data_5X61
# 
_entry.id   5X61 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5X61         
WWPDB D_1300002990 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5X61 
_pdbx_database_status.recvd_initial_deposition_date   2017-02-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Han, Q.'       1 ? 
'Robinson, H.'  2 ? 
'Ding, H.'      3 ? 
'Wong, D.M.'    4 ? 
'Lam, P.C.H.'   5 ? 
'Totrov, M.M.'  6 ? 
'Carlier, P.R.' 7 ? 
'Li, J.'        8 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Insect Sci.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1744-7917 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Crystal structure of acetylcholinesterase catalytic subunits of the malaria vector Anopheles gambiae' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1111/1744-7917.12450 
_citation.pdbx_database_id_PubMed   28247978 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Han, Q.'       1 ? 
primary 'Wong, D.M.'    2 ? 
primary 'Robinson, H.'  3 ? 
primary 'Ding, H.'      4 ? 
primary 'Lam, P.C.H.'   5 ? 
primary 'Totrov, M.M.'  6 ? 
primary 'Carlier, P.R.' 7 ? 
primary 'Li, J.'        8 ? 
# 
_cell.entry_id           5X61 
_cell.length_a           148.723 
_cell.length_b           148.723 
_cell.length_c           225.796 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5X61 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase                                                                      61684.125 2  3.1.1.7 ? 
'CATALYTIC SUBUNIT, UNP RESIDUES 162-714' ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2  ?       ? 
?                                         ? 
3 non-polymer syn 'SULFATE ION'                                                                             96.063    16 ?       ? 
?                                         ? 
4 non-polymer syn 'AMMONIUM ION'                                                                            18.038    2  ?       ? 
?                                         ? 
5 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'                                     238.305   2  ?       ? 
?                                         ? 
6 water       nat water                                                                                     18.015    6  ?       ? 
?                                         ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFPG
ATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLGT
PEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEA
TLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTG
SNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHFT
CNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTGN
PNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESSA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFPG
ATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLGT
PEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEA
TLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTG
SNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHFT
CNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTGN
PNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESSA
;
_entity_poly.pdbx_strand_id                 B,A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASN n 
1 3   ASP n 
1 4   PRO n 
1 5   LEU n 
1 6   VAL n 
1 7   VAL n 
1 8   ASN n 
1 9   THR n 
1 10  ASP n 
1 11  LYS n 
1 12  GLY n 
1 13  ARG n 
1 14  ILE n 
1 15  ARG n 
1 16  GLY n 
1 17  ILE n 
1 18  THR n 
1 19  VAL n 
1 20  ASP n 
1 21  ALA n 
1 22  PRO n 
1 23  SER n 
1 24  GLY n 
1 25  LYS n 
1 26  LYS n 
1 27  VAL n 
1 28  ASP n 
1 29  VAL n 
1 30  TRP n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  TYR n 
1 36  ALA n 
1 37  GLN n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  PRO n 
1 43  LEU n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  HIS n 
1 48  PRO n 
1 49  ARG n 
1 50  PRO n 
1 51  ALA n 
1 52  GLU n 
1 53  LYS n 
1 54  TRP n 
1 55  THR n 
1 56  GLY n 
1 57  VAL n 
1 58  LEU n 
1 59  ASN n 
1 60  THR n 
1 61  THR n 
1 62  THR n 
1 63  PRO n 
1 64  PRO n 
1 65  ASN n 
1 66  SER n 
1 67  CYS n 
1 68  VAL n 
1 69  GLN n 
1 70  ILE n 
1 71  VAL n 
1 72  ASP n 
1 73  THR n 
1 74  VAL n 
1 75  PHE n 
1 76  GLY n 
1 77  ASP n 
1 78  PHE n 
1 79  PRO n 
1 80  GLY n 
1 81  ALA n 
1 82  THR n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  THR n 
1 89  PRO n 
1 90  LEU n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  ILE n 
1 98  ASN n 
1 99  VAL n 
1 100 VAL n 
1 101 ALA n 
1 102 PRO n 
1 103 ARG n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 ASN n 
1 109 ALA n 
1 110 ALA n 
1 111 VAL n 
1 112 MET n 
1 113 LEU n 
1 114 TRP n 
1 115 ILE n 
1 116 PHE n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 THR n 
1 125 ALA n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASP n 
1 132 HIS n 
1 133 ARG n 
1 134 ALA n 
1 135 LEU n 
1 136 ALA n 
1 137 SER n 
1 138 GLU n 
1 139 GLU n 
1 140 ASN n 
1 141 VAL n 
1 142 ILE n 
1 143 VAL n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 GLN n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 ALA n 
1 152 SER n 
1 153 LEU n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 PHE n 
1 158 LEU n 
1 159 GLY n 
1 160 THR n 
1 161 PRO n 
1 162 GLU n 
1 163 ALA n 
1 164 PRO n 
1 165 GLY n 
1 166 ASN n 
1 167 ALA n 
1 168 GLY n 
1 169 LEU n 
1 170 PHE n 
1 171 ASP n 
1 172 GLN n 
1 173 ASN n 
1 174 LEU n 
1 175 ALA n 
1 176 LEU n 
1 177 ARG n 
1 178 TRP n 
1 179 VAL n 
1 180 ARG n 
1 181 ASP n 
1 182 ASN n 
1 183 ILE n 
1 184 HIS n 
1 185 ARG n 
1 186 PHE n 
1 187 GLY n 
1 188 GLY n 
1 189 ASP n 
1 190 PRO n 
1 191 SER n 
1 192 ARG n 
1 193 VAL n 
1 194 THR n 
1 195 LEU n 
1 196 PHE n 
1 197 GLY n 
1 198 GLU n 
1 199 SER n 
1 200 ALA n 
1 201 GLY n 
1 202 ALA n 
1 203 VAL n 
1 204 SER n 
1 205 VAL n 
1 206 SER n 
1 207 LEU n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 SER n 
1 212 ALA n 
1 213 LEU n 
1 214 SER n 
1 215 ARG n 
1 216 ASP n 
1 217 LEU n 
1 218 PHE n 
1 219 GLN n 
1 220 ARG n 
1 221 ALA n 
1 222 ILE n 
1 223 LEU n 
1 224 GLN n 
1 225 SER n 
1 226 GLY n 
1 227 SER n 
1 228 PRO n 
1 229 THR n 
1 230 ALA n 
1 231 PRO n 
1 232 TRP n 
1 233 ALA n 
1 234 LEU n 
1 235 VAL n 
1 236 SER n 
1 237 ARG n 
1 238 GLU n 
1 239 GLU n 
1 240 ALA n 
1 241 THR n 
1 242 LEU n 
1 243 ARG n 
1 244 ALA n 
1 245 LEU n 
1 246 ARG n 
1 247 LEU n 
1 248 ALA n 
1 249 GLU n 
1 250 ALA n 
1 251 VAL n 
1 252 GLY n 
1 253 CYS n 
1 254 PRO n 
1 255 HIS n 
1 256 GLU n 
1 257 PRO n 
1 258 SER n 
1 259 LYS n 
1 260 LEU n 
1 261 SER n 
1 262 ASP n 
1 263 ALA n 
1 264 VAL n 
1 265 GLU n 
1 266 CYS n 
1 267 LEU n 
1 268 ARG n 
1 269 GLY n 
1 270 LYS n 
1 271 ASP n 
1 272 PRO n 
1 273 HIS n 
1 274 VAL n 
1 275 LEU n 
1 276 VAL n 
1 277 ASN n 
1 278 ASN n 
1 279 GLU n 
1 280 TRP n 
1 281 GLY n 
1 282 THR n 
1 283 LEU n 
1 284 GLY n 
1 285 ILE n 
1 286 CYS n 
1 287 GLU n 
1 288 PHE n 
1 289 PRO n 
1 290 PHE n 
1 291 VAL n 
1 292 PRO n 
1 293 VAL n 
1 294 VAL n 
1 295 ASP n 
1 296 GLY n 
1 297 ALA n 
1 298 PHE n 
1 299 LEU n 
1 300 ASP n 
1 301 GLU n 
1 302 THR n 
1 303 PRO n 
1 304 GLN n 
1 305 ARG n 
1 306 SER n 
1 307 LEU n 
1 308 ALA n 
1 309 SER n 
1 310 GLY n 
1 311 ARG n 
1 312 PHE n 
1 313 LYS n 
1 314 LYS n 
1 315 THR n 
1 316 GLU n 
1 317 ILE n 
1 318 LEU n 
1 319 THR n 
1 320 GLY n 
1 321 SER n 
1 322 ASN n 
1 323 THR n 
1 324 GLU n 
1 325 GLU n 
1 326 GLY n 
1 327 TYR n 
1 328 TYR n 
1 329 PHE n 
1 330 ILE n 
1 331 ILE n 
1 332 TYR n 
1 333 TYR n 
1 334 LEU n 
1 335 THR n 
1 336 GLU n 
1 337 LEU n 
1 338 LEU n 
1 339 ARG n 
1 340 LYS n 
1 341 GLU n 
1 342 GLU n 
1 343 GLY n 
1 344 VAL n 
1 345 THR n 
1 346 VAL n 
1 347 THR n 
1 348 ARG n 
1 349 GLU n 
1 350 GLU n 
1 351 PHE n 
1 352 LEU n 
1 353 GLN n 
1 354 ALA n 
1 355 VAL n 
1 356 ARG n 
1 357 GLU n 
1 358 LEU n 
1 359 ASN n 
1 360 PRO n 
1 361 TYR n 
1 362 VAL n 
1 363 ASN n 
1 364 GLY n 
1 365 ALA n 
1 366 ALA n 
1 367 ARG n 
1 368 GLN n 
1 369 ALA n 
1 370 ILE n 
1 371 VAL n 
1 372 PHE n 
1 373 GLU n 
1 374 TYR n 
1 375 THR n 
1 376 ASP n 
1 377 TRP n 
1 378 THR n 
1 379 GLU n 
1 380 PRO n 
1 381 ASP n 
1 382 ASN n 
1 383 PRO n 
1 384 ASN n 
1 385 SER n 
1 386 ASN n 
1 387 ARG n 
1 388 ASP n 
1 389 ALA n 
1 390 LEU n 
1 391 ASP n 
1 392 LYS n 
1 393 MET n 
1 394 VAL n 
1 395 GLY n 
1 396 ASP n 
1 397 TYR n 
1 398 HIS n 
1 399 PHE n 
1 400 THR n 
1 401 CYS n 
1 402 ASN n 
1 403 VAL n 
1 404 ASN n 
1 405 GLU n 
1 406 PHE n 
1 407 ALA n 
1 408 GLN n 
1 409 ARG n 
1 410 TYR n 
1 411 ALA n 
1 412 GLU n 
1 413 GLU n 
1 414 GLY n 
1 415 ASN n 
1 416 ASN n 
1 417 VAL n 
1 418 TYR n 
1 419 MET n 
1 420 TYR n 
1 421 LEU n 
1 422 TYR n 
1 423 THR n 
1 424 HIS n 
1 425 ARG n 
1 426 SER n 
1 427 LYS n 
1 428 GLY n 
1 429 ASN n 
1 430 PRO n 
1 431 TRP n 
1 432 PRO n 
1 433 ARG n 
1 434 TRP n 
1 435 THR n 
1 436 GLY n 
1 437 VAL n 
1 438 MET n 
1 439 HIS n 
1 440 GLY n 
1 441 ASP n 
1 442 GLU n 
1 443 ILE n 
1 444 ASN n 
1 445 TYR n 
1 446 VAL n 
1 447 PHE n 
1 448 GLY n 
1 449 GLU n 
1 450 PRO n 
1 451 LEU n 
1 452 ASN n 
1 453 PRO n 
1 454 THR n 
1 455 LEU n 
1 456 GLY n 
1 457 TYR n 
1 458 THR n 
1 459 GLU n 
1 460 ASP n 
1 461 GLU n 
1 462 LYS n 
1 463 ASP n 
1 464 PHE n 
1 465 SER n 
1 466 ARG n 
1 467 LYS n 
1 468 ILE n 
1 469 MET n 
1 470 ARG n 
1 471 TYR n 
1 472 TRP n 
1 473 SER n 
1 474 ASN n 
1 475 PHE n 
1 476 ALA n 
1 477 LYS n 
1 478 THR n 
1 479 GLY n 
1 480 ASN n 
1 481 PRO n 
1 482 ASN n 
1 483 PRO n 
1 484 ASN n 
1 485 THR n 
1 486 ALA n 
1 487 SER n 
1 488 SER n 
1 489 GLU n 
1 490 PHE n 
1 491 PRO n 
1 492 GLU n 
1 493 TRP n 
1 494 PRO n 
1 495 LYS n 
1 496 HIS n 
1 497 THR n 
1 498 ALA n 
1 499 HIS n 
1 500 GLY n 
1 501 ARG n 
1 502 HIS n 
1 503 TYR n 
1 504 LEU n 
1 505 GLU n 
1 506 LEU n 
1 507 GLY n 
1 508 LEU n 
1 509 ASN n 
1 510 THR n 
1 511 SER n 
1 512 PHE n 
1 513 VAL n 
1 514 GLY n 
1 515 ARG n 
1 516 GLY n 
1 517 PRO n 
1 518 ARG n 
1 519 LEU n 
1 520 ARG n 
1 521 GLN n 
1 522 CYS n 
1 523 ALA n 
1 524 PHE n 
1 525 TRP n 
1 526 LYS n 
1 527 LYS n 
1 528 TYR n 
1 529 LEU n 
1 530 PRO n 
1 531 GLN n 
1 532 LEU n 
1 533 VAL n 
1 534 ALA n 
1 535 ALA n 
1 536 THR n 
1 537 SER n 
1 538 ASN n 
1 539 LEU n 
1 540 PRO n 
1 541 GLY n 
1 542 PRO n 
1 543 ALA n 
1 544 PRO n 
1 545 PRO n 
1 546 SER n 
1 547 GLU n 
1 548 PRO n 
1 549 CYS n 
1 550 GLU n 
1 551 SER n 
1 552 SER n 
1 553 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   553 
_entity_src_gen.gene_src_common_name               'African malaria mosquito' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Ace, ACE1, ACHE1, AGAP001356' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Anopheles gambiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7165 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Komagataella pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PPICZ* A' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_ANOGA 
_struct_ref.pdbx_db_accession          Q869C3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DNDPLVVNTDKGRIRGITVDAPSGKKVDVWLGIPYAQPPVGPLRFRHPRPAEKWTGVLNTTTPPNSCVQIVDTVFGDFPG
ATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRALASEENVIVVSLQYRVASLGFLFLGT
PEAPGNAGLFDQNLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQSGSPTAPWALVSREEA
TLRALRLAEAVGCPHEPSKLSDAVECLRGKDPHVLVNNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTG
SNTEEGYYFIIYYLTELLRKEEGVTVTREEFLQAVRELNPYVNGAARQAIVFEYTDWTEPDNPNSNRDALDKMVGDYHFT
CNVNEFAQRYAEEGNNVYMYLYTHRSKGNPWPRWTGVMHGDEINYVFGEPLNPTLGYTEDEKDFSRKIMRYWSNFAKTGN
PNPNTASSEFPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLPGPAPPSEPCESSA
;
_struct_ref.pdbx_align_begin           162 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5X61 B 1 ? 553 ? Q869C3 162 ? 714 ? 162 714 
2 1 5X61 A 1 ? 553 ? Q869C3 162 ? 714 ? 162 714 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                              ? 'C3 H7 N O2 S'   121.158 
EPE non-polymer                  . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S' 238.305 
GLN 'L-peptide linking'          y GLUTAMINE                                             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                 ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                            ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose              
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
NH4 non-polymer                  . 'AMMONIUM ION'                                        ? 'H4 N 1'         18.038  
PHE 'L-peptide linking'          y PHENYLALANINE                                         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                  . 'SULFATE ION'                                         ? 'O4 S -2'        96.063  
THR 'L-peptide linking'          y THREONINE                                             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5X61 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            5.84 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         78.95 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES BUFFER, 1.6M AMMONIUM SULFATE, 0.1M SODIUM CHLORIDE' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-11-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'SI 111 CHANNEL' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.075 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.075 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5X61 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.400 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       38760 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             64.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  20.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.40 
_reflns_shell.d_res_low                   3.52 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5X61 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     36750 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.93 
_refine.ls_d_res_high                            3.40 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.195 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.194 
_refine.ls_R_factor_R_free                       0.221 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1940 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.923 
_refine.correlation_coeff_Fo_to_Fc_free          0.898 
_refine.B_iso_mean                               70.67 
_refine.aniso_B[1][1]                            0.00000 
_refine.aniso_B[2][2]                            0.00000 
_refine.aniso_B[3][3]                            -0.01000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2HA2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.377 
_refine.pdbx_overall_ESU_R_Free                  0.372 
_refine.overall_SU_ML                            0.258 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             16.367 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8498 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         168 
_refine_hist.number_atoms_solvent             6 
_refine_hist.number_atoms_total               8672 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        48.93 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.004  0.019  ? 8906  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.929  1.967  ? 12170 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.811  5.000  ? 1072  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.251 23.302 ? 424   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.303 15.000 ? 1324  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.220 15.000 ? 70    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.067  0.200  ? 1308  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.021  ? 6948  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.40 
_refine_ls_shell.d_res_low                        3.49 
_refine_ls_shell.number_reflns_R_work             2683 
_refine_ls_shell.R_factor_R_work                  0.2810 
_refine_ls_shell.percent_reflns_obs               99.58 
_refine_ls_shell.R_factor_R_free                  0.2910 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                     5X61 
_struct.title                        
'Crystal structure of Acetylcholinesterase Catalytic Subunit of the Malaria Vector Anopheles Gambiae, 3.4 A' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5X61 
_struct_keywords.text            'ALPHA/BETA HYDROLASE FOLD, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 4 ? 
N N N 5 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 3 ? 
V N N 3 ? 
W N N 4 ? 
X N N 5 ? 
Y N N 6 ? 
Z N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 40  ? ARG A 44  ? VAL B 201 ARG B 205 5 ? 5  
HELX_P HELX_P2  AA2 PHE A 78  ? MET A 83  ? PHE B 239 MET B 244 1 ? 6  
HELX_P HELX_P3  AA3 LEU A 127 ? ASP A 131 ? LEU B 288 ASP B 292 5 ? 5  
HELX_P HELX_P4  AA4 HIS A 132 ? ASN A 140 ? HIS B 293 ASN B 301 1 ? 9  
HELX_P HELX_P5  AA5 ALA A 151 ? LEU A 156 ? ALA B 312 LEU B 317 1 ? 6  
HELX_P HELX_P6  AA6 ASN A 166 ? ILE A 183 ? ASN B 327 ILE B 344 1 ? 18 
HELX_P HELX_P7  AA7 HIS A 184 ? PHE A 186 ? HIS B 345 PHE B 347 5 ? 3  
HELX_P HELX_P8  AA8 SER A 199 ? SER A 211 ? SER B 360 SER B 372 1 ? 13 
HELX_P HELX_P9  AA9 SER A 236 ? GLY A 252 ? SER B 397 GLY B 413 1 ? 17 
HELX_P HELX_P10 AB1 LYS A 259 ? ARG A 268 ? LYS B 420 ARG B 429 1 ? 10 
HELX_P HELX_P11 AB2 ASP A 271 ? ASN A 277 ? ASP B 432 ASN B 438 1 ? 7  
HELX_P HELX_P12 AB3 THR A 302 ? SER A 309 ? THR B 463 SER B 470 1 ? 8  
HELX_P HELX_P13 AB4 GLY A 326 ? LEU A 334 ? GLY B 487 LEU B 495 1 ? 9  
HELX_P HELX_P14 AB5 THR A 347 ? ASN A 359 ? THR B 508 ASN B 520 1 ? 13 
HELX_P HELX_P15 AB6 GLY A 364 ? TYR A 374 ? GLY B 525 TYR B 535 1 ? 11 
HELX_P HELX_P16 AB7 ASN A 382 ? PHE A 399 ? ASN B 543 PHE B 560 1 ? 18 
HELX_P HELX_P17 AB8 PHE A 399 ? GLU A 413 ? PHE B 560 GLU B 574 1 ? 15 
HELX_P HELX_P18 AB9 PRO A 432 ? GLY A 436 ? PRO B 593 GLY B 597 5 ? 5  
HELX_P HELX_P19 AC1 GLU A 442 ? PHE A 447 ? GLU B 603 PHE B 608 1 ? 6  
HELX_P HELX_P20 AC2 ASN A 452 ? GLY A 456 ? ASN B 613 GLY B 617 5 ? 5  
HELX_P HELX_P21 AC3 THR A 458 ? GLY A 479 ? THR B 619 GLY B 640 1 ? 22 
HELX_P HELX_P22 AC4 ARG A 518 ? LYS A 527 ? ARG B 679 LYS B 688 1 ? 10 
HELX_P HELX_P23 AC5 LYS A 527 ? SER A 537 ? LYS B 688 SER B 698 1 ? 11 
HELX_P HELX_P24 AC6 VAL B 40  ? ARG B 44  ? VAL A 201 ARG A 205 5 ? 5  
HELX_P HELX_P25 AC7 PHE B 78  ? MET B 83  ? PHE A 239 MET A 244 1 ? 6  
HELX_P HELX_P26 AC8 ASP B 131 ? ASN B 140 ? ASP A 292 ASN A 301 1 ? 10 
HELX_P HELX_P27 AC9 ALA B 151 ? LEU B 156 ? ALA A 312 LEU A 317 1 ? 6  
HELX_P HELX_P28 AD1 ASN B 166 ? ILE B 183 ? ASN A 327 ILE A 344 1 ? 18 
HELX_P HELX_P29 AD2 HIS B 184 ? PHE B 186 ? HIS A 345 PHE A 347 5 ? 3  
HELX_P HELX_P30 AD3 SER B 199 ? SER B 211 ? SER A 360 SER A 372 1 ? 13 
HELX_P HELX_P31 AD4 SER B 214 ? PHE B 218 ? SER A 375 PHE A 379 5 ? 5  
HELX_P HELX_P32 AD5 SER B 236 ? VAL B 251 ? SER A 397 VAL A 412 1 ? 16 
HELX_P HELX_P33 AD6 LYS B 259 ? LYS B 270 ? LYS A 420 LYS A 431 1 ? 12 
HELX_P HELX_P34 AD7 ASP B 271 ? ASN B 278 ? ASP A 432 ASN A 439 1 ? 8  
HELX_P HELX_P35 AD8 THR B 302 ? SER B 309 ? THR A 463 SER A 470 1 ? 8  
HELX_P HELX_P36 AD9 GLY B 326 ? TYR B 333 ? GLY A 487 TYR A 494 1 ? 8  
HELX_P HELX_P37 AE1 THR B 347 ? ASN B 359 ? THR A 508 ASN A 520 1 ? 13 
HELX_P HELX_P38 AE2 GLY B 364 ? TYR B 374 ? GLY A 525 TYR A 535 1 ? 11 
HELX_P HELX_P39 AE3 ASN B 382 ? PHE B 399 ? ASN A 543 PHE A 560 1 ? 18 
HELX_P HELX_P40 AE4 PHE B 399 ? GLU B 412 ? PHE A 560 GLU A 573 1 ? 14 
HELX_P HELX_P41 AE5 PRO B 432 ? GLY B 436 ? PRO A 593 GLY A 597 5 ? 5  
HELX_P HELX_P42 AE6 GLU B 442 ? PHE B 447 ? GLU A 603 PHE A 608 1 ? 6  
HELX_P HELX_P43 AE7 THR B 458 ? GLY B 479 ? THR A 619 GLY A 640 1 ? 22 
HELX_P HELX_P44 AE8 ARG B 518 ? LYS B 527 ? ARG A 679 LYS A 688 1 ? 10 
HELX_P HELX_P45 AE9 LYS B 527 ? THR B 536 ? LYS A 688 THR A 697 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? B CYS 228 B CYS 255 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf2 disulf ?    ? A CYS 253 SG  ? ? ? 1_555 A CYS 266 SG ? ? B CYS 414 B CYS 427 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf3 disulf ?    ? A CYS 401 SG  ? ? ? 1_555 A CYS 522 SG ? ? B CYS 562 B CYS 683 1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf4 disulf ?    ? B CYS 67  SG  ? ? ? 1_555 B CYS 94  SG ? ? A CYS 228 A CYS 255 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf5 disulf ?    ? B CYS 253 SG  ? ? ? 1_555 B CYS 266 SG ? ? A CYS 414 A CYS 427 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf6 disulf ?    ? B CYS 401 SG  ? ? ? 1_555 B CYS 522 SG ? ? A CYS 562 A CYS 683 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
covale1 covale one  ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? B ASN 220 C NAG 1   1_555 ? ? ? ? ? ? ? 1.972 ? N-Glycosylation 
covale2 covale one  ? B ASN 59  ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 220 D NAG 1   1_555 ? ? ? ? ? ? ? 1.567 ? N-Glycosylation 
covale3 covale both ? C NAG .   O3  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.178 ? ?               
covale4 covale both ? D NAG .   O3  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 103 A . ? ARG 264 B PRO 104 A ? PRO 265 B 1 2.08  
2 GLY 516 A . ? GLY 677 B PRO 517 A ? PRO 678 B 1 2.54  
3 ARG 103 B . ? ARG 264 A PRO 104 B ? PRO 265 A 1 3.02  
4 GLY 516 B . ? GLY 677 A PRO 517 B ? PRO 678 A 1 -0.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 3  ? 
AA6 ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA4 1  2  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? parallel      
AA6 5  6  ? parallel      
AA6 6  7  ? parallel      
AA6 7  8  ? parallel      
AA6 8  9  ? parallel      
AA6 9  10 ? parallel      
AA6 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 6   ? VAL A 7   ? VAL B 167 VAL B 168 
AA1 2  ARG A 13  ? ARG A 15  ? ARG B 174 ARG B 176 
AA1 3  VAL A 57  ? ASN A 59  ? VAL B 218 ASN B 220 
AA2 1  ILE A 17  ? ASP A 20  ? ILE B 178 ASP B 181 
AA2 2  LYS A 26  ? PRO A 34  ? LYS B 187 PRO B 195 
AA2 3  TYR A 96  ? PRO A 102 ? TYR B 257 PRO B 263 
AA2 4  ILE A 142 ? LEU A 146 ? ILE B 303 LEU B 307 
AA2 5  ALA A 109 ? ILE A 115 ? ALA B 270 ILE B 276 
AA2 6  GLY A 188 ? GLU A 198 ? GLY B 349 GLU B 359 
AA2 7  ARG A 220 ? GLN A 224 ? ARG B 381 GLN B 385 
AA2 8  ILE A 317 ? ASN A 322 ? ILE B 478 ASN B 483 
AA2 9  VAL A 417 ? TYR A 422 ? VAL B 578 TYR B 583 
AA2 10 HIS A 502 ? LEU A 506 ? HIS B 663 LEU B 667 
AA2 11 VAL A 513 ? ARG A 515 ? VAL B 674 ARG B 676 
AA3 1  ALA A 36  ? GLN A 37  ? ALA B 197 GLN B 198 
AA3 2  ARG A 49  ? PRO A 50  ? ARG B 210 PRO B 211 
AA4 1  SER A 66  ? CYS A 67  ? SER B 227 CYS B 228 
AA4 2  LEU A 90  ? SER A 91  ? LEU B 251 SER B 252 
AA5 1  VAL B 6   ? THR B 9   ? VAL A 167 THR A 170 
AA5 2  GLY B 12  ? ARG B 15  ? GLY A 173 ARG A 176 
AA5 3  VAL B 57  ? ASN B 59  ? VAL A 218 ASN A 220 
AA6 1  ILE B 17  ? ASP B 20  ? ILE A 178 ASP A 181 
AA6 2  LYS B 26  ? PRO B 34  ? LYS A 187 PRO A 195 
AA6 3  TYR B 96  ? PRO B 102 ? TYR A 257 PRO A 263 
AA6 4  ILE B 142 ? LEU B 146 ? ILE A 303 LEU A 307 
AA6 5  ALA B 109 ? ILE B 115 ? ALA A 270 ILE A 276 
AA6 6  GLY B 188 ? GLU B 198 ? GLY A 349 GLU A 359 
AA6 7  ARG B 220 ? GLN B 224 ? ARG A 381 GLN A 385 
AA6 8  ILE B 317 ? ASN B 322 ? ILE A 478 ASN A 483 
AA6 9  VAL B 417 ? TYR B 422 ? VAL A 578 TYR A 583 
AA6 10 HIS B 502 ? LEU B 506 ? HIS A 663 LEU A 667 
AA6 11 VAL B 513 ? ARG B 515 ? VAL A 674 ARG A 676 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 7   ? N VAL B 168 O ILE A 14  ? O ILE B 175 
AA1 2  3  N ARG A 15  ? N ARG B 176 O LEU A 58  ? O LEU B 219 
AA2 1  2  N VAL A 19  ? N VAL B 180 O VAL A 27  ? O VAL B 188 
AA2 2  3  N ASP A 28  ? N ASP B 189 O ALA A 101 ? O ALA B 262 
AA2 3  4  N ASN A 98  ? N ASN B 259 O SER A 145 ? O SER B 306 
AA2 4  5  O VAL A 144 ? O VAL B 305 N TRP A 114 ? N TRP B 275 
AA2 5  6  N VAL A 111 ? N VAL B 272 O THR A 194 ? O THR B 355 
AA2 6  7  N LEU A 195 ? N LEU B 356 O ILE A 222 ? O ILE B 383 
AA2 7  8  N LEU A 223 ? N LEU B 384 O LEU A 318 ? O LEU B 479 
AA2 8  9  N SER A 321 ? N SER B 482 O TYR A 422 ? O TYR B 583 
AA2 9  10 N LEU A 421 ? N LEU B 582 O LEU A 506 ? O LEU B 667 
AA2 10 11 N TYR A 503 ? N TYR B 664 O GLY A 514 ? O GLY B 675 
AA3 1  2  N GLN A 37  ? N GLN B 198 O ARG A 49  ? O ARG B 210 
AA4 1  2  N SER A 66  ? N SER B 227 O SER A 91  ? O SER B 252 
AA5 1  2  N VAL B 7   ? N VAL A 168 O ILE B 14  ? O ILE A 175 
AA5 2  3  N ARG B 15  ? N ARG A 176 O LEU B 58  ? O LEU A 219 
AA6 1  2  N VAL B 19  ? N VAL A 180 O VAL B 27  ? O VAL A 188 
AA6 2  3  N ASP B 28  ? N ASP A 189 O ALA B 101 ? O ALA A 262 
AA6 3  4  N ASN B 98  ? N ASN A 259 O SER B 145 ? O SER A 306 
AA6 4  5  O VAL B 144 ? O VAL A 305 N TRP B 114 ? N TRP A 275 
AA6 5  6  N VAL B 111 ? N VAL A 272 O THR B 194 ? O THR A 355 
AA6 6  7  N LEU B 195 ? N LEU A 356 O ILE B 222 ? O ILE A 383 
AA6 7  8  N LEU B 223 ? N LEU A 384 O LEU B 318 ? O LEU A 479 
AA6 8  9  N SER B 321 ? N SER A 482 O TYR B 422 ? O TYR A 583 
AA6 9  10 N LEU B 421 ? N LEU A 582 O LEU B 506 ? O LEU A 667 
AA6 10 11 N TYR B 503 ? N TYR A 664 O GLY B 514 ? O GLY A 675 
# 
_database_PDB_matrix.entry_id          5X61 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5X61 
_atom_sites.fract_transf_matrix[1][1]   0.006724 
_atom_sites.fract_transf_matrix[1][2]   0.003882 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007764 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004429 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? -37.313  5.609   105.552 1.00 107.54 ? 162 ASP B N   1 
ATOM   2    C CA  . ASP A 1 1   ? -37.205  4.259   106.177 1.00 109.92 ? 162 ASP B CA  1 
ATOM   3    C C   . ASP A 1 1   ? -36.348  3.332   105.312 1.00 112.84 ? 162 ASP B C   1 
ATOM   4    O O   . ASP A 1 1   ? -36.297  3.484   104.089 1.00 114.11 ? 162 ASP B O   1 
ATOM   5    C CB  . ASP A 1 1   ? -38.600  3.658   106.390 1.00 107.11 ? 162 ASP B CB  1 
ATOM   6    C CG  . ASP A 1 1   ? -38.732  2.926   107.720 1.00 104.59 ? 162 ASP B CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? -37.815  2.161   108.092 1.00 104.17 ? 162 ASP B OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? -39.767  3.114   108.394 1.00 101.96 ? 162 ASP B OD2 1 
ATOM   9    N N   . ASN A 1 2   ? -35.675  2.378   105.956 1.00 115.17 ? 163 ASN B N   1 
ATOM   10   C CA  . ASN A 1 2   ? -34.807  1.423   105.258 1.00 114.48 ? 163 ASN B CA  1 
ATOM   11   C C   . ASN A 1 2   ? -35.160  -0.047  105.530 1.00 112.66 ? 163 ASN B C   1 
ATOM   12   O O   . ASN A 1 2   ? -34.389  -0.954  105.198 1.00 113.93 ? 163 ASN B O   1 
ATOM   13   C CB  . ASN A 1 2   ? -33.324  1.708   105.562 1.00 116.08 ? 163 ASN B CB  1 
ATOM   14   C CG  . ASN A 1 2   ? -32.982  1.587   107.042 1.00 117.50 ? 163 ASN B CG  1 
ATOM   15   O OD1 . ASN A 1 2   ? -33.850  1.684   107.912 1.00 119.38 ? 163 ASN B OD1 1 
ATOM   16   N ND2 . ASN A 1 2   ? -31.702  1.380   107.330 1.00 116.01 ? 163 ASN B ND2 1 
ATOM   17   N N   . ASP A 1 3   ? -36.329  -0.267  106.130 1.00 107.53 ? 164 ASP B N   1 
ATOM   18   C CA  . ASP A 1 3   ? -36.845  -1.609  106.388 1.00 102.81 ? 164 ASP B CA  1 
ATOM   19   C C   . ASP A 1 3   ? -37.709  -2.063  105.204 1.00 100.81 ? 164 ASP B C   1 
ATOM   20   O O   . ASP A 1 3   ? -38.681  -1.391  104.857 1.00 100.95 ? 164 ASP B O   1 
ATOM   21   C CB  . ASP A 1 3   ? -37.649  -1.616  107.696 1.00 100.36 ? 164 ASP B CB  1 
ATOM   22   C CG  . ASP A 1 3   ? -38.176  -2.995  108.069 1.00 100.17 ? 164 ASP B CG  1 
ATOM   23   O OD1 . ASP A 1 3   ? -37.550  -4.015  107.706 1.00 99.32  ? 164 ASP B OD1 1 
ATOM   24   O OD2 . ASP A 1 3   ? -39.224  -3.055  108.746 1.00 100.76 ? 164 ASP B OD2 1 
ATOM   25   N N   . PRO A 1 4   ? -37.344  -3.196  104.565 1.00 98.68  ? 165 PRO B N   1 
ATOM   26   C CA  . PRO A 1 4   ? -38.107  -3.698  103.414 1.00 96.69  ? 165 PRO B CA  1 
ATOM   27   C C   . PRO A 1 4   ? -39.550  -4.087  103.749 1.00 94.70  ? 165 PRO B C   1 
ATOM   28   O O   . PRO A 1 4   ? -40.421  -4.017  102.878 1.00 93.91  ? 165 PRO B O   1 
ATOM   29   C CB  . PRO A 1 4   ? -37.315  -4.937  102.978 1.00 96.93  ? 165 PRO B CB  1 
ATOM   30   C CG  . PRO A 1 4   ? -35.937  -4.711  103.496 1.00 97.15  ? 165 PRO B CG  1 
ATOM   31   C CD  . PRO A 1 4   ? -36.129  -3.997  104.801 1.00 97.94  ? 165 PRO B CD  1 
ATOM   32   N N   . LEU A 1 5   ? -39.792  -4.479  105.000 1.00 91.99  ? 166 LEU B N   1 
ATOM   33   C CA  . LEU A 1 5   ? -41.111  -4.948  105.441 1.00 87.84  ? 166 LEU B CA  1 
ATOM   34   C C   . LEU A 1 5   ? -42.142  -3.834  105.633 1.00 85.28  ? 166 LEU B C   1 
ATOM   35   O O   . LEU A 1 5   ? -43.342  -4.107  105.692 1.00 85.60  ? 166 LEU B O   1 
ATOM   36   C CB  . LEU A 1 5   ? -40.997  -5.798  106.716 1.00 87.99  ? 166 LEU B CB  1 
ATOM   37   C CG  . LEU A 1 5   ? -40.637  -7.290  106.607 1.00 88.97  ? 166 LEU B CG  1 
ATOM   38   C CD1 . LEU A 1 5   ? -41.587  -8.036  105.676 1.00 88.09  ? 166 LEU B CD1 1 
ATOM   39   C CD2 . LEU A 1 5   ? -39.187  -7.507  106.188 1.00 90.41  ? 166 LEU B CD2 1 
ATOM   40   N N   . VAL A 1 6   ? -41.679  -2.590  105.741 1.00 82.84  ? 167 VAL B N   1 
ATOM   41   C CA  . VAL A 1 6   ? -42.590  -1.442  105.742 1.00 80.95  ? 167 VAL B CA  1 
ATOM   42   C C   . VAL A 1 6   ? -42.701  -0.835  104.342 1.00 79.69  ? 167 VAL B C   1 
ATOM   43   O O   . VAL A 1 6   ? -41.703  -0.691  103.632 1.00 78.75  ? 167 VAL B O   1 
ATOM   44   C CB  . VAL A 1 6   ? -42.236  -0.363  106.800 1.00 80.16  ? 167 VAL B CB  1 
ATOM   45   C CG1 . VAL A 1 6   ? -42.447  -0.898  108.209 1.00 79.31  ? 167 VAL B CG1 1 
ATOM   46   C CG2 . VAL A 1 6   ? -40.815  0.154   106.630 1.00 81.85  ? 167 VAL B CG2 1 
ATOM   47   N N   . VAL A 1 7   ? -43.930  -0.509  103.949 1.00 78.94  ? 168 VAL B N   1 
ATOM   48   C CA  . VAL A 1 7   ? -44.211  0.057   102.632 1.00 79.51  ? 168 VAL B CA  1 
ATOM   49   C C   . VAL A 1 7   ? -45.092  1.293   102.797 1.00 81.04  ? 168 VAL B C   1 
ATOM   50   O O   . VAL A 1 7   ? -46.055  1.278   103.567 1.00 82.11  ? 168 VAL B O   1 
ATOM   51   C CB  . VAL A 1 7   ? -44.892  -0.976  101.700 1.00 79.23  ? 168 VAL B CB  1 
ATOM   52   C CG1 . VAL A 1 7   ? -45.384  -0.322  100.417 1.00 78.93  ? 168 VAL B CG1 1 
ATOM   53   C CG2 . VAL A 1 7   ? -43.944  -2.121  101.374 1.00 78.95  ? 168 VAL B CG2 1 
ATOM   54   N N   . ASN A 1 8   ? -44.749  2.360   102.080 1.00 82.84  ? 169 ASN B N   1 
ATOM   55   C CA  . ASN A 1 8   ? -45.473  3.625   102.181 1.00 85.32  ? 169 ASN B CA  1 
ATOM   56   C C   . ASN A 1 8   ? -46.633  3.739   101.196 1.00 84.99  ? 169 ASN B C   1 
ATOM   57   O O   . ASN A 1 8   ? -46.522  4.403   100.163 1.00 84.96  ? 169 ASN B O   1 
ATOM   58   C CB  . ASN A 1 8   ? -44.511  4.810   102.033 1.00 87.46  ? 169 ASN B CB  1 
ATOM   59   C CG  . ASN A 1 8   ? -43.735  5.094   103.306 1.00 89.48  ? 169 ASN B CG  1 
ATOM   60   O OD1 . ASN A 1 8   ? -44.295  5.569   104.297 1.00 90.45  ? 169 ASN B OD1 1 
ATOM   61   N ND2 . ASN A 1 8   ? -42.436  4.813   103.283 1.00 90.33  ? 169 ASN B ND2 1 
ATOM   62   N N   . THR A 1 9   ? -47.744  3.082   101.530 1.00 84.23  ? 170 THR B N   1 
ATOM   63   C CA  . THR A 1 9   ? -48.978  3.169   100.744 1.00 83.25  ? 170 THR B CA  1 
ATOM   64   C C   . THR A 1 9   ? -49.520  4.601   100.747 1.00 82.53  ? 170 THR B C   1 
ATOM   65   O O   . THR A 1 9   ? -49.360  5.326   101.724 1.00 82.81  ? 170 THR B O   1 
ATOM   66   C CB  . THR A 1 9   ? -50.053  2.161   101.229 1.00 82.90  ? 170 THR B CB  1 
ATOM   67   O OG1 . THR A 1 9   ? -51.328  2.503   100.672 1.00 83.77  ? 170 THR B OG1 1 
ATOM   68   C CG2 . THR A 1 9   ? -50.163  2.144   102.751 1.00 81.72  ? 170 THR B CG2 1 
ATOM   69   N N   . ASP A 1 10  ? -50.157  4.998   99.648  1.00 82.14  ? 171 ASP B N   1 
ATOM   70   C CA  . ASP A 1 10  ? -50.610  6.381   99.454  1.00 81.45  ? 171 ASP B CA  1 
ATOM   71   C C   . ASP A 1 10  ? -51.431  6.970   100.611 1.00 80.56  ? 171 ASP B C   1 
ATOM   72   O O   . ASP A 1 10  ? -51.501  8.190   100.758 1.00 82.99  ? 171 ASP B O   1 
ATOM   73   C CB  . ASP A 1 10  ? -51.374  6.519   98.128  1.00 83.74  ? 171 ASP B CB  1 
ATOM   74   C CG  . ASP A 1 10  ? -52.665  5.703   98.092  1.00 86.99  ? 171 ASP B CG  1 
ATOM   75   O OD1 . ASP A 1 10  ? -52.930  4.915   99.029  1.00 87.95  ? 171 ASP B OD1 1 
ATOM   76   O OD2 . ASP A 1 10  ? -53.424  5.852   97.110  1.00 89.28  ? 171 ASP B OD2 1 
ATOM   77   N N   . LYS A 1 11  ? -52.037  6.111   101.427 1.00 78.29  ? 172 LYS B N   1 
ATOM   78   C CA  . LYS A 1 11  ? -52.897  6.568   102.523 1.00 77.54  ? 172 LYS B CA  1 
ATOM   79   C C   . LYS A 1 11  ? -52.287  6.395   103.922 1.00 78.72  ? 172 LYS B C   1 
ATOM   80   O O   . LYS A 1 11  ? -52.871  6.820   104.917 1.00 79.29  ? 172 LYS B O   1 
ATOM   81   C CB  . LYS A 1 11  ? -54.275  5.897   102.443 1.00 76.04  ? 172 LYS B CB  1 
ATOM   82   C CG  . LYS A 1 11  ? -55.114  6.312   101.241 1.00 73.24  ? 172 LYS B CG  1 
ATOM   83   C CD  . LYS A 1 11  ? -55.857  7.616   101.484 1.00 71.01  ? 172 LYS B CD  1 
ATOM   84   C CE  . LYS A 1 11  ? -56.778  7.950   100.323 1.00 69.52  ? 172 LYS B CE  1 
ATOM   85   N NZ  . LYS A 1 11  ? -57.702  9.063   100.667 1.00 66.86  ? 172 LYS B NZ  1 
ATOM   86   N N   . GLY A 1 12  ? -51.109  5.778   103.986 1.00 79.86  ? 173 GLY B N   1 
ATOM   87   C CA  . GLY A 1 12  ? -50.379  5.602   105.245 1.00 81.22  ? 173 GLY B CA  1 
ATOM   88   C C   . GLY A 1 12  ? -49.161  4.720   105.043 1.00 82.48  ? 173 GLY B C   1 
ATOM   89   O O   . GLY A 1 12  ? -48.618  4.649   103.942 1.00 83.42  ? 173 GLY B O   1 
ATOM   90   N N   . ARG A 1 13  ? -48.710  4.055   106.101 1.00 82.00  ? 174 ARG B N   1 
ATOM   91   C CA  . ARG A 1 13  ? -47.698  3.013   105.925 1.00 82.61  ? 174 ARG B CA  1 
ATOM   92   C C   . ARG A 1 13  ? -47.978  1.742   106.715 1.00 81.70  ? 174 ARG B C   1 
ATOM   93   O O   . ARG A 1 13  ? -48.556  1.776   107.805 1.00 82.30  ? 174 ARG B O   1 
ATOM   94   C CB  . ARG A 1 13  ? -46.261  3.516   106.131 1.00 83.82  ? 174 ARG B CB  1 
ATOM   95   C CG  . ARG A 1 13  ? -46.016  4.418   107.326 1.00 84.97  ? 174 ARG B CG  1 
ATOM   96   C CD  . ARG A 1 13  ? -44.519  4.616   107.507 1.00 85.91  ? 174 ARG B CD  1 
ATOM   97   N NE  . ARG A 1 13  ? -44.187  5.972   107.935 1.00 87.77  ? 174 ARG B NE  1 
ATOM   98   C CZ  . ARG A 1 13  ? -44.144  6.377   109.201 1.00 89.20  ? 174 ARG B CZ  1 
ATOM   99   N NH1 . ARG A 1 13  ? -44.414  5.535   110.191 1.00 89.37  ? 174 ARG B NH1 1 
ATOM   100  N NH2 . ARG A 1 13  ? -43.830  7.634   109.479 1.00 90.77  ? 174 ARG B NH2 1 
ATOM   101  N N   . ILE A 1 14  ? -47.557  0.625   106.132 1.00 78.69  ? 175 ILE B N   1 
ATOM   102  C CA  . ILE A 1 14  ? -47.894  -0.699  106.628 1.00 76.55  ? 175 ILE B CA  1 
ATOM   103  C C   . ILE A 1 14  ? -46.647  -1.556  106.813 1.00 76.38  ? 175 ILE B C   1 
ATOM   104  O O   . ILE A 1 14  ? -45.662  -1.394  106.094 1.00 75.61  ? 175 ILE B O   1 
ATOM   105  C CB  . ILE A 1 14  ? -48.885  -1.416  105.681 1.00 75.81  ? 175 ILE B CB  1 
ATOM   106  C CG1 . ILE A 1 14  ? -48.368  -1.404  104.236 1.00 74.57  ? 175 ILE B CG1 1 
ATOM   107  C CG2 . ILE A 1 14  ? -50.262  -0.769  105.765 1.00 75.49  ? 175 ILE B CG2 1 
ATOM   108  C CD1 . ILE A 1 14  ? -48.958  -2.480  103.351 1.00 73.90  ? 175 ILE B CD1 1 
ATOM   109  N N   . ARG A 1 15  ? -46.706  -2.464  107.784 1.00 77.23  ? 176 ARG B N   1 
ATOM   110  C CA  . ARG A 1 15  ? -45.616  -3.393  108.060 1.00 77.92  ? 176 ARG B CA  1 
ATOM   111  C C   . ARG A 1 15  ? -46.074  -4.832  107.872 1.00 76.54  ? 176 ARG B C   1 
ATOM   112  O O   . ARG A 1 15  ? -47.020  -5.283  108.523 1.00 77.56  ? 176 ARG B O   1 
ATOM   113  C CB  . ARG A 1 15  ? -45.097  -3.198  109.485 1.00 82.20  ? 176 ARG B CB  1 
ATOM   114  C CG  . ARG A 1 15  ? -43.841  -3.993  109.817 1.00 85.55  ? 176 ARG B CG  1 
ATOM   115  C CD  . ARG A 1 15  ? -43.353  -3.686  111.223 1.00 87.13  ? 176 ARG B CD  1 
ATOM   116  N NE  . ARG A 1 15  ? -43.125  -2.255  111.415 1.00 89.78  ? 176 ARG B NE  1 
ATOM   117  C CZ  . ARG A 1 15  ? -42.867  -1.682  112.587 1.00 92.80  ? 176 ARG B CZ  1 
ATOM   118  N NH1 . ARG A 1 15  ? -42.793  -2.412  113.691 1.00 95.79  ? 176 ARG B NH1 1 
ATOM   119  N NH2 . ARG A 1 15  ? -42.675  -0.371  112.655 1.00 93.07  ? 176 ARG B NH2 1 
ATOM   120  N N   . GLY A 1 16  ? -45.397  -5.548  106.980 1.00 74.72  ? 177 GLY B N   1 
ATOM   121  C CA  . GLY A 1 16  ? -45.663  -6.963  106.769 1.00 74.19  ? 177 GLY B CA  1 
ATOM   122  C C   . GLY A 1 16  ? -44.698  -7.845  107.535 1.00 74.87  ? 177 GLY B C   1 
ATOM   123  O O   . GLY A 1 16  ? -43.908  -7.358  108.347 1.00 75.58  ? 177 GLY B O   1 
ATOM   124  N N   . ILE A 1 17  ? -44.771  -9.148  107.279 1.00 75.33  ? 178 ILE B N   1 
ATOM   125  C CA  . ILE A 1 17  ? -43.851  -10.114 107.879 1.00 75.75  ? 178 ILE B CA  1 
ATOM   126  C C   . ILE A 1 17  ? -43.348  -11.122 106.855 1.00 76.31  ? 178 ILE B C   1 
ATOM   127  O O   . ILE A 1 17  ? -44.097  -11.560 105.980 1.00 76.66  ? 178 ILE B O   1 
ATOM   128  C CB  . ILE A 1 17  ? -44.471  -10.874 109.076 1.00 75.33  ? 178 ILE B CB  1 
ATOM   129  C CG1 . ILE A 1 17  ? -45.961  -11.159 108.837 1.00 75.23  ? 178 ILE B CG1 1 
ATOM   130  C CG2 . ILE A 1 17  ? -44.238  -10.104 110.370 1.00 76.13  ? 178 ILE B CG2 1 
ATOM   131  C CD1 . ILE A 1 17  ? -46.562  -12.186 109.777 1.00 75.00  ? 178 ILE B CD1 1 
ATOM   132  N N   . THR A 1 18  ? -42.068  -11.471 106.969 1.00 77.04  ? 179 THR B N   1 
ATOM   133  C CA  . THR A 1 18  ? -41.479  -12.545 106.178 1.00 76.46  ? 179 THR B CA  1 
ATOM   134  C C   . THR A 1 18  ? -41.876  -13.878 106.805 1.00 75.62  ? 179 THR B C   1 
ATOM   135  O O   . THR A 1 18  ? -41.757  -14.060 108.018 1.00 74.65  ? 179 THR B O   1 
ATOM   136  C CB  . THR A 1 18  ? -39.942  -12.424 106.101 1.00 76.38  ? 179 THR B CB  1 
ATOM   137  O OG1 . THR A 1 18  ? -39.590  -11.180 105.483 1.00 76.43  ? 179 THR B OG1 1 
ATOM   138  C CG2 . THR A 1 18  ? -39.340  -13.571 105.292 1.00 75.89  ? 179 THR B CG2 1 
ATOM   139  N N   . VAL A 1 19  ? -42.356  -14.795 105.969 1.00 75.37  ? 180 VAL B N   1 
ATOM   140  C CA  . VAL A 1 19  ? -42.873  -16.084 106.422 1.00 74.92  ? 180 VAL B CA  1 
ATOM   141  C C   . VAL A 1 19  ? -42.528  -17.185 105.408 1.00 76.26  ? 180 VAL B C   1 
ATOM   142  O O   . VAL A 1 19  ? -42.321  -16.902 104.226 1.00 75.20  ? 180 VAL B O   1 
ATOM   143  C CB  . VAL A 1 19  ? -44.398  -15.998 106.709 1.00 73.49  ? 180 VAL B CB  1 
ATOM   144  C CG1 . VAL A 1 19  ? -45.183  -15.653 105.450 1.00 72.06  ? 180 VAL B CG1 1 
ATOM   145  C CG2 . VAL A 1 19  ? -44.924  -17.275 107.353 1.00 74.87  ? 180 VAL B CG2 1 
ATOM   146  N N   . ASP A 1 20  ? -42.446  -18.428 105.882 1.00 80.18  ? 181 ASP B N   1 
ATOM   147  C CA  . ASP A 1 20  ? -42.129  -19.578 105.029 1.00 83.54  ? 181 ASP B CA  1 
ATOM   148  C C   . ASP A 1 20  ? -43.342  -20.016 104.216 1.00 84.03  ? 181 ASP B C   1 
ATOM   149  O O   . ASP A 1 20  ? -44.485  -19.831 104.636 1.00 84.91  ? 181 ASP B O   1 
ATOM   150  C CB  . ASP A 1 20  ? -41.648  -20.781 105.856 1.00 85.02  ? 181 ASP B CB  1 
ATOM   151  C CG  . ASP A 1 20  ? -41.009  -20.383 107.173 1.00 86.62  ? 181 ASP B CG  1 
ATOM   152  O OD1 . ASP A 1 20  ? -41.734  -19.912 108.076 1.00 86.96  ? 181 ASP B OD1 1 
ATOM   153  O OD2 . ASP A 1 20  ? -39.782  -20.568 107.312 1.00 87.43  ? 181 ASP B OD2 1 
ATOM   154  N N   . ALA A 1 21  ? -43.079  -20.599 103.053 1.00 85.17  ? 182 ALA B N   1 
ATOM   155  C CA  . ALA A 1 21  ? -44.107  -21.278 102.279 1.00 88.58  ? 182 ALA B CA  1 
ATOM   156  C C   . ALA A 1 21  ? -44.020  -22.774 102.587 1.00 92.13  ? 182 ALA B C   1 
ATOM   157  O O   . ALA A 1 21  ? -43.002  -23.231 103.118 1.00 93.52  ? 182 ALA B O   1 
ATOM   158  C CB  . ALA A 1 21  ? -43.912  -21.016 100.793 1.00 88.06  ? 182 ALA B CB  1 
ATOM   159  N N   . PRO A 1 22  ? -45.086  -23.543 102.272 1.00 94.17  ? 183 PRO B N   1 
ATOM   160  C CA  . PRO A 1 22  ? -45.031  -25.001 102.425 1.00 95.15  ? 183 PRO B CA  1 
ATOM   161  C C   . PRO A 1 22  ? -43.904  -25.644 101.611 1.00 96.19  ? 183 PRO B C   1 
ATOM   162  O O   . PRO A 1 22  ? -43.462  -26.749 101.930 1.00 96.01  ? 183 PRO B O   1 
ATOM   163  C CB  . PRO A 1 22  ? -46.388  -25.456 101.889 1.00 95.02  ? 183 PRO B CB  1 
ATOM   164  C CG  . PRO A 1 22  ? -47.288  -24.296 102.123 1.00 93.73  ? 183 PRO B CG  1 
ATOM   165  C CD  . PRO A 1 22  ? -46.431  -23.093 101.864 1.00 94.02  ? 183 PRO B CD  1 
ATOM   166  N N   . SER A 1 23  ? -43.449  -24.946 100.571 1.00 96.37  ? 184 SER B N   1 
ATOM   167  C CA  . SER A 1 23  ? -42.334  -25.400 99.743  1.00 96.04  ? 184 SER B CA  1 
ATOM   168  C C   . SER A 1 23  ? -40.977  -25.253 100.444 1.00 95.17  ? 184 SER B C   1 
ATOM   169  O O   . SER A 1 23  ? -39.986  -25.852 100.020 1.00 96.46  ? 184 SER B O   1 
ATOM   170  C CB  . SER A 1 23  ? -42.329  -24.650 98.407  1.00 96.54  ? 184 SER B CB  1 
ATOM   171  O OG  . SER A 1 23  ? -42.372  -23.247 98.605  1.00 96.50  ? 184 SER B OG  1 
ATOM   172  N N   . GLY A 1 24  ? -40.944  -24.465 101.517 1.00 92.24  ? 185 GLY B N   1 
ATOM   173  C CA  . GLY A 1 24  ? -39.707  -24.190 102.245 1.00 89.70  ? 185 GLY B CA  1 
ATOM   174  C C   . GLY A 1 24  ? -39.155  -22.811 101.935 1.00 89.45  ? 185 GLY B C   1 
ATOM   175  O O   . GLY A 1 24  ? -38.478  -22.202 102.766 1.00 89.01  ? 185 GLY B O   1 
ATOM   176  N N   . LYS A 1 25  ? -39.449  -22.326 100.729 1.00 88.62  ? 186 LYS B N   1 
ATOM   177  C CA  . LYS A 1 25  ? -39.051  -20.991 100.282 1.00 87.08  ? 186 LYS B CA  1 
ATOM   178  C C   . LYS A 1 25  ? -39.801  -19.920 101.074 1.00 86.00  ? 186 LYS B C   1 
ATOM   179  O O   . LYS A 1 25  ? -40.925  -20.149 101.518 1.00 87.88  ? 186 LYS B O   1 
ATOM   180  C CB  . LYS A 1 25  ? -39.327  -20.837 98.782  1.00 86.86  ? 186 LYS B CB  1 
ATOM   181  C CG  . LYS A 1 25  ? -38.599  -21.852 97.910  1.00 86.94  ? 186 LYS B CG  1 
ATOM   182  C CD  . LYS A 1 25  ? -39.250  -22.007 96.544  1.00 84.37  ? 186 LYS B CD  1 
ATOM   183  C CE  . LYS A 1 25  ? -38.626  -23.161 95.774  1.00 81.48  ? 186 LYS B CE  1 
ATOM   184  N NZ  . LYS A 1 25  ? -39.318  -23.414 94.481  1.00 78.12  ? 186 LYS B NZ  1 
ATOM   185  N N   . LYS A 1 26  ? -39.178  -18.758 101.255 1.00 82.83  ? 187 LYS B N   1 
ATOM   186  C CA  . LYS A 1 26  ? -39.782  -17.681 102.046 1.00 81.02  ? 187 LYS B CA  1 
ATOM   187  C C   . LYS A 1 26  ? -40.337  -16.548 101.182 1.00 79.35  ? 187 LYS B C   1 
ATOM   188  O O   . LYS A 1 26  ? -39.816  -16.267 100.102 1.00 79.62  ? 187 LYS B O   1 
ATOM   189  C CB  . LYS A 1 26  ? -38.783  -17.125 103.066 1.00 81.12  ? 187 LYS B CB  1 
ATOM   190  C CG  . LYS A 1 26  ? -38.363  -18.109 104.148 1.00 80.48  ? 187 LYS B CG  1 
ATOM   191  C CD  . LYS A 1 26  ? -37.382  -17.461 105.115 1.00 79.78  ? 187 LYS B CD  1 
ATOM   192  C CE  . LYS A 1 26  ? -36.589  -18.496 105.897 1.00 78.71  ? 187 LYS B CE  1 
ATOM   193  N NZ  . LYS A 1 26  ? -37.423  -19.197 106.910 1.00 78.75  ? 187 LYS B NZ  1 
ATOM   194  N N   . VAL A 1 27  ? -41.402  -15.912 101.669 1.00 76.89  ? 188 VAL B N   1 
ATOM   195  C CA  . VAL A 1 27  ? -42.034  -14.772 100.994 1.00 74.94  ? 188 VAL B CA  1 
ATOM   196  C C   . VAL A 1 27  ? -42.393  -13.667 101.989 1.00 75.03  ? 188 VAL B C   1 
ATOM   197  O O   . VAL A 1 27  ? -42.488  -13.918 103.192 1.00 75.29  ? 188 VAL B O   1 
ATOM   198  C CB  . VAL A 1 27  ? -43.305  -15.183 100.207 1.00 74.27  ? 188 VAL B CB  1 
ATOM   199  C CG1 . VAL A 1 27  ? -42.948  -16.008 98.978  1.00 74.66  ? 188 VAL B CG1 1 
ATOM   200  C CG2 . VAL A 1 27  ? -44.296  -15.922 101.097 1.00 73.75  ? 188 VAL B CG2 1 
ATOM   201  N N   . ASP A 1 28  ? -42.588  -12.451 101.482 1.00 76.20  ? 189 ASP B N   1 
ATOM   202  C CA  . ASP A 1 28  ? -43.037  -11.320 102.300 1.00 76.73  ? 189 ASP B CA  1 
ATOM   203  C C   . ASP A 1 28  ? -44.537  -11.098 102.116 1.00 74.48  ? 189 ASP B C   1 
ATOM   204  O O   . ASP A 1 28  ? -45.008  -10.916 100.990 1.00 74.68  ? 189 ASP B O   1 
ATOM   205  C CB  . ASP A 1 28  ? -42.265  -10.041 101.943 1.00 79.27  ? 189 ASP B CB  1 
ATOM   206  C CG  . ASP A 1 28  ? -40.793  -10.110 102.327 1.00 80.80  ? 189 ASP B CG  1 
ATOM   207  O OD1 . ASP A 1 28  ? -40.197  -11.203 102.243 1.00 83.07  ? 189 ASP B OD1 1 
ATOM   208  O OD2 . ASP A 1 28  ? -40.227  -9.063  102.707 1.00 80.44  ? 189 ASP B OD2 1 
ATOM   209  N N   . VAL A 1 29  ? -45.281  -11.119 103.220 1.00 71.35  ? 190 VAL B N   1 
ATOM   210  C CA  . VAL A 1 29  ? -46.739  -10.964 103.167 1.00 69.22  ? 190 VAL B CA  1 
ATOM   211  C C   . VAL A 1 29  ? -47.227  -9.710  103.897 1.00 67.98  ? 190 VAL B C   1 
ATOM   212  O O   . VAL A 1 29  ? -46.700  -9.344  104.947 1.00 68.24  ? 190 VAL B O   1 
ATOM   213  C CB  . VAL A 1 29  ? -47.498  -12.219 103.688 1.00 68.07  ? 190 VAL B CB  1 
ATOM   214  C CG1 . VAL A 1 29  ? -47.055  -13.471 102.945 1.00 66.67  ? 190 VAL B CG1 1 
ATOM   215  C CG2 . VAL A 1 29  ? -47.320  -12.405 105.189 1.00 67.70  ? 190 VAL B CG2 1 
ATOM   216  N N   . TRP A 1 30  ? -48.226  -9.056  103.314 1.00 66.79  ? 191 TRP B N   1 
ATOM   217  C CA  . TRP A 1 30  ? -48.934  -7.956  103.958 1.00 66.38  ? 191 TRP B CA  1 
ATOM   218  C C   . TRP A 1 30  ? -50.410  -8.322  103.967 1.00 65.47  ? 191 TRP B C   1 
ATOM   219  O O   . TRP A 1 30  ? -51.044  -8.401  102.911 1.00 65.92  ? 191 TRP B O   1 
ATOM   220  C CB  . TRP A 1 30  ? -48.721  -6.643  103.201 1.00 67.66  ? 191 TRP B CB  1 
ATOM   221  C CG  . TRP A 1 30  ? -47.300  -6.160  103.170 1.00 67.69  ? 191 TRP B CG  1 
ATOM   222  C CD1 . TRP A 1 30  ? -46.735  -5.228  103.990 1.00 67.27  ? 191 TRP B CD1 1 
ATOM   223  C CD2 . TRP A 1 30  ? -46.269  -6.577  102.263 1.00 67.85  ? 191 TRP B CD2 1 
ATOM   224  N NE1 . TRP A 1 30  ? -45.415  -5.041  103.657 1.00 67.54  ? 191 TRP B NE1 1 
ATOM   225  C CE2 . TRP A 1 30  ? -45.103  -5.855  102.600 1.00 67.45  ? 191 TRP B CE2 1 
ATOM   226  C CE3 . TRP A 1 30  ? -46.217  -7.490  101.200 1.00 67.97  ? 191 TRP B CE3 1 
ATOM   227  C CZ2 . TRP A 1 30  ? -43.896  -6.020  101.912 1.00 66.73  ? 191 TRP B CZ2 1 
ATOM   228  C CZ3 . TRP A 1 30  ? -45.016  -7.652  100.517 1.00 66.88  ? 191 TRP B CZ3 1 
ATOM   229  C CH2 . TRP A 1 30  ? -43.874  -6.920  100.877 1.00 66.43  ? 191 TRP B CH2 1 
ATOM   230  N N   . LEU A 1 31  ? -50.953  -8.558  105.157 1.00 63.87  ? 192 LEU B N   1 
ATOM   231  C CA  . LEU A 1 31  ? -52.306  -9.095  105.276 1.00 62.37  ? 192 LEU B CA  1 
ATOM   232  C C   . LEU A 1 31  ? -53.266  -8.128  105.956 1.00 61.05  ? 192 LEU B C   1 
ATOM   233  O O   . LEU A 1 31  ? -53.046  -7.715  107.096 1.00 62.15  ? 192 LEU B O   1 
ATOM   234  C CB  . LEU A 1 31  ? -52.296  -10.442 106.014 1.00 62.61  ? 192 LEU B CB  1 
ATOM   235  C CG  . LEU A 1 31  ? -51.237  -11.489 105.644 1.00 62.73  ? 192 LEU B CG  1 
ATOM   236  C CD1 . LEU A 1 31  ? -51.322  -12.680 106.588 1.00 62.45  ? 192 LEU B CD1 1 
ATOM   237  C CD2 . LEU A 1 31  ? -51.355  -11.935 104.192 1.00 61.88  ? 192 LEU B CD2 1 
ATOM   238  N N   . GLY A 1 32  ? -54.333  -7.777  105.245 1.00 58.80  ? 193 GLY B N   1 
ATOM   239  C CA  . GLY A 1 32  ? -55.369  -6.907  105.783 1.00 57.03  ? 193 GLY B CA  1 
ATOM   240  C C   . GLY A 1 32  ? -55.036  -5.434  105.671 1.00 56.07  ? 193 GLY B C   1 
ATOM   241  O O   . GLY A 1 32  ? -55.161  -4.690  106.643 1.00 56.65  ? 193 GLY B O   1 
ATOM   242  N N   . ILE A 1 33  ? -54.604  -5.016  104.484 1.00 54.82  ? 194 ILE B N   1 
ATOM   243  C CA  . ILE A 1 33  ? -54.412  -3.600  104.188 1.00 54.04  ? 194 ILE B CA  1 
ATOM   244  C C   . ILE A 1 33  ? -55.783  -2.993  103.899 1.00 55.10  ? 194 ILE B C   1 
ATOM   245  O O   . ILE A 1 33  ? -56.466  -3.432  102.972 1.00 56.34  ? 194 ILE B O   1 
ATOM   246  C CB  . ILE A 1 33  ? -53.502  -3.384  102.961 1.00 52.86  ? 194 ILE B CB  1 
ATOM   247  C CG1 . ILE A 1 33  ? -52.267  -4.288  103.023 1.00 51.58  ? 194 ILE B CG1 1 
ATOM   248  C CG2 . ILE A 1 33  ? -53.109  -1.915  102.845 1.00 52.80  ? 194 ILE B CG2 1 
ATOM   249  C CD1 . ILE A 1 33  ? -51.621  -4.538  101.677 1.00 50.95  ? 194 ILE B CD1 1 
ATOM   250  N N   . PRO A 1 34  ? -56.195  -1.988  104.693 1.00 55.43  ? 195 PRO B N   1 
ATOM   251  C CA  . PRO A 1 34  ? -57.509  -1.379  104.477 1.00 56.72  ? 195 PRO B CA  1 
ATOM   252  C C   . PRO A 1 34  ? -57.529  -0.509  103.223 1.00 58.27  ? 195 PRO B C   1 
ATOM   253  O O   . PRO A 1 34  ? -56.814  0.493   103.153 1.00 60.41  ? 195 PRO B O   1 
ATOM   254  C CB  . PRO A 1 34  ? -57.727  -0.535  105.738 1.00 56.52  ? 195 PRO B CB  1 
ATOM   255  C CG  . PRO A 1 34  ? -56.358  -0.246  106.253 1.00 56.33  ? 195 PRO B CG  1 
ATOM   256  C CD  . PRO A 1 34  ? -55.463  -1.370  105.814 1.00 55.60  ? 195 PRO B CD  1 
ATOM   257  N N   . TYR A 1 35  ? -58.330  -0.904  102.237 1.00 58.58  ? 196 TYR B N   1 
ATOM   258  C CA  . TYR A 1 35  ? -58.408  -0.165  100.977 1.00 59.10  ? 196 TYR B CA  1 
ATOM   259  C C   . TYR A 1 35  ? -59.645  0.728   100.908 1.00 59.69  ? 196 TYR B C   1 
ATOM   260  O O   . TYR A 1 35  ? -59.774  1.560   100.005 1.00 60.92  ? 196 TYR B O   1 
ATOM   261  C CB  . TYR A 1 35  ? -58.330  -1.116  99.771  1.00 58.99  ? 196 TYR B CB  1 
ATOM   262  C CG  . TYR A 1 35  ? -59.574  -1.940  99.499  1.00 58.80  ? 196 TYR B CG  1 
ATOM   263  C CD1 . TYR A 1 35  ? -59.769  -3.178  100.111 1.00 58.57  ? 196 TYR B CD1 1 
ATOM   264  C CD2 . TYR A 1 35  ? -60.547  -1.490  98.608  1.00 58.87  ? 196 TYR B CD2 1 
ATOM   265  C CE1 . TYR A 1 35  ? -60.901  -3.935  99.851  1.00 57.95  ? 196 TYR B CE1 1 
ATOM   266  C CE2 . TYR A 1 35  ? -61.683  -2.237  98.348  1.00 58.40  ? 196 TYR B CE2 1 
ATOM   267  C CZ  . TYR A 1 35  ? -61.855  -3.458  98.971  1.00 57.84  ? 196 TYR B CZ  1 
ATOM   268  O OH  . TYR A 1 35  ? -62.983  -4.197  98.707  1.00 57.49  ? 196 TYR B OH  1 
ATOM   269  N N   . ALA A 1 36  ? -60.542  0.558   101.874 1.00 59.61  ? 197 ALA B N   1 
ATOM   270  C CA  . ALA A 1 36  ? -61.787  1.314   101.905 1.00 60.57  ? 197 ALA B CA  1 
ATOM   271  C C   . ALA A 1 36  ? -62.232  1.659   103.322 1.00 61.11  ? 197 ALA B C   1 
ATOM   272  O O   . ALA A 1 36  ? -61.905  0.958   104.283 1.00 62.10  ? 197 ALA B O   1 
ATOM   273  C CB  . ALA A 1 36  ? -62.885  0.555   101.175 1.00 60.17  ? 197 ALA B CB  1 
ATOM   274  N N   . GLN A 1 37  ? -62.971  2.759   103.431 1.00 61.04  ? 198 GLN B N   1 
ATOM   275  C CA  . GLN A 1 37  ? -63.654  3.149   104.656 1.00 61.39  ? 198 GLN B CA  1 
ATOM   276  C C   . GLN A 1 37  ? -64.726  2.093   104.960 1.00 60.94  ? 198 GLN B C   1 
ATOM   277  O O   . GLN A 1 37  ? -65.581  1.830   104.107 1.00 62.93  ? 198 GLN B O   1 
ATOM   278  C CB  . GLN A 1 37  ? -64.292  4.523   104.445 1.00 62.01  ? 198 GLN B CB  1 
ATOM   279  C CG  . GLN A 1 37  ? -64.678  5.288   105.700 1.00 61.17  ? 198 GLN B CG  1 
ATOM   280  C CD  . GLN A 1 37  ? -65.421  6.573   105.375 1.00 60.02  ? 198 GLN B CD  1 
ATOM   281  O OE1 . GLN A 1 37  ? -65.106  7.261   104.402 1.00 58.35  ? 198 GLN B OE1 1 
ATOM   282  N NE2 . GLN A 1 37  ? -66.416  6.900   106.188 1.00 60.18  ? 198 GLN B NE2 1 
ATOM   283  N N   . PRO A 1 38  ? -64.676  1.478   106.165 1.00 58.79  ? 199 PRO B N   1 
ATOM   284  C CA  . PRO A 1 38  ? -65.578  0.379   106.532 1.00 57.25  ? 199 PRO B CA  1 
ATOM   285  C C   . PRO A 1 38  ? -67.044  0.720   106.275 1.00 56.92  ? 199 PRO B C   1 
ATOM   286  O O   . PRO A 1 38  ? -67.543  1.713   106.808 1.00 56.63  ? 199 PRO B O   1 
ATOM   287  C CB  . PRO A 1 38  ? -65.322  0.185   108.033 1.00 56.77  ? 199 PRO B CB  1 
ATOM   288  C CG  . PRO A 1 38  ? -64.597  1.409   108.476 1.00 58.15  ? 199 PRO B CG  1 
ATOM   289  C CD  . PRO A 1 38  ? -63.798  1.843   107.287 1.00 58.81  ? 199 PRO B CD  1 
ATOM   290  N N   . PRO A 1 39  ? -67.728  -0.102  105.457 1.00 56.97  ? 200 PRO B N   1 
ATOM   291  C CA  . PRO A 1 39  ? -69.067  0.184   104.940 1.00 57.18  ? 200 PRO B CA  1 
ATOM   292  C C   . PRO A 1 39  ? -70.177  -0.062  105.966 1.00 57.71  ? 200 PRO B C   1 
ATOM   293  O O   . PRO A 1 39  ? -71.112  -0.822  105.705 1.00 57.82  ? 200 PRO B O   1 
ATOM   294  C CB  . PRO A 1 39  ? -69.187  -0.782  103.761 1.00 56.93  ? 200 PRO B CB  1 
ATOM   295  C CG  . PRO A 1 39  ? -68.355  -1.951  104.160 1.00 56.94  ? 200 PRO B CG  1 
ATOM   296  C CD  . PRO A 1 39  ? -67.236  -1.419  105.009 1.00 56.77  ? 200 PRO B CD  1 
ATOM   297  N N   . VAL A 1 40  ? -70.073  0.607   107.112 1.00 58.61  ? 201 VAL B N   1 
ATOM   298  C CA  . VAL A 1 40  ? -70.982  0.390   108.236 1.00 59.24  ? 201 VAL B CA  1 
ATOM   299  C C   . VAL A 1 40  ? -71.915  1.591   108.441 1.00 60.70  ? 201 VAL B C   1 
ATOM   300  O O   . VAL A 1 40  ? -71.606  2.708   108.017 1.00 61.28  ? 201 VAL B O   1 
ATOM   301  C CB  . VAL A 1 40  ? -70.196  0.105   109.539 1.00 58.25  ? 201 VAL B CB  1 
ATOM   302  C CG1 . VAL A 1 40  ? -71.033  -0.721  110.508 1.00 59.22  ? 201 VAL B CG1 1 
ATOM   303  C CG2 . VAL A 1 40  ? -68.893  -0.621  109.235 1.00 57.09  ? 201 VAL B CG2 1 
ATOM   304  N N   . GLY A 1 41  ? -73.058  1.343   109.080 1.00 62.18  ? 202 GLY B N   1 
ATOM   305  C CA  . GLY A 1 41  ? -74.014  2.392   109.435 1.00 63.60  ? 202 GLY B CA  1 
ATOM   306  C C   . GLY A 1 41  ? -74.795  2.908   108.242 1.00 66.06  ? 202 GLY B C   1 
ATOM   307  O O   . GLY A 1 41  ? -75.529  2.147   107.605 1.00 67.08  ? 202 GLY B O   1 
ATOM   308  N N   . PRO A 1 42  ? -74.641  4.210   107.929 1.00 67.20  ? 203 PRO B N   1 
ATOM   309  C CA  . PRO A 1 42  ? -75.308  4.825   106.780 1.00 67.68  ? 203 PRO B CA  1 
ATOM   310  C C   . PRO A 1 42  ? -74.671  4.415   105.452 1.00 68.28  ? 203 PRO B C   1 
ATOM   311  O O   . PRO A 1 42  ? -75.219  4.707   104.387 1.00 68.70  ? 203 PRO B O   1 
ATOM   312  C CB  . PRO A 1 42  ? -75.097  6.322   107.019 1.00 67.68  ? 203 PRO B CB  1 
ATOM   313  C CG  . PRO A 1 42  ? -73.824  6.399   107.790 1.00 67.13  ? 203 PRO B CG  1 
ATOM   314  C CD  . PRO A 1 42  ? -73.818  5.184   108.673 1.00 67.47  ? 203 PRO B CD  1 
ATOM   315  N N   . LEU A 1 43  ? -73.527  3.742   105.528 1.00 68.86  ? 204 LEU B N   1 
ATOM   316  C CA  . LEU A 1 43  ? -72.763  3.373   104.344 1.00 69.26  ? 204 LEU B CA  1 
ATOM   317  C C   . LEU A 1 43  ? -73.056  1.954   103.854 1.00 70.75  ? 204 LEU B C   1 
ATOM   318  O O   . LEU A 1 43  ? -72.484  1.515   102.850 1.00 74.16  ? 204 LEU B O   1 
ATOM   319  C CB  . LEU A 1 43  ? -71.264  3.568   104.597 1.00 68.11  ? 204 LEU B CB  1 
ATOM   320  C CG  . LEU A 1 43  ? -70.806  4.990   104.938 1.00 67.65  ? 204 LEU B CG  1 
ATOM   321  C CD1 . LEU A 1 43  ? -69.365  4.976   105.422 1.00 68.64  ? 204 LEU B CD1 1 
ATOM   322  C CD2 . LEU A 1 43  ? -70.977  5.937   103.758 1.00 66.06  ? 204 LEU B CD2 1 
ATOM   323  N N   . ARG A 1 44  ? -73.942  1.245   104.555 1.00 68.78  ? 205 ARG B N   1 
ATOM   324  C CA  . ARG A 1 44  ? -74.363  -0.096  104.139 1.00 67.09  ? 205 ARG B CA  1 
ATOM   325  C C   . ARG A 1 44  ? -75.140  -0.044  102.822 1.00 65.78  ? 205 ARG B C   1 
ATOM   326  O O   . ARG A 1 44  ? -75.898  0.899   102.580 1.00 65.92  ? 205 ARG B O   1 
ATOM   327  C CB  . ARG A 1 44  ? -75.183  -0.785  105.241 1.00 67.45  ? 205 ARG B CB  1 
ATOM   328  C CG  . ARG A 1 44  ? -75.672  -2.185  104.881 1.00 67.04  ? 205 ARG B CG  1 
ATOM   329  C CD  . ARG A 1 44  ? -75.624  -3.141  106.062 1.00 65.37  ? 205 ARG B CD  1 
ATOM   330  N NE  . ARG A 1 44  ? -76.677  -2.881  107.038 1.00 65.01  ? 205 ARG B NE  1 
ATOM   331  C CZ  . ARG A 1 44  ? -76.728  -3.418  108.254 1.00 65.24  ? 205 ARG B CZ  1 
ATOM   332  N NH1 . ARG A 1 44  ? -75.780  -4.247  108.670 1.00 64.64  ? 205 ARG B NH1 1 
ATOM   333  N NH2 . ARG A 1 44  ? -77.731  -3.120  109.063 1.00 66.66  ? 205 ARG B NH2 1 
ATOM   334  N N   . PHE A 1 45  ? -74.925  -1.060  101.982 1.00 64.38  ? 206 PHE B N   1 
ATOM   335  C CA  . PHE A 1 45  ? -75.531  -1.183  100.642 1.00 65.18  ? 206 PHE B CA  1 
ATOM   336  C C   . PHE A 1 45  ? -74.937  -0.221  99.608  1.00 65.32  ? 206 PHE B C   1 
ATOM   337  O O   . PHE A 1 45  ? -75.135  -0.396  98.402  1.00 66.40  ? 206 PHE B O   1 
ATOM   338  C CB  . PHE A 1 45  ? -77.066  -1.053  100.671 1.00 65.44  ? 206 PHE B CB  1 
ATOM   339  C CG  . PHE A 1 45  ? -77.739  -1.914  101.707 1.00 65.29  ? 206 PHE B CG  1 
ATOM   340  C CD1 . PHE A 1 45  ? -77.510  -3.285  101.756 1.00 65.66  ? 206 PHE B CD1 1 
ATOM   341  C CD2 . PHE A 1 45  ? -78.615  -1.351  102.627 1.00 64.78  ? 206 PHE B CD2 1 
ATOM   342  C CE1 . PHE A 1 45  ? -78.133  -4.074  102.711 1.00 65.46  ? 206 PHE B CE1 1 
ATOM   343  C CE2 . PHE A 1 45  ? -79.242  -2.135  103.582 1.00 64.61  ? 206 PHE B CE2 1 
ATOM   344  C CZ  . PHE A 1 45  ? -79.001  -3.498  103.624 1.00 64.78  ? 206 PHE B CZ  1 
ATOM   345  N N   . ARG A 1 46  ? -74.214  0.788   100.086 1.00 64.64  ? 207 ARG B N   1 
ATOM   346  C CA  . ARG A 1 46  ? -73.664  1.831   99.225  1.00 64.54  ? 207 ARG B CA  1 
ATOM   347  C C   . ARG A 1 46  ? -72.280  1.484   98.708  1.00 63.43  ? 207 ARG B C   1 
ATOM   348  O O   . ARG A 1 46  ? -71.608  0.604   99.244  1.00 64.65  ? 207 ARG B O   1 
ATOM   349  C CB  . ARG A 1 46  ? -73.599  3.160   99.975  1.00 66.49  ? 207 ARG B CB  1 
ATOM   350  C CG  . ARG A 1 46  ? -74.926  3.883   100.099 1.00 67.87  ? 207 ARG B CG  1 
ATOM   351  C CD  . ARG A 1 46  ? -74.777  5.060   101.041 1.00 70.09  ? 207 ARG B CD  1 
ATOM   352  N NE  . ARG A 1 46  ? -75.997  5.853   101.132 1.00 72.75  ? 207 ARG B NE  1 
ATOM   353  C CZ  . ARG A 1 46  ? -76.159  6.883   101.955 1.00 74.79  ? 207 ARG B CZ  1 
ATOM   354  N NH1 . ARG A 1 46  ? -75.176  7.257   102.767 1.00 74.72  ? 207 ARG B NH1 1 
ATOM   355  N NH2 . ARG A 1 46  ? -77.307  7.546   101.967 1.00 77.20  ? 207 ARG B NH2 1 
ATOM   356  N N   . HIS A 1 47  ? -71.863  2.197   97.666  1.00 61.65  ? 208 HIS B N   1 
ATOM   357  C CA  . HIS A 1 47  ? -70.530  2.065   97.092  1.00 60.52  ? 208 HIS B CA  1 
ATOM   358  C C   . HIS A 1 47  ? -69.466  2.439   98.127  1.00 59.20  ? 208 HIS B C   1 
ATOM   359  O O   . HIS A 1 47  ? -69.721  3.272   99.001  1.00 58.41  ? 208 HIS B O   1 
ATOM   360  C CB  . HIS A 1 47  ? -70.413  2.953   95.849  1.00 61.92  ? 208 HIS B CB  1 
ATOM   361  C CG  . HIS A 1 47  ? -71.315  2.544   94.721  1.00 63.20  ? 208 HIS B CG  1 
ATOM   362  N ND1 . HIS A 1 47  ? -72.374  1.676   94.884  1.00 63.26  ? 208 HIS B ND1 1 
ATOM   363  C CD2 . HIS A 1 47  ? -71.328  2.910   93.418  1.00 63.84  ? 208 HIS B CD2 1 
ATOM   364  C CE1 . HIS A 1 47  ? -72.989  1.510   93.726  1.00 63.14  ? 208 HIS B CE1 1 
ATOM   365  N NE2 . HIS A 1 47  ? -72.378  2.254   92.822  1.00 63.56  ? 208 HIS B NE2 1 
ATOM   366  N N   . PRO A 1 48  ? -68.277  1.811   98.047  1.00 58.79  ? 209 PRO B N   1 
