   1.00 61.70  ? 189  ARG C CB    1 
ATOM   5040  C  CG    . ARG C  2  189  ? 53.593  -23.039 42.639   1.00 60.10  ? 189  ARG C CG    1 
ATOM   5041  C  CD    . ARG C  2  189  ? 54.734  -23.059 41.640   1.00 62.06  ? 189  ARG C CD    1 
ATOM   5042  N  NE    . ARG C  2  189  ? 54.972  -21.741 41.059   1.00 69.22  ? 189  ARG C NE    1 
ATOM   5043  C  CZ    . ARG C  2  189  ? 54.394  -21.300 39.946   1.00 71.94  ? 189  ARG C CZ    1 
ATOM   5044  N  NH1   . ARG C  2  189  ? 53.542  -22.075 39.288   1.00 67.75  ? 189  ARG C NH1   1 
ATOM   5045  N  NH2   . ARG C  2  189  ? 54.670  -20.086 39.489   1.00 71.33  ? 189  ARG C NH2   1 
ATOM   5046  N  N     . LYS C  2  190  ? 50.419  -26.218 43.816   1.00 65.63  ? 190  LYS C N     1 
ATOM   5047  C  CA    . LYS C  2  190  ? 49.836  -27.553 43.892   1.00 64.54  ? 190  LYS C CA    1 
ATOM   5048  C  C     . LYS C  2  190  ? 50.162  -28.379 42.651   1.00 68.62  ? 190  LYS C C     1 
ATOM   5049  O  O     . LYS C  2  190  ? 50.009  -27.904 41.525   1.00 68.95  ? 190  LYS C O     1 
ATOM   5050  C  CB    . LYS C  2  190  ? 48.315  -27.458 44.039   1.00 59.44  ? 190  LYS C CB    1 
ATOM   5051  C  CG    . LYS C  2  190  ? 47.822  -26.962 45.386   1.00 57.94  ? 190  LYS C CG    1 
ATOM   5052  C  CD    . LYS C  2  190  ? 47.679  -28.108 46.374   1.00 68.57  ? 190  LYS C CD    1 
ATOM   5053  C  CE    . LYS C  2  190  ? 46.684  -27.769 47.473   1.00 71.52  ? 190  LYS C CE    1 
ATOM   5054  N  NZ    . LYS C  2  190  ? 45.314  -27.543 46.929   1.00 69.18  ? 190  LYS C NZ    1 
ATOM   5055  N  N     . PHE C  2  191  ? 50.619  -29.611 42.854   1.00 69.16  ? 191  PHE C N     1 
ATOM   5056  C  CA    . PHE C  2  191  ? 50.763  -30.554 41.743   1.00 68.54  ? 191  PHE C CA    1 
ATOM   5057  C  C     . PHE C  2  191  ? 50.486  -31.989 42.200   1.00 70.67  ? 191  PHE C C     1 
ATOM   5058  O  O     . PHE C  2  191  ? 50.643  -32.301 43.378   1.00 71.58  ? 191  PHE C O     1 
ATOM   5059  C  CB    . PHE C  2  191  ? 52.143  -30.428 41.077   1.00 66.86  ? 191  PHE C CB    1 
ATOM   5060  C  CG    . PHE C  2  191  ? 53.290  -30.849 41.953   1.00 72.49  ? 191  PHE C CG    1 
ATOM   5061  C  CD1   . PHE C  2  191  ? 53.734  -32.163 41.958   1.00 71.10  ? 191  PHE C CD1   1 
ATOM   5062  C  CD2   . PHE C  2  191  ? 53.937  -29.927 42.758   1.00 74.46  ? 191  PHE C CD2   1 
ATOM   5063  C  CE1   . PHE C  2  191  ? 54.791  -32.551 42.761   1.00 68.42  ? 191  PHE C CE1   1 
ATOM   5064  C  CE2   . PHE C  2  191  ? 54.996  -30.308 43.561   1.00 73.02  ? 191  PHE C CE2   1 
ATOM   5065  C  CZ    . PHE C  2  191  ? 55.423  -31.621 43.561   1.00 70.19  ? 191  PHE C CZ    1 
ATOM   5066  N  N     . PRO C  2  192  ? 50.059  -32.864 41.273   1.00 69.30  ? 192  PRO C N     1 
ATOM   5067  C  CA    . PRO C  2  192  ? 49.800  -34.265 41.631   1.00 68.63  ? 192  PRO C CA    1 
ATOM   5068  C  C     . PRO C  2  192  ? 51.049  -34.989 42.135   1.00 66.03  ? 192  PRO C C     1 
ATOM   5069  O  O     . PRO C  2  192  ? 52.111  -34.894 41.521   1.00 63.65  ? 192  PRO C O     1 
ATOM   5070  C  CB    . PRO C  2  192  ? 49.316  -34.884 40.312   1.00 68.44  ? 192  PRO C CB    1 
ATOM   5071  C  CG    . PRO C  2  192  ? 49.771  -33.938 39.244   1.00 64.81  ? 192  PRO C CG    1 
ATOM   5072  C  CD    . PRO C  2  192  ? 49.718  -32.585 39.868   1.00 62.42  ? 192  PRO C CD    1 
ATOM   5073  N  N     . LEU C  2  193  ? 50.908  -35.705 43.248   1.00 67.83  ? 193  LEU C N     1 
ATOM   5074  C  CA    . LEU C  2  193  ? 52.028  -36.394 43.887   1.00 68.46  ? 193  LEU C CA    1 
ATOM   5075  C  C     . LEU C  2  193  ? 52.548  -37.548 43.032   1.00 69.41  ? 193  LEU C C     1 
ATOM   5076  O  O     . LEU C  2  193  ? 53.698  -37.977 43.175   1.00 67.64  ? 193  LEU C O     1 
ATOM   5077  C  CB    . LEU C  2  193  ? 51.610  -36.904 45.270   1.00 67.58  ? 193  LEU C CB    1 
ATOM   5078  C  CG    . LEU C  2  193  ? 52.684  -37.544 46.153   1.00 63.83  ? 193  LEU C CG    1 
ATOM   5079  C  CD1   . LEU C  2  193  ? 53.812  -36.561 46.428   1.00 62.40  ? 193  LEU C CD1   1 
ATOM   5080  C  CD2   . LEU C  2  193  ? 52.082  -38.054 47.454   1.00 56.46  ? 193  LEU C CD2   1 
ATOM   5081  N  N     . VAL C  2  194  ? 51.692  -38.042 42.143   1.00 71.62  ? 194  VAL C N     1 
ATOM   5082  C  CA    . VAL C  2  194  ? 52.034  -39.148 41.256   1.00 69.63  ? 194  VAL C CA    1 
ATOM   5083  C  C     . VAL C  2  194  ? 53.291  -38.850 40.445   1.00 67.98  ? 194  VAL C C     1 
ATOM   5084  O  O     . VAL C  2  194  ? 54.120  -39.731 40.222   1.00 68.74  ? 194  VAL C O     1 
ATOM   5085  C  CB    . VAL C  2  194  ? 50.887  -39.442 40.275   1.00 72.75  ? 194  VAL C CB    1 
ATOM   5086  C  CG1   . VAL C  2  194  ? 51.046  -40.831 39.680   1.00 75.76  ? 194  VAL C CG1   1 
ATOM   5087  C  CG2   . VAL C  2  194  ? 49.540  -39.299 40.970   1.00 75.35  ? 194  VAL C CG2   1 
ATOM   5088  N  N     . LEU C  2  195  ? 53.421  -37.600 40.011   1.00 66.93  ? 195  LEU C N     1 
ATOM   5089  C  CA    . LEU C  2  195  ? 54.545  -37.173 39.183   1.00 64.30  ? 195  LEU C CA    1 
ATOM   5090  C  C     . LEU C  2  195  ? 55.866  -37.267 39.939   1.00 67.11  ? 195  LEU C C     1 
ATOM   5091  O  O     . LEU C  2  195  ? 56.824  -37.888 39.466   1.00 72.31  ? 195  LEU C O     1 
ATOM   5092  C  CB    . LEU C  2  195  ? 54.323  -35.741 38.696   1.00 61.88  ? 195  LEU C CB    1 
ATOM   5093  C  CG    . LEU C  2  195  ? 55.294  -35.199 37.648   1.00 61.96  ? 195  LEU C CG    1 
ATOM   5094  C  CD1   . LEU C  2  195  ? 55.230  -36.036 36.387   1.00 64.40  ? 195  LEU C CD1   1 
ATOM   5095  C  CD2   . LEU C  2  195  ? 54.974  -33.750 37.339   1.00 61.59  ? 195  LEU C CD2   1 
ATOM   5096  N  N     . LEU C  2  196  ? 55.912  -36.647 41.114   1.00 67.27  ? 196  LEU C N     1 
ATOM   5097  C  CA    . LEU C  2  196  ? 57.107  -36.682 41.947   1.00 69.10  ? 196  LEU C CA    1 
ATOM   5098  C  C     . LEU C  2  196  ? 57.445  -38.113 42.346   1.00 70.21  ? 196  LEU C C     1 
ATOM   5099  O  O     . LEU C  2  196  ? 58.613  -38.502 42.351   1.00 70.62  ? 196  LEU C O     1 
ATOM   5100  C  CB    . LEU C  2  196  ? 56.933  -35.815 43.195   1.00 68.10  ? 196  LEU C CB    1 
ATOM   5101  C  CG    . LEU C  2  196  ? 58.155  -35.772 44.116   1.00 65.03  ? 196  LEU C CG    1 
ATOM   5102  C  CD1   . LEU C  2  196  ? 59.329  -35.093 43.426   1.00 66.21  ? 196  LEU C CD1   1 
ATOM   5103  C  CD2   . LEU C  2  196  ? 57.834  -35.087 45.430   1.00 60.35  ? 196  LEU C CD2   1 
ATOM   5104  N  N     . LEU C  2  197  ? 56.421  -38.895 42.675   1.00 67.14  ? 197  LEU C N     1 
ATOM   5105  C  CA    . LEU C  2  197  ? 56.625  -40.300 43.008   1.00 64.49  ? 197  LEU C CA    1 
ATOM   5106  C  C     . LEU C  2  197  ? 57.206  -41.071 41.827   1.00 69.22  ? 197  LEU C C     1 
ATOM   5107  O  O     . LEU C  2  197  ? 57.984  -42.006 42.010   1.00 71.62  ? 197  LEU C O     1 
ATOM   5108  C  CB    . LEU C  2  197  ? 55.324  -40.945 43.483   1.00 64.07  ? 197  LEU C CB    1 
ATOM   5109  C  CG    . LEU C  2  197  ? 54.911  -40.582 44.909   1.00 64.22  ? 197  LEU C CG    1 
ATOM   5110  C  CD1   . LEU C  2  197  ? 53.704  -41.397 45.344   1.00 68.24  ? 197  LEU C CD1   1 
ATOM   5111  C  CD2   . LEU C  2  197  ? 56.076  -40.783 45.867   1.00 61.85  ? 197  LEU C CD2   1 
ATOM   5112  N  N     . ARG C  2  198  ? 56.832  -40.670 40.615   1.00 71.25  ? 198  ARG C N     1 
ATOM   5113  C  CA    . ARG C  2  198  ? 57.396  -41.272 39.412   1.00 73.94  ? 198  ARG C CA    1 
ATOM   5114  C  C     . ARG C  2  198  ? 58.862  -40.883 39.278   1.00 72.40  ? 198  ARG C C     1 
ATOM   5115  O  O     . ARG C  2  198  ? 59.691  -41.692 38.861   1.00 75.57  ? 198  ARG C O     1 
ATOM   5116  C  CB    . ARG C  2  198  ? 56.621  -40.839 38.166   1.00 76.01  ? 198  ARG C CB    1 
ATOM   5117  C  CG    . ARG C  2  198  ? 57.025  -41.575 36.895   1.00 80.58  ? 198  ARG C CG    1 
ATOM   5118  C  CD    . ARG C  2  198  ? 56.622  -43.044 36.953   1.00 86.91  ? 198  ARG C CD    1 
ATOM   5119  N  NE    . ARG C  2  198  ? 56.976  -43.763 35.732   1.00 88.25  ? 198  ARG C NE    1 
ATOM   5120  C  CZ    . ARG C  2  198  ? 58.014  -44.585 35.619   1.00 85.60  ? 198  ARG C CZ    1 
ATOM   5121  N  NH1   . ARG C  2  198  ? 58.258  -45.194 34.467   1.00 82.93  ? 198  ARG C NH1   1 
ATOM   5122  N  NH2   . ARG C  2  198  ? 58.808  -44.803 36.660   1.00 81.49  ? 198  ARG C NH2   1 
ATOM   5123  N  N     . VAL C  2  199  ? 59.177  -39.640 39.633   1.00 71.54  ? 199  VAL C N     1 
ATOM   5124  C  CA    . VAL C  2  199  ? 60.563  -39.178 39.621   1.00 73.16  ? 199  VAL C CA    1 
ATOM   5125  C  C     . VAL C  2  199  ? 61.395  -39.941 40.652   1.00 71.81  ? 199  VAL C C     1 
ATOM   5126  O  O     . VAL C  2  199  ? 62.557  -40.269 40.406   1.00 73.16  ? 199  VAL C O     1 
ATOM   5127  C  CB    . VAL C  2  199  ? 60.663  -37.660 39.888   1.00 76.21  ? 199  VAL C CB    1 
ATOM   5128  C  CG1   . VAL C  2  199  ? 62.118  -37.208 39.876   1.00 73.29  ? 199  VAL C CG1   1 
ATOM   5129  C  CG2   . VAL C  2  199  ? 59.857  -36.885 38.858   1.00 75.87  ? 199  VAL C CG2   1 
ATOM   5130  N  N     . LEU C  2  200  ? 60.789  -40.237 41.799   1.00 71.31  ? 200  LEU C N     1 
ATOM   5131  C  CA    . LEU C  2  200  ? 61.462  -40.994 42.853   1.00 72.14  ? 200  LEU C CA    1 
ATOM   5132  C  C     . LEU C  2  200  ? 61.694  -42.456 42.467   1.00 71.44  ? 200  LEU C C     1 
ATOM   5133  O  O     . LEU C  2  200  ? 62.398  -43.186 43.166   1.00 69.34  ? 200  LEU C O     1 
ATOM   5134  C  CB    . LEU C  2  200  ? 60.684  -40.915 44.171   1.00 72.87  ? 200  LEU C CB    1 
ATOM   5135  C  CG    . LEU C  2  200  ? 61.120  -39.856 45.191   1.00 68.40  ? 200  LEU C CG    1 
ATOM   5136  C  CD1   . LEU C  2  200  ? 62.639  -39.801 45.294   1.00 69.77  ? 200  LEU C CD1   1 
ATOM   5137  C  CD2   . LEU C  2  200  ? 60.551  -38.487 44.866   1.00 64.78  ? 200  LEU C CD2   1 
ATOM   5138  N  N     . GLY C  2  201  ? 61.095  -42.879 41.356   1.00 71.69  ? 201  GLY C N     1 
ATOM   5139  C  CA    . GLY C  2  201  ? 61.307  -44.219 40.841   1.00 71.94  ? 201  GLY C CA    1 
ATOM   5140  C  C     . GLY C  2  201  ? 60.194  -45.200 41.156   1.00 70.41  ? 201  GLY C C     1 
ATOM   5141  O  O     . GLY C  2  201  ? 60.367  -46.409 41.002   1.00 75.23  ? 201  GLY C O     1 
ATOM   5142  N  N     . TYR C  2  202  ? 59.052  -44.689 41.603   1.00 69.95  ? 202  TYR C N     1 
ATOM   5143  C  CA    . TYR C  2  202  ? 57.922  -45.550 41.938   1.00 73.91  ? 202  TYR C CA    1 
ATOM   5144  C  C     . TYR C  2  202  ? 57.144  -45.994 40.705   1.00 76.84  ? 202  TYR C C     1 
ATOM   5145  O  O     . TYR C  2  202  ? 56.934  -45.219 39.771   1.00 71.79  ? 202  TYR C O     1 
ATOM   5146  C  CB    . TYR C  2  202  ? 56.992  -44.868 42.943   1.00 73.89  ? 202  TYR C CB    1 
ATOM   5147  C  CG    . TYR C  2  202  ? 57.585  -44.765 44.327   1.00 70.90  ? 202  TYR C CG    1 
ATOM   5148  C  CD1   . TYR C  2  202  ? 57.373  -45.764 45.267   1.00 67.30  ? 202  TYR C CD1   1 
ATOM   5149  C  CD2   . TYR C  2  202  ? 58.366  -43.677 44.691   1.00 67.48  ? 202  TYR C CD2   1 
ATOM   5150  C  CE1   . TYR C  2  202  ? 57.918  -45.679 46.532   1.00 65.93  ? 202  TYR C CE1   1 
ATOM   5151  C  CE2   . TYR C  2  202  ? 58.915  -43.583 45.954   1.00 66.79  ? 202  TYR C CE2   1 
ATOM   5152  C  CZ    . TYR C  2  202  ? 58.687  -44.586 46.871   1.00 65.67  ? 202  TYR C CZ    1 
ATOM   5153  O  OH    . TYR C  2  202  ? 59.233  -44.498 48.130   1.00 63.57  ? 202  TYR C OH    1 
ATOM   5154  N  N     . ASP C  2  203  ? 56.717  -47.253 40.719   1.00 84.51  ? 203  ASP C N     1 
ATOM   5155  C  CA    . ASP C  2  203  ? 55.971  -47.829 39.610   1.00 90.85  ? 203  ASP C CA    1 
ATOM   5156  C  C     . ASP C  2  203  ? 54.577  -48.212 40.085   1.00 91.17  ? 203  ASP C C     1 
ATOM   5157  O  O     . ASP C  2  203  ? 54.357  -48.414 41.280   1.00 89.36  ? 203  ASP C O     1 
ATOM   5158  C  CB    . ASP C  2  203  ? 56.700  -49.057 39.059   1.00 93.17  ? 203  ASP C CB    1 
ATOM   5159  C  CG    . ASP C  2  203  ? 56.232  -49.440 37.667   1.00 104.91 ? 203  ASP C CG    1 
ATOM   5160  O  OD1   . ASP C  2  203  ? 57.096  -49.706 36.805   1.00 114.09 ? 203  ASP C OD1   1 
ATOM   5161  O  OD2   . ASP C  2  203  ? 55.005  -49.480 37.432   1.00 103.92 ? 203  ASP C OD2   1 
ATOM   5162  N  N     . GLN C  2  204  ? 53.641  -48.301 39.144   1.00 90.73  ? 204  GLN C N     1 
ATOM   5163  C  CA    . GLN C  2  204  ? 52.252  -48.633 39.449   1.00 87.99  ? 204  GLN C CA    1 
ATOM   5164  C  C     . GLN C  2  204  ? 52.145  -49.935 40.238   1.00 89.15  ? 204  GLN C C     1 
ATOM   5165  O  O     . GLN C  2  204  ? 51.280  -50.076 41.102   1.00 84.80  ? 204  GLN C O     1 
ATOM   5166  C  CB    . GLN C  2  204  ? 51.433  -48.719 38.160   1.00 85.19  ? 204  GLN C CB    1 
ATOM   5167  C  CG    . GLN C  2  204  ? 49.948  -48.933 38.378   1.00 83.24  ? 204  GLN C CG    1 
ATOM   5168  C  CD    . GLN C  2  204  ? 49.140  -48.694 37.120   1.00 83.11  ? 204  GLN C CD    1 
ATOM   5169  O  OE1   . GLN C  2  204  ? 49.646  -48.154 36.136   1.00 75.88  ? 204  GLN C OE1   1 
ATOM   5170  N  NE2   . GLN C  2  204  ? 47.874  -49.096 37.144   1.00 86.67  ? 204  GLN C NE2   1 
ATOM   5171  N  N     . GLU C  2  205  ? 53.038  -50.874 39.937   1.00 93.04  ? 205  GLU C N     1 
ATOM   5172  C  CA    . GLU C  2  205  ? 53.140  -52.127 40.674   1.00 93.37  ? 205  GLU C CA    1 
ATOM   5173  C  C     . GLU C  2  205  ? 53.357  -51.855 42.158   1.00 88.68  ? 205  GLU C C     1 
ATOM   5174  O  O     . GLU C  2  205  ? 52.588  -52.312 43.008   1.00 88.92  ? 205  GLU C O     1 
ATOM   5175  C  CB    . GLU C  2  205  ? 54.313  -52.948 40.134   1.00 98.77  ? 205  GLU C CB    1 
ATOM   5176  C  CG    . GLU C  2  205  ? 54.521  -54.288 40.821   1.00 97.22  ? 205  GLU C CG    1 
ATOM   5177  C  CD    . GLU C  2  205  ? 53.793  -55.418 40.122   1.00 101.77 ? 205  GLU C CD    1 
ATOM   5178  O  OE1   . GLU C  2  205  ? 53.088  -55.148 39.127   1.00 99.23  ? 205  GLU C OE1   1 
ATOM   5179  O  OE2   . GLU C  2  205  ? 53.930  -56.578 40.565   1.00 106.62 ? 205  GLU C OE2   1 
ATOM   5180  N  N     . THR C  2  206  ? 54.407  -51.090 42.448   1.00 88.90  ? 206  THR C N     1 
ATOM   5181  C  CA    . THR C  2  206  ? 54.811  -50.773 43.814   1.00 90.00  ? 206  THR C CA    1 
ATOM   5182  C  C     . THR C  2  206  ? 53.699  -50.089 44.609   1.00 90.48  ? 206  THR C C     1 
ATOM   5183  O  O     . THR C  2  206  ? 53.367  -50.506 45.722   1.00 89.99  ? 206  THR C O     1 
ATOM   5184  C  CB    . THR C  2  206  ? 56.054  -49.862 43.818   1.00 82.77  ? 206  THR C CB    1 
ATOM   5185  O  OG1   . THR C  2  206  ? 56.952  -50.265 42.775   1.00 72.82  ? 206  THR C OG1   1 
ATOM   5186  C  CG2   . THR C  2  206  ? 56.766  -49.931 45.160   1.00 81.18  ? 206  THR C CG2   1 
ATOM   5187  N  N     . LEU C  2  207  ? 53.126  -49.039 44.030   1.00 87.92  ? 207  LEU C N     1 
ATOM   5188  C  CA    . LEU C  2  207  ? 52.065  -48.286 44.688   1.00 83.19  ? 207  LEU C CA    1 
ATOM   5189  C  C     . LEU C  2  207  ? 50.798  -49.121 44.861   1.00 86.68  ? 207  LEU C C     1 
ATOM   5190  O  O     . LEU C  2  207  ? 50.065  -48.948 45.835   1.00 90.70  ? 207  LEU C O     1 
ATOM   5191  C  CB    . LEU C  2  207  ? 51.761  -46.996 43.921   1.00 80.77  ? 207  LEU C CB    1 
ATOM   5192  C  CG    . LEU C  2  207  ? 52.904  -45.979 43.856   1.00 76.83  ? 207  LEU C CG    1 
ATOM   5193  C  CD1   . LEU C  2  207  ? 52.498  -44.752 43.051   1.00 69.62  ? 207  LEU C CD1   1 
ATOM   5194  C  CD2   . LEU C  2  207  ? 53.348  -45.583 45.255   1.00 76.79  ? 207  LEU C CD2   1 
ATOM   5195  N  N     . ALA C  2  208  ? 50.542  -50.026 43.920   1.00 87.88  ? 208  ALA C N     1 
ATOM   5196  C  CA    . ALA C  2  208  ? 49.374  -50.898 44.013   1.00 87.12  ? 208  ALA C CA    1 
ATOM   5197  C  C     . ALA C  2  208  ? 49.517  -51.914 45.141   1.00 84.56  ? 208  ALA C C     1 
ATOM   5198  O  O     . ALA C  2  208  ? 48.589  -52.111 45.925   1.00 78.36  ? 208  ALA C O     1 
ATOM   5199  C  CB    . ALA C  2  208  ? 49.117  -51.605 42.691   1.00 90.40  ? 208  ALA C CB    1 
ATOM   5200  N  N     . ARG C  2  209  ? 50.676  -52.562 45.219   1.00 89.10  ? 209  ARG C N     1 
ATOM   5201  C  CA    . ARG C  2  209  ? 50.897  -53.569 46.255   1.00 90.24  ? 209  ARG C CA    1 
ATOM   5202  C  C     . ARG C  2  209  ? 51.046  -52.953 47.645   1.00 88.31  ? 209  ARG C C     1 
ATOM   5203  O  O     . ARG C  2  209  ? 50.654  -53.558 48.643   1.00 87.19  ? 209  ARG C O     1 
ATOM   5204  C  CB    . ARG C  2  209  ? 52.106  -54.456 45.928   1.00 90.70  ? 209  ARG C CB    1 
ATOM   5205  C  CG    . ARG C  2  209  ? 53.401  -53.700 45.681   1.00 92.32  ? 209  ARG C CG    1 
ATOM   5206  C  CD    . ARG C  2  209  ? 54.596  -54.638 45.637   1.00 90.94  ? 209  ARG C CD    1 
ATOM   5207  N  NE    . ARG C  2  209  ? 54.993  -55.065 46.975   1.00 96.85  ? 209  ARG C NE    1 
ATOM   5208  C  CZ    . ARG C  2  209  ? 55.861  -54.409 47.739   1.00 96.36  ? 209  ARG C CZ    1 
ATOM   5209  N  NH1   . ARG C  2  209  ? 56.425  -53.294 47.294   1.00 90.23  ? 209  ARG C NH1   1 
ATOM   5210  N  NH2   . ARG C  2  209  ? 56.166  -54.866 48.946   1.00 96.03  ? 209  ARG C NH2   1 
ATOM   5211  N  N     . GLU C  2  210  ? 51.621  -51.756 47.710   1.00 89.03  ? 210  GLU C N     1 
ATOM   5212  C  CA    . GLU C  2  210  ? 51.813  -51.084 48.992   1.00 90.91  ? 210  GLU C CA    1 
ATOM   5213  C  C     . GLU C  2  210  ? 50.538  -50.414 49.513   1.00 88.36  ? 210  GLU C C     1 
ATOM   5214  O  O     . GLU C  2  210  ? 50.170  -50.578 50.677   1.00 85.68  ? 210  GLU C O     1 
ATOM   5215  C  CB    . GLU C  2  210  ? 52.936  -50.047 48.887   1.00 93.21  ? 210  GLU C CB    1 
ATOM   5216  C  CG    . GLU C  2  210  ? 53.657  -49.775 50.196   1.00 88.07  ? 210  GLU C CG    1 
ATOM   5217  C  CD    . GLU C  2  210  ? 54.485  -50.959 50.652   1.00 95.58  ? 210  GLU C CD    1 
ATOM   5218  O  OE1   . GLU C  2  210  ? 55.071  -51.642 49.785   1.00 96.62  ? 210  GLU C OE1   1 
ATOM   5219  O  OE2   . GLU C  2  210  ? 54.542  -51.213 51.873   1.00 100.49 ? 210  GLU C OE2   1 
ATOM   5220  N  N     . LEU C  2  211  ? 49.875  -49.654 48.647   1.00 89.60  ? 211  LEU C N     1 
ATOM   5221  C  CA    . LEU C  2  211  ? 48.747  -48.815 49.059   1.00 87.07  ? 211  LEU C CA    1 
ATOM   5222  C  C     . LEU C  2  211  ? 47.354  -49.401 48.790   1.00 89.01  ? 211  LEU C C     1 
ATOM   5223  O  O     . LEU C  2  211  ? 46.341  -48.755 49.063   1.00 88.31  ? 211  LEU C O     1 
ATOM   5224  C  CB    . LEU C  2  211  ? 48.872  -47.414 48.447   1.00 83.73  ? 211  LEU C CB    1 
ATOM   5225  C  CG    . LEU C  2  211  ? 49.671  -46.357 49.222   1.00 82.89  ? 211  LEU C CG    1 
ATOM   5226  C  CD1   . LEU C  2  211  ? 50.983  -46.906 49.768   1.00 81.69  ? 211  LEU C CD1   1 
ATOM   5227  C  CD2   . LEU C  2  211  ? 49.941  -45.148 48.345   1.00 76.64  ? 211  LEU C CD2   1 
ATOM   5228  N  N     . GLY C  2  212  ? 47.306  -50.619 48.260   1.00 91.19  ? 212  GLY C N     1 
ATOM   5229  C  CA    . GLY C  2  212  ? 46.052  -51.223 47.838   1.00 92.45  ? 212  GLY C CA    1 
ATOM   5230  C  C     . GLY C  2  212  ? 45.046  -51.562 48.927   1.00 91.32  ? 212  GLY C C     1 
ATOM   5231  O  O     . GLY C  2  212  ? 43.855  -51.699 48.647   1.00 93.42  ? 212  GLY C O     1 
ATOM   5232  N  N     . ALA C  2  213  ? 45.512  -51.688 50.167   1.00 83.04  ? 213  ALA C N     1 
ATOM   5233  C  CA    . ALA C  2  213  ? 44.663  -52.154 51.266   1.00 85.14  ? 213  ALA C CA    1 
ATOM   5234  C  C     . ALA C  2  213  ? 43.541  -51.187 51.656   1.00 92.40  ? 213  ALA C C     1 
ATOM   5235  O  O     . ALA C  2  213  ? 42.635  -51.550 52.409   1.00 90.10  ? 213  ALA C O     1 
ATOM   5236  C  CB    . ALA C  2  213  ? 45.514  -52.496 52.482   1.00 79.69  ? 213  ALA C CB    1 
ATOM   5237  N  N     . TYR C  2  214  ? 43.602  -49.962 51.143   1.00 95.75  ? 214  TYR C N     1 
ATOM   5238  C  CA    . TYR C  2  214  ? 42.606  -48.948 51.467   1.00 94.39  ? 214  TYR C CA    1 
ATOM   5239  C  C     . TYR C  2  214  ? 41.660  -48.753 50.288   1.00 91.65  ? 214  TYR C C     1 
ATOM   5240  O  O     . TYR C  2  214  ? 42.101  -48.673 49.142   1.00 89.34  ? 214  TYR C O     1 
ATOM   5241  C  CB    . TYR C  2  214  ? 43.298  -47.634 51.831   1.00 89.11  ? 214  TYR C CB    1 
ATOM   5242  C  CG    . TYR C  2  214  ? 44.560  -47.834 52.645   1.00 88.64  ? 214  TYR C CG    1 
ATOM   5243  C  CD1   . TYR C  2  214  ? 44.517  -48.447 53.892   1.00 83.96  ? 214  TYR C CD1   1 
ATOM   5244  C  CD2   . TYR C  2  214  ? 45.794  -47.412 52.165   1.00 84.37  ? 214  TYR C CD2   1 
ATOM   5245  C  CE1   . TYR C  2  214  ? 45.670  -48.635 54.639   1.00 78.10  ? 214  TYR C CE1   1 
ATOM   5246  C  CE2   . TYR C  2  214  ? 46.951  -47.593 52.906   1.00 77.85  ? 214  TYR C CE2   1 
ATOM   5247  C  CZ    . TYR C  2  214  ? 46.883  -48.206 54.140   1.00 75.83  ? 214  TYR C CZ    1 
ATOM   5248  O  OH    . TYR C  2  214  ? 48.030  -48.389 54.880   1.00 69.08  ? 214  TYR C OH    1 
ATOM   5249  N  N     . GLY C  2  215  ? 40.360  -48.693 50.566   1.00 90.41  ? 215  GLY C N     1 
ATOM   5250  C  CA    . GLY C  2  215  ? 39.381  -48.632 49.498   1.00 93.87  ? 215  GLY C CA    1 
ATOM   5251  C  C     . GLY C  2  215  ? 39.443  -47.356 48.680   1.00 97.01  ? 215  GLY C C     1 
ATOM   5252  O  O     . GLY C  2  215  ? 39.268  -46.255 49.202   1.00 95.06  ? 215  GLY C O     1 
ATOM   5253  N  N     . GLU C  2  216  ? 39.707  -47.525 47.387   1.00 100.96 ? 216  GLU C N     1 
ATOM   5254  C  CA    . GLU C  2  216  ? 39.644  -46.453 46.388   1.00 98.80  ? 216  GLU C CA    1 
ATOM   5255  C  C     . GLU C  2  216  ? 40.621  -45.283 46.572   1.00 93.88  ? 216  GLU C C     1 
ATOM   5256  O  O     . GLU C  2  216  ? 40.741  -44.435 45.687   1.00 91.17  ? 216  GLU C O     1 
ATOM   5257  C  CB    . GLU C  2  216  ? 38.206  -45.957 46.194   1.00 100.33 ? 216  GLU C CB    1 
ATOM   5258  C  CG    . GLU C  2  216  ? 37.304  -46.956 45.471   1.00 109.42 ? 216  GLU C CG    1 
ATOM   5259  C  CD    . GLU C  2  216  ? 37.792  -47.291 44.068   1.00 108.06 ? 216  GLU C CD    1 
ATOM   5260  O  OE1   . GLU C  2  216  ? 37.390  -46.593 43.113   1.00 104.60 ? 216  GLU C OE1   1 
ATOM   5261  O  OE2   . GLU C  2  216  ? 38.574  -48.254 43.918   1.00 104.49 ? 216  GLU C OE2   1 
ATOM   5262  N  N     . LEU C  2  217  ? 41.318  -45.243 47.706   1.00 94.11  ? 217  LEU C N     1 
ATOM   5263  C  CA    . LEU C  2  217  ? 42.285  -44.182 47.976   1.00 86.86  ? 217  LEU C CA    1 
ATOM   5264  C  C     . LEU C  2  217  ? 43.424  -44.205 46.965   1.00 86.79  ? 217  LEU C C     1 
ATOM   5265  O  O     . LEU C  2  217  ? 43.811  -43.169 46.426   1.00 86.96  ? 217  LEU C O     1 
ATOM   5266  C  CB    . LEU C  2  217  ? 42.855  -44.304 49.393   1.00 79.83  ? 217  LEU C CB    1 
ATOM   5267  C  CG    . LEU C  2  217  ? 42.187  -43.499 50.511   1.00 74.22  ? 217  LEU C CG    1 
ATOM   5268  C  CD1   . LEU C  2  217  ? 41.908  -42.077 50.046   1.00 66.89  ? 217  LEU C CD1   1 
ATOM   5269  C  CD2   . LEU C  2  217  ? 40.909  -44.168 50.986   1.00 81.11  ? 217  LEU C CD2   1 
ATOM   5270  N  N     . VAL C  2  218  ? 43.949  -45.398 46.709   1.00 88.46  ? 218  VAL C N     1 
ATOM   5271  C  CA    . VAL C  2  218  ? 45.086  -45.567 45.811   1.00 87.01  ? 218  VAL C CA    1 
ATOM   5272  C  C     . VAL C  2  218  ? 44.717  -45.218 44.366   1.00 86.78  ? 218  VAL C C     1 
ATOM   5273  O  O     . VAL C  2  218  ? 45.575  -44.833 43.570   1.00 83.67  ? 218  VAL C O     1 
ATOM   5274  C  CB    . VAL C  2  218  ? 45.654  -47.007 45.902   1.00 85.17  ? 218  VAL C CB    1 
ATOM   5275  C  CG1   . VAL C  2  218  ? 44.612  -48.029 45.460   1.00 89.02  ? 218  VAL C CG1   1 
ATOM   5276  C  CG2   . VAL C  2  218  ? 46.938  -47.143 45.093   1.00 84.37  ? 218  VAL C CG2   1 
ATOM   5277  N  N     . GLN C  2  219  ? 43.431  -45.329 44.041   1.00 89.67  ? 219  GLN C N     1 
ATOM   5278  C  CA    . GLN C  2  219  ? 42.952  -45.078 42.682   1.00 94.40  ? 219  GLN C CA    1 
ATOM   5279  C  C     . GLN C  2  219  ? 43.136  -43.629 42.230   1.00 93.73  ? 219  GLN C C     1 
ATOM   5280  O  O     . GLN C  2  219  ? 43.258  -43.355 41.035   1.00 93.68  ? 219  GLN C O     1 
ATOM   5281  C  CB    . GLN C  2  219  ? 41.487  -45.497 42.541   1.00 94.34  ? 219  GLN C CB    1 
ATOM   5282  C  CG    . GLN C  2  219  ? 41.280  -47.002 42.510   1.00 97.13  ? 219  GLN C CG    1 
ATOM   5283  C  CD    . GLN C  2  219  ? 41.949  -47.656 41.314   1.00 101.46 ? 219  GLN C CD    1 
ATOM   5284  O  OE1   . GLN C  2  219  ? 42.069  -47.054 40.247   1.00 97.11  ? 219  GLN C OE1   1 
ATOM   5285  N  NE2   . GLN C  2  219  ? 42.395  -48.895 41.490   1.00 103.64 ? 219  GLN C NE2   1 
ATOM   5286  N  N     . GLY C  2  220  ? 43.150  -42.705 43.185   1.00 86.84  ? 220  GLY C N     1 
ATOM   5287  C  CA    . GLY C  2  220  ? 43.385  -41.307 42.879   1.00 80.66  ? 220  GLY C CA    1 
ATOM   5288  C  C     . GLY C  2  220  ? 44.851  -41.058 42.585   1.00 87.36  ? 220  GLY C C     1 
ATOM   5289  O  O     . GLY C  2  220  ? 45.209  -40.104 41.893   1.00 86.80  ? 220  GLY C O     1 
ATOM   5290  N  N     . LEU C  2  221  ? 45.700  -41.928 43.123   1.00 92.18  ? 221  LEU C N     1 
ATOM   5291  C  CA    . LEU C  2  221  ? 47.139  -41.856 42.899   1.00 91.61  ? 221  LEU C CA    1 
ATOM   5292  C  C     . LEU C  2  221  ? 47.492  -42.516 41.567   1.00 89.72  ? 221  LEU C C     1 
ATOM   5293  O  O     . LEU C  2  221  ? 48.630  -42.445 41.103   1.00 85.32  ? 221  LEU C O     1 
ATOM   5294  C  CB    . LEU C  2  221  ? 47.883  -42.530 44.059   1.00 84.50  ? 221  LEU C CB    1 
ATOM   5295  C  CG    . LEU C  2  221  ? 49.412  -42.626 44.044   1.00 82.04  ? 221  LEU C CG    1 
ATOM   5296  C  CD1   . LEU C  2  221  ? 50.061  -41.257 43.946   1.00 74.31  ? 221  LEU C CD1   1 
ATOM   5297  C  CD2   . LEU C  2  221  ? 49.905  -43.362 45.272   1.00 77.67  ? 221  LEU C CD2   1 
ATOM   5298  N  N     . MET C  2  222  ? 46.498  -43.133 40.936   1.00 91.27  ? 222  MET C N     1 
ATOM   5299  C  CA    . MET C  2  222  ? 46.726  -43.840 39.683   1.00 93.09  ? 222  MET C CA    1 
ATOM   5300  C  C     . MET C  2  222  ? 46.500  -42.924 38.489   1.00 95.97  ? 222  MET C C     1 
ATOM   5301  O  O     . MET C  2  222  ? 45.372  -42.523 38.200   1.00 99.67  ? 222  MET C O     1 
ATOM   5302  C  CB    . MET C  2  222  ? 45.797  -45.051 39.578   1.00 93.23  ? 222  MET C CB    1 
ATOM   5303  C  CG    . MET C  2  222  ? 46.065  -46.145 40.596   1.00 94.21  ? 222  MET C CG    1 
ATOM   5304  S  SD    . MET C  2  222  ? 47.667  -46.937 40.359   1.00 105.93 ? 222  MET C SD    1 
ATOM   5305  C  CE    . MET C  2  222  ? 47.584  -48.237 41.588   1.00 92.76  ? 222  MET C CE    1 
ATOM   5306  N  N     . ASP C  2  223  ? 47.585  -42.597 37.796   1.00 93.02  ? 223  ASP C N     1 
ATOM   5307  C  CA    . ASP C  2  223  ? 47.499  -41.852 36.550   1.00 92.20  ? 223  ASP C CA    1 
ATOM   5308  C  C     . ASP C  2  223  ? 48.306  -42.590 35.491   1.00 95.57  ? 223  ASP C C     1 
ATOM   5309  O  O     . ASP C  2  223  ? 49.532  -42.659 35.570   1.00 89.97  ? 223  ASP C O     1 
ATOM   5310  C  CB    . ASP C  2  223  ? 48.029  -40.430 36.735   1.00 88.77  ? 223  ASP C CB    1 
ATOM   5311  C  CG    . ASP C  2  223  ? 47.626  -39.506 35.602   1.00 93.74  ? 223  ASP C CG    1 
ATOM   5312  O  OD1   . ASP C  2  223  ? 48.332  -39.485 34.573   1.00 97.04  ? 223  ASP C OD1   1 
ATOM   5313  O  OD2   . ASP C  2  223  ? 46.604  -38.801 35.741   1.00 96.06  ? 223  ASP C OD2   1 
ATOM   5314  N  N     . GLU C  2  224  ? 47.610  -43.126 34.495   1.00 98.17  ? 224  GLU C N     1 
ATOM   5315  C  CA    . GLU C  2  224  ? 48.229  -43.983 33.489   1.00 94.37  ? 224  GLU C CA    1 
ATOM   5316  C  C     . GLU C  2  224  ? 49.233  -43.240 32.612   1.00 93.45  ? 224  GLU C C     1 
ATOM   5317  O  O     . GLU C  2  224  ? 50.214  -43.823 32.151   1.00 94.04  ? 224  GLU C O     1 
ATOM   5318  C  CB    . GLU C  2  224  ? 47.161  -44.661 32.622   1.00 97.90  ? 224  GLU C CB    1 
ATOM   5319  C  CG    . GLU C  2  224  ? 46.210  -43.703 31.910   1.00 105.54 ? 224  GLU C CG    1 
ATOM   5320  C  CD    . GLU C  2  224  ? 45.144  -43.133 32.830   1.00 107.17 ? 224  GLU C CD    1 
ATOM   5321  O  OE1   . GLU C  2  224  ? 44.920  -43.715 33.914   1.00 104.20 ? 224  GLU C OE1   1 
ATOM   5322  O  OE2   . GLU C  2  224  ? 44.538  -42.101 32.474   1.00 99.76  ? 224  GLU C OE2   1 
ATOM   5323  N  N     . SER C  2  225  ? 48.986  -41.953 32.388   1.00 92.80  ? 225  SER C N     1 
ATOM   5324  C  CA    . SER C  2  225  ? 49.863  -41.140 31.553   1.00 93.26  ? 225  SER C CA    1 
ATOM   5325  C  C     . SER C  2  225  ? 51.203  -40.877 32.237   1.00 93.44  ? 225  SER C C     1 
ATOM   5326  O  O     . SER C  2  225  ? 52.230  -40.733 31.574   1.00 93.11  ? 225  SER C O     1 
ATOM   5327  C  CB    . SER C  2  225  ? 49.183  -39.819 31.184   1.00 92.34  ? 225  SER C CB    1 
ATOM   5328  O  OG    . SER C  2  225  ? 48.776  -39.112 32.342   1.00 93.66  ? 225  SER C OG    1 
ATOM   5329  N  N     . VAL C  2  226  ? 51.186  -40.816 33.565   1.00 93.11  ? 226  VAL C N     1 
ATOM   5330  C  CA    . VAL C  2  226  ? 52.403  -40.588 34.336   1.00 89.76  ? 226  VAL C CA    1 
ATOM   5331  C  C     . VAL C  2  226  ? 53.314  -41.814 34.303   1.00 89.57  ? 226  VAL C C     1 
ATOM   5332  O  O     . VAL C  2  226  ? 54.529  -41.692 34.146   1.00 89.90  ? 226  VAL C O     1 
ATOM   5333  C  CB    . VAL C  2  226  ? 52.087  -40.211 35.798   1.00 88.21  ? 226  VAL C CB    1 
ATOM   5334  C  CG1   . VAL C  2  226  ? 53.368  -40.073 36.605   1.00 80.20  ? 226  VAL C CG1   1 
ATOM   5335  C  CG2   . VAL C  2  226  ? 51.284  -38.922 35.847   1.00 89.30  ? 226  VAL C CG2   1 
ATOM   5336  N  N     . PHE C  2  227  ? 52.720  -42.995 34.441   1.00 86.29  ? 227  PHE C N     1 
ATOM   5337  C  CA    . PHE C  2  227  ? 53.480  -44.239 34.388   1.00 83.72  ? 227  PHE C CA    1 
ATOM   5338  C  C     . PHE C  2  227  ? 53.952  -44.545 32.971   1.00 88.22  ? 227  PHE C C     1 
ATOM   5339  O  O     . PHE C  2  227  ? 54.816  -45.398 32.765   1.00 86.57  ? 227  PHE C O     1 
ATOM   5340  C  CB    . PHE C  2  227  ? 52.651  -45.405 34.926   1.00 84.14  ? 227  PHE C CB    1 
ATOM   5341  C  CG    . PHE C  2  227  ? 52.245  -45.247 36.361   1.00 87.25  ? 227  PHE C CG    1 
ATOM   5342  C  CD1   . PHE C  2  227  ? 53.193  -45.282 37.370   1.00 87.19  ? 227  PHE C CD1   1 
ATOM   5343  C  CD2   . PHE C  2  227  ? 50.915  -45.075 36.703   1.00 87.27  ? 227  PHE C CD2   1 
ATOM   5344  C  CE1   . PHE C  2  227  ? 52.822  -45.138 38.693   1.00 88.79  ? 227  PHE C CE1   1 
ATOM   5345  C  CE2   . PHE C  2  227  ? 50.536  -44.929 38.023   1.00 87.97  ? 227  PHE C CE2   1 
ATOM   5346  C  CZ    . PHE C  2  227  ? 51.491  -44.962 39.020   1.00 91.53  ? 227  PHE C CZ    1 
ATOM   5347  N  N     . ALA C  2  228  ? 53.379  -43.845 31.997   1.00 90.32  ? 228  ALA C N     1 
ATOM   5348  C  CA    . ALA C  2  228  ? 53.733  -44.041 30.595   1.00 89.02  ? 228  ALA C CA    1 
ATOM   5349  C  C     . ALA C  2  228  ? 55.090  -43.426 30.268   1.00 88.44  ? 228  ALA C C     1 
ATOM   5350  O  O     . ALA C  2  228  ? 55.684  -43.725 29.232   1.00 86.38  ? 228  ALA C O     1 
ATOM   5351  C  CB    . ALA C  2  228  ? 52.654  -43.461 29.691   1.00 85.26  ? 228  ALA C CB    1 
ATOM   5352  N  N     . MET C  2  229  ? 55.578  -42.565 31.155   1.00 90.39  ? 229  MET C N     1 
ATOM   5353  C  CA    . MET C  2  229  ? 56.865  -41.912 30.954   1.00 91.01  ? 229  MET C CA    1 
ATOM   5354  C  C     . MET C  2  229  ? 57.857  -42.256 32.061   1.00 85.25  ? 229  MET C C     1 
ATOM   5355  O  O     . MET C  2  229  ? 57.494  -42.332 33.235   1.00 83.07  ? 229  MET C O     1 
ATOM   5356  C  CB    . MET C  2  229  ? 56.690  -40.393 30.844   1.00 95.44  ? 229  MET C CB    1 
ATOM   5357  C  CG    . MET C  2  229  ? 55.889  -39.764 31.977   1.00 95.62  ? 229  MET C CG    1 
ATOM   5358  S  SD    . MET C  2  229  ? 55.648  -37.986 31.769   1.00 102.65 ? 229  MET C SD    1 
ATOM   5359  C  CE    . MET C  2  229  ? 54.553  -37.627 33.141   1.00 85.51  ? 229  MET C CE    1 
ATOM   5360  N  N     . ARG C  2  230  ? 59.111  -42.472 31.674   1.00 87.62  ? 230  ARG C N     1 
ATOM   5361  C  CA    . ARG C  2  230  ? 60.178  -42.752 32.628   1.00 91.15  ? 230  ARG C CA    1 
ATOM   5362  C  C     . ARG C  2  230  ? 60.448  -41.528 33.507   1.00 88.01  ? 230  ARG C C     1 
ATOM   5363  O  O     . ARG C  2  230  ? 60.065  -40.415 33.145   1.00 83.31  ? 230  ARG C O     1 
ATOM   5364  C  CB    . ARG C  2  230  ? 61.448  -43.207 31.895   1.00 93.94  ? 230  ARG C CB    1 
ATOM   5365  C  CG    . ARG C  2  230  ? 61.549  -42.771 30.447   1.00 93.81  ? 230  ARG C CG    1 
ATOM   5366  C  CD    . ARG C  2  230  ? 62.815  -43.328 29.813   1.00 88.58  ? 230  ARG C CD    1 
ATOM   5367  N  NE    . ARG C  2  230  ? 62.730  -43.360 28.357   1.00 91.82  ? 230  ARG C NE    1 
ATOM   5368  C  CZ    . ARG C  2  230  ? 63.054  -42.342 27.567   1.00 100.57 ? 230  ARG C CZ    1 
ATOM   5369  N  NH1   . ARG C  2  230  ? 62.945  -42.461 26.251   1.00 101.66 ? 230  ARG C NH1   1 
ATOM   5370  N  NH2   . ARG C  2  230  ? 63.485  -41.203 28.094   1.00 103.20 ? 230  ARG C NH2   1 
ATOM   5371  N  N     . PRO C  2  231  ? 61.101  -41.732 34.668   1.00 88.73  ? 231  PRO C N     1 
ATOM   5372  C  CA    . PRO C  2  231  ? 61.361  -40.657 35.636   1.00 86.92  ? 231  PRO C CA    1 
ATOM   5373  C  C     . PRO C  2  231  ? 61.972  -39.373 35.063   1.00 89.60  ? 231  PRO C C     1 
ATOM   5374  O  O     . PRO C  2  231  ? 61.786  -38.319 35.666   1.00 89.64  ? 231  PRO C O     1 
ATOM   5375  C  CB    . PRO C  2  231  ? 62.336  -41.312 36.613   1.00 85.82  ? 231  PRO C CB    1 
ATOM   5376  C  CG    . PRO C  2  231  ? 61.913  -42.732 36.631   1.00 82.07  ? 231  PRO C CG    1 
ATOM   5377  C  CD    . PRO C  2  231  ? 61.464  -43.050 35.226   1.00 85.60  ? 231  PRO C CD    1 
ATOM   5378  N  N     . GLU C  2  232  ? 62.690  -39.454 33.946   1.00 91.46  ? 232  GLU C N     1 
ATOM   5379  C  CA    . GLU C  2  232  ? 63.298  -38.264 33.345   1.00 91.29  ? 232  GLU C CA    1 
ATOM   5380  C  C     . GLU C  2  232  ? 62.258  -37.286 32.793   1.00 83.73  ? 232  GLU C C     1 
ATOM   5381  O  O     . GLU C  2  232  ? 62.305  -36.083 33.076   1.00 81.09  ? 232  GLU C O     1 
ATOM   5382  C  CB    . GLU C  2  232  ? 64.297  -38.654 32.250   1.00 94.69  ? 232  GLU C CB    1 
ATOM   5383  C  CG    . GLU C  2  232  ? 65.678  -39.034 32.769   1.00 98.95  ? 232  GLU C CG    1 
ATOM   5384  C  CD    . GLU C  2  232  ? 65.657  -40.260 33.664   1.00 106.96 ? 232  GLU C CD    1 
ATOM   5385  O  OE1   . GLU C  2  232  ? 64.839  -41.170 33.411   1.00 103.38 ? 232  GLU C OE1   1 
ATOM   5386  O  OE2   . GLU C  2  232  ? 66.456  -40.309 34.623   1.00 103.28 ? 232  GLU C OE2   1 
ATOM   5387  N  N     . GLU C  2  233  ? 61.324  -37.807 32.003   1.00 84.99  ? 233  GLU C N     1 
ATOM   5388  C  CA    . GLU C  2  233  ? 60.249  -36.993 31.448   1.00 85.23  ? 233  GLU C CA    1 
ATOM   5389  C  C     . GLU C  2  233  ? 59.380  -36.429 32.567   1.00 84.15  ? 233  GLU C C     1 
ATOM   5390  O  O     . GLU C  2  233  ? 58.877  -35.310 32.471   1.00 79.26  ? 233  GLU C O     1 
ATOM   5391  C  CB    . GLU C  2  233  ? 59.394  -37.816 30.482   1.00 92.00  ? 233  GLU C CB    1 
ATOM   5392  C  CG    . GLU C  2  233  ? 60.179  -38.478 29.360   1.00 92.34  ? 233  GLU C CG    1 
ATOM   5393  C  CD    . GLU C  2  233  ? 59.294  -39.266 28.411   1.00 92.26  ? 233  GLU C CD    1 
ATOM   5394  O  OE1   . GLU C  2  233  ? 58.089  -38.950 28.314   1.00 89.91  ? 233  GLU C OE1   1 
ATOM   5395  O  OE2   . GLU C  2  233  ? 59.803  -40.205 27.765   1.00 92.78  ? 233  GLU C OE2   1 
ATOM   5396  N  N     . ALA C  2  234  ? 59.215  -37.212 33.629   1.00 85.79  ? 234  ALA C N     1 
ATOM   5397  C  CA    . ALA C  2  234  ? 58.452  -36.788 34.796   1.00 77.66  ? 234  ALA C CA    1 
ATOM   5398  C  C     . ALA C  2  234  ? 59.178  -35.667 35.532   1.00 72.72  ? 234  ALA C C     1 
ATOM   5399  O  O     . ALA C  2  234  ? 58.552  -34.760 36.082   1.00 71.28  ? 234  ALA C O     1 
ATOM   5400  C  CB    . ALA C  2  234  ? 58.217  -37.968 35.726   1.00 75.84  ? 234  ALA C CB    1 
ATOM   5401  N  N     . LEU C  2  235  ? 60.505  -35.742 35.530   1.00 77.05  ? 235  LEU C N     1 
ATOM   5402  C  CA    . LEU C  2  235  ? 61.350  -34.746 36.178   1.00 77.34  ? 235  LEU C CA    1 
ATOM   5403  C  C     . LEU C  2  235  ? 61.293  -33.419 35.432   1.00 78.43  ? 235  LEU C C     1 
ATOM   5404  O  O     . LEU C  2  235  ? 61.148  -32.360 36.046   1.00 77.29  ? 235  LEU C O     1 
ATOM   5405  C  CB    . LEU C  2  235  ? 62.796  -35.242 36.249   1.00 78.34  ? 235  LEU C CB    1 
ATOM   5406  C  CG    . LEU C  2  235  ? 63.828  -34.303 36.877   1.00 69.35  ? 235  LEU C CG    1 
ATOM   5407  C  CD1   . LEU C  2  235  ? 63.592  -34.177 38.370   1.00 72.51  ? 235  LEU C CD1   1 
ATOM   5408  C  CD2   . LEU C  2  235  ? 65.241  -34.786 36.594   1.00 64.55  ? 235  LEU C CD2   1 
ATOM   5409  N  N     . ILE C  2  236  ? 61.414  -33.479 34.108   1.00 78.78  ? 236  ILE C N     1 
ATOM   5410  C  CA    . ILE C  2  236  ? 61.331  -32.273 33.286   1.00 75.36  ? 236  ILE C CA    1 
ATOM   5411  C  C     . ILE C  2  236  ? 59.924  -31.671 33.337   1.00 76.54  ? 236  ILE C C     1 
ATOM   5412  O  O     . ILE C  2  236  ? 59.764  -30.449 33.405   1.00 76.23  ? 236  ILE C O     1 
ATOM   5413  C  CB    . ILE C  2  236  ? 61.767  -32.542 31.827   1.00 68.85  ? 236  ILE C CB    1 
ATOM   5414  C  CG1   . ILE C  2  236  ? 63.268  -32.836 31.775   1.00 66.92  ? 236  ILE C CG1   1 
ATOM   5415  C  CG2   . ILE C  2  236  ? 61.442  -31.358 30.933   1.00 61.84  ? 236  ILE C CG2   1 
ATOM   5416  C  CD1   . ILE C  2  236  ? 63.823  -32.957 30.374   1.00 65.54  ? 236  ILE C CD1   1 
ATOM   5417  N  N     . ARG C  2  237  ? 58.913  -32.536 33.326   1.00 75.41  ? 237  ARG C N     1 
ATOM   5418  C  CA    . ARG C  2  237  ? 57.522  -32.108 33.457   1.00 73.08  ? 237  ARG C CA    1 
ATOM   5419  C  C     . ARG C  2  237  ? 57.299  -31.371 34.775   1.00 72.37  ? 237  ARG C C     1 
ATOM   5420  O  O     . ARG C  2  237  ? 56.717  -30.281 34.802   1.00 75.42  ? 237  ARG C O     1 
ATOM   5421  C  CB    . ARG C  2  237  ? 56.583  -33.314 33.363   1.00 75.64  ? 237  ARG C CB    1 
ATOM   5422  C  CG    . ARG C  2  237  ? 55.125  -33.009 33.668   1.00 76.80  ? 237  ARG C CG    1 
ATOM   5423  C  CD    . ARG C  2  237  ? 54.544  -31.994 32.696   1.00 75.64  ? 237  ARG C CD    1 
ATOM   5424  N  NE    . ARG C  2  237  ? 53.124  -31.759 32.943   1.00 80.51  ? 237  ARG C NE    1 
ATOM   5425  C  CZ    . ARG C  2  237  ? 52.391  -30.856 32.300   1.00 78.68  ? 237  ARG C CZ    1 
ATOM   5426  N  NH1   . ARG C  2  237  ? 51.104  -30.714 32.592   1.00 71.30  ? 237  ARG C NH1   1 
ATOM   5427  N  NH2   . ARG C  2  237  ? 52.943  -30.094 31.366   1.00 76.94  ? 237  ARG C NH2   1 
ATOM   5428  N  N     . LEU C  2  238  ? 57.769  -31.971 35.865   1.00 68.59  ? 238  LEU C N     1 
ATOM   5429  C  CA    . LEU C  2  238  ? 57.668  -31.356 37.182   1.00 66.03  ? 238  LEU C CA    1 
ATOM   5430  C  C     . LEU C  2  238  ? 58.418  -30.031 37.227   1.00 70.08  ? 238  LEU C C     1 
ATOM   5431  O  O     . LEU C  2  238  ? 57.966  -29.073 37.854   1.00 70.59  ? 238  LEU C O     1 
ATOM   5432  C  CB    . LEU C  2  238  ? 58.207  -32.298 38.258   1.00 64.26  ? 238  LEU C CB    1 
ATOM   5433  C  CG    . LEU C  2  238  ? 58.166  -31.744 39.682   1.00 67.19  ? 238  LEU C CG    1 
ATOM   5434  C  CD1   . LEU C  2  238  ? 56.743  -31.363 40.066   1.00 64.20  ? 238  LEU C CD1   1 
ATOM   5435  C  CD2   . LEU C  2  238  ? 58.746  -32.745 40.667   1.00 69.83  ? 238  LEU C CD2   1 
ATOM   5436  N  N     . PHE C  2  239  ? 59.564  -29.984 36.555   1.00 71.28  ? 239  PHE C N     1 
ATOM   5437  C  CA    . PHE C  2  239  ? 60.367  -28.768 36.496   1.00 69.44  ? 239  PHE C CA    1 
ATOM   5438  C  C     . PHE C  2  239  ? 59.619  -27.643 35.787   1.00 72.41  ? 239  PHE C C     1 
ATOM   5439  O  O     . PHE C  2  239  ? 59.669  -26.490 36.215   1.00 72.12  ? 239  PHE C O     1 
ATOM   5440  C  CB    . PHE C  2  239  ? 61.704  -29.035 35.806   1.00 66.27  ? 239  PHE C CB    1 
ATOM   5441  C  CG    . PHE C  2  239  ? 62.611  -27.839 35.761   1.00 69.36  ? 239  PHE C CG    1 
ATOM   5442  C  CD1   . PHE C  2  239  ? 62.779  -27.123 34.586   1.00 71.73  ? 239  PHE C CD1   1 
ATOM   5443  C  CD2   . PHE C  2  239  ? 63.289  -27.425 36.895   1.00 67.56  ? 239  PHE C CD2   1 
ATOM   5444  C  CE1   . PHE C  2  239  ? 63.611  -26.021 34.543   1.00 70.86  ? 239  PHE C CE1   1 
ATOM   5445  C  CE2   . PHE C  2  239  ? 64.123  -26.325 36.859   1.00 69.07  ? 239  PHE C CE2   1 
ATOM   5446  C  CZ    . PHE C  2  239  ? 64.285  -25.622 35.681   1.00 70.66  ? 239  PHE C CZ    1 
ATOM   5447  N  N     . THR C  2  240  ? 58.925  -27.981 34.703   1.00 75.62  ? 240  THR C N     1 
ATOM   5448  C  CA    . THR C  2  240  ? 58.124  -26.995 33.983   1.00 73.36  ? 240  THR C CA    1 
ATOM   5449  C  C     . THR C  2  240  ? 56.904  -26.580 34.799   1.00 71.04  ? 240  THR C C     1 
ATOM   5450  O  O     . THR C  2  240  ? 56.413  -25.459 34.666   1.00 72.73  ? 240  THR C O     1 
ATOM   5451  C  CB    . THR C  2  240  ? 57.667  -27.512 32.603   1.00 73.51  ? 240  THR C CB    1 
ATOM   5452  O  OG1   . THR C  2  240  ? 56.896  -28.710 32.766   1.00 76.87  ? 240  THR C OG1   1 
ATOM   5453  C  CG2   . THR C  2  240  ? 58.867  -27.797 31.715   1.00 72.30  ? 240  THR C CG2   1 
ATOM   5454  N  N     . LEU C  2  241  ? 56.417  -27.486 35.643   1.00 70.13  ? 241  LEU C N     1 
ATOM   5455  C  CA    . LEU C  2  241  ? 55.307  -27.161 36.534   1.00 70.17  ? 241  LEU C CA    1 
ATOM   5456  C  C     . LEU C  2  241  ? 55.726  -26.152 37.600   1.00 72.03  ? 241  LEU C C     1 
ATOM   5457  O  O     . LEU C  2  241  ? 55.059  -25.137 37.804   1.00 68.23  ? 241  LEU C O     1 
ATOM   5458  C  CB    . LEU C  2  241  ? 54.750  -28.422 37.199   1.00 65.61  ? 241  LEU C CB    1 
ATOM   5459  C  CG    . LEU C  2  241  ? 53.949  -29.375 36.310   1.00 67.35  ? 241  LEU C CG    1 
ATOM   5460  C  CD1   . LEU C  2  241  ? 53.303  -30.467 37.148   1.00 64.79  ? 241  LEU C CD1   1 
ATOM   5461  C  CD2   . LEU C  2  241  ? 52.903  -28.614 35.512   1.00 69.30  ? 241  LEU C CD2   1 
ATOM   5462  N  N     . LEU C  2  242  ? 56.835  -26.438 38.275   1.00 73.72  ? 242  LEU C N     1 
ATOM   5463  C  CA    . LEU C  2  242  ? 57.307  -25.596 39.370   1.00 73.18  ? 242  LEU C CA    1 
ATOM   5464  C  C     . LEU C  2  242  ? 58.019  -24.336 38.881   1.00 71.29  ? 242  LEU C C     1 
ATOM   5465  O  O     . LEU C  2  242  ? 58.047  -23.324 39.579   1.00 73.99  ? 242  LEU C O     1 
ATOM   5466  C  CB    . LEU C  2  242  ? 58.234  -26.389 40.296   1.00 70.98  ? 242  LEU C CB    1 
ATOM   5467  C  CG    . LEU C  2  242  ? 57.692  -27.700 40.871   1.00 69.02  ? 242  LEU C CG    1 
ATOM   5468  C  CD1   . LEU C  2  242  ? 58.718  -28.347 41.791   1.00 62.62  ? 242  LEU C CD1   1 
ATOM   5469  C  CD2   . LEU C  2  242  ? 56.380  -27.470 41.604   1.00 68.12  ? 242  LEU C CD2   1 
ATOM   5470  N  N     . ARG C  2  243  ? 58.598  -24.402 37.686   1.00 71.87  ? 243  ARG C N     1 
ATOM   5471  C  CA    . ARG C  2  243  ? 59.376  -23.285 37.156   1.00 75.09  ? 243  ARG C CA    1 
ATOM   5472  C  C     . ARG C  2  243  ? 59.002  -22.943 35.714   1.00 76.34  ? 243  ARG C C     1 
ATOM   5473  O  O     . ARG C  2  243  ? 59.727  -23.297 34.783   1.00 75.03  ? 243  ARG C O     1 
ATOM   5474  C  CB    . ARG C  2  243  ? 60.873  -23.598 37.240   1.00 75.40  ? 243  ARG C CB    1 
ATOM   5475  C  CG    . ARG C  2  243  ? 61.386  -23.844 38.651   1.00 72.64  ? 243  ARG C CG    1 
ATOM   5476  C  CD    . ARG C  2  243  ? 61.870  -22.559 39.297   1.00 70.96  ? 243  ARG C CD    1 
ATOM   5477  N  NE    . ARG C  2  243  ? 63.010  -21.997 38.579   1.00 73.97  ? 243  ARG C NE    1 
ATOM   5478  C  CZ    . ARG C  2  243  ? 63.719  -20.955 39.000   1.00 72.96  ? 243  ARG C CZ    1 
ATOM   5479  N  NH1   . ARG C  2  243  ? 64.741  -20.510 38.280   1.00 64.82  ? 243  ARG C NH1   1 
ATOM   5480  N  NH2   . ARG C  2  243  ? 63.407  -20.357 40.141   1.00 74.27  ? 243  ARG C NH2   1 
ATOM   5481  N  N     . PRO C  2  244  ? 57.868  -22.250 35.525   1.00 78.99  ? 244  PRO C N     1 
ATOM   5482  C  CA    . PRO C  2  244  ? 57.429  -21.845 34.184   1.00 77.83  ? 244  PRO C CA    1 
ATOM   5483  C  C     . PRO C  2  244  ? 58.348  -20.791 33.573   1.00 76.01  ? 244  PRO C C     1 
ATOM   5484  O  O     . PRO C  2  244  ? 58.820  -19.899 34.279   1.00 72.06  ? 244  PRO C O     1 
ATOM   5485  C  CB    . PRO C  2  244  ? 56.040  -21.243 34.436   1.00 78.86  ? 244  PRO C CB    1 
ATOM   5486  C  CG    . PRO C  2  244  ? 55.618  -21.771 35.772   1.00 76.55  ? 244  PRO C CG    1 
ATOM   5487  C  CD    . PRO C  2  244  ? 56.882  -21.892 36.557   1.00 75.18  ? 244  PRO C CD    1 
ATOM   5488  N  N     . GLY C  2  245  ? 58.603  -20.901 32.273   1.00 76.53  ? 245  GLY C N     1 
ATOM   5489  C  CA    . GLY C  2  245  ? 59.439  -19.942 31.574   1.00 81.52  ? 245  GLY C CA    1 
ATOM   5490  C  C     . GLY C  2  245  ? 60.906  -20.325 31.597   1.00 85.53  ? 245  GLY C C     1 
ATOM   5491  O  O     . GLY C  2  245  ? 61.689  -19.885 30.755   1.00 82.95  ? 245  GLY C O     1 
ATOM   5492  N  N     . ASP C  2  246  ? 61.275  -21.154 32.568   1.00 85.15  ? 246  ASP C N     1 
ATOM   5493  C  CA    . ASP C  2  246  ? 62.640  -21.643 32.696   1.00 82.15  ? 246  ASP C CA    1 
ATOM   5494  C  C     . ASP C  2  246  ? 62.876  -22.713 31.638   1.00 83.25  ? 246  ASP C C     1 
ATOM   5495  O  O     . ASP C  2  246  ? 62.085  -23.652 31.524   1.00 81.84  ? 246  ASP C O     1 
ATOM   5496  C  CB    . ASP C  2  246  ? 62.845  -22.226 34.099   1.00 83.03  ? 246  ASP C CB    1 
ATOM   5497  C  CG    . ASP C  2  246  ? 64.310  -22.431 34.451   1.00 84.37  ? 246  ASP C CG    1 
ATOM   5498  O  OD1   . ASP C  2  246  ? 65.080  -22.912 33.595   1.00 85.44  ? 246  ASP C OD1   1 
ATOM   5499  O  OD2   . ASP C  2  246  ? 64.691  -22.114 35.599   1.00 86.17  ? 246  ASP C OD2   1 
ATOM   5500  N  N     . PRO C  2  247  ? 63.954  -22.571 30.845   1.00 83.71  ? 247  PRO C N     1 
ATOM   5501  C  CA    . PRO C  2  247  ? 64.259  -23.611 29.856   1.00 86.78  ? 247  PRO C CA    1 
ATOM   5502  C  C     . PRO C  2  247  ? 64.520  -24.950 30.544   1.00 87.59  ? 247  PRO C C     1 
ATOM   5503  O  O     . PRO C  2  247  ? 65.352  -25.026 31.449   1.00 86.70  ? 247  PRO C O     1 
ATOM   5504  C  CB    . PRO C  2  247  ? 65.530  -23.088 29.172   1.00 76.88  ? 247  PRO C CB    1 
ATOM   5505  C  CG    . PRO C  2  247  ? 66.099  -22.073 30.117   1.00 69.77  ? 247  PRO C CG    1 
ATOM   5506  C  CD    . PRO C  2  247  ? 64.918  -21.458 30.798   1.00 74.14  ? 247  PRO C CD    1 
ATOM   5507  N  N     . PRO C  2  248  ? 63.811  -26.003 30.109   1.00 83.38  ? 248  PRO C N     1 
ATOM   5508  C  CA    . PRO C  2  248  ? 63.807  -27.296 30.801   1.00 80.82  ? 248  PRO C CA    1 
ATOM   5509  C  C     . PRO C  2  248  ? 64.994  -28.191 30.455   1.00 84.11  ? 248  PRO C C     1 
ATOM   5510  O  O     . PRO C  2  248  ? 64.790  -29.304 29.970   1.00 86.41  ? 248  PRO C O     1 
ATOM   5511  C  CB    . PRO C  2  248  ? 62.503  -27.950 30.315   1.00 80.63  ? 248  PRO C CB    1 
ATOM   5512  C  CG    . PRO C  2  248  ? 61.732  -26.857 29.615   1.00 82.27  ? 248  PRO C CG    1 
ATOM   5513  C  CD    . PRO C  2  248  ? 62.775  -25.945 29.069   1.00 84.17  ? 248  PRO C CD    1 
ATOM   5514  N  N     . LYS C  2  249  ? 66.210  -27.718 30.706   1.00 83.15  ? 249  LYS C N     1 
ATOM   5515  C  CA    . LYS C  2  249  ? 67.389  -28.560 30.548   1.00 82.76  ? 249  LYS C CA    1 
ATOM   5516  C  C     . LYS C  2  249  ? 67.395  -29.603 31.665   1.00 86.50  ? 249  LYS C C     1 
ATOM   5517  O  O     . LYS C  2  249  ? 66.938  -29.331 32.775   1.00 85.08  ? 249  LYS C O     1 
ATOM   5518  C  CB    . LYS C  2  249  ? 68.667  -27.720 30.579   1.00 80.13  ? 249  LYS C CB    1 
ATOM   5519  C  CG    . LYS C  2  249  ? 69.905  -28.453 30.084   1.00 83.96  ? 249  LYS C CG    1 
ATOM   5520  C  CD    . LYS C  2  249  ? 71.102  -27.519 29.997   1.00 85.42  ? 249  LYS C CD    1 
ATOM   5521  C  CE    . LYS C  2  249  ? 72.319  -28.226 29.420   1.00 81.05  ? 249  LYS C CE    1 
ATOM   5522  N  NZ    . LYS C  2  249  ? 72.063  -28.758 28.053   1.00 78.58  ? 249  LYS C NZ    1 
ATOM   5523  N  N     . ARG C  2  250  ? 67.906  -30.793 31.365   1.00 89.34  ? 250  ARG C N     1 
ATOM   5524  C  CA    . ARG C  2  250  ? 67.829  -31.923 32.290   1.00 88.62  ? 250  ARG C CA    1 
ATOM   5525  C  C     . ARG C  2  250  ? 68.576  -31.675 33.602   1.00 84.62  ? 250  ARG C C     1 
ATOM   5526  O  O     . ARG C  2  250  ? 68.005  -31.813 34.688   1.00 81.96  ? 250  ARG C O     1 
ATOM   5527  C  CB    . ARG C  2  250  ? 68.338  -33.199 31.611   1.00 85.91  ? 250  ARG C CB    1 
ATOM   5528  C  CG    . ARG C  2  250  ? 67.971  -34.489 32.330   1.00 84.17  ? 250  ARG C CG    1 
ATOM   5529  C  CD    . ARG C  2  250  ? 69.138  -35.033 33.137   1.00 86.08  ? 250  ARG C CD    1 
ATOM   5530  N  NE    . ARG C  2  250  ? 68.798  -36.281 33.813   1.00 85.80  ? 250  ARG C NE    1 
ATOM   5531  C  CZ    . ARG C  2  250  ? 69.657  -37.002 34.526   1.00 87.00  ? 250  ARG C CZ    1 
ATOM   5532  N  NH1   . ARG C  2  250  ? 70.915  -36.602 34.655   1.00 81.69  ? 250  ARG C NH1   1 
ATOM   5533  N  NH2   . ARG C  2  250  ? 69.259  -38.126 35.107   1.00 88.89  ? 250  ARG C NH2   1 
ATOM   5534  N  N     . ASP C  2  251  ? 69.849  -31.304 33.496   1.00 84.21  ? 251  ASP C N     1 
ATOM   5535  C  CA    . ASP C  2  251  ? 70.687  -31.075 34.671   1.00 86.76  ? 251  ASP C CA    1 
ATOM   5536  C  C     . ASP C  2  251  ? 70.191  -29.910 35.524   1.00 82.81  ? 251  ASP C C     1 
ATOM   5537  O  O     . ASP C  2  251  ? 70.461  -29.850 36.724   1.00 82.66  ? 251  ASP C O     1 
ATOM   5538  C  CB    . ASP C  2  251  ? 72.139  -30.839 34.252   1.00 87.88  ? 251  ASP C CB    1 
ATOM   5539  C  CG    . ASP C  2  251  ? 72.271  -29.747 33.213   1.00 88.68  ? 251  ASP C CG    1 
ATOM   5540  O  OD1   . ASP C  2  251  ? 72.162  -30.061 32.009   1.00 89.93  ? 251  ASP C OD1   1 
ATOM   5541  O  OD2   . ASP C  2  251  ? 72.479  -28.577 33.598   1.00 85.25  ? 251  ASP C OD2   1 
ATOM   5542  N  N     . LYS C  2  252  ? 69.469  -28.986 34.898   1.00 77.21  ? 252  LYS C N     1 
ATOM   5543  C  CA    . LYS C  2  252  ? 68.885  -27.858 35.610   1.00 73.19  ? 252  LYS C CA    1 
ATOM   5544  C  C     . LYS C  2  252  ? 67.764  -28.359 36.512   1.00 73.12  ? 252  LYS C C     1 
ATOM   5545  O  O     . LYS C  2  252  ? 67.648  -27.949 37.669   1.00 69.67  ? 252  LYS C O     1 
ATOM   5546  C  CB    . LYS C  2  252  ? 68.344  -26.833 34.613   1.00 70.80  ? 252  LYS C CB    1 
ATOM   5547  C  CG    . LYS C  2  252  ? 68.301  -25.406 35.131   1.00 63.68  ? 252  LYS C CG    1 
ATOM   5548  C  CD    . LYS C  2  252  ? 68.057  -24.433 33.988   1.00 66.38  ? 252  LYS C CD    1 
ATOM   5549  C  CE    . LYS C  2  252  ? 68.274  -22.993 34.419   1.00 68.60  ? 252  LYS C CE    1 
ATOM   5550  N  NZ    . LYS C  2  252  ? 68.175  -22.053 33.266   1.00 66.46  ? 252  LYS C NZ    1 
ATOM   5551  N  N     . ALA C  2  253  ? 66.947  -29.258 35.969   1.00 77.03  ? 253  ALA C N     1 
ATOM   5552  C  CA    . ALA C  2  253  ? 65.859  -29.876 36.719   1.00 75.67  ? 253  ALA C CA    1 
ATOM   5553  C  C     . ALA C  2  253  ? 66.409  -30.740 37.844   1.00 70.87  ? 253  ALA C C     1 
ATOM   5554  O  O     . ALA C  2  253  ? 65.890  -30.720 38.964   1.00 70.18  ? 253  ALA C O     1 
ATOM   5555  C  CB    . ALA C  2  253  ? 64.981  -30.705 35.795   1.00 74.25  ? 253  ALA C CB    1 
ATOM   5556  N  N     . VAL C  2  254  ? 67.456  -31.500 37.538   1.00 72.49  ? 254  VAL C N     1 
ATOM   5557  C  CA    . VAL C  2  254  ? 68.125  -32.315 38.544   1.00 72.50  ? 254  VAL C CA    1 
ATOM   5558  C  C     . VAL C  2  254  ? 68.624  -31.436 39.681   1.00 71.66  ? 254  VAL C C     1 
ATOM   5559  O  O     . VAL C  2  254  ? 68.403  -31.743 40.848   1.00 68.55  ? 254  VAL C O     1 
ATOM   5560  C  CB    . VAL C  2  254  ? 69.314  -33.099 37.955   1.00 72.46  ? 254  VAL C CB    1 
ATOM   5561  C  CG1   . VAL C  2  254  ? 70.070  -33.828 39.058   1.00 66.73  ? 254  VAL C CG1   1 
ATOM   5562  C  CG2   . VAL C  2  254  ? 68.833  -34.078 36.898   1.00 80.92  ? 254  VAL C CG2   1 
ATOM   5563  N  N     . ALA C  2  255  ? 69.281  -30.333 39.331   1.00 75.00  ? 255  ALA C N     1 
ATOM   5564  C  CA    . ALA C  2  255  ? 69.822  -29.406 40.320   1.00 69.09  ? 255  ALA C CA    1 
ATOM   5565  C  C     . ALA C  2  255  ? 68.724  -28.792 41.185   1.00 67.18  ? 255  ALA C C     1 
ATOM   5566  O  O     . ALA C  2  255  ? 68.874  -28.677 42.404   1.00 66.31  ? 255  ALA C O     1 
ATOM   5567  C  CB    . ALA C  2  255  ? 70.635  -28.314 39.637   1.00 62.54  ? 255  ALA C CB    1 
ATOM   5568  N  N     . TYR C  2  256  ? 67.622  -28.401 40.551   1.00 67.40  ? 256  TYR C N     1 
ATOM   5569  C  CA    . TYR C  2  256  ? 66.509  -27.787 41.270   1.00 64.53  ? 256  TYR C CA    1 
ATOM   5570  C  C     . TYR C  2  256  ? 65.840  -28.759 42.239   1.00 61.42  ? 256  TYR C C     1 
ATOM   5571  O  O     . TYR C  2  256  ? 65.666  -28.448 43.417   1.00 60.62  ? 256  TYR C O     1 
ATOM   5572  C  CB    . TYR C  2  256  ? 65.471  -27.221 40.298   1.00 63.56  ? 256  TYR C CB    1 
ATOM   5573  C  CG    . TYR C  2  256  ? 64.321  -26.517 40.987   1.00 63.63  ? 256  TYR C CG    1 
ATOM   5574  C  CD1   . TYR C  2  256  ? 64.430  -25.188 41.375   1.00 66.45  ? 256  TYR C CD1   1 
ATOM   5575  C  CD2   . TYR C  2  256  ? 63.130  -27.182 41.253   1.00 65.26  ? 256  TYR C CD2   1 
ATOM   5576  C  CE1   . TYR C  2  256  ? 63.385  -24.540 42.008   1.00 72.32  ? 256  TYR C CE1   1 
ATOM   5577  C  CE2   . TYR C  2  256  ? 62.079  -26.542 41.887   1.00 68.90  ? 256  TYR C CE2   1 
ATOM   5578  C  CZ    . TYR C  2  256  ? 62.212  -25.221 42.261   1.00 72.76  ? 256  TYR C CZ    1 
ATOM   5579  O  OH    . TYR C  2  256  ? 61.169  -24.578 42.890   1.00 70.87  ? 256  TYR C OH    1 
ATOM   5580  N  N     . VAL C  2  257  ? 65.460  -29.930 41.738   1.00 59.67  ? 257  VAL C N     1 
ATOM   5581  C  CA    . VAL C  2  257  ? 64.786  -30.924 42.568   1.00 57.47  ? 257  VAL C CA    1 
ATOM   5582  C  C     . VAL C  2  257  ? 65.709  -31.446 43.669   1.00 61.85  ? 257  VAL C C     1 
ATOM   5583  O  O     . VAL C  2  257  ? 65.262  -31.729 44.779   1.00 64.72  ? 257  VAL C O     1 
ATOM   5584  C  CB    . VAL C  2  257  ? 64.222  -32.084 41.719   1.00 56.53  ? 257  VAL C CB    1 
ATOM   5585  C  CG1   . VAL C  2  257  ? 63.684  -33.199 42.605   1.00 52.12  ? 257  VAL C CG1   1 
ATOM   5586  C  CG2   . VAL C  2  257  ? 63.130  -31.567 40.800   1.00 57.92  ? 257  VAL C CG2   1 
ATOM   5587  N  N     . TYR C  2  258  ? 66.999  -31.550 43.366   1.00 62.32  ? 258  TYR C N     1 
ATOM   5588  C  CA    . TYR C  2  258  ? 67.987  -31.964 44.361   1.00 61.89  ? 258  TYR C CA    1 
ATOM   5589  C  C     . TYR C  2  258  ? 68.128  -30.923 45.468   1.00 62.80  ? 258  TYR C C     1 
ATOM   5590  O  O     . TYR C  2  258  ? 68.116  -31.258 46.654   1.00 60.31  ? 258  TYR C O     1 
ATOM   5591  C  CB    . TYR C  2  258  ? 69.343  -32.225 43.698   1.00 61.60  ? 258  TYR C CB    1 
ATOM   5592  C  CG    . TYR C  2  258  ? 70.485  -32.451 44.663   1.00 61.79  ? 258  TYR C CG    1 
ATOM   5593  C  CD1   . TYR C  2  258  ? 71.499  -31.512 44.800   1.00 59.10  ? 258  TYR C CD1   1 
ATOM   5594  C  CD2   . TYR C  2  258  ? 70.554  -33.605 45.431   1.00 61.47  ? 258  TYR C CD2   1 
ATOM   5595  C  CE1   . TYR C  2  258  ? 72.549  -31.716 45.676   1.00 57.35  ? 258  TYR C CE1   1 
ATOM   5596  C  CE2   . TYR C  2  258  ? 71.597  -33.816 46.313   1.00 62.58  ? 258  TYR C CE2   1 
ATOM   5597  C  CZ    . TYR C  2  258  ? 72.592  -32.869 46.431   1.00 61.38  ? 258  TYR C CZ    1 
ATOM   5598  O  OH    . TYR C  2  258  ? 73.633  -33.075 47.307   1.00 66.47  ? 258  TYR C OH    1 
ATOM   5599  N  N     . GLY C  2  259  ? 68.255  -29.659 45.073   1.00 63.89  ? 259  GLY C N     1 
ATOM   5600  C  CA    . GLY C  2  259  ? 68.382  -28.570 46.027   1.00 63.63  ? 259  GLY C CA    1 
ATOM   5601  C  C     . GLY C  2  259  ? 67.148  -28.409 46.893   1.00 60.87  ? 259  GLY C C     1 
ATOM   5602  O  O     . GLY C  2  259  ? 67.236  -28.069 48.072   1.00 61.34  ? 259  GLY C O     1 
ATOM   5603  N  N     . LEU C  2  260  ? 65.985  -28.634 46.292   1.00 60.00  ? 260  LEU C N     1 
ATOM   5604  C  CA    . LEU C  2  260  ? 64.726  -28.528 47.013   1.00 58.99  ? 260  LEU C CA    1 
ATOM   5605  C  C     . LEU C  2  260  ? 64.473  -29.698 47.971   1.00 56.72  ? 260  LEU C C     1 
ATOM   5606  O  O     . LEU C  2  260  ? 64.304  -29.497 49.174   1.00 54.19  ? 260  LEU C O     1 
ATOM   5607  C  CB    . LEU C  2  260  ? 63.572  -28.414 46.010   1.00 60.01  ? 260  LEU C CB    1 
ATOM   5608  C  CG    . LEU C  2  260  ? 62.228  -27.899 46.510   1.00 57.62  ? 260  LEU C CG    1 
ATOM   5609  C  CD1   . LEU C  2  260  ? 62.359  -26.454 46.965   1.00 60.73  ? 260  LEU C CD1   1 
ATOM   5610  C  CD2   . LEU C  2  260  ? 61.151  -28.031 45.436   1.00 54.35  ? 260  LEU C CD2   1 
ATOM   5611  N  N     . ILE C  2  261  ? 64.459  -30.914 47.430   1.00 58.62  ? 261  ILE C N     1 
ATOM   5612  C  CA    . ILE C  2  261  ? 64.021  -32.095 48.182   1.00 58.55  ? 261  ILE C CA    1 
ATOM   5613  C  C     . ILE C  2  261  ? 65.105  -33.009 48.770   1.00 58.31  ? 261  ILE C C     1 
ATOM   5614  O  O     . ILE C  2  261  ? 64.798  -33.928 49.534   1.00 57.59  ? 261  ILE C O     1 
ATOM   5615  C  CB    . ILE C  2  261  ? 63.091  -32.971 47.303   1.00 59.38  ? 261  ILE C CB    1 
ATOM   5616  C  CG1   . ILE C  2  261  ? 61.973  -33.563 48.153   1.00 57.27  ? 261  ILE C CG1   1 
ATOM   5617  C  CG2   . ILE C  2  261  ? 63.881  -34.049 46.549   1.00 56.47  ? 261  ILE C CG2   1 
ATOM   5618  C  CD1   . ILE C  2  261  ? 61.129  -32.507 48.804   1.00 57.65  ? 261  ILE C CD1   1 
ATOM   5619  N  N     . ALA C  2  262  ? 66.365  -32.748 48.441   1.00 56.56  ? 262  ALA C N     1 
ATOM   5620  C  CA    . ALA C  2  262  ? 67.409  -33.754 48.643   1.00 59.99  ? 262  ALA C CA    1 
ATOM   5621  C  C     . ALA C  2  262  ? 68.646  -33.264 49.381   1.00 58.48  ? 262  ALA C C     1 
ATOM   5622  O  O     . ALA C  2  262  ? 69.016  -33.810 50.418   1.00 55.87  ? 262  ALA C O     1 
ATOM   5623  C  CB    . ALA C  2  262  ? 67.796  -34.394 47.316   1.00 65.51  ? 262  ALA C CB    1 
ATOM   5624  N  N     . ASP C  2  263  ? 69.307  -32.269 48.797   1.00 59.35  ? 263  ASP C N     1 
ATOM   5625  C  CA    . ASP C  2  263  ? 70.560  -31.734 49.315   1.00 57.61  ? 263  ASP C CA    1 
ATOM   5626  C  C     . ASP C  2  263  ? 70.433  -31.346 50.786   1.00 61.98  ? 263  ASP C C     1 
ATOM   5627  O  O     . ASP C  2  263  ? 69.613  -30.500 51.141   1.00 63.63  ? 263  ASP C O     1 
ATOM   5628  C  CB    . ASP C  2  263  ? 70.953  -30.509 48.486   1.00 54.98  ? 263  ASP C CB    1 
ATOM   5629  C  CG    . ASP C  2  263  ? 72.275  -29.906 48.913   1.00 59.75  ? 263  ASP C CG    1 
ATOM   5630  O  OD1   . ASP C  2  263  ? 73.117  -30.635 49.473   1.00 63.84  ? 263  ASP C OD1   1 
ATOM   5631  O  OD2   . ASP C  2  263  ? 72.475  -28.696 48.676   1.00 60.78  ? 263  ASP C OD2   1 
ATOM   5632  N  N     . PRO C  2  264  ? 71.248  -31.977 51.649   1.00 64.21  ? 264  PRO C N     1 
ATOM   5633  C  CA    . PRO C  2  264  ? 71.236  -31.725 53.096   1.00 61.25  ? 264  PRO C CA    1 
ATOM   5634  C  C     . PRO C  2  264  ? 71.762  -30.340 53.450   1.00 58.85  ? 264  PRO C C     1 
ATOM   5635  O  O     . PRO C  2  264  ? 71.506  -29.837 54.544   1.00 60.61  ? 264  PRO C O     1 
ATOM   5636  C  CB    . PRO C  2  264  ? 72.167  -32.812 53.648   1.00 60.04  ? 264  PRO C CB    1 
ATOM   5637  C  CG    . PRO C  2  264  ? 73.047  -33.178 52.501   1.00 61.70  ? 264  PRO C CG    1 
ATOM   5638  C  CD    . PRO C  2  264  ? 72.184  -33.055 51.284   1.00 62.28  ? 264  PRO C CD    1 
ATOM   5639  N  N     . ARG C  2  265  ? 72.488  -29.734 52.518   1.00 56.12  ? 265  ARG C N     1 
ATOM   5640  C  CA    . ARG C  2  265  ? 73.058  -28.410 52.720   1.00 57.44  ? 265  ARG C CA    1 
ATOM   5641  C  C     . ARG C  2  265  ? 71.988  -27.340 52.546   1.00 62.04  ? 265  ARG C C     1 
ATOM   5642  O  O     . ARG C  2  265  ? 72.154  -26.200 52.984   1.00 60.47  ? 265  ARG C O     1 
ATOM   5643  C  CB    . ARG C  2  265  ? 74.204  -28.187 51.733   1.00 61.05  ? 265  ARG C CB    1 
ATOM   5644  C  CG    . ARG C  2  265  ? 75.158  -29.371 51.647   1.00 65.58  ? 265  ARG C CG    1 
ATOM   5645  C  CD    . ARG C  2  265  ? 76.011  -29.320 50.390   1.00 63.81  ? 265  ARG C CD    1 
ATOM   5646  N  NE    . ARG C  2  265  ? 77.002  -28.250 50.439   1.00 68.14  ? 265  ARG C NE    1 
ATOM   5647  C  CZ    . ARG C  2  265  ? 78.226  -28.389 50.938   1.00 64.42  ? 265  ARG C CZ    1 
ATOM   5648  N  NH1   . ARG C  2  265  ? 78.614  -29.557 51.435   1.00 56.57  ? 265  ARG C NH1   1 
ATOM   5649  N  NH2   . ARG C  2  265  ? 79.062  -27.359 50.941   1.00 61.72  ? 265  ARG C NH2   1 
ATOM   5650  N  N     . ARG C  2  266  ? 70.887  -27.720 51.903   1.00 62.96  ? 266  ARG C N     1 
ATOM   5651  C  CA    . ARG C  2  266  ? 69.756  -26.821 51.700   1.00 59.56  ? 266  ARG C CA    1 
ATOM   5652  C  C     . ARG C  2  266  ? 68.553  -27.261 52.532   1.00 55.27  ? 266  ARG C C     1 
ATOM   5653  O  O     . ARG C  2  266  ? 68.107  -26.528 53.413   1.00 56.91  ? 266  ARG C O     1 
ATOM   5654  C  CB    . ARG C  2  266  ? 69.395  -26.713 50.215   1.00 61.31  ? 266  ARG C CB    1 
ATOM   5655  C  CG    . ARG C  2  266  ? 70.525  -26.163 49.349   1.00 65.96  ? 266  ARG C CG    1 
ATOM   5656  C  CD    . ARG C  2  266  ? 70.042  -25.775 47.958   1.00 71.04  ? 266  ARG C CD    1 
ATOM   5657  N  NE    . ARG C  2  266  ? 69.272  -24.534 47.971   1.00 78.27  ? 266  ARG C NE    1 
ATOM   5658  C  CZ    . ARG C  2  266  ? 68.718  -23.987 46.894   1.00 79.46  ? 266  ARG C CZ    1 
ATOM   5659  N  NH1   . ARG C  2  266  ? 68.035  -22.855 46.999   1.00 79.51  ? 266  ARG C NH1   1 
ATOM   5660  N  NH2   . ARG C  2  266  ? 68.845  -24.573 45.711   1.00 78.26  ? 266  ARG C NH2   1 
ATOM   5661  N  N     . TYR C  2  267  ? 68.029  -28.453 52.250   1.00 52.33  ? 267  TYR C N     1 
ATOM   5662  C  CA    . TYR C  2  267  ? 66.940  -29.010 53.049   1.00 54.47  ? 267  TYR C CA    1 
ATOM   5663  C  C     . TYR C  2  267  ? 67.479  -29.761 54.261   1.00 54.32  ? 267  TYR C C     1 
ATOM   5664  O  O     . TYR C  2  267  ? 68.209  -30.740 54.115   1.00 55.82  ? 267  TYR C O     1 
ATOM   5665  C  CB    . TYR C  2  267  ? 66.060  -29.944 52.217   1.00 52.04  ? 267  TYR C CB    1 
ATOM   5666  C  CG    . TYR C  2  267  ? 64.761  -30.300 52.905   1.00 50.29  ? 267  TYR C CG    1 
ATOM   5667  C  CD1   . TYR C  2  267  ? 63.595  -29.602 52.626   1.00 51.87  ? 267  TYR C CD1   1 
ATOM   5668  C  CD2   . TYR C  2  267  ? 64.702  -31.322 53.846   1.00 49.58  ? 267  TYR C CD2   1 
ATOM   5669  C  CE1   . TYR C  2  267  ? 62.406  -29.915 53.254   1.00 51.89  ? 267  TYR C CE1   1 
ATOM   5670  C  CE2   . TYR C  2  267  ? 63.519  -31.639 54.483   1.00 50.37  ? 267  TYR C CE2   1 
ATOM   5671  C  CZ    . TYR C  2  267  ? 62.373  -30.934 54.182   1.00 51.51  ? 267  TYR C CZ    1 
ATOM   5672  O  OH    . TYR C  2  267  ? 61.189  -31.249 54.810   1.00 51.22  ? 267  TYR C OH    1 
ATOM   5673  N  N     . ASP C  2  268  ? 67.114  -29.303 55.455   1.00 50.73  ? 268  ASP C N     1 
ATOM   5674  C  CA    . ASP C  2  268  ? 67.582  -29.930 56.685   1.00 52.48  ? 268  ASP C CA    1 
ATOM   5675  C  C     . ASP C  2  268  ? 66.466  -30.076 57.723   1.00 53.58  ? 268  ASP C C     1 
ATOM   5676  O  O     . ASP C  2  268  ? 65.912  -29.082 58.189   1.00 55.68  ? 268  ASP C O     1 
ATOM   5677  C  CB    . ASP C  2  268  ? 68.745  -29.111 57.264   1.00 56.01  ? 268  ASP C CB    1 
ATOM   5678  C  CG    . ASP C  2  268  ? 69.396  -29.772 58.469   1.00 59.76  ? 268  ASP C CG    1 
ATOM   5679  O  OD1   . ASP C  2  268  ? 69.395  -31.018 58.542   1.00 66.24  ? 268  ASP C OD1   1 
ATOM   5680  O  OD2   . ASP C  2  268  ? 69.921  -29.043 59.340   1.00 54.05  ? 268  ASP C OD2   1 
ATOM   5681  N  N     . LEU C  2  269  ? 66.132  -31.315 58.078   1.00 52.71  ? 269  LEU C N     1 
ATOM   5682  C  CA    . LEU C  2  269  ? 65.295  -31.571 59.247   1.00 50.48  ? 269  LEU C CA    1 
ATOM   5683  C  C     . LEU C  2  269  ? 66.172  -31.449 60.481   1.00 54.05  ? 269  LEU C C     1 
ATOM   5684  O  O     . LEU C  2  269  ? 67.394  -31.534 60.384   1.00 56.72  ? 269  LEU C O     1 
ATOM   5685  C  CB    . LEU C  2  269  ? 64.665  -32.967 59.205   1.00 49.69  ? 269  LEU C CB    1 
ATOM   5686  C  CG    . LEU C  2  269  ? 63.676  -33.341 58.096   1.00 50.00  ? 269  LEU C CG    1 
ATOM   5687  C  CD1   . LEU C  2  269  ? 63.158  -34.757 58.313   1.00 50.50  ? 269  LEU C CD1   1 
ATOM   5688  C  CD2   . LEU C  2  269  ? 62.527  -32.358 58.002   1.00 46.58  ? 269  LEU C CD2   1 
ATOM   5689  N  N     . GLY C  2  270  ? 65.562  -31.230 61.638   1.00 53.58  ? 270  GLY C N     1 
ATOM   5690  C  CA    . GLY C  2  270  ? 66.308  -31.292 62.881   1.00 61.48  ? 270  GLY C CA    1 
ATOM   5691  C  C     . GLY C  2  270  ? 66.556  -32.742 63.250   1.00 62.29  ? 270  GLY C C     1 
ATOM   5692  O  O     . GLY C  2  270  ? 65.965  -33.644 62.653   1.00 63.17  ? 270  GLY C O     1 
ATOM   5693  N  N     . GLU C  2  271  ? 67.431  -32.977 64.224   1.00 58.78  ? 271  GLU C N     1 
ATOM   5694  C  CA    . GLU C  2  271  ? 67.607  -34.322 64.759   1.00 63.01  ? 271  GLU C CA    1 
ATOM   5695  C  C     . GLU C  2  271  ? 66.310  -34.704 65.461   1.00 58.61  ? 271  GLU C C     1 
ATOM   5696  O  O     . GLU C  2  271  ? 65.939  -35.880 65.533   1.00 56.68  ? 271  GLU C O     1 
ATOM   5697  C  CB    . GLU C  2  271  ? 68.783  -34.377 65.736   1.00 70.35  ? 271  GLU C CB    1 
ATOM   5698  C  CG    . GLU C  2  271  ? 69.242  -35.790 66.081   1.00 77.77  ? 271  GLU C CG    1 
ATOM   5699  C  CD    . GLU C  2  271  ? 69.922  -36.488 64.914   1.00 82.44  ? 271  GLU C CD    1 
ATOM   5700  O  OE1   . GLU C  2  271  ? 70.436  -35.787 64.016   1.00 76.04  ? 271  GLU C OE1   1 
ATOM   5701  O  OE2   . GLU C  2  271  ? 69.942  -37.738 64.894   1.00 80.03  ? 271  GLU C OE2   1 
ATOM   5702  N  N     . ALA C  2  272  ? 65.625  -33.685 65.971   1.00 54.24  ? 272  ALA C N     1 
ATOM   5703  C  CA    . ALA C  2  272  ? 64.293  -33.841 66.532   1.00 50.76  ? 272  ALA C CA    1 
ATOM   5704  C  C     . ALA C  2  272  ? 63.304  -34.194 65.427   1.00 52.60  ? 272  ALA C C     1 
ATOM   5705  O  O     . ALA C  2  272  ? 62.387  -34.984 65.636   1.00 47.97  ? 272  ALA C O     1 
ATOM   5706  C  CB    . ALA C  2  272  ? 63.868  -32.564 67.238   1.00 45.10  ? 272  ALA C CB    1 
ATOM   5707  N  N     . GLY C  2  273  ? 63.498  -33.605 64.250   1.00 54.90  ? 273  GLY C N     1 
ATOM   5708  C  CA    . GLY C  2  273  ? 62.650  -33.885 63.103   1.00 53.10  ? 273  GLY C CA    1 
ATOM   5709  C  C     . GLY C  2  273  ? 62.851  -35.296 62.585   1.00 56.77  ? 273  GLY C C     1 
ATOM   5710  O  O     . GLY C  2  273  ? 61.892  -35.986 62.234   1.00 59.31  ? 273  GLY C O     1 
ATOM   5711  N  N     . ARG C  2  274  ? 64.109  -35.721 62.540   1.00 57.77  ? 274  ARG C N     1 
ATOM   5712  C  CA    . ARG C  2  274  ? 64.468  -37.075 62.136   1.00 59.97  ? 274  ARG C CA    1 
ATOM   5713  C  C     . ARG C  2  274  ? 63.879  -38.092 63.110   1.00 58.88  ? 274  ARG C C     1 
ATOM   5714  O  O     . ARG C  2  274  ? 63.219  -39.055 62.704   1.00 56.28  ? 274  ARG C O     1 
ATOM   5715  C  CB    . ARG C  2  274  ? 65.992  -37.206 62.091   1.00 66.50  ? 274  ARG C CB    1 
ATOM   5716  C  CG    . ARG C  2  274  ? 66.519  -38.547 61.609   1.00 70.69  ? 274  ARG C CG    1 
ATOM   5717  C  CD    . ARG C  2  274  ? 68.043  -38.546 61.626   1.00 76.84  ? 274  ARG C CD    1 
ATOM   5718  N  NE    . ARG C  2  274  ? 68.616  -39.753 61.039   1.00 86.40  ? 274  ARG C NE    1 
ATOM   5719  C  CZ    . ARG C  2  274  ? 69.007  -40.814 61.737   1.00 89.27  ? 274  ARG C CZ    1 
ATOM   5720  N  NH1   . ARG C  2  274  ? 68.887  -40.824 63.059   1.00 82.81  ? 274  ARG C NH1   1 
ATOM   5721  N  NH2   . ARG C  2  274  ? 69.521  -41.866 61.113   1.00 89.23  ? 274  ARG C NH2   1 
ATOM   5722  N  N     . TYR C  2  275  ? 64.116  -37.862 64.399   1.00 59.65  ? 275  TYR C N     1 
ATOM   5723  C  CA    . TYR C  2  275  ? 63.616  -38.745 65.447   1.00 60.31  ? 275  TYR C CA    1 
ATOM   5724  C  C     . TYR C  2  275  ? 62.091  -38.830 65.465   1.00 60.38  ? 275  TYR C C     1 
ATOM   5725  O  O     . TYR C  2  275  ? 61.526  -39.912 65.628   1.00 63.44  ? 275  TYR C O     1 
ATOM   5726  C  CB    . TYR C  2  275  ? 64.135  -38.299 66.816   1.00 62.27  ? 275  TYR C CB    1 
ATOM   5727  C  CG    . TYR C  2  275  ? 63.379  -38.902 67.978   1.00 69.93  ? 275  TYR C CG    1 
ATOM   5728  C  CD1   . TYR C  2  275  ? 63.501  -40.251 68.286   1.00 74.39  ? 275  TYR C CD1   1 
ATOM   5729  C  CD2   . TYR C  2  275  ? 62.546  -38.122 68.769   1.00 71.01  ? 275  TYR C CD2   1 
ATOM   5730  C  CE1   . TYR C  2  275  ? 62.810  -40.807 69.346   1.00 74.92  ? 275  TYR C CE1   1 
ATOM   5731  C  CE2   . TYR C  2  275  ? 61.852  -38.668 69.833   1.00 74.10  ? 275  TYR C CE2   1 
ATOM   5732  C  CZ    . TYR C  2  275  ? 61.988  -40.011 70.117   1.00 77.35  ? 275  TYR C CZ    1 
ATOM   5733  O  OH    . TYR C  2  275  ? 61.300  -40.559 71.174   1.00 83.42  ? 275  TYR C OH    1 
ATOM   5734  N  N     . LYS C  2  276  ? 61.428  -37.689 65.302   1.00 58.38  ? 276  LYS C N     1 
ATOM   5735  C  CA    . LYS C  2  276  ? 59.968  -37.653 65.301   1.00 60.54  ? 276  LYS C CA    1 
ATOM   5736  C  C     . LYS C  2  276  ? 59.387  -38.315 64.059   1.00 57.72  ? 276  LYS C C     1 
ATOM   5737  O  O     . LYS C  2  276  ? 58.346  -38.966 64.128   1.00 57.53  ? 276  LYS C O     1 
ATOM   5738  C  CB    . LYS C  2  276  ? 59.445  -36.220 65.434   1.00 59.31  ? 276  LYS C CB    1 
ATOM   5739  C  CG    . LYS C  2  276  ? 59.526  -35.662 66.849   1.00 56.80  ? 276  LYS C CG    1 
ATOM   5740  C  CD    . LYS C  2  276  ? 58.731  -34.370 67.004   1.00 44.90  ? 276  LYS C CD    1 
ATOM   5741  C  CE    . LYS C  2  276  ? 57.251  -34.635 67.250   1.00 40.09  ? 276  LYS C CE    1 
ATOM   5742  N  NZ    . LYS C  2  276  ? 56.522  -35.089 66.033   1.00 48.53  ? 276  LYS C NZ    1 
ATOM   5743  N  N     . ALA C  2  277  ? 60.059  -38.143 62.925   1.00 54.87  ? 277  ALA C N     1 
ATOM   5744  C  CA    . ALA C  2  277  ? 59.649  -38.814 61.698   1.00 56.09  ? 277  ALA C CA    1 
ATOM   5745  C  C     . ALA C  2  277  ? 59.740  -40.327 61.873   1.00 61.60  ? 277  ALA C C     1 
ATOM   5746  O  O     . ALA C  2  277  ? 58.808  -41.059 61.529   1.00 62.19  ? 277  ALA C O     1 
ATOM   5747  C  CB    . ALA C  2  277  ? 60.502  -38.357 60.527   1.00 50.60  ? 277  ALA C CB    1 
ATOM   5748  N  N     . GLU C  2  278  ? 60.863  -40.788 62.420   1.00 61.94  ? 278  GLU C N     1 
ATOM   5749  C  CA    . GLU C  2  278  ? 61.067  -42.213 62.671   1.00 60.06  ? 278  GLU C CA    1 
ATOM   5750  C  C     . GLU C  2  278  ? 60.041  -42.783 63.649   1.00 62.63  ? 278  GLU C C     1 
ATOM   5751  O  O     . GLU C  2  278  ? 59.502  -43.868 63.434   1.00 62.93  ? 278  GLU C O     1 
ATOM   5752  C  CB    . GLU C  2  278  ? 62.477  -42.469 63.205   1.00 65.27  ? 278  GLU C CB    1 
ATOM   5753  C  CG    . GLU C  2  278  ? 63.586  -42.214 62.201   1.00 72.46  ? 278  GLU C CG    1 
ATOM   5754  C  CD    . GLU C  2  278  ? 64.962  -42.470 62.784   1.00 80.26  ? 278  GLU C CD    1 
ATOM   5755  O  OE1   . GLU C  2  278  ? 65.043  -42.876 63.963   1.00 79.91  ? 278  GLU C OE1   1 
ATOM   5756  O  OE2   . GLU C  2  278  ? 65.963  -42.264 62.065   1.00 81.25  ? 278  GLU C OE2   1 
ATOM   5757  N  N     . GLU C  2  279  ? 59.779  -42.046 64.723   1.00 66.40  ? 279  GLU C N     1 
ATOM   5758  C  CA    . GLU C  2  279  ? 58.866  -42.503 65.765   1.00 67.33  ? 279  GLU C CA    1 
ATOM   5759  C  C     . GLU C  2  279  ? 57.423  -42.539 65.273   1.00 62.63  ? 279  GLU C C     1 
ATOM   5760  O  O     . GLU C  2  279  ? 56.674  -43.468 65.577   1.00 56.56  ? 279  GLU C O     1 
ATOM   5761  C  CB    . GLU C  2  279  ? 58.974  -41.600 66.996   1.00 72.95  ? 279  GLU C CB    1 
ATOM   5762  C  CG    . GLU C  2  279  ? 58.322  -42.169 68.245   1.00 82.01  ? 279  GLU C CG    1 
ATOM   5763  C  CD    . GLU C  2  279  ? 59.105  -43.328 68.835   1.00 89.60  ? 279  GLU C CD    1 
ATOM   5764  O  OE1   . GLU C  2  279  ? 58.532  -44.082 69.649   1.00 96.28  ? 279  GLU C OE1   1 
ATOM   5765  O  OE2   . GLU C  2  279  ? 60.296  -43.481 68.490   1.00 89.09  ? 279  GLU C OE2   1 
ATOM   5766  N  N     . LYS C  2  280  ? 57.044  -41.523 64.506   1.00 60.86  ? 280  LYS C N     1 
ATOM   5767  C  CA    . LYS C  2  280  ? 55.680  -41.397 64.009   1.00 63.66  ? 280  LYS C CA    1 
ATOM   5768  C  C     . LYS C  2  280  ? 55.413  -42.363 62.861   1.00 60.81  ? 280  LYS C C     1 
ATOM   5769  O  O     . LYS C  2  280  ? 54.584  -43.267 62.981   1.00 58.48  ? 280  LYS C O     1 
ATOM   5770  C  CB    . LYS C  2  280  ? 55.409  -39.960 63.556   1.00 63.86  ? 280  LYS C CB    1 
ATOM   5771  C  CG    . LYS C  2  280  ? 53.989  -39.706 63.074   1.00 67.50  ? 280  LYS C CG    1 
ATOM   5772  C  CD    . LYS C  2  280  ? 52.977  -39.908 64.191   1.00 64.88  ? 280  LYS C CD    1 
ATOM   5773  C  CE    . LYS C  2  280  ? 51.574  -39.541 63.735   1.00 62.60  ? 280  LYS C CE    1 
ATOM   5774  N  NZ    . LYS C  2  280  ? 50.566  -39.737 64.814   1.00 66.62  ? 280  LYS C NZ    1 
ATOM   5775  N  N     . LEU C  2  281  ? 56.119  -42.164 61.752   1.00 57.97  ? 281  LEU C N     1 
ATOM   5776  C  CA    . LEU C  2  281  ? 55.903  -42.956 60.544   1.00 59.76  ? 281  LEU C CA    1 
ATOM   5777  C  C     . LEU C  2  281  ? 56.220  -44.435 60.751   1.00 63.68  ? 281  LEU C C     1 
ATOM   5778  O  O     . LEU C  2  281  ? 55.681  -45.295 60.054   1.00 65.56  ? 281  LEU C O     1 
ATOM   5779  C  CB    . LEU C  2  281  ? 56.735  -42.401 59.385   1.00 57.79  ? 281  LEU C CB    1 
ATOM   5780  C  CG    . LEU C  2  281  ? 56.508  -40.930 59.026   1.00 55.99  ? 281  LEU C CG    1 
ATOM   5781  C  CD1   . LEU C  2  281  ? 57.428  -40.505 57.891   1.00 48.64  ? 281  LEU C CD1   1 
ATOM   5782  C  CD2   . LEU C  2  281  ? 55.051  -40.677 58.664   1.00 56.03  ? 281  LEU C CD2   1 
ATOM   5783  N  N     . GLY C  2  282  ? 57.092  -44.723 61.713   1.00 66.14  ? 282  GLY C N     1 
ATOM   5784  C  CA    . GLY C  2  282  ? 57.507  -46.087 61.990   1.00 66.67  ? 282  GLY C CA    1 
ATOM   5785  C  C     . GLY C  2  282  ? 58.519  -46.604 60.986   1.00 60.38  ? 282  GLY C C     1 
ATOM   5786  O  O     . GLY C  2  282  ? 58.452  -47.756 60.557   1.00 55.89  ? 282  GLY C O     1 
ATOM   5787  N  N     . ILE C  2  283  ? 59.462  -45.744 60.610   1.00 59.91  ? 283  ILE C N     1 
ATOM   5788  C  CA    . ILE C  2  283  ? 60.503  -46.108 59.655   1.00 60.75  ? 283  ILE C CA    1 
ATOM   5789  C  C     . ILE C  2  283  ? 61.885  -45.728 60.178   1.00 67.45  ? 283  ILE C C     1 
ATOM   5790  O  O     . ILE C  2  283  ? 62.028  -45.276 61.314   1.00 66.18  ? 283  ILE C O     1 
ATOM   5791  C  CB    . ILE C  2  283  ? 60.291  -45.422 58.291   1.00 55.38  ? 283  ILE C CB    1 
ATOM   5792  C  CG1   . ILE C  2  283  ? 60.429  -43.905 58.430   1.00 55.24  ? 283  ILE C CG1   1 
ATOM   5793  C  CG2   . ILE C  2  283  ? 58.936  -45.794 57.708   1.00 57.20  ? 283  ILE C CG2   1 
ATOM   5794  C  CD1   . ILE C  2  283  ? 60.312  -43.162 57.121   1.00 56.05  ? 283  ILE C CD1   1 
ATOM   5795  N  N     . ARG C  2  284  ? 62.901  -45.920 59.343   1.00 69.80  ? 284  ARG C N     1 
ATOM   5796  C  CA    . ARG C  2  284  ? 64.261  -45.540 59.697   1.00 70.05  ? 284  ARG C CA    1 
ATOM   5797  C  C     . ARG C  2  284  ? 64.848  -44.643 58.614   1.00 70.64  ? 284  ARG C C     1 
ATOM   5798  O  O     . ARG C  2  284  ? 65.066  -45.080 57.484   1.00 70.90  ? 284  ARG C O     1 
ATOM   5799  C  CB    . ARG C  2  284  ? 65.132  -46.784 59.880   1.00 73.11  ? 284  ARG C CB    1 
ATOM   5800  C  CG    . ARG C  2  284  ? 66.414  -46.543 60.658   1.00 81.20  ? 284  ARG C CG    1 
ATOM   5801  C  CD    . ARG C  2  284  ? 66.116  -46.135 62.094   1.00 88.98  ? 284  ARG C CD    1 
ATOM   5802  N  NE    . ARG C  2  284  ? 67.321  -46.107 62.919   1.00 97.32  ? 284  ARG C NE    1 
ATOM   5803  C  CZ    . ARG C  2  284  ? 68.083  -45.032 63.095   1.00 99.86  ? 284  ARG C CZ    1 
ATOM   5804  N  NH1   . ARG C  2  284  ? 69.162  -45.101 63.864   1.00 101.39 ? 284  ARG C NH1   1 
ATOM   5805  N  NH2   . ARG C  2  284  ? 67.768  -43.889 62.503   1.00 94.14  ? 284  ARG C NH2   1 
ATOM   5806  N  N     . LEU C  2  285  ? 65.104  -43.388 58.966   1.00 72.17  ? 285  LEU C N     1 
ATOM   5807  C  CA    . LEU C  2  285  ? 65.653  -42.422 58.022   1.00 72.26  ? 285  LEU C CA    1 
ATOM   5808  C  C     . LEU C  2  285  ? 67.171  -42.513 57.979   1.00 71.63  ? 285  LEU C C     1 
ATOM   5809  O  O     . LEU C  2  285  ? 67.831  -42.521 59.018   1.00 72.94  ? 285  LEU C O     1 
ATOM   5810  C  CB    . LEU C  2  285  ? 65.232  -41.002 58.408   1.00 75.16  ? 285  LEU C CB    1 
ATOM   5811  C  CG    . LEU C  2  285  ? 64.433  -40.197 57.381   1.00 70.52  ? 285  LEU C CG    1 
ATOM   5812  C  CD1   . LEU C  2  285  ? 65.262  -39.928 56.139   1.00 68.20  ? 285  LEU C CD1   1 
ATOM   5813  C  CD2   . LEU C  2  285  ? 63.145  -40.916 57.018   1.00 68.25  ? 285  LEU C CD2   1 
ATOM   5814  N  N     . SER C  2  286  ? 67.722  -42.596 56.774   1.00 69.81  ? 286  SER C N     1 
ATOM   5815  C  CA    . SER C  2  286  ? 69.167  -42.583 56.618   1.00 74.53  ? 286  SER C CA    1 
ATOM   5816  C  C     . SER C  2  286  ? 69.703  -41.213 57.005   1.00 75.39  ? 286  SER C C     1 
ATOM   5817  O  O     . SER C  2  286  ? 70.554  -41.088 57.885   1.00 79.39  ? 286  SER C O     1 
ATOM   5818  C  CB    . SER C  2  286  ? 69.552  -42.897 55.173   1.00 77.52  ? 286  SER C CB    1 
ATOM   5819  O  OG    . SER C  2  286  ? 69.144  -41.856 54.302   1.00 77.24  ? 286  SER C OG    1 
ATOM   5820  N  N     . GLY C  2  287  ? 69.194  -40.188 56.331   1.00 74.73  ? 287  GLY C N     1 
ATOM   5821  C  CA    . GLY C  2  287  ? 69.607  -38.824 56.583   1.00 73.55  ? 287  GLY C CA    1 
ATOM   5822  C  C     . GLY C  2  287  ? 68.542  -37.963 57.229   1.00 76.32  ? 287  GLY C C     1 
ATOM   5823  O  O     . GLY C  2  287  ? 67.534  -38.451 57.741   1.00 74.91  ? 287  GLY C O     1 
ATOM   5824  N  N     . ARG C  2  288  ? 68.792  -36.661 57.214   1.00 75.29  ? 288  ARG C N     1 
ATOM   5825  C  CA    . ARG C  2  288  ? 67.829  -35.668 57.672   1.00 70.94  ? 288  ARG C CA    1 
ATOM   5826  C  C     . ARG C  2  288  ? 67.006  -35.076 56.523   1.00 67.68  ? 288  ARG C C     1 
ATOM   5827  O  O     . ARG C  2  288  ? 66.315  -34.077 56.698   1.00 63.04  ? 288  ARG C O     1 
ATOM   5828  C  CB    . ARG C  2  288  ? 68.510  -34.586 58.513   1.00 64.72  ? 288  ARG C CB    1 
ATOM   5829  C  CG    . ARG C  2  288  ? 69.088  -35.127 59.816   1.00 64.64  ? 288  ARG C CG    1 
ATOM   5830  C  CD    . ARG C  2  288  ? 69.204  -34.045 60.875   1.00 65.97  ? 288  ARG C CD    1 
ATOM   5831  N  NE    . ARG C  2  288  ? 70.114  -32.980 60.465   1.00 62.11  ? 288  ARG C NE    1 
ATOM   5832  C  CZ    . ARG C  2  288  ? 71.401  -32.933 60.793   1.00 66.85  ? 288  ARG C CZ    1 
ATOM   5833  N  NH1   . ARG C  2  288  ? 71.930  -33.889 61.545   1.00 70.12  ? 288  ARG C NH1   1 
ATOM   5834  N  NH2   . ARG C  2  288  ? 72.159  -31.929 60.374   1.00 68.41  ? 288  ARG C NH2   1 
ATOM   5835  N  N     . THR C  2  289  ? 67.127  -35.666 55.337   1.00 68.60  ? 289  THR C N     1 
ATOM   5836  C  CA    . THR C  2  289  ? 66.461  -35.136 54.149   1.00 62.92  ? 289  THR C CA    1 
ATOM   5837  C  C     . THR C  2  289  ? 65.359  -36.056 53.628   1.00 63.25  ? 289  THR C C     1 
ATOM   5838  O  O     . THR C  2  289  ? 65.359  -37.259 53.894   1.00 64.55  ? 289  THR C O     1 
ATOM   5839  C  CB    . THR C  2  289  ? 67.463  -34.866 53.015   1.00 60.40  ? 289  THR C CB    1 
ATOM   5840  O  OG1   . THR C  2  289  ? 67.967  -36.108 52.506   1.00 62.45  ? 289  THR C OG1   1 
ATOM   5841  C  CG2   . THR C  2  289  ? 68.614  -34.029 53.527   1.00 61.41  ? 289  THR C CG2   1 
ATOM   5842  N  N     . LEU C  2  290  ? 64.415  -35.468 52.898   1.00 61.43  ? 290  LEU C N     1 
ATOM   5843  C  CA    . LEU C  2  290  ? 63.258  -36.195 52.383   1.00 61.74  ? 290  LEU C CA    1 
ATOM   5844  C  C     . LEU C  2  290  ? 63.622  -37.188 51.282   1.00 65.48  ? 290  LEU C C     1 
ATOM   5845  O  O     . LEU C  2  290  ? 62.990  -38.236 51.146   1.00 65.75  ? 290  LEU C O     1 
ATOM   5846  C  CB    . LEU C  2  290  ? 62.201  -35.218 51.862   1.00 61.55  ? 290  LEU C CB    1 
ATOM   5847  C  CG    . LEU C  2  290  ? 61.766  -34.102 52.813   1.00 56.74  ? 290  LEU C CG    1 
ATOM   5848  C  CD1   . LEU C  2  290  ? 60.596  -33.321 52.242   1.00 56.55  ? 290  LEU C CD1   1 
ATOM   5849  C  CD2   . LEU C  2  290  ? 61.424  -34.652 54.185   1.00 50.38  ? 290  LEU C CD2   1 
ATOM   5850  N  N     . ALA C  2  291  ? 64.632  -36.849 50.489   1.00 66.02  ? 291  ALA C N     1 
ATOM   5851  C  CA    . ALA C  2  291  ? 65.064  -37.713 49.397   1.00 66.02  ? 291  ALA C CA    1 
ATOM   5852  C  C     . ALA C  2  291  ? 66.582  -37.721 49.267   1.00 65.96  ? 291  ALA C C     1 
ATOM   5853  O  O     . ALA C  2  291  ? 67.265  -36.844 49.795   1.00 61.06  ? 291  ALA C O     1 
ATOM   5854  C  CB    . ALA C  2  291  ? 64.421  -37.279 48.092   1.00 65.55  ? 291  ALA C CB    1 
ATOM   5855  N  N     . ARG C  2  292  ? 67.105  -38.720 48.563   1.00 74.23  ? 292  ARG C N     1 
ATOM   5856  C  CA    . ARG C  2  292  ? 68.543  -38.851 48.376   1.00 74.57  ? 292  ARG C CA    1 
ATOM   5857  C  C     . ARG C  2  292  ? 68.897  -38.920 46.900   1.00 73.62  ? 292  ARG C C     1 
ATOM   5858  O  O     . ARG C  2  292  ? 68.112  -39.405 46.086   1.00 75.09  ? 292  ARG C O     1 
ATOM   5859  C  CB    . ARG C  2  292  ? 69.058  -40.117 49.062   1.00 73.62  ? 292  ARG C CB    1 
ATOM   5860  C  CG    . ARG C  2  292  ? 68.726  -40.223 50.536   1.00 71.78  ? 292  ARG C CG    1 
ATOM   5861  C  CD    . ARG C  2  292  ? 69.176  -41.567 51.082   1.00 77.71  ? 292  ARG C CD    1 
ATOM   5862  N  NE    . ARG C  2  292  ? 68.564  -42.678 50.358   1.00 83.79  ? 292  ARG C NE    1 
ATOM   5863  C  CZ    . ARG C  2  292  ? 68.780  -43.961 50.631   1.00 86.98  ? 292  ARG C CZ    1 
ATOM   5864  N  NH1   . ARG C  2  292  ? 69.598  -44.305 51.617   1.00 85.05  ? 292  ARG C NH1   1 
ATOM   5865  N  NH2   . ARG C  2  292  ? 68.178  -44.903 49.918   1.00 85.40  ? 292  ARG C NH2   1 
ATOM   5866  N  N     . PHE C  2  293  ? 70.082  -38.429 46.558   1.00 75.37  ? 293  PHE C N     1 
ATOM   5867  C  CA    . PHE C  2  293  ? 70.627  -38.650 45.229   1.00 79.32  ? 293  PHE C CA    1 
ATOM   5868  C  C     . PHE C  2  293  ? 71.720  -39.702 45.360   1.00 90.33  ? 293  PHE C C     1 
ATOM   5869  O  O     . PHE C  2  293  ? 72.799  -39.432 45.889   1.00 89.45  ? 293  PHE C O     1 
ATOM   5870  C  CB    . PHE C  2  293  ? 71.188  -37.352 44.648   1.00 77.35  ? 293  PHE C CB    1 
ATOM   5871  C  CG    . PHE C  2  293  ? 71.458  -37.416 43.169   1.00 82.78  ? 293  PHE C CG    1 
ATOM   5872  C  CD1   . PHE C  2  293  ? 70.455  -37.136 42.255   1.00 81.61  ? 293  PHE C CD1   1 
ATOM   5873  C  CD2   . PHE C  2  293  ? 72.715  -37.755 42.693   1.00 86.61  ? 293  PHE C CD2   1 
ATOM   5874  C  CE1   . PHE C  2  293  ? 70.699  -37.193 40.894   1.00 79.83  ? 293  PHE C CE1   1 
ATOM   5875  C  CE2   . PHE C  2  293  ? 72.965  -37.814 41.333   1.00 84.26  ? 293  PHE C CE2   1 
ATOM   5876  C  CZ    . PHE C  2  293  ? 71.956  -37.533 40.433   1.00 81.04  ? 293  PHE C CZ    1 
ATOM   5877  N  N     . GLU C  2  294  ? 71.429  -40.903 44.872   1.00 98.56  ? 294  GLU C N     1 
ATOM   5878  C  CA    . GLU C  2  294  ? 72.324  -42.044 45.028   1.00 98.65  ? 294  GLU C CA    1 
ATOM   5879  C  C     . GLU C  2  294  ? 72.340  -42.870 43.748   1.00 101.10 ? 294  GLU C C     1 
ATOM   5880  O  O     . GLU C  2  294  ? 71.288  -43.148 43.172   1.00 100.88 ? 294  GLU C O     1 
ATOM   5881  C  CB    . GLU C  2  294  ? 71.877  -42.907 46.212   1.00 93.66  ? 294  GLU C CB    1 
ATOM   5882  C  CG    . GLU C  2  294  ? 72.671  -44.192 46.391   1.00 98.58  ? 294  GLU C CG    1 
ATOM   5883  C  CD    . GLU C  2  294  ? 72.137  -45.053 47.521   1.00 99.39  ? 294  GLU C CD    1 
ATOM   5884  O  OE1   . GLU C  2  294  ? 72.298  -46.291 47.454   1.00 98.43  ? 294  GLU C OE1   1 
ATOM   5885  O  OE2   . GLU C  2  294  ? 71.558  -44.494 48.476   1.00 93.59  ? 294  GLU C OE2   1 
ATOM   5886  N  N     . ASP C  2  295  ? 73.538  -43.250 43.310   1.00 101.14 ? 295  ASP C N     1 
ATOM   5887  C  CA    . ASP C  2  295  ? 73.722  -44.002 42.069   1.00 101.55 ? 295  ASP C CA    1 
ATOM   5888  C  C     . ASP C  2  295  ? 73.167  -43.249 40.859   1.00 93.88  ? 295  ASP C C     1 
ATOM   5889  O  O     . ASP C  2  295  ? 72.724  -43.860 39.886   1.00 90.20  ? 295  ASP C O     1 
ATOM   5890  C  CB    . ASP C  2  295  ? 73.100  -45.400 42.169   1.00 102.01 ? 295  ASP C CB    1 
ATOM   5891  C  CG    . ASP C  2  295  ? 73.668  -46.211 43.320   1.00 99.14  ? 295  ASP C CG    1 
ATOM   5892  O  OD1   . ASP C  2  295  ? 72.899  -46.966 43.954   1.00 93.75  ? 295  ASP C OD1   1 
ATOM   5893  O  OD2   . ASP C  2  295  ? 74.881  -46.093 43.591   1.00 98.03  ? 295  ASP C OD2   1 
ATOM   5894  N  N     . GLY C  2  296  ? 73.192  -41.922 40.933   1.00 88.01  ? 296  GLY C N     1 
ATOM   5895  C  CA    . GLY C  2  296  ? 72.775  -41.081 39.826   1.00 84.72  ? 296  GLY C CA    1 
ATOM   5896  C  C     . GLY C  2  296  ? 71.276  -40.875 39.710   1.00 85.94  ? 296  GLY C C     1 
ATOM   5897  O  O     . GLY C  2  296  ? 70.810  -40.200 38.792   1.00 85.14  ? 296  GLY C O     1 
ATOM   5898  N  N     . GLU C  2  297  ? 70.517  -41.451 40.638   1.00 85.66  ? 297  GLU C N     1 
ATOM   5899  C  CA    . GLU C  2  297  ? 69.062  -41.343 40.603   1.00 84.60  ? 297  GLU C CA    1 
ATOM   5900  C  C     . GLU C  2  297  ? 68.497  -40.796 41.912   1.00 81.65  ? 297  GLU C C     1 
ATOM   5901  O  O     . GLU C  2  297  ? 69.243  -40.477 42.836   1.00 81.83  ? 297  GLU C O     1 
ATOM   5902  C  CB    . GLU C  2  297  ? 68.433  -42.703 40.290   1.00 82.17  ? 297  GLU C CB    1 
ATOM   5903  C  CG    . GLU C  2  297  ? 68.829  -43.804 41.258   1.00 84.56  ? 297  GLU C CG    1 
ATOM   5904  C  CD    . GLU C  2  297  ? 68.135  -45.118 40.966   1.00 88.54  ? 297  GLU C CD    1 
ATOM   5905  O  OE1   . GLU C  2  297  ? 68.524  -46.143 41.564   1.00 91.02  ? 297  GLU C OE1   1 
ATOM   5906  O  OE2   . GLU C  2  297  ? 67.197  -45.126 40.141   1.00 87.82  ? 297  GLU C OE2   1 
ATOM   5907  N  N     . PHE C  2  298  ? 67.173  -40.688 41.979   1.00 78.80  ? 298  PHE C N     1 
ATOM   5908  C  CA    . PHE C  2  298  ? 66.500  -40.228 43.190   1.00 75.18  ? 298  PHE C CA    1 
ATOM   5909  C  C     . PHE C  2  298  ? 65.906  -41.391 43.981   1.00 74.48  ? 298  PHE C C     1 
ATOM   5910  O  O     . PHE C  2  298  ? 65.074  -42.142 43.471   1.00 70.95  ? 298  PHE C O     1 
ATOM   5911  C  CB    . PHE C  2  298  ? 65.403  -39.214 42.850   1.00 70.35  ? 298  PHE C CB    1 
ATOM   5912  C  CG    . PHE C  2  298  ? 65.918  -37.832 42.559   1.00 69.41  ? 298  PHE C CG    1 
ATOM   5913  C  CD1   . PHE C  2  298  ? 66.030  -37.379 41.255   1.00 74.89  ? 298  PHE C CD1   1 
ATOM   5914  C  CD2   . PHE C  2  298  ? 66.286  -36.985 43.592   1.00 67.10  ? 298  PHE C CD2   1 
ATOM   5915  C  CE1   . PHE C  2  298  ? 66.501  -36.106 40.986   1.00 71.30  ? 298  PHE C CE1   1 
ATOM   5916  C  CE2   . PHE C  2  298  ? 66.758  -35.711 43.329   1.00 64.86  ? 298  PHE C CE2   1 
ATOM   5917  C  CZ    . PHE C  2  298  ? 66.866  -35.271 42.024   1.00 66.51  ? 298  PHE C CZ    1 
ATOM   5918  N  N     . LYS C  2  299  ? 66.339  -41.533 45.229   1.00 75.81  ? 299  LYS C N     1 
ATOM   5919  C  CA    . LYS C  2  299  ? 65.809  -42.565 46.112   1.00 75.02  ? 299  LYS C CA    1 