ATOM   367  C CA  . PRO A 1 48  ? -67.227  2.074   99.031  1.00 59.55  ? 209 PRO B CA  1 
ATOM   368  C C   . PRO A 1 48  ? -66.575  3.449   98.874  1.00 60.32  ? 209 PRO B C   1 
ATOM   369  O O   . PRO A 1 48  ? -66.521  3.990   97.767  1.00 60.33  ? 209 PRO B O   1 
ATOM   370  C CB  . PRO A 1 48  ? -66.199  0.978   98.739  1.00 58.49  ? 209 PRO B CB  1 
ATOM   371  C CG  . PRO A 1 48  ? -66.383  0.673   97.293  1.00 57.47  ? 209 PRO B CG  1 
ATOM   372  C CD  . PRO A 1 48  ? -67.864  0.782   97.073  1.00 57.87  ? 209 PRO B CD  1 
ATOM   373  N N   . ARG A 1 49  ? -66.096  3.999   99.986  1.00 61.05  ? 210 ARG B N   1 
ATOM   374  C CA  . ARG A 1 49  ? -65.270  5.205   99.974  1.00 61.35  ? 210 ARG B CA  1 
ATOM   375  C C   . ARG A 1 49  ? -63.830  4.786   100.252 1.00 62.49  ? 210 ARG B C   1 
ATOM   376  O O   . ARG A 1 49  ? -63.609  3.831   100.997 1.00 62.77  ? 210 ARG B O   1 
ATOM   377  C CB  . ARG A 1 49  ? -65.724  6.198   101.053 1.00 60.64  ? 210 ARG B CB  1 
ATOM   378  C CG  . ARG A 1 49  ? -67.229  6.336   101.223 1.00 59.28  ? 210 ARG B CG  1 
ATOM   379  C CD  . ARG A 1 49  ? -67.854  7.145   100.104 1.00 58.97  ? 210 ARG B CD  1 
ATOM   380  N NE  . ARG A 1 49  ? -69.137  6.574   99.703  1.00 60.27  ? 210 ARG B NE  1 
ATOM   381  C CZ  . ARG A 1 49  ? -70.324  7.007   100.115 1.00 60.43  ? 210 ARG B CZ  1 
ATOM   382  N NH1 . ARG A 1 49  ? -70.417  8.040   100.944 1.00 61.31  ? 210 ARG B NH1 1 
ATOM   383  N NH2 . ARG A 1 49  ? -71.426  6.403   99.689  1.00 59.46  ? 210 ARG B NH2 1 
ATOM   384  N N   . PRO A 1 50  ? -62.844  5.491   99.661  1.00 63.59  ? 211 PRO B N   1 
ATOM   385  C CA  . PRO A 1 50  ? -61.458  5.200   100.035 1.00 65.01  ? 211 PRO B CA  1 
ATOM   386  C C   . PRO A 1 50  ? -61.257  5.404   101.535 1.00 67.25  ? 211 PRO B C   1 
ATOM   387  O O   . PRO A 1 50  ? -61.961  6.213   102.146 1.00 67.57  ? 211 PRO B O   1 
ATOM   388  C CB  . PRO A 1 50  ? -60.655  6.241   99.249  1.00 64.27  ? 211 PRO B CB  1 
ATOM   389  C CG  . PRO A 1 50  ? -61.525  6.598   98.093  1.00 63.91  ? 211 PRO B CG  1 
ATOM   390  C CD  . PRO A 1 50  ? -62.928  6.528   98.616  1.00 63.78  ? 211 PRO B CD  1 
ATOM   391  N N   . ALA A 1 51  ? -60.321  4.662   102.120 1.00 69.43  ? 212 ALA B N   1 
ATOM   392  C CA  . ALA A 1 51  ? -60.051  4.752   103.554 1.00 72.09  ? 212 ALA B CA  1 
ATOM   393  C C   . ALA A 1 51  ? -59.381  6.077   103.933 1.00 73.55  ? 212 ALA B C   1 
ATOM   394  O O   . ALA A 1 51  ? -58.711  6.702   103.105 1.00 74.83  ? 212 ALA B O   1 
ATOM   395  C CB  . ALA A 1 51  ? -59.199  3.573   104.001 1.00 73.08  ? 212 ALA B CB  1 
ATOM   396  N N   . GLU A 1 52  ? -59.577  6.500   105.182 1.00 73.12  ? 213 GLU B N   1 
ATOM   397  C CA  . GLU A 1 52  ? -58.920  7.695   105.713 1.00 73.73  ? 213 GLU B CA  1 
ATOM   398  C C   . GLU A 1 52  ? -57.436  7.426   105.926 1.00 74.44  ? 213 GLU B C   1 
ATOM   399  O O   . GLU A 1 52  ? -57.038  6.280   106.148 1.00 74.77  ? 213 GLU B O   1 
ATOM   400  C CB  . GLU A 1 52  ? -59.549  8.114   107.042 1.00 75.28  ? 213 GLU B CB  1 
ATOM   401  C CG  . GLU A 1 52  ? -61.037  8.421   106.981 1.00 78.19  ? 213 GLU B CG  1 
ATOM   402  C CD  . GLU A 1 52  ? -61.605  8.827   108.330 1.00 80.20  ? 213 GLU B CD  1 
ATOM   403  O OE1 . GLU A 1 52  ? -61.108  9.812   108.919 1.00 81.01  ? 213 GLU B OE1 1 
ATOM   404  O OE2 . GLU A 1 52  ? -62.555  8.164   108.799 1.00 81.36  ? 213 GLU B OE2 1 
ATOM   405  N N   . LYS A 1 53  ? -56.623  8.480   105.859 1.00 75.92  ? 214 LYS B N   1 
ATOM   406  C CA  . LYS A 1 53  ? -55.187  8.365   106.118 1.00 77.34  ? 214 LYS B CA  1 
ATOM   407  C C   . LYS A 1 53  ? -54.950  7.984   107.573 1.00 78.11  ? 214 LYS B C   1 
ATOM   408  O O   . LYS A 1 53  ? -55.664  8.447   108.464 1.00 78.18  ? 214 LYS B O   1 
ATOM   409  C CB  . LYS A 1 53  ? -54.453  9.680   105.831 1.00 78.55  ? 214 LYS B CB  1 
ATOM   410  C CG  . LYS A 1 53  ? -54.878  10.422  104.576 1.00 82.00  ? 214 LYS B CG  1 
ATOM   411  C CD  . LYS A 1 53  ? -54.286  11.823  104.572 1.00 85.09  ? 214 LYS B CD  1 
ATOM   412  C CE  . LYS A 1 53  ? -55.091  12.773  103.699 1.00 85.56  ? 214 LYS B CE  1 
ATOM   413  N NZ  . LYS A 1 53  ? -54.608  14.176  103.829 1.00 85.60  ? 214 LYS B NZ  1 
ATOM   414  N N   . TRP A 1 54  ? -53.954  7.135   107.810 1.00 78.95  ? 215 TRP B N   1 
ATOM   415  C CA  . TRP A 1 54  ? -53.551  6.802   109.173 1.00 80.30  ? 215 TRP B CA  1 
ATOM   416  C C   . TRP A 1 54  ? -52.123  7.258   109.445 1.00 81.90  ? 215 TRP B C   1 
ATOM   417  O O   . TRP A 1 54  ? -51.258  7.189   108.567 1.00 82.47  ? 215 TRP B O   1 
ATOM   418  C CB  . TRP A 1 54  ? -53.710  5.304   109.463 1.00 80.33  ? 215 TRP B CB  1 
ATOM   419  C CG  . TRP A 1 54  ? -52.914  4.411   108.559 1.00 80.42  ? 215 TRP B CG  1 
ATOM   420  C CD1 . TRP A 1 54  ? -51.605  4.040   108.711 1.00 80.57  ? 215 TRP B CD1 1 
ATOM   421  C CD2 . TRP A 1 54  ? -53.375  3.771   107.365 1.00 80.08  ? 215 TRP B CD2 1 
ATOM   422  N NE1 . TRP A 1 54  ? -51.223  3.214   107.682 1.00 80.27  ? 215 TRP B NE1 1 
ATOM   423  C CE2 . TRP A 1 54  ? -52.290  3.031   106.841 1.00 80.22  ? 215 TRP B CE2 1 
ATOM   424  C CE3 . TRP A 1 54  ? -54.600  3.752   106.684 1.00 79.17  ? 215 TRP B CE3 1 
ATOM   425  C CZ2 . TRP A 1 54  ? -52.393  2.280   105.667 1.00 79.13  ? 215 TRP B CZ2 1 
ATOM   426  C CZ3 . TRP A 1 54  ? -54.702  3.006   105.516 1.00 78.93  ? 215 TRP B CZ3 1 
ATOM   427  C CH2 . TRP A 1 54  ? -53.603  2.279   105.021 1.00 79.25  ? 215 TRP B CH2 1 
ATOM   428  N N   . THR A 1 55  ? -51.896  7.735   110.665 1.00 83.07  ? 216 THR B N   1 
ATOM   429  C CA  . THR A 1 55  ? -50.566  8.136   111.112 1.00 82.85  ? 216 THR B CA  1 
ATOM   430  C C   . THR A 1 55  ? -49.858  6.949   111.760 1.00 82.47  ? 216 THR B C   1 
ATOM   431  O O   . THR A 1 55  ? -50.506  6.023   112.255 1.00 82.92  ? 216 THR B O   1 
ATOM   432  C CB  . THR A 1 55  ? -50.630  9.317   112.104 1.00 83.19  ? 216 THR B CB  1 
ATOM   433  O OG1 . THR A 1 55  ? -51.520  8.997   113.180 1.00 83.44  ? 216 THR B OG1 1 
ATOM   434  C CG2 . THR A 1 55  ? -51.117  10.581  111.406 1.00 83.10  ? 216 THR B CG2 1 
ATOM   435  N N   . GLY A 1 56  ? -48.528  6.981   111.748 1.00 82.08  ? 217 GLY B N   1 
ATOM   436  C CA  . GLY A 1 56  ? -47.719  5.890   112.284 1.00 80.89  ? 217 GLY B CA  1 
ATOM   437  C C   . GLY A 1 56  ? -47.670  4.710   111.333 1.00 79.71  ? 217 GLY B C   1 
ATOM   438  O O   . GLY A 1 56  ? -47.979  4.846   110.147 1.00 80.68  ? 217 GLY B O   1 
ATOM   439  N N   . VAL A 1 57  ? -47.279  3.552   111.855 1.00 78.87  ? 218 VAL B N   1 
ATOM   440  C CA  . VAL A 1 57  ? -47.206  2.331   111.057 1.00 79.58  ? 218 VAL B CA  1 
ATOM   441  C C   . VAL A 1 57  ? -48.332  1.361   111.443 1.00 81.78  ? 218 VAL B C   1 
ATOM   442  O O   . VAL A 1 57  ? -48.746  1.306   112.605 1.00 82.32  ? 218 VAL B O   1 
ATOM   443  C CB  . VAL A 1 57  ? -45.808  1.668   111.159 1.00 78.71  ? 218 VAL B CB  1 
ATOM   444  C CG1 . VAL A 1 57  ? -45.683  0.817   112.420 1.00 79.15  ? 218 VAL B CG1 1 
ATOM   445  C CG2 . VAL A 1 57  ? -45.506  0.849   109.912 1.00 77.46  ? 218 VAL B CG2 1 
ATOM   446  N N   . LEU A 1 58  ? -48.827  0.614   110.459 1.00 82.72  ? 219 LEU B N   1 
ATOM   447  C CA  . LEU A 1 58  ? -49.913  -0.339  110.678 1.00 82.80  ? 219 LEU B CA  1 
ATOM   448  C C   . LEU A 1 58  ? -49.439  -1.780  110.490 1.00 86.12  ? 219 LEU B C   1 
ATOM   449  O O   . LEU A 1 58  ? -48.921  -2.137  109.431 1.00 88.49  ? 219 LEU B O   1 
ATOM   450  C CB  . LEU A 1 58  ? -51.089  -0.028  109.744 1.00 78.75  ? 219 LEU B CB  1 
ATOM   451  C CG  . LEU A 1 58  ? -52.425  -0.744  109.967 1.00 76.62  ? 219 LEU B CG  1 
ATOM   452  C CD1 . LEU A 1 58  ? -53.075  -0.329  111.279 1.00 76.70  ? 219 LEU B CD1 1 
ATOM   453  C CD2 . LEU A 1 58  ? -53.363  -0.471  108.804 1.00 75.75  ? 219 LEU B CD2 1 
ATOM   454  N N   . ASN A 1 59  ? -49.611  -2.595  111.530 1.00 88.55  ? 220 ASN B N   1 
ATOM   455  C CA  . ASN A 1 59  ? -49.277  -4.019  111.487 1.00 90.69  ? 220 ASN B CA  1 
ATOM   456  C C   . ASN A 1 59  ? -50.201  -4.782  110.534 1.00 86.64  ? 220 ASN B C   1 
ATOM   457  O O   . ASN A 1 59  ? -51.323  -5.133  110.905 1.00 88.05  ? 220 ASN B O   1 
ATOM   458  C CB  . ASN A 1 59  ? -49.413  -4.639  112.885 1.00 98.82  ? 220 ASN B CB  1 
ATOM   459  C CG  . ASN A 1 59  ? -48.162  -4.499  113.748 1.00 105.35 ? 220 ASN B CG  1 
ATOM   460  O OD1 . ASN A 1 59  ? -47.744  -5.472  114.380 1.00 108.07 ? 220 ASN B OD1 1 
ATOM   461  N ND2 . ASN A 1 59  ? -47.574  -3.298  113.796 1.00 108.70 ? 220 ASN B ND2 1 
ATOM   462  N N   . THR A 1 60  ? -49.743  -5.036  109.311 1.00 81.32  ? 221 THR B N   1 
ATOM   463  C CA  . THR A 1 60  ? -50.518  -5.856  108.374 1.00 78.38  ? 221 THR B CA  1 
ATOM   464  C C   . THR A 1 60  ? -49.983  -7.285  108.359 1.00 78.07  ? 221 THR B C   1 
ATOM   465  O O   . THR A 1 60  ? -49.423  -7.751  107.361 1.00 78.66  ? 221 THR B O   1 
ATOM   466  C CB  . THR A 1 60  ? -50.552  -5.262  106.949 1.00 77.06  ? 221 THR B CB  1 
ATOM   467  O OG1 . THR A 1 60  ? -49.221  -4.954  106.516 1.00 75.69  ? 221 THR B OG1 1 
ATOM   468  C CG2 . THR A 1 60  ? -51.402  -4.005  106.916 1.00 76.87  ? 221 THR B CG2 1 
ATOM   469  N N   . THR A 1 61  ? -50.175  -7.977  109.478 1.00 76.38  ? 222 THR B N   1 
ATOM   470  C CA  . THR A 1 61  ? -49.538  -9.272  109.712 1.00 75.38  ? 222 THR B CA  1 
ATOM   471  C C   . THR A 1 61  ? -50.523  -10.433 109.866 1.00 74.51  ? 222 THR B C   1 
ATOM   472  O O   . THR A 1 61  ? -50.167  -11.588 109.620 1.00 73.89  ? 222 THR B O   1 
ATOM   473  C CB  . THR A 1 61  ? -48.628  -9.222  110.955 1.00 75.05  ? 222 THR B CB  1 
ATOM   474  O OG1 . THR A 1 61  ? -49.394  -8.808  112.092 1.00 76.07  ? 222 THR B OG1 1 
ATOM   475  C CG2 . THR A 1 61  ? -47.482  -8.241  110.743 1.00 74.77  ? 222 THR B CG2 1 
ATOM   476  N N   . THR A 1 62  ? -51.753  -10.124 110.274 1.00 73.20  ? 223 THR B N   1 
ATOM   477  C CA  . THR A 1 62  ? -52.783  -11.142 110.499 1.00 71.86  ? 223 THR B CA  1 
ATOM   478  C C   . THR A 1 62  ? -53.860  -11.091 109.412 1.00 70.31  ? 223 THR B C   1 
ATOM   479  O O   . THR A 1 62  ? -54.217  -10.001 108.958 1.00 70.75  ? 223 THR B O   1 
ATOM   480  C CB  . THR A 1 62  ? -53.453  -10.982 111.880 1.00 72.23  ? 223 THR B CB  1 
ATOM   481  O OG1 . THR A 1 62  ? -54.164  -9.740  111.930 1.00 73.06  ? 223 THR B OG1 1 
ATOM   482  C CG2 . THR A 1 62  ? -52.417  -11.021 113.000 1.00 72.69  ? 223 THR B CG2 1 
ATOM   483  N N   . PRO A 1 63  ? -54.380  -12.267 108.992 1.00 68.69  ? 224 PRO B N   1 
ATOM   484  C CA  . PRO A 1 63  ? -55.430  -12.329 107.964 1.00 66.25  ? 224 PRO B CA  1 
ATOM   485  C C   . PRO A 1 63  ? -56.694  -11.557 108.364 1.00 63.76  ? 224 PRO B C   1 
ATOM   486  O O   . PRO A 1 63  ? -57.151  -11.682 109.502 1.00 62.87  ? 224 PRO B O   1 
ATOM   487  C CB  . PRO A 1 63  ? -55.723  -13.833 107.838 1.00 66.36  ? 224 PRO B CB  1 
ATOM   488  C CG  . PRO A 1 63  ? -55.171  -14.451 109.078 1.00 67.33  ? 224 PRO B CG  1 
ATOM   489  C CD  . PRO A 1 63  ? -53.980  -13.616 109.435 1.00 68.17  ? 224 PRO B CD  1 
ATOM   490  N N   . PRO A 1 64  ? -57.249  -10.760 107.429 1.00 62.16  ? 225 PRO B N   1 
ATOM   491  C CA  . PRO A 1 64  ? -58.365  -9.842  107.687 1.00 61.66  ? 225 PRO B CA  1 
ATOM   492  C C   . PRO A 1 64  ? -59.686  -10.539 107.989 1.00 61.20  ? 225 PRO B C   1 
ATOM   493  O O   . PRO A 1 64  ? -59.814  -11.741 107.763 1.00 61.39  ? 225 PRO B O   1 
ATOM   494  C CB  . PRO A 1 64  ? -58.489  -9.070  106.372 1.00 61.60  ? 225 PRO B CB  1 
ATOM   495  C CG  . PRO A 1 64  ? -57.955  -10.001 105.341 1.00 61.77  ? 225 PRO B CG  1 
ATOM   496  C CD  . PRO A 1 64  ? -56.815  -10.700 106.020 1.00 61.86  ? 225 PRO B CD  1 
ATOM   497  N N   . ASN A 1 65  ? -60.654  -9.773  108.491 1.00 61.35  ? 226 ASN B N   1 
ATOM   498  C CA  . ASN A 1 65  ? -62.013  -10.267 108.718 1.00 61.88  ? 226 ASN B CA  1 
ATOM   499  C C   . ASN A 1 65  ? -62.689  -10.689 107.421 1.00 61.81  ? 226 ASN B C   1 
ATOM   500  O O   . ASN A 1 65  ? -62.384  -10.164 106.350 1.00 63.07  ? 226 ASN B O   1 
ATOM   501  C CB  . ASN A 1 65  ? -62.871  -9.199  109.404 1.00 61.96  ? 226 ASN B CB  1 
ATOM   502  C CG  . ASN A 1 65  ? -62.449  -8.935  110.835 1.00 62.87  ? 226 ASN B CG  1 
ATOM   503  O OD1 . ASN A 1 65  ? -61.697  -9.707  111.432 1.00 64.98  ? 226 ASN B OD1 1 
ATOM   504  N ND2 . ASN A 1 65  ? -62.938  -7.837  111.397 1.00 63.04  ? 226 ASN B ND2 1 
ATOM   505  N N   . SER A 1 66  ? -63.607  -11.642 107.522 1.00 61.22  ? 227 SER B N   1 
ATOM   506  C CA  . SER A 1 66  ? -64.404  -12.048 106.377 1.00 62.16  ? 227 SER B CA  1 
ATOM   507  C C   . SER A 1 66  ? -65.742  -11.326 106.423 1.00 62.84  ? 227 SER B C   1 
ATOM   508  O O   . SER A 1 66  ? -66.264  -11.054 107.504 1.00 62.97  ? 227 SER B O   1 
ATOM   509  C CB  . SER A 1 66  ? -64.604  -13.560 106.377 1.00 62.77  ? 227 SER B CB  1 
ATOM   510  O OG  . SER A 1 66  ? -63.359  -14.229 106.297 1.00 62.45  ? 227 SER B OG  1 
ATOM   511  N N   . CYS A 1 67  ? -66.288  -11.011 105.250 1.00 63.94  ? 228 CYS B N   1 
ATOM   512  C CA  . CYS A 1 67  ? -67.561  -10.295 105.158 1.00 63.91  ? 228 CYS B CA  1 
ATOM   513  C C   . CYS A 1 67  ? -68.716  -11.140 105.674 1.00 63.30  ? 228 CYS B C   1 
ATOM   514  O O   . CYS A 1 67  ? -68.742  -12.358 105.476 1.00 63.04  ? 228 CYS B O   1 
ATOM   515  C CB  . CYS A 1 67  ? -67.832  -9.832  103.723 1.00 64.56  ? 228 CYS B CB  1 
ATOM   516  S SG  . CYS A 1 67  ? -66.630  -8.645  103.066 1.00 65.87  ? 228 CYS B SG  1 
ATOM   517  N N   . VAL A 1 68  ? -69.661  -10.483 106.345 1.00 63.05  ? 229 VAL B N   1 
ATOM   518  C CA  . VAL A 1 68  ? -70.826  -11.153 106.923 1.00 62.55  ? 229 VAL B CA  1 
ATOM   519  C C   . VAL A 1 68  ? -71.547  -11.957 105.847 1.00 62.13  ? 229 VAL B C   1 
ATOM   520  O O   . VAL A 1 68  ? -71.903  -11.429 104.793 1.00 62.50  ? 229 VAL B O   1 
ATOM   521  C CB  . VAL A 1 68  ? -71.791  -10.152 107.604 1.00 62.55  ? 229 VAL B CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? -73.102  -10.824 107.994 1.00 61.75  ? 229 VAL B CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? -71.138  -9.529  108.827 1.00 63.30  ? 229 VAL B CG2 1 
ATOM   524  N N   . GLN A 1 69  ? -71.731  -13.245 106.124 1.00 62.01  ? 230 GLN B N   1 
ATOM   525  C CA  . GLN A 1 69  ? -72.336  -14.178 105.186 1.00 62.25  ? 230 GLN B CA  1 
ATOM   526  C C   . GLN A 1 69  ? -72.938  -15.368 105.921 1.00 63.34  ? 230 GLN B C   1 
ATOM   527  O O   . GLN A 1 69  ? -72.692  -15.565 107.112 1.00 64.05  ? 230 GLN B O   1 
ATOM   528  C CB  . GLN A 1 69  ? -71.291  -14.671 104.181 1.00 62.41  ? 230 GLN B CB  1 
ATOM   529  C CG  . GLN A 1 69  ? -70.152  -15.473 104.798 1.00 62.10  ? 230 GLN B CG  1 
ATOM   530  C CD  . GLN A 1 69  ? -69.045  -15.776 103.811 1.00 61.97  ? 230 GLN B CD  1 
ATOM   531  O OE1 . GLN A 1 69  ? -68.748  -14.973 102.929 1.00 60.94  ? 230 GLN B OE1 1 
ATOM   532  N NE2 . GLN A 1 69  ? -68.425  -16.937 103.959 1.00 62.94  ? 230 GLN B NE2 1 
ATOM   533  N N   . ILE A 1 70  ? -73.720  -16.157 105.192 1.00 65.17  ? 231 ILE B N   1 
ATOM   534  C CA  . ILE A 1 70  ? -74.289  -17.404 105.700 1.00 66.19  ? 231 ILE B CA  1 
ATOM   535  C C   . ILE A 1 70  ? -73.170  -18.434 105.863 1.00 65.65  ? 231 ILE B C   1 
ATOM   536  O O   . ILE A 1 70  ? -72.192  -18.418 105.114 1.00 66.18  ? 231 ILE B O   1 
ATOM   537  C CB  . ILE A 1 70  ? -75.378  -17.961 104.748 1.00 67.26  ? 231 ILE B CB  1 
ATOM   538  C CG1 . ILE A 1 70  ? -76.289  -16.841 104.219 1.00 69.42  ? 231 ILE B CG1 1 
ATOM   539  C CG2 . ILE A 1 70  ? -76.222  -19.020 105.443 1.00 66.99  ? 231 ILE B CG2 1 
ATOM   540  C CD1 . ILE A 1 70  ? -75.819  -16.174 102.936 1.00 69.70  ? 231 ILE B CD1 1 
ATOM   541  N N   . VAL A 1 71  ? -73.307  -19.311 106.853 1.00 66.32  ? 232 VAL B N   1 
ATOM   542  C CA  . VAL A 1 71  ? -72.342  -20.392 107.056 1.00 68.79  ? 232 VAL B CA  1 
ATOM   543  C C   . VAL A 1 71  ? -72.921  -21.751 106.659 1.00 70.83  ? 232 VAL B C   1 
ATOM   544  O O   . VAL A 1 71  ? -73.973  -22.161 107.161 1.00 72.88  ? 232 VAL B O   1 
ATOM   545  C CB  . VAL A 1 71  ? -71.794  -20.436 108.501 1.00 68.24  ? 232 VAL B CB  1 
ATOM   546  C CG1 . VAL A 1 71  ? -70.637  -19.459 108.659 1.00 68.36  ? 232 VAL B CG1 1 
ATOM   547  C CG2 . VAL A 1 71  ? -72.893  -20.156 109.520 1.00 69.09  ? 232 VAL B CG2 1 
ATOM   548  N N   . ASP A 1 72  ? -72.234  -22.431 105.740 1.00 71.52  ? 233 ASP B N   1 
ATOM   549  C CA  . ASP A 1 72  ? -72.634  -23.760 105.282 1.00 71.34  ? 233 ASP B CA  1 
ATOM   550  C C   . ASP A 1 72  ? -72.494  -24.747 106.427 1.00 70.57  ? 233 ASP B C   1 
ATOM   551  O O   . ASP A 1 72  ? -71.440  -24.833 107.058 1.00 71.24  ? 233 ASP B O   1 
ATOM   552  C CB  . ASP A 1 72  ? -71.786  -24.200 104.082 1.00 73.47  ? 233 ASP B CB  1 
ATOM   553  C CG  . ASP A 1 72  ? -72.080  -25.632 103.634 1.00 75.17  ? 233 ASP B CG  1 
ATOM   554  O OD1 . ASP A 1 72  ? -73.209  -26.133 103.854 1.00 74.58  ? 233 ASP B OD1 1 
ATOM   555  O OD2 . ASP A 1 72  ? -71.171  -26.254 103.045 1.00 75.53  ? 233 ASP B OD2 1 
ATOM   556  N N   . THR A 1 73  ? -73.566  -25.486 106.692 1.00 69.06  ? 234 THR B N   1 
ATOM   557  C CA  . THR A 1 73  ? -73.615  -26.365 107.853 1.00 67.43  ? 234 THR B CA  1 
ATOM   558  C C   . THR A 1 73  ? -74.465  -27.625 107.629 1.00 68.23  ? 234 THR B C   1 
ATOM   559  O O   . THR A 1 73  ? -74.679  -28.403 108.562 1.00 70.20  ? 234 THR B O   1 
ATOM   560  C CB  . THR A 1 73  ? -74.078  -25.591 109.114 1.00 65.72  ? 234 THR B CB  1 
ATOM   561  O OG1 . THR A 1 73  ? -73.935  -26.425 110.267 1.00 66.68  ? 234 THR B OG1 1 
ATOM   562  C CG2 . THR A 1 73  ? -75.536  -25.128 108.992 1.00 65.37  ? 234 THR B CG2 1 
ATOM   563  N N   . VAL A 1 74  ? -74.924  -27.834 106.394 1.00 67.02  ? 235 VAL B N   1 
ATOM   564  C CA  . VAL A 1 74  ? -75.791  -28.980 106.075 1.00 65.22  ? 235 VAL B CA  1 
ATOM   565  C C   . VAL A 1 74  ? -75.052  -30.325 106.131 1.00 64.75  ? 235 VAL B C   1 
ATOM   566  O O   . VAL A 1 74  ? -75.684  -31.377 106.230 1.00 65.26  ? 235 VAL B O   1 
ATOM   567  C CB  . VAL A 1 74  ? -76.544  -28.818 104.725 1.00 64.50  ? 235 VAL B CB  1 
ATOM   568  C CG1 . VAL A 1 74  ? -77.202  -27.447 104.624 1.00 65.77  ? 235 VAL B CG1 1 
ATOM   569  C CG2 . VAL A 1 74  ? -75.622  -29.052 103.541 1.00 64.08  ? 235 VAL B CG2 1 
ATOM   570  N N   . PHE A 1 75  ? -73.723  -30.284 106.070 1.00 64.69  ? 236 PHE B N   1 
ATOM   571  C CA  . PHE A 1 75  ? -72.910  -31.490 106.216 1.00 65.56  ? 236 PHE B CA  1 
ATOM   572  C C   . PHE A 1 75  ? -72.032  -31.432 107.466 1.00 67.26  ? 236 PHE B C   1 
ATOM   573  O O   . PHE A 1 75  ? -71.132  -32.256 107.645 1.00 67.63  ? 236 PHE B O   1 
ATOM   574  C CB  . PHE A 1 75  ? -72.072  -31.750 104.957 1.00 65.35  ? 236 PHE B CB  1 
ATOM   575  C CG  . PHE A 1 75  ? -72.895  -32.020 103.727 1.00 66.02  ? 236 PHE B CG  1 
ATOM   576  C CD1 . PHE A 1 75  ? -73.703  -33.152 103.645 1.00 65.68  ? 236 PHE B CD1 1 
ATOM   577  C CD2 . PHE A 1 75  ? -72.863  -31.144 102.646 1.00 66.46  ? 236 PHE B CD2 1 
ATOM   578  C CE1 . PHE A 1 75  ? -74.467  -33.398 102.515 1.00 65.14  ? 236 PHE B CE1 1 
ATOM   579  C CE2 . PHE A 1 75  ? -73.624  -31.387 101.512 1.00 65.58  ? 236 PHE B CE2 1 
ATOM   580  C CZ  . PHE A 1 75  ? -74.425  -32.516 101.446 1.00 64.93  ? 236 PHE B CZ  1 
ATOM   581  N N   . GLY A 1 76  ? -72.317  -30.458 108.330 1.00 68.07  ? 237 GLY B N   1 
ATOM   582  C CA  . GLY A 1 76  ? -71.627  -30.313 109.609 1.00 70.18  ? 237 GLY B CA  1 
ATOM   583  C C   . GLY A 1 76  ? -70.162  -29.961 109.453 1.00 72.52  ? 237 GLY B C   1 
ATOM   584  O O   . GLY A 1 76  ? -69.807  -29.085 108.662 1.00 74.51  ? 237 GLY B O   1 
ATOM   585  N N   . ASP A 1 77  ? -69.312  -30.656 110.204 1.00 74.29  ? 238 ASP B N   1 
ATOM   586  C CA  . ASP A 1 77  ? -67.869  -30.423 110.166 1.00 76.18  ? 238 ASP B CA  1 
ATOM   587  C C   . ASP A 1 77  ? -67.173  -31.353 109.162 1.00 73.67  ? 238 ASP B C   1 
ATOM   588  O O   . ASP A 1 77  ? -66.174  -32.005 109.480 1.00 73.58  ? 238 ASP B O   1 
ATOM   589  C CB  . ASP A 1 77  ? -67.265  -30.549 111.574 1.00 81.75  ? 238 ASP B CB  1 
ATOM   590  C CG  . ASP A 1 77  ? -67.694  -29.414 112.508 1.00 86.19  ? 238 ASP B CG  1 
ATOM   591  O OD1 . ASP A 1 77  ? -67.748  -28.245 112.060 1.00 88.37  ? 238 ASP B OD1 1 
ATOM   592  O OD2 . ASP A 1 77  ? -67.967  -29.688 113.698 1.00 88.59  ? 238 ASP B OD2 1 
ATOM   593  N N   . PHE A 1 78  ? -67.713  -31.390 107.945 1.00 70.03  ? 239 PHE B N   1 
ATOM   594  C CA  . PHE A 1 78  ? -67.203  -32.226 106.857 1.00 67.11  ? 239 PHE B CA  1 
ATOM   595  C C   . PHE A 1 78  ? -66.174  -31.449 106.023 1.00 66.71  ? 239 PHE B C   1 
ATOM   596  O O   . PHE A 1 78  ? -66.482  -30.366 105.517 1.00 66.90  ? 239 PHE B O   1 
ATOM   597  C CB  . PHE A 1 78  ? -68.385  -32.729 106.008 1.00 64.81  ? 239 PHE B CB  1 
ATOM   598  C CG  . PHE A 1 78  ? -68.001  -33.327 104.679 1.00 63.53  ? 239 PHE B CG  1 
ATOM   599  C CD1 . PHE A 1 78  ? -67.212  -34.471 104.603 1.00 63.33  ? 239 PHE B CD1 1 
ATOM   600  C CD2 . PHE A 1 78  ? -68.474  -32.767 103.496 1.00 62.99  ? 239 PHE B CD2 1 
ATOM   601  C CE1 . PHE A 1 78  ? -66.874  -35.021 103.374 1.00 62.46  ? 239 PHE B CE1 1 
ATOM   602  C CE2 . PHE A 1 78  ? -68.143  -33.315 102.265 1.00 62.18  ? 239 PHE B CE2 1 
ATOM   603  C CZ  . PHE A 1 78  ? -67.341  -34.443 102.205 1.00 61.80  ? 239 PHE B CZ  1 
ATOM   604  N N   . PRO A 1 79  ? -64.942  -31.995 105.893 1.00 65.66  ? 240 PRO B N   1 
ATOM   605  C CA  . PRO A 1 79  ? -63.812  -31.373 105.188 1.00 64.70  ? 240 PRO B CA  1 
ATOM   606  C C   . PRO A 1 79  ? -64.148  -30.769 103.824 1.00 64.27  ? 240 PRO B C   1 
ATOM   607  O O   . PRO A 1 79  ? -63.618  -29.713 103.475 1.00 64.88  ? 240 PRO B O   1 
ATOM   608  C CB  . PRO A 1 79  ? -62.836  -32.536 105.013 1.00 64.55  ? 240 PRO B CB  1 
ATOM   609  C CG  . PRO A 1 79  ? -63.075  -33.383 106.210 1.00 65.16  ? 240 PRO B CG  1 
ATOM   610  C CD  . PRO A 1 79  ? -64.544  -33.272 106.521 1.00 65.52  ? 240 PRO B CD  1 
ATOM   611  N N   . GLY A 1 80  ? -65.014  -31.436 103.065 1.00 64.33  ? 241 GLY B N   1 
ATOM   612  C CA  . GLY A 1 80  ? -65.417  -30.959 101.742 1.00 63.80  ? 241 GLY B CA  1 
ATOM   613  C C   . GLY A 1 80  ? -66.196  -29.659 101.781 1.00 62.52  ? 241 GLY B C   1 
ATOM   614  O O   . GLY A 1 80  ? -66.077  -28.833 100.875 1.00 63.31  ? 241 GLY B O   1 
ATOM   615  N N   . ALA A 1 81  ? -66.984  -29.478 102.837 1.00 61.37  ? 242 ALA B N   1 
ATOM   616  C CA  . ALA A 1 81  ? -67.817  -28.290 103.001 1.00 61.53  ? 242 ALA B CA  1 
ATOM   617  C C   . ALA A 1 81  ? -67.096  -27.164 103.743 1.00 61.64  ? 242 ALA B C   1 
ATOM   618  O O   . ALA A 1 81  ? -67.207  -25.996 103.361 1.00 61.79  ? 242 ALA B O   1 
ATOM   619  C CB  . ALA A 1 81  ? -69.112  -28.650 103.712 1.00 62.21  ? 242 ALA B CB  1 
ATOM   620  N N   . THR A 1 82  ? -66.358  -27.526 104.793 1.00 61.40  ? 243 THR B N   1 
ATOM   621  C CA  . THR A 1 82  ? -65.721  -26.553 105.690 1.00 61.01  ? 243 THR B CA  1 
ATOM   622  C C   . THR A 1 82  ? -64.569  -25.771 105.048 1.00 61.24  ? 243 THR B C   1 
ATOM   623  O O   . THR A 1 82  ? -64.242  -24.666 105.494 1.00 62.53  ? 243 THR B O   1 
ATOM   624  C CB  . THR A 1 82  ? -65.230  -27.207 107.002 1.00 61.00  ? 243 THR B CB  1 
ATOM   625  O OG1 . THR A 1 82  ? -64.324  -28.278 106.705 1.00 61.41  ? 243 THR B OG1 1 
ATOM   626  C CG2 . THR A 1 82  ? -66.403  -27.741 107.815 1.00 60.05  ? 243 THR B CG2 1 
ATOM   627  N N   . MET A 1 83  ? -63.963  -26.337 104.005 1.00 60.02  ? 244 MET B N   1 
ATOM   628  C CA  . MET A 1 83  ? -62.883  -25.661 103.284 1.00 59.16  ? 244 MET B CA  1 
ATOM   629  C C   . MET A 1 83  ? -63.368  -24.403 102.556 1.00 58.52  ? 244 MET B C   1 
ATOM   630  O O   . MET A 1 83  ? -62.561  -23.561 102.162 1.00 58.50  ? 244 MET B O   1 
ATOM   631  C CB  . MET A 1 83  ? -62.185  -26.614 102.308 1.00 60.42  ? 244 MET B CB  1 
ATOM   632  C CG  . MET A 1 83  ? -63.048  -27.097 101.151 1.00 62.04  ? 244 MET B CG  1 
ATOM   633  S SD  . MET A 1 83  ? -62.087  -27.460 99.666  1.00 65.63  ? 244 MET B SD  1 
ATOM   634  C CE  . MET A 1 83  ? -61.187  -28.933 100.165 1.00 64.84  ? 244 MET B CE  1 
ATOM   635  N N   . TRP A 1 84  ? -64.685  -24.287 102.386 1.00 58.18  ? 245 TRP B N   1 
ATOM   636  C CA  . TRP A 1 84  ? -65.298  -23.122 101.747 1.00 57.75  ? 245 TRP B CA  1 
ATOM   637  C C   . TRP A 1 84  ? -65.916  -22.160 102.755 1.00 57.45  ? 245 TRP B C   1 
ATOM   638  O O   . TRP A 1 84  ? -66.266  -21.033 102.405 1.00 58.62  ? 245 TRP B O   1 
ATOM   639  C CB  . TRP A 1 84  ? -66.339  -23.553 100.711 1.00 58.14  ? 245 TRP B CB  1 
ATOM   640  C CG  . TRP A 1 84  ? -65.780  -24.478 99.678  1.00 58.97  ? 245 TRP B CG  1 
ATOM   641  C CD1 . TRP A 1 84  ? -66.114  -25.783 99.483  1.00 58.92  ? 245 TRP B CD1 1 
ATOM   642  C CD2 . TRP A 1 84  ? -64.763  -24.173 98.713  1.00 59.71  ? 245 TRP B CD2 1 
ATOM   643  N NE1 . TRP A 1 84  ? -65.379  -26.312 98.450  1.00 60.28  ? 245 TRP B NE1 1 
ATOM   644  C CE2 . TRP A 1 84  ? -64.540  -25.345 97.961  1.00 60.13  ? 245 TRP B CE2 1 
ATOM   645  C CE3 . TRP A 1 84  ? -64.022  -23.023 98.410  1.00 59.42  ? 245 TRP B CE3 1 
ATOM   646  C CZ2 . TRP A 1 84  ? -63.606  -25.403 96.922  1.00 60.27  ? 245 TRP B CZ2 1 
ATOM   647  C CZ3 . TRP A 1 84  ? -63.094  -23.080 97.380  1.00 59.68  ? 245 TRP B CZ3 1 
ATOM   648  C CH2 . TRP A 1 84  ? -62.896  -24.264 96.648  1.00 60.38  ? 245 TRP B CH2 1 
ATOM   649  N N   . ASN A 1 85  ? -66.047  -22.612 104.000 1.00 56.83  ? 246 ASN B N   1 
ATOM   650  C CA  . ASN A 1 85  ? -66.530  -21.778 105.097 1.00 56.29  ? 246 ASN B CA  1 
ATOM   651  C C   . ASN A 1 85  ? -65.473  -20.779 105.562 1.00 55.80  ? 246 ASN B C   1 
ATOM   652  O O   . ASN A 1 85  ? -64.283  -21.106 105.570 1.00 55.60  ? 246 ASN B O   1 
ATOM   653  C CB  . ASN A 1 85  ? -66.974  -22.647 106.276 1.00 57.07  ? 246 ASN B CB  1 
ATOM   654  C CG  . ASN A 1 85  ? -68.363  -23.223 106.090 1.00 57.28  ? 246 ASN B CG  1 
ATOM   655  O OD1 . ASN A 1 85  ? -69.244  -22.588 105.506 1.00 58.01  ? 246 ASN B OD1 1 
ATOM   656  N ND2 . ASN A 1 85  ? -68.569  -24.428 106.598 1.00 57.22  ? 246 ASN B ND2 1 
ATOM   657  N N   . PRO A 1 86  ? -65.907  -19.566 105.969 1.00 55.26  ? 247 PRO B N   1 
ATOM   658  C CA  . PRO A 1 86  ? -64.992  -18.485 106.351 1.00 54.91  ? 247 PRO B CA  1 
ATOM   659  C C   . PRO A 1 86  ? -64.126  -18.855 107.551 1.00 55.10  ? 247 PRO B C   1 
ATOM   660  O O   . PRO A 1 86  ? -64.634  -19.387 108.539 1.00 55.59  ? 247 PRO B O   1 
ATOM   661  C CB  . PRO A 1 86  ? -65.936  -17.329 106.699 1.00 54.43  ? 247 PRO B CB  1 
ATOM   662  C CG  . PRO A 1 86  ? -67.223  -17.982 107.059 1.00 54.95  ? 247 PRO B CG  1 
ATOM   663  C CD  . PRO A 1 86  ? -67.317  -19.180 106.165 1.00 55.09  ? 247 PRO B CD  1 
ATOM   664  N N   . ASN A 1 87  ? -62.829  -18.577 107.448 1.00 55.55  ? 248 ASN B N   1 
ATOM   665  C CA  . ASN A 1 87  ? -61.858  -18.987 108.461 1.00 56.78  ? 248 ASN B CA  1 
ATOM   666  C C   . ASN A 1 87  ? -61.326  -17.830 109.310 1.00 57.50  ? 248 ASN B C   1 
ATOM   667  O O   . ASN A 1 87  ? -60.314  -17.967 110.002 1.00 57.87  ? 248 ASN B O   1 
ATOM   668  C CB  . ASN A 1 87  ? -60.701  -19.743 107.803 1.00 57.92  ? 248 ASN B CB  1 
ATOM   669  C CG  . ASN A 1 87  ? -59.933  -18.889 106.812 1.00 59.31  ? 248 ASN B CG  1 
ATOM   670  O OD1 . ASN A 1 87  ? -60.520  -18.220 105.963 1.00 60.90  ? 248 ASN B OD1 1 
ATOM   671  N ND2 . ASN A 1 87  ? -58.612  -18.912 106.916 1.00 60.56  ? 248 ASN B ND2 1 
ATOM   672  N N   . THR A 1 88  ? -62.008  -16.690 109.240 1.00 58.55  ? 249 THR B N   1 
ATOM   673  C CA  . THR A 1 88  ? -61.697  -15.531 110.079 1.00 58.97  ? 249 THR B CA  1 
ATOM   674  C C   . THR A 1 88  ? -63.002  -14.934 110.613 1.00 59.55  ? 249 THR B C   1 
ATOM   675  O O   . THR A 1 88  ? -64.064  -15.152 110.020 1.00 60.05  ? 249 THR B O   1 
ATOM   676  C CB  . THR A 1 88  ? -60.915  -14.441 109.311 1.00 59.06  ? 249 THR B CB  1 
ATOM   677  O OG1 . THR A 1 88  ? -61.735  -13.890 108.274 1.00 58.95  ? 249 THR B OG1 1 
ATOM   678  C CG2 . THR A 1 88  ? -59.624  -14.997 108.711 1.00 59.26  ? 249 THR B CG2 1 
ATOM   679  N N   . PRO A 1 89  ? -62.932  -14.188 111.736 1.00 59.45  ? 250 PRO B N   1 
ATOM   680  C CA  . PRO A 1 89  ? -64.120  -13.540 112.300 1.00 60.13  ? 250 PRO B CA  1 
ATOM   681  C C   . PRO A 1 89  ? -64.967  -12.804 111.256 1.00 60.97  ? 250 PRO B C   1 
ATOM   682  O O   . PRO A 1 89  ? -64.432  -12.057 110.431 1.00 61.89  ? 250 PRO B O   1 
ATOM   683  C CB  . PRO A 1 89  ? -63.538  -12.547 113.323 1.00 59.51  ? 250 PRO B CB  1 
ATOM   684  C CG  . PRO A 1 89  ? -62.047  -12.686 113.251 1.00 59.68  ? 250 PRO B CG  1 
ATOM   685  C CD  . PRO A 1 89  ? -61.765  -14.008 112.613 1.00 59.07  ? 250 PRO B CD  1 
ATOM   686  N N   . LEU A 1 90  ? -66.277  -13.039 111.292 1.00 61.47  ? 251 LEU B N   1 
ATOM   687  C CA  . LEU A 1 90  ? -67.216  -12.384 110.386 1.00 61.64  ? 251 LEU B CA  1 
ATOM   688  C C   . LEU A 1 90  ? -67.511  -10.966 110.857 1.00 61.74  ? 251 LEU B C   1 
ATOM   689  O O   . LEU A 1 90  ? -67.918  -10.749 112.000 1.00 61.99  ? 251 LEU B O   1 
ATOM   690  C CB  . LEU A 1 90  ? -68.522  -13.180 110.272 1.00 61.85  ? 251 LEU B CB  1 
ATOM   691  C CG  . LEU A 1 90  ? -68.577  -14.429 109.389 1.00 61.98  ? 251 LEU B CG  1 
ATOM   692  C CD1 . LEU A 1 90  ? -67.869  -15.620 110.026 1.00 62.75  ? 251 LEU B CD1 1 
ATOM   693  C CD2 . LEU A 1 90  ? -70.027  -14.777 109.096 1.00 61.42  ? 251 LEU B CD2 1 
ATOM   694  N N   . SER A 1 91  ? -67.297  -10.004 109.967 1.00 62.40  ? 252 SER B N   1 
ATOM   695  C CA  . SER A 1 91  ? -67.514  -8.597  110.282 1.00 63.07  ? 252 SER B CA  1 
ATOM   696  C C   . SER A 1 91  ? -67.973  -7.814  109.060 1.00 63.55  ? 252 SER B C   1 
ATOM   697  O O   . SER A 1 91  ? -67.565  -8.106  107.934 1.00 65.12  ? 252 SER B O   1 
ATOM   698  C CB  . SER A 1 91  ? -66.236  -7.977  110.845 1.00 62.71  ? 252 SER B CB  1 
ATOM   699  O OG  . SER A 1 91  ? -66.398  -6.586  111.056 1.00 63.32  ? 252 SER B OG  1 
ATOM   700  N N   . GLU A 1 92  ? -68.822  -6.820  109.296 1.00 63.40  ? 253 GLU B N   1 
ATOM   701  C CA  . GLU A 1 92  ? -69.265  -5.911  108.247 1.00 64.35  ? 253 GLU B CA  1 
ATOM   702  C C   . GLU A 1 92  ? -68.078  -5.081  107.767 1.00 63.48  ? 253 GLU B C   1 
ATOM   703  O O   . GLU A 1 92  ? -68.023  -4.664  106.608 1.00 64.88  ? 253 GLU B O   1 
ATOM   704  C CB  . GLU A 1 92  ? -70.369  -5.007  108.779 1.00 67.07  ? 253 GLU B CB  1 
ATOM   705  C CG  . GLU A 1 92  ? -71.371  -4.556  107.732 1.00 70.83  ? 253 GLU B CG  1 
ATOM   706  C CD  . GLU A 1 92  ? -72.654  -4.034  108.352 1.00 74.11  ? 253 GLU B CD  1 
ATOM   707  O OE1 . GLU A 1 92  ? -73.136  -4.635  109.338 1.00 76.39  ? 253 GLU B OE1 1 
ATOM   708  O OE2 . GLU A 1 92  ? -73.188  -3.024  107.854 1.00 75.56  ? 253 GLU B OE2 1 
ATOM   709  N N   . ASP A 1 93  ? -67.135  -4.851  108.679 1.00 60.83  ? 254 ASP B N   1 
ATOM   710  C CA  . ASP A 1 93  ? -65.846  -4.257  108.365 1.00 59.64  ? 254 ASP B CA  1 
ATOM   711  C C   . ASP A 1 93  ? -64.940  -5.372  107.848 1.00 59.86  ? 254 ASP B C   1 
ATOM   712  O O   . ASP A 1 93  ? -64.337  -6.110  108.630 1.00 60.18  ? 254 ASP B O   1 
ATOM   713  C CB  . ASP A 1 93  ? -65.262  -3.601  109.622 1.00 59.27  ? 254 ASP B CB  1 
ATOM   714  C CG  . ASP A 1 93  ? -63.869  -3.021  109.406 1.00 59.44  ? 254 ASP B CG  1 
ATOM   715  O OD1 . ASP A 1 93  ? -63.417  -2.899  108.246 1.00 60.38  ? 254 ASP B OD1 1 
ATOM   716  O OD2 . ASP A 1 93  ? -63.223  -2.678  110.418 1.00 59.18  ? 254 ASP B OD2 1 
ATOM   717  N N   . CYS A 1 94  ? -64.856  -5.488  106.526 1.00 59.87  ? 255 CYS B N   1 
ATOM   718  C CA  . CYS A 1 94  ? -64.158  -6.606  105.895 1.00 59.46  ? 255 CYS B CA  1 
ATOM   719  C C   . CYS A 1 94  ? -63.370  -6.232  104.641 1.00 59.31  ? 255 CYS B C   1 
ATOM   720  O O   . CYS A 1 94  ? -62.646  -7.067  104.097 1.00 60.15  ? 255 CYS B O   1 
ATOM   721  C CB  . CYS A 1 94  ? -65.156  -7.715  105.557 1.00 60.44  ? 255 CYS B CB  1 
ATOM   722  S SG  . CYS A 1 94  ? -66.516  -7.189  104.489 1.00 62.15  ? 255 CYS B SG  1 
ATOM   723  N N   . LEU A 1 95  ? -63.501  -4.984  104.192 1.00 58.33  ? 256 LEU B N   1 
ATOM   724  C CA  . LEU A 1 95  ? -62.874  -4.541  102.944 1.00 57.13  ? 256 LEU B CA  1 
ATOM   725  C C   . LEU A 1 95  ? -61.364  -4.350  103.074 1.00 56.44  ? 256 LEU B C   1 
ATOM   726  O O   . LEU A 1 95  ? -60.885  -3.246  103.334 1.00 56.25  ? 256 LEU B O   1 
ATOM   727  C CB  . LEU A 1 95  ? -63.544  -3.265  102.420 1.00 57.39  ? 256 LEU B CB  1 
ATOM   728  C CG  . LEU A 1 95  ? -65.049  -3.308  102.131 1.00 57.93  ? 256 LEU B CG  1 
ATOM   729  C CD1 . LEU A 1 95  ? -65.542  -1.944  101.673 1.00 58.22  ? 256 LEU B CD1 1 
ATOM   730  C CD2 . LEU A 1 95  ? -65.391  -4.373  101.101 1.00 57.74  ? 256 LEU B CD2 1 
ATOM   731  N N   . TYR A 1 96  ? -60.622  -5.436  102.881 1.00 56.85  ? 257 TYR B N   1 
ATOM   732  C CA  . TYR A 1 96  ? -59.169  -5.425  103.023 1.00 58.00  ? 257 TYR B CA  1 
ATOM   733  C C   . TYR A 1 96  ? -58.485  -6.102  101.842 1.00 59.39  ? 257 TYR B C   1 
ATOM   734  O O   . TYR A 1 96  ? -59.106  -6.884  101.120 1.00 61.38  ? 257 TYR B O   1 
ATOM   735  C CB  . TYR A 1 96  ? -58.756  -6.089  104.342 1.00 58.29  ? 257 TYR B CB  1 
ATOM   736  C CG  . TYR A 1 96  ? -59.228  -5.329  105.562 1.00 59.71  ? 257 TYR B CG  1 
ATOM   737  C CD1 . TYR A 1 96  ? -60.482  -5.580  106.125 1.00 60.53  ? 257 TYR B CD1 1 
ATOM   738  C CD2 . TYR A 1 96  ? -58.431  -4.345  106.145 1.00 59.63  ? 257 TYR B CD2 1 
ATOM   739  C CE1 . TYR A 1 96  ? -60.928  -4.872  107.231 1.00 61.17  ? 257 TYR B CE1 1 
ATOM   740  C CE2 . TYR A 1 96  ? -58.865  -3.633  107.254 1.00 60.30  ? 257 TYR B CE2 1 
ATOM   741  C CZ  . TYR A 1 96  ? -60.112  -3.901  107.792 1.00 61.25  ? 257 TYR B CZ  1 
ATOM   742  O OH  . TYR A 1 96  ? -60.545  -3.198  108.891 1.00 62.19  ? 257 TYR B OH  1 
ATOM   743  N N   . ILE A 1 97  ? -57.209  -5.782  101.643 1.00 59.83  ? 258 ILE B N   1 
ATOM   744  C CA  . ILE A 1 97  ? -56.406  -6.389  100.582 1.00 60.60  ? 258 ILE B CA  1 
ATOM   745  C C   . ILE A 1 97  ? -55.256  -7.195  101.190 1.00 61.34  ? 258 ILE B C   1 
ATOM   746  O O   . ILE A 1 97  ? -54.811  -6.911  102.305 1.00 62.68  ? 258 ILE B O   1 
ATOM   747  C CB  . ILE A 1 97  ? -55.884  -5.324  99.583  1.00 60.65  ? 258 ILE B CB  1 
ATOM   748  C CG1 . ILE A 1 97  ? -57.036  -4.815  98.710  1.00 61.22  ? 258 ILE B CG1 1 
ATOM   749  C CG2 . ILE A 1 97  ? -54.774  -5.884  98.697  1.00 60.73  ? 258 ILE B CG2 1 
ATOM   750  C CD1 . ILE A 1 97  ? -56.665  -3.706  97.748  1.00 61.39  ? 258 ILE B CD1 1 
ATOM   751  N N   . ASN A 1 98  ? -54.806  -8.213  100.461 1.00 61.01  ? 259 ASN B N   1 
ATOM   752  C CA  . ASN A 1 98  ? -53.628  -8.986  100.836 1.00 61.12  ? 259 ASN B CA  1 
ATOM   753  C C   . ASN A 1 98  ? -52.606  -8.979  99.704  1.00 61.59  ? 259 ASN B C   1 
ATOM   754  O O   . ASN A 1 98  ? -52.963  -9.170  98.540  1.00 61.92  ? 259 ASN B O   1 
ATOM   755  C CB  . ASN A 1 98  ? -54.016  -10.423 101.191 1.00 61.85  ? 259 ASN B CB  1 
ATOM   756  C CG  . ASN A 1 98  ? -55.027  -10.494 102.321 1.00 63.14  ? 259 ASN B CG  1 
ATOM   757  O OD1 . ASN A 1 98  ? -54.729  -10.136 103.460 1.00 64.21  ? 259 ASN B OD1 1 
ATOM   758  N ND2 . ASN A 1 98  ? -56.231  -10.963 102.010 1.00 63.08  ? 259 ASN B ND2 1 
ATOM   759  N N   . VAL A 1 99  ? -51.343  -8.736  100.047 1.00 61.45  ? 260 VAL B N   1 
ATOM   760  C CA  . VAL A 1 99  ? -50.258  -8.733  99.062  1.00 61.53  ? 260 VAL B CA  1 
ATOM   761  C C   . VAL A 1 99  ? -49.152  -9.690  99.505  1.00 61.87  ? 260 VAL B C   1 
ATOM   762  O O   . VAL A 1 99  ? -48.687  -9.628  100.645 1.00 61.47  ? 260 VAL B O   1 
ATOM   763  C CB  . VAL A 1 99  ? -49.683  -7.312  98.821  1.00 61.36  ? 260 VAL B CB  1 
ATOM   764  C CG1 . VAL A 1 99  ? -48.602  -7.335  97.750  1.00 61.19  ? 260 VAL B CG1 1 
ATOM   765  C CG2 . VAL A 1 99  ? -50.783  -6.340  98.418  1.00 61.00  ? 260 VAL B CG2 1 
ATOM   766  N N   . VAL A 1 100 ? -48.752  -10.581 98.599  1.00 63.43  ? 261 VAL B N   1 
ATOM   767  C CA  . VAL A 1 100 ? -47.700  -11.568 98.867  1.00 64.43  ? 261 VAL B CA  1 
ATOM   768  C C   . VAL A 1 100 ? -46.609  -11.504 97.793  1.00 65.90  ? 261 VAL B C   1 
ATOM   769  O O   . VAL A 1 100 ? -46.868  -11.755 96.613  1.00 65.24  ? 261 VAL B O   1 
ATOM   770  C CB  . VAL A 1 100 ? -48.276  -13.000 98.969  1.00 62.76  ? 261 VAL B CB  1 
ATOM   771  C CG1 . VAL A 1 100 ? -47.168  -14.017 99.202  1.00 62.72  ? 261 VAL B CG1 1 
ATOM   772  C CG2 . VAL A 1 100 ? -49.308  -13.083 100.082 1.00 62.15  ? 261 VAL B CG2 1 
ATOM   773  N N   . ALA A 1 101 ? -45.391  -11.172 98.218  1.00 67.55  ? 262 ALA B N   1 
ATOM   774  C CA  . ALA A 1 101 ? -44.266  -10.969 97.306  1.00 69.84  ? 262 ALA B CA  1 
ATOM   775  C C   . ALA A 1 101 ? -43.166  -12.016 97.503  1.00 70.98  ? 262 ALA B C   1 
ATOM   776  O O   . ALA A 1 101 ? -42.898  -12.418 98.637  1.00 71.02  ? 262 ALA B O   1 
ATOM   777  C CB  . ALA A 1 101 ? -43.701  -9.568  97.483  1.00 70.59  ? 262 ALA B CB  1 
ATOM   778  N N   . PRO A 1 102 ? -42.519  -12.454 96.401  1.00 71.89  ? 263 PRO B N   1 
ATOM   779  C CA  . PRO A 1 102 ? -41.454  -13.454 96.487  1.00 74.13  ? 263 PRO B CA  1 
ATOM   780  C C   . PRO A 1 102 ? -40.144  -12.877 97.020  1.00 77.57  ? 263 PRO B C   1 
ATOM   781  O O   . PRO A 1 102 ? -39.949  -11.660 97.003  1.00 78.33  ? 263 PRO B O   1 
ATOM   782  C CB  . PRO A 1 102 ? -41.262  -13.904 95.027  1.00 72.61  ? 263 PRO B CB  1 
ATOM   783  C CG  . PRO A 1 102 ? -42.365  -13.274 94.244  1.00 71.38  ? 263 PRO B CG  1 
ATOM   784  C CD  . PRO A 1 102 ? -42.761  -12.054 95.006  1.00 71.31  ? 263 PRO B CD  1 
ATOM   785  N N   . ARG A 1 103 ? -39.266  -13.761 97.496  1.00 81.62  ? 264 ARG B N   1 
ATOM   786  C CA  . ARG A 1 103 ? -37.902  -13.399 97.886  1.00 84.23  ? 264 ARG B CA  1 
ATOM   787  C C   . ARG A 1 103 ? -36.883  -14.021 96.922  1.00 86.19  ? 264 ARG B C   1 
ATOM   788  O O   . ARG A 1 103 ? -36.930  -15.227 96.669  1.00 85.82  ? 264 ARG B O   1 
ATOM   789  C CB  . ARG A 1 103 ? -37.607  -13.837 99.322  1.00 84.03  ? 264 ARG B CB  1 
ATOM   790  C CG  . ARG A 1 103 ? -38.096  -12.873 100.386 1.00 84.35  ? 264 ARG B CG  1 
ATOM   791  C CD  . ARG A 1 103 ? -37.461  -13.191 101.729 1.00 86.53  ? 264 ARG B CD  1 
ATOM   792  N NE  . ARG A 1 103 ? -37.679  -12.132 102.714 1.00 89.54  ? 264 ARG B NE  1 
ATOM   793  C CZ  . ARG A 1 103 ? -36.887  -11.076 102.883 1.00 91.51  ? 264 ARG B CZ  1 
ATOM   794  N NH1 . ARG A 1 103 ? -35.805  -10.912 102.130 1.00 93.17  ? 264 ARG B NH1 1 
ATOM   795  N NH2 . ARG A 1 103 ? -37.181  -10.173 103.811 1.00 92.26  ? 264 ARG B NH2 1 
ATOM   796  N N   . PRO A 1 104 ? -35.956  -13.203 96.382  1.00 87.81  ? 265 PRO B N   1 
ATOM   797  C CA  . PRO A 1 104 ? -35.789  -11.772 96.653  1.00 87.86  ? 265 PRO B CA  1 
ATOM   798  C C   . PRO A 1 104 ? -36.842  -10.921 95.944  1.00 88.31  ? 265 PRO B C   1 
ATOM   799  O O   . PRO A 1 104 ? -37.350  -11.317 94.889  1.00 88.41  ? 265 PRO B O   1 
ATOM   800  C CB  . PRO A 1 104 ? -34.397  -11.474 96.095  1.00 88.34  ? 265 PRO B CB  1 
ATOM   801  C CG  . PRO A 1 104 ? -34.221  -12.456 94.987  1.00 88.36  ? 265 PRO B CG  1 
ATOM   802  C CD  . PRO A 1 104 ? -34.993  -13.688 95.372  1.00 87.71  ? 265 PRO B CD  1 
ATOM   803  N N   . ARG A 1 105 ? -37.163  -9.769  96.531  1.00 87.93  ? 266 ARG B N   1 
ATOM   804  C CA  . ARG A 1 105 ? -38.189  -8.878  95.992  1.00 89.11  ? 266 ARG B CA  1 
ATOM   805  C C   . ARG A 1 105 ? -37.880  -8.452  94.559  1.00 92.08  ? 266 ARG B C   1 
ATOM   806  O O   . ARG A 1 105 ? -36.804  -7.917  94.289  1.00 96.33  ? 266 ARG B O   1 
ATOM   807  C CB  . ARG A 1 105 ? -38.363  -7.646  96.878  1.00 87.07  ? 266 ARG B CB  1 
ATOM   808  C CG  . ARG A 1 105 ? -39.482  -6.716  96.429  1.00 86.99  ? 266 ARG B CG  1 
ATOM   809  C CD  . ARG A 1 105 ? -39.970  -5.861  97.584  1.00 87.63  ? 266 ARG B CD  1 
ATOM   810  N NE  . ARG A 1 105 ? -40.240  -6.684  98.760  1.00 87.86  ? 266 ARG B NE  1 
ATOM   811  C CZ  . ARG A 1 105 ? -40.442  -6.215  99.987  1.00 88.96  ? 266 ARG B CZ  1 
ATOM   812  N NH1 . ARG A 1 105 ? -40.672  -7.060  100.980 1.00 90.66  ? 266 ARG B NH1 1 
ATOM   813  N NH2 . ARG A 1 105 ? -40.409  -4.909  100.227 1.00 88.06  ? 266 ARG B NH2 1 
ATOM   814  N N   . PRO A 1 106 ? -38.824  -8.701  93.634  1.00 92.50  ? 267 PRO B N   1 
ATOM   815  C CA  . PRO A 1 106 ? -38.667  -8.276  92.244  1.00 91.79  ? 267 PRO B CA  1 
ATOM   816  C C   . PRO A 1 106 ? -38.890  -6.773  92.084  1.00 90.73  ? 267 PRO B C   1 
ATOM   817  O O   . PRO A 1 106 ? -39.445  -6.130  92.979  1.00 88.13  ? 267 PRO B O   1 
ATOM   818  C CB  . PRO A 1 106 ? -39.756  -9.064  91.517  1.00 92.71  ? 267 PRO B CB  1 
ATOM   819  C CG  . PRO A 1 106 ? -40.804  -9.293  92.551  1.00 93.03  ? 267 PRO B CG  1 
ATOM   820  C CD  . PRO A 1 106 ? -40.071  -9.459  93.847  1.00 92.75  ? 267 PRO B CD  1 
ATOM   821  N N   . LYS A 1 107 ? -38.454  -6.228  90.952  1.00 91.67  ? 268 LYS B N   1 
ATOM   822  C CA  . LYS A 1 107 ? -38.571  -4.796  90.689  1.00 93.80  ? 268 LYS B CA  1 
ATOM   823  C C   . LYS A 1 107 ? -39.915  -4.466  90.035  1.00 92.24  ? 268 LYS B C   1 
ATOM   824  O O   . LYS A 1 107 ? -40.696  -3.675  90.574  1.00 92.16  ? 268 LYS B O   1 
ATOM   825  C CB  . LYS A 1 107 ? -37.400  -4.307  89.827  1.00 97.41  ? 268 LYS B CB  1 
ATOM   826  C CG  . LYS A 1 107 ? -37.025  -2.848  90.046  1.00 100.26 ? 268 LYS B CG  1 
ATOM   827  C CD  . LYS A 1 107 ? -35.805  -2.451  89.223  1.00 101.46 ? 268 LYS B CD  1 
ATOM   828  C CE  . LYS A 1 107 ? -35.260  -1.089  89.634  1.00 100.50 ? 268 LYS B CE  1 
ATOM   829  N NZ  . LYS A 1 107 ? -36.176  0.037   89.294  1.00 101.06 ? 268 LYS B NZ  1 
ATOM   830  N N   . ASN A 1 108 ? -40.176  -5.079  88.881  1.00 89.14  ? 269 ASN B N   1 
ATOM   831  C CA  . ASN A 1 108 ? -41.432  -4.889  88.153  1.00 87.25  ? 269 ASN B CA  1 
ATOM   832  C C   . ASN A 1 108 ? -42.051  -6.207  87.692  1.00 84.31  ? 269 ASN B C   1 
ATOM   833  O O   . ASN A 1 108 ? -42.237  -6.435  86.493  1.00 84.46  ? 269 ASN B O   1 
ATOM   834  C CB  . ASN A 1 108 ? -41.237  -3.936  86.963  1.00 88.91  ? 269 ASN B CB  1 
ATOM   835  C CG  . ASN A 1 108 ? -41.649  -2.504  87.274  1.00 90.55  ? 269 ASN B CG  1 
ATOM   836  O OD1 . ASN A 1 108 ? -41.545  -1.624  86.419  1.00 90.74  ? 269 ASN B OD1 1 
ATOM   837  N ND2 . ASN A 1 108 ? -42.126  -2.265  88.493  1.00 91.77  ? 269 ASN B ND2 1 
ATOM   838  N N   . ALA A 1 109 ? -42.375  -7.066  88.656  1.00 81.14  ? 270 ALA B N   1 
ATOM   839  C CA  . ALA A 1 109 ? -42.931  -8.389  88.370  1.00 78.35  ? 270 ALA B CA  1 
ATOM   840  C C   . ALA A 1 109 ? -44.388  -8.321  87.931  1.00 76.44  ? 270 ALA B C   1 
ATOM   841  O O   . ALA A 1 109 ? -45.046  -7.287  88.083  1.00 77.26  ? 270 ALA B O   1 
ATOM   842  C CB  . ALA A 1 109 ? -42.793  -9.296  89.581  1.00 77.38  ? 270 ALA B CB  1 
ATOM   843  N N   . ALA A 1 110 ? -44.879  -9.430  87.380  1.00 72.91  ? 271 ALA B N   1 
ATOM   844  C CA  . ALA A 1 110 ? -46.287  -9.572  87.028  1.00 70.02  ? 271 ALA B CA  1 
ATOM   845  C C   . ALA A 1 110 ? -47.140  -9.712  88.289  1.00 68.69  ? 271 ALA B C   1 
ATOM   846  O O   . ALA A 1 110 ? -46.678  -10.224 89.312  1.00 68.58  ? 271 ALA B O   1 
ATOM   847  C CB  . ALA A 1 110 ? -46.488  -10.765 86.109  1.00 69.60  ? 271 ALA B CB  1 
ATOM   848  N N   . VAL A 1 111 ? -48.382  -9.244  88.207  1.00 66.63  ? 272 VAL B N   1 
ATOM   849  C CA  . VAL A 1 111 ? -49.298  -9.256  89.344  1.00 64.35  ? 272 VAL B CA  1 
ATOM   850  C C   . VAL A 1 111 ? -50.490  -10.158 89.037  1.00 63.79  ? 272 VAL B C   1 
ATOM   851  O O   . VAL A 1 111 ? -51.187  -9.957  88.038  1.00 64.23  ? 272 VAL B O   1 
ATOM   852  C CB  . VAL A 1 111 ? -49.795  -7.831  89.684  1.00 63.58  ? 272 VAL B CB  1 
ATOM   853  C CG1 . VAL A 1 111 ? -50.747  -7.848  90.871  1.00 63.15  ? 272 VAL B CG1 1 
ATOM   854  C CG2 . VAL A 1 111 ? -48.625  -6.897  89.955  1.00 62.80  ? 272 VAL B CG2 1 
ATOM   855  N N   . MET A 1 112 ? -50.711  -11.155 89.890  1.00 62.42  ? 273 MET B N   1 
ATOM   856  C CA  . MET A 1 112 ? -51.880  -12.019 89.768  1.00 62.31  ? 273 MET B CA  1 
ATOM   857  C C   . MET A 1 112 ? -52.883  -11.710 90.873  1.00 63.15  ? 273 MET B C   1 
ATOM   858  O O   . MET A 1 112 ? -52.630  -11.976 92.052  1.00 63.89  ? 273 MET B O   1 
ATOM   859  C CB  . MET A 1 112 ? -51.481  -13.494 89.769  1.00 61.49  ? 273 MET B CB  1 
ATOM   860  C CG  . MET A 1 112 ? -50.827  -13.938 88.473  1.00 62.26  ? 273 MET B CG  1 
ATOM   861  S SD  . MET A 1 112 ? -50.547  -15.714 88.372  1.00 65.68  ? 273 MET B SD  1 
ATOM   862  C CE  . MET A 1 112 ? -52.197  -16.314 88.010  1.00 64.57  ? 273 MET B CE  1 
ATOM   863  N N   . LEU A 1 113 ? -54.016  -11.134 90.474  1.00 62.50  ? 274 LEU B N   1 
ATOM   864  C CA  . LEU A 1 113 ? -55.029  -10.669 91.413  1.00 61.85  ? 274 LEU B CA  1 
ATOM   865  C C   . LEU A 1 113 ? -56.190  -11.656 91.493  1.00 62.37  ? 274 LEU B C   1 
ATOM   866  O O   . LEU A 1 113 ? -56.884  -11.890 90.500  1.00 64.06  ? 274 LEU B O   1 
ATOM   867  C CB  . LEU A 1 113 ? -55.532  -9.285  91.000  1.00 61.09  ? 274 LEU B CB  1 
ATOM   868  C CG  . LEU A 1 113 ? -55.803  -8.257  92.102  1.00 61.20  ? 274 LEU B CG  1 
ATOM   869  C CD1 . LEU A 1 113 ? -55.972  -6.882  91.481  1.00 61.76  ? 274 LEU B CD1 1 
ATOM   870  C CD2 . LEU A 1 113 ? -57.015  -8.612  92.950  1.00 61.39  ? 274 LEU B CD2 1 
ATOM   871  N N   . TRP A 1 114 ? -56.394  -12.225 92.680  1.00 61.74  ? 275 TRP B N   1 
ATOM   872  C CA  . TRP A 1 114 ? -57.409  -13.257 92.887  1.00 60.62  ? 275 TRP B CA  1 
ATOM   873  C C   . TRP A 1 114 ? -58.727  -12.722 93.439  1.00 60.65  ? 275 TRP B C   1 
ATOM   874  O O   . TRP A 1 114 ? -58.784  -12.182 94.549  1.00 61.56  ? 275 TRP B O   1 
ATOM   875  C CB  . TRP A 1 114 ? -56.878  -14.373 93.794  1.00 60.14  ? 275 TRP B CB  1 
ATOM   876  C CG  . TRP A 1 114 ? -57.929  -15.387 94.151  1.00 60.48  ? 275 TRP B CG  1 
ATOM   877  C CD1 . TRP A 1 114 ? -58.628  -15.466 95.319  1.00 60.59  ? 275 TRP B CD1 1 
ATOM   878  C CD2 . TRP A 1 114 ? -58.413  -16.453 93.323  1.00 60.98  ? 275 TRP B CD2 1 
ATOM   879  N NE1 . TRP A 1 114 ? -59.508  -16.519 95.276  1.00 60.63  ? 275 TRP B NE1 1 
ATOM   880  C CE2 . TRP A 1 114 ? -59.397  -17.142 94.062  1.00 60.74  ? 275 TRP B CE2 1 
ATOM   881  C CE3 . TRP A 1 114 ? -58.104  -16.898 92.031  1.00 61.89  ? 275 TRP B CE3 1 
ATOM   882  C CZ2 . TRP A 1 114 ? -60.078  -18.252 93.550  1.00 61.87  ? 275 TRP B CZ2 1 
ATOM   883  C CZ3 . TRP A 1 114 ? -58.782  -18.002 91.522  1.00 62.03  ? 275 TRP B CZ3 1 
ATOM   884  C CH2 . TRP A 1 114 ? -59.758  -18.664 92.282  1.00 62.17  ? 275 TRP B CH2 1 
ATOM   885  N N   . ILE A 1 115 ? -59.786  -12.897 92.655  1.00 59.70  ? 276 ILE B N   1 
ATOM   886  C CA  . ILE A 1 115 ? -61.141  -12.609 93.110  1.00 59.00  ? 276 ILE B CA  1 
ATOM   887  C C   . ILE A 1 115 ? -61.837  -13.930 93.444  1.00 59.02  ? 276 ILE B C   1 
ATOM   888  O O   . ILE A 1 115 ? -62.090  -14.751 92.558  1.00 58.69  ? 276 ILE B O   1 
ATOM   889  C CB  . ILE A 1 115 ? -61.939  -11.797 92.063  1.00 58.39  ? 276 ILE B CB  1 
ATOM   890  C CG1 . ILE A 1 115 ? -61.251  -10.450 91.800  1.00 58.51  ? 276 ILE B CG1 1 
ATOM   891  C CG2 . ILE A 1 115 ? -63.376  -11.589 92.524  1.00 57.89  ? 276 ILE B CG2 1 
ATOM   892  C CD1 . ILE A 1 115 ? -61.823  -9.656  90.642  1.00 58.83  ? 276 ILE B CD1 1 
ATOM   893  N N   . PHE A 1 116 ? -62.123  -14.133 94.729  1.00 58.41  ? 277 PHE B N   1 
ATOM   894  C CA  . PHE A 1 116 ? -62.790  -15.348 95.194  1.00 57.68  ? 277 PHE B CA  1 
ATOM   895  C C   . PHE A 1 116 ? -64.234  -15.412 94.715  1.00 57.65  ? 277 PHE B C   1 
ATOM   896  O O   . PHE A 1 116 ? -64.836  -14.387 94.404  1.00 57.97  ? 277 PHE B O   1 
ATOM   897  C CB  . PHE A 1 116 ? -62.728  -15.458 96.721  1.00 58.58  ? 277 PHE B CB  1 
ATOM   898  C CG  . PHE A 1 116 ? -63.531  -14.413 97.451  1.00 59.12  ? 277 PHE B CG  1 
ATOM   899  C CD1 . PHE A 1 116 ? -64.900  -14.577 97.653  1.00 58.99  ? 277 PHE B CD1 1 
ATOM   900  C CD2 . PHE A 1 116 ? -62.913  -13.278 97.966  1.00 59.70  ? 277 PHE B CD2 1 
ATOM   901  C CE1 . PHE A 1 116 ? -65.638  -13.618 98.331  1.00 58.77  ? 277 PHE B CE1 1 
ATOM   902  C CE2 . PHE A 1 116 ? -63.646  -12.318 98.649  1.00 59.63  ? 277 PHE B CE2 1 
ATOM   903  C CZ  . PHE A 1 116 ? -65.010  -12.490 98.834  1.00 59.09  ? 277 PHE B CZ  1 
ATOM   904  N N   . GLY A 1 117 ? -64.790  -16.617 94.669  1.00 58.65  ? 278 GLY B N   1 
ATOM   905  C CA  . GLY A 1 117 ? -66.145  -16.804 94.170  1.00 60.86  ? 278 GLY B CA  1 
ATOM   906  C C   . GLY A 1 117 ? -66.998  -17.744 94.990  1.00 61.98  ? 278 GLY B C   1 
ATOM   907  O O   . GLY A 1 117 ? -66.907  -18.964 94.846  1.00 62.98  ? 278 GLY B O   1 
ATOM   908  N N   . GLY A 1 118 ? -67.840  -17.172 95.845  1.00 62.20  ? 279 GLY B N   1 
ATOM   909  C CA  . GLY A 1 118 ? -68.787  -17.955 96.628  1.00 62.52  ? 279 GLY B CA  1 
ATOM   910  C C   . GLY A 1 118 ? -70.224  -17.774 96.176  1.00 61.90  ? 279 GLY B C   1 
ATOM   911  O O   . GLY A 1 118 ? -71.133  -17.690 97.006  1.00 61.83  ? 279 GLY B O   1 
ATOM   912  N N   . GLY A 1 119 ? -70.427  -17.711 94.861  1.00 60.73  ? 280 GLY B N   1 
ATOM   913  C CA  . GLY A 1 119 ? -71.759  -17.542 94.277  1.00 60.88  ? 280 GLY B CA  1 
ATOM   914  C C   . GLY A 1 119 ? -72.428  -16.215 94.601  1.00 61.32  ? 280 GLY B C   1 
ATOM   915  O O   . GLY A 1 119 ? -73.653  -16.096 94.501  1.00 61.36  ? 280 GLY B O   1 
ATOM   916  N N   . PHE A 1 120 ? -71.619  -15.224 94.986  1.00 61.21  ? 281 PHE B N   1 
ATOM   917  C CA  . PHE A 1 120 ? -72.087  -13.887 95.386  1.00 60.27  ? 281 PHE B CA  1 
ATOM   918  C C   . PHE A 1 120 ? -72.864  -13.842 96.706  1.00 61.23  ? 281 PHE B C   1 
ATOM   919  O O   . PHE A 1 120 ? -73.482  -12.824 97.025  1.00 61.87  ? 281 PHE B O   1 
ATOM   920  C CB  . PHE A 1 120 ? -72.915  -13.224 94.277  1.00 59.47  ? 281 PHE B CB  1 
ATOM   921  C CG  . PHE A 1 120 ? -72.126  -12.875 93.052  1.00 59.09  ? 281 PHE B CG  1 
ATOM   922  C CD1 . PHE A 1 120 ? -71.086  -11.954 93.115  1.00 58.80  ? 281 PHE B CD1 1 
ATOM   923  C CD2 . PHE A 1 120 ? -72.435  -13.454 91.830  1.00 58.76  ? 281 PHE B CD2 1 
ATOM   924  C CE1 . PHE A 1 120 ? -70.359  -11.627 91.982  1.00 58.06  ? 281 PHE B CE1 1 
ATOM   925  C CE2 . PHE A 1 120 ? -71.716  -13.128 90.694  1.00 58.37  ? 281 PHE B CE2 1 
ATOM   926  C CZ  . PHE A 1 120 ? -70.676  -12.214 90.772  1.00 57.77  ? 281 PHE B CZ  1 
ATOM   927  N N   . TYR A 1 121 ? -72.823  -14.929 97.473  1.00 61.13  ? 282 TYR B N   1 
ATOM   928  C CA  . TYR A 1 121 ? -73.480  -14.972 98.779  1.00 60.08  ? 282 TYR B CA  1 
ATOM   929  C C   . TYR A 1 121 ? -72.506  -15.338 99.895  1.00 58.00  ? 282 TYR B C   1 
ATOM   930  O O   . TYR A 1 121 ? -72.791  -15.116 101.075 1.00 57.49  ? 282 TYR B O   1 
ATOM   931  C CB  . TYR A 1 121 ? -74.682  -15.931 98.763  1.00 62.09  ? 282 TYR B CB  1 
ATOM   932  C CG  . TYR A 1 121 ? -74.327  -17.394 98.579  1.00 63.26  ? 282 TYR B CG  1 
ATOM   933  C CD1 . TYR A 1 121 ? -73.991  -18.195 99.672  1.00 63.41  ? 282 TYR B CD1 1 
ATOM   934  C CD2 . TYR A 1 121 ? -74.341  -17.979 97.313  1.00 64.23  ? 282 TYR B CD2 1 
ATOM   935  C CE1 . TYR A 1 121 ? -73.665  -19.531 99.507  1.00 64.52  ? 282 TYR B CE1 1 
ATOM   936  C CE2 . TYR A 1 121 ? -74.019  -19.316 97.139  1.00 65.18  ? 282 TYR B CE2 1 
ATOM   937  C CZ  . TYR A 1 121 ? -73.682  -20.086 98.238  1.00 65.61  ? 282 TYR B CZ  1 
ATOM   938  O OH  . TYR A 1 121 ? -73.362  -21.414 98.072  1.00 67.21  ? 282 TYR B OH  1 
ATOM   939  N N   . SER A 1 122 ? -71.360  -15.897 99.507  1.00 56.28  ? 283 SER B N   1 
ATOM   940  C CA  . SER A 1 122 ? -70.354  -16.383 100.451 1.00 55.53  ? 283 SER B CA  1 
ATOM   941  C C   . SER A 1 122 ? -68.931  -16.187 99.935  1.00 54.76  ? 283 SER B C   1 
ATOM   942  O O   . SER A 1 122 ? -68.725  -15.711 98.819  1.00 55.14  ? 283 SER B O   1 
ATOM   943  C CB  . SER A 1 122 ? -70.588  -17.866 100.750 1.00 55.84  ? 283 SER B CB  1 
ATOM   944  O OG  . SER A 1 122 ? -70.483  -18.641 99.568  1.00 54.70  ? 283 SER B OG  1 
ATOM   945  N N   . GLY A 1 123 ? -67.953  -16.559 100.759 1.00 54.33  ? 284 GLY B N   1 
ATOM   946  C CA  . GLY A 1 123 ? -66.550  -16.542 100.358 1.00 54.49  ? 284 GLY B CA  1 
ATOM   947  C C   . GLY A 1 123 ? -65.675  -15.579 101.137 1.00 54.46  ? 284 GLY B C   1 
ATOM   948  O O   . GLY A 1 123 ? -66.170  -14.680 101.817 1.00 55.70  ? 284 GLY B O   1 
ATOM   949  N N   . THR A 1 124 ? -64.364  -15.778 101.029 1.00 54.23  ? 285 THR B N   1 
ATOM   950  C CA  . THR A 1 124 ? -63.367  -14.905 101.649 1.00 54.07  ? 285 THR B CA  1 
ATOM   951  C C   . THR A 1 124 ? -61.992  -15.146 101.031 1.00 54.46  ? 285 THR B C   1 
ATOM   952  O O   . THR A 1 124 ? -61.691  -16.250 100.575 1.00 54.53  ? 285 THR B O   1 
ATOM   953  C CB  . THR A 1 124 ? -63.304  -15.075 103.188 1.00 53.92  ? 285 THR B CB  1 
ATOM   954  O OG1 . THR A 1 124 ? -62.240  -14.278 103.723 1.00 54.46  ? 285 THR B OG1 1 
ATOM   955  C CG2 . THR A 1 124 ? -63.082  -16.524 103.587 1.00 53.84  ? 285 THR B CG2 1 
ATOM   956  N N   . ALA A 1 125 ? -61.167  -14.104 101.020 1.00 55.26  ? 286 ALA B N   1 
ATOM   957  C CA  . ALA A 1 125 ? -59.814  -14.189 100.478 1.00 56.05  ? 286 ALA B CA  1 
ATOM   958  C C   . ALA A 1 125 ? -58.880  -15.007 101.373 1.00 55.93  ? 286 ALA B C   1 
ATOM   959  O O   . ALA A 1 125 ? -57.810  -15.432 100.936 1.00 56.42  ? 286 ALA B O   1 
ATOM   960  C CB  . ALA A 1 125 ? -59.251  -12.791 100.253 1.00 56.57  ? 286 ALA B CB  1 
ATOM   961  N N   . THR A 1 126 ? -59.303  -15.239 102.613 1.00 56.11  ? 287 THR B N   1 
ATOM   962  C CA  . THR A 1 126 ? -58.452  -15.855 103.632 1.00 57.74  ? 287 THR B CA  1 
ATOM   963  C C   . THR A 1 126 ? -58.457  -17.387 103.652 1.00 58.35  ? 287 THR B C   1 
ATOM   964  O O   . THR A 1 126 ? -57.685  -17.995 104.398 1.00 58.12  ? 287 THR B O   1 
ATOM   965  C CB  . THR A 1 126 ? -58.818  -15.352 105.041 1.00 58.48  ? 287 THR B CB  1 
ATOM   966  O OG1 . THR A 1 126 ? -60.228  -15.492 105.248 1.00 59.26  ? 287 THR B OG1 1 
ATOM   967  C CG2 . THR A 1 126 ? -58.429  -13.894 105.202 1.00 59.51  ? 287 THR B CG2 1 
ATOM   968  N N   . LEU A 1 127 ? -59.318  -18.005 102.844 1.00 58.99  ? 288 LEU B N   1 
ATOM   969  C CA  . LEU A 1 127 ? -59.423  -19.468 102.799 1.00 58.94  ? 288 LEU B CA  1 
ATOM   970  C C   . LEU A 1 127 ? -58.065  -20.114 102.556 1.00 60.86  ? 288 LEU B C   1 
ATOM   971  O O   . LEU A 1 127 ? -57.299  -19.653 101.706 1.00 60.57  ? 288 LEU B O   1 
ATOM   972  C CB  . LEU A 1 127 ? -60.426  -19.920 101.730 1.00 56.89  ? 288 LEU B CB  1 
ATOM   973  C CG  . LEU A 1 127 ? -61.907  -19.578 101.933 1.00 55.35  ? 288 LEU B CG  1 
ATOM   974  C CD1 . LEU A 1 127 ? -62.757  -20.138 100.805 1.00 55.27  ? 288 LEU B CD1 1 
ATOM   975  C CD2 . LEU A 1 127 ? -62.411  -20.089 103.272 1.00 55.41  ? 288 LEU B CD2 1 
ATOM   976  N N   . ASP A 1 128 ? -57.780  -21.175 103.311 1.00 64.03  ? 289 ASP B N   1 
ATOM   977  C CA  . ASP A 1 128 ? -56.489  -21.872 103.249 1.00 66.82  ? 289 ASP B CA  1 
ATOM   978  C C   . ASP A 1 128 ? -56.216  -22.480 101.877 1.00 67.11  ? 289 ASP B C   1 
ATOM   979  O O   . ASP A 1 128 ? -55.062  -22.720 101.511 1.00 66.37  ? 289 ASP B O   1 
ATOM   980  C CB  . ASP A 1 128 ? -56.402  -22.951 104.331 1.00 69.48  ? 289 ASP B CB  1 
ATOM   981  C CG  . ASP A 1 128 ? -56.470  -22.377 105.734 1.00 72.98  ? 289 ASP B CG  1 
ATOM   982  O OD1 . ASP A 1 128 ? -57.537  -21.850 106.115 1.00 76.05  ? 289 ASP B OD1 1 
ATOM   983  O OD2 . ASP A 1 128 ? -55.458  -22.461 106.461 1.00 74.70  ? 289 ASP B OD2 1 
ATOM   984  N N   . VAL A 1 129 ? -57.292  -22.720 101.128 1.00 67.51  ? 290 VAL B N   1 
ATOM   985  C CA  . VAL A 1 129 ? -57.209  -23.182 99.745  1.00 67.73  ? 290 VAL B CA  1 
ATOM   986  C C   . VAL A 1 129 ? -56.524  -22.127 98.871  1.00 67.82  ? 290 VAL B C   1 
ATOM   987  O O   . VAL A 1 129 ? -55.701  -22.463 98.017  1.00 67.70  ? 290 VAL B O   1 
ATOM   988  C CB  . VAL A 1 129 ? -58.608  -23.497 99.166  1.00 67.31  ? 290 VAL B CB  1 
ATOM   989  C CG1 . VAL A 1 129 ? -58.496  -24.452 97.986  1.00 66.28  ? 290 VAL B CG1 1 
ATOM   990  C CG2 . VAL A 1 129 ? -59.514  -24.091 100.235 1.00 68.61  ? 290 VAL B CG2 1 
ATOM   991  N N   . TYR A 1 130 ? -56.856  -20.857 99.105  1.00 68.10  ? 291 TYR B N   1 
ATOM   992  C CA  . TYR A 1 130 ? -56.326  -19.749 98.306  1.00 68.82  ? 291 TYR B CA  1 
ATOM   993  C C   . TYR A 1 130 ? -54.927  -19.279 98.726  1.00 71.74  ? 291 TYR B C   1 
ATOM   994  O O   . TYR A 1 130 ? -54.438  -18.272 98.203  1.00 73.83  ? 291 TYR B O   1 
ATOM   995  C CB  . TYR A 1 130 ? -57.271  -18.538 98.341  1.00 65.56  ? 291 TYR B CB  1 
ATOM   996  C CG  . TYR A 1 130 ? -58.708  -18.788 97.941  1.00 62.62  ? 291 TYR B CG  1 
ATOM   997  C CD1 . TYR A 1 130 ? -59.033  -19.663 96.904  1.00 61.83  ? 291 TYR B CD1 1 
ATOM   998  C CD2 . TYR A 1 130 ? -59.743  -18.111 98.579  1.00 61.25  ? 291 TYR B CD2 1 
ATOM   999  C CE1 . TYR A 1 130 ? -60.354  -19.877 96.540  1.00 60.63  ? 291 TYR B CE1 1 
ATOM   1000 C CE2 . TYR A 1 130 ? -61.062  -18.315 98.218  1.00 60.30  ? 291 TYR B CE2 1 
ATOM   1001 C CZ  . TYR A 1 130 ? -61.363  -19.196 97.199  1.00 59.92  ? 291 TYR B CZ  1 
ATOM   1002 O OH  . TYR A 1 130 ? -62.675  -19.395 96.844  1.00 59.06  ? 291 TYR B OH  1 
ATOM   1003 N N   . ASP A 1 131 ? -54.291  -19.991 99.658  1.00 72.31  ? 292 ASP B N   1 
ATOM   1004 C CA  . ASP A 1 131 ? -52.992  -19.570 100.194 1.00 73.50  ? 292 ASP B CA  1 
ATOM   1005 C C   . ASP A 1 131 ? -52.008  -19.174 99.085  1.00 74.12  ? 292 ASP B C   1 
ATOM   1006 O O   . ASP A 1 131 ? -51.622  -19.998 98.245  1.00 73.86  ? 292 ASP B O   1 
ATOM   1007 C CB  . ASP A 1 131 ? -52.394  -20.647 101.105 1.00 75.90  ? 292 ASP B CB  1 
ATOM   1008 C CG  . ASP A 1 131 ? -51.259  -20.120 101.975 1.00 77.49  ? 292 ASP B CG  1 
ATOM   1009 O OD1 . ASP A 1 131 ? -51.227  -18.900 102.253 1.00 79.29  ? 292 ASP B OD1 1 
ATOM   1010 O OD2 . ASP A 1 131 ? -50.401  -20.929 102.389 1.00 77.90  ? 292 ASP B OD2 1 
ATOM   1011 N N   . HIS A 1 132 ? -51.623  -17.898 99.098  1.00 72.82  ? 293 HIS B N   1 
ATOM   1012 C CA  . HIS A 1 132 ? -50.832  -17.293 98.025  1.00 72.16  ? 293 HIS B CA  1 
ATOM   1013 C C   . HIS A 1 132 ? -49.357  -17.666 98.069  1.00 73.47  ? 293 HIS B C   1 
ATOM   1014 O O   . HIS A 1 132 ? -48.668  -17.605 97.048  1.00 74.81  ? 293 HIS B O   1 
ATOM   1015 C CB  . HIS A 1 132 ? -50.945  -15.768 98.070  1.00 71.05  ? 293 HIS B CB  1 