ATOM   5920  C  C     . LYS C  2  299  ? 65.019  -41.939 47.258   1.00 74.73  ? 299  LYS C C     1 
ATOM   5921  O  O     . LYS C  2  299  ? 65.538  -41.106 48.003   1.00 72.65  ? 299  LYS C O     1 
ATOM   5922  C  CB    . LYS C  2  299  ? 66.938  -43.440 46.660   1.00 80.26  ? 299  LYS C CB    1 
ATOM   5923  C  CG    . LYS C  2  299  ? 67.711  -44.195 45.590   1.00 85.07  ? 299  LYS C CG    1 
ATOM   5924  C  CD    . LYS C  2  299  ? 68.774  -45.091 46.204   1.00 88.32  ? 299  LYS C CD    1 
ATOM   5925  C  CE    . LYS C  2  299  ? 69.567  -45.825 45.134   1.00 88.93  ? 299  LYS C CE    1 
ATOM   5926  N  NZ    . LYS C  2  299  ? 68.700  -46.696 44.293   1.00 83.38  ? 299  LYS C NZ    1 
ATOM   5927  N  N     . ASP C  2  300  ? 63.761  -42.349 47.391   1.00 76.45  ? 300  ASP C N     1 
ATOM   5928  C  CA    . ASP C  2  300  ? 62.862  -41.778 48.389   1.00 72.65  ? 300  ASP C CA    1 
ATOM   5929  C  C     . ASP C  2  300  ? 63.228  -42.197 49.811   1.00 70.81  ? 300  ASP C C     1 
ATOM   5930  O  O     . ASP C  2  300  ? 63.845  -43.240 50.027   1.00 72.99  ? 300  ASP C O     1 
ATOM   5931  C  CB    . ASP C  2  300  ? 61.412  -42.166 48.081   1.00 73.47  ? 300  ASP C CB    1 
ATOM   5932  C  CG    . ASP C  2  300  ? 60.411  -41.471 48.989   1.00 73.11  ? 300  ASP C CG    1 
ATOM   5933  O  OD1   . ASP C  2  300  ? 60.657  -40.305 49.367   1.00 71.90  ? 300  ASP C OD1   1 
ATOM   5934  O  OD2   . ASP C  2  300  ? 59.381  -42.092 49.330   1.00 68.66  ? 300  ASP C OD2   1 
ATOM   5935  N  N     . GLU C  2  301  ? 62.849  -41.361 50.771   1.00 67.96  ? 301  GLU C N     1 
ATOM   5936  C  CA    . GLU C  2  301  ? 63.023  -41.647 52.189   1.00 68.75  ? 301  GLU C CA    1 
ATOM   5937  C  C     . GLU C  2  301  ? 61.693  -41.456 52.910   1.00 63.04  ? 301  GLU C C     1 
ATOM   5938  O  O     . GLU C  2  301  ? 61.140  -42.385 53.500   1.00 59.49  ? 301  GLU C O     1 
ATOM   5939  C  CB    . GLU C  2  301  ? 64.079  -40.722 52.796   1.00 71.20  ? 301  GLU C CB    1 
ATOM   5940  C  CG    . GLU C  2  301  ? 65.515  -41.131 52.513   1.00 75.40  ? 301  GLU C CG    1 
ATOM   5941  C  CD    . GLU C  2  301  ? 65.962  -42.301 53.369   1.00 80.97  ? 301  GLU C CD    1 
ATOM   5942  O  OE1   . GLU C  2  301  ? 65.267  -42.618 54.359   1.00 74.11  ? 301  GLU C OE1   1 
ATOM   5943  O  OE2   . GLU C  2  301  ? 67.009  -42.905 53.053   1.00 85.63  ? 301  GLU C OE2   1 
ATOM   5944  N  N     . VAL C  2  302  ? 61.199  -40.226 52.846   1.00 61.64  ? 302  VAL C N     1 
ATOM   5945  C  CA    . VAL C  2  302  ? 60.017  -39.780 53.579   1.00 60.56  ? 302  VAL C CA    1 
ATOM   5946  C  C     . VAL C  2  302  ? 58.676  -40.043 52.877   1.00 61.93  ? 302  VAL C C     1 
ATOM   5947  O  O     . VAL C  2  302  ? 57.788  -40.662 53.459   1.00 60.64  ? 302  VAL C O     1 
ATOM   5948  C  CB    . VAL C  2  302  ? 60.143  -38.303 54.000   1.00 53.93  ? 302  VAL C CB    1 
ATOM   5949  C  CG1   . VAL C  2  302  ? 58.917  -37.865 54.780   1.00 51.54  ? 302  VAL C CG1   1 
ATOM   5950  C  CG2   . VAL C  2  302  ? 61.396  -38.116 54.837   1.00 54.75  ? 302  VAL C CG2   1 
ATOM   5951  N  N     . PHE C  2  303  ? 58.525  -39.528 51.657   1.00 58.30  ? 303  PHE C N     1 
ATOM   5952  C  CA    . PHE C  2  303  ? 57.230  -39.440 50.967   1.00 55.75  ? 303  PHE C CA    1 
ATOM   5953  C  C     . PHE C  2  303  ? 56.313  -40.667 51.011   1.00 57.18  ? 303  PHE C C     1 
ATOM   5954  O  O     . PHE C  2  303  ? 55.128  -40.538 51.320   1.00 56.03  ? 303  PHE C O     1 
ATOM   5955  C  CB    . PHE C  2  303  ? 57.445  -39.064 49.501   1.00 50.90  ? 303  PHE C CB    1 
ATOM   5956  C  CG    . PHE C  2  303  ? 57.937  -37.666 49.300   1.00 55.61  ? 303  PHE C CG    1 
ATOM   5957  C  CD1   . PHE C  2  303  ? 59.289  -37.407 49.154   1.00 60.16  ? 303  PHE C CD1   1 
ATOM   5958  C  CD2   . PHE C  2  303  ? 57.047  -36.607 49.251   1.00 57.09  ? 303  PHE C CD2   1 
ATOM   5959  C  CE1   . PHE C  2  303  ? 59.743  -36.120 48.965   1.00 61.09  ? 303  PHE C CE1   1 
ATOM   5960  C  CE2   . PHE C  2  303  ? 57.495  -35.318 49.064   1.00 58.06  ? 303  PHE C CE2   1 
ATOM   5961  C  CZ    . PHE C  2  303  ? 58.843  -35.074 48.920   1.00 60.43  ? 303  PHE C CZ    1 
ATOM   5962  N  N     . LEU C  2  304  ? 56.838  -41.846 50.691   1.00 57.02  ? 304  LEU C N     1 
ATOM   5963  C  CA    . LEU C  2  304  ? 55.987  -43.037 50.653   1.00 55.89  ? 304  LEU C CA    1 
ATOM   5964  C  C     . LEU C  2  304  ? 55.418  -43.446 52.020   1.00 54.71  ? 304  LEU C C     1 
ATOM   5965  O  O     . LEU C  2  304  ? 54.220  -43.696 52.124   1.00 57.87  ? 304  LEU C O     1 
ATOM   5966  C  CB    . LEU C  2  304  ? 56.667  -44.222 49.955   1.00 58.93  ? 304  LEU C CB    1 
ATOM   5967  C  CG    . LEU C  2  304  ? 55.822  -45.500 49.951   1.00 61.87  ? 304  LEU C CG    1 
ATOM   5968  C  CD1   . LEU C  2  304  ? 54.634  -45.364 49.005   1.00 60.45  ? 304  LEU C CD1   1 
ATOM   5969  C  CD2   . LEU C  2  304  ? 56.656  -46.730 49.615   1.00 65.77  ? 304  LEU C CD2   1 
ATOM   5970  N  N     . PRO C  2  305  ? 56.268  -43.531 53.064   1.00 53.85  ? 305  PRO C N     1 
ATOM   5971  C  CA    . PRO C  2  305  ? 55.697  -43.805 54.390   1.00 58.21  ? 305  PRO C CA    1 
ATOM   5972  C  C     . PRO C  2  305  ? 54.687  -42.748 54.845   1.00 62.31  ? 305  PRO C C     1 
ATOM   5973  O  O     . PRO C  2  305  ? 53.702  -43.089 55.505   1.00 60.08  ? 305  PRO C O     1 
ATOM   5974  C  CB    . PRO C  2  305  ? 56.923  -43.778 55.304   1.00 58.50  ? 305  PRO C CB    1 
ATOM   5975  C  CG    . PRO C  2  305  ? 58.037  -44.212 54.431   1.00 56.98  ? 305  PRO C CG    1 
ATOM   5976  C  CD    . PRO C  2  305  ? 57.740  -43.646 53.075   1.00 55.17  ? 305  PRO C CD    1 
ATOM   5977  N  N     . THR C  2  306  ? 54.933  -41.489 54.493   1.00 62.78  ? 306  THR C N     1 
ATOM   5978  C  CA    . THR C  2  306  ? 54.036  -40.394 54.855   1.00 57.22  ? 306  THR C CA    1 
ATOM   5979  C  C     . THR C  2  306  ? 52.675  -40.554 54.186   1.00 60.08  ? 306  THR C C     1 
ATOM   5980  O  O     . THR C  2  306  ? 51.636  -40.454 54.839   1.00 58.53  ? 306  THR C O     1 
ATOM   5981  C  CB    . THR C  2  306  ? 54.628  -39.026 54.467   1.00 50.07  ? 306  THR C CB    1 
ATOM   5982  O  OG1   . THR C  2  306  ? 55.850  -38.813 55.182   1.00 52.76  ? 306  THR C OG1   1 
ATOM   5983  C  CG2   . THR C  2  306  ? 53.656  -37.908 54.800   1.00 50.75  ? 306  THR C CG2   1 
ATOM   5984  N  N     . LEU C  2  307  ? 52.695  -40.804 52.880   1.00 59.48  ? 307  LEU C N     1 
ATOM   5985  C  CA    . LEU C  2  307  ? 51.477  -41.029 52.111   1.00 55.20  ? 307  LEU C CA    1 
ATOM   5986  C  C     . LEU C  2  307  ? 50.744  -42.265 52.624   1.00 58.93  ? 307  LEU C C     1 
ATOM   5987  O  O     . LEU C  2  307  ? 49.511  -42.320 52.633   1.00 61.58  ? 307  LEU C O     1 
ATOM   5988  C  CB    . LEU C  2  307  ? 51.819  -41.198 50.632   1.00 54.17  ? 307  LEU C CB    1 
ATOM   5989  C  CG    . LEU C  2  307  ? 50.644  -41.377 49.672   1.00 64.16  ? 307  LEU C CG    1 
ATOM   5990  C  CD1   . LEU C  2  307  ? 49.717  -40.174 49.736   1.00 66.78  ? 307  LEU C CD1   1 
ATOM   5991  C  CD2   . LEU C  2  307  ? 51.149  -41.596 48.255   1.00 66.76  ? 307  LEU C CD2   1 
ATOM   5992  N  N     . ARG C  2  308  ? 51.523  -43.252 53.056   1.00 58.32  ? 308  ARG C N     1 
ATOM   5993  C  CA    . ARG C  2  308  ? 50.988  -44.480 53.624   1.00 59.02  ? 308  ARG C CA    1 
ATOM   5994  C  C     . ARG C  2  308  ? 50.217  -44.160 54.899   1.00 60.21  ? 308  ARG C C     1 
ATOM   5995  O  O     . ARG C  2  308  ? 49.102  -44.643 55.095   1.00 60.15  ? 308  ARG C O     1 
ATOM   5996  C  CB    . ARG C  2  308  ? 52.127  -45.465 53.914   1.00 56.11  ? 308  ARG C CB    1 
ATOM   5997  C  CG    . ARG C  2  308  ? 51.711  -46.928 54.059   1.00 61.38  ? 308  ARG C CG    1 
ATOM   5998  C  CD    . ARG C  2  308  ? 51.148  -47.228 55.438   1.00 56.94  ? 308  ARG C CD    1 
ATOM   5999  N  NE    . ARG C  2  308  ? 51.983  -46.662 56.492   1.00 65.23  ? 308  ARG C NE    1 
ATOM   6000  C  CZ    . ARG C  2  308  ? 51.610  -46.555 57.763   1.00 68.95  ? 308  ARG C CZ    1 
ATOM   6001  N  NH1   . ARG C  2  308  ? 50.409  -46.974 58.138   1.00 68.87  ? 308  ARG C NH1   1 
ATOM   6002  N  NH2   . ARG C  2  308  ? 52.434  -46.025 58.658   1.00 65.21  ? 308  ARG C NH2   1 
ATOM   6003  N  N     . TYR C  2  309  ? 50.814  -43.345 55.764   1.00 61.35  ? 309  TYR C N     1 
ATOM   6004  C  CA    . TYR C  2  309  ? 50.174  -42.977 57.023   1.00 65.86  ? 309  TYR C CA    1 
ATOM   6005  C  C     . TYR C  2  309  ? 48.933  -42.127 56.772   1.00 65.60  ? 309  TYR C C     1 
ATOM   6006  O  O     . TYR C  2  309  ? 47.931  -42.258 57.471   1.00 65.86  ? 309  TYR C O     1 
ATOM   6007  C  CB    . TYR C  2  309  ? 51.149  -42.231 57.939   1.00 64.21  ? 309  TYR C CB    1 
ATOM   6008  C  CG    . TYR C  2  309  ? 50.722  -42.200 59.393   1.00 64.32  ? 309  TYR C CG    1 
ATOM   6009  C  CD1   . TYR C  2  309  ? 51.316  -43.036 60.329   1.00 66.75  ? 309  TYR C CD1   1 
ATOM   6010  C  CD2   . TYR C  2  309  ? 49.722  -41.339 59.829   1.00 64.13  ? 309  TYR C CD2   1 
ATOM   6011  C  CE1   . TYR C  2  309  ? 50.930  -43.012 61.658   1.00 68.74  ? 309  TYR C CE1   1 
ATOM   6012  C  CE2   . TYR C  2  309  ? 49.328  -41.308 61.152   1.00 67.04  ? 309  TYR C CE2   1 
ATOM   6013  C  CZ    . TYR C  2  309  ? 49.935  -42.147 62.062   1.00 70.18  ? 309  TYR C CZ    1 
ATOM   6014  O  OH    . TYR C  2  309  ? 49.545  -42.119 63.381   1.00 73.89  ? 309  TYR C OH    1 
ATOM   6015  N  N     . LEU C  2  310  ? 49.012  -41.252 55.774   1.00 63.97  ? 310  LEU C N     1 
ATOM   6016  C  CA    . LEU C  2  310  ? 47.885  -40.406 55.398   1.00 60.85  ? 310  LEU C CA    1 
ATOM   6017  C  C     . LEU C  2  310  ? 46.699  -41.259 54.962   1.00 63.00  ? 310  LEU C C     1 
ATOM   6018  O  O     . LEU C  2  310  ? 45.576  -41.073 55.438   1.00 61.45  ? 310  LEU C O     1 
ATOM   6019  C  CB    . LEU C  2  310  ? 48.288  -39.451 54.273   1.00 56.42  ? 310  LEU C CB    1 
ATOM   6020  C  CG    . LEU C  2  310  ? 47.189  -38.561 53.689   1.00 54.11  ? 310  LEU C CG    1 
ATOM   6021  C  CD1   . LEU C  2  310  ? 46.572  -37.692 54.773   1.00 57.61  ? 310  LEU C CD1   1 
ATOM   6022  C  CD2   . LEU C  2  310  ? 47.737  -37.705 52.555   1.00 53.41  ? 310  LEU C CD2   1 
ATOM   6023  N  N     . PHE C  2  311  ? 46.960  -42.202 54.062   1.00 66.11  ? 311  PHE C N     1 
ATOM   6024  C  CA    . PHE C  2  311  ? 45.915  -43.088 53.560   1.00 68.58  ? 311  PHE C CA    1 
ATOM   6025  C  C     . PHE C  2  311  ? 45.363  -44.014 54.643   1.00 66.06  ? 311  PHE C C     1 
ATOM   6026  O  O     . PHE C  2  311  ? 44.162  -44.286 54.684   1.00 66.22  ? 311  PHE C O     1 
ATOM   6027  C  CB    . PHE C  2  311  ? 46.426  -43.901 52.369   1.00 66.78  ? 311  PHE C CB    1 
ATOM   6028  C  CG    . PHE C  2  311  ? 46.477  -43.123 51.086   1.00 64.68  ? 311  PHE C CG    1 
ATOM   6029  C  CD1   . PHE C  2  311  ? 45.662  -42.019 50.900   1.00 67.36  ? 311  PHE C CD1   1 
ATOM   6030  C  CD2   . PHE C  2  311  ? 47.334  -43.495 50.066   1.00 64.71  ? 311  PHE C CD2   1 
ATOM   6031  C  CE1   . PHE C  2  311  ? 45.703  -41.299 49.721   1.00 69.82  ? 311  PHE C CE1   1 
ATOM   6032  C  CE2   . PHE C  2  311  ? 47.379  -42.779 48.883   1.00 69.90  ? 311  PHE C CE2   1 
ATOM   6033  C  CZ    . PHE C  2  311  ? 46.563  -41.680 48.711   1.00 66.31  ? 311  PHE C CZ    1 
ATOM   6034  N  N     . ALA C  2  312  ? 46.242  -44.488 55.521   1.00 63.80  ? 312  ALA C N     1 
ATOM   6035  C  CA    . ALA C  2  312  ? 45.834  -45.360 56.615   1.00 66.52  ? 312  ALA C CA    1 
ATOM   6036  C  C     . ALA C  2  312  ? 44.936  -44.613 57.595   1.00 67.74  ? 312  ALA C C     1 
ATOM   6037  O  O     . ALA C  2  312  ? 43.931  -45.147 58.067   1.00 69.76  ? 312  ALA C O     1 
ATOM   6038  C  CB    . ALA C  2  312  ? 47.052  -45.921 57.329   1.00 63.78  ? 312  ALA C CB    1 
ATOM   6039  N  N     . LEU C  2  313  ? 45.306  -43.373 57.893   1.00 66.25  ? 313  LEU C N     1 
ATOM   6040  C  CA    . LEU C  2  313  ? 44.529  -42.525 58.788   1.00 70.15  ? 313  LEU C CA    1 
ATOM   6041  C  C     . LEU C  2  313  ? 43.168  -42.204 58.182   1.00 65.96  ? 313  LEU C C     1 
ATOM   6042  O  O     . LEU C  2  313  ? 42.141  -42.296 58.856   1.00 61.44  ? 313  LEU C O     1 
ATOM   6043  C  CB    . LEU C  2  313  ? 45.290  -41.230 59.086   1.00 74.37  ? 313  LEU C CB    1 
ATOM   6044  C  CG    . LEU C  2  313  ? 44.568  -40.176 59.929   1.00 72.10  ? 313  LEU C CG    1 
ATOM   6045  C  CD1   . LEU C  2  313  ? 44.230  -40.726 61.307   1.00 75.25  ? 313  LEU C CD1   1 
ATOM   6046  C  CD2   . LEU C  2  313  ? 45.406  -38.907 60.038   1.00 61.14  ? 313  LEU C CD2   1 
ATOM   6047  N  N     . THR C  2  314  ? 43.172  -41.828 56.905   1.00 64.11  ? 314  THR C N     1 
ATOM   6048  C  CA    . THR C  2  314  ? 41.941  -41.500 56.195   1.00 61.66  ? 314  THR C CA    1 
ATOM   6049  C  C     . THR C  2  314  ? 41.008  -42.706 56.133   1.00 61.04  ? 314  THR C C     1 
ATOM   6050  O  O     . THR C  2  314  ? 39.789  -42.567 56.234   1.00 64.41  ? 314  THR C O     1 
ATOM   6051  C  CB    . THR C  2  314  ? 42.231  -41.004 54.763   1.00 62.66  ? 314  THR C CB    1 
ATOM   6052  O  OG1   . THR C  2  314  ? 43.165  -39.918 54.809   1.00 62.05  ? 314  THR C OG1   1 
ATOM   6053  C  CG2   . THR C  2  314  ? 40.951  -40.535 54.085   1.00 63.82  ? 314  THR C CG2   1 
ATOM   6054  N  N     . ALA C  2  315  ? 41.588  -43.892 55.978   1.00 64.73  ? 315  ALA C N     1 
ATOM   6055  C  CA    . ALA C  2  315  ? 40.807  -45.121 55.899   1.00 69.94  ? 315  ALA C CA    1 
ATOM   6056  C  C     . ALA C  2  315  ? 40.143  -45.463 57.231   1.00 65.06  ? 315  ALA C C     1 
ATOM   6057  O  O     . ALA C  2  315  ? 39.130  -46.161 57.268   1.00 64.34  ? 315  ALA C O     1 
ATOM   6058  C  CB    . ALA C  2  315  ? 41.680  -46.277 55.427   1.00 70.93  ? 315  ALA C CB    1 
ATOM   6059  N  N     . GLY C  2  316  ? 40.714  -44.964 58.323   1.00 60.72  ? 316  GLY C N     1 
ATOM   6060  C  CA    . GLY C  2  316  ? 40.198  -45.262 59.645   1.00 63.17  ? 316  GLY C CA    1 
ATOM   6061  C  C     . GLY C  2  316  ? 40.911  -46.436 60.288   1.00 70.34  ? 316  GLY C C     1 
ATOM   6062  O  O     . GLY C  2  316  ? 40.390  -47.061 61.213   1.00 71.40  ? 316  GLY C O     1 
ATOM   6063  N  N     . VAL C  2  317  ? 42.104  -46.742 59.787   1.00 69.98  ? 317  VAL C N     1 
ATOM   6064  C  CA    . VAL C  2  317  ? 42.913  -47.829 60.327   1.00 66.38  ? 317  VAL C CA    1 
ATOM   6065  C  C     . VAL C  2  317  ? 43.377  -47.524 61.748   1.00 67.63  ? 317  VAL C C     1 
ATOM   6066  O  O     . VAL C  2  317  ? 44.021  -46.502 61.987   1.00 69.46  ? 317  VAL C O     1 
ATOM   6067  C  CB    . VAL C  2  317  ? 44.149  -48.098 59.449   1.00 65.09  ? 317  VAL C CB    1 
ATOM   6068  C  CG1   . VAL C  2  317  ? 45.017  -49.179 60.072   1.00 66.23  ? 317  VAL C CG1   1 
ATOM   6069  C  CG2   . VAL C  2  317  ? 43.726  -48.484 58.038   1.00 67.25  ? 317  VAL C CG2   1 
ATOM   6070  N  N     . PRO C  2  318  ? 43.041  -48.412 62.698   1.00 67.01  ? 318  PRO C N     1 
ATOM   6071  C  CA    . PRO C  2  318  ? 43.429  -48.277 64.107   1.00 66.83  ? 318  PRO C CA    1 
ATOM   6072  C  C     . PRO C  2  318  ? 44.940  -48.160 64.271   1.00 66.03  ? 318  PRO C C     1 
ATOM   6073  O  O     . PRO C  2  318  ? 45.692  -48.795 63.531   1.00 60.51  ? 318  PRO C O     1 
ATOM   6074  C  CB    . PRO C  2  318  ? 42.932  -49.584 64.730   1.00 61.29  ? 318  PRO C CB    1 
ATOM   6075  C  CG    . PRO C  2  318  ? 41.804  -50.001 63.860   1.00 65.48  ? 318  PRO C CG    1 
ATOM   6076  C  CD    . PRO C  2  318  ? 42.198  -49.598 62.472   1.00 65.09  ? 318  PRO C CD    1 
ATOM   6077  N  N     . GLY C  2  319  ? 45.372  -47.353 65.234   1.00 67.82  ? 319  GLY C N     1 
ATOM   6078  C  CA    . GLY C  2  319  ? 46.786  -47.113 65.448   1.00 65.67  ? 319  GLY C CA    1 
ATOM   6079  C  C     . GLY C  2  319  ? 47.247  -45.846 64.756   1.00 70.85  ? 319  GLY C C     1 
ATOM   6080  O  O     . GLY C  2  319  ? 48.445  -45.622 64.579   1.00 70.99  ? 319  GLY C O     1 
ATOM   6081  N  N     . HIS C  2  320  ? 46.288  -45.015 64.360   1.00 73.92  ? 320  HIS C N     1 
ATOM   6082  C  CA    . HIS C  2  320  ? 46.592  -43.746 63.707   1.00 77.31  ? 320  HIS C CA    1 
ATOM   6083  C  C     . HIS C  2  320  ? 45.818  -42.597 64.347   1.00 80.44  ? 320  HIS C C     1 
ATOM   6084  O  O     . HIS C  2  320  ? 44.589  -42.628 64.425   1.00 79.76  ? 320  HIS C O     1 
ATOM   6085  C  CB    . HIS C  2  320  ? 46.292  -43.822 62.209   1.00 73.15  ? 320  HIS C CB    1 
ATOM   6086  C  CG    . HIS C  2  320  ? 47.141  -44.811 61.475   1.00 70.84  ? 320  HIS C CG    1 
ATOM   6087  N  ND1   . HIS C  2  320  ? 46.965  -46.174 61.591   1.00 69.46  ? 320  HIS C ND1   1 
ATOM   6088  C  CD2   . HIS C  2  320  ? 48.178  -44.637 60.621   1.00 67.30  ? 320  HIS C CD2   1 
ATOM   6089  C  CE1   . HIS C  2  320  ? 47.854  -46.796 60.837   1.00 70.74  ? 320  HIS C CE1   1 
ATOM   6090  N  NE2   . HIS C  2  320  ? 48.603  -45.886 60.239   1.00 69.26  ? 320  HIS C NE2   1 
ATOM   6091  N  N     . GLU C  2  321  ? 46.549  -41.585 64.803   1.00 79.46  ? 321  GLU C N     1 
ATOM   6092  C  CA    . GLU C  2  321  ? 45.946  -40.450 65.489   1.00 77.65  ? 321  GLU C CA    1 
ATOM   6093  C  C     . GLU C  2  321  ? 46.364  -39.131 64.854   1.00 72.25  ? 321  GLU C C     1 
ATOM   6094  O  O     . GLU C  2  321  ? 47.422  -39.036 64.230   1.00 67.28  ? 321  GLU C O     1 
ATOM   6095  C  CB    . GLU C  2  321  ? 46.354  -40.447 66.963   1.00 78.80  ? 321  GLU C CB    1 
ATOM   6096  C  CG    . GLU C  2  321  ? 45.990  -41.710 67.719   1.00 82.09  ? 321  GLU C CG    1 
ATOM   6097  C  CD    . GLU C  2  321  ? 46.644  -41.771 69.084   1.00 89.64  ? 321  GLU C CD    1 
ATOM   6098  O  OE1   . GLU C  2  321  ? 47.843  -41.433 69.184   1.00 87.77  ? 321  GLU C OE1   1 
ATOM   6099  O  OE2   . GLU C  2  321  ? 45.959  -42.150 70.057   1.00 92.70  ? 321  GLU C OE2   1 
ATOM   6100  N  N     . VAL C  2  322  ? 45.523  -38.115 65.013   1.00 69.31  ? 322  VAL C N     1 
ATOM   6101  C  CA    . VAL C  2  322  ? 45.884  -36.765 64.609   1.00 63.59  ? 322  VAL C CA    1 
ATOM   6102  C  C     . VAL C  2  322  ? 46.868  -36.197 65.621   1.00 59.47  ? 322  VAL C C     1 
ATOM   6103  O  O     . VAL C  2  322  ? 46.924  -36.648 66.766   1.00 55.32  ? 322  VAL C O     1 
ATOM   6104  C  CB    . VAL C  2  322  ? 44.653  -35.845 64.517   1.00 64.24  ? 322  VAL C CB    1 
ATOM   6105  C  CG1   . VAL C  2  322  ? 43.742  -36.293 63.389   1.00 67.19  ? 322  VAL C CG1   1 
ATOM   6106  C  CG2   . VAL C  2  322  ? 43.902  -35.832 65.839   1.00 63.71  ? 322  VAL C CG2   1 
ATOM   6107  N  N     . ASP C  2  323  ? 47.646  -35.209 65.196   1.00 55.11  ? 323  ASP C N     1 
ATOM   6108  C  CA    . ASP C  2  323  ? 48.644  -34.611 66.071   1.00 52.61  ? 323  ASP C CA    1 
ATOM   6109  C  C     . ASP C  2  323  ? 48.188  -33.271 66.632   1.00 48.89  ? 323  ASP C C     1 
ATOM   6110  O  O     . ASP C  2  323  ? 47.943  -32.325 65.884   1.00 49.63  ? 323  ASP C O     1 
ATOM   6111  C  CB    . ASP C  2  323  ? 49.973  -34.431 65.331   1.00 55.66  ? 323  ASP C CB    1 
ATOM   6112  C  CG    . ASP C  2  323  ? 50.654  -35.749 65.022   1.00 59.22  ? 323  ASP C CG    1 
ATOM   6113  O  OD1   . ASP C  2  323  ? 51.312  -36.305 65.927   1.00 57.32  ? 323  ASP C OD1   1 
ATOM   6114  O  OD2   . ASP C  2  323  ? 50.538  -36.224 63.872   1.00 61.36  ? 323  ASP C OD2   1 
ATOM   6115  N  N     . ASP C  2  324  ? 48.075  -33.195 67.953   1.00 45.44  ? 324  ASP C N     1 
ATOM   6116  C  CA    . ASP C  2  324  ? 47.878  -31.917 68.613   1.00 41.17  ? 324  ASP C CA    1 
ATOM   6117  C  C     . ASP C  2  324  ? 49.198  -31.181 68.442   1.00 39.77  ? 324  ASP C C     1 
ATOM   6118  O  O     . ASP C  2  324  ? 50.240  -31.672 68.870   1.00 42.80  ? 324  ASP C O     1 
ATOM   6119  C  CB    . ASP C  2  324  ? 47.585  -32.143 70.099   1.00 39.01  ? 324  ASP C CB    1 
ATOM   6120  C  CG    . ASP C  2  324  ? 47.148  -30.877 70.816   1.00 41.91  ? 324  ASP C CG    1 
ATOM   6121  O  OD1   . ASP C  2  324  ? 47.318  -29.774 70.255   1.00 47.21  ? 324  ASP C OD1   1 
ATOM   6122  O  OD2   . ASP C  2  324  ? 46.638  -30.986 71.953   1.00 37.80  ? 324  ASP C OD2   1 
ATOM   6123  N  N     . ILE C  2  325  ? 49.166  -30.008 67.820   1.00 36.32  ? 325  ILE C N     1 
ATOM   6124  C  CA    . ILE C  2  325  ? 50.411  -29.318 67.498   1.00 42.29  ? 325  ILE C CA    1 
ATOM   6125  C  C     . ILE C  2  325  ? 50.861  -28.383 68.614   1.00 42.47  ? 325  ILE C C     1 
ATOM   6126  O  O     . ILE C  2  325  ? 51.963  -27.835 68.570   1.00 43.02  ? 325  ILE C O     1 
ATOM   6127  C  CB    . ILE C  2  325  ? 50.323  -28.546 66.165   1.00 44.27  ? 325  ILE C CB    1 
ATOM   6128  C  CG1   . ILE C  2  325  ? 49.375  -27.354 66.290   1.00 42.07  ? 325  ILE C CG1   1 
ATOM   6129  C  CG2   . ILE C  2  325  ? 49.894  -29.478 65.041   1.00 44.03  ? 325  ILE C CG2   1 
ATOM   6130  C  CD1   . ILE C  2  325  ? 49.391  -26.445 65.082   1.00 40.88  ? 325  ILE C CD1   1 
ATOM   6131  N  N     . ASP C  2  326  ? 49.999  -28.194 69.607   1.00 38.10  ? 326  ASP C N     1 
ATOM   6132  C  CA    . ASP C  2  326  ? 50.366  -27.425 70.788   1.00 40.30  ? 326  ASP C CA    1 
ATOM   6133  C  C     . ASP C  2  326  ? 50.812  -28.348 71.918   1.00 39.22  ? 326  ASP C C     1 
ATOM   6134  O  O     . ASP C  2  326  ? 51.234  -27.888 72.981   1.00 38.21  ? 326  ASP C O     1 
ATOM   6135  C  CB    . ASP C  2  326  ? 49.204  -26.539 71.232   1.00 42.78  ? 326  ASP C CB    1 
ATOM   6136  C  CG    . ASP C  2  326  ? 48.932  -25.410 70.257   1.00 46.78  ? 326  ASP C CG    1 
ATOM   6137  O  OD1   . ASP C  2  326  ? 49.882  -24.669 69.921   1.00 41.14  ? 326  ASP C OD1   1 
ATOM   6138  O  OD2   . ASP C  2  326  ? 47.772  -25.270 69.816   1.00 53.41  ? 326  ASP C OD2   1 
ATOM   6139  N  N     . HIS C  2  327  ? 50.713  -29.652 71.673   1.00 37.29  ? 327  HIS C N     1 
ATOM   6140  C  CA    . HIS C  2  327  ? 51.212  -30.663 72.596   1.00 34.19  ? 327  HIS C CA    1 
ATOM   6141  C  C     . HIS C  2  327  ? 52.715  -30.456 72.731   1.00 35.47  ? 327  HIS C C     1 
ATOM   6142  O  O     . HIS C  2  327  ? 53.407  -30.265 71.731   1.00 36.30  ? 327  HIS C O     1 
ATOM   6143  C  CB    . HIS C  2  327  ? 50.910  -32.059 72.046   1.00 34.09  ? 327  HIS C CB    1 
ATOM   6144  C  CG    . HIS C  2  327  ? 51.108  -33.166 73.035   1.00 30.99  ? 327  HIS C CG    1 
ATOM   6145  N  ND1   . HIS C  2  327  ? 52.355  -33.579 73.451   1.00 28.99  ? 327  HIS C ND1   1 
ATOM   6146  C  CD2   . HIS C  2  327  ? 50.216  -33.961 73.672   1.00 32.58  ? 327  HIS C CD2   1 
ATOM   6147  C  CE1   . HIS C  2  327  ? 52.222  -34.573 74.311   1.00 32.99  ? 327  HIS C CE1   1 
ATOM   6148  N  NE2   . HIS C  2  327  ? 50.935  -34.824 74.464   1.00 31.62  ? 327  HIS C NE2   1 
ATOM   6149  N  N     . LEU C  2  328  ? 53.225  -30.484 73.958   1.00 33.59  ? 328  LEU C N     1 
ATOM   6150  C  CA    . LEU C  2  328  ? 54.633  -30.161 74.186   1.00 33.51  ? 328  LEU C CA    1 
ATOM   6151  C  C     . LEU C  2  328  ? 55.588  -31.229 73.657   1.00 35.97  ? 328  LEU C C     1 
ATOM   6152  O  O     . LEU C  2  328  ? 56.806  -31.035 73.639   1.00 34.52  ? 328  LEU C O     1 
ATOM   6153  C  CB    . LEU C  2  328  ? 54.904  -29.853 75.660   1.00 27.48  ? 328  LEU C CB    1 
ATOM   6154  C  CG    . LEU C  2  328  ? 54.700  -28.384 76.036   1.00 25.77  ? 328  LEU C CG    1 
ATOM   6155  C  CD1   . LEU C  2  328  ? 55.192  -28.109 77.446   1.00 28.41  ? 328  LEU C CD1   1 
ATOM   6156  C  CD2   . LEU C  2  328  ? 55.400  -27.474 75.036   1.00 25.04  ? 328  LEU C CD2   1 
ATOM   6157  N  N     . GLY C  2  329  ? 55.028  -32.353 73.222   1.00 35.86  ? 329  GLY C N     1 
ATOM   6158  C  CA    . GLY C  2  329  ? 55.798  -33.362 72.523   1.00 35.89  ? 329  GLY C CA    1 
ATOM   6159  C  C     . GLY C  2  329  ? 56.047  -32.929 71.092   1.00 35.93  ? 329  GLY C C     1 
ATOM   6160  O  O     . GLY C  2  329  ? 56.987  -33.391 70.447   1.00 40.34  ? 329  GLY C O     1 
ATOM   6161  N  N     . ASN C  2  330  ? 55.182  -32.056 70.584   1.00 32.96  ? 330  ASN C N     1 
ATOM   6162  C  CA    . ASN C  2  330  ? 55.345  -31.507 69.241   1.00 33.93  ? 330  ASN C CA    1 
ATOM   6163  C  C     . ASN C  2  330  ? 55.971  -30.108 69.191   1.00 34.21  ? 330  ASN C C     1 
ATOM   6164  O  O     . ASN C  2  330  ? 56.187  -29.555 68.111   1.00 32.36  ? 330  ASN C O     1 
ATOM   6165  C  CB    . ASN C  2  330  ? 54.013  -31.538 68.491   1.00 36.35  ? 330  ASN C CB    1 
ATOM   6166  C  CG    . ASN C  2  330  ? 53.433  -32.938 68.397   1.00 38.21  ? 330  ASN C CG    1 
ATOM   6167  O  OD1   . ASN C  2  330  ? 54.166  -33.922 68.299   1.00 42.05  ? 330  ASN C OD1   1 
ATOM   6168  N  ND2   . ASN C  2  330  ? 52.110  -33.033 68.431   1.00 40.95  ? 330  ASN C ND2   1 
ATOM   6169  N  N     . ARG C  2  331  ? 56.255  -29.537 70.359   1.00 33.76  ? 331  ARG C N     1 
ATOM   6170  C  CA    . ARG C  2  331  ? 56.919  -28.237 70.432   1.00 32.85  ? 331  ARG C CA    1 
ATOM   6171  C  C     . ARG C  2  331  ? 58.256  -28.356 71.157   1.00 29.82  ? 331  ARG C C     1 
ATOM   6172  O  O     . ARG C  2  331  ? 58.356  -29.018 72.190   1.00 31.50  ? 331  ARG C O     1 
ATOM   6173  C  CB    . ARG C  2  331  ? 56.030  -27.201 71.129   1.00 34.60  ? 331  ARG C CB    1 
ATOM   6174  C  CG    . ARG C  2  331  ? 54.710  -26.917 70.421   1.00 37.95  ? 331  ARG C CG    1 
ATOM   6175  C  CD    . ARG C  2  331  ? 53.891  -25.865 71.162   1.00 35.73  ? 331  ARG C CD    1 
ATOM   6176  N  NE    . ARG C  2  331  ? 54.478  -24.531 71.057   1.00 35.21  ? 331  ARG C NE    1 
ATOM   6177  C  CZ    . ARG C  2  331  ? 54.039  -23.468 71.724   1.00 32.16  ? 331  ARG C CZ    1 
ATOM   6178  N  NH1   . ARG C  2  331  ? 53.010  -23.583 72.553   1.00 35.32  ? 331  ARG C NH1   1 
ATOM   6179  N  NH2   . ARG C  2  331  ? 54.632  -22.292 71.568   1.00 24.62  ? 331  ARG C NH2   1 
ATOM   6180  N  N     . ARG C  2  332  ? 59.284  -27.714 70.613   1.00 26.21  ? 332  ARG C N     1 
ATOM   6181  C  CA    . ARG C  2  332  ? 60.618  -27.801 71.194   1.00 26.84  ? 332  ARG C CA    1 
ATOM   6182  C  C     . ARG C  2  332  ? 61.221  -26.424 71.461   1.00 27.45  ? 332  ARG C C     1 
ATOM   6183  O  O     . ARG C  2  332  ? 60.759  -25.414 70.923   1.00 27.14  ? 332  ARG C O     1 
ATOM   6184  C  CB    . ARG C  2  332  ? 61.544  -28.624 70.292   1.00 32.75  ? 332  ARG C CB    1 
ATOM   6185  C  CG    . ARG C  2  332  ? 61.735  -28.044 68.899   1.00 31.01  ? 332  ARG C CG    1 
ATOM   6186  C  CD    . ARG C  2  332  ? 62.618  -28.933 68.038   1.00 28.65  ? 332  ARG C CD    1 
ATOM   6187  N  NE    . ARG C  2  332  ? 63.971  -29.056 68.572   1.00 28.67  ? 332  ARG C NE    1 
ATOM   6188  C  CZ    . ARG C  2  332  ? 64.958  -28.205 68.310   1.00 29.80  ? 332  ARG C CZ    1 
ATOM   6189  N  NH1   . ARG C  2  332  ? 64.744  -27.160 67.523   1.00 28.51  ? 332  ARG C NH1   1 
ATOM   6190  N  NH2   . ARG C  2  332  ? 66.159  -28.396 68.838   1.00 28.88  ? 332  ARG C NH2   1 
ATOM   6191  N  N     . ILE C  2  333  ? 62.250  -26.392 72.302   1.00 25.46  ? 333  ILE C N     1 
ATOM   6192  C  CA    . ILE C  2  333  ? 62.922  -25.147 72.642   1.00 21.74  ? 333  ILE C CA    1 
ATOM   6193  C  C     . ILE C  2  333  ? 64.269  -25.056 71.949   1.00 21.87  ? 333  ILE C C     1 
ATOM   6194  O  O     . ILE C  2  333  ? 65.091  -25.964 72.050   1.00 24.04  ? 333  ILE C O     1 
ATOM   6195  C  CB    . ILE C  2  333  ? 63.173  -25.031 74.155   1.00 22.99  ? 333  ILE C CB    1 
ATOM   6196  C  CG1   . ILE C  2  333  ? 61.957  -25.515 74.945   1.00 22.37  ? 333  ILE C CG1   1 
ATOM   6197  C  CG2   . ILE C  2  333  ? 63.543  -23.600 74.526   1.00 20.89  ? 333  ILE C CG2   1 
ATOM   6198  C  CD1   . ILE C  2  333  ? 60.749  -24.626 74.812   1.00 26.82  ? 333  ILE C CD1   1 
ATOM   6199  N  N     . ARG C  2  334  ? 64.489  -23.954 71.244   1.00 25.12  ? 334  ARG C N     1 
ATOM   6200  C  CA    . ARG C  2  334  ? 65.795  -23.659 70.682   1.00 29.02  ? 334  ARG C CA    1 
ATOM   6201  C  C     . ARG C  2  334  ? 66.533  -22.793 71.687   1.00 29.37  ? 334  ARG C C     1 
ATOM   6202  O  O     . ARG C  2  334  ? 66.169  -21.636 71.911   1.00 32.27  ? 334  ARG C O     1 
ATOM   6203  C  CB    . ARG C  2  334  ? 65.656  -22.910 69.357   1.00 26.22  ? 334  ARG C CB    1 
ATOM   6204  C  CG    . ARG C  2  334  ? 64.732  -23.581 68.356   1.00 28.61  ? 334  ARG C CG    1 
ATOM   6205  C  CD    . ARG C  2  334  ? 64.492  -22.686 67.155   1.00 31.79  ? 334  ARG C CD    1 
ATOM   6206  N  NE    . ARG C  2  334  ? 65.665  -22.597 66.293   1.00 31.43  ? 334  ARG C NE    1 
ATOM   6207  C  CZ    . ARG C  2  334  ? 65.804  -21.705 65.319   1.00 34.11  ? 334  ARG C CZ    1 
ATOM   6208  N  NH1   . ARG C  2  334  ? 64.845  -20.817 65.089   1.00 31.60  ? 334  ARG C NH1   1 
ATOM   6209  N  NH2   . ARG C  2  334  ? 66.904  -21.696 64.580   1.00 38.49  ? 334  ARG C NH2   1 
ATOM   6210  N  N     . THR C  2  335  ? 67.569  -23.359 72.294   1.00 27.68  ? 335  THR C N     1 
ATOM   6211  C  CA    . THR C  2  335  ? 68.331  -22.659 73.317   1.00 27.16  ? 335  THR C CA    1 
ATOM   6212  C  C     . THR C  2  335  ? 69.402  -21.784 72.679   1.00 29.72  ? 335  THR C C     1 
ATOM   6213  O  O     . THR C  2  335  ? 69.465  -21.672 71.455   1.00 32.65  ? 335  THR C O     1 
ATOM   6214  C  CB    . THR C  2  335  ? 68.971  -23.648 74.293   1.00 27.19  ? 335  THR C CB    1 
ATOM   6215  O  OG1   . THR C  2  335  ? 69.739  -24.607 73.557   1.00 33.21  ? 335  THR C OG1   1 
ATOM   6216  C  CG2   . THR C  2  335  ? 67.898  -24.380 75.081   1.00 28.69  ? 335  THR C CG2   1 
ATOM   6217  N  N     . VAL C  2  336  ? 70.238  -21.166 73.509   1.00 29.65  ? 336  VAL C N     1 
ATOM   6218  C  CA    . VAL C  2  336  ? 71.247  -20.218 73.037   1.00 30.33  ? 336  VAL C CA    1 
ATOM   6219  C  C     . VAL C  2  336  ? 72.195  -20.840 72.017   1.00 32.79  ? 336  VAL C C     1 
ATOM   6220  O  O     . VAL C  2  336  ? 72.549  -20.214 71.010   1.00 32.62  ? 336  VAL C O     1 
ATOM   6221  C  CB    . VAL C  2  336  ? 72.075  -19.661 74.207   1.00 28.62  ? 336  VAL C CB    1 
ATOM   6222  C  CG1   . VAL C  2  336  ? 73.001  -18.557 73.724   1.00 26.28  ? 336  VAL C CG1   1 
ATOM   6223  C  CG2   . VAL C  2  336  ? 71.156  -19.149 75.297   1.00 30.97  ? 336  VAL C CG2   1 
ATOM   6224  N  N     . GLY C  2  337  ? 72.594  -22.080 72.284   1.00 35.84  ? 337  GLY C N     1 
ATOM   6225  C  CA    . GLY C  2  337  ? 73.499  -22.805 71.414   1.00 36.33  ? 337  GLY C CA    1 
ATOM   6226  C  C     . GLY C  2  337  ? 72.974  -22.947 70.000   1.00 34.64  ? 337  GLY C C     1 
ATOM   6227  O  O     . GLY C  2  337  ? 73.691  -22.675 69.041   1.00 34.47  ? 337  GLY C O     1 
ATOM   6228  N  N     . GLU C  2  338  ? 71.719  -23.366 69.873   1.00 31.92  ? 338  GLU C N     1 
ATOM   6229  C  CA    . GLU C  2  338  ? 71.102  -23.567 68.568   1.00 29.64  ? 338  GLU C CA    1 
ATOM   6230  C  C     . GLU C  2  338  ? 70.907  -22.245 67.824   1.00 31.40  ? 338  GLU C C     1 
ATOM   6231  O  O     . GLU C  2  338  ? 71.211  -22.138 66.630   1.00 38.03  ? 338  GLU C O     1 
ATOM   6232  C  CB    . GLU C  2  338  ? 69.769  -24.303 68.723   1.00 26.31  ? 338  GLU C CB    1 
ATOM   6233  C  CG    . GLU C  2  338  ? 69.107  -24.684 67.410   1.00 34.98  ? 338  GLU C CG    1 
ATOM   6234  C  CD    . GLU C  2  338  ? 68.059  -25.770 67.580   1.00 35.71  ? 338  GLU C CD    1 
ATOM   6235  O  OE1   . GLU C  2  338  ? 68.055  -26.434 68.639   1.00 27.23  ? 338  GLU C OE1   1 
ATOM   6236  O  OE2   . GLU C  2  338  ? 67.242  -25.961 66.653   1.00 37.48  ? 338  GLU C OE2   1 
ATOM   6237  N  N     . LEU C  2  339  ? 70.411  -21.241 68.542   1.00 28.65  ? 339  LEU C N     1 
ATOM   6238  C  CA    . LEU C  2  339  ? 70.148  -19.926 67.964   1.00 28.81  ? 339  LEU C CA    1 
ATOM   6239  C  C     . LEU C  2  339  ? 71.420  -19.263 67.449   1.00 34.04  ? 339  LEU C C     1 
ATOM   6240  O  O     . LEU C  2  339  ? 71.409  -18.616 66.401   1.00 39.26  ? 339  LEU C O     1 
ATOM   6241  C  CB    . LEU C  2  339  ? 69.464  -19.018 68.986   1.00 27.80  ? 339  LEU C CB    1 
ATOM   6242  C  CG    . LEU C  2  339  ? 68.103  -19.500 69.492   1.00 29.69  ? 339  LEU C CG    1 
ATOM   6243  C  CD1   . LEU C  2  339  ? 67.601  -18.606 70.610   1.00 26.94  ? 339  LEU C CD1   1 
ATOM   6244  C  CD2   . LEU C  2  339  ? 67.097  -19.559 68.355   1.00 31.20  ? 339  LEU C CD2   1 
ATOM   6245  N  N     . MET C  2  340  ? 72.513  -19.422 68.189   1.00 34.89  ? 340  MET C N     1 
ATOM   6246  C  CA    . MET C  2  340  ? 73.805  -18.899 67.756   1.00 35.63  ? 340  MET C CA    1 
ATOM   6247  C  C     . MET C  2  340  ? 74.347  -19.724 66.585   1.00 38.07  ? 340  MET C C     1 
ATOM   6248  O  O     . MET C  2  340  ? 74.856  -19.178 65.594   1.00 39.11  ? 340  MET C O     1 
ATOM   6249  C  CB    . MET C  2  340  ? 74.791  -18.909 68.929   1.00 31.97  ? 340  MET C CB    1 
ATOM   6250  C  CG    . MET C  2  340  ? 76.102  -18.179 68.677   1.00 34.37  ? 340  MET C CG    1 
ATOM   6251  S  SD    . MET C  2  340  ? 77.330  -19.156 67.787   1.00 49.85  ? 340  MET C SD    1 
ATOM   6252  C  CE    . MET C  2  340  ? 77.393  -20.629 68.807   1.00 41.05  ? 340  MET C CE    1 
ATOM   6253  N  N     . THR C  2  341  ? 74.222  -21.042 66.711   1.00 37.61  ? 341  THR C N     1 
ATOM   6254  C  CA    . THR C  2  341  ? 74.710  -21.982 65.708   1.00 36.31  ? 341  THR C CA    1 
ATOM   6255  C  C     . THR C  2  341  ? 74.120  -21.721 64.327   1.00 39.70  ? 341  THR C C     1 
ATOM   6256  O  O     . THR C  2  341  ? 74.832  -21.781 63.328   1.00 40.87  ? 341  THR C O     1 
ATOM   6257  C  CB    . THR C  2  341  ? 74.419  -23.441 66.119   1.00 35.98  ? 341  THR C CB    1 
ATOM   6258  O  OG1   . THR C  2  341  ? 75.113  -23.739 67.336   1.00 34.47  ? 341  THR C OG1   1 
ATOM   6259  C  CG2   . THR C  2  341  ? 74.866  -24.412 65.038   1.00 42.91  ? 341  THR C CG2   1 
ATOM   6260  N  N     . ASP C  2  342  ? 72.824  -21.426 64.270   1.00 38.89  ? 342  ASP C N     1 
ATOM   6261  C  CA    . ASP C  2  342  ? 72.180  -21.154 62.985   1.00 39.45  ? 342  ASP C CA    1 
ATOM   6262  C  C     . ASP C  2  342  ? 72.781  -19.949 62.262   1.00 40.65  ? 342  ASP C C     1 
ATOM   6263  O  O     . ASP C  2  342  ? 73.043  -20.004 61.057   1.00 46.43  ? 342  ASP C O     1 
ATOM   6264  C  CB    . ASP C  2  342  ? 70.669  -20.984 63.150   1.00 40.22  ? 342  ASP C CB    1 
ATOM   6265  C  CG    . ASP C  2  342  ? 69.921  -22.293 63.000   1.00 49.07  ? 342  ASP C CG    1 
ATOM   6266  O  OD1   . ASP C  2  342  ? 70.449  -23.335 63.446   1.00 45.60  ? 342  ASP C OD1   1 
ATOM   6267  O  OD2   . ASP C  2  342  ? 68.811  -22.282 62.426   1.00 52.45  ? 342  ASP C OD2   1 
ATOM   6268  N  N     . GLN C  2  343  ? 73.006  -18.866 62.998   1.00 38.13  ? 343  GLN C N     1 
ATOM   6269  C  CA    . GLN C  2  343  ? 73.617  -17.676 62.415   1.00 43.77  ? 343  GLN C CA    1 
ATOM   6270  C  C     . GLN C  2  343  ? 75.066  -17.933 62.009   1.00 42.38  ? 343  GLN C C     1 
ATOM   6271  O  O     . GLN C  2  343  ? 75.538  -17.419 60.984   1.00 42.07  ? 343  GLN C O     1 
ATOM   6272  C  CB    . GLN C  2  343  ? 73.520  -16.488 63.372   1.00 41.85  ? 343  GLN C CB    1 
ATOM   6273  C  CG    . GLN C  2  343  ? 72.104  -15.984 63.547   1.00 38.65  ? 343  GLN C CG    1 
ATOM   6274  C  CD    . GLN C  2  343  ? 71.417  -15.740 62.219   1.00 40.75  ? 343  GLN C CD    1 
ATOM   6275  O  OE1   . GLN C  2  343  ? 70.423  -16.389 61.894   1.00 43.20  ? 343  GLN C OE1   1 
ATOM   6276  N  NE2   . GLN C  2  343  ? 71.946  -14.803 61.440   1.00 39.72  ? 343  GLN C NE2   1 
ATOM   6277  N  N     . PHE C  2  344  ? 75.764  -18.734 62.811   1.00 41.38  ? 344  PHE C N     1 
ATOM   6278  C  CA    . PHE C  2  344  ? 77.113  -19.158 62.452   1.00 43.40  ? 344  PHE C CA    1 
ATOM   6279  C  C     . PHE C  2  344  ? 77.087  -19.898 61.115   1.00 47.06  ? 344  PHE C C     1 
ATOM   6280  O  O     . PHE C  2  344  ? 77.939  -19.678 60.253   1.00 45.87  ? 344  PHE C O     1 
ATOM   6281  C  CB    . PHE C  2  344  ? 77.716  -20.053 63.538   1.00 41.46  ? 344  PHE C CB    1 
ATOM   6282  C  CG    . PHE C  2  344  ? 79.174  -20.357 63.329   1.00 43.21  ? 344  PHE C CG    1 
ATOM   6283  C  CD1   . PHE C  2  344  ? 79.571  -21.495 62.647   1.00 45.67  ? 344  PHE C CD1   1 
ATOM   6284  C  CD2   . PHE C  2  344  ? 80.147  -19.498 63.808   1.00 41.82  ? 344  PHE C CD2   1 
ATOM   6285  C  CE1   . PHE C  2  344  ? 80.912  -21.770 62.450   1.00 45.04  ? 344  PHE C CE1   1 
ATOM   6286  C  CE2   . PHE C  2  344  ? 81.487  -19.766 63.615   1.00 38.74  ? 344  PHE C CE2   1 
ATOM   6287  C  CZ    . PHE C  2  344  ? 81.871  -20.904 62.936   1.00 41.66  ? 344  PHE C CZ    1 
ATOM   6288  N  N     . ARG C  2  345  ? 76.094  -20.767 60.952   1.00 47.50  ? 345  ARG C N     1 
ATOM   6289  C  CA    . ARG C  2  345  ? 75.920  -21.540 59.729   1.00 43.53  ? 345  ARG C CA    1 
ATOM   6290  C  C     . ARG C  2  345  ? 75.647  -20.637 58.533   1.00 41.12  ? 345  ARG C C     1 
ATOM   6291  O  O     . ARG C  2  345  ? 76.205  -20.843 57.457   1.00 44.20  ? 345  ARG C O     1 
ATOM   6292  C  CB    . ARG C  2  345  ? 74.784  -22.550 59.896   1.00 42.80  ? 345  ARG C CB    1 
ATOM   6293  C  CG    . ARG C  2  345  ? 74.309  -23.180 58.598   1.00 44.55  ? 345  ARG C CG    1 
ATOM   6294  C  CD    . ARG C  2  345  ? 73.241  -24.233 58.847   1.00 51.10  ? 345  ARG C CD    1 
ATOM   6295  N  NE    . ARG C  2  345  ? 73.770  -25.402 59.547   1.00 56.80  ? 345  ARG C NE    1 
ATOM   6296  C  CZ    . ARG C  2  345  ? 73.647  -25.616 60.854   1.00 53.72  ? 345  ARG C CZ    1 
ATOM   6297  N  NH1   . ARG C  2  345  ? 73.007  -24.739 61.616   1.00 53.96  ? 345  ARG C NH1   1 
ATOM   6298  N  NH2   . ARG C  2  345  ? 74.163  -26.709 61.400   1.00 48.01  ? 345  ARG C NH2   1 
ATOM   6299  N  N     . VAL C  2  346  ? 74.786  -19.641 58.726   1.00 40.25  ? 346  VAL C N     1 
ATOM   6300  C  CA    . VAL C  2  346  ? 74.485  -18.677 57.670   1.00 41.25  ? 346  VAL C CA    1 
ATOM   6301  C  C     . VAL C  2  346  ? 75.745  -17.945 57.212   1.00 43.18  ? 346  VAL C C     1 
ATOM   6302  O  O     . VAL C  2  346  ? 76.067  -17.919 56.014   1.00 44.86  ? 346  VAL C O     1 
ATOM   6303  C  CB    . VAL C  2  346  ? 73.435  -17.647 58.128   1.00 42.17  ? 346  VAL C CB    1 
ATOM   6304  C  CG1   . VAL C  2  346  ? 73.295  -16.533 57.099   1.00 41.85  ? 346  VAL C CG1   1 
ATOM   6305  C  CG2   . VAL C  2  346  ? 72.098  -18.329 58.377   1.00 41.38  ? 346  VAL C CG2   1 
ATOM   6306  N  N     . GLY C  2  347  ? 76.460  -17.360 58.171   1.00 45.19  ? 347  GLY C N     1 
ATOM   6307  C  CA    . GLY C  2  347  ? 77.702  -16.668 57.872   1.00 45.31  ? 347  GLY C CA    1 
ATOM   6308  C  C     . GLY C  2  347  ? 78.732  -17.577 57.226   1.00 47.57  ? 347  GLY C C     1 
ATOM   6309  O  O     . GLY C  2  347  ? 79.560  -17.133 56.424   1.00 47.10  ? 347  GLY C O     1 
ATOM   6310  N  N     . LEU C  2  348  ? 78.669  -18.861 57.570   1.00 45.93  ? 348  LEU C N     1 
ATOM   6311  C  CA    . LEU C  2  348  ? 79.592  -19.855 57.039   1.00 46.44  ? 348  LEU C CA    1 
ATOM   6312  C  C     . LEU C  2  348  ? 79.284  -20.179 55.580   1.00 47.13  ? 348  LEU C C     1 
ATOM   6313  O  O     . LEU C  2  348  ? 80.193  -20.338 54.763   1.00 49.51  ? 348  LEU C O     1 
ATOM   6314  C  CB    . LEU C  2  348  ? 79.535  -21.129 57.880   1.00 44.83  ? 348  LEU C CB    1 
ATOM   6315  C  CG    . LEU C  2  348  ? 80.881  -21.796 58.155   1.00 46.02  ? 348  LEU C CG    1 
ATOM   6316  C  CD1   . LEU C  2  348  ? 81.853  -20.790 58.751   1.00 39.86  ? 348  LEU C CD1   1 
ATOM   6317  C  CD2   . LEU C  2  348  ? 80.700  -22.984 59.082   1.00 42.87  ? 348  LEU C CD2   1 
ATOM   6318  N  N     . ALA C  2  349  ? 77.998  -20.280 55.261   1.00 42.67  ? 349  ALA C N     1 
ATOM   6319  C  CA    . ALA C  2  349  ? 77.569  -20.521 53.891   1.00 41.31  ? 349  ALA C CA    1 
ATOM   6320  C  C     . ALA C  2  349  ? 77.907  -19.319 53.017   1.00 44.05  ? 349  ALA C C     1 
ATOM   6321  O  O     . ALA C  2  349  ? 78.349  -19.477 51.876   1.00 52.48  ? 349  ALA C O     1 
ATOM   6322  C  CB    . ALA C  2  349  ? 76.083  -20.817 53.842   1.00 40.89  ? 349  ALA C CB    1 
ATOM   6323  N  N     . ARG C  2  350  ? 77.701  -18.118 53.554   1.00 42.53  ? 350  ARG C N     1 
ATOM   6324  C  CA    . ARG C  2  350  ? 78.090  -16.904 52.838   1.00 49.84  ? 350  ARG C CA    1 
ATOM   6325  C  C     . ARG C  2  350  ? 79.599  -16.892 52.588   1.00 51.80  ? 350  ARG C C     1 
ATOM   6326  O  O     . ARG C  2  350  ? 80.065  -16.543 51.493   1.00 52.37  ? 350  ARG C O     1 
ATOM   6327  C  CB    . ARG C  2  350  ? 77.667  -15.653 53.612   1.00 49.39  ? 350  ARG C CB    1 
ATOM   6328  C  CG    . ARG C  2  350  ? 76.161  -15.464 53.715   1.00 50.72  ? 350  ARG C CG    1 
ATOM   6329  C  CD    . ARG C  2  350  ? 75.814  -14.273 54.594   1.00 52.48  ? 350  ARG C CD    1 
ATOM   6330  N  NE    . ARG C  2  350  ? 74.374  -14.142 54.797   1.00 53.35  ? 350  ARG C NE    1 
ATOM   6331  C  CZ    . ARG C  2  350  ? 73.815  -13.297 55.657   1.00 57.03  ? 350  ARG C CZ    1 
ATOM   6332  N  NH1   . ARG C  2  350  ? 74.577  -12.506 56.402   1.00 58.32  ? 350  ARG C NH1   1 
ATOM   6333  N  NH2   . ARG C  2  350  ? 72.496  -13.244 55.778   1.00 59.44  ? 350  ARG C NH2   1 
ATOM   6334  N  N     . LEU C  2  351  ? 80.354  -17.285 53.611   1.00 50.55  ? 351  LEU C N     1 
ATOM   6335  C  CA    . LEU C  2  351  ? 81.802  -17.418 53.496   1.00 52.22  ? 351  LEU C CA    1 
ATOM   6336  C  C     . LEU C  2  351  ? 82.164  -18.392 52.377   1.00 54.56  ? 351  LEU C C     1 
ATOM   6337  O  O     . LEU C  2  351  ? 83.118  -18.166 51.632   1.00 55.10  ? 351  LEU C O     1 
ATOM   6338  C  CB    . LEU C  2  351  ? 82.403  -17.875 54.829   1.00 49.66  ? 351  LEU C CB    1 
ATOM   6339  C  CG    . LEU C  2  351  ? 83.920  -18.054 54.929   1.00 44.64  ? 351  LEU C CG    1 
ATOM   6340  C  CD1   . LEU C  2  351  ? 84.417  -17.571 56.280   1.00 43.34  ? 351  LEU C CD1   1 
ATOM   6341  C  CD2   . LEU C  2  351  ? 84.304  -19.509 54.720   1.00 45.15  ? 351  LEU C CD2   1 
ATOM   6342  N  N     . ALA C  2  352  ? 81.391  -19.469 52.261   1.00 53.73  ? 352  ALA C N     1 
ATOM   6343  C  CA    . ALA C  2  352  ? 81.598  -20.461 51.210   1.00 54.28  ? 352  ALA C CA    1 
ATOM   6344  C  C     . ALA C  2  352  ? 81.344  -19.873 49.824   1.00 54.24  ? 352  ALA C C     1 
ATOM   6345  O  O     . ALA C  2  352  ? 82.098  -20.132 48.881   1.00 55.99  ? 352  ALA C O     1 
ATOM   6346  C  CB    . ALA C  2  352  ? 80.713  -21.677 51.443   1.00 48.19  ? 352  ALA C CB    1 
ATOM   6347  N  N     . ARG C  2  353  ? 80.276  -19.086 49.707   1.00 54.22  ? 353  ARG C N     1 
ATOM   6348  C  CA    . ARG C  2  353  ? 79.966  -18.397 48.458   1.00 58.87  ? 353  ARG C CA    1 
ATOM   6349  C  C     . ARG C  2  353  ? 81.146  -17.516 48.062   1.00 62.08  ? 353  ARG C C     1 
ATOM   6350  O  O     . ARG C  2  353  ? 81.551  -17.481 46.894   1.00 64.62  ? 353  ARG C O     1 
ATOM   6351  C  CB    . ARG C  2  353  ? 78.696  -17.553 48.609   1.00 60.37  ? 353  ARG C CB    1 
ATOM   6352  C  CG    . ARG C  2  353  ? 77.874  -17.401 47.331   1.00 67.44  ? 353  ARG C CG    1 
ATOM   6353  C  CD    . ARG C  2  353  ? 78.397  -16.292 46.422   1.00 79.62  ? 353  ARG C CD    1 
ATOM   6354  N  NE    . ARG C  2  353  ? 78.143  -14.958 46.964   1.00 90.60  ? 353  ARG C NE    1 
ATOM   6355  C  CZ    . ARG C  2  353  ? 78.213  -13.835 46.255   1.00 86.60  ? 353  ARG C CZ    1 
ATOM   6356  N  NH1   . ARG C  2  353  ? 78.522  -13.878 44.965   1.00 82.51  ? 353  ARG C NH1   1 
ATOM   6357  N  NH2   . ARG C  2  353  ? 77.966  -12.666 46.831   1.00 75.71  ? 353  ARG C NH2   1 
ATOM   6358  N  N     . GLY C  2  354  ? 81.703  -16.817 49.049   1.00 62.47  ? 354  GLY C N     1 
ATOM   6359  C  CA    . GLY C  2  354  ? 82.885  -16.003 48.827   1.00 64.64  ? 354  GLY C CA    1 