ATOM   1016 C CG  . HIS A 1 132 ? -52.331  -15.266 98.327  1.00 70.13  ? 293 HIS B CG  1 
ATOM   1017 N ND1 . HIS A 1 132 ? -53.397  -15.573 97.510  1.00 69.73  ? 293 HIS B ND1 1 
ATOM   1018 C CD2 . HIS A 1 132 ? -52.821  -14.465 99.301  1.00 69.83  ? 293 HIS B CD2 1 
ATOM   1019 C CE1 . HIS A 1 132 ? -54.487  -14.993 97.977  1.00 69.36  ? 293 HIS B CE1 1 
ATOM   1020 N NE2 . HIS A 1 132 ? -54.165  -14.312 99.062  1.00 69.36  ? 293 HIS B NE2 1 
ATOM   1021 N N   . ARG A 1 133 ? -48.883  -18.043 99.254  1.00 74.45  ? 294 ARG B N   1 
ATOM   1022 C CA  . ARG A 1 133 ? -47.457  -18.260 99.510  1.00 74.20  ? 294 ARG B CA  1 
ATOM   1023 C C   . ARG A 1 133 ? -46.782  -19.204 98.514  1.00 73.94  ? 294 ARG B C   1 
ATOM   1024 O O   . ARG A 1 133 ? -45.651  -18.955 98.088  1.00 73.75  ? 294 ARG B O   1 
ATOM   1025 C CB  . ARG A 1 133 ? -47.235  -18.723 100.954 1.00 74.57  ? 294 ARG B CB  1 
ATOM   1026 C CG  . ARG A 1 133 ? -47.556  -17.644 101.977 1.00 77.19  ? 294 ARG B CG  1 
ATOM   1027 C CD  . ARG A 1 133 ? -47.057  -17.987 103.368 1.00 80.10  ? 294 ARG B CD  1 
ATOM   1028 N NE  . ARG A 1 133 ? -48.073  -18.656 104.176 1.00 84.11  ? 294 ARG B NE  1 
ATOM   1029 C CZ  . ARG A 1 133 ? -48.066  -19.951 104.480 1.00 87.58  ? 294 ARG B CZ  1 
ATOM   1030 N NH1 . ARG A 1 133 ? -47.089  -20.739 104.051 1.00 89.74  ? 294 ARG B NH1 1 
ATOM   1031 N NH2 . ARG A 1 133 ? -49.039  -20.460 105.223 1.00 89.14  ? 294 ARG B NH2 1 
ATOM   1032 N N   . ALA A 1 134 ? -47.484  -20.269 98.132  1.00 73.35  ? 295 ALA B N   1 
ATOM   1033 C CA  . ALA A 1 134 ? -46.953  -21.246 97.187  1.00 73.03  ? 295 ALA B CA  1 
ATOM   1034 C C   . ALA A 1 134 ? -46.813  -20.674 95.774  1.00 73.29  ? 295 ALA B C   1 
ATOM   1035 O O   . ALA A 1 134 ? -45.740  -20.762 95.176  1.00 74.95  ? 295 ALA B O   1 
ATOM   1036 C CB  . ALA A 1 134 ? -47.805  -22.506 97.182  1.00 73.34  ? 295 ALA B CB  1 
ATOM   1037 N N   . LEU A 1 135 ? -47.891  -20.081 95.257  1.00 72.62  ? 296 LEU B N   1 
ATOM   1038 C CA  . LEU A 1 135 ? -47.903  -19.516 93.900  1.00 70.25  ? 296 LEU B CA  1 
ATOM   1039 C C   . LEU A 1 135 ? -46.881  -18.398 93.719  1.00 69.46  ? 296 LEU B C   1 
ATOM   1040 O O   . LEU A 1 135 ? -46.218  -18.323 92.684  1.00 69.17  ? 296 LEU B O   1 
ATOM   1041 C CB  . LEU A 1 135 ? -49.306  -19.025 93.516  1.00 69.12  ? 296 LEU B CB  1 
ATOM   1042 C CG  . LEU A 1 135 ? -49.505  -18.442 92.111  1.00 67.82  ? 296 LEU B CG  1 
ATOM   1043 C CD1 . LEU A 1 135 ? -49.345  -19.504 91.034  1.00 67.46  ? 296 LEU B CD1 1 
ATOM   1044 C CD2 . LEU A 1 135 ? -50.864  -17.769 91.996  1.00 67.97  ? 296 LEU B CD2 1 
ATOM   1045 N N   . ALA A 1 136 ? -46.764  -17.541 94.730  1.00 69.84  ? 297 ALA B N   1 
ATOM   1046 C CA  . ALA A 1 136 ? -45.827  -16.423 94.709  1.00 70.32  ? 297 ALA B CA  1 
ATOM   1047 C C   . ALA A 1 136 ? -44.372  -16.887 94.641  1.00 70.81  ? 297 ALA B C   1 
ATOM   1048 O O   . ALA A 1 136 ? -43.604  -16.424 93.794  1.00 70.08  ? 297 ALA B O   1 
ATOM   1049 C CB  . ALA A 1 136 ? -46.048  -15.524 95.918  1.00 70.11  ? 297 ALA B CB  1 
ATOM   1050 N N   . SER A 1 137 ? -44.012  -17.813 95.526  1.00 71.23  ? 298 SER B N   1 
ATOM   1051 C CA  . SER A 1 137 ? -42.642  -18.311 95.622  1.00 71.84  ? 298 SER B CA  1 
ATOM   1052 C C   . SER A 1 137 ? -42.235  -19.145 94.410  1.00 71.77  ? 298 SER B C   1 
ATOM   1053 O O   . SER A 1 137 ? -41.119  -19.012 93.909  1.00 72.06  ? 298 SER B O   1 
ATOM   1054 C CB  . SER A 1 137 ? -42.469  -19.137 96.897  1.00 72.12  ? 298 SER B CB  1 
ATOM   1055 O OG  . SER A 1 137 ? -43.344  -20.251 96.898  1.00 72.89  ? 298 SER B OG  1 
ATOM   1056 N N   . GLU A 1 138 ? -43.147  -19.992 93.942  1.00 71.85  ? 299 GLU B N   1 
ATOM   1057 C CA  . GLU A 1 138 ? -42.837  -20.976 92.907  1.00 72.07  ? 299 GLU B CA  1 
ATOM   1058 C C   . GLU A 1 138 ? -42.793  -20.387 91.502  1.00 71.83  ? 299 GLU B C   1 
ATOM   1059 O O   . GLU A 1 138 ? -42.049  -20.866 90.647  1.00 71.01  ? 299 GLU B O   1 
ATOM   1060 C CB  . GLU A 1 138 ? -43.846  -22.124 92.955  1.00 72.00  ? 299 GLU B CB  1 
ATOM   1061 C CG  . GLU A 1 138 ? -43.295  -23.467 92.507  1.00 72.80  ? 299 GLU B CG  1 
ATOM   1062 C CD  . GLU A 1 138 ? -42.399  -24.122 93.547  1.00 73.29  ? 299 GLU B CD  1 
ATOM   1063 O OE1 . GLU A 1 138 ? -42.394  -23.679 94.720  1.00 71.50  ? 299 GLU B OE1 1 
ATOM   1064 O OE2 . GLU A 1 138 ? -41.704  -25.095 93.186  1.00 73.79  ? 299 GLU B OE2 1 
ATOM   1065 N N   . GLU A 1 139 ? -43.594  -19.353 91.269  1.00 72.92  ? 300 GLU B N   1 
ATOM   1066 C CA  . GLU A 1 139 ? -43.718  -18.763 89.938  1.00 73.74  ? 300 GLU B CA  1 
ATOM   1067 C C   . GLU A 1 139 ? -43.060  -17.389 89.832  1.00 74.08  ? 300 GLU B C   1 
ATOM   1068 O O   . GLU A 1 139 ? -43.063  -16.773 88.761  1.00 73.94  ? 300 GLU B O   1 
ATOM   1069 C CB  . GLU A 1 139 ? -45.189  -18.703 89.516  1.00 74.13  ? 300 GLU B CB  1 
ATOM   1070 C CG  . GLU A 1 139 ? -45.853  -20.068 89.376  1.00 75.28  ? 300 GLU B CG  1 
ATOM   1071 C CD  . GLU A 1 139 ? -45.108  -20.998 88.433  1.00 76.86  ? 300 GLU B CD  1 
ATOM   1072 O OE1 . GLU A 1 139 ? -44.815  -20.591 87.291  1.00 77.54  ? 300 GLU B OE1 1 
ATOM   1073 O OE2 . GLU A 1 139 ? -44.816  -22.144 88.835  1.00 78.79  ? 300 GLU B OE2 1 
ATOM   1074 N N   . ASN A 1 140 ? -42.492  -16.924 90.946  1.00 74.54  ? 301 ASN B N   1 
ATOM   1075 C CA  . ASN A 1 140 ? -41.828  -15.621 91.026  1.00 75.50  ? 301 ASN B CA  1 
ATOM   1076 C C   . ASN A 1 140 ? -42.726  -14.485 90.517  1.00 73.99  ? 301 ASN B C   1 
ATOM   1077 O O   . ASN A 1 140 ? -42.394  -13.780 89.559  1.00 73.56  ? 301 ASN B O   1 
ATOM   1078 C CB  . ASN A 1 140 ? -40.470  -15.653 90.307  1.00 77.76  ? 301 ASN B CB  1 
ATOM   1079 C CG  . ASN A 1 140 ? -39.500  -14.612 90.834  1.00 80.03  ? 301 ASN B CG  1 
ATOM   1080 O OD1 . ASN A 1 140 ? -39.520  -14.257 92.016  1.00 81.29  ? 301 ASN B OD1 1 
ATOM   1081 N ND2 . ASN A 1 140 ? -38.630  -14.122 89.957  1.00 81.20  ? 301 ASN B ND2 1 
ATOM   1082 N N   . VAL A 1 141 ? -43.873  -14.338 91.177  1.00 72.42  ? 302 VAL B N   1 
ATOM   1083 C CA  . VAL A 1 141 ? -44.913  -13.378 90.813  1.00 69.71  ? 302 VAL B CA  1 
ATOM   1084 C C   . VAL A 1 141 ? -45.600  -12.916 92.095  1.00 68.74  ? 302 VAL B C   1 
ATOM   1085 O O   . VAL A 1 141 ? -45.919  -13.739 92.954  1.00 69.48  ? 302 VAL B O   1 
ATOM   1086 C CB  . VAL A 1 141 ? -45.937  -14.022 89.842  1.00 68.76  ? 302 VAL B CB  1 
ATOM   1087 C CG1 . VAL A 1 141 ? -47.345  -13.476 90.042  1.00 68.85  ? 302 VAL B CG1 1 
ATOM   1088 C CG2 . VAL A 1 141 ? -45.495  -13.841 88.400  1.00 69.13  ? 302 VAL B CG2 1 
ATOM   1089 N N   . ILE A 1 142 ? -45.819  -11.610 92.237  1.00 67.86  ? 303 ILE B N   1 
ATOM   1090 C CA  . ILE A 1 142 ? -46.524  -11.096 93.419  1.00 67.77  ? 303 ILE B CA  1 
ATOM   1091 C C   . ILE A 1 142 ? -48.039  -11.365 93.320  1.00 68.09  ? 303 ILE B C   1 
ATOM   1092 O O   . ILE A 1 142 ? -48.689  -10.997 92.334  1.00 68.23  ? 303 ILE B O   1 
ATOM   1093 C CB  . ILE A 1 142 ? -46.170  -9.617  93.751  1.00 66.46  ? 303 ILE B CB  1 
ATOM   1094 C CG1 . ILE A 1 142 ? -46.817  -8.633  92.782  1.00 66.76  ? 303 ILE B CG1 1 
ATOM   1095 C CG2 . ILE A 1 142 ? -44.667  -9.397  93.778  1.00 66.17  ? 303 ILE B CG2 1 
ATOM   1096 C CD1 . ILE A 1 142 ? -47.990  -7.911  93.396  1.00 68.29  ? 303 ILE B CD1 1 
ATOM   1097 N N   . VAL A 1 143 ? -48.581  -12.035 94.337  1.00 66.64  ? 304 VAL B N   1 
ATOM   1098 C CA  . VAL A 1 143 ? -49.981  -12.468 94.334  1.00 64.20  ? 304 VAL B CA  1 
ATOM   1099 C C   . VAL A 1 143 ? -50.827  -11.566 95.228  1.00 63.78  ? 304 VAL B C   1 
ATOM   1100 O O   . VAL A 1 143 ? -50.472  -11.304 96.379  1.00 64.67  ? 304 VAL B O   1 
ATOM   1101 C CB  . VAL A 1 143 ? -50.132  -13.939 94.788  1.00 63.54  ? 304 VAL B CB  1 
ATOM   1102 C CG1 . VAL A 1 143 ? -51.569  -14.409 94.618  1.00 63.56  ? 304 VAL B CG1 1 
ATOM   1103 C CG2 . VAL A 1 143 ? -49.192  -14.846 94.008  1.00 63.07  ? 304 VAL B CG2 1 
ATOM   1104 N N   . VAL A 1 144 ? -51.948  -11.095 94.685  1.00 62.13  ? 305 VAL B N   1 
ATOM   1105 C CA  . VAL A 1 144 ? -52.845  -10.193 95.405  1.00 60.66  ? 305 VAL B CA  1 
ATOM   1106 C C   . VAL A 1 144 ? -54.241  -10.804 95.537  1.00 59.70  ? 305 VAL B C   1 
ATOM   1107 O O   . VAL A 1 144 ? -54.719  -11.480 94.626  1.00 60.00  ? 305 VAL B O   1 
ATOM   1108 C CB  . VAL A 1 144 ? -52.935  -8.814  94.707  1.00 60.41  ? 305 VAL B CB  1 
ATOM   1109 C CG1 . VAL A 1 144 ? -53.843  -7.862  95.473  1.00 60.95  ? 305 VAL B CG1 1 
ATOM   1110 C CG2 . VAL A 1 144 ? -51.552  -8.203  94.558  1.00 60.08  ? 305 VAL B CG2 1 
ATOM   1111 N N   . SER A 1 145 ? -54.878  -10.576 96.682  1.00 58.31  ? 306 SER B N   1 
ATOM   1112 C CA  . SER A 1 145 ? -56.278  -10.944 96.874  1.00 57.65  ? 306 SER B CA  1 
ATOM   1113 C C   . SER A 1 145 ? -57.054  -9.838  97.581  1.00 57.56  ? 306 SER B C   1 
ATOM   1114 O O   . SER A 1 145 ? -56.516  -9.115  98.426  1.00 56.57  ? 306 SER B O   1 
ATOM   1115 C CB  . SER A 1 145 ? -56.413  -12.264 97.638  1.00 58.08  ? 306 SER B CB  1 
ATOM   1116 O OG  . SER A 1 145 ? -55.937  -12.149 98.968  1.00 57.85  ? 306 SER B OG  1 
ATOM   1117 N N   . LEU A 1 146 ? -58.326  -9.718  97.221  1.00 57.68  ? 307 LEU B N   1 
ATOM   1118 C CA  . LEU A 1 146 ? -59.186  -8.689  97.776  1.00 57.65  ? 307 LEU B CA  1 
ATOM   1119 C C   . LEU A 1 146 ? -60.416  -9.294  98.442  1.00 58.32  ? 307 LEU B C   1 
ATOM   1120 O O   . LEU A 1 146 ? -60.841  -10.406 98.111  1.00 58.95  ? 307 LEU B O   1 
ATOM   1121 C CB  . LEU A 1 146 ? -59.593  -7.688  96.683  1.00 56.73  ? 307 LEU B CB  1 
ATOM   1122 C CG  . LEU A 1 146 ? -60.547  -8.132  95.568  1.00 55.98  ? 307 LEU B CG  1 
ATOM   1123 C CD1 . LEU A 1 146 ? -61.994  -7.846  95.943  1.00 55.60  ? 307 LEU B CD1 1 
ATOM   1124 C CD2 . LEU A 1 146 ? -60.206  -7.430  94.266  1.00 56.04  ? 307 LEU B CD2 1 
ATOM   1125 N N   . GLN A 1 147 ? -60.970  -8.548  99.389  1.00 58.30  ? 308 GLN B N   1 
ATOM   1126 C CA  . GLN A 1 147 ? -62.256  -8.867  99.982  1.00 58.18  ? 308 GLN B CA  1 
ATOM   1127 C C   . GLN A 1 147 ? -63.296  -7.956  99.355  1.00 56.88  ? 308 GLN B C   1 
ATOM   1128 O O   . GLN A 1 147 ? -63.049  -6.765  99.163  1.00 57.14  ? 308 GLN B O   1 
ATOM   1129 C CB  . GLN A 1 147 ? -62.219  -8.638  101.492 1.00 59.35  ? 308 GLN B CB  1 
ATOM   1130 C CG  . GLN A 1 147 ? -61.284  -9.562  102.256 1.00 61.78  ? 308 GLN B CG  1 
ATOM   1131 C CD  . GLN A 1 147 ? -61.937  -10.874 102.644 1.00 64.29  ? 308 GLN B CD  1 
ATOM   1132 O OE1 . GLN A 1 147 ? -62.626  -11.510 101.841 1.00 66.38  ? 308 GLN B OE1 1 
ATOM   1133 N NE2 . GLN A 1 147 ? -61.717  -11.293 103.884 1.00 65.51  ? 308 GLN B NE2 1 
ATOM   1134 N N   . TYR A 1 148 ? -64.451  -8.516  99.020  1.00 55.25  ? 309 TYR B N   1 
ATOM   1135 C CA  . TYR A 1 148 ? -65.567  -7.712  98.540  1.00 54.61  ? 309 TYR B CA  1 
ATOM   1136 C C   . TYR A 1 148 ? -66.850  -8.113  99.248  1.00 54.54  ? 309 TYR B C   1 
ATOM   1137 O O   . TYR A 1 148 ? -67.047  -9.287  99.569  1.00 55.57  ? 309 TYR B O   1 
ATOM   1138 C CB  . TYR A 1 148 ? -65.716  -7.801  97.014  1.00 54.35  ? 309 TYR B CB  1 
ATOM   1139 C CG  . TYR A 1 148 ? -66.078  -9.172  96.475  1.00 54.36  ? 309 TYR B CG  1 
ATOM   1140 C CD1 . TYR A 1 148 ? -65.088  -10.105 96.162  1.00 53.89  ? 309 TYR B CD1 1 
ATOM   1141 C CD2 . TYR A 1 148 ? -67.410  -9.529  96.261  1.00 54.19  ? 309 TYR B CD2 1 
ATOM   1142 C CE1 . TYR A 1 148 ? -65.415  -11.356 95.663  1.00 53.37  ? 309 TYR B CE1 1 
ATOM   1143 C CE2 . TYR A 1 148 ? -67.745  -10.778 95.764  1.00 54.20  ? 309 TYR B CE2 1 
ATOM   1144 C CZ  . TYR A 1 148 ? -66.745  -11.688 95.468  1.00 53.75  ? 309 TYR B CZ  1 
ATOM   1145 O OH  . TYR A 1 148 ? -67.077  -12.931 94.978  1.00 53.90  ? 309 TYR B OH  1 
ATOM   1146 N N   . ARG A 1 149 ? -67.709  -7.130  99.500  1.00 54.53  ? 310 ARG B N   1 
ATOM   1147 C CA  . ARG A 1 149 ? -68.995  -7.378  100.138 1.00 54.08  ? 310 ARG B CA  1 
ATOM   1148 C C   . ARG A 1 149 ? -69.817  -8.377  99.337  1.00 55.72  ? 310 ARG B C   1 
ATOM   1149 O O   . ARG A 1 149 ? -69.840  -8.352  98.104  1.00 56.20  ? 310 ARG B O   1 
ATOM   1150 C CB  . ARG A 1 149 ? -69.770  -6.083  100.350 1.00 52.53  ? 310 ARG B CB  1 
ATOM   1151 C CG  . ARG A 1 149 ? -69.387  -5.346  101.620 1.00 52.31  ? 310 ARG B CG  1 
ATOM   1152 C CD  . ARG A 1 149 ? -70.096  -4.010  101.698 1.00 52.44  ? 310 ARG B CD  1 
ATOM   1153 N NE  . ARG A 1 149 ? -69.472  -3.024  100.821 1.00 53.35  ? 310 ARG B NE  1 
ATOM   1154 C CZ  . ARG A 1 149 ? -70.094  -1.960  100.322 1.00 53.59  ? 310 ARG B CZ  1 
ATOM   1155 N NH1 . ARG A 1 149 ? -71.373  -1.737  100.601 1.00 53.89  ? 310 ARG B NH1 1 
ATOM   1156 N NH2 . ARG A 1 149 ? -69.438  -1.120  99.533  1.00 53.45  ? 310 ARG B NH2 1 
ATOM   1157 N N   . VAL A 1 150 ? -70.484  -9.260  100.066 1.00 56.71  ? 311 VAL B N   1 
ATOM   1158 C CA  . VAL A 1 150 ? -71.147  -10.404 99.482  1.00 56.03  ? 311 VAL B CA  1 
ATOM   1159 C C   . VAL A 1 150 ? -72.604  -10.427 99.955  1.00 56.67  ? 311 VAL B C   1 
ATOM   1160 O O   . VAL A 1 150 ? -72.955  -9.724  100.909 1.00 57.10  ? 311 VAL B O   1 
ATOM   1161 C CB  . VAL A 1 150 ? -70.366  -11.685 99.851  1.00 55.37  ? 311 VAL B CB  1 
ATOM   1162 C CG1 . VAL A 1 150 ? -70.827  -12.262 101.183 1.00 55.36  ? 311 VAL B CG1 1 
ATOM   1163 C CG2 . VAL A 1 150 ? -70.448  -12.708 98.736  1.00 56.73  ? 311 VAL B CG2 1 
ATOM   1164 N N   . ALA A 1 151 ? -73.448  -11.205 99.275  1.00 57.01  ? 312 ALA B N   1 
ATOM   1165 C CA  . ALA A 1 151 ? -74.885  -11.298 99.587  1.00 58.02  ? 312 ALA B CA  1 
ATOM   1166 C C   . ALA A 1 151 ? -75.595  -9.940  99.502  1.00 59.12  ? 312 ALA B C   1 
ATOM   1167 O O   . ALA A 1 151 ? -75.117  -9.031  98.816  1.00 60.63  ? 312 ALA B O   1 
ATOM   1168 C CB  . ALA A 1 151 ? -75.103  -11.953 100.947 1.00 58.21  ? 312 ALA B CB  1 
ATOM   1169 N N   . SER A 1 152 ? -76.729  -9.810  100.193 1.00 59.44  ? 313 SER B N   1 
ATOM   1170 C CA  . SER A 1 152 ? -77.508  -8.563  100.196 1.00 59.26  ? 313 SER B CA  1 
ATOM   1171 C C   . SER A 1 152 ? -76.681  -7.361  100.647 1.00 59.56  ? 313 SER B C   1 
ATOM   1172 O O   . SER A 1 152 ? -76.887  -6.245  100.166 1.00 60.58  ? 313 SER B O   1 
ATOM   1173 C CB  . SER A 1 152 ? -78.762  -8.700  101.066 1.00 58.08  ? 313 SER B CB  1 
ATOM   1174 O OG  . SER A 1 152 ? -78.439  -9.104  102.385 1.00 57.30  ? 313 SER B OG  1 
ATOM   1175 N N   . LEU A 1 153 ? -75.738  -7.604  101.556 1.00 58.42  ? 314 LEU B N   1 
ATOM   1176 C CA  . LEU A 1 153 ? -74.848  -6.565  102.077 1.00 57.04  ? 314 LEU B CA  1 
ATOM   1177 C C   . LEU A 1 153 ? -73.974  -5.918  101.004 1.00 57.81  ? 314 LEU B C   1 
ATOM   1178 O O   . LEU A 1 153 ? -73.485  -4.798  101.184 1.00 58.37  ? 314 LEU B O   1 
ATOM   1179 C CB  . LEU A 1 153 ? -73.975  -7.134  103.196 1.00 54.70  ? 314 LEU B CB  1 
ATOM   1180 C CG  . LEU A 1 153 ? -74.443  -6.906  104.635 1.00 53.64  ? 314 LEU B CG  1 
ATOM   1181 C CD1 . LEU A 1 153 ? -75.891  -7.318  104.850 1.00 53.62  ? 314 LEU B CD1 1 
ATOM   1182 C CD2 . LEU A 1 153 ? -73.536  -7.648  105.597 1.00 53.64  ? 314 LEU B CD2 1 
ATOM   1183 N N   . GLY A 1 154 ? -73.789  -6.623  99.891  1.00 57.62  ? 315 GLY B N   1 
ATOM   1184 C CA  . GLY A 1 154 ? -72.990  -6.114  98.786  1.00 58.38  ? 315 GLY B CA  1 
ATOM   1185 C C   . GLY A 1 154 ? -73.710  -6.051  97.454  1.00 59.05  ? 315 GLY B C   1 
ATOM   1186 O O   . GLY A 1 154 ? -73.141  -5.580  96.465  1.00 59.61  ? 315 GLY B O   1 
ATOM   1187 N N   . PHE A 1 155 ? -74.956  -6.523  97.411  1.00 58.32  ? 316 PHE B N   1 
ATOM   1188 C CA  . PHE A 1 155 ? -75.682  -6.607  96.142  1.00 58.26  ? 316 PHE B CA  1 
ATOM   1189 C C   . PHE A 1 155 ? -77.179  -6.281  96.201  1.00 59.70  ? 316 PHE B C   1 
ATOM   1190 O O   . PHE A 1 155 ? -77.922  -6.597  95.265  1.00 61.44  ? 316 PHE B O   1 
ATOM   1191 C CB  . PHE A 1 155 ? -75.432  -7.966  95.474  1.00 56.47  ? 316 PHE B CB  1 
ATOM   1192 C CG  . PHE A 1 155 ? -74.031  -8.130  94.960  1.00 55.10  ? 316 PHE B CG  1 
ATOM   1193 C CD1 . PHE A 1 155 ? -73.668  -7.611  93.723  1.00 54.56  ? 316 PHE B CD1 1 
ATOM   1194 C CD2 . PHE A 1 155 ? -73.068  -8.779  95.721  1.00 54.94  ? 316 PHE B CD2 1 
ATOM   1195 C CE1 . PHE A 1 155 ? -72.373  -7.748  93.249  1.00 54.06  ? 316 PHE B CE1 1 
ATOM   1196 C CE2 . PHE A 1 155 ? -71.770  -8.918  95.254  1.00 54.92  ? 316 PHE B CE2 1 
ATOM   1197 C CZ  . PHE A 1 155 ? -71.423  -8.402  94.016  1.00 54.32  ? 316 PHE B CZ  1 
ATOM   1198 N N   . LEU A 1 156 ? -77.612  -5.635  97.283  1.00 59.84  ? 317 LEU B N   1 
ATOM   1199 C CA  . LEU A 1 156 ? -78.992  -5.168  97.397  1.00 59.45  ? 317 LEU B CA  1 
ATOM   1200 C C   . LEU A 1 156 ? -79.252  -4.065  96.382  1.00 59.95  ? 317 LEU B C   1 
ATOM   1201 O O   . LEU A 1 156 ? -78.521  -3.072  96.331  1.00 59.60  ? 317 LEU B O   1 
ATOM   1202 C CB  . LEU A 1 156 ? -79.283  -4.650  98.807  1.00 60.01  ? 317 LEU B CB  1 
ATOM   1203 C CG  . LEU A 1 156 ? -80.739  -4.304  99.142  1.00 61.05  ? 317 LEU B CG  1 
ATOM   1204 C CD1 . LEU A 1 156 ? -81.517  -5.555  99.528  1.00 61.52  ? 317 LEU B CD1 1 
ATOM   1205 C CD2 . LEU A 1 156 ? -80.809  -3.273  100.258 1.00 61.05  ? 317 LEU B CD2 1 
ATOM   1206 N N   . PHE A 1 157 ? -80.287  -4.252  95.571  1.00 61.35  ? 318 PHE B N   1 
ATOM   1207 C CA  . PHE A 1 157 ? -80.696  -3.250  94.591  1.00 62.82  ? 318 PHE B CA  1 
ATOM   1208 C C   . PHE A 1 157 ? -82.152  -2.855  94.801  1.00 64.49  ? 318 PHE B C   1 
ATOM   1209 O O   . PHE A 1 157 ? -83.020  -3.719  94.942  1.00 66.14  ? 318 PHE B O   1 
ATOM   1210 C CB  . PHE A 1 157 ? -80.490  -3.765  93.162  1.00 62.00  ? 318 PHE B CB  1 
ATOM   1211 C CG  . PHE A 1 157 ? -80.980  -2.819  92.098  1.00 61.81  ? 318 PHE B CG  1 
ATOM   1212 C CD1 . PHE A 1 157 ? -80.193  -1.746  91.687  1.00 62.16  ? 318 PHE B CD1 1 
ATOM   1213 C CD2 . PHE A 1 157 ? -82.225  -2.997  91.506  1.00 61.53  ? 318 PHE B CD2 1 
ATOM   1214 C CE1 . PHE A 1 157 ? -80.639  -0.870  90.710  1.00 61.64  ? 318 PHE B CE1 1 
ATOM   1215 C CE2 . PHE A 1 157 ? -82.676  -2.125  90.528  1.00 61.91  ? 318 PHE B CE2 1 
ATOM   1216 C CZ  . PHE A 1 157 ? -81.881  -1.060  90.130  1.00 61.87  ? 318 PHE B CZ  1 
ATOM   1217 N N   . LEU A 1 158 ? -82.409  -1.549  94.818  1.00 65.20  ? 319 LEU B N   1 
ATOM   1218 C CA  . LEU A 1 158 ? -83.772  -1.028  94.906  1.00 65.46  ? 319 LEU B CA  1 
ATOM   1219 C C   . LEU A 1 158 ? -84.095  -0.009  93.811  1.00 67.17  ? 319 LEU B C   1 
ATOM   1220 O O   . LEU A 1 158 ? -85.264  0.269   93.542  1.00 68.98  ? 319 LEU B O   1 
ATOM   1221 C CB  . LEU A 1 158 ? -84.047  -0.442  96.294  1.00 64.10  ? 319 LEU B CB  1 
ATOM   1222 C CG  . LEU A 1 158 ? -84.509  -1.438  97.362  1.00 64.31  ? 319 LEU B CG  1 
ATOM   1223 C CD1 . LEU A 1 158 ? -84.237  -0.903  98.760  1.00 65.17  ? 319 LEU B CD1 1 
ATOM   1224 C CD2 . LEU A 1 158 ? -85.982  -1.791  97.198  1.00 63.74  ? 319 LEU B CD2 1 
ATOM   1225 N N   . GLY A 1 159 ? -83.061  0.528   93.171  1.00 67.25  ? 320 GLY B N   1 
ATOM   1226 C CA  . GLY A 1 159 ? -83.244  1.554   92.149  1.00 67.65  ? 320 GLY B CA  1 
ATOM   1227 C C   . GLY A 1 159 ? -82.958  2.944   92.678  1.00 69.28  ? 320 GLY B C   1 
ATOM   1228 O O   . GLY A 1 159 ? -82.648  3.854   91.908  1.00 70.32  ? 320 GLY B O   1 
ATOM   1229 N N   . THR A 1 160 ? -83.071  3.107   93.995  1.00 70.51  ? 321 THR B N   1 
ATOM   1230 C CA  . THR A 1 160 ? -82.729  4.359   94.666  1.00 72.59  ? 321 THR B CA  1 
ATOM   1231 C C   . THR A 1 160 ? -81.210  4.485   94.814  1.00 72.12  ? 321 THR B C   1 
ATOM   1232 O O   . THR A 1 160 ? -80.507  3.474   94.780  1.00 70.86  ? 321 THR B O   1 
ATOM   1233 C CB  . THR A 1 160 ? -83.385  4.460   96.062  1.00 74.44  ? 321 THR B CB  1 
ATOM   1234 O OG1 . THR A 1 160 ? -82.982  3.346   96.871  1.00 76.30  ? 321 THR B OG1 1 
ATOM   1235 C CG2 . THR A 1 160 ? -84.901  4.485   95.947  1.00 75.15  ? 321 THR B CG2 1 
ATOM   1236 N N   . PRO A 1 161 ? -80.696  5.724   94.970  1.00 72.27  ? 322 PRO B N   1 
ATOM   1237 C CA  . PRO A 1 161 ? -79.267  5.910   95.228  1.00 73.25  ? 322 PRO B CA  1 
ATOM   1238 C C   . PRO A 1 161 ? -78.846  5.358   96.589  1.00 75.49  ? 322 PRO B C   1 
ATOM   1239 O O   . PRO A 1 161 ? -77.662  5.092   96.807  1.00 76.45  ? 322 PRO B O   1 
ATOM   1240 C CB  . PRO A 1 161 ? -79.098  7.433   95.203  1.00 72.43  ? 322 PRO B CB  1 
ATOM   1241 C CG  . PRO A 1 161 ? -80.454  7.978   95.489  1.00 72.23  ? 322 PRO B CG  1 
ATOM   1242 C CD  . PRO A 1 161 ? -81.392  7.017   94.828  1.00 72.14  ? 322 PRO B CD  1 
ATOM   1243 N N   . GLU A 1 162 ? -79.817  5.191   97.484  1.00 78.15  ? 323 GLU B N   1 
ATOM   1244 C CA  . GLU A 1 162 ? -79.586  4.645   98.821  1.00 80.92  ? 323 GLU B CA  1 
ATOM   1245 C C   . GLU A 1 162 ? -79.185  3.172   98.750  1.00 78.70  ? 323 GLU B C   1 
ATOM   1246 O O   . GLU A 1 162 ? -78.402  2.692   99.574  1.00 79.75  ? 323 GLU B O   1 
ATOM   1247 C CB  . GLU A 1 162 ? -80.839  4.807   99.692  1.00 87.58  ? 323 GLU B CB  1 
ATOM   1248 C CG  . GLU A 1 162 ? -81.412  6.220   99.753  1.00 93.44  ? 323 GLU B CG  1 
ATOM   1249 C CD  . GLU A 1 162 ? -80.492  7.216   100.446 1.00 97.13  ? 323 GLU B CD  1 
ATOM   1250 O OE1 . GLU A 1 162 ? -80.008  6.918   101.561 1.00 97.41  ? 323 GLU B OE1 1 
ATOM   1251 O OE2 . GLU A 1 162 ? -80.260  8.306   99.876  1.00 99.30  ? 323 GLU B OE2 1 
ATOM   1252 N N   . ALA A 1 163 ? -79.742  2.470   97.763  1.00 74.93  ? 324 ALA B N   1 
ATOM   1253 C CA  . ALA A 1 163 ? -79.394  1.082   97.468  1.00 70.45  ? 324 ALA B CA  1 
ATOM   1254 C C   . ALA A 1 163 ? -79.280  0.905   95.951  1.00 67.55  ? 324 ALA B C   1 
ATOM   1255 O O   . ALA A 1 163 ? -80.223  0.430   95.308  1.00 66.34  ? 324 ALA B O   1 
ATOM   1256 C CB  . ALA A 1 163 ? -80.438  0.137   98.047  1.00 70.56  ? 324 ALA B CB  1 
ATOM   1257 N N   . PRO A 1 164 ? -78.124  1.299   95.373  1.00 64.64  ? 325 PRO B N   1 
ATOM   1258 C CA  . PRO A 1 164 ? -77.940  1.326   93.920  1.00 63.00  ? 325 PRO B CA  1 
ATOM   1259 C C   . PRO A 1 164 ? -77.513  -0.004  93.304  1.00 62.06  ? 325 PRO B C   1 
ATOM   1260 O O   . PRO A 1 164 ? -77.565  -0.155  92.083  1.00 60.86  ? 325 PRO B O   1 
ATOM   1261 C CB  . PRO A 1 164 ? -76.843  2.377   93.727  1.00 62.08  ? 325 PRO B CB  1 
ATOM   1262 C CG  . PRO A 1 164 ? -76.089  2.402   95.013  1.00 61.84  ? 325 PRO B CG  1 
ATOM   1263 C CD  . PRO A 1 164 ? -76.909  1.737   96.084  1.00 63.23  ? 325 PRO B CD  1 
ATOM   1264 N N   . GLY A 1 165 ? -77.088  -0.949  94.140  1.00 62.79  ? 326 GLY B N   1 
ATOM   1265 C CA  . GLY A 1 165 ? -76.647  -2.261  93.672  1.00 62.91  ? 326 GLY B CA  1 
ATOM   1266 C C   . GLY A 1 165 ? -75.182  -2.308  93.279  1.00 62.24  ? 326 GLY B C   1 
ATOM   1267 O O   . GLY A 1 165 ? -74.540  -1.270  93.096  1.00 62.38  ? 326 GLY B O   1 
ATOM   1268 N N   . ASN A 1 166 ? -74.662  -3.530  93.157  1.00 61.04  ? 327 ASN B N   1 
ATOM   1269 C CA  . ASN A 1 166 ? -73.275  -3.796  92.743  1.00 59.05  ? 327 ASN B CA  1 
ATOM   1270 C C   . ASN A 1 166 ? -72.199  -3.226  93.669  1.00 57.61  ? 327 ASN B C   1 
ATOM   1271 O O   . ASN A 1 166 ? -71.056  -3.019  93.249  1.00 56.88  ? 327 ASN B O   1 
ATOM   1272 C CB  . ASN A 1 166 ? -73.036  -3.351  91.294  1.00 59.40  ? 327 ASN B CB  1 
ATOM   1273 C CG  . ASN A 1 166 ? -73.947  -4.052  90.307  1.00 60.65  ? 327 ASN B CG  1 
ATOM   1274 O OD1 . ASN A 1 166 ? -75.050  -4.488  90.651  1.00 62.39  ? 327 ASN B OD1 1 
ATOM   1275 N ND2 . ASN A 1 166 ? -73.495  -4.157  89.064  1.00 60.82  ? 327 ASN B ND2 1 
ATOM   1276 N N   . ALA A 1 167 ? -72.565  -2.997  94.930  1.00 56.35  ? 328 ALA B N   1 
ATOM   1277 C CA  . ALA A 1 167 ? -71.631  -2.503  95.940  1.00 55.86  ? 328 ALA B CA  1 
ATOM   1278 C C   . ALA A 1 167 ? -70.374  -3.368  96.020  1.00 55.59  ? 328 ALA B C   1 
ATOM   1279 O O   . ALA A 1 167 ? -69.264  -2.850  96.135  1.00 55.85  ? 328 ALA B O   1 
ATOM   1280 C CB  . ALA A 1 167 ? -72.311  -2.415  97.297  1.00 55.78  ? 328 ALA B CB  1 
ATOM   1281 N N   . GLY A 1 168 ? -70.560  -4.685  95.942  1.00 55.35  ? 329 GLY B N   1 
ATOM   1282 C CA  . GLY A 1 168 ? -69.451  -5.633  95.942  1.00 55.95  ? 329 GLY B CA  1 
ATOM   1283 C C   . GLY A 1 168 ? -68.545  -5.493  94.733  1.00 56.98  ? 329 GLY B C   1 
ATOM   1284 O O   . GLY A 1 168 ? -67.330  -5.671  94.838  1.00 57.55  ? 329 GLY B O   1 
ATOM   1285 N N   . LEU A 1 169 ? -69.136  -5.178  93.583  1.00 57.67  ? 330 LEU B N   1 
ATOM   1286 C CA  . LEU A 1 169 ? -68.368  -4.967  92.355  1.00 58.10  ? 330 LEU B CA  1 
ATOM   1287 C C   . LEU A 1 169 ? -67.575  -3.666  92.410  1.00 58.52  ? 330 LEU B C   1 
ATOM   1288 O O   . LEU A 1 169 ? -66.438  -3.602  91.935  1.00 59.42  ? 330 LEU B O   1 
ATOM   1289 C CB  . LEU A 1 169 ? -69.276  -5.003  91.123  1.00 57.60  ? 330 LEU B CB  1 
ATOM   1290 C CG  . LEU A 1 169 ? -69.773  -6.383  90.678  1.00 57.74  ? 330 LEU B CG  1 
ATOM   1291 C CD1 . LEU A 1 169 ? -70.790  -6.234  89.561  1.00 58.41  ? 330 LEU B CD1 1 
ATOM   1292 C CD2 . LEU A 1 169 ? -68.628  -7.285  90.238  1.00 57.53  ? 330 LEU B CD2 1 
ATOM   1293 N N   . PHE A 1 170 ? -68.177  -2.634  92.998  1.00 57.30  ? 331 PHE B N   1 
ATOM   1294 C CA  . PHE A 1 170 ? -67.472  -1.383  93.251  1.00 56.36  ? 331 PHE B CA  1 
ATOM   1295 C C   . PHE A 1 170 ? -66.416  -1.564  94.340  1.00 55.65  ? 331 PHE B C   1 
ATOM   1296 O O   . PHE A 1 170 ? -65.403  -0.864  94.343  1.00 56.22  ? 331 PHE B O   1 
ATOM   1297 C CB  . PHE A 1 170 ? -68.452  -0.264  93.607  1.00 56.25  ? 331 PHE B CB  1 
ATOM   1298 C CG  . PHE A 1 170 ? -69.147  0.331   92.415  1.00 56.40  ? 331 PHE B CG  1 
ATOM   1299 C CD1 . PHE A 1 170 ? -68.593  1.413   91.740  1.00 56.56  ? 331 PHE B CD1 1 
ATOM   1300 C CD2 . PHE A 1 170 ? -70.356  -0.190  91.963  1.00 56.74  ? 331 PHE B CD2 1 
ATOM   1301 C CE1 . PHE A 1 170 ? -69.233  1.963   90.640  1.00 56.84  ? 331 PHE B CE1 1 
ATOM   1302 C CE2 . PHE A 1 170 ? -70.999  0.354   90.860  1.00 56.43  ? 331 PHE B CE2 1 
ATOM   1303 C CZ  . PHE A 1 170 ? -70.437  1.434   90.199  1.00 56.83  ? 331 PHE B CZ  1 
ATOM   1304 N N   . ASP A 1 171 ? -66.658  -2.508  95.251  1.00 54.86  ? 332 ASP B N   1 
ATOM   1305 C CA  . ASP A 1 171 ? -65.647  -2.934  96.220  1.00 54.76  ? 332 ASP B CA  1 
ATOM   1306 C C   . ASP A 1 171 ? -64.441  -3.504  95.484  1.00 55.80  ? 332 ASP B C   1 
ATOM   1307 O O   . ASP A 1 171 ? -63.300  -3.143  95.777  1.00 56.09  ? 332 ASP B O   1 
ATOM   1308 C CB  . ASP A 1 171 ? -66.205  -3.996  97.176  1.00 53.35  ? 332 ASP B CB  1 
ATOM   1309 C CG  . ASP A 1 171 ? -67.123  -3.420  98.236  1.00 52.62  ? 332 ASP B CG  1 
ATOM   1310 O OD1 . ASP A 1 171 ? -67.077  -2.204  98.499  1.00 53.28  ? 332 ASP B OD1 1 
ATOM   1311 O OD2 . ASP A 1 171 ? -67.894  -4.197  98.823  1.00 52.15  ? 332 ASP B OD2 1 
ATOM   1312 N N   . GLN A 1 172 ? -64.712  -4.390  94.526  1.00 56.81  ? 333 GLN B N   1 
ATOM   1313 C CA  . GLN A 1 172 ? -63.675  -5.002  93.697  1.00 57.60  ? 333 GLN B CA  1 
ATOM   1314 C C   . GLN A 1 172 ? -62.942  -3.953  92.867  1.00 58.49  ? 333 GLN B C   1 
ATOM   1315 O O   . GLN A 1 172 ? -61.713  -3.982  92.769  1.00 58.34  ? 333 GLN B O   1 
ATOM   1316 C CB  . GLN A 1 172 ? -64.278  -6.057  92.769  1.00 57.12  ? 333 GLN B CB  1 
ATOM   1317 C CG  . GLN A 1 172 ? -64.751  -7.325  93.460  1.00 55.92  ? 333 GLN B CG  1 
ATOM   1318 C CD  . GLN A 1 172 ? -65.365  -8.319  92.494  1.00 55.89  ? 333 GLN B CD  1 
ATOM   1319 O OE1 . GLN A 1 172 ? -65.239  -8.183  91.277  1.00 55.69  ? 333 GLN B OE1 1 
ATOM   1320 N NE2 . GLN A 1 172 ? -66.033  -9.329  93.035  1.00 56.14  ? 333 GLN B NE2 1 
ATOM   1321 N N   . ASN A 1 173 ? -63.709  -3.031  92.284  1.00 59.29  ? 334 ASN B N   1 
ATOM   1322 C CA  . ASN A 1 173 ? -63.170  -1.962  91.438  1.00 59.51  ? 334 ASN B CA  1 
ATOM   1323 C C   . ASN A 1 173 ? -62.206  -1.038  92.183  1.00 58.76  ? 334 ASN B C   1 
ATOM   1324 O O   . ASN A 1 173 ? -61.111  -0.753  91.690  1.00 58.59  ? 334 ASN B O   1 
ATOM   1325 C CB  . ASN A 1 173 ? -64.308  -1.159  90.792  1.00 59.67  ? 334 ASN B CB  1 
ATOM   1326 C CG  . ASN A 1 173 ? -63.804  -0.006  89.941  1.00 59.55  ? 334 ASN B CG  1 
ATOM   1327 O OD1 . ASN A 1 173 ? -63.467  1.058   90.458  1.00 60.44  ? 334 ASN B OD1 1 
ATOM   1328 N ND2 . ASN A 1 173 ? -63.764  -0.208  88.629  1.00 58.88  ? 334 ASN B ND2 1 
ATOM   1329 N N   . LEU A 1 174 ? -62.622  -0.579  93.364  1.00 57.47  ? 335 LEU B N   1 
ATOM   1330 C CA  . LEU A 1 174 ? -61.791  0.278   94.210  1.00 57.07  ? 335 LEU B CA  1 
ATOM   1331 C C   . LEU A 1 174 ? -60.498  -0.425  94.625  1.00 57.63  ? 335 LEU B C   1 
ATOM   1332 O O   . LEU A 1 174 ? -59.452  0.216   94.763  1.00 58.67  ? 335 LEU B O   1 
ATOM   1333 C CB  . LEU A 1 174 ? -62.574  0.754   95.442  1.00 55.96  ? 335 LEU B CB  1 
ATOM   1334 C CG  . LEU A 1 174 ? -61.859  1.593   96.510  1.00 55.15  ? 335 LEU B CG  1 
ATOM   1335 C CD1 . LEU A 1 174 ? -61.306  2.893   95.944  1.00 55.86  ? 335 LEU B CD1 1 
ATOM   1336 C CD2 . LEU A 1 174 ? -62.787  1.875   97.678  1.00 54.56  ? 335 LEU B CD2 1 
ATOM   1337 N N   . ALA A 1 175 ? -60.577  -1.742  94.812  1.00 57.25  ? 336 ALA B N   1 
ATOM   1338 C CA  . ALA A 1 175 ? -59.401  -2.553  95.112  1.00 57.35  ? 336 ALA B CA  1 
ATOM   1339 C C   . ALA A 1 175 ? -58.433  -2.586  93.928  1.00 58.03  ? 336 ALA B C   1 
ATOM   1340 O O   . ALA A 1 175 ? -57.216  -2.560  94.119  1.00 57.07  ? 336 ALA B O   1 
ATOM   1341 C CB  . ALA A 1 175 ? -59.810  -3.958  95.520  1.00 56.36  ? 336 ALA B CB  1 
ATOM   1342 N N   . LEU A 1 176 ? -58.979  -2.629  92.713  1.00 60.25  ? 337 LEU B N   1 
ATOM   1343 C CA  . LEU A 1 176 ? -58.165  -2.603  91.495  1.00 63.01  ? 337 LEU B CA  1 
ATOM   1344 C C   . LEU A 1 176 ? -57.417  -1.283  91.359  1.00 65.85  ? 337 LEU B C   1 
ATOM   1345 O O   . LEU A 1 176 ? -56.236  -1.266  91.001  1.00 66.73  ? 337 LEU B O   1 
ATOM   1346 C CB  . LEU A 1 176 ? -59.017  -2.847  90.241  1.00 61.84  ? 337 LEU B CB  1 
ATOM   1347 C CG  . LEU A 1 176 ? -59.807  -4.147  90.060  1.00 61.17  ? 337 LEU B CG  1 
ATOM   1348 C CD1 . LEU A 1 176 ? -60.221  -4.310  88.606  1.00 60.49  ? 337 LEU B CD1 1 
ATOM   1349 C CD2 . LEU A 1 176 ? -59.019  -5.363  90.519  1.00 60.71  ? 337 LEU B CD2 1 
ATOM   1350 N N   . ARG A 1 177 ? -58.109  -0.183  91.653  1.00 68.57  ? 338 ARG B N   1 
ATOM   1351 C CA  . ARG A 1 177 ? -57.509  1.144   91.564  1.00 71.47  ? 338 ARG B CA  1 
ATOM   1352 C C   . ARG A 1 177 ? -56.489  1.363   92.682  1.00 71.17  ? 338 ARG B C   1 
ATOM   1353 O O   . ARG A 1 177 ? -55.563  2.162   92.531  1.00 73.23  ? 338 ARG B O   1 
ATOM   1354 C CB  . ARG A 1 177 ? -58.581  2.236   91.573  1.00 74.48  ? 338 ARG B CB  1 
ATOM   1355 C CG  . ARG A 1 177 ? -58.320  3.352   90.566  1.00 78.57  ? 338 ARG B CG  1 
ATOM   1356 C CD  . ARG A 1 177 ? -59.293  4.518   90.703  1.00 82.44  ? 338 ARG B CD  1 
ATOM   1357 N NE  . ARG A 1 177 ? -60.700  4.118   90.601  1.00 84.25  ? 338 ARG B NE  1 
ATOM   1358 C CZ  . ARG A 1 177 ? -61.558  4.093   91.622  1.00 84.08  ? 338 ARG B CZ  1 
ATOM   1359 N NH1 . ARG A 1 177 ? -61.169  4.450   92.841  1.00 84.64  ? 338 ARG B NH1 1 
ATOM   1360 N NH2 . ARG A 1 177 ? -62.813  3.715   91.423  1.00 83.08  ? 338 ARG B NH2 1 
ATOM   1361 N N   . TRP A 1 178 ? -56.660  0.649   93.795  1.00 69.44  ? 339 TRP B N   1 
ATOM   1362 C CA  . TRP A 1 178 ? -55.663  0.644   94.867  1.00 67.18  ? 339 TRP B CA  1 
ATOM   1363 C C   . TRP A 1 178 ? -54.401  -0.069  94.401  1.00 67.05  ? 339 TRP B C   1 
ATOM   1364 O O   . TRP A 1 178 ? -53.293  0.418   94.627  1.00 68.39  ? 339 TRP B O   1 
ATOM   1365 C CB  . TRP A 1 178 ? -56.200  -0.031  96.133  1.00 65.05  ? 339 TRP B CB  1 
ATOM   1366 C CG  . TRP A 1 178 ? -55.248  0.050   97.302  1.00 62.86  ? 339 TRP B CG  1 
ATOM   1367 C CD1 . TRP A 1 178 ? -55.276  0.963   98.316  1.00 62.94  ? 339 TRP B CD1 1 
ATOM   1368 C CD2 . TRP A 1 178 ? -54.125  -0.809  97.569  1.00 61.54  ? 339 TRP B CD2 1 
ATOM   1369 N NE1 . TRP A 1 178 ? -54.248  0.728   99.197  1.00 62.52  ? 339 TRP B NE1 1 
ATOM   1370 C CE2 . TRP A 1 178 ? -53.525  -0.353  98.764  1.00 61.21  ? 339 TRP B CE2 1 
ATOM   1371 C CE3 . TRP A 1 178 ? -53.570  -1.919  96.917  1.00 60.85  ? 339 TRP B CE3 1 
ATOM   1372 C CZ2 . TRP A 1 178 ? -52.399  -0.967  99.321  1.00 59.93  ? 339 TRP B CZ2 1 
ATOM   1373 C CZ3 . TRP A 1 178 ? -52.448  -2.529  97.471  1.00 59.99  ? 339 TRP B CZ3 1 
ATOM   1374 C CH2 . TRP A 1 178 ? -51.877  -2.050  98.662  1.00 59.68  ? 339 TRP B CH2 1 
ATOM   1375 N N   . VAL A 1 179 ? -54.580  -1.227  93.767  1.00 66.53  ? 340 VAL B N   1 
ATOM   1376 C CA  . VAL A 1 179 ? -53.463  -2.013  93.244  1.00 67.03  ? 340 VAL B CA  1 
ATOM   1377 C C   . VAL A 1 179 ? -52.640  -1.170  92.270  1.00 68.20  ? 340 VAL B C   1 
ATOM   1378 O O   . VAL A 1 179 ? -51.417  -1.105  92.382  1.00 67.74  ? 340 VAL B O   1 
ATOM   1379 C CB  . VAL A 1 179 ? -53.949  -3.335  92.598  1.00 66.53  ? 340 VAL B CB  1 
ATOM   1380 C CG1 . VAL A 1 179 ? -52.882  -3.952  91.704  1.00 65.52  ? 340 VAL B CG1 1 
ATOM   1381 C CG2 . VAL A 1 179 ? -54.364  -4.324  93.677  1.00 66.46  ? 340 VAL B CG2 1 
ATOM   1382 N N   . ARG A 1 180 ? -53.322  -0.494  91.347  1.00 69.69  ? 341 ARG B N   1 
ATOM   1383 C CA  . ARG A 1 180 ? -52.658  0.346   90.354  1.00 71.56  ? 341 ARG B CA  1 
ATOM   1384 C C   . ARG A 1 180 ? -51.806  1.448   90.993  1.00 72.24  ? 341 ARG B C   1 
ATOM   1385 O O   . ARG A 1 180 ? -50.699  1.725   90.530  1.00 73.32  ? 341 ARG B O   1 
ATOM   1386 C CB  . ARG A 1 180 ? -53.683  0.947   89.393  1.00 72.66  ? 341 ARG B CB  1 
ATOM   1387 C CG  . ARG A 1 180 ? -53.079  1.449   88.095  1.00 75.11  ? 341 ARG B CG  1 
ATOM   1388 C CD  . ARG A 1 180 ? -54.149  1.952   87.142  1.00 77.12  ? 341 ARG B CD  1 
ATOM   1389 N NE  . ARG A 1 180 ? -53.561  2.489   85.916  1.00 79.34  ? 341 ARG B NE  1 
ATOM   1390 C CZ  . ARG A 1 180 ? -53.271  1.768   84.836  1.00 80.04  ? 341 ARG B CZ  1 
ATOM   1391 N NH1 . ARG A 1 180 ? -53.512  0.463   84.810  1.00 80.54  ? 341 ARG B NH1 1 
ATOM   1392 N NH2 . ARG A 1 180 ? -52.735  2.356   83.775  1.00 80.61  ? 341 ARG B NH2 1 
ATOM   1393 N N   . ASP A 1 181 ? -52.323  2.057   92.059  1.00 72.82  ? 342 ASP B N   1 
ATOM   1394 C CA  . ASP A 1 181 ? -51.631  3.133   92.771  1.00 72.56  ? 342 ASP B CA  1 
ATOM   1395 C C   . ASP A 1 181 ? -50.449  2.658   93.614  1.00 72.64  ? 342 ASP B C   1 
ATOM   1396 O O   . ASP A 1 181 ? -49.434  3.350   93.699  1.00 74.92  ? 342 ASP B O   1 
ATOM   1397 C CB  . ASP A 1 181 ? -52.606  3.902   93.672  1.00 73.94  ? 342 ASP B CB  1 
ATOM   1398 C CG  . ASP A 1 181 ? -53.580  4.769   92.888  1.00 76.48  ? 342 ASP B CG  1 
ATOM   1399 O OD1 . ASP A 1 181 ? -53.515  4.782   91.640  1.00 77.94  ? 342 ASP B OD1 1 
ATOM   1400 O OD2 . ASP A 1 181 ? -54.417  5.444   93.526  1.00 77.44  ? 342 ASP B OD2 1 
ATOM   1401 N N   . ASN A 1 182 ? -50.577  1.486   94.228  1.00 71.77  ? 343 ASN B N   1 
ATOM   1402 C CA  . ASN A 1 182 ? -49.649  1.071   95.282  1.00 71.49  ? 343 ASN B CA  1 
ATOM   1403 C C   . ASN A 1 182 ? -48.800  -0.168  95.021  1.00 71.96  ? 343 ASN B C   1 
ATOM   1404 O O   . ASN A 1 182 ? -47.838  -0.418  95.750  1.00 70.91  ? 343 ASN B O   1 
ATOM   1405 C CB  . ASN A 1 182 ? -50.410  0.893   96.599  1.00 71.31  ? 343 ASN B CB  1 
ATOM   1406 C CG  . ASN A 1 182 ? -50.938  2.199   97.146  1.00 71.41  ? 343 ASN B CG  1 
ATOM   1407 O OD1 . ASN A 1 182 ? -50.168  3.090   97.509  1.00 72.42  ? 343 ASN B OD1 1 
ATOM   1408 N ND2 . ASN A 1 182 ? -52.258  2.321   97.216  1.00 72.00  ? 343 ASN B ND2 1 
ATOM   1409 N N   . ILE A 1 183 ? -49.142  -0.940  93.992  1.00 73.63  ? 344 ILE B N   1 
ATOM   1410 C CA  . ILE A 1 183 ? -48.498  -2.240  93.784  1.00 75.64  ? 344 ILE B CA  1 
ATOM   1411 C C   . ILE A 1 183 ? -47.017  -2.145  93.405  1.00 78.08  ? 344 ILE B C   1 
ATOM   1412 O O   . ILE A 1 183 ? -46.256  -3.085  93.641  1.00 77.94  ? 344 ILE B O   1 
ATOM   1413 C CB  . ILE A 1 183 ? -49.290  -3.139  92.796  1.00 75.42  ? 344 ILE B CB  1 
ATOM   1414 C CG1 . ILE A 1 183 ? -49.157  -4.615  93.180  1.00 74.08  ? 344 ILE B CG1 1 
ATOM   1415 C CG2 . ILE A 1 183 ? -48.888  -2.886  91.346  1.00 76.70  ? 344 ILE B CG2 1 
ATOM   1416 C CD1 . ILE A 1 183 ? -49.825  -4.969  94.491  1.00 74.34  ? 344 ILE B CD1 1 
ATOM   1417 N N   . HIS A 1 184 ? -46.616  -1.006  92.838  1.00 81.75  ? 345 HIS B N   1 
ATOM   1418 C CA  . HIS A 1 184 ? -45.222  -0.783  92.458  1.00 85.84  ? 345 HIS B CA  1 
ATOM   1419 C C   . HIS A 1 184 ? -44.313  -0.811  93.683  1.00 85.31  ? 345 HIS B C   1 
ATOM   1420 O O   . HIS A 1 184 ? -43.171  -1.271  93.608  1.00 86.19  ? 345 HIS B O   1 
ATOM   1421 C CB  . HIS A 1 184 ? -45.055  0.542   91.709  1.00 90.71  ? 345 HIS B CB  1 
ATOM   1422 C CG  . HIS A 1 184 ? -43.832  0.597   90.843  1.00 97.44  ? 345 HIS B CG  1 
ATOM   1423 N ND1 . HIS A 1 184 ? -43.885  0.903   89.499  1.00 100.57 ? 345 HIS B ND1 1 
ATOM   1424 C CD2 . HIS A 1 184 ? -42.525  0.374   91.124  1.00 97.99  ? 345 HIS B CD2 1 
ATOM   1425 C CE1 . HIS A 1 184 ? -42.665  0.875   88.994  1.00 100.19 ? 345 HIS B CE1 1 
ATOM   1426 N NE2 . HIS A 1 184 ? -41.822  0.553   89.958  1.00 99.80  ? 345 HIS B NE2 1 
ATOM   1427 N N   . ARG A 1 185 ? -44.841  -0.334  94.808  1.00 83.72  ? 346 ARG B N   1 
ATOM   1428 C CA  . ARG A 1 185 ? -44.096  -0.260  96.063  1.00 81.89  ? 346 ARG B CA  1 
ATOM   1429 C C   . ARG A 1 185 ? -43.792  -1.638  96.652  1.00 79.61  ? 346 ARG B C   1 
ATOM   1430 O O   . ARG A 1 185 ? -42.918  -1.769  97.512  1.00 80.59  ? 346 ARG B O   1 
ATOM   1431 C CB  . ARG A 1 185 ? -44.856  0.584   97.087  1.00 83.31  ? 346 ARG B CB  1 
ATOM   1432 C CG  . ARG A 1 185 ? -45.324  1.938   96.579  1.00 87.12  ? 346 ARG B CG  1 
ATOM   1433 C CD  . ARG A 1 185 ? -46.225  2.598   97.607  1.00 90.23  ? 346 ARG B CD  1 
ATOM   1434 N NE  . ARG A 1 185 ? -47.058  3.651   97.029  1.00 92.03  ? 346 ARG B NE  1 
ATOM   1435 C CZ  . ARG A 1 185 ? -46.738  4.942   96.998  1.00 92.82  ? 346 ARG B CZ  1 
ATOM   1436 N NH1 . ARG A 1 185 ? -45.589  5.366   97.510  1.00 94.11  ? 346 ARG B NH1 1 
ATOM   1437 N NH2 . ARG A 1 185 ? -47.574  5.814   96.451  1.00 93.72  ? 346 ARG B NH2 1 
ATOM   1438 N N   . PHE A 1 186 ? -44.516  -2.656  96.190  1.00 76.61  ? 347 PHE B N   1 
ATOM   1439 C CA  . PHE A 1 186 ? -44.308  -4.030  96.643  1.00 74.36  ? 347 PHE B CA  1 
ATOM   1440 C C   . PHE A 1 186 ? -43.444  -4.813  95.661  1.00 74.16  ? 347 PHE B C   1 
ATOM   1441 O O   . PHE A 1 186 ? -42.985  -5.915  95.966  1.00 74.95  ? 347 PHE B O   1 
ATOM   1442 C CB  . PHE A 1 186 ? -45.650  -4.738  96.856  1.00 73.42  ? 347 PHE B CB  1 
ATOM   1443 C CG  . PHE A 1 186 ? -46.537  -4.067  97.864  1.00 73.42  ? 347 PHE B CG  1 
ATOM   1444 C CD1 . PHE A 1 186 ? -47.505  -3.153  97.458  1.00 73.70  ? 347 PHE B CD1 1 
ATOM   1445 C CD2 . PHE A 1 186 ? -46.408  -4.344  99.221  1.00 73.40  ? 347 PHE B CD2 1 
ATOM   1446 C CE1 . PHE A 1 186 ? -48.326  -2.527  98.385  1.00 72.96  ? 347 PHE B CE1 1 
ATOM   1447 C CE2 . PHE A 1 186 ? -47.228  -3.723  100.153 1.00 73.48  ? 347 PHE B CE2 1 
ATOM   1448 C CZ  . PHE A 1 186 ? -48.189  -2.814  99.734  1.00 72.94  ? 347 PHE B CZ  1 
ATOM   1449 N N   . GLY A 1 187 ? -43.223  -4.234  94.484  1.00 73.69  ? 348 GLY B N   1 
ATOM   1450 C CA  . GLY A 1 187 ? -42.411  -4.865  93.449  1.00 73.47  ? 348 GLY B CA  1 
ATOM   1451 C C   . GLY A 1 187 ? -43.238  -5.409  92.303  1.00 72.59  ? 348 GLY B C   1 
ATOM   1452 O O   . GLY A 1 187 ? -42.855  -6.386  91.657  1.00 73.90  ? 348 GLY B O   1 
ATOM   1453 N N   . GLY A 1 188 ? -44.378  -4.770  92.053  1.00 71.42  ? 349 GLY B N   1 
ATOM   1454 C CA  . GLY A 1 188 ? -45.258  -5.161  90.961  1.00 71.59  ? 349 GLY B CA  1 
ATOM   1455 C C   . GLY A 1 188 ? -45.312  -4.111  89.872  1.00 71.91  ? 349 GLY B C   1 
ATOM   1456 O O   . GLY A 1 188 ? -45.131  -2.921  90.133  1.00 72.13  ? 349 GLY B O   1 
ATOM   1457 N N   . ASP A 1 189 ? -45.553  -4.557  88.645  1.00 72.17  ? 350 ASP B N   1 
ATOM   1458 C CA  . ASP A 1 189 ? -45.725  -3.653  87.520  1.00 72.99  ? 350 ASP B CA  1 
ATOM   1459 C C   . ASP A 1 189 ? -47.218  -3.414  87.303  1.00 72.26  ? 350 ASP B C   1 
ATOM   1460 O O   . ASP A 1 189 ? -47.930  -4.315  86.850  1.00 73.63  ? 350 ASP B O   1 
ATOM   1461 C CB  . ASP A 1 189 ? -45.066  -4.238  86.269  1.00 75.03  ? 350 ASP B CB  1 
ATOM   1462 C CG  . ASP A 1 189 ? -45.116  -3.298  85.075  1.00 77.49  ? 350 ASP B CG  1 
ATOM   1463 O OD1 . ASP A 1 189 ? -45.984  -2.398  85.034  1.00 78.45  ? 350 ASP B OD1 1 
ATOM   1464 O OD2 . ASP A 1 189 ? -44.281  -3.471  84.163  1.00 79.79  ? 350 ASP B OD2 1 
ATOM   1465 N N   . PRO A 1 190 ? -47.696  -2.193  87.616  1.00 70.56  ? 351 PRO B N   1 
ATOM   1466 C CA  . PRO A 1 190 ? -49.126  -1.865  87.591  1.00 70.84  ? 351 PRO B CA  1 
ATOM   1467 C C   . PRO A 1 190 ? -49.762  -1.944  86.201  1.00 72.08  ? 351 PRO B C   1 
ATOM   1468 O O   . PRO A 1 190 ? -50.986  -1.842  86.081  1.00 72.66  ? 351 PRO B O   1 
ATOM   1469 C CB  . PRO A 1 190 ? -49.169  -0.417  88.105  1.00 70.29  ? 351 PRO B CB  1 
ATOM   1470 C CG  . PRO A 1 190 ? -47.847  -0.182  88.754  1.00 70.07  ? 351 PRO B CG  1 
ATOM   1471 C CD  . PRO A 1 190 ? -46.883  -1.021  87.978  1.00 70.01  ? 351 PRO B CD  1 
ATOM   1472 N N   . SER A 1 191 ? -48.939  -2.123  85.168  1.00 72.32  ? 352 SER B N   1 
ATOM   1473 C CA  . SER A 1 191 ? -49.431  -2.217  83.795  1.00 73.11  ? 352 SER B CA  1 
ATOM   1474 C C   . SER A 1 191 ? -49.724  -3.662  83.384  1.00 73.47  ? 352 SER B C   1 
ATOM   1475 O O   . SER A 1 191 ? -50.491  -3.902  82.447  1.00 73.52  ? 352 SER B O   1 
ATOM   1476 C CB  . SER A 1 191 ? -48.446  -1.569  82.819  1.00 72.69  ? 352 SER B CB  1 
ATOM   1477 O OG  . SER A 1 191 ? -47.264  -2.340  82.696  1.00 73.34  ? 352 SER B OG  1 
ATOM   1478 N N   . ARG A 1 192 ? -49.108  -4.613  84.084  1.00 73.20  ? 353 ARG B N   1 
ATOM   1479 C CA  . ARG A 1 192 ? -49.316  -6.038  83.807  1.00 72.43  ? 353 ARG B CA  1 
ATOM   1480 C C   . ARG A 1 192 ? -49.951  -6.801  84.982  1.00 71.75  ? 353 ARG B C   1 
ATOM   1481 O O   . ARG A 1 192 ? -49.388  -7.770  85.504  1.00 72.31  ? 353 ARG B O   1 
ATOM   1482 C CB  . ARG A 1 192 ? -48.028  -6.707  83.300  1.00 71.06  ? 353 ARG B CB  1 
ATOM   1483 C CG  . ARG A 1 192 ? -46.792  -6.470  84.153  1.00 70.94  ? 353 ARG B CG  1 
ATOM   1484 C CD  . ARG A 1 192 ? -45.527  -6.572  83.318  1.00 70.75  ? 353 ARG B CD  1 
ATOM   1485 N NE  . ARG A 1 192 ? -45.306  -7.922  82.802  1.00 70.19  ? 353 ARG B NE  1 
ATOM   1486 C CZ  . ARG A 1 192 ? -44.447  -8.797  83.319  1.00 69.67  ? 353 ARG B CZ  1 
ATOM   1487 N NH1 . ARG A 1 192 ? -44.324  -9.999  82.772  1.00 68.88  ? 353 ARG B NH1 1 
ATOM   1488 N NH2 . ARG A 1 192 ? -43.711  -8.475  84.376  1.00 69.10  ? 353 ARG B NH2 1 
ATOM   1489 N N   . VAL A 1 193 ? -51.134  -6.343  85.382  1.00 69.31  ? 354 VAL B N   1 
ATOM   1490 C CA  . VAL A 1 193 ? -51.951  -7.025  86.378  1.00 66.46  ? 354 VAL B CA  1 
ATOM   1491 C C   . VAL A 1 193 ? -52.947  -7.921  85.651  1.00 66.14  ? 354 VAL B C   1 
ATOM   1492 O O   . VAL A 1 193 ? -53.690  -7.448  84.789  1.00 67.20  ? 354 VAL B O   1 
ATOM   1493 C CB  . VAL A 1 193 ? -52.719  -6.016  87.259  1.00 65.54  ? 354 VAL B CB  1 
ATOM   1494 C CG1 . VAL A 1 193 ? -53.605  -6.734  88.268  1.00 64.89  ? 354 VAL B CG1 1 
ATOM   1495 C CG2 . VAL A 1 193 ? -51.753  -5.085  87.973  1.00 66.74  ? 354 VAL B CG2 1 
ATOM   1496 N N   . THR A 1 194 ? -52.955  -9.211  85.984  1.00 64.56  ? 355 THR B N   1 
ATOM   1497 C CA  . THR A 1 194 ? -53.954  -10.131 85.425  1.00 62.76  ? 355 THR B CA  1 
ATOM   1498 C C   . THR A 1 194 ? -54.915  -10.644 86.497  1.00 60.75  ? 355 THR B C   1 
ATOM   1499 O O   . THR A 1 194 ? -54.495  -11.168 87.534  1.00 59.70  ? 355 THR B O   1 
ATOM   1500 C CB  . THR A 1 194 ? -53.333  -11.315 84.640  1.00 62.91  ? 355 THR B CB  1 
ATOM   1501 O OG1 . THR A 1 194 ? -53.021  -12.393 85.530  1.00 62.00  ? 355 THR B OG1 1 
ATOM   1502 C CG2 . THR A 1 194 ? -52.080  -10.877 83.887  1.00 63.32  ? 355 THR B CG2 1 
ATOM   1503 N N   . LEU A 1 195 ? -56.208  -10.472 86.235  1.00 58.65  ? 356 LEU B N   1 
ATOM   1504 C CA  . LEU A 1 195 ? -57.256  -10.912 87.144  1.00 56.76  ? 356 LEU B CA  1 
ATOM   1505 C C   . LEU A 1 195 ? -57.552  -12.387 86.932  1.00 56.44  ? 356 LEU B C   1 
ATOM   1506 O O   . LEU A 1 195 ? -57.694  -12.839 85.797  1.00 57.70  ? 356 LEU B O   1 
ATOM   1507 C CB  . LEU A 1 195 ? -58.536  -10.103 86.914  1.00 55.76  ? 356 LEU B CB  1 
ATOM   1508 C CG  . LEU A 1 195 ? -58.497  -8.582  87.066  1.00 55.33  ? 356 LEU B CG  1 
ATOM   1509 C CD1 . LEU A 1 195 ? -59.830  -7.977  86.653  1.00 54.00  ? 356 LEU B CD1 1 
ATOM   1510 C CD2 . LEU A 1 195 ? -58.143  -8.195  88.494  1.00 55.87  ? 356 LEU B CD2 1 
ATOM   1511 N N   . PHE A 1 196 ? -57.635  -13.138 88.023  1.00 55.12  ? 357 PHE B N   1 
ATOM   1512 C CA  . PHE A 1 196 ? -58.095  -14.517 87.943  1.00 54.84  ? 357 PHE B CA  1 
ATOM   1513 C C   . PHE A 1 196 ? -59.060  -14.861 89.070  1.00 55.85  ? 357 PHE B C   1 
ATOM   1514 O O   . PHE A 1 196 ? -58.841  -14.493 90.224  1.00 56.65  ? 357 PHE B O   1 
ATOM   1515 C CB  . PHE A 1 196 ? -56.928  -15.519 87.814  1.00 53.68  ? 357 PHE B CB  1 
ATOM   1516 C CG  . PHE A 1 196 ? -56.095  -15.696 89.061  1.00 53.03  ? 357 PHE B CG  1 
ATOM   1517 C CD1 . PHE A 1 196 ? -55.551  -14.607 89.733  1.00 53.11  ? 357 PHE B CD1 1 
ATOM   1518 C CD2 . PHE A 1 196 ? -55.803  -16.974 89.525  1.00 52.70  ? 357 PHE B CD2 1 
ATOM   1519 C CE1 . PHE A 1 196 ? -54.770  -14.787 90.865  1.00 52.63  ? 357 PHE B CE1 1 
ATOM   1520 C CE2 . PHE A 1 196 ? -55.019  -17.161 90.654  1.00 52.36  ? 357 PHE B CE2 1 
ATOM   1521 C CZ  . PHE A 1 196 ? -54.504  -16.065 91.326  1.00 52.37  ? 357 PHE B CZ  1 
ATOM   1522 N N   . GLY A 1 197 ? -60.148  -15.533 88.706  1.00 55.81  ? 358 GLY B N   1 
ATOM   1523 C CA  . GLY A 1 197 ? -61.185  -15.909 89.656  1.00 56.10  ? 358 GLY B CA  1 
ATOM   1524 C C   . GLY A 1 197 ? -61.906  -17.169 89.232  1.00 56.85  ? 358 GLY B C   1 
ATOM   1525 O O   . GLY A 1 197 ? -61.739  -17.642 88.106  1.00 57.90  ? 358 GLY B O   1 
ATOM   1526 N N   . GLU A 1 198 ? -62.710  -17.711 90.141  1.00 57.04  ? 359 GLU B N   1 
ATOM   1527 C CA  . GLU A 1 198 ? -63.469  -18.927 89.878  1.00 57.46  ? 359 GLU B CA  1 
ATOM   1528 C C   . GLU A 1 198 ? -64.930  -18.736 90.261  1.00 57.31  ? 359 GLU B C   1 
ATOM   1529 O O   . GLU A 1 198 ? -65.230  -18.090 91.268  1.00 58.11  ? 359 GLU B O   1 
ATOM   1530 C CB  . GLU A 1 198 ? -62.856  -20.106 90.636  1.00 58.31  ? 359 GLU B CB  1 
ATOM   1531 C CG  . GLU A 1 198 ? -63.367  -21.478 90.215  1.00 59.89  ? 359 GLU B CG  1 
ATOM   1532 C CD  . GLU A 1 198 ? -64.498  -22.005 91.087  1.00 60.55  ? 359 GLU B CD  1 
ATOM   1533 O OE1 . GLU A 1 198 ? -64.818  -21.385 92.127  1.00 60.36  ? 359 GLU B OE1 1 
ATOM   1534 O OE2 . GLU A 1 198 ? -65.069  -23.057 90.728  1.00 61.08  ? 359 GLU B OE2 1 
ATOM   1535 N N   . SER A 1 199 ? -65.826  -19.302 89.452  1.00 56.56  ? 360 SER B N   1 
ATOM   1536 C CA  . SER A 1 199 ? -67.274  -19.212 89.668  1.00 57.61  ? 360 SER B CA  1 
ATOM   1537 C C   . SER A 1 199 ? -67.746  -17.752 89.649  1.00 57.96  ? 360 SER B C   1 
ATOM   1538 O O   . SER A 1 199 ? -67.608  -17.071 88.632  1.00 58.10  ? 360 SER B O   1 
ATOM   1539 C CB  . SER A 1 199 ? -67.678  -19.922 90.969  1.00 58.18  ? 360 SER B CB  1 
ATOM   1540 O OG  . SER A 1 199 ? -69.084  -20.070 91.068  1.00 58.31  ? 360 SER B OG  1 
ATOM   1541 N N   . ALA A 1 200 ? -68.288  -17.277 90.770  1.00 58.02  ? 361 ALA B N   1 
ATOM   1542 C CA  . ALA A 1 200 ? -68.706  -15.881 90.901  1.00 57.74  ? 361 ALA B CA  1 
ATOM   1543 C C   . ALA A 1 200 ? -67.513  -14.936 90.778  1.00 57.72  ? 361 ALA B C   1 
ATOM   1544 O O   . ALA A 1 200 ? -67.648  -13.810 90.296  1.00 58.00  ? 361 ALA B O   1 
ATOM   1545 C CB  . ALA A 1 200 ? -69.426  -15.662 92.220  1.00 57.89  ? 361 ALA B CB  1 
ATOM   1546 N N   . GLY A 1 201 ? -66.348  -15.407 91.218  1.00 57.49  ? 362 GLY B N   1 
ATOM   1547 C CA  . GLY A 1 201 ? -65.102  -14.669 91.064  1.00 57.59  ? 362 GLY B CA  1 
ATOM   1548 C C   . GLY A 1 201 ? -64.711  -14.547 89.604  1.00 57.78  ? 362 GLY B C   1 
ATOM   1549 O O   . GLY A 1 201 ? -64.157  -13.530 89.188  1.00 58.25  ? 362 GLY B O   1 
ATOM   1550 N N   . ALA A 1 202 ? -65.012  -15.586 88.828  1.00 57.33  ? 363 ALA B N   1 
ATOM   1551 C CA  . ALA A 1 202 ? -64.722  -15.594 87.399  1.00 56.97  ? 363 ALA B CA  1 
ATOM   1552 C C   . ALA A 1 202 ? -65.660  -14.674 86.630  1.00 56.73  ? 363 ALA B C   1 
ATOM   1553 O O   . ALA A 1 202 ? -65.228  -13.987 85.703  1.00 57.20  ? 363 ALA B O   1 
ATOM   1554 C CB  . ALA A 1 202 ? -64.786  -17.006 86.844  1.00 57.74  ? 363 ALA B CB  1 
ATOM   1555 N N   . VAL A 1 203 ? -66.937  -14.653 87.011  1.00 56.42  ? 364 VAL B N   1 
ATOM   1556 C CA  . VAL A 1 203 ? -67.888  -13.743 86.365  1.00 56.73  ? 364 VAL B CA  1 
ATOM   1557 C C   . VAL A 1 203 ? -67.629  -12.304 86.806  1.00 56.75  ? 364 VAL B C   1 
ATOM   1558 O O   . VAL A 1 203 ? -68.076  -11.361 86.157  1.00 57.34  ? 364 VAL B O   1 
ATOM   1559 C CB  . VAL A 1 203 ? -69.374  -14.145 86.553  1.00 56.24  ? 364 VAL B CB  1 
ATOM   1560 C CG1 . VAL A 1 203 ? -69.569  -15.637 86.322  1.00 57.19  ? 364 VAL B CG1 1 
ATOM   1561 C CG2 . VAL A 1 203 ? -69.888  -13.748 87.920  1.00 55.81  ? 364 VAL B CG2 1 
ATOM   1562 N N   . SER A 1 204 ? -66.894  -12.150 87.905  1.00 57.06  ? 365 SER B N   1 
ATOM   1563 C CA  . SER A 1 204 ? -66.440  -10.839 88.353  1.00 57.37  ? 365 SER B CA  1 
ATOM   1564 C C   . SER A 1 204 ? -65.334  -10.296 87.446  1.00 57.66  ? 365 SER B C   1 
ATOM   1565 O O   . SER A 1 204 ? -65.426  -9.160  86.978  1.00 59.22  ? 365 SER B O   1 
ATOM   1566 C CB  . SER A 1 204 ? -65.980  -10.887 89.811  1.00 56.66  ? 365 SER B CB  1 
ATOM   1567 O OG  . SER A 1 204 ? -67.090  -10.996 90.685  1.00 56.09  ? 365 SER B OG  1 
ATOM   1568 N N   . VAL A 1 205 ? -64.307  -11.107 87.180  1.00 56.58  ? 366 VAL B N   1 
ATOM   1569 C CA  . VAL A 1 205 ? -63.219  -10.682 86.293  1.00 56.08  ? 366 VAL B CA  1 
ATOM   1570 C C   . VAL A 1 205 ? -63.724  -10.488 84.862  1.00 56.15  ? 366 VAL B C   1 
ATOM   1571 O O   . VAL A 1 205 ? -63.157  -9.706  84.101  1.00 57.91  ? 366 VAL B O   1 
ATOM   1572 C CB  . VAL A 1 205 ? -61.979  -11.621 86.325  1.00 55.70  ? 366 VAL B CB  1 
ATOM   1573 C CG1 . VAL A 1 205 ? -61.667  -12.076 87.743  1.00 55.74  ? 366 VAL B CG1 1 
ATOM   1574 C CG2 . VAL A 1 205 ? -62.153  -12.821 85.410  1.00 55.76  ? 366 VAL B CG2 1 
ATOM   1575 N N   . SER A 1 206 ? -64.798  -11.194 84.513  1.00 55.42  ? 367 SER B N   1 
ATOM   1576 C CA  . SER A 1 206 ? -65.413  -11.063 83.198  1.00 55.54  ? 367 SER B CA  1 
ATOM   1577 C C   . SER A 1 206 ? -66.178  -9.750  83.087  1.00 55.01  ? 367 SER B C   1 
ATOM   1578 O O   . SER A 1 206 ? -66.254  -9.157  82.009  1.00 55.56  ? 367 SER B O   1 
ATOM   1579 C CB  . SER A 1 206 ? -66.352  -12.234 82.924  1.00 55.76  ? 367 SER B CB  1 
ATOM   1580 O OG  . SER A 1 206 ? -67.573  -12.089 83.627  1.00 56.02  ? 367 SER B OG  1 
ATOM   1581 N N   . LEU A 1 207 ? -66.749  -9.309  84.205  1.00 53.93  ? 368 LEU B N   1 
ATOM   1582 C CA  . LEU A 1 207 ? -67.484  -8.049  84.243  1.00 53.10  ? 368 LEU B CA  1 
ATOM   1583 C C   . LEU A 1 207 ? -66.547  -6.845  84.239  1.00 53.87  ? 368 LEU B C   1 
ATOM   1584 O O   . LEU A 1 207 ? -66.929  -5.769  83.787  1.00 54.61  ? 368 LEU B O   1 
ATOM   1585 C CB  . LEU A 1 207 ? -68.444  -7.998  85.435  1.00 51.45  ? 368 LEU B CB  1 
ATOM   1586 C CG  . LEU A 1 207 ? -69.692  -8.883  85.371  1.00 50.60  ? 368 LEU B CG  1 
ATOM   1587 C CD1 . LEU A 1 207 ? -70.537  -8.682  86.618  1.00 50.54  ? 368 LEU B CD1 1 
ATOM   1588 C CD2 . LEU A 1 207 ? -70.520  -8.637  84.116  1.00 50.13  ? 368 LEU B CD2 1 
ATOM   1589 N N   . HIS A 1 208 ? -65.326  -7.030  84.735  1.00 54.14  ? 369 HIS B N   1 
ATOM   1590 C CA  . HIS A 1 208 ? -64.306  -5.989  84.649  1.00 54.52  ? 369 HIS B CA  1 
ATOM   1591 C C   . HIS A 1 208 ? -63.813  -5.832  83.211  1.00 56.25  ? 369 HIS B C   1 
ATOM   1592 O O   . HIS A 1 208 ? -63.466  -4.726  82.784  1.00 58.27  ? 369 HIS B O   1 
ATOM   1593 C CB  . HIS A 1 208 ? -63.144  -6.274  85.600  1.00 53.29  ? 369 HIS B CB  1 
ATOM   1594 C CG  . HIS A 1 208 ? -63.505  -6.148  87.047  1.00 53.06  ? 369 HIS B CG  1 
ATOM   1595 N ND1 . HIS A 1 208 ? -64.080  -5.012  87.575  1.00 52.46  ? 369 HIS B ND1 1 
ATOM   1596 C CD2 . HIS A 1 208 ? -63.364  -7.012  88.080  1.00 52.87  ? 369 HIS B CD2 1 
ATOM   1597 C CE1 . HIS A 1 208 ? -64.283  -5.184  88.869  1.00 52.03  ? 369 HIS B CE1 1 
ATOM   1598 N NE2 . HIS A 1 208 ? -63.858  -6.390  89.201  1.00 52.13  ? 369 HIS B NE2 1 
ATOM   1599 N N   . LEU A 1 209 ? -63.800  -6.940  82.470  1.00 56.73  ? 370 LEU B N   1 
ATOM   1600 C CA  . LEU A 1 209 ? -63.499  -6.924  81.037  1.00 57.88  ? 370 LEU B CA  1 
ATOM   1601 C C   . LEU A 1 209 ? -64.561  -6.153  80.248  1.00 58.77  ? 370 LEU B C   1 
ATOM   1602 O O   . LEU A 1 209 ? -64.284  -5.628  79.168  1.00 61.14  ? 370 LEU B O   1 
ATOM   1603 C CB  . LEU A 1 209 ? -63.391  -8.350  80.487  1.00 57.25  ? 370 LEU B CB  1 
ATOM   1604 C CG  . LEU A 1 209 ? -62.199  -9.232  80.866  1.00 56.64  ? 370 LEU B CG  1 
ATOM   1605 C CD1 . LEU A 1 209 ? -62.522  -10.688 80.567  1.00 56.45  ? 370 LEU B CD1 1 
ATOM   1606 C CD2 . LEU A 1 209 ? -60.935  -8.803  80.139  1.00 56.45  ? 370 LEU B CD2 1 
ATOM   1607 N N   . LEU A 1 210 ? -65.772  -6.094  80.797  1.00 57.79  ? 371 LEU B N   1 
ATOM   1608 C CA  . LEU A 1 210 ? -66.887  -5.404  80.156  1.00 57.92  ? 371 LEU B CA  1 
ATOM   1609 C C   . LEU A 1 210 ? -67.083  -3.976  80.655  1.00 59.38  ? 371 LEU B C   1 
ATOM   1610 O O   . LEU A 1 210 ? -67.471  -3.100  79.883  1.00 59.68  ? 371 LEU B O   1 
ATOM   1611 C CB  . LEU A 1 210 ? -68.182  -6.196  80.347  1.00 55.85  ? 371 LEU B CB  1 
ATOM   1612 C CG  . LEU A 1 210 ? -68.635  -7.121  79.219  1.00 54.72  ? 371 LEU B CG  1 
ATOM   1613 C CD1 . LEU A 1 210 ? -67.621  -8.217  78.924  1.00 54.37  ? 371 LEU B CD1 1 
ATOM   1614 C CD2 . LEU A 1 210 ? -69.979  -7.719  79.586  1.00 53.88  ? 371 LEU B CD2 1 
ATOM   1615 N N   . SER A 1 211 ? -66.815  -3.755  81.942  1.00 60.84  ? 372 SER B N   1 
ATOM   1616 C CA  . SER A 1 211 ? -67.095  -2.478  82.602  1.00 61.17  ? 372 SER B CA  1 
ATOM   1617 C C   . SER A 1 211 ? -66.246  -1.332  82.076  1.00 61.44  ? 372 SER B C   1 
ATOM   1618 O O   . SER A 1 211 ? -65.062  -1.508  81.763  1.00 61.75  ? 372 SER B O   1 
ATOM   1619 C CB  . SER A 1 211 ? -66.904  -2.595  84.116  1.00 62.43  ? 372 SER B CB  1 
ATOM   1620 O OG  . SER A 1 211 ? -67.127  -1.348  84.755  1.00 63.12  ? 372 SER B OG  1 
ATOM   1621 N N   . ALA A 1 212 ? -66.878  -0.163  81.997  1.00 60.29  ? 373 ALA B N   1 
ATOM   1622 C CA  . ALA A 1 212 ? -66.226  1.077   81.593  1.00 58.96  ? 373 ALA B CA  1 
ATOM   1623 C C   . ALA A 1 212 ? -65.253  1.562   82.665  1.00 58.62  ? 373 ALA B C   1 
ATOM   1624 O O   . ALA A 1 212 ? -64.142  1.997   82.355  1.00 58.74  ? 373 ALA B O   1 
ATOM   1625 C CB  . ALA A 1 212 ? -67.273  2.142   81.312  1.00 59.14  ? 373 ALA B CB  1 
ATOM   1626 N N   . LEU A 1 213 ? -65.678  1.468   83.924  1.00 57.91  ? 374 LEU B N   1 
ATOM   1627 C CA  . LEU A 1 213 ? -64.894  1.950   85.061  1.00 58.26  ? 374 LEU B CA  1 
ATOM   1628 C C   . LEU A 1 213 ? -63.680  1.079   85.364  1.00 59.64  ? 374 LEU B C   1 
ATOM   1629 O O   . LEU A 1 213 ? -62.799  1.487   86.122  1.00 59.99  ? 374 LEU B O   1 
ATOM   1630 C CB  . LEU A 1 213 ? -65.773  2.052   86.314  1.00 56.99  ? 374 LEU B CB  1 
ATOM   1631 C CG  . LEU A 1 213 ? -67.019  2.942   86.263  1.00 56.51  ? 374 LEU B CG  1 
ATOM   1632 C CD1 . LEU A 1 213 ? -68.025  2.499   87.311  1.00 55.61  ? 374 LEU B CD1 1 
ATOM   1633 C CD2 . LEU A 1 213 ? -66.670  4.414   86.431  1.00 56.00  ? 374 LEU B CD2 1 
ATOM   1634 N N   . SER A 1 214 ? -63.632  -0.112  84.770  1.00 61.57  ? 375 SER B N   1 
ATOM   1635 C CA  . SER A 1 214 ? -62.585  -1.084  85.078  1.00 63.53  ? 375 SER B CA  1 
ATOM   1636 C C   . SER A 1 214 ? -61.604  -1.355  83.940  1.00 65.23  ? 375 SER B C   1 
ATOM   1637 O O   . SER A 1 214 ? -60.549  -1.950  84.168  1.00 66.75  ? 375 SER B O   1 
ATOM   1638 C CB  . SER A 1 214 ? -63.204  -2.406  85.542  1.00 63.22  ? 375 SER B CB  1 
ATOM   1639 O OG  . SER A 1 214 ? -63.743  -2.295  86.846  1.00 63.10  ? 375 SER B OG  1 
ATOM   1640 N N   . ARG A 1 215 ? -61.936  -0.911  82.729  1.00 66.30  ? 376 ARG B N   1 
ATOM   1641 C CA  . ARG A 1 215 ? -61.203  -1.339  81.531  1.00 68.36  ? 376 ARG B CA  1 
ATOM   1642 C C   . ARG A 1 215 ? -59.716  -0.945  81.463  1.00 69.48  ? 376 ARG B C   1 
ATOM   1643 O O   . ARG A 1 215 ? -58.924  -1.618  80.800  1.00 70.34  ? 376 ARG B O   1 
ATOM   1644 C CB  . ARG A 1 215 ? -61.936  -0.926  80.252  1.00 67.57  ? 376 ARG B CB  1 
ATOM   1645 C CG  . ARG A 1 215 ? -61.563  -1.787  79.057  1.00 66.91  ? 376 ARG B CG  1 
ATOM   1646 C CD  . ARG A 1 215 ? -62.390  -1.456  77.835  1.00 67.35  ? 376 ARG B CD  1 
ATOM   1647 N NE  . ARG A 1 215 ? -63.740  -1.997  77.917  1.00 68.58  ? 376 ARG B NE  1 
ATOM   1648 C CZ  . ARG A 1 215 ? -64.639  -1.910  76.941  1.00 70.63  ? 376 ARG B CZ  1 
ATOM   1649 N NH1 . ARG A 1 215 ? -64.331  -1.303  75.800  1.00 69.67  ? 376 ARG B NH1 1 
ATOM   1650 N NH2 . ARG A 1 215 ? -65.849  -2.430  77.104  1.00 72.83  ? 376 ARG B NH2 1 
ATOM   1651 N N   . ASP A 1 216 ? -59.337  0.129   82.149  1.00 71.29  ? 377 ASP B N   1 
ATOM   1652 C CA  . ASP A 1 216 ? -57.938  0.559   82.170  1.00 73.09  ? 377 ASP B CA  1 
ATOM   1653 C C   . ASP A 1 216 ? -57.239  0.239   83.498  1.00 71.34  ? 377 ASP B C   1 
ATOM   1654 O O   . ASP A 1 216 ? -56.231  0.862   83.846  1.00 71.04  ? 377 ASP B O   1 
ATOM   1655 C CB  . ASP A 1 216 ? -57.821  2.053   81.819  1.00 77.76  ? 377 ASP B CB  1 
ATOM   1656 C CG  . ASP A 1 216 ? -58.616  2.952   82.765  1.00 82.50  ? 377 ASP B CG  1 
ATOM   1657 O OD1 . ASP A 1 216 ? -59.574  2.475   83.414  1.00 85.19  ? 377 ASP B OD1 1 
ATOM   1658 O OD2 . ASP A 1 216 ? -58.281  4.154   82.851  1.00 85.42  ? 377 ASP B OD2 1 
ATOM   1659 N N   . LEU A 1 217 ? -57.764  -0.747  84.222  1.00 68.51  ? 378 LEU B N   1 
ATOM   1660 C CA  . LEU A 1 217 ? -57.258  -1.084  85.553  1.00 66.23  ? 378 LEU B CA  1 
ATOM   1661 C C   . LEU A 1 217 ? -56.422  -2.362  85.608  1.00 65.27  ? 378 LEU B C   1 
ATOM   1662 O O   . LEU A 1 217 ? -55.697  -2.586  86.576  1.00 65.94  ? 378 LEU B O   1 
ATOM   1663 C CB  . LEU A 1 217 ? -58.409  -1.165  86.565  1.00 65.36  ? 378 LEU B CB  1 