ATOM   6360  C  C     . GLY C  2  354  ? 84.070  -16.829 48.358   1.00 63.83  ? 354  GLY C C     1 
ATOM   6361  O  O     . GLY C  2  354  ? 84.817  -16.418 47.462   1.00 67.49  ? 354  GLY C O     1 
ATOM   6362  N  N     . VAL C  2  355  ? 84.235  -18.003 48.962   1.00 60.39  ? 355  VAL C N     1 
ATOM   6363  C  CA    . VAL C  2  355  ? 85.318  -18.913 48.602   1.00 60.77  ? 355  VAL C CA    1 
ATOM   6364  C  C     . VAL C  2  355  ? 85.229  -19.357 47.145   1.00 61.25  ? 355  VAL C C     1 
ATOM   6365  O  O     . VAL C  2  355  ? 86.215  -19.290 46.415   1.00 59.65  ? 355  VAL C O     1 
ATOM   6366  C  CB    . VAL C  2  355  ? 85.349  -20.153 49.521   1.00 57.59  ? 355  VAL C CB    1 
ATOM   6367  C  CG1   . VAL C  2  355  ? 86.244  -21.236 48.935   1.00 56.48  ? 355  VAL C CG1   1 
ATOM   6368  C  CG2   . VAL C  2  355  ? 85.818  -19.766 50.914   1.00 58.30  ? 355  VAL C CG2   1 
ATOM   6369  N  N     . ARG C  2  356  ? 84.048  -19.804 46.724   1.00 62.08  ? 356  ARG C N     1 
ATOM   6370  C  CA    . ARG C  2  356  ? 83.842  -20.217 45.336   1.00 58.40  ? 356  ARG C CA    1 
ATOM   6371  C  C     . ARG C  2  356  ? 84.047  -19.056 44.365   1.00 60.28  ? 356  ARG C C     1 
ATOM   6372  O  O     . ARG C  2  356  ? 84.715  -19.200 43.330   1.00 63.47  ? 356  ARG C O     1 
ATOM   6373  C  CB    . ARG C  2  356  ? 82.448  -20.825 45.153   1.00 52.36  ? 356  ARG C CB    1 
ATOM   6374  C  CG    . ARG C  2  356  ? 82.387  -22.320 45.420   1.00 60.25  ? 356  ARG C CG    1 
ATOM   6375  C  CD    . ARG C  2  356  ? 80.967  -22.859 45.315   1.00 69.47  ? 356  ARG C CD    1 
ATOM   6376  N  NE    . ARG C  2  356  ? 80.283  -22.884 46.606   1.00 73.06  ? 356  ARG C NE    1 
ATOM   6377  C  CZ    . ARG C  2  356  ? 80.149  -23.971 47.362   1.00 66.07  ? 356  ARG C CZ    1 
ATOM   6378  N  NH1   . ARG C  2  356  ? 79.510  -23.901 48.522   1.00 61.73  ? 356  ARG C NH1   1 
ATOM   6379  N  NH2   . ARG C  2  356  ? 80.650  -25.130 46.956   1.00 57.51  ? 356  ARG C NH2   1 
ATOM   6380  N  N     . GLU C  2  357  ? 83.475  -17.906 44.713   1.00 63.53  ? 357  GLU C N     1 
ATOM   6381  C  CA    . GLU C  2  357  ? 83.584  -16.712 43.882   1.00 66.44  ? 357  GLU C CA    1 
ATOM   6382  C  C     . GLU C  2  357  ? 85.039  -16.298 43.675   1.00 68.68  ? 357  GLU C C     1 
ATOM   6383  O  O     . GLU C  2  357  ? 85.419  -15.867 42.586   1.00 69.45  ? 357  GLU C O     1 
ATOM   6384  C  CB    . GLU C  2  357  ? 82.782  -15.558 44.490   1.00 72.12  ? 357  GLU C CB    1 
ATOM   6385  C  CG    . GLU C  2  357  ? 82.741  -14.307 43.627   1.00 76.92  ? 357  GLU C CG    1 
ATOM   6386  C  CD    . GLU C  2  357  ? 81.838  -13.232 44.200   1.00 79.53  ? 357  GLU C CD    1 
ATOM   6387  O  OE1   . GLU C  2  357  ? 82.346  -12.350 44.923   1.00 82.48  ? 357  GLU C OE1   1 
ATOM   6388  O  OE2   . GLU C  2  357  ? 80.619  -13.269 43.926   1.00 77.69  ? 357  GLU C OE2   1 
ATOM   6389  N  N     . ARG C  2  358  ? 85.853  -16.436 44.718   1.00 69.60  ? 358  ARG C N     1 
ATOM   6390  C  CA    . ARG C  2  358  ? 87.276  -16.120 44.604   1.00 71.47  ? 358  ARG C CA    1 
ATOM   6391  C  C     . ARG C  2  358  ? 88.074  -17.279 44.009   1.00 74.99  ? 358  ARG C C     1 
ATOM   6392  O  O     . ARG C  2  358  ? 89.224  -17.106 43.603   1.00 76.25  ? 358  ARG C O     1 
ATOM   6393  C  CB    . ARG C  2  358  ? 87.856  -15.707 45.959   1.00 68.66  ? 358  ARG C CB    1 
ATOM   6394  C  CG    . ARG C  2  358  ? 87.343  -14.368 46.453   1.00 69.72  ? 358  ARG C CG    1 
ATOM   6395  C  CD    . ARG C  2  358  ? 87.895  -14.015 47.821   1.00 64.98  ? 358  ARG C CD    1 
ATOM   6396  N  NE    . ARG C  2  358  ? 87.257  -12.813 48.348   1.00 64.33  ? 358  ARG C NE    1 
ATOM   6397  C  CZ    . ARG C  2  358  ? 86.114  -12.813 49.026   1.00 62.17  ? 358  ARG C CZ    1 
ATOM   6398  N  NH1   . ARG C  2  358  ? 85.600  -11.672 49.464   1.00 59.74  ? 358  ARG C NH1   1 
ATOM   6399  N  NH2   . ARG C  2  358  ? 85.483  -13.954 49.265   1.00 60.42  ? 358  ARG C NH2   1 
ATOM   6400  N  N     . MET C  2  359  ? 87.461  -18.457 43.957   1.00 73.92  ? 359  MET C N     1 
ATOM   6401  C  CA    . MET C  2  359  ? 88.099  -19.624 43.360   1.00 68.50  ? 359  MET C CA    1 
ATOM   6402  C  C     . MET C  2  359  ? 88.033  -19.563 41.842   1.00 74.08  ? 359  MET C C     1 
ATOM   6403  O  O     . MET C  2  359  ? 89.002  -19.895 41.159   1.00 78.96  ? 359  MET C O     1 
ATOM   6404  C  CB    . MET C  2  359  ? 87.459  -20.923 43.855   1.00 59.66  ? 359  MET C CB    1 
ATOM   6405  C  CG    . MET C  2  359  ? 88.138  -21.523 45.071   1.00 59.14  ? 359  MET C CG    1 
ATOM   6406  S  SD    . MET C  2  359  ? 87.739  -23.266 45.298   1.00 64.54  ? 359  MET C SD    1 
ATOM   6407  C  CE    . MET C  2  359  ? 85.986  -23.182 45.641   1.00 68.08  ? 359  MET C CE    1 
ATOM   6408  N  N     . LEU C  2  360  ? 86.887  -19.142 41.316   1.00 74.68  ? 360  LEU C N     1 
ATOM   6409  C  CA    . LEU C  2  360  ? 86.724  -19.046 39.867   1.00 75.07  ? 360  LEU C CA    1 
ATOM   6410  C  C     . LEU C  2  360  ? 87.659  -18.007 39.243   1.00 79.16  ? 360  LEU C C     1 
ATOM   6411  O  O     . LEU C  2  360  ? 88.169  -18.203 38.140   1.00 77.99  ? 360  LEU C O     1 
ATOM   6412  C  CB    . LEU C  2  360  ? 85.270  -18.740 39.504   1.00 70.17  ? 360  LEU C CB    1 
ATOM   6413  C  CG    . LEU C  2  360  ? 84.580  -19.790 38.632   1.00 66.45  ? 360  LEU C CG    1 
ATOM   6414  C  CD1   . LEU C  2  360  ? 84.584  -21.148 39.321   1.00 59.06  ? 360  LEU C CD1   1 
ATOM   6415  C  CD2   . LEU C  2  360  ? 83.162  -19.361 38.292   1.00 70.16  ? 360  LEU C CD2   1 
ATOM   6416  N  N     . MET C  2  361  ? 87.881  -16.907 39.955   1.00 80.51  ? 361  MET C N     1 
ATOM   6417  C  CA    . MET C  2  361  ? 88.731  -15.827 39.461   1.00 82.62  ? 361  MET C CA    1 
ATOM   6418  C  C     . MET C  2  361  ? 90.175  -15.996 39.925   1.00 89.58  ? 361  MET C C     1 
ATOM   6419  O  O     . MET C  2  361  ? 90.538  -17.025 40.495   1.00 91.10  ? 361  MET C O     1 
ATOM   6420  C  CB    . MET C  2  361  ? 88.199  -14.473 39.935   1.00 85.73  ? 361  MET C CB    1 
ATOM   6421  C  CG    . MET C  2  361  ? 86.725  -14.228 39.644   1.00 88.76  ? 361  MET C CG    1 
ATOM   6422  S  SD    . MET C  2  361  ? 86.344  -14.066 37.888   1.00 90.24  ? 361  MET C SD    1 
ATOM   6423  C  CE    . MET C  2  361  ? 85.596  -15.658 37.546   1.00 76.54  ? 361  MET C CE    1 
ATOM   6424  N  N     . GLY C  2  362  ? 90.995  -14.981 39.665   1.00 94.70  ? 362  GLY C N     1 
ATOM   6425  C  CA    . GLY C  2  362  ? 92.358  -14.938 40.169   1.00 100.71 ? 362  GLY C CA    1 
ATOM   6426  C  C     . GLY C  2  362  ? 93.287  -15.970 39.560   1.00 107.80 ? 362  GLY C C     1 
ATOM   6427  O  O     . GLY C  2  362  ? 92.880  -16.768 38.715   1.00 105.68 ? 362  GLY C O     1 
ATOM   6428  N  N     . SER C  2  363  ? 94.545  -15.951 39.991   1.00 109.35 ? 363  SER C N     1 
ATOM   6429  C  CA    . SER C  2  363  ? 95.513  -16.945 39.548   1.00 109.69 ? 363  SER C CA    1 
ATOM   6430  C  C     . SER C  2  363  ? 95.160  -18.297 40.154   1.00 109.84 ? 363  SER C C     1 
ATOM   6431  O  O     . SER C  2  363  ? 95.047  -18.430 41.371   1.00 107.47 ? 363  SER C O     1 
ATOM   6432  C  CB    . SER C  2  363  ? 96.933  -16.540 39.951   1.00 98.75  ? 363  SER C CB    1 
ATOM   6433  O  OG    . SER C  2  363  ? 97.298  -15.302 39.368   1.00 101.39 ? 363  SER C OG    1 
ATOM   6434  N  N     . GLU C  2  364  ? 94.985  -19.298 39.298   1.00 115.01 ? 364  GLU C N     1 
ATOM   6435  C  CA    . GLU C  2  364  ? 94.610  -20.630 39.751   1.00 116.24 ? 364  GLU C CA    1 
ATOM   6436  C  C     . GLU C  2  364  ? 95.807  -21.364 40.342   1.00 112.93 ? 364  GLU C C     1 
ATOM   6437  O  O     . GLU C  2  364  ? 95.656  -22.413 40.970   1.00 105.57 ? 364  GLU C O     1 
ATOM   6438  C  CB    . GLU C  2  364  ? 94.004  -21.438 38.601   1.00 119.73 ? 364  GLU C CB    1 
ATOM   6439  C  CG    . GLU C  2  364  ? 92.754  -20.818 37.993   1.00 118.39 ? 364  GLU C CG    1 
ATOM   6440  C  CD    . GLU C  2  364  ? 91.573  -20.816 38.946   1.00 108.98 ? 364  GLU C CD    1 
ATOM   6441  O  OE1   . GLU C  2  364  ? 90.645  -20.005 38.741   1.00 101.47 ? 364  GLU C OE1   1 
ATOM   6442  O  OE2   . GLU C  2  364  ? 91.567  -21.628 39.897   1.00 104.33 ? 364  GLU C OE2   1 
ATOM   6443  N  N     . ASP C  2  365  ? 96.995  -20.800 40.144   1.00 110.76 ? 365  ASP C N     1 
ATOM   6444  C  CA    . ASP C  2  365  ? 98.216  -21.384 40.686   1.00 110.58 ? 365  ASP C CA    1 
ATOM   6445  C  C     . ASP C  2  365  ? 98.507  -20.887 42.098   1.00 107.46 ? 365  ASP C C     1 
ATOM   6446  O  O     . ASP C  2  365  ? 98.547  -21.679 43.039   1.00 107.53 ? 365  ASP C O     1 
ATOM   6447  C  CB    . ASP C  2  365  ? 99.418  -21.138 39.771   1.00 109.63 ? 365  ASP C CB    1 
ATOM   6448  C  CG    . ASP C  2  365  ? 100.604 -22.012 40.131   1.00 106.27 ? 365  ASP C CG    1 
ATOM   6449  O  OD1   . ASP C  2  365  ? 100.396 -23.054 40.792   1.00 100.44 ? 365  ASP C OD1   1 
ATOM   6450  O  OD2   . ASP C  2  365  ? 101.740 -21.662 39.752   1.00 108.77 ? 365  ASP C OD2   1 
ATOM   6451  N  N     . SER C  2  366  ? 98.714  -19.582 42.253   1.00 105.07 ? 366  SER C N     1 
ATOM   6452  C  CA    . SER C  2  366  ? 99.025  -19.063 43.573   1.00 103.25 ? 366  SER C CA    1 
ATOM   6453  C  C     . SER C  2  366  ? 97.750  -18.631 44.273   1.00 101.80 ? 366  SER C C     1 
ATOM   6454  O  O     . SER C  2  366  ? 97.173  -17.585 43.972   1.00 101.87 ? 366  SER C O     1 
ATOM   6455  C  CB    . SER C  2  366  ? 99.976  -17.870 43.461   1.00 101.89 ? 366  SER C CB    1 
ATOM   6456  O  OG    . SER C  2  366  ? 99.381  -16.811 42.728   1.00 89.75  ? 366  SER C OG    1 
ATOM   6457  N  N     . LEU C  2  367  ? 97.337  -19.457 45.227   1.00 96.85  ? 367  LEU C N     1 
ATOM   6458  C  CA    . LEU C  2  367  ? 96.225  -19.174 46.117   1.00 85.18  ? 367  LEU C CA    1 
ATOM   6459  C  C     . LEU C  2  367  ? 96.449  -19.957 47.396   1.00 84.08  ? 367  LEU C C     1 
ATOM   6460  O  O     . LEU C  2  367  ? 96.929  -21.089 47.361   1.00 83.59  ? 367  LEU C O     1 
ATOM   6461  C  CB    . LEU C  2  367  ? 94.896  -19.593 45.487   1.00 81.22  ? 367  LEU C CB    1 
ATOM   6462  C  CG    . LEU C  2  367  ? 94.249  -18.636 44.484   1.00 80.00  ? 367  LEU C CG    1 
ATOM   6463  C  CD1   . LEU C  2  367  ? 92.934  -19.199 43.965   1.00 82.52  ? 367  LEU C CD1   1 
ATOM   6464  C  CD2   . LEU C  2  367  ? 94.042  -17.271 45.117   1.00 73.95  ? 367  LEU C CD2   1 
ATOM   6465  N  N     . THR C  2  368  ? 96.085  -19.363 48.523   1.00 81.46  ? 368  THR C N     1 
ATOM   6466  C  CA    . THR C  2  368  ? 96.183  -20.036 49.807   1.00 78.52  ? 368  THR C CA    1 
ATOM   6467  C  C     . THR C  2  368  ? 94.846  -19.873 50.517   1.00 72.20  ? 368  THR C C     1 
ATOM   6468  O  O     . THR C  2  368  ? 94.075  -18.978 50.170   1.00 70.46  ? 368  THR C O     1 
ATOM   6469  C  CB    . THR C  2  368  ? 97.324  -19.446 50.668   1.00 75.70  ? 368  THR C CB    1 
ATOM   6470  O  OG1   . THR C  2  368  ? 97.177  -18.023 50.755   1.00 75.54  ? 368  THR C OG1   1 
ATOM   6471  C  CG2   . THR C  2  368  ? 98.681  -19.775 50.059   1.00 70.13  ? 368  THR C CG2   1 
ATOM   6472  N  N     . PRO C  2  369  ? 94.554  -20.745 51.498   1.00 67.09  ? 369  PRO C N     1 
ATOM   6473  C  CA    . PRO C  2  369  ? 93.316  -20.597 52.272   1.00 64.41  ? 369  PRO C CA    1 
ATOM   6474  C  C     . PRO C  2  369  ? 93.159  -19.198 52.868   1.00 63.77  ? 369  PRO C C     1 
ATOM   6475  O  O     . PRO C  2  369  ? 92.036  -18.759 53.106   1.00 61.41  ? 369  PRO C O     1 
ATOM   6476  C  CB    . PRO C  2  369  ? 93.484  -21.632 53.383   1.00 60.26  ? 369  PRO C CB    1 
ATOM   6477  C  CG    . PRO C  2  369  ? 94.297  -22.702 52.751   1.00 62.71  ? 369  PRO C CG    1 
ATOM   6478  C  CD    . PRO C  2  369  ? 95.258  -21.998 51.829   1.00 63.95  ? 369  PRO C CD    1 
ATOM   6479  N  N     . ALA C  2  370  ? 94.274  -18.510 53.096   1.00 66.90  ? 370  ALA C N     1 
ATOM   6480  C  CA    . ALA C  2  370  ? 94.243  -17.135 53.580   1.00 66.58  ? 370  ALA C CA    1 
ATOM   6481  C  C     . ALA C  2  370  ? 93.676  -16.180 52.531   1.00 65.06  ? 370  ALA C C     1 
ATOM   6482  O  O     . ALA C  2  370  ? 92.917  -15.268 52.857   1.00 66.20  ? 370  ALA C O     1 
ATOM   6483  C  CB    . ALA C  2  370  ? 95.634  -16.692 54.012   1.00 65.69  ? 370  ALA C CB    1 
ATOM   6484  N  N     . LYS C  2  371  ? 94.051  -16.389 51.273   1.00 65.83  ? 371  LYS C N     1 
ATOM   6485  C  CA    . LYS C  2  371  ? 93.580  -15.534 50.188   1.00 66.78  ? 371  LYS C CA    1 
ATOM   6486  C  C     . LYS C  2  371  ? 92.182  -15.918 49.701   1.00 63.24  ? 371  LYS C C     1 
ATOM   6487  O  O     . LYS C  2  371  ? 91.488  -15.109 49.086   1.00 60.00  ? 371  LYS C O     1 
ATOM   6488  C  CB    . LYS C  2  371  ? 94.572  -15.546 49.023   1.00 69.79  ? 371  LYS C CB    1 
ATOM   6489  C  CG    . LYS C  2  371  ? 95.937  -14.969 49.367   1.00 67.74  ? 371  LYS C CG    1 
ATOM   6490  C  CD    . LYS C  2  371  ? 96.873  -15.009 48.170   1.00 70.99  ? 371  LYS C CD    1 
ATOM   6491  C  CE    . LYS C  2  371  ? 98.214  -14.375 48.496   1.00 69.61  ? 371  LYS C CE    1 
ATOM   6492  N  NZ    . LYS C  2  371  ? 99.146  -14.432 47.337   1.00 77.54  ? 371  LYS C NZ    1 
ATOM   6493  N  N     . LEU C  2  372  ? 91.779  -17.157 49.966   1.00 63.27  ? 372  LEU C N     1 
ATOM   6494  C  CA    . LEU C  2  372  ? 90.444  -17.617 49.592   1.00 66.60  ? 372  LEU C CA    1 
ATOM   6495  C  C     . LEU C  2  372  ? 89.367  -17.197 50.590   1.00 66.41  ? 372  LEU C C     1 
ATOM   6496  O  O     . LEU C  2  372  ? 88.284  -16.757 50.200   1.00 63.54  ? 372  LEU C O     1 
ATOM   6497  C  CB    . LEU C  2  372  ? 90.416  -19.139 49.432   1.00 62.68  ? 372  LEU C CB    1 
ATOM   6498  C  CG    . LEU C  2  372  ? 91.113  -19.746 48.216   1.00 63.40  ? 372  LEU C CG    1 
ATOM   6499  C  CD1   . LEU C  2  372  ? 90.745  -21.215 48.094   1.00 62.95  ? 372  LEU C CD1   1 
ATOM   6500  C  CD2   . LEU C  2  372  ? 90.732  -18.995 46.953   1.00 66.55  ? 372  LEU C CD2   1 
ATOM   6501  N  N     . VAL C  2  373  ? 89.675  -17.332 51.876   1.00 60.94  ? 373  VAL C N     1 
ATOM   6502  C  CA    . VAL C  2  373  ? 88.670  -17.185 52.925   1.00 53.51  ? 373  VAL C CA    1 
ATOM   6503  C  C     . VAL C  2  373  ? 88.480  -15.748 53.408   1.00 52.40  ? 373  VAL C C     1 
ATOM   6504  O  O     . VAL C  2  373  ? 89.417  -15.108 53.885   1.00 47.75  ? 373  VAL C O     1 
ATOM   6505  C  CB    . VAL C  2  373  ? 88.979  -18.093 54.135   1.00 45.68  ? 373  VAL C CB    1 
ATOM   6506  C  CG1   . VAL C  2  373  ? 87.993  -17.834 55.258   1.00 44.17  ? 373  VAL C CG1   1 
ATOM   6507  C  CG2   . VAL C  2  373  ? 88.946  -19.557 53.723   1.00 45.57  ? 373  VAL C CG2   1 
ATOM   6508  N  N     . ASN C  2  374  ? 87.254  -15.254 53.274   1.00 55.10  ? 374  ASN C N     1 
ATOM   6509  C  CA    . ASN C  2  374  ? 86.871  -13.968 53.838   1.00 50.31  ? 374  ASN C CA    1 
ATOM   6510  C  C     . ASN C  2  374  ? 85.915  -14.198 55.001   1.00 51.24  ? 374  ASN C C     1 
ATOM   6511  O  O     . ASN C  2  374  ? 84.815  -14.717 54.816   1.00 49.81  ? 374  ASN C O     1 
ATOM   6512  C  CB    . ASN C  2  374  ? 86.215  -13.085 52.775   1.00 47.79  ? 374  ASN C CB    1 
ATOM   6513  C  CG    . ASN C  2  374  ? 86.087  -11.637 53.215   1.00 51.58  ? 374  ASN C CG    1 
ATOM   6514  O  OD1   . ASN C  2  374  ? 86.020  -11.339 54.407   1.00 54.42  ? 374  ASN C OD1   1 
ATOM   6515  N  ND2   . ASN C  2  374  ? 86.054  -10.727 52.249   1.00 55.66  ? 374  ASN C ND2   1 
ATOM   6516  N  N     . SER C  2  375  ? 86.343  -13.811 56.199   1.00 52.37  ? 375  SER C N     1 
ATOM   6517  C  CA    . SER C  2  375  ? 85.586  -14.090 57.415   1.00 50.76  ? 375  SER C CA    1 
ATOM   6518  C  C     . SER C  2  375  ? 84.494  -13.060 57.693   1.00 51.08  ? 375  SER C C     1 
ATOM   6519  O  O     . SER C  2  375  ? 83.611  -13.298 58.520   1.00 51.39  ? 375  SER C O     1 
ATOM   6520  C  CB    . SER C  2  375  ? 86.530  -14.181 58.616   1.00 50.13  ? 375  SER C CB    1 
ATOM   6521  O  OG    . SER C  2  375  ? 87.219  -12.959 58.817   1.00 51.62  ? 375  SER C OG    1 
ATOM   6522  N  N     . ARG C  2  376  ? 84.559  -11.926 57.001   1.00 49.06  ? 376  ARG C N     1 
ATOM   6523  C  CA    . ARG C  2  376  ? 83.606  -10.826 57.195   1.00 50.38  ? 376  ARG C CA    1 
ATOM   6524  C  C     . ARG C  2  376  ? 82.116  -11.210 57.240   1.00 47.06  ? 376  ARG C C     1 
ATOM   6525  O  O     . ARG C  2  376  ? 81.390  -10.713 58.098   1.00 45.34  ? 376  ARG C O     1 
ATOM   6526  C  CB    . ARG C  2  376  ? 83.845  -9.698  56.180   1.00 50.17  ? 376  ARG C CB    1 
ATOM   6527  C  CG    . ARG C  2  376  ? 84.651  -8.521  56.721   1.00 49.64  ? 376  ARG C CG    1 
ATOM   6528  C  CD    . ARG C  2  376  ? 86.050  -8.940  57.151   1.00 52.65  ? 376  ARG C CD    1 
ATOM   6529  N  NE    . ARG C  2  376  ? 86.879  -7.791  57.510   1.00 51.56  ? 376  ARG C NE    1 
ATOM   6530  C  CZ    . ARG C  2  376  ? 87.544  -7.674  58.655   1.00 53.54  ? 376  ARG C CZ    1 
ATOM   6531  N  NH1   . ARG C  2  376  ? 87.484  -8.640  59.562   1.00 53.53  ? 376  ARG C NH1   1 
ATOM   6532  N  NH2   . ARG C  2  376  ? 88.274  -6.592  58.894   1.00 51.40  ? 376  ARG C NH2   1 
ATOM   6533  N  N     . PRO C  2  377  ? 81.649  -12.082 56.324   1.00 45.93  ? 377  PRO C N     1 
ATOM   6534  C  CA    . PRO C  2  377  ? 80.239  -12.481 56.434   1.00 49.14  ? 377  PRO C CA    1 
ATOM   6535  C  C     . PRO C  2  377  ? 79.917  -13.268 57.709   1.00 49.28  ? 377  PRO C C     1 
ATOM   6536  O  O     . PRO C  2  377  ? 78.812  -13.136 58.240   1.00 52.01  ? 377  PRO C O     1 
ATOM   6537  C  CB    . PRO C  2  377  ? 80.023  -13.360 55.195   1.00 47.21  ? 377  PRO C CB    1 
ATOM   6538  C  CG    . PRO C  2  377  ? 81.387  -13.782 54.773   1.00 45.20  ? 377  PRO C CG    1 
ATOM   6539  C  CD    . PRO C  2  377  ? 82.266  -12.622 55.100   1.00 46.36  ? 377  PRO C CD    1 
ATOM   6540  N  N     . LEU C  2  378  ? 80.863  -14.069 58.191   1.00 43.39  ? 378  LEU C N     1 
ATOM   6541  C  CA    . LEU C  2  378  ? 80.655  -14.844 59.411   1.00 43.17  ? 378  LEU C CA    1 
ATOM   6542  C  C     . LEU C  2  378  ? 80.626  -13.937 60.638   1.00 44.22  ? 378  LEU C C     1 
ATOM   6543  O  O     . LEU C  2  378  ? 79.725  -14.031 61.485   1.00 42.31  ? 378  LEU C O     1 
ATOM   6544  C  CB    . LEU C  2  378  ? 81.751  -15.898 59.567   1.00 41.71  ? 378  LEU C CB    1 
ATOM   6545  C  CG    . LEU C  2  378  ? 81.635  -16.789 60.804   1.00 41.07  ? 378  LEU C CG    1 
ATOM   6546  C  CD1   . LEU C  2  378  ? 80.306  -17.523 60.808   1.00 38.89  ? 378  LEU C CD1   1 
ATOM   6547  C  CD2   . LEU C  2  378  ? 82.793  -17.771 60.869   1.00 43.15  ? 378  LEU C CD2   1 
ATOM   6548  N  N     . GLU C  2  379  ? 81.625  -13.062 60.724   1.00 43.93  ? 379  GLU C N     1 
ATOM   6549  C  CA    . GLU C  2  379  ? 81.709  -12.081 61.796   1.00 44.59  ? 379  GLU C CA    1 
ATOM   6550  C  C     . GLU C  2  379  ? 80.450  -11.227 61.823   1.00 43.51  ? 379  GLU C C     1 
ATOM   6551  O  O     . GLU C  2  379  ? 79.883  -10.976 62.885   1.00 44.54  ? 379  GLU C O     1 
ATOM   6552  C  CB    . GLU C  2  379  ? 82.932  -11.180 61.606   1.00 49.94  ? 379  GLU C CB    1 
ATOM   6553  C  CG    . GLU C  2  379  ? 84.262  -11.916 61.573   1.00 55.83  ? 379  GLU C CG    1 
ATOM   6554  C  CD    . GLU C  2  379  ? 85.442  -10.979 61.378   1.00 56.84  ? 379  GLU C CD    1 
ATOM   6555  O  OE1   . GLU C  2  379  ? 85.817  -10.722 60.213   1.00 51.46  ? 379  GLU C OE1   1 
ATOM   6556  O  OE2   . GLU C  2  379  ? 85.995  -10.500 62.392   1.00 58.40  ? 379  GLU C OE2   1 
ATOM   6557  N  N     . ALA C  2  380  ? 80.016  -10.791 60.644   1.00 43.32  ? 380  ALA C N     1 
ATOM   6558  C  CA    . ALA C  2  380  ? 78.823  -9.963  60.521   1.00 42.30  ? 380  ALA C CA    1 
ATOM   6559  C  C     . ALA C  2  380  ? 77.563  -10.721 60.925   1.00 43.94  ? 380  ALA C C     1 
ATOM   6560  O  O     . ALA C  2  380  ? 76.662  -10.148 61.529   1.00 44.01  ? 380  ALA C O     1 
ATOM   6561  C  CB    . ALA C  2  380  ? 78.688  -9.421  59.106   1.00 39.61  ? 380  ALA C CB    1 
ATOM   6562  N  N     . ALA C  2  381  ? 77.501  -12.007 60.591   1.00 43.18  ? 381  ALA C N     1 
ATOM   6563  C  CA    . ALA C  2  381  ? 76.354  -12.831 60.964   1.00 40.54  ? 381  ALA C CA    1 
ATOM   6564  C  C     . ALA C  2  381  ? 76.247  -12.965 62.480   1.00 42.56  ? 381  ALA C C     1 
ATOM   6565  O  O     . ALA C  2  381  ? 75.186  -12.718 63.068   1.00 44.92  ? 381  ALA C O     1 
ATOM   6566  C  CB    . ALA C  2  381  ? 76.445  -14.201 60.314   1.00 42.56  ? 381  ALA C CB    1 
ATOM   6567  N  N     . ILE C  2  382  ? 77.353  -13.350 63.112   1.00 44.74  ? 382  ILE C N     1 
ATOM   6568  C  CA    . ILE C  2  382  ? 77.371  -13.511 64.565   1.00 41.26  ? 382  ILE C CA    1 
ATOM   6569  C  C     . ILE C  2  382  ? 77.109  -12.195 65.303   1.00 38.01  ? 382  ILE C C     1 
ATOM   6570  O  O     . ILE C  2  382  ? 76.280  -12.142 66.216   1.00 39.03  ? 382  ILE C O     1 
ATOM   6571  C  CB    . ILE C  2  382  ? 78.692  -14.129 65.052   1.00 37.81  ? 382  ILE C CB    1 
ATOM   6572  C  CG1   . ILE C  2  382  ? 78.817  -15.568 64.553   1.00 34.96  ? 382  ILE C CG1   1 
ATOM   6573  C  CG2   . ILE C  2  382  ? 78.765  -14.101 66.567   1.00 37.76  ? 382  ILE C CG2   1 
ATOM   6574  C  CD1   . ILE C  2  382  ? 80.025  -16.288 65.096   1.00 38.64  ? 382  ILE C CD1   1 
ATOM   6575  N  N     . ARG C  2  383  ? 77.812  -11.139 64.900   1.00 36.01  ? 383  ARG C N     1 
ATOM   6576  C  CA    . ARG C  2  383  ? 77.630  -9.821  65.503   1.00 37.34  ? 383  ARG C CA    1 
ATOM   6577  C  C     . ARG C  2  383  ? 76.198  -9.321  65.348   1.00 41.38  ? 383  ARG C C     1 
ATOM   6578  O  O     . ARG C  2  383  ? 75.625  -8.768  66.286   1.00 44.01  ? 383  ARG C O     1 
ATOM   6579  C  CB    . ARG C  2  383  ? 78.611  -8.803  64.914   1.00 40.81  ? 383  ARG C CB    1 
ATOM   6580  C  CG    . ARG C  2  383  ? 78.384  -7.378  65.401   1.00 43.11  ? 383  ARG C CG    1 
ATOM   6581  C  CD    . ARG C  2  383  ? 79.448  -6.416  64.889   1.00 46.03  ? 383  ARG C CD    1 
ATOM   6582  N  NE    . ARG C  2  383  ? 79.535  -6.408  63.431   1.00 52.55  ? 383  ARG C NE    1 
ATOM   6583  C  CZ    . ARG C  2  383  ? 80.538  -6.942  62.741   1.00 58.65  ? 383  ARG C CZ    1 
ATOM   6584  N  NH1   . ARG C  2  383  ? 81.547  -7.524  63.377   1.00 58.39  ? 383  ARG C NH1   1 
ATOM   6585  N  NH2   . ARG C  2  383  ? 80.535  -6.892  61.415   1.00 55.74  ? 383  ARG C NH2   1 
ATOM   6586  N  N     . GLU C  2  384  ? 75.625  -9.518  64.163   1.00 44.21  ? 384  GLU C N     1 
ATOM   6587  C  CA    . GLU C  2  384  ? 74.228  -9.163  63.920   1.00 47.71  ? 384  GLU C CA    1 
ATOM   6588  C  C     . GLU C  2  384  ? 73.303  -9.952  64.844   1.00 46.10  ? 384  GLU C C     1 
ATOM   6589  O  O     . GLU C  2  384  ? 72.311  -9.416  65.342   1.00 47.95  ? 384  GLU C O     1 
ATOM   6590  C  CB    . GLU C  2  384  ? 73.851  -9.384  62.450   1.00 47.43  ? 384  GLU C CB    1 
ATOM   6591  C  CG    . GLU C  2  384  ? 72.605  -10.232 62.224   1.00 51.96  ? 384  GLU C CG    1 
ATOM   6592  C  CD    . GLU C  2  384  ? 72.777  -11.233 61.094   1.00 57.72  ? 384  GLU C CD    1 
ATOM   6593  O  OE1   . GLU C  2  384  ? 73.358  -10.863 60.050   1.00 59.42  ? 384  GLU C OE1   1 
ATOM   6594  O  OE2   . GLU C  2  384  ? 72.341  -12.393 61.253   1.00 55.83  ? 384  GLU C OE2   1 
ATOM   6595  N  N     . PHE C  2  385  ? 73.638  -11.219 65.083   1.00 40.98  ? 385  PHE C N     1 
ATOM   6596  C  CA    . PHE C  2  385  ? 72.842  -12.041 65.989   1.00 34.70  ? 385  PHE C CA    1 
ATOM   6597  C  C     . PHE C  2  385  ? 72.880  -11.527 67.424   1.00 34.73  ? 385  PHE C C     1 
ATOM   6598  O  O     . PHE C  2  385  ? 71.840  -11.340 68.048   1.00 35.42  ? 385  PHE C O     1 
ATOM   6599  C  CB    . PHE C  2  385  ? 73.299  -13.496 65.957   1.00 34.80  ? 385  PHE C CB    1 
ATOM   6600  C  CG    . PHE C  2  385  ? 72.636  -14.357 66.994   1.00 33.66  ? 385  PHE C CG    1 
ATOM   6601  C  CD1   . PHE C  2  385  ? 71.344  -14.819 66.805   1.00 32.62  ? 385  PHE C CD1   1 
ATOM   6602  C  CD2   . PHE C  2  385  ? 73.303  -14.703 68.159   1.00 31.21  ? 385  PHE C CD2   1 
ATOM   6603  C  CE1   . PHE C  2  385  ? 70.731  -15.612 67.756   1.00 33.29  ? 385  PHE C CE1   1 
ATOM   6604  C  CE2   . PHE C  2  385  ? 72.695  -15.494 69.113   1.00 29.46  ? 385  PHE C CE2   1 
ATOM   6605  C  CZ    . PHE C  2  385  ? 71.408  -15.950 68.912   1.00 31.08  ? 385  PHE C CZ    1 
ATOM   6606  N  N     . PHE C  2  386  ? 74.079  -11.304 67.951   1.00 36.12  ? 386  PHE C N     1 
ATOM   6607  C  CA    . PHE C  2  386  ? 74.214  -10.899 69.350   1.00 36.38  ? 386  PHE C CA    1 
ATOM   6608  C  C     . PHE C  2  386  ? 73.854  -9.436  69.603   1.00 35.00  ? 386  PHE C C     1 
ATOM   6609  O  O     . PHE C  2  386  ? 73.630  -9.035  70.746   1.00 33.67  ? 386  PHE C O     1 
ATOM   6610  C  CB    . PHE C  2  386  ? 75.615  -11.211 69.879   1.00 32.71  ? 386  PHE C CB    1 
ATOM   6611  C  CG    . PHE C  2  386  ? 75.805  -12.649 70.271   1.00 31.20  ? 386  PHE C CG    1 
ATOM   6612  C  CD1   . PHE C  2  386  ? 76.433  -13.539 69.416   1.00 30.16  ? 386  PHE C CD1   1 
ATOM   6613  C  CD2   . PHE C  2  386  ? 75.345  -13.113 71.493   1.00 27.75  ? 386  PHE C CD2   1 
ATOM   6614  C  CE1   . PHE C  2  386  ? 76.606  -14.861 69.776   1.00 27.83  ? 386  PHE C CE1   1 
ATOM   6615  C  CE2   . PHE C  2  386  ? 75.514  -14.435 71.858   1.00 25.81  ? 386  PHE C CE2   1 
ATOM   6616  C  CZ    . PHE C  2  386  ? 76.145  -15.311 70.998   1.00 27.50  ? 386  PHE C CZ    1 
ATOM   6617  N  N     . SER C  2  387  ? 73.796  -8.642  68.540   1.00 35.98  ? 387  SER C N     1 
ATOM   6618  C  CA    . SER C  2  387  ? 73.433  -7.235  68.673   1.00 42.24  ? 387  SER C CA    1 
ATOM   6619  C  C     . SER C  2  387  ? 71.956  -6.988  68.368   1.00 41.31  ? 387  SER C C     1 
ATOM   6620  O  O     . SER C  2  387  ? 71.194  -6.573  69.241   1.00 43.73  ? 387  SER C O     1 
ATOM   6621  C  CB    . SER C  2  387  ? 74.317  -6.346  67.787   1.00 51.30  ? 387  SER C CB    1 
ATOM   6622  O  OG    . SER C  2  387  ? 75.663  -6.324  68.240   1.00 48.89  ? 387  SER C OG    1 
ATOM   6623  N  N     . ARG C  2  388  ? 71.556  -7.242  67.126   1.00 42.60  ? 388  ARG C N     1 
ATOM   6624  C  CA    . ARG C  2  388  ? 70.236  -6.826  66.654   1.00 43.50  ? 388  ARG C CA    1 
ATOM   6625  C  C     . ARG C  2  388  ? 69.096  -7.859  66.672   1.00 39.35  ? 388  ARG C C     1 
ATOM   6626  O  O     . ARG C  2  388  ? 67.992  -7.554  66.224   1.00 44.01  ? 388  ARG C O     1 
ATOM   6627  C  CB    . ARG C  2  388  ? 70.350  -6.153  65.280   1.00 49.67  ? 388  ARG C CB    1 
ATOM   6628  C  CG    . ARG C  2  388  ? 70.602  -4.653  65.369   1.00 55.62  ? 388  ARG C CG    1 
ATOM   6629  C  CD    . ARG C  2  388  ? 71.220  -4.100  64.096   1.00 67.04  ? 388  ARG C CD    1 
ATOM   6630  N  NE    . ARG C  2  388  ? 72.576  -4.600  63.888   1.00 75.49  ? 388  ARG C NE    1 
ATOM   6631  C  CZ    . ARG C  2  388  ? 73.661  -4.090  64.464   1.00 77.92  ? 388  ARG C CZ    1 
ATOM   6632  N  NH1   . ARG C  2  388  ? 73.557  -3.060  65.294   1.00 79.16  ? 388  ARG C NH1   1 
ATOM   6633  N  NH2   . ARG C  2  388  ? 74.854  -4.612  64.213   1.00 80.48  ? 388  ARG C NH2   1 
ATOM   6634  N  N     . SER C  2  389  ? 69.342  -9.064  67.179   1.00 33.45  ? 389  SER C N     1 
ATOM   6635  C  CA    . SER C  2  389  ? 68.271  -10.061 67.255   1.00 32.25  ? 389  SER C CA    1 
ATOM   6636  C  C     . SER C  2  389  ? 67.248  -9.750  68.345   1.00 32.57  ? 389  SER C C     1 
ATOM   6637  O  O     . SER C  2  389  ? 67.577  -9.154  69.372   1.00 33.05  ? 389  SER C O     1 
ATOM   6638  C  CB    . SER C  2  389  ? 68.830  -11.469 67.460   1.00 33.92  ? 389  SER C CB    1 
ATOM   6639  O  OG    . SER C  2  389  ? 67.778  -12.407 67.621   1.00 29.92  ? 389  SER C OG    1 
ATOM   6640  N  N     . GLN C  2  390  ? 66.004  -10.159 68.109   1.00 34.94  ? 390  GLN C N     1 
ATOM   6641  C  CA    . GLN C  2  390  ? 64.934  -9.977  69.085   1.00 34.65  ? 390  GLN C CA    1 
ATOM   6642  C  C     . GLN C  2  390  ? 65.146  -10.879 70.296   1.00 33.44  ? 390  GLN C C     1 
ATOM   6643  O  O     . GLN C  2  390  ? 64.799  -10.517 71.421   1.00 33.15  ? 390  GLN C O     1 
ATOM   6644  C  CB    . GLN C  2  390  ? 63.564  -10.247 68.450   1.00 36.73  ? 390  GLN C CB    1 
ATOM   6645  C  CG    . GLN C  2  390  ? 62.409  -10.242 69.444   1.00 41.55  ? 390  GLN C CG    1 
ATOM   6646  C  CD    . GLN C  2  390  ? 61.067  -9.967  68.792   1.00 51.63  ? 390  GLN C CD    1 
ATOM   6647  O  OE1   . GLN C  2  390  ? 60.707  -10.589 67.793   1.00 51.91  ? 390  GLN C OE1   1 
ATOM   6648  N  NE2   . GLN C  2  390  ? 60.322  -9.023  69.356   1.00 55.02  ? 390  GLN C NE2   1 
ATOM   6649  N  N     . LEU C  2  391  ? 65.725  -12.051 70.060   1.00 30.80  ? 391  LEU C N     1 
ATOM   6650  C  CA    . LEU C  2  391  ? 65.984  -13.002 71.133   1.00 28.74  ? 391  LEU C CA    1 
ATOM   6651  C  C     . LEU C  2  391  ? 67.192  -12.594 71.971   1.00 28.29  ? 391  LEU C C     1 
ATOM   6652  O  O     . LEU C  2  391  ? 67.428  -13.146 73.046   1.00 26.20  ? 391  LEU C O     1 
ATOM   6653  C  CB    . LEU C  2  391  ? 66.167  -14.407 70.567   1.00 26.41  ? 391  LEU C CB    1 
ATOM   6654  C  CG    . LEU C  2  391  ? 64.884  -15.000 69.987   1.00 27.27  ? 391  LEU C CG    1 
ATOM   6655  C  CD1   . LEU C  2  391  ? 65.167  -16.302 69.260   1.00 30.49  ? 391  LEU C CD1   1 
ATOM   6656  C  CD2   . LEU C  2  391  ? 63.862  -15.210 71.092   1.00 26.44  ? 391  LEU C CD2   1 
ATOM   6657  N  N     . SER C  2  392  ? 67.950  -11.623 71.471   1.00 28.19  ? 392  SER C N     1 
ATOM   6658  C  CA    . SER C  2  392  ? 69.047  -11.040 72.230   1.00 26.55  ? 392  SER C CA    1 
ATOM   6659  C  C     . SER C  2  392  ? 68.518  -9.821  72.960   1.00 28.09  ? 392  SER C C     1 
ATOM   6660  O  O     . SER C  2  392  ? 68.193  -8.809  72.338   1.00 30.75  ? 392  SER C O     1 
ATOM   6661  C  CB    . SER C  2  392  ? 70.186  -10.626 71.298   1.00 31.01  ? 392  SER C CB    1 
ATOM   6662  O  OG    . SER C  2  392  ? 71.191  -9.921  72.005   1.00 27.75  ? 392  SER C OG    1 
ATOM   6663  N  N     . GLN C  2  393  ? 68.442  -9.912  74.283   1.00 29.72  ? 393  GLN C N     1 
ATOM   6664  C  CA    . GLN C  2  393  ? 67.813  -8.856  75.066   1.00 29.47  ? 393  GLN C CA    1 
ATOM   6665  C  C     . GLN C  2  393  ? 68.760  -8.233  76.081   1.00 27.52  ? 393  GLN C C     1 
ATOM   6666  O  O     . GLN C  2  393  ? 69.605  -8.914  76.659   1.00 27.56  ? 393  GLN C O     1 
ATOM   6667  C  CB    . GLN C  2  393  ? 66.559  -9.387  75.763   1.00 23.63  ? 393  GLN C CB    1 
ATOM   6668  C  CG    . GLN C  2  393  ? 65.507  -9.906  74.800   1.00 25.09  ? 393  GLN C CG    1 
ATOM   6669  C  CD    . GLN C  2  393  ? 64.294  -10.466 75.507   1.00 28.74  ? 393  GLN C CD    1 
ATOM   6670  O  OE1   . GLN C  2  393  ? 64.196  -10.409 76.732   1.00 30.74  ? 393  GLN C OE1   1 
ATOM   6671  N  NE2   . GLN C  2  393  ? 63.362  -11.019 74.738   1.00 34.48  ? 393  GLN C NE2   1 
ATOM   6672  N  N     . PHE C  2  394  ? 68.614  -6.926  76.277   1.00 27.73  ? 394  PHE C N     1 
ATOM   6673  C  CA    . PHE C  2  394  ? 69.364  -6.203  77.290   1.00 25.87  ? 394  PHE C CA    1 
ATOM   6674  C  C     . PHE C  2  394  ? 69.083  -6.869  78.630   1.00 25.96  ? 394  PHE C C     1 
ATOM   6675  O  O     . PHE C  2  394  ? 67.925  -7.014  79.021   1.00 31.05  ? 394  PHE C O     1 
ATOM   6676  C  CB    . PHE C  2  394  ? 68.900  -4.747  77.312   1.00 29.32  ? 394  PHE C CB    1 
ATOM   6677  C  CG    . PHE C  2  394  ? 69.911  -3.789  77.868   1.00 36.02  ? 394  PHE C CG    1 
ATOM   6678  C  CD1   . PHE C  2  394  ? 71.023  -3.422  77.124   1.00 38.52  ? 394  PHE C CD1   1 
ATOM   6679  C  CD2   . PHE C  2  394  ? 69.739  -3.234  79.125   1.00 35.25  ? 394  PHE C CD2   1 
ATOM   6680  C  CE1   . PHE C  2  394  ? 71.952  -2.532  77.632   1.00 42.96  ? 394  PHE C CE1   1 
ATOM   6681  C  CE2   . PHE C  2  394  ? 70.662  -2.342  79.636   1.00 37.37  ? 394  PHE C CE2   1 
ATOM   6682  C  CZ    . PHE C  2  394  ? 71.771  -1.992  78.891   1.00 43.11  ? 394  PHE C CZ    1 
ATOM   6683  N  N     . LYS C  2  395  ? 70.136  -7.282  79.328   1.00 25.72  ? 395  LYS C N     1 
ATOM   6684  C  CA    . LYS C  2  395  ? 69.975  -8.092  80.534   1.00 26.91  ? 395  LYS C CA    1 
ATOM   6685  C  C     . LYS C  2  395  ? 69.266  -7.333  81.642   1.00 29.69  ? 395  LYS C C     1 
ATOM   6686  O  O     . LYS C  2  395  ? 69.633  -6.201  81.956   1.00 31.43  ? 395  LYS C O     1 
ATOM   6687  C  CB    . LYS C  2  395  ? 71.330  -8.578  81.049   1.00 26.81  ? 395  LYS C CB    1 
ATOM   6688  C  CG    . LYS C  2  395  ? 71.243  -9.383  82.338   1.00 26.90  ? 395  LYS C CG    1 
ATOM   6689  C  CD    . LYS C  2  395  ? 72.621  -9.717  82.885   1.00 30.20  ? 395  LYS C CD    1 
ATOM   6690  C  CE    . LYS C  2  395  ? 72.527  -10.573 84.137   1.00 30.69  ? 395  LYS C CE    1 
ATOM   6691  N  NZ    . LYS C  2  395  ? 73.869  -10.879 84.703   1.00 31.76  ? 395  LYS C NZ    1 
ATOM   6692  N  N     . ASP C  2  396  ? 68.261  -7.957  82.247   1.00 26.89  ? 396  ASP C N     1 
ATOM   6693  C  CA    . ASP C  2  396  ? 67.615  -7.334  83.389   1.00 28.37  ? 396  ASP C CA    1 
ATOM   6694  C  C     . ASP C  2  396  ? 68.284  -7.857  84.656   1.00 28.73  ? 396  ASP C C     1 
ATOM   6695  O  O     . ASP C  2  396  ? 68.055  -8.991  85.084   1.00 26.98  ? 396  ASP C O     1 
ATOM   6696  C  CB    . ASP C  2  396  ? 66.120  -7.667  83.374   1.00 28.04  ? 396  ASP C CB    1 
ATOM   6697  C  CG    . ASP C  2  396  ? 65.408  -7.245  84.643   1.00 31.83  ? 396  ASP C CG    1 
ATOM   6698  O  OD1   . ASP C  2  396  ? 65.771  -6.200  85.222   1.00 32.86  ? 396  ASP C OD1   1 
ATOM   6699  O  OD2   . ASP C  2  396  ? 64.477  -7.966  85.061   1.00 31.01  ? 396  ASP C OD2   1 
ATOM   6700  N  N     . GLU C  2  397  ? 69.122  -7.007  85.242   1.00 26.42  ? 397  GLU C N     1 
ATOM   6701  C  CA    . GLU C  2  397  ? 69.851  -7.314  86.476   1.00 28.81  ? 397  GLU C CA    1 
ATOM   6702  C  C     . GLU C  2  397  ? 69.328  -6.711  87.784   1.00 32.01  ? 397  GLU C C     1 
ATOM   6703  O  O     . GLU C  2  397  ? 70.034  -6.753  88.793   1.00 34.87  ? 397  GLU C O     1 
ATOM   6704  C  CB    . GLU C  2  397  ? 71.376  -7.169  86.332   1.00 31.42  ? 397  GLU C CB    1 
ATOM   6705  C  CG    . GLU C  2  397  ? 71.880  -6.019  85.495   1.00 33.87  ? 397  GLU C CG    1 
ATOM   6706  C  CD    . GLU C  2  397  ? 73.383  -6.109  85.295   1.00 39.78  ? 397  GLU C CD    1 
ATOM   6707  O  OE1   . GLU C  2  397  ? 73.953  -7.177  85.608   1.00 37.54  ? 397  GLU C OE1   1 
ATOM   6708  O  OE2   . GLU C  2  397  ? 73.994  -5.122  84.836   1.00 44.22  ? 397  GLU C OE2   1 
ATOM   6709  N  N     . THR C  2  398  ? 68.128  -6.129  87.750   1.00 28.72  ? 398  THR C N     1 
ATOM   6710  C  CA    . THR C  2  398  ? 67.602  -5.307  88.845   1.00 26.29  ? 398  THR C CA    1 
ATOM   6711  C  C     . THR C  2  398  ? 67.880  -5.919  90.216   1.00 24.46  ? 398  THR C C     1 
ATOM   6712  O  O     . THR C  2  398  ? 68.383  -5.245  91.114   1.00 24.10  ? 398  THR C O     1 
ATOM   6713  C  CB    . THR C  2  398  ? 66.073  -5.142  88.714   1.00 24.42  ? 398  THR C CB    1 
ATOM   6714  O  OG1   . THR C  2  398  ? 65.739  -4.750  87.378   1.00 26.84  ? 398  THR C OG1   1 
ATOM   6715  C  CG2   . THR C  2  398  ? 65.552  -4.103  89.696   1.00 24.22  ? 398  THR C CG2   1 
ATOM   6716  N  N     . ASN C  2  399  ? 67.565  -7.200  90.362   1.00 22.39  ? 399  ASN C N     1 
ATOM   6717  C  CA    . ASN C  2  399  ? 68.009  -7.991  91.504   1.00 21.68  ? 399  ASN C CA    1 
ATOM   6718  C  C     . ASN C  2  399  ? 68.357  -9.390  90.992   1.00 22.32  ? 399  ASN C C     1 
ATOM   6719  O  O     . ASN C  2  399  ? 67.963  -9.737  89.884   1.00 23.48  ? 399  ASN C O     1 
ATOM   6720  C  CB    . ASN C  2  399  ? 66.942  -8.021  92.603   1.00 19.02  ? 399  ASN C CB    1 
ATOM   6721  C  CG    . ASN C  2  399  ? 65.652  -8.660  92.150   1.00 19.92  ? 399  ASN C CG    1 
ATOM   6722  O  OD1   . ASN C  2  399  ? 65.568  -9.878  92.005   1.00 21.92  ? 399  ASN C OD1   1 
ATOM   6723  N  ND2   . ASN C  2  399  ? 64.628  -7.842  91.940   1.00 20.05  ? 399  ASN C ND2   1 
ATOM   6724  N  N     . PRO C  2  400  ? 69.116  -10.187 91.770   1.00 23.32  ? 400  PRO C N     1 
ATOM   6725  C  CA    . PRO C  2  400  ? 69.529  -11.520 91.304   1.00 23.65  ? 400  PRO C CA    1 
ATOM   6726  C  C     . PRO C  2  400  ? 68.405  -12.356 90.684   1.00 23.78  ? 400  PRO C C     1 
ATOM   6727  O  O     . PRO C  2  400  ? 68.631  -13.054 89.685   1.00 26.50  ? 400  PRO C O     1 
ATOM   6728  C  CB    . PRO C  2  400  ? 70.021  -12.184 92.588   1.00 26.56  ? 400  PRO C CB    1 
ATOM   6729  C  CG    . PRO C  2  400  ? 70.600  -11.060 93.367   1.00 29.30  ? 400  PRO C CG    1 
ATOM   6730  C  CD    . PRO C  2  400  ? 69.758  -9.843  93.053   1.00 27.98  ? 400  PRO C CD    1 
ATOM   6731  N  N     . LEU C  2  401  ? 67.209  -12.271 91.258   1.00 19.90  ? 401  LEU C N     1 
ATOM   6732  C  CA    . LEU C  2  401  ? 66.065  -13.011 90.738   1.00 18.82  ? 401  LEU C CA    1 
ATOM   6733  C  C     . LEU C  2  401  ? 65.663  -12.535 89.341   1.00 20.11  ? 401  LEU C C     1 
ATOM   6734  O  O     . LEU C  2  401  ? 65.146  -13.315 88.540   1.00 20.16  ? 401  LEU C O     1 
ATOM   6735  C  CB    . LEU C  2  401  ? 64.879  -12.919 91.697   1.00 15.64  ? 401  LEU C CB    1 
ATOM   6736  C  CG    . LEU C  2  401  ? 63.659  -13.761 91.322   1.00 16.14  ? 401  LEU C CG    1 
ATOM   6737  C  CD1   . LEU C  2  401  ? 64.025  -15.237 91.255   1.00 16.26  ? 401  LEU C CD1   1 
ATOM   6738  C  CD2   . LEU C  2  401  ? 62.526  -13.526 92.304   1.00 17.43  ? 401  LEU C CD2   1 
ATOM   6739  N  N     . SER C  2  402  ? 65.907  -11.260 89.050   1.00 20.38  ? 402  SER C N     1 
ATOM   6740  C  CA    . SER C  2  402  ? 65.608  -10.708 87.731   1.00 22.63  ? 402  SER C CA    1 
ATOM   6741  C  C     . SER C  2  402  ? 66.415  -11.434 86.664   1.00 25.61  ? 402  SER C C     1 
ATOM   6742  O  O     . SER C  2  402  ? 65.862  -11.925 85.679   1.00 27.91  ? 402  SER C O     1 
ATOM   6743  C  CB    . SER C  2  402  ? 65.922  -9.211  87.678   1.00 23.37  ? 402  SER C CB    1 
ATOM   6744  O  OG    . SER C  2  402  ? 65.545  -8.562  88.878   1.00 24.84  ? 402  SER C OG    1 
ATOM   6745  N  N     . SER C  2  403  ? 67.727  -11.492 86.874   1.00 24.81  ? 403  SER C N     1 
ATOM   6746  C  CA    . SER C  2  403  ? 68.636  -12.170 85.960   1.00 23.70  ? 403  SER C CA    1 
ATOM   6747  C  C     . SER C  2  403  ? 68.293  -13.649 85.868   1.00 23.90  ? 403  SER C C     1 
ATOM   6748  O  O     . SER C  2  403  ? 68.148  -14.203 84.768   1.00 25.85  ? 403  SER C O     1 
ATOM   6749  C  CB    . SER C  2  403  ? 70.078  -12.005 86.440   1.00 23.37  ? 403  SER C CB    1 
ATOM   6750  O  OG    . SER C  2  403  ? 70.379  -10.643 86.690   1.00 23.64  ? 403  SER C OG    1 
ATOM   6751  N  N     . LEU C  2  404  ? 68.160  -14.280 87.033   1.00 23.29  ? 404  LEU C N     1 
ATOM   6752  C  CA    . LEU C  2  404  ? 67.846  -15.702 87.104   1.00 24.70  ? 404  LEU C CA    1 
ATOM   6753  C  C     . LEU C  2  404  ? 66.601  -16.058 86.295   1.00 24.62  ? 404  LEU C C     1 
ATOM   6754  O  O     . LEU C  2  404  ? 66.577  -17.065 85.588   1.00 25.96  ? 404  LEU C O     1 
ATOM   6755  C  CB    . LEU C  2  404  ? 67.664  -16.141 88.556   1.00 23.87  ? 404  LEU C CB    1 
ATOM   6756  C  CG    . LEU C  2  404  ? 67.315  -17.618 88.727   1.00 21.62  ? 404  LEU C CG    1 
ATOM   6757  C  CD1   . LEU C  2  404  ? 68.439  -18.479 88.181   1.00 27.02  ? 404  LEU C CD1   1 
ATOM   6758  C  CD2   . LEU C  2  404  ? 67.038  -17.942 90.183   1.00 26.52  ? 404  LEU C CD2   1 
ATOM   6759  N  N     . ARG C  2  405  ? 65.573  -15.222 86.398   1.00 22.43  ? 405  ARG C N     1 
ATOM   6760  C  CA    . ARG C  2  405  ? 64.333  -15.451 85.668   1.00 24.66  ? 405  ARG C CA    1 
ATOM   6761  C  C     . ARG C  2  405  ? 64.520  -15.186 84.183   1.00 25.81  ? 405  ARG C C     1 
ATOM   6762  O  O     . ARG C  2  405  ? 64.017  -15.929 83.338   1.00 24.53  ? 405  ARG C O     1 
ATOM   6763  C  CB    . ARG C  2  405  ? 63.221  -14.551 86.202   1.00 24.91  ? 405  ARG C CB    1 
ATOM   6764  C  CG    . ARG C  2  405  ? 61.869  -14.821 85.571   1.00 26.77  ? 405  ARG C CG    1 
ATOM   6765  C  CD    . ARG C  2  405  ? 60.912  -13.669 85.801   1.00 28.81  ? 405  ARG C CD    1 
ATOM   6766  N  NE    . ARG C  2  405  ? 61.070  -12.624 84.795   1.00 29.72  ? 405  ARG C NE    1 
ATOM   6767  C  CZ    . ARG C  2  405  ? 60.064  -11.909 84.304   1.00 33.82  ? 405  ARG C CZ    1 
ATOM   6768  N  NH1   . ARG C  2  405  ? 58.825  -12.128 84.726   1.00 28.21  ? 405  ARG C NH1   1 
ATOM   6769  N  NH2   . ARG C  2  405  ? 60.295  -10.977 83.389   1.00 37.32  ? 405  ARG C NH2   1 
ATOM   6770  N  N     . HIS C  2  406  ? 65.247  -14.115 83.878   1.00 26.49  ? 406  HIS C N     1 
ATOM   6771  C  CA    . HIS C  2  406  ? 65.459  -13.684 82.502   1.00 24.01  ? 406  HIS C CA    1 
ATOM   6772  C  C     . HIS C  2  406  ? 66.154  -14.766 81.687   1.00 23.57  ? 406  HIS C C     1 
ATOM   6773  O  O     . HIS C  2  406  ? 65.861  -14.948 80.506   1.00 22.89  ? 406  HIS C O     1 
ATOM   6774  C  CB    . HIS C  2  406  ? 66.273  -12.389 82.469   1.00 22.09  ? 406  HIS C CB    1 
ATOM   6775  C  CG    . HIS C  2  406  ? 66.298  -11.725 81.129   1.00 19.03  ? 406  HIS C CG    1 
ATOM   6776  N  ND1   . HIS C  2  406  ? 67.124  -10.659 80.842   1.00 20.47  ? 406  HIS C ND1   1 
ATOM   6777  C  CD2   . HIS C  2  406  ? 65.594  -11.971 79.998   1.00 17.89  ? 406  HIS C CD2   1 
ATOM   6778  C  CE1   . HIS C  2  406  ? 66.931  -10.280 79.592   1.00 22.15  ? 406  HIS C CE1   1 
ATOM   6779  N  NE2   . HIS C  2  406  ? 66.009  -11.060 79.057   1.00 21.34  ? 406  HIS C NE2   1 
ATOM   6780  N  N     . LYS C  2  407  ? 67.072  -15.488 82.320   1.00 26.77  ? 407  LYS C N     1 
ATOM   6781  C  CA    . LYS C  2  407  ? 67.765  -16.573 81.631   1.00 27.12  ? 407  LYS C CA    1 
ATOM   6782  C  C     . LYS C  2  407  ? 66.851  -17.778 81.390   1.00 26.13  ? 407  LYS C C     1 
ATOM   6783  O  O     . LYS C  2  407  ? 67.107  -18.594 80.505   1.00 26.02  ? 407  LYS C O     1 
ATOM   6784  C  CB    . LYS C  2  407  ? 69.021  -16.981 82.405   1.00 27.37  ? 407  LYS C CB    1 
ATOM   6785  C  CG    . LYS C  2  407  ? 70.088  -15.897 82.430   1.00 26.01  ? 407  LYS C CG    1 
ATOM   6786  C  CD    . LYS C  2  407  ? 70.969  -15.997 83.663   1.00 29.00  ? 407  LYS C CD    1 
ATOM   6787  C  CE    . LYS C  2  407  ? 71.859  -14.771 83.793   1.00 30.88  ? 407  LYS C CE    1 
ATOM   6788  N  NZ    . LYS C  2  407  ? 72.549  -14.716 85.112   1.00 35.06  ? 407  LYS C NZ    1 
ATOM   6789  N  N     . ARG C  2  408  ? 65.781  -17.877 82.173   1.00 23.96  ? 408  ARG C N     1 
ATOM   6790  C  CA    . ARG C  2  408  ? 64.850  -18.998 82.068   1.00 22.18  ? 408  ARG C CA    1 
ATOM   6791  C  C     . ARG C  2  408  ? 63.633  -18.709 81.186   1.00 24.85  ? 408  ARG C C     1 
ATOM   6792  O  O     . ARG C  2  408  ? 62.717  -19.527 81.100   1.00 22.80  ? 408  ARG C O     1 
ATOM   6793  C  CB    . ARG C  2  408  ? 64.409  -19.460 83.457   1.00 20.61  ? 408  ARG C CB    1 
ATOM   6794  C  CG    . ARG C  2  408  ? 65.554  -19.969 84.316   1.00 21.56  ? 408  ARG C CG    1 
ATOM   6795  C  CD    . ARG C  2  408  ? 65.087  -20.312 85.719   1.00 20.66  ? 408  ARG C CD    1 
ATOM   6796  N  NE    . ARG C  2  408  ? 64.087  -21.373 85.717   1.00 19.87  ? 408  ARG C NE    1 
ATOM   6797  C  CZ    . ARG C  2  408  ? 64.366  -22.662 85.874   1.00 21.93  ? 408  ARG C CZ    1 
ATOM   6798  N  NH1   . ARG C  2  408  ? 63.391  -23.559 85.860   1.00 23.14  ? 408  ARG C NH1   1 
ATOM   6799  N  NH2   . ARG C  2  408  ? 65.619  -23.056 86.049   1.00 26.11  ? 408  ARG C NH2   1 