ATOM   1664 C CG  . LEU A 1 217 ? -59.228  0.097   86.856  1.00 64.86  ? 378 LEU B CG  1 
ATOM   1665 C CD1 . LEU A 1 217 ? -60.338  -0.220  87.845  1.00 65.45  ? 378 LEU B CD1 1 
ATOM   1666 C CD2 . LEU A 1 217 ? -58.360  1.228   87.387  1.00 65.39  ? 378 LEU B CD2 1 
ATOM   1667 N N   . PHE A 1 218 ? -56.521  -3.193  84.574  1.00 64.52  ? 379 PHE B N   1 
ATOM   1668 C CA  . PHE A 1 218 ? -55.771  -4.450  84.514  1.00 64.60  ? 379 PHE B CA  1 
ATOM   1669 C C   . PHE A 1 218 ? -55.337  -4.769  83.082  1.00 66.04  ? 379 PHE B C   1 
ATOM   1670 O O   . PHE A 1 218 ? -55.717  -4.065  82.144  1.00 67.69  ? 379 PHE B O   1 
ATOM   1671 C CB  . PHE A 1 218 ? -56.601  -5.598  85.107  1.00 63.40  ? 379 PHE B CB  1 
ATOM   1672 C CG  . PHE A 1 218 ? -57.846  -5.922  84.326  1.00 62.37  ? 379 PHE B CG  1 
ATOM   1673 C CD1 . PHE A 1 218 ? -58.984  -5.128  84.435  1.00 62.22  ? 379 PHE B CD1 1 
ATOM   1674 C CD2 . PHE A 1 218 ? -57.882  -7.027  83.486  1.00 61.55  ? 379 PHE B CD2 1 
ATOM   1675 C CE1 . PHE A 1 218 ? -60.130  -5.427  83.714  1.00 61.33  ? 379 PHE B CE1 1 
ATOM   1676 C CE2 . PHE A 1 218 ? -59.026  -7.332  82.764  1.00 61.01  ? 379 PHE B CE2 1 
ATOM   1677 C CZ  . PHE A 1 218 ? -60.151  -6.531  82.879  1.00 60.94  ? 379 PHE B CZ  1 
ATOM   1678 N N   . GLN A 1 219 ? -54.548  -5.829  82.917  1.00 66.54  ? 380 GLN B N   1 
ATOM   1679 C CA  . GLN A 1 219 ? -54.042  -6.216  81.599  1.00 67.75  ? 380 GLN B CA  1 
ATOM   1680 C C   . GLN A 1 219 ? -54.781  -7.419  80.998  1.00 67.46  ? 380 GLN B C   1 
ATOM   1681 O O   . GLN A 1 219 ? -55.448  -7.289  79.969  1.00 67.00  ? 380 GLN B O   1 
ATOM   1682 C CB  . GLN A 1 219 ? -52.536  -6.480  81.657  1.00 69.05  ? 380 GLN B CB  1 
ATOM   1683 C CG  . GLN A 1 219 ? -51.866  -6.538  80.294  1.00 71.17  ? 380 GLN B CG  1 
ATOM   1684 C CD  . GLN A 1 219 ? -50.438  -7.039  80.364  1.00 73.95  ? 380 GLN B CD  1 
ATOM   1685 O OE1 . GLN A 1 219 ? -50.106  -7.905  81.175  1.00 74.34  ? 380 GLN B OE1 1 
ATOM   1686 N NE2 . GLN A 1 219 ? -49.584  -6.503  79.502  1.00 77.26  ? 380 GLN B NE2 1 
ATOM   1687 N N   . ARG A 1 220 ? -54.645  -8.580  81.638  1.00 66.93  ? 381 ARG B N   1 
ATOM   1688 C CA  . ARG A 1 220 ? -55.223  -9.834  81.137  1.00 65.39  ? 381 ARG B CA  1 
ATOM   1689 C C   . ARG A 1 220 ? -56.219  -10.430 82.130  1.00 64.48  ? 381 ARG B C   1 
ATOM   1690 O O   . ARG A 1 220 ? -56.416  -9.891  83.222  1.00 64.86  ? 381 ARG B O   1 
ATOM   1691 C CB  . ARG A 1 220 ? -54.121  -10.854 80.839  1.00 65.38  ? 381 ARG B CB  1 
ATOM   1692 C CG  . ARG A 1 220 ? -53.047  -10.356 79.893  1.00 66.47  ? 381 ARG B CG  1 
ATOM   1693 C CD  . ARG A 1 220 ? -51.960  -11.392 79.692  1.00 67.55  ? 381 ARG B CD  1 
ATOM   1694 N NE  . ARG A 1 220 ? -50.930  -10.884 78.791  1.00 69.22  ? 381 ARG B NE  1 
ATOM   1695 C CZ  . ARG A 1 220 ? -49.739  -10.437 79.181  1.00 70.89  ? 381 ARG B CZ  1 
ATOM   1696 N NH1 . ARG A 1 220 ? -49.403  -10.442 80.466  1.00 71.56  ? 381 ARG B NH1 1 
ATOM   1697 N NH2 . ARG A 1 220 ? -48.875  -9.989  78.280  1.00 72.19  ? 381 ARG B NH2 1 
ATOM   1698 N N   . ALA A 1 221 ? -56.839  -11.545 81.748  1.00 62.34  ? 382 ALA B N   1 
ATOM   1699 C CA  . ALA A 1 221 ? -57.816  -12.212 82.602  1.00 60.42  ? 382 ALA B CA  1 
ATOM   1700 C C   . ALA A 1 221 ? -57.766  -13.733 82.488  1.00 59.65  ? 382 ALA B C   1 
ATOM   1701 O O   . ALA A 1 221 ? -57.665  -14.276 81.388  1.00 60.40  ? 382 ALA B O   1 
ATOM   1702 C CB  . ALA A 1 221 ? -59.219  -11.704 82.297  1.00 60.11  ? 382 ALA B CB  1 
ATOM   1703 N N   . ILE A 1 222 ? -57.823  -14.406 83.638  1.00 58.36  ? 383 ILE B N   1 
ATOM   1704 C CA  . ILE A 1 222 ? -58.011  -15.858 83.701  1.00 56.07  ? 383 ILE B CA  1 
ATOM   1705 C C   . ILE A 1 222 ? -59.374  -16.136 84.332  1.00 55.53  ? 383 ILE B C   1 
ATOM   1706 O O   . ILE A 1 222 ? -59.677  -15.639 85.418  1.00 55.27  ? 383 ILE B O   1 
ATOM   1707 C CB  . ILE A 1 222 ? -56.895  -16.573 84.497  1.00 54.94  ? 383 ILE B CB  1 
ATOM   1708 C CG1 . ILE A 1 222 ? -55.513  -16.179 83.969  1.00 55.32  ? 383 ILE B CG1 1 
ATOM   1709 C CG2 . ILE A 1 222 ? -57.074  -18.084 84.431  1.00 53.97  ? 383 ILE B CG2 1 
ATOM   1710 C CD1 . ILE A 1 222 ? -54.361  -16.560 84.877  1.00 55.40  ? 383 ILE B CD1 1 
ATOM   1711 N N   . LEU A 1 223 ? -60.191  -16.925 83.641  1.00 55.59  ? 384 LEU B N   1 
ATOM   1712 C CA  . LEU A 1 223 ? -61.574  -17.161 84.056  1.00 55.86  ? 384 LEU B CA  1 
ATOM   1713 C C   . LEU A 1 223 ? -61.869  -18.649 84.236  1.00 56.16  ? 384 LEU B C   1 
ATOM   1714 O O   . LEU A 1 223 ? -62.120  -19.364 83.264  1.00 56.96  ? 384 LEU B O   1 
ATOM   1715 C CB  . LEU A 1 223 ? -62.553  -16.543 83.051  1.00 55.23  ? 384 LEU B CB  1 
ATOM   1716 C CG  . LEU A 1 223 ? -62.425  -15.052 82.734  1.00 54.80  ? 384 LEU B CG  1 
ATOM   1717 C CD1 . LEU A 1 223 ? -61.412  -14.799 81.629  1.00 55.87  ? 384 LEU B CD1 1 
ATOM   1718 C CD2 . LEU A 1 223 ? -63.777  -14.493 82.335  1.00 55.07  ? 384 LEU B CD2 1 
ATOM   1719 N N   . GLN A 1 224 ? -61.843  -19.103 85.485  1.00 55.27  ? 385 GLN B N   1 
ATOM   1720 C CA  . GLN A 1 224 ? -62.091  -20.503 85.802  1.00 54.45  ? 385 GLN B CA  1 
ATOM   1721 C C   . GLN A 1 224 ? -63.571  -20.748 86.087  1.00 54.70  ? 385 GLN B C   1 
ATOM   1722 O O   . GLN A 1 224 ? -64.121  -20.197 87.041  1.00 55.63  ? 385 GLN B O   1 
ATOM   1723 C CB  . GLN A 1 224 ? -61.247  -20.934 87.002  1.00 54.38  ? 385 GLN B CB  1 
ATOM   1724 C CG  . GLN A 1 224 ? -59.745  -20.869 86.776  1.00 55.20  ? 385 GLN B CG  1 
ATOM   1725 C CD  . GLN A 1 224 ? -58.943  -21.022 88.060  1.00 56.83  ? 385 GLN B CD  1 
ATOM   1726 O OE1 . GLN A 1 224 ? -57.773  -20.638 88.124  1.00 57.31  ? 385 GLN B OE1 1 
ATOM   1727 N NE2 . GLN A 1 224 ? -59.570  -21.582 89.092  1.00 57.01  ? 385 GLN B NE2 1 
ATOM   1728 N N   . SER A 1 225 ? -64.206  -21.565 85.246  1.00 54.57  ? 386 SER B N   1 
ATOM   1729 C CA  . SER A 1 225 ? -65.595  -22.014 85.436  1.00 54.46  ? 386 SER B CA  1 
ATOM   1730 C C   . SER A 1 225 ? -66.600  -20.873 85.645  1.00 54.15  ? 386 SER B C   1 
ATOM   1731 O O   . SER A 1 225 ? -67.453  -20.946 86.530  1.00 54.41  ? 386 SER B O   1 
ATOM   1732 C CB  . SER A 1 225 ? -65.690  -23.020 86.599  1.00 54.88  ? 386 SER B CB  1 
ATOM   1733 O OG  . SER A 1 225 ? -64.760  -24.082 86.465  1.00 54.93  ? 386 SER B OG  1 
ATOM   1734 N N   . GLY A 1 226 ? -66.500  -19.826 84.832  1.00 54.72  ? 387 GLY B N   1 
ATOM   1735 C CA  . GLY A 1 226 ? -67.413  -18.686 84.941  1.00 55.86  ? 387 GLY B CA  1 
ATOM   1736 C C   . GLY A 1 226 ? -67.355  -17.718 83.774  1.00 57.03  ? 387 GLY B C   1 
ATOM   1737 O O   . GLY A 1 226 ? -66.292  -17.493 83.190  1.00 58.03  ? 387 GLY B O   1 
ATOM   1738 N N   . SER A 1 227 ? -68.511  -17.153 83.434  1.00 57.21  ? 388 SER B N   1 
ATOM   1739 C CA  . SER A 1 227 ? -68.619  -16.168 82.360  1.00 57.61  ? 388 SER B CA  1 
ATOM   1740 C C   . SER A 1 227 ? -69.806  -15.236 82.614  1.00 57.76  ? 388 SER B C   1 
ATOM   1741 O O   . SER A 1 227 ? -70.769  -15.634 83.277  1.00 56.93  ? 388 SER B O   1 
ATOM   1742 C CB  . SER A 1 227 ? -68.771  -16.863 81.006  1.00 58.19  ? 388 SER B CB  1 
ATOM   1743 O OG  . SER A 1 227 ? -70.113  -17.252 80.791  1.00 59.53  ? 388 SER B OG  1 
ATOM   1744 N N   . PRO A 1 228 ? -69.759  -14.002 82.064  1.00 58.01  ? 389 PRO B N   1 
ATOM   1745 C CA  . PRO A 1 228 ? -70.781  -13.000 82.382  1.00 57.84  ? 389 PRO B CA  1 
ATOM   1746 C C   . PRO A 1 228 ? -72.154  -13.321 81.786  1.00 57.43  ? 389 PRO B C   1 
ATOM   1747 O O   . PRO A 1 228 ? -73.145  -12.681 82.145  1.00 57.85  ? 389 PRO B O   1 
ATOM   1748 C CB  . PRO A 1 228 ? -70.217  -11.722 81.759  1.00 58.15  ? 389 PRO B CB  1 
ATOM   1749 C CG  . PRO A 1 228 ? -69.391  -12.195 80.614  1.00 57.46  ? 389 PRO B CG  1 
ATOM   1750 C CD  . PRO A 1 228 ? -68.839  -13.534 81.009  1.00 57.76  ? 389 PRO B CD  1 
ATOM   1751 N N   . THR A 1 229 ? -72.203  -14.305 80.893  1.00 56.65  ? 390 THR B N   1 
ATOM   1752 C CA  . THR A 1 229 ? -73.444  -14.687 80.227  1.00 56.10  ? 390 THR B CA  1 
ATOM   1753 C C   . THR A 1 229 ? -74.186  -15.823 80.950  1.00 55.09  ? 390 THR B C   1 
ATOM   1754 O O   . THR A 1 229 ? -75.283  -16.208 80.542  1.00 54.15  ? 390 THR B O   1 
ATOM   1755 C CB  . THR A 1 229 ? -73.209  -15.013 78.730  1.00 56.78  ? 390 THR B CB  1 
ATOM   1756 O OG1 . THR A 1 229 ? -74.467  -15.227 78.080  1.00 58.38  ? 390 THR B OG1 1 
ATOM   1757 C CG2 . THR A 1 229 ? -72.328  -16.247 78.553  1.00 56.36  ? 390 THR B CG2 1 
ATOM   1758 N N   . ALA A 1 230 ? -73.588  -16.336 82.025  1.00 55.39  ? 391 ALA B N   1 
ATOM   1759 C CA  . ALA A 1 230 ? -74.198  -17.381 82.854  1.00 56.21  ? 391 ALA B CA  1 
ATOM   1760 C C   . ALA A 1 230 ? -75.540  -16.922 83.429  1.00 57.04  ? 391 ALA B C   1 
ATOM   1761 O O   . ALA A 1 230 ? -75.659  -15.775 83.865  1.00 58.03  ? 391 ALA B O   1 
ATOM   1762 C CB  . ALA A 1 230 ? -73.252  -17.790 83.973  1.00 56.21  ? 391 ALA B CB  1 
ATOM   1763 N N   . PRO A 1 231 ? -76.555  -17.814 83.432  1.00 57.06  ? 392 PRO B N   1 
ATOM   1764 C CA  . PRO A 1 231 ? -77.917  -17.448 83.852  1.00 56.47  ? 392 PRO B CA  1 
ATOM   1765 C C   . PRO A 1 231 ? -78.024  -16.943 85.291  1.00 56.07  ? 392 PRO B C   1 
ATOM   1766 O O   . PRO A 1 231 ? -78.900  -16.131 85.586  1.00 57.23  ? 392 PRO B O   1 
ATOM   1767 C CB  . PRO A 1 231 ? -78.703  -18.756 83.692  1.00 56.67  ? 392 PRO B CB  1 
ATOM   1768 C CG  . PRO A 1 231 ? -77.673  -19.832 83.699  1.00 56.81  ? 392 PRO B CG  1 
ATOM   1769 C CD  . PRO A 1 231 ? -76.478  -19.228 83.028  1.00 56.70  ? 392 PRO B CD  1 
ATOM   1770 N N   . TRP A 1 232 ? -77.140  -17.416 86.167  1.00 55.20  ? 393 TRP B N   1 
ATOM   1771 C CA  . TRP A 1 232 ? -77.151  -17.025 87.579  1.00 54.15  ? 393 TRP B CA  1 
ATOM   1772 C C   . TRP A 1 232 ? -76.384  -15.734 87.868  1.00 55.11  ? 393 TRP B C   1 
ATOM   1773 O O   . TRP A 1 232 ? -76.519  -15.167 88.955  1.00 55.61  ? 393 TRP B O   1 
ATOM   1774 C CB  . TRP A 1 232 ? -76.608  -18.154 88.459  1.00 52.41  ? 393 TRP B CB  1 
ATOM   1775 C CG  . TRP A 1 232 ? -75.274  -18.688 88.029  1.00 50.75  ? 393 TRP B CG  1 
ATOM   1776 C CD1 . TRP A 1 232 ? -75.048  -19.728 87.175  1.00 50.59  ? 393 TRP B CD1 1 
ATOM   1777 C CD2 . TRP A 1 232 ? -73.983  -18.216 88.436  1.00 49.92  ? 393 TRP B CD2 1 
ATOM   1778 N NE1 . TRP A 1 232 ? -73.699  -19.932 87.021  1.00 50.08  ? 393 TRP B NE1 1 
ATOM   1779 C CE2 . TRP A 1 232 ? -73.020  -19.019 87.784  1.00 49.66  ? 393 TRP B CE2 1 
ATOM   1780 C CE3 . TRP A 1 232 ? -73.544  -17.192 89.287  1.00 49.47  ? 393 TRP B CE3 1 
ATOM   1781 C CZ2 . TRP A 1 232 ? -71.643  -18.831 87.954  1.00 48.67  ? 393 TRP B CZ2 1 
ATOM   1782 C CZ3 . TRP A 1 232 ? -72.172  -17.005 89.455  1.00 49.18  ? 393 TRP B CZ3 1 
ATOM   1783 C CH2 . TRP A 1 232 ? -71.240  -17.824 88.790  1.00 48.44  ? 393 TRP B CH2 1 
ATOM   1784 N N   . ALA A 1 233 ? -75.593  -15.277 86.897  1.00 55.69  ? 394 ALA B N   1 
ATOM   1785 C CA  . ALA A 1 233 ? -74.710  -14.120 87.075  1.00 56.14  ? 394 ALA B CA  1 
ATOM   1786 C C   . ALA A 1 233 ? -75.448  -12.807 87.333  1.00 56.43  ? 394 ALA B C   1 
ATOM   1787 O O   . ALA A 1 233 ? -75.091  -12.071 88.252  1.00 58.08  ? 394 ALA B O   1 
ATOM   1788 C CB  . ALA A 1 233 ? -73.763  -13.975 85.892  1.00 56.29  ? 394 ALA B CB  1 
ATOM   1789 N N   . LEU A 1 234 ? -76.466  -12.513 86.526  1.00 56.42  ? 395 LEU B N   1 
ATOM   1790 C CA  . LEU A 1 234 ? -77.233  -11.275 86.679  1.00 57.19  ? 395 LEU B CA  1 
ATOM   1791 C C   . LEU A 1 234 ? -78.720  -11.524 86.905  1.00 58.29  ? 395 LEU B C   1 
ATOM   1792 O O   . LEU A 1 234 ? -79.255  -12.561 86.509  1.00 59.00  ? 395 LEU B O   1 
ATOM   1793 C CB  . LEU A 1 234 ? -77.072  -10.361 85.457  1.00 57.02  ? 395 LEU B CB  1 
ATOM   1794 C CG  . LEU A 1 234 ? -75.739  -9.876  84.877  1.00 57.41  ? 395 LEU B CG  1 
ATOM   1795 C CD1 . LEU A 1 234 ? -75.970  -8.492  84.298  1.00 57.41  ? 395 LEU B CD1 1 
ATOM   1796 C CD2 . LEU A 1 234 ? -74.597  -9.826  85.880  1.00 57.79  ? 395 LEU B CD2 1 
ATOM   1797 N N   . VAL A 1 235 ? -79.375  -10.558 87.543  1.00 59.02  ? 396 VAL B N   1 
ATOM   1798 C CA  . VAL A 1 235 ? -80.831  -10.549 87.663  1.00 60.54  ? 396 VAL B CA  1 
ATOM   1799 C C   . VAL A 1 235 ? -81.383  -9.237  87.130  1.00 62.25  ? 396 VAL B C   1 
ATOM   1800 O O   . VAL A 1 235 ? -80.705  -8.207  87.174  1.00 63.19  ? 396 VAL B O   1 
ATOM   1801 C CB  . VAL A 1 235 ? -81.316  -10.750 89.117  1.00 60.44  ? 396 VAL B CB  1 
ATOM   1802 C CG1 . VAL A 1 235 ? -81.186  -12.208 89.532  1.00 61.65  ? 396 VAL B CG1 1 
ATOM   1803 C CG2 . VAL A 1 235 ? -80.583  -9.825  90.081  1.00 60.65  ? 396 VAL B CG2 1 
ATOM   1804 N N   . SER A 1 236 ? -82.615  -9.281  86.630  1.00 64.33  ? 397 SER B N   1 
ATOM   1805 C CA  . SER A 1 236 ? -83.293  -8.086  86.140  1.00 66.80  ? 397 SER B CA  1 
ATOM   1806 C C   . SER A 1 236 ? -83.530  -7.088  87.272  1.00 68.08  ? 397 SER B C   1 
ATOM   1807 O O   . SER A 1 236 ? -83.525  -7.460  88.448  1.00 68.85  ? 397 SER B O   1 
ATOM   1808 C CB  . SER A 1 236 ? -84.621  -8.455  85.468  1.00 67.96  ? 397 SER B CB  1 
ATOM   1809 O OG  . SER A 1 236 ? -85.617  -8.776  86.426  1.00 69.29  ? 397 SER B OG  1 
ATOM   1810 N N   . ARG A 1 237 ? -83.732  -5.823  86.908  1.00 68.95  ? 398 ARG B N   1 
ATOM   1811 C CA  . ARG A 1 237 ? -84.013  -4.764  87.875  1.00 69.18  ? 398 ARG B CA  1 
ATOM   1812 C C   . ARG A 1 237 ? -85.321  -5.028  88.617  1.00 69.78  ? 398 ARG B C   1 
ATOM   1813 O O   . ARG A 1 237 ? -85.384  -4.852  89.834  1.00 69.08  ? 398 ARG B O   1 
ATOM   1814 C CB  . ARG A 1 237 ? -84.076  -3.398  87.188  1.00 70.84  ? 398 ARG B CB  1 
ATOM   1815 C CG  . ARG A 1 237 ? -83.098  -3.210  86.038  1.00 72.14  ? 398 ARG B CG  1 
ATOM   1816 C CD  . ARG A 1 237 ? -81.755  -2.661  86.486  1.00 71.85  ? 398 ARG B CD  1 
ATOM   1817 N NE  . ARG A 1 237 ? -81.836  -1.266  86.912  1.00 71.74  ? 398 ARG B NE  1 
ATOM   1818 C CZ  . ARG A 1 237 ? -81.998  -0.230  86.093  1.00 71.46  ? 398 ARG B CZ  1 
ATOM   1819 N NH1 . ARG A 1 237 ? -82.113  -0.414  84.785  1.00 70.27  ? 398 ARG B NH1 1 
ATOM   1820 N NH2 . ARG A 1 237 ? -82.057  0.998   86.590  1.00 72.06  ? 398 ARG B NH2 1 
ATOM   1821 N N   . GLU A 1 238 ? -86.353  -5.451  87.880  1.00 71.03  ? 399 GLU B N   1 
ATOM   1822 C CA  . GLU A 1 238 ? -87.648  -5.793  88.474  1.00 73.52  ? 399 GLU B CA  1 
ATOM   1823 C C   . GLU A 1 238 ? -87.468  -6.833  89.565  1.00 73.05  ? 399 GLU B C   1 
ATOM   1824 O O   . GLU A 1 238 ? -87.867  -6.615  90.708  1.00 74.06  ? 399 GLU B O   1 
ATOM   1825 C CB  . GLU A 1 238 ? -88.636  -6.331  87.433  1.00 77.62  ? 399 GLU B CB  1 
ATOM   1826 C CG  . GLU A 1 238 ? -89.297  -5.283  86.554  1.00 85.20  ? 399 GLU B CG  1 
ATOM   1827 C CD  . GLU A 1 238 ? -88.803  -5.315  85.117  1.00 91.58  ? 399 GLU B CD  1 
ATOM   1828 O OE1 . GLU A 1 238 ? -88.214  -6.338  84.698  1.00 94.66  ? 399 GLU B OE1 1 
ATOM   1829 O OE2 . GLU A 1 238 ? -89.016  -4.315  84.397  1.00 95.96  ? 399 GLU B OE2 1 
ATOM   1830 N N   . GLU A 1 239 ? -86.856  -7.958  89.202  1.00 72.40  ? 400 GLU B N   1 
ATOM   1831 C CA  . GLU A 1 239 ? -86.611  -9.044  90.141  1.00 72.40  ? 400 GLU B CA  1 
ATOM   1832 C C   . GLU A 1 239 ? -85.787  -8.553  91.328  1.00 71.70  ? 400 GLU B C   1 
ATOM   1833 O O   . GLU A 1 239 ? -86.209  -8.702  92.472  1.00 72.56  ? 400 GLU B O   1 
ATOM   1834 C CB  . GLU A 1 239 ? -85.930  -10.229 89.441  1.00 73.71  ? 400 GLU B CB  1 
ATOM   1835 C CG  . GLU A 1 239 ? -85.722  -11.464 90.313  1.00 76.05  ? 400 GLU B CG  1 
ATOM   1836 C CD  . GLU A 1 239 ? -87.019  -12.121 90.767  1.00 76.79  ? 400 GLU B CD  1 
ATOM   1837 O OE1 . GLU A 1 239 ? -88.033  -12.037 90.040  1.00 78.32  ? 400 GLU B OE1 1 
ATOM   1838 O OE2 . GLU A 1 239 ? -87.019  -12.733 91.856  1.00 75.84  ? 400 GLU B OE2 1 
ATOM   1839 N N   . ALA A 1 240 ? -84.640  -7.937  91.043  1.00 70.68  ? 401 ALA B N   1 
ATOM   1840 C CA  . ALA A 1 240 ? -83.720  -7.454  92.078  1.00 70.42  ? 401 ALA B CA  1 
ATOM   1841 C C   . ALA A 1 240 ? -84.383  -6.560  93.126  1.00 70.41  ? 401 ALA B C   1 
ATOM   1842 O O   . ALA A 1 240 ? -84.032  -6.626  94.307  1.00 69.83  ? 401 ALA B O   1 
ATOM   1843 C CB  . ALA A 1 240 ? -82.533  -6.742  91.445  1.00 70.87  ? 401 ALA B CB  1 
ATOM   1844 N N   . THR A 1 241 ? -85.335  -5.731  92.689  1.00 70.83  ? 402 THR B N   1 
ATOM   1845 C CA  . THR A 1 241 ? -86.098  -4.867  93.598  1.00 71.18  ? 402 THR B CA  1 
ATOM   1846 C C   . THR A 1 241 ? -87.143  -5.660  94.380  1.00 70.86  ? 402 THR B C   1 
ATOM   1847 O O   . THR A 1 241 ? -87.363  -5.397  95.564  1.00 71.83  ? 402 THR B O   1 
ATOM   1848 C CB  . THR A 1 241 ? -86.804  -3.703  92.867  1.00 70.66  ? 402 THR B CB  1 
ATOM   1849 O OG1 . THR A 1 241 ? -87.645  -4.221  91.831  1.00 73.26  ? 402 THR B OG1 1 
ATOM   1850 C CG2 . THR A 1 241 ? -85.798  -2.746  92.261  1.00 69.64  ? 402 THR B CG2 1 
ATOM   1851 N N   . LEU A 1 242 ? -87.784  -6.621  93.713  1.00 69.54  ? 403 LEU B N   1 
ATOM   1852 C CA  . LEU A 1 242 ? -88.762  -7.495  94.361  1.00 69.11  ? 403 LEU B CA  1 
ATOM   1853 C C   . LEU A 1 242 ? -88.086  -8.423  95.366  1.00 69.83  ? 403 LEU B C   1 
ATOM   1854 O O   . LEU A 1 242 ? -88.635  -8.682  96.437  1.00 71.69  ? 403 LEU B O   1 
ATOM   1855 C CB  . LEU A 1 242 ? -89.558  -8.307  93.333  1.00 68.31  ? 403 LEU B CB  1 
ATOM   1856 C CG  . LEU A 1 242 ? -90.523  -7.568  92.397  1.00 68.81  ? 403 LEU B CG  1 
ATOM   1857 C CD1 . LEU A 1 242 ? -91.086  -8.527  91.359  1.00 68.84  ? 403 LEU B CD1 1 
ATOM   1858 C CD2 . LEU A 1 242 ? -91.648  -6.874  93.153  1.00 69.19  ? 403 LEU B CD2 1 
ATOM   1859 N N   . ARG A 1 243 ? -86.894  -8.909  95.011  1.00 69.24  ? 404 ARG B N   1 
ATOM   1860 C CA  . ARG A 1 243 ? -86.055  -9.709  95.909  1.00 68.58  ? 404 ARG B CA  1 
ATOM   1861 C C   . ARG A 1 243 ? -85.702  -8.899  97.153  1.00 68.76  ? 404 ARG B C   1 
ATOM   1862 O O   . ARG A 1 243 ? -85.674  -9.432  98.265  1.00 70.10  ? 404 ARG B O   1 
ATOM   1863 C CB  . ARG A 1 243 ? -84.762  -10.145 95.206  1.00 68.27  ? 404 ARG B CB  1 
ATOM   1864 C CG  . ARG A 1 243 ? -84.942  -11.048 93.995  1.00 68.46  ? 404 ARG B CG  1 
ATOM   1865 C CD  . ARG A 1 243 ? -84.651  -12.506 94.310  1.00 69.24  ? 404 ARG B CD  1 
ATOM   1866 N NE  . ARG A 1 243 ? -84.537  -13.313 93.093  1.00 69.10  ? 404 ARG B NE  1 
ATOM   1867 C CZ  . ARG A 1 243 ? -83.406  -13.524 92.421  1.00 68.42  ? 404 ARG B CZ  1 
ATOM   1868 N NH1 . ARG A 1 243 ? -82.267  -12.987 92.832  1.00 68.25  ? 404 ARG B NH1 1 
ATOM   1869 N NH2 . ARG A 1 243 ? -83.413  -14.275 91.329  1.00 68.42  ? 404 ARG B NH2 1 
ATOM   1870 N N   . ALA A 1 244 ? -85.436  -7.610  96.949  1.00 67.99  ? 405 ALA B N   1 
ATOM   1871 C CA  . ALA A 1 244 ? -85.077  -6.696  98.027  1.00 67.69  ? 405 ALA B CA  1 
ATOM   1872 C C   . ALA A 1 244 ? -86.250  -6.458  98.969  1.00 68.15  ? 405 ALA B C   1 
ATOM   1873 O O   . ALA A 1 244 ? -86.101  -6.565  100.186 1.00 69.27  ? 405 ALA B O   1 
ATOM   1874 C CB  . ALA A 1 244 ? -84.572  -5.380  97.459  1.00 68.04  ? 405 ALA B CB  1 
ATOM   1875 N N   . LEU A 1 245 ? -87.412  -6.143  98.400  1.00 68.62  ? 406 LEU B N   1 
ATOM   1876 C CA  . LEU A 1 245 ? -88.622  -5.890  99.184  1.00 70.05  ? 406 LEU B CA  1 
ATOM   1877 C C   . LEU A 1 245 ? -89.106  -7.136  99.924  1.00 72.29  ? 406 LEU B C   1 
ATOM   1878 O O   . LEU A 1 245 ? -89.670  -7.030  101.015 1.00 72.56  ? 406 LEU B O   1 
ATOM   1879 C CB  . LEU A 1 245 ? -89.742  -5.328  98.303  1.00 69.58  ? 406 LEU B CB  1 
ATOM   1880 C CG  . LEU A 1 245 ? -89.596  -3.905  97.753  1.00 69.70  ? 406 LEU B CG  1 
ATOM   1881 C CD1 . LEU A 1 245 ? -90.736  -3.596  96.796  1.00 69.78  ? 406 LEU B CD1 1 
ATOM   1882 C CD2 . LEU A 1 245 ? -89.539  -2.864  98.863  1.00 69.77  ? 406 LEU B CD2 1 
ATOM   1883 N N   . ARG A 1 246 ? -88.883  -8.308  99.328  1.00 73.81  ? 407 ARG B N   1 
ATOM   1884 C CA  . ARG A 1 246 ? -89.188  -9.577  99.987  1.00 74.62  ? 407 ARG B CA  1 
ATOM   1885 C C   . ARG A 1 246 ? -88.256  -9.828  101.168 1.00 74.40  ? 407 ARG B C   1 
ATOM   1886 O O   . ARG A 1 246 ? -88.676  -10.391 102.180 1.00 76.62  ? 407 ARG B O   1 
ATOM   1887 C CB  . ARG A 1 246 ? -89.132  -10.749 99.005  1.00 76.17  ? 407 ARG B CB  1 
ATOM   1888 C CG  . ARG A 1 246 ? -90.386  -10.906 98.157  1.00 79.16  ? 407 ARG B CG  1 
ATOM   1889 C CD  . ARG A 1 246 ? -90.536  -12.324 97.621  1.00 81.89  ? 407 ARG B CD  1 
ATOM   1890 N NE  . ARG A 1 246 ? -89.368  -12.771 96.859  1.00 84.17  ? 407 ARG B NE  1 
ATOM   1891 C CZ  . ARG A 1 246 ? -89.191  -12.578 95.553  1.00 84.79  ? 407 ARG B CZ  1 
ATOM   1892 N NH1 . ARG A 1 246 ? -90.104  -11.933 94.834  1.00 84.78  ? 407 ARG B NH1 1 
ATOM   1893 N NH2 . ARG A 1 246 ? -88.091  -13.028 94.964  1.00 84.46  ? 407 ARG B NH2 1 
ATOM   1894 N N   . LEU A 1 247 ? -86.997  -9.410  101.033 1.00 72.32  ? 408 LEU B N   1 
ATOM   1895 C CA  . LEU A 1 247 ? -86.041  -9.470  102.138 1.00 71.18  ? 408 LEU B CA  1 
ATOM   1896 C C   . LEU A 1 247 ? -86.457  -8.515  103.251 1.00 72.71  ? 408 LEU B C   1 
ATOM   1897 O O   . LEU A 1 247 ? -86.339  -8.844  104.433 1.00 73.44  ? 408 LEU B O   1 
ATOM   1898 C CB  . LEU A 1 247 ? -84.620  -9.148  101.661 1.00 68.13  ? 408 LEU B CB  1 
ATOM   1899 C CG  . LEU A 1 247 ? -83.542  -8.921  102.730 1.00 65.22  ? 408 LEU B CG  1 
ATOM   1900 C CD1 . LEU A 1 247 ? -83.229  -10.195 103.500 1.00 64.35  ? 408 LEU B CD1 1 
ATOM   1901 C CD2 . LEU A 1 247 ? -82.282  -8.353  102.102 1.00 65.14  ? 408 LEU B CD2 1 
ATOM   1902 N N   . ALA A 1 248 ? -86.941  -7.338  102.861 1.00 74.88  ? 409 ALA B N   1 
ATOM   1903 C CA  . ALA A 1 248 ? -87.459  -6.355  103.806 1.00 77.07  ? 409 ALA B CA  1 
ATOM   1904 C C   . ALA A 1 248 ? -88.667  -6.914  104.555 1.00 78.12  ? 409 ALA B C   1 
ATOM   1905 O O   . ALA A 1 248 ? -88.752  -6.795  105.777 1.00 78.94  ? 409 ALA B O   1 
ATOM   1906 C CB  . ALA A 1 248 ? -87.821  -5.062  103.088 1.00 76.87  ? 409 ALA B CB  1 
ATOM   1907 N N   . GLU A 1 249 ? -89.579  -7.538  103.811 1.00 78.87  ? 410 GLU B N   1 
ATOM   1908 C CA  . GLU A 1 249 ? -90.799  -8.123  104.369 1.00 78.65  ? 410 GLU B CA  1 
ATOM   1909 C C   . GLU A 1 249 ? -90.504  -9.276  105.324 1.00 77.29  ? 410 GLU B C   1 
ATOM   1910 O O   . GLU A 1 249 ? -91.078  -9.346  106.411 1.00 77.44  ? 410 GLU B O   1 
ATOM   1911 C CB  . GLU A 1 249 ? -91.722  -8.591  103.243 1.00 80.78  ? 410 GLU B CB  1 
ATOM   1912 C CG  . GLU A 1 249 ? -93.078  -9.096  103.707 1.00 85.03  ? 410 GLU B CG  1 
ATOM   1913 C CD  . GLU A 1 249 ? -94.072  -9.241  102.570 1.00 89.77  ? 410 GLU B CD  1 
ATOM   1914 O OE1 . GLU A 1 249 ? -93.643  -9.411  101.406 1.00 91.50  ? 410 GLU B OE1 1 
ATOM   1915 O OE2 . GLU A 1 249 ? -95.290  -9.186  102.844 1.00 92.74  ? 410 GLU B OE2 1 
ATOM   1916 N N   . ALA A 1 250 ? -89.605  -10.168 104.913 1.00 76.73  ? 411 ALA B N   1 
ATOM   1917 C CA  . ALA A 1 250 ? -89.236  -11.332 105.715 1.00 76.85  ? 411 ALA B CA  1 
ATOM   1918 C C   . ALA A 1 250 ? -88.545  -10.946 107.020 1.00 77.24  ? 411 ALA B C   1 
ATOM   1919 O O   . ALA A 1 250 ? -88.800  -11.552 108.061 1.00 78.80  ? 411 ALA B O   1 
ATOM   1920 C CB  . ALA A 1 250 ? -88.363  -12.284 104.909 1.00 76.60  ? 411 ALA B CB  1 
ATOM   1921 N N   . VAL A 1 251 ? -87.683  -9.932  106.962 1.00 77.81  ? 412 VAL B N   1 
ATOM   1922 C CA  . VAL A 1 251 ? -86.928  -9.486  108.137 1.00 77.71  ? 412 VAL B CA  1 
ATOM   1923 C C   . VAL A 1 251 ? -87.754  -8.561  109.049 1.00 78.76  ? 412 VAL B C   1 
ATOM   1924 O O   . VAL A 1 251 ? -87.345  -8.248  110.171 1.00 78.29  ? 412 VAL B O   1 
ATOM   1925 C CB  . VAL A 1 251 ? -85.565  -8.862  107.734 1.00 76.18  ? 412 VAL B CB  1 
ATOM   1926 C CG1 . VAL A 1 251 ? -85.707  -7.385  107.382 1.00 76.54  ? 412 VAL B CG1 1 
ATOM   1927 C CG2 . VAL A 1 251 ? -84.531  -9.066  108.832 1.00 75.00  ? 412 VAL B CG2 1 
ATOM   1928 N N   . GLY A 1 252 ? -88.918  -8.134  108.557 1.00 80.14  ? 413 GLY B N   1 
ATOM   1929 C CA  . GLY A 1 252 ? -89.877  -7.365  109.353 1.00 82.04  ? 413 GLY B CA  1 
ATOM   1930 C C   . GLY A 1 252 ? -89.857  -5.859  109.157 1.00 82.92  ? 413 GLY B C   1 
ATOM   1931 O O   . GLY A 1 252 ? -90.204  -5.110  110.071 1.00 82.45  ? 413 GLY B O   1 
ATOM   1932 N N   . CYS A 1 253 ? -89.461  -5.419  107.965 1.00 84.87  ? 414 CYS B N   1 
ATOM   1933 C CA  . CYS A 1 253 ? -89.379  -3.996  107.628 1.00 84.34  ? 414 CYS B CA  1 
ATOM   1934 C C   . CYS A 1 253 ? -90.501  -3.573  106.680 1.00 83.15  ? 414 CYS B C   1 
ATOM   1935 O O   . CYS A 1 253 ? -91.129  -4.429  106.049 1.00 83.63  ? 414 CYS B O   1 
ATOM   1936 C CB  . CYS A 1 253 ? -88.024  -3.684  106.989 1.00 86.37  ? 414 CYS B CB  1 
ATOM   1937 S SG  . CYS A 1 253 ? -86.663  -3.540  108.166 1.00 93.57  ? 414 CYS B SG  1 
ATOM   1938 N N   . PRO A 1 254 ? -90.771  -2.252  106.590 1.00 81.67  ? 415 PRO B N   1 
ATOM   1939 C CA  . PRO A 1 254 ? -91.656  -1.737  105.543 1.00 82.00  ? 415 PRO B CA  1 
ATOM   1940 C C   . PRO A 1 254 ? -91.189  -2.184  104.158 1.00 82.26  ? 415 PRO B C   1 
ATOM   1941 O O   . PRO A 1 254 ? -90.001  -2.095  103.844 1.00 82.94  ? 415 PRO B O   1 
ATOM   1942 C CB  . PRO A 1 254 ? -91.543  -0.209  105.690 1.00 81.34  ? 415 PRO B CB  1 
ATOM   1943 C CG  . PRO A 1 254 ? -90.526  0.042   106.760 1.00 80.56  ? 415 PRO B CG  1 
ATOM   1944 C CD  . PRO A 1 254 ? -90.440  -1.209  107.574 1.00 80.41  ? 415 PRO B CD  1 
ATOM   1945 N N   . HIS A 1 255 ? -92.122  -2.673  103.349 1.00 81.86  ? 416 HIS B N   1 
ATOM   1946 C CA  . HIS A 1 255 ? -91.786  -3.290  102.071 1.00 82.80  ? 416 HIS B CA  1 
ATOM   1947 C C   . HIS A 1 255 ? -92.661  -2.792  100.922 1.00 84.20  ? 416 HIS B C   1 
ATOM   1948 O O   . HIS A 1 255 ? -92.850  -3.497  99.926  1.00 84.98  ? 416 HIS B O   1 
ATOM   1949 C CB  . HIS A 1 255 ? -91.869  -4.816  102.192 1.00 83.27  ? 416 HIS B CB  1 
ATOM   1950 C CG  . HIS A 1 255 ? -93.199  -5.314  102.669 1.00 83.90  ? 416 HIS B CG  1 
ATOM   1951 N ND1 . HIS A 1 255 ? -93.555  -5.328  104.001 1.00 84.00  ? 416 HIS B ND1 1 
ATOM   1952 C CD2 . HIS A 1 255 ? -94.259  -5.816  101.991 1.00 83.56  ? 416 HIS B CD2 1 
ATOM   1953 C CE1 . HIS A 1 255 ? -94.777  -5.817  104.123 1.00 83.96  ? 416 HIS B CE1 1 
ATOM   1954 N NE2 . HIS A 1 255 ? -95.226  -6.120  102.919 1.00 84.13  ? 416 HIS B NE2 1 
ATOM   1955 N N   . GLU A 1 256 ? -93.184  -1.575  101.057 1.00 86.15  ? 417 GLU B N   1 
ATOM   1956 C CA  . GLU A 1 256 ? -94.073  -1.001  100.048 1.00 88.33  ? 417 GLU B CA  1 
ATOM   1957 C C   . GLU A 1 256 ? -93.271  -0.372  98.905  1.00 88.12  ? 417 GLU B C   1 
ATOM   1958 O O   . GLU A 1 256 ? -92.421  0.490   99.146  1.00 88.09  ? 417 GLU B O   1 
ATOM   1959 C CB  . GLU A 1 256 ? -95.022  0.023   100.681 1.00 90.90  ? 417 GLU B CB  1 
ATOM   1960 C CG  . GLU A 1 256 ? -96.295  0.280   99.882  1.00 93.46  ? 417 GLU B CG  1 
ATOM   1961 C CD  . GLU A 1 256 ? -97.309  1.139   100.622 1.00 95.52  ? 417 GLU B CD  1 
ATOM   1962 O OE1 . GLU A 1 256 ? -98.366  1.446   100.030 1.00 96.12  ? 417 GLU B OE1 1 
ATOM   1963 O OE2 . GLU A 1 256 ? -97.062  1.510   101.792 1.00 95.43  ? 417 GLU B OE2 1 
ATOM   1964 N N   . PRO A 1 257 ? -93.545  -0.802  97.655  1.00 87.48  ? 418 PRO B N   1 
ATOM   1965 C CA  . PRO A 1 257 ? -92.820  -0.329  96.468  1.00 87.65  ? 418 PRO B CA  1 
ATOM   1966 C C   . PRO A 1 257 ? -93.089  1.139   96.121  1.00 89.31  ? 418 PRO B C   1 
ATOM   1967 O O   . PRO A 1 257 ? -92.619  1.623   95.090  1.00 90.03  ? 418 PRO B O   1 
ATOM   1968 C CB  . PRO A 1 257 ? -93.337  -1.245  95.354  1.00 86.72  ? 418 PRO B CB  1 
ATOM   1969 C CG  . PRO A 1 257 ? -94.687  -1.670  95.814  1.00 86.72  ? 418 PRO B CG  1 
ATOM   1970 C CD  . PRO A 1 257 ? -94.572  -1.800  97.304  1.00 87.08  ? 418 PRO B CD  1 
ATOM   1971 N N   . SER A 1 258 ? -93.839  1.830   96.977  1.00 91.79  ? 419 SER B N   1 
ATOM   1972 C CA  . SER A 1 258 ? -94.119  3.253   96.812  1.00 92.26  ? 419 SER B CA  1 
ATOM   1973 C C   . SER A 1 258 ? -93.026  4.076   97.488  1.00 92.98  ? 419 SER B C   1 
ATOM   1974 O O   . SER A 1 258 ? -92.379  4.906   96.849  1.00 93.11  ? 419 SER B O   1 
ATOM   1975 C CB  . SER A 1 258 ? -95.488  3.606   97.401  1.00 91.79  ? 419 SER B CB  1 
ATOM   1976 O OG  . SER A 1 258 ? -96.478  2.675   96.994  1.00 91.67  ? 419 SER B OG  1 
ATOM   1977 N N   . LYS A 1 259 ? -92.828  3.829   98.781  1.00 95.17  ? 420 LYS B N   1 
ATOM   1978 C CA  . LYS A 1 259 ? -91.798  4.505   99.569  1.00 96.97  ? 420 LYS B CA  1 
ATOM   1979 C C   . LYS A 1 259 ? -90.618  3.566   99.855  1.00 94.35  ? 420 LYS B C   1 
ATOM   1980 O O   . LYS A 1 259 ? -90.637  2.780   100.808 1.00 93.97  ? 420 LYS B O   1 
ATOM   1981 C CB  . LYS A 1 259 ? -92.395  5.087   100.862 1.00 100.36 ? 420 LYS B CB  1 
ATOM   1982 C CG  . LYS A 1 259 ? -93.285  4.128   101.644 1.00 103.42 ? 420 LYS B CG  1 
ATOM   1983 C CD  . LYS A 1 259 ? -93.755  4.734   102.957 1.00 105.62 ? 420 LYS B CD  1 
ATOM   1984 C CE  . LYS A 1 259 ? -94.126  3.655   103.966 1.00 106.45 ? 420 LYS B CE  1 
ATOM   1985 N NZ  . LYS A 1 259 ? -95.259  2.797   103.520 1.00 107.52 ? 420 LYS B NZ  1 
ATOM   1986 N N   . LEU A 1 260 ? -89.595  3.654   99.009  1.00 90.68  ? 421 LEU B N   1 
ATOM   1987 C CA  . LEU A 1 260 ? -88.438  2.764   99.089  1.00 89.02  ? 421 LEU B CA  1 
ATOM   1988 C C   . LEU A 1 260 ? -87.431  3.190   100.151 1.00 90.93  ? 421 LEU B C   1 
ATOM   1989 O O   . LEU A 1 260 ? -86.783  2.343   100.770 1.00 90.77  ? 421 LEU B O   1 
ATOM   1990 C CB  . LEU A 1 260 ? -87.748  2.656   97.725  1.00 85.76  ? 421 LEU B CB  1 
ATOM   1991 C CG  . LEU A 1 260 ? -88.213  1.583   96.737  1.00 83.09  ? 421 LEU B CG  1 
ATOM   1992 C CD1 . LEU A 1 260 ? -89.652  1.780   96.298  1.00 82.24  ? 421 LEU B CD1 1 
ATOM   1993 C CD2 . LEU A 1 260 ? -87.307  1.568   95.522  1.00 82.10  ? 421 LEU B CD2 1 
ATOM   1994 N N   . SER A 1 261 ? -87.301  4.499   100.356 1.00 94.16  ? 422 SER B N   1 
ATOM   1995 C CA  . SER A 1 261 ? -86.363  5.044   101.340 1.00 96.06  ? 422 SER B CA  1 
ATOM   1996 C C   . SER A 1 261 ? -86.703  4.630   102.777 1.00 95.47  ? 422 SER B C   1 
ATOM   1997 O O   . SER A 1 261 ? -85.840  4.655   103.654 1.00 95.65  ? 422 SER B O   1 
ATOM   1998 C CB  . SER A 1 261 ? -86.259  6.570   101.216 1.00 97.39  ? 422 SER B CB  1 
ATOM   1999 O OG  . SER A 1 261 ? -87.532  7.184   101.295 1.00 99.79  ? 422 SER B OG  1 
ATOM   2000 N N   . ASP A 1 262 ? -87.958  4.247   103.005 1.00 94.66  ? 423 ASP B N   1 
ATOM   2001 C CA  . ASP A 1 262 ? -88.386  3.705   104.292 1.00 94.28  ? 423 ASP B CA  1 
ATOM   2002 C C   . ASP A 1 262 ? -87.822  2.307   104.516 1.00 92.21  ? 423 ASP B C   1 
ATOM   2003 O O   . ASP A 1 262 ? -87.454  1.951   105.638 1.00 92.92  ? 423 ASP B O   1 
ATOM   2004 C CB  . ASP A 1 262 ? -89.912  3.663   104.379 1.00 97.56  ? 423 ASP B CB  1 
ATOM   2005 C CG  . ASP A 1 262 ? -90.522  5.023   104.656 1.00 99.83  ? 423 ASP B CG  1 
ATOM   2006 O OD1 . ASP A 1 262 ? -90.064  6.025   104.064 1.00 102.21 ? 423 ASP B OD1 1 
ATOM   2007 O OD2 . ASP A 1 262 ? -91.472  5.088   105.463 1.00 100.29 ? 423 ASP B OD2 1 
ATOM   2008 N N   . ALA A 1 263 ? -87.764  1.524   103.440 1.00 88.84  ? 424 ALA B N   1 
ATOM   2009 C CA  . ALA A 1 263 ? -87.275  0.149   103.495 1.00 85.82  ? 424 ALA B CA  1 
ATOM   2010 C C   . ALA A 1 263 ? -85.777  0.087   103.777 1.00 84.07  ? 424 ALA B C   1 
ATOM   2011 O O   . ALA A 1 263 ? -85.345  -0.609  104.696 1.00 82.58  ? 424 ALA B O   1 
ATOM   2012 C CB  . ALA A 1 263 ? -87.609  -0.587  102.205 1.00 85.97  ? 424 ALA B CB  1 
ATOM   2013 N N   . VAL A 1 264 ? -84.997  0.829   102.991 1.00 83.21  ? 425 VAL B N   1 
ATOM   2014 C CA  . VAL A 1 264 ? -83.538  0.840   103.118 1.00 83.19  ? 425 VAL B CA  1 
ATOM   2015 C C   . VAL A 1 264 ? -83.086  1.337   104.495 1.00 82.73  ? 425 VAL B C   1 
ATOM   2016 O O   . VAL A 1 264 ? -82.176  0.762   105.094 1.00 82.32  ? 425 VAL B O   1 
ATOM   2017 C CB  . VAL A 1 264 ? -82.858  1.625   101.963 1.00 84.14  ? 425 VAL B CB  1 
ATOM   2018 C CG1 . VAL A 1 264 ? -83.329  3.073   101.918 1.00 86.04  ? 425 VAL B CG1 1 
ATOM   2019 C CG2 . VAL A 1 264 ? -81.339  1.551   102.061 1.00 84.82  ? 425 VAL B CG2 1 
ATOM   2020 N N   . GLU A 1 265 ? -83.741  2.385   104.995 1.00 84.15  ? 426 GLU B N   1 
ATOM   2021 C CA  . GLU A 1 265 ? -83.451  2.930   106.322 1.00 85.93  ? 426 GLU B CA  1 
ATOM   2022 C C   . GLU A 1 265 ? -83.684  1.895   107.418 1.00 84.75  ? 426 GLU B C   1 
ATOM   2023 O O   . GLU A 1 265 ? -82.888  1.785   108.353 1.00 84.44  ? 426 GLU B O   1 
ATOM   2024 C CB  . GLU A 1 265 ? -84.289  4.181   106.593 1.00 89.33  ? 426 GLU B CB  1 
ATOM   2025 C CG  . GLU A 1 265 ? -83.725  5.456   105.985 1.00 93.26  ? 426 GLU B CG  1 
ATOM   2026 C CD  . GLU A 1 265 ? -84.716  6.608   106.001 1.00 96.78  ? 426 GLU B CD  1 
ATOM   2027 O OE1 . GLU A 1 265 ? -85.632  6.609   106.853 1.00 97.85  ? 426 GLU B OE1 1 
ATOM   2028 O OE2 . GLU A 1 265 ? -84.574  7.519   105.157 1.00 98.45  ? 426 GLU B OE2 1 
ATOM   2029 N N   . CYS A 1 266 ? -84.773  1.139   107.291 1.00 83.99  ? 427 CYS B N   1 
ATOM   2030 C CA  . CYS A 1 266 ? -85.078  0.051   108.215 1.00 84.53  ? 427 CYS B CA  1 
ATOM   2031 C C   . CYS A 1 266 ? -84.030  -1.062  108.120 1.00 81.85  ? 427 CYS B C   1 
ATOM   2032 O O   . CYS A 1 266 ? -83.576  -1.584  109.143 1.00 80.61  ? 427 CYS B O   1 
ATOM   2033 C CB  . CYS A 1 266 ? -86.479  -0.508  107.947 1.00 88.60  ? 427 CYS B CB  1 
ATOM   2034 S SG  . CYS A 1 266 ? -87.024  -1.775  109.120 1.00 95.47  ? 427 CYS B SG  1 
ATOM   2035 N N   . LEU A 1 267 ? -83.647  -1.405  106.888 1.00 78.18  ? 428 LEU B N   1 
ATOM   2036 C CA  . LEU A 1 267 ? -82.667  -2.463  106.627 1.00 74.33  ? 428 LEU B CA  1 
ATOM   2037 C C   . LEU A 1 267 ? -81.282  -2.129  107.176 1.00 73.36  ? 428 LEU B C   1 
ATOM   2038 O O   . LEU A 1 267 ? -80.533  -3.032  107.557 1.00 73.77  ? 428 LEU B O   1 
ATOM   2039 C CB  . LEU A 1 267 ? -82.574  -2.767  105.128 1.00 73.63  ? 428 LEU B CB  1 
ATOM   2040 C CG  . LEU A 1 267 ? -83.747  -3.474  104.443 1.00 73.68  ? 428 LEU B CG  1 
ATOM   2041 C CD1 . LEU A 1 267 ? -83.583  -3.424  102.931 1.00 72.99  ? 428 LEU B CD1 1 
ATOM   2042 C CD2 . LEU A 1 267 ? -83.898  -4.912  104.918 1.00 74.01  ? 428 LEU B CD2 1 
ATOM   2043 N N   . ARG A 1 268 ? -80.952  -0.838  107.214 1.00 71.79  ? 429 ARG B N   1 
ATOM   2044 C CA  . ARG A 1 268 ? -79.695  -0.374  107.801 1.00 71.11  ? 429 ARG B CA  1 
ATOM   2045 C C   . ARG A 1 268 ? -79.688  -0.557  109.316 1.00 70.27  ? 429 ARG B C   1 
ATOM   2046 O O   . ARG A 1 268 ? -78.624  -0.558  109.940 1.00 70.62  ? 429 ARG B O   1 
ATOM   2047 C CB  . ARG A 1 268 ? -79.436  1.097   107.467 1.00 72.30  ? 429 ARG B CB  1 
ATOM   2048 C CG  . ARG A 1 268 ? -79.080  1.381   106.018 1.00 73.71  ? 429 ARG B CG  1 
ATOM   2049 C CD  . ARG A 1 268 ? -78.411  2.740   105.893 1.00 75.00  ? 429 ARG B CD  1 
ATOM   2050 N NE  . ARG A 1 268 ? -78.838  3.453   104.692 1.00 77.00  ? 429 ARG B NE  1 
ATOM   2051 C CZ  . ARG A 1 268 ? -79.752  4.421   104.676 1.00 77.40  ? 429 ARG B CZ  1 
ATOM   2052 N NH1 . ARG A 1 268 ? -80.345  4.810   105.799 1.00 75.86  ? 429 ARG B NH1 1 
ATOM   2053 N NH2 . ARG A 1 268 ? -80.073  5.009   103.531 1.00 78.82  ? 429 ARG B NH2 1 
ATOM   2054 N N   . GLY A 1 269 ? -80.876  -0.705  109.898 1.00 68.69  ? 430 GLY B N   1 
ATOM   2055 C CA  . GLY A 1 269 ? -81.022  -0.904  111.336 1.00 68.47  ? 430 GLY B CA  1 
ATOM   2056 C C   . GLY A 1 269 ? -80.799  -2.338  111.783 1.00 68.24  ? 430 GLY B C   1 
ATOM   2057 O O   . GLY A 1 269 ? -80.205  -2.578  112.839 1.00 67.81  ? 430 GLY B O   1 
ATOM   2058 N N   . LYS A 1 270 ? -81.266  -3.287  110.973 1.00 67.66  ? 431 LYS B N   1 
ATOM   2059 C CA  . LYS A 1 270 ? -81.245  -4.713  111.325 1.00 65.99  ? 431 LYS B CA  1 
ATOM   2060 C C   . LYS A 1 270 ? -79.842  -5.319  111.351 1.00 65.74  ? 431 LYS B C   1 
ATOM   2061 O O   . LYS A 1 270 ? -78.926  -4.821  110.695 1.00 65.75  ? 431 LYS B O   1 
ATOM   2062 C CB  . LYS A 1 270 ? -82.170  -5.517  110.399 1.00 64.38  ? 431 LYS B CB  1 
ATOM   2063 C CG  . LYS A 1 270 ? -83.654  -5.205  110.567 1.00 63.96  ? 431 LYS B CG  1 
ATOM   2064 C CD  . LYS A 1 270 ? -84.188  -5.667  111.919 1.00 64.30  ? 431 LYS B CD  1 
ATOM   2065 C CE  . LYS A 1 270 ? -85.518  -5.012  112.260 1.00 62.87  ? 431 LYS B CE  1 
ATOM   2066 N NZ  . LYS A 1 270 ? -86.620  -5.473  111.370 1.00 62.29  ? 431 LYS B NZ  1 
ATOM   2067 N N   . ASP A 1 271 ? -79.694  -6.389  112.130 1.00 65.94  ? 432 ASP B N   1 
ATOM   2068 C CA  . ASP A 1 271 ? -78.423  -7.095  112.306 1.00 66.08  ? 432 ASP B CA  1 
ATOM   2069 C C   . ASP A 1 271 ? -77.901  -7.635  110.970 1.00 65.75  ? 432 ASP B C   1 
ATOM   2070 O O   . ASP A 1 271 ? -78.680  -8.153  110.168 1.00 67.16  ? 432 ASP B O   1 
ATOM   2071 C CB  . ASP A 1 271 ? -78.610  -8.234  113.318 1.00 67.58  ? 432 ASP B CB  1 
ATOM   2072 C CG  . ASP A 1 271 ? -77.302  -8.893  113.722 1.00 69.44  ? 432 ASP B CG  1 
ATOM   2073 O OD1 . ASP A 1 271 ? -76.720  -9.627  112.900 1.00 70.83  ? 432 ASP B OD1 1 
ATOM   2074 O OD2 . ASP A 1 271 ? -76.868  -8.699  114.876 1.00 71.00  ? 432 ASP B OD2 1 
ATOM   2075 N N   . PRO A 1 272 ? -76.584  -7.501  110.720 1.00 64.66  ? 433 PRO B N   1 
ATOM   2076 C CA  . PRO A 1 272 ? -75.987  -8.031  109.490 1.00 64.22  ? 433 PRO B CA  1 
ATOM   2077 C C   . PRO A 1 272 ? -76.281  -9.518  109.262 1.00 64.12  ? 433 PRO B C   1 
ATOM   2078 O O   . PRO A 1 272 ? -76.572  -9.918  108.134 1.00 64.29  ? 433 PRO B O   1 
ATOM   2079 C CB  . PRO A 1 272 ? -74.478  -7.795  109.692 1.00 63.73  ? 433 PRO B CB  1 
ATOM   2080 C CG  . PRO A 1 272 ? -74.308  -7.411  111.127 1.00 63.83  ? 433 PRO B CG  1 
ATOM   2081 C CD  . PRO A 1 272 ? -75.596  -6.760  111.521 1.00 64.58  ? 433 PRO B CD  1 
ATOM   2082 N N   . HIS A 1 273 ? -76.214  -10.316 110.326 1.00 63.68  ? 434 HIS B N   1 
ATOM   2083 C CA  . HIS A 1 273 ? -76.458  -11.756 110.240 1.00 62.63  ? 434 HIS B CA  1 
ATOM   2084 C C   . HIS A 1 273 ? -77.925  -12.092 110.027 1.00 61.82  ? 434 HIS B C   1 
ATOM   2085 O O   . HIS A 1 273 ? -78.245  -12.979 109.236 1.00 62.49  ? 434 HIS B O   1 
ATOM   2086 C CB  . HIS A 1 273 ? -75.931  -12.471 111.482 1.00 63.31  ? 434 HIS B CB  1 
ATOM   2087 C CG  . HIS A 1 273 ? -74.443  -12.446 111.600 1.00 64.42  ? 434 HIS B CG  1 
ATOM   2088 N ND1 . HIS A 1 273 ? -73.762  -11.399 112.181 1.00 64.76  ? 434 HIS B ND1 1 
ATOM   2089 C CD2 . HIS A 1 273 ? -73.503  -13.334 111.202 1.00 65.81  ? 434 HIS B CD2 1 
ATOM   2090 C CE1 . HIS A 1 273 ? -72.464  -11.646 112.141 1.00 66.21  ? 434 HIS B CE1 1 
ATOM   2091 N NE2 . HIS A 1 273 ? -72.281  -12.814 111.552 1.00 66.91  ? 434 HIS B NE2 1 
ATOM   2092 N N   . VAL A 1 274 ? -78.814  -11.388 110.726 1.00 60.92  ? 435 VAL B N   1 
ATOM   2093 C CA  . VAL A 1 274 ? -80.254  -11.610 110.571 1.00 61.43  ? 435 VAL B CA  1 
ATOM   2094 C C   . VAL A 1 274 ? -80.711  -11.202 109.162 1.00 61.63  ? 435 VAL B C   1 
ATOM   2095 O O   . VAL A 1 274 ? -81.798  -11.576 108.712 1.00 62.72  ? 435 VAL B O   1 
ATOM   2096 C CB  . VAL A 1 274 ? -81.076  -10.911 111.688 1.00 60.93  ? 435 VAL B CB  1 
ATOM   2097 C CG1 . VAL A 1 274 ? -81.423  -9.475  111.320 1.00 61.57  ? 435 VAL B CG1 1 
ATOM   2098 C CG2 . VAL A 1 274 ? -82.344  -11.697 111.993 1.00 61.26  ? 435 VAL B CG2 1 
ATOM   2099 N N   . LEU A 1 275 ? -79.851  -10.461 108.468 1.00 61.19  ? 436 LEU B N   1 
ATOM   2100 C CA  . LEU A 1 275 ? -80.140  -9.969  107.129 1.00 60.73  ? 436 LEU B CA  1 
ATOM   2101 C C   . LEU A 1 275 ? -79.751  -10.990 106.060 1.00 61.18  ? 436 LEU B C   1 
ATOM   2102 O O   . LEU A 1 275 ? -80.494  -11.198 105.103 1.00 61.33  ? 436 LEU B O   1 
ATOM   2103 C CB  . LEU A 1 275 ? -79.423  -8.632  106.899 1.00 59.54  ? 436 LEU B CB  1 
ATOM   2104 C CG  . LEU A 1 275 ? -80.126  -7.515  106.124 1.00 58.43  ? 436 LEU B CG  1 
ATOM   2105 C CD1 . LEU A 1 275 ? -81.531  -7.251  106.648 1.00 57.92  ? 436 LEU B CD1 1 
ATOM   2106 C CD2 . LEU A 1 275 ? -79.299  -6.242  106.193 1.00 58.37  ? 436 LEU B CD2 1 
ATOM   2107 N N   . VAL A 1 276 ? -78.597  -11.633 106.236 1.00 62.57  ? 437 VAL B N   1 
ATOM   2108 C CA  . VAL A 1 276 ? -78.087  -12.599 105.255 1.00 63.97  ? 437 VAL B CA  1 
ATOM   2109 C C   . VAL A 1 276 ? -78.779  -13.963 105.324 1.00 66.64  ? 437 VAL B C   1 
ATOM   2110 O O   . VAL A 1 276 ? -78.732  -14.729 104.362 1.00 67.79  ? 437 VAL B O   1 
ATOM   2111 C CB  . VAL A 1 276 ? -76.550  -12.791 105.345 1.00 62.98  ? 437 VAL B CB  1 
ATOM   2112 C CG1 . VAL A 1 276 ? -75.824  -11.494 105.018 1.00 62.62  ? 437 VAL B CG1 1 
ATOM   2113 C CG2 . VAL A 1 276 ? -76.133  -13.318 106.711 1.00 62.93  ? 437 VAL B CG2 1 
ATOM   2114 N N   . ASN A 1 277 ? -79.413  -14.262 106.456 1.00 69.43  ? 438 ASN B N   1 
ATOM   2115 C CA  . ASN A 1 277 ? -80.037  -15.570 106.671 1.00 71.34  ? 438 ASN B CA  1 
ATOM   2116 C C   . ASN A 1 277 ? -81.465  -15.688 106.141 1.00 72.44  ? 438 ASN B C   1 
ATOM   2117 O O   . ASN A 1 277 ? -81.952  -16.794 105.900 1.00 73.10  ? 438 ASN B O   1 
ATOM   2118 C CB  . ASN A 1 277 ? -79.983  -15.956 108.153 1.00 71.62  ? 438 ASN B CB  1 
ATOM   2119 C CG  . ASN A 1 277 ? -78.588  -16.361 108.601 1.00 73.25  ? 438 ASN B CG  1 
ATOM   2120 O OD1 . ASN A 1 277 ? -77.964  -17.250 108.018 1.00 73.60  ? 438 ASN B OD1 1 
ATOM   2121 N ND2 . ASN A 1 277 ? -78.095  -15.713 109.649 1.00 74.03  ? 438 ASN B ND2 1 
ATOM   2122 N N   . ASN A 1 278 ? -82.122  -14.547 105.952 1.00 73.76  ? 439 ASN B N   1 
ATOM   2123 C CA  . ASN A 1 278 ? -83.517  -14.518 105.520 1.00 74.49  ? 439 ASN B CA  1 
ATOM   2124 C C   . ASN A 1 278 ? -83.703  -14.234 104.033 1.00 74.97  ? 439 ASN B C   1 
ATOM   2125 O O   . ASN A 1 278 ? -84.833  -14.112 103.555 1.00 76.87  ? 439 ASN B O   1 
ATOM   2126 C CB  . ASN A 1 278 ? -84.308  -13.503 106.349 1.00 75.42  ? 439 ASN B CB  1 
ATOM   2127 C CG  . ASN A 1 278 ? -84.484  -13.939 107.788 1.00 76.29  ? 439 ASN B CG  1 
ATOM   2128 O OD1 . ASN A 1 278 ? -85.565  -14.374 108.184 1.00 77.80  ? 439 ASN B OD1 1 
ATOM   2129 N ND2 . ASN A 1 278 ? -83.421  -13.834 108.579 1.00 76.52  ? 439 ASN B ND2 1 
ATOM   2130 N N   . GLU A 1 279 ? -82.595  -14.134 103.305 1.00 74.92  ? 440 GLU B N   1 
ATOM   2131 C CA  . GLU A 1 279 ? -82.640  -13.831 101.874 1.00 74.99  ? 440 GLU B CA  1 
ATOM   2132 C C   . GLU A 1 279 ? -82.937  -15.064 101.021 1.00 72.91  ? 440 GLU B C   1 
ATOM   2133 O O   . GLU A 1 279 ? -83.230  -14.948 99.829  1.00 72.42  ? 440 GLU B O   1 
ATOM   2134 C CB  . GLU A 1 279 ? -81.347  -13.142 101.420 1.00 76.77  ? 440 GLU B CB  1 
ATOM   2135 C CG  . GLU A 1 279 ? -80.086  -13.985 101.544 1.00 78.71  ? 440 GLU B CG  1 
ATOM   2136 C CD  . GLU A 1 279 ? -78.809  -13.181 101.368 1.00 79.13  ? 440 GLU B CD  1 
ATOM   2137 O OE1 . GLU A 1 279 ? -77.751  -13.806 101.141 1.00 80.40  ? 440 GLU B OE1 1 
ATOM   2138 O OE2 . GLU A 1 279 ? -78.856  -11.935 101.458 1.00 77.50  ? 440 GLU B OE2 1 
ATOM   2139 N N   . TRP A 1 280 ? -82.866  -16.236 101.642 1.00 71.81  ? 441 TRP B N   1 
ATOM   2140 C CA  . TRP A 1 280 ? -83.075  -17.494 100.940 1.00 72.65  ? 441 TRP B CA  1 
ATOM   2141 C C   . TRP A 1 280 ? -84.527  -17.948 101.003 1.00 74.27  ? 441 TRP B C   1 
ATOM   2142 O O   . TRP A 1 280 ? -84.955  -18.580 101.971 1.00 74.31  ? 441 TRP B O   1 
ATOM   2143 C CB  . TRP A 1 280 ? -82.139  -18.568 101.488 1.00 71.80  ? 441 TRP B CB  1 
ATOM   2144 C CG  . TRP A 1 280 ? -80.714  -18.302 101.144 1.00 71.05  ? 441 TRP B CG  1 
ATOM   2145 C CD1 . TRP A 1 280 ? -79.794  -17.646 101.909 1.00 71.22  ? 441 TRP B CD1 1 
ATOM   2146 C CD2 . TRP A 1 280 ? -80.043  -18.665 99.932  1.00 69.87  ? 441 TRP B CD2 1 
ATOM   2147 N NE1 . TRP A 1 280 ? -78.590  -17.585 101.253 1.00 70.73  ? 441 TRP B NE1 1 
ATOM   2148 C CE2 . TRP A 1 280 ? -78.714  -18.205 100.037 1.00 70.23  ? 441 TRP B CE2 1 
ATOM   2149 C CE3 . TRP A 1 280 ? -80.435  -19.340 98.770  1.00 69.25  ? 441 TRP B CE3 1 
ATOM   2150 C CZ2 . TRP A 1 280 ? -77.772  -18.399 99.022  1.00 70.29  ? 441 TRP B CZ2 1 
ATOM   2151 C CZ3 . TRP A 1 280 ? -79.499  -19.534 97.762  1.00 68.97  ? 441 TRP B CZ3 1 
ATOM   2152 C CH2 . TRP A 1 280 ? -78.183  -19.066 97.896  1.00 69.34  ? 441 TRP B CH2 1 
ATOM   2153 N N   . GLY A 1 281 ? -85.278  -17.608 99.957  1.00 76.86  ? 442 GLY B N   1 
ATOM   2154 C CA  . GLY A 1 281 ? -86.686  -17.986 99.846  1.00 79.26  ? 442 GLY B CA  1 
ATOM   2155 C C   . GLY A 1 281 ? -86.868  -19.204 98.965  1.00 79.24  ? 442 GLY B C   1 
ATOM   2156 O O   . GLY A 1 281 ? -86.300  -20.266 99.232  1.00 79.61  ? 442 GLY B O   1 
ATOM   2157 N N   . THR A 1 282 ? -87.666  -19.052 97.914  1.00 78.72  ? 443 THR B N   1 
ATOM   2158 C CA  . THR A 1 282 ? -87.870  -20.124 96.948  1.00 79.65  ? 443 THR B CA  1 
ATOM   2159 C C   . THR A 1 282 ? -87.083  -19.834 95.671  1.00 78.15  ? 443 THR B C   1 
ATOM   2160 O O   . THR A 1 282 ? -87.536  -19.086 94.799  1.00 78.36  ? 443 THR B O   1 
ATOM   2161 C CB  . THR A 1 282 ? -89.367  -20.346 96.633  1.00 81.67  ? 443 THR B CB  1 
ATOM   2162 O OG1 . THR A 1 282 ? -89.976  -19.097 96.284  1.00 84.03  ? 443 THR B OG1 1 
ATOM   2163 C CG2 . THR A 1 282 ? -90.093  -20.952 97.837  1.00 80.04  ? 443 THR B CG2 1 
ATOM   2164 N N   . LEU A 1 283 ? -85.892  -20.421 95.583  1.00 75.98  ? 444 LEU B N   1 
ATOM   2165 C CA  . LEU A 1 283 ? -85.013  -20.245 94.429  1.00 73.98  ? 444 LEU B CA  1 
ATOM   2166 C C   . LEU A 1 283 ? -84.661  -21.593 93.809  1.00 72.71  ? 444 LEU B C   1 
ATOM   2167 O O   . LEU A 1 283 ? -84.387  -22.559 94.524  1.00 72.72  ? 444 LEU B O   1 
ATOM   2168 C CB  . LEU A 1 283 ? -83.736  -19.504 94.835  1.00 73.72  ? 444 LEU B CB  1 
ATOM   2169 C CG  . LEU A 1 283 ? -83.887  -18.093 95.416  1.00 74.68  ? 444 LEU B CG  1 
ATOM   2170 C CD1 . LEU A 1 283 ? -82.728  -17.770 96.343  1.00 74.25  ? 444 LEU B CD1 1 
ATOM   2171 C CD2 . LEU A 1 283 ? -84.023  -17.044 94.320  1.00 74.47  ? 444 LEU B CD2 1 
ATOM   2172 N N   . GLY A 1 284 ? -84.669  -21.651 92.479  1.00 71.19  ? 445 GLY B N   1 
ATOM   2173 C CA  . GLY A 1 284 ? -84.333  -22.875 91.752  1.00 69.86  ? 445 GLY B CA  1 
ATOM   2174 C C   . GLY A 1 284 ? -82.864  -23.246 91.861  1.00 69.38  ? 445 GLY B C   1 
ATOM   2175 O O   . GLY A 1 284 ? -82.090  -22.570 92.541  1.00 70.31  ? 445 GLY B O   1 
ATOM   2176 N N   . ILE A 1 285 ? -82.486  -24.338 91.200  1.00 67.79  ? 446 ILE B N   1 
ATOM   2177 C CA  . ILE A 1 285 ? -81.087  -24.762 91.130  1.00 65.71  ? 446 ILE B CA  1 
ATOM   2178 C C   . ILE A 1 285 ? -80.249  -23.660 90.475  1.00 65.39  ? 446 ILE B C   1 
ATOM   2179 O O   . ILE A 1 285 ? -80.681  -23.046 89.495  1.00 65.45  ? 446 ILE B O   1 
ATOM   2180 C CB  . ILE A 1 285 ? -80.936  -26.112 90.377  1.00 64.89  ? 446 ILE B CB  1 
ATOM   2181 C CG1 . ILE A 1 285 ? -79.467  -26.526 90.237  1.00 63.79  ? 446 ILE B CG1 1 
ATOM   2182 C CG2 . ILE A 1 285 ? -81.592  -26.058 89.005  1.00 66.42  ? 446 ILE B CG2 1 
ATOM   2183 C CD1 . ILE A 1 285 ? -78.995  -27.509 91.282  1.00 62.02  ? 446 ILE B CD1 1 
ATOM   2184 N N   . CYS A 1 286 ? -79.070  -23.405 91.042  1.00 65.53  ? 447 CYS B N   1 
ATOM   2185 C CA  . CYS A 1 286 ? -78.151  -22.357 90.570  1.00 65.20  ? 447 CYS B CA  1 
ATOM   2186 C C   . CYS A 1 286 ? -78.825  -20.991 90.420  1.00 64.91  ? 447 CYS B C   1 
ATOM   2187 O O   . CYS A 1 286 ? -78.627  -20.297 89.423  1.00 65.96  ? 447 CYS B O   1 
ATOM   2188 C CB  . CYS A 1 286 ? -77.458  -22.769 89.266  1.00 64.80  ? 447 CYS B CB  1 
ATOM   2189 S SG  . CYS A 1 286 ? -76.329  -24.167 89.437  1.00 67.00  ? 447 CYS B SG  1 
ATOM   2190 N N   . GLU A 1 287 ? -79.635  -20.633 91.413  1.00 64.29  ? 448 GLU B N   1 
ATOM   2191 C CA  . GLU A 1 287 ? -80.238  -19.309 91.503  1.00 63.09  ? 448 GLU B CA  1 
ATOM   2192 C C   . GLU A 1 287 ? -79.842  -18.691 92.831  1.00 63.70  ? 448 GLU B C   1 
ATOM   2193 O O   . GLU A 1 287 ? -80.112  -19.257 93.895  1.00 64.73  ? 448 GLU B O   1 
ATOM   2194 C CB  . GLU A 1 287 ? -81.760  -19.387 91.407  1.00 63.19  ? 448 GLU B CB  1 
ATOM   2195 C CG  . GLU A 1 287 ? -82.289  -19.644 90.007  1.00 64.97  ? 448 GLU B CG  1 
ATOM   2196 C CD  . GLU A 1 287 ? -83.803  -19.560 89.917  1.00 66.37  ? 448 GLU B CD  1 
ATOM   2197 O OE1 . GLU A 1 287 ? -84.473  -19.305 90.944  1.00 66.67  ? 448 GLU B OE1 1 
ATOM   2198 O OE2 . GLU A 1 287 ? -84.328  -19.748 88.802  1.00 67.30  ? 448 GLU B OE2 1 
ATOM   2199 N N   . PHE A 1 288 ? -79.196  -17.533 92.766  1.00 63.29  ? 449 PHE B N   1 
ATOM   2200 C CA  . PHE A 1 288 ? -78.717  -16.865 93.969  1.00 62.67  ? 449 PHE B CA  1 
ATOM   2201 C C   . PHE A 1 288 ? -79.438  -15.535 94.182  1.00 63.71  ? 449 PHE B C   1 
ATOM   2202 O O   . PHE A 1 288 ? -79.599  -14.759 93.234  1.00 64.26  ? 449 PHE B O   1 
ATOM   2203 C CB  . PHE A 1 288 ? -77.194  -16.710 93.915  1.00 61.36  ? 449 PHE B CB  1 
ATOM   2204 C CG  . PHE A 1 288 ? -76.476  -17.974 93.523  1.00 60.73  ? 449 PHE B CG  1 
ATOM   2205 C CD1 . PHE A 1 288 ? -76.673  -19.156 94.236  1.00 60.66  ? 449 PHE B CD1 1 
ATOM   2206 C CD2 . PHE A 1 288 ? -75.608  -17.989 92.439  1.00 60.77  ? 449 PHE B CD2 1 
ATOM   2207 C CE1 . PHE A 1 288 ? -76.021  -20.324 93.873  1.00 60.36  ? 449 PHE B CE1 1 
ATOM   2208 C CE2 . PHE A 1 288 ? -74.949  -19.154 92.074  1.00 60.36  ? 449 PHE B CE2 1 
ATOM   2209 C CZ  . PHE A 1 288 ? -75.156  -20.323 92.791  1.00 60.32  ? 449 PHE B CZ  1 
ATOM   2210 N N   . PRO A 1 289 ? -79.887  -15.275 95.429  1.00 63.65  ? 450 PRO B N   1 
ATOM   2211 C CA  . PRO A 1 289 ? -80.827  -14.186 95.719  1.00 63.13  ? 450 PRO B CA  1 
ATOM   2212 C C   . PRO A 1 289 ? -80.281  -12.790 95.427  1.00 62.68  ? 450 PRO B C   1 
ATOM   2213 O O   . PRO A 1 289 ? -81.018  -11.936 94.929  1.00 63.09  ? 450 PRO B O   1 
ATOM   2214 C CB  . PRO A 1 289 ? -81.111  -14.351 97.217  1.00 62.88  ? 450 PRO B CB  1 
ATOM   2215 C CG  . PRO A 1 289 ? -79.910  -15.044 97.757  1.00 63.08  ? 450 PRO B CG  1 
ATOM   2216 C CD  . PRO A 1 289 ? -79.440  -15.954 96.661  1.00 63.36  ? 450 PRO B CD  1 
ATOM   2217 N N   . PHE A 1 290 ? -79.005  -12.563 95.727  1.00 62.26  ? 451 PHE B N   1 
ATOM   2218 C CA  . PHE A 1 290 ? -78.412  -11.245 95.533  1.00 61.17  ? 451 PHE B CA  1 
ATOM   2219 C C   . PHE A 1 290 ? -77.103  -11.287 94.752  1.00 60.07  ? 451 PHE B C   1 
ATOM   2220 O O   . PHE A 1 290 ? -76.076  -11.764 95.239  1.00 59.89  ? 451 PHE B O   1 
ATOM   2221 C CB  . PHE A 1 290 ? -78.291  -10.505 96.869  1.00 61.21  ? 451 PHE B CB  1 
ATOM   2222 C CG  . PHE A 1 290 ? -79.622  -10.163 97.477  1.00 60.95  ? 451 PHE B CG  1 
ATOM   2223 C CD1 . PHE A 1 290 ? -80.363  -9.083  96.996  1.00 61.28  ? 451 PHE B CD1 1 
ATOM   2224 C CD2 . PHE A 1 290 ? -80.154  -10.933 98.502  1.00 60.27  ? 451 PHE B CD2 1 
ATOM   2225 C CE1 . PHE A 1 290 ? -81.599  -8.771  97.540  1.00 60.58  ? 451 PHE B CE1 1 
ATOM   2226 C CE2 . PHE A 1 290 ? -81.390  -10.623 99.050  1.00 60.30  ? 451 PHE B CE2 1 
ATOM   2227 C CZ  . PHE A 1 290 ? -82.113  -9.543  98.568  1.00 60.19  ? 451 PHE B CZ  1 
ATOM   2228 N N   . VAL A 1 291 ? -77.183  -10.788 93.521  1.00 59.20  ? 452 VAL B N   1 
ATOM   2229 C CA  . VAL A 1 291 ? -76.099  -10.852 92.542  1.00 58.24  ? 452 VAL B CA  1 
ATOM   2230 C C   . VAL A 1 291 ? -75.997  -9.520  91.789  1.00 58.41  ? 452 VAL B C   1 
ATOM   2231 O O   . VAL A 1 291 ? -76.840  -8.637  91.986  1.00 58.44  ? 452 VAL B O   1 
ATOM   2232 C CB  . VAL A 1 291 ? -76.317  -12.011 91.533  1.00 57.80  ? 452 VAL B CB  1 
ATOM   2233 C CG1 . VAL A 1 291 ? -76.069  -13.363 92.188  1.00 58.34  ? 452 VAL B CG1 1 
ATOM   2234 C CG2 . VAL A 1 291 ? -77.707  -11.950 90.915  1.00 56.71  ? 452 VAL B CG2 1 
ATOM   2235 N N   . PRO A 1 292 ? -74.961  -9.364  90.932  1.00 58.20  ? 453 PRO B N   1 
ATOM   2236 C CA  . PRO A 1 292 ? -74.801  -8.165  90.105  1.00 57.77  ? 453 PRO B CA  1 
ATOM   2237 C C   . PRO A 1 292 ? -76.030  -7.812  89.271  1.00 57.78  ? 453 PRO B C   1 
ATOM   2238 O O   . PRO A 1 292 ? -76.776  -8.695  88.843  1.00 57.10  ? 453 PRO B O   1 
ATOM   2239 C CB  . PRO A 1 292 ? -73.644  -8.535  89.179  1.00 57.27  ? 453 PRO B CB  1 
ATOM   2240 C CG  . PRO A 1 292 ? -72.820  -9.468  89.984  1.00 57.58  ? 453 PRO B CG  1 
ATOM   2241 C CD  . PRO A 1 292 ? -73.783  -10.248 90.834  1.00 57.61  ? 453 PRO B CD  1 
ATOM   2242 N N   . VAL A 1 293 ? -76.220  -6.513  89.058  1.00 59.09  ? 454 VAL B N   1 
ATOM   2243 C CA  . VAL A 1 293 ? -77.327  -5.986  88.267  1.00 60.28  ? 454 VAL B CA  1 
ATOM   2244 C C   . VAL A 1 293 ? -76.782  -4.921  87.318  1.00 60.56  ? 454 VAL B C   1 
ATOM   2245 O O   . VAL A 1 293 ? -75.814  -4.234  87.643  1.00 61.32  ? 454 VAL B O   1 
ATOM   2246 C CB  . VAL A 1 293 ? -78.412  -5.360  89.172  1.00 61.00  ? 454 VAL B CB  1 
ATOM   2247 C CG1 . VAL A 1 293 ? -79.569  -4.825  88.345  1.00 63.10  ? 454 VAL B CG1 1 
ATOM   2248 C CG2 . VAL A 1 293 ? -78.933  -6.377  90.177  1.00 62.03  ? 454 VAL B CG2 1 
ATOM   2249 N N   . VAL A 1 294 ? -77.393  -4.796  86.143  1.00 60.71  ? 455 VAL B N   1 
ATOM   2250 C CA  . VAL A 1 294 ? -77.050  -3.721  85.212  1.00 61.78  ? 455 VAL B CA  1 
ATOM   2251 C C   . VAL A 1 294 ? -77.531  -2.367  85.772  1.00 62.50  ? 455 VAL B C   1 
ATOM   2252 O O   . VAL A 1 294 ? -78.697  -1.987  85.634  1.00 62.31  ? 455 VAL B O   1 
ATOM   2253 C CB  . VAL A 1 294 ? -77.557  -4.023  83.776  1.00 61.72  ? 455 VAL B CB  1 
ATOM   2254 C CG1 . VAL A 1 294 ? -79.033  -4.402  83.772  1.00 62.96  ? 455 VAL B CG1 1 
ATOM   2255 C CG2 . VAL A 1 294 ? -77.265  -2.867  82.832  1.00 61.73  ? 455 VAL B CG2 1 
ATOM   2256 N N   . ASP A 1 295 ? -76.608  -1.653  86.417  1.00 63.37  ? 456 ASP B N   1 
ATOM   2257 C CA  . ASP A 1 295 ? -76.938  -0.477  87.229  1.00 63.27  ? 456 ASP B CA  1 
ATOM   2258 C C   . ASP A 1 295 ? -76.983  0.847   86.463  1.00 63.22  ? 456 ASP B C   1 
ATOM   2259 O O   . ASP A 1 295 ? -77.880  1.663   86.689  1.00 63.30  ? 456 ASP B O   1 
ATOM   2260 C CB  . ASP A 1 295 ? -75.981  -0.370  88.425  1.00 63.95  ? 456 ASP B CB  1 
ATOM   2261 C CG  . ASP A 1 295 ? -74.525  -0.280  88.006  1.00 64.98  ? 456 ASP B CG  1 
ATOM   2262 O OD1 . ASP A 1 295 ? -74.038  0.848   87.796  1.00 65.59  ? 456 ASP B OD1 1 
ATOM   2263 O OD2 . ASP A 1 295 ? -73.867  -1.335  87.893  1.00 65.97  ? 456 ASP B OD2 1 
ATOM   2264 N N   . GLY A 1 296 ? -76.020  1.058   85.569  1.00 62.88  ? 457 GLY B N   1 
ATOM   2265 C CA  . GLY A 1 296 ? -75.919  2.305   84.812  1.00 61.17  ? 457 GLY B CA  1 
ATOM   2266 C C   . GLY A 1 296 ? -74.506  2.858   84.763  1.00 60.51  ? 457 GLY B C   1 
ATOM   2267 O O   . GLY A 1 296 ? -74.118  3.496   83.781  1.00 60.89  ? 457 GLY B O   1 
ATOM   2268 N N   . ALA A 1 297 ? -73.739  2.607   85.823  1.00 59.16  ? 458 ALA B N   1 
ATOM   2269 C CA  . ALA A 1 297 ? -72.359  3.080   85.922  1.00 59.41  ? 458 ALA B CA  1 
ATOM   2270 C C   . ALA A 1 297 ? -71.340  1.970   85.665  1.00 60.97  ? 458 ALA B C   1 
ATOM   2271 O O   . ALA A 1 297 ? -70.511  2.088   84.757  1.00 62.41  ? 458 ALA B O   1 
ATOM   2272 C CB  . ALA A 1 297 ? -72.113  3.727   87.275  1.00 57.76  ? 458 ALA B CB  1 
ATOM   2273 N N   . PHE A 1 298 ? -71.402  0.902   86.465  1.00 61.11  ? 459 PHE B N   1 
ATOM   2274 C CA  . PHE A 1 298 ? -70.500  -0.243  86.312  1.00 59.41  ? 459 PHE B CA  1 
ATOM   2275 C C   . PHE A 1 298 ? -70.840  -1.054  85.062  1.00 59.45  ? 459 PHE B C   1 
ATOM   2276 O O   . PHE A 1 298 ? -69.946  -1.488  84.331  1.00 59.41  ? 459 PHE B O   1 
ATOM   2277 C CB  . PHE A 1 298 ? -70.519  -1.133  87.557  1.00 58.30  ? 459 PHE B CB  1 
ATOM   2278 C CG  . PHE A 1 298 ? -69.415  -2.153  87.588  1.00 58.92  ? 459 PHE B CG  1 
ATOM   2279 C CD1 . PHE A 1 298 ? -68.135  -1.800  88.011  1.00 58.88  ? 459 PHE B CD1 1 
ATOM   2280 C CD2 . PHE A 1 298 ? -69.650  -3.465  87.191  1.00 59.10  ? 459 PHE B CD2 1 
ATOM   2281 C CE1 . PHE A 1 298 ? -67.111  -2.736  88.036  1.00 58.27  ? 459 PHE B CE1 1 
ATOM   2282 C CE2 . PHE A 1 298 ? -68.629  -4.406  87.215  1.00 59.20  ? 459 PHE B CE2 1 
ATOM   2283 C CZ  . PHE A 1 298 ? -67.359  -4.040  87.637  1.00 59.06  ? 459 PHE B CZ  1 
ATOM   2284 N N   . LEU A 1 299 ? -72.135  -1.262  84.835  1.00 58.67  ? 460 LEU B N   1 
ATOM   2285 C CA  . LEU A 1 299 ? -72.632  -1.827  83.585  1.00 58.55  ? 460 LEU B CA  1 
ATOM   2286 C C   . LEU A 1 299 ? -73.819  -0.988  83.122  1.00 59.97  ? 460 LEU B C   1 
ATOM   2287 O O   . LEU A 1 299 ? -74.716  -0.698  83.918  1.00 61.18  ? 460 LEU B O   1 
ATOM   2288 C CB  . LEU A 1 299 ? -73.065  -3.287  83.775  1.00 56.99  ? 460 LEU B CB  1 
ATOM   2289 C CG  . LEU A 1 299 ? -72.099  -4.341  84.326  1.00 55.65  ? 460 LEU B CG  1 
ATOM   2290 C CD1 . LEU A 1 299 ? -72.863  -5.605  84.682  1.00 55.18  ? 460 LEU B CD1 1 
ATOM   2291 C CD2 . LEU A 1 299 ? -70.977  -4.658  83.350  1.00 55.20  ? 460 LEU B CD2 1 
ATOM   2292 N N   . ASP A 1 300 ? -73.823  -0.586  81.851  1.00 60.34  ? 461 ASP B N   1 
ATOM   2293 C CA  . ASP A 1 300 ? -74.959  0.165   81.301  1.00 62.01  ? 461 ASP B CA  1 
ATOM   2294 C C   . ASP A 1 300 ? -75.749  -0.623  80.248  1.00 61.76  ? 461 ASP B C   1 
ATOM   2295 O O   . ASP A 1 300 ? -76.665  -0.092  79.613  1.00 61.99  ? 461 ASP B O   1 
ATOM   2296 C CB  . ASP A 1 300 ? -74.535  1.552   80.787  1.00 64.41  ? 461 ASP B CB  1 
ATOM   2297 C CG  . ASP A 1 300 ? -73.684  1.490   79.529  1.00 66.99  ? 461 ASP B CG  1 
ATOM   2298 O OD1 . ASP A 1 300 ? -74.191  1.077   78.463  1.00 67.29  ? 461 ASP B OD1 1 
ATOM   2299 O OD2 . ASP A 1 300 ? -72.504  1.884   79.603  1.00 69.21  ? 461 ASP B OD2 1 
ATOM   2300 N N   . GLU A 1 301 ? -75.380  -1.889  80.074  1.00 61.75  ? 462 GLU B N   1 
ATOM   2301 C CA  . GLU A 1 301 ? -76.126  -2.829  79.237  1.00 62.56  ? 462 GLU B CA  1 
ATOM   2302 C C   . GLU A 1 301 ? -75.867  -4.257  79.709  1.00 63.54  ? 462 GLU B C   1 
ATOM   2303 O O   . GLU A 1 301 ? -74.864  -4.522  80.378  1.00 64.29  ? 462 GLU B O   1 
ATOM   2304 C CB  . GLU A 1 301 ? -75.753  -2.676  77.757  1.00 62.55  ? 462 GLU B CB  1 
ATOM   2305 C CG  . GLU A 1 301 ? -74.288  -2.949  77.433  1.00 62.66  ? 462 GLU B CG  1 
ATOM   2306 C CD  . GLU A 1 301 ? -73.924  -2.616  75.999  1.00 62.16  ? 462 GLU B CD  1 
ATOM   2307 O OE1 . GLU A 1 301 ? -74.797  -2.125  75.249  1.00 60.99  ? 462 GLU B OE1 1 
ATOM   2308 O OE2 . GLU A 1 301 ? -72.755  -2.847  75.622  1.00 62.36  ? 462 GLU B OE2 1 
ATOM   2309 N N   . THR A 1 302 ? -76.775  -5.167  79.364  1.00 64.04  ? 463 THR B N   1 
ATOM   2310 C CA  . THR A 1 302 ? -76.607  -6.588  79.666  1.00 64.08  ? 463 THR B CA  1 
ATOM   2311 C C   . THR A 1 302 ? -75.355  -7.138  78.975  1.00 64.27  ? 463 THR B C   1 
ATOM   2312 O O   . THR A 1 302 ? -75.038  -6.722  77.857  1.00 66.28  ? 463 THR B O   1 