ATOM   6800  N  N     . ARG C  2  409  ? 63.622  -17.542 80.547   1.00 26.89  ? 409  ARG C N     1 
ATOM   6801  C  CA    . ARG C  2  409  ? 62.511  -17.143 79.681   1.00 27.80  ? 409  ARG C CA    1 
ATOM   6802  C  C     . ARG C  2  409  ? 62.349  -18.034 78.447   1.00 27.20  ? 409  ARG C C     1 
ATOM   6803  O  O     . ARG C  2  409  ? 63.318  -18.589 77.931   1.00 29.74  ? 409  ARG C O     1 
ATOM   6804  C  CB    . ARG C  2  409  ? 62.675  -15.690 79.229   1.00 28.90  ? 409  ARG C CB    1 
ATOM   6805  C  CG    . ARG C  2  409  ? 62.713  -14.676 80.356   1.00 36.26  ? 409  ARG C CG    1 
ATOM   6806  C  CD    . ARG C  2  409  ? 61.550  -13.700 80.275   1.00 38.37  ? 409  ARG C CD    1 
ATOM   6807  N  NE    . ARG C  2  409  ? 60.336  -14.244 80.876   1.00 40.12  ? 409  ARG C NE    1 
ATOM   6808  C  CZ    . ARG C  2  409  ? 59.225  -13.542 81.072   1.00 45.02  ? 409  ARG C CZ    1 
ATOM   6809  N  NH1   . ARG C  2  409  ? 59.175  -12.265 80.710   1.00 42.09  ? 409  ARG C NH1   1 
ATOM   6810  N  NH2   . ARG C  2  409  ? 58.164  -14.113 81.629   1.00 40.63  ? 409  ARG C NH2   1 
ATOM   6811  N  N     . ILE C  2  410  ? 61.111  -18.150 77.977   1.00 24.18  ? 410  ILE C N     1 
ATOM   6812  C  CA    . ILE C  2  410  ? 60.799  -18.889 76.760   1.00 21.65  ? 410  ILE C CA    1 
ATOM   6813  C  C     . ILE C  2  410  ? 59.895  -18.044 75.866   1.00 26.17  ? 410  ILE C C     1 
ATOM   6814  O  O     . ILE C  2  410  ? 58.792  -17.678 76.266   1.00 29.57  ? 410  ILE C O     1 
ATOM   6815  C  CB    . ILE C  2  410  ? 60.082  -20.210 77.080   1.00 18.96  ? 410  ILE C CB    1 
ATOM   6816  C  CG1   . ILE C  2  410  ? 60.994  -21.139 77.880   1.00 20.10  ? 410  ILE C CG1   1 
ATOM   6817  C  CG2   . ILE C  2  410  ? 59.632  -20.890 75.806   1.00 19.70  ? 410  ILE C CG2   1 
ATOM   6818  C  CD1   . ILE C  2  410  ? 60.369  -22.482 78.193   1.00 21.08  ? 410  ILE C CD1   1 
ATOM   6819  N  N     . SER C  2  411  ? 60.356  -17.731 74.659   1.00 24.48  ? 411  SER C N     1 
ATOM   6820  C  CA    . SER C  2  411  ? 59.593  -16.866 73.760   1.00 23.97  ? 411  SER C CA    1 
ATOM   6821  C  C     . SER C  2  411  ? 59.141  -17.575 72.487   1.00 24.80  ? 411  SER C C     1 
ATOM   6822  O  O     . SER C  2  411  ? 59.873  -18.385 71.926   1.00 27.23  ? 411  SER C O     1 
ATOM   6823  C  CB    . SER C  2  411  ? 60.408  -15.624 73.393   1.00 25.13  ? 411  SER C CB    1 
ATOM   6824  O  OG    . SER C  2  411  ? 59.730  -14.841 72.425   1.00 27.33  ? 411  SER C OG    1 
ATOM   6825  N  N     . ALA C  2  412  ? 57.927  -17.270 72.040   1.00 24.39  ? 412  ALA C N     1 
ATOM   6826  C  CA    . ALA C  2  412  ? 57.445  -17.763 70.757   1.00 24.45  ? 412  ALA C CA    1 
ATOM   6827  C  C     . ALA C  2  412  ? 57.674  -16.710 69.680   1.00 29.22  ? 412  ALA C C     1 
ATOM   6828  O  O     . ALA C  2  412  ? 57.388  -16.935 68.505   1.00 32.24  ? 412  ALA C O     1 
ATOM   6829  C  CB    . ALA C  2  412  ? 55.977  -18.128 70.842   1.00 23.32  ? 412  ALA C CB    1 
ATOM   6830  N  N     . LEU C  2  413  ? 58.199  -15.560 70.093   1.00 29.30  ? 413  LEU C N     1 
ATOM   6831  C  CA    . LEU C  2  413  ? 58.471  -14.458 69.177   1.00 29.88  ? 413  LEU C CA    1 
ATOM   6832  C  C     . LEU C  2  413  ? 59.865  -14.579 68.577   1.00 31.84  ? 413  LEU C C     1 
ATOM   6833  O  O     . LEU C  2  413  ? 60.540  -15.590 68.760   1.00 34.59  ? 413  LEU C O     1 
ATOM   6834  C  CB    . LEU C  2  413  ? 58.327  -13.119 69.900   1.00 33.20  ? 413  LEU C CB    1 
ATOM   6835  C  CG    . LEU C  2  413  ? 56.943  -12.816 70.474   1.00 36.29  ? 413  LEU C CG    1 
ATOM   6836  C  CD1   . LEU C  2  413  ? 56.953  -11.496 71.230   1.00 38.23  ? 413  LEU C CD1   1 
ATOM   6837  C  CD2   . LEU C  2  413  ? 55.900  -12.797 69.368   1.00 34.63  ? 413  LEU C CD2   1 
ATOM   6838  N  N     . GLY C  2  414  ? 60.293  -13.545 67.860   1.00 32.59  ? 414  GLY C N     1 
ATOM   6839  C  CA    . GLY C  2  414  ? 61.603  -13.548 67.236   1.00 33.94  ? 414  GLY C CA    1 
ATOM   6840  C  C     . GLY C  2  414  ? 61.614  -14.269 65.901   1.00 39.70  ? 414  GLY C C     1 
ATOM   6841  O  O     . GLY C  2  414  ? 60.594  -14.814 65.478   1.00 41.05  ? 414  GLY C O     1 
ATOM   6842  N  N     . PRO C  2  415  ? 62.775  -14.274 65.227   1.00 41.65  ? 415  PRO C N     1 
ATOM   6843  C  CA    . PRO C  2  415  ? 62.957  -14.919 63.921   1.00 39.64  ? 415  PRO C CA    1 
ATOM   6844  C  C     . PRO C  2  415  ? 62.699  -16.424 63.971   1.00 40.39  ? 415  PRO C C     1 
ATOM   6845  O  O     . PRO C  2  415  ? 63.206  -17.112 64.858   1.00 37.59  ? 415  PRO C O     1 
ATOM   6846  C  CB    . PRO C  2  415  ? 64.432  -14.653 63.603   1.00 37.33  ? 415  PRO C CB    1 
ATOM   6847  C  CG    . PRO C  2  415  ? 64.785  -13.450 64.411   1.00 39.60  ? 415  PRO C CG    1 
ATOM   6848  C  CD    . PRO C  2  415  ? 63.996  -13.581 65.673   1.00 38.12  ? 415  PRO C CD    1 
ATOM   6849  N  N     . GLY C  2  416  ? 61.915  -16.923 63.022   1.00 40.20  ? 416  GLY C N     1 
ATOM   6850  C  CA    . GLY C  2  416  ? 61.602  -18.339 62.957   1.00 39.12  ? 416  GLY C CA    1 
ATOM   6851  C  C     . GLY C  2  416  ? 60.348  -18.698 63.730   1.00 40.45  ? 416  GLY C C     1 
ATOM   6852  O  O     . GLY C  2  416  ? 59.783  -19.777 63.547   1.00 37.24  ? 416  GLY C O     1 
ATOM   6853  N  N     . GLY C  2  417  ? 59.912  -17.788 64.596   1.00 40.38  ? 417  GLY C N     1 
ATOM   6854  C  CA    . GLY C  2  417  ? 58.743  -18.019 65.423   1.00 40.45  ? 417  GLY C CA    1 
ATOM   6855  C  C     . GLY C  2  417  ? 57.533  -17.217 64.988   1.00 44.15  ? 417  GLY C C     1 
ATOM   6856  O  O     . GLY C  2  417  ? 57.448  -16.761 63.846   1.00 41.61  ? 417  GLY C O     1 
ATOM   6857  N  N     . LEU C  2  418  ? 56.593  -17.041 65.912   1.00 43.21  ? 418  LEU C N     1 
ATOM   6858  C  CA    . LEU C  2  418  ? 55.353  -16.330 65.630   1.00 39.45  ? 418  LEU C CA    1 
ATOM   6859  C  C     . LEU C  2  418  ? 55.560  -14.830 65.479   1.00 44.02  ? 418  LEU C C     1 
ATOM   6860  O  O     . LEU C  2  418  ? 56.476  -14.251 66.060   1.00 42.46  ? 418  LEU C O     1 
ATOM   6861  C  CB    . LEU C  2  418  ? 54.322  -16.579 66.737   1.00 34.69  ? 418  LEU C CB    1 
ATOM   6862  C  CG    . LEU C  2  418  ? 53.520  -17.882 66.717   1.00 36.25  ? 418  LEU C CG    1 
ATOM   6863  C  CD1   . LEU C  2  418  ? 52.981  -18.142 65.321   1.00 44.35  ? 418  LEU C CD1   1 
ATOM   6864  C  CD2   . LEU C  2  418  ? 54.357  -19.053 67.202   1.00 43.15  ? 418  LEU C CD2   1 
ATOM   6865  N  N     . THR C  2  419  ? 54.693  -14.214 64.684   1.00 50.91  ? 419  THR C N     1 
ATOM   6866  C  CA    . THR C  2  419  ? 54.571  -12.766 64.626   1.00 48.54  ? 419  THR C CA    1 
ATOM   6867  C  C     . THR C  2  419  ? 53.277  -12.440 65.353   1.00 52.26  ? 419  THR C C     1 
ATOM   6868  O  O     . THR C  2  419  ? 52.358  -13.257 65.360   1.00 52.33  ? 419  THR C O     1 
ATOM   6869  C  CB    . THR C  2  419  ? 54.464  -12.270 63.178   1.00 48.23  ? 419  THR C CB    1 
ATOM   6870  O  OG1   . THR C  2  419  ? 55.475  -12.893 62.377   1.00 53.44  ? 419  THR C OG1   1 
ATOM   6871  C  CG2   . THR C  2  419  ? 54.624  -10.757 63.110   1.00 46.95  ? 419  THR C CG2   1 
ATOM   6872  N  N     . ARG C  2  420  ? 53.198  -11.279 65.993   1.00 54.96  ? 420  ARG C N     1 
ATOM   6873  C  CA    . ARG C  2  420  ? 51.949  -10.909 66.645   1.00 55.69  ? 420  ARG C CA    1 
ATOM   6874  C  C     . ARG C  2  420  ? 50.856  -10.722 65.593   1.00 62.17  ? 420  ARG C C     1 
ATOM   6875  O  O     . ARG C  2  420  ? 51.125  -10.297 64.467   1.00 63.56  ? 420  ARG C O     1 
ATOM   6876  C  CB    . ARG C  2  420  ? 52.105  -9.671  67.529   1.00 50.82  ? 420  ARG C CB    1 
ATOM   6877  C  CG    . ARG C  2  420  ? 51.044  -9.582  68.619   1.00 51.20  ? 420  ARG C CG    1 
ATOM   6878  C  CD    . ARG C  2  420  ? 51.395  -8.554  69.682   1.00 49.18  ? 420  ARG C CD    1 
ATOM   6879  N  NE    . ARG C  2  420  ? 52.602  -8.908  70.425   1.00 39.43  ? 420  ARG C NE    1 
ATOM   6880  C  CZ    . ARG C  2  420  ? 53.799  -8.374  70.202   1.00 41.57  ? 420  ARG C CZ    1 
ATOM   6881  N  NH1   . ARG C  2  420  ? 53.954  -7.458  69.255   1.00 39.97  ? 420  ARG C NH1   1 
ATOM   6882  N  NH2   . ARG C  2  420  ? 54.842  -8.755  70.927   1.00 40.78  ? 420  ARG C NH2   1 
ATOM   6883  N  N     . GLU C  2  421  ? 49.633  -11.068 65.982   1.00 60.14  ? 421  GLU C N     1 
ATOM   6884  C  CA    . GLU C  2  421  ? 48.495  -11.258 65.082   1.00 63.31  ? 421  GLU C CA    1 
ATOM   6885  C  C     . GLU C  2  421  ? 48.742  -12.350 64.041   1.00 54.58  ? 421  GLU C C     1 
ATOM   6886  O  O     . GLU C  2  421  ? 48.031  -12.433 63.040   1.00 53.40  ? 421  GLU C O     1 
ATOM   6887  C  CB    . GLU C  2  421  ? 48.106  -9.949  64.378   1.00 70.20  ? 421  GLU C CB    1 
ATOM   6888  C  CG    . GLU C  2  421  ? 47.121  -9.076  65.143   1.00 70.88  ? 421  GLU C CG    1 
ATOM   6889  C  CD    . GLU C  2  421  ? 47.769  -8.298  66.272   1.00 77.45  ? 421  GLU C CD    1 
ATOM   6890  O  OE1   . GLU C  2  421  ? 48.038  -8.896  67.337   1.00 69.24  ? 421  GLU C OE1   1 
ATOM   6891  O  OE2   . GLU C  2  421  ? 48.006  -7.083  66.094   1.00 80.11  ? 421  GLU C OE2   1 
ATOM   6892  N  N     . ARG C  2  422  ? 49.752  -13.182 64.270   1.00 53.86  ? 422  ARG C N     1 
ATOM   6893  C  CA    . ARG C  2  422  ? 49.763  -14.536 63.737   1.00 53.75  ? 422  ARG C CA    1 
ATOM   6894  C  C     . ARG C  2  422  ? 49.455  -15.512 64.867   1.00 47.42  ? 422  ARG C C     1 
ATOM   6895  O  O     . ARG C  2  422  ? 49.349  -16.720 64.654   1.00 46.14  ? 422  ARG C O     1 
ATOM   6896  C  CB    . ARG C  2  422  ? 51.094  -14.870 63.065   1.00 59.00  ? 422  ARG C CB    1 
ATOM   6897  C  CG    . ARG C  2  422  ? 51.359  -14.097 61.782   1.00 65.08  ? 422  ARG C CG    1 
ATOM   6898  C  CD    . ARG C  2  422  ? 51.990  -15.003 60.736   1.00 70.13  ? 422  ARG C CD    1 
ATOM   6899  N  NE    . ARG C  2  422  ? 53.161  -15.701 61.260   1.00 75.17  ? 422  ARG C NE    1 
ATOM   6900  C  CZ    . ARG C  2  422  ? 53.567  -16.896 60.843   1.00 80.51  ? 422  ARG C CZ    1 
ATOM   6901  N  NH1   . ARG C  2  422  ? 54.644  -17.458 61.376   1.00 71.86  ? 422  ARG C NH1   1 
ATOM   6902  N  NH2   . ARG C  2  422  ? 52.893  -17.532 59.894   1.00 83.12  ? 422  ARG C NH2   1 
ATOM   6903  N  N     . ALA C  2  423  ? 49.316  -14.972 66.074   1.00 42.26  ? 423  ALA C N     1 
ATOM   6904  C  CA    . ALA C  2  423  ? 49.183  -15.797 67.268   1.00 39.67  ? 423  ALA C CA    1 
ATOM   6905  C  C     . ALA C  2  423  ? 47.735  -15.897 67.731   1.00 40.52  ? 423  ALA C C     1 
ATOM   6906  O  O     . ALA C  2  423  ? 47.166  -14.935 68.247   1.00 38.46  ? 423  ALA C O     1 
ATOM   6907  C  CB    . ALA C  2  423  ? 50.063  -15.251 68.386   1.00 38.86  ? 423  ALA C CB    1 
ATOM   6908  N  N     . GLY C  2  424  ? 47.152  -17.079 67.564   1.00 39.47  ? 424  GLY C N     1 
ATOM   6909  C  CA    . GLY C  2  424  ? 45.764  -17.298 67.920   1.00 39.56  ? 424  GLY C CA    1 
ATOM   6910  C  C     . GLY C  2  424  ? 45.576  -17.537 69.403   1.00 39.17  ? 424  GLY C C     1 
ATOM   6911  O  O     . GLY C  2  424  ? 46.480  -17.300 70.202   1.00 34.10  ? 424  GLY C O     1 
ATOM   6912  N  N     . PHE C  2  425  ? 44.388  -17.998 69.772   1.00 42.95  ? 425  PHE C N     1 
ATOM   6913  C  CA    . PHE C  2  425  ? 44.099  -18.337 71.157   1.00 40.85  ? 425  PHE C CA    1 
ATOM   6914  C  C     . PHE C  2  425  ? 44.665  -19.708 71.511   1.00 40.15  ? 425  PHE C C     1 
ATOM   6915  O  O     . PHE C  2  425  ? 44.995  -19.972 72.667   1.00 41.12  ? 425  PHE C O     1 
ATOM   6916  C  CB    . PHE C  2  425  ? 42.592  -18.303 71.413   1.00 44.10  ? 425  PHE C CB    1 
ATOM   6917  C  CG    . PHE C  2  425  ? 42.006  -16.923 71.391   1.00 36.02  ? 425  PHE C CG    1 
ATOM   6918  C  CD1   . PHE C  2  425  ? 41.779  -16.237 72.571   1.00 33.23  ? 425  PHE C CD1   1 
ATOM   6919  C  CD2   . PHE C  2  425  ? 41.684  -16.309 70.192   1.00 38.03  ? 425  PHE C CD2   1 
ATOM   6920  C  CE1   . PHE C  2  425  ? 41.241  -14.966 72.557   1.00 37.07  ? 425  PHE C CE1   1 
ATOM   6921  C  CE2   . PHE C  2  425  ? 41.144  -15.038 70.171   1.00 40.22  ? 425  PHE C CE2   1 
ATOM   6922  C  CZ    . PHE C  2  425  ? 40.921  -14.367 71.356   1.00 39.51  ? 425  PHE C CZ    1 
ATOM   6923  N  N     . ASP C  2  426  ? 44.769  -20.575 70.509   1.00 40.33  ? 426  ASP C N     1 
ATOM   6924  C  CA    . ASP C  2  426  ? 45.289  -21.923 70.706   1.00 41.03  ? 426  ASP C CA    1 
ATOM   6925  C  C     . ASP C  2  426  ? 46.745  -21.879 71.155   1.00 36.74  ? 426  ASP C C     1 
ATOM   6926  O  O     . ASP C  2  426  ? 47.149  -22.602 72.067   1.00 34.72  ? 426  ASP C O     1 
ATOM   6927  C  CB    . ASP C  2  426  ? 45.171  -22.736 69.414   1.00 46.15  ? 426  ASP C CB    1 
ATOM   6928  C  CG    . ASP C  2  426  ? 43.757  -22.758 68.863   1.00 49.21  ? 426  ASP C CG    1 
ATOM   6929  O  OD1   . ASP C  2  426  ? 42.804  -22.664 69.665   1.00 53.36  ? 426  ASP C OD1   1 
ATOM   6930  O  OD2   . ASP C  2  426  ? 43.599  -22.869 67.629   1.00 42.87  ? 426  ASP C OD2   1 
ATOM   6931  N  N     . VAL C  2  427  ? 47.521  -21.017 70.507   1.00 34.22  ? 427  VAL C N     1 
ATOM   6932  C  CA    . VAL C  2  427  ? 48.948  -20.888 70.775   1.00 29.34  ? 427  VAL C CA    1 
ATOM   6933  C  C     . VAL C  2  427  ? 49.216  -20.377 72.187   1.00 29.43  ? 427  VAL C C     1 
ATOM   6934  O  O     . VAL C  2  427  ? 50.171  -20.801 72.839   1.00 29.79  ? 427  VAL C O     1 
ATOM   6935  C  CB    . VAL C  2  427  ? 49.606  -19.917 69.776   1.00 30.09  ? 427  VAL C CB    1 
ATOM   6936  C  CG1   . VAL C  2  427  ? 51.120  -20.005 69.864   1.00 30.23  ? 427  VAL C CG1   1 
ATOM   6937  C  CG2   . VAL C  2  427  ? 49.131  -20.210 68.360   1.00 37.36  ? 427  VAL C CG2   1 
ATOM   6938  N  N     . ARG C  2  428  ? 48.363  -19.471 72.655   1.00 31.80  ? 428  ARG C N     1 
ATOM   6939  C  CA    . ARG C  2  428  ? 48.570  -18.797 73.933   1.00 25.83  ? 428  ARG C CA    1 
ATOM   6940  C  C     . ARG C  2  428  ? 48.013  -19.590 75.107   1.00 26.33  ? 428  ARG C C     1 
ATOM   6941  O  O     . ARG C  2  428  ? 48.272  -19.259 76.260   1.00 27.77  ? 428  ARG C O     1 
ATOM   6942  C  CB    . ARG C  2  428  ? 47.922  -17.412 73.911   1.00 24.12  ? 428  ARG C CB    1 
ATOM   6943  C  CG    . ARG C  2  428  ? 48.289  -16.569 72.706   1.00 27.10  ? 428  ARG C CG    1 
ATOM   6944  C  CD    . ARG C  2  428  ? 47.459  -15.300 72.661   1.00 24.31  ? 428  ARG C CD    1 
ATOM   6945  N  NE    . ARG C  2  428  ? 48.266  -14.109 72.902   1.00 23.12  ? 428  ARG C NE    1 
ATOM   6946  C  CZ    . ARG C  2  428  ? 48.656  -13.269 71.949   1.00 24.15  ? 428  ARG C CZ    1 
ATOM   6947  N  NH1   . ARG C  2  428  ? 48.305  -13.486 70.689   1.00 24.27  ? 428  ARG C NH1   1 
ATOM   6948  N  NH2   . ARG C  2  428  ? 49.389  -12.209 72.257   1.00 23.78  ? 428  ARG C NH2   1 
ATOM   6949  N  N     . ASP C  2  429  ? 47.254  -20.638 74.809   1.00 27.57  ? 429  ASP C N     1 
ATOM   6950  C  CA    . ASP C  2  429  ? 46.582  -21.419 75.843   1.00 28.51  ? 429  ASP C CA    1 
ATOM   6951  C  C     . ASP C  2  429  ? 47.559  -22.186 76.730   1.00 26.06  ? 429  ASP C C     1 
ATOM   6952  O  O     . ASP C  2  429  ? 48.714  -22.403 76.359   1.00 26.73  ? 429  ASP C O     1 
ATOM   6953  C  CB    . ASP C  2  429  ? 45.583  -22.390 75.206   1.00 36.31  ? 429  ASP C CB    1 
ATOM   6954  C  CG    . ASP C  2  429  ? 44.143  -22.070 75.570   1.00 43.25  ? 429  ASP C CG    1 
ATOM   6955  O  OD1   . ASP C  2  429  ? 43.896  -21.676 76.729   1.00 41.85  ? 429  ASP C OD1   1 
ATOM   6956  O  OD2   . ASP C  2  429  ? 43.260  -22.212 74.696   1.00 43.21  ? 429  ASP C OD2   1 
ATOM   6957  N  N     . VAL C  2  430  ? 47.090  -22.584 77.908   1.00 23.51  ? 430  VAL C N     1 
ATOM   6958  C  CA    . VAL C  2  430  ? 47.868  -23.448 78.784   1.00 22.95  ? 430  VAL C CA    1 
ATOM   6959  C  C     . VAL C  2  430  ? 47.513  -24.896 78.480   1.00 26.02  ? 430  VAL C C     1 
ATOM   6960  O  O     . VAL C  2  430  ? 46.390  -25.336 78.727   1.00 28.28  ? 430  VAL C O     1 
ATOM   6961  C  CB    . VAL C  2  430  ? 47.583  -23.160 80.271   1.00 19.25  ? 430  VAL C CB    1 
ATOM   6962  C  CG1   . VAL C  2  430  ? 48.147  -24.262 81.148   1.00 20.20  ? 430  VAL C CG1   1 
ATOM   6963  C  CG2   . VAL C  2  430  ? 48.176  -21.828 80.671   1.00 21.07  ? 430  VAL C CG2   1 
ATOM   6964  N  N     . HIS C  2  431  ? 48.471  -25.630 77.925   1.00 24.15  ? 431  HIS C N     1 
ATOM   6965  C  CA    . HIS C  2  431  ? 48.252  -27.024 77.566   1.00 24.69  ? 431  HIS C CA    1 
ATOM   6966  C  C     . HIS C  2  431  ? 48.382  -27.926 78.789   1.00 24.80  ? 431  HIS C C     1 
ATOM   6967  O  O     . HIS C  2  431  ? 49.060  -27.581 79.755   1.00 24.41  ? 431  HIS C O     1 
ATOM   6968  C  CB    . HIS C  2  431  ? 49.236  -27.460 76.479   1.00 26.26  ? 431  HIS C CB    1 
ATOM   6969  C  CG    . HIS C  2  431  ? 48.677  -28.476 75.531   1.00 32.41  ? 431  HIS C CG    1 
ATOM   6970  N  ND1   . HIS C  2  431  ? 48.337  -29.753 75.922   1.00 34.41  ? 431  HIS C ND1   1 
ATOM   6971  C  CD2   . HIS C  2  431  ? 48.399  -28.402 74.208   1.00 37.03  ? 431  HIS C CD2   1 
ATOM   6972  C  CE1   . HIS C  2  431  ? 47.872  -30.421 74.881   1.00 33.81  ? 431  HIS C CE1   1 
ATOM   6973  N  NE2   . HIS C  2  431  ? 47.901  -29.625 73.828   1.00 35.49  ? 431  HIS C NE2   1 
ATOM   6974  N  N     . ARG C  2  432  ? 47.727  -29.080 78.741   1.00 25.03  ? 432  ARG C N     1 
ATOM   6975  C  CA    . ARG C  2  432  ? 47.842  -30.074 79.801   1.00 25.00  ? 432  ARG C CA    1 
ATOM   6976  C  C     . ARG C  2  432  ? 49.276  -30.583 79.914   1.00 25.70  ? 432  ARG C C     1 
ATOM   6977  O  O     . ARG C  2  432  ? 49.687  -31.087 80.959   1.00 22.48  ? 432  ARG C O     1 
ATOM   6978  C  CB    . ARG C  2  432  ? 46.905  -31.249 79.524   1.00 28.21  ? 432  ARG C CB    1 
ATOM   6979  C  CG    . ARG C  2  432  ? 47.202  -31.966 78.217   1.00 33.13  ? 432  ARG C CG    1 
ATOM   6980  C  CD    . ARG C  2  432  ? 46.329  -33.192 78.039   1.00 40.87  ? 432  ARG C CD    1 
ATOM   6981  N  NE    . ARG C  2  432  ? 46.617  -33.895 76.791   1.00 42.42  ? 432  ARG C NE    1 
ATOM   6982  C  CZ    . ARG C  2  432  ? 47.515  -34.867 76.666   1.00 42.03  ? 432  ARG C CZ    1 
ATOM   6983  N  NH1   . ARG C  2  432  ? 48.223  -35.260 77.717   1.00 41.98  ? 432  ARG C NH1   1 
ATOM   6984  N  NH2   . ARG C  2  432  ? 47.707  -35.446 75.489   1.00 41.46  ? 432  ARG C NH2   1 
ATOM   6985  N  N     . THR C  2  433  ? 50.033  -30.446 78.829   1.00 27.29  ? 433  THR C N     1 
ATOM   6986  C  CA    . THR C  2  433  ? 51.413  -30.910 78.789   1.00 26.91  ? 433  THR C CA    1 
ATOM   6987  C  C     . THR C  2  433  ? 52.383  -29.862 79.323   1.00 25.84  ? 433  THR C C     1 
ATOM   6988  O  O     . THR C  2  433  ? 53.584  -30.110 79.411   1.00 28.96  ? 433  THR C O     1 
ATOM   6989  C  CB    . THR C  2  433  ? 51.836  -31.320 77.365   1.00 27.56  ? 433  THR C CB    1 
ATOM   6990  O  OG1   . THR C  2  433  ? 51.748  -30.188 76.490   1.00 26.53  ? 433  THR C OG1   1 
ATOM   6991  C  CG2   . THR C  2  433  ? 50.939  -32.431 76.846   1.00 29.01  ? 433  THR C CG2   1 
ATOM   6992  N  N     . HIS C  2  434  ? 51.863  -28.692 79.681   1.00 23.24  ? 434  HIS C N     1 
ATOM   6993  C  CA    . HIS C  2  434  ? 52.686  -27.661 80.304   1.00 24.19  ? 434  HIS C CA    1 
ATOM   6994  C  C     . HIS C  2  434  ? 53.025  -28.053 81.738   1.00 25.58  ? 434  HIS C C     1 
ATOM   6995  O  O     . HIS C  2  434  ? 53.907  -27.460 82.363   1.00 24.46  ? 434  HIS C O     1 
ATOM   6996  C  CB    . HIS C  2  434  ? 51.969  -26.310 80.297   1.00 25.61  ? 434  HIS C CB    1 
ATOM   6997  C  CG    . HIS C  2  434  ? 51.957  -25.633 78.962   1.00 24.76  ? 434  HIS C CG    1 
ATOM   6998  N  ND1   . HIS C  2  434  ? 52.220  -26.300 77.785   1.00 27.94  ? 434  HIS C ND1   1 
ATOM   6999  C  CD2   . HIS C  2  434  ? 51.715  -24.346 78.620   1.00 24.07  ? 434  HIS C CD2   1 
ATOM   7000  C  CE1   . HIS C  2  434  ? 52.139  -25.452 76.774   1.00 27.85  ? 434  HIS C CE1   1 
ATOM   7001  N  NE2   . HIS C  2  434  ? 51.833  -24.260 77.254   1.00 28.18  ? 434  HIS C NE2   1 
ATOM   7002  N  N     . TYR C  2  435  ? 52.313  -29.052 82.249   1.00 24.62  ? 435  TYR C N     1 
ATOM   7003  C  CA    . TYR C  2  435  ? 52.499  -29.524 83.614   1.00 23.15  ? 435  TYR C CA    1 
ATOM   7004  C  C     . TYR C  2  435  ? 53.943  -29.952 83.859   1.00 24.34  ? 435  TYR C C     1 
ATOM   7005  O  O     . TYR C  2  435  ? 54.482  -30.793 83.141   1.00 26.97  ? 435  TYR C O     1 
ATOM   7006  C  CB    . TYR C  2  435  ? 51.550  -30.691 83.891   1.00 22.27  ? 435  TYR C CB    1 
ATOM   7007  C  CG    . TYR C  2  435  ? 51.461  -31.081 85.346   1.00 24.78  ? 435  TYR C CG    1 
ATOM   7008  C  CD1   . TYR C  2  435  ? 50.479  -30.549 86.168   1.00 25.90  ? 435  TYR C CD1   1 
ATOM   7009  C  CD2   . TYR C  2  435  ? 52.358  -31.984 85.899   1.00 31.36  ? 435  TYR C CD2   1 
ATOM   7010  C  CE1   . TYR C  2  435  ? 50.393  -30.902 87.501   1.00 30.47  ? 435  TYR C CE1   1 
ATOM   7011  C  CE2   . TYR C  2  435  ? 52.282  -32.342 87.231   1.00 35.67  ? 435  TYR C CE2   1 
ATOM   7012  C  CZ    . TYR C  2  435  ? 51.296  -31.799 88.027   1.00 32.78  ? 435  TYR C CZ    1 
ATOM   7013  O  OH    . TYR C  2  435  ? 51.212  -32.151 89.354   1.00 34.87  ? 435  TYR C OH    1 
ATOM   7014  N  N     . GLY C  2  436  ? 54.562  -29.364 84.878   1.00 25.67  ? 436  GLY C N     1 
ATOM   7015  C  CA    . GLY C  2  436  ? 55.932  -29.685 85.237   1.00 26.74  ? 436  GLY C CA    1 
ATOM   7016  C  C     . GLY C  2  436  ? 56.974  -29.174 84.257   1.00 25.22  ? 436  GLY C C     1 
ATOM   7017  O  O     . GLY C  2  436  ? 58.174  -29.355 84.466   1.00 27.32  ? 436  GLY C O     1 
ATOM   7018  N  N     . ARG C  2  437  ? 56.519  -28.529 83.189   1.00 19.55  ? 437  ARG C N     1 
ATOM   7019  C  CA    . ARG C  2  437  ? 57.415  -28.066 82.137   1.00 22.15  ? 437  ARG C CA    1 
ATOM   7020  C  C     . ARG C  2  437  ? 57.406  -26.547 81.999   1.00 24.65  ? 437  ARG C C     1 
ATOM   7021  O  O     . ARG C  2  437  ? 58.429  -25.889 82.188   1.00 24.31  ? 437  ARG C O     1 
ATOM   7022  C  CB    . ARG C  2  437  ? 57.065  -28.736 80.807   1.00 23.31  ? 437  ARG C CB    1 
ATOM   7023  C  CG    . ARG C  2  437  ? 57.330  -30.228 80.809   1.00 24.52  ? 437  ARG C CG    1 
ATOM   7024  C  CD    . ARG C  2  437  ? 56.835  -30.909 79.548   1.00 25.21  ? 437  ARG C CD    1 
ATOM   7025  N  NE    . ARG C  2  437  ? 56.910  -32.360 79.679   1.00 29.32  ? 437  ARG C NE    1 
ATOM   7026  C  CZ    . ARG C  2  437  ? 55.975  -33.103 80.262   1.00 30.52  ? 437  ARG C CZ    1 
ATOM   7027  N  NH1   . ARG C  2  437  ? 54.889  -32.533 80.765   1.00 27.18  ? 437  ARG C NH1   1 
ATOM   7028  N  NH2   . ARG C  2  437  ? 56.124  -34.418 80.347   1.00 37.34  ? 437  ARG C NH2   1 
ATOM   7029  N  N     . ILE C  2  438  ? 56.253  -25.995 81.643   1.00 23.70  ? 438  ILE C N     1 
ATOM   7030  C  CA    . ILE C  2  438  ? 56.109  -24.550 81.549   1.00 22.16  ? 438  ILE C CA    1 
ATOM   7031  C  C     . ILE C  2  438  ? 55.127  -24.067 82.611   1.00 21.03  ? 438  ILE C C     1 
ATOM   7032  O  O     . ILE C  2  438  ? 54.111  -24.711 82.867   1.00 20.56  ? 438  ILE C O     1 
ATOM   7033  C  CB    . ILE C  2  438  ? 55.642  -24.119 80.146   1.00 24.13  ? 438  ILE C CB    1 
ATOM   7034  C  CG1   . ILE C  2  438  ? 56.535  -24.748 79.075   1.00 23.31  ? 438  ILE C CG1   1 
ATOM   7035  C  CG2   . ILE C  2  438  ? 55.654  -22.605 80.018   1.00 27.33  ? 438  ILE C CG2   1 
ATOM   7036  C  CD1   . ILE C  2  438  ? 56.228  -24.283 77.670   1.00 25.63  ? 438  ILE C CD1   1 
ATOM   7037  N  N     . CYS C  2  439  ? 55.445  -22.938 83.234   1.00 20.08  ? 439  CYS C N     1 
ATOM   7038  C  CA    . CYS C  2  439  ? 54.629  -22.403 84.315   1.00 18.21  ? 439  CYS C CA    1 
ATOM   7039  C  C     . CYS C  2  439  ? 53.259  -21.943 83.824   1.00 18.72  ? 439  CYS C C     1 
ATOM   7040  O  O     . CYS C  2  439  ? 53.161  -21.162 82.876   1.00 20.38  ? 439  CYS C O     1 
ATOM   7041  C  CB    . CYS C  2  439  ? 55.358  -21.252 85.010   1.00 21.53  ? 439  CYS C CB    1 
ATOM   7042  S  SG    . CYS C  2  439  ? 54.593  -20.709 86.552   1.00 24.05  ? 439  CYS C SG    1 
ATOM   7043  N  N     . PRO C  2  440  ? 52.195  -22.446 84.465   1.00 17.41  ? 440  PRO C N     1 
ATOM   7044  C  CA    . PRO C  2  440  ? 50.806  -22.067 84.185   1.00 17.02  ? 440  PRO C CA    1 
ATOM   7045  C  C     . PRO C  2  440  ? 50.498  -20.655 84.672   1.00 18.98  ? 440  PRO C C     1 
ATOM   7046  O  O     . PRO C  2  440  ? 49.514  -20.053 84.244   1.00 22.34  ? 440  PRO C O     1 
ATOM   7047  C  CB    . PRO C  2  440  ? 50.005  -23.084 84.995   1.00 14.39  ? 440  PRO C CB    1 
ATOM   7048  C  CG    . PRO C  2  440  ? 50.893  -23.409 86.141   1.00 18.08  ? 440  PRO C CG    1 
ATOM   7049  C  CD    . PRO C  2  440  ? 52.287  -23.400 85.583   1.00 16.87  ? 440  PRO C CD    1 
ATOM   7050  N  N     . VAL C  2  441  ? 51.338  -20.138 85.562   1.00 19.04  ? 441  VAL C N     1 
ATOM   7051  C  CA    . VAL C  2  441  ? 51.090  -18.848 86.193   1.00 16.39  ? 441  VAL C CA    1 
ATOM   7052  C  C     . VAL C  2  441  ? 51.887  -17.704 85.568   1.00 19.05  ? 441  VAL C C     1 
ATOM   7053  O  O     . VAL C  2  441  ? 51.305  -16.773 85.015   1.00 22.17  ? 441  VAL C O     1 
ATOM   7054  C  CB    . VAL C  2  441  ? 51.366  -18.897 87.707   1.00 17.41  ? 441  VAL C CB    1 
ATOM   7055  C  CG1   . VAL C  2  441  ? 51.238  -17.511 88.312   1.00 19.10  ? 441  VAL C CG1   1 
ATOM   7056  C  CG2   . VAL C  2  441  ? 50.411  -19.867 88.388   1.00 17.20  ? 441  VAL C CG2   1 
ATOM   7057  N  N     . GLU C  2  442  ? 53.212  -17.772 85.658   1.00 22.25  ? 442  GLU C N     1 
ATOM   7058  C  CA    . GLU C  2  442  ? 54.052  -16.645 85.258   1.00 25.60  ? 442  GLU C CA    1 
ATOM   7059  C  C     . GLU C  2  442  ? 54.036  -16.385 83.754   1.00 24.75  ? 442  GLU C C     1 
ATOM   7060  O  O     . GLU C  2  442  ? 54.373  -17.260 82.954   1.00 23.85  ? 442  GLU C O     1 
ATOM   7061  C  CB    . GLU C  2  442  ? 55.493  -16.846 85.733   1.00 27.51  ? 442  GLU C CB    1 
ATOM   7062  C  CG    . GLU C  2  442  ? 56.413  -15.685 85.391   1.00 29.61  ? 442  GLU C CG    1 
ATOM   7063  C  CD    . GLU C  2  442  ? 57.874  -16.003 85.638   1.00 30.87  ? 442  GLU C CD    1 
ATOM   7064  O  OE1   . GLU C  2  442  ? 58.182  -16.642 86.667   1.00 27.74  ? 442  GLU C OE1   1 
ATOM   7065  O  OE2   . GLU C  2  442  ? 58.712  -15.622 84.795   1.00 35.60  ? 442  GLU C OE2   1 
ATOM   7066  N  N     . THR C  2  443  ? 53.669  -15.156 83.400   1.00 25.37  ? 443  THR C N     1 
ATOM   7067  C  CA    . THR C  2  443  ? 53.557  -14.704 82.017   1.00 26.95  ? 443  THR C CA    1 
ATOM   7068  C  C     . THR C  2  443  ? 53.148  -13.230 82.062   1.00 29.47  ? 443  THR C C     1 
ATOM   7069  O  O     . THR C  2  443  ? 52.527  -12.789 83.031   1.00 30.69  ? 443  THR C O     1 
ATOM   7070  C  CB    . THR C  2  443  ? 52.512  -15.533 81.221   1.00 22.71  ? 443  THR C CB    1 
ATOM   7071  O  OG1   . THR C  2  443  ? 52.833  -15.518 79.825   1.00 23.12  ? 443  THR C OG1   1 
ATOM   7072  C  CG2   . THR C  2  443  ? 51.105  -14.997 81.427   1.00 21.32  ? 443  THR C CG2   1 
ATOM   7073  N  N     . PRO C  2  444  ? 53.522  -12.452 81.034   1.00 29.96  ? 444  PRO C N     1 
ATOM   7074  C  CA    . PRO C  2  444  ? 53.182  -11.024 81.027   1.00 29.34  ? 444  PRO C CA    1 
ATOM   7075  C  C     . PRO C  2  444  ? 51.685  -10.753 80.877   1.00 28.26  ? 444  PRO C C     1 
ATOM   7076  O  O     . PRO C  2  444  ? 50.969  -11.527 80.240   1.00 25.33  ? 444  PRO C O     1 
ATOM   7077  C  CB    . PRO C  2  444  ? 53.924  -10.495 79.793   1.00 27.15  ? 444  PRO C CB    1 
ATOM   7078  C  CG    . PRO C  2  444  ? 55.018  -11.473 79.554   1.00 28.31  ? 444  PRO C CG    1 
ATOM   7079  C  CD    . PRO C  2  444  ? 54.449  -12.799 79.945   1.00 27.55  ? 444  PRO C CD    1 
ATOM   7080  N  N     . GLU C  2  445  ? 51.224  -9.660  81.477   1.00 29.67  ? 445  GLU C N     1 
ATOM   7081  C  CA    . GLU C  2  445  ? 49.892  -9.144  81.207   1.00 29.13  ? 445  GLU C CA    1 
ATOM   7082  C  C     . GLU C  2  445  ? 49.968  -8.379  79.895   1.00 31.77  ? 445  GLU C C     1 
ATOM   7083  O  O     . GLU C  2  445  ? 51.010  -7.814  79.565   1.00 39.57  ? 445  GLU C O     1 
ATOM   7084  C  CB    . GLU C  2  445  ? 49.440  -8.197  82.318   1.00 32.30  ? 445  GLU C CB    1 
ATOM   7085  C  CG    . GLU C  2  445  ? 49.729  -8.682  83.729   1.00 37.51  ? 445  GLU C CG    1 
ATOM   7086  C  CD    . GLU C  2  445  ? 49.287  -7.685  84.788   1.00 43.78  ? 445  GLU C CD    1 
ATOM   7087  O  OE1   . GLU C  2  445  ? 48.143  -7.189  84.699   1.00 40.61  ? 445  GLU C OE1   1 
ATOM   7088  O  OE2   . GLU C  2  445  ? 50.085  -7.391  85.704   1.00 44.15  ? 445  GLU C OE2   1 
ATOM   7089  N  N     . GLY C  2  446  ? 48.872  -8.349  79.147   1.00 28.91  ? 446  GLY C N     1 
ATOM   7090  C  CA    . GLY C  2  446  ? 48.847  -7.607  77.901   1.00 27.04  ? 446  GLY C CA    1 
ATOM   7091  C  C     . GLY C  2  446  ? 49.163  -8.430  76.668   1.00 25.29  ? 446  GLY C C     1 
ATOM   7092  O  O     . GLY C  2  446  ? 48.955  -9.641  76.646   1.00 25.08  ? 446  GLY C O     1 
ATOM   7093  N  N     . ALA C  2  447  ? 49.670  -7.754  75.641   1.00 25.17  ? 447  ALA C N     1 
ATOM   7094  C  CA    . ALA C  2  447  ? 49.825  -8.323  74.302   1.00 25.41  ? 447  ALA C CA    1 
ATOM   7095  C  C     . ALA C  2  447  ? 50.649  -9.607  74.225   1.00 27.66  ? 447  ALA C C     1 
ATOM   7096  O  O     . ALA C  2  447  ? 50.451  -10.421 73.323   1.00 28.62  ? 447  ALA C O     1 
ATOM   7097  C  CB    . ALA C  2  447  ? 50.402  -7.275  73.355   1.00 28.72  ? 447  ALA C CB    1 
ATOM   7098  N  N     . ASN C  2  448  ? 51.571  -9.788  75.162   1.00 26.76  ? 448  ASN C N     1 
ATOM   7099  C  CA    . ASN C  2  448  ? 52.498  -10.911 75.089   1.00 26.19  ? 448  ASN C CA    1 
ATOM   7100  C  C     . ASN C  2  448  ? 52.051  -12.172 75.825   1.00 25.36  ? 448  ASN C C     1 
ATOM   7101  O  O     . ASN C  2  448  ? 52.800  -13.145 75.893   1.00 28.29  ? 448  ASN C O     1 
ATOM   7102  C  CB    . ASN C  2  448  ? 53.893  -10.490 75.556   1.00 28.34  ? 448  ASN C CB    1 
ATOM   7103  C  CG    . ASN C  2  448  ? 54.646  -9.708  74.499   1.00 34.00  ? 448  ASN C CG    1 
ATOM   7104  O  OD1   . ASN C  2  448  ? 54.531  -9.987  73.305   1.00 32.39  ? 448  ASN C OD1   1 
ATOM   7105  N  ND2   . ASN C  2  448  ? 55.420  -8.721  74.933   1.00 43.87  ? 448  ASN C ND2   1 
ATOM   7106  N  N     . ILE C  2  449  ? 50.839  -12.156 76.374   1.00 23.95  ? 449  ILE C N     1 
ATOM   7107  C  CA    . ILE C  2  449  ? 50.352  -13.292 77.152   1.00 22.82  ? 449  ILE C CA    1 
ATOM   7108  C  C     . ILE C  2  449  ? 50.356  -14.594 76.346   1.00 22.63  ? 449  ILE C C     1 
ATOM   7109  O  O     . ILE C  2  449  ? 49.805  -14.667 75.247   1.00 23.07  ? 449  ILE C O     1 
ATOM   7110  C  CB    . ILE C  2  449  ? 48.953  -13.027 77.767   1.00 20.95  ? 449  ILE C CB    1 
ATOM   7111  C  CG1   . ILE C  2  449  ? 48.485  -14.242 78.571   1.00 20.14  ? 449  ILE C CG1   1 
ATOM   7112  C  CG2   . ILE C  2  449  ? 47.939  -12.667 76.692   1.00 23.71  ? 449  ILE C CG2   1 
ATOM   7113  C  CD1   . ILE C  2  449  ? 47.158  -14.043 79.263   1.00 22.39  ? 449  ILE C CD1   1 
ATOM   7114  N  N     . GLY C  2  450  ? 51.018  -15.607 76.896   1.00 22.43  ? 450  GLY C N     1 
ATOM   7115  C  CA    . GLY C  2  450  ? 51.112  -16.911 76.266   1.00 25.28  ? 450  GLY C CA    1 
ATOM   7116  C  C     . GLY C  2  450  ? 52.290  -17.017 75.316   1.00 26.04  ? 450  GLY C C     1 
ATOM   7117  O  O     . GLY C  2  450  ? 52.785  -18.111 75.043   1.00 25.98  ? 450  GLY C O     1 
ATOM   7118  N  N     . LEU C  2  451  ? 52.741  -15.873 74.812   1.00 24.10  ? 451  LEU C N     1 
ATOM   7119  C  CA    . LEU C  2  451  ? 53.895  -15.828 73.921   1.00 24.35  ? 451  LEU C CA    1 
ATOM   7120  C  C     . LEU C  2  451  ? 55.203  -15.849 74.703   1.00 26.07  ? 451  LEU C C     1 
ATOM   7121  O  O     . LEU C  2  451  ? 56.172  -16.488 74.295   1.00 32.09  ? 451  LEU C O     1 
ATOM   7122  C  CB    . LEU C  2  451  ? 53.830  -14.601 73.012   1.00 24.13  ? 451  LEU C CB    1 
ATOM   7123  C  CG    . LEU C  2  451  ? 52.567  -14.514 72.152   1.00 24.74  ? 451  LEU C CG    1 
ATOM   7124  C  CD1   . LEU C  2  451  ? 52.701  -13.418 71.107   1.00 30.48  ? 451  LEU C CD1   1 
ATOM   7125  C  CD2   . LEU C  2  451  ? 52.256  -15.856 71.501   1.00 22.11  ? 451  LEU C CD2   1 
ATOM   7126  N  N     . ILE C  2  452  ? 55.225  -15.139 75.824   1.00 24.95  ? 452  ILE C N     1 
ATOM   7127  C  CA    . ILE C  2  452  ? 56.386  -15.135 76.702   1.00 24.40  ? 452  ILE C CA    1 
ATOM   7128  C  C     . ILE C  2  452  ? 56.054  -15.907 77.971   1.00 24.93  ? 452  ILE C C     1 
ATOM   7129  O  O     . ILE C  2  452  ? 55.100  -15.582 78.674   1.00 25.67  ? 452  ILE C O     1 
ATOM   7130  C  CB    . ILE C  2  452  ? 56.810  -13.704 77.078   1.00 26.32  ? 452  ILE C CB    1 
ATOM   7131  C  CG1   . ILE C  2  452  ? 56.829  -12.805 75.839   1.00 26.71  ? 452  ILE C CG1   1 
ATOM   7132  C  CG2   . ILE C  2  452  ? 58.168  -13.715 77.761   1.00 28.94  ? 452  ILE C CG2   1 
ATOM   7133  C  CD1   . ILE C  2  452  ? 57.808  -13.248 74.777   1.00 31.88  ? 452  ILE C CD1   1 
ATOM   7134  N  N     . THR C  2  453  ? 56.836  -16.940 78.254   1.00 24.46  ? 453  THR C N     1 
ATOM   7135  C  CA    . THR C  2  453  ? 56.608  -17.766 79.432   1.00 29.01  ? 453  THR C CA    1 
ATOM   7136  C  C     . THR C  2  453  ? 57.910  -18.056 80.166   1.00 28.99  ? 453  THR C C     1 
ATOM   7137  O  O     . THR C  2  453  ? 58.965  -17.525 79.815   1.00 26.78  ? 453  THR C O     1 
ATOM   7138  C  CB    . THR C  2  453  ? 55.908  -19.094 79.075   1.00 30.42  ? 453  THR C CB    1 
ATOM   7139  O  OG1   . THR C  2  453  ? 56.482  -19.634 77.878   1.00 30.09  ? 453  THR C OG1   1 
ATOM   7140  C  CG2   . THR C  2  453  ? 54.414  -18.873 78.860   1.00 27.27  ? 453  THR C CG2   1 
ATOM   7141  N  N     . SER C  2  454  ? 57.830  -18.894 81.192   1.00 28.96  ? 454  SER C N     1 
ATOM   7142  C  CA    . SER C  2  454  ? 59.000  -19.216 81.994   1.00 26.83  ? 454  SER C CA    1 
ATOM   7143  C  C     . SER C  2  454  ? 59.113  -20.719 82.222   1.00 23.77  ? 454  SER C C     1 
ATOM   7144  O  O     . SER C  2  454  ? 58.111  -21.434 82.253   1.00 21.60  ? 454  SER C O     1 
ATOM   7145  C  CB    . SER C  2  454  ? 58.950  -18.473 83.331   1.00 29.65  ? 454  SER C CB    1 
ATOM   7146  O  OG    . SER C  2  454  ? 60.253  -18.250 83.844   1.00 31.24  ? 454  SER C OG    1 
ATOM   7147  N  N     . LEU C  2  455  ? 60.347  -21.185 82.376   1.00 24.20  ? 455  LEU C N     1 
ATOM   7148  C  CA    . LEU C  2  455  ? 60.630  -22.600 82.568   1.00 22.93  ? 455  LEU C CA    1 
ATOM   7149  C  C     . LEU C  2  455  ? 60.277  -23.036 83.986   1.00 24.70  ? 455  LEU C C     1 
ATOM   7150  O  O     . LEU C  2  455  ? 60.524  -22.305 84.944   1.00 29.04  ? 455  LEU C O     1 
ATOM   7151  C  CB    . LEU C  2  455  ? 62.110  -22.867 82.290   1.00 20.08  ? 455  LEU C CB    1 
ATOM   7152  C  CG    . LEU C  2  455  ? 62.544  -24.320 82.116   1.00 23.77  ? 455  LEU C CG    1 
ATOM   7153  C  CD1   . LEU C  2  455  ? 61.718  -24.992 81.034   1.00 28.55  ? 455  LEU C CD1   1 
ATOM   7154  C  CD2   . LEU C  2  455  ? 64.024  -24.387 81.781   1.00 24.61  ? 455  LEU C CD2   1 
ATOM   7155  N  N     . ALA C  2  456  ? 59.697  -24.225 84.121   1.00 22.53  ? 456  ALA C N     1 
ATOM   7156  C  CA    . ALA C  2  456  ? 59.377  -24.763 85.440   1.00 22.42  ? 456  ALA C CA    1 
ATOM   7157  C  C     . ALA C  2  456  ? 60.660  -25.031 86.218   1.00 26.59  ? 456  ALA C C     1 
ATOM   7158  O  O     . ALA C  2  456  ? 61.726  -25.203 85.626   1.00 28.73  ? 456  ALA C O     1 
ATOM   7159  C  CB    . ALA C  2  456  ? 58.550  -26.031 85.322   1.00 23.60  ? 456  ALA C CB    1 
ATOM   7160  N  N     . ALA C  2  457  ? 60.550  -25.058 87.543   1.00 29.36  ? 457  ALA C N     1 
ATOM   7161  C  CA    . ALA C  2  457  ? 61.712  -25.207 88.416   1.00 30.14  ? 457  ALA C CA    1 
ATOM   7162  C  C     . ALA C  2  457  ? 62.501  -26.493 88.158   1.00 32.40  ? 457  ALA C C     1 
ATOM   7163  O  O     . ALA C  2  457  ? 63.705  -26.450 87.899   1.00 29.45  ? 457  ALA C O     1 
ATOM   7164  C  CB    . ALA C  2  457  ? 61.289  -25.125 89.877   1.00 24.76  ? 457  ALA C CB    1 
ATOM   7165  N  N     . TYR C  2  458  ? 61.818  -27.632 88.221   1.00 31.51  ? 458  TYR C N     1 
ATOM   7166  C  CA    . TYR C  2  458  ? 62.473  -28.924 88.041   1.00 31.57  ? 458  TYR C CA    1 
ATOM   7167  C  C     . TYR C  2  458  ? 62.625  -29.311 86.573   1.00 32.57  ? 458  TYR C C     1 
ATOM   7168  O  O     . TYR C  2  458  ? 63.177  -30.365 86.258   1.00 37.61  ? 458  TYR C O     1 
ATOM   7169  C  CB    . TYR C  2  458  ? 61.716  -30.021 88.792   1.00 30.02  ? 458  TYR C CB    1 
ATOM   7170  C  CG    . TYR C  2  458  ? 62.050  -30.106 90.264   1.00 30.61  ? 458  TYR C CG    1 
ATOM   7171  C  CD1   . TYR C  2  458  ? 61.222  -29.533 91.220   1.00 31.34  ? 458  TYR C CD1   1 
ATOM   7172  C  CD2   . TYR C  2  458  ? 63.192  -30.765 90.698   1.00 36.92  ? 458  TYR C CD2   1 
ATOM   7173  C  CE1   . TYR C  2  458  ? 61.523  -29.613 92.568   1.00 33.45  ? 458  TYR C CE1   1 
ATOM   7174  C  CE2   . TYR C  2  458  ? 63.502  -30.850 92.043   1.00 39.59  ? 458  TYR C CE2   1 
ATOM   7175  C  CZ    . TYR C  2  458  ? 62.664  -30.272 92.973   1.00 39.72  ? 458  TYR C CZ    1 
ATOM   7176  O  OH    . TYR C  2  458  ? 62.969  -30.353 94.313   1.00 43.14  ? 458  TYR C OH    1 
ATOM   7177  N  N     . ALA C  2  459  ? 62.139  -28.458 85.679   1.00 28.47  ? 459  ALA C N     1 
ATOM   7178  C  CA    . ALA C  2  459  ? 62.158  -28.753 84.250   1.00 32.01  ? 459  ALA C CA    1 
ATOM   7179  C  C     . ALA C  2  459  ? 63.568  -28.802 83.659   1.00 35.60  ? 459  ALA C C     1 
ATOM   7180  O  O     . ALA C  2  459  ? 64.460  -28.063 84.081   1.00 31.30  ? 459  ALA C O     1 
ATOM   7181  C  CB    . ALA C  2  459  ? 61.304  -27.748 83.493   1.00 31.23  ? 459  ALA C CB    1 
ATOM   7182  N  N     . ARG C  2  460  ? 63.753  -29.682 82.677   1.00 39.60  ? 460  ARG C N     1 
ATOM   7183  C  CA    . ARG C  2  460  ? 65.015  -29.794 81.949   1.00 36.39  ? 460  ARG C CA    1 
ATOM   7184  C  C     . ARG C  2  460  ? 64.789  -29.845 80.440   1.00 34.00  ? 460  ARG C C     1 
ATOM   7185  O  O     . ARG C  2  460  ? 63.806  -30.413 79.965   1.00 32.43  ? 460  ARG C O     1 
ATOM   7186  C  CB    . ARG C  2  460  ? 65.799  -31.029 82.398   1.00 38.72  ? 460  ARG C CB    1 
ATOM   7187  C  CG    . ARG C  2  460  ? 66.792  -30.765 83.518   1.00 45.02  ? 460  ARG C CG    1 
ATOM   7188  C  CD    . ARG C  2  460  ? 67.703  -31.962 83.743   1.00 44.78  ? 460  ARG C CD    1 
ATOM   7189  N  NE    . ARG C  2  460  ? 68.748  -31.676 84.722   1.00 49.94  ? 460  ARG C NE    1 
ATOM   7190  C  CZ    . ARG C  2  460  ? 69.639  -32.567 85.146   1.00 58.41  ? 460  ARG C CZ    1 
ATOM   7191  N  NH1   . ARG C  2  460  ? 69.611  -33.808 84.678   1.00 65.74  ? 460  ARG C NH1   1 
ATOM   7192  N  NH2   . ARG C  2  460  ? 70.556  -32.219 86.039   1.00 52.40  ? 460  ARG C NH2   1 
ATOM   7193  N  N     . VAL C  2  461  ? 65.713  -29.250 79.693   1.00 34.00  ? 461  VAL C N     1 
ATOM   7194  C  CA    . VAL C  2  461  ? 65.644  -29.243 78.238   1.00 37.55  ? 461  VAL C CA    1 
ATOM   7195  C  C     . VAL C  2  461  ? 66.724  -30.159 77.669   1.00 41.22  ? 461  VAL C C     1 
ATOM   7196  O  O     . VAL C  2  461  ? 67.916  -29.889 77.826   1.00 42.48  ? 461  VAL C O     1 
ATOM   7197  C  CB    . VAL C  2  461  ? 65.843  -27.818 77.682   1.00 40.18  ? 461  VAL C CB    1 
ATOM   7198  C  CG1   . VAL C  2  461  ? 65.753  -27.815 76.163   1.00 39.57  ? 461  VAL C CG1   1 
ATOM   7199  C  CG2   . VAL C  2  461  ? 64.822  -26.864 78.287   1.00 33.50  ? 461  VAL C CG2   1 
ATOM   7200  N  N     . ASP C  2  462  ? 66.312  -31.240 77.009   1.00 38.91  ? 462  ASP C N     1 
ATOM   7201  C  CA    . ASP C  2  462  ? 67.272  -32.230 76.517   1.00 44.52  ? 462  ASP C CA    1 
ATOM   7202  C  C     . ASP C  2  462  ? 68.011  -31.797 75.248   1.00 44.58  ? 462  ASP C C     1 
ATOM   7203  O  O     . ASP C  2  462  ? 67.892  -30.655 74.803   1.00 44.27  ? 462  ASP C O     1 
ATOM   7204  C  CB    . ASP C  2  462  ? 66.627  -33.617 76.344   1.00 42.88  ? 462  ASP C CB    1 
ATOM   7205  C  CG    . ASP C  2  462  ? 65.492  -33.632 75.328   1.00 43.40  ? 462  ASP C CG    1 
ATOM   7206  O  OD1   . ASP C  2  462  ? 65.513  -32.841 74.361   1.00 40.28  ? 462  ASP C OD1   1 
ATOM   7207  O  OD2   . ASP C  2  462  ? 64.574  -34.462 75.491   1.00 45.09  ? 462  ASP C OD2   1 
ATOM   7208  N  N     . GLU C  2  463  ? 68.777  -32.722 74.677   1.00 43.00  ? 463  GLU C N     1 
ATOM   7209  C  CA    . GLU C  2  463  ? 69.579  -32.435 73.494   1.00 43.22  ? 463  GLU C CA    1 
ATOM   7210  C  C     . GLU C  2  463  ? 68.710  -32.200 72.261   1.00 40.12  ? 463  GLU C C     1 
ATOM   7211  O  O     . GLU C  2  463  ? 69.136  -31.551 71.306   1.00 34.35  ? 463  GLU C O     1 
ATOM   7212  C  CB    . GLU C  2  463  ? 70.563  -33.577 73.235   1.00 57.26  ? 463  GLU C CB    1 
ATOM   7213  C  CG    . GLU C  2  463  ? 71.433  -33.928 74.435   1.00 68.11  ? 463  GLU C CG    1 
ATOM   7214  C  CD    . GLU C  2  463  ? 72.361  -35.097 74.161   1.00 76.85  ? 463  GLU C CD    1 
ATOM   7215  O  OE1   . GLU C  2  463  ? 73.024  -35.569 75.110   1.00 75.00  ? 463  GLU C OE1   1 
ATOM   7216  O  OE2   . GLU C  2  463  ? 72.427  -35.543 72.996   1.00 75.50  ? 463  GLU C OE2   1 
ATOM   7217  N  N     . LEU C  2  464  ? 67.493  -32.734 72.285   1.00 43.73  ? 464  LEU C N     1 
ATOM   7218  C  CA    . LEU C  2  464  ? 66.566  -32.585 71.165   1.00 42.78  ? 464  LEU C CA    1 
ATOM   7219  C  C     . LEU C  2  464  ? 65.755  -31.288 71.229   1.00 39.88  ? 464  LEU C C     1 
ATOM   7220  O  O     . LEU C  2  464  ? 65.152  -30.877 70.236   1.00 35.10  ? 464  LEU C O     1 
ATOM   7221  C  CB    . LEU C  2  464  ? 65.631  -33.794 71.086   1.00 44.40  ? 464  LEU C CB    1 
ATOM   7222  C  CG    . LEU C  2  464  ? 65.935  -34.839 70.010   1.00 45.91  ? 464  LEU C CG    1 
ATOM   7223  C  CD1   . LEU C  2  464  ? 67.428  -35.119 69.912   1.00 41.82  ? 464  LEU C CD1   1 
ATOM   7224  C  CD2   . LEU C  2  464  ? 65.155  -36.120 70.276   1.00 50.34  ? 464  LEU C CD2   1 
ATOM   7225  N  N     . GLY C  2  465  ? 65.748  -30.649 72.395   1.00 41.47  ? 465  GLY C N     1 
ATOM   7226  C  CA    . GLY C  2  465  ? 65.058  -29.383 72.571   1.00 34.88  ? 465  GLY C CA    1 
ATOM   7227  C  C     . GLY C  2  465  ? 63.712  -29.484 73.269   1.00 31.36  ? 465  GLY C C     1 
ATOM   7228  O  O     . GLY C  2  465  ? 63.028  -28.478 73.457   1.00 28.04  ? 465  GLY C O     1 
ATOM   7229  N  N     . PHE C  2  466  ? 63.330  -30.698 73.653   1.00 31.23  ? 466  PHE C N     1 
ATOM   7230  C  CA    . PHE C  2  466  ? 62.052  -30.921 74.322   1.00 29.82  ? 466  PHE C CA    1 
ATOM   7231  C  C     . PHE C  2  466  ? 62.190  -30.780 75.833   1.00 33.80  ? 466  PHE C C     1 
ATOM   7232  O  O     . PHE C  2  466  ? 63.187  -31.205 76.416   1.00 37.54  ? 466  PHE C O     1 
ATOM   7233  C  CB    . PHE C  2  466  ? 61.496  -32.301 73.968   1.00 33.47  ? 466  PHE C CB    1 
ATOM   7234  C  CG    . PHE C  2  466  ? 61.294  -32.510 72.495   1.00 38.38  ? 466  PHE C CG    1 
ATOM   7235  C  CD1   . PHE C  2  466  ? 62.338  -32.945 71.696   1.00 39.96  ? 466  PHE C CD1   1 
ATOM   7236  C  CD2   . PHE C  2  466  ? 60.063  -32.272 71.909   1.00 37.01  ? 466  PHE C CD2   1 
ATOM   7237  C  CE1   . PHE C  2  466  ? 62.159  -33.136 70.340   1.00 38.78  ? 466  PHE C CE1   1 
ATOM   7238  C  CE2   . PHE C  2  466  ? 59.879  -32.462 70.553   1.00 37.09  ? 466  PHE C CE2   1 
ATOM   7239  C  CZ    . PHE C  2  466  ? 60.928  -32.896 69.769   1.00 39.49  ? 466  PHE C CZ    1 
ATOM   7240  N  N     . ILE C  2  467  ? 61.185  -30.184 76.465   1.00 34.50  ? 467  ILE C N     1 