ATOM   2313 C CB  . THR A 1 302 ? -77.834  -7.416  79.230  1.00 63.69  ? 463 THR B CB  1 
ATOM   2314 O OG1 . THR A 1 302 ? -78.137  -7.145  77.856  1.00 63.09  ? 463 THR B OG1 1 
ATOM   2315 C CG2 . THR A 1 302 ? -79.044  -7.080  80.091  1.00 63.82  ? 463 THR B CG2 1 
ATOM   2316 N N   . PRO A 1 303 ? -74.632  -8.059  79.642  1.00 63.30  ? 464 PRO B N   1 
ATOM   2317 C CA  . PRO A 1 303 ? -73.461  -8.693  79.035  1.00 64.36  ? 464 PRO B CA  1 
ATOM   2318 C C   . PRO A 1 303 ? -73.787  -9.403  77.719  1.00 66.52  ? 464 PRO B C   1 
ATOM   2319 O O   . PRO A 1 303 ? -72.917  -9.527  76.856  1.00 65.19  ? 464 PRO B O   1 
ATOM   2320 C CB  . PRO A 1 303 ? -73.025  -9.703  80.099  1.00 63.64  ? 464 PRO B CB  1 
ATOM   2321 C CG  . PRO A 1 303 ? -73.486  -9.101  81.381  1.00 62.01  ? 464 PRO B CG  1 
ATOM   2322 C CD  . PRO A 1 303 ? -74.806  -8.473  81.044  1.00 62.14  ? 464 PRO B CD  1 
ATOM   2323 N N   . GLN A 1 304 ? -75.035  -9.856  77.583  1.00 70.34  ? 465 GLN B N   1 
ATOM   2324 C CA  . GLN A 1 304 ? -75.547  -10.440 76.341  1.00 73.64  ? 465 GLN B CA  1 
ATOM   2325 C C   . GLN A 1 304 ? -75.395  -9.461  75.177  1.00 73.42  ? 465 GLN B C   1 
ATOM   2326 O O   . GLN A 1 304 ? -74.830  -9.808  74.136  1.00 74.18  ? 465 GLN B O   1 
ATOM   2327 C CB  . GLN A 1 304 ? -77.024  -10.820 76.501  1.00 76.79  ? 465 GLN B CB  1 
ATOM   2328 C CG  . GLN A 1 304 ? -77.301  -11.905 77.531  1.00 81.20  ? 465 GLN B CG  1 
ATOM   2329 C CD  . GLN A 1 304 ? -77.296  -13.306 76.937  1.00 84.91  ? 465 GLN B CD  1 
ATOM   2330 O OE1 . GLN A 1 304 ? -76.362  -13.701 76.236  1.00 86.54  ? 465 GLN B OE1 1 
ATOM   2331 N NE2 . GLN A 1 304 ? -78.344  -14.069 77.226  1.00 86.29  ? 465 GLN B NE2 1 
ATOM   2332 N N   . ARG A 1 305 ? -75.897  -8.242  75.375  1.00 72.69  ? 466 ARG B N   1 
ATOM   2333 C CA  . ARG A 1 305 ? -75.809  -7.169  74.383  1.00 70.37  ? 466 ARG B CA  1 
ATOM   2334 C C   . ARG A 1 305 ? -74.379  -6.664  74.224  1.00 67.05  ? 466 ARG B C   1 
ATOM   2335 O O   . ARG A 1 305 ? -73.965  -6.289  73.128  1.00 66.81  ? 466 ARG B O   1 
ATOM   2336 C CB  . ARG A 1 305 ? -76.732  -6.003  74.757  1.00 71.77  ? 466 ARG B CB  1 
ATOM   2337 C CG  . ARG A 1 305 ? -78.214  -6.260  74.523  1.00 73.55  ? 466 ARG B CG  1 
ATOM   2338 C CD  . ARG A 1 305 ? -79.043  -5.034  74.879  1.00 75.07  ? 466 ARG B CD  1 
ATOM   2339 N NE  . ARG A 1 305 ? -80.480  -5.314  74.886  1.00 77.83  ? 466 ARG B NE  1 
ATOM   2340 C CZ  . ARG A 1 305 ? -81.171  -5.742  75.944  1.00 78.59  ? 466 ARG B CZ  1 
ATOM   2341 N NH1 . ARG A 1 305 ? -80.568  -5.954  77.108  1.00 80.01  ? 466 ARG B NH1 1 
ATOM   2342 N NH2 . ARG A 1 305 ? -82.474  -5.963  75.840  1.00 77.72  ? 466 ARG B NH2 1 
ATOM   2343 N N   . SER A 1 306 ? -73.631  -6.659  75.324  1.00 64.93  ? 467 SER B N   1 
ATOM   2344 C CA  . SER A 1 306 ? -72.249  -6.193  75.316  1.00 63.95  ? 467 SER B CA  1 
ATOM   2345 C C   . SER A 1 306 ? -71.334  -7.164  74.566  1.00 63.26  ? 467 SER B C   1 
ATOM   2346 O O   . SER A 1 306 ? -70.342  -6.750  73.963  1.00 62.84  ? 467 SER B O   1 
ATOM   2347 C CB  . SER A 1 306 ? -71.753  -5.967  76.744  1.00 63.80  ? 467 SER B CB  1 
ATOM   2348 O OG  . SER A 1 306 ? -70.579  -5.177  76.749  1.00 64.17  ? 467 SER B OG  1 
ATOM   2349 N N   . LEU A 1 307 ? -71.678  -8.450  74.607  1.00 62.51  ? 468 LEU B N   1 
ATOM   2350 C CA  . LEU A 1 307 ? -70.960  -9.471  73.842  1.00 61.77  ? 468 LEU B CA  1 
ATOM   2351 C C   . LEU A 1 307 ? -71.335  -9.432  72.365  1.00 62.16  ? 468 LEU B C   1 
ATOM   2352 O O   . LEU A 1 307 ? -70.471  -9.574  71.497  1.00 63.25  ? 468 LEU B O   1 
ATOM   2353 C CB  . LEU A 1 307 ? -71.209  -10.867 74.419  1.00 59.88  ? 468 LEU B CB  1 
ATOM   2354 C CG  . LEU A 1 307 ? -70.085  -11.534 75.220  1.00 59.11  ? 468 LEU B CG  1 
ATOM   2355 C CD1 . LEU A 1 307 ? -69.542  -10.645 76.329  1.00 59.05  ? 468 LEU B CD1 1 
ATOM   2356 C CD2 . LEU A 1 307 ? -70.564  -12.861 75.790  1.00 59.88  ? 468 LEU B CD2 1 
ATOM   2357 N N   . ALA A 1 308 ? -72.624  -9.234  72.092  1.00 61.37  ? 469 ALA B N   1 
ATOM   2358 C CA  . ALA A 1 308 ? -73.132  -9.139  70.725  1.00 60.96  ? 469 ALA B CA  1 
ATOM   2359 C C   . ALA A 1 308 ? -72.480  -7.991  69.954  1.00 60.55  ? 469 ALA B C   1 
ATOM   2360 O O   . ALA A 1 308 ? -72.088  -8.156  68.801  1.00 61.15  ? 469 ALA B O   1 
ATOM   2361 C CB  . ALA A 1 308 ? -74.648  -8.990  70.729  1.00 60.38  ? 469 ALA B CB  1 
ATOM   2362 N N   . SER A 1 309 ? -72.354  -6.838  70.608  1.00 60.32  ? 470 SER B N   1 
ATOM   2363 C CA  . SER A 1 309 ? -71.781  -5.642  69.992  1.00 60.25  ? 470 SER B CA  1 
ATOM   2364 C C   . SER A 1 309 ? -70.250  -5.618  70.035  1.00 58.93  ? 470 SER B C   1 
ATOM   2365 O O   . SER A 1 309 ? -69.617  -4.779  69.390  1.00 58.28  ? 470 SER B O   1 
ATOM   2366 C CB  . SER A 1 309 ? -72.345  -4.386  70.658  1.00 62.27  ? 470 SER B CB  1 
ATOM   2367 O OG  . SER A 1 309 ? -72.010  -4.345  72.036  1.00 64.60  ? 470 SER B OG  1 
ATOM   2368 N N   . GLY A 1 310 ? -69.660  -6.530  70.801  1.00 57.80  ? 471 GLY B N   1 
ATOM   2369 C CA  . GLY A 1 310 ? -68.206  -6.629  70.893  1.00 57.30  ? 471 GLY B CA  1 
ATOM   2370 C C   . GLY A 1 310 ? -67.567  -5.600  71.807  1.00 56.32  ? 471 GLY B C   1 
ATOM   2371 O O   . GLY A 1 310 ? -66.356  -5.376  71.746  1.00 56.25  ? 471 GLY B O   1 
ATOM   2372 N N   . ARG A 1 311 ? -68.379  -4.982  72.661  1.00 55.61  ? 472 ARG B N   1 
ATOM   2373 C CA  . ARG A 1 311 ? -67.895  -3.969  73.596  1.00 54.98  ? 472 ARG B CA  1 
ATOM   2374 C C   . ARG A 1 311 ? -67.253  -4.591  74.836  1.00 54.60  ? 472 ARG B C   1 
ATOM   2375 O O   . ARG A 1 311 ? -67.840  -4.614  75.921  1.00 54.11  ? 472 ARG B O   1 
ATOM   2376 C CB  . ARG A 1 311 ? -69.018  -3.002  73.982  1.00 55.00  ? 472 ARG B CB  1 
ATOM   2377 C CG  . ARG A 1 311 ? -69.320  -1.960  72.918  1.00 54.92  ? 472 ARG B CG  1 
ATOM   2378 C CD  . ARG A 1 311 ? -70.292  -0.912  73.425  1.00 55.00  ? 472 ARG B CD  1 
ATOM   2379 N NE  . ARG A 1 311 ? -71.654  -1.432  73.520  1.00 55.19  ? 472 ARG B NE  1 
ATOM   2380 C CZ  . ARG A 1 311 ? -72.554  -1.372  72.543  1.00 55.83  ? 472 ARG B CZ  1 
ATOM   2381 N NH1 . ARG A 1 311 ? -73.764  -1.877  72.734  1.00 56.57  ? 472 ARG B NH1 1 
ATOM   2382 N NH2 . ARG A 1 311 ? -72.251  -0.820  71.375  1.00 56.03  ? 472 ARG B NH2 1 
ATOM   2383 N N   . PHE A 1 312 ? -66.041  -5.103  74.650  1.00 54.75  ? 473 PHE B N   1 
ATOM   2384 C CA  . PHE A 1 312 ? -65.235  -5.642  75.742  1.00 56.71  ? 473 PHE B CA  1 
ATOM   2385 C C   . PHE A 1 312 ? -63.755  -5.400  75.472  1.00 58.49  ? 473 PHE B C   1 
ATOM   2386 O O   . PHE A 1 312 ? -63.349  -5.226  74.319  1.00 60.89  ? 473 PHE B O   1 
ATOM   2387 C CB  . PHE A 1 312 ? -65.511  -7.137  75.968  1.00 56.69  ? 473 PHE B CB  1 
ATOM   2388 C CG  . PHE A 1 312 ? -65.636  -7.942  74.700  1.00 56.48  ? 473 PHE B CG  1 
ATOM   2389 C CD1 . PHE A 1 312 ? -64.509  -8.296  73.962  1.00 56.20  ? 473 PHE B CD1 1 
ATOM   2390 C CD2 . PHE A 1 312 ? -66.887  -8.361  74.252  1.00 55.96  ? 473 PHE B CD2 1 
ATOM   2391 C CE1 . PHE A 1 312 ? -64.630  -9.042  72.799  1.00 56.33  ? 473 PHE B CE1 1 
ATOM   2392 C CE2 . PHE A 1 312 ? -67.013  -9.109  73.092  1.00 55.18  ? 473 PHE B CE2 1 
ATOM   2393 C CZ  . PHE A 1 312 ? -65.882  -9.448  72.363  1.00 55.78  ? 473 PHE B CZ  1 
ATOM   2394 N N   . LYS A 1 313 ? -62.957  -5.393  76.539  1.00 58.68  ? 474 LYS B N   1 
ATOM   2395 C CA  . LYS A 1 313 ? -61.523  -5.124  76.449  1.00 59.15  ? 474 LYS B CA  1 
ATOM   2396 C C   . LYS A 1 313 ? -60.820  -6.031  75.434  1.00 61.25  ? 474 LYS B C   1 
ATOM   2397 O O   . LYS A 1 313 ? -61.070  -7.238  75.387  1.00 61.96  ? 474 LYS B O   1 
ATOM   2398 C CB  . LYS A 1 313 ? -60.872  -5.252  77.832  1.00 56.49  ? 474 LYS B CB  1 
ATOM   2399 C CG  . LYS A 1 313 ? -59.434  -4.764  77.898  1.00 54.33  ? 474 LYS B CG  1 
ATOM   2400 C CD  . LYS A 1 313 ? -58.930  -4.714  79.330  1.00 52.74  ? 474 LYS B CD  1 
ATOM   2401 C CE  . LYS A 1 313 ? -57.413  -4.603  79.384  1.00 51.88  ? 474 LYS B CE  1 
ATOM   2402 N NZ  . LYS A 1 313 ? -56.896  -3.322  78.832  1.00 50.86  ? 474 LYS B NZ  1 
ATOM   2403 N N   . LYS A 1 314 ? -59.963  -5.435  74.608  1.00 63.41  ? 475 LYS B N   1 
ATOM   2404 C CA  . LYS A 1 314 ? -59.109  -6.198  73.705  1.00 65.88  ? 475 LYS B CA  1 
ATOM   2405 C C   . LYS A 1 314 ? -57.940  -6.729  74.520  1.00 65.72  ? 475 LYS B C   1 
ATOM   2406 O O   . LYS A 1 314 ? -57.082  -5.959  74.957  1.00 67.28  ? 475 LYS B O   1 
ATOM   2407 C CB  . LYS A 1 314 ? -58.595  -5.333  72.543  1.00 67.71  ? 475 LYS B CB  1 
ATOM   2408 C CG  . LYS A 1 314 ? -59.657  -4.531  71.801  1.00 73.17  ? 475 LYS B CG  1 
ATOM   2409 C CD  . LYS A 1 314 ? -60.635  -5.416  71.042  1.00 78.29  ? 475 LYS B CD  1 
ATOM   2410 C CE  . LYS A 1 314 ? -61.806  -4.609  70.498  1.00 80.70  ? 475 LYS B CE  1 
ATOM   2411 N NZ  . LYS A 1 314 ? -62.842  -5.491  69.891  1.00 81.66  ? 475 LYS B NZ  1 
ATOM   2412 N N   . THR A 1 315 ? -57.930  -8.040  74.746  1.00 65.03  ? 476 THR B N   1 
ATOM   2413 C CA  . THR A 1 315 ? -56.870  -8.697  75.515  1.00 65.39  ? 476 THR B CA  1 
ATOM   2414 C C   . THR A 1 315 ? -57.017  -10.218 75.482  1.00 64.62  ? 476 THR B C   1 
ATOM   2415 O O   . THR A 1 315 ? -58.090  -10.740 75.170  1.00 65.39  ? 476 THR B O   1 
ATOM   2416 C CB  . THR A 1 315 ? -56.815  -8.199  76.982  1.00 66.14  ? 476 THR B CB  1 
ATOM   2417 O OG1 . THR A 1 315 ? -55.714  -8.815  77.664  1.00 66.80  ? 476 THR B OG1 1 
ATOM   2418 C CG2 . THR A 1 315 ? -58.117  -8.502  77.724  1.00 66.28  ? 476 THR B CG2 1 
ATOM   2419 N N   . GLU A 1 316 ? -55.932  -10.917 75.806  1.00 63.35  ? 477 GLU B N   1 
ATOM   2420 C CA  . GLU A 1 316 ? -55.928  -12.376 75.845  1.00 62.64  ? 477 GLU B CA  1 
ATOM   2421 C C   . GLU A 1 316 ? -56.642  -12.881 77.095  1.00 61.27  ? 477 GLU B C   1 
ATOM   2422 O O   . GLU A 1 316 ? -56.510  -12.295 78.173  1.00 61.37  ? 477 GLU B O   1 
ATOM   2423 C CB  . GLU A 1 316 ? -54.497  -12.927 75.808  1.00 63.45  ? 477 GLU B CB  1 
ATOM   2424 C CG  . GLU A 1 316 ? -53.558  -12.242 74.822  1.00 65.27  ? 477 GLU B CG  1 
ATOM   2425 C CD  . GLU A 1 316 ? -52.888  -11.002 75.397  1.00 66.39  ? 477 GLU B CD  1 
ATOM   2426 O OE1 . GLU A 1 316 ? -52.508  -11.011 76.588  1.00 64.75  ? 477 GLU B OE1 1 
ATOM   2427 O OE2 . GLU A 1 316 ? -52.732  -10.014 74.651  1.00 68.80  ? 477 GLU B OE2 1 
ATOM   2428 N N   . ILE A 1 317 ? -57.408  -13.959 76.947  1.00 59.12  ? 478 ILE B N   1 
ATOM   2429 C CA  . ILE A 1 317 ? -58.067  -14.590 78.092  1.00 57.87  ? 478 ILE B CA  1 
ATOM   2430 C C   . ILE A 1 317 ? -57.813  -16.095 78.155  1.00 58.22  ? 478 ILE B C   1 
ATOM   2431 O O   . ILE A 1 317 ? -57.771  -16.772 77.127  1.00 58.60  ? 478 ILE B O   1 
ATOM   2432 C CB  . ILE A 1 317 ? -59.590  -14.308 78.143  1.00 56.64  ? 478 ILE B CB  1 
ATOM   2433 C CG1 . ILE A 1 317 ? -60.293  -14.800 76.873  1.00 56.33  ? 478 ILE B CG1 1 
ATOM   2434 C CG2 . ILE A 1 317 ? -59.858  -12.825 78.379  1.00 56.97  ? 478 ILE B CG2 1 
ATOM   2435 C CD1 . ILE A 1 317 ? -61.771  -15.075 77.054  1.00 55.84  ? 478 ILE B CD1 1 
ATOM   2436 N N   . LEU A 1 318 ? -57.625  -16.602 79.372  1.00 58.76  ? 479 LEU B N   1 
ATOM   2437 C CA  . LEU A 1 318 ? -57.482  -18.035 79.617  1.00 58.51  ? 479 LEU B CA  1 
ATOM   2438 C C   . LEU A 1 318 ? -58.677  -18.523 80.428  1.00 58.86  ? 479 LEU B C   1 
ATOM   2439 O O   . LEU A 1 318 ? -58.908  -18.065 81.546  1.00 58.91  ? 479 LEU B O   1 
ATOM   2440 C CB  . LEU A 1 318 ? -56.173  -18.333 80.352  1.00 57.94  ? 479 LEU B CB  1 
ATOM   2441 C CG  . LEU A 1 318 ? -55.662  -19.775 80.358  1.00 57.35  ? 479 LEU B CG  1 
ATOM   2442 C CD1 . LEU A 1 318 ? -54.146  -19.798 80.491  1.00 57.43  ? 479 LEU B CD1 1 
ATOM   2443 C CD2 . LEU A 1 318 ? -56.315  -20.600 81.457  1.00 57.32  ? 479 LEU B CD2 1 
ATOM   2444 N N   . THR A 1 319 ? -59.430  -19.459 79.861  1.00 59.23  ? 480 THR B N   1 
ATOM   2445 C CA  . THR A 1 319 ? -60.695  -19.881 80.453  1.00 59.66  ? 480 THR B CA  1 
ATOM   2446 C C   . THR A 1 319 ? -60.908  -21.391 80.304  1.00 59.99  ? 480 THR B C   1 
ATOM   2447 O O   . THR A 1 319 ? -60.182  -22.050 79.559  1.00 60.44  ? 480 THR B O   1 
ATOM   2448 C CB  . THR A 1 319 ? -61.873  -19.072 79.853  1.00 60.11  ? 480 THR B CB  1 
ATOM   2449 O OG1 . THR A 1 319 ? -63.003  -19.114 80.733  1.00 61.99  ? 480 THR B OG1 1 
ATOM   2450 C CG2 . THR A 1 319 ? -62.267  -19.589 78.471  1.00 59.51  ? 480 THR B CG2 1 
ATOM   2451 N N   . GLY A 1 320 ? -61.886  -21.937 81.023  1.00 60.03  ? 481 GLY B N   1 
ATOM   2452 C CA  . GLY A 1 320 ? -62.207  -23.358 80.915  1.00 61.29  ? 481 GLY B CA  1 
ATOM   2453 C C   . GLY A 1 320 ? -63.113  -23.893 82.005  1.00 62.63  ? 481 GLY B C   1 
ATOM   2454 O O   . GLY A 1 320 ? -63.399  -23.197 82.981  1.00 63.71  ? 481 GLY B O   1 
ATOM   2455 N N   . SER A 1 321 ? -63.551  -25.140 81.834  1.00 63.16  ? 482 SER B N   1 
ATOM   2456 C CA  . SER A 1 321 ? -64.506  -25.778 82.741  1.00 62.95  ? 482 SER B CA  1 
ATOM   2457 C C   . SER A 1 321 ? -63.956  -27.073 83.336  1.00 62.34  ? 482 SER B C   1 
ATOM   2458 O O   . SER A 1 321 ? -62.902  -27.562 82.925  1.00 62.64  ? 482 SER B O   1 
ATOM   2459 C CB  . SER A 1 321 ? -65.816  -26.087 82.004  1.00 63.72  ? 482 SER B CB  1 
ATOM   2460 O OG  . SER A 1 321 ? -66.315  -24.953 81.318  1.00 65.57  ? 482 SER B OG  1 
ATOM   2461 N N   . ASN A 1 322 ? -64.683  -27.614 84.310  1.00 61.84  ? 483 ASN B N   1 
ATOM   2462 C CA  . ASN A 1 322 ? -64.443  -28.961 84.817  1.00 61.33  ? 483 ASN B CA  1 
ATOM   2463 C C   . ASN A 1 322 ? -65.445  -29.927 84.190  1.00 61.23  ? 483 ASN B C   1 
ATOM   2464 O O   . ASN A 1 322 ? -66.401  -29.498 83.543  1.00 61.89  ? 483 ASN B O   1 
ATOM   2465 C CB  . ASN A 1 322 ? -64.547  -28.993 86.344  1.00 61.66  ? 483 ASN B CB  1 
ATOM   2466 C CG  . ASN A 1 322 ? -63.586  -28.028 87.019  1.00 62.59  ? 483 ASN B CG  1 
ATOM   2467 O OD1 . ASN A 1 322 ? -62.691  -27.468 86.383  1.00 63.46  ? 483 ASN B OD1 1 
ATOM   2468 N ND2 . ASN A 1 322 ? -63.771  -27.828 88.319  1.00 63.11  ? 483 ASN B ND2 1 
ATOM   2469 N N   . THR A 1 323 ? -65.225  -31.226 84.378  1.00 60.92  ? 484 THR B N   1 
ATOM   2470 C CA  . THR A 1 323 ? -66.078  -32.248 83.765  1.00 60.75  ? 484 THR B CA  1 
ATOM   2471 C C   . THR A 1 323 ? -67.422  -32.429 84.463  1.00 61.16  ? 484 THR B C   1 
ATOM   2472 O O   . THR A 1 323 ? -68.424  -32.725 83.807  1.00 61.54  ? 484 THR B O   1 
ATOM   2473 C CB  . THR A 1 323 ? -65.372  -33.611 83.676  1.00 60.74  ? 484 THR B CB  1 
ATOM   2474 O OG1 . THR A 1 323 ? -64.597  -33.829 84.862  1.00 61.65  ? 484 THR B OG1 1 
ATOM   2475 C CG2 . THR A 1 323 ? -64.462  -33.655 82.466  1.00 60.56  ? 484 THR B CG2 1 
ATOM   2476 N N   . GLU A 1 324 ? -67.441  -32.257 85.784  1.00 61.54  ? 485 GLU B N   1 
ATOM   2477 C CA  . GLU A 1 324 ? -68.664  -32.435 86.573  1.00 61.69  ? 485 GLU B CA  1 
ATOM   2478 C C   . GLU A 1 324 ? -69.055  -31.167 87.332  1.00 61.46  ? 485 GLU B C   1 
ATOM   2479 O O   . GLU A 1 324 ? -69.076  -31.142 88.565  1.00 61.25  ? 485 GLU B O   1 
ATOM   2480 C CB  . GLU A 1 324 ? -68.532  -33.626 87.534  1.00 61.80  ? 485 GLU B CB  1 
ATOM   2481 C CG  . GLU A 1 324 ? -68.756  -34.990 86.895  1.00 62.39  ? 485 GLU B CG  1 
ATOM   2482 C CD  . GLU A 1 324 ? -67.582  -35.460 86.056  1.00 63.18  ? 485 GLU B CD  1 
ATOM   2483 O OE1 . GLU A 1 324 ? -66.428  -35.393 86.536  1.00 63.47  ? 485 GLU B OE1 1 
ATOM   2484 O OE2 . GLU A 1 324 ? -67.817  -35.905 84.913  1.00 63.49  ? 485 GLU B OE2 1 
ATOM   2485 N N   . GLU A 1 325 ? -69.380  -30.119 86.581  1.00 62.03  ? 486 GLU B N   1 
ATOM   2486 C CA  . GLU A 1 325 ? -69.743  -28.832 87.169  1.00 62.89  ? 486 GLU B CA  1 
ATOM   2487 C C   . GLU A 1 325 ? -71.046  -28.919 87.962  1.00 62.85  ? 486 GLU B C   1 
ATOM   2488 O O   . GLU A 1 325 ? -71.162  -28.335 89.041  1.00 63.42  ? 486 GLU B O   1 
ATOM   2489 C CB  . GLU A 1 325 ? -69.849  -27.752 86.085  1.00 62.86  ? 486 GLU B CB  1 
ATOM   2490 C CG  . GLU A 1 325 ? -68.559  -27.494 85.312  1.00 63.04  ? 486 GLU B CG  1 
ATOM   2491 C CD  . GLU A 1 325 ? -67.645  -26.468 85.966  1.00 64.05  ? 486 GLU B CD  1 
ATOM   2492 O OE1 . GLU A 1 325 ? -66.972  -25.725 85.220  1.00 65.03  ? 486 GLU B OE1 1 
ATOM   2493 O OE2 . GLU A 1 325 ? -67.588  -26.393 87.214  1.00 64.05  ? 486 GLU B OE2 1 
ATOM   2494 N N   . GLY A 1 326 ? -72.005  -29.671 87.429  1.00 62.91  ? 487 GLY B N   1 
ATOM   2495 C CA  . GLY A 1 326 ? -73.354  -29.750 87.987  1.00 63.04  ? 487 GLY B CA  1 
ATOM   2496 C C   . GLY A 1 326 ? -73.515  -30.396 89.353  1.00 62.57  ? 487 GLY B C   1 
ATOM   2497 O O   . GLY A 1 326 ? -74.307  -29.920 90.168  1.00 62.92  ? 487 GLY B O   1 
ATOM   2498 N N   . TYR A 1 327 ? -72.771  -31.471 89.607  1.00 61.97  ? 488 TYR B N   1 
ATOM   2499 C CA  . TYR A 1 327 ? -72.951  -32.280 90.820  1.00 61.76  ? 488 TYR B CA  1 
ATOM   2500 C C   . TYR A 1 327 ? -72.977  -31.487 92.125  1.00 62.47  ? 488 TYR B C   1 
ATOM   2501 O O   . TYR A 1 327 ? -73.831  -31.737 92.980  1.00 63.04  ? 488 TYR B O   1 
ATOM   2502 C CB  . TYR A 1 327 ? -71.893  -33.386 90.917  1.00 61.12  ? 488 TYR B CB  1 
ATOM   2503 C CG  . TYR A 1 327 ? -72.239  -34.672 90.195  1.00 60.64  ? 488 TYR B CG  1 
ATOM   2504 C CD1 . TYR A 1 327 ? -73.535  -35.196 90.224  1.00 60.02  ? 488 TYR B CD1 1 
ATOM   2505 C CD2 . TYR A 1 327 ? -71.260  -35.384 89.508  1.00 60.88  ? 488 TYR B CD2 1 
ATOM   2506 C CE1 . TYR A 1 327 ? -73.842  -36.380 89.570  1.00 60.68  ? 488 TYR B CE1 1 
ATOM   2507 C CE2 . TYR A 1 327 ? -71.555  -36.569 88.854  1.00 61.54  ? 488 TYR B CE2 1 
ATOM   2508 C CZ  . TYR A 1 327 ? -72.845  -37.063 88.887  1.00 61.73  ? 488 TYR B CZ  1 
ATOM   2509 O OH  . TYR A 1 327 ? -73.131  -38.241 88.237  1.00 62.93  ? 488 TYR B OH  1 
ATOM   2510 N N   . TYR A 1 328 ? -72.054  -30.536 92.268  1.00 62.17  ? 489 TYR B N   1 
ATOM   2511 C CA  . TYR A 1 328 ? -71.945  -29.742 93.496  1.00 60.62  ? 489 TYR B CA  1 
ATOM   2512 C C   . TYR A 1 328 ? -73.277  -29.132 93.905  1.00 59.32  ? 489 TYR B C   1 
ATOM   2513 O O   . TYR A 1 328 ? -73.720  -29.289 95.045  1.00 58.84  ? 489 TYR B O   1 
ATOM   2514 C CB  . TYR A 1 328 ? -70.880  -28.645 93.360  1.00 60.63  ? 489 TYR B CB  1 
ATOM   2515 C CG  . TYR A 1 328 ? -70.612  -27.908 94.658  1.00 60.70  ? 489 TYR B CG  1 
ATOM   2516 C CD1 . TYR A 1 328 ? -69.660  -28.376 95.563  1.00 61.22  ? 489 TYR B CD1 1 
ATOM   2517 C CD2 . TYR A 1 328 ? -71.320  -26.750 94.985  1.00 60.26  ? 489 TYR B CD2 1 
ATOM   2518 C CE1 . TYR A 1 328 ? -69.418  -27.710 96.754  1.00 61.59  ? 489 TYR B CE1 1 
ATOM   2519 C CE2 . TYR A 1 328 ? -71.085  -26.079 96.173  1.00 60.59  ? 489 TYR B CE2 1 
ATOM   2520 C CZ  . TYR A 1 328 ? -70.134  -26.562 97.051  1.00 61.58  ? 489 TYR B CZ  1 
ATOM   2521 O OH  . TYR A 1 328 ? -69.898  -25.900 98.231  1.00 63.10  ? 489 TYR B OH  1 
ATOM   2522 N N   . PHE A 1 329 ? -73.909  -28.451 92.957  1.00 58.29  ? 490 PHE B N   1 
ATOM   2523 C CA  . PHE A 1 329 ? -75.123  -27.688 93.218  1.00 57.53  ? 490 PHE B CA  1 
ATOM   2524 C C   . PHE A 1 329 ? -76.357  -28.572 93.344  1.00 56.58  ? 490 PHE B C   1 
ATOM   2525 O O   . PHE A 1 329 ? -77.293  -28.212 94.057  1.00 57.32  ? 490 PHE B O   1 
ATOM   2526 C CB  . PHE A 1 329 ? -75.305  -26.602 92.153  1.00 57.60  ? 490 PHE B CB  1 
ATOM   2527 C CG  . PHE A 1 329 ? -74.144  -25.651 92.072  1.00 57.82  ? 490 PHE B CG  1 
ATOM   2528 C CD1 . PHE A 1 329 ? -74.100  -24.515 92.876  1.00 58.34  ? 490 PHE B CD1 1 
ATOM   2529 C CD2 . PHE A 1 329 ? -73.077  -25.905 91.216  1.00 57.67  ? 490 PHE B CD2 1 
ATOM   2530 C CE1 . PHE A 1 329 ? -73.024  -23.644 92.818  1.00 58.08  ? 490 PHE B CE1 1 
ATOM   2531 C CE2 . PHE A 1 329 ? -71.996  -25.039 91.156  1.00 58.34  ? 490 PHE B CE2 1 
ATOM   2532 C CZ  . PHE A 1 329 ? -71.971  -23.905 91.956  1.00 58.37  ? 490 PHE B CZ  1 
ATOM   2533 N N   . ILE A 1 330 ? -76.347  -29.720 92.663  1.00 54.26  ? 491 ILE B N   1 
ATOM   2534 C CA  . ILE A 1 330 ? -77.419  -30.713 92.786  1.00 51.84  ? 491 ILE B CA  1 
ATOM   2535 C C   . ILE A 1 330 ? -77.369  -31.354 94.171  1.00 50.88  ? 491 ILE B C   1 
ATOM   2536 O O   . ILE A 1 330 ? -78.398  -31.459 94.848  1.00 50.51  ? 491 ILE B O   1 
ATOM   2537 C CB  . ILE A 1 330 ? -77.343  -31.809 91.700  1.00 51.42  ? 491 ILE B CB  1 
ATOM   2538 C CG1 . ILE A 1 330 ? -77.312  -31.186 90.304  1.00 52.13  ? 491 ILE B CG1 1 
ATOM   2539 C CG2 . ILE A 1 330 ? -78.532  -32.755 91.808  1.00 50.82  ? 491 ILE B CG2 1 
ATOM   2540 C CD1 . ILE A 1 330 ? -76.861  -32.136 89.216  1.00 52.46  ? 491 ILE B CD1 1 
ATOM   2541 N N   . ILE A 1 331 ? -76.169  -31.761 94.586  1.00 49.66  ? 492 ILE B N   1 
ATOM   2542 C CA  . ILE A 1 331 ? -75.941  -32.336 95.914  1.00 49.35  ? 492 ILE B CA  1 
ATOM   2543 C C   . ILE A 1 331 ? -76.600  -31.506 97.014  1.00 50.57  ? 492 ILE B C   1 
ATOM   2544 O O   . ILE A 1 331 ? -77.232  -32.052 97.921  1.00 51.18  ? 492 ILE B O   1 
ATOM   2545 C CB  . ILE A 1 331 ? -74.432  -32.537 96.187  1.00 48.29  ? 492 ILE B CB  1 
ATOM   2546 C CG1 . ILE A 1 331 ? -73.972  -33.862 95.571  1.00 48.18  ? 492 ILE B CG1 1 
ATOM   2547 C CG2 . ILE A 1 331 ? -74.123  -32.499 97.680  1.00 48.02  ? 492 ILE B CG2 1 
ATOM   2548 C CD1 . ILE A 1 331 ? -72.481  -34.107 95.636  1.00 48.32  ? 492 ILE B CD1 1 
ATOM   2549 N N   . TYR A 1 332 ? -76.471  -30.186 96.910  1.00 52.02  ? 493 TYR B N   1 
ATOM   2550 C CA  . TYR A 1 332 ? -77.092  -29.277 97.861  1.00 53.05  ? 493 TYR B CA  1 
ATOM   2551 C C   . TYR A 1 332 ? -78.568  -29.041 97.565  1.00 54.21  ? 493 TYR B C   1 
ATOM   2552 O O   . TYR A 1 332 ? -79.371  -28.967 98.490  1.00 55.76  ? 493 TYR B O   1 
ATOM   2553 C CB  . TYR A 1 332 ? -76.326  -27.953 97.924  1.00 52.95  ? 493 TYR B CB  1 
ATOM   2554 C CG  . TYR A 1 332 ? -75.114  -28.003 98.828  1.00 53.41  ? 493 TYR B CG  1 
ATOM   2555 C CD1 . TYR A 1 332 ? -73.921  -28.591 98.402  1.00 53.99  ? 493 TYR B CD1 1 
ATOM   2556 C CD2 . TYR A 1 332 ? -75.160  -27.466 100.114 1.00 53.75  ? 493 TYR B CD2 1 
ATOM   2557 C CE1 . TYR A 1 332 ? -72.810  -28.641 99.233  1.00 54.95  ? 493 TYR B CE1 1 
ATOM   2558 C CE2 . TYR A 1 332 ? -74.054  -27.506 100.950 1.00 54.17  ? 493 TYR B CE2 1 
ATOM   2559 C CZ  . TYR A 1 332 ? -72.885  -28.096 100.509 1.00 54.75  ? 493 TYR B CZ  1 
ATOM   2560 O OH  . TYR A 1 332 ? -71.789  -28.138 101.342 1.00 54.61  ? 493 TYR B OH  1 
ATOM   2561 N N   . TYR A 1 333 ? -78.926  -28.937 96.285  1.00 55.28  ? 494 TYR B N   1 
ATOM   2562 C CA  . TYR A 1 333 ? -80.308  -28.633 95.901  1.00 56.07  ? 494 TYR B CA  1 
ATOM   2563 C C   . TYR A 1 333 ? -81.239  -29.836 96.036  1.00 57.33  ? 494 TYR B C   1 
ATOM   2564 O O   . TYR A 1 333 ? -82.098  -29.850 96.917  1.00 59.33  ? 494 TYR B O   1 
ATOM   2565 C CB  . TYR A 1 333 ? -80.388  -28.041 94.492  1.00 55.98  ? 494 TYR B CB  1 
ATOM   2566 C CG  . TYR A 1 333 ? -81.760  -27.515 94.139  1.00 56.21  ? 494 TYR B CG  1 
ATOM   2567 C CD1 . TYR A 1 333 ? -82.140  -26.220 94.484  1.00 56.35  ? 494 TYR B CD1 1 
ATOM   2568 C CD2 . TYR A 1 333 ? -82.685  -28.316 93.468  1.00 56.28  ? 494 TYR B CD2 1 
ATOM   2569 C CE1 . TYR A 1 333 ? -83.400  -25.736 94.170  1.00 56.43  ? 494 TYR B CE1 1 
ATOM   2570 C CE2 . TYR A 1 333 ? -83.947  -27.842 93.150  1.00 56.21  ? 494 TYR B CE2 1 
ATOM   2571 C CZ  . TYR A 1 333 ? -84.297  -26.551 93.502  1.00 56.27  ? 494 TYR B CZ  1 
ATOM   2572 O OH  . TYR A 1 333 ? -85.547  -26.076 93.187  1.00 56.89  ? 494 TYR B OH  1 
ATOM   2573 N N   . LEU A 1 334 ? -81.083  -30.830 95.162  1.00 57.98  ? 495 LEU B N   1 
ATOM   2574 C CA  . LEU A 1 334 ? -81.854  -32.068 95.268  1.00 58.45  ? 495 LEU B CA  1 
ATOM   2575 C C   . LEU A 1 334 ? -81.263  -32.907 96.388  1.00 59.75  ? 495 LEU B C   1 
ATOM   2576 O O   . LEU A 1 334 ? -80.541  -33.868 96.144  1.00 59.95  ? 495 LEU B O   1 
ATOM   2577 C CB  . LEU A 1 334 ? -81.847  -32.846 93.949  1.00 57.91  ? 495 LEU B CB  1 
ATOM   2578 C CG  . LEU A 1 334 ? -82.567  -32.265 92.729  1.00 58.10  ? 495 LEU B CG  1 
ATOM   2579 C CD1 . LEU A 1 334 ? -82.357  -33.175 91.528  1.00 58.65  ? 495 LEU B CD1 1 
ATOM   2580 C CD2 . LEU A 1 334 ? -84.053  -32.058 92.990  1.00 57.63  ? 495 LEU B CD2 1 
ATOM   2581 N N   . THR A 1 335 ? -81.574  -32.524 97.621  1.00 62.36  ? 496 THR B N   1 
ATOM   2582 C CA  . THR A 1 335 ? -80.936  -33.090 98.806  1.00 63.60  ? 496 THR B CA  1 
ATOM   2583 C C   . THR A 1 335 ? -81.372  -34.527 99.114  1.00 65.16  ? 496 THR B C   1 
ATOM   2584 O O   . THR A 1 335 ? -80.605  -35.300 99.689  1.00 65.14  ? 496 THR B O   1 
ATOM   2585 C CB  . THR A 1 335 ? -81.139  -32.176 100.038 1.00 63.26  ? 496 THR B CB  1 
ATOM   2586 O OG1 . THR A 1 335 ? -80.518  -32.769 101.183 1.00 65.98  ? 496 THR B OG1 1 
ATOM   2587 C CG2 . THR A 1 335 ? -82.627  -31.933 100.323 1.00 62.10  ? 496 THR B CG2 1 
ATOM   2588 N N   . GLU A 1 336 ? -82.591  -34.875 98.714  1.00 68.98  ? 497 GLU B N   1 
ATOM   2589 C CA  . GLU A 1 336 ? -83.175  -36.176 99.030  1.00 72.92  ? 497 GLU B CA  1 
ATOM   2590 C C   . GLU A 1 336 ? -82.752  -37.243 98.019  1.00 71.43  ? 497 GLU B C   1 
ATOM   2591 O O   . GLU A 1 336 ? -82.515  -38.397 98.380  1.00 72.43  ? 497 GLU B O   1 
ATOM   2592 C CB  . GLU A 1 336 ? -84.701  -36.068 99.102  1.00 78.09  ? 497 GLU B CB  1 
ATOM   2593 C CG  . GLU A 1 336 ? -85.294  -36.577 100.408 1.00 83.68  ? 497 GLU B CG  1 
ATOM   2594 C CD  . GLU A 1 336 ? -84.757  -35.839 101.626 1.00 88.60  ? 497 GLU B CD  1 
ATOM   2595 O OE1 . GLU A 1 336 ? -84.727  -34.587 101.610 1.00 90.27  ? 497 GLU B OE1 1 
ATOM   2596 O OE2 . GLU A 1 336 ? -84.361  -36.513 102.601 1.00 92.02  ? 497 GLU B OE2 1 
ATOM   2597 N N   . LEU A 1 337 ? -82.674  -36.845 96.753  1.00 69.64  ? 498 LEU B N   1 
ATOM   2598 C CA  . LEU A 1 337 ? -82.125  -37.687 95.696  1.00 67.17  ? 498 LEU B CA  1 
ATOM   2599 C C   . LEU A 1 337 ? -80.621  -37.457 95.624  1.00 66.36  ? 498 LEU B C   1 
ATOM   2600 O O   . LEU A 1 337 ? -80.151  -36.353 95.878  1.00 68.23  ? 498 LEU B O   1 
ATOM   2601 C CB  . LEU A 1 337 ? -82.783  -37.333 94.361  1.00 65.88  ? 498 LEU B CB  1 
ATOM   2602 C CG  . LEU A 1 337 ? -82.260  -37.956 93.067  1.00 64.49  ? 498 LEU B CG  1 
ATOM   2603 C CD1 . LEU A 1 337 ? -82.633  -39.428 92.981  1.00 65.33  ? 498 LEU B CD1 1 
ATOM   2604 C CD2 . LEU A 1 337 ? -82.798  -37.193 91.868  1.00 64.34  ? 498 LEU B CD2 1 
ATOM   2605 N N   . LEU A 1 338 ? -79.870  -38.494 95.269  1.00 64.66  ? 499 LEU B N   1 
ATOM   2606 C CA  . LEU A 1 338 ? -78.400  -38.435 95.252  1.00 65.25  ? 499 LEU B CA  1 
ATOM   2607 C C   . LEU A 1 338 ? -77.797  -37.673 96.448  1.00 65.23  ? 499 LEU B C   1 
ATOM   2608 O O   . LEU A 1 338 ? -77.199  -36.602 96.306  1.00 63.92  ? 499 LEU B O   1 
ATOM   2609 C CB  . LEU A 1 338 ? -77.851  -37.965 93.884  1.00 64.10  ? 499 LEU B CB  1 
ATOM   2610 C CG  . LEU A 1 338 ? -78.101  -36.599 93.234  1.00 62.14  ? 499 LEU B CG  1 
ATOM   2611 C CD1 . LEU A 1 338 ? -76.984  -35.624 93.565  1.00 60.93  ? 499 LEU B CD1 1 
ATOM   2612 C CD2 . LEU A 1 338 ? -78.185  -36.774 91.728  1.00 61.82  ? 499 LEU B CD2 1 
ATOM   2613 N N   . ARG A 1 339 ? -77.976  -38.246 97.634  1.00 66.08  ? 500 ARG B N   1 
ATOM   2614 C CA  . ARG A 1 339 ? -77.411  -37.688 98.859  1.00 67.34  ? 500 ARG B CA  1 
ATOM   2615 C C   . ARG A 1 339 ? -75.914  -37.989 98.961  1.00 66.19  ? 500 ARG B C   1 
ATOM   2616 O O   . ARG A 1 339 ? -75.344  -38.628 98.074  1.00 65.07  ? 500 ARG B O   1 
ATOM   2617 C CB  . ARG A 1 339 ? -78.179  -38.186 100.091 1.00 70.00  ? 500 ARG B CB  1 
ATOM   2618 C CG  . ARG A 1 339 ? -78.510  -39.670 100.082 1.00 72.50  ? 500 ARG B CG  1 
ATOM   2619 C CD  . ARG A 1 339 ? -79.501  -40.017 101.182 1.00 76.37  ? 500 ARG B CD  1 
ATOM   2620 N NE  . ARG A 1 339 ? -80.885  -39.765 100.781 1.00 79.19  ? 500 ARG B NE  1 
ATOM   2621 C CZ  . ARG A 1 339 ? -81.909  -39.633 101.623 1.00 81.08  ? 500 ARG B CZ  1 
ATOM   2622 N NH1 . ARG A 1 339 ? -81.721  -39.717 102.936 1.00 81.71  ? 500 ARG B NH1 1 
ATOM   2623 N NH2 . ARG A 1 339 ? -83.128  -39.409 101.151 1.00 81.32  ? 500 ARG B NH2 1 
ATOM   2624 N N   . LYS A 1 340 ? -75.287  -37.527 100.043 1.00 65.80  ? 501 LYS B N   1 
ATOM   2625 C CA  . LYS A 1 340 ? -73.835  -37.612 100.217 1.00 65.13  ? 501 LYS B CA  1 
ATOM   2626 C C   . LYS A 1 340 ? -73.363  -39.027 100.586 1.00 67.94  ? 501 LYS B C   1 
ATOM   2627 O O   . LYS A 1 340 ? -72.506  -39.206 101.455 1.00 68.49  ? 501 LYS B O   1 
ATOM   2628 C CB  . LYS A 1 340 ? -73.383  -36.600 101.273 1.00 62.34  ? 501 LYS B CB  1 
ATOM   2629 C CG  . LYS A 1 340 ? -71.994  -36.020 101.047 1.00 59.92  ? 501 LYS B CG  1 
ATOM   2630 C CD  . LYS A 1 340 ? -71.300  -35.735 102.371 1.00 56.92  ? 501 LYS B CD  1 
ATOM   2631 C CE  . LYS A 1 340 ? -70.651  -36.991 102.932 1.00 54.30  ? 501 LYS B CE  1 
ATOM   2632 N NZ  . LYS A 1 340 ? -70.568  -36.946 104.412 1.00 52.35  ? 501 LYS B NZ  1 
ATOM   2633 N N   . GLU A 1 341 ? -73.926  -40.027 99.914  1.00 72.55  ? 502 GLU B N   1 
ATOM   2634 C CA  . GLU A 1 341 ? -73.574  -41.427 100.142 1.00 75.25  ? 502 GLU B CA  1 
ATOM   2635 C C   . GLU A 1 341 ? -72.615  -41.928 99.072  1.00 74.69  ? 502 GLU B C   1 
ATOM   2636 O O   . GLU A 1 341 ? -72.499  -41.334 97.997  1.00 74.38  ? 502 GLU B O   1 
ATOM   2637 C CB  . GLU A 1 341 ? -74.825  -42.308 100.127 1.00 79.03  ? 502 GLU B CB  1 
ATOM   2638 C CG  . GLU A 1 341 ? -75.837  -42.025 101.224 1.00 82.76  ? 502 GLU B CG  1 
ATOM   2639 C CD  . GLU A 1 341 ? -77.159  -42.736 100.991 1.00 85.99  ? 502 GLU B CD  1 
ATOM   2640 O OE1 . GLU A 1 341 ? -77.554  -42.919 99.816  1.00 86.67  ? 502 GLU B OE1 1 
ATOM   2641 O OE2 . GLU A 1 341 ? -77.814  -43.104 101.989 1.00 88.93  ? 502 GLU B OE2 1 
ATOM   2642 N N   . GLU A 1 342 ? -71.938  -43.032 99.374  1.00 73.99  ? 503 GLU B N   1 
ATOM   2643 C CA  . GLU A 1 342 ? -71.094  -43.707 98.402  1.00 74.63  ? 503 GLU B CA  1 
ATOM   2644 C C   . GLU A 1 342 ? -71.957  -44.556 97.470  1.00 73.28  ? 503 GLU B C   1 
ATOM   2645 O O   . GLU A 1 342 ? -72.894  -45.219 97.918  1.00 71.60  ? 503 GLU B O   1 
ATOM   2646 C CB  . GLU A 1 342 ? -70.044  -44.568 99.114  1.00 76.69  ? 503 GLU B CB  1 
ATOM   2647 C CG  . GLU A 1 342 ? -68.864  -44.977 98.242  1.00 79.85  ? 503 GLU B CG  1 
ATOM   2648 C CD  . GLU A 1 342 ? -68.146  -43.786 97.628  1.00 81.40  ? 503 GLU B CD  1 
ATOM   2649 O OE1 . GLU A 1 342 ? -68.156  -43.666 96.383  1.00 81.70  ? 503 GLU B OE1 1 
ATOM   2650 O OE2 . GLU A 1 342 ? -67.586  -42.966 98.389  1.00 81.72  ? 503 GLU B OE2 1 
ATOM   2651 N N   . GLY A 1 343 ? -71.647  -44.508 96.175  1.00 73.40  ? 504 GLY B N   1 
ATOM   2652 C CA  . GLY A 1 343 ? -72.331  -45.317 95.161  1.00 73.33  ? 504 GLY B CA  1 
ATOM   2653 C C   . GLY A 1 343 ? -73.830  -45.100 95.020  1.00 73.06  ? 504 GLY B C   1 
ATOM   2654 O O   . GLY A 1 343 ? -74.596  -46.064 94.929  1.00 71.89  ? 504 GLY B O   1 
ATOM   2655 N N   . VAL A 1 344 ? -74.253  -43.839 94.997  1.00 73.49  ? 505 VAL B N   1 
ATOM   2656 C CA  . VAL A 1 344 ? -75.665  -43.502 94.808  1.00 72.80  ? 505 VAL B CA  1 
ATOM   2657 C C   . VAL A 1 344 ? -76.020  -43.520 93.316  1.00 72.36  ? 505 VAL B C   1 
ATOM   2658 O O   . VAL A 1 344 ? -75.157  -43.280 92.467  1.00 71.75  ? 505 VAL B O   1 
ATOM   2659 C CB  . VAL A 1 344 ? -76.024  -42.148 95.471  1.00 72.40  ? 505 VAL B CB  1 
ATOM   2660 C CG1 . VAL A 1 344 ? -75.683  -40.977 94.561  1.00 70.32  ? 505 VAL B CG1 1 
ATOM   2661 C CG2 . VAL A 1 344 ? -77.496  -42.114 95.866  1.00 73.71  ? 505 VAL B CG2 1 
ATOM   2662 N N   . THR A 1 345 ? -77.281  -43.823 93.007  1.00 72.41  ? 506 THR B N   1 
ATOM   2663 C CA  . THR A 1 345 ? -77.763  -43.911 91.621  1.00 71.90  ? 506 THR B CA  1 
ATOM   2664 C C   . THR A 1 345 ? -79.163  -43.316 91.456  1.00 70.56  ? 506 THR B C   1 
ATOM   2665 O O   . THR A 1 345 ? -79.895  -43.146 92.435  1.00 71.32  ? 506 THR B O   1 
ATOM   2666 C CB  . THR A 1 345 ? -77.794  -45.367 91.114  1.00 72.86  ? 506 THR B CB  1 
ATOM   2667 O OG1 . THR A 1 345 ? -78.482  -46.189 92.064  1.00 74.79  ? 506 THR B OG1 1 
ATOM   2668 C CG2 . THR A 1 345 ? -76.386  -45.912 90.893  1.00 73.09  ? 506 THR B CG2 1 
ATOM   2669 N N   . VAL A 1 346 ? -79.529  -43.014 90.210  1.00 68.52  ? 507 VAL B N   1 
ATOM   2670 C CA  . VAL A 1 346 ? -80.825  -42.407 89.890  1.00 67.17  ? 507 VAL B CA  1 
ATOM   2671 C C   . VAL A 1 346 ? -81.602  -43.265 88.885  1.00 67.48  ? 507 VAL B C   1 
ATOM   2672 O O   . VAL A 1 346 ? -81.093  -43.585 87.808  1.00 67.31  ? 507 VAL B O   1 
ATOM   2673 C CB  . VAL A 1 346 ? -80.651  -40.972 89.333  1.00 65.69  ? 507 VAL B CB  1 
ATOM   2674 C CG1 . VAL A 1 346 ? -81.990  -40.368 88.934  1.00 65.07  ? 507 VAL B CG1 1 
ATOM   2675 C CG2 . VAL A 1 346 ? -79.961  -40.078 90.352  1.00 65.69  ? 507 VAL B CG2 1 
ATOM   2676 N N   . THR A 1 347 ? -82.834  -43.633 89.244  1.00 67.22  ? 508 THR B N   1 
ATOM   2677 C CA  . THR A 1 347 ? -83.718  -44.384 88.346  1.00 66.34  ? 508 THR B CA  1 
ATOM   2678 C C   . THR A 1 347 ? -84.255  -43.482 87.240  1.00 65.95  ? 508 THR B C   1 
ATOM   2679 O O   . THR A 1 347 ? -84.271  -42.259 87.385  1.00 66.82  ? 508 THR B O   1 
ATOM   2680 C CB  . THR A 1 347 ? -84.909  -45.028 89.093  1.00 65.81  ? 508 THR B CB  1 
ATOM   2681 O OG1 . THR A 1 347 ? -85.698  -44.011 89.721  1.00 65.20  ? 508 THR B OG1 1 
ATOM   2682 C CG2 . THR A 1 347 ? -84.424  -46.024 90.142  1.00 65.86  ? 508 THR B CG2 1 
ATOM   2683 N N   . ARG A 1 348 ? -84.692  -44.090 86.140  1.00 65.83  ? 509 ARG B N   1 
ATOM   2684 C CA  . ARG A 1 348 ? -85.216  -43.347 84.994  1.00 66.49  ? 509 ARG B CA  1 
ATOM   2685 C C   . ARG A 1 348 ? -86.417  -42.485 85.382  1.00 68.51  ? 509 ARG B C   1 
ATOM   2686 O O   . ARG A 1 348 ? -86.579  -41.370 84.886  1.00 68.27  ? 509 ARG B O   1 
ATOM   2687 C CB  . ARG A 1 348 ? -85.581  -44.307 83.856  1.00 65.28  ? 509 ARG B CB  1 
ATOM   2688 C CG  . ARG A 1 348 ? -85.994  -43.636 82.552  1.00 63.23  ? 509 ARG B CG  1 
ATOM   2689 C CD  . ARG A 1 348 ? -84.828  -42.931 81.881  1.00 62.06  ? 509 ARG B CD  1 
ATOM   2690 N NE  . ARG A 1 348 ? -85.238  -42.256 80.653  1.00 61.62  ? 509 ARG B NE  1 
ATOM   2691 C CZ  . ARG A 1 348 ? -84.434  -41.516 79.893  1.00 61.34  ? 509 ARG B CZ  1 
ATOM   2692 N NH1 . ARG A 1 348 ? -84.908  -40.948 78.794  1.00 60.96  ? 509 ARG B NH1 1 
ATOM   2693 N NH2 . ARG A 1 348 ? -83.161  -41.339 80.228  1.00 61.36  ? 509 ARG B NH2 1 
ATOM   2694 N N   . GLU A 1 349 ? -87.243  -43.012 86.282  1.00 72.99  ? 510 GLU B N   1 
ATOM   2695 C CA  . GLU A 1 349 ? -88.425  -42.313 86.781  1.00 77.15  ? 510 GLU B CA  1 
ATOM   2696 C C   . GLU A 1 349 ? -88.026  -41.099 87.615  1.00 75.50  ? 510 GLU B C   1 
ATOM   2697 O O   . GLU A 1 349 ? -88.650  -40.040 87.516  1.00 75.13  ? 510 GLU B O   1 
ATOM   2698 C CB  . GLU A 1 349 ? -89.305  -43.263 87.606  1.00 82.43  ? 510 GLU B CB  1 
ATOM   2699 C CG  . GLU A 1 349 ? -89.884  -44.444 86.826  1.00 90.90  ? 510 GLU B CG  1 
ATOM   2700 C CD  . GLU A 1 349 ? -88.855  -45.515 86.466  1.00 95.61  ? 510 GLU B CD  1 
ATOM   2701 O OE1 . GLU A 1 349 ? -87.842  -45.660 87.188  1.00 98.54  ? 510 GLU B OE1 1 
ATOM   2702 O OE2 . GLU A 1 349 ? -89.063  -46.222 85.454  1.00 96.88  ? 510 GLU B OE2 1 
ATOM   2703 N N   . GLU A 1 350 ? -86.980  -41.264 88.425  1.00 74.48  ? 511 GLU B N   1 
ATOM   2704 C CA  . GLU A 1 350 ? -86.421  -40.176 89.229  1.00 73.61  ? 511 GLU B CA  1 
ATOM   2705 C C   . GLU A 1 350 ? -85.712  -39.131 88.370  1.00 73.61  ? 511 GLU B C   1 
ATOM   2706 O O   . GLU A 1 350 ? -85.681  -37.951 88.723  1.00 73.80  ? 511 GLU B O   1 
ATOM   2707 C CB  . GLU A 1 350 ? -85.462  -40.721 90.287  1.00 72.31  ? 511 GLU B CB  1 
ATOM   2708 C CG  . GLU A 1 350 ? -86.151  -41.342 91.491  1.00 72.48  ? 511 GLU B CG  1 
ATOM   2709 C CD  . GLU A 1 350 ? -85.184  -42.022 92.443  1.00 72.53  ? 511 GLU B CD  1 
ATOM   2710 O OE1 . GLU A 1 350 ? -84.060  -42.372 92.023  1.00 72.29  ? 511 GLU B OE1 1 
ATOM   2711 O OE2 . GLU A 1 350 ? -85.555  -42.210 93.618  1.00 73.46  ? 511 GLU B OE2 1 
ATOM   2712 N N   . PHE A 1 351 ? -85.141  -39.576 87.251  1.00 72.91  ? 512 PHE B N   1 
ATOM   2713 C CA  . PHE A 1 351 ? -84.518  -38.679 86.281  1.00 70.97  ? 512 PHE B CA  1 
ATOM   2714 C C   . PHE A 1 351 ? -85.571  -37.819 85.587  1.00 71.35  ? 512 PHE B C   1 
ATOM   2715 O O   . PHE A 1 351 ? -85.397  -36.607 85.453  1.00 72.51  ? 512 PHE B O   1 
ATOM   2716 C CB  . PHE A 1 351 ? -83.704  -39.473 85.252  1.00 69.55  ? 512 PHE B CB  1 
ATOM   2717 C CG  . PHE A 1 351 ? -83.253  -38.659 84.070  1.00 69.54  ? 512 PHE B CG  1 
ATOM   2718 C CD1 . PHE A 1 351 ? -82.223  -37.733 84.198  1.00 70.06  ? 512 PHE B CD1 1 
ATOM   2719 C CD2 . PHE A 1 351 ? -83.854  -38.820 82.827  1.00 69.26  ? 512 PHE B CD2 1 
ATOM   2720 C CE1 . PHE A 1 351 ? -81.807  -36.976 83.112  1.00 69.34  ? 512 PHE B CE1 1 
ATOM   2721 C CE2 . PHE A 1 351 ? -83.440  -38.070 81.737  1.00 69.75  ? 512 PHE B CE2 1 
ATOM   2722 C CZ  . PHE A 1 351 ? -82.415  -37.149 81.879  1.00 69.65  ? 512 PHE B CZ  1 
ATOM   2723 N N   . LEU A 1 352 ? -86.659  -38.456 85.157  1.00 71.34  ? 513 LEU B N   1 
ATOM   2724 C CA  . LEU A 1 352 ? -87.765  -37.773 84.483  1.00 71.81  ? 513 LEU B CA  1 
ATOM   2725 C C   . LEU A 1 352 ? -88.434  -36.716 85.362  1.00 72.72  ? 513 LEU B C   1 
ATOM   2726 O O   . LEU A 1 352 ? -88.926  -35.702 84.861  1.00 72.40  ? 513 LEU B O   1 
ATOM   2727 C CB  . LEU A 1 352 ? -88.803  -38.789 83.986  1.00 71.17  ? 513 LEU B CB  1 
ATOM   2728 C CG  . LEU A 1 352 ? -88.775  -39.280 82.529  1.00 70.49  ? 513 LEU B CG  1 
ATOM   2729 C CD1 . LEU A 1 352 ? -89.266  -38.199 81.572  1.00 71.50  ? 513 LEU B CD1 1 
ATOM   2730 C CD2 . LEU A 1 352 ? -87.410  -39.804 82.097  1.00 70.22  ? 513 LEU B CD2 1 
ATOM   2731 N N   . GLN A 1 353 ? -88.449  -36.965 86.669  1.00 74.24  ? 514 GLN B N   1 
ATOM   2732 C CA  . GLN A 1 353 ? -88.957  -36.003 87.642  1.00 76.01  ? 514 GLN B CA  1 
ATOM   2733 C C   . GLN A 1 353 ? -87.933  -34.898 87.903  1.00 75.95  ? 514 GLN B C   1 
ATOM   2734 O O   . GLN A 1 353 ? -88.302  -33.735 88.087  1.00 77.36  ? 514 GLN B O   1 
ATOM   2735 C CB  . GLN A 1 353 ? -89.342  -36.718 88.946  1.00 77.92  ? 514 GLN B CB  1 
ATOM   2736 C CG  . GLN A 1 353 ? -89.683  -35.813 90.128  1.00 79.88  ? 514 GLN B CG  1 
ATOM   2737 C CD  . GLN A 1 353 ? -90.938  -34.978 89.925  1.00 81.03  ? 514 GLN B CD  1 
ATOM   2738 O OE1 . GLN A 1 353 ? -91.769  -35.266 89.059  1.00 82.18  ? 514 GLN B OE1 1 
ATOM   2739 N NE2 . GLN A 1 353 ? -91.085  -33.935 90.736  1.00 80.88  ? 514 GLN B NE2 1 
ATOM   2740 N N   . ALA A 1 354 ? -86.653  -35.267 87.905  1.00 74.58  ? 515 ALA B N   1 
ATOM   2741 C CA  . ALA A 1 354 ? -85.568  -34.327 88.186  1.00 73.36  ? 515 ALA B CA  1 
ATOM   2742 C C   . ALA A 1 354 ? -85.464  -33.198 87.161  1.00 72.91  ? 515 ALA B C   1 
ATOM   2743 O O   . ALA A 1 354 ? -85.236  -32.049 87.536  1.00 74.56  ? 515 ALA B O   1 
ATOM   2744 C CB  . ALA A 1 354 ? -84.241  -35.058 88.314  1.00 72.57  ? 515 ALA B CB  1 
ATOM   2745 N N   . VAL A 1 355 ? -85.644  -33.519 85.880  1.00 71.25  ? 516 VAL B N   1 
ATOM   2746 C CA  . VAL A 1 355 ? -85.554  -32.512 84.816  1.00 70.65  ? 516 VAL B CA  1 
ATOM   2747 C C   . VAL A 1 355 ? -86.607  -31.412 84.980  1.00 73.10  ? 516 VAL B C   1 
ATOM   2748 O O   . VAL A 1 355 ? -86.389  -30.271 84.566  1.00 74.47  ? 516 VAL B O   1 
ATOM   2749 C CB  . VAL A 1 355 ? -85.628  -33.124 83.395  1.00 68.85  ? 516 VAL B CB  1 
ATOM   2750 C CG1 . VAL A 1 355 ? -84.538  -34.166 83.197  1.00 67.99  ? 516 VAL B CG1 1 
ATOM   2751 C CG2 . VAL A 1 355 ? -87.000  -33.721 83.120  1.00 70.25  ? 516 VAL B CG2 1 
ATOM   2752 N N   . ARG A 1 356 ? -87.739  -31.762 85.591  1.00 74.99  ? 517 ARG B N   1 
ATOM   2753 C CA  . ARG A 1 356 ? -88.789  -30.795 85.890  1.00 77.91  ? 517 ARG B CA  1 
ATOM   2754 C C   . ARG A 1 356 ? -88.369  -29.904 87.060  1.00 77.35  ? 517 ARG B C   1 
ATOM   2755 O O   . ARG A 1 356 ? -88.637  -28.702 87.058  1.00 78.76  ? 517 ARG B O   1 
ATOM   2756 C CB  . ARG A 1 356 ? -90.113  -31.509 86.194  1.00 82.76  ? 517 ARG B CB  1 
ATOM   2757 C CG  . ARG A 1 356 ? -91.338  -30.598 86.184  1.00 88.47  ? 517 ARG B CG  1 
ATOM   2758 C CD  . ARG A 1 356 ? -92.639  -31.368 86.380  1.00 92.55  ? 517 ARG B CD  1 
ATOM   2759 N NE  . ARG A 1 356 ? -93.019  -32.145 85.198  1.00 97.45  ? 517 ARG B NE  1 
ATOM   2760 C CZ  . ARG A 1 356 ? -92.975  -33.474 85.112  1.00 99.73  ? 517 ARG B CZ  1 
ATOM   2761 N NH1 . ARG A 1 356 ? -92.575  -34.207 86.146  1.00 100.43 ? 517 ARG B NH1 1 
ATOM   2762 N NH2 . ARG A 1 356 ? -93.342  -34.075 83.986  1.00 99.64  ? 517 ARG B NH2 1 
ATOM   2763 N N   . GLU A 1 357 ? -87.700  -30.500 88.046  1.00 75.87  ? 518 GLU B N   1 
ATOM   2764 C CA  . GLU A 1 357 ? -87.229  -29.772 89.227  1.00 74.24  ? 518 GLU B CA  1 
ATOM   2765 C C   . GLU A 1 357 ? -85.981  -28.938 88.949  1.00 73.39  ? 518 GLU B C   1 
ATOM   2766 O O   . GLU A 1 357 ? -85.697  -27.987 89.676  1.00 75.17  ? 518 GLU B O   1 
ATOM   2767 C CB  . GLU A 1 357 ? -86.949  -30.733 90.383  1.00 74.33  ? 518 GLU B CB  1 
ATOM   2768 C CG  . GLU A 1 357 ? -88.185  -31.383 90.978  1.00 76.53  ? 518 GLU B CG  1 
ATOM   2769 C CD  . GLU A 1 357 ? -87.872  -32.189 92.224  1.00 78.29  ? 518 GLU B CD  1 
ATOM   2770 O OE1 . GLU A 1 357 ? -87.496  -31.581 93.249  1.00 79.19  ? 518 GLU B OE1 1 
ATOM   2771 O OE2 . GLU A 1 357 ? -88.009  -33.429 92.180  1.00 79.24  ? 518 GLU B OE2 1 
ATOM   2772 N N   . LEU A 1 358 ? -85.239  -29.301 87.907  1.00 71.49  ? 519 LEU B N   1 
ATOM   2773 C CA  . LEU A 1 358 ? -84.004  -28.599 87.563  1.00 70.02  ? 519 LEU B CA  1 
ATOM   2774 C C   . LEU A 1 358 ? -84.201  -27.567 86.451  1.00 71.29  ? 519 LEU B C   1 
ATOM   2775 O O   . LEU A 1 358 ? -83.440  -26.603 86.354  1.00 73.21  ? 519 LEU B O   1 
ATOM   2776 C CB  . LEU A 1 358 ? -82.886  -29.589 87.209  1.00 67.65  ? 519 LEU B CB  1 
ATOM   2777 C CG  . LEU A 1 358 ? -82.414  -30.566 88.296  1.00 65.22  ? 519 LEU B CG  1 
ATOM   2778 C CD1 . LEU A 1 358 ? -81.480  -31.610 87.706  1.00 64.55  ? 519 LEU B CD1 1 
ATOM   2779 C CD2 . LEU A 1 358 ? -81.745  -29.859 89.464  1.00 64.45  ? 519 LEU B CD2 1 
ATOM   2780 N N   . ASN A 1 359 ? -85.214  -27.774 85.612  1.00 72.03  ? 520 ASN B N   1 
ATOM   2781 C CA  . ASN A 1 359 ? -85.602  -26.788 84.602  1.00 73.50  ? 520 ASN B CA  1 
ATOM   2782 C C   . ASN A 1 359 ? -87.066  -26.418 84.799  1.00 76.46  ? 520 ASN B C   1 
ATOM   2783 O O   . ASN A 1 359 ? -87.925  -26.829 84.015  1.00 78.04  ? 520 ASN B O   1 
ATOM   2784 C CB  . ASN A 1 359 ? -85.370  -27.315 83.183  1.00 71.66  ? 520 ASN B CB  1 
ATOM   2785 C CG  . ASN A 1 359 ? -84.016  -27.970 83.018  1.00 71.19  ? 520 ASN B CG  1 
ATOM   2786 O OD1 . ASN A 1 359 ? -83.680  -28.907 83.738  1.00 71.51  ? 520 ASN B OD1 1 
ATOM   2787 N ND2 . ASN A 1 359 ? -83.234  -27.486 82.062  1.00 71.02  ? 520 ASN B ND2 1 
ATOM   2788 N N   . PRO A 1 360 ? -87.358  -25.637 85.853  1.00 78.33  ? 521 PRO B N   1 
ATOM   2789 C CA  . PRO A 1 360 ? -88.745  -25.423 86.246  1.00 80.04  ? 521 PRO B CA  1 
ATOM   2790 C C   . PRO A 1 360 ? -89.453  -24.319 85.455  1.00 82.24  ? 521 PRO B C   1 
ATOM   2791 O O   . PRO A 1 360 ? -90.544  -23.895 85.840  1.00 83.64  ? 521 PRO B O   1 
ATOM   2792 C CB  . PRO A 1 360 ? -88.624  -25.036 87.723  1.00 79.57  ? 521 PRO B CB  1 
ATOM   2793 C CG  . PRO A 1 360 ? -87.263  -24.425 87.854  1.00 78.86  ? 521 PRO B CG  1 
ATOM   2794 C CD  . PRO A 1 360 ? -86.430  -24.832 86.669  1.00 77.96  ? 521 PRO B CD  1 
ATOM   2795 N N   . TYR A 1 361 ? -88.846  -23.869 84.357  1.00 83.44  ? 522 TYR B N   1 
ATOM   2796 C CA  . TYR A 1 361 ? -89.403  -22.769 83.569  1.00 83.80  ? 522 TYR B CA  1 
ATOM   2797 C C   . TYR A 1 361 ? -89.821  -23.165 82.155  1.00 85.19  ? 522 TYR B C   1 
ATOM   2798 O O   . TYR A 1 361 ? -90.681  -22.517 81.556  1.00 86.43  ? 522 TYR B O   1 
ATOM   2799 C CB  . TYR A 1 361 ? -88.439  -21.577 83.539  1.00 83.73  ? 522 TYR B CB  1 
ATOM   2800 C CG  . TYR A 1 361 ? -88.010  -21.115 84.916  1.00 85.05  ? 522 TYR B CG  1 
ATOM   2801 C CD1 . TYR A 1 361 ? -88.951  -20.906 85.927  1.00 85.33  ? 522 TYR B CD1 1 
ATOM   2802 C CD2 . TYR A 1 361 ? -86.669  -20.881 85.207  1.00 85.72  ? 522 TYR B CD2 1 
ATOM   2803 C CE1 . TYR A 1 361 ? -88.567  -20.490 87.189  1.00 85.81  ? 522 TYR B CE1 1 
ATOM   2804 C CE2 . TYR A 1 361 ? -86.276  -20.458 86.467  1.00 85.60  ? 522 TYR B CE2 1 
ATOM   2805 C CZ  . TYR A 1 361 ? -87.228  -20.266 87.453  1.00 85.85  ? 522 TYR B CZ  1 
ATOM   2806 O OH  . TYR A 1 361 ? -86.854  -19.849 88.709  1.00 87.26  ? 522 TYR B OH  1 
ATOM   2807 N N   . VAL A 1 362 ? -89.217  -24.228 81.630  1.00 87.17  ? 523 VAL B N   1 
ATOM   2808 C CA  . VAL A 1 362 ? -89.540  -24.727 80.290  1.00 88.05  ? 523 VAL B CA  1 
ATOM   2809 C C   . VAL A 1 362 ? -90.917  -25.410 80.252  1.00 88.78  ? 523 VAL B C   1 
ATOM   2810 O O   . VAL A 1 362 ? -91.367  -25.973 81.253  1.00 87.70  ? 523 VAL B O   1 
ATOM   2811 C CB  . VAL A 1 362 ? -88.428  -25.641 79.727  1.00 88.58  ? 523 VAL B CB  1 
ATOM   2812 C CG1 . VAL A 1 362 ? -87.143  -24.850 79.527  1.00 87.83  ? 523 VAL B CG1 1 
ATOM   2813 C CG2 . VAL A 1 362 ? -88.186  -26.845 80.630  1.00 89.47  ? 523 VAL B CG2 1 
ATOM   2814 N N   . ASN A 1 363 ? -91.564  -25.362 79.089  1.00 89.92  ? 524 ASN B N   1 
ATOM   2815 C CA  . ASN A 1 363 ? -93.000  -25.661 78.970  1.00 92.24  ? 524 ASN B CA  1 
ATOM   2816 C C   . ASN A 1 363 ? -93.439  -27.121 79.114  1.00 90.86  ? 524 ASN B C   1 
ATOM   2817 O O   . ASN A 1 363 ? -94.449  -27.405 79.766  1.00 93.41  ? 524 ASN B O   1 
ATOM   2818 C CB  . ASN A 1 363 ? -93.570  -25.064 77.676  1.00 94.63  ? 524 ASN B CB  1 
ATOM   2819 C CG  . ASN A 1 363 ? -92.746  -25.417 76.451  1.00 96.51  ? 524 ASN B CG  1 
ATOM   2820 O OD1 . ASN A 1 363 ? -92.552  -26.591 76.129  1.00 97.56  ? 524 ASN B OD1 1 
ATOM   2821 N ND2 . ASN A 1 363 ? -92.262  -24.394 75.756  1.00 97.26  ? 524 ASN B ND2 1 
ATOM   2822 N N   . GLY A 1 364 ? -92.694  -28.036 78.501  1.00 86.20  ? 525 GLY B N   1 
ATOM   2823 C CA  . GLY A 1 364 ? -93.074  -29.447 78.480  1.00 81.21  ? 525 GLY B CA  1 
ATOM   2824 C C   . GLY A 1 364 ? -92.585  -30.131 77.223  1.00 78.35  ? 525 GLY B C   1 
ATOM   2825 O O   . GLY A 1 364 ? -92.092  -31.259 77.272  1.00 77.77  ? 525 GLY B O   1 
ATOM   2826 N N   . ALA A 1 365 ? -92.735  -29.446 76.092  1.00 76.78  ? 526 ALA B N   1 
ATOM   2827 C CA  . ALA A 1 365 ? -92.109  -29.860 74.841  1.00 74.45  ? 526 ALA B CA  1 
ATOM   2828 C C   . ALA A 1 365 ? -90.599  -29.680 74.962  1.00 73.14  ? 526 ALA B C   1 
ATOM   2829 O O   . ALA A 1 365 ? -89.822  -30.458 74.402  1.00 73.22  ? 526 ALA B O   1 
ATOM   2830 C CB  . ALA A 1 365 ? -92.654  -29.045 73.678  1.00 73.01  ? 526 ALA B CB  1 
ATOM   2831 N N   . ALA A 1 366 ? -90.201  -28.652 75.709  1.00 71.43  ? 527 ALA B N   1 
ATOM   2832 C CA  . ALA A 1 366 ? -88.797  -28.366 75.970  1.00 70.71  ? 527 ALA B CA  1 
ATOM   2833 C C   . ALA A 1 366 ? -88.200  -29.326 76.999  1.00 71.18  ? 527 ALA B C   1 
ATOM   2834 O O   . ALA A 1 366 ? -87.020  -29.667 76.913  1.00 71.01  ? 527 ALA B O   1 
ATOM   2835 C CB  . ALA A 1 366 ? -88.629  -26.924 76.414  1.00 70.74  ? 527 ALA B CB  1 
ATOM   2836 N N   . ARG A 1 367 ? -89.015  -29.754 77.965  1.00 71.24  ? 528 ARG B N   1 
ATOM   2837 C CA  . ARG A 1 367 ? -88.615  -30.798 78.916  1.00 71.71  ? 528 ARG B CA  1 
ATOM   2838 C C   . ARG A 1 367 ? -88.256  -32.100 78.202  1.00 71.90  ? 528 ARG B C   1 
ATOM   2839 O O   . ARG A 1 367 ? -87.274  -32.760 78.547  1.00 71.61  ? 528 ARG B O   1 
ATOM   2840 C CB  . ARG A 1 367 ? -89.727  -31.067 79.931  1.00 71.95  ? 528 ARG B CB  1 
ATOM   2841 C CG  . ARG A 1 367 ? -89.492  -30.454 81.299  1.00 73.59  ? 528 ARG B CG  1 
ATOM   2842 C CD  . ARG A 1 367 ? -90.523  -30.942 82.306  1.00 75.67  ? 528 ARG B CD  1 
ATOM   2843 N NE  . ARG A 1 367 ? -91.875  -30.489 81.978  1.00 78.32  ? 528 ARG B NE  1 
ATOM   2844 C CZ  . ARG A 1 367 ? -92.378  -29.301 82.308  1.00 80.73  ? 528 ARG B CZ  1 
ATOM   2845 N NH1 . ARG A 1 367 ? -91.646  -28.420 82.985  1.00 82.06  ? 528 ARG B NH1 1 
ATOM   2846 N NH2 . ARG A 1 367 ? -93.620  -28.988 81.959  1.00 81.69  ? 528 ARG B NH2 1 
ATOM   2847 N N   . GLN A 1 368 ? -89.064  -32.454 77.205  1.00 72.07  ? 529 GLN B N   1 
ATOM   2848 C CA  . GLN A 1 368 ? -88.863  -33.665 76.420  1.00 71.43  ? 529 GLN B CA  1 
ATOM   2849 C C   . GLN A 1 368 ? -87.658  -33.542 75.495  1.00 69.73  ? 529 GLN B C   1 
ATOM   2850 O O   . GLN A 1 368 ? -86.988  -34.534 75.200  1.00 70.03  ? 529 GLN B O   1 
ATOM   2851 C CB  . GLN A 1 368 ? -90.123  -33.996 75.626  1.00 74.56  ? 529 GLN B CB  1 
ATOM   2852 C CG  . GLN A 1 368 ? -91.293  -34.424 76.498  1.00 79.26  ? 529 GLN B CG  1 
ATOM   2853 C CD  . GLN A 1 368 ? -92.604  -34.508 75.738  1.00 83.63  ? 529 GLN B CD  1 
ATOM   2854 O OE1 . GLN A 1 368 ? -92.812  -33.806 74.747  1.00 86.53  ? 529 GLN B OE1 1 
ATOM   2855 N NE2 . GLN A 1 368 ? -93.500  -35.369 76.207  1.00 86.22  ? 529 GLN B NE2 1 
ATOM   2856 N N   . ALA A 1 369 ? -87.390  -32.316 75.045  1.00 67.38  ? 530 ALA B N   1 
ATOM   2857 C CA  . ALA A 1 369 ? -86.200  -32.014 74.253  1.00 65.28  ? 530 ALA B CA  1 
ATOM   2858 C C   . ALA A 1 369 ? -84.937  -32.177 75.090  1.00 63.80  ? 530 ALA B C   1 
ATOM   2859 O O   . ALA A 1 369 ? -83.882  -32.551 74.574  1.00 64.04  ? 530 ALA B O   1 
ATOM   2860 C CB  . ALA A 1 369 ? -86.281  -30.608 73.688  1.00 65.23  ? 530 ALA B CB  1 
ATOM   2861 N N   . ILE A 1 370 ? -85.059  -31.888 76.384  1.00 61.61  ? 531 ILE B N   1 
ATOM   2862 C CA  . ILE A 1 370 ? -83.959  -32.060 77.325  1.00 59.27  ? 531 ILE B CA  1 
ATOM   2863 C C   . ILE A 1 370 ? -83.728  -33.544 77.611  1.00 59.88  ? 531 ILE B C   1 
ATOM   2864 O O   . ILE A 1 370 ? -82.597  -34.022 77.478  1.00 60.86  ? 531 ILE B O   1 
ATOM   2865 C CB  . ILE A 1 370 ? -84.182  -31.256 78.628  1.00 57.40  ? 531 ILE B CB  1 
ATOM   2866 C CG1 . ILE A 1 370 ? -84.120  -29.752 78.338  1.00 56.16  ? 531 ILE B CG1 1 
ATOM   2867 C CG2 . ILE A 1 370 ? -83.142  -31.628 79.676  1.00 56.45  ? 531 ILE B CG2 1 
ATOM   2868 C CD1 . ILE A 1 370 ? -84.867  -28.889 79.331  1.00 55.20  ? 531 ILE B CD1 1 
ATOM   2869 N N   . VAL A 1 371 ? -84.790  -34.272 77.976  1.00 59.86  ? 532 VAL B N   1 
ATOM   2870 C CA  . VAL A 1 371 ? -84.659  -35.703 78.304  1.00 59.56  ? 532 VAL B CA  1 
ATOM   2871 C C   . VAL A 1 371 ? -84.084  -36.509 77.145  1.00 59.73  ? 532 VAL B C   1 
ATOM   2872 O O   . VAL A 1 371 ? -83.330  -37.454 77.373  1.00 60.20  ? 532 VAL B O   1 
ATOM   2873 C CB  . VAL A 1 371 ? -85.960  -36.377 78.827  1.00 58.77  ? 532 VAL B CB  1 
ATOM   2874 C CG1 . VAL A 1 371 ? -86.397  -35.768 80.148  1.00 58.92  ? 532 VAL B CG1 1 
ATOM   2875 C CG2 . VAL A 1 371 ? -87.084  -36.329 77.803  1.00 59.17  ? 532 VAL B CG2 1 
ATOM   2876 N N   . PHE A 1 372 ? -84.424  -36.131 75.913  1.00 58.82  ? 533 PHE B N   1 
ATOM   2877 C CA  . PHE A 1 372 ? -83.846  -36.795 74.754  1.00 58.67  ? 533 PHE B CA  1 
ATOM   2878 C C   . PHE A 1 372 ? -82.360  -36.478 74.614  1.00 58.37  ? 533 PHE B C   1 
ATOM   2879 O O   . PHE A 1 372 ? -81.558  -37.368 74.332  1.00 59.73  ? 533 PHE B O   1 
ATOM   2880 C CB  . PHE A 1 372 ? -84.577  -36.452 73.455  1.00 59.74  ? 533 PHE B CB  1 
ATOM   2881 C CG  . PHE A 1 372 ? -83.876  -36.973 72.232  1.00 61.70  ? 533 PHE B CG  1 
ATOM   2882 C CD1 . PHE A 1 372 ? -83.896  -38.330 71.930  1.00 61.58  ? 533 PHE B CD1 1 
ATOM   2883 C CD2 . PHE A 1 372 ? -83.153  -36.116 71.408  1.00 63.40  ? 533 PHE B CD2 1 
ATOM   2884 C CE1 . PHE A 1 372 ? -83.229  -38.819 70.820  1.00 62.43  ? 533 PHE B CE1 1 
ATOM   2885 C CE2 . PHE A 1 372 ? -82.483  -36.601 70.293  1.00 63.55  ? 533 PHE B CE2 1 
ATOM   2886 C CZ  . PHE A 1 372 ? -82.521  -37.954 70.001  1.00 62.86  ? 533 PHE B CZ  1 
ATOM   2887 N N   . GLU A 1 373 ? -82.005  -35.211 74.809  1.00 57.84  ? 534 GLU B N   1 
ATOM   2888 C CA  . GLU A 1 373 ? -80.622  -34.763 74.664  1.00 57.82  ? 534 GLU B CA  1 
ATOM   2889 C C   . GLU A 1 373 ? -79.714  -35.342 75.747  1.00 57.14  ? 534 GLU B C   1 
ATOM   2890 O O   . GLU A 1 373 ? -78.523  -35.565 75.512  1.00 56.72  ? 534 GLU B O   1 
ATOM   2891 C CB  . GLU A 1 373 ? -80.553  -33.230 74.656  1.00 59.22  ? 534 GLU B CB  1 
ATOM   2892 C CG  . GLU A 1 373 ? -79.169  -32.638 74.398  1.00 61.11  ? 534 GLU B CG  1 
ATOM   2893 C CD  . GLU A 1 373 ? -78.563  -33.062 73.068  1.00 62.23  ? 534 GLU B CD  1 
ATOM   2894 O OE1 . GLU A 1 373 ? -79.275  -33.022 72.040  1.00 63.58  ? 534 GLU B OE1 1 
ATOM   2895 O OE2 . GLU A 1 373 ? -77.367  -33.425 73.050  1.00 62.25  ? 534 GLU B OE2 1 
ATOM   2896 N N   . TYR A 1 374 ? -80.281  -35.601 76.923  1.00 56.31  ? 535 TYR B N   1 
ATOM   2897 C CA  . TYR A 1 374 ? -79.498  -36.089 78.055  1.00 57.38  ? 535 TYR B CA  1 
ATOM   2898 C C   . TYR A 1 374 ? -79.830  -37.526 78.481  1.00 59.48  ? 535 TYR B C   1 
ATOM   2899 O O   . TYR A 1 374 ? -79.901  -37.841 79.672  1.00 61.14  ? 535 TYR B O   1 
ATOM   2900 C CB  . TYR A 1 374 ? -79.572  -35.093 79.220  1.00 56.33  ? 535 TYR B CB  1 
ATOM   2901 C CG  . TYR A 1 374 ? -78.780  -33.833 78.951  1.00 55.54  ? 535 TYR B CG  1 
ATOM   2902 C CD1 . TYR A 1 374 ? -77.422  -33.762 79.265  1.00 55.56  ? 535 TYR B CD1 1 
ATOM   2903 C CD2 . TYR A 1 374 ? -79.377  -32.720 78.359  1.00 54.88  ? 535 TYR B CD2 1 
ATOM   2904 C CE1 . TYR A 1 374 ? -76.684  -32.618 79.007  1.00 55.18  ? 535 TYR B CE1 1 
ATOM   2905 C CE2 . TYR A 1 374 ? -78.647  -31.570 78.099  1.00 54.72  ? 535 TYR B CE2 1 
ATOM   2906 C CZ  . TYR A 1 374 ? -77.302  -31.525 78.426  1.00 55.04  ? 535 TYR B CZ  1 
ATOM   2907 O OH  . TYR A 1 374 ? -76.571  -30.389 78.172  1.00 55.23  ? 535 TYR B OH  1 
ATOM   2908 N N   . THR A 1 375 ? -80.019  -38.392 77.487  1.00 60.22  ? 536 THR B N   1 
ATOM   2909 C CA  . THR A 1 375 ? -80.203  -39.822 77.706  1.00 60.46  ? 536 THR B CA  1 
ATOM   2910 C C   . THR A 1 375 ? -79.082  -40.575 77.010  1.00 62.58  ? 536 THR B C   1 
ATOM   2911 O O   . THR A 1 375 ? -78.812  -40.339 75.831  1.00 64.92  ? 536 THR B O   1 
ATOM   2912 C CB  . THR A 1 375 ? -81.555  -40.313 77.149  1.00 59.48  ? 536 THR B CB  1 
ATOM   2913 O OG1 . THR A 1 375 ? -82.620  -39.745 77.914  1.00 60.20  ? 536 THR B OG1 1 
ATOM   2914 C CG2 . THR A 1 375 ? -81.661  -41.829 77.219  1.00 59.85  ? 536 THR B CG2 1 
ATOM   2915 N N   . ASP A 1 376 ? -78.424  -41.469 77.743  1.00 64.64  ? 537 ASP B N   1 
ATOM   2916 C CA  . ASP A 1 376 ? -77.460  -42.384 77.144  1.00 66.21  ? 537 ASP B CA  1 
ATOM   2917 C C   . ASP A 1 376 ? -78.239  -43.464 76.401  1.00 67.18  ? 537 ASP B C   1 
ATOM   2918 O O   . ASP A 1 376 ? -78.674  -44.447 77.000  1.00 68.50  ? 537 ASP B O   1 
ATOM   2919 C CB  . ASP A 1 376 ? -76.558  -43.001 78.217  1.00 66.98  ? 537 ASP B CB  1 
ATOM   2920 C CG  . ASP A 1 376 ? -75.645  -44.083 77.669  1.00 68.09  ? 537 ASP B CG  1 
ATOM   2921 O OD1 . ASP A 1 376 ? -74.977  -43.844 76.641  1.00 69.35  ? 537 ASP B OD1 1 
ATOM   2922 O OD2 . ASP A 1 376 ? -75.593  -45.177 78.271  1.00 68.96  ? 537 ASP B OD2 1 
ATOM   2923 N N   . TRP A 1 377 ? -78.425  -43.270 75.098  1.00 67.81  ? 538 TRP B N   1 
ATOM   2924 C CA  . TRP A 1 377 ? -79.286  -44.150 74.306  1.00 68.04  ? 538 TRP B CA  1 
ATOM   2925 C C   . TRP A 1 377 ? -78.682  -45.530 74.023  1.00 70.38  ? 538 TRP B C   1 
ATOM   2926 O O   . TRP A 1 377 ? -79.284  -46.350 73.325  1.00 70.73  ? 538 TRP B O   1 
ATOM   2927 C CB  . TRP A 1 377 ? -79.734  -43.459 73.020  1.00 66.01  ? 538 TRP B CB  1 
ATOM   2928 C CG  . TRP A 1 377 ? -80.742  -42.380 73.260  1.00 64.99  ? 538 TRP B CG  1 
ATOM   2929 C CD1 . TRP A 1 377 ? -80.547  -41.035 73.141  1.00 65.30  ? 538 TRP B CD1 1 
ATOM   2930 C CD2 . TRP A 1 377 ? -82.104  -42.553 73.675  1.00 64.70  ? 538 TRP B CD2 1 
ATOM   2931 N NE1 . TRP A 1 377 ? -81.703  -40.358 73.447  1.00 64.85  ? 538 TRP B NE1 1 
ATOM   2932 C CE2 . TRP A 1 377 ? -82.676  -41.265 73.777  1.00 64.45  ? 538 TRP B CE2 1 
ATOM   2933 C CE3 . TRP A 1 377 ? -82.899  -43.671 73.964  1.00 64.82  ? 538 TRP B CE3 1 
ATOM   2934 C CZ2 . TRP A 1 377 ? -84.006  -41.062 74.160  1.00 63.90  ? 538 TRP B CZ2 1 
ATOM   2935 C CZ3 . TRP A 1 377 ? -84.225  -43.468 74.341  1.00 64.09  ? 538 TRP B CZ3 1 
ATOM   2936 C CH2 . TRP A 1 377 ? -84.762  -42.173 74.435  1.00 63.48  ? 538 TRP B CH2 1 
ATOM   2937 N N   . THR A 1 378 ? -77.496  -45.772 74.573  1.00 72.46  ? 539 THR B N   1 
ATOM   2938 C CA  . THR A 1 378 ? -76.921  -47.110 74.626  1.00 75.05  ? 539 THR B CA  1 
ATOM   2939 C C   . THR A 1 378 ? -77.689  -47.933 75.670  1.00 78.51  ? 539 THR B C   1 
ATOM   2940 O O   . THR A 1 378 ? -78.266  -48.974 75.347  1.00 79.47  ? 539 THR B O   1 
ATOM   2941 C CB  . THR A 1 378 ? -75.413  -47.051 74.945  1.00 73.94  ? 539 THR B CB  1 
ATOM   2942 O OG1 . THR A 1 378 ? -74.744  -46.309 73.920  1.00 71.78  ? 539 THR B OG1 1 
ATOM   2943 C CG2 . THR A 1 378 ? -74.811  -48.443 75.011  1.00 74.84  ? 539 THR B CG2 1 
ATOM   2944 N N   . GLU A 1 379 ? -77.699  -47.449 76.911  1.00 80.87  ? 540 GLU B N   1 
ATOM   2945 C CA  . GLU A 1 379 ? -78.512  -48.032 77.978  1.00 83.10  ? 540 GLU B CA  1 
ATOM   2946 C C   . GLU A 1 379 ? -79.385  -46.939 78.604  1.00 83.12  ? 540 GLU B C   1 
ATOM   2947 O O   . GLU A 1 379 ? -78.991  -46.329 79.603  1.00 84.37  ? 540 GLU B O   1 
ATOM   2948 C CB  . GLU A 1 379 ? -77.629  -48.689 79.043  1.00 85.76  ? 540 GLU B CB  1 
ATOM   2949 C CG  . GLU A 1 379 ? -76.885  -49.933 78.579  1.00 88.70  ? 540 GLU B CG  1 
ATOM   2950 C CD  . GLU A 1 379 ? -76.021  -50.548 79.668  1.00 90.91  ? 540 GLU B CD  1 
ATOM   2951 O OE1 . GLU A 1 379 ? -76.421  -50.512 80.852  1.00 91.38  ? 540 GLU B OE1 1 
ATOM   2952 O OE2 . GLU A 1 379 ? -74.937  -51.077 79.338  1.00 91.31  ? 540 GLU B OE2 1 
ATOM   2953 N N   . PRO A 1 380 ? -80.573  -46.684 78.014  1.00 82.55  ? 541 PRO B N   1 
ATOM   2954 C CA  . PRO A 1 380 ? -81.440  -45.561 78.406  1.00 81.40  ? 541 PRO B CA  1 
ATOM   2955 C C   . PRO A 1 380 ? -81.903  -45.578 79.865  1.00 80.01  ? 541 PRO B C   1 
ATOM   2956 O O   . PRO A 1 380 ? -82.197  -44.519 80.423  1.00 78.78  ? 541 PRO B O   1 
ATOM   2957 C CB  . PRO A 1 380 ? -82.646  -45.696 77.465  1.00 81.44  ? 541 PRO B CB  1 
ATOM   2958 C CG  . PRO A 1 380 ? -82.628  -47.115 77.013  1.00 83.34  ? 541 PRO B CG  1 
ATOM   2959 C CD  . PRO A 1 380 ? -81.176  -47.480 76.930  1.00 83.34  ? 541 PRO B CD  1 
ATOM   2960 N N   . ASP A 1 381 ? -81.955  -46.764 80.469  1.00 79.78  ? 542 ASP B N   1 
ATOM   2961 C CA  . ASP A 1 381 ? -82.436  -46.918 81.844  1.00 78.78  ? 542 ASP B CA  1 