ATOM   7241  C  CA    . ILE C  2  467  ? 61.224  -29.965 77.906   1.00 34.50  ? 467  ILE C CA    1 
ATOM   7242  C  C     . ILE C  2  467  ? 60.840  -31.227 78.671   1.00 32.21  ? 467  ILE C C     1 
ATOM   7243  O  O     . ILE C  2  467  ? 59.792  -31.823 78.421   1.00 29.28  ? 467  ILE C O     1 
ATOM   7244  C  CB    . ILE C  2  467  ? 60.304  -28.808 78.335   1.00 30.14  ? 467  ILE C CB    1 
ATOM   7245  C  CG1   . ILE C  2  467  ? 60.572  -27.571 77.478   1.00 26.95  ? 467  ILE C CG1   1 
ATOM   7246  C  CG2   . ILE C  2  467  ? 60.509  -28.486 79.804   1.00 30.91  ? 467  ILE C CG2   1 
ATOM   7247  C  CD1   . ILE C  2  467  ? 59.754  -26.365 77.881   1.00 29.08  ? 467  ILE C CD1   1 
ATOM   7248  N  N     . ARG C  2  468  ? 61.697  -31.626 79.605   1.00 32.13  ? 468  ARG C N     1 
ATOM   7249  C  CA    . ARG C  2  468  ? 61.469  -32.836 80.381   1.00 32.54  ? 468  ARG C CA    1 
ATOM   7250  C  C     . ARG C  2  468  ? 61.289  -32.527 81.862   1.00 31.24  ? 468  ARG C C     1 
ATOM   7251  O  O     . ARG C  2  468  ? 61.919  -31.618 82.398   1.00 32.37  ? 468  ARG C O     1 
ATOM   7252  C  CB    . ARG C  2  468  ? 62.627  -33.819 80.191   1.00 36.34  ? 468  ARG C CB    1 
ATOM   7253  C  CG    . ARG C  2  468  ? 63.051  -34.012 78.743   1.00 39.77  ? 468  ARG C CG    1 
ATOM   7254  C  CD    . ARG C  2  468  ? 64.190  -35.015 78.632   1.00 45.16  ? 468  ARG C CD    1 
ATOM   7255  N  NE    . ARG C  2  468  ? 63.716  -36.396 78.616   1.00 51.22  ? 468  ARG C NE    1 
ATOM   7256  C  CZ    . ARG C  2  468  ? 63.708  -37.169 77.534   1.00 47.93  ? 468  ARG C CZ    1 
ATOM   7257  N  NH1   . ARG C  2  468  ? 64.156  -36.698 76.378   1.00 41.23  ? 468  ARG C NH1   1 
ATOM   7258  N  NH2   . ARG C  2  468  ? 63.258  -38.415 77.609   1.00 47.16  ? 468  ARG C NH2   1 
ATOM   7259  N  N     . THR C  2  469  ? 60.425  -33.294 82.517   1.00 29.49  ? 469  THR C N     1 
ATOM   7260  C  CA    . THR C  2  469  ? 60.184  -33.129 83.944   1.00 30.71  ? 469  THR C CA    1 
ATOM   7261  C  C     . THR C  2  469  ? 60.409  -34.445 84.682   1.00 34.19  ? 469  THR C C     1 
ATOM   7262  O  O     . THR C  2  469  ? 60.072  -35.512 84.170   1.00 36.65  ? 469  THR C O     1 
ATOM   7263  C  CB    . THR C  2  469  ? 58.753  -32.625 84.212   1.00 35.15  ? 469  THR C CB    1 
ATOM   7264  O  OG1   . THR C  2  469  ? 58.434  -32.790 85.600   1.00 37.28  ? 469  THR C OG1   1 
ATOM   7265  C  CG2   . THR C  2  469  ? 57.751  -33.402 83.374   1.00 35.37  ? 469  THR C CG2   1 
ATOM   7266  N  N     . PRO C  2  470  ? 60.989  -34.371 85.891   1.00 35.29  ? 470  PRO C N     1 
ATOM   7267  C  CA    . PRO C  2  470  ? 61.276  -35.562 86.697   1.00 37.83  ? 470  PRO C CA    1 
ATOM   7268  C  C     . PRO C  2  470  ? 60.032  -36.187 87.327   1.00 34.55  ? 470  PRO C C     1 
ATOM   7269  O  O     . PRO C  2  470  ? 59.124  -35.476 87.757   1.00 31.63  ? 470  PRO C O     1 
ATOM   7270  C  CB    . PRO C  2  470  ? 62.200  -35.022 87.791   1.00 35.83  ? 470  PRO C CB    1 
ATOM   7271  C  CG    . PRO C  2  470  ? 61.812  -33.599 87.931   1.00 31.99  ? 470  PRO C CG    1 
ATOM   7272  C  CD    . PRO C  2  470  ? 61.473  -33.141 86.542   1.00 35.08  ? 470  PRO C CD    1 
ATOM   7273  N  N     . TYR C  2  471  ? 60.005  -37.516 87.372   1.00 37.08  ? 471  TYR C N     1 
ATOM   7274  C  CA    . TYR C  2  471  ? 58.965  -38.255 88.079   1.00 40.53  ? 471  TYR C CA    1 
ATOM   7275  C  C     . TYR C  2  471  ? 59.600  -39.399 88.862   1.00 46.16  ? 471  TYR C C     1 
ATOM   7276  O  O     . TYR C  2  471  ? 60.745  -39.770 88.611   1.00 46.48  ? 471  TYR C O     1 
ATOM   7277  C  CB    . TYR C  2  471  ? 57.927  -38.815 87.107   1.00 43.64  ? 471  TYR C CB    1 
ATOM   7278  C  CG    . TYR C  2  471  ? 57.101  -37.769 86.391   1.00 43.84  ? 471  TYR C CG    1 
ATOM   7279  C  CD1   . TYR C  2  471  ? 57.317  -37.486 85.048   1.00 39.99  ? 471  TYR C CD1   1 
ATOM   7280  C  CD2   . TYR C  2  471  ? 56.100  -37.072 87.055   1.00 46.04  ? 471  TYR C CD2   1 
ATOM   7281  C  CE1   . TYR C  2  471  ? 56.561  -36.538 84.387   1.00 36.12  ? 471  TYR C CE1   1 
ATOM   7282  C  CE2   . TYR C  2  471  ? 55.340  -36.119 86.402   1.00 43.82  ? 471  TYR C CE2   1 
ATOM   7283  C  CZ    . TYR C  2  471  ? 55.575  -35.856 85.068   1.00 39.71  ? 471  TYR C CZ    1 
ATOM   7284  O  OH    . TYR C  2  471  ? 54.819  -34.909 84.415   1.00 39.35  ? 471  TYR C OH    1 
ATOM   7285  N  N     . ARG C  2  472  ? 58.855  -39.959 89.807   1.00 49.23  ? 472  ARG C N     1 
ATOM   7286  C  CA    . ARG C  2  472  ? 59.349  -41.075 90.605   1.00 53.51  ? 472  ARG C CA    1 
ATOM   7287  C  C     . ARG C  2  472  ? 58.660  -42.383 90.234   1.00 53.29  ? 472  ARG C C     1 
ATOM   7288  O  O     . ARG C  2  472  ? 57.434  -42.444 90.140   1.00 51.54  ? 472  ARG C O     1 
ATOM   7289  C  CB    . ARG C  2  472  ? 59.171  -40.800 92.099   1.00 51.03  ? 472  ARG C CB    1 
ATOM   7290  C  CG    . ARG C  2  472  ? 60.253  -39.926 92.705   1.00 51.47  ? 472  ARG C CG    1 
ATOM   7291  C  CD    . ARG C  2  472  ? 60.379  -40.190 94.195   1.00 60.23  ? 472  ARG C CD    1 
ATOM   7292  N  NE    . ARG C  2  472  ? 59.197  -39.764 94.938   1.00 63.35  ? 472  ARG C NE    1 
ATOM   7293  C  CZ    . ARG C  2  472  ? 58.979  -40.045 96.220   1.00 63.41  ? 472  ARG C CZ    1 
ATOM   7294  N  NH1   . ARG C  2  472  ? 59.859  -40.765 96.902   1.00 60.35  ? 472  ARG C NH1   1 
ATOM   7295  N  NH2   . ARG C  2  472  ? 57.876  -39.615 96.817   1.00 64.02  ? 472  ARG C NH2   1 
ATOM   7296  N  N     . ARG C  2  473  ? 59.458  -43.427 90.033   1.00 50.22  ? 473  ARG C N     1 
ATOM   7297  C  CA    . ARG C  2  473  ? 58.932  -44.743 89.697   1.00 47.99  ? 473  ARG C CA    1 
ATOM   7298  C  C     . ARG C  2  473  ? 58.179  -45.353 90.873   1.00 49.14  ? 473  ARG C C     1 
ATOM   7299  O  O     . ARG C  2  473  ? 58.677  -45.375 91.999   1.00 51.98  ? 473  ARG C O     1 
ATOM   7300  C  CB    . ARG C  2  473  ? 60.066  -45.678 89.269   1.00 50.85  ? 473  ARG C CB    1 
ATOM   7301  C  CG    . ARG C  2  473  ? 59.624  -47.109 88.992   1.00 52.55  ? 473  ARG C CG    1 
ATOM   7302  C  CD    . ARG C  2  473  ? 59.222  -47.302 87.541   1.00 46.11  ? 473  ARG C CD    1 
ATOM   7303  N  NE    . ARG C  2  473  ? 60.365  -47.159 86.647   1.00 45.61  ? 473  ARG C NE    1 
ATOM   7304  C  CZ    . ARG C  2  473  ? 60.321  -47.365 85.335   1.00 55.96  ? 473  ARG C CZ    1 
ATOM   7305  N  NH1   . ARG C  2  473  ? 59.184  -47.728 84.756   1.00 58.27  ? 473  ARG C NH1   1 
ATOM   7306  N  NH2   . ARG C  2  473  ? 61.415  -47.210 84.601   1.00 61.11  ? 473  ARG C NH2   1 
ATOM   7307  N  N     . VAL C  2  474  ? 56.973  -45.842 90.606   1.00 45.74  ? 474  VAL C N     1 
ATOM   7308  C  CA    . VAL C  2  474  ? 56.190  -46.538 91.617   1.00 46.00  ? 474  VAL C CA    1 
ATOM   7309  C  C     . VAL C  2  474  ? 55.955  -47.979 91.185   1.00 52.00  ? 474  VAL C C     1 
ATOM   7310  O  O     . VAL C  2  474  ? 55.317  -48.232 90.164   1.00 51.31  ? 474  VAL C O     1 
ATOM   7311  C  CB    . VAL C  2  474  ? 54.834  -45.854 91.855   1.00 46.16  ? 474  VAL C CB    1 
ATOM   7312  C  CG1   . VAL C  2  474  ? 53.996  -46.666 92.831   1.00 49.97  ? 474  VAL C CG1   1 
ATOM   7313  C  CG2   . VAL C  2  474  ? 55.040  -44.441 92.369   1.00 47.04  ? 474  VAL C CG2   1 
ATOM   7314  N  N     . VAL C  2  475  ? 56.480  -48.921 91.962   1.00 57.38  ? 475  VAL C N     1 
ATOM   7315  C  CA    . VAL C  2  475  ? 56.333  -50.335 91.640   1.00 55.50  ? 475  VAL C CA    1 
ATOM   7316  C  C     . VAL C  2  475  ? 55.466  -51.053 92.671   1.00 50.62  ? 475  VAL C C     1 
ATOM   7317  O  O     . VAL C  2  475  ? 55.884  -51.251 93.812   1.00 48.33  ? 475  VAL C O     1 
ATOM   7318  C  CB    . VAL C  2  475  ? 57.703  -51.038 91.555   1.00 48.45  ? 475  VAL C CB    1 
ATOM   7319  C  CG1   . VAL C  2  475  ? 57.535  -52.465 91.061   1.00 46.10  ? 475  VAL C CG1   1 
ATOM   7320  C  CG2   . VAL C  2  475  ? 58.644  -50.264 90.643   1.00 42.98  ? 475  VAL C CG2   1 
ATOM   7321  N  N     . GLY C  2  476  ? 54.263  -51.441 92.257   1.00 46.50  ? 476  GLY C N     1 
ATOM   7322  C  CA    . GLY C  2  476  ? 53.352  -52.191 93.105   1.00 48.73  ? 476  GLY C CA    1 
ATOM   7323  C  C     . GLY C  2  476  ? 53.020  -51.533 94.433   1.00 56.47  ? 476  GLY C C     1 
ATOM   7324  O  O     . GLY C  2  476  ? 53.179  -52.142 95.491   1.00 56.03  ? 476  GLY C O     1 
ATOM   7325  N  N     . GLY C  2  477  ? 52.564  -50.286 94.381   1.00 59.70  ? 477  GLY C N     1 
ATOM   7326  C  CA    . GLY C  2  477  ? 52.187  -49.563 95.583   1.00 56.23  ? 477  GLY C CA    1 
ATOM   7327  C  C     . GLY C  2  477  ? 53.379  -49.081 96.387   1.00 55.59  ? 477  GLY C C     1 
ATOM   7328  O  O     . GLY C  2  477  ? 53.221  -48.468 97.443   1.00 58.72  ? 477  GLY C O     1 
ATOM   7329  N  N     . VAL C  2  478  ? 54.576  -49.363 95.886   1.00 53.96  ? 478  VAL C N     1 
ATOM   7330  C  CA    . VAL C  2  478  ? 55.805  -48.940 96.543   1.00 55.61  ? 478  VAL C CA    1 
ATOM   7331  C  C     . VAL C  2  478  ? 56.482  -47.850 95.725   1.00 53.82  ? 478  VAL C C     1 
ATOM   7332  O  O     . VAL C  2  478  ? 56.750  -48.030 94.538   1.00 53.22  ? 478  VAL C O     1 
ATOM   7333  C  CB    . VAL C  2  478  ? 56.785  -50.115 96.719   1.00 58.55  ? 478  VAL C CB    1 
ATOM   7334  C  CG1   . VAL C  2  478  ? 58.056  -49.648 97.415   1.00 53.46  ? 478  VAL C CG1   1 
ATOM   7335  C  CG2   . VAL C  2  478  ? 56.125  -51.245 97.496   1.00 62.30  ? 478  VAL C CG2   1 
ATOM   7336  N  N     . VAL C  2  479  ? 56.763  -46.722 96.366   1.00 54.84  ? 479  VAL C N     1 
ATOM   7337  C  CA    . VAL C  2  479  ? 57.375  -45.597 95.673   1.00 56.32  ? 479  VAL C CA    1 
ATOM   7338  C  C     . VAL C  2  479  ? 58.891  -45.669 95.787   1.00 49.94  ? 479  VAL C C     1 
ATOM   7339  O  O     . VAL C  2  479  ? 59.451  -45.501 96.869   1.00 54.91  ? 479  VAL C O     1 
ATOM   7340  C  CB    . VAL C  2  479  ? 56.895  -44.253 96.253   1.00 56.98  ? 479  VAL C CB    1 
ATOM   7341  C  CG1   . VAL C  2  479  ? 57.513  -43.096 95.487   1.00 53.50  ? 479  VAL C CG1   1 
ATOM   7342  C  CG2   . VAL C  2  479  ? 55.375  -44.171 96.220   1.00 53.56  ? 479  VAL C CG2   1 
ATOM   7343  N  N     . THR C  2  480  ? 59.553  -45.917 94.662   1.00 42.77  ? 480  THR C N     1 
ATOM   7344  C  CA    . THR C  2  480  ? 61.004  -46.011 94.653   1.00 50.97  ? 480  THR C CA    1 
ATOM   7345  C  C     . THR C  2  480  ? 61.612  -44.619 94.649   1.00 54.98  ? 480  THR C C     1 
ATOM   7346  O  O     . THR C  2  480  ? 60.894  -43.620 94.601   1.00 57.37  ? 480  THR C O     1 
ATOM   7347  C  CB    . THR C  2  480  ? 61.507  -46.764 93.413   1.00 55.61  ? 480  THR C CB    1 
ATOM   7348  O  OG1   . THR C  2  480  ? 61.444  -45.902 92.270   1.00 53.48  ? 480  THR C OG1   1 
ATOM   7349  C  CG2   . THR C  2  480  ? 60.662  -48.006 93.164   1.00 55.16  ? 480  THR C CG2   1 
ATOM   7350  N  N     . ASP C  2  481  ? 62.936  -44.553 94.706   1.00 55.31  ? 481  ASP C N     1 
ATOM   7351  C  CA    . ASP C  2  481  ? 63.633  -43.278 94.597   1.00 59.16  ? 481  ASP C CA    1 
ATOM   7352  C  C     . ASP C  2  481  ? 64.146  -43.029 93.181   1.00 58.06  ? 481  ASP C C     1 
ATOM   7353  O  O     . ASP C  2  481  ? 64.781  -42.008 92.916   1.00 59.62  ? 481  ASP C O     1 
ATOM   7354  C  CB    . ASP C  2  481  ? 64.767  -43.179 95.620   1.00 65.64  ? 481  ASP C CB    1 
ATOM   7355  C  CG    . ASP C  2  481  ? 64.258  -42.921 97.029   1.00 75.14  ? 481  ASP C CG    1 
ATOM   7356  O  OD1   . ASP C  2  481  ? 63.128  -42.404 97.171   1.00 73.32  ? 481  ASP C OD1   1 
ATOM   7357  O  OD2   . ASP C  2  481  ? 64.989  -43.230 97.994   1.00 77.05  ? 481  ASP C OD2   1 
ATOM   7358  N  N     . GLU C  2  482  ? 63.870  -43.965 92.277   1.00 53.41  ? 482  GLU C N     1 
ATOM   7359  C  CA    . GLU C  2  482  ? 64.275  -43.819 90.883   1.00 53.87  ? 482  GLU C CA    1 
ATOM   7360  C  C     . GLU C  2  482  ? 63.585  -42.618 90.245   1.00 54.15  ? 482  GLU C C     1 
ATOM   7361  O  O     . GLU C  2  482  ? 62.363  -42.485 90.308   1.00 51.42  ? 482  GLU C O     1 
ATOM   7362  C  CB    . GLU C  2  482  ? 63.962  -45.087 90.083   1.00 56.83  ? 482  GLU C CB    1 
ATOM   7363  C  CG    . GLU C  2  482  ? 64.395  -45.012 88.622   1.00 58.11  ? 482  GLU C CG    1 
ATOM   7364  C  CD    . GLU C  2  482  ? 63.829  -46.140 87.777   1.00 55.50  ? 482  GLU C CD    1 
ATOM   7365  O  OE1   . GLU C  2  482  ? 64.040  -46.127 86.544   1.00 49.33  ? 482  GLU C OE1   1 
ATOM   7366  O  OE2   . GLU C  2  482  ? 63.171  -47.038 88.343   1.00 57.53  ? 482  GLU C OE2   1 
ATOM   7367  N  N     . VAL C  2  483  ? 64.377  -41.744 89.632   1.00 54.69  ? 483  VAL C N     1 
ATOM   7368  C  CA    . VAL C  2  483  ? 63.845  -40.531 89.023   1.00 49.79  ? 483  VAL C CA    1 
ATOM   7369  C  C     . VAL C  2  483  ? 64.013  -40.526 87.506   1.00 47.44  ? 483  VAL C C     1 
ATOM   7370  O  O     . VAL C  2  483  ? 65.129  -40.596 86.990   1.00 44.68  ? 483  VAL C O     1 
ATOM   7371  C  CB    . VAL C  2  483  ? 64.495  -39.273 89.623   1.00 48.11  ? 483  VAL C CB    1 
ATOM   7372  C  CG1   . VAL C  2  483  ? 64.000  -38.030 88.906   1.00 47.09  ? 483  VAL C CG1   1 
ATOM   7373  C  CG2   . VAL C  2  483  ? 64.199  -39.190 91.111   1.00 48.21  ? 483  VAL C CG2   1 
ATOM   7374  N  N     . VAL C  2  484  ? 62.892  -40.436 86.799   1.00 46.91  ? 484  VAL C N     1 
ATOM   7375  C  CA    . VAL C  2  484  ? 62.888  -40.459 85.344   1.00 43.22  ? 484  VAL C CA    1 
ATOM   7376  C  C     . VAL C  2  484  ? 62.470  -39.109 84.775   1.00 40.85  ? 484  VAL C C     1 
ATOM   7377  O  O     . VAL C  2  484  ? 61.378  -38.619 85.060   1.00 42.61  ? 484  VAL C O     1 
ATOM   7378  C  CB    . VAL C  2  484  ? 61.918  -41.531 84.812   1.00 42.84  ? 484  VAL C CB    1 
ATOM   7379  C  CG1   . VAL C  2  484  ? 61.985  -41.603 83.295   1.00 43.10  ? 484  VAL C CG1   1 
ATOM   7380  C  CG2   . VAL C  2  484  ? 62.228  -42.884 85.431   1.00 46.71  ? 484  VAL C CG2   1 
ATOM   7381  N  N     . TYR C  2  485  ? 63.343  -38.509 83.972   1.00 37.98  ? 485  TYR C N     1 
ATOM   7382  C  CA    . TYR C  2  485  ? 63.008  -37.277 83.266   1.00 40.30  ? 485  TYR C CA    1 
ATOM   7383  C  C     . TYR C  2  485  ? 62.306  -37.621 81.957   1.00 44.63  ? 485  TYR C C     1 
ATOM   7384  O  O     . TYR C  2  485  ? 62.892  -38.259 81.083   1.00 48.68  ? 485  TYR C O     1 
ATOM   7385  C  CB    . TYR C  2  485  ? 64.271  -36.462 82.981   1.00 41.79  ? 485  TYR C CB    1 
ATOM   7386  C  CG    . TYR C  2  485  ? 64.680  -35.523 84.096   1.00 41.99  ? 485  TYR C CG    1 
ATOM   7387  C  CD1   . TYR C  2  485  ? 65.415  -35.978 85.182   1.00 42.83  ? 485  TYR C CD1   1 
ATOM   7388  C  CD2   . TYR C  2  485  ? 64.342  -34.176 84.052   1.00 43.04  ? 485  TYR C CD2   1 
ATOM   7389  C  CE1   . TYR C  2  485  ? 65.794  -35.118 86.199   1.00 46.46  ? 485  TYR C CE1   1 
ATOM   7390  C  CE2   . TYR C  2  485  ? 64.717  -33.310 85.063   1.00 42.10  ? 485  TYR C CE2   1 
ATOM   7391  C  CZ    . TYR C  2  485  ? 65.443  -33.786 86.133   1.00 46.64  ? 485  TYR C CZ    1 
ATOM   7392  O  OH    . TYR C  2  485  ? 65.817  -32.925 87.140   1.00 46.40  ? 485  TYR C OH    1 
ATOM   7393  N  N     . MET C  2  486  ? 61.055  -37.189 81.819   1.00 44.32  ? 486  MET C N     1 
ATOM   7394  C  CA    . MET C  2  486  ? 60.240  -37.580 80.672   1.00 43.97  ? 486  MET C CA    1 
ATOM   7395  C  C     . MET C  2  486  ? 59.802  -36.406 79.816   1.00 40.13  ? 486  MET C C     1 
ATOM   7396  O  O     . MET C  2  486  ? 59.591  -35.304 80.315   1.00 39.09  ? 486  MET C O     1 
ATOM   7397  C  CB    . MET C  2  486  ? 58.980  -38.309 81.134   1.00 38.20  ? 486  MET C CB    1 
ATOM   7398  C  CG    . MET C  2  486  ? 59.212  -39.455 82.081   1.00 36.30  ? 486  MET C CG    1 
ATOM   7399  S  SD    . MET C  2  486  ? 57.663  -40.322 82.364   1.00 45.83  ? 486  MET C SD    1 
ATOM   7400  C  CE    . MET C  2  486  ? 57.915  -40.904 84.033   1.00 46.71  ? 486  MET C CE    1 
ATOM   7401  N  N     . THR C  2  487  ? 59.640  -36.663 78.523   1.00 41.20  ? 487  THR C N     1 
ATOM   7402  C  CA    . THR C  2  487  ? 58.980  -35.716 77.639   1.00 40.44  ? 487  THR C CA    1 
ATOM   7403  C  C     . THR C  2  487  ? 57.479  -35.847 77.858   1.00 39.17  ? 487  THR C C     1 
ATOM   7404  O  O     . THR C  2  487  ? 57.031  -36.677 78.651   1.00 37.61  ? 487  THR C O     1 
ATOM   7405  C  CB    . THR C  2  487  ? 59.296  -36.004 76.161   1.00 42.38  ? 487  THR C CB    1 
ATOM   7406  O  OG1   . THR C  2  487  ? 58.702  -37.250 75.775   1.00 44.59  ? 487  THR C OG1   1 
ATOM   7407  C  CG2   . THR C  2  487  ? 60.799  -36.070 75.938   1.00 39.38  ? 487  THR C CG2   1 
ATOM   7408  N  N     . ALA C  2  488  ? 56.701  -35.033 77.153   1.00 38.38  ? 488  ALA C N     1 
ATOM   7409  C  CA    . ALA C  2  488  ? 55.248  -35.079 77.276   1.00 40.97  ? 488  ALA C CA    1 
ATOM   7410  C  C     . ALA C  2  488  ? 54.698  -36.380 76.697   1.00 44.46  ? 488  ALA C C     1 
ATOM   7411  O  O     . ALA C  2  488  ? 53.799  -37.007 77.274   1.00 42.60  ? 488  ALA C O     1 
ATOM   7412  C  CB    . ALA C  2  488  ? 54.624  -33.876 76.588   1.00 35.25  ? 488  ALA C CB    1 
ATOM   7413  N  N     . THR C  2  489  ? 55.257  -36.779 75.557   1.00 44.43  ? 489  THR C N     1 
ATOM   7414  C  CA    . THR C  2  489  ? 54.866  -38.006 74.875   1.00 42.81  ? 489  THR C CA    1 
ATOM   7415  C  C     . THR C  2  489  ? 55.018  -39.210 75.797   1.00 46.06  ? 489  THR C C     1 
ATOM   7416  O  O     . THR C  2  489  ? 54.087  -40.002 75.959   1.00 46.10  ? 489  THR C O     1 
ATOM   7417  C  CB    . THR C  2  489  ? 55.717  -38.232 73.613   1.00 40.28  ? 489  THR C CB    1 
ATOM   7418  O  OG1   . THR C  2  489  ? 55.755  -37.027 72.837   1.00 37.42  ? 489  THR C OG1   1 
ATOM   7419  C  CG2   . THR C  2  489  ? 55.138  -39.359 72.773   1.00 47.42  ? 489  THR C CG2   1 
ATOM   7420  N  N     . GLU C  2  490  ? 56.195  -39.338 76.402   1.00 44.33  ? 490  GLU C N     1 
ATOM   7421  C  CA    . GLU C  2  490  ? 56.454  -40.398 77.368   1.00 47.24  ? 490  GLU C CA    1 
ATOM   7422  C  C     . GLU C  2  490  ? 55.495  -40.312 78.551   1.00 45.29  ? 490  GLU C C     1 
ATOM   7423  O  O     . GLU C  2  490  ? 54.981  -41.329 79.017   1.00 44.96  ? 490  GLU C O     1 
ATOM   7424  C  CB    . GLU C  2  490  ? 57.904  -40.339 77.858   1.00 51.38  ? 490  GLU C CB    1 
ATOM   7425  C  CG    . GLU C  2  490  ? 58.884  -41.135 77.006   1.00 60.94  ? 490  GLU C CG    1 
ATOM   7426  C  CD    . GLU C  2  490  ? 58.751  -42.636 77.208   1.00 71.77  ? 490  GLU C CD    1 
ATOM   7427  O  OE1   . GLU C  2  490  ? 58.782  -43.380 76.204   1.00 72.45  ? 490  GLU C OE1   1 
ATOM   7428  O  OE2   . GLU C  2  490  ? 58.621  -43.072 78.372   1.00 68.77  ? 490  GLU C OE2   1 
ATOM   7429  N  N     . GLU C  2  491  ? 55.251  -39.091 79.020   1.00 43.30  ? 491  GLU C N     1 
ATOM   7430  C  CA    . GLU C  2  491  ? 54.360  -38.863 80.154   1.00 43.71  ? 491  GLU C CA    1 
ATOM   7431  C  C     . GLU C  2  491  ? 52.955  -39.400 79.895   1.00 44.97  ? 491  GLU C C     1 
ATOM   7432  O  O     . GLU C  2  491  ? 52.329  -39.975 80.787   1.00 42.79  ? 491  GLU C O     1 
ATOM   7433  C  CB    . GLU C  2  491  ? 54.287  -37.372 80.497   1.00 42.08  ? 491  GLU C CB    1 
ATOM   7434  C  CG    . GLU C  2  491  ? 53.233  -37.040 81.546   1.00 43.66  ? 491  GLU C CG    1 
ATOM   7435  C  CD    . GLU C  2  491  ? 53.084  -35.552 81.792   1.00 40.29  ? 491  GLU C CD    1 
ATOM   7436  O  OE1   . GLU C  2  491  ? 51.940  -35.098 82.003   1.00 36.54  ? 491  GLU C OE1   1 
ATOM   7437  O  OE2   . GLU C  2  491  ? 54.107  -34.839 81.784   1.00 37.98  ? 491  GLU C OE2   1 
ATOM   7438  N  N     . ASP C  2  492  ? 52.472  -39.228 78.668   1.00 44.98  ? 492  ASP C N     1 
ATOM   7439  C  CA    . ASP C  2  492  ? 51.115  -39.651 78.317   1.00 47.60  ? 492  ASP C CA    1 
ATOM   7440  C  C     . ASP C  2  492  ? 50.872  -41.157 78.459   1.00 47.10  ? 492  ASP C C     1 
ATOM   7441  O  O     . ASP C  2  492  ? 49.726  -41.608 78.446   1.00 42.70  ? 492  ASP C O     1 
ATOM   7442  C  CB    . ASP C  2  492  ? 50.755  -39.192 76.901   1.00 47.17  ? 492  ASP C CB    1 
ATOM   7443  C  CG    . ASP C  2  492  ? 50.423  -37.711 76.833   1.00 47.22  ? 492  ASP C CG    1 
ATOM   7444  O  OD1   . ASP C  2  492  ? 49.642  -37.315 75.940   1.00 45.44  ? 492  ASP C OD1   1 
ATOM   7445  O  OD2   . ASP C  2  492  ? 50.936  -36.944 77.673   1.00 45.86  ? 492  ASP C OD2   1 
ATOM   7446  N  N     . ARG C  2  493  ? 51.947  -41.926 78.601   1.00 49.77  ? 493  ARG C N     1 
ATOM   7447  C  CA    . ARG C  2  493  ? 51.853  -43.384 78.661   1.00 49.10  ? 493  ARG C CA    1 
ATOM   7448  C  C     . ARG C  2  493  ? 51.492  -43.947 80.039   1.00 46.59  ? 493  ARG C C     1 
ATOM   7449  O  O     . ARG C  2  493  ? 51.017  -45.079 80.143   1.00 43.60  ? 493  ARG C O     1 
ATOM   7450  C  CB    . ARG C  2  493  ? 53.158  -44.016 78.171   1.00 46.19  ? 493  ARG C CB    1 
ATOM   7451  C  CG    . ARG C  2  493  ? 53.537  -43.625 76.755   1.00 49.96  ? 493  ARG C CG    1 
ATOM   7452  C  CD    . ARG C  2  493  ? 54.902  -44.174 76.369   1.00 59.60  ? 493  ARG C CD    1 
ATOM   7453  N  NE    . ARG C  2  493  ? 54.945  -45.634 76.409   1.00 65.66  ? 493  ARG C NE    1 
ATOM   7454  C  CZ    . ARG C  2  493  ? 55.832  -46.337 77.105   1.00 62.01  ? 493  ARG C CZ    1 
ATOM   7455  N  NH1   . ARG C  2  493  ? 56.759  -45.715 77.822   1.00 57.38  ? 493  ARG C NH1   1 
ATOM   7456  N  NH2   . ARG C  2  493  ? 55.796  -47.663 77.083   1.00 60.64  ? 493  ARG C NH2   1 
ATOM   7457  N  N     . TYR C  2  494  ? 51.703  -43.165 81.093   1.00 46.07  ? 494  TYR C N     1 
ATOM   7458  C  CA    . TYR C  2  494  ? 51.567  -43.690 82.451   1.00 46.42  ? 494  TYR C CA    1 
ATOM   7459  C  C     . TYR C  2  494  ? 50.476  -43.005 83.269   1.00 47.55  ? 494  TYR C C     1 
ATOM   7460  O  O     . TYR C  2  494  ? 50.061  -41.886 82.965   1.00 50.66  ? 494  TYR C O     1 
ATOM   7461  C  CB    . TYR C  2  494  ? 52.897  -43.586 83.204   1.00 47.15  ? 494  TYR C CB    1 
ATOM   7462  C  CG    . TYR C  2  494  ? 54.108  -44.012 82.403   1.00 48.61  ? 494  TYR C CG    1 
ATOM   7463  C  CD1   . TYR C  2  494  ? 54.337  -45.349 82.107   1.00 48.13  ? 494  TYR C CD1   1 
ATOM   7464  C  CD2   . TYR C  2  494  ? 55.030  -43.076 81.956   1.00 47.44  ? 494  TYR C CD2   1 
ATOM   7465  C  CE1   . TYR C  2  494  ? 55.444  -45.741 81.378   1.00 48.88  ? 494  TYR C CE1   1 
ATOM   7466  C  CE2   . TYR C  2  494  ? 56.141  -43.458 81.228   1.00 50.39  ? 494  TYR C CE2   1 
ATOM   7467  C  CZ    . TYR C  2  494  ? 56.343  -44.791 80.941   1.00 49.77  ? 494  TYR C CZ    1 
ATOM   7468  O  OH    . TYR C  2  494  ? 57.448  -45.176 80.216   1.00 48.46  ? 494  TYR C OH    1 
ATOM   7469  N  N     . THR C  2  495  ? 50.020  -43.693 84.312   1.00 45.81  ? 495  THR C N     1 
ATOM   7470  C  CA    . THR C  2  495  ? 49.090  -43.118 85.275   1.00 44.84  ? 495  THR C CA    1 
ATOM   7471  C  C     . THR C  2  495  ? 49.916  -42.508 86.401   1.00 41.78  ? 495  THR C C     1 
ATOM   7472  O  O     . THR C  2  495  ? 50.555  -43.228 87.167   1.00 45.02  ? 495  THR C O     1 
ATOM   7473  C  CB    . THR C  2  495  ? 48.159  -44.198 85.862   1.00 42.19  ? 495  THR C CB    1 
ATOM   7474  O  OG1   . THR C  2  495  ? 47.436  -44.841 84.805   1.00 38.89  ? 495  THR C OG1   1 
ATOM   7475  C  CG2   . THR C  2  495  ? 47.175  -43.587 86.850   1.00 39.62  ? 495  THR C CG2   1 
ATOM   7476  N  N     . ILE C  2  496  ? 49.901  -41.183 86.507   1.00 37.62  ? 496  ILE C N     1 
ATOM   7477  C  CA    . ILE C  2  496  ? 50.827  -40.502 87.410   1.00 39.95  ? 496  ILE C CA    1 
ATOM   7478  C  C     . ILE C  2  496  ? 50.161  -39.895 88.644   1.00 40.85  ? 496  ILE C C     1 
ATOM   7479  O  O     . ILE C  2  496  ? 49.406  -38.930 88.544   1.00 42.89  ? 496  ILE C O     1 
ATOM   7480  C  CB    . ILE C  2  496  ? 51.631  -39.417 86.671   1.00 37.91  ? 496  ILE C CB    1 
ATOM   7481  C  CG1   . ILE C  2  496  ? 52.329  -40.018 85.449   1.00 39.40  ? 496  ILE C CG1   1 
ATOM   7482  C  CG2   . ILE C  2  496  ? 52.644  -38.778 87.604   1.00 39.24  ? 496  ILE C CG2   1 
ATOM   7483  C  CD1   . ILE C  2  496  ? 53.201  -39.037 84.698   1.00 39.17  ? 496  ILE C CD1   1 
ATOM   7484  N  N     . ALA C  2  497  ? 50.466  -40.459 89.809   1.00 40.64  ? 497  ALA C N     1 
ATOM   7485  C  CA    . ALA C  2  497  ? 49.873  -40.014 91.066   1.00 39.48  ? 497  ALA C CA    1 
ATOM   7486  C  C     . ALA C  2  497  ? 50.390  -38.648 91.499   1.00 42.00  ? 497  ALA C C     1 
ATOM   7487  O  O     . ALA C  2  497  ? 51.484  -38.236 91.116   1.00 41.49  ? 497  ALA C O     1 
ATOM   7488  C  CB    . ALA C  2  497  ? 50.123  -41.040 92.157   1.00 41.87  ? 497  ALA C CB    1 
ATOM   7489  N  N     . GLN C  2  498  ? 49.592  -37.953 92.305   1.00 45.44  ? 498  GLN C N     1 
ATOM   7490  C  CA    . GLN C  2  498  ? 49.974  -36.646 92.831   1.00 48.09  ? 498  GLN C CA    1 
ATOM   7491  C  C     . GLN C  2  498  ? 50.964  -36.779 93.985   1.00 46.93  ? 498  GLN C C     1 
ATOM   7492  O  O     . GLN C  2  498  ? 50.968  -37.783 94.698   1.00 49.16  ? 498  GLN C O     1 
ATOM   7493  C  CB    . GLN C  2  498  ? 48.735  -35.861 93.272   1.00 47.53  ? 498  GLN C CB    1 
ATOM   7494  C  CG    . GLN C  2  498  ? 47.972  -35.218 92.123   1.00 39.70  ? 498  GLN C CG    1 
ATOM   7495  C  CD    . GLN C  2  498  ? 48.750  -34.089 91.472   1.00 37.71  ? 498  GLN C CD    1 
ATOM   7496  O  OE1   . GLN C  2  498  ? 49.376  -33.277 92.153   1.00 36.39  ? 498  GLN C OE1   1 
ATOM   7497  N  NE2   . GLN C  2  498  ? 48.719  -34.038 90.145   1.00 38.85  ? 498  GLN C NE2   1 
ATOM   7498  N  N     . ALA C  2  499  ? 51.795  -35.757 94.166   1.00 43.05  ? 499  ALA C N     1 
ATOM   7499  C  CA    . ALA C  2  499  ? 52.875  -35.802 95.149   1.00 44.21  ? 499  ALA C CA    1 
ATOM   7500  C  C     . ALA C  2  499  ? 52.395  -35.744 96.600   1.00 48.67  ? 499  ALA C C     1 
ATOM   7501  O  O     . ALA C  2  499  ? 53.118  -36.143 97.514   1.00 47.24  ? 499  ALA C O     1 
ATOM   7502  C  CB    . ALA C  2  499  ? 53.884  -34.692 94.877   1.00 42.75  ? 499  ALA C CB    1 
ATOM   7503  N  N     . ASN C  2  500  ? 51.179  -35.251 96.813   1.00 51.32  ? 500  ASN C N     1 
ATOM   7504  C  CA    . ASN C  2  500  ? 50.664  -35.068 98.168   1.00 50.22  ? 500  ASN C CA    1 
ATOM   7505  C  C     . ASN C  2  500  ? 49.896  -36.275 98.709   1.00 52.16  ? 500  ASN C C     1 
ATOM   7506  O  O     . ASN C  2  500  ? 49.329  -36.217 99.799   1.00 57.90  ? 500  ASN C O     1 
ATOM   7507  C  CB    . ASN C  2  500  ? 49.809  -33.800 98.265   1.00 47.58  ? 500  ASN C CB    1 
ATOM   7508  C  CG    . ASN C  2  500  ? 48.436  -33.968 97.642   1.00 50.68  ? 500  ASN C CG    1 
ATOM   7509  O  OD1   . ASN C  2  500  ? 48.255  -34.736 96.697   1.00 49.25  ? 500  ASN C OD1   1 
ATOM   7510  N  ND2   . ASN C  2  500  ? 47.457  -33.245 98.173   1.00 53.54  ? 500  ASN C ND2   1 
ATOM   7511  N  N     . THR C  2  501  ? 49.870  -37.358 97.937   1.00 49.79  ? 501  THR C N     1 
ATOM   7512  C  CA    . THR C  2  501  ? 49.198  -38.583 98.359   1.00 47.40  ? 501  THR C CA    1 
ATOM   7513  C  C     . THR C  2  501  ? 49.851  -39.159 99.615   1.00 47.02  ? 501  THR C C     1 
ATOM   7514  O  O     . THR C  2  501  ? 51.076  -39.160 99.732   1.00 45.69  ? 501  THR C O     1 
ATOM   7515  C  CB    . THR C  2  501  ? 49.196  -39.639 97.235   1.00 46.91  ? 501  THR C CB    1 
ATOM   7516  O  OG1   . THR C  2  501  ? 50.539  -39.882 96.799   1.00 42.58  ? 501  THR C OG1   1 
ATOM   7517  C  CG2   . THR C  2  501  ? 48.366  -39.154 96.057   1.00 45.30  ? 501  THR C CG2   1 
ATOM   7518  N  N     . PRO C  2  502  ? 49.025  -39.641 100.562  1.00 47.76  ? 502  PRO C N     1 
ATOM   7519  C  CA    . PRO C  2  502  ? 49.458  -40.159 101.868  1.00 48.62  ? 502  PRO C CA    1 
ATOM   7520  C  C     . PRO C  2  502  ? 50.521  -41.251 101.768  1.00 53.43  ? 502  PRO C C     1 
ATOM   7521  O  O     . PRO C  2  502  ? 50.379  -42.178 100.972  1.00 53.83  ? 502  PRO C O     1 
ATOM   7522  C  CB    . PRO C  2  502  ? 48.170  -40.745 102.454  1.00 48.91  ? 502  PRO C CB    1 
ATOM   7523  C  CG    . PRO C  2  502  ? 47.082  -39.973 101.808  1.00 45.86  ? 502  PRO C CG    1 
ATOM   7524  C  CD    . PRO C  2  502  ? 47.559  -39.688 100.415  1.00 45.49  ? 502  PRO C CD    1 
ATOM   7525  N  N     . LEU C  2  503  ? 51.569  -41.138 102.580  1.00 59.24  ? 503  LEU C N     1 
ATOM   7526  C  CA    . LEU C  2  503  ? 52.666  -42.101 102.557  1.00 63.20  ? 503  LEU C CA    1 
ATOM   7527  C  C     . LEU C  2  503  ? 53.093  -42.560 103.949  1.00 70.24  ? 503  LEU C C     1 
ATOM   7528  O  O     . LEU C  2  503  ? 53.458  -41.747 104.801  1.00 68.77  ? 503  LEU C O     1 
ATOM   7529  C  CB    . LEU C  2  503  ? 53.881  -41.514 101.830  1.00 58.46  ? 503  LEU C CB    1 
ATOM   7530  C  CG    . LEU C  2  503  ? 53.831  -41.431 100.304  1.00 62.41  ? 503  LEU C CG    1 
ATOM   7531  C  CD1   . LEU C  2  503  ? 55.086  -40.763 99.762   1.00 63.29  ? 503  LEU C CD1   1 
ATOM   7532  C  CD2   . LEU C  2  503  ? 53.665  -42.817 99.710   1.00 60.85  ? 503  LEU C CD2   1 
ATOM   7533  N  N     . GLU C  2  504  ? 53.041  -43.869 104.171  1.00 74.24  ? 504  GLU C N     1 
ATOM   7534  C  CA    . GLU C  2  504  ? 53.691  -44.471 105.325  1.00 73.65  ? 504  GLU C CA    1 
ATOM   7535  C  C     . GLU C  2  504  ? 54.979  -45.114 104.825  1.00 71.50  ? 504  GLU C C     1 
ATOM   7536  O  O     . GLU C  2  504  ? 54.956  -46.148 104.154  1.00 66.05  ? 504  GLU C O     1 
ATOM   7537  C  CB    . GLU C  2  504  ? 52.780  -45.505 105.992  1.00 69.64  ? 504  GLU C CB    1 
ATOM   7538  C  CG    . GLU C  2  504  ? 52.036  -46.409 105.015  1.00 75.19  ? 504  GLU C CG    1 
ATOM   7539  C  CD    . GLU C  2  504  ? 51.326  -47.562 105.699  1.00 80.17  ? 504  GLU C CD    1 
ATOM   7540  O  OE1   . GLU C  2  504  ? 51.247  -47.562 106.945  1.00 82.90  ? 504  GLU C OE1   1 
ATOM   7541  O  OE2   . GLU C  2  504  ? 50.850  -48.473 104.987  1.00 74.89  ? 504  GLU C OE2   1 
ATOM   7542  N  N     . GLY C  2  505  ? 56.107  -44.499 105.160  1.00 70.73  ? 505  GLY C N     1 
ATOM   7543  C  CA    . GLY C  2  505  ? 57.369  -44.885 104.561  1.00 70.13  ? 505  GLY C CA    1 
ATOM   7544  C  C     . GLY C  2  505  ? 57.311  -44.663 103.060  1.00 67.64  ? 505  GLY C C     1 
ATOM   7545  O  O     . GLY C  2  505  ? 56.962  -43.576 102.600  1.00 66.60  ? 505  GLY C O     1 
ATOM   7546  N  N     . ASN C  2  506  ? 57.661  -45.691 102.293  1.00 63.83  ? 506  ASN C N     1 
ATOM   7547  C  CA    . ASN C  2  506  ? 57.583  -45.618 100.837  1.00 59.28  ? 506  ASN C CA    1 
ATOM   7548  C  C     . ASN C  2  506  ? 56.319  -46.247 100.249  1.00 59.38  ? 506  ASN C C     1 
ATOM   7549  O  O     . ASN C  2  506  ? 56.154  -46.297 99.031   1.00 58.53  ? 506  ASN C O     1 
ATOM   7550  C  CB    . ASN C  2  506  ? 58.831  -46.226 100.194  1.00 57.52  ? 506  ASN C CB    1 
ATOM   7551  C  CG    . ASN C  2  506  ? 60.094  -45.456 100.530  1.00 62.64  ? 506  ASN C CG    1 
ATOM   7552  O  OD1   . ASN C  2  506  ? 60.453  -44.497 99.844   1.00 63.68  ? 506  ASN C OD1   1 
ATOM   7553  N  ND2   . ASN C  2  506  ? 60.777  -45.874 101.588  1.00 69.32  ? 506  ASN C ND2   1 
ATOM   7554  N  N     . ARG C  2  507  ? 55.435  -46.731 101.117  1.00 62.65  ? 507  ARG C N     1 
ATOM   7555  C  CA    . ARG C  2  507  ? 54.199  -47.371 100.674  1.00 68.70  ? 507  ARG C CA    1 
ATOM   7556  C  C     . ARG C  2  507  ? 53.036  -46.380 100.622  1.00 68.18  ? 507  ARG C C     1 
ATOM   7557  O  O     . ARG C  2  507  ? 52.908  -45.515 101.490  1.00 68.38  ? 507  ARG C O     1 
ATOM   7558  C  CB    . ARG C  2  507  ? 53.854  -48.547 101.594  1.00 78.35  ? 507  ARG C CB    1 
ATOM   7559  C  CG    . ARG C  2  507  ? 52.650  -49.370 101.155  1.00 81.10  ? 507  ARG C CG    1 
ATOM   7560  C  CD    . ARG C  2  507  ? 52.524  -50.637 101.989  1.00 86.03  ? 507  ARG C CD    1 
ATOM   7561  N  NE    . ARG C  2  507  ? 53.745  -51.436 101.937  1.00 91.79  ? 507  ARG C NE    1 
ATOM   7562  C  CZ    . ARG C  2  507  ? 54.011  -52.330 100.991  1.00 92.41  ? 507  ARG C CZ    1 
ATOM   7563  N  NH1   . ARG C  2  507  ? 53.140  -52.543 100.015  1.00 89.42  ? 507  ARG C NH1   1 
ATOM   7564  N  NH2   . ARG C  2  507  ? 55.149  -53.011 101.020  1.00 89.88  ? 507  ARG C NH2   1 
ATOM   7565  N  N     . ILE C  2  508  ? 52.190  -46.511 99.604   1.00 63.09  ? 508  ILE C N     1 
ATOM   7566  C  CA    . ILE C  2  508  ? 51.022  -45.646 99.470   1.00 61.74  ? 508  ILE C CA    1 
ATOM   7567  C  C     . ILE C  2  508  ? 50.018  -45.961 100.575  1.00 61.78  ? 508  ILE C C     1 
ATOM   7568  O  O     . ILE C  2  508  ? 49.566  -47.098 100.712  1.00 65.89  ? 508  ILE C O     1 
ATOM   7569  C  CB    . ILE C  2  508  ? 50.352  -45.816 98.092   1.00 61.70  ? 508  ILE C CB    1 
ATOM   7570  C  CG1   . ILE C  2  508  ? 51.314  -45.395 96.977   1.00 59.74  ? 508  ILE C CG1   1 
ATOM   7571  C  CG2   . ILE C  2  508  ? 49.063  -45.011 98.016   1.00 61.17  ? 508  ILE C CG2   1 
ATOM   7572  C  CD1   . ILE C  2  508  ? 50.733  -45.519 95.581   1.00 55.82  ? 508  ILE C CD1   1 
ATOM   7573  N  N     . ALA C  2  509  ? 49.670  -44.943 101.357  1.00 59.20  ? 509  ALA C N     1 
ATOM   7574  C  CA    . ALA C  2  509  ? 48.863  -45.137 102.558  1.00 63.31  ? 509  ALA C CA    1 
ATOM   7575  C  C     . ALA C  2  509  ? 47.363  -45.001 102.313  1.00 61.02  ? 509  ALA C C     1 
ATOM   7576  O  O     . ALA C  2  509  ? 46.557  -45.262 103.205  1.00 62.01  ? 509  ALA C O     1 
ATOM   7577  C  CB    . ALA C  2  509  ? 49.310  -44.176 103.653  1.00 62.65  ? 509  ALA C CB    1 
ATOM   7578  N  N     . ALA C  2  510  ? 46.992  -44.589 101.106  1.00 58.91  ? 510  ALA C N     1 
ATOM   7579  C  CA    . ALA C  2  510  ? 45.589  -44.370 100.781  1.00 63.15  ? 510  ALA C CA    1 
ATOM   7580  C  C     . ALA C  2  510  ? 45.044  -45.454 99.858   1.00 69.89  ? 510  ALA C C     1 
ATOM   7581  O  O     . ALA C  2  510  ? 45.758  -45.967 98.996   1.00 67.18  ? 510  ALA C O     1 
ATOM   7582  C  CB    . ALA C  2  510  ? 45.398  -42.996 100.158  1.00 61.54  ? 510  ALA C CB    1 
ATOM   7583  N  N     . GLU C  2  511  ? 43.774  -45.799 100.050  1.00 72.20  ? 511  GLU C N     1 
ATOM   7584  C  CA    . GLU C  2  511  ? 43.106  -46.774 99.199   1.00 74.50  ? 511  GLU C CA    1 
ATOM   7585  C  C     . GLU C  2  511  ? 42.742  -46.130 97.867   1.00 76.21  ? 511  GLU C C     1 
ATOM   7586  O  O     . GLU C  2  511  ? 42.810  -46.766 96.814   1.00 73.72  ? 511  GLU C O     1 
ATOM   7587  C  CB    . GLU C  2  511  ? 41.845  -47.301 99.884   1.00 74.91  ? 511  GLU C CB    1 
ATOM   7588  C  CG    . GLU C  2  511  ? 41.140  -48.409 99.122   1.00 84.35  ? 511  GLU C CG    1 
ATOM   7589  C  CD    . GLU C  2  511  ? 39.753  -48.693 99.664   1.00 98.78  ? 511  GLU C CD    1 
ATOM   7590  O  OE1   . GLU C  2  511  ? 39.377  -49.881 99.751   1.00 104.97 ? 511  GLU C OE1   1 
ATOM   7591  O  OE2   . GLU C  2  511  ? 39.038  -47.726 99.999   1.00 100.97 ? 511  GLU C OE2   1 
ATOM   7592  N  N     . ARG C  2  512  ? 42.352  -44.861 97.926   1.00 74.71  ? 512  ARG C N     1 
ATOM   7593  C  CA    . ARG C  2  512  ? 42.001  -44.099 96.735   1.00 67.68  ? 512  ARG C CA    1 
ATOM   7594  C  C     . ARG C  2  512  ? 43.046  -43.016 96.492   1.00 60.43  ? 512  ARG C C     1 
ATOM   7595  O  O     . ARG C  2  512  ? 43.261  -42.151 97.341   1.00 60.06  ? 512  ARG C O     1 
ATOM   7596  C  CB    . ARG C  2  512  ? 40.622  -43.463 96.907   1.00 67.11  ? 512  ARG C CB    1 
ATOM   7597  C  CG    . ARG C  2  512  ? 39.537  -44.437 97.340   1.00 67.91  ? 512  ARG C CG    1 
ATOM   7598  C  CD    . ARG C  2  512  ? 38.257  -43.712 97.741   1.00 71.16  ? 512  ARG C CD    1 
ATOM   7599  N  NE    . ARG C  2  512  ? 37.646  -42.994 96.624   1.00 73.93  ? 512  ARG C NE    1 
ATOM   7600  C  CZ    . ARG C  2  512  ? 37.773  -41.687 96.412   1.00 67.67  ? 512  ARG C CZ    1 
ATOM   7601  N  NH1   . ARG C  2  512  ? 38.491  -40.943 97.242   1.00 64.16  ? 512  ARG C NH1   1 
ATOM   7602  N  NH2   . ARG C  2  512  ? 37.180  -41.124 95.368   1.00 64.36  ? 512  ARG C NH2   1 
ATOM   7603  N  N     . VAL C  2  513  ? 43.695  -43.064 95.334   1.00 55.32  ? 513  VAL C N     1 
ATOM   7604  C  CA    . VAL C  2  513  ? 44.766  -42.119 95.031   1.00 50.64  ? 513  VAL C CA    1 
ATOM   7605  C  C     . VAL C  2  513  ? 44.457  -41.240 93.818   1.00 52.24  ? 513  VAL C C     1 
ATOM   7606  O  O     . VAL C  2  513  ? 44.038  -41.730 92.768   1.00 50.93  ? 513  VAL C O     1 
ATOM   7607  C  CB    . VAL C  2  513  ? 46.128  -42.842 94.855   1.00 46.43  ? 513  VAL C CB    1 
ATOM   7608  C  CG1   . VAL C  2  513  ? 45.950  -44.138 94.092   1.00 55.38  ? 513  VAL C CG1   1 
ATOM   7609  C  CG2   . VAL C  2  513  ? 47.133  -41.948 94.150   1.00 44.22  ? 513  VAL C CG2   1 
ATOM   7610  N  N     . VAL C  2  514  ? 44.654  -39.935 93.986   1.00 51.19  ? 514  VAL C N     1 
ATOM   7611  C  CA    . VAL C  2  514  ? 44.474  -38.971 92.909   1.00 44.52  ? 514  VAL C CA    1 
ATOM   7612  C  C     . VAL C  2  514  ? 45.622  -39.067 91.914   1.00 43.22  ? 514  VAL C C     1 
ATOM   7613  O  O     . VAL C  2  514  ? 46.790  -38.996 92.298   1.00 43.73  ? 514  VAL C O     1 
ATOM   7614  C  CB    . VAL C  2  514  ? 44.430  -37.534 93.457   1.00 40.32  ? 514  VAL C CB    1 
ATOM   7615  C  CG1   . VAL C  2  514  ? 44.227  -36.539 92.326   1.00 39.59  ? 514  VAL C CG1   1 
ATOM   7616  C  CG2   . VAL C  2  514  ? 43.338  -37.397 94.503   1.00 39.10  ? 514  VAL C CG2   1 
ATOM   7617  N  N     . ALA C  2  515  ? 45.292  -39.224 90.636   1.00 41.61  ? 515  ALA C N     1 
ATOM   7618  C  CA    . ALA C  2  515  ? 46.317  -39.320 89.603   1.00 39.65  ? 515  ALA C CA    1 
ATOM   7619  C  C     . ALA C  2  515  ? 45.883  -38.705 88.274   1.00 36.89  ? 515  ALA C C     1 
ATOM   7620  O  O     . ALA C  2  515  ? 44.744  -38.260 88.117   1.00 38.39  ? 515  ALA C O     1 
ATOM   7621  C  CB    . ALA C  2  515  ? 46.730  -40.771 89.406   1.00 41.86  ? 515  ALA C CB    1 
ATOM   7622  N  N     . ARG C  2  516  ? 46.804  -38.709 87.316   1.00 35.70  ? 516  ARG C N     1 
ATOM   7623  C  CA    . ARG C  2  516  ? 46.574  -38.120 86.004   1.00 38.41  ? 516  ARG C CA    1 
ATOM   7624  C  C     . ARG C  2  516  ? 46.858  -39.130 84.898   1.00 45.43  ? 516  ARG C C     1 
ATOM   7625  O  O     . ARG C  2  516  ? 47.916  -39.766 84.880   1.00 47.60  ? 516  ARG C O     1 
ATOM   7626  C  CB    . ARG C  2  516  ? 47.466  -36.889 85.807   1.00 33.72  ? 516  ARG C CB    1 
ATOM   7627  C  CG    . ARG C  2  516  ? 47.274  -35.798 86.844   1.00 33.68  ? 516  ARG C CG    1 
ATOM   7628  C  CD    . ARG C  2  516  ? 48.163  -34.590 86.566   1.00 33.36  ? 516  ARG C CD    1 
ATOM   7629  N  NE    . ARG C  2  516  ? 49.588  -34.896 86.674   1.00 31.37  ? 516  ARG C NE    1 
ATOM   7630  C  CZ    . ARG C  2  516  ? 50.426  -34.929 85.643   1.00 32.00  ? 516  ARG C CZ    1 
ATOM   7631  N  NH1   . ARG C  2  516  ? 49.985  -34.672 84.419   1.00 30.44  ? 516  ARG C NH1   1 
ATOM   7632  N  NH2   . ARG C  2  516  ? 51.707  -35.213 85.833   1.00 33.76  ? 516  ARG C NH2   1 
ATOM   7633  N  N     . ARG C  2  517  ? 45.899  -39.280 83.988   1.00 46.37  ? 517  ARG C N     1 
ATOM   7634  C  CA    . ARG C  2  517  ? 46.089  -40.063 82.772   1.00 46.24  ? 517  ARG C CA    1 
ATOM   7635  C  C     . ARG C  2  517  ? 45.873  -39.156 81.569   1.00 44.05  ? 517  ARG C C     1 
ATOM   7636  O  O     . ARG C  2  517  ? 44.747  -38.730 81.303   1.00 43.32  ? 517  ARG C O     1 
ATOM   7637  C  CB    . ARG C  2  517  ? 45.109  -41.236 82.723   1.00 47.79  ? 517  ARG C CB    1 
ATOM   7638  C  CG    . ARG C  2  517  ? 45.390  -42.324 83.743   1.00 44.64  ? 517  ARG C CG    1 
ATOM   7639  C  CD    . ARG C  2  517  ? 44.270  -43.348 83.782   1.00 38.73  ? 517  ARG C CD    1 
ATOM   7640  N  NE    . ARG C  2  517  ? 44.584  -44.452 84.683   1.00 41.99  ? 517  ARG C NE    1 
ATOM   7641  C  CZ    . ARG C  2  517  ? 43.706  -45.367 85.079   1.00 45.72  ? 517  ARG C CZ    1 
ATOM   7642  N  NH1   . ARG C  2  517  ? 42.450  -45.308 84.659   1.00 46.08  ? 517  ARG C NH1   1 
ATOM   7643  N  NH2   . ARG C  2  517  ? 44.082  -46.337 85.900   1.00 48.80  ? 517  ARG C NH2   1 
ATOM   7644  N  N     . LYS C  2  518  ? 46.953  -38.879 80.840   1.00 43.97  ? 518  LYS C N     1 
ATOM   7645  C  CA    . LYS C  2  518  ? 46.940  -37.894 79.759   1.00 45.91  ? 518  LYS C CA    1 
ATOM   7646  C  C     . LYS C  2  518  ? 46.365  -36.556 80.226   1.00 44.24  ? 518  LYS C C     1 
ATOM   7647  O  O     . LYS C  2  518  ? 45.662  -35.878 79.479   1.00 39.12  ? 518  LYS C O     1 
ATOM   7648  C  CB    . LYS C  2  518  ? 46.173  -38.414 78.539   1.00 46.10  ? 518  LYS C CB    1 
ATOM   7649  C  CG    . LYS C  2  518  ? 46.938  -39.427 77.703   1.00 44.41  ? 518  LYS C CG    1 
ATOM   7650  C  CD    . LYS C  2  518  ? 46.193  -39.738 76.413   1.00 44.84  ? 518  LYS C CD    1 
ATOM   7651  C  CE    . LYS C  2  518  ? 47.010  -40.632 75.497   1.00 42.97  ? 518  LYS C CE    1 
ATOM   7652  N  NZ    . LYS C  2  518  ? 47.263  -41.964 76.108   1.00 52.20  ? 518  LYS C NZ    1 
ATOM   7653  N  N     . GLY C  2  519  ? 46.656  -36.197 81.472   1.00 44.60  ? 519  GLY C N     1 
ATOM   7654  C  CA    . GLY C  2  519  ? 46.205  -34.940 82.039   1.00 42.04  ? 519  GLY C CA    1 
ATOM   7655  C  C     . GLY C  2  519  ? 44.842  -35.023 82.701   1.00 42.29  ? 519  GLY C C     1 
ATOM   7656  O  O     . GLY C  2  519  ? 44.509  -34.202 83.555   1.00 44.05  ? 519  GLY C O     1 
ATOM   7657  N  N     . GLU C  2  520  ? 44.053  -36.020 82.316   1.00 40.38  ? 520  GLU C N     1 
ATOM   7658  C  CA    . GLU C  2  520  ? 42.700  -36.167 82.840   1.00 42.34  ? 520  GLU C CA    1 
ATOM   7659  C  C     . GLU C  2  520  ? 42.731  -36.646 84.288   1.00 42.55  ? 520  GLU C C     1 
ATOM   7660  O  O     . GLU C  2  520  ? 43.238  -37.730 84.574   1.00 45.57  ? 520  GLU C O     1 
ATOM   7661  C  CB    . GLU C  2  520  ? 41.900  -37.146 81.980   1.00 47.32  ? 520  GLU C CB    1 
ATOM   7662  C  CG    . GLU C  2  520  ? 40.398  -37.100 82.214   1.00 50.92  ? 520  GLU C CG    1 
ATOM   7663  C  CD    . GLU C  2  520  ? 39.749  -35.863 81.619   1.00 55.99  ? 520  GLU C CD    1 
ATOM   7664  O  OE1   . GLU C  2  520  ? 38.686  -35.447 82.128   1.00 55.39  ? 520  GLU C OE1   1 
ATOM   7665  O  OE2   . GLU C  2  520  ? 40.297  -35.312 80.640   1.00 54.39  ? 520  GLU C OE2   1 
ATOM   7666  N  N     . PRO C  2  521  ? 42.191  -35.832 85.209   1.00 42.08  ? 521  PRO C N     1 
ATOM   7667  C  CA    . PRO C  2  521  ? 42.176  -36.170 86.637   1.00 42.34  ? 521  PRO C CA    1 
ATOM   7668  C  C     . PRO C  2  521  ? 41.326  -37.406 86.907   1.00 43.24  ? 521  PRO C C     1 
ATOM   7669  O  O     . PRO C  2  521  ? 40.200  -37.490 86.416   1.00 43.69  ? 521  PRO C O     1 
ATOM   7670  C  CB    . PRO C  2  521  ? 41.530  -34.938 87.281   1.00 38.33  ? 521  PRO C CB    1 
ATOM   7671  C  CG    . PRO C  2  521  ? 41.716  -33.839 86.287   1.00 38.73  ? 521  PRO C CG    1 
ATOM   7672  C  CD    . PRO C  2  521  ? 41.615  -34.503 84.952   1.00 42.00  ? 521  PRO C CD    1 
ATOM   7673  N  N     . VAL C  2  522  ? 41.858  -38.350 87.676   1.00 41.46  ? 522  VAL C N     1 
ATOM   7674  C  CA    . VAL C  2  522  ? 41.141  -39.592 87.943   1.00 42.87  ? 522  VAL C CA    1 
ATOM   7675  C  C     . VAL C  2  522  ? 41.528  -40.194 89.298   1.00 45.80  ? 522  VAL C C     1 
ATOM   7676  O  O     . VAL C  2  522  ? 42.667  -40.055 89.744   1.00 44.11  ? 522  VAL C O     1 
ATOM   7677  C  CB    . VAL C  2  522  ? 41.376  -40.613 86.799   1.00 44.94  ? 522  VAL C CB    1 
ATOM   7678  C  CG1   . VAL C  2  522  ? 42.856  -40.959 86.684   1.00 43.46  ? 522  VAL C CG1   1 
ATOM   7679  C  CG2   . VAL C  2  522  ? 40.525  -41.865 86.986   1.00 46.38  ? 522  VAL C CG2   1 
ATOM   7680  N  N     . ILE C  2  523  ? 40.570  -40.846 89.953   1.00 52.38  ? 523  ILE C N     1 