ATOM   2962 C C   . ASP A 1 381 ? -81.327  -47.060 82.887  1.00 76.44  ? 542 ASP B C   1 
ATOM   2963 O O   . ASP A 1 381 ? -81.617  -47.170 84.082  1.00 75.05  ? 542 ASP B O   1 
ATOM   2964 C CB  . ASP A 1 381 ? -83.397  -48.108 81.944  1.00 80.17  ? 542 ASP B CB  1 
ATOM   2965 C CG  . ASP A 1 381 ? -84.726  -47.848 81.262  1.00 81.03  ? 542 ASP B CG  1 
ATOM   2966 O OD1 . ASP A 1 381 ? -85.293  -46.748 81.437  1.00 80.96  ? 542 ASP B OD1 1 
ATOM   2967 O OD2 . ASP A 1 381 ? -85.211  -48.756 80.556  1.00 82.18  ? 542 ASP B OD2 1 
ATOM   2968 N N   . ASN A 1 382 ? -80.071  -47.056 82.437  1.00 75.23  ? 543 ASN B N   1 
ATOM   2969 C CA  . ASN A 1 382 ? -78.919  -47.244 83.324  1.00 74.82  ? 543 ASN B CA  1 
ATOM   2970 C C   . ASN A 1 382 ? -78.885  -46.223 84.460  1.00 75.12  ? 543 ASN B C   1 
ATOM   2971 O O   . ASN A 1 382 ? -78.852  -45.015 84.208  1.00 75.99  ? 543 ASN B O   1 
ATOM   2972 C CB  . ASN A 1 382 ? -77.604  -47.211 82.536  1.00 74.63  ? 543 ASN B CB  1 
ATOM   2973 C CG  . ASN A 1 382 ? -76.410  -47.681 83.356  1.00 74.81  ? 543 ASN B CG  1 
ATOM   2974 O OD1 . ASN A 1 382 ? -76.133  -47.164 84.440  1.00 73.31  ? 543 ASN B OD1 1 
ATOM   2975 N ND2 . ASN A 1 382 ? -75.686  -48.660 82.828  1.00 75.91  ? 543 ASN B ND2 1 
ATOM   2976 N N   . PRO A 1 383 ? -78.900  -46.713 85.716  1.00 74.60  ? 544 PRO B N   1 
ATOM   2977 C CA  . PRO A 1 383 ? -78.889  -45.876 86.917  1.00 74.62  ? 544 PRO B CA  1 
ATOM   2978 C C   . PRO A 1 383 ? -77.697  -44.916 86.996  1.00 75.37  ? 544 PRO B C   1 
ATOM   2979 O O   . PRO A 1 383 ? -77.854  -43.792 87.481  1.00 78.52  ? 544 PRO B O   1 
ATOM   2980 C CB  . PRO A 1 383 ? -78.838  -46.901 88.052  1.00 74.37  ? 544 PRO B CB  1 
ATOM   2981 C CG  . PRO A 1 383 ? -79.494  -48.109 87.482  1.00 74.08  ? 544 PRO B CG  1 
ATOM   2982 C CD  . PRO A 1 383 ? -79.030  -48.143 86.056  1.00 74.29  ? 544 PRO B CD  1 
ATOM   2983 N N   . ASN A 1 384 ? -76.527  -45.351 86.527  1.00 72.62  ? 545 ASN B N   1 
ATOM   2984 C CA  . ASN A 1 384 ? -75.348  -44.483 86.470  1.00 69.13  ? 545 ASN B CA  1 
ATOM   2985 C C   . ASN A 1 384 ? -75.459  -43.402 85.398  1.00 66.59  ? 545 ASN B C   1 
ATOM   2986 O O   . ASN A 1 384 ? -75.125  -42.243 85.648  1.00 66.23  ? 545 ASN B O   1 
ATOM   2987 C CB  . ASN A 1 384 ? -74.068  -45.301 86.278  1.00 68.94  ? 545 ASN B CB  1 
ATOM   2988 C CG  . ASN A 1 384 ? -73.480  -45.785 87.589  1.00 68.44  ? 545 ASN B CG  1 
ATOM   2989 O OD1 . ASN A 1 384 ? -74.201  -46.227 88.485  1.00 68.15  ? 545 ASN B OD1 1 
ATOM   2990 N ND2 . ASN A 1 384 ? -72.158  -45.708 87.706  1.00 67.69  ? 545 ASN B ND2 1 
ATOM   2991 N N   . SER A 1 385 ? -75.929  -43.793 84.213  1.00 64.45  ? 546 SER B N   1 
ATOM   2992 C CA  . SER A 1 385 ? -76.154  -42.859 83.109  1.00 62.94  ? 546 SER B CA  1 
ATOM   2993 C C   . SER A 1 385 ? -77.127  -41.751 83.500  1.00 61.76  ? 546 SER B C   1 
ATOM   2994 O O   . SER A 1 385 ? -76.848  -40.573 83.281  1.00 61.38  ? 546 SER B O   1 
ATOM   2995 C CB  . SER A 1 385 ? -76.676  -43.593 81.872  1.00 62.91  ? 546 SER B CB  1 
ATOM   2996 O OG  . SER A 1 385 ? -75.648  -44.332 81.239  1.00 62.63  ? 546 SER B OG  1 
ATOM   2997 N N   . ASN A 1 386 ? -78.255  -42.143 84.092  1.00 60.52  ? 547 ASN B N   1 
ATOM   2998 C CA  . ASN A 1 386 ? -79.298  -41.202 84.499  1.00 60.04  ? 547 ASN B CA  1 
ATOM   2999 C C   . ASN A 1 386 ? -78.892  -40.238 85.615  1.00 59.82  ? 547 ASN B C   1 
ATOM   3000 O O   . ASN A 1 386 ? -79.436  -39.136 85.713  1.00 59.77  ? 547 ASN B O   1 
ATOM   3001 C CB  . ASN A 1 386 ? -80.578  -41.950 84.874  1.00 59.76  ? 547 ASN B CB  1 
ATOM   3002 C CG  . ASN A 1 386 ? -81.427  -42.289 83.664  1.00 60.05  ? 547 ASN B CG  1 
ATOM   3003 O OD1 . ASN A 1 386 ? -81.793  -41.412 82.882  1.00 61.12  ? 547 ASN B OD1 1 
ATOM   3004 N ND2 . ASN A 1 386 ? -81.750  -43.565 83.508  1.00 60.72  ? 547 ASN B ND2 1 
ATOM   3005 N N   . ARG A 1 387 ? -77.944  -40.655 86.450  1.00 59.42  ? 548 ARG B N   1 
ATOM   3006 C CA  . ARG A 1 387 ? -77.385  -39.782 87.476  1.00 59.60  ? 548 ARG B CA  1 
ATOM   3007 C C   . ARG A 1 387 ? -76.389  -38.807 86.855  1.00 60.30  ? 548 ARG B C   1 
ATOM   3008 O O   . ARG A 1 387 ? -76.437  -37.605 87.124  1.00 61.00  ? 548 ARG B O   1 
ATOM   3009 C CB  . ARG A 1 387 ? -76.708  -40.603 88.574  1.00 59.98  ? 548 ARG B CB  1 
ATOM   3010 C CG  . ARG A 1 387 ? -76.080  -39.769 89.682  1.00 60.24  ? 548 ARG B CG  1 
ATOM   3011 C CD  . ARG A 1 387 ? -74.957  -40.534 90.357  1.00 60.88  ? 548 ARG B CD  1 
ATOM   3012 N NE  . ARG A 1 387 ? -73.941  -40.941 89.391  1.00 61.67  ? 548 ARG B NE  1 
ATOM   3013 C CZ  . ARG A 1 387 ? -73.299  -42.104 89.420  1.00 63.21  ? 548 ARG B CZ  1 
ATOM   3014 N NH1 . ARG A 1 387 ? -73.566  -42.996 90.366  1.00 63.90  ? 548 ARG B NH1 1 
ATOM   3015 N NH2 . ARG A 1 387 ? -72.394  -42.381 88.492  1.00 64.50  ? 548 ARG B NH2 1 
ATOM   3016 N N   . ASP A 1 388 ? -75.491  -39.333 86.022  1.00 60.81  ? 549 ASP B N   1 
ATOM   3017 C CA  . ASP A 1 388 ? -74.501  -38.517 85.323  1.00 60.88  ? 549 ASP B CA  1 
ATOM   3018 C C   . ASP A 1 388 ? -75.171  -37.524 84.380  1.00 58.78  ? 549 ASP B C   1 
ATOM   3019 O O   . ASP A 1 388 ? -74.637  -36.443 84.118  1.00 57.76  ? 549 ASP B O   1 
ATOM   3020 C CB  . ASP A 1 388 ? -73.524  -39.402 84.548  1.00 63.20  ? 549 ASP B CB  1 
ATOM   3021 C CG  . ASP A 1 388 ? -72.276  -38.655 84.124  1.00 65.93  ? 549 ASP B CG  1 
ATOM   3022 O OD1 . ASP A 1 388 ? -71.484  -38.266 85.013  1.00 67.45  ? 549 ASP B OD1 1 
ATOM   3023 O OD2 . ASP A 1 388 ? -72.084  -38.459 82.903  1.00 66.60  ? 549 ASP B OD2 1 
ATOM   3024 N N   . ALA A 1 389 ? -76.346  -37.904 83.883  1.00 57.46  ? 550 ALA B N   1 
ATOM   3025 C CA  . ALA A 1 389 ? -77.161  -37.047 83.032  1.00 57.05  ? 550 ALA B CA  1 
ATOM   3026 C C   . ALA A 1 389 ? -77.532  -35.749 83.741  1.00 56.05  ? 550 ALA B C   1 
ATOM   3027 O O   . ALA A 1 389 ? -77.496  -34.677 83.137  1.00 56.75  ? 550 ALA B O   1 
ATOM   3028 C CB  . ALA A 1 389 ? -78.413  -37.783 82.583  1.00 57.05  ? 550 ALA B CB  1 
ATOM   3029 N N   . LEU A 1 390 ? -77.875  -35.853 85.023  1.00 54.65  ? 551 LEU B N   1 
ATOM   3030 C CA  . LEU A 1 390 ? -78.255  -34.692 85.819  1.00 53.78  ? 551 LEU B CA  1 
ATOM   3031 C C   . LEU A 1 390 ? -77.103  -33.710 85.979  1.00 54.61  ? 551 LEU B C   1 
ATOM   3032 O O   . LEU A 1 390 ? -77.297  -32.498 85.868  1.00 55.22  ? 551 LEU B O   1 
ATOM   3033 C CB  . LEU A 1 390 ? -78.793  -35.120 87.184  1.00 52.68  ? 551 LEU B CB  1 
ATOM   3034 C CG  . LEU A 1 390 ? -80.116  -35.886 87.194  1.00 52.56  ? 551 LEU B CG  1 
ATOM   3035 C CD1 . LEU A 1 390 ? -80.561  -36.142 88.625  1.00 52.98  ? 551 LEU B CD1 1 
ATOM   3036 C CD2 . LEU A 1 390 ? -81.194  -35.135 86.424  1.00 52.50  ? 551 LEU B CD2 1 
ATOM   3037 N N   . ASP A 1 391 ? -75.905  -34.240 86.227  1.00 54.93  ? 552 ASP B N   1 
ATOM   3038 C CA  . ASP A 1 391 ? -74.700  -33.422 86.327  1.00 55.06  ? 552 ASP B CA  1 
ATOM   3039 C C   . ASP A 1 391 ? -74.472  -32.615 85.053  1.00 55.67  ? 552 ASP B C   1 
ATOM   3040 O O   . ASP A 1 391 ? -74.175  -31.420 85.113  1.00 56.63  ? 552 ASP B O   1 
ATOM   3041 C CB  . ASP A 1 391 ? -73.475  -34.294 86.606  1.00 54.91  ? 552 ASP B CB  1 
ATOM   3042 C CG  . ASP A 1 391 ? -72.172  -33.527 86.471  1.00 55.18  ? 552 ASP B CG  1 
ATOM   3043 O OD1 . ASP A 1 391 ? -71.507  -33.658 85.422  1.00 55.38  ? 552 ASP B OD1 1 
ATOM   3044 O OD2 . ASP A 1 391 ? -71.826  -32.773 87.401  1.00 55.58  ? 552 ASP B OD2 1 
ATOM   3045 N N   . LYS A 1 392 ? -74.615  -33.279 83.909  1.00 55.32  ? 553 LYS B N   1 
ATOM   3046 C CA  . LYS A 1 392 ? -74.337  -32.670 82.613  1.00 55.36  ? 553 LYS B CA  1 
ATOM   3047 C C   . LYS A 1 392 ? -75.330  -31.575 82.220  1.00 56.20  ? 553 LYS B C   1 
ATOM   3048 O O   . LYS A 1 392 ? -74.922  -30.491 81.812  1.00 56.81  ? 553 LYS B O   1 
ATOM   3049 C CB  . LYS A 1 392 ? -74.239  -33.741 81.523  1.00 54.32  ? 553 LYS B CB  1 
ATOM   3050 C CG  . LYS A 1 392 ? -72.815  -34.168 81.198  1.00 53.87  ? 553 LYS B CG  1 
ATOM   3051 C CD  . LYS A 1 392 ? -72.139  -34.880 82.357  1.00 53.75  ? 553 LYS B CD  1 
ATOM   3052 C CE  . LYS A 1 392 ? -70.660  -35.088 82.078  1.00 53.90  ? 553 LYS B CE  1 
ATOM   3053 N NZ  . LYS A 1 392 ? -69.977  -35.737 83.230  1.00 54.42  ? 553 LYS B NZ  1 
ATOM   3054 N N   . MET A 1 393 ? -76.622  -31.851 82.360  1.00 56.99  ? 554 MET B N   1 
ATOM   3055 C CA  . MET A 1 393 ? -77.657  -30.886 81.983  1.00 58.04  ? 554 MET B CA  1 
ATOM   3056 C C   . MET A 1 393 ? -77.654  -29.634 82.859  1.00 58.06  ? 554 MET B C   1 
ATOM   3057 O O   . MET A 1 393 ? -78.125  -28.577 82.437  1.00 59.05  ? 554 MET B O   1 
ATOM   3058 C CB  . MET A 1 393 ? -79.036  -31.541 81.997  1.00 59.58  ? 554 MET B CB  1 
ATOM   3059 C CG  . MET A 1 393 ? -79.467  -32.047 83.362  1.00 60.71  ? 554 MET B CG  1 
ATOM   3060 S SD  . MET A 1 393 ? -81.179  -32.580 83.360  1.00 63.18  ? 554 MET B SD  1 
ATOM   3061 C CE  . MET A 1 393 ? -82.003  -31.019 83.089  1.00 61.71  ? 554 MET B CE  1 
ATOM   3062 N N   . VAL A 1 394 ? -77.134  -29.767 84.078  1.00 56.90  ? 555 VAL B N   1 
ATOM   3063 C CA  . VAL A 1 394 ? -76.960  -28.632 84.979  1.00 55.70  ? 555 VAL B CA  1 
ATOM   3064 C C   . VAL A 1 394 ? -75.636  -27.933 84.666  1.00 56.07  ? 555 VAL B C   1 
ATOM   3065 O O   . VAL A 1 394 ? -75.607  -26.724 84.442  1.00 57.36  ? 555 VAL B O   1 
ATOM   3066 C CB  . VAL A 1 394 ? -77.035  -29.059 86.464  1.00 54.34  ? 555 VAL B CB  1 
ATOM   3067 C CG1 . VAL A 1 394 ? -76.579  -27.937 87.386  1.00 53.54  ? 555 VAL B CG1 1 
ATOM   3068 C CG2 . VAL A 1 394 ? -78.451  -29.478 86.819  1.00 54.42  ? 555 VAL B CG2 1 
ATOM   3069 N N   . GLY A 1 395 ? -74.555  -28.709 84.628  1.00 56.15  ? 556 GLY B N   1 
ATOM   3070 C CA  . GLY A 1 395 ? -73.216  -28.190 84.352  1.00 56.33  ? 556 GLY B CA  1 
ATOM   3071 C C   . GLY A 1 395 ? -73.047  -27.505 83.006  1.00 56.59  ? 556 GLY B C   1 
ATOM   3072 O O   . GLY A 1 395 ? -72.231  -26.596 82.873  1.00 57.22  ? 556 GLY B O   1 
ATOM   3073 N N   . ASP A 1 396 ? -73.811  -27.940 82.005  1.00 56.80  ? 557 ASP B N   1 
ATOM   3074 C CA  . ASP A 1 396 ? -73.752  -27.330 80.677  1.00 57.69  ? 557 ASP B CA  1 
ATOM   3075 C C   . ASP A 1 396 ? -74.461  -25.986 80.651  1.00 58.51  ? 557 ASP B C   1 
ATOM   3076 O O   . ASP A 1 396 ? -73.855  -24.972 80.303  1.00 60.34  ? 557 ASP B O   1 
ATOM   3077 C CB  . ASP A 1 396 ? -74.352  -28.249 79.607  1.00 57.15  ? 557 ASP B CB  1 
ATOM   3078 C CG  . ASP A 1 396 ? -73.533  -29.504 79.379  1.00 56.66  ? 557 ASP B CG  1 
ATOM   3079 O OD1 . ASP A 1 396 ? -72.317  -29.511 79.683  1.00 56.12  ? 557 ASP B OD1 1 
ATOM   3080 O OD2 . ASP A 1 396 ? -74.116  -30.493 78.890  1.00 55.71  ? 557 ASP B OD2 1 
ATOM   3081 N N   . TYR A 1 397 ? -75.740  -25.988 81.026  1.00 58.28  ? 558 TYR B N   1 
ATOM   3082 C CA  . TYR A 1 397 ? -76.578  -24.790 80.960  1.00 57.29  ? 558 TYR B CA  1 
ATOM   3083 C C   . TYR A 1 397 ? -76.065  -23.666 81.849  1.00 56.86  ? 558 TYR B C   1 
ATOM   3084 O O   . TYR A 1 397 ? -76.057  -22.505 81.441  1.00 57.20  ? 558 TYR B O   1 
ATOM   3085 C CB  . TYR A 1 397 ? -78.036  -25.116 81.307  1.00 56.82  ? 558 TYR B CB  1 
ATOM   3086 C CG  . TYR A 1 397 ? -78.946  -23.905 81.304  1.00 57.84  ? 558 TYR B CG  1 
ATOM   3087 C CD1 . TYR A 1 397 ? -79.262  -23.248 80.113  1.00 58.20  ? 558 TYR B CD1 1 
ATOM   3088 C CD2 . TYR A 1 397 ? -79.487  -23.411 82.491  1.00 58.73  ? 558 TYR B CD2 1 
ATOM   3089 C CE1 . TYR A 1 397 ? -80.091  -22.135 80.105  1.00 58.41  ? 558 TYR B CE1 1 
ATOM   3090 C CE2 . TYR A 1 397 ? -80.318  -22.299 82.493  1.00 58.62  ? 558 TYR B CE2 1 
ATOM   3091 C CZ  . TYR A 1 397 ? -80.616  -21.668 81.298  1.00 58.48  ? 558 TYR B CZ  1 
ATOM   3092 O OH  . TYR A 1 397 ? -81.438  -20.567 81.291  1.00 59.05  ? 558 TYR B OH  1 
ATOM   3093 N N   . HIS A 1 398 ? -75.630  -24.021 83.054  1.00 57.14  ? 559 HIS B N   1 
ATOM   3094 C CA  . HIS A 1 398 ? -75.213  -23.035 84.044  1.00 57.65  ? 559 HIS B CA  1 
ATOM   3095 C C   . HIS A 1 398 ? -73.729  -22.673 83.987  1.00 58.19  ? 559 HIS B C   1 
ATOM   3096 O O   . HIS A 1 398 ? -73.339  -21.615 84.481  1.00 59.83  ? 559 HIS B O   1 
ATOM   3097 C CB  . HIS A 1 398 ? -75.601  -23.492 85.455  1.00 57.62  ? 559 HIS B CB  1 
ATOM   3098 C CG  . HIS A 1 398 ? -77.079  -23.569 85.681  1.00 57.97  ? 559 HIS B CG  1 
ATOM   3099 N ND1 . HIS A 1 398 ? -77.857  -22.453 85.898  1.00 58.58  ? 559 HIS B ND1 1 
ATOM   3100 C CD2 . HIS A 1 398 ? -77.921  -24.628 85.722  1.00 58.17  ? 559 HIS B CD2 1 
ATOM   3101 C CE1 . HIS A 1 398 ? -79.116  -22.820 86.061  1.00 59.10  ? 559 HIS B CE1 1 
ATOM   3102 N NE2 . HIS A 1 398 ? -79.181  -24.136 85.961  1.00 58.75  ? 559 HIS B NE2 1 
ATOM   3103 N N   . PHE A 1 399 ? -72.902  -23.529 83.390  1.00 58.84  ? 560 PHE B N   1 
ATOM   3104 C CA  . PHE A 1 399 ? -71.451  -23.300 83.410  1.00 60.71  ? 560 PHE B CA  1 
ATOM   3105 C C   . PHE A 1 399 ? -70.723  -23.485 82.075  1.00 62.23  ? 560 PHE B C   1 
ATOM   3106 O O   . PHE A 1 399 ? -70.403  -22.498 81.408  1.00 64.34  ? 560 PHE B O   1 
ATOM   3107 C CB  . PHE A 1 399 ? -70.784  -24.126 84.520  1.00 59.69  ? 560 PHE B CB  1 
ATOM   3108 C CG  . PHE A 1 399 ? -71.245  -23.758 85.898  1.00 59.43  ? 560 PHE B CG  1 
ATOM   3109 C CD1 . PHE A 1 399 ? -72.301  -24.434 86.497  1.00 59.59  ? 560 PHE B CD1 1 
ATOM   3110 C CD2 . PHE A 1 399 ? -70.636  -22.717 86.591  1.00 59.81  ? 560 PHE B CD2 1 
ATOM   3111 C CE1 . PHE A 1 399 ? -72.737  -24.085 87.766  1.00 59.66  ? 560 PHE B CE1 1 
ATOM   3112 C CE2 . PHE A 1 399 ? -71.067  -22.365 87.861  1.00 59.82  ? 560 PHE B CE2 1 
ATOM   3113 C CZ  . PHE A 1 399 ? -72.119  -23.048 88.448  1.00 59.37  ? 560 PHE B CZ  1 
ATOM   3114 N N   . THR A 1 400 ? -70.470  -24.736 81.694  1.00 62.47  ? 561 THR B N   1 
ATOM   3115 C CA  . THR A 1 400 ? -69.623  -25.061 80.541  1.00 63.12  ? 561 THR B CA  1 
ATOM   3116 C C   . THR A 1 400 ? -69.977  -24.280 79.275  1.00 62.70  ? 561 THR B C   1 
ATOM   3117 O O   . THR A 1 400 ? -69.098  -23.698 78.637  1.00 62.74  ? 561 THR B O   1 
ATOM   3118 C CB  . THR A 1 400 ? -69.616  -26.579 80.245  1.00 64.10  ? 561 THR B CB  1 
ATOM   3119 O OG1 . THR A 1 400 ? -69.163  -27.291 81.402  1.00 64.51  ? 561 THR B OG1 1 
ATOM   3120 C CG2 . THR A 1 400 ? -68.692  -26.904 79.077  1.00 64.91  ? 561 THR B CG2 1 
ATOM   3121 N N   . CYS A 1 401 ? -71.262  -24.258 78.930  1.00 63.25  ? 562 CYS B N   1 
ATOM   3122 C CA  . CYS A 1 401 ? -71.718  -23.632 77.689  1.00 65.23  ? 562 CYS B CA  1 
ATOM   3123 C C   . CYS A 1 401 ? -71.543  -22.125 77.640  1.00 63.94  ? 562 CYS B C   1 
ATOM   3124 O O   . CYS A 1 401 ? -71.239  -21.562 76.586  1.00 64.87  ? 562 CYS B O   1 
ATOM   3125 C CB  . CYS A 1 401 ? -73.154  -24.034 77.381  1.00 68.84  ? 562 CYS B CB  1 
ATOM   3126 S SG  . CYS A 1 401 ? -73.210  -25.716 76.734  1.00 76.93  ? 562 CYS B SG  1 
ATOM   3127 N N   . ASN A 1 402 ? -71.736  -21.482 78.785  1.00 62.73  ? 563 ASN B N   1 
ATOM   3128 C CA  . ASN A 1 402 ? -71.562  -20.043 78.907  1.00 60.78  ? 563 ASN B CA  1 
ATOM   3129 C C   . ASN A 1 402 ? -70.093  -19.645 78.829  1.00 58.75  ? 563 ASN B C   1 
ATOM   3130 O O   . ASN A 1 402 ? -69.763  -18.593 78.281  1.00 58.61  ? 563 ASN B O   1 
ATOM   3131 C CB  . ASN A 1 402 ? -72.192  -19.554 80.206  1.00 62.06  ? 563 ASN B CB  1 
ATOM   3132 C CG  . ASN A 1 402 ? -73.642  -19.969 80.338  1.00 63.55  ? 563 ASN B CG  1 
ATOM   3133 O OD1 . ASN A 1 402 ? -74.463  -19.708 79.456  1.00 64.20  ? 563 ASN B OD1 1 
ATOM   3134 N ND2 . ASN A 1 402 ? -73.964  -20.627 81.442  1.00 64.99  ? 563 ASN B ND2 1 
ATOM   3135 N N   . VAL A 1 403 ? -69.225  -20.495 79.375  1.00 56.78  ? 564 VAL B N   1 
ATOM   3136 C CA  . VAL A 1 403 ? -67.775  -20.318 79.284  1.00 56.24  ? 564 VAL B CA  1 
ATOM   3137 C C   . VAL A 1 403 ? -67.325  -20.424 77.827  1.00 56.93  ? 564 VAL B C   1 
ATOM   3138 O O   . VAL A 1 403 ? -66.500  -19.632 77.366  1.00 56.72  ? 564 VAL B O   1 
ATOM   3139 C CB  . VAL A 1 403 ? -67.019  -21.348 80.154  1.00 55.63  ? 564 VAL B CB  1 
ATOM   3140 C CG1 . VAL A 1 403 ? -65.515  -21.263 79.929  1.00 55.18  ? 564 VAL B CG1 1 
ATOM   3141 C CG2 . VAL A 1 403 ? -67.339  -21.140 81.626  1.00 56.05  ? 564 VAL B CG2 1 
ATOM   3142 N N   . ASN A 1 404 ? -67.879  -21.403 77.114  1.00 58.25  ? 565 ASN B N   1 
ATOM   3143 C CA  . ASN A 1 404 ? -67.618  -21.586 75.688  1.00 59.22  ? 565 ASN B CA  1 
ATOM   3144 C C   . ASN A 1 404 ? -68.021  -20.362 74.880  1.00 60.38  ? 565 ASN B C   1 
ATOM   3145 O O   . ASN A 1 404 ? -67.260  -19.888 74.033  1.00 62.31  ? 565 ASN B O   1 
ATOM   3146 C CB  . ASN A 1 404 ? -68.362  -22.815 75.156  1.00 58.85  ? 565 ASN B CB  1 
ATOM   3147 C CG  . ASN A 1 404 ? -67.717  -24.123 75.575  1.00 59.40  ? 565 ASN B CG  1 
ATOM   3148 O OD1 . ASN A 1 404 ? -66.891  -24.168 76.492  1.00 59.86  ? 565 ASN B OD1 1 
ATOM   3149 N ND2 . ASN A 1 404 ? -68.098  -25.201 74.901  1.00 59.20  ? 565 ASN B ND2 1 
ATOM   3150 N N   . GLU A 1 405 ? -69.219  -19.853 75.159  1.00 60.19  ? 566 GLU B N   1 
ATOM   3151 C CA  . GLU A 1 405 ? -69.762  -18.701 74.457  1.00 61.27  ? 566 GLU B CA  1 
ATOM   3152 C C   . GLU A 1 405 ? -68.852  -17.482 74.592  1.00 61.28  ? 566 GLU B C   1 
ATOM   3153 O O   . GLU A 1 405 ? -68.552  -16.817 73.604  1.00 62.23  ? 566 GLU B O   1 
ATOM   3154 C CB  . GLU A 1 405 ? -71.162  -18.385 74.976  1.00 63.55  ? 566 GLU B CB  1 
ATOM   3155 C CG  . GLU A 1 405 ? -71.914  -17.360 74.150  1.00 67.50  ? 566 GLU B CG  1 
ATOM   3156 C CD  . GLU A 1 405 ? -73.210  -16.925 74.805  1.00 71.12  ? 566 GLU B CD  1 
ATOM   3157 O OE1 . GLU A 1 405 ? -73.966  -17.796 75.291  1.00 72.58  ? 566 GLU B OE1 1 
ATOM   3158 O OE2 . GLU A 1 405 ? -73.473  -15.703 74.829  1.00 73.02  ? 566 GLU B OE2 1 
ATOM   3159 N N   . PHE A 1 406 ? -68.410  -17.205 75.816  1.00 61.39  ? 567 PHE B N   1 
ATOM   3160 C CA  . PHE A 1 406 ? -67.544  -16.063 76.095  1.00 60.86  ? 567 PHE B CA  1 
ATOM   3161 C C   . PHE A 1 406 ? -66.196  -16.195 75.392  1.00 61.17  ? 567 PHE B C   1 
ATOM   3162 O O   . PHE A 1 406 ? -65.714  -15.235 74.794  1.00 63.05  ? 567 PHE B O   1 
ATOM   3163 C CB  . PHE A 1 406 ? -67.350  -15.897 77.607  1.00 60.71  ? 567 PHE B CB  1 
ATOM   3164 C CG  . PHE A 1 406 ? -66.678  -14.608 78.005  1.00 60.65  ? 567 PHE B CG  1 
ATOM   3165 C CD1 . PHE A 1 406 ? -67.306  -13.381 77.797  1.00 60.61  ? 567 PHE B CD1 1 
ATOM   3166 C CD2 . PHE A 1 406 ? -65.428  -14.622 78.614  1.00 60.19  ? 567 PHE B CD2 1 
ATOM   3167 C CE1 . PHE A 1 406 ? -66.690  -12.197 78.174  1.00 59.94  ? 567 PHE B CE1 1 
ATOM   3168 C CE2 . PHE A 1 406 ? -64.808  -13.439 78.993  1.00 59.62  ? 567 PHE B CE2 1 
ATOM   3169 C CZ  . PHE A 1 406 ? -65.442  -12.227 78.776  1.00 59.78  ? 567 PHE B CZ  1 
ATOM   3170 N N   . ALA A 1 407 ? -65.607  -17.387 75.455  1.00 61.33  ? 568 ALA B N   1 
ATOM   3171 C CA  . ALA A 1 407 ? -64.301  -17.648 74.849  1.00 62.06  ? 568 ALA B CA  1 
ATOM   3172 C C   . ALA A 1 407 ? -64.326  -17.476 73.335  1.00 62.63  ? 568 ALA B C   1 
ATOM   3173 O O   . ALA A 1 407 ? -63.419  -16.875 72.758  1.00 62.92  ? 568 ALA B O   1 
ATOM   3174 C CB  . ALA A 1 407 ? -63.816  -19.041 75.214  1.00 62.16  ? 568 ALA B CB  1 
ATOM   3175 N N   . GLN A 1 408 ? -65.368  -18.007 72.701  1.00 63.41  ? 569 GLN B N   1 
ATOM   3176 C CA  . GLN A 1 408 ? -65.530  -17.912 71.256  1.00 65.06  ? 569 GLN B CA  1 
ATOM   3177 C C   . GLN A 1 408 ? -65.773  -16.466 70.837  1.00 64.96  ? 569 GLN B C   1 
ATOM   3178 O O   . GLN A 1 408 ? -65.176  -15.981 69.876  1.00 65.95  ? 569 GLN B O   1 
ATOM   3179 C CB  . GLN A 1 408 ? -66.688  -18.794 70.795  1.00 66.69  ? 569 GLN B CB  1 
ATOM   3180 C CG  . GLN A 1 408 ? -66.977  -18.717 69.305  1.00 69.17  ? 569 GLN B CG  1 
ATOM   3181 C CD  . GLN A 1 408 ? -68.399  -19.113 68.976  1.00 72.73  ? 569 GLN B CD  1 
ATOM   3182 O OE1 . GLN A 1 408 ? -68.989  -19.970 69.639  1.00 74.80  ? 569 GLN B OE1 1 
ATOM   3183 N NE2 . GLN A 1 408 ? -68.961  -18.492 67.946  1.00 73.97  ? 569 GLN B NE2 1 
ATOM   3184 N N   . ARG A 1 409 ? -66.648  -15.789 71.574  1.00 64.19  ? 570 ARG B N   1 
ATOM   3185 C CA  . ARG A 1 409 ? -66.991  -14.401 71.304  1.00 62.39  ? 570 ARG B CA  1 
ATOM   3186 C C   . ARG A 1 409 ? -65.758  -13.502 71.387  1.00 60.84  ? 570 ARG B C   1 
ATOM   3187 O O   . ARG A 1 409 ? -65.617  -12.562 70.609  1.00 61.51  ? 570 ARG B O   1 
ATOM   3188 C CB  . ARG A 1 409 ? -68.080  -13.935 72.272  1.00 63.35  ? 570 ARG B CB  1 
ATOM   3189 C CG  . ARG A 1 409 ? -68.984  -12.838 71.737  1.00 65.45  ? 570 ARG B CG  1 
ATOM   3190 C CD  . ARG A 1 409 ? -69.740  -13.271 70.490  1.00 66.17  ? 570 ARG B CD  1 
ATOM   3191 N NE  . ARG A 1 409 ? -70.068  -12.113 69.664  1.00 70.02  ? 570 ARG B NE  1 
ATOM   3192 C CZ  . ARG A 1 409 ? -69.226  -11.530 68.811  1.00 72.27  ? 570 ARG B CZ  1 
ATOM   3193 N NH1 . ARG A 1 409 ? -67.992  -11.994 68.650  1.00 72.63  ? 570 ARG B NH1 1 
ATOM   3194 N NH2 . ARG A 1 409 ? -69.619  -10.474 68.111  1.00 75.05  ? 570 ARG B NH2 1 
ATOM   3195 N N   . TYR A 1 410 ? -64.864  -13.808 72.324  1.00 60.02  ? 571 TYR B N   1 
ATOM   3196 C CA  . TYR A 1 410 ? -63.578  -13.124 72.427  1.00 60.02  ? 571 TYR B CA  1 
ATOM   3197 C C   . TYR A 1 410 ? -62.651  -13.468 71.269  1.00 61.10  ? 571 TYR B C   1 
ATOM   3198 O O   . TYR A 1 410 ? -61.955  -12.599 70.748  1.00 61.89  ? 571 TYR B O   1 
ATOM   3199 C CB  . TYR A 1 410 ? -62.896  -13.444 73.759  1.00 59.75  ? 571 TYR B CB  1 
ATOM   3200 C CG  . TYR A 1 410 ? -62.771  -12.249 74.669  1.00 59.72  ? 571 TYR B CG  1 
ATOM   3201 C CD1 . TYR A 1 410 ? -63.878  -11.741 75.344  1.00 59.93  ? 571 TYR B CD1 1 
ATOM   3202 C CD2 . TYR A 1 410 ? -61.543  -11.617 74.849  1.00 59.89  ? 571 TYR B CD2 1 
ATOM   3203 C CE1 . TYR A 1 410 ? -63.766  -10.638 76.174  1.00 60.73  ? 571 TYR B CE1 1 
ATOM   3204 C CE2 . TYR A 1 410 ? -61.419  -10.515 75.678  1.00 60.74  ? 571 TYR B CE2 1 
ATOM   3205 C CZ  . TYR A 1 410 ? -62.534  -10.028 76.336  1.00 61.03  ? 571 TYR B CZ  1 
ATOM   3206 O OH  . TYR A 1 410 ? -62.421  -8.934  77.161  1.00 61.80  ? 571 TYR B OH  1 
ATOM   3207 N N   . ALA A 1 411 ? -62.652  -14.738 70.873  1.00 62.29  ? 572 ALA B N   1 
ATOM   3208 C CA  . ALA A 1 411 ? -61.829  -15.205 69.761  1.00 63.36  ? 572 ALA B CA  1 
ATOM   3209 C C   . ALA A 1 411 ? -62.291  -14.610 68.434  1.00 64.57  ? 572 ALA B C   1 
ATOM   3210 O O   . ALA A 1 411 ? -61.465  -14.172 67.631  1.00 65.51  ? 572 ALA B O   1 
ATOM   3211 C CB  . ALA A 1 411 ? -61.837  -16.724 69.697  1.00 63.30  ? 572 ALA B CB  1 
ATOM   3212 N N   . GLU A 1 412 ? -63.608  -14.588 68.220  1.00 65.38  ? 573 GLU B N   1 
ATOM   3213 C CA  . GLU A 1 412 ? -64.213  -14.032 67.007  1.00 66.75  ? 573 GLU B CA  1 
ATOM   3214 C C   . GLU A 1 412 ? -63.815  -12.577 66.777  1.00 67.26  ? 573 GLU B C   1 
ATOM   3215 O O   . GLU A 1 412 ? -63.669  -12.140 65.636  1.00 68.11  ? 573 GLU B O   1 
ATOM   3216 C CB  . GLU A 1 412 ? -65.737  -14.130 67.068  1.00 68.28  ? 573 GLU B CB  1 
ATOM   3217 C CG  . GLU A 1 412 ? -66.304  -15.504 66.759  1.00 71.51  ? 573 GLU B CG  1 
ATOM   3218 C CD  . GLU A 1 412 ? -67.819  -15.552 66.881  1.00 75.09  ? 573 GLU B CD  1 
ATOM   3219 O OE1 . GLU A 1 412 ? -68.393  -14.761 67.664  1.00 76.08  ? 573 GLU B OE1 1 
ATOM   3220 O OE2 . GLU A 1 412 ? -68.442  -16.391 66.195  1.00 77.32  ? 573 GLU B OE2 1 
ATOM   3221 N N   . GLU A 1 413 ? -63.640  -11.838 67.868  1.00 67.68  ? 574 GLU B N   1 
ATOM   3222 C CA  . GLU A 1 413 ? -63.258  -10.435 67.800  1.00 68.01  ? 574 GLU B CA  1 
ATOM   3223 C C   . GLU A 1 413 ? -61.743  -10.266 67.659  1.00 67.12  ? 574 GLU B C   1 
ATOM   3224 O O   . GLU A 1 413 ? -61.219  -9.160  67.794  1.00 68.83  ? 574 GLU B O   1 
ATOM   3225 C CB  . GLU A 1 413 ? -63.781  -9.686  69.030  1.00 70.29  ? 574 GLU B CB  1 
ATOM   3226 C CG  . GLU A 1 413 ? -64.344  -8.305  68.724  1.00 72.94  ? 574 GLU B CG  1 
ATOM   3227 C CD  . GLU A 1 413 ? -65.532  -8.347  67.777  1.00 75.54  ? 574 GLU B CD  1 
ATOM   3228 O OE1 . GLU A 1 413 ? -65.605  -7.477  66.884  1.00 77.15  ? 574 GLU B OE1 1 
ATOM   3229 O OE2 . GLU A 1 413 ? -66.389  -9.250  67.916  1.00 76.42  ? 574 GLU B OE2 1 
ATOM   3230 N N   . GLY A 1 414 ? -61.048  -11.369 67.390  1.00 65.88  ? 575 GLY B N   1 
ATOM   3231 C CA  . GLY A 1 414 ? -59.617  -11.341 67.096  1.00 65.94  ? 575 GLY B CA  1 
ATOM   3232 C C   . GLY A 1 414 ? -58.695  -11.421 68.300  1.00 66.19  ? 575 GLY B C   1 
ATOM   3233 O O   . GLY A 1 414 ? -57.501  -11.132 68.192  1.00 66.47  ? 575 GLY B O   1 
ATOM   3234 N N   . ASN A 1 415 ? -59.242  -11.815 69.446  1.00 65.81  ? 576 ASN B N   1 
ATOM   3235 C CA  . ASN A 1 415 ? -58.447  -11.961 70.661  1.00 65.06  ? 576 ASN B CA  1 
ATOM   3236 C C   . ASN A 1 415 ? -57.926  -13.382 70.835  1.00 64.52  ? 576 ASN B C   1 
ATOM   3237 O O   . ASN A 1 415 ? -58.605  -14.348 70.479  1.00 64.60  ? 576 ASN B O   1 
ATOM   3238 C CB  . ASN A 1 415 ? -59.250  -11.531 71.890  1.00 65.32  ? 576 ASN B CB  1 
ATOM   3239 C CG  . ASN A 1 415 ? -59.409  -10.025 71.984  1.00 66.02  ? 576 ASN B CG  1 
ATOM   3240 O OD1 . ASN A 1 415 ? -58.460  -9.310  72.313  1.00 66.82  ? 576 ASN B OD1 1 
ATOM   3241 N ND2 . ASN A 1 415 ? -60.614  -9.534  71.705  1.00 65.33  ? 576 ASN B ND2 1 
ATOM   3242 N N   . ASN A 1 416 ? -56.715  -13.495 71.373  1.00 64.24  ? 577 ASN B N   1 
ATOM   3243 C CA  . ASN A 1 416 ? -56.115  -14.790 71.681  1.00 63.89  ? 577 ASN B CA  1 
ATOM   3244 C C   . ASN A 1 416 ? -56.755  -15.426 72.909  1.00 62.98  ? 577 ASN B C   1 
ATOM   3245 O O   . ASN A 1 416 ? -56.791  -14.828 73.986  1.00 63.10  ? 577 ASN B O   1 
ATOM   3246 C CB  . ASN A 1 416 ? -54.604  -14.653 71.881  1.00 65.04  ? 577 ASN B CB  1 
ATOM   3247 C CG  . ASN A 1 416 ? -53.862  -14.412 70.582  1.00 65.71  ? 577 ASN B CG  1 
ATOM   3248 O OD1 . ASN A 1 416 ? -54.427  -13.915 69.608  1.00 67.20  ? 577 ASN B OD1 1 
ATOM   3249 N ND2 . ASN A 1 416 ? -52.584  -14.766 70.562  1.00 65.85  ? 577 ASN B ND2 1 
ATOM   3250 N N   . VAL A 1 417 ? -57.268  -16.639 72.732  1.00 61.09  ? 578 VAL B N   1 
ATOM   3251 C CA  . VAL A 1 417 ? -57.962  -17.352 73.800  1.00 59.24  ? 578 VAL B CA  1 
ATOM   3252 C C   . VAL A 1 417 ? -57.291  -18.703 74.038  1.00 60.32  ? 578 VAL B C   1 
ATOM   3253 O O   . VAL A 1 417 ? -56.831  -19.348 73.096  1.00 61.52  ? 578 VAL B O   1 
ATOM   3254 C CB  . VAL A 1 417 ? -59.459  -17.551 73.466  1.00 57.21  ? 578 VAL B CB  1 
ATOM   3255 C CG1 . VAL A 1 417 ? -60.192  -18.220 74.617  1.00 56.99  ? 578 VAL B CG1 1 
ATOM   3256 C CG2 . VAL A 1 417 ? -60.120  -16.220 73.139  1.00 56.89  ? 578 VAL B CG2 1 
ATOM   3257 N N   . TYR A 1 418 ? -57.225  -19.116 75.301  1.00 61.10  ? 579 TYR B N   1 
ATOM   3258 C CA  . TYR A 1 418 ? -56.736  -20.445 75.651  1.00 61.51  ? 579 TYR B CA  1 
ATOM   3259 C C   . TYR A 1 418 ? -57.757  -21.163 76.525  1.00 60.98  ? 579 TYR B C   1 
ATOM   3260 O O   . TYR A 1 418 ? -58.027  -20.750 77.657  1.00 60.74  ? 579 TYR B O   1 
ATOM   3261 C CB  . TYR A 1 418 ? -55.367  -20.370 76.332  1.00 62.71  ? 579 TYR B CB  1 
ATOM   3262 C CG  . TYR A 1 418 ? -54.317  -19.686 75.486  1.00 64.37  ? 579 TYR B CG  1 
ATOM   3263 C CD1 . TYR A 1 418 ? -53.597  -20.393 74.521  1.00 64.91  ? 579 TYR B CD1 1 
ATOM   3264 C CD2 . TYR A 1 418 ? -54.050  -18.326 75.642  1.00 65.69  ? 579 TYR B CD2 1 
ATOM   3265 C CE1 . TYR A 1 418 ? -52.639  -19.766 73.741  1.00 66.09  ? 579 TYR B CE1 1 
ATOM   3266 C CE2 . TYR A 1 418 ? -53.094  -17.690 74.867  1.00 66.73  ? 579 TYR B CE2 1 
ATOM   3267 C CZ  . TYR A 1 418 ? -52.393  -18.413 73.921  1.00 66.99  ? 579 TYR B CZ  1 
ATOM   3268 O OH  . TYR A 1 418 ? -51.448  -17.774 73.154  1.00 68.19  ? 579 TYR B OH  1 
ATOM   3269 N N   . MET A 1 419 ? -58.334  -22.228 75.972  1.00 59.97  ? 580 MET B N   1 
ATOM   3270 C CA  . MET A 1 419 ? -59.389  -22.984 76.636  1.00 58.44  ? 580 MET B CA  1 
ATOM   3271 C C   . MET A 1 419 ? -58.822  -24.247 77.274  1.00 58.55  ? 580 MET B C   1 
ATOM   3272 O O   . MET A 1 419 ? -57.974  -24.918 76.683  1.00 59.81  ? 580 MET B O   1 
ATOM   3273 C CB  . MET A 1 419 ? -60.489  -23.340 75.634  1.00 57.59  ? 580 MET B CB  1 
ATOM   3274 C CG  . MET A 1 419 ? -61.643  -24.133 76.219  1.00 57.84  ? 580 MET B CG  1 
ATOM   3275 S SD  . MET A 1 419 ? -62.803  -23.129 77.157  1.00 59.53  ? 580 MET B SD  1 
ATOM   3276 C CE  . MET A 1 419 ? -63.914  -22.610 75.852  1.00 58.85  ? 580 MET B CE  1 
ATOM   3277 N N   . TYR A 1 420 ? -59.288  -24.557 78.483  1.00 57.73  ? 581 TYR B N   1 
ATOM   3278 C CA  . TYR A 1 420 ? -58.898  -25.789 79.168  1.00 56.67  ? 581 TYR B CA  1 
ATOM   3279 C C   . TYR A 1 420 ? -60.105  -26.639 79.566  1.00 55.89  ? 581 TYR B C   1 
ATOM   3280 O O   . TYR A 1 420 ? -61.209  -26.123 79.750  1.00 55.66  ? 581 TYR B O   1 
ATOM   3281 C CB  . TYR A 1 420 ? -58.020  -25.494 80.398  1.00 56.37  ? 581 TYR B CB  1 
ATOM   3282 C CG  . TYR A 1 420 ? -58.763  -24.983 81.618  1.00 56.80  ? 581 TYR B CG  1 
ATOM   3283 C CD1 . TYR A 1 420 ? -59.475  -25.854 82.442  1.00 57.41  ? 581 TYR B CD1 1 
ATOM   3284 C CD2 . TYR A 1 420 ? -58.734  -23.633 81.963  1.00 57.27  ? 581 TYR B CD2 1 
ATOM   3285 C CE1 . TYR A 1 420 ? -60.158  -25.395 83.556  1.00 57.80  ? 581 TYR B CE1 1 
ATOM   3286 C CE2 . TYR A 1 420 ? -59.410  -23.165 83.082  1.00 57.66  ? 581 TYR B CE2 1 
ATOM   3287 C CZ  . TYR A 1 420 ? -60.121  -24.051 83.874  1.00 57.86  ? 581 TYR B CZ  1 
ATOM   3288 O OH  . TYR A 1 420 ? -60.798  -23.605 84.986  1.00 57.76  ? 581 TYR B OH  1 
ATOM   3289 N N   . LEU A 1 421 ? -59.882  -27.943 79.686  1.00 54.81  ? 582 LEU B N   1 
ATOM   3290 C CA  . LEU A 1 421 ? -60.848  -28.835 80.310  1.00 54.26  ? 582 LEU B CA  1 
ATOM   3291 C C   . LEU A 1 421 ? -60.150  -29.590 81.435  1.00 55.96  ? 582 LEU B C   1 
ATOM   3292 O O   . LEU A 1 421 ? -59.265  -30.414 81.189  1.00 57.30  ? 582 LEU B O   1 
ATOM   3293 C CB  . LEU A 1 421 ? -61.461  -29.797 79.290  1.00 52.20  ? 582 LEU B CB  1 
ATOM   3294 C CG  . LEU A 1 421 ? -62.541  -30.768 79.780  1.00 51.52  ? 582 LEU B CG  1 
ATOM   3295 C CD1 . LEU A 1 421 ? -63.702  -30.044 80.447  1.00 51.54  ? 582 LEU B CD1 1 
ATOM   3296 C CD2 . LEU A 1 421 ? -63.041  -31.624 78.629  1.00 51.38  ? 582 LEU B CD2 1 
ATOM   3297 N N   . TYR A 1 422 ? -60.539  -29.284 82.670  1.00 56.63  ? 583 TYR B N   1 
ATOM   3298 C CA  . TYR A 1 422 ? -59.913  -29.872 83.847  1.00 57.30  ? 583 TYR B CA  1 
ATOM   3299 C C   . TYR A 1 422 ? -60.596  -31.190 84.209  1.00 58.02  ? 583 TYR B C   1 
ATOM   3300 O O   . TYR A 1 422 ? -61.751  -31.204 84.644  1.00 58.96  ? 583 TYR B O   1 
ATOM   3301 C CB  . TYR A 1 422 ? -59.938  -28.879 85.015  1.00 58.38  ? 583 TYR B CB  1 
ATOM   3302 C CG  . TYR A 1 422 ? -59.168  -29.342 86.228  1.00 59.92  ? 583 TYR B CG  1 
ATOM   3303 C CD1 . TYR A 1 422 ? -57.800  -29.107 86.344  1.00 59.87  ? 583 TYR B CD1 1 
ATOM   3304 C CD2 . TYR A 1 422 ? -59.809  -30.019 87.259  1.00 61.51  ? 583 TYR B CD2 1 
ATOM   3305 C CE1 . TYR A 1 422 ? -57.093  -29.536 87.456  1.00 60.99  ? 583 TYR B CE1 1 
ATOM   3306 C CE2 . TYR A 1 422 ? -59.114  -30.453 88.373  1.00 62.67  ? 583 TYR B CE2 1 
ATOM   3307 C CZ  . TYR A 1 422 ? -57.759  -30.211 88.467  1.00 62.23  ? 583 TYR B CZ  1 
ATOM   3308 O OH  . TYR A 1 422 ? -57.079  -30.648 89.578  1.00 63.16  ? 583 TYR B OH  1 
ATOM   3309 N N   . THR A 1 423 ? -59.867  -32.289 84.027  1.00 58.19  ? 584 THR B N   1 
ATOM   3310 C CA  . THR A 1 423 ? -60.424  -33.639 84.148  1.00 57.90  ? 584 THR B CA  1 
ATOM   3311 C C   . THR A 1 423 ? -59.807  -34.463 85.276  1.00 58.85  ? 584 THR B C   1 
ATOM   3312 O O   . THR A 1 423 ? -60.177  -35.623 85.469  1.00 59.89  ? 584 THR B O   1 
ATOM   3313 C CB  . THR A 1 423 ? -60.235  -34.436 82.844  1.00 57.55  ? 584 THR B CB  1 
ATOM   3314 O OG1 . THR A 1 423 ? -58.839  -34.511 82.529  1.00 56.80  ? 584 THR B OG1 1 
ATOM   3315 C CG2 . THR A 1 423 ? -60.977  -33.780 81.694  1.00 58.16  ? 584 THR B CG2 1 
ATOM   3316 N N   . HIS A 1 424 ? -58.870  -33.873 86.012  1.00 59.47  ? 585 HIS B N   1 
ATOM   3317 C CA  . HIS A 1 424 ? -58.149  -34.605 87.052  1.00 59.62  ? 585 HIS B CA  1 
ATOM   3318 C C   . HIS A 1 424 ? -58.873  -34.611 88.392  1.00 59.15  ? 585 HIS B C   1 
ATOM   3319 O O   . HIS A 1 424 ? -59.121  -33.556 88.980  1.00 58.49  ? 585 HIS B O   1 
ATOM   3320 C CB  . HIS A 1 424 ? -56.723  -34.063 87.218  1.00 60.40  ? 585 HIS B CB  1 
ATOM   3321 C CG  . HIS A 1 424 ? -56.050  -34.510 88.480  1.00 60.88  ? 585 HIS B CG  1 
ATOM   3322 N ND1 . HIS A 1 424 ? -55.785  -35.835 88.754  1.00 61.48  ? 585 HIS B ND1 1 
ATOM   3323 C CD2 . HIS A 1 424 ? -55.592  -33.808 89.543  1.00 61.03  ? 585 HIS B CD2 1 
ATOM   3324 C CE1 . HIS A 1 424 ? -55.194  -35.929 89.932  1.00 61.54  ? 585 HIS B CE1 1 
ATOM   3325 N NE2 . HIS A 1 424 ? -55.063  -34.714 90.430  1.00 61.21  ? 585 HIS B NE2 1 
ATOM   3326 N N   . ARG A 1 425 ? -59.211  -35.809 88.861  1.00 59.44  ? 586 ARG B N   1 
ATOM   3327 C CA  . ARG A 1 425 ? -59.746  -35.986 90.204  1.00 60.22  ? 586 ARG B CA  1 
ATOM   3328 C C   . ARG A 1 425 ? -58.604  -36.273 91.172  1.00 61.72  ? 586 ARG B C   1 
ATOM   3329 O O   . ARG A 1 425 ? -57.839  -37.222 90.984  1.00 61.11  ? 586 ARG B O   1 
ATOM   3330 C CB  . ARG A 1 425 ? -60.774  -37.117 90.246  1.00 59.44  ? 586 ARG B CB  1 
ATOM   3331 C CG  . ARG A 1 425 ? -61.532  -37.197 91.561  1.00 59.08  ? 586 ARG B CG  1 
ATOM   3332 C CD  . ARG A 1 425 ? -62.602  -38.275 91.525  1.00 59.43  ? 586 ARG B CD  1 
ATOM   3333 N NE  . ARG A 1 425 ? -63.637  -38.046 92.532  1.00 59.18  ? 586 ARG B NE  1 
ATOM   3334 C CZ  . ARG A 1 425 ? -63.596  -38.509 93.778  1.00 58.85  ? 586 ARG B CZ  1 
ATOM   3335 N NH1 . ARG A 1 425 ? -62.567  -39.236 94.193  1.00 59.35  ? 586 ARG B NH1 1 
ATOM   3336 N NH2 . ARG A 1 425 ? -64.591  -38.242 94.612  1.00 58.60  ? 586 ARG B NH2 1 
ATOM   3337 N N   . SER A 1 426 ? -58.494  -35.433 92.198  1.00 64.46  ? 587 SER B N   1 
ATOM   3338 C CA  . SER A 1 426 ? -57.486  -35.587 93.241  1.00 65.52  ? 587 SER B CA  1 
ATOM   3339 C C   . SER A 1 426 ? -57.709  -36.914 93.965  1.00 66.87  ? 587 SER B C   1 
ATOM   3340 O O   . SER A 1 426 ? -58.854  -37.306 94.209  1.00 67.32  ? 587 SER B O   1 
ATOM   3341 C CB  . SER A 1 426 ? -57.575  -34.414 94.222  1.00 65.19  ? 587 SER B CB  1 
ATOM   3342 O OG  . SER A 1 426 ? -56.323  -34.150 94.826  1.00 65.04  ? 587 SER B OG  1 
ATOM   3343 N N   . LYS A 1 427 ? -56.619  -37.608 94.288  1.00 68.29  ? 588 LYS B N   1 
ATOM   3344 C CA  . LYS A 1 427 ? -56.709  -38.930 94.911  1.00 69.24  ? 588 LYS B CA  1 
ATOM   3345 C C   . LYS A 1 427 ? -57.338  -38.860 96.299  1.00 68.92  ? 588 LYS B C   1 
ATOM   3346 O O   . LYS A 1 427 ? -58.308  -39.567 96.581  1.00 69.07  ? 588 LYS B O   1 
ATOM   3347 C CB  . LYS A 1 427 ? -55.340  -39.616 94.972  1.00 70.83  ? 588 LYS B CB  1 
ATOM   3348 C CG  . LYS A 1 427 ? -55.433  -41.125 95.132  1.00 73.95  ? 588 LYS B CG  1 
ATOM   3349 C CD  . LYS A 1 427 ? -54.066  -41.784 95.204  1.00 76.72  ? 588 LYS B CD  1 
ATOM   3350 C CE  . LYS A 1 427 ? -54.191  -43.298 95.161  1.00 78.55  ? 588 LYS B CE  1 
ATOM   3351 N NZ  . LYS A 1 427 ? -52.903  -43.979 95.465  1.00 78.34  ? 588 LYS B NZ  1 
ATOM   3352 N N   . GLY A 1 428 ? -56.796  -37.995 97.152  1.00 68.80  ? 589 GLY B N   1 
ATOM   3353 C CA  . GLY A 1 428 ? -57.323  -37.806 98.500  1.00 69.93  ? 589 GLY B CA  1 
ATOM   3354 C C   . GLY A 1 428 ? -58.565  -36.934 98.525  1.00 69.99  ? 589 GLY B C   1 
ATOM   3355 O O   . GLY A 1 428 ? -58.596  -35.907 99.204  1.00 73.42  ? 589 GLY B O   1 
ATOM   3356 N N   . ASN A 1 429 ? -59.591  -37.347 97.787  1.00 67.77  ? 590 ASN B N   1 
ATOM   3357 C CA  . ASN A 1 429 ? -60.829  -36.584 97.688  1.00 66.08  ? 590 ASN B CA  1 
ATOM   3358 C C   . ASN A 1 429 ? -61.815  -36.955 98.794  1.00 66.53  ? 590 ASN B C   1 
ATOM   3359 O O   . ASN A 1 429 ? -62.078  -38.138 99.014  1.00 68.08  ? 590 ASN B O   1 
ATOM   3360 C CB  . ASN A 1 429 ? -61.462  -36.788 96.311  1.00 64.52  ? 590 ASN B CB  1 
ATOM   3361 C CG  . ASN A 1 429 ? -62.502  -35.736 95.984  1.00 63.08  ? 590 ASN B CG  1 
ATOM   3362 O OD1 . ASN A 1 429 ? -63.524  -35.623 96.656  1.00 62.66  ? 590 ASN B OD1 1 
ATOM   3363 N ND2 . ASN A 1 429 ? -62.249  -34.966 94.933  1.00 62.85  ? 590 ASN B ND2 1 
ATOM   3364 N N   . PRO A 1 430 ? -62.360  -35.942 99.497  1.00 66.22  ? 591 PRO B N   1 
ATOM   3365 C CA  . PRO A 1 430 ? -63.336  -36.162 100.573 1.00 66.14  ? 591 PRO B CA  1 
ATOM   3366 C C   . PRO A 1 430 ? -64.728  -36.596 100.094 1.00 65.47  ? 591 PRO B C   1 
ATOM   3367 O O   . PRO A 1 430 ? -65.435  -37.289 100.830 1.00 64.67  ? 591 PRO B O   1 
ATOM   3368 C CB  . PRO A 1 430 ? -63.418  -34.793 101.256 1.00 66.32  ? 591 PRO B CB  1 
ATOM   3369 C CG  . PRO A 1 430 ? -63.027  -33.820 100.199 1.00 65.92  ? 591 PRO B CG  1 
ATOM   3370 C CD  . PRO A 1 430 ? -61.983  -34.522 99.382  1.00 65.96  ? 591 PRO B CD  1 
ATOM   3371 N N   . TRP A 1 431 ? -65.110  -36.186 98.884  1.00 64.93  ? 592 TRP B N   1 
ATOM   3372 C CA  . TRP A 1 431 ? -66.431  -36.495 98.319  1.00 63.98  ? 592 TRP B CA  1 
ATOM   3373 C C   . TRP A 1 431 ? -66.499  -37.935 97.800  1.00 63.74  ? 592 TRP B C   1 
ATOM   3374 O O   . TRP A 1 431 ? -65.458  -38.557 97.586  1.00 64.00  ? 592 TRP B O   1 
ATOM   3375 C CB  . TRP A 1 431 ? -66.777  -35.509 97.195  1.00 63.22  ? 592 TRP B CB  1 
ATOM   3376 C CG  . TRP A 1 431 ? -66.864  -34.083 97.646  1.00 62.92  ? 592 TRP B CG  1 
ATOM   3377 C CD1 . TRP A 1 431 ? -65.865  -33.153 97.615  1.00 62.86  ? 592 TRP B CD1 1 
ATOM   3378 C CD2 . TRP A 1 431 ? -68.008  -33.424 98.200  1.00 62.96  ? 592 TRP B CD2 1 
ATOM   3379 N NE1 . TRP A 1 431 ? -66.315  -31.956 98.113  1.00 63.23  ? 592 TRP B NE1 1 
ATOM   3380 C CE2 . TRP A 1 431 ? -67.628  -32.093 98.480  1.00 63.05  ? 592 TRP B CE2 1 
ATOM   3381 C CE3 . TRP A 1 431 ? -69.319  -33.829 98.486  1.00 63.25  ? 592 TRP B CE3 1 
ATOM   3382 C CZ2 . TRP A 1 431 ? -68.511  -31.160 99.033  1.00 63.25  ? 592 TRP B CZ2 1 
ATOM   3383 C CZ3 . TRP A 1 431 ? -70.199  -32.900 99.036  1.00 63.05  ? 592 TRP B CZ3 1 
ATOM   3384 C CH2 . TRP A 1 431 ? -69.789  -31.582 99.303  1.00 63.31  ? 592 TRP B CH2 1 
ATOM   3385 N N   . PRO A 1 432 ? -67.726  -38.470 97.603  1.00 63.92  ? 593 PRO B N   1 
ATOM   3386 C CA  . PRO A 1 432 ? -67.889  -39.819 97.047  1.00 64.50  ? 593 PRO B CA  1 
ATOM   3387 C C   . PRO A 1 432 ? -67.346  -39.939 95.622  1.00 65.70  ? 593 PRO B C   1 
ATOM   3388 O O   . PRO A 1 432 ? -67.264  -38.939 94.908  1.00 66.86  ? 593 PRO B O   1 
ATOM   3389 C CB  . PRO A 1 432 ? -69.408  -40.018 97.047  1.00 63.77  ? 593 PRO B CB  1 
ATOM   3390 C CG  . PRO A 1 432 ? -69.928  -39.066 98.065  1.00 63.62  ? 593 PRO B CG  1 
ATOM   3391 C CD  . PRO A 1 432 ? -69.023  -37.876 97.975  1.00 63.92  ? 593 PRO B CD  1 
ATOM   3392 N N   . ARG A 1 433 ? -66.993  -41.159 95.217  1.00 66.79  ? 594 ARG B N   1 
ATOM   3393 C CA  . ARG A 1 433 ? -66.351  -41.408 93.921  1.00 66.58  ? 594 ARG B CA  1 
ATOM   3394 C C   . ARG A 1 433 ? -67.201  -41.022 92.712  1.00 63.76  ? 594 ARG B C   1 
ATOM   3395 O O   . ARG A 1 433 ? -66.656  -40.662 91.671  1.00 63.30  ? 594 ARG B O   1 
ATOM   3396 C CB  . ARG A 1 433 ? -65.925  -42.872 93.795  1.00 71.13  ? 594 ARG B CB  1 
ATOM   3397 C CG  . ARG A 1 433 ? -64.847  -43.308 94.776  1.00 76.78  ? 594 ARG B CG  1 
ATOM   3398 C CD  . ARG A 1 433 ? -64.496  -44.782 94.610  1.00 82.25  ? 594 ARG B CD  1 
ATOM   3399 N NE  . ARG A 1 433 ? -65.670  -45.657 94.692  1.00 85.03  ? 594 ARG B NE  1 
ATOM   3400 C CZ  . ARG A 1 433 ? -66.155  -46.183 95.816  1.00 85.84  ? 594 ARG B CZ  1 
ATOM   3401 N NH1 . ARG A 1 433 ? -65.577  -45.938 96.987  1.00 85.82  ? 594 ARG B NH1 1 
ATOM   3402 N NH2 . ARG A 1 433 ? -67.229  -46.961 95.767  1.00 86.87  ? 594 ARG B NH2 1 
ATOM   3403 N N   . TRP A 1 434 ? -68.525  -41.100 92.851  1.00 61.60  ? 595 TRP B N   1 
ATOM   3404 C CA  . TRP A 1 434 ? -69.444  -40.803 91.744  1.00 60.49  ? 595 TRP B CA  1 
ATOM   3405 C C   . TRP A 1 434 ? -69.494  -39.322 91.368  1.00 60.26  ? 595 TRP B C   1 
ATOM   3406 O O   . TRP A 1 434 ? -69.949  -38.968 90.275  1.00 61.04  ? 595 TRP B O   1 
ATOM   3407 C CB  . TRP A 1 434 ? -70.860  -41.325 92.037  1.00 59.72  ? 595 TRP B CB  1 
ATOM   3408 C CG  . TRP A 1 434 ? -71.485  -40.749 93.271  1.00 59.14  ? 595 TRP B CG  1 
ATOM   3409 C CD1 . TRP A 1 434 ? -71.459  -41.285 94.524  1.00 59.28  ? 595 TRP B CD1 1 
ATOM   3410 C CD2 . TRP A 1 434 ? -72.234  -39.529 93.371  1.00 58.95  ? 595 TRP B CD2 1 
ATOM   3411 N NE1 . TRP A 1 434 ? -72.143  -40.477 95.400  1.00 59.28  ? 595 TRP B NE1 1 
ATOM   3412 C CE2 . TRP A 1 434 ? -72.625  -39.390 94.721  1.00 59.42  ? 595 TRP B CE2 1 
ATOM   3413 C CE3 . TRP A 1 434 ? -72.610  -38.538 92.455  1.00 58.30  ? 595 TRP B CE3 1 
ATOM   3414 C CZ2 . TRP A 1 434 ? -73.377  -38.299 95.178  1.00 59.10  ? 595 TRP B CZ2 1 
ATOM   3415 C CZ3 . TRP A 1 434 ? -73.357  -37.454 92.912  1.00 57.87  ? 595 TRP B CZ3 1 
ATOM   3416 C CH2 . TRP A 1 434 ? -73.732  -37.345 94.260  1.00 57.39  ? 595 TRP B CH2 1 
ATOM   3417 N N   . THR A 1 435 ? -69.030  -38.465 92.274  1.00 58.71  ? 596 THR B N   1 
ATOM   3418 C CA  . THR A 1 435 ? -69.084  -37.019 92.071  1.00 58.20  ? 596 THR B CA  1 
ATOM   3419 C C   . THR A 1 435 ? -68.084  -36.533 91.017  1.00 58.76  ? 596 THR B C   1 
ATOM   3420 O O   . THR A 1 435 ? -68.290  -35.490 90.395  1.00 59.85  ? 596 THR B O   1 
ATOM   3421 C CB  . THR A 1 435 ? -68.865  -36.249 93.386  1.00 57.47  ? 596 THR B CB  1 
ATOM   3422 O OG1 . THR A 1 435 ? -67.570  -36.557 93.916  1.00 58.31  ? 596 THR B OG1 1 
ATOM   3423 C CG2 . THR A 1 435 ? -69.937  -36.604 94.410  1.00 56.51  ? 596 THR B CG2 1 
ATOM   3424 N N   . GLY A 1 436 ? -67.008  -37.295 90.825  1.00 58.26  ? 597 GLY B N   1 
ATOM   3425 C CA  . GLY A 1 436 ? -65.996  -36.980 89.817  1.00 58.44  ? 597 GLY B CA  1 
ATOM   3426 C C   . GLY A 1 436 ? -65.270  -35.677 90.091  1.00 59.10  ? 597 GLY B C   1 
ATOM   3427 O O   . GLY A 1 436 ? -65.023  -35.331 91.250  1.00 59.46  ? 597 GLY B O   1 
ATOM   3428 N N   . VAL A 1 437 ? -64.938  -34.954 89.021  1.00 59.37  ? 598 VAL B N   1 
ATOM   3429 C CA  . VAL A 1 437 ? -64.234  -33.673 89.122  1.00 59.62  ? 598 VAL B CA  1 
ATOM   3430 C C   . VAL A 1 437 ? -65.236  -32.523 89.171  1.00 61.09  ? 598 VAL B C   1 
ATOM   3431 O O   . VAL A 1 437 ? -65.685  -32.025 88.133  1.00 60.59  ? 598 VAL B O   1 
ATOM   3432 C CB  . VAL A 1 437 ? -63.245  -33.462 87.959  1.00 59.13  ? 598 VAL B CB  1 
ATOM   3433 C CG1 . VAL A 1 437 ? -62.367  -32.250 88.225  1.00 59.32  ? 598 VAL B CG1 1 
ATOM   3434 C CG2 . VAL A 1 437 ? -62.383  -34.696 87.761  1.00 59.84  ? 598 VAL B CG2 1 
ATOM   3435 N N   . MET A 1 438 ? -65.569  -32.107 90.390  1.00 63.81  ? 599 MET B N   1 
ATOM   3436 C CA  . MET A 1 438 ? -66.626  -31.123 90.622  1.00 66.33  ? 599 MET B CA  1 
ATOM   3437 C C   . MET A 1 438 ? -66.169  -29.678 90.459  1.00 66.83  ? 599 MET B C   1 
ATOM   3438 O O   . MET A 1 438 ? -64.979  -29.393 90.307  1.00 67.94  ? 599 MET B O   1 
ATOM   3439 C CB  . MET A 1 438 ? -67.234  -31.303 92.015  1.00 67.25  ? 599 MET B CB  1 
ATOM   3440 C CG  . MET A 1 438 ? -67.993  -32.599 92.224  1.00 67.44  ? 599 MET B CG  1 
ATOM   3441 S SD  . MET A 1 438 ? -68.280  -32.864 93.981  1.00 71.54  ? 599 MET B SD  1 
ATOM   3442 C CE  . MET A 1 438 ? -69.848  -32.046 94.218  1.00 67.70  ? 599 MET B CE  1 
ATOM   3443 N N   . HIS A 1 439 ? -67.147  -28.778 90.499  1.00 66.52  ? 600 HIS B N   1 
ATOM   3444 C CA  . HIS A 1 439 ? -66.926  -27.342 90.479  1.00 66.43  ? 600 HIS B CA  1 
ATOM   3445 C C   . HIS A 1 439 ? -65.885  -26.935 91.524  1.00 65.98  ? 600 HIS B C   1 
ATOM   3446 O O   . HIS A 1 439 ? -66.052  -27.204 92.714  1.00 66.60  ? 600 HIS B O   1 
ATOM   3447 C CB  . HIS A 1 439 ? -68.262  -26.645 90.745  1.00 67.38  ? 600 HIS B CB  1 
ATOM   3448 C CG  . HIS A 1 439 ? -68.241  -25.166 90.521  1.00 68.70  ? 600 HIS B CG  1 
ATOM   3449 N ND1 . HIS A 1 439 ? -67.960  -24.602 89.296  1.00 69.64  ? 600 HIS B ND1 1 
ATOM   3450 C CD2 . HIS A 1 439 ? -68.497  -24.136 91.361  1.00 69.39  ? 600 HIS B CD2 1 
ATOM   3451 C CE1 . HIS A 1 439 ? -68.027  -23.286 89.395  1.00 70.67  ? 600 HIS B CE1 1 
ATOM   3452 N NE2 . HIS A 1 439 ? -68.354  -22.979 90.638  1.00 70.61  ? 600 HIS B NE2 1 
ATOM   3453 N N   . GLY A 1 440 ? -64.799  -26.320 91.065  1.00 65.12  ? 601 GLY B N   1 
ATOM   3454 C CA  . GLY A 1 440 ? -63.786  -25.768 91.963  1.00 64.45  ? 601 GLY B CA  1 
ATOM   3455 C C   . GLY A 1 440 ? -62.726  -26.733 92.462  1.00 63.52  ? 601 GLY B C   1 
ATOM   3456 O O   . GLY A 1 440 ? -62.059  -26.459 93.459  1.00 63.26  ? 601 GLY B O   1 
ATOM   3457 N N   . ASP A 1 441 ? -62.563  -27.857 91.774  1.00 64.51  ? 602 ASP B N   1 
ATOM   3458 C CA  . ASP A 1 441 ? -61.520  -28.822 92.126  1.00 66.39  ? 602 ASP B CA  1 
ATOM   3459 C C   . ASP A 1 441 ? -60.131  -28.347 91.702  1.00 66.56  ? 602 ASP B C   1 
ATOM   3460 O O   . ASP A 1 441 ? -59.122  -28.773 92.272  1.00 67.35  ? 602 ASP B O   1 
ATOM   3461 C CB  . ASP A 1 441 ? -61.817  -30.195 91.511  1.00 66.46  ? 602 ASP B CB  1 
ATOM   3462 C CG  . ASP A 1 441 ? -62.935  -30.936 92.230  1.00 66.42  ? 602 ASP B CG  1 
ATOM   3463 O OD1 . ASP A 1 441 ? -63.559  -30.370 93.151  1.00 66.73  ? 602 ASP B OD1 1 
ATOM   3464 O OD2 . ASP A 1 441 ? -63.190  -32.100 91.865  1.00 66.83  ? 602 ASP B OD2 1 
ATOM   3465 N N   . GLU A 1 442 ? -60.094  -27.462 90.706  1.00 66.17  ? 603 GLU B N   1 
ATOM   3466 C CA  . GLU A 1 442 ? -58.844  -26.957 90.134  1.00 65.18  ? 603 GLU B CA  1 
ATOM   3467 C C   . GLU A 1 442 ? -58.109  -25.988 91.062  1.00 63.25  ? 603 GLU B C   1 
ATOM   3468 O O   . GLU A 1 442 ? -56.880  -25.884 91.004  1.00 62.23  ? 603 GLU B O   1 
ATOM   3469 C CB  . GLU A 1 442 ? -59.096  -26.310 88.763  1.00 66.29  ? 603 GLU B CB  1 
ATOM   3470 C CG  . GLU A 1 442 ? -59.755  -24.931 88.791  1.00 68.66  ? 603 GLU B CG  1 
ATOM   3471 C CD  . GLU A 1 442 ? -61.275  -24.969 88.894  1.00 71.45  ? 603 GLU B CD  1 
ATOM   3472 O OE1 . GLU A 1 442 ? -61.834  -25.962 89.405  1.00 73.71  ? 603 GLU B OE1 1 
ATOM   3473 O OE2 . GLU A 1 442 ? -61.920  -23.990 88.462  1.00 72.63  ? 603 GLU B OE2 1 
ATOM   3474 N N   . ILE A 1 443 ? -58.866  -25.297 91.916  1.00 61.42  ? 604 ILE B N   1 
ATOM   3475 C CA  . ILE A 1 443 ? -58.322  -24.279 92.824  1.00 60.39  ? 604 ILE B CA  1 
ATOM   3476 C C   . ILE A 1 443 ? -57.079  -24.772 93.568  1.00 60.18  ? 604 ILE B C   1 
ATOM   3477 O O   . ILE A 1 443 ? -56.060  -24.078 93.609  1.00 59.90  ? 604 ILE B O   1 
ATOM   3478 C CB  . ILE A 1 443 ? -59.378  -23.783 93.851  1.00 59.40  ? 604 ILE B CB  1 
ATOM   3479 C CG1 . ILE A 1 443 ? -60.695  -23.393 93.167  1.00 58.07  ? 604 ILE B CG1 1 
ATOM   3480 C CG2 . ILE A 1 443 ? -58.834  -22.622 94.678  1.00 58.82  ? 604 ILE B CG2 1 
ATOM   3481 C CD1 . ILE A 1 443 ? -60.614  -22.150 92.313  1.00 57.99  ? 604 ILE B CD1 1 
ATOM   3482 N N   . ASN A 1 444 ? -57.174  -25.974 94.137  1.00 59.91  ? 605 ASN B N   1 
ATOM   3483 C CA  . ASN A 1 444 ? -56.088  -26.566 94.918  1.00 60.19  ? 605 ASN B CA  1 
ATOM   3484 C C   . ASN A 1 444 ? -54.784  -26.662 94.138  1.00 59.59  ? 605 ASN B C   1 
ATOM   3485 O O   . ASN A 1 444 ? -53.708  -26.419 94.682  1.00 60.03  ? 605 ASN B O   1 
ATOM   3486 C CB  . ASN A 1 444 ? -56.479  -27.956 95.427  1.00 61.21  ? 605 ASN B CB  1 
ATOM   3487 C CG  . ASN A 1 444 ? -57.842  -27.977 96.082  1.00 61.73  ? 605 ASN B CG  1 
ATOM   3488 O OD1 . ASN A 1 444 ? -58.870  -27.874 95.409  1.00 62.85  ? 605 ASN B OD1 1 
ATOM   3489 N ND2 . ASN A 1 444 ? -57.860  -28.122 97.402  1.00 61.56  ? 605 ASN B ND2 1 
ATOM   3490 N N   . TYR A 1 445 ? -54.887  -27.009 92.861  1.00 58.70  ? 606 TYR B N   1 
ATOM   3491 C CA  . TYR A 1 445 ? -53.709  -27.168 92.024  1.00 58.99  ? 606 TYR B CA  1 
ATOM   3492 C C   . TYR A 1 445 ? -53.211  -25.832 91.485  1.00 58.91  ? 606 TYR B C   1 
ATOM   3493 O O   . TYR A 1 445 ? -52.009  -25.651 91.296  1.00 57.66  ? 606 TYR B O   1 
ATOM   3494 C CB  . TYR A 1 445 ? -53.978  -28.175 90.903  1.00 59.33  ? 606 TYR B CB  1 
ATOM   3495 C CG  . TYR A 1 445 ? -54.147  -29.591 91.410  1.00 59.93  ? 606 TYR B CG  1 
ATOM   3496 C CD1 . TYR A 1 445 ? -55.344  -30.004 92.001  1.00 60.46  ? 606 TYR B CD1 1 
ATOM   3497 C CD2 . TYR A 1 445 ? -53.106  -30.515 91.314  1.00 59.41  ? 606 TYR B CD2 1 
ATOM   3498 C CE1 . TYR A 1 445 ? -55.503  -31.296 92.472  1.00 60.76  ? 606 TYR B CE1 1 
ATOM   3499 C CE2 . TYR A 1 445 ? -53.256  -31.811 91.784  1.00 60.01  ? 606 TYR B CE2 1 
ATOM   3500 C CZ  . TYR A 1 445 ? -54.456  -32.194 92.363  1.00 60.71  ? 606 TYR B CZ  1 
ATOM   3501 O OH  . TYR A 1 445 ? -54.617  -33.478 92.832  1.00 61.12  ? 606 TYR B OH  1 
ATOM   3502 N N   . VAL A 1 446 ? -54.140  -24.903 91.257  1.00 60.28  ? 607 VAL B N   1 
ATOM   3503 C CA  . VAL A 1 446 ? -53.809  -23.544 90.811  1.00 61.71  ? 607 VAL B CA  1 
ATOM   3504 C C   . VAL A 1 446 ? -52.958  -22.808 91.851  1.00 63.20  ? 607 VAL B C   1 
ATOM   3505 O O   . VAL A 1 446 ? -51.977  -22.148 91.501  1.00 64.16  ? 607 VAL B O   1 
ATOM   3506 C CB  . VAL A 1 446 ? -55.080  -22.723 90.464  1.00 61.27  ? 607 VAL B CB  1 
ATOM   3507 C CG1 . VAL A 1 446 ? -54.769  -21.240 90.306  1.00 60.59  ? 607 VAL B CG1 1 
ATOM   3508 C CG2 . VAL A 1 446 ? -55.727  -23.252 89.193  1.00 61.48  ? 607 VAL B CG2 1 
ATOM   3509 N N   . PHE A 1 447 ? -53.324  -22.936 93.124  1.00 64.00  ? 608 PHE B N   1 
ATOM   3510 C CA  . PHE A 1 447 ? -52.609  -22.242 94.195  1.00 65.90  ? 608 PHE B CA  1 
ATOM   3511 C C   . PHE A 1 447 ? -51.450  -23.035 94.795  1.00 67.78  ? 608 PHE B C   1 
ATOM   3512 O O   . PHE A 1 447 ? -50.810  -22.577 95.746  1.00 70.62  ? 608 PHE B O   1 
ATOM   3513 C CB  . PHE A 1 447 ? -53.578  -21.779 95.287  1.00 65.57  ? 608 PHE B CB  1 
ATOM   3514 C CG  . PHE A 1 447 ? -54.307  -20.515 94.943  1.00 65.64  ? 608 PHE B CG  1 
ATOM   3515 C CD1 . PHE A 1 447 ? -53.667  -19.284 95.033  1.00 65.15  ? 608 PHE B CD1 1 
ATOM   3516 C CD2 . PHE A 1 447 ? -55.630  -20.552 94.521  1.00 65.66  ? 608 PHE B CD2 1 
ATOM   3517 C CE1 . PHE A 1 447 ? -54.333  -18.114 94.710  1.00 64.48  ? 608 PHE B CE1 1 
ATOM   3518 C CE2 . PHE A 1 447 ? -56.303  -19.384 94.199  1.00 64.73  ? 608 PHE B CE2 1 
ATOM   3519 C CZ  . PHE A 1 447 ? -55.652  -18.166 94.294  1.00 64.68  ? 608 PHE B CZ  1 
ATOM   3520 N N   . GLY A 1 448 ? -51.183  -24.214 94.232  1.00 67.05  ? 609 GLY B N   1 
ATOM   3521 C CA  . GLY A 1 448 ? -50.050  -25.042 94.644  1.00 66.54  ? 609 GLY B CA  1 
ATOM   3522 C C   . GLY A 1 448 ? -50.186  -25.681 96.010  1.00 66.33  ? 609 GLY B C   1 
ATOM   3523 O O   . GLY A 1 448 ? -49.239  -25.696 96.797  1.00 67.15  ? 609 GLY B O   1 
ATOM   3524 N N   . GLU A 1 449 ? -51.371  -26.217 96.288  1.00 65.95  ? 610 GLU B N   1 
ATOM   3525 C CA  . GLU A 1 449 ? -51.630  -26.902 97.548  1.00 65.55  ? 610 GLU B CA  1 
ATOM   3526 C C   . GLU A 1 449 ? -50.973  -28.288 97.625  1.00 63.92  ? 610 GLU B C   1 
ATOM   3527 O O   . GLU A 1 449 ? -50.636  -28.735 98.721  1.00 63.82  ? 610 GLU B O   1 
ATOM   3528 C CB  . GLU A 1 449 ? -53.135  -27.002 97.809  1.00 67.15  ? 610 GLU B CB  1 
ATOM   3529 C CG  . GLU A 1 449 ? -53.508  -26.935 99.279  1.00 69.47  ? 610 GLU B CG  1 
ATOM   3530 C CD  . GLU A 1 449 ? -54.867  -27.544 99.568  1.00 71.39  ? 610 GLU B CD  1 
ATOM   3531 O OE1 . GLU A 1 449 ? -55.688  -26.870 100.223 1.00 72.52  ? 610 GLU B OE1 1 
ATOM   3532 O OE2 . GLU A 1 449 ? -55.113  -28.694 99.143  1.00 71.47  ? 610 GLU B OE2 1 
ATOM   3533 N N   . PRO A 1 450 ? -50.796  -28.979 96.474  1.00 62.47  ? 611 PRO B N   1 
ATOM   3534 C CA  . PRO A 1 450 ? -50.052  -30.243 96.497  1.00 62.24  ? 611 PRO B CA  1 
ATOM   3535 C C   . PRO A 1 450 ? -48.596  -30.102 96.927  1.00 62.85  ? 611 PRO B C   1 
ATOM   3536 O O   . PRO A 1 450 ? -48.001  -31.070 97.408  1.00 62.58  ? 611 PRO B O   1 
ATOM   3537 C CB  . PRO A 1 450 ? -50.126  -30.714 95.045  1.00 61.72  ? 611 PRO B CB  1 
ATOM   3538 C CG  . PRO A 1 450 ? -51.409  -30.151 94.555  1.00 61.43  ? 611 PRO B CG  1 
ATOM   3539 C CD  . PRO A 1 450 ? -51.466  -28.787 95.173  1.00 61.94  ? 611 PRO B CD  1 
ATOM   3540 N N   . LEU A 1 451 ? -48.040  -28.903 96.757  1.00 63.21  ? 612 LEU B N   1 
ATOM   3541 C CA  . LEU A 1 451 ? -46.661  -28.614 97.149  1.00 63.47  ? 612 LEU B CA  1 
ATOM   3542 C C   . LEU A 1 451 ? -46.491  -28.526 98.667  1.00 64.09  ? 612 LEU B C   1 
ATOM   3543 O O   . LEU A 1 451 ? -45.375  -28.359 99.165  1.00 64.53  ? 612 LEU B O   1 
ATOM   3544 C CB  . LEU A 1 451 ? -46.163  -27.336 96.469  1.00 62.59  ? 612 LEU B CB  1 
ATOM   3545 C CG  . LEU A 1 451 ? -45.496  -27.467 95.096  1.00 62.16  ? 612 LEU B CG  1 
ATOM   3546 C CD1 . LEU A 1 451 ? -46.419  -28.054 94.039  1.00 62.35  ? 612 LEU B CD1 1 
ATOM   3547 C CD2 . LEU A 1 451 ? -44.990  -26.108 94.650  1.00 63.02  ? 612 LEU B CD2 1 
ATOM   3548 N N   . ASN A 1 452 ? -47.604  -28.634 99.388  1.00 64.80  ? 613 ASN B N   1 
ATOM   3549 C CA  . ASN A 1 452 ? -47.585  -28.794 100.836 1.00 65.66  ? 613 ASN B CA  1 
ATOM   3550 C C   . ASN A 1 452 ? -47.516  -30.283 101.188 1.00 66.02  ? 613 ASN B C   1 
ATOM   3551 O O   . ASN A 1 452 ? -48.500  -31.012 101.013 1.00 66.02  ? 613 ASN B O   1 
ATOM   3552 C CB  . ASN A 1 452 ? -48.819  -28.138 101.465 1.00 66.42  ? 613 ASN B CB  1 
ATOM   3553 C CG  . ASN A 1 452 ? -48.708  -27.997 102.973 1.00 66.87  ? 613 ASN B CG  1 
ATOM   3554 O OD1 . ASN A 1 452 ? -47.842  -28.597 103.612 1.00 67.25  ? 613 ASN B OD1 1 
ATOM   3555 N ND2 . ASN A 1 452 ? -49.594  -27.195 103.552 1.00 67.68  ? 613 ASN B ND2 1 
ATOM   3556 N N   . PRO A 1 453 ? -46.350  -30.741 101.685 1.00 65.93  ? 614 PRO B N   1 
ATOM   3557 C CA  . PRO A 1 453 ? -46.136  -32.171 101.931 1.00 65.59  ? 614 PRO B CA  1 
ATOM   3558 C C   . PRO A 1 453 ? -46.954  -32.735 103.099 1.00 64.84  ? 614 PRO B C   1 
ATOM   3559 O O   . PRO A 1 453 ? -47.082  -33.954 103.228 1.00 65.27  ? 614 PRO B O   1 
ATOM   3560 C CB  . PRO A 1 453 ? -44.636  -32.256 102.228 1.00 64.78  ? 614 PRO B CB  1 
ATOM   3561 C CG  . PRO A 1 453 ? -44.279  -30.913 102.757 1.00 63.85  ? 614 PRO B CG  1 
ATOM   3562 C CD  . PRO A 1 453 ? -45.172  -29.933 102.057 1.00 64.80  ? 614 PRO B CD  1 
ATOM   3563 N N   . THR A 1 454 ? -47.509  -31.853 103.928 1.00 62.63  ? 615 THR B N   1 
ATOM   3564 C CA  . THR A 1 454 ? -48.317  -32.270 105.071 1.00 61.33  ? 615 THR B CA  1 
ATOM   3565 C C   . THR A 1 454 ? -49.730  -32.670 104.654 1.00 60.48  ? 615 THR B C   1 
ATOM   3566 O O   . THR A 1 454 ? -50.504  -33.176 105.470 1.00 60.36  ? 615 THR B O   1 
ATOM   3567 C CB  . THR A 1 454 ? -48.411  -31.165 106.141 1.00 62.11  ? 615 THR B CB  1 
ATOM   3568 O OG1 . THR A 1 454 ? -49.175  -30.063 105.633 1.00 63.02  ? 615 THR B OG1 1 
ATOM   3569 C CG2 . THR A 1 454 ? -47.024  -30.684 106.550 1.00 62.26  ? 615 THR B CG2 1 
ATOM   3570 N N   . LEU A 1 455 ? -50.063  -32.438 103.388 1.00 60.38  ? 616 LEU B N   1 
ATOM   3571 C CA  . LEU A 1 455 ? -51.395  -32.761 102.872 1.00 60.40  ? 616 LEU B CA  1 
ATOM   3572 C C   . LEU A 1 455 ? -51.432  -34.074 102.079 1.00 60.64  ? 616 LEU B C   1 
ATOM   3573 O O   . LEU A 1 455 ? -52.501  -34.533 101.673 1.00 60.62  ? 616 LEU B O   1 
ATOM   3574 C CB  . LEU A 1 455 ? -51.960  -31.591 102.057 1.00 58.66  ? 616 LEU B CB  1 
ATOM   3575 C CG  . LEU A 1 455 ? -52.206  -30.302 102.851 1.00 57.52  ? 616 LEU B CG  1 
ATOM   3576 C CD1 . LEU A 1 455 ? -52.372  -29.121 101.911 1.00 57.50  ? 616 LEU B CD1 1 
ATOM   3577 C CD2 . LEU A 1 455 ? -53.407  -30.425 103.780 1.00 57.15  ? 616 LEU B CD2 1 
ATOM   3578 N N   . GLY A 1 456 ? -50.257  -34.668 101.872 1.00 60.62  ? 617 GLY B N   1 
ATOM   3579 C CA  . GLY A 1 456 ? -50.139  -36.015 101.316 1.00 60.34  ? 617 GLY B CA  1 
ATOM   3580 C C   . GLY A 1 456 ? -50.634  -36.208 99.895  1.00 60.27  ? 617 GLY B C   1 
ATOM   3581 O O   . GLY A 1 456 ? -51.233  -37.236 99.583  1.00 59.96  ? 617 GLY B O   1 
ATOM   3582 N N   . TYR A 1 457 ? -50.386  -35.222 99.038  1.00 61.58  ? 618 TYR B N   1 
ATOM   3583 C CA  . TYR A 1 457 ? -50.685  -35.338 97.611  1.00 63.18  ? 618 TYR B CA  1 
ATOM   3584 C C   . TYR A 1 457 ? -49.661  -36.252 96.940  1.00 64.27  ? 618 TYR B C   1 
ATOM   3585 O O   . TYR A 1 457 ? -48.486  -36.252 97.319  1.00 64.67  ? 618 TYR B O   1 
ATOM   3586 C CB  . TYR A 1 457 ? -50.636  -33.964 96.947  1.00 63.68  ? 618 TYR B CB  1 
ATOM   3587 C CG  . TYR A 1 457 ? -51.889  -33.122 97.081  1.00 63.92  ? 618 TYR B CG  1 
ATOM   3588 C CD1 . TYR A 1 457 ? -52.107  -32.329 98.209  1.00 64.05  ? 618 TYR B CD1 1 
ATOM   3589 C CD2 . TYR A 1 457 ? -52.838  -33.088 96.060  1.00 63.79  ? 618 TYR B CD2 1 
ATOM   3590 C CE1 . TYR A 1 457 ? -53.243  -31.539 98.320  1.00 63.47  ? 618 TYR B CE1 1 
ATOM   3591 C CE2 . TYR A 1 457 ? -53.976  -32.304 96.162  1.00 62.68  ? 618 TYR B CE2 1 
ATOM   3592 C CZ  . TYR A 1 457 ? -54.173  -31.533 97.292  1.00 62.87  ? 618 TYR B CZ  1 
ATOM   3593 O OH  . TYR A 1 457 ? -55.302  -30.756 97.392  1.00 63.05  ? 618 TYR B OH  1 
ATOM   3594 N N   . THR A 1 458 ? -50.102  -37.013 95.937  1.00 65.40  ? 619 THR B N   1 
ATOM   3595 C CA  . THR A 1 458 ? -49.218  -37.947 95.223  1.00 67.18  ? 619 THR B CA  1 
ATOM   3596 C C   . THR A 1 458 ? -48.127  -37.210 94.442  1.00 68.99  ? 619 THR B C   1 
ATOM   3597 O O   . THR A 1 458 ? -48.267  -36.025 94.134  1.00 69.17  ? 619 THR B O   1 
ATOM   3598 C CB  . THR A 1 458 ? -49.987  -38.899 94.271  1.00 67.11  ? 619 THR B CB  1 
ATOM   3599 O OG1 . THR A 1 458 ? -50.214  -38.263 93.007  1.00 66.90  ? 619 THR B OG1 1 
ATOM   3600 C CG2 . THR A 1 458 ? -51.316  -39.336 94.875  1.00 67.31  ? 619 THR B CG2 1 
ATOM   3601 N N   . GLU A 1 459 ? -47.049  -37.925 94.126  1.00 71.80  ? 620 GLU B N   1 
ATOM   3602 C CA  . GLU A 1 459 ? -45.902  -37.348 93.426  1.00 74.45  ? 620 GLU B CA  1 
ATOM   3603 C C   . GLU A 1 459 ? -46.265  -36.824 92.033  1.00 74.51  ? 620 GLU B C   1 
ATOM   3604 O O   . GLU A 1 459 ? -45.784  -35.766 91.623  1.00 76.02  ? 620 GLU B O   1 
ATOM   3605 C CB  . GLU A 1 459 ? -44.751  -38.362 93.353  1.00 76.64  ? 620 GLU B CB  1 
ATOM   3606 C CG  . GLU A 1 459 ? -43.392  -37.771 92.985  1.00 79.24  ? 620 GLU B CG  1 
ATOM   3607 C CD  . GLU A 1 459 ? -42.926  -36.676 93.934  1.00 80.58  ? 620 GLU B CD  1 
ATOM   3608 O OE1 . GLU A 1 459 ? -43.143  -36.792 95.161  1.00 80.42  ? 620 GLU B OE1 1 
ATOM   3609 O OE2 . GLU A 1 459 ? -42.331  -35.691 93.447  1.00 82.99  ? 620 GLU B OE2 1 
ATOM   3610 N N   . ASP A 1 460 ? -47.117  -37.561 91.320  1.00 73.24  ? 621 ASP B N   1 
ATOM   3611 C CA  . ASP A 1 460 ? -47.621  -37.126 90.015  1.00 72.56  ? 621 ASP B CA  1 
ATOM   3612 C C   . ASP A 1 460 ? -48.508  -35.885 90.130  1.00 72.39  ? 621 ASP B C   1 
ATOM   3613 O O   . ASP A 1 460 ? -48.471  -35.008 89.264  1.00 72.34  ? 621 ASP B O   1 
ATOM   3614 C CB  . ASP A 1 460 ? -48.376  -38.262 89.315  1.00 72.06  ? 621 ASP B CB  1 
ATOM   3615 C CG  . ASP A 1 460 ? -47.446  -39.265 88.647  1.00 71.82  ? 621 ASP B CG  1 
ATOM   3616 O OD1 . ASP A 1 460 ? -46.277  -39.388 89.072  1.00 72.68  ? 621 ASP B OD1 1 
ATOM   3617 O OD2 . ASP A 1 460 ? -47.888  -39.936 87.692  1.00 70.66  ? 621 ASP B OD2 1 
ATOM   3618 N N   . GLU A 1 461 ? -49.295  -35.822 91.205  1.00 72.06  ? 622 GLU B N   1 
ATOM   3619 C CA  . GLU A 1 461 ? -50.139  -34.662 91.501  1.00 71.28  ? 622 GLU B CA  1 
ATOM   3620 C C   . GLU A 1 461 ? -49.309  -33.429 91.852  1.00 72.09  ? 622 GLU B C   1 
ATOM   3621 O O   . GLU A 1 461 ? -49.695  -32.302 91.528  1.00 74.57  ? 622 GLU B O   1 
ATOM   3622 C CB  . GLU A 1 461 ? -51.117  -34.977 92.636  1.00 69.76  ? 622 GLU B CB  1 
ATOM   3623 C CG  . GLU A 1 461 ? -52.291  -35.848 92.220  1.00 70.04  ? 622 GLU B CG  1 
ATOM   3624 C CD  . GLU A 1 461 ? -53.142  -36.308 93.391  1.00 70.87  ? 622 GLU B CD  1 
ATOM   3625 O OE1 . GLU A 1 461 ? -52.781  -36.037 94.559  1.00 69.67  ? 622 GLU B OE1 1 
ATOM   3626 O OE2 . GLU A 1 461 ? -54.183  -36.952 93.139  1.00 71.99  ? 622 GLU B OE2 1 
ATOM   3627 N N   . LYS A 1 462 ? -48.174  -33.649 92.515  1.00 70.69  ? 623 LYS B N   1 
ATOM   3628 C CA  . LYS A 1 462 ? -47.240  -32.573 92.845  1.00 69.85  ? 623 LYS B CA  1 
ATOM   3629 C C   . LYS A 1 462 ? -46.668  -31.937 91.578  1.00 70.40  ? 623 LYS B C   1 
ATOM   3630 O O   . LYS A 1 462 ? -46.520  -30.715 91.503  1.00 71.51  ? 623 LYS B O   1 
ATOM   3631 C CB  . LYS A 1 462 ? -46.113  -33.084 93.749  1.00 68.91  ? 623 LYS B CB  1 
ATOM   3632 C CG  . LYS A 1 462 ? -46.533  -33.353 95.187  1.00 67.97  ? 623 LYS B CG  1 
ATOM   3633 C CD  . LYS A 1 462 ? -45.365  -33.842 96.033  1.00 67.00  ? 623 LYS B CD  1 
ATOM   3634 C CE  . LYS A 1 462 ? -45.800  -34.142 97.459  1.00 65.24  ? 623 LYS B CE  1 
ATOM   3635 N NZ  . LYS A 1 462 ? -44.639  -34.377 98.360  1.00 62.81  ? 623 LYS B NZ  1 
ATOM   3636 N N   . ASP A 1 463 ? -46.359  -32.771 90.587  1.00 69.86  ? 624 ASP B N   1 
ATOM   3637 C CA  . ASP A 1 463 ? -45.867  -32.301 89.292  1.00 69.17  ? 624 ASP B CA  1 
ATOM   3638 C C   . ASP A 1 463 ? -46.976  -31.637 88.483  1.00 67.79  ? 624 ASP B C   1 
ATOM   3639 O O   . ASP A 1 463 ? -46.733  -30.659 87.773  1.00 67.82  ? 624 ASP B O   1 
ATOM   3640 C CB  . ASP A 1 463 ? -45.253  -33.456 88.496  1.00 69.20  ? 624 ASP B CB  1 
ATOM   3641 C CG  . ASP A 1 463 ? -43.928  -33.929 89.072  1.00 69.67  ? 624 ASP B CG  1 
ATOM   3642 O OD1 . ASP A 1 463 ? -43.505  -33.423 90.136  1.00 69.71  ? 624 ASP B OD1 1 
ATOM   3643 O OD2 . ASP A 1 463 ? -43.305  -34.814 88.452  1.00 70.33  ? 624 ASP B OD2 1 
ATOM   3644 N N   . PHE A 1 464 ? -48.187  -32.176 88.604  1.00 66.37  ? 625 PHE B N   1 
ATOM   3645 C CA  . PHE A 1 464 ? -49.366  -31.645 87.925  1.00 65.51  ? 625 PHE B CA  1 
ATOM   3646 C C   . PHE A 1 464 ? -49.668  -30.212 88.364  1.00 65.78  ? 625 PHE B C   1 
ATOM   3647 O O   . PHE A 1 464 ? -50.034  -29.367 87.541  1.00 65.18  ? 625 PHE B O   1 
ATOM   3648 C CB  . PHE A 1 464 ? -50.574  -32.557 88.179  1.00 64.58  ? 625 PHE B CB  1 
ATOM   3649 C CG  . PHE A 1 464 ? -51.803  -32.187 87.392  1.00 63.69  ? 625 PHE B CG  1 
ATOM   3650 C CD1 . PHE A 1 464 ? -51.825  -32.299 86.003  1.00 63.45  ? 625 PHE B CD1 1 
ATOM   3651 C CD2 . PHE A 1 464 ? -52.950  -31.748 88.041  1.00 63.15  ? 625 PHE B CD2 1 
ATOM   3652 C CE1 . PHE A 1 464 ? -52.959  -31.962 85.281  1.00 62.53  ? 625 PHE B CE1 1 
ATOM   3653 C CE2 . PHE A 1 464 ? -54.087  -31.412 87.324  1.00 63.13  ? 625 PHE B CE2 1 
ATOM   3654 C CZ  . PHE A 1 464 ? -54.092  -31.520 85.943  1.00 62.45  ? 625 PHE B CZ  1 
ATOM   3655 N N   . SER A 1 465 ? -49.500  -29.946 89.659  1.00 65.85  ? 626 SER B N   1 
ATOM   3656 C CA  . SER A 1 465 ? -49.709  -28.613 90.211  1.00 66.72  ? 626 SER B CA  1 
ATOM   3657 C C   . SER A 1 465 ? -48.684  -27.613 89.677  1.00 68.46  ? 626 SER B C   1 
ATOM   3658 O O   . SER A 1 465 ? -49.051  -26.510 89.273  1.00 70.41  ? 626 SER B O   1 
ATOM   3659 C CB  . SER A 1 465 ? -49.676  -28.645 91.736  1.00 66.57  ? 626 SER B CB  1 
ATOM   3660 O OG  . SER A 1 465 ? -50.077  -27.397 92.272  1.00 66.85  ? 626 SER B OG  1 
ATOM   3661 N N   . ARG A 1 466 ? -47.409  -28.004 89.668  1.00 69.10  ? 627 ARG B N   1 
ATOM   3662 C CA  . ARG A 1 466 ? -46.343  -27.178 89.090  1.00 69.02  ? 627 ARG B CA  1 
ATOM   3663 C C   . ARG A 1 466 ? -46.566  -26.911 87.605  1.00 67.98  ? 627 ARG B C   1 
ATOM   3664 O O   . ARG A 1 466 ? -46.184  -25.856 87.098  1.00 67.21  ? 627 ARG B O   1 
ATOM   3665 C CB  . ARG A 1 466 ? -44.974  -27.829 89.286  1.00 70.19  ? 627 ARG B CB  1 
ATOM   3666 C CG  . ARG A 1 466 ? -44.375  -27.626 90.665  1.00 72.28  ? 627 ARG B CG  1 
ATOM   3667 C CD  . ARG A 1 466 ? -42.917  -28.055 90.690  1.00 73.14  ? 627 ARG B CD  1 
ATOM   3668 N NE  . ARG A 1 466 ? -42.531  -28.584 91.996  1.00 73.69  ? 627 ARG B NE  1 
ATOM   3669 C CZ  . ARG A 1 466 ? -42.684  -29.853 92.372  1.00 73.38  ? 627 ARG B CZ  1 
ATOM   3670 N NH1 . ARG A 1 466 ? -43.219  -30.747 91.545  1.00 71.25  ? 627 ARG B NH1 1 
ATOM   3671 N NH2 . ARG A 1 466 ? -42.301  -30.231 93.583  1.00 74.30  ? 627 ARG B NH2 1 
ATOM   3672 N N   . LYS A 1 467 ? -47.180  -27.878 86.923  1.00 67.52  ? 628 LYS B N   1 
ATOM   3673 C CA  . LYS A 1 467 ? -47.490  -27.775 85.500  1.00 67.17  ? 628 LYS B CA  1 
ATOM   3674 C C   . LYS A 1 467 ? -48.544  -26.707 85.227  1.00 68.74  ? 628 LYS B C   1 
ATOM   3675 O O   . LYS A 1 467 ? -48.361  -25.868 84.341  1.00 70.66  ? 628 LYS B O   1 
ATOM   3676 C CB  . LYS A 1 467 ? -47.950  -29.131 84.951  1.00 65.71  ? 628 LYS B CB  1 
ATOM   3677 C CG  . LYS A 1 467 ? -48.310  -29.143 83.471  1.00 63.04  ? 628 LYS B CG  1 
ATOM   3678 C CD  . LYS A 1 467 ? -48.840  -30.509 83.061  1.00 61.59  ? 628 LYS B CD  1 
ATOM   3679 C CE  . LYS A 1 467 ? -49.356  -30.505 81.634  1.00 59.64  ? 628 LYS B CE  1 
ATOM   3680 N NZ  . LYS A 1 467 ? -49.747  -31.874 81.204  1.00 57.36  ? 628 LYS B NZ  1 
ATOM   3681 N N   . ILE A 1 468 ? -49.641  -26.737 85.985  1.00 68.76  ? 629 ILE B N   1 
ATOM   3682 C CA  . ILE A 1 468 ? -50.731  -25.785 85.762  1.00 69.20  ? 629 ILE B CA  1 
ATOM   3683 C C   . ILE A 1 468 ? -50.457  -24.422 86.408  1.00 68.23  ? 629 ILE B C   1 
ATOM   3684 O O   . ILE A 1 468 ? -50.974  -23.403 85.948  1.00 68.90  ? 629 ILE B O   1 
ATOM   3685 C CB  . ILE A 1 468 ? -52.135  -26.341 86.135  1.00 70.35  ? 629 ILE B CB  1 
ATOM   3686 C CG1 . ILE A 1 468 ? -52.375  -26.320 87.643  1.00 72.81  ? 629 ILE B CG1 1 
ATOM   3687 C CG2 . ILE A 1 468 ? -52.351  -27.740 85.564  1.00 69.29  ? 629 ILE B CG2 1 
ATOM   3688 C CD1 . ILE A 1 468 ? -53.841  -26.205 87.997  1.00 76.55  ? 629 ILE B CD1 1 
ATOM   3689 N N   . MET A 1 469 ? -49.639  -24.405 87.461  1.00 67.19  ? 630 MET B N   1 
ATOM   3690 C CA  . MET A 1 469 ? -49.171  -23.149 88.050  1.00 66.69  ? 630 MET B CA  1 
ATOM   3691 C C   . MET A 1 469 ? -48.326  -22.373 87.051  1.00 67.47  ? 630 MET B C   1 
ATOM   3692 O O   . MET A 1 469 ? -48.395  -21.147 86.993  1.00 68.34  ? 630 MET B O   1 
ATOM   3693 C CB  . MET A 1 469 ? -48.366  -23.395 89.323  1.00 65.40  ? 630 MET B CB  1 
ATOM   3694 C CG  . MET A 1 469 ? -49.203  -23.359 90.586  1.00 66.34  ? 630 MET B CG  1 
ATOM   3695 S SD  . MET A 1 469 ? -48.324  -23.982 92.028  1.00 69.19  ? 630 MET B SD  1 
ATOM   3696 C CE  . MET A 1 469 ? -47.199  -22.636 92.366  1.00 69.11  ? 630 MET B CE  1 
ATOM   3697 N N   . ARG A 1 470 ? -47.534  -23.100 86.267  1.00 67.84  ? 631 ARG B N   1 
ATOM   3698 C CA  . ARG A 1 470 ? -46.724  -22.500 85.220  1.00 67.12  ? 631 ARG B CA  1 
ATOM   3699 C C   . ARG A 1 470 ? -47.610  -21.943 84.115  1.00 67.40  ? 631 ARG B C   1 
ATOM   3700 O O   . ARG A 1 470 ? -47.547  -20.747 83.830  1.00 69.33  ? 631 ARG B O   1 
ATOM   3701 C CB  . ARG A 1 470 ? -45.709  -23.504 84.666  1.00 67.58  ? 631 ARG B CB  1 
ATOM   3702 C CG  . ARG A 1 470 ? -44.726  -22.938 83.646  1.00 68.38  ? 631 ARG B CG  1 
ATOM   3703 C CD  . ARG A 1 470 ? -43.994  -21.697 84.145  1.00 68.36  ? 631 ARG B CD  1 
ATOM   3704 N NE  . ARG A 1 470 ? -43.401  -21.882 85.468  1.00 67.80  ? 631 ARG B NE  1 
ATOM   3705 C CZ  . ARG A 1 470 ? -42.190  -22.381 85.692  1.00 67.97  ? 631 ARG B CZ  1 
ATOM   3706 N NH1 . ARG A 1 470 ? -41.418  -22.757 84.680  1.00 69.05  ? 631 ARG B NH1 1 
ATOM   3707 N NH2 . ARG A 1 470 ? -41.747  -22.504 86.934  1.00 68.46  ? 631 ARG B NH2 1 
ATOM   3708 N N   . TYR A 1 471 ? -48.439  -22.800 83.513  1.00 66.10  ? 632 TYR B N   1 
ATOM   3709 C CA  . TYR A 1 471 ? -49.387  -22.375 82.478  1.00 65.96  ? 632 TYR B CA  1 
ATOM   3710 C C   . TYR A 1 471 ? -50.037  -21.041 82.846  1.00 65.53  ? 632 TYR B C   1 
ATOM   3711 O O   . TYR A 1 471 ? -49.964  -20.072 82.088  1.00 65.15  ? 632 TYR B O   1 
ATOM   3712 C CB  . TYR A 1 471 ? -50.491  -23.418 82.276  1.00 66.73  ? 632 TYR B CB  1 
ATOM   3713 C CG  . TYR A 1 471 ? -50.157  -24.603 81.395  1.00 67.23  ? 632 TYR B CG  1 
ATOM   3714 C CD1 . TYR A 1 471 ? -49.232  -24.504 80.354  1.00 66.84  ? 632 TYR B CD1 1 
ATOM   3715 C CD2 . TYR A 1 471 ? -50.811  -25.820 81.579  1.00 68.12  ? 632 TYR B CD2 1 
ATOM   3716 C CE1 . TYR A 1 471 ? -48.947  -25.597 79.547  1.00 67.06  ? 632 TYR B CE1 1 
ATOM   3717 C CE2 . TYR A 1 471 ? -50.538  -26.914 80.776  1.00 68.28  ? 632 TYR B CE2 1 
ATOM   3718 C CZ  . TYR A 1 471 ? -49.607  -26.799 79.763  1.00 67.93  ? 632 TYR B CZ  1 
ATOM   3719 O OH  . TYR A 1 471 ? -49.348  -27.894 78.975  1.00 68.70  ? 632 TYR B OH  1 
ATOM   3720 N N   . TRP A 1 472 ? -50.664  -21.016 84.021  1.00 64.46  ? 633 TRP B N   1 
ATOM   3721 C CA  . TRP A 1 472 ? -51.309  -19.827 84.564  1.00 63.66  ? 633 TRP B CA  1 
ATOM   3722 C C   . TRP A 1 472 ? -50.333  -18.661 84.664  1.00 65.06  ? 633 TRP B C   1 
ATOM   3723 O O   . TRP A 1 472 ? -50.622  -17.560 84.191  1.00 66.13  ? 633 TRP B O   1 
ATOM   3724 C CB  . TRP A 1 472 ? -51.896  -20.140 85.945  1.00 60.99  ? 633 TRP B CB  1 
ATOM   3725 C CG  . TRP A 1 472 ? -53.359  -20.502 85.953  1.00 59.09  ? 633 TRP B CG  1 
ATOM   3726 C CD1 . TRP A 1 472 ? -54.340  -19.896 86.682  1.00 58.68  ? 633 TRP B CD1 1 
ATOM   3727 C CD2 . TRP A 1 472 ? -54.004  -21.549 85.208  1.00 57.82  ? 633 TRP B CD2 1 
ATOM   3728 N NE1 . TRP A 1 472 ? -55.552  -20.493 86.442  1.00 58.01  ? 633 TRP B NE1 1 
ATOM   3729 C CE2 . TRP A 1 472 ? -55.376  -21.510 85.540  1.00 58.16  ? 633 TRP B CE2 1 
ATOM   3730 C CE3 . TRP A 1 472 ? -53.558  -22.513 84.293  1.00 56.78  ? 633 TRP B CE3 1 
ATOM   3731 C CZ2 . TRP A 1 472 ? -56.308  -22.398 84.988  1.00 57.88  ? 633 TRP B CZ2 1 
ATOM   3732 C CZ3 . TRP A 1 472 ? -54.485  -23.394 83.746  1.00 56.48  ? 633 TRP B CZ3 1 
ATOM   3733 C CH2 . TRP A 1 472 ? -55.844  -23.330 84.096  1.00 57.13  ? 633 TRP B CH2 1 
ATOM   3734 N N   . SER A 1 473 ? -49.174  -18.926 85.262  1.00 66.13  ? 634 SER B N   1 
ATOM   3735 C CA  . SER A 1 473 ? -48.164  -17.906 85.534  1.00 67.05  ? 634 SER B CA  1 
ATOM   3736 C C   . SER A 1 473 ? -47.636  -17.235 84.270  1.00 67.61  ? 634 SER B C   1 
ATOM   3737 O O   . SER A 1 473 ? -47.778  -16.022 84.105  1.00 67.43  ? 634 SER B O   1 
ATOM   3738 C CB  . SER A 1 473 ? -47.010  -18.509 86.333  1.00 67.36  ? 634 SER B CB  1 
ATOM   3739 O OG  . SER A 1 473 ? -45.918  -17.613 86.431  1.00 69.74  ? 634 SER B OG  1 
ATOM   3740 N N   . ASN A 1 474 ? -47.030  -18.018 83.380  1.00 68.08  ? 635 ASN B N   1 
ATOM   3741 C CA  . ASN A 1 474 ? -46.457  -17.447 82.162  1.00 69.38  ? 635 ASN B CA  1 
ATOM   3742 C C   . ASN A 1 474 ? -47.507  -16.986 81.129  1.00 67.40  ? 635 ASN B C   1 
ATOM   3743 O O   . ASN A 1 474 ? -47.154  -16.415 80.097  1.00 67.64  ? 635 ASN B O   1 
ATOM   3744 C CB  . ASN A 1 474 ? -45.358  -18.344 81.555  1.00 72.07  ? 635 ASN B CB  1 
ATOM   3745 C CG  . ASN A 1 474 ? -45.835  -19.751 81.244  1.00 74.13  ? 635 ASN B CG  1 
ATOM   3746 O OD1 . ASN A 1 474 ? -47.032  -20.035 81.253  1.00 77.98  ? 635 ASN B OD1 1 
ATOM   3747 N ND2 . ASN A 1 474 ? -44.891  -20.641 80.955  1.00 73.33  ? 635 ASN B ND2 1 
ATOM   3748 N N   . PHE A 1 475 ? -48.786  -17.226 81.416  1.00 64.95  ? 636 PHE B N   1 
ATOM   3749 C CA  . PHE A 1 475 ? -49.864  -16.556 80.690  1.00 63.23  ? 636 PHE B CA  1 
ATOM   3750 C C   . PHE A 1 475 ? -50.028  -15.141 81.237  1.00 63.27  ? 636 PHE B C   1 
ATOM   3751 O O   . PHE A 1 475 ? -50.176  -14.184 80.476  1.00 63.69  ? 636 PHE B O   1 
ATOM   3752 C CB  . PHE A 1 475 ? -51.189  -17.321 80.791  1.00 61.13  ? 636 PHE B CB  1 
ATOM   3753 C CG  . PHE A 1 475 ? -52.375  -16.548 80.278  1.00 59.45  ? 636 PHE B CG  1 
ATOM   3754 C CD1 . PHE A 1 475 ? -52.638  -16.470 78.914  1.00 59.56  ? 636 PHE B CD1 1 
ATOM   3755 C CD2 . PHE A 1 475 ? -53.226  -15.888 81.158  1.00 58.95  ? 636 PHE B CD2 1 
ATOM   3756 C CE1 . PHE A 1 475 ? -53.728  -15.751 78.440  1.00 59.29  ? 636 PHE B CE1 1 
ATOM   3757 C CE2 . PHE A 1 475 ? -54.316  -15.167 80.690  1.00 58.48  ? 636 PHE B CE2 1 
ATOM   3758 C CZ  . PHE A 1 475 ? -54.568  -15.100 79.329  1.00 58.50  ? 636 PHE B CZ  1 
ATOM   3759 N N   . ALA A 1 476 ? -50.000  -15.022 82.563  1.00 62.71  ? 637 ALA B N   1 
ATOM   3760 C CA  . ALA A 1 476 ? -50.082  -13.729 83.236  1.00 62.99  ? 637 ALA B CA  1 
ATOM   3761 C C   . ALA A 1 476 ? -48.874  -12.868 82.896  1.00 63.85  ? 637 ALA B C   1 
ATOM   3762 O O   . ALA A 1 476 ? -48.940  -11.636 82.947  1.00 65.39  ? 637 ALA B O   1 
ATOM   3763 C CB  . ALA A 1 476 ? -50.189  -13.920 84.740  1.00 62.63  ? 637 ALA B CB  1 
ATOM   3764 N N   . LYS A 1 477 ? -47.774  -13.532 82.547  1.00 62.68  ? 638 LYS B N   1 
ATOM   3765 C CA  . LYS A 1 477 ? -46.531  -12.863 82.194  1.00 61.74  ? 638 LYS B CA  1 
ATOM   3766 C C   . LYS A 1 477 ? -46.486  -12.489 80.713  1.00 61.87  ? 638 LYS B C   1 
ATOM   3767 O O   . LYS A 1 477 ? -46.272  -11.327 80.371  1.00 62.76  ? 638 LYS B O   1 
ATOM   3768 C CB  . LYS A 1 477 ? -45.332  -13.747 82.541  1.00 60.40  ? 638 LYS B CB  1 
ATOM   3769 C CG  . LYS A 1 477 ? -45.091  -13.969 84.026  1.00 58.81  ? 638 LYS B CG  1 
ATOM   3770 C CD  . LYS A 1 477 ? -44.044  -15.057 84.222  1.00 58.89  ? 638 LYS B CD  1 
ATOM   3771 C CE  . LYS A 1 477 ? -43.506  -15.090 85.641  1.00 57.90  ? 638 LYS B CE  1 
ATOM   3772 N NZ  . LYS A 1 477 ? -42.628  -16.271 85.862  1.00 56.60  ? 638 LYS B NZ  1 
ATOM   3773 N N   . THR A 1 478 ? -46.699  -13.473 79.842  1.00 62.12  ? 639 THR B N   1 
ATOM   3774 C CA  . THR A 1 478 ? -46.450  -13.303 78.407  1.00 62.82  ? 639 THR B CA  1 
ATOM   3775 C C   . THR A 1 478 ? -47.713  -13.127 77.558  1.00 61.99  ? 639 THR B C   1 
ATOM   3776 O O   . THR A 1 478 ? -47.655  -12.536 76.481  1.00 62.38  ? 639 THR B O   1 
ATOM   3777 C CB  . THR A 1 478 ? -45.600  -14.464 77.823  1.00 65.09  ? 639 THR B CB  1 
ATOM   3778 O OG1 . THR A 1 478 ? -46.398  -15.651 77.703  1.00 65.73  ? 639 THR B OG1 1 
ATOM   3779 C CG2 . THR A 1 478 ? -44.375  -14.754 78.700  1.00 65.07  ? 639 THR B CG2 1 
ATOM   3780 N N   . GLY A 1 479 ? -48.843  -13.639 78.039  1.00 61.66  ? 640 GLY B N   1 
ATOM   3781 C CA  . GLY A 1 479 ? -50.081  -13.648 77.253  1.00 62.83  ? 640 GLY B CA  1 
ATOM   3782 C C   . GLY A 1 479 ? -50.273  -14.971 76.536  1.00 64.02  ? 640 GLY B C   1 
ATOM   3783 O O   . GLY A 1 479 ? -51.186  -15.129 75.721  1.00 63.06  ? 640 GLY B O   1 
ATOM   3784 N N   . ASN A 1 480 ? -49.394  -15.919 76.852  1.00 65.75  ? 641 ASN B N   1 
ATOM   3785 C CA  . ASN A 1 480 ? -49.420  -17.265 76.299  1.00 66.62  ? 641 ASN B CA  1 
ATOM   3786 C C   . ASN A 1 480 ? -48.909  -18.246 77.362  1.00 67.39  ? 641 ASN B C   1 
ATOM   3787 O O   . ASN A 1 480 ? -47.835  -18.036 77.932  1.00 67.33  ? 641 ASN B O   1 
ATOM   3788 C CB  . ASN A 1 480 ? -48.570  -17.322 75.021  1.00 66.30  ? 641 ASN B CB  1 
ATOM   3789 C CG  . ASN A 1 480 ? -48.513  -18.709 74.407  1.00 66.93  ? 641 ASN B CG  1 
ATOM   3790 O OD1 . ASN A 1 480 ? -47.852  -19.601 74.928  1.00 67.69  ? 641 ASN B OD1 1 
ATOM   3791 N ND2 . ASN A 1 480 ? -49.183  -18.886 73.277  1.00 67.79  ? 641 ASN B ND2 1 
ATOM   3792 N N   . PRO A 1 481 ? -49.681  -19.314 77.642  1.00 67.57  ? 642 PRO B N   1 
ATOM   3793 C CA  . PRO A 1 481 ? -49.320  -20.257 78.704  1.00 68.28  ? 642 PRO B CA  1 
ATOM   3794 C C   . PRO A 1 481 ? -48.161  -21.192 78.347  1.00 70.74  ? 642 PRO B C   1 
ATOM   3795 O O   . PRO A 1 481 ? -47.560  -21.782 79.244  1.00 72.14  ? 642 PRO B O   1 
ATOM   3796 C CB  . PRO A 1 481 ? -50.608  -21.056 78.915  1.00 67.15  ? 642 PRO B CB  1 
ATOM   3797 C CG  . PRO A 1 481 ? -51.302  -21.003 77.601  1.00 66.94  ? 642 PRO B CG  1 
ATOM   3798 C CD  . PRO A 1 481 ? -50.948  -19.682 76.983  1.00 66.95  ? 642 PRO B CD  1 
ATOM   3799 N N   . ASN A 1 482 ? -47.855  -21.328 77.059  1.00 73.24  ? 643 ASN B N   1 
ATOM   3800 C CA  . ASN A 1 482 ? -46.748  -22.172 76.611  1.00 76.58  ? 643 ASN B CA  1 
ATOM   3801 C C   . ASN A 1 482 ? -45.399  -21.543 76.942  1.00 82.29  ? 643 ASN B C   1 
ATOM   3802 O O   . ASN A 1 482 ? -45.270  -20.316 76.920  1.00 81.89  ? 643 ASN B O   1 
ATOM   3803 C CB  . ASN A 1 482 ? -46.827  -22.428 75.103  1.00 75.40  ? 643 ASN B CB  1 
ATOM   3804 C CG  . ASN A 1 482 ? -48.155  -23.017 74.671  1.00 74.94  ? 643 ASN B CG  1 
ATOM   3805 O OD1 . ASN A 1 482 ? -48.250  -24.209 74.390  1.00 75.85  ? 643 ASN B OD1 1 
ATOM   3806 N ND2 . ASN A 1 482 ? -49.186  -22.182 74.606  1.00 74.80  ? 643 ASN B ND2 1 
ATOM   3807 N N   . PRO A 1 483 ? -44.388  -22.376 77.267  1.00 88.26  ? 644 PRO B N   1 
ATOM   3808 C CA  . PRO A 1 483 ? -43.028  -21.856 77.402  1.00 92.84  ? 644 PRO B CA  1 
ATOM   3809 C C   . PRO A 1 483 ? -42.361  -21.705 76.032  1.00 98.05  ? 644 PRO B C   1 
ATOM   3810 O O   . PRO A 1 483 ? -42.941  -22.104 75.015  1.00 98.14  ? 644 PRO B O   1 
ATOM   3811 C CB  . PRO A 1 483 ? -42.314  -22.928 78.245  1.00 90.82  ? 644 PRO B CB  1 
ATOM   3812 C CG  . PRO A 1 483 ? -43.382  -23.868 78.714  1.00 89.18  ? 644 PRO B CG  1 
ATOM   3813 C CD  . PRO A 1 483 ? -44.465  -23.785 77.685  1.00 88.00  ? 644 PRO B CD  1 
ATOM   3814 N N   . ASN A 1 484 ? -41.159  -21.135 76.011  1.00 104.03 ? 645 ASN B N   1 
ATOM   3815 C CA  . ASN A 1 484 ? -40.430  -20.889 74.764  1.00 109.55 ? 645 ASN B CA  1 
ATOM   3816 C C   . ASN A 1 484 ? -39.934  -22.164 74.083  1.00 115.57 ? 645 ASN B C   1 
ATOM   3817 O O   . ASN A 1 484 ? -40.124  -22.342 72.877  1.00 117.00 ? 645 ASN B O   1 
ATOM   3818 C CB  . ASN A 1 484 ? -39.256  -19.934 74.999  1.00 107.72 ? 645 ASN B CB  1 
ATOM   3819 C CG  . ASN A 1 484 ? -39.695  -18.596 75.559  1.00 107.14 ? 645 ASN B CG  1 
ATOM   3820 O OD1 . ASN A 1 484 ? -39.903  -17.640 74.814  1.00 107.42 ? 645 ASN B OD1 1 
ATOM   3821 N ND2 . ASN A 1 484 ? -39.846  -18.524 76.877  1.00 106.43 ? 645 ASN B ND2 1 
ATOM   3822 N N   . THR A 1 485 ? -39.309  -23.044 74.866  1.00 122.21 ? 646 THR B N   1 
ATOM   3823 C CA  . THR A 1 485 ? -38.683  -24.268 74.348  1.00 124.86 ? 646 THR B CA  1 
ATOM   3824 C C   . THR A 1 485 ? -39.692  -25.357 73.967  1.00 124.98 ? 646 THR B C   1 
ATOM   3825 O O   . THR A 1 485 ? -39.504  -26.057 72.968  1.00 124.18 ? 646 THR B O   1 
ATOM   3826 C CB  . THR A 1 485 ? -37.651  -24.851 75.343  1.00 124.36 ? 646 THR B CB  1 
ATOM   3827 O OG1 . THR A 1 485 ? -38.290  -25.136 76.594  1.00 123.23 ? 646 THR B OG1 1 
ATOM   3828 C CG2 . THR A 1 485 ? -36.495  -23.875 75.569  1.00 121.89 ? 646 THR B CG2 1 
ATOM   3829 N N   . ALA A 1 486 ? -40.753  -25.484 74.766  1.00 125.84 ? 647 ALA B N   1 
ATOM   3830 C CA  . ALA A 1 486 ? -41.789  -26.513 74.597  1.00 127.12 ? 647 ALA B CA  1 
ATOM   3831 C C   . ALA A 1 486 ? -41.239  -27.943 74.707  1.00 127.39 ? 647 ALA B C   1 
ATOM   3832 O O   . ALA A 1 486 ? -41.034  -28.627 73.700  1.00 127.73 ? 647 ALA B O   1 
ATOM   3833 C CB  . ALA A 1 486 ? -42.565  -26.311 73.295  1.00 125.54 ? 647 ALA B CB  1 
ATOM   3834 N N   . SER A 1 487 ? -41.000  -28.372 75.945  1.00 126.13 ? 648 SER B N   1 
ATOM   3835 C CA  . SER A 1 487 ? -40.529  -29.727 76.235  1.00 124.24 ? 648 SER B CA  1 
ATOM   3836 C C   . SER A 1 487 ? -41.703  -30.701 76.386  1.00 123.69 ? 648 SER B C   1 
ATOM   3837 O O   . SER A 1 487 ? -42.862  -30.311 76.231  1.00 123.70 ? 648 SER B O   1 
ATOM   3838 C CB  . SER A 1 487 ? -39.652  -29.732 77.494  1.00 122.52 ? 648 SER B CB  1 
ATOM   3839 O OG  . SER A 1 487 ? -40.348  -29.194 78.604  1.00 118.78 ? 648 SER B OG  1 
ATOM   3840 N N   . SER A 1 488 ? -41.398  -31.964 76.681  1.00 122.65 ? 649 SER B N   1 
ATOM   3841 C CA  . SER A 1 488 ? -42.423  -33.003 76.825  1.00 119.40 ? 649 SER B CA  1 
ATOM   3842 C C   . SER A 1 488 ? -43.210  -32.901 78.136  1.00 116.55 ? 649 SER B C   1 
ATOM   3843 O O   . SER A 1 488 ? -44.378  -33.291 78.192  1.00 114.10 ? 649 SER B O   1 
ATOM   3844 C CB  . SER A 1 488 ? -41.809  -34.399 76.670  1.00 119.15 ? 649 SER B CB  1 
ATOM   3845 O OG  . SER A 1 488 ? -40.724  -34.588 77.560  1.00 119.57 ? 649 SER B OG  1 
ATOM   3846 N N   . GLU A 1 489 ? -42.568  -32.376 79.179  1.00 115.22 ? 650 GLU B N   1 
ATOM   3847 C CA  . GLU A 1 489 ? -43.214  -32.171 80.481  1.00 113.77 ? 650 GLU B CA  1 
ATOM   3848 C C   . GLU A 1 489 ? -44.235  -31.030 80.461  1.00 111.70 ? 650 GLU B C   1 
ATOM   3849 O O   . GLU A 1 489 ? -45.169  -31.013 81.267  1.00 111.30 ? 650 GLU B O   1 
ATOM   3850 C CB  . GLU A 1 489 ? -42.175  -31.944 81.588  1.00 116.25 ? 650 GLU B CB  1 
ATOM   3851 C CG  . GLU A 1 489 ? -41.185  -30.816 81.322  1.00 119.66 ? 650 GLU B CG  1 
ATOM   3852 C CD  . GLU A 1 489 ? -40.493  -30.312 82.578  1.00 123.05 ? 650 GLU B CD  1 
ATOM   3853 O OE1 . GLU A 1 489 ? -39.956  -29.184 82.544  1.00 124.30 ? 650 GLU B OE1 1 
ATOM   3854 O OE2 . GLU A 1 489 ? -40.483  -31.031 83.601  1.00 124.54 ? 650 GLU B OE2 1 
ATOM   3855 N N   . PHE A 1 490 ? -44.042  -30.080 79.546  1.00 108.47 ? 651 PHE B N   1 
ATOM   3856 C CA  . PHE A 1 490 ? -44.992  -28.990 79.316  1.00 102.34 ? 651 PHE B CA  1 
ATOM   3857 C C   . PHE A 1 490 ? -45.523  -29.040 77.881  1.00 96.69  ? 651 PHE B C   1 
ATOM   3858 O O   . PHE A 1 490 ? -44.979  -28.372 76.997  1.00 98.25  ? 651 PHE B O   1 
ATOM   3859 C CB  . PHE A 1 490 ? -44.343  -27.627 79.595  1.00 103.11 ? 651 PHE B CB  1 
ATOM   3860 C CG  . PHE A 1 490 ? -44.133  -27.336 81.054  1.00 105.21 ? 651 PHE B CG  1 
ATOM   3861 C CD1 . PHE A 1 490 ? -42.909  -27.603 81.662  1.00 105.73 ? 651 PHE B CD1 1 
ATOM   3862 C CD2 . PHE A 1 490 ? -45.155  -26.789 81.822  1.00 106.07 ? 651 PHE B CD2 1 
ATOM   3863 C CE1 . PHE A 1 490 ? -42.712  -27.337 83.010  1.00 105.27 ? 651 PHE B CE1 1 
ATOM   3864 C CE2 . PHE A 1 490 ? -44.962  -26.522 83.169  1.00 105.68 ? 651 PHE B CE2 1 
ATOM   3865 C CZ  . PHE A 1 490 ? -43.739  -26.794 83.764  1.00 104.95 ? 651 PHE B CZ  1 
ATOM   3866 N N   . PRO A 1 491 ? -46.589  -29.835 77.643  1.00 90.75  ? 652 PRO B N   1 
ATOM   3867 C CA  . PRO A 1 491 ? -47.189  -29.986 76.312  1.00 87.29  ? 652 PRO B CA  1 
ATOM   3868 C C   . PRO A 1 491 ? -47.669  -28.666 75.706  1.00 84.47  ? 652 PRO B C   1 
ATOM   3869 O O   . PRO A 1 491 ? -47.790  -27.662 76.411  1.00 82.29  ? 652 PRO B O   1 
ATOM   3870 C CB  . PRO A 1 491 ? -48.389  -30.900 76.570  1.00 87.46  ? 652 PRO B CB  1 
ATOM   3871 C CG  . PRO A 1 491 ? -48.035  -31.653 77.802  1.00 88.04  ? 652 PRO B CG  1 
ATOM   3872 C CD  . PRO A 1 491 ? -47.275  -30.674 78.643  1.00 89.49  ? 652 PRO B CD  1 
ATOM   3873 N N   . GLU A 1 492 ? -47.941  -28.680 74.404  1.00 83.68  ? 653 GLU B N   1 
ATOM   3874 C CA  . GLU A 1 492 ? -48.403  -27.489 73.701  1.00 81.02  ? 653 GLU B CA  1 
ATOM   3875 C C   . GLU A 1 492 ? -49.882  -27.231 73.969  1.00 75.76  ? 653 GLU B C   1 
ATOM   3876 O O   . GLU A 1 492 ? -50.687  -28.162 74.037  1.00 75.16  ? 653 GLU B O   1 
ATOM   3877 C CB  . GLU A 1 492 ? -48.154  -27.615 72.199  1.00 85.52  ? 653 GLU B CB  1 
ATOM   3878 C CG  . GLU A 1 492 ? -48.118  -26.283 71.466  1.00 91.36  ? 653 GLU B CG  1 
ATOM   3879 C CD  . GLU A 1 492 ? -48.508  -26.404 70.006  1.00 97.00  ? 653 GLU B CD  1 
ATOM   3880 O OE1 . GLU A 1 492 ? -48.170  -27.429 69.372  1.00 100.54 ? 653 GLU B OE1 1 
ATOM   3881 O OE2 . GLU A 1 492 ? -49.155  -25.469 69.489  1.00 98.60  ? 653 GLU B OE2 1 
ATOM   3882 N N   . TRP A 1 493 ? -50.221  -25.955 74.123  1.00 71.06  ? 654 TRP B N   1 
ATOM   3883 C CA  . TRP A 1 493 ? -51.589  -25.514 74.358  1.00 66.61  ? 654 TRP B CA  1 
ATOM   3884 C C   . TRP A 1 493 ? -52.004  -24.594 73.208  1.00 65.90  ? 654 TRP B C   1 
ATOM   3885 O O   . TRP A 1 493 ? -51.710  -23.394 73.234  1.00 65.94  ? 654 TRP B O   1 
ATOM   3886 C CB  . TRP A 1 493 ? -51.674  -24.774 75.696  1.00 63.74  ? 654 TRP B CB  1 
ATOM   3887 C CG  . TRP A 1 493 ? -53.069  -24.474 76.187  1.00 61.46  ? 654 TRP B CG  1 
ATOM   3888 C CD1 . TRP A 1 493 ? -54.210  -24.369 75.437  1.00 61.75  ? 654 TRP B CD1 1 
ATOM   3889 C CD2 . TRP A 1 493 ? -53.456  -24.202 77.540  1.00 60.13  ? 654 TRP B CD2 1 
ATOM   3890 N NE1 . TRP A 1 493 ? -55.282  -24.066 76.242  1.00 60.63  ? 654 TRP B NE1 1 
ATOM   3891 C CE2 . TRP A 1 493 ? -54.848  -23.957 77.536  1.00 59.51  ? 654 TRP B CE2 1 
ATOM   3892 C CE3 . TRP A 1 493 ? -52.762  -24.150 78.757  1.00 59.23  ? 654 TRP B CE3 1 
ATOM   3893 C CZ2 . TRP A 1 493 ? -55.559  -23.661 78.701  1.00 58.31  ? 654 TRP B CZ2 1 
ATOM   3894 C CZ3 . TRP A 1 493 ? -53.471  -23.857 79.916  1.00 58.66  ? 654 TRP B CZ3 1 
ATOM   3895 C CH2 . TRP A 1 493 ? -54.857  -23.619 79.879  1.00 58.45  ? 654 TRP B CH2 1 
ATOM   3896 N N   . PRO A 1 494 ? -52.685  -25.153 72.189  1.00 64.88  ? 655 PRO B N   1 
ATOM   3897 C CA  . PRO A 1 494 ? -53.084  -24.364 71.022  1.00 64.87  ? 655 PRO B CA  1 
ATOM   3898 C C   . PRO A 1 494 ? -54.130  -23.305 71.358  1.00 65.35  ? 655 PRO B C   1 
ATOM   3899 O O   . PRO A 1 494 ? -54.906  -23.475 72.303  1.00 66.43  ? 655 PRO B O   1 
ATOM   3900 C CB  . PRO A 1 494 ? -53.675  -25.411 70.072  1.00 64.67  ? 655 PRO B CB  1 
ATOM   3901 C CG  . PRO A 1 494 ? -54.105  -26.529 70.953  1.00 64.14  ? 655 PRO B CG  1 
ATOM   3902 C CD  . PRO A 1 494 ? -53.118  -26.558 72.081  1.00 64.55  ? 655 PRO B CD  1 
ATOM   3903 N N   . LYS A 1 495 ? -54.136  -22.224 70.583  1.00 65.97  ? 656 LYS B N   1 
ATOM   3904 C CA  . LYS A 1 495 ? -55.101  -21.141 70.755  1.00 66.36  ? 656 LYS B CA  1 
ATOM   3905 C C   . LYS A 1 495 ? -56.519  -21.603 70.420  1.00 66.63  ? 656 LYS B C   1 
ATOM   3906 O O   . LYS A 1 495 ? -56.721  -22.426 69.522  1.00 67.43  ? 656 LYS B O   1 
ATOM   3907 C CB  . LYS A 1 495 ? -54.727  -19.933 69.887  1.00 66.28  ? 656 LYS B CB  1 
ATOM   3908 C CG  . LYS A 1 495 ? -53.384  -19.300 70.223  1.00 66.48  ? 656 LYS B CG  1 
ATOM   3909 C CD  . LYS A 1 495 ? -52.950  -18.324 69.140  1.00 66.47  ? 656 LYS B CD  1 
ATOM   3910 C CE  . LYS A 1 495 ? -51.472  -17.989 69.262  1.00 65.93  ? 656 LYS B CE  1 
ATOM   3911 N NZ  . LYS A 1 495 ? -50.982  -17.244 68.070  1.00 65.08  ? 656 LYS B NZ  1 
ATOM   3912 N N   . HIS A 1 496 ? -57.487  -21.074 71.161  1.00 66.00  ? 657 HIS B N   1 
ATOM   3913 C CA  . HIS A 1 496 ? -58.895  -21.355 70.932  1.00 65.98  ? 657 HIS B CA  1 
ATOM   3914 C C   . HIS A 1 496 ? -59.415  -20.397 69.863  1.00 66.22  ? 657 HIS B C   1 
ATOM   3915 O O   . HIS A 1 496 ? -59.903  -19.312 70.176  1.00 67.06  ? 657 HIS B O   1 
ATOM   3916 C CB  . HIS A 1 496 ? -59.670  -21.200 72.245  1.00 66.52  ? 657 HIS B CB  1 
ATOM   3917 C CG  . HIS A 1 496 ? -61.111  -21.602 72.159  1.00 67.55  ? 657 HIS B CG  1 
ATOM   3918 N ND1 . HIS A 1 496 ? -61.541  -22.887 72.409  1.00 68.02  ? 657 HIS B ND1 1 
ATOM   3919 C CD2 . HIS A 1 496 ? -62.222  -20.882 71.873  1.00 67.58  ? 657 HIS B CD2 1 
ATOM   3920 C CE1 . HIS A 1 496 ? -62.855  -22.944 72.272  1.00 68.57  ? 657 HIS B CE1 1 
ATOM   3921 N NE2 . HIS A 1 496 ? -63.292  -21.741 71.944  1.00 68.26  ? 657 HIS B NE2 1 
ATOM   3922 N N   . THR A 1 497 ? -59.283  -20.797 68.600  1.00 66.74  ? 658 THR B N   1 
ATOM   3923 C CA  . THR A 1 497 ? -59.707  -19.963 67.470  1.00 67.62  ? 658 THR B CA  1 
ATOM   3924 C C   . THR A 1 497 ? -61.213  -20.036 67.246  1.00 68.45  ? 658 THR B C   1 
ATOM   3925 O O   . THR A 1 497 ? -61.881  -20.932 67.761  1.00 68.43  ? 658 THR B O   1 
ATOM   3926 C CB  . THR A 1 497 ? -58.979  -20.340 66.165  1.00 67.30  ? 658 THR B CB  1 
ATOM   3927 O OG1 . THR A 1 497 ? -58.931  -21.765 66.036  1.00 68.20  ? 658 THR B OG1 1 
ATOM   3928 C CG2 . THR A 1 497 ? -57.560  -19.780 66.158  1.00 67.27  ? 658 THR B CG2 1 
ATOM   3929 N N   . ALA A 1 498 ? -61.735  -19.084 66.474  1.00 70.30  ? 659 ALA B N   1 
ATOM   3930 C CA  . ALA A 1 498 ? -63.170  -18.989 66.207  1.00 73.33  ? 659 ALA B CA  1 
ATOM   3931 C C   . ALA A 1 498 ? -63.737  -20.231 65.515  1.00 75.90  ? 659 ALA B C   1 
ATOM   3932 O O   . ALA A 1 498 ? -64.834  -20.681 65.852  1.00 76.51  ? 659 ALA B O   1 
ATOM   3933 C CB  . ALA A 1 498 ? -63.478  -17.736 65.400  1.00 72.96  ? 659 ALA B CB  1 
ATOM   3934 N N   . HIS A 1 499 ? -62.985  -20.782 64.561  1.00 79.45  ? 660 HIS B N   1 
ATOM   3935 C CA  . HIS A 1 499 ? -63.419  -21.962 63.810  1.00 82.39  ? 660 HIS B CA  1 
ATOM   3936 C C   . HIS A 1 499 ? -62.855  -23.263 64.370  1.00 81.96  ? 660 HIS B C   1 
ATOM   3937 O O   . HIS A 1 499 ? -63.519  -24.299 64.326  1.00 82.82  ? 660 HIS B O   1 
ATOM   3938 C CB  . HIS A 1 499 ? -63.063  -21.830 62.327  1.00 87.60  ? 660 HIS B CB  1 
ATOM   3939 C CG  . HIS A 1 499 ? -63.851  -20.778 61.609  1.00 93.86  ? 660 HIS B CG  1 
ATOM   3940 N ND1 . HIS A 1 499 ? -65.195  -20.915 61.330  1.00 96.14  ? 660 HIS B ND1 1 
ATOM   3941 C CD2 . HIS A 1 499 ? -63.484  -19.573 61.109  1.00 95.79  ? 660 HIS B CD2 1 
ATOM   3942 C CE1 . HIS A 1 499 ? -65.622  -19.839 60.693  1.00 96.86  ? 660 HIS B CE1 1 
ATOM   3943 N NE2 . HIS A 1 499 ? -64.603  -19.010 60.546  1.00 98.47  ? 660 HIS B NE2 1 
ATOM   3944 N N   . GLY A 1 500 ? -61.631  -23.206 64.891  1.00 81.68  ? 661 GLY B N   1 
ATOM   3945 C CA  . GLY A 1 500 ? -60.979  -24.371 65.487  1.00 81.29  ? 661 GLY B CA  1 
ATOM   3946 C C   . GLY A 1 500 ? -61.601  -24.786 66.809  1.00 80.81  ? 661 GLY B C   1 
ATOM   3947 O O   . GLY A 1 500 ? -61.974  -25.944 66.988  1.00 81.68  ? 661 GLY B O   1 
ATOM   3948 N N   . ARG A 1 501 ? -61.713  -23.829 67.729  1.00 80.33  ? 662 ARG B N   1 
ATOM   3949 C CA  . ARG A 1 501 ? -62.291  -24.043 69.065  1.00 78.72  ? 662 ARG B CA  1 
ATOM   3950 C C   . ARG A 1 501 ? -61.579  -25.138 69.867  1.00 76.03  ? 662 ARG B C   1 
ATOM   3951 O O   . ARG A 1 501 ? -62.218  -25.969 70.516  1.00 75.36  ? 662 ARG B O   1 
ATOM   3952 C CB  . ARG A 1 501 ? -63.805  -24.306 68.992  1.00 80.01  ? 662 ARG B CB  1 
ATOM   3953 C CG  . ARG A 1 501 ? -64.635  -23.170 68.411  1.00 82.31  ? 662 ARG B CG  1 
ATOM   3954 C CD  . ARG A 1 501 ? -66.060  -23.219 68.943  1.00 85.92  ? 662 ARG B CD  1 
ATOM   3955 N NE  . ARG A 1 501 ? -67.050  -22.860 67.928  1.00 89.13  ? 662 ARG B NE  1 
ATOM   3956 C CZ  . ARG A 1 501 ? -67.681  -23.734 67.144  1.00 91.90  ? 662 ARG B CZ  1 
ATOM   3957 N NH1 . ARG A 1 501 ? -67.435  -25.035 67.243  1.00 92.34  ? 662 ARG B NH1 1 
ATOM   3958 N NH2 . ARG A 1 501 ? -68.565  -23.307 66.252  1.00 94.34  ? 662 ARG B NH2 1 
ATOM   3959 N N   . HIS A 1 502 ? -60.250  -25.117 69.824  1.00 73.57  ? 663 HIS B N   1 
ATOM   3960 C CA  . HIS A 1 502 ? -59.434  -26.130 70.486  1.00 72.76  ? 663 HIS B CA  1 
ATOM   3961 C C   . HIS A 1 502 ? -59.247  -25.875 71.983  1.00 70.82  ? 663 HIS B C   1 
ATOM   3962 O O   . HIS A 1 502 ? -59.048  -24.734 72.411  1.00 71.69  ? 663 HIS B O   1 
ATOM   3963 C CB  . HIS A 1 502 ? -58.066  -26.246 69.803  1.00 73.97  ? 663 HIS B CB  1 
ATOM   3964 C CG  . HIS A 1 502 ? -58.115  -26.905 68.459  1.00 74.36  ? 663 HIS B CG  1 
ATOM   3965 N ND1 . HIS A 1 502 ? -58.069  -28.274 68.299  1.00 73.87  ? 663 HIS B ND1 1 
ATOM   3966 C CD2 . HIS A 1 502 ? -58.199  -26.383 67.212  1.00 74.31  ? 663 HIS B CD2 1 
ATOM   3967 C CE1 . HIS A 1 502 ? -58.126  -28.566 67.013  1.00 73.53  ? 663 HIS B CE1 1 
ATOM   3968 N NE2 . HIS A 1 502 ? -58.205  -27.438 66.332  1.00 74.20  ? 663 HIS B NE2 1 
ATOM   3969 N N   . TYR A 1 503 ? -59.314  -26.952 72.768  1.00 67.58  ? 664 TYR B N   1 
ATOM   3970 C CA  . TYR A 1 503 ? -59.021  -26.903 74.204  1.00 64.05  ? 664 TYR B CA  1 
ATOM   3971 C C   . TYR A 1 503 ? -57.966  -27.936 74.589  1.00 61.07  ? 664 TYR B C   1 
ATOM   3972 O O   . TYR A 1 503 ? -57.849  -28.982 73.952  1.00 60.54  ? 664 TYR B O   1 
ATOM   3973 C CB  . TYR A 1 503 ? -60.291  -27.114 75.042  1.00 63.75  ? 664 TYR B CB  1 
ATOM   3974 C CG  . TYR A 1 503 ? -60.844  -28.523 75.013  1.00 63.92  ? 664 TYR B CG  1 
ATOM   3975 C CD1 . TYR A 1 503 ? -60.328  -29.515 75.850  1.00 63.83  ? 664 TYR B CD1 1 
ATOM   3976 C CD2 . TYR A 1 503 ? -61.891  -28.864 74.158  1.00 63.59  ? 664 TYR B CD2 1 
ATOM   3977 C CE1 . TYR A 1 503 ? -60.827  -30.807 75.824  1.00 62.95  ? 664 TYR B CE1 1 
ATOM   3978 C CE2 . TYR A 1 503 ? -62.399  -30.154 74.129  1.00 62.93  ? 664 TYR B CE2 1 
ATOM   3979 C CZ  . TYR A 1 503 ? -61.864  -31.119 74.963  1.00 62.29  ? 664 TYR B CZ  1 
ATOM   3980 O OH  . TYR A 1 503 ? -62.363  -32.398 74.937  1.00 61.59  ? 664 TYR B OH  1 
ATOM   3981 N N   . LEU A 1 504 ? -57.206  -27.636 75.636  1.00 59.08  ? 665 LEU B N   1 
ATOM   3982 C CA  . LEU A 1 504 ? -56.244  -28.584 76.176  1.00 58.80  ? 665 LEU B CA  1 
ATOM   3983 C C   . LEU A 1 504 ? -56.820  -29.252 77.415  1.00 60.12  ? 665 LEU B C   1 
ATOM   3984 O O   . LEU A 1 504 ? -57.231  -28.575 78.360  1.00 61.29  ? 665 LEU B O   1 
ATOM   3985 C CB  . LEU A 1 504 ? -54.924  -27.889 76.517  1.00 57.97  ? 665 LEU B CB  1 
ATOM   3986 C CG  . LEU A 1 504 ? -53.859  -28.701 77.267  1.00 57.50  ? 665 LEU B CG  1 
ATOM   3987 C CD1 . LEU A 1 504 ? -53.209  -29.740 76.363  1.00 57.61  ? 665 LEU B CD1 1 
ATOM   3988 C CD2 . LEU A 1 504 ? -52.807  -27.782 77.867  1.00 57.58  ? 665 LEU B CD2 1 
ATOM   3989 N N   . GLU A 1 505 ? -56.849  -30.583 77.401  1.00 60.90  ? 666 GLU B N   1 
ATOM   3990 C CA  . GLU A 1 505 ? -57.283  -31.360 78.556  1.00 61.02  ? 666 GLU B CA  1 
ATOM   3991 C C   . GLU A 1 505 ? -56.200  -31.325 79.633  1.00 61.03  ? 666 GLU B C   1 
ATOM   3992 O O   . GLU A 1 505 ? -55.037  -31.650 79.372  1.00 60.75  ? 666 GLU B O   1 
ATOM   3993 C CB  . GLU A 1 505 ? -57.598  -32.804 78.153  1.00 61.65  ? 666 GLU B CB  1 
ATOM   3994 C CG  . GLU A 1 505 ? -58.225  -33.641 79.259  1.00 62.89  ? 666 GLU B CG  1 
ATOM   3995 C CD  . GLU A 1 505 ? -58.358  -35.113 78.904  1.00 64.88  ? 666 GLU B CD  1 
ATOM   3996 O OE1 . GLU A 1 505 ? -58.224  -35.473 77.713  1.00 66.29  ? 666 GLU B OE1 1 
ATOM   3997 O OE2 . GLU A 1 505 ? -58.603  -35.920 79.825  1.00 65.83  ? 666 GLU B OE2 1 
ATOM   3998 N N   . LEU A 1 506 ? -56.589  -30.913 80.836  1.00 60.51  ? 667 LEU B N   1 
ATOM   3999 C CA  . LEU A 1 506 ? -55.665  -30.835 81.958  1.00 60.83  ? 667 LEU B CA  1 
ATOM   4000 C C   . LEU A 1 506 ? -55.889  -31.993 82.924  1.00 62.62  ? 667 LEU B C   1 
ATOM   4001 O O   . LEU A 1 506 ? -56.586  -31.856 83.930  1.00 63.63  ? 667 LEU B O   1 
ATOM   4002 C CB  . LEU A 1 506 ? -55.793  -29.489 82.680  1.00 59.97  ? 667 LEU B CB  1 
ATOM   4003 C CG  . LEU A 1 506 ? -55.423  -28.200 81.941  1.00 59.28  ? 667 LEU B CG  1 
ATOM   4004 C CD1 . LEU A 1 506 ? -55.762  -26.998 82.808  1.00 59.85  ? 667 LEU B CD1 1 
ATOM   4005 C CD2 . LEU A 1 506 ? -53.954  -28.170 81.548  1.00 58.66  ? 667 LEU B CD2 1 
ATOM   4006 N N   . GLY A 1 507 ? -55.302  -33.138 82.593  1.00 64.76  ? 668 GLY B N   1 
ATOM   4007 C CA  . GLY A 1 507 ? -55.356  -34.329 83.437  1.00 67.59  ? 668 GLY B CA  1 
ATOM   4008 C C   . GLY A 1 507 ? -53.958  -34.873 83.647  1.00 69.65  ? 668 GLY B C   1 
ATOM   4009 O O   . GLY A 1 507 ? -52.994  -34.330 83.107  1.00 71.80  ? 668 GLY B O   1 
ATOM   4010 N N   . LEU A 1 508 ? -53.844  -35.949 84.420  1.00 71.05  ? 669 LEU B N   1 
ATOM   4011 C CA  . LEU A 1 508 ? -52.536  -36.478 84.813  1.00 72.34  ? 669 LEU B CA  1 
ATOM   4012 C C   . LEU A 1 508 ? -51.724  -37.114 83.683  1.00 75.53  ? 669 LEU B C   1 
ATOM   4013 O O   . LEU A 1 508 ? -50.618  -36.661 83.383  1.00 77.22  ? 669 LEU B O   1 
ATOM   4014 C CB  . LEU A 1 508 ? -52.670  -37.448 85.990  1.00 70.62  ? 669 LEU B CB  1 
ATOM   4015 C CG  . LEU A 1 508 ? -52.528  -36.850 87.389  1.00 69.96  ? 669 LEU B CG  1 
ATOM   4016 C CD1 . LEU A 1 508 ? -52.781  -37.919 88.440  1.00 70.99  ? 669 LEU B CD1 1 
ATOM   4017 C CD2 . LEU A 1 508 ? -51.151  -36.232 87.584  1.00 70.16  ? 669 LEU B CD2 1 
ATOM   4018 N N   . ASN A 1 509 ? -52.267  -38.160 83.065  1.00 77.77  ? 670 ASN B N   1 
ATOM   4019 C CA  . ASN A 1 509 ? -51.535  -38.907 82.042  1.00 80.03  ? 670 ASN B CA  1 
ATOM   4020 C C   . ASN A 1 509 ? -51.753  -38.351 80.637  1.00 79.18  ? 670 ASN B C   1 
ATOM   4021 O O   . ASN A 1 509 ? -51.169  -38.843 79.669  1.00 80.82  ? 670 ASN B O   1 
ATOM   4022 C CB  . ASN A 1 509 ? -51.917  -40.395 82.096  1.00 83.18  ? 670 ASN B CB  1 
ATOM   4023 C CG  . ASN A 1 509 ? -50.835  -41.309 81.532  1.00 83.81  ? 670 ASN B CG  1 
ATOM   4024 O OD1 . ASN A 1 509 ? -49.699  -40.886 81.296  1.00 82.86  ? 670 ASN B OD1 1 
ATOM   4025 N ND2 . ASN A 1 509 ? -51.186  -42.574 81.321  1.00 84.01  ? 670 ASN B ND2 1 
ATOM   4026 N N   . THR A 1 510 ? -52.576  -37.311 80.534  1.00 77.83  ? 671 THR B N   1 
ATOM   4027 C CA  . THR A 1 510 ? -53.034  -36.817 79.236  1.00 76.25  ? 671 THR B CA  1 
ATOM   4028 C C   . THR A 1 510 ? -52.228  -35.641 78.673  1.00 74.17  ? 671 THR B C   1 
ATOM   4029 O O   . THR A 1 510 ? -51.441  -35.006 79.375  1.00 73.08  ? 671 THR B O   1 
ATOM   4030 C CB  . THR A 1 510 ? -54.539  -36.465 79.260  1.00 76.74  ? 671 THR B CB  1 
ATOM   4031 O OG1 . THR A 1 510 ? -55.035  -36.383 77.919  1.00 76.97  ? 671 THR B OG1 1 
ATOM   4032 C CG2 . THR A 1 510 ? -54.785  -35.142 79.972  1.00 76.33  ? 671 THR B CG2 1 
ATOM   4033 N N   . SER A 1 511 ? -52.451  -35.383 77.388  1.00 73.33  ? 672 SER B N   1 
ATOM   4034 C CA  . SER A 1 511 ? -51.919  -34.229 76.677  1.00 72.82  ? 672 SER B CA  1 
ATOM   4035 C C   . SER A 1 511 ? -52.857  -33.944 75.501  1.00 71.13  ? 672 SER B C   1 
ATOM   4036 O O   . SER A 1 511 ? -52.516  -33.214 74.567  1.00 71.32  ? 672 SER B O   1 
ATOM   4037 C CB  . SER A 1 511 ? -50.499  -34.517 76.191  1.00 74.43  ? 672 SER B CB  1 
ATOM   4038 O OG  . SER A 1 511 ? -49.936  -33.381 75.567  1.00 77.36  ? 672 SER B OG  1 
ATOM   4039 N N   . PHE A 1 512 ? -54.053  -34.526 75.588  1.00 69.31  ? 673 PHE B N   1 
ATOM   4040 C CA  . PHE A 1 512 ? -55.071  -34.510 74.537  1.00 67.84  ? 673 PHE B CA  1 
ATOM   4041 C C   . PHE A 1 512 ? -55.603  -33.113 74.236  1.00 66.29  ? 673 PHE B C   1 
ATOM   4042 O O   . PHE A 1 512 ? -55.808  -32.310 75.146  1.00 67.70  ? 673 PHE B O   1 
ATOM   4043 C CB  . PHE A 1 512 ? -56.222  -35.439 74.948  1.00 68.47  ? 673 PHE B CB  1 
ATOM   4044 C CG  . PHE A 1 512 ? -57.394  -35.431 74.007  1.00 69.49  ? 673 PHE B CG  1 
ATOM   4045 C CD1 . PHE A 1 512 ? -57.352  -36.142 72.813  1.00 70.99  ? 673 PHE B CD1 1 
ATOM   4046 C CD2 . PHE A 1 512 ? -58.554  -34.735 74.329  1.00 69.79  ? 673 PHE B CD2 1 
ATOM   4047 C CE1 . PHE A 1 512 ? -58.438  -36.145 71.949  1.00 71.49  ? 673 PHE B CE1 1 
ATOM   4048 C CE2 . PHE A 1 512 ? -59.642  -34.732 73.470  1.00 70.49  ? 673 PHE B CE2 1 
ATOM   4049 C CZ  . PHE A 1 512 ? -59.584  -35.439 72.278  1.00 70.91  ? 673 PHE B CZ  1 
ATOM   4050 N N   . VAL A 1 513 ? -55.821  -32.839 72.951  1.00 63.84  ? 674 VAL B N   1 
ATOM   4051 C CA  . VAL A 1 513 ? -56.425  -31.584 72.504  1.00 62.21  ? 674 VAL B CA  1 
ATOM   4052 C C   . VAL A 1 513 ? -57.737  -31.884 71.784  1.00 62.48  ? 674 VAL B C   1 
ATOM   4053 O O   . VAL A 1 513 ? -57.764  -32.648 70.817  1.00 63.28  ? 674 VAL B O   1 
ATOM   4054 C CB  . VAL A 1 513 ? -55.477  -30.784 71.580  1.00 61.19  ? 674 VAL B CB  1 
ATOM   4055 C CG1 . VAL A 1 513 ? -56.190  -29.575 70.984  1.00 60.18  ? 674 VAL B CG1 1 
ATOM   4056 C CG2 . VAL A 1 513 ? -54.228  -30.349 72.335  1.00 60.36  ? 674 VAL B CG2 1 
ATOM   4057 N N   . GLY A 1 514 ? -58.823  -31.285 72.266  1.00 62.09  ? 675 GLY B N   1 
ATOM   4058 C CA  . GLY A 1 514 ? -60.147  -31.522 71.699  1.00 61.74  ? 675 GLY B CA  1 
ATOM   4059 C C   . GLY A 1 514 ? -60.797  -30.279 71.126  1.00 62.12  ? 675 GLY B C   1 
ATOM   4060 O O   . GLY A 1 514 ? -60.181  -29.216 71.054  1.00 61.46  ? 675 GLY B O   1 
ATOM   4061 N N   . ARG A 1 515 ? -62.053  -30.428 70.718  1.00 63.76  ? 676 ARG B N   1 
ATOM   4062 C CA  . ARG A 1 515 ? -62.842  -29.332 70.170  1.00 65.08  ? 676 ARG B CA  1 
ATOM   4063 C C   . ARG A 1 515 ? -63.992  -29.028 71.124  1.00 64.76  ? 676 ARG B C   1 
ATOM   4064 O O   . ARG A 1 515 ? -64.787  -29.915 71.442  1.00 65.38  ? 676 ARG B O   1 
ATOM   4065 C CB  . ARG A 1 515 ? -63.408  -29.707 68.791  1.00 66.67  ? 676 ARG B CB  1 
ATOM   4066 C CG  . ARG A 1 515 ? -62.400  -30.260 67.788  1.00 67.96  ? 676 ARG B CG  1 
ATOM   4067 C CD  . ARG A 1 515 ? -61.703  -29.161 67.001  1.00 68.05  ? 676 ARG B CD  1 
ATOM   4068 N NE  . ARG A 1 515 ? -62.626  -28.462 66.107  1.00 69.21  ? 676 ARG B NE  1 
ATOM   4069 C CZ  . ARG A 1 515 ? -62.706  -28.660 64.794  1.00 69.75  ? 676 ARG B CZ  1 
ATOM   4070 N NH1 . ARG A 1 515 ? -61.911  -29.539 64.196  1.00 71.18  ? 676 ARG B NH1 1 
ATOM   4071 N NH2 . ARG A 1 515 ? -63.584  -27.970 64.074  1.00 68.81  ? 676 ARG B NH2 1 
ATOM   4072 N N   . GLY A 1 516 ? -64.077  -27.783 71.586  1.00 64.60  ? 677 GLY B N   1 
ATOM   4073 C CA  . GLY A 1 516 ? -65.191  -27.359 72.435  1.00 63.13  ? 677 GLY B CA  1 
ATOM   4074 C C   . GLY A 1 516 ? -64.799  -26.787 73.785  1.00 61.45  ? 677 GLY B C   1 
ATOM   4075 O O   . GLY A 1 516 ? -64.251  -25.686 73.848  1.00 61.64  ? 677 GLY B O   1 
ATOM   4076 N N   . PRO A 1 517 ? -65.078  -27.529 74.878  1.00 59.93  ? 678 PRO B N   1 
ATOM   4077 C CA  . PRO A 1 517 ? -65.680  -28.869 74.919  1.00 59.56  ? 678 PRO B CA  1 
ATOM   4078 C C   . PRO A 1 517 ? -67.205  -28.887 74.798  1.00 59.72  ? 678 PRO B C   1 
ATOM   4079 O O   . PRO A 1 517 ? -67.853  -27.845 74.918  1.00 60.36  ? 678 PRO B O   1 
ATOM   4080 C CB  . PRO A 1 517 ? -65.272  -29.378 76.301  1.00 58.90  ? 678 PRO B CB  1 
ATOM   4081 C CG  . PRO A 1 517 ? -65.217  -28.149 77.136  1.00 58.60  ? 678 PRO B CG  1 
ATOM   4082 C CD  . PRO A 1 517 ? -64.752  -27.040 76.231  1.00 59.27  ? 678 PRO B CD  1 
ATOM   4083 N N   . ARG A 1 518 ? -67.753  -30.080 74.564  1.00 59.36  ? 679 ARG B N   1 
ATOM   4084 C CA  . ARG A 1 518 ? -69.203  -30.325 74.516  1.00 59.63  ? 679 ARG B CA  1 
ATOM   4085 C C   . ARG A 1 518 ? -69.947  -29.375 73.568  1.00 60.04  ? 679 ARG B C   1 
ATOM   4086 O O   . ARG A 1 518 ? -70.825  -28.619 73.994  1.00 59.41  ? 679 ARG B O   1 
ATOM   4087 C CB  . ARG A 1 518 ? -69.824  -30.296 75.927  1.00 58.50  ? 679 ARG B CB  1 
ATOM   4088 C CG  . ARG A 1 518 ? -68.962  -30.926 77.014  1.00 58.03  ? 679 ARG B CG  1 
ATOM   4089 C CD  . ARG A 1 518 ? -69.749  -31.247 78.275  1.00 56.85  ? 679 ARG B CD  1 
ATOM   4090 N NE  . ARG A 1 518 ? -70.339  -32.583 78.223  1.00 56.08  ? 679 ARG B NE  1 
ATOM   4091 C CZ  . ARG A 1 518 ? -71.610  -32.834 77.928  1.00 55.39  ? 679 ARG B CZ  1 
ATOM   4092 N NH1 . ARG A 1 518 ? -72.438  -31.840 77.664  1.00 55.95  ? 679 ARG B NH1 1 
ATOM   4093 N NH2 . ARG A 1 518 ? -72.054  -34.082 77.901  1.00 55.19  ? 679 ARG B NH2 1 
ATOM   4094 N N   . LEU A 1 519 ? -69.589  -29.428 72.285  1.00 61.22  ? 680 LEU B N   1 
ATOM   4095 C CA  . LEU A 1 519 ? -70.196  -28.561 71.269  1.00 62.00  ? 680 LEU B CA  1 
ATOM   4096 C C   . LEU A 1 519 ? -71.684  -28.814 71.023  1.00 62.43  ? 680 LEU B C   1 
ATOM   4097 O O   . LEU A 1 519 ? -72.461  -27.865 70.925  1.00 62.09  ? 680 LEU B O   1 
ATOM   4098 C CB  . LEU A 1 519 ? -69.444  -28.641 69.934  1.00 62.31  ? 680 LEU B CB  1 
ATOM   4099 C CG  . LEU A 1 519 ? -68.300  -27.681 69.580  1.00 62.63  ? 680 LEU B CG  1 
ATOM   4100 C CD1 . LEU A 1 519 ? -68.242  -26.449 70.479  1.00 62.18  ? 680 LEU B CD1 1 
ATOM   4101 C CD2 . LEU A 1 519 ? -66.977  -28.421 69.595  1.00 62.67  ? 680 LEU B CD2 1 
ATOM   4102 N N   . ARG A 1 520 ? -72.072  -30.085 70.913  1.00 63.92  ? 681 ARG B N   1 
ATOM   4103 C CA  . ARG A 1 520 ? -73.456  -30.429 70.582  1.00 65.76  ? 681 ARG B CA  1 
ATOM   4104 C C   . ARG A 1 520 ? -74.427  -29.908 71.630  1.00 66.12  ? 681 ARG B C   1 
ATOM   4105 O O   . ARG A 1 520 ? -75.513  -29.430 71.295  1.00 67.67  ? 681 ARG B O   1 
ATOM   4106 C CB  . ARG A 1 520 ? -73.642  -31.940 70.390  1.00 67.98  ? 681 ARG B CB  1 
ATOM   4107 C CG  . ARG A 1 520 ? -74.941  -32.290 69.672  1.00 72.07  ? 681 ARG B CG  1 
ATOM   4108 C CD  . ARG A 1 520 ? -75.105  -33.779 69.415  1.00 75.41  ? 681 ARG B CD  1 
ATOM   4109 N NE  . ARG A 1 520 ? -75.639  -34.492 70.576  1.00 78.70  ? 681 ARG B NE  1 
ATOM   4110 C CZ  . ARG A 1 520 ? -74.926  -35.283 71.376  1.00 80.29  ? 681 ARG B CZ  1 
ATOM   4111 N NH1 . ARG A 1 520 ? -75.514  -35.886 72.401  1.00 80.68  ? 681 ARG B NH1 1 
ATOM   4112 N NH2 . ARG A 1 520 ? -73.628  -35.480 71.158  1.00 80.87  ? 681 ARG B NH2 1 
ATOM   4113 N N   . GLN A 1 521 ? -74.024  -29.988 72.894  1.00 65.63  ? 682 GLN B N   1 
ATOM   4114 C CA  . GLN A 1 521 ? -74.888  -29.595 73.998  1.00 66.04  ? 682 GLN B CA  1 
ATOM   4115 C C   . GLN A 1 521 ? -75.008  -28.080 74.123  1.00 67.53  ? 682 GLN B C   1 
ATOM   4116 O O   . GLN A 1 521 ? -76.065  -27.567 74.488  1.00 69.54  ? 682 GLN B O   1 
ATOM   4117 C CB  . GLN A 1 521 ? -74.414  -30.222 75.309  1.00 64.90  ? 682 GLN B CB  1 
ATOM   4118 C CG  . GLN A 1 521 ? -74.569  -31.737 75.355  1.00 64.17  ? 682 GLN B CG  1 
ATOM   4119 C CD  . GLN A 1 521 ? -73.463  -32.480 74.619  1.00 63.38  ? 682 GLN B CD  1 
ATOM   4120 O OE1 . GLN A 1 521 ? -72.393  -31.930 74.347  1.00 63.15  ? 682 GLN B OE1 1 
ATOM   4121 N NE2 . GLN A 1 521 ? -73.718  -33.739 74.298  1.00 63.14  ? 682 GLN B NE2 1 
ATOM   4122 N N   . CYS A 1 522 ? -73.932  -27.368 73.807  1.00 67.88  ? 683 CYS B N   1 
ATOM   4123 C CA  . CYS A 1 522 ? -73.961  -25.906 73.816  1.00 69.17  ? 683 CYS B CA  1 
ATOM   4124 C C   . CYS A 1 522 ? -74.783  -25.365 72.664  1.00 68.40  ? 683 CYS B C   1 
ATOM   4125 O O   . CYS A 1 522 ? -75.451  -24.338 72.793  1.00 69.16  ? 683 CYS B O   1 
ATOM   4126 C CB  . CYS A 1 522 ? -72.547  -25.343 73.806  1.00 71.58  ? 683 CYS B CB  1 
ATOM   4127 S SG  . CYS A 1 522 ? -71.703  -25.737 75.348  1.00 78.26  ? 683 CYS B SG  1 
ATOM   4128 N N   . ALA A 1 523 ? -74.737  -26.077 71.544  1.00 66.36  ? 684 ALA B N   1 
ATOM   4129 C CA  . ALA A 1 523 ? -75.609  -25.809 70.417  1.00 64.30  ? 684 ALA B CA  1 
ATOM   4130 C C   . ALA A 1 523 ? -77.063  -26.130 70.770  1.00 63.67  ? 684 ALA B C   1 
ATOM   4131 O O   . ALA A 1 523 ? -77.987  -25.543 70.207  1.00 64.82  ? 684 ALA B O   1 
ATOM   4132 C CB  . ALA A 1 523 ? -75.162  -26.616 69.218  1.00 64.11  ? 684 ALA B CB  1 
ATOM   4133 N N   . PHE A 1 524 ? -77.261  -27.060 71.702  1.00 61.53  ? 685 PHE B N   1 
ATOM   4134 C CA  . PHE A 1 524 ? -78.599  -27.385 72.181  1.00 60.43  ? 685 PHE B CA  1 
ATOM   4135 C C   . PHE A 1 524 ? -79.192  -26.240 72.996  1.00 61.62  ? 685 PHE B C   1 
ATOM   4136 O O   . PHE A 1 524 ? -80.343  -25.853 72.784  1.00 61.80  ? 685 PHE B O   1 
ATOM   4137 C CB  . PHE A 1 524 ? -78.594  -28.681 73.002  1.00 59.04  ? 685 PHE B CB  1 
ATOM   4138 C CG  . PHE A 1 524 ? -79.898  -28.964 73.689  1.00 58.40  ? 685 PHE B CG  1 
ATOM   4139 C CD1 . PHE A 1 524 ? -80.996  -29.424 72.969  1.00 58.24  ? 685 PHE B CD1 1 
ATOM   4140 C CD2 . PHE A 1 524 ? -80.036  -28.761 75.056  1.00 58.55  ? 685 PHE B CD2 1 
ATOM   4141 C CE1 . PHE A 1 524 ? -82.203  -29.680 73.599  1.00 58.14  ? 685 PHE B CE1 1 
ATOM   4142 C CE2 . PHE A 1 524 ? -81.241  -29.014 75.693  1.00 58.58  ? 685 PHE B CE2 1 
ATOM   4143 C CZ  . PHE A 1 524 ? -82.326  -29.474 74.963  1.00 58.27  ? 685 PHE B CZ  1 
ATOM   4144 N N   . TRP A 1 525 ? -78.397  -25.702 73.919  1.00 62.96  ? 686 TRP B N   1 
ATOM   4145 C CA  . TRP A 1 525 ? -78.865  -24.668 74.841  1.00 63.84  ? 686 TRP B CA  1 
ATOM   4146 C C   . TRP A 1 525 ? -78.886  -23.264 74.235  1.00 66.63  ? 686 TRP B C   1 
ATOM   4147 O O   . TRP A 1 525 ? -79.752  -22.461 74.577  1.00 66.69  ? 686 TRP B O   1 
ATOM   4148 C CB  . TRP A 1 525 ? -78.026  -24.662 76.123  1.00 61.01  ? 686 TRP B CB  1 
ATOM   4149 C CG  . TRP A 1 525 ? -78.172  -25.890 76.978  1.00 58.32  ? 686 TRP B CG  1 
ATOM   4150 C CD1 . TRP A 1 525 ? -77.240  -26.868 77.169  1.00 57.59  ? 686 TRP B CD1 1 
ATOM   4151 C CD2 . TRP A 1 525 ? -79.309  -26.262 77.770  1.00 57.11  ? 686 TRP B CD2 1 
ATOM   4152 N NE1 . TRP A 1 525 ? -77.724  -27.827 78.022  1.00 56.85  ? 686 TRP B NE1 1 
ATOM   4153 C CE2 . TRP A 1 525 ? -78.992  -27.482 78.408  1.00 56.90  ? 686 TRP B CE2 1 
ATOM   4154 C CE3 . TRP A 1 525 ? -80.566  -25.686 78.001  1.00 56.32  ? 686 TRP B CE3 1 
ATOM   4155 C CZ2 . TRP A 1 525 ? -79.885  -28.138 79.263  1.00 56.35  ? 686 TRP B CZ2 1 
ATOM   4156 C CZ3 . TRP A 1 525 ? -81.454  -26.340 78.854  1.00 55.74  ? 686 TRP B CZ3 1 
ATOM   4157 C CH2 . TRP A 1 525 ? -81.108  -27.553 79.471  1.00 55.80  ? 686 TRP B CH2 1 
ATOM   4158 N N   . LYS A 1 526 ? -77.932  -22.967 73.352  1.00 70.08  ? 687 LYS B N   1 
ATOM   4159 C CA  . LYS A 1 526 ? -77.808  -21.625 72.771  1.00 73.89  ? 687 LYS B CA  1 
ATOM   4160 C C   . LYS A 1 526 ? -78.593  -21.461 71.466  1.00 73.58  ? 687 LYS B C   1 
ATOM   4161 O O   . LYS A 1 526 ? -79.086  -20.370 71.175  1.00 74.25  ? 687 LYS B O   1 
ATOM   4162 C CB  . LYS A 1 526 ? -76.333  -21.253 72.557  1.00 77.94  ? 687 LYS B CB  1 
ATOM   4163 C CG  . LYS A 1 526 ? -76.075  -19.772 72.284  1.00 82.13  ? 687 LYS B CG  1 
ATOM   4164 C CD  . LYS A 1 526 ? -74.665  -19.531 71.752  1.00 83.77  ? 687 LYS B CD  1 
ATOM   4165 C CE  . LYS A 1 526 ? -74.376  -18.051 71.528  1.00 82.33  ? 687 LYS B CE  1 
ATOM   4166 N NZ  . LYS A 1 526 ? -75.150  -17.463 70.400  1.00 81.96  ? 687 LYS B NZ  1 
ATOM   4167 N N   . LYS A 1 527 ? -78.705  -22.537 70.689  1.00 73.39  ? 688 LYS B N   1 
ATOM   4168 C CA  . LYS A 1 527 ? -79.344  -22.469 69.370  1.00 73.39  ? 688 LYS B CA  1 
ATOM   4169 C C   . LYS A 1 527 ? -80.720  -23.145 69.303  1.00 71.16  ? 688 LYS B C   1 
ATOM   4170 O O   . LYS A 1 527 ? -81.722  -22.485 69.020  1.00 69.03  ? 688 LYS B O   1 
ATOM   4171 C CB  . LYS A 1 527 ? -78.416  -23.022 68.273  1.00 75.30  ? 688 LYS B CB  1 
ATOM   4172 C CG  . LYS A 1 527 ? -77.102  -22.269 68.096  1.00 78.38  ? 688 LYS B CG  1 
ATOM   4173 C CD  . LYS A 1 527 ? -77.298  -20.936 67.387  1.00 81.63  ? 688 LYS B CD  1 
ATOM   4174 C CE  . LYS A 1 527 ? -76.052  -20.070 67.485  1.00 83.56  ? 688 LYS B CE  1 
ATOM   4175 N NZ  . LYS A 1 527 ? -76.279  -18.715 66.911  1.00 84.54  ? 688 LYS B NZ  1 
ATOM   4176 N N   . TYR A 1 528 ? -80.762  -24.451 69.568  1.00 70.40  ? 689 TYR B N   1 
ATOM   4177 C CA  . TYR A 1 528 ? -81.982  -25.236 69.379  1.00 69.50  ? 689 TYR B CA  1 
ATOM   4178 C C   . TYR A 1 528 ? -83.101  -24.910 70.370  1.00 69.91  ? 689 TYR B C   1 
ATOM   4179 O O   . TYR A 1 528 ? -84.187  -24.500 69.960  1.00 71.09  ? 689 TYR B O   1 
ATOM   4180 C CB  . TYR A 1 528 ? -81.699  -26.747 69.367  1.00 69.58  ? 689 TYR B CB  1 
ATOM   4181 C CG  . TYR A 1 528 ? -82.964  -27.571 69.265  1.00 70.59  ? 689 TYR B CG  1 
ATOM   4182 C CD1 . TYR A 1 528 ? -83.699  -27.608 68.080  1.00 71.62  ? 689 TYR B CD1 1 
ATOM   4183 C CD2 . TYR A 1 528 ? -83.449  -28.284 70.362  1.00 71.56  ? 689 TYR B CD2 1 
ATOM   4184 C CE1 . TYR A 1 528 ? -84.873  -28.340 67.987  1.00 72.64  ? 689 TYR B CE1 1 
ATOM   4185 C CE2 . TYR A 1 528 ? -84.621  -29.022 70.276  1.00 72.28  ? 689 TYR B CE2 1 
ATOM   4186 C CZ  . TYR A 1 528 ? -85.328  -29.045 69.087  1.00 72.56  ? 689 TYR B CZ  1 
ATOM   4187 O OH  . TYR A 1 528 ? -86.492  -29.774 68.990  1.00 72.93  ? 689 TYR B OH  1 
ATOM   4188 N N   . LEU A 1 529 ? -82.845  -25.099 71.663  1.00 70.39  ? 690 LEU B N   1 
ATOM   4189 C CA  . LEU A 1 529 ? -83.892  -24.931 72.677  1.00 71.26  ? 690 LEU B CA  1 
ATOM   4190 C C   . LEU A 1 529 ? -84.524  -23.530 72.720  1.00 73.45  ? 690 LEU B C   1 
ATOM   4191 O O   . LEU A 1 529 ? -85.742  -23.425 72.868  1.00 73.47  ? 690 LEU B O   1 
ATOM   4192 C CB  . LEU A 1 529 ? -83.418  -25.371 74.070  1.00 70.28  ? 690 LEU B CB  1 
ATOM   4193 C CG  . LEU A 1 529 ? -84.527  -25.699 75.080  1.00 70.02  ? 690 LEU B CG  1 
ATOM   4194 C CD1 . LEU A 1 529 ? -85.325  -26.926 74.661  1.00 69.87  ? 690 LEU B CD1 1 
ATOM   4195 C CD2 . LEU A 1 529 ? -83.964  -25.899 76.474  1.00 70.39  ? 690 LEU B CD2 1 
ATOM   4196 N N   . PRO A 1 530 ? -83.714  -22.454 72.583  1.00 75.61  ? 691 PRO B N   1 
ATOM   4197 C CA  . PRO A 1 530 ? -84.319  -21.119 72.544  1.00 76.79  ? 691 PRO B CA  1 
ATOM   4198 C C   . PRO A 1 530 ? -85.312  -20.939 71.398  1.00 79.38  ? 691 PRO B C   1 
ATOM   4199 O O   . PRO A 1 530 ? -86.365  -20.329 71.595  1.00 81.34  ? 691 PRO B O   1 
ATOM   4200 C CB  . PRO A 1 530 ? -83.118  -20.192 72.343  1.00 76.13  ? 691 PRO B CB  1 
ATOM   4201 C CG  . PRO A 1 530 ? -81.972  -20.940 72.917  1.00 75.60  ? 691 PRO B CG  1 
ATOM   4202 C CD  . PRO A 1 530 ? -82.240  -22.377 72.577  1.00 75.83  ? 691 PRO B CD  1 
ATOM   4203 N N   . GLN A 1 531 ? -84.983  -21.467 70.219  1.00 81.87  ? 692 GLN B N   1 
ATOM   4204 C CA  . GLN A 1 531 ? -85.875  -21.360 69.063  1.00 84.49  ? 692 GLN B CA  1 
ATOM   4205 C C   . GLN A 1 531 ? -87.050  -22.342 69.134  1.00 84.28  ? 692 GLN B C   1 
ATOM   4206 O O   . GLN A 1 531 ? -88.080  -22.129 68.493  1.00 85.06  ? 692 GLN B O   1 
ATOM   4207 C CB  . GLN A 1 531 ? -85.106  -21.472 67.735  1.00 86.93  ? 692 GLN B CB  1 
ATOM   4208 C CG  . GLN A 1 531 ? -84.653  -22.872 67.343  1.00 92.00  ? 692 GLN B CG  1 
ATOM   4209 C CD  . GLN A 1 531 ? -83.730  -22.883 66.133  1.00 96.29  ? 692 GLN B CD  1 
ATOM   4210 O OE1 . GLN A 1 531 ? -83.037  -21.901 65.851  1.00 97.03  ? 692 GLN B OE1 1 
ATOM   4211 N NE2 . GLN A 1 531 ? -83.711  -24.003 65.416  1.00 97.00  ? 692 GLN B NE2 1 
ATOM   4212 N N   . LEU A 1 532 ? -86.891  -23.406 69.921  1.00 84.82  ? 693 LEU B N   1 
ATOM   4213 C CA  . LEU A 1 532 ? -87.979  -24.354 70.157  1.00 86.48  ? 693 LEU B CA  1 
ATOM   4214 C C   . LEU A 1 532 ? -89.038  -23.776 71.095  1.00 86.31  ? 693 LEU B C   1 
ATOM   4215 O O   . LEU A 1 532 ? -90.229  -23.869 70.806  1.00 88.01  ? 693 LEU B O   1 
ATOM   4216 C CB  . LEU A 1 532 ? -87.460  -25.692 70.698  1.00 87.21  ? 693 LEU B CB  1 
ATOM   4217 C CG  . LEU A 1 532 ? -88.518  -26.744 71.068  1.00 86.92  ? 693 LEU B CG  1 
ATOM   4218 C CD1 . LEU A 1 532 ? -89.217  -27.306 69.837  1.00 87.68  ? 693 LEU B CD1 1 
ATOM   4219 C CD2 . LEU A 1 532 ? -87.903  -27.866 71.884  1.00 87.17  ? 693 LEU B CD2 1 
ATOM   4220 N N   . VAL A 1 533 ? -88.597  -23.181 72.207  1.00 85.33  ? 694 VAL B N   1 
ATOM   4221 C CA  . VAL A 1 533 ? -89.508  -22.570 73.186  1.00 84.52  ? 694 VAL B CA  1 
ATOM   4222 C C   . VAL A 1 533 ? -90.328  -21.446 72.547  1.00 85.82  ? 694 VAL B C   1 
ATOM   4223 O O   . VAL A 1 533 ? -91.489  -21.236 72.907  1.00 86.17  ? 694 VAL B O   1 
ATOM   4224 C CB  . VAL A 1 533 ? -88.762  -22.042 74.437  1.00 83.44  ? 694 VAL B CB  1 
ATOM   4225 C CG1 . VAL A 1 533 ? -89.747  -21.520 75.476  1.00 82.82  ? 694 VAL B CG1 1 
ATOM   4226 C CG2 . VAL A 1 533 ? -87.903  -23.134 75.057  1.00 83.28  ? 694 VAL B CG2 1 
ATOM   4227 N N   . ALA A 1 534 ? -89.719  -20.745 71.590  1.00 87.03  ? 695 ALA B N   1 
ATOM   4228 C CA  . ALA A 1 534 ? -90.389  -19.684 70.838  1.00 87.83  ? 695 ALA B CA  1 
ATOM   4229 C C   . ALA A 1 534 ? -91.485  -20.225 69.912  1.00 89.03  ? 695 ALA B C   1 
ATOM   4230 O O   . ALA A 1 534 ? -92.544  -19.611 69.776  1.00 91.19  ? 695 ALA B O   1 
ATOM   4231 C CB  . ALA A 1 534 ? -89.373  -18.869 70.050  1.00 86.14  ? 695 ALA B CB  1 
ATOM   4232 N N   . ALA A 1 535 ? -91.227  -21.375 69.291  1.00 89.31  ? 696 ALA B N   1 
ATOM   4233 C CA  . ALA A 1 535 ? -92.174  -21.995 68.359  1.00 89.68  ? 696 ALA B CA  1 
ATOM   4234 C C   . ALA A 1 535 ? -93.372  -22.663 69.048  1.00 90.68  ? 696 ALA B C   1 
ATOM   4235 O O   . ALA A 1 535 ? -94.372  -22.971 68.396  1.00 90.82  ? 696 ALA B O   1 
ATOM   4236 C CB  . ALA A 1 535 ? -91.453  -22.989 67.457  1.00 88.04  ? 696 ALA B CB  1 
ATOM   4237 N N   . THR A 1 536 ? -93.272  -22.877 70.358  1.00 92.31  ? 697 THR B N   1 
ATOM   4238 C CA  . THR A 1 536 ? -94.301  -23.602 71.107  1.00 94.86  ? 697 THR B CA  1 
ATOM   4239 C C   . THR A 1 536 ? -94.991  -22.771 72.207  1.00 99.04  ? 697 THR B C   1 
ATOM   4240 O O   . THR A 1 536 ? -95.909  -23.261 72.873  1.00 100.68 ? 697 THR B O   1 
ATOM   4241 C CB  . THR A 1 536 ? -93.749  -24.932 71.681  1.00 94.24  ? 697 THR B CB  1 
ATOM   4242 O OG1 . THR A 1 536 ? -94.760  -25.583 72.457  1.00 98.94  ? 697 THR B OG1 1 
ATOM   4243 C CG2 . THR A 1 536 ? -92.534  -24.696 72.563  1.00 92.94  ? 697 THR B CG2 1 
ATOM   4244 N N   . SER A 1 537 ? -94.558  -21.518 72.368  1.00 102.90 ? 698 SER B N   1 
ATOM   4245 C CA  . SER A 1 537 ? -95.068  -20.595 73.404  1.00 104.90 ? 698 SER B CA  1 
ATOM   4246 C C   . SER A 1 537 ? -94.768  -21.048 74.838  1.00 105.01 ? 698 SER B C   1 
ATOM   4247 O O   . SER A 1 537 ? -95.519  -21.821 75.438  1.00 105.20 ? 698 SER B O   1 
ATOM   4248 C CB  . SER A 1 537 ? -96.569  -20.301 73.227  1.00 104.22 ? 698 SER B CB  1 
ATOM   4249 O OG  . SER A 1 537 ? -96.795  -19.362 72.191  1.00 103.74 ? 698 SER B OG  1 
ATOM   4250 N N   . ASP B 1 1   ? -37.034  7.425   72.850  1.00 106.50 ? 162 ASP A N   1 
ATOM   4251 C CA  . ASP B 1 1   ? -37.021  8.872   72.484  1.00 107.71 ? 162 ASP A CA  1 
ATOM   4252 C C   . ASP B 1 1   ? -36.287  9.729   73.510  1.00 109.36 ? 162 ASP A C   1 
ATOM   4253 O O   . ASP B 1 1   ? -36.557  9.651   74.711  1.00 111.26 ? 162 ASP A O   1 
ATOM   4254 C CB  . ASP B 1 1   ? -38.449  9.398   72.296  1.00 104.96 ? 162 ASP A CB  1 
ATOM   4255 C CG  . ASP B 1 1   ? -38.941  9.268   70.864  1.00 102.96 ? 162 ASP A CG  1 
ATOM   4256 O OD1 . ASP B 1 1   ? -38.173  9.581   69.929  1.00 101.88 ? 162 ASP A OD1 1 
ATOM   4257 O OD2 . ASP B 1 1   ? -40.108  8.867   70.674  1.00 101.59 ? 162 ASP A OD2 1 
ATOM   4258 N N   . ASN B 1 2   ? -35.354  10.540  73.020  1.00 110.61 ? 163 ASN A N   1 