ATOM   7681  C  CA    . ILE C  2  523  ? 40.825  -41.553 91.205   1.00 51.63  ? 523  ILE C CA    1 
ATOM   7682  C  C     . ILE C  2  523  ? 41.079  -43.030 90.930   1.00 57.37  ? 523  ILE C C     1 
ATOM   7683  O  O     . ILE C  2  523  ? 40.244  -43.706 90.328   1.00 57.50  ? 523  ILE C O     1 
ATOM   7684  C  CB    . ILE C  2  523  ? 39.635  -41.436 92.171   1.00 51.35  ? 523  ILE C CB    1 
ATOM   7685  C  CG1   . ILE C  2  523  ? 39.359  -39.969 92.501   1.00 60.03  ? 523  ILE C CG1   1 
ATOM   7686  C  CG2   . ILE C  2  523  ? 39.904  -42.227 93.439   1.00 59.34  ? 523  ILE C CG2   1 
ATOM   7687  C  CD1   . ILE C  2  523  ? 40.533  -39.259 93.131   1.00 57.21  ? 523  ILE C CD1   1 
ATOM   7688  N  N     . VAL C  2  524  ? 42.229  -43.533 91.372   1.00 58.92  ? 524  VAL C N     1 
ATOM   7689  C  CA    . VAL C  2  524  ? 42.607  -44.915 91.086   1.00 59.85  ? 524  VAL C CA    1 
ATOM   7690  C  C     . VAL C  2  524  ? 43.018  -45.702 92.329   1.00 61.35  ? 524  VAL C C     1 
ATOM   7691  O  O     . VAL C  2  524  ? 43.027  -45.175 93.443   1.00 60.10  ? 524  VAL C O     1 
ATOM   7692  C  CB    . VAL C  2  524  ? 43.759  -44.982 90.059   1.00 57.07  ? 524  VAL C CB    1 
ATOM   7693  C  CG1   . VAL C  2  524  ? 43.315  -44.423 88.716   1.00 53.20  ? 524  VAL C CG1   1 
ATOM   7694  C  CG2   . VAL C  2  524  ? 44.976  -44.231 90.576   1.00 52.91  ? 524  VAL C CG2   1 
ATOM   7695  N  N     . SER C  2  525  ? 43.334  -46.978 92.120   1.00 65.11  ? 525  SER C N     1 
ATOM   7696  C  CA    . SER C  2  525  ? 43.885  -47.841 93.160   1.00 64.06  ? 525  SER C CA    1 
ATOM   7697  C  C     . SER C  2  525  ? 45.414  -47.791 93.125   1.00 60.72  ? 525  SER C C     1 
ATOM   7698  O  O     . SER C  2  525  ? 46.000  -47.529 92.074   1.00 55.38  ? 525  SER C O     1 
ATOM   7699  C  CB    . SER C  2  525  ? 43.386  -49.277 92.977   1.00 61.59  ? 525  SER C CB    1 
ATOM   7700  O  OG    . SER C  2  525  ? 41.980  -49.353 93.150   1.00 55.31  ? 525  SER C OG    1 
ATOM   7701  N  N     . PRO C  2  526  ? 46.065  -48.042 94.276   1.00 62.94  ? 526  PRO C N     1 
ATOM   7702  C  CA    . PRO C  2  526  ? 47.530  -47.982 94.383   1.00 62.54  ? 526  PRO C CA    1 
ATOM   7703  C  C     . PRO C  2  526  ? 48.269  -48.925 93.430   1.00 64.11  ? 526  PRO C C     1 
ATOM   7704  O  O     . PRO C  2  526  ? 49.442  -48.691 93.133   1.00 60.80  ? 526  PRO C O     1 
ATOM   7705  C  CB    . PRO C  2  526  ? 47.789  -48.400 95.833   1.00 62.15  ? 526  PRO C CB    1 
ATOM   7706  C  CG    . PRO C  2  526  ? 46.546  -48.024 96.555   1.00 63.42  ? 526  PRO C CG    1 
ATOM   7707  C  CD    . PRO C  2  526  ? 45.432  -48.280 95.585   1.00 61.92  ? 526  PRO C CD    1 
ATOM   7708  N  N     . GLU C  2  527  ? 47.596  -49.972 92.963   1.00 69.35  ? 527  GLU C N     1 
ATOM   7709  C  CA    . GLU C  2  527  ? 48.207  -50.923 92.038   1.00 67.83  ? 527  GLU C CA    1 
ATOM   7710  C  C     . GLU C  2  527  ? 48.372  -50.305 90.657   1.00 62.89  ? 527  GLU C C     1 
ATOM   7711  O  O     . GLU C  2  527  ? 49.197  -50.751 89.859   1.00 63.91  ? 527  GLU C O     1 
ATOM   7712  C  CB    . GLU C  2  527  ? 47.366  -52.199 91.929   1.00 69.65  ? 527  GLU C CB    1 
ATOM   7713  C  CG    . GLU C  2  527  ? 47.350  -53.061 93.184   1.00 77.87  ? 527  GLU C CG    1 
ATOM   7714  C  CD    . GLU C  2  527  ? 46.435  -52.514 94.263   1.00 79.71  ? 527  GLU C CD    1 
ATOM   7715  O  OE1   . GLU C  2  527  ? 45.560  -51.683 93.937   1.00 75.96  ? 527  GLU C OE1   1 
ATOM   7716  O  OE2   . GLU C  2  527  ? 46.592  -52.915 95.436   1.00 76.75  ? 527  GLU C OE2   1 
ATOM   7717  N  N     . GLU C  2  528  ? 47.582  -49.273 90.384   1.00 59.28  ? 528  GLU C N     1 
ATOM   7718  C  CA    . GLU C  2  528  ? 47.558  -48.661 89.065   1.00 55.41  ? 528  GLU C CA    1 
ATOM   7719  C  C     . GLU C  2  528  ? 48.573  -47.536 88.935   1.00 52.51  ? 528  GLU C C     1 
ATOM   7720  O  O     . GLU C  2  528  ? 48.792  -47.021 87.839   1.00 52.64  ? 528  GLU C O     1 
ATOM   7721  C  CB    . GLU C  2  528  ? 46.158  -48.130 88.755   1.00 57.53  ? 528  GLU C CB    1 
ATOM   7722  C  CG    . GLU C  2  528  ? 45.038  -49.079 89.143   1.00 61.39  ? 528  GLU C CG    1 
ATOM   7723  C  CD    . GLU C  2  528  ? 43.667  -48.535 88.795   1.00 63.64  ? 528  GLU C CD    1 
ATOM   7724  O  OE1   . GLU C  2  528  ? 42.727  -48.736 89.593   1.00 62.94  ? 528  GLU C OE1   1 
ATOM   7725  O  OE2   . GLU C  2  528  ? 43.528  -47.910 87.722   1.00 62.54  ? 528  GLU C OE2   1 
ATOM   7726  N  N     . VAL C  2  529  ? 49.201  -47.156 90.044   1.00 52.49  ? 529  VAL C N     1 
ATOM   7727  C  CA    . VAL C  2  529  ? 50.111  -46.021 90.000   1.00 50.58  ? 529  VAL C CA    1 
ATOM   7728  C  C     . VAL C  2  529  ? 51.456  -46.446 89.434   1.00 47.74  ? 529  VAL C C     1 
ATOM   7729  O  O     . VAL C  2  529  ? 52.192  -47.221 90.046   1.00 52.57  ? 529  VAL C O     1 
ATOM   7730  C  CB    . VAL C  2  529  ? 50.331  -45.438 91.406   1.00 49.70  ? 529  VAL C CB    1 
ATOM   7731  C  CG1   . VAL C  2  529  ? 51.407  -44.372 91.373   1.00 44.60  ? 529  VAL C CG1   1 
ATOM   7732  C  CG2   . VAL C  2  529  ? 49.029  -44.878 91.958   1.00 52.59  ? 529  VAL C CG2   1 
ATOM   7733  N  N     . GLU C  2  530  ? 51.765  -45.922 88.255   1.00 44.53  ? 530  GLU C N     1 
ATOM   7734  C  CA    . GLU C  2  530  ? 53.037  -46.177 87.592   1.00 47.89  ? 530  GLU C CA    1 
ATOM   7735  C  C     . GLU C  2  530  ? 54.149  -45.218 88.020   1.00 49.20  ? 530  GLU C C     1 
ATOM   7736  O  O     . GLU C  2  530  ? 55.295  -45.624 88.216   1.00 48.71  ? 530  GLU C O     1 
ATOM   7737  C  CB    . GLU C  2  530  ? 52.837  -46.217 86.077   1.00 46.89  ? 530  GLU C CB    1 
ATOM   7738  C  CG    . GLU C  2  530  ? 51.764  -47.227 85.681   1.00 47.17  ? 530  GLU C CG    1 
ATOM   7739  C  CD    . GLU C  2  530  ? 51.434  -47.212 84.203   1.00 54.40  ? 530  GLU C CD    1 
ATOM   7740  O  OE1   . GLU C  2  530  ? 50.234  -47.122 83.867   1.00 55.42  ? 530  GLU C OE1   1 
ATOM   7741  O  OE2   . GLU C  2  530  ? 52.367  -47.303 83.380   1.00 53.28  ? 530  GLU C OE2   1 
ATOM   7742  N  N     . PHE C  2  531  ? 53.797  -43.942 88.156   1.00 50.71  ? 531  PHE C N     1 
ATOM   7743  C  CA    . PHE C  2  531  ? 54.745  -42.915 88.576   1.00 48.44  ? 531  PHE C CA    1 
ATOM   7744  C  C     . PHE C  2  531  ? 54.120  -41.945 89.573   1.00 46.52  ? 531  PHE C C     1 
ATOM   7745  O  O     . PHE C  2  531  ? 52.942  -42.055 89.911   1.00 46.09  ? 531  PHE C O     1 
ATOM   7746  C  CB    . PHE C  2  531  ? 55.279  -42.139 87.369   1.00 46.34  ? 531  PHE C CB    1 
ATOM   7747  C  CG    . PHE C  2  531  ? 56.341  -42.868 86.597   1.00 51.36  ? 531  PHE C CG    1 
ATOM   7748  C  CD1   . PHE C  2  531  ? 56.012  -43.624 85.484   1.00 53.14  ? 531  PHE C CD1   1 
ATOM   7749  C  CD2   . PHE C  2  531  ? 57.670  -42.794 86.984   1.00 52.78  ? 531  PHE C CD2   1 
ATOM   7750  C  CE1   . PHE C  2  531  ? 56.988  -44.294 84.771   1.00 53.38  ? 531  PHE C CE1   1 
ATOM   7751  C  CE2   . PHE C  2  531  ? 58.653  -43.464 86.276   1.00 54.04  ? 531  PHE C CE2   1 
ATOM   7752  C  CZ    . PHE C  2  531  ? 58.311  -44.214 85.167   1.00 55.71  ? 531  PHE C CZ    1 
ATOM   7753  N  N     . MET C  2  532  ? 54.917  -40.989 90.036   1.00 42.62  ? 532  MET C N     1 
ATOM   7754  C  CA    . MET C  2  532  ? 54.441  -40.007 91.000   1.00 40.48  ? 532  MET C CA    1 
ATOM   7755  C  C     . MET C  2  532  ? 55.195  -38.692 90.840   1.00 44.67  ? 532  MET C C     1 
ATOM   7756  O  O     . MET C  2  532  ? 56.364  -38.683 90.466   1.00 42.83  ? 532  MET C O     1 
ATOM   7757  C  CB    . MET C  2  532  ? 54.598  -40.552 92.421   1.00 38.55  ? 532  MET C CB    1 
ATOM   7758  C  CG    . MET C  2  532  ? 54.181  -39.601 93.529   1.00 38.02  ? 532  MET C CG    1 
ATOM   7759  S  SD    . MET C  2  532  ? 54.130  -40.429 95.128   1.00 42.24  ? 532  MET C SD    1 
ATOM   7760  C  CE    . MET C  2  532  ? 54.110  -39.034 96.250   1.00 49.63  ? 532  MET C CE    1 
ATOM   7761  N  N     . ASP C  2  533  ? 54.515  -37.583 91.110   1.00 49.10  ? 533  ASP C N     1 
ATOM   7762  C  CA    . ASP C  2  533  ? 55.142  -36.269 91.047   1.00 46.78  ? 533  ASP C CA    1 
ATOM   7763  C  C     . ASP C  2  533  ? 56.236  -36.147 92.103   1.00 41.26  ? 533  ASP C C     1 
ATOM   7764  O  O     . ASP C  2  533  ? 56.070  -36.601 93.236   1.00 43.27  ? 533  ASP C O     1 
ATOM   7765  C  CB    . ASP C  2  533  ? 54.099  -35.166 91.248   1.00 51.64  ? 533  ASP C CB    1 
ATOM   7766  C  CG    . ASP C  2  533  ? 53.068  -35.123 90.133   1.00 54.24  ? 533  ASP C CG    1 
ATOM   7767  O  OD1   . ASP C  2  533  ? 52.835  -36.168 89.491   1.00 52.85  ? 533  ASP C OD1   1 
ATOM   7768  O  OD2   . ASP C  2  533  ? 52.487  -34.041 89.903   1.00 54.74  ? 533  ASP C OD2   1 
ATOM   7769  N  N     . VAL C  2  534  ? 57.356  -35.541 91.725   1.00 34.88  ? 534  VAL C N     1 
ATOM   7770  C  CA    . VAL C  2  534  ? 58.451  -35.326 92.660   1.00 33.20  ? 534  VAL C CA    1 
ATOM   7771  C  C     . VAL C  2  534  ? 58.022  -34.362 93.759   1.00 37.25  ? 534  VAL C C     1 
ATOM   7772  O  O     . VAL C  2  534  ? 58.045  -34.698 94.943   1.00 41.48  ? 534  VAL C O     1 
ATOM   7773  C  CB    . VAL C  2  534  ? 59.685  -34.737 91.946   1.00 32.26  ? 534  VAL C CB    1 
ATOM   7774  C  CG1   . VAL C  2  534  ? 60.762  -34.366 92.953   1.00 36.00  ? 534  VAL C CG1   1 
ATOM   7775  C  CG2   . VAL C  2  534  ? 60.223  -35.714 90.913   1.00 34.10  ? 534  VAL C CG2   1 
ATOM   7776  N  N     . SER C  2  535  ? 57.616  -33.165 93.349   1.00 38.07  ? 535  SER C N     1 
ATOM   7777  C  CA    . SER C  2  535  ? 57.204  -32.115 94.273   1.00 37.74  ? 535  SER C CA    1 
ATOM   7778  C  C     . SER C  2  535  ? 56.116  -31.273 93.623   1.00 35.79  ? 535  SER C C     1 
ATOM   7779  O  O     . SER C  2  535  ? 56.001  -31.251 92.400   1.00 37.02  ? 535  SER C O     1 
ATOM   7780  C  CB    . SER C  2  535  ? 58.402  -31.232 94.630   1.00 37.22  ? 535  SER C CB    1 
ATOM   7781  O  OG    . SER C  2  535  ? 58.057  -30.238 95.580   1.00 35.55  ? 535  SER C OG    1 
ATOM   7782  N  N     . PRO C  2  536  ? 55.297  -30.588 94.435   1.00 34.39  ? 536  PRO C N     1 
ATOM   7783  C  CA    . PRO C  2  536  ? 54.419  -29.572 93.848   1.00 30.45  ? 536  PRO C CA    1 
ATOM   7784  C  C     . PRO C  2  536  ? 55.240  -28.485 93.156   1.00 28.80  ? 536  PRO C C     1 
ATOM   7785  O  O     . PRO C  2  536  ? 54.815  -27.938 92.135   1.00 28.95  ? 536  PRO C O     1 
ATOM   7786  C  CB    . PRO C  2  536  ? 53.687  -28.995 95.067   1.00 28.44  ? 536  PRO C CB    1 
ATOM   7787  C  CG    . PRO C  2  536  ? 54.471  -29.458 96.266   1.00 30.32  ? 536  PRO C CG    1 
ATOM   7788  C  CD    . PRO C  2  536  ? 55.034  -30.778 95.869   1.00 33.24  ? 536  PRO C CD    1 
ATOM   7789  N  N     . LYS C  2  537  ? 56.424  -28.212 93.699   1.00 28.95  ? 537  LYS C N     1 
ATOM   7790  C  CA    . LYS C  2  537  ? 57.302  -27.147 93.214   1.00 26.06  ? 537  LYS C CA    1 
ATOM   7791  C  C     . LYS C  2  537  ? 57.646  -27.250 91.729   1.00 26.17  ? 537  LYS C C     1 
ATOM   7792  O  O     . LYS C  2  537  ? 57.997  -26.252 91.103   1.00 24.82  ? 537  LYS C O     1 
ATOM   7793  C  CB    . LYS C  2  537  ? 58.594  -27.113 94.035   1.00 26.93  ? 537  LYS C CB    1 
ATOM   7794  C  CG    . LYS C  2  537  ? 58.378  -26.949 95.531   1.00 40.12  ? 537  LYS C CG    1 
ATOM   7795  C  CD    . LYS C  2  537  ? 59.700  -26.805 96.274   1.00 46.36  ? 537  LYS C CD    1 
ATOM   7796  C  CE    . LYS C  2  537  ? 59.488  -26.728 97.781   1.00 52.77  ? 537  LYS C CE    1 
ATOM   7797  N  NZ    . LYS C  2  537  ? 58.590  -25.605 98.178   1.00 49.84  ? 537  LYS C NZ    1 
ATOM   7798  N  N     . GLN C  2  538  ? 57.551  -28.453 91.171   1.00 29.92  ? 538  GLN C N     1 
ATOM   7799  C  CA    . GLN C  2  538  ? 57.910  -28.676 89.773   1.00 29.36  ? 538  GLN C CA    1 
ATOM   7800  C  C     . GLN C  2  538  ? 56.875  -28.095 88.817   1.00 28.20  ? 538  GLN C C     1 
ATOM   7801  O  O     . GLN C  2  538  ? 57.152  -27.909 87.632   1.00 25.77  ? 538  GLN C O     1 
ATOM   7802  C  CB    . GLN C  2  538  ? 58.089  -30.169 89.489   1.00 29.39  ? 538  GLN C CB    1 
ATOM   7803  C  CG    . GLN C  2  538  ? 56.787  -30.949 89.424   1.00 27.60  ? 538  GLN C CG    1 
ATOM   7804  C  CD    . GLN C  2  538  ? 57.001  -32.415 89.104   1.00 34.22  ? 538  GLN C CD    1 
ATOM   7805  O  OE1   . GLN C  2  538  ? 58.069  -32.812 88.638   1.00 34.71  ? 538  GLN C OE1   1 
ATOM   7806  N  NE2   . GLN C  2  538  ? 55.982  -33.230 89.354   1.00 33.70  ? 538  GLN C NE2   1 
ATOM   7807  N  N     . VAL C  2  539  ? 55.684  -27.812 89.337   1.00 27.40  ? 539  VAL C N     1 
ATOM   7808  C  CA    . VAL C  2  539  ? 54.581  -27.331 88.510   1.00 22.68  ? 539  VAL C CA    1 
ATOM   7809  C  C     . VAL C  2  539  ? 54.724  -25.847 88.164   1.00 21.68  ? 539  VAL C C     1 
ATOM   7810  O  O     . VAL C  2  539  ? 54.233  -25.388 87.132   1.00 22.24  ? 539  VAL C O     1 
ATOM   7811  C  CB    . VAL C  2  539  ? 53.222  -27.613 89.191   1.00 19.57  ? 539  VAL C CB    1 
ATOM   7812  C  CG1   . VAL C  2  539  ? 52.064  -27.094 88.352   1.00 18.53  ? 539  VAL C CG1   1 
ATOM   7813  C  CG2   . VAL C  2  539  ? 53.071  -29.103 89.430   1.00 23.96  ? 539  VAL C CG2   1 
ATOM   7814  N  N     . PHE C  2  540  ? 55.439  -25.107 89.005   1.00 21.59  ? 540  PHE C N     1 
ATOM   7815  C  CA    . PHE C  2  540  ? 55.529  -23.659 88.846   1.00 20.54  ? 540  PHE C CA    1 
ATOM   7816  C  C     . PHE C  2  540  ? 56.965  -23.183 88.671   1.00 17.49  ? 540  PHE C C     1 
ATOM   7817  O  O     . PHE C  2  540  ? 57.912  -23.907 88.973   1.00 19.85  ? 540  PHE C O     1 
ATOM   7818  C  CB    . PHE C  2  540  ? 54.884  -22.959 90.043   1.00 20.10  ? 540  PHE C CB    1 
ATOM   7819  C  CG    . PHE C  2  540  ? 53.496  -23.441 90.344   1.00 18.40  ? 540  PHE C CG    1 
ATOM   7820  C  CD1   . PHE C  2  540  ? 53.282  -24.421 91.297   1.00 20.02  ? 540  PHE C CD1   1 
ATOM   7821  C  CD2   . PHE C  2  540  ? 52.407  -22.924 89.666   1.00 18.94  ? 540  PHE C CD2   1 
ATOM   7822  C  CE1   . PHE C  2  540  ? 52.008  -24.872 91.572   1.00 20.35  ? 540  PHE C CE1   1 
ATOM   7823  C  CE2   . PHE C  2  540  ? 51.129  -23.371 89.938   1.00 19.54  ? 540  PHE C CE2   1 
ATOM   7824  C  CZ    . PHE C  2  540  ? 50.930  -24.346 90.893   1.00 19.10  ? 540  PHE C CZ    1 
ATOM   7825  N  N     . SER C  2  541  ? 57.119  -21.956 88.185   1.00 16.97  ? 541  SER C N     1 
ATOM   7826  C  CA    . SER C  2  541  ? 58.438  -21.396 87.922   1.00 21.47  ? 541  SER C CA    1 
ATOM   7827  C  C     . SER C  2  541  ? 59.165  -21.081 89.221   1.00 22.28  ? 541  SER C C     1 
ATOM   7828  O  O     . SER C  2  541  ? 58.646  -21.326 90.311   1.00 20.80  ? 541  SER C O     1 
ATOM   7829  C  CB    . SER C  2  541  ? 58.320  -20.124 87.080   1.00 23.22  ? 541  SER C CB    1 
ATOM   7830  O  OG    . SER C  2  541  ? 57.643  -19.102 87.792   1.00 21.12  ? 541  SER C OG    1 
ATOM   7831  N  N     . VAL C  2  542  ? 60.373  -20.542 89.100   1.00 21.99  ? 542  VAL C N     1 
ATOM   7832  C  CA    . VAL C  2  542  ? 61.153  -20.161 90.269   1.00 21.10  ? 542  VAL C CA    1 
ATOM   7833  C  C     . VAL C  2  542  ? 60.455  -19.040 91.030   1.00 22.82  ? 542  VAL C C     1 
ATOM   7834  O  O     . VAL C  2  542  ? 60.298  -19.112 92.249   1.00 26.79  ? 542  VAL C O     1 
ATOM   7835  C  CB    . VAL C  2  542  ? 62.579  -19.724 89.879   1.00 20.92  ? 542  VAL C CB    1 
ATOM   7836  C  CG1   . VAL C  2  542  ? 63.275  -19.046 91.050   1.00 19.80  ? 542  VAL C CG1   1 
ATOM   7837  C  CG2   . VAL C  2  542  ? 63.383  -20.920 89.393   1.00 22.82  ? 542  VAL C CG2   1 
ATOM   7838  N  N     . ASN C  2  543  ? 60.023  -18.015 90.300   1.00 21.38  ? 543  ASN C N     1 
ATOM   7839  C  CA    . ASN C  2  543  ? 59.355  -16.865 90.902   1.00 20.45  ? 543  ASN C CA    1 
ATOM   7840  C  C     . ASN C  2  543  ? 58.055  -17.246 91.602   1.00 20.26  ? 543  ASN C C     1 
ATOM   7841  O  O     . ASN C  2  543  ? 57.817  -16.859 92.747   1.00 21.56  ? 543  ASN C O     1 
ATOM   7842  C  CB    . ASN C  2  543  ? 59.080  -15.797 89.844   1.00 20.01  ? 543  ASN C CB    1 
ATOM   7843  C  CG    . ASN C  2  543  ? 60.333  -15.371 89.110   1.00 22.04  ? 543  ASN C CG    1 
ATOM   7844  O  OD1   . ASN C  2  543  ? 60.851  -16.106 88.270   1.00 24.14  ? 543  ASN C OD1   1 
ATOM   7845  N  ND2   . ASN C  2  543  ? 60.823  -14.175 89.418   1.00 19.93  ? 543  ASN C ND2   1 
ATOM   7846  N  N     . THR C  2  544  ? 57.219  -18.009 90.905   1.00 17.76  ? 544  THR C N     1 
ATOM   7847  C  CA    . THR C  2  544  ? 55.945  -18.457 91.450   1.00 17.14  ? 544  THR C CA    1 
ATOM   7848  C  C     . THR C  2  544  ? 56.163  -19.315 92.694   1.00 19.68  ? 544  THR C C     1 
ATOM   7849  O  O     . THR C  2  544  ? 55.319  -19.361 93.591   1.00 19.71  ? 544  THR C O     1 
ATOM   7850  C  CB    . THR C  2  544  ? 55.149  -19.252 90.399   1.00 18.67  ? 544  THR C CB    1 
ATOM   7851  O  OG1   . THR C  2  544  ? 55.077  -18.495 89.185   1.00 21.22  ? 544  THR C OG1   1 
ATOM   7852  C  CG2   . THR C  2  544  ? 53.742  -19.545 90.889   1.00 18.10  ? 544  THR C CG2   1 
ATOM   7853  N  N     . ASN C  2  545  ? 57.313  -19.980 92.748   1.00 22.26  ? 545  ASN C N     1 
ATOM   7854  C  CA    . ASN C  2  545  ? 57.665  -20.823 93.886   1.00 23.01  ? 545  ASN C CA    1 
ATOM   7855  C  C     . ASN C  2  545  ? 58.121  -20.031 95.106   1.00 22.01  ? 545  ASN C C     1 
ATOM   7856  O  O     . ASN C  2  545  ? 58.321  -20.596 96.180   1.00 23.40  ? 545  ASN C O     1 
ATOM   7857  C  CB    . ASN C  2  545  ? 58.742  -21.832 93.490   1.00 20.41  ? 545  ASN C CB    1 
ATOM   7858  C  CG    . ASN C  2  545  ? 58.173  -23.198 93.192   1.00 24.11  ? 545  ASN C CG    1 
ATOM   7859  O  OD1   . ASN C  2  545  ? 57.997  -24.016 94.093   1.00 25.60  ? 545  ASN C OD1   1 
ATOM   7860  N  ND2   . ASN C  2  545  ? 57.879  -23.456 91.923   1.00 25.16  ? 545  ASN C ND2   1 
ATOM   7861  N  N     . LEU C  2  546  ? 58.292  -18.726 94.935   1.00 17.81  ? 546  LEU C N     1 
ATOM   7862  C  CA    . LEU C  2  546  ? 58.717  -17.865 96.030   1.00 17.75  ? 546  LEU C CA    1 
ATOM   7863  C  C     . LEU C  2  546  ? 57.529  -17.232 96.750   1.00 19.80  ? 546  LEU C C     1 
ATOM   7864  O  O     . LEU C  2  546  ? 57.703  -16.396 97.637   1.00 20.91  ? 546  LEU C O     1 
ATOM   7865  C  CB    . LEU C  2  546  ? 59.685  -16.797 95.527   1.00 17.30  ? 546  LEU C CB    1 
ATOM   7866  C  CG    . LEU C  2  546  ? 61.014  -17.363 95.025   1.00 16.65  ? 546  LEU C CG    1 
ATOM   7867  C  CD1   . LEU C  2  546  ? 61.927  -16.259 94.535   1.00 16.88  ? 546  LEU C CD1   1 
ATOM   7868  C  CD2   . LEU C  2  546  ? 61.688  -18.163 96.124   1.00 21.63  ? 546  LEU C CD2   1 
ATOM   7869  N  N     . ILE C  2  547  ? 56.324  -17.633 96.357   1.00 18.97  ? 547  ILE C N     1 
ATOM   7870  C  CA    . ILE C  2  547  ? 55.100  -17.116 96.958   1.00 16.15  ? 547  ILE C CA    1 
ATOM   7871  C  C     . ILE C  2  547  ? 54.522  -18.083 97.984   1.00 16.54  ? 547  ILE C C     1 
ATOM   7872  O  O     . ILE C  2  547  ? 54.002  -19.136 97.620   1.00 19.47  ? 547  ILE C O     1 
ATOM   7873  C  CB    . ILE C  2  547  ? 54.023  -16.868 95.891   1.00 16.51  ? 547  ILE C CB    1 
ATOM   7874  C  CG1   . ILE C  2  547  ? 54.548  -15.922 94.809   1.00 16.88  ? 547  ILE C CG1   1 
ATOM   7875  C  CG2   . ILE C  2  547  ? 52.756  -16.319 96.530   1.00 18.02  ? 547  ILE C CG2   1 
ATOM   7876  C  CD1   . ILE C  2  547  ? 53.588  -15.728 93.655   1.00 16.79  ? 547  ILE C CD1   1 
ATOM   7877  N  N     . PRO C  2  548  ? 54.600  -17.725 99.273   1.00 16.27  ? 548  PRO C N     1 
ATOM   7878  C  CA    . PRO C  2  548  ? 54.013  -18.563 100.323  1.00 16.53  ? 548  PRO C CA    1 
ATOM   7879  C  C     . PRO C  2  548  ? 52.494  -18.547 100.235  1.00 16.59  ? 548  PRO C C     1 
ATOM   7880  O  O     . PRO C  2  548  ? 51.936  -17.561 99.764   1.00 18.26  ? 548  PRO C O     1 
ATOM   7881  C  CB    . PRO C  2  548  ? 54.477  -17.882 101.612  1.00 17.24  ? 548  PRO C CB    1 
ATOM   7882  C  CG    . PRO C  2  548  ? 54.717  -16.464 101.224  1.00 17.96  ? 548  PRO C CG    1 
ATOM   7883  C  CD    . PRO C  2  548  ? 55.232  -16.511 99.818   1.00 17.85  ? 548  PRO C CD    1 
ATOM   7884  N  N     . PHE C  2  549  ? 51.845  -19.625 100.669  1.00 17.51  ? 549  PHE C N     1 
ATOM   7885  C  CA    . PHE C  2  549  ? 50.386  -19.734 100.625  1.00 19.34  ? 549  PHE C CA    1 
ATOM   7886  C  C     . PHE C  2  549  ? 49.824  -19.488 99.226   1.00 19.94  ? 549  PHE C C     1 
ATOM   7887  O  O     . PHE C  2  549  ? 48.738  -18.927 99.076   1.00 18.93  ? 549  PHE C O     1 
ATOM   7888  C  CB    . PHE C  2  549  ? 49.736  -18.771 101.620  1.00 19.03  ? 549  PHE C CB    1 
ATOM   7889  C  CG    . PHE C  2  549  ? 50.227  -18.931 103.027  1.00 19.64  ? 549  PHE C CG    1 
ATOM   7890  C  CD1   . PHE C  2  549  ? 49.638  -19.849 103.879  1.00 21.04  ? 549  PHE C CD1   1 
ATOM   7891  C  CD2   . PHE C  2  549  ? 51.276  -18.160 103.499  1.00 18.02  ? 549  PHE C CD2   1 
ATOM   7892  C  CE1   . PHE C  2  549  ? 50.087  -19.996 105.175  1.00 22.33  ? 549  PHE C CE1   1 
ATOM   7893  C  CE2   . PHE C  2  549  ? 51.730  -18.303 104.793  1.00 18.18  ? 549  PHE C CE2   1 
ATOM   7894  C  CZ    . PHE C  2  549  ? 51.135  -19.222 105.633  1.00 21.30  ? 549  PHE C CZ    1 
ATOM   7895  N  N     . LEU C  2  550  ? 50.573  -19.910 98.211   1.00 19.80  ? 550  LEU C N     1 
ATOM   7896  C  CA    . LEU C  2  550  ? 50.165  -19.750 96.820   1.00 18.90  ? 550  LEU C CA    1 
ATOM   7897  C  C     . LEU C  2  550  ? 48.846  -20.462 96.539   1.00 20.91  ? 550  LEU C C     1 
ATOM   7898  O  O     . LEU C  2  550  ? 48.079  -20.056 95.665   1.00 19.81  ? 550  LEU C O     1 
ATOM   7899  C  CB    . LEU C  2  550  ? 51.253  -20.288 95.891   1.00 19.56  ? 550  LEU C CB    1 
ATOM   7900  C  CG    . LEU C  2  550  ? 50.955  -20.260 94.394   1.00 17.15  ? 550  LEU C CG    1 
ATOM   7901  C  CD1   . LEU C  2  550  ? 50.938  -18.828 93.889   1.00 19.14  ? 550  LEU C CD1   1 
ATOM   7902  C  CD2   . LEU C  2  550  ? 51.963  -21.100 93.632   1.00 18.55  ? 550  LEU C CD2   1 
ATOM   7903  N  N     . GLU C  2  551  ? 48.586  -21.526 97.293   1.00 22.70  ? 551  GLU C N     1 
ATOM   7904  C  CA    . GLU C  2  551  ? 47.354  -22.291 97.149   1.00 23.36  ? 551  GLU C CA    1 
ATOM   7905  C  C     . GLU C  2  551  ? 46.134  -21.480 97.576   1.00 20.82  ? 551  GLU C C     1 
ATOM   7906  O  O     . GLU C  2  551  ? 45.004  -21.815 97.228   1.00 19.03  ? 551  GLU C O     1 
ATOM   7907  C  CB    . GLU C  2  551  ? 47.431  -23.594 97.952   1.00 25.85  ? 551  GLU C CB    1 
ATOM   7908  C  CG    . GLU C  2  551  ? 47.663  -23.416 99.451   1.00 25.17  ? 551  GLU C CG    1 
ATOM   7909  C  CD    . GLU C  2  551  ? 49.134  -23.309 99.820   1.00 26.71  ? 551  GLU C CD    1 
ATOM   7910  O  OE1   . GLU C  2  551  ? 49.469  -23.528 101.005  1.00 29.29  ? 551  GLU C OE1   1 
ATOM   7911  O  OE2   . GLU C  2  551  ? 49.956  -23.006 98.929   1.00 25.82  ? 551  GLU C OE2   1 
ATOM   7912  N  N     . HIS C  2  552  ? 46.369  -20.421 98.344   1.00 20.98  ? 552  HIS C N     1 
ATOM   7913  C  CA    . HIS C  2  552  ? 45.286  -19.562 98.808   1.00 22.09  ? 552  HIS C CA    1 
ATOM   7914  C  C     . HIS C  2  552  ? 45.103  -18.322 97.934   1.00 18.67  ? 552  HIS C C     1 
ATOM   7915  O  O     . HIS C  2  552  ? 44.188  -17.532 98.156   1.00 19.14  ? 552  HIS C O     1 
ATOM   7916  C  CB    . HIS C  2  552  ? 45.511  -19.160 100.269  1.00 21.59  ? 552  HIS C CB    1 
ATOM   7917  C  CG    . HIS C  2  552  ? 45.623  -20.325 101.202  1.00 23.36  ? 552  HIS C CG    1 
ATOM   7918  N  ND1   . HIS C  2  552  ? 46.835  -20.815 101.639  1.00 24.49  ? 552  HIS C ND1   1 
ATOM   7919  C  CD2   . HIS C  2  552  ? 44.674  -21.102 101.777  1.00 22.65  ? 552  HIS C CD2   1 
ATOM   7920  C  CE1   . HIS C  2  552  ? 46.628  -21.841 102.445  1.00 25.02  ? 552  HIS C CE1   1 
ATOM   7921  N  NE2   . HIS C  2  552  ? 45.325  -22.036 102.545  1.00 24.70  ? 552  HIS C NE2   1 
ATOM   7922  N  N     . ASP C  2  553  ? 45.968  -18.161 96.937   1.00 18.78  ? 553  ASP C N     1 
ATOM   7923  C  CA    . ASP C  2  553  ? 45.903  -17.005 96.045   1.00 19.16  ? 553  ASP C CA    1 
ATOM   7924  C  C     . ASP C  2  553  ? 45.257  -17.351 94.707   1.00 20.39  ? 553  ASP C C     1 
ATOM   7925  O  O     . ASP C  2  553  ? 45.422  -18.457 94.193   1.00 24.17  ? 553  ASP C O     1 
ATOM   7926  C  CB    . ASP C  2  553  ? 47.300  -16.424 95.794   1.00 18.55  ? 553  ASP C CB    1 
ATOM   7927  C  CG    . ASP C  2  553  ? 47.846  -15.666 96.987   1.00 18.85  ? 553  ASP C CG    1 
ATOM   7928  O  OD1   . ASP C  2  553  ? 49.086  -15.577 97.109   1.00 17.28  ? 553  ASP C OD1   1 
ATOM   7929  O  OD2   . ASP C  2  553  ? 47.045  -15.160 97.800   1.00 19.84  ? 553  ASP C OD2   1 
ATOM   7930  N  N     . ASP C  2  554  ? 44.515  -16.400 94.148   1.00 19.21  ? 554  ASP C N     1 
ATOM   7931  C  CA    . ASP C  2  554  ? 43.965  -16.555 92.808   1.00 19.52  ? 554  ASP C CA    1 
ATOM   7932  C  C     . ASP C  2  554  ? 45.087  -16.441 91.781   1.00 18.56  ? 554  ASP C C     1 
ATOM   7933  O  O     . ASP C  2  554  ? 46.032  -15.675 91.969   1.00 17.06  ? 554  ASP C O     1 
ATOM   7934  C  CB    . ASP C  2  554  ? 42.877  -15.510 92.551   1.00 25.53  ? 554  ASP C CB    1 
ATOM   7935  C  CG    . ASP C  2  554  ? 42.390  -15.510 91.112   1.00 31.89  ? 554  ASP C CG    1 
ATOM   7936  O  OD1   . ASP C  2  554  ? 41.849  -16.542 90.661   1.00 32.27  ? 554  ASP C OD1   1 
ATOM   7937  O  OD2   . ASP C  2  554  ? 42.539  -14.468 90.437   1.00 32.49  ? 554  ASP C OD2   1 
ATOM   7938  N  N     . ALA C  2  555  ? 44.980  -17.213 90.704   1.00 18.94  ? 555  ALA C N     1 
ATOM   7939  C  CA    . ALA C  2  555  ? 46.029  -17.282 89.691   1.00 17.87  ? 555  ALA C CA    1 
ATOM   7940  C  C     . ALA C  2  555  ? 46.362  -15.920 89.084   1.00 18.90  ? 555  ALA C C     1 
ATOM   7941  O  O     . ALA C  2  555  ? 47.532  -15.605 88.852   1.00 19.44  ? 555  ALA C O     1 
ATOM   7942  C  CB    . ALA C  2  555  ? 45.645  -18.271 88.602   1.00 16.68  ? 555  ALA C CB    1 
ATOM   7943  N  N     . ASN C  2  556  ? 45.331  -15.116 88.837   1.00 18.43  ? 556  ASN C N     1 
ATOM   7944  C  CA    . ASN C  2  556  ? 45.507  -13.803 88.223   1.00 17.44  ? 556  ASN C CA    1 
ATOM   7945  C  C     . ASN C  2  556  ? 46.409  -12.880 89.035   1.00 18.16  ? 556  ASN C C     1 
ATOM   7946  O  O     . ASN C  2  556  ? 47.245  -12.167 88.478   1.00 19.45  ? 556  ASN C O     1 
ATOM   7947  C  CB    . ASN C  2  556  ? 44.153  -13.132 87.983   1.00 21.59  ? 556  ASN C CB    1 
ATOM   7948  C  CG    . ASN C  2  556  ? 43.359  -13.801 86.878   1.00 26.32  ? 556  ASN C CG    1 
ATOM   7949  O  OD1   . ASN C  2  556  ? 43.550  -13.506 85.697   1.00 25.80  ? 556  ASN C OD1   1 
ATOM   7950  N  ND2   . ASN C  2  556  ? 42.457  -14.702 87.257   1.00 28.22  ? 556  ASN C ND2   1 
ATOM   7951  N  N     . ARG C  2  557  ? 46.230  -12.889 90.351   1.00 17.54  ? 557  ARG C N     1 
ATOM   7952  C  CA    . ARG C  2  557  ? 47.046  -12.064 91.233   1.00 17.24  ? 557  ARG C CA    1 
ATOM   7953  C  C     . ARG C  2  557  ? 48.402  -12.713 91.498   1.00 16.01  ? 557  ARG C C     1 
ATOM   7954  O  O     . ARG C  2  557  ? 49.409  -12.022 91.672   1.00 15.75  ? 557  ARG C O     1 
ATOM   7955  C  CB    . ARG C  2  557  ? 46.314  -11.789 92.548   1.00 19.19  ? 557  ARG C CB    1 
ATOM   7956  C  CG    . ARG C  2  557  ? 46.298  -10.321 92.937   1.00 18.25  ? 557  ARG C CG    1 
ATOM   7957  C  CD    . ARG C  2  557  ? 45.597  -9.485  91.879   1.00 18.36  ? 557  ARG C CD    1 
ATOM   7958  N  NE    . ARG C  2  557  ? 45.887  -8.062  92.027   1.00 18.25  ? 557  ARG C NE    1 
ATOM   7959  C  CZ    . ARG C  2  557  ? 45.356  -7.110  91.267   1.00 20.39  ? 557  ARG C CZ    1 
ATOM   7960  N  NH1   . ARG C  2  557  ? 44.499  -7.428  90.306   1.00 21.80  ? 557  ARG C NH1   1 
ATOM   7961  N  NH2   . ARG C  2  557  ? 45.680  -5.839  91.471   1.00 18.72  ? 557  ARG C NH2   1 
ATOM   7962  N  N     . ALA C  2  558  ? 48.416  -14.043 91.528   1.00 16.07  ? 558  ALA C N     1 
ATOM   7963  C  CA    . ALA C  2  558  ? 49.648  -14.802 91.708   1.00 15.29  ? 558  ALA C CA    1 
ATOM   7964  C  C     . ALA C  2  558  ? 50.623  -14.481 90.586   1.00 14.40  ? 558  ALA C C     1 
ATOM   7965  O  O     . ALA C  2  558  ? 51.834  -14.427 90.796   1.00 14.04  ? 558  ALA C O     1 
ATOM   7966  C  CB    . ALA C  2  558  ? 49.351  -16.291 91.741   1.00 14.79  ? 558  ALA C CB    1 
ATOM   7967  N  N     . LEU C  2  559  ? 50.075  -14.271 89.394   1.00 15.24  ? 559  LEU C N     1 
ATOM   7968  C  CA    . LEU C  2  559  ? 50.854  -13.857 88.236   1.00 14.66  ? 559  LEU C CA    1 
ATOM   7969  C  C     . LEU C  2  559  ? 51.608  -12.565 88.526   1.00 15.85  ? 559  LEU C C     1 
ATOM   7970  O  O     . LEU C  2  559  ? 52.825  -12.489 88.352   1.00 18.78  ? 559  LEU C O     1 
ATOM   7971  C  CB    . LEU C  2  559  ? 49.924  -13.671 87.034   1.00 15.59  ? 559  LEU C CB    1 
ATOM   7972  C  CG    . LEU C  2  559  ? 50.498  -13.229 85.688   1.00 18.27  ? 559  LEU C CG    1 
ATOM   7973  C  CD1   . LEU C  2  559  ? 49.703  -13.872 84.570   1.00 18.79  ? 559  LEU C CD1   1 
ATOM   7974  C  CD2   . LEU C  2  559  ? 50.466  -11.717 85.546   1.00 19.62  ? 559  LEU C CD2   1 
ATOM   7975  N  N     . MET C  2  560  ? 50.873  -11.552 88.973   1.00 17.47  ? 560  MET C N     1 
ATOM   7976  C  CA    . MET C  2  560  ? 51.452  -10.242 89.246   1.00 18.93  ? 560  MET C CA    1 
ATOM   7977  C  C     . MET C  2  560  ? 52.469  -10.300 90.379   1.00 17.11  ? 560  MET C C     1 
ATOM   7978  O  O     . MET C  2  560  ? 53.533  -9.688  90.296   1.00 17.06  ? 560  MET C O     1 
ATOM   7979  C  CB    . MET C  2  560  ? 50.356  -9.230  89.579   1.00 18.98  ? 560  MET C CB    1 
ATOM   7980  C  CG    . MET C  2  560  ? 49.258  -9.152  88.538   1.00 21.12  ? 560  MET C CG    1 
ATOM   7981  S  SD    . MET C  2  560  ? 48.066  -7.855  88.905   1.00 34.34  ? 560  MET C SD    1 
ATOM   7982  C  CE    . MET C  2  560  ? 46.878  -8.106  87.587   1.00 31.68  ? 560  MET C CE    1 
ATOM   7983  N  N     . GLY C  2  561  ? 52.136  -11.032 91.437   1.00 15.61  ? 561  GLY C N     1 
ATOM   7984  C  CA    . GLY C  2  561  ? 53.050  -11.207 92.549   1.00 15.96  ? 561  GLY C CA    1 
ATOM   7985  C  C     . GLY C  2  561  ? 54.339  -11.851 92.079   1.00 16.58  ? 561  GLY C C     1 
ATOM   7986  O  O     . GLY C  2  561  ? 55.430  -11.493 92.525   1.00 16.93  ? 561  GLY C O     1 
ATOM   7987  N  N     . SER C  2  562  ? 54.204  -12.799 91.160   1.00 15.61  ? 562  SER C N     1 
ATOM   7988  C  CA    . SER C  2  562  ? 55.349  -13.492 90.592   1.00 15.43  ? 562  SER C CA    1 
ATOM   7989  C  C     . SER C  2  562  ? 56.216  -12.544 89.773   1.00 16.10  ? 562  SER C C     1 
ATOM   7990  O  O     . SER C  2  562  ? 57.440  -12.549 89.893   1.00 18.53  ? 562  SER C O     1 
ATOM   7991  C  CB    . SER C  2  562  ? 54.879  -14.659 89.723   1.00 16.82  ? 562  SER C CB    1 
ATOM   7992  O  OG    . SER C  2  562  ? 55.970  -15.282 89.073   1.00 20.82  ? 562  SER C OG    1 
ATOM   7993  N  N     . ASN C  2  563  ? 55.576  -11.724 88.948   1.00 17.31  ? 563  ASN C N     1 
ATOM   7994  C  CA    . ASN C  2  563  ? 56.300  -10.820 88.057   1.00 18.94  ? 563  ASN C CA    1 
ATOM   7995  C  C     . ASN C  2  563  ? 56.914  -9.603  88.748   1.00 17.79  ? 563  ASN C C     1 
ATOM   7996  O  O     . ASN C  2  563  ? 57.867  -9.014  88.241   1.00 19.08  ? 563  ASN C O     1 
ATOM   7997  C  CB    . ASN C  2  563  ? 55.395  -10.359 86.911   1.00 24.08  ? 563  ASN C CB    1 
ATOM   7998  C  CG    . ASN C  2  563  ? 55.107  -11.463 85.913   1.00 30.15  ? 563  ASN C CG    1 
ATOM   7999  O  OD1   . ASN C  2  563  ? 55.989  -12.251 85.567   1.00 36.49  ? 563  ASN C OD1   1 
ATOM   8000  N  ND2   . ASN C  2  563  ? 53.866  -11.526 85.442   1.00 27.02  ? 563  ASN C ND2   1 
ATOM   8001  N  N     . MET C  2  564  ? 56.368  -9.224  89.900   1.00 16.85  ? 564  MET C N     1 
ATOM   8002  C  CA    . MET C  2  564  ? 56.814  -8.008  90.579   1.00 16.99  ? 564  MET C CA    1 
ATOM   8003  C  C     . MET C  2  564  ? 58.082  -8.193  91.411   1.00 18.49  ? 564  MET C C     1 
ATOM   8004  O  O     . MET C  2  564  ? 58.741  -7.217  91.772   1.00 17.86  ? 564  MET C O     1 
ATOM   8005  C  CB    . MET C  2  564  ? 55.691  -7.420  91.435   1.00 14.89  ? 564  MET C CB    1 
ATOM   8006  C  CG    . MET C  2  564  ? 54.626  -6.707  90.624   1.00 15.79  ? 564  MET C CG    1 
ATOM   8007  S  SD    . MET C  2  564  ? 53.341  -5.968  91.644   1.00 22.99  ? 564  MET C SD    1 
ATOM   8008  C  CE    . MET C  2  564  ? 52.677  -7.416  92.463   1.00 15.93  ? 564  MET C CE    1 
ATOM   8009  N  N     . GLN C  2  565  ? 58.425  -9.441  91.709   1.00 17.50  ? 565  GLN C N     1 
ATOM   8010  C  CA    . GLN C  2  565  ? 59.659  -9.733  92.427   1.00 15.26  ? 565  GLN C CA    1 
ATOM   8011  C  C     . GLN C  2  565  ? 60.852  -9.470  91.518   1.00 15.36  ? 565  GLN C C     1 
ATOM   8012  O  O     . GLN C  2  565  ? 61.956  -9.192  91.979   1.00 16.22  ? 565  GLN C O     1 
ATOM   8013  C  CB    . GLN C  2  565  ? 59.660  -11.176 92.919   1.00 13.29  ? 565  GLN C CB    1 
ATOM   8014  C  CG    . GLN C  2  565  ? 58.598  -11.453 93.964   1.00 14.55  ? 565  GLN C CG    1 
ATOM   8015  C  CD    . GLN C  2  565  ? 58.523  -12.913 94.345   1.00 17.84  ? 565  GLN C CD    1 
ATOM   8016  O  OE1   . GLN C  2  565  ? 58.989  -13.314 95.412   1.00 18.64  ? 565  GLN C OE1   1 
ATOM   8017  N  NE2   . GLN C  2  565  ? 57.927  -13.720 93.475   1.00 17.77  ? 565  GLN C NE2   1 
ATOM   8018  N  N     . THR C  2  566  ? 60.608  -9.555  90.218   1.00 15.71  ? 566  THR C N     1 
ATOM   8019  C  CA    . THR C  2  566  ? 61.609  -9.226  89.219   1.00 16.72  ? 566  THR C CA    1 
ATOM   8020  C  C     . THR C  2  566  ? 61.864  -7.722  89.236   1.00 20.23  ? 566  THR C C     1 
ATOM   8021  O  O     . THR C  2  566  ? 62.929  -7.255  88.829   1.00 25.93  ? 566  THR C O     1 
ATOM   8022  C  CB    . THR C  2  566  ? 61.126  -9.653  87.818   1.00 21.27  ? 566  THR C CB    1 
ATOM   8023  O  OG1   . THR C  2  566  ? 60.652  -11.004 87.868   1.00 23.84  ? 566  THR C OG1   1 
ATOM   8024  C  CG2   . THR C  2  566  ? 62.245  -9.550  86.793   1.00 24.01  ? 566  THR C CG2   1 
ATOM   8025  N  N     . GLN C  2  567  ? 60.880  -6.966  89.713   1.00 19.17  ? 567  GLN C N     1 
ATOM   8026  C  CA    . GLN C  2  567  ? 60.970  -5.508  89.735   1.00 19.84  ? 567  GLN C CA    1 
ATOM   8027  C  C     . GLN C  2  567  ? 61.416  -4.935  91.083   1.00 17.81  ? 567  GLN C C     1 
ATOM   8028  O  O     . GLN C  2  567  ? 61.508  -3.719  91.244   1.00 17.67  ? 567  GLN C O     1 
ATOM   8029  C  CB    . GLN C  2  567  ? 59.637  -4.891  89.302   1.00 18.41  ? 567  GLN C CB    1 
ATOM   8030  C  CG    . GLN C  2  567  ? 59.165  -5.379  87.940   1.00 19.18  ? 567  GLN C CG    1 
ATOM   8031  C  CD    . GLN C  2  567  ? 57.800  -4.838  87.556   1.00 18.74  ? 567  GLN C CD    1 
ATOM   8032  O  OE1   . GLN C  2  567  ? 57.269  -3.935  88.204   1.00 19.25  ? 567  GLN C OE1   1 
ATOM   8033  N  NE2   . GLN C  2  567  ? 57.224  -5.392  86.495   1.00 18.58  ? 567  GLN C NE2   1 
ATOM   8034  N  N     . ALA C  2  568  ? 61.694  -5.808  92.045   1.00 17.21  ? 568  ALA C N     1 
ATOM   8035  C  CA    . ALA C  2  568  ? 62.094  -5.370  93.381   1.00 16.55  ? 568  ALA C CA    1 
ATOM   8036  C  C     . ALA C  2  568  ? 63.504  -4.772  93.419   1.00 15.83  ? 568  ALA C C     1 
ATOM   8037  O  O     . ALA C  2  568  ? 64.454  -5.357  92.904   1.00 20.05  ? 568  ALA C O     1 
ATOM   8038  C  CB    . ALA C  2  568  ? 61.970  -6.518  94.373   1.00 18.29  ? 568  ALA C CB    1 
ATOM   8039  N  N     . VAL C  2  569  ? 63.628  -3.605  94.043   1.00 14.67  ? 569  VAL C N     1 
ATOM   8040  C  CA    . VAL C  2  569  ? 64.901  -2.895  94.129   1.00 15.78  ? 569  VAL C CA    1 
ATOM   8041  C  C     . VAL C  2  569  ? 65.716  -3.372  95.330   1.00 18.12  ? 569  VAL C C     1 
ATOM   8042  O  O     . VAL C  2  569  ? 65.159  -3.606  96.403   1.00 19.78  ? 569  VAL C O     1 
ATOM   8043  C  CB    . VAL C  2  569  ? 64.666  -1.368  94.241   1.00 18.85  ? 569  VAL C CB    1 
ATOM   8044  C  CG1   . VAL C  2  569  ? 65.979  -0.605  94.269   1.00 21.19  ? 569  VAL C CG1   1 
ATOM   8045  C  CG2   . VAL C  2  569  ? 63.809  -0.882  93.092   1.00 20.07  ? 569  VAL C CG2   1 
ATOM   8046  N  N     . PRO C  2  570  ? 67.038  -3.540  95.148   1.00 18.39  ? 570  PRO C N     1 
ATOM   8047  C  CA    . PRO C  2  570  ? 67.926  -3.864  96.270   1.00 18.02  ? 570  PRO C CA    1 
ATOM   8048  C  C     . PRO C  2  570  ? 67.926  -2.764  97.325   1.00 20.90  ? 570  PRO C C     1 
ATOM   8049  O  O     . PRO C  2  570  ? 68.125  -1.592  96.999   1.00 19.70  ? 570  PRO C O     1 
ATOM   8050  C  CB    . PRO C  2  570  ? 69.305  -3.940  95.610   1.00 20.29  ? 570  PRO C CB    1 
ATOM   8051  C  CG    . PRO C  2  570  ? 69.028  -4.276  94.192   1.00 22.58  ? 570  PRO C CG    1 
ATOM   8052  C  CD    . PRO C  2  570  ? 67.748  -3.573  93.858   1.00 20.86  ? 570  PRO C CD    1 
ATOM   8053  N  N     . LEU C  2  571  ? 67.722  -3.149  98.580   1.00 22.90  ? 571  LEU C N     1 
ATOM   8054  C  CA    . LEU C  2  571  ? 67.693  -2.197  99.684   1.00 21.53  ? 571  LEU C CA    1 
ATOM   8055  C  C     . LEU C  2  571  ? 68.925  -2.370  100.566  1.00 22.04  ? 571  LEU C C     1 
ATOM   8056  O  O     . LEU C  2  571  ? 69.424  -3.483  100.737  1.00 21.32  ? 571  LEU C O     1 
ATOM   8057  C  CB    . LEU C  2  571  ? 66.419  -2.384  100.509  1.00 20.95  ? 571  LEU C CB    1 
ATOM   8058  C  CG    . LEU C  2  571  ? 65.104  -2.381  99.724   1.00 20.69  ? 571  LEU C CG    1 
ATOM   8059  C  CD1   . LEU C  2  571  ? 63.942  -2.780  100.617  1.00 19.26  ? 571  LEU C CD1   1 
ATOM   8060  C  CD2   . LEU C  2  571  ? 64.855  -1.017  99.101   1.00 22.61  ? 571  LEU C CD2   1 
ATOM   8061  N  N     . ILE C  2  572  ? 69.417  -1.266  101.120  1.00 22.99  ? 572  ILE C N     1 
ATOM   8062  C  CA    . ILE C  2  572  ? 70.605  -1.304  101.967  1.00 22.66  ? 572  ILE C CA    1 
ATOM   8063  C  C     . ILE C  2  572  ? 70.337  -2.087  103.255  1.00 24.25  ? 572  ILE C C     1 
ATOM   8064  O  O     . ILE C  2  572  ? 71.236  -2.708  103.822  1.00 28.11  ? 572  ILE C O     1 
ATOM   8065  C  CB    . ILE C  2  572  ? 71.126  0.122   102.285  1.00 20.45  ? 572  ILE C CB    1 
ATOM   8066  C  CG1   . ILE C  2  572  ? 70.086  0.926   103.067  1.00 24.22  ? 572  ILE C CG1   1 
ATOM   8067  C  CG2   . ILE C  2  572  ? 71.483  0.858   101.001  1.00 21.19  ? 572  ILE C CG2   1 
ATOM   8068  C  CD1   . ILE C  2  572  ? 70.508  2.353   103.358  1.00 26.31  ? 572  ILE C CD1   1 
ATOM   8069  N  N     . ARG C  2  573  ? 69.092  -2.041  103.713  1.00 23.69  ? 573  ARG C N     1 
ATOM   8070  C  CA    . ARG C  2  573  ? 68.661  -2.754  104.914  1.00 22.12  ? 573  ARG C CA    1 
ATOM   8071  C  C     . ARG C  2  573  ? 67.974  -4.105  104.665  1.00 24.78  ? 573  ARG C C     1 
ATOM   8072  O  O     . ARG C  2  573  ? 67.414  -4.692  105.591  1.00 26.78  ? 573  ARG C O     1 
ATOM   8073  C  CB    . ARG C  2  573  ? 67.826  -1.848  105.819  1.00 23.04  ? 573  ARG C CB    1 
ATOM   8074  C  CG    . ARG C  2  573  ? 68.608  -0.647  106.329  1.00 26.69  ? 573  ARG C CG    1 
ATOM   8075  C  CD    . ARG C  2  573  ? 68.255  -0.314  107.767  1.00 27.48  ? 573  ARG C CD    1 
ATOM   8076  N  NE    . ARG C  2  573  ? 68.610  -1.387  108.693  1.00 29.44  ? 573  ARG C NE    1 
ATOM   8077  C  CZ    . ARG C  2  573  ? 68.393  -1.338  110.003  1.00 34.48  ? 573  ARG C CZ    1 
ATOM   8078  N  NH1   . ARG C  2  573  ? 67.823  -0.268  110.542  1.00 27.82  ? 573  ARG C NH1   1 
ATOM   8079  N  NH2   . ARG C  2  573  ? 68.745  -2.358  110.776  1.00 41.35  ? 573  ARG C NH2   1 
ATOM   8080  N  N     . ALA C  2  574  ? 68.012  -4.576  103.417  1.00 24.37  ? 574  ALA C N     1 
ATOM   8081  C  CA    . ALA C  2  574  ? 67.157  -5.669  102.936  1.00 23.27  ? 574  ALA C CA    1 
ATOM   8082  C  C     . ALA C  2  574  ? 67.099  -6.902  103.841  1.00 21.19  ? 574  ALA C C     1 
ATOM   8083  O  O     . ALA C  2  574  ? 68.111  -7.344  104.381  1.00 21.67  ? 574  ALA C O     1 
ATOM   8084  C  CB    . ALA C  2  574  ? 67.581  -6.081  101.526  1.00 20.22  ? 574  ALA C CB    1 
ATOM   8085  N  N     . GLN C  2  575  ? 65.890  -7.439  104.000  1.00 20.01  ? 575  GLN C N     1 
ATOM   8086  C  CA    . GLN C  2  575  ? 65.641  -8.576  104.880  1.00 21.98  ? 575  GLN C CA    1 
ATOM   8087  C  C     . GLN C  2  575  ? 64.983  -9.730  104.132  1.00 22.53  ? 575  GLN C C     1 
ATOM   8088  O  O     . GLN C  2  575  ? 64.162  -9.516  103.243  1.00 24.45  ? 575  GLN C O     1 
ATOM   8089  C  CB    . GLN C  2  575  ? 64.708  -8.168  106.020  1.00 23.33  ? 575  GLN C CB    1 
ATOM   8090  C  CG    . GLN C  2  575  ? 64.997  -6.820  106.645  1.00 23.09  ? 575  GLN C CG    1 
ATOM   8091  C  CD    . GLN C  2  575  ? 63.968  -6.451  107.695  1.00 24.36  ? 575  GLN C CD    1 
ATOM   8092  O  OE1   . GLN C  2  575  ? 62.991  -5.759  107.407  1.00 23.31  ? 575  GLN C OE1   1 
ATOM   8093  N  NE2   . GLN C  2  575  ? 64.176  -6.921  108.920  1.00 29.36  ? 575  GLN C NE2   1 
ATOM   8094  N  N     . ALA C  2  576  ? 65.345  -10.956 104.496  1.00 25.18  ? 576  ALA C N     1 
ATOM   8095  C  CA    . ALA C  2  576  ? 64.647  -12.130 103.991  1.00 22.72  ? 576  ALA C CA    1 
ATOM   8096  C  C     . ALA C  2  576  ? 63.258  -12.155 104.614  1.00 22.84  ? 576  ALA C C     1 
ATOM   8097  O  O     . ALA C  2  576  ? 63.080  -11.699 105.743  1.00 25.59  ? 576  ALA C O     1 
ATOM   8098  C  CB    . ALA C  2  576  ? 65.413  -13.394 104.341  1.00 26.41  ? 576  ALA C CB    1 
ATOM   8099  N  N     . PRO C  2  577  ? 62.265  -12.675 103.878  1.00 21.33  ? 577  PRO C N     1 
ATOM   8100  C  CA    . PRO C  2  577  ? 60.881  -12.716 104.366  1.00 22.14  ? 577  PRO C CA    1 
ATOM   8101  C  C     . PRO C  2  577  ? 60.734  -13.483 105.679  1.00 23.73  ? 577  PRO C C     1 
ATOM   8102  O  O     . PRO C  2  577  ? 61.492  -14.417 105.935  1.00 26.22  ? 577  PRO C O     1 
ATOM   8103  C  CB    . PRO C  2  577  ? 60.143  -13.458 103.248  1.00 22.68  ? 577  PRO C CB    1 
ATOM   8104  C  CG    . PRO C  2  577  ? 60.960  -13.215 102.030  1.00 22.13  ? 577  PRO C CG    1 
ATOM   8105  C  CD    . PRO C  2  577  ? 62.381  -13.189 102.502  1.00 22.85  ? 577  PRO C CD    1 
ATOM   8106  N  N     . VAL C  2  578  ? 59.769  -13.078 106.501  1.00 22.59  ? 578  VAL C N     1 
ATOM   8107  C  CA    . VAL C  2  578  ? 59.451  -13.801 107.726  1.00 22.01  ? 578  VAL C CA    1 
ATOM   8108  C  C     . VAL C  2  578  ? 58.932  -15.194 107.385  1.00 22.77  ? 578  VAL C C     1 
ATOM   8109  O  O     . VAL C  2  578  ? 59.341  -16.187 107.986  1.00 26.40  ? 578  VAL C O     1 
ATOM   8110  C  CB    . VAL C  2  578  ? 58.402  -13.052 108.569  1.00 21.59  ? 578  VAL C CB    1 
ATOM   8111  C  CG1   . VAL C  2  578  ? 57.878  -13.942 109.688  1.00 23.04  ? 578  VAL C CG1   1 
ATOM   8112  C  CG2   . VAL C  2  578  ? 58.998  -11.775 109.139  1.00 20.45  ? 578  VAL C CG2   1 
ATOM   8113  N  N     . VAL C  2  579  ? 58.032  -15.262 106.410  1.00 20.61  ? 579  VAL C N     1 
ATOM   8114  C  CA    . VAL C  2  579  ? 57.550  -16.541 105.914  1.00 21.19  ? 579  VAL C CA    1 
ATOM   8115  C  C     . VAL C  2  579  ? 58.134  -16.803 104.534  1.00 23.21  ? 579  VAL C C     1 
ATOM   8116  O  O     . VAL C  2  579  ? 57.768  -16.138 103.565  1.00 24.08  ? 579  VAL C O     1 
ATOM   8117  C  CB    . VAL C  2  579  ? 56.019  -16.565 105.808  1.00 18.42  ? 579  VAL C CB    1 
ATOM   8118  C  CG1   . VAL C  2  579  ? 55.543  -17.954 105.413  1.00 18.41  ? 579  VAL C CG1   1 
ATOM   8119  C  CG2   . VAL C  2  579  ? 55.391  -16.131 107.119  1.00 19.63  ? 579  VAL C CG2   1 
ATOM   8120  N  N     . MET C  2  580  ? 59.047  -17.764 104.445  1.00 25.92  ? 580  MET C N     1 
ATOM   8121  C  CA    . MET C  2  580  ? 59.636  -18.117 103.160  1.00 24.57  ? 580  MET C CA    1 
ATOM   8122  C  C     . MET C  2  580  ? 59.062  -19.431 102.646  1.00 26.18  ? 580  MET C C     1 
ATOM   8123  O  O     . MET C  2  580  ? 58.310  -20.103 103.351  1.00 29.04  ? 580  MET C O     1 
ATOM   8124  C  CB    . MET C  2  580  ? 61.153  -18.220 103.304  1.00 24.93  ? 580  MET C CB    1 
ATOM   8125  C  CG    . MET C  2  580  ? 61.805  -16.926 103.760  1.00 27.58  ? 580  MET C CG    1 
ATOM   8126  S  SD    . MET C  2  580  ? 63.509  -17.141 104.302  1.00 33.51  ? 580  MET C SD    1 
ATOM   8127  C  CE    . MET C  2  580  ? 63.275  -18.200 105.726  1.00 32.72  ? 580  MET C CE    1 
ATOM   8128  N  N     . THR C  2  581  ? 59.411  -19.793 101.416  1.00 25.54  ? 581  THR C N     1 
ATOM   8129  C  CA    . THR C  2  581  ? 58.988  -21.075 100.857  1.00 28.48  ? 581  THR C CA    1 
ATOM   8130  C  C     . THR C  2  581  ? 60.084  -22.134 100.901  1.00 28.64  ? 581  THR C C     1 
ATOM   8131  O  O     . THR C  2  581  ? 59.852  -23.292 100.550  1.00 28.37  ? 581  THR C O     1 
ATOM   8132  C  CB    . THR C  2  581  ? 58.483  -20.927 99.412   1.00 29.56  ? 581  THR C CB    1 
ATOM   8133  O  OG1   . THR C  2  581  ? 59.528  -20.390 98.592   1.00 30.27  ? 581  THR C OG1   1 
ATOM   8134  C  CG2   . THR C  2  581  ? 57.275  -20.003 99.362   1.00 23.85  ? 581  THR C CG2   1 
ATOM   8135  N  N     . GLY C  2  582  ? 61.274  -21.735 101.337  1.00 28.98  ? 582  GLY C N     1 
ATOM   8136  C  CA    . GLY C  2  582  ? 62.411  -22.637 101.380  1.00 32.72  ? 582  GLY C CA    1 
ATOM   8137  C  C     . GLY C  2  582  ? 63.256  -22.632 100.118  1.00 33.47  ? 582  GLY C C     1 
ATOM   8138  O  O     . GLY C  2  582  ? 64.254  -23.346 100.030  1.00 38.13  ? 582  GLY C O     1 
ATOM   8139  N  N     . LEU C  2  583  ? 62.852  -21.842 99.130   1.00 28.86  ? 583  LEU C N     1 
ATOM   8140  C  CA    . LEU C  2  583  ? 63.614  -21.734 97.892   1.00 28.44  ? 583  LEU C CA    1 
ATOM   8141  C  C     . LEU C  2  583  ? 64.528  -20.505 97.898   1.00 29.70  ? 583  LEU C C     1 
ATOM   8142  O  O     . LEU C  2  583  ? 65.294  -20.281 96.962   1.00 30.50  ? 583  LEU C O     1 
ATOM   8143  C  CB    . LEU C  2  583  ? 62.666  -21.702 96.688   1.00 28.54  ? 583  LEU C CB    1 
ATOM   8144  C  CG    . LEU C  2  583  ? 63.286  -21.911 95.305   1.00 27.84  ? 583  LEU C CG    1 
ATOM   8145  C  CD1   . LEU C  2  583  ? 64.282  -23.054 95.353   1.00 36.64  ? 583  LEU C CD1   1 
ATOM   8146  C  CD2   . LEU C  2  583  ? 62.222  -22.161 94.253   1.00 25.66  ? 583  LEU C CD2   1 
ATOM   8147  N  N     . GLU C  2  584  ? 64.459  -19.725 98.971   1.00 29.20  ? 584  GLU C N     1 
ATOM   8148  C  CA    . GLU C  2  584  ? 65.121  -18.422 99.016   1.00 29.96  ? 584  GLU C CA    1 
ATOM   8149  C  C     . GLU C  2  584  ? 66.649  -18.475 98.965   1.00 34.42  ? 584  GLU C C     1 
ATOM   8150  O  O     . GLU C  2  584  ? 67.284  -17.542 98.473   1.00 34.43  ? 584  GLU C O     1 
ATOM   8151  C  CB    . GLU C  2  584  ? 64.649  -17.621 100.235  1.00 28.70  ? 584  GLU C CB    1 
ATOM   8152  C  CG    . GLU C  2  584  ? 63.253  -17.018 100.090  1.00 28.98  ? 584  GLU C CG    1 
ATOM   8153  C  CD    . GLU C  2  584  ? 62.140  -18.058 100.096  1.00 33.93  ? 584  GLU C CD    1 
ATOM   8154  O  OE1   . GLU C  2  584  ? 60.978  -17.686 99.823   1.00 31.11  ? 584  GLU C OE1   1 
ATOM   8155  O  OE2   . GLU C  2  584  ? 62.418  -19.243 100.385  1.00 33.06  ? 584  GLU C OE2   1 
ATOM   8156  N  N     . GLU C  2  585  ? 67.237  -19.554 99.475   1.00 37.67  ? 585  GLU C N     1 
ATOM   8157  C  CA    . GLU C  2  585  ? 68.693  -19.707 99.465   1.00 38.17  ? 585  GLU C CA    1 
ATOM   8158  C  C     . GLU C  2  585  ? 69.249  -20.141 98.109   1.00 34.98  ? 585  GLU C C     1 
ATOM   8159  O  O     . GLU C  2  585  ? 70.237  -19.582 97.619   1.00 33.85  ? 585  GLU C O     1 
ATOM   8160  C  CB    . GLU C  2  585  ? 69.142  -20.683 100.553  1.00 39.94  ? 585  GLU C CB    1 
ATOM   8161  C  CG    . GLU C  2  585  ? 69.235  -20.059 101.932  1.00 44.80  ? 585  GLU C CG    1 
ATOM   8162  C  CD    . GLU C  2  585  ? 69.585  -21.066 103.008  1.00 54.66  ? 585  GLU C CD    1 
ATOM   8163  O  OE1   . GLU C  2  585  ? 68.961  -22.148 103.036  1.00 55.72  ? 585  GLU C OE1   1 
ATOM   8164  O  OE2   . GLU C  2  585  ? 70.484  -20.774 103.826  1.00 54.95  ? 585  GLU C OE2   1 
ATOM   8165  N  N     . ARG C  2  586  ? 68.610  -21.142 97.512   1.00 33.36  ? 586  ARG C N     1 
ATOM   8166  C  CA    . ARG C  2  586  ? 69.048  -21.683 96.231   1.00 33.54  ? 586  ARG C CA    1 
ATOM   8167  C  C     . ARG C  2  586  ? 69.052  -20.631 95.128   1.00 34.90  ? 586  ARG C C     1 
ATOM   8168  O  O     . ARG C  2  586  ? 69.872  -20.687 94.212   1.00 38.08  ? 586  ARG C O     1 
ATOM   8169  C  CB    . ARG C  2  586  ? 68.171  -22.866 95.824   1.00 35.12  ? 586  ARG C CB    1 
ATOM   8170  C  CG    . ARG C  2  586  ? 68.580  -24.182 96.459   1.00 38.00  ? 586  ARG C CG    1 
ATOM   8171  C  CD    . ARG C  2  586  ? 69.959  -24.608 95.979   1.00 41.42  ? 586  ARG C CD    1 
ATOM   8172  N  NE    . ARG C  2  586  ? 70.056  -24.583 94.522   1.00 38.97  ? 586  ARG C NE    1 
ATOM   8173  C  CZ    . ARG C  2  586  ? 69.631  -25.561 93.729   1.00 38.25  ? 586  ARG C CZ    1 
ATOM   8174  N  NH1   . ARG C  2  586  ? 69.074  -26.646 94.252   1.00 42.47  ? 586  ARG C NH1   1 
ATOM   8175  N  NH2   . ARG C  2  586  ? 69.758  -25.455 92.413   1.00 31.51  ? 586  ARG C NH2   1 
ATOM   8176  N  N     . VAL C  2  587  ? 68.132  -19.676 95.221   1.00 32.46  ? 587  VAL C N     1 
ATOM   8177  C  CA    . VAL C  2  587  ? 68.059  -18.588 94.254   1.00 29.29  ? 587  VAL C CA    1 
ATOM   8178  C  C     . VAL C  2  587  ? 69.301  -17.706 94.329   1.00 31.63  ? 587  VAL C C     1 
ATOM   8179  O  O     . VAL C  2  587  ? 69.912  -17.399 93.307   1.00 33.68  ? 587  VAL C O     1 
ATOM   8180  C  CB    . VAL C  2  587  ? 66.802  -17.728 94.466   1.00 24.78  ? 587  VAL C CB    1 
ATOM   8181  C  CG1   . VAL C  2  587  ? 66.847  -16.492 93.583   1.00 20.73  ? 587  VAL C CG1   1 
ATOM   8182  C  CG2   . VAL C  2  587  ? 65.554  -18.547 94.185   1.00 25.97  ? 587  VAL C CG2   1 
ATOM   8183  N  N     . VAL C  2  588  ? 69.674  -17.310 95.542   1.00 32.91  ? 588  VAL C N     1 
ATOM   8184  C  CA    . VAL C  2  588  ? 70.869  -16.499 95.752   1.00 35.20  ? 588  VAL C CA    1 
ATOM   8185  C  C     . VAL C  2  588  ? 72.114  -17.264 95.325   1.00 38.17  ? 588  VAL C C     1 
ATOM   8186  O  O     . VAL C  2  588  ? 73.026  -16.701 94.714   1.00 38.41  ? 588  VAL C O     1 
ATOM   8187  C  CB    . VAL C  2  588  ? 71.023  -16.085 97.230   1.00 33.61  ? 588  VAL C CB    1 
ATOM   8188  C  CG1   . VAL C  2  588  ? 72.279  -15.253 97.425   1.00 33.51  ? 588  VAL C CG1   1 
ATOM   8189  C  CG2   . VAL C  2  588  ? 69.808  -15.314 97.687   1.00 32.45  ? 588  VAL C CG2   1 
ATOM   8190  N  N     . ARG C  2  589  ? 72.142  -18.554 95.643   1.00 38.28  ? 589  ARG C N     1 
ATOM   8191  C  CA    . ARG C  2  589  ? 73.295  -19.385 95.319   1.00 39.55  ? 589  ARG C CA    1 
ATOM   8192  C  C     . ARG C  2  589  ? 73.498  -19.522 93.811   1.00 39.62  ? 589  ARG C C     1 
ATOM   8193  O  O     . ARG C  2  589  ? 74.575  -19.222 93.295   1.00 41.40  ? 589  ARG C O     1 
ATOM   8194  C  CB    . ARG C  2  589  ? 73.161  -20.765 95.969   1.00 41.54  ? 589  ARG C CB    1 
ATOM   8195  C  CG    . ARG C  2  589  ? 74.374  -21.660 95.776   1.00 44.10  ? 589  ARG C CG    1 
ATOM   8196  C  CD    . ARG C  2  589  ? 74.240  -22.959 96.557   1.00 48.44  ? 589  ARG C CD    1 
ATOM   8197  N  NE    . ARG C  2  589  ? 74.284  -22.744 98.001   1.00 47.80  ? 589  ARG C NE    1 
ATOM   8198  C  CZ    . ARG C  2  589  ? 75.406  -22.687 98.714   1.00 47.32  ? 589  ARG C CZ    1 
ATOM   8199  N  NH1   . ARG C  2  589  ? 76.583  -22.825 98.117   1.00 50.87  ? 589  ARG C NH1   1 
ATOM   8200  N  NH2   . ARG C  2  589  ? 75.352  -22.491 100.025  1.00 41.15  ? 589  ARG C NH2   1 
ATOM   8201  N  N     . ASP C  2  590  ? 72.457  -19.959 93.107   1.00 37.75  ? 590  ASP C N     1 
ATOM   8202  C  CA    . ASP C  2  590  ? 72.557  -20.214 91.671   1.00 35.76  ? 590  ASP C CA    1 
ATOM   8203  C  C     . ASP C  2  590  ? 72.642  -18.942 90.834   1.00 37.45  ? 590  ASP C C     1 
ATOM   8204  O  O     . ASP C  2  590  ? 73.039  -18.987 89.670   1.00 42.66  ? 590  ASP C O     1 
ATOM   8205  C  CB    . ASP C  2  590  ? 71.393  -21.083 91.191   1.00 34.09  ? 590  ASP C CB    1 
ATOM   8206  C  CG    . ASP C  2  590  ? 71.503  -22.517 91.667   1.00 40.03  ? 590  ASP C CG    1 
ATOM   8207  O  OD1   . ASP C  2  590  ? 71.890  -22.731 92.836   1.00 40.59  ? 590  ASP C OD1   1 
ATOM   8208  O  OD2   . ASP C  2  590  ? 71.209  -23.432 90.869   1.00 42.53  ? 590  ASP C OD2   1 
ATOM   8209  N  N     . SER C  2  591  ? 72.269  -17.811 91.422   1.00 36.20  ? 591  SER C N     1 
ATOM   8210  C  CA    . SER C  2  591  ? 72.374  -16.532 90.729   1.00 40.08  ? 591  SER C CA    1 
ATOM   8211  C  C     . SER C  2  591  ? 73.825  -16.076 90.695   1.00 40.87  ? 591  SER C C     1 
ATOM   8212  O  O     . SER C  2  591  ? 74.186  -15.178 89.932   1.00 40.75  ? 591  SER C O     1 
ATOM   8213  C  CB    . SER C  2  591  ? 71.519  -15.470 91.418   1.00 40.79  ? 591  SER C CB    1 
ATOM   8214  O  OG    . SER C  2  591  ? 72.040  -15.155 92.699   1.00 43.54  ? 591  SER C OG    1 
ATOM   8215  N  N     . LEU C  2  592  ? 74.644  -16.701 91.538   1.00 39.74  ? 592  LEU C N     1 
ATOM   8216  C  CA    . LEU C  2  592  ? 76.062  -16.375 91.662   1.00 43.43  ? 592  LEU C CA    1 
ATOM   8217  C  C     . LEU C  2  592  ? 76.281  -14.927 92.096   1.00 46.20  ? 592  LEU C C     1 
ATOM   8218  O  O     . LEU C  2  592  ? 77.311  -14.324 91.789   1.00 44.26  ? 592  LEU C O     1 
ATOM   8219  C  CB    . LEU C  2  592  ? 76.810  -16.679 90.362   1.00 40.44  ? 592  LEU C CB    1 
ATOM   8220  C  CG    . LEU C  2  592  ? 76.657  -18.115 89.860   1.00 40.54  ? 592  LEU C CG    1 
ATOM   8221  C  CD1   . LEU C  2  592  ? 77.415  -18.316 88.559   1.00 44.03  ? 592  LEU C CD1   1 
ATOM   8222  C  CD2   . LEU C  2  592  ? 77.122  -19.104 90.918   1.00 39.36  ? 592  LEU C CD2   1 
ATOM   8223  N  N     . ALA C  2  593  ? 75.300  -14.375 92.804   1.00 45.46  ? 593  ALA C N     1 
ATOM   8224  C  CA    . ALA C  2  593  ? 75.425  -13.044 93.383   1.00 45.31  ? 593  ALA C CA    1 
ATOM   8225  C  C     . ALA C  2  593  ? 76.281  -13.099 94.644   1.00 47.78  ? 593  ALA C C     1 
ATOM   8226  O  O     . ALA C  2  593  ? 77.189  -12.288 94.831   1.00 45.67  ? 593  ALA C O     1 
ATOM   8227  C  CB    . ALA C  2  593  ? 74.050  -12.472 93.697   1.00 43.18  ? 593  ALA C CB    1 
ATOM   8228  N  N     . ALA C  2  594  ? 75.980  -14.067 95.505   1.00 47.88  ? 594  ALA C N     1 
ATOM   8229  C  CA    . ALA C  2  594  ? 76.721  -14.260 96.746   1.00 44.12  ? 594  ALA C CA    1 
ATOM   8230  C  C     . ALA C  2  594  ? 78.059  -14.949 96.499   1.00 46.97  ? 594  ALA C C     1 
ATOM   8231  O  O     . ALA C  2  594  ? 78.236  -15.641 95.496   1.00 48.31  ? 594  ALA C O     1 
ATOM   8232  C  CB    . ALA C  2  594  ? 75.891  -15.055 97.741   1.00 41.21  ? 594  ALA C CB    1 
ATOM   8233  N  N     . LEU C  2  595  ? 78.996  -14.754 97.421   1.00 47.87  ? 595  LEU C N     1 
ATOM   8234  C  CA    . LEU C  2  595  ? 80.310  -15.379 97.333   1.00 44.99  ? 595  LEU C CA    1 
ATOM   8235  C  C     . LEU C  2  595  ? 80.399  -16.534 98.327   1.00 43.36  ? 595  LEU C C     1 
ATOM   8236  O  O     . LEU C  2  595  ? 80.072  -16.374 99.502   1.00 44.58  ? 595  LEU C O     1 
ATOM   8237  C  CB    . LEU C  2  595  ? 81.400  -14.344 97.614   1.00 44.12  ? 595  LEU C CB    1 
ATOM   8238  C  CG    . LEU C  2  595  ? 82.726  -14.478 96.861   1.00 50.01  ? 595  LEU C CG    1 
ATOM   8239  C  CD1   . LEU C  2  595  ? 83.514  -13.179 96.952   1.00 47.36  ? 595  LEU C CD1   1 
ATOM   8240  C  CD2   . LEU C  2  595  ? 83.549  -15.643 97.392   1.00 51.92  ? 595  LEU C CD2   1 
ATOM   8241  N  N     . TYR C  2  596  ? 80.840  -17.696 97.855   1.00 44.84  ? 596  TYR C N     1 
ATOM   8242  C  CA    . TYR C  2  596  ? 80.880  -18.888 98.698   1.00 50.75  ? 596  TYR C CA    1 
ATOM   8243  C  C     . TYR C  2  596  ? 82.278  -19.490 98.837   1.00 56.72  ? 596  TYR C C     1 
ATOM   8244  O  O     . TYR C  2  596  ? 83.128  -19.333 97.958   1.00 54.97  ? 596  TYR C O     1 
ATOM   8245  C  CB    . TYR C  2  596  ? 79.899  -19.943 98.181   1.00 49.96  ? 596  TYR C CB    1 
ATOM   8246  C  CG    . TYR C  2  596  ? 78.461  -19.481 98.185   1.00 44.76  ? 596  TYR C CG    1 
ATOM   8247  C  CD1   . TYR C  2  596  ? 77.823  -19.121 97.005   1.00 46.79  ? 596  TYR C CD1   1 
ATOM   8248  C  CD2   . TYR C  2  596  ? 77.745  -19.394 99.369   1.00 45.20  ? 596  TYR C CD2   1 
ATOM   8249  C  CE1   . TYR C  2  596  ? 76.508  -18.694 97.006   1.00 45.49  ? 596  TYR C CE1   1 
ATOM   8250  C  CE2   . TYR C  2  596  ? 76.431  -18.969 99.380   1.00 47.80  ? 596  TYR C CE2   1 
ATOM   8251  C  CZ    . TYR C  2  596  ? 75.817  -18.620 98.196   1.00 45.83  ? 596  TYR C CZ    1 
ATOM   8252  O  OH    . TYR C  2  596  ? 74.507  -18.196 98.206   1.00 44.16  ? 596  TYR C OH    1 
ATOM   8253  N  N     . ALA C  2  597  ? 82.501  -20.184 99.951   1.00 58.00  ? 597  ALA C N     1 
ATOM   8254  C  CA    . ALA C  2  597  ? 83.790  -20.804 100.240  1.00 59.52  ? 597  ALA C CA    1 
ATOM   8255  C  C     . ALA C  2  597  ? 83.970  -22.105 99.463   1.00 66.32  ? 597  ALA C C     1 
ATOM   8256  O  O     . ALA C  2  597  ? 83.145  -23.016 99.559   1.00 64.47  ? 597  ALA C O     1 
ATOM   8257  C  CB    . ALA C  2  597  ? 83.933  -21.052 101.732  1.00 60.25  ? 597  ALA C CB    1 
ATOM   8258  N  N     . GLU C  2  598  ? 85.056  -22.182 98.700   1.00 69.13  ? 598  GLU C N     1 
ATOM   8259  C  CA    . GLU C  2  598  ? 85.323  -23.324 97.828   1.00 71.40  ? 598  GLU C CA    1 
ATOM   8260  C  C     . GLU C  2  598  ? 85.520  -24.636 98.590   1.00 69.96  ? 598  GLU C C     1 
ATOM   8261  O  O     . GLU C  2  598  ? 84.807  -25.612 98.356   1.00 65.33  ? 598  GLU C O     1 
ATOM   8262  C  CB    . GLU C  2  598  ? 86.539  -23.034 96.945   1.00 69.14  ? 598  GLU C CB    1 
ATOM   8263  C  CG    . GLU C  2  598  ? 86.787  -24.067 95.863   1.00 76.61  ? 598  GLU C CG    1 
ATOM   8264  C  CD    . GLU C  2  598  ? 87.768  -23.580 94.816   1.00 85.99  ? 598  GLU C CD    1 
ATOM   8265  O  OE1   . GLU C  2  598  ? 88.172  -22.398 94.884   1.00 84.53  ? 598  GLU C OE1   1 
ATOM   8266  O  OE2   . GLU C  2  598  ? 88.134  -24.374 93.924   1.00 86.76  ? 598  GLU C OE2   1 
ATOM   8267  N  N     . GLU C  2  599  ? 86.489  -24.652 99.499   1.00 67.21  ? 599  GLU C N     1 
ATOM   8268  C  CA    . GLU C  2  599  ? 86.765  -25.833 100.309  1.00 72.53  ? 599  GLU C CA    1 
ATOM   8269  C  C     . GLU C  2  599  ? 86.673  -25.446 101.782  1.00 72.84  ? 599  GLU C C     1 
ATOM   8270  O  O     . GLU C  2  599  ? 86.339  -24.306 102.103  1.00 73.33  ? 599  GLU C O     1 
ATOM   8271  C  CB    . GLU C  2  599  ? 88.158  -26.384 99.982   1.00 78.16  ? 599  GLU C CB    1 
ATOM   8272  C  CG    . GLU C  2  599  ? 88.348  -27.871 100.273  1.00 83.90  ? 599  GLU C CG    1 
ATOM   8273  C  CD    . GLU C  2  599  ? 87.550  -28.763 99.339   1.00 88.62  ? 599  GLU C CD    1 
ATOM   8274  O  OE1   . GLU C  2  599  ? 87.271  -28.338 98.197   1.00 86.36  ? 599  GLU C OE1   1 
ATOM   8275  O  OE2   . GLU C  2  599  ? 87.202  -29.892 99.748   1.00 84.76  ? 599  GLU C OE2   1 
ATOM   8276  N  N     . ASP C  2  600  ? 86.950  -26.388 102.677  1.00 70.68  ? 600  ASP C N     1 
ATOM   8277  C  CA    . ASP C  2  600  ? 87.036  -26.069 104.096  1.00 66.80  ? 600  ASP C CA    1 
ATOM   8278  C  C     . ASP C  2  600  ? 88.270  -25.203 104.322  1.00 71.41  ? 600  ASP C C     1 
ATOM   8279  O  O     . ASP C  2  600  ? 89.232  -25.278 103.558  1.00 76.75  ? 600  ASP C O     1 
ATOM   8280  C  CB    . ASP C  2  600  ? 87.123  -27.343 104.938  1.00 66.22  ? 600  ASP C CB    1 
ATOM   8281  C  CG    . ASP C  2  600  ? 85.984  -28.305 104.662  1.00 66.00  ? 600  ASP C CG    1 
ATOM   8282  O  OD1   . ASP C  2  600  ? 85.676  -28.537 103.474  1.00 69.74  ? 600  ASP C OD1   1 
ATOM   8283  O  OD2   . ASP C  2  600  ? 85.394  -28.826 105.633  1.00 61.18  ? 600  ASP C OD2   1 
ATOM   8284  N  N     . GLY C  2  601  ? 88.245  -24.375 105.360  1.00 64.54  ? 601  GLY C N     1 
ATOM   8285  C  CA    . GLY C  2  601  ? 89.376  -23.514 105.644  1.00 62.79  ? 601  GLY C CA    1 
ATOM   8286  C  C     . GLY C  2  601  ? 89.109  -22.446 106.683  1.00 56.77  ? 601  GLY C C     1 
ATOM   8287  O  O     . GLY C  2  601  ? 88.060  -22.429 107.326  1.00 53.91  ? 601  GLY C O     1 
ATOM   8288  N  N     . GLU C  2  602  ? 90.076  -21.549 106.844  1.00 58.62  ? 602  GLU C N     1 
ATOM   8289  C  CA    . GLU C  2  602  ? 89.986  -20.475 107.824  1.00 60.22  ? 602  GLU C CA    1 
ATOM   8290  C  C     . GLU C  2  602  ? 90.133  -19.126 107.135  1.00 57.49  ? 602  GLU C C     1 
ATOM   8291  O  O     . GLU C  2  602  ? 90.934  -18.974 106.213  1.00 53.99  ? 602  GLU C O     1 
ATOM   8292  C  CB    . GLU C  2  602  ? 91.069  -20.645 108.893  1.00 67.94  ? 602  GLU C CB    1 
ATOM   8293  C  CG    . GLU C  2  602  ? 91.099  -19.549 109.948  1.00 65.72  ? 602  GLU C CG    1 
ATOM   8294  C  CD    . GLU C  2  602  ? 92.078  -19.848 111.069  1.00 70.10  ? 602  GLU C CD    1 
ATOM   8295  O  OE1   . GLU C  2  602  ? 92.557  -20.999 111.152  1.00 77.41  ? 602  GLU C OE1   1 
ATOM   8296  O  OE2   . GLU C  2  602  ? 92.370  -18.932 111.866  1.00 68.08  ? 602  GLU C OE2   1 
ATOM   8297  N  N     . VAL C  2  603  ? 89.359  -18.144 107.584  1.00 56.30  ? 603  VAL C N     1 
ATOM   8298  C  CA    . VAL C  2  603  ? 89.393  -16.826 106.970  1.00 54.63  ? 603  VAL C CA    1 
ATOM   8299  C  C     . VAL C  2  603  ? 90.645  -16.070 107.394  1.00 52.55  ? 603  VAL C C     1 
ATOM   8300  O  O     . VAL C  2  603  ? 90.858  -15.816 108.579  1.00 53.11  ? 603  VAL C O     1 
ATOM   8301  C  CB    . VAL C  2  603  ? 88.161  -15.997 107.362  1.00 56.33  ? 603  VAL C CB    1 
ATOM   8302  C  CG1   . VAL C  2  603  ? 88.226  -14.624 106.722  1.00 53.94  ? 603  VAL C CG1   1 
ATOM   8303  C  CG2   . VAL C  2  603  ? 86.884  -16.720 106.960  1.00 60.92  ? 603  VAL C CG2   1 
ATOM   8304  N  N     . ALA C  2  604  ? 91.469  -15.711 106.415  1.00 52.53  ? 604  ALA C N     1 
ATOM   8305  C  CA    . ALA C  2  604  ? 92.697  -14.971 106.676  1.00 53.15  ? 604  ALA C CA    1 
ATOM   8306  C  C     . ALA C  2  604  ? 92.443  -13.480 106.875  1.00 50.14  ? 604  ALA C C     1 
ATOM   8307  O  O     . ALA C  2  604  ? 92.945  -12.872 107.819  1.00 46.02  ? 604  ALA C O     1 
ATOM   8308  C  CB    . ALA C  2  604  ? 93.698  -15.194 105.552  1.00 51.81  ? 604  ALA C CB    1 
ATOM   8309  N  N     . LYS C  2  605  ? 91.658  -12.897 105.975  1.00 54.55  ? 605  LYS C N     1 
ATOM   8310  C  CA    . LYS C  2  605  ? 91.446  -11.456 105.963  1.00 55.24  ? 605  LYS C CA    1 
ATOM   8311  C  C     . LYS C  2  605  ? 90.011  -11.078 105.593  1.00 55.62  ? 605  LYS C C     1 
ATOM   8312  O  O     . LYS C  2  605  ? 89.423  -11.652 104.675  1.00 54.78  ? 605  LYS C O     1 
ATOM   8313  C  CB    . LYS C  2  605  ? 92.421  -10.788 104.988  1.00 54.52  ? 605  LYS C CB    1 
ATOM   8314  C  CG    . LYS C  2  605  ? 93.870  -10.755 105.448  1.00 49.63  ? 605  LYS C CG    1 
ATOM   8315  C  CD    . LYS C  2  605  ? 94.724  -9.967  104.467  1.00 50.42  ? 605  LYS C CD    1 
ATOM   8316  C  CE    . LYS C  2  605  ? 96.156  -9.827  104.953  1.00 46.77  ? 605  LYS C CE    1 
ATOM   8317  N  NZ    . LYS C  2  605  ? 96.968  -8.980  104.034  1.00 43.38  ? 605  LYS C NZ    1 
ATOM   8318  N  N     . VAL C  2  606  ? 89.455  -10.108 106.314  1.00 58.06  ? 606  VAL C N     1 
ATOM   8319  C  CA    . VAL C  2  606  ? 88.143  -9.560  105.989  1.00 50.97  ? 606  VAL C CA    1 
ATOM   8320  C  C     . VAL C  2  606  ? 88.215  -8.045  105.842  1.00 51.36  ? 606  VAL C C     1 
ATOM   8321  O  O     . VAL C  2  606  ? 88.533  -7.327  106.790  1.00 49.15  ? 606  VAL C O     1 
ATOM   8322  C  CB    . VAL C  2  606  ? 87.082  -9.924  107.045  1.00 46.29  ? 606  VAL C CB    1 
ATOM   8323  C  CG1   . VAL C  2  606  ? 85.849  -9.052  106.881  1.00 43.62  ? 606  VAL C CG1   1 
ATOM   8324  C  CG2   . VAL C  2  606  ? 86.714  -11.392 106.938  1.00 48.30  ? 606  VAL C CG2   1 
ATOM   8325  N  N     . ASP C  2  607  ? 87.920  -7.569  104.639  1.00 54.86  ? 607  ASP C N     1 
ATOM   8326  C  CA    . ASP C  2  607  ? 87.981  -6.149  104.337  1.00 51.22  ? 607  ASP C CA    1 
ATOM   8327  C  C     . ASP C  2  607  ? 86.706  -5.745  103.613  1.00 48.73  ? 607  ASP C C     1 
ATOM   8328  O  O     . ASP C  2  607  ? 85.943  -6.600  103.161  1.00 50.28  ? 607  ASP C O     1 
ATOM   8329  C  CB    . ASP C  2  607  ? 89.200  -5.858  103.460  1.00 53.82  ? 607  ASP C CB    1 
ATOM   8330  C  CG    . ASP C  2  607  ? 89.569  -4.389  103.435  1.00 55.22  ? 607  ASP C CG    1 
ATOM   8331  O  OD1   . ASP C  2  607  ? 89.222  -3.673  104.398  1.00 56.00  ? 607  ASP C OD1   1 
ATOM   8332  O  OD2   . ASP C  2  607  ? 90.212  -3.955  102.456  1.00 51.81  ? 607  ASP C OD2   1 
ATOM   8333  N  N     . GLY C  2  608  ? 86.471  -4.444  103.511  1.00 47.02  ? 608  GLY C N     1 
ATOM   8334  C  CA    . GLY C  2  608  ? 85.345  -3.947  102.748  1.00 45.76  ? 608  GLY C CA    1 
ATOM   8335  C  C     . GLY C  2  608  ? 85.492  -4.286  101.278  1.00 45.80  ? 608  GLY C C     1 
ATOM   8336  O  O     . GLY C  2  608  ? 84.517  -4.635  100.613  1.00 48.24  ? 608  GLY C O     1 
ATOM   8337  N  N     . ASN C  2  609  ? 86.715  -4.179  100.768  1.00 44.62  ? 609  ASN C N     1 
ATOM   8338  C  CA    . ASN C  2  609  ? 86.968  -4.425  99.352   1.00 43.89  ? 609  ASN C CA    1 
ATOM   8339  C  C     . ASN C  2  609  ? 87.397  -5.847  98.972   1.00 42.61  ? 609  ASN C C     1 
ATOM   8340  O  O     . ASN C  2  609  ? 87.382  -6.197  97.793   1.00 42.86  ? 609  ASN C O     1 
ATOM   8341  C  CB    . ASN C  2  609  ? 87.998  -3.420  98.833   1.00 42.69  ? 609  ASN C CB    1 
ATOM   8342  C  CG    . ASN C  2  609  ? 87.616  -1.988  99.144   1.00 44.24  ? 609  ASN C CG    1 
ATOM   8343  O  OD1   . ASN C  2  609  ? 86.498  -1.557  98.863   1.00 49.35  ? 609  ASN C OD1   1 
ATOM   8344  N  ND2   . ASN C  2  609  ? 88.540  -1.246  99.741   1.00 46.87  ? 609  ASN C ND2   1 
ATOM   8345  N  N     . ARG C  2  610  ? 87.765  -6.669  99.952   1.00 43.35  ? 610  ARG C N     1 
ATOM   8346  C  CA    . ARG C  2  610  ? 88.249  -8.017  99.646   1.00 46.76  ? 610  ARG C CA    1 
ATOM   8347  C  C     . ARG C  2  610  ? 88.179  -8.995  100.820  1.00 48.72  ? 610  ARG C C     1 
ATOM   8348  O  O     . ARG C  2  610  ? 88.103  -8.588  101.978  1.00 49.46  ? 610  ARG C O     1 
ATOM   8349  C  CB    . ARG C  2  610  ? 89.677  -7.960  99.096   1.00 50.27  ? 610  ARG C CB    1 
ATOM   8350  C  CG    . ARG C  2  610  ? 90.653  -7.200  99.981   1.00 53.75  ? 610  ARG C CG    1 
ATOM   8351  C  CD    . ARG C  2  610  ? 91.701  -8.124  100.582  1.00 57.58  ? 610  ARG C CD    1 
ATOM   8352  N  NE    . ARG C  2  610  ? 92.615  -7.406  101.467  1.00 60.99  ? 610  ARG C NE    1 
ATOM   8353  C  CZ    . ARG C  2  610  ? 92.518  -7.394  102.793  1.00 60.21  ? 610  ARG C CZ    1 
ATOM   8354  N  NH1   . ARG C  2  610  ? 91.550  -8.070  103.395  1.00 55.70  ? 610  ARG C NH1   1 
ATOM   8355  N  NH2   . ARG C  2  610  ? 93.395  -6.712  103.518  1.00 60.15  ? 610  ARG C NH2   1 
ATOM   8356  N  N     . ILE C  2  611  ? 88.211  -10.287 100.505  1.00 46.34  ? 611  ILE C N     1 
ATOM   8357  C  CA    . ILE C  2  611  ? 88.243  -11.335 101.523  1.00 48.14  ? 611  ILE C CA    1 
ATOM   8358  C  C     . ILE C  2  611  ? 89.283  -12.395 101.176  1.00 50.58  ? 611  ILE C C     1 
ATOM   8359  O  O     . ILE C  2  611  ? 89.189  -13.045 100.137  1.00 50.10  ? 611  ILE C O     1 
ATOM   8360  C  CB    . ILE C  2  611  ? 86.874  -12.029 101.678  1.00 48.21  ? 611  ILE C CB    1 
ATOM   8361  C  CG1   . ILE C  2  611  ? 85.828  -11.053 102.217  1.00 48.97  ? 611  ILE C CG1   1 
ATOM   8362  C  CG2   . ILE C  2  611  ? 86.985  -13.238 102.599  1.00 48.34  ? 611  ILE C CG2   1 
ATOM   8363  C  CD1   . ILE C  2  611  ? 84.463  -11.680 102.430  1.00 49.61  ? 611  ILE C CD1   1 
ATOM   8364  N  N     . VAL C  2  612  ? 90.265  -12.573 102.054  1.00 53.51  ? 612  VAL C N     1 
ATOM   8365  C  CA    . VAL C  2  612  ? 91.310  -13.567 101.836  1.00 50.68  ? 612  VAL C CA    1 
ATOM   8366  C  C     . VAL C  2  612  ? 91.067  -14.818 102.677  1.00 49.88  ? 612  VAL C C     1 
ATOM   8367  O  O     . VAL C  2  612  ? 90.866  -14.736 103.886  1.00 52.20  ? 612  VAL C O     1 
ATOM   8368  C  CB    . VAL C  2  612  ? 92.704  -12.997 102.152  1.00 47.99  ? 612  VAL C CB    1 
ATOM   8369  C  CG1   . VAL C  2  612  ? 93.775  -14.035 101.875  1.00 51.63  ? 612  VAL C CG1   1 
ATOM   8370  C  CG2   . VAL C  2  612  ? 92.955  -11.738 101.339  1.00 50.49  ? 612  VAL C CG2   1 
ATOM   8371  N  N     . VAL C  2  613  ? 91.086  -15.976 102.026  1.00 49.94  ? 613  VAL C N     1 
ATOM   8372  C  CA    . VAL C  2  613  ? 90.819  -17.242 102.695  1.00 54.30  ? 613  VAL C CA    1 
ATOM   8373  C  C     . VAL C  2  613  ? 91.959  -18.236 102.488  1.00 63.00  ? 613  VAL C C     1 
ATOM   8374  O  O     . VAL C  2  613  ? 92.476  -18.388 101.376  1.00 61.82  ? 613  VAL C O     1 
ATOM   8375  C  CB    . VAL C  2  613  ? 89.501  -17.873 102.193  1.00 57.66  ? 613  VAL C CB    1 
ATOM   8376  C  CG1   . VAL C  2  613  ? 89.205  -19.170 102.936  1.00 58.58  ? 613  VAL C CG1   1 
ATOM   8377  C  CG2   . VAL C  2  613  ? 88.349  -16.895 102.352  1.00 61.76  ? 613  VAL C CG2   1 
ATOM   8378  N  N     . ARG C  2  614  ? 92.353  -18.897 103.572  1.00 69.69  ? 614  ARG C N     1 
ATOM   8379  C  CA    . ARG C  2  614  ? 93.317  -19.988 103.512  1.00 73.14  ? 614  ARG C CA    1 
ATOM   8380  C  C     . ARG C  2  614  ? 92.598  -21.319 103.705  1.00 72.15  ? 614  ARG C C     1 
ATOM   8381  O  O     . ARG C  2  614  ? 92.078  -21.602 104.785  1.00 68.37  ? 614  ARG C O     1 
ATOM   8382  C  CB    . ARG C  2  614  ? 94.396  -19.814 104.583  1.00 76.82  ? 614  ARG C CB    1 
ATOM   8383  C  CG    . ARG C  2  614  ? 95.357  -20.989 104.688  1.00 78.64  ? 614  ARG C CG    1 
ATOM   8384  C  CD    . ARG C  2  614  ? 96.419  -20.745 105.748  1.00 79.10  ? 614  ARG C CD    1 
ATOM   8385  N  NE    . ARG C  2  614  ? 97.206  -19.548 105.466  1.00 86.14  ? 614  ARG C NE    1 
ATOM   8386  C  CZ    . ARG C  2  614  ? 98.268  -19.523 104.668  1.00 87.28  ? 614  ARG C CZ    1 
ATOM   8387  N  NH1   . ARG C  2  614  ? 98.925  -18.388 104.470  1.00 77.42  ? 614  ARG C NH1   1 
ATOM   8388  N  NH2   . ARG C  2  614  ? 98.673  -20.633 104.065  1.00 87.70  ? 614  ARG C NH2   1 
ATOM   8389  N  N     . TYR C  2  615  ? 92.566  -22.130 102.653  1.00 71.09  ? 615  TYR C N     1 
ATOM   8390  C  CA    . TYR C  2  615  ? 91.877  -23.415 102.702  1.00 79.05  ? 615  TYR C CA    1 
ATOM   8391  C  C     . TYR C  2  615  ? 92.765  -24.517 103.277  1.00 87.35  ? 615  TYR C C     1 
ATOM   8392  O  O     . TYR C  2  615  ? 93.892  -24.260 103.703  1.00 89.66  ? 615  TYR C O     1 
ATOM   8393  C  CB    . TYR C  2  615  ? 91.371  -23.807 101.311  1.00 81.49  ? 615  TYR C CB    1 
ATOM   8394  C  CG    . TYR C  2  615  ? 90.305  -22.881 100.769  1.00 76.30  ? 615  TYR C CG    1 
ATOM   8395  C  CD1   . TYR C  2  615  ? 90.596  -21.959 99.771   1.00 70.45  ? 615  TYR C CD1   1 
ATOM   8396  C  CD2   . TYR C  2  615  ? 89.008  -22.924 101.261  1.00 73.31  ? 615  TYR C CD2   1 
ATOM   8397  C  CE1   . TYR C  2  615  ? 89.621  -21.110 99.276   1.00 70.22  ? 615  TYR C CE1   1 
ATOM   8398  C  CE2   . TYR C  2  615  ? 88.029  -22.080 100.774  1.00 72.32  ? 615  TYR C CE2   1 
ATOM   8399  C  CZ    . TYR C  2  615  ? 88.339  -21.176 99.782   1.00 73.06  ? 615  TYR C CZ    1 
ATOM   8400  O  OH    . TYR C  2  615  ? 87.362  -20.336 99.297   1.00 67.15  ? 615  TYR C OH    1 
ATOM   8401  N  N     . GLU C  2  616  ? 92.247  -25.743 103.288  1.00 87.96  ? 616  GLU C N     1 
ATOM   8402  C  CA    . GLU C  2  616  ? 92.986  -26.893 103.803  1.00 87.15  ? 616  GLU C CA    1 
ATOM   8403  C  C     . GLU C  2  616  ? 94.232  -27.157 102.967  1.00 88.75  ? 616  GLU C C     1 
ATOM   8404  O  O     . GLU C  2  616  ? 95.214  -27.718 103.453  1.00 85.19  ? 616  GLU C O     1 
ATOM   8405  C  CB    . GLU C  2  616  ? 92.100  -28.142 103.818  1.00 85.10  ? 616  GLU C CB    1 
ATOM   8406  C  CG    . GLU C  2  616  ? 90.737  -27.959 104.481  1.00 83.92  ? 616  GLU C CG    1 
ATOM   8407  C  CD    . GLU C  2  616  ? 90.786  -28.019 106.001  1.00 81.03  ? 616  GLU C CD    1 
ATOM   8408  O  OE1   . GLU C  2  616  ? 91.735  -27.473 106.603  1.00 81.86  ? 616  GLU C OE1   1 
ATOM   8409  O  OE2   . GLU C  2  616  ? 89.866  -28.617 106.597  1.00 73.27  ? 616  GLU C OE2   1 
ATOM   8410  N  N     . ASP C  2  617  ? 94.180  -26.745 101.704  1.00 93.13  ? 617  ASP C N     1 
ATOM   8411  C  CA    . ASP C  2  617  ? 95.296  -26.914 100.783  1.00 91.02  ? 617  ASP C CA    1 
ATOM   8412  C  C     . ASP C  2  617  ? 96.490  -26.061 101.201  1.00 85.66  ? 617  ASP C C     1 
ATOM   8413  O  O     . ASP C  2  617  ? 97.629  -26.350 100.836  1.00 86.93  ? 617  ASP C O     1 
ATOM   8414  C  CB    . ASP C  2  617  ? 94.866  -26.553 99.360   1.00 87.43  ? 617  ASP C CB    1 
ATOM   8415  C  CG    . ASP C  2  617  ? 93.618  -27.297 98.922   1.00 90.22  ? 617  ASP C CG    1 
ATOM   8416  O  OD1   . ASP C  2  617  ? 92.765  -27.594 99.787   1.00 86.75  ? 617  ASP C OD1   1 
ATOM   8417  O  OD2   . ASP C  2  617  ? 93.488  -27.585 97.714   1.00 93.02  ? 617  ASP C OD2   1 
ATOM   8418  N  N     . GLY C  2  618  ? 96.221  -25.008 101.968  1.00 79.13  ? 618  GLY C N     1 
ATOM   8419  C  CA    . GLY C  2  618  ? 97.267  -24.125 102.450  1.00 81.51  ? 618  GLY C CA    1 
ATOM   8420  C  C     . GLY C  2  618  ? 97.501  -22.943 101.530  1.00 81.32  ? 618  GLY C C     1 
ATOM   8421  O  O     . GLY C  2  618  ? 98.231  -22.011 101.871  1.00 77.06  ? 618  GLY C O     1 
ATOM   8422  N  N     . ARG C  2  619  ? 96.880  -22.984 100.356  1.00 80.79  ? 619  ARG C N     1 
ATOM   8423  C  CA    . ARG C  2  619  ? 97.009  -21.911 99.379   1.00 73.15  ? 619  ARG C CA    1 
ATOM   8424  C  C     . ARG C  2  619  ? 96.225  -20.679 99.817   1.00 71.07  ? 619  ARG C C     1 
ATOM   8425  O  O     . ARG C  2  619  ? 95.203  -20.791 100.496  1.00 73.30  ? 619  ARG C O     1 
ATOM   8426  C  CB    . ARG C  2  619  ? 96.529  -22.384 98.006   1.00 68.81  ? 619  ARG C CB    1 
ATOM   8427  C  CG    . ARG C  2  619  ? 95.099  -22.889 98.002   1.00 71.00  ? 619  ARG C CG    1 
ATOM   8428  C  CD    . ARG C  2  619  ? 94.787  -23.673 96.741   1.00 71.31  ? 619  ARG C CD    1 
ATOM   8429  N  NE    . ARG C  2  619  ? 93.399  -24.122 96.723   1.00 70.32  ? 619  ARG C NE    1 
ATOM   8430  C  CZ    . ARG C  2  619  ? 92.416  -23.480 96.103   1.00 71.94  ? 619  ARG C CZ    1 
ATOM   8431  N  NH1   . ARG C  2  619  ? 91.180  -23.958 96.140   1.00 78.01  ? 619  ARG C NH1   1 
ATOM   8432  N  NH2   . ARG C  2  619  ? 92.670  -22.361 95.439   1.00 68.96  ? 619  ARG C NH2   1 
ATOM   8433  N  N     . LEU C  2  620  ? 96.711  -19.505 99.430   1.00 69.64  ? 620  LEU C N     1 
ATOM   8434  C  CA    . LEU C  2  620  ? 96.063  -18.252 99.795   1.00 64.47  ? 620  LEU C CA    1 
ATOM   8435  C  C     . LEU C  2  620  ? 95.176  -17.763 98.654   1.00 65.59  ? 620  LEU C C     1 
ATOM   8436  O  O     . LEU C  2  620  ? 95.670  -17.391 97.589   1.00 66.49  ? 620  LEU C O     1 
ATOM   8437  C  CB    . LEU C  2  620  ? 97.115  -17.195 100.136  1.00 57.05  ? 620  LEU C CB    1 
ATOM   8438  C  CG    . LEU C  2  620  ? 96.745  -16.182 101.218  1.00 52.44  ? 620  LEU C CG    1 
ATOM   8439  C  CD1   . LEU C  2  620  ? 96.544  -16.884 102.552  1.00 59.43  ? 620  LEU C CD1   1 
ATOM   8440  C  CD2   . LEU C  2  620  ? 97.810  -15.102 101.332  1.00 44.60  ? 620  LEU C CD2   1 
ATOM   8441  N  N     . VAL C  2  621  ? 93.866  -17.764 98.879   1.00 60.83  ? 621  VAL C N     1 
ATOM   8442  C  CA    . VAL C  2  621  ? 92.923  -17.351 97.846   1.00 54.57  ? 621  VAL C CA    1 
ATOM   8443  C  C     . VAL C  2  621  ? 92.312  -15.997 98.172   1.00 53.00  ? 621  VAL C C     1 
ATOM   8444  O  O     . VAL C  2  621  ? 91.695  -15.829 99.219   1.00 56.68  ? 621  VAL C O     1 
ATOM   8445  C  CB    . VAL C  2  621  ? 91.786  -18.374 97.684   1.00 56.79  ? 621  VAL C CB    1 
ATOM   8446  C  CG1   . VAL C  2  621  ? 90.863  -17.964 96.547   1.00 56.45  ? 621  VAL C CG1   1 
ATOM   8447  C  CG2   . VAL C  2  621  ? 92.354  -19.760 97.440   1.00 64.41  ? 621  VAL C CG2   1 
ATOM   8448  N  N     . GLU C  2  622  ? 92.477  -15.030 97.277   1.00 50.76  ? 622  GLU C N     1 
ATOM   8449  C  CA    . GLU C  2  622  ? 91.910  -13.706 97.502   1.00 52.39  ? 622  GLU C CA    1 
ATOM   8450  C  C     . GLU C  2  622  ? 90.682  -13.458 96.632   1.00 56.37  ? 622  GLU C C     1 
ATOM   8451  O  O     . GLU C  2  622  ? 90.777  -13.416 95.405   1.00 57.99  ? 622  GLU C O     1 
ATOM   8452  C  CB    . GLU C  2  622  ? 92.951  -12.613 97.257   1.00 52.25  ? 622  GLU C CB    1 
ATOM   8453  C  CG    . GLU C  2  622  ? 92.482  -11.228 97.674   1.00 54.78  ? 622  GLU C CG    1 
ATOM   8454  C  CD    . GLU C  2  622  ? 93.431  -10.130 97.239   1.00 66.16  ? 622  GLU C CD    1 
ATOM   8455  O  OE1   . GLU C  2  622  ? 93.690  -9.213  98.047   1.00 68.72  ? 622  GLU C OE1   1 
ATOM   8456  O  OE2   . GLU C  2  622  ? 93.912  -10.180 96.088   1.00 73.40  ? 622  GLU C OE2   1 
ATOM   8457  N  N     . TYR C  2  623  ? 89.530  -13.298 97.277   1.00 55.65  ? 623  TYR C N     1 
ATOM   8458  C  CA    . TYR C  2  623  ? 88.297  -12.966 96.577   1.00 50.14  ? 623  TYR C CA    1 
ATOM   8459  C  C     . TYR C  2  623  ? 88.034  -11.470 96.665   1.00 50.87  ? 623  TYR C C     1 
ATOM   8460  O  O     . TYR C  2  623  ? 87.685  -10.963 97.731   1.00 50.93  ? 623  TYR C O     1 
ATOM   8461  C  CB    . TYR C  2  623  ? 87.110  -13.711 97.189   1.00 44.05  ? 623  TYR C CB    1 
ATOM   8462  C  CG    . TYR C  2  623  ? 87.232  -15.215 97.183   1.00 46.30  ? 623  TYR C CG    1 
ATOM   8463  C  CD1   . TYR C  2  623  ? 87.260  -15.924 95.990   1.00 51.64  ? 623  TYR C CD1   1 
ATOM   8464  C  CD2   . TYR C  2  623  ? 87.293  -15.930 98.372   1.00 48.03  ? 623  TYR C CD2   1 
ATOM   8465  C  CE1   . TYR C  2  623  ? 87.362  -17.303 95.980   1.00 54.93  ? 623  TYR C CE1   1 
ATOM   8466  C  CE2   . TYR C  2  623  ? 87.394  -17.308 98.372   1.00 54.01  ? 623  TYR C CE2   1 
ATOM   8467  C  CZ    . TYR C  2  623  ? 87.428  -17.990 97.174   1.00 55.66  ? 623  TYR C CZ    1 
ATOM   8468  O  OH    . TYR C  2  623  ? 87.528  -19.363 97.168   1.00 61.79  ? 623  TYR C OH    1 
ATOM   8469  N  N     . PRO C  2  624  ? 88.200  -10.753 95.543   1.00 49.09  ? 624  PRO C N     1 
ATOM   8470  C  CA    . PRO C  2  624  ? 87.851  -9.331  95.524   1.00 47.58  ? 624  PRO C CA    1 
ATOM   8471  C  C     . PRO C  2  624  ? 86.335  -9.155  95.549   1.00 50.92  ? 624  PRO C C     1 
ATOM   8472  O  O     . PRO C  2  624  ? 85.614  -9.951  94.945   1.00 47.69  ? 624  PRO C O     1 
ATOM   8473  C  CB    . PRO C  2  624  ? 88.431  -8.846  94.193   1.00 42.97  ? 624  PRO C CB    1 
ATOM   8474  C  CG    . PRO C  2  624  ? 88.463  -10.060 93.334   1.00 50.15  ? 624  PRO C CG    1 
ATOM   8475  C  CD    . PRO C  2  624  ? 88.751  -11.209 94.255   1.00 49.44  ? 624  PRO C CD    1 
ATOM   8476  N  N     . LEU C  2  625  ? 85.861  -8.131  96.251   1.00 52.93  ? 625  LEU C N     1 
ATOM   8477  C  CA    . LEU C  2  625  ? 84.428  -7.893  96.379   1.00 49.12  ? 625  LEU C CA    1 
ATOM   8478  C  C     . LEU C  2  625  ? 83.950  -6.803  95.426   1.00 50.79  ? 625  LEU C C     1 
ATOM   8479  O  O     . LEU C  2  625  ? 84.555  -5.733  95.336   1.00 46.87  ? 625  LEU C O     1 
ATOM   8480  C  CB    . LEU C  2  625  ? 84.073  -7.520  97.821   1.00 45.39  ? 625  LEU C CB    1 
ATOM   8481  C  CG    . LEU C  2  625  ? 84.330  -8.588  98.886   1.00 42.56  ? 625  LEU C CG    1 
ATOM   8482  C  CD1   . LEU C  2  625  ? 83.951  -8.077  100.269  1.00 38.56  ? 625  LEU C CD1   1 
ATOM   8483  C  CD2   . LEU C  2  625  ? 83.570  -9.859  98.554   1.00 40.41  ? 625  LEU C CD2   1 
ATOM   8484  N  N     . ARG C  2  626  ? 82.864  -7.085  94.713   1.00 51.24  ? 626  ARG C N     1 
ATOM   8485  C  CA    . ARG C  2  626  ? 82.250  -6.098  93.837   1.00 50.59  ? 626  ARG C CA    1 
ATOM   8486  C  C     . ARG C  2  626  ? 81.609  -5.025  94.709   1.00 50.46  ? 626  ARG C C     1 
ATOM   8487  O  O     . ARG C  2  626  ? 80.795  -5.334  95.577   1.00 50.75  ? 626  ARG C O     1 
ATOM   8488  C  CB    . ARG C  2  626  ? 81.204  -6.764  92.939   1.00 53.55  ? 626  ARG C CB    1 
ATOM   8489  C  CG    . ARG C  2  626  ? 80.563  -5.836  91.920   1.00 58.31  ? 626  ARG C CG    1 
ATOM   8490  C  CD    . ARG C  2  626  ? 79.650  -6.586  90.954   1.00 60.53  ? 626  ARG C CD    1 
ATOM   8491  N  NE    . ARG C  2  626  ? 80.393  -7.449  90.037   1.00 64.42  ? 626  ARG C NE    1 
ATOM   8492  C  CZ    . ARG C  2  626  ? 80.414  -8.777  90.105   1.00 61.10  ? 626  ARG C CZ    1 
ATOM   8493  N  NH1   . ARG C  2  626  ? 79.727  -9.409  91.047   1.00 57.93  ? 626  ARG C NH1   1 
ATOM   8494  N  NH2   . ARG C  2  626  ? 81.119  -9.476  89.225   1.00 55.04  ? 626  ARG C NH2   1 
ATOM   8495  N  N     . ARG C  2  627  ? 81.986  -3.769  94.488   1.00 50.93  ? 627  ARG C N     1 
ATOM   8496  C  CA    . ARG C  2  627  ? 81.537  -2.681  95.355   1.00 49.24  ? 627  ARG C CA    1 
ATOM   8497  C  C     . ARG C  2  627  ? 80.932  -1.493  94.610   1.00 51.53  ? 627  ARG C C     1 
ATOM   8498  O  O     . ARG C  2  627  ? 81.612  -0.818  93.835   1.00 55.27  ? 627  ARG C O     1 
ATOM   8499  C  CB    . ARG C  2  627  ? 82.678  -2.207  96.258   1.00 46.26  ? 627  ARG C CB    1 
ATOM   8500  C  CG    . ARG C  2  627  ? 82.791  -2.979  97.558   1.00 44.74  ? 627  ARG C CG    1 
ATOM   8501  C  CD    . ARG C  2  627  ? 81.510  -2.859  98.363   1.00 43.21  ? 627  ARG C CD    1 
ATOM   8502  N  NE    . ARG C  2  627  ? 81.613  -3.508  99.665   1.00 42.82  ? 627  ARG C NE    1 
ATOM   8503  C  CZ    . ARG C  2  627  ? 80.677  -3.441  100.605  1.00 46.60  ? 627  ARG C CZ    1 
ATOM   8504  N  NH1   . ARG C  2  627  ? 79.566  -2.751  100.386  1.00 46.22  ? 627  ARG C NH1   1 
ATOM   8505  N  NH2   . ARG C  2  627  ? 80.851  -4.061  101.764  1.00 48.88  ? 627  ARG C NH2   1 
ATOM   8506  N  N     . PHE C  2  628  ? 79.653  -1.245  94.877   1.00 48.83  ? 628  PHE C N     1 
ATOM   8507  C  CA    . PHE C  2  628  ? 78.908  -0.130  94.298   1.00 49.01  ? 628  PHE C CA    1 
ATOM   8508  C  C     . PHE C  2  628  ? 78.986  -0.089  92.773   1.00 50.49  ? 628  PHE C C     1 
ATOM   8509  O  O     . PHE C  2  628  ? 79.346  0.931   92.185   1.00 47.04  ? 628  PHE C O     1 
ATOM   8510  C  CB    . PHE C  2  628  ? 79.357  1.198   94.914   1.00 47.24  ? 628  PHE C CB    1 
ATOM   8511  C  CG    . PHE C  2  628  ? 79.116  1.286   96.396   1.00 48.82  ? 628  PHE C CG    1 
ATOM   8512  C  CD1   . PHE C  2  628  ? 77.884  1.686   96.888   1.00 45.92  ? 628  PHE C CD1   1 
ATOM   8513  C  CD2   . PHE C  2  628  ? 80.117  0.962   97.297   1.00 48.95  ? 628  PHE C CD2   1 
ATOM   8514  C  CE1   . PHE C  2  628  ? 77.657  1.767   98.250   1.00 42.36  ? 628  PHE C CE1   1 
ATOM   8515  C  CE2   . PHE C  2  628  ? 79.896  1.038   98.660   1.00 45.41  ? 628  PHE C CE2   1 
ATOM   8516  C  CZ    . PHE C  2  628  ? 78.665  1.443   99.136   1.00 43.51  ? 628  PHE C CZ    1 
ATOM   8517  N  N     . TYR C  2  629  ? 78.652  -1.212  92.145   1.00 50.75  ? 629  TYR C N     1 
ATOM   8518  C  CA    . TYR C  2  629  ? 78.617  -1.304  90.690   1.00 49.70  ? 629  TYR C CA    1 
ATOM   8519  C  C     . TYR C  2  629  ? 77.202  -1.087  90.179   1.00 42.63  ? 629  TYR C C     1 
ATOM   8520  O  O     . TYR C  2  629  ? 76.267  -1.768  90.601   1.00 41.98  ? 629  TYR C O     1 
ATOM   8521  C  CB    . TYR C  2  629  ? 79.144  -2.662  90.218   1.00 55.12  ? 629  TYR C CB    1 
ATOM   8522  C  CG    . TYR C  2  629  ? 80.654  -2.743  90.130   1.00 69.10  ? 629  TYR C CG    1 
ATOM   8523  C  CD1   . TYR C  2  629  ? 81.448  -2.544  91.253   1.00 68.11  ? 629  TYR C CD1   1 
ATOM   8524  C  CD2   . TYR C  2  629  ? 81.284  -3.028  88.925   1.00 74.60  ? 629  TYR C CD2   1 
ATOM   8525  C  CE1   . TYR C  2  629  ? 82.828  -2.620  91.179   1.00 66.48  ? 629  TYR C CE1   1 
ATOM   8526  C  CE2   . TYR C  2  629  ? 82.665  -3.108  88.841   1.00 81.68  ? 629  TYR C CE2   1 
ATOM   8527  C  CZ    . TYR C  2  629  ? 83.431  -2.902  89.971   1.00 75.61  ? 629  TYR C CZ    1 
ATOM   8528  O  OH    . TYR C  2  629  ? 84.803  -2.979  89.895   1.00 71.17  ? 629  TYR C OH    1 
ATOM   8529  N  N     . ARG C  2  630  ? 77.052  -0.126  89.274   1.00 39.26  ? 630  ARG C N     1 
ATOM   8530  C  CA    . ARG C  2  630  ? 75.758  0.183   88.683   1.00 34.45  ? 630  ARG C CA    1 
ATOM   8531  C  C     . ARG C  2  630  ? 75.306  -0.923  87.737   1.00 31.01  ? 630  ARG C C     1 
ATOM   8532  O  O     . ARG C  2  630  ? 76.059  -1.344  86.861   1.00 34.15  ? 630  ARG C O     1 
ATOM   8533  C  CB    . ARG C  2  630  ? 75.830  1.512   87.930   1.00 31.65  ? 630  ARG C CB    1 
ATOM   8534  C  CG    . ARG C  2  630  ? 74.722  1.703   86.914   1.00 29.84  ? 630  ARG C CG    1 
ATOM   8535  C  CD    . ARG C  2  630  ? 75.009  2.870   85.987   1.00 31.60  ? 630  ARG C CD    1 
ATOM   8536  N  NE    . ARG C  2  630  ? 74.417  2.663   84.669   1.00 33.52  ? 630  ARG C NE    1 
ATOM   8537  C  CZ    . ARG C  2  630  ? 73.170  2.989   84.347   1.00 30.41  ? 630  ARG C CZ    1 
ATOM   8538  N  NH1   . ARG C  2  630  ? 72.373  3.544   85.249   1.00 30.18  ? 630  ARG C NH1   1 
ATOM   8539  N  NH2   . ARG C  2  630  ? 72.720  2.760   83.122   1.00 34.17  ? 630  ARG C NH2   1 
ATOM   8540  N  N     . SER C  2  631  ? 74.076  -1.394  87.919   1.00 29.95  ? 631  SER C N     1 
ATOM   8541  C  CA    . SER C  2  631  ? 73.524  -2.419  87.042   1.00 32.22  ? 631  SER C CA    1 
ATOM   8542  C  C     . SER C  2  631  ? 72.904  -1.782  85.806   1.00 34.08  ? 631  SER C C     1 
ATOM   8543  O  O     . SER C  2  631  ? 72.879  -0.559  85.671   1.00 34.26  ? 631  SER C O     1 
ATOM   8544  C  CB    . SER C  2  631  ? 72.472  -3.255  87.773   1.00 33.15  ? 631  SER C CB    1 
ATOM   8545  O  OG    . SER C  2  631  ? 71.263  -2.532  87.929   1.00 31.14  ? 631  SER C OG    1 
ATOM   8546  N  N     . ASN C  2  632  ? 72.393  -2.622  84.913   1.00 35.08  ? 632  ASN C N     1 
ATOM   8547  C  CA    . ASN C  2  632  ? 71.747  -2.151  83.695   1.00 35.57  ? 632  ASN C CA    1 
ATOM   8548  C  C     . ASN C  2  632  ? 70.512  -1.312  84.001   1.00 32.61  ? 632  ASN C C     1 
ATOM   8549  O  O     . ASN C  2  632  ? 70.194  -0.367  83.280   1.00 33.80  ? 632  ASN C O     1 
ATOM   8550  C  CB    . ASN C  2  632  ? 71.368  -3.338  82.808   1.00 35.74  ? 632  ASN C CB    1 
ATOM   8551  C  CG    . ASN C  2  632  ? 72.573  -3.982  82.149   1.00 37.73  ? 632  ASN C CG    1 
ATOM   8552  O  OD1   . ASN C  2  632  ? 73.706  -3.533  82.326   1.00 35.74  ? 632  ASN C OD1   1 
ATOM   8553  N  ND2   . ASN C  2  632  ? 72.333  -5.046  81.388   1.00 36.93  ? 632  ASN C ND2   1 
ATOM   8554  N  N     . GLN C  2  633  ? 69.827  -1.662  85.084   1.00 29.42  ? 633  GLN C N     1 
ATOM   8555  C  CA    . GLN C  2  633  ? 68.606  -0.971  85.474   1.00 28.68  ? 633  GLN C CA    1 
ATOM   8556  C  C     . GLN C  2  633  ? 68.897  0.157   86.457   1.00 30.41  ? 633  GLN C C     1 
ATOM   8557  O  O     . GLN C  2  633  ? 67.981  0.818   86.946   1.00 33.38  ? 633  GLN C O     1 
ATOM   8558  C  CB    . GLN C  2  633  ? 67.591  -1.955  86.064   1.00 28.56  ? 633  GLN C CB    1 
ATOM   8559  C  CG    . GLN C  2  633  ? 66.922  -2.859  85.034   1.00 27.43  ? 633  GLN C CG    1 
ATOM   8560  C  CD    . GLN C  2  633  ? 67.883  -3.847  84.396   1.00 29.18  ? 633  GLN C CD    1 
ATOM   8