ATOM   4259 C CA  . ASN B 1 2   ? -34.673  11.544  73.835  1.00 111.12 ? 163 ASN A CA  1 
ATOM   4260 C C   . ASN B 1 2   ? -35.275  12.934  73.607  1.00 108.04 ? 163 ASN A C   1 
ATOM   4261 O O   . ASN B 1 2   ? -34.861  13.917  74.230  1.00 106.43 ? 163 ASN A O   1 
ATOM   4262 C CB  . ASN B 1 2   ? -33.164  11.546  73.554  1.00 115.63 ? 163 ASN A CB  1 
ATOM   4263 C CG  . ASN B 1 2   ? -32.828  11.951  72.127  1.00 119.32 ? 163 ASN A CG  1 
ATOM   4264 O OD1 . ASN B 1 2   ? -32.349  13.060  71.884  1.00 120.83 ? 163 ASN A OD1 1 
ATOM   4265 N ND2 . ASN B 1 2   ? -33.079  11.055  71.176  1.00 120.73 ? 163 ASN A ND2 1 
ATOM   4266 N N   . ASP B 1 3   ? -36.257  12.992  72.707  1.00 104.41 ? 164 ASP A N   1 
ATOM   4267 C CA  . ASP B 1 3   ? -36.990  14.215  72.385  1.00 100.16 ? 164 ASP A CA  1 
ATOM   4268 C C   . ASP B 1 3   ? -37.973  14.553  73.513  1.00 96.77  ? 164 ASP A C   1 
ATOM   4269 O O   . ASP B 1 3   ? -38.855  13.751  73.824  1.00 98.68  ? 164 ASP A O   1 
ATOM   4270 C CB  . ASP B 1 3   ? -37.722  14.039  71.046  1.00 98.38  ? 164 ASP A CB  1 
ATOM   4271 C CG  . ASP B 1 3   ? -38.508  15.274  70.625  1.00 97.97  ? 164 ASP A CG  1 
ATOM   4272 O OD1 . ASP B 1 3   ? -38.072  16.409  70.913  1.00 98.19  ? 164 ASP A OD1 1 
ATOM   4273 O OD2 . ASP B 1 3   ? -39.567  15.102  69.984  1.00 96.66  ? 164 ASP A OD2 1 
ATOM   4274 N N   . PRO B 1 4   ? -37.815  15.738  74.137  1.00 91.80  ? 165 PRO A N   1 
ATOM   4275 C CA  . PRO B 1 4   ? -38.649  16.116  75.285  1.00 88.22  ? 165 PRO A CA  1 
ATOM   4276 C C   . PRO B 1 4   ? -40.134  16.291  74.955  1.00 84.57  ? 165 PRO A C   1 
ATOM   4277 O O   . PRO B 1 4   ? -40.984  16.016  75.803  1.00 83.13  ? 165 PRO A O   1 
ATOM   4278 C CB  . PRO B 1 4   ? -38.045  17.453  75.738  1.00 88.95  ? 165 PRO A CB  1 
ATOM   4279 C CG  . PRO B 1 4   ? -37.322  17.976  74.544  1.00 89.46  ? 165 PRO A CG  1 
ATOM   4280 C CD  . PRO B 1 4   ? -36.795  16.762  73.842  1.00 90.10  ? 165 PRO A CD  1 
ATOM   4281 N N   . LEU B 1 5   ? -40.431  16.729  73.732  1.00 81.12  ? 166 LEU A N   1 
ATOM   4282 C CA  . LEU B 1 5   ? -41.802  17.047  73.323  1.00 77.78  ? 166 LEU A CA  1 
ATOM   4283 C C   . LEU B 1 5   ? -42.693  15.828  73.073  1.00 76.60  ? 166 LEU A C   1 
ATOM   4284 O O   . LEU B 1 5   ? -43.920  15.955  73.032  1.00 75.75  ? 166 LEU A O   1 
ATOM   4285 C CB  . LEU B 1 5   ? -41.805  17.981  72.106  1.00 77.39  ? 166 LEU A CB  1 
ATOM   4286 C CG  . LEU B 1 5   ? -42.018  19.486  72.326  1.00 77.23  ? 166 LEU A CG  1 
ATOM   4287 C CD1 . LEU B 1 5   ? -41.097  20.066  73.394  1.00 77.78  ? 166 LEU A CD1 1 
ATOM   4288 C CD2 . LEU B 1 5   ? -41.850  20.235  71.012  1.00 76.79  ? 166 LEU A CD2 1 
ATOM   4289 N N   . VAL B 1 6   ? -42.086  14.656  72.896  1.00 75.06  ? 167 VAL A N   1 
ATOM   4290 C CA  . VAL B 1 6   ? -42.867  13.421  72.863  1.00 75.33  ? 167 VAL A CA  1 
ATOM   4291 C C   . VAL B 1 6   ? -42.993  12.845  74.267  1.00 76.47  ? 167 VAL A C   1 
ATOM   4292 O O   . VAL B 1 6   ? -42.036  12.859  75.045  1.00 76.37  ? 167 VAL A O   1 
ATOM   4293 C CB  . VAL B 1 6   ? -42.326  12.356  71.877  1.00 74.65  ? 167 VAL A CB  1 
ATOM   4294 C CG1 . VAL B 1 6   ? -42.744  12.681  70.452  1.00 73.69  ? 167 VAL A CG1 1 
ATOM   4295 C CG2 . VAL B 1 6   ? -40.817  12.207  71.984  1.00 76.47  ? 167 VAL A CG2 1 
ATOM   4296 N N   . VAL B 1 7   ? -44.192  12.370  74.588  1.00 77.47  ? 168 VAL A N   1 
ATOM   4297 C CA  . VAL B 1 7   ? -44.476  11.770  75.885  1.00 78.63  ? 168 VAL A CA  1 
ATOM   4298 C C   . VAL B 1 7   ? -45.218  10.455  75.665  1.00 80.59  ? 168 VAL A C   1 
ATOM   4299 O O   . VAL B 1 7   ? -46.177  10.398  74.894  1.00 79.47  ? 168 VAL A O   1 
ATOM   4300 C CB  . VAL B 1 7   ? -45.290  12.728  76.787  1.00 78.04  ? 168 VAL A CB  1 
ATOM   4301 C CG1 . VAL B 1 7   ? -45.872  11.995  77.987  1.00 79.12  ? 168 VAL A CG1 1 
ATOM   4302 C CG2 . VAL B 1 7   ? -44.425  13.892  77.251  1.00 76.79  ? 168 VAL A CG2 1 
ATOM   4303 N N   . ASN B 1 8   ? -44.757  9.400   76.330  1.00 84.30  ? 169 ASN A N   1 
ATOM   4304 C CA  . ASN B 1 8   ? -45.363  8.082   76.192  1.00 88.65  ? 169 ASN A CA  1 
ATOM   4305 C C   . ASN B 1 8   ? -46.443  7.823   77.249  1.00 88.96  ? 169 ASN A C   1 
ATOM   4306 O O   . ASN B 1 8   ? -46.162  7.280   78.321  1.00 89.10  ? 169 ASN A O   1 
ATOM   4307 C CB  . ASN B 1 8   ? -44.283  6.989   76.217  1.00 91.65  ? 169 ASN A CB  1 
ATOM   4308 C CG  . ASN B 1 8   ? -44.823  5.615   75.846  1.00 95.11  ? 169 ASN A CG  1 
ATOM   4309 O OD1 . ASN B 1 8   ? -45.870  5.488   75.207  1.00 96.12  ? 169 ASN A OD1 1 
ATOM   4310 N ND2 . ASN B 1 8   ? -44.099  4.574   76.245  1.00 96.55  ? 169 ASN A ND2 1 
ATOM   4311 N N   . THR B 1 9   ? -47.677  8.214   76.933  1.00 87.48  ? 170 THR A N   1 
ATOM   4312 C CA  . THR B 1 9   ? -48.819  7.995   77.827  1.00 86.07  ? 170 THR A CA  1 
ATOM   4313 C C   . THR B 1 9   ? -49.223  6.522   77.841  1.00 86.91  ? 170 THR A C   1 
ATOM   4314 O O   . THR B 1 9   ? -48.797  5.748   76.982  1.00 88.11  ? 170 THR A O   1 
ATOM   4315 C CB  . THR B 1 9   ? -50.039  8.857   77.436  1.00 84.17  ? 170 THR A CB  1 
ATOM   4316 O OG1 . THR B 1 9   ? -50.586  8.394   76.195  1.00 83.84  ? 170 THR A OG1 1 
ATOM   4317 C CG2 . THR B 1 9   ? -49.654  10.327  77.313  1.00 83.13  ? 170 THR A CG2 1 
ATOM   4318 N N   . ASP B 1 10  ? -50.056  6.148   78.812  1.00 88.28  ? 171 ASP A N   1 
ATOM   4319 C CA  . ASP B 1 10  ? -50.476  4.756   79.000  1.00 88.85  ? 171 ASP A CA  1 
ATOM   4320 C C   . ASP B 1 10  ? -51.217  4.152   77.798  1.00 85.41  ? 171 ASP A C   1 
ATOM   4321 O O   . ASP B 1 10  ? -51.303  2.929   77.675  1.00 86.43  ? 171 ASP A O   1 
ATOM   4322 C CB  . ASP B 1 10  ? -51.314  4.607   80.280  1.00 92.96  ? 171 ASP A CB  1 
ATOM   4323 C CG  . ASP B 1 10  ? -52.640  5.349   80.207  1.00 98.47  ? 171 ASP A CG  1 
ATOM   4324 O OD1 . ASP B 1 10  ? -52.627  6.595   80.112  1.00 101.98 ? 171 ASP A OD1 1 
ATOM   4325 O OD2 . ASP B 1 10  ? -53.699  4.687   80.254  1.00 100.90 ? 171 ASP A OD2 1 
ATOM   4326 N N   . LYS B 1 11  ? -51.739  5.003   76.917  1.00 81.05  ? 172 LYS A N   1 
ATOM   4327 C CA  . LYS B 1 11  ? -52.457  4.529   75.732  1.00 80.26  ? 172 LYS A CA  1 
ATOM   4328 C C   . LYS B 1 11  ? -51.684  4.722   74.418  1.00 81.34  ? 172 LYS A C   1 
ATOM   4329 O O   . LYS B 1 11  ? -52.072  4.193   73.375  1.00 80.34  ? 172 LYS A O   1 
ATOM   4330 C CB  . LYS B 1 11  ? -53.858  5.153   75.654  1.00 78.62  ? 172 LYS A CB  1 
ATOM   4331 C CG  . LYS B 1 11  ? -54.821  4.677   76.736  1.00 75.89  ? 172 LYS A CG  1 
ATOM   4332 C CD  . LYS B 1 11  ? -55.269  3.238   76.520  1.00 72.86  ? 172 LYS A CD  1 
ATOM   4333 C CE  . LYS B 1 11  ? -56.164  2.756   77.652  1.00 70.17  ? 172 LYS A CE  1 
ATOM   4334 N NZ  . LYS B 1 11  ? -56.901  1.517   77.283  1.00 66.01  ? 172 LYS A NZ  1 
ATOM   4335 N N   . GLY B 1 12  ? -50.588  5.474   74.475  1.00 81.96  ? 173 GLY A N   1 
ATOM   4336 C CA  . GLY B 1 12  ? -49.745  5.688   73.300  1.00 82.64  ? 173 GLY A CA  1 
ATOM   4337 C C   . GLY B 1 12  ? -48.796  6.861   73.446  1.00 84.03  ? 173 GLY A C   1 
ATOM   4338 O O   . GLY B 1 12  ? -48.746  7.508   74.494  1.00 84.19  ? 173 GLY A O   1 
ATOM   4339 N N   . ARG B 1 13  ? -48.032  7.128   72.390  1.00 83.70  ? 174 ARG A N   1 
ATOM   4340 C CA  . ARG B 1 13  ? -47.110  8.259   72.374  1.00 81.98  ? 174 ARG A CA  1 
ATOM   4341 C C   . ARG B 1 13  ? -47.763  9.495   71.765  1.00 79.25  ? 174 ARG A C   1 
ATOM   4342 O O   . ARG B 1 13  ? -48.520  9.397   70.798  1.00 79.24  ? 174 ARG A O   1 
ATOM   4343 C CB  . ARG B 1 13  ? -45.825  7.909   71.621  1.00 84.50  ? 174 ARG A CB  1 
ATOM   4344 C CG  . ARG B 1 13  ? -44.785  7.191   72.467  1.00 87.13  ? 174 ARG A CG  1 
ATOM   4345 C CD  . ARG B 1 13  ? -43.469  7.038   71.719  1.00 89.83  ? 174 ARG A CD  1 
ATOM   4346 N NE  . ARG B 1 13  ? -43.571  6.080   70.618  1.00 92.78  ? 174 ARG A NE  1 
ATOM   4347 C CZ  . ARG B 1 13  ? -42.736  6.021   69.583  1.00 93.42  ? 174 ARG A CZ  1 
ATOM   4348 N NH1 . ARG B 1 13  ? -41.722  6.873   69.481  1.00 92.85  ? 174 ARG A NH1 1 
ATOM   4349 N NH2 . ARG B 1 13  ? -42.922  5.110   68.637  1.00 93.96  ? 174 ARG A NH2 1 
ATOM   4350 N N   . ILE B 1 14  ? -47.467  10.653  72.349  1.00 75.54  ? 175 ILE A N   1 
ATOM   4351 C CA  . ILE B 1 14  ? -48.004  11.928  71.875  1.00 71.82  ? 175 ILE A CA  1 
ATOM   4352 C C   . ILE B 1 14  ? -46.893  12.957  71.674  1.00 71.33  ? 175 ILE A C   1 
ATOM   4353 O O   . ILE B 1 14  ? -45.920  12.980  72.428  1.00 70.37  ? 175 ILE A O   1 
ATOM   4354 C CB  . ILE B 1 14  ? -49.085  12.502  72.825  1.00 70.71  ? 175 ILE A CB  1 
ATOM   4355 C CG1 . ILE B 1 14  ? -48.559  12.625  74.263  1.00 69.78  ? 175 ILE A CG1 1 
ATOM   4356 C CG2 . ILE B 1 14  ? -50.353  11.661  72.773  1.00 70.08  ? 175 ILE A CG2 1 
ATOM   4357 C CD1 . ILE B 1 14  ? -49.303  13.628  75.119  1.00 67.84  ? 175 ILE A CD1 1 
ATOM   4358 N N   . ARG B 1 15  ? -47.042  13.799  70.652  1.00 71.82  ? 176 ARG A N   1 
ATOM   4359 C CA  . ARG B 1 15  ? -46.103  14.896  70.410  1.00 72.09  ? 176 ARG A CA  1 
ATOM   4360 C C   . ARG B 1 15  ? -46.764  16.256  70.604  1.00 72.12  ? 176 ARG A C   1 
ATOM   4361 O O   . ARG B 1 15  ? -47.823  16.534  70.034  1.00 72.68  ? 176 ARG A O   1 
ATOM   4362 C CB  . ARG B 1 15  ? -45.488  14.812  69.007  1.00 72.47  ? 176 ARG A CB  1 
ATOM   4363 C CG  . ARG B 1 15  ? -44.432  15.880  68.746  1.00 72.32  ? 176 ARG A CG  1 
ATOM   4364 C CD  . ARG B 1 15  ? -43.934  15.879  67.311  1.00 72.83  ? 176 ARG A CD  1 
ATOM   4365 N NE  . ARG B 1 15  ? -42.921  14.852  67.078  1.00 72.16  ? 176 ARG A NE  1 
ATOM   4366 C CZ  . ARG B 1 15  ? -43.130  13.719  66.414  1.00 72.21  ? 176 ARG A CZ  1 
ATOM   4367 N NH1 . ARG B 1 15  ? -44.322  13.446  65.896  1.00 72.16  ? 176 ARG A NH1 1 
ATOM   4368 N NH2 . ARG B 1 15  ? -42.137  12.855  66.262  1.00 73.09  ? 176 ARG A NH2 1 
ATOM   4369 N N   . GLY B 1 16  ? -46.122  17.096  71.410  1.00 71.58  ? 177 GLY A N   1 
ATOM   4370 C CA  . GLY B 1 16  ? -46.569  18.467  71.626  1.00 70.11  ? 177 GLY A CA  1 
ATOM   4371 C C   . GLY B 1 16  ? -45.737  19.466  70.849  1.00 68.88  ? 177 GLY A C   1 
ATOM   4372 O O   . GLY B 1 16  ? -44.932  19.087  69.996  1.00 70.64  ? 177 GLY A O   1 
ATOM   4373 N N   . ILE B 1 17  ? -45.931  20.746  71.150  1.00 67.61  ? 178 ILE A N   1 
ATOM   4374 C CA  . ILE B 1 17  ? -45.237  21.825  70.448  1.00 66.79  ? 178 ILE A CA  1 
ATOM   4375 C C   . ILE B 1 17  ? -44.838  22.953  71.405  1.00 67.20  ? 178 ILE A C   1 
ATOM   4376 O O   . ILE B 1 17  ? -45.539  23.224  72.383  1.00 66.61  ? 178 ILE A O   1 
ATOM   4377 C CB  . ILE B 1 17  ? -46.079  22.362  69.259  1.00 65.26  ? 178 ILE A CB  1 
ATOM   4378 C CG1 . ILE B 1 17  ? -45.280  23.385  68.441  1.00 65.56  ? 178 ILE A CG1 1 
ATOM   4379 C CG2 . ILE B 1 17  ? -47.414  22.922  69.736  1.00 64.40  ? 178 ILE A CG2 1 
ATOM   4380 C CD1 . ILE B 1 17  ? -46.016  23.947  67.246  1.00 66.29  ? 178 ILE A CD1 1 
ATOM   4381 N N   . THR B 1 18  ? -43.702  23.588  71.124  1.00 68.36  ? 179 THR A N   1 
ATOM   4382 C CA  . THR B 1 18  ? -43.238  24.740  71.896  1.00 69.75  ? 179 THR A CA  1 
ATOM   4383 C C   . THR B 1 18  ? -43.815  26.030  71.315  1.00 70.94  ? 179 THR A C   1 
ATOM   4384 O O   . THR B 1 18  ? -43.633  26.327  70.132  1.00 70.67  ? 179 THR A O   1 
ATOM   4385 C CB  . THR B 1 18  ? -41.697  24.823  71.941  1.00 68.93  ? 179 THR A CB  1 
ATOM   4386 O OG1 . THR B 1 18  ? -41.161  23.565  72.367  1.00 70.06  ? 179 THR A OG1 1 
ATOM   4387 C CG2 . THR B 1 18  ? -41.239  25.910  72.906  1.00 67.78  ? 179 THR A CG2 1 
ATOM   4388 N N   . VAL B 1 19  ? -44.524  26.779  72.156  1.00 72.47  ? 180 VAL A N   1 
ATOM   4389 C CA  . VAL B 1 19  ? -45.133  28.044  71.755  1.00 74.54  ? 180 VAL A CA  1 
ATOM   4390 C C   . VAL B 1 19  ? -44.848  29.113  72.806  1.00 75.45  ? 180 VAL A C   1 
ATOM   4391 O O   . VAL B 1 19  ? -44.640  28.802  73.980  1.00 74.36  ? 180 VAL A O   1 
ATOM   4392 C CB  . VAL B 1 19  ? -46.666  27.927  71.559  1.00 75.48  ? 180 VAL A CB  1 
ATOM   4393 C CG1 . VAL B 1 19  ? -47.170  29.021  70.624  1.00 76.71  ? 180 VAL A CG1 1 
ATOM   4394 C CG2 . VAL B 1 19  ? -47.055  26.562  71.008  1.00 75.87  ? 180 VAL A CG2 1 
ATOM   4395 N N   . ASP B 1 20  ? -44.832  30.370  72.369  1.00 78.06  ? 181 ASP A N   1 
ATOM   4396 C CA  . ASP B 1 20  ? -44.720  31.506  73.273  1.00 79.35  ? 181 ASP A CA  1 
ATOM   4397 C C   . ASP B 1 20  ? -46.064  31.791  73.929  1.00 77.78  ? 181 ASP A C   1 
ATOM   4398 O O   . ASP B 1 20  ? -47.117  31.589  73.322  1.00 76.93  ? 181 ASP A O   1 
ATOM   4399 C CB  . ASP B 1 20  ? -44.264  32.759  72.515  1.00 83.35  ? 181 ASP A CB  1 
ATOM   4400 C CG  . ASP B 1 20  ? -42.888  32.607  71.885  1.00 86.21  ? 181 ASP A CG  1 
ATOM   4401 O OD1 . ASP B 1 20  ? -42.023  31.908  72.460  1.00 89.00  ? 181 ASP A OD1 1 
ATOM   4402 O OD2 . ASP B 1 20  ? -42.669  33.205  70.809  1.00 86.57  ? 181 ASP A OD2 1 
ATOM   4403 N N   . ALA B 1 21  ? -46.019  32.259  75.171  1.00 76.93  ? 182 ALA A N   1 
ATOM   4404 C CA  . ALA B 1 21  ? -47.181  32.859  75.810  1.00 77.31  ? 182 ALA A CA  1 
ATOM   4405 C C   . ALA B 1 21  ? -47.372  34.250  75.198  1.00 78.82  ? 182 ALA A C   1 
ATOM   4406 O O   . ALA B 1 21  ? -46.496  34.721  74.465  1.00 79.92  ? 182 ALA A O   1 
ATOM   4407 C CB  . ALA B 1 21  ? -46.961  32.956  77.311  1.00 76.69  ? 182 ALA A CB  1 
ATOM   4408 N N   . PRO B 1 22  ? -48.515  34.912  75.474  1.00 78.98  ? 183 PRO A N   1 
ATOM   4409 C CA  . PRO B 1 22  ? -48.621  36.310  75.047  1.00 79.25  ? 183 PRO A CA  1 
ATOM   4410 C C   . PRO B 1 22  ? -47.552  37.190  75.704  1.00 80.46  ? 183 PRO A C   1 
ATOM   4411 O O   . PRO B 1 22  ? -47.090  38.158  75.097  1.00 79.35  ? 183 PRO A O   1 
ATOM   4412 C CB  . PRO B 1 22  ? -50.021  36.721  75.517  1.00 77.93  ? 183 PRO A CB  1 
ATOM   4413 C CG  . PRO B 1 22  ? -50.410  35.704  76.538  1.00 78.05  ? 183 PRO A CG  1 
ATOM   4414 C CD  . PRO B 1 22  ? -49.774  34.434  76.070  1.00 77.96  ? 183 PRO A CD  1 
ATOM   4415 N N   . SER B 1 23  ? -47.155  36.826  76.923  1.00 82.16  ? 184 SER A N   1 
ATOM   4416 C CA  . SER B 1 23  ? -46.124  37.545  77.675  1.00 82.56  ? 184 SER A CA  1 
ATOM   4417 C C   . SER B 1 23  ? -44.733  37.454  77.038  1.00 80.50  ? 184 SER A C   1 
ATOM   4418 O O   . SER B 1 23  ? -43.844  38.241  77.365  1.00 81.37  ? 184 SER A O   1 
ATOM   4419 C CB  . SER B 1 23  ? -46.081  37.054  79.130  1.00 85.39  ? 184 SER A CB  1 
ATOM   4420 O OG  . SER B 1 23  ? -45.996  35.640  79.208  1.00 86.60  ? 184 SER A OG  1 
ATOM   4421 N N   . GLY B 1 24  ? -44.557  36.501  76.127  1.00 78.28  ? 185 GLY A N   1 
ATOM   4422 C CA  . GLY B 1 24  ? -43.273  36.287  75.464  1.00 76.10  ? 185 GLY A CA  1 
ATOM   4423 C C   . GLY B 1 24  ? -42.572  35.028  75.942  1.00 74.81  ? 185 GLY A C   1 
ATOM   4424 O O   . GLY B 1 24  ? -41.821  34.407  75.188  1.00 75.00  ? 185 GLY A O   1 
ATOM   4425 N N   . LYS B 1 25  ? -42.826  34.656  77.197  1.00 72.99  ? 186 LYS A N   1 
ATOM   4426 C CA  . LYS B 1 25  ? -42.220  33.479  77.827  1.00 70.94  ? 186 LYS A CA  1 
ATOM   4427 C C   . LYS B 1 25  ? -42.650  32.189  77.131  1.00 71.29  ? 186 LYS A C   1 
ATOM   4428 O O   . LYS B 1 25  ? -43.837  31.980  76.880  1.00 72.07  ? 186 LYS A O   1 
ATOM   4429 C CB  . LYS B 1 25  ? -42.588  33.424  79.314  1.00 68.87  ? 186 LYS A CB  1 
ATOM   4430 C CG  . LYS B 1 25  ? -42.183  34.657  80.110  1.00 67.20  ? 186 LYS A CG  1 
ATOM   4431 C CD  . LYS B 1 25  ? -42.633  34.567  81.560  1.00 64.82  ? 186 LYS A CD  1 
ATOM   4432 C CE  . LYS B 1 25  ? -42.142  35.762  82.363  1.00 62.00  ? 186 LYS A CE  1 
ATOM   4433 N NZ  . LYS B 1 25  ? -42.530  35.659  83.795  1.00 58.81  ? 186 LYS A NZ  1 
ATOM   4434 N N   . LYS B 1 26  ? -41.685  31.329  76.817  1.00 72.01  ? 187 LYS A N   1 
ATOM   4435 C CA  . LYS B 1 26  ? -41.970  30.090  76.086  1.00 72.91  ? 187 LYS A CA  1 
ATOM   4436 C C   . LYS B 1 26  ? -42.417  28.942  76.994  1.00 71.34  ? 187 LYS A C   1 
ATOM   4437 O O   . LYS B 1 26  ? -41.877  28.749  78.085  1.00 70.46  ? 187 LYS A O   1 
ATOM   4438 C CB  . LYS B 1 26  ? -40.786  29.673  75.197  1.00 75.66  ? 187 LYS A CB  1 
ATOM   4439 C CG  . LYS B 1 26  ? -39.423  29.644  75.881  1.00 79.32  ? 187 LYS A CG  1 
ATOM   4440 C CD  . LYS B 1 26  ? -38.327  29.216  74.912  1.00 80.54  ? 187 LYS A CD  1 
ATOM   4441 C CE  . LYS B 1 26  ? -36.939  29.308  75.533  1.00 79.25  ? 187 LYS A CE  1 
ATOM   4442 N NZ  . LYS B 1 26  ? -36.746  28.371  76.677  1.00 77.76  ? 187 LYS A NZ  1 
ATOM   4443 N N   . VAL B 1 27  ? -43.418  28.198  76.526  1.00 70.52  ? 188 VAL A N   1 
ATOM   4444 C CA  . VAL B 1 27  ? -43.966  27.037  77.238  1.00 69.52  ? 188 VAL A CA  1 
ATOM   4445 C C   . VAL B 1 27  ? -44.134  25.845  76.294  1.00 70.11  ? 188 VAL A C   1 
ATOM   4446 O O   . VAL B 1 27  ? -44.048  25.996  75.075  1.00 72.65  ? 188 VAL A O   1 
ATOM   4447 C CB  . VAL B 1 27  ? -45.329  27.348  77.902  1.00 68.20  ? 188 VAL A CB  1 
ATOM   4448 C CG1 . VAL B 1 27  ? -45.159  28.329  79.052  1.00 68.88  ? 188 VAL A CG1 1 
ATOM   4449 C CG2 . VAL B 1 27  ? -46.336  27.869  76.884  1.00 67.31  ? 188 VAL A CG2 1 
ATOM   4450 N N   . ASP B 1 28  ? -44.378  24.666  76.862  1.00 69.73  ? 189 ASP A N   1 
ATOM   4451 C CA  . ASP B 1 28  ? -44.610  23.456  76.074  1.00 69.21  ? 189 ASP A CA  1 
ATOM   4452 C C   . ASP B 1 28  ? -46.060  23.005  76.216  1.00 66.54  ? 189 ASP A C   1 
ATOM   4453 O O   . ASP B 1 28  ? -46.542  22.780  77.327  1.00 66.68  ? 189 ASP A O   1 
ATOM   4454 C CB  . ASP B 1 28  ? -43.652  22.338  76.500  1.00 72.47  ? 189 ASP A CB  1 
ATOM   4455 C CG  . ASP B 1 28  ? -42.189  22.753  76.411  1.00 76.12  ? 189 ASP A CG  1 
ATOM   4456 O OD1 . ASP B 1 28  ? -41.731  23.119  75.305  1.00 76.46  ? 189 ASP A OD1 1 
ATOM   4457 O OD2 . ASP B 1 28  ? -41.495  22.706  77.451  1.00 78.71  ? 189 ASP A OD2 1 
ATOM   4458 N N   . VAL B 1 29  ? -46.755  22.882  75.089  1.00 63.60  ? 190 VAL A N   1 
ATOM   4459 C CA  . VAL B 1 29  ? -48.187  22.578  75.106  1.00 61.88  ? 190 VAL A CA  1 
ATOM   4460 C C   . VAL B 1 29  ? -48.527  21.233  74.455  1.00 61.06  ? 190 VAL A C   1 
ATOM   4461 O O   . VAL B 1 29  ? -47.824  20.769  73.557  1.00 61.91  ? 190 VAL A O   1 
ATOM   4462 C CB  . VAL B 1 29  ? -49.031  23.717  74.473  1.00 61.77  ? 190 VAL A CB  1 
ATOM   4463 C CG1 . VAL B 1 29  ? -48.672  25.066  75.085  1.00 61.21  ? 190 VAL A CG1 1 
ATOM   4464 C CG2 . VAL B 1 29  ? -48.869  23.760  72.960  1.00 61.10  ? 190 VAL A CG2 1 
ATOM   4465 N N   . TRP B 1 30  ? -49.604  20.614  74.933  1.00 59.63  ? 191 TRP A N   1 
ATOM   4466 C CA  . TRP B 1 30  ? -50.143  19.383  74.357  1.00 58.19  ? 191 TRP A CA  1 
ATOM   4467 C C   . TRP B 1 30  ? -51.655  19.533  74.214  1.00 57.31  ? 191 TRP A C   1 
ATOM   4468 O O   . TRP B 1 30  ? -52.395  19.417  75.193  1.00 57.64  ? 191 TRP A O   1 
ATOM   4469 C CB  . TRP B 1 30  ? -49.813  18.177  75.240  1.00 58.60  ? 191 TRP A CB  1 
ATOM   4470 C CG  . TRP B 1 30  ? -48.364  17.811  75.257  1.00 58.39  ? 191 TRP A CG  1 
ATOM   4471 C CD1 . TRP B 1 30  ? -47.738  16.918  74.441  1.00 58.41  ? 191 TRP A CD1 1 
ATOM   4472 C CD2 . TRP B 1 30  ? -47.358  18.320  76.142  1.00 58.20  ? 191 TRP A CD2 1 
ATOM   4473 N NE1 . TRP B 1 30  ? -46.403  16.843  74.754  1.00 58.42  ? 191 TRP A NE1 1 
ATOM   4474 C CE2 . TRP B 1 30  ? -46.142  17.692  75.796  1.00 57.86  ? 191 TRP A CE2 1 
ATOM   4475 C CE3 . TRP B 1 30  ? -47.365  19.248  77.192  1.00 58.59  ? 191 TRP A CE3 1 
ATOM   4476 C CZ2 . TRP B 1 30  ? -44.943  17.961  76.462  1.00 57.69  ? 191 TRP A CZ2 1 
ATOM   4477 C CZ3 . TRP B 1 30  ? -46.170  19.515  77.854  1.00 58.37  ? 191 TRP A CZ3 1 
ATOM   4478 C CH2 . TRP B 1 30  ? -44.977  18.872  77.485  1.00 57.98  ? 191 TRP A CH2 1 
ATOM   4479 N N   . LEU B 1 31  ? -52.104  19.795  72.990  1.00 55.47  ? 192 LEU A N   1 
ATOM   4480 C CA  . LEU B 1 31  ? -53.498  20.159  72.736  1.00 53.77  ? 192 LEU A CA  1 
ATOM   4481 C C   . LEU B 1 31  ? -54.316  19.020  72.135  1.00 53.25  ? 192 LEU A C   1 
ATOM   4482 O O   . LEU B 1 31  ? -54.060  18.583  71.010  1.00 54.01  ? 192 LEU A O   1 
ATOM   4483 C CB  . LEU B 1 31  ? -53.560  21.388  71.822  1.00 53.49  ? 192 LEU A CB  1 
ATOM   4484 C CG  . LEU B 1 31  ? -53.460  22.820  72.368  1.00 52.99  ? 192 LEU A CG  1 
ATOM   4485 C CD1 . LEU B 1 31  ? -52.589  22.957  73.610  1.00 52.03  ? 192 LEU A CD1 1 
ATOM   4486 C CD2 . LEU B 1 31  ? -52.966  23.742  71.263  1.00 52.79  ? 192 LEU A CD2 1 
ATOM   4487 N N   . GLY B 1 32  ? -55.298  18.544  72.895  1.00 52.31  ? 193 GLY A N   1 
ATOM   4488 C CA  . GLY B 1 32  ? -56.241  17.544  72.405  1.00 52.37  ? 193 GLY A CA  1 
ATOM   4489 C C   . GLY B 1 32  ? -55.803  16.099  72.554  1.00 52.67  ? 193 GLY A C   1 
ATOM   4490 O O   . GLY B 1 32  ? -55.943  15.307  71.620  1.00 53.46  ? 193 GLY A O   1 
ATOM   4491 N N   . ILE B 1 33  ? -55.273  15.754  73.726  1.00 51.99  ? 194 ILE A N   1 
ATOM   4492 C CA  . ILE B 1 33  ? -54.936  14.368  74.048  1.00 51.35  ? 194 ILE A CA  1 
ATOM   4493 C C   . ILE B 1 33  ? -56.235  13.617  74.345  1.00 52.28  ? 194 ILE A C   1 
ATOM   4494 O O   . ILE B 1 33  ? -56.939  13.971  75.291  1.00 53.00  ? 194 ILE A O   1 
ATOM   4495 C CB  . ILE B 1 33  ? -54.018  14.268  75.285  1.00 50.23  ? 194 ILE A CB  1 
ATOM   4496 C CG1 . ILE B 1 33  ? -52.907  15.323  75.240  1.00 49.17  ? 194 ILE A CG1 1 
ATOM   4497 C CG2 . ILE B 1 33  ? -53.446  12.861  75.407  1.00 50.13  ? 194 ILE A CG2 1 
ATOM   4498 C CD1 . ILE B 1 33  ? -52.285  15.626  76.588  1.00 48.50  ? 194 ILE A CD1 1 
ATOM   4499 N N   . PRO B 1 34  ? -56.560  12.583  73.540  1.00 53.09  ? 195 PRO A N   1 
ATOM   4500 C CA  . PRO B 1 34  ? -57.822  11.859  73.743  1.00 54.09  ? 195 PRO A CA  1 
ATOM   4501 C C   . PRO B 1 34  ? -57.798  11.000  75.006  1.00 55.31  ? 195 PRO A C   1 
ATOM   4502 O O   . PRO B 1 34  ? -56.908  10.159  75.168  1.00 56.69  ? 195 PRO A O   1 
ATOM   4503 C CB  . PRO B 1 34  ? -57.946  10.992  72.486  1.00 53.46  ? 195 PRO A CB  1 
ATOM   4504 C CG  . PRO B 1 34  ? -56.552  10.823  71.989  1.00 53.17  ? 195 PRO A CG  1 
ATOM   4505 C CD  . PRO B 1 34  ? -55.757  12.015  72.440  1.00 53.12  ? 195 PRO A CD  1 
ATOM   4506 N N   . TYR B 1 35  ? -58.760  11.228  75.897  1.00 55.61  ? 196 TYR A N   1 
ATOM   4507 C CA  . TYR B 1 35  ? -58.810  10.509  77.171  1.00 55.64  ? 196 TYR A CA  1 
ATOM   4508 C C   . TYR B 1 35  ? -59.967  9.512   77.240  1.00 55.52  ? 196 TYR A C   1 
ATOM   4509 O O   . TYR B 1 35  ? -60.079  8.747   78.204  1.00 55.99  ? 196 TYR A O   1 
ATOM   4510 C CB  . TYR B 1 35  ? -58.831  11.484  78.363  1.00 55.21  ? 196 TYR A CB  1 
ATOM   4511 C CG  . TYR B 1 35  ? -60.138  12.226  78.586  1.00 55.30  ? 196 TYR A CG  1 
ATOM   4512 C CD1 . TYR B 1 35  ? -61.152  11.672  79.367  1.00 55.15  ? 196 TYR A CD1 1 
ATOM   4513 C CD2 . TYR B 1 35  ? -60.352  13.491  78.036  1.00 55.20  ? 196 TYR A CD2 1 
ATOM   4514 C CE1 . TYR B 1 35  ? -62.344  12.345  79.577  1.00 54.82  ? 196 TYR A CE1 1 
ATOM   4515 C CE2 . TYR B 1 35  ? -61.540  14.174  78.250  1.00 54.70  ? 196 TYR A CE2 1 
ATOM   4516 C CZ  . TYR B 1 35  ? -62.532  13.594  79.019  1.00 54.52  ? 196 TYR A CZ  1 
ATOM   4517 O OH  . TYR B 1 35  ? -63.714  14.258  79.234  1.00 54.36  ? 196 TYR A OH  1 
ATOM   4518 N N   . ALA B 1 36  ? -60.811  9.515   76.210  1.00 54.57  ? 197 ALA A N   1 
ATOM   4519 C CA  . ALA B 1 36  ? -61.960  8.619   76.151  1.00 54.96  ? 197 ALA A CA  1 
ATOM   4520 C C   . ALA B 1 36  ? -62.366  8.285   74.721  1.00 55.32  ? 197 ALA A C   1 
ATOM   4521 O O   . ALA B 1 36  ? -62.091  9.052   73.798  1.00 55.56  ? 197 ALA A O   1 
ATOM   4522 C CB  . ALA B 1 36  ? -63.135  9.229   76.899  1.00 55.12  ? 197 ALA A CB  1 
ATOM   4523 N N   . GLN B 1 37  ? -63.013  7.132   74.546  1.00 56.54  ? 198 GLN A N   1 
ATOM   4524 C CA  . GLN B 1 37  ? -63.669  6.789   73.285  1.00 58.10  ? 198 GLN A CA  1 
ATOM   4525 C C   . GLN B 1 37  ? -64.703  7.860   72.959  1.00 57.94  ? 198 GLN A C   1 
ATOM   4526 O O   . GLN B 1 37  ? -65.508  8.212   73.829  1.00 59.21  ? 198 GLN A O   1 
ATOM   4527 C CB  . GLN B 1 37  ? -64.392  5.445   73.395  1.00 59.48  ? 198 GLN A CB  1 
ATOM   4528 C CG  . GLN B 1 37  ? -63.543  4.205   73.169  1.00 60.38  ? 198 GLN A CG  1 
ATOM   4529 C CD  . GLN B 1 37  ? -64.366  2.927   73.237  1.00 61.01  ? 198 GLN A CD  1 
ATOM   4530 O OE1 . GLN B 1 37  ? -65.446  2.832   72.645  1.00 60.36  ? 198 GLN A OE1 1 
ATOM   4531 N NE2 . GLN B 1 37  ? -63.860  1.936   73.963  1.00 61.24  ? 198 GLN A NE2 1 
ATOM   4532 N N   . PRO B 1 38  ? -64.683  8.390   71.718  1.00 56.68  ? 199 PRO A N   1 
ATOM   4533 C CA  . PRO B 1 38  ? -65.699  9.358   71.301  1.00 56.05  ? 199 PRO A CA  1 
ATOM   4534 C C   . PRO B 1 38  ? -67.108  8.820   71.559  1.00 55.86  ? 199 PRO A C   1 
ATOM   4535 O O   . PRO B 1 38  ? -67.475  7.778   71.009  1.00 56.13  ? 199 PRO A O   1 
ATOM   4536 C CB  . PRO B 1 38  ? -65.442  9.534   69.795  1.00 55.68  ? 199 PRO A CB  1 
ATOM   4537 C CG  . PRO B 1 38  ? -64.444  8.490   69.416  1.00 56.11  ? 199 PRO A CG  1 
ATOM   4538 C CD  . PRO B 1 38  ? -63.678  8.176   70.665  1.00 56.48  ? 199 PRO A CD  1 
ATOM   4539 N N   . PRO B 1 39  ? -67.882  9.516   72.414  1.00 55.44  ? 200 PRO A N   1 
ATOM   4540 C CA  . PRO B 1 39  ? -69.201  9.059   72.860  1.00 56.02  ? 200 PRO A CA  1 
ATOM   4541 C C   . PRO B 1 39  ? -70.283  9.228   71.788  1.00 57.16  ? 200 PRO A C   1 
ATOM   4542 O O   . PRO B 1 39  ? -71.259  9.954   71.989  1.00 58.07  ? 200 PRO A O   1 
ATOM   4543 C CB  . PRO B 1 39  ? -69.480  9.947   74.075  1.00 55.73  ? 200 PRO A CB  1 
ATOM   4544 C CG  . PRO B 1 39  ? -68.727  11.200  73.800  1.00 55.22  ? 200 PRO A CG  1 
ATOM   4545 C CD  . PRO B 1 39  ? -67.504  10.803  73.030  1.00 54.96  ? 200 PRO A CD  1 
ATOM   4546 N N   . VAL B 1 40  ? -70.106  8.538   70.666  1.00 58.93  ? 201 VAL A N   1 
ATOM   4547 C CA  . VAL B 1 40  ? -70.986  8.677   69.509  1.00 60.16  ? 201 VAL A CA  1 
ATOM   4548 C C   . VAL B 1 40  ? -71.824  7.412   69.303  1.00 62.30  ? 201 VAL A C   1 
ATOM   4549 O O   . VAL B 1 40  ? -71.412  6.315   69.689  1.00 62.82  ? 201 VAL A O   1 
ATOM   4550 C CB  . VAL B 1 40  ? -70.175  8.980   68.228  1.00 58.93  ? 201 VAL A CB  1 
ATOM   4551 C CG1 . VAL B 1 40  ? -71.077  9.530   67.131  1.00 60.18  ? 201 VAL A CG1 1 
ATOM   4552 C CG2 . VAL B 1 40  ? -69.057  9.970   68.524  1.00 58.10  ? 201 VAL A CG2 1 
ATOM   4553 N N   . GLY B 1 41  ? -73.003  7.581   68.705  1.00 64.26  ? 202 GLY A N   1 
ATOM   4554 C CA  . GLY B 1 41  ? -73.870  6.464   68.345  1.00 67.63  ? 202 GLY A CA  1 
ATOM   4555 C C   . GLY B 1 41  ? -74.459  5.752   69.548  1.00 70.28  ? 202 GLY A C   1 
ATOM   4556 O O   . GLY B 1 41  ? -75.234  6.349   70.296  1.00 72.67  ? 202 GLY A O   1 
ATOM   4557 N N   . PRO B 1 42  ? -74.091  4.470   69.744  1.00 71.22  ? 203 PRO A N   1 
ATOM   4558 C CA  . PRO B 1 42  ? -74.578  3.668   70.869  1.00 71.36  ? 203 PRO A CA  1 
ATOM   4559 C C   . PRO B 1 42  ? -74.107  4.191   72.226  1.00 72.31  ? 203 PRO A C   1 
ATOM   4560 O O   . PRO B 1 42  ? -74.727  3.889   73.248  1.00 73.77  ? 203 PRO A O   1 
ATOM   4561 C CB  . PRO B 1 42  ? -73.963  2.286   70.611  1.00 70.86  ? 203 PRO A CB  1 
ATOM   4562 C CG  . PRO B 1 42  ? -73.601  2.277   69.166  1.00 70.51  ? 203 PRO A CG  1 
ATOM   4563 C CD  . PRO B 1 42  ? -73.208  3.687   68.862  1.00 71.30  ? 203 PRO A CD  1 
ATOM   4564 N N   . LEU B 1 43  ? -73.028  4.972   72.225  1.00 71.50  ? 204 LEU A N   1 
ATOM   4565 C CA  . LEU B 1 43  ? -72.397  5.438   73.459  1.00 70.64  ? 204 LEU A CA  1 
ATOM   4566 C C   . LEU B 1 43  ? -72.959  6.756   73.998  1.00 70.56  ? 204 LEU A C   1 
ATOM   4567 O O   . LEU B 1 43  ? -72.578  7.190   75.091  1.00 71.75  ? 204 LEU A O   1 
ATOM   4568 C CB  . LEU B 1 43  ? -70.880  5.549   73.273  1.00 70.30  ? 204 LEU A CB  1 
ATOM   4569 C CG  . LEU B 1 43  ? -70.101  4.272   72.947  1.00 70.36  ? 204 LEU A CG  1 
ATOM   4570 C CD1 . LEU B 1 43  ? -68.658  4.609   72.602  1.00 71.23  ? 204 LEU A CD1 1 
ATOM   4571 C CD2 . LEU B 1 43  ? -70.162  3.270   74.091  1.00 69.44  ? 204 LEU A CD2 1 
ATOM   4572 N N   . ARG B 1 44  ? -73.860  7.380   73.239  1.00 68.39  ? 205 ARG A N   1 
ATOM   4573 C CA  . ARG B 1 44  ? -74.442  8.672   73.620  1.00 67.57  ? 205 ARG A CA  1 
ATOM   4574 C C   . ARG B 1 44  ? -75.301  8.594   74.885  1.00 68.34  ? 205 ARG A C   1 
ATOM   4575 O O   . ARG B 1 44  ? -76.031  7.619   75.094  1.00 68.93  ? 205 ARG A O   1 
ATOM   4576 C CB  . ARG B 1 44  ? -75.246  9.270   72.462  1.00 67.34  ? 205 ARG A CB  1 
ATOM   4577 C CG  . ARG B 1 44  ? -75.687  10.706  72.697  1.00 66.53  ? 205 ARG A CG  1 
ATOM   4578 C CD  . ARG B 1 44  ? -75.720  11.490  71.402  1.00 66.21  ? 205 ARG A CD  1 
ATOM   4579 N NE  . ARG B 1 44  ? -76.990  11.366  70.700  1.00 67.14  ? 205 ARG A NE  1 
ATOM   4580 C CZ  . ARG B 1 44  ? -77.218  11.836  69.476  1.00 68.19  ? 205 ARG A CZ  1 
ATOM   4581 N NH1 . ARG B 1 44  ? -76.261  12.457  68.799  1.00 66.68  ? 205 ARG A NH1 1 
ATOM   4582 N NH2 . ARG B 1 44  ? -78.411  11.680  68.922  1.00 70.12  ? 205 ARG A NH2 1 
ATOM   4583 N N   . PHE B 1 45  ? -75.195  9.643   75.708  1.00 67.85  ? 206 PHE A N   1 
ATOM   4584 C CA  . PHE B 1 45  ? -75.857  9.766   77.022  1.00 67.43  ? 206 PHE A CA  1 
ATOM   4585 C C   . PHE B 1 45  ? -75.198  8.926   78.114  1.00 68.43  ? 206 PHE A C   1 
ATOM   4586 O O   . PHE B 1 45  ? -75.358  9.208   79.305  1.00 69.63  ? 206 PHE A O   1 
ATOM   4587 C CB  . PHE B 1 45  ? -77.363  9.469   76.951  1.00 66.62  ? 206 PHE A CB  1 
ATOM   4588 C CG  . PHE B 1 45  ? -78.084  10.232  75.879  1.00 66.52  ? 206 PHE A CG  1 
ATOM   4589 C CD1 . PHE B 1 45  ? -78.155  11.619  75.919  1.00 66.69  ? 206 PHE A CD1 1 
ATOM   4590 C CD2 . PHE B 1 45  ? -78.697  9.561   74.829  1.00 67.25  ? 206 PHE A CD2 1 
ATOM   4591 C CE1 . PHE B 1 45  ? -78.821  12.323  74.930  1.00 67.84  ? 206 PHE A CE1 1 
ATOM   4592 C CE2 . PHE B 1 45  ? -79.364  10.259  73.835  1.00 67.86  ? 206 PHE A CE2 1 
ATOM   4593 C CZ  . PHE B 1 45  ? -79.427  11.641  73.886  1.00 68.17  ? 206 PHE A CZ  1 
ATOM   4594 N N   . ARG B 1 46  ? -74.453  7.905   77.694  1.00 69.04  ? 207 ARG A N   1 
ATOM   4595 C CA  . ARG B 1 46  ? -73.810  6.961   78.602  1.00 68.43  ? 207 ARG A CA  1 
ATOM   4596 C C   . ARG B 1 46  ? -72.439  7.442   79.050  1.00 68.41  ? 207 ARG A C   1 
ATOM   4597 O O   . ARG B 1 46  ? -71.846  8.331   78.438  1.00 68.94  ? 207 ARG A O   1 
ATOM   4598 C CB  . ARG B 1 46  ? -73.663  5.597   77.934  1.00 68.21  ? 207 ARG A CB  1 
ATOM   4599 C CG  . ARG B 1 46  ? -74.967  4.921   77.558  1.00 68.36  ? 207 ARG A CG  1 
ATOM   4600 C CD  . ARG B 1 46  ? -74.676  3.791   76.592  1.00 68.83  ? 207 ARG A CD  1 
ATOM   4601 N NE  . ARG B 1 46  ? -75.826  2.924   76.377  1.00 70.35  ? 207 ARG A NE  1 
ATOM   4602 C CZ  . ARG B 1 46  ? -75.771  1.754   75.748  1.00 71.61  ? 207 ARG A CZ  1 
ATOM   4603 N NH1 . ARG B 1 46  ? -74.616  1.303   75.272  1.00 71.37  ? 207 ARG A NH1 1 
ATOM   4604 N NH2 . ARG B 1 46  ? -76.872  1.030   75.597  1.00 73.23  ? 207 ARG A NH2 1 
ATOM   4605 N N   . HIS B 1 47  ? -71.942  6.823   80.117  1.00 68.58  ? 208 HIS A N   1 
ATOM   4606 C CA  . HIS B 1 47  ? -70.644  7.140   80.706  1.00 68.47  ? 208 HIS A CA  1 
ATOM   4607 C C   . HIS B 1 47  ? -69.501  6.846   79.734  1.00 67.04  ? 208 HIS A C   1 
ATOM   4608 O O   . HIS B 1 47  ? -69.650  6.013   78.838  1.00 67.97  ? 208 HIS A O   1 
ATOM   4609 C CB  . HIS B 1 47  ? -70.472  6.352   82.008  1.00 70.43  ? 208 HIS A CB  1 
ATOM   4610 C CG  . HIS B 1 47  ? -71.490  6.690   83.054  1.00 72.38  ? 208 HIS A CG  1 
ATOM   4611 N ND1 . HIS B 1 47  ? -71.319  6.379   84.385  1.00 74.05  ? 208 HIS A ND1 1 
ATOM   4612 C CD2 . HIS B 1 47  ? -72.682  7.328   82.968  1.00 72.95  ? 208 HIS A CD2 1 
ATOM   4613 C CE1 . HIS B 1 47  ? -72.371  6.792   85.070  1.00 74.49  ? 208 HIS A CE1 1 
ATOM   4614 N NE2 . HIS B 1 47  ? -73.208  7.381   84.235  1.00 73.96  ? 208 HIS A NE2 1 
ATOM   4615 N N   . PRO B 1 48  ? -68.357  7.535   79.901  1.00 65.81  ? 209 PRO A N   1 
ATOM   4616 C CA  . PRO B 1 48  ? -67.272  7.384   78.937  1.00 65.98  ? 209 PRO A CA  1 
ATOM   4617 C C   . PRO B 1 48  ? -66.504  6.072   79.098  1.00 65.82  ? 209 PRO A C   1 
ATOM   4618 O O   . PRO B 1 48  ? -66.435  5.519   80.199  1.00 65.42  ? 209 PRO A O   1 
ATOM   4619 C CB  . PRO B 1 48  ? -66.363  8.569   79.258  1.00 65.56  ? 209 PRO A CB  1 
ATOM   4620 C CG  . PRO B 1 48  ? -66.557  8.793   80.719  1.00 65.03  ? 209 PRO A CG  1 
ATOM   4621 C CD  . PRO B 1 48  ? -67.998  8.464   80.991  1.00 65.15  ? 209 PRO A CD  1 
ATOM   4622 N N   . ARG B 1 49  ? -65.949  5.582   77.994  1.00 65.47  ? 210 ARG A N   1 
ATOM   4623 C CA  . ARG B 1 49  ? -65.033  4.446   78.015  1.00 65.54  ? 210 ARG A CA  1 
ATOM   4624 C C   . ARG B 1 49  ? -63.622  4.997   77.860  1.00 66.92  ? 210 ARG A C   1 
ATOM   4625 O O   . ARG B 1 49  ? -63.436  6.009   77.186  1.00 66.51  ? 210 ARG A O   1 
ATOM   4626 C CB  . ARG B 1 49  ? -65.334  3.473   76.867  1.00 64.21  ? 210 ARG A CB  1 
ATOM   4627 C CG  . ARG B 1 49  ? -66.809  3.176   76.641  1.00 62.55  ? 210 ARG A CG  1 
ATOM   4628 C CD  . ARG B 1 49  ? -67.408  2.400   77.800  1.00 62.50  ? 210 ARG A CD  1 
ATOM   4629 N NE  . ARG B 1 49  ? -68.815  2.734   78.002  1.00 62.16  ? 210 ARG A NE  1 
ATOM   4630 C CZ  . ARG B 1 49  ? -69.832  2.069   77.463  1.00 61.85  ? 210 ARG A CZ  1 
ATOM   4631 N NH1 . ARG B 1 49  ? -69.611  1.018   76.679  1.00 62.50  ? 210 ARG A NH1 1 
ATOM   4632 N NH2 . ARG B 1 49  ? -71.075  2.458   77.706  1.00 59.85  ? 210 ARG A NH2 1 
ATOM   4633 N N   . PRO B 1 50  ? -62.620  4.342   78.479  1.00 68.36  ? 211 PRO A N   1 
ATOM   4634 C CA  . PRO B 1 50  ? -61.246  4.806   78.289  1.00 69.63  ? 211 PRO A CA  1 
ATOM   4635 C C   . PRO B 1 50  ? -60.862  4.787   76.812  1.00 72.01  ? 211 PRO A C   1 
ATOM   4636 O O   . PRO B 1 50  ? -61.423  4.004   76.039  1.00 72.50  ? 211 PRO A O   1 
ATOM   4637 C CB  . PRO B 1 50  ? -60.419  3.783   79.069  1.00 69.09  ? 211 PRO A CB  1 
ATOM   4638 C CG  . PRO B 1 50  ? -61.356  3.245   80.095  1.00 68.79  ? 211 PRO A CG  1 
ATOM   4639 C CD  . PRO B 1 50  ? -62.686  3.195   79.403  1.00 68.88  ? 211 PRO A CD  1 
ATOM   4640 N N   . ALA B 1 51  ? -59.926  5.653   76.431  1.00 74.20  ? 212 ALA A N   1 
ATOM   4641 C CA  . ALA B 1 51  ? -59.487  5.767   75.041  1.00 75.93  ? 212 ALA A CA  1 
ATOM   4642 C C   . ALA B 1 51  ? -58.817  4.482   74.564  1.00 77.41  ? 212 ALA A C   1 
ATOM   4643 O O   . ALA B 1 51  ? -58.113  3.826   75.334  1.00 78.30  ? 212 ALA A O   1 
ATOM   4644 C CB  . ALA B 1 51  ? -58.541  6.947   74.884  1.00 75.65  ? 212 ALA A CB  1 
ATOM   4645 N N   . GLU B 1 52  ? -59.051  4.119   73.304  1.00 77.39  ? 213 GLU A N   1 
ATOM   4646 C CA  . GLU B 1 52  ? -58.366  2.983   72.688  1.00 79.17  ? 213 GLU A CA  1 
ATOM   4647 C C   . GLU B 1 52  ? -56.894  3.311   72.480  1.00 80.48  ? 213 GLU A C   1 
ATOM   4648 O O   . GLU B 1 52  ? -56.561  4.423   72.062  1.00 83.70  ? 213 GLU A O   1 
ATOM   4649 C CB  . GLU B 1 52  ? -58.989  2.644   71.342  1.00 80.94  ? 213 GLU A CB  1 
ATOM   4650 C CG  . GLU B 1 52  ? -60.351  1.987   71.420  1.00 85.61  ? 213 GLU A CG  1 
ATOM   4651 C CD  . GLU B 1 52  ? -60.828  1.512   70.063  1.00 89.97  ? 213 GLU A CD  1 
ATOM   4652 O OE1 . GLU B 1 52  ? -61.936  1.913   69.649  1.00 94.18  ? 213 GLU A OE1 1 
ATOM   4653 O OE2 . GLU B 1 52  ? -60.091  0.747   69.402  1.00 90.78  ? 213 GLU A OE2 1 
ATOM   4654 N N   . LYS B 1 53  ? -56.017  2.350   72.765  1.00 80.12  ? 214 LYS A N   1 
ATOM   4655 C CA  . LYS B 1 53  ? -54.579  2.571   72.607  1.00 79.01  ? 214 LYS A CA  1 
ATOM   4656 C C   . LYS B 1 53  ? -54.210  2.718   71.130  1.00 77.47  ? 214 LYS A C   1 
ATOM   4657 O O   . LYS B 1 53  ? -54.743  2.004   70.277  1.00 76.33  ? 214 LYS A O   1 
ATOM   4658 C CB  . LYS B 1 53  ? -53.749  1.483   73.310  1.00 80.40  ? 214 LYS A CB  1 
ATOM   4659 C CG  . LYS B 1 53  ? -53.596  0.165   72.566  1.00 82.21  ? 214 LYS A CG  1 
ATOM   4660 C CD  . LYS B 1 53  ? -52.499  -0.680  73.196  1.00 83.88  ? 214 LYS A CD  1 
ATOM   4661 C CE  . LYS B 1 53  ? -52.226  -1.936  72.384  1.00 83.89  ? 214 LYS A CE  1 
ATOM   4662 N NZ  . LYS B 1 53  ? -51.218  -2.809  73.046  1.00 83.61  ? 214 LYS A NZ  1 
ATOM   4663 N N   . TRP B 1 54  ? -53.320  3.664   70.837  1.00 76.62  ? 215 TRP A N   1 
ATOM   4664 C CA  . TRP B 1 54  ? -52.963  3.978   69.451  1.00 76.16  ? 215 TRP A CA  1 
ATOM   4665 C C   . TRP B 1 54  ? -51.527  3.611   69.091  1.00 76.91  ? 215 TRP A C   1 
ATOM   4666 O O   . TRP B 1 54  ? -50.601  3.762   69.897  1.00 75.46  ? 215 TRP A O   1 
ATOM   4667 C CB  . TRP B 1 54  ? -53.250  5.449   69.111  1.00 75.39  ? 215 TRP A CB  1 
ATOM   4668 C CG  . TRP B 1 54  ? -52.569  6.438   70.012  1.00 74.12  ? 215 TRP A CG  1 
ATOM   4669 C CD1 . TRP B 1 54  ? -51.287  6.901   69.908  1.00 73.07  ? 215 TRP A CD1 1 
ATOM   4670 C CD2 . TRP B 1 54  ? -53.138  7.090   71.153  1.00 73.16  ? 215 TRP A CD2 1 
ATOM   4671 N NE1 . TRP B 1 54  ? -51.022  7.795   70.915  1.00 72.22  ? 215 TRP A NE1 1 
ATOM   4672 C CE2 . TRP B 1 54  ? -52.141  7.931   71.695  1.00 72.72  ? 215 TRP A CE2 1 
ATOM   4673 C CE3 . TRP B 1 54  ? -54.395  7.043   71.774  1.00 71.76  ? 215 TRP A CE3 1 
ATOM   4674 C CZ2 . TRP B 1 54  ? -52.360  8.720   72.828  1.00 71.92  ? 215 TRP A CZ2 1 
ATOM   4675 C CZ3 . TRP B 1 54  ? -54.612  7.827   72.901  1.00 71.52  ? 215 TRP A CZ3 1 
ATOM   4676 C CH2 . TRP B 1 54  ? -53.598  8.656   73.414  1.00 71.57  ? 215 TRP A CH2 1 
ATOM   4677 N N   . THR B 1 55  ? -51.368  3.137   67.859  1.00 78.51  ? 216 THR A N   1 
ATOM   4678 C CA  . THR B 1 55  ? -50.074  2.757   67.310  1.00 79.24  ? 216 THR A CA  1 
ATOM   4679 C C   . THR B 1 55  ? -49.370  3.965   66.680  1.00 78.70  ? 216 THR A C   1 
ATOM   4680 O O   . THR B 1 55  ? -49.962  4.701   65.885  1.00 80.06  ? 216 THR A O   1 
ATOM   4681 C CB  . THR B 1 55  ? -50.217  1.590   66.299  1.00 80.67  ? 216 THR A CB  1 
ATOM   4682 O OG1 . THR B 1 55  ? -48.969  1.363   65.633  1.00 84.20  ? 216 THR A OG1 1 
ATOM   4683 C CG2 . THR B 1 55  ? -51.316  1.867   65.257  1.00 79.15  ? 216 THR A CG2 1 
ATOM   4684 N N   . GLY B 1 56  ? -48.110  4.168   67.055  1.00 77.16  ? 217 GLY A N   1 
ATOM   4685 C CA  . GLY B 1 56  ? -47.309  5.269   66.522  1.00 75.98  ? 217 GLY A CA  1 
ATOM   4686 C C   . GLY B 1 56  ? -47.279  6.487   67.426  1.00 75.44  ? 217 GLY A C   1 
ATOM   4687 O O   . GLY B 1 56  ? -47.567  6.391   68.623  1.00 77.30  ? 217 GLY A O   1 
ATOM   4688 N N   . VAL B 1 57  ? -46.919  7.632   66.849  1.00 73.17  ? 218 VAL A N   1 
ATOM   4689 C CA  . VAL B 1 57  ? -46.880  8.902   67.576  1.00 70.55  ? 218 VAL A CA  1 
ATOM   4690 C C   . VAL B 1 57  ? -47.999  9.818   67.090  1.00 70.62  ? 218 VAL A C   1 
ATOM   4691 O O   . VAL B 1 57  ? -48.090  10.123  65.901  1.00 71.78  ? 218 VAL A O   1 
ATOM   4692 C CB  . VAL B 1 57  ? -45.513  9.610   67.430  1.00 68.16  ? 218 VAL A CB  1 
ATOM   4693 C CG1 . VAL B 1 57  ? -45.552  11.007  68.034  1.00 65.81  ? 218 VAL A CG1 1 
ATOM   4694 C CG2 . VAL B 1 57  ? -44.417  8.784   68.084  1.00 67.90  ? 218 VAL A CG2 1 
ATOM   4695 N N   . LEU B 1 58  ? -48.852  10.239  68.018  1.00 70.71  ? 219 LEU A N   1 
ATOM   4696 C CA  . LEU B 1 58  ? -49.942  11.153  67.709  1.00 70.41  ? 219 LEU A CA  1 
ATOM   4697 C C   . LEU B 1 58  ? -49.542  12.589  68.019  1.00 72.91  ? 219 LEU A C   1 
ATOM   4698 O O   . LEU B 1 58  ? -49.101  12.893  69.129  1.00 74.36  ? 219 LEU A O   1 
ATOM   4699 C CB  . LEU B 1 58  ? -51.200  10.776  68.498  1.00 67.76  ? 219 LEU A CB  1 
ATOM   4700 C CG  . LEU B 1 58  ? -52.365  11.770  68.490  1.00 66.30  ? 219 LEU A CG  1 
ATOM   4701 C CD1 . LEU B 1 58  ? -52.983  11.893  67.104  1.00 66.59  ? 219 LEU A CD1 1 
ATOM   4702 C CD2 . LEU B 1 58  ? -53.410  11.367  69.516  1.00 66.18  ? 219 LEU A CD2 1 
ATOM   4703 N N   . ASN B 1 59  ? -49.697  13.468  67.032  1.00 73.34  ? 220 ASN A N   1 
ATOM   4704 C CA  . ASN B 1 59  ? -49.457  14.888  67.235  1.00 73.18  ? 220 ASN A CA  1 
ATOM   4705 C C   . ASN B 1 59  ? -50.604  15.537  67.991  1.00 72.87  ? 220 ASN A C   1 
ATOM   4706 O O   . ASN B 1 59  ? -51.607  15.938  67.394  1.00 72.64  ? 220 ASN A O   1 
ATOM   4707 C CB  . ASN B 1 59  ? -49.279  15.606  65.904  1.00 75.74  ? 220 ASN A CB  1 
ATOM   4708 C CG  . ASN B 1 59  ? -47.943  15.328  65.251  1.00 77.58  ? 220 ASN A CG  1 
ATOM   4709 O OD1 . ASN B 1 59  ? -46.893  15.273  65.900  1.00 77.15  ? 220 ASN A OD1 1 
ATOM   4710 N ND2 . ASN B 1 59  ? -47.989  15.161  63.941  1.00 79.94  ? 220 ASN A ND2 1 
ATOM   4711 N N   . THR B 1 60  ? -50.458  15.629  69.307  1.00 72.42  ? 221 THR A N   1 
ATOM   4712 C CA  . THR B 1 60  ? -51.435  16.326  70.132  1.00 71.58  ? 221 THR A CA  1 
ATOM   4713 C C   . THR B 1 60  ? -51.062  17.814  70.145  1.00 69.36  ? 221 THR A C   1 
ATOM   4714 O O   . THR B 1 60  ? -50.439  18.321  71.082  1.00 68.83  ? 221 THR A O   1 
ATOM   4715 C CB  . THR B 1 60  ? -51.553  15.689  71.537  1.00 72.94  ? 221 THR A CB  1 
ATOM   4716 O OG1 . THR B 1 60  ? -52.623  16.305  72.262  1.00 76.05  ? 221 THR A OG1 1 
ATOM   4717 C CG2 . THR B 1 60  ? -50.251  15.806  72.324  1.00 72.27  ? 221 THR A CG2 1 
ATOM   4718 N N   . THR B 1 61  ? -51.455  18.502  69.076  1.00 67.43  ? 222 THR A N   1 
ATOM   4719 C CA  . THR B 1 61  ? -50.859  19.791  68.731  1.00 65.94  ? 222 THR A CA  1 
ATOM   4720 C C   . THR B 1 61  ? -51.860  20.862  68.241  1.00 65.56  ? 222 THR A C   1 
ATOM   4721 O O   . THR B 1 61  ? -51.471  21.986  67.912  1.00 65.98  ? 222 THR A O   1 
ATOM   4722 C CB  . THR B 1 61  ? -49.709  19.577  67.711  1.00 64.77  ? 222 THR A CB  1 
ATOM   4723 O OG1 . THR B 1 61  ? -48.891  20.748  67.646  1.00 66.99  ? 222 THR A OG1 1 
ATOM   4724 C CG2 . THR B 1 61  ? -50.240  19.233  66.315  1.00 63.56  ? 222 THR A CG2 1 
ATOM   4725 N N   . THR B 1 62  ? -53.144  20.514  68.221  1.00 64.13  ? 223 THR A N   1 
ATOM   4726 C CA  . THR B 1 62  ? -54.193  21.390  67.699  1.00 62.83  ? 223 THR A CA  1 
ATOM   4727 C C   . THR B 1 62  ? -55.339  21.475  68.710  1.00 63.63  ? 223 THR A C   1 
ATOM   4728 O O   . THR B 1 62  ? -55.763  20.443  69.230  1.00 65.16  ? 223 THR A O   1 
ATOM   4729 C CB  . THR B 1 62  ? -54.718  20.848  66.352  1.00 62.04  ? 223 THR A CB  1 
ATOM   4730 O OG1 . THR B 1 62  ? -53.612  20.604  65.476  1.00 61.45  ? 223 THR A OG1 1 
ATOM   4731 C CG2 . THR B 1 62  ? -55.682  21.824  65.685  1.00 61.69  ? 223 THR A CG2 1 
ATOM   4732 N N   . PRO B 1 63  ? -55.840  22.700  68.998  1.00 64.13  ? 224 PRO A N   1 
ATOM   4733 C CA  . PRO B 1 63  ? -56.934  22.860  69.966  1.00 62.88  ? 224 PRO A CA  1 
ATOM   4734 C C   . PRO B 1 63  ? -58.145  21.996  69.606  1.00 61.14  ? 224 PRO A C   1 
ATOM   4735 O O   . PRO B 1 63  ? -58.676  22.117  68.499  1.00 61.00  ? 224 PRO A O   1 
ATOM   4736 C CB  . PRO B 1 63  ? -57.281  24.355  69.878  1.00 63.43  ? 224 PRO A CB  1 
ATOM   4737 C CG  . PRO B 1 63  ? -56.678  24.828  68.597  1.00 64.62  ? 224 PRO A CG  1 
ATOM   4738 C CD  . PRO B 1 63  ? -55.442  23.996  68.421  1.00 65.09  ? 224 PRO A CD  1 
ATOM   4739 N N   . PRO B 1 64  ? -58.572  21.122  70.538  1.00 59.55  ? 225 PRO A N   1 
ATOM   4740 C CA  . PRO B 1 64  ? -59.567  20.082  70.266  1.00 58.64  ? 225 PRO A CA  1 
ATOM   4741 C C   . PRO B 1 64  ? -60.961  20.635  70.007  1.00 58.06  ? 225 PRO A C   1 
ATOM   4742 O O   . PRO B 1 64  ? -61.223  21.805  70.285  1.00 58.58  ? 225 PRO A O   1 
ATOM   4743 C CB  . PRO B 1 64  ? -59.569  19.264  71.558  1.00 58.53  ? 225 PRO A CB  1 
ATOM   4744 C CG  . PRO B 1 64  ? -59.175  20.238  72.614  1.00 58.40  ? 225 PRO A CG  1 
ATOM   4745 C CD  . PRO B 1 64  ? -58.168  21.136  71.957  1.00 58.82  ? 225 PRO A CD  1 
ATOM   4746 N N   . ASN B 1 65  ? -61.841  19.790  69.475  1.00 57.83  ? 226 ASN A N   1 
ATOM   4747 C CA  . ASN B 1 65  ? -63.248  20.140  69.300  1.00 58.51  ? 226 ASN A CA  1 
ATOM   4748 C C   . ASN B 1 65  ? -63.915  20.469  70.626  1.00 58.86  ? 226 ASN A C   1 
ATOM   4749 O O   . ASN B 1 65  ? -63.581  19.887  71.659  1.00 59.81  ? 226 ASN A O   1 
ATOM   4750 C CB  . ASN B 1 65  ? -64.014  18.989  68.645  1.00 58.86  ? 226 ASN A CB  1 
ATOM   4751 C CG  . ASN B 1 65  ? -63.497  18.646  67.266  1.00 59.44  ? 226 ASN A CG  1 
ATOM   4752 O OD1 . ASN B 1 65  ? -62.906  19.480  66.578  1.00 60.67  ? 226 ASN A OD1 1 
ATOM   4753 N ND2 . ASN B 1 65  ? -63.726  17.409  66.849  1.00 60.09  ? 226 ASN A ND2 1 
ATOM   4754 N N   . SER B 1 66  ? -64.849  21.409  70.593  1.00 59.12  ? 227 SER A N   1 
ATOM   4755 C CA  . SER B 1 66  ? -65.704  21.669  71.741  1.00 60.34  ? 227 SER A CA  1 
ATOM   4756 C C   . SER B 1 66  ? -66.986  20.871  71.567  1.00 60.15  ? 227 SER A C   1 
ATOM   4757 O O   . SER B 1 66  ? -67.404  20.609  70.440  1.00 59.51  ? 227 SER A O   1 
ATOM   4758 C CB  . SER B 1 66  ? -66.001  23.159  71.874  1.00 60.99  ? 227 SER A CB  1 
ATOM   4759 O OG  . SER B 1 66  ? -66.134  23.768  70.606  1.00 63.64  ? 227 SER A OG  1 
ATOM   4760 N N   . CYS B 1 67  ? -67.599  20.481  72.681  1.00 61.13  ? 228 CYS A N   1 
ATOM   4761 C CA  . CYS B 1 67  ? -68.790  19.630  72.647  1.00 61.53  ? 228 CYS A CA  1 
ATOM   4762 C C   . CYS B 1 67  ? -70.015  20.376  72.127  1.00 60.75  ? 228 CYS A C   1 
ATOM   4763 O O   . CYS B 1 67  ? -70.064  21.608  72.169  1.00 61.06  ? 228 CYS A O   1 
ATOM   4764 C CB  . CYS B 1 67  ? -69.059  19.025  74.027  1.00 63.27  ? 228 CYS A CB  1 
ATOM   4765 S SG  . CYS B 1 67  ? -67.668  18.076  74.696  1.00 66.23  ? 228 CYS A SG  1 
ATOM   4766 N N   . VAL B 1 68  ? -70.993  19.622  71.632  1.00 59.89  ? 229 VAL A N   1 
ATOM   4767 C CA  . VAL B 1 68  ? -72.190  20.198  71.019  1.00 59.88  ? 229 VAL A CA  1 
ATOM   4768 C C   . VAL B 1 68  ? -73.007  20.997  72.034  1.00 60.56  ? 229 VAL A C   1 
ATOM   4769 O O   . VAL B 1 68  ? -73.358  20.492  73.101  1.00 60.35  ? 229 VAL A O   1 
ATOM   4770 C CB  . VAL B 1 68  ? -73.063  19.114  70.349  1.00 59.56  ? 229 VAL A CB  1 
ATOM   4771 C CG1 . VAL B 1 68  ? -74.323  19.718  69.743  1.00 58.92  ? 229 VAL A CG1 1 
ATOM   4772 C CG2 . VAL B 1 68  ? -72.266  18.371  69.288  1.00 60.24  ? 229 VAL A CG2 1 
ATOM   4773 N N   . GLN B 1 69  ? -73.288  22.250  71.681  1.00 61.91  ? 230 GLN A N   1 
ATOM   4774 C CA  . GLN B 1 69  ? -74.015  23.186  72.538  1.00 62.87  ? 230 GLN A CA  1 
ATOM   4775 C C   . GLN B 1 69  ? -74.650  24.292  71.696  1.00 64.57  ? 230 GLN A C   1 
ATOM   4776 O O   . GLN B 1 69  ? -74.353  24.420  70.506  1.00 64.20  ? 230 GLN A O   1 
ATOM   4777 C CB  . GLN B 1 69  ? -73.064  23.800  73.570  1.00 61.84  ? 230 GLN A CB  1 
ATOM   4778 C CG  . GLN B 1 69  ? -71.947  24.638  72.965  1.00 60.90  ? 230 GLN A CG  1 
ATOM   4779 C CD  . GLN B 1 69  ? -70.817  24.898  73.935  1.00 60.65  ? 230 GLN A CD  1 
ATOM   4780 O OE1 . GLN B 1 69  ? -70.622  26.024  74.386  1.00 61.87  ? 230 GLN A OE1 1 
ATOM   4781 N NE2 . GLN B 1 69  ? -70.065  23.855  74.264  1.00 60.24  ? 230 GLN A NE2 1 
ATOM   4782 N N   . ILE B 1 70  ? -75.518  25.087  72.321  1.00 67.27  ? 231 ILE A N   1 
ATOM   4783 C CA  . ILE B 1 70  ? -76.100  26.270  71.677  1.00 69.36  ? 231 ILE A CA  1 
ATOM   4784 C C   . ILE B 1 70  ? -75.065  27.388  71.542  1.00 70.06  ? 231 ILE A C   1 
ATOM   4785 O O   . ILE B 1 70  ? -74.096  27.442  72.306  1.00 71.50  ? 231 ILE A O   1 
ATOM   4786 C CB  . ILE B 1 70  ? -77.328  26.814  72.449  1.00 70.11  ? 231 ILE A CB  1 
ATOM   4787 C CG1 . ILE B 1 70  ? -76.965  27.123  73.910  1.00 71.59  ? 231 ILE A CG1 1 
ATOM   4788 C CG2 . ILE B 1 70  ? -78.491  25.834  72.368  1.00 70.07  ? 231 ILE A CG2 1 
ATOM   4789 C CD1 . ILE B 1 70  ? -77.823  28.191  74.558  1.00 72.91  ? 231 ILE A CD1 1 
ATOM   4790 N N   . VAL B 1 71  ? -75.267  28.270  70.567  1.00 70.07  ? 232 VAL A N   1 
ATOM   4791 C CA  . VAL B 1 71  ? -74.436  29.469  70.435  1.00 70.92  ? 232 VAL A CA  1 
ATOM   4792 C C   . VAL B 1 71  ? -75.217  30.720  70.849  1.00 72.45  ? 232 VAL A C   1 
ATOM   4793 O O   . VAL B 1 71  ? -76.397  30.867  70.520  1.00 74.31  ? 232 VAL A O   1 
ATOM   4794 C CB  . VAL B 1 71  ? -73.816  29.625  69.023  1.00 69.81  ? 232 VAL A CB  1 
ATOM   4795 C CG1 . VAL B 1 71  ? -72.757  28.557  68.780  1.00 67.95  ? 232 VAL A CG1 1 
ATOM   4796 C CG2 . VAL B 1 71  ? -74.884  29.595  67.935  1.00 71.31  ? 232 VAL A CG2 1 
ATOM   4797 N N   . ASP B 1 72  ? -74.555  31.606  71.586  1.00 73.06  ? 233 ASP A N   1 
ATOM   4798 C CA  . ASP B 1 72  ? -75.190  32.801  72.131  1.00 75.71  ? 233 ASP A CA  1 
ATOM   4799 C C   . ASP B 1 72  ? -75.314  33.878  71.052  1.00 78.46  ? 233 ASP A C   1 
ATOM   4800 O O   . ASP B 1 72  ? -74.353  34.594  70.756  1.00 81.07  ? 233 ASP A O   1 
ATOM   4801 C CB  . ASP B 1 72  ? -74.390  33.307  73.339  1.00 76.53  ? 233 ASP A CB  1 
ATOM   4802 C CG  . ASP B 1 72  ? -75.100  34.409  74.114  1.00 77.08  ? 233 ASP A CG  1 
ATOM   4803 O OD1 . ASP B 1 72  ? -76.260  34.751  73.794  1.00 77.54  ? 233 ASP A OD1 1 
ATOM   4804 O OD2 . ASP B 1 72  ? -74.479  34.933  75.062  1.00 75.98  ? 233 ASP A OD2 1 
ATOM   4805 N N   . THR B 1 73  ? -76.505  33.981  70.467  1.00 79.55  ? 234 THR A N   1 
ATOM   4806 C CA  . THR B 1 73  ? -76.750  34.921  69.371  1.00 80.75  ? 234 THR A CA  1 
ATOM   4807 C C   . THR B 1 73  ? -77.799  35.981  69.719  1.00 82.48  ? 234 THR A C   1 
ATOM   4808 O O   . THR B 1 73  ? -78.324  36.655  68.827  1.00 83.76  ? 234 THR A O   1 
ATOM   4809 C CB  . THR B 1 73  ? -77.182  34.190  68.081  1.00 80.27  ? 234 THR A CB  1 
ATOM   4810 O OG1 . THR B 1 73  ? -78.326  33.372  68.353  1.00 80.72  ? 234 THR A OG1 1 
ATOM   4811 C CG2 . THR B 1 73  ? -76.050  33.321  67.540  1.00 81.00  ? 234 THR A CG2 1 
ATOM   4812 N N   . VAL B 1 74  ? -78.092  36.132  71.011  1.00 82.30  ? 235 VAL A N   1 
ATOM   4813 C CA  . VAL B 1 74  ? -79.118  37.079  71.467  1.00 80.39  ? 235 VAL A CA  1 
ATOM   4814 C C   . VAL B 1 74  ? -78.622  38.535  71.492  1.00 79.53  ? 235 VAL A C   1 
ATOM   4815 O O   . VAL B 1 74  ? -79.420  39.466  71.360  1.00 80.32  ? 235 VAL A O   1 
ATOM   4816 C CB  . VAL B 1 74  ? -79.748  36.649  72.821  1.00 79.61  ? 235 VAL A CB  1 
ATOM   4817 C CG1 . VAL B 1 74  ? -78.845  36.997  73.994  1.00 78.76  ? 235 VAL A CG1 1 
ATOM   4818 C CG2 . VAL B 1 74  ? -81.131  37.264  73.000  1.00 79.37  ? 235 VAL A CG2 1 
ATOM   4819 N N   . PHE B 1 75  ? -77.314  38.725  71.653  1.00 78.05  ? 236 PHE A N   1 
ATOM   4820 C CA  . PHE B 1 75  ? -76.720  40.060  71.570  1.00 77.26  ? 236 PHE A CA  1 
ATOM   4821 C C   . PHE B 1 75  ? -75.836  40.211  70.337  1.00 77.69  ? 236 PHE A C   1 
ATOM   4822 O O   . PHE B 1 75  ? -75.050  41.156  70.236  1.00 77.47  ? 236 PHE A O   1 
ATOM   4823 C CB  . PHE B 1 75  ? -75.950  40.408  72.850  1.00 77.30  ? 236 PHE A CB  1 
ATOM   4824 C CG  . PHE B 1 75  ? -76.834  40.625  74.043  1.00 76.66  ? 236 PHE A CG  1 
ATOM   4825 C CD1 . PHE B 1 75  ? -77.734  41.685  74.074  1.00 75.90  ? 236 PHE A CD1 1 
ATOM   4826 C CD2 . PHE B 1 75  ? -76.773  39.769  75.136  1.00 76.43  ? 236 PHE A CD2 1 
ATOM   4827 C CE1 . PHE B 1 75  ? -78.557  41.885  75.169  1.00 75.65  ? 236 PHE A CE1 1 
ATOM   4828 C CE2 . PHE B 1 75  ? -77.594  39.964  76.234  1.00 75.83  ? 236 PHE A CE2 1 
ATOM   4829 C CZ  . PHE B 1 75  ? -78.486  41.024  76.250  1.00 75.38  ? 236 PHE A CZ  1 
ATOM   4830 N N   . GLY B 1 76  ? -75.987  39.276  69.401  1.00 77.79  ? 237 GLY A N   1 
ATOM   4831 C CA  . GLY B 1 76  ? -75.256  39.297  68.138  1.00 77.18  ? 237 GLY A CA  1 
ATOM   4832 C C   . GLY B 1 76  ? -73.775  39.057  68.323  1.00 76.92  ? 237 GLY A C   1 
ATOM   4833 O O   . GLY B 1 76  ? -73.372  38.136  69.037  1.00 78.14  ? 237 GLY A O   1 
ATOM   4834 N N   . ASP B 1 77  ? -72.967  39.899  67.685  1.00 76.73  ? 238 ASP A N   1 
ATOM   4835 C CA  . ASP B 1 77  ? -71.513  39.792  67.757  1.00 77.82  ? 238 ASP A CA  1 
ATOM   4836 C C   . ASP B 1 77  ? -70.914  40.661  68.868  1.00 78.52  ? 238 ASP A C   1 
ATOM   4837 O O   . ASP B 1 77  ? -69.757  41.080  68.785  1.00 79.78  ? 238 ASP A O   1 
ATOM   4838 C CB  . ASP B 1 77  ? -70.886  40.132  66.399  1.00 79.03  ? 238 ASP A CB  1 
ATOM   4839 C CG  . ASP B 1 77  ? -71.298  39.163  65.302  1.00 80.78  ? 238 ASP A CG  1 
ATOM   4840 O OD1 . ASP B 1 77  ? -71.600  37.990  65.613  1.00 80.59  ? 238 ASP A OD1 1 
ATOM   4841 O OD2 . ASP B 1 77  ? -71.313  39.576  64.122  1.00 83.25  ? 238 ASP A OD2 1 
ATOM   4842 N N   . PHE B 1 78  ? -71.710  40.921  69.905  1.00 78.25  ? 239 PHE A N   1 
ATOM   4843 C CA  . PHE B 1 78  ? -71.264  41.666  71.081  1.00 78.39  ? 239 PHE A CA  1 
ATOM   4844 C C   . PHE B 1 78  ? -70.127  40.913  71.782  1.00 78.72  ? 239 PHE A C   1 
ATOM   4845 O O   . PHE B 1 78  ? -70.318  39.776  72.222  1.00 79.85  ? 239 PHE A O   1 
ATOM   4846 C CB  . PHE B 1 78  ? -72.448  41.901  72.028  1.00 78.86  ? 239 PHE A CB  1 
ATOM   4847 C CG  . PHE B 1 78  ? -72.095  42.648  73.286  1.00 80.66  ? 239 PHE A CG  1 
ATOM   4848 C CD1 . PHE B 1 78  ? -71.653  43.968  73.234  1.00 81.52  ? 239 PHE A CD1 1 
ATOM   4849 C CD2 . PHE B 1 78  ? -72.229  42.038  74.529  1.00 80.75  ? 239 PHE A CD2 1 
ATOM   4850 C CE1 . PHE B 1 78  ? -71.334  44.656  74.396  1.00 81.92  ? 239 PHE A CE1 1 
ATOM   4851 C CE2 . PHE B 1 78  ? -71.913  42.721  75.694  1.00 81.03  ? 239 PHE A CE2 1 
ATOM   4852 C CZ  . PHE B 1 78  ? -71.465  44.032  75.628  1.00 81.49  ? 239 PHE A CZ  1 
ATOM   4853 N N   . PRO B 1 79  ? -68.936  41.542  71.876  1.00 77.94  ? 240 PRO A N   1 
ATOM   4854 C CA  . PRO B 1 79  ? -67.716  40.911  72.407  1.00 77.65  ? 240 PRO A CA  1 
ATOM   4855 C C   . PRO B 1 79  ? -67.846  40.357  73.828  1.00 77.68  ? 240 PRO A C   1 
ATOM   4856 O O   . PRO B 1 79  ? -67.076  39.476  74.216  1.00 78.18  ? 240 PRO A O   1 
ATOM   4857 C CB  . PRO B 1 79  ? -66.691  42.050  72.378  1.00 77.59  ? 240 PRO A CB  1 
ATOM   4858 C CG  . PRO B 1 79  ? -67.182  42.967  71.313  1.00 78.06  ? 240 PRO A CG  1 
ATOM   4859 C CD  . PRO B 1 79  ? -68.677  42.925  71.434  1.00 77.87  ? 240 PRO A CD  1 
ATOM   4860 N N   . GLY B 1 80  ? -68.805  40.872  74.592  1.00 78.16  ? 241 GLY A N   1 
ATOM   4861 C CA  . GLY B 1 80  ? -69.060  40.392  75.947  1.00 76.93  ? 241 GLY A CA  1 
ATOM   4862 C C   . GLY B 1 80  ? -69.855  39.100  75.981  1.00 75.45  ? 241 GLY A C   1 
ATOM   4863 O O   . GLY B 1 80  ? -69.803  38.361  76.966  1.00 76.21  ? 241 GLY A O   1 
ATOM   4864 N N   . ALA B 1 81  ? -70.592  38.833  74.905  1.00 74.19  ? 242 ALA A N   1 
ATOM   4865 C CA  . ALA B 1 81  ? -71.410  37.626  74.793  1.00 74.44  ? 242 ALA A CA  1 
ATOM   4866 C C   . ALA B 1 81  ? -70.699  36.510  74.027  1.00 74.46  ? 242 ALA A C   1 
ATOM   4867 O O   . ALA B 1 81  ? -70.922  35.327  74.296  1.00 75.09  ? 242 ALA A O   1 
ATOM   4868 C CB  . ALA B 1 81  ? -72.746  37.949  74.138  1.00 74.17  ? 242 ALA A CB  1 
ATOM   4869 N N   . THR B 1 82  ? -69.844  36.895  73.080  1.00 73.24  ? 243 THR A N   1 
ATOM   4870 C CA  . THR B 1 82  ? -69.172  35.942  72.192  1.00 71.68  ? 243 THR A CA  1 
ATOM   4871 C C   . THR B 1 82  ? -67.883  35.345  72.767  1.00 72.77  ? 243 THR A C   1 
ATOM   4872 O O   . THR B 1 82  ? -67.401  34.324  72.273  1.00 74.34  ? 243 THR A O   1 
ATOM   4873 C CB  . THR B 1 82  ? -68.886  36.549  70.800  1.00 70.08  ? 243 THR A CB  1 
ATOM   4874 O OG1 . THR B 1 82  ? -68.240  37.820  70.945  1.00 67.82  ? 243 THR A OG1 1 
ATOM   4875 C CG2 . THR B 1 82  ? -70.177  36.726  70.014  1.00 69.75  ? 243 THR A CG2 1 
ATOM   4876 N N   . MET B 1 83  ? -67.332  35.970  73.806  1.00 73.37  ? 244 MET A N   1 
ATOM   4877 C CA  . MET B 1 83  ? -66.131  35.447  74.467  1.00 74.00  ? 244 MET A CA  1 
ATOM   4878 C C   . MET B 1 83  ? -66.393  34.108  75.160  1.00 74.12  ? 244 MET A C   1 
ATOM   4879 O O   . MET B 1 83  ? -65.463  33.336  75.397  1.00 74.22  ? 244 MET A O   1 
ATOM   4880 C CB  . MET B 1 83  ? -65.547  36.460  75.461  1.00 75.86  ? 244 MET A CB  1 
ATOM   4881 C CG  . MET B 1 83  ? -66.453  36.820  76.633  1.00 77.05  ? 244 MET A CG  1 
ATOM   4882 S SD  . MET B 1 83  ? -65.550  37.195  78.151  1.00 78.85  ? 244 MET A SD  1 
ATOM   4883 C CE  . MET B 1 83  ? -64.702  38.714  77.709  1.00 77.84  ? 244 MET A CE  1 
ATOM   4884 N N   . TRP B 1 84  ? -67.662  33.851  75.480  1.00 74.10  ? 245 TRP A N   1 
ATOM   4885 C CA  . TRP B 1 84  ? -68.088  32.597  76.102  1.00 72.90  ? 245 TRP A CA  1 
ATOM   4886 C C   . TRP B 1 84  ? -68.537  31.562  75.071  1.00 71.88  ? 245 TRP A C   1 
ATOM   4887 O O   . TRP B 1 84  ? -68.669  30.380  75.392  1.00 73.22  ? 245 TRP A O   1 
ATOM   4888 C CB  . TRP B 1 84  ? -69.208  32.841  77.117  1.00 73.90  ? 245 TRP A CB  1 
ATOM   4889 C CG  . TRP B 1 84  ? -68.857  33.822  78.202  1.00 75.69  ? 245 TRP A CG  1 
ATOM   4890 C CD1 . TRP B 1 84  ? -69.530  34.967  78.516  1.00 76.13  ? 245 TRP A CD1 1 
ATOM   4891 C CD2 . TRP B 1 84  ? -67.751  33.745  79.115  1.00 76.23  ? 245 TRP A CD2 1 
ATOM   4892 N NE1 . TRP B 1 84  ? -68.917  35.607  79.566  1.00 77.34  ? 245 TRP A NE1 1 
ATOM   4893 C CE2 . TRP B 1 84  ? -67.822  34.879  79.952  1.00 76.94  ? 245 TRP A CE2 1 
ATOM   4894 C CE3 . TRP B 1 84  ? -66.709  32.827  79.307  1.00 75.45  ? 245 TRP A CE3 1 
ATOM   4895 C CZ2 . TRP B 1 84  ? -66.890  35.122  80.965  1.00 76.59  ? 245 TRP A CZ2 1 
ATOM   4896 C CZ3 . TRP B 1 84  ? -65.784  33.071  80.313  1.00 74.95  ? 245 TRP A CZ3 1 
ATOM   4897 C CH2 . TRP B 1 84  ? -65.881  34.210  81.127  1.00 75.44  ? 245 TRP A CH2 1 
ATOM   4898 N N   . ASN B 1 85  ? -68.776  32.015  73.841  1.00 70.29  ? 246 ASN A N   1 
ATOM   4899 C CA  . ASN B 1 85  ? -69.111  31.128  72.727  1.00 68.69  ? 246 ASN A CA  1 
ATOM   4900 C C   . ASN B 1 85  ? -67.920  30.281  72.283  1.00 68.23  ? 246 ASN A C   1 
ATOM   4901 O O   . ASN B 1 85  ? -66.800  30.793  72.185  1.00 68.64  ? 246 ASN A O   1 
ATOM   4902 C CB  . ASN B 1 85  ? -69.636  31.932  71.535  1.00 67.98  ? 246 ASN A CB  1 
ATOM   4903 C CG  . ASN B 1 85  ? -71.077  32.355  71.705  1.00 67.13  ? 246 ASN A CG  1 
ATOM   4904 O OD1 . ASN B 1 85  ? -71.868  31.667  72.349  1.00 67.64  ? 246 ASN A OD1 1 
ATOM   4905 N ND2 . ASN B 1 85  ? -71.431  33.489  71.114  1.00 66.75  ? 246 ASN A ND2 1 
ATOM   4906 N N   . PRO B 1 86  ? -68.161  28.985  72.003  1.00 66.57  ? 247 PRO A N   1 
ATOM   4907 C CA  . PRO B 1 86  ? -67.115  28.057  71.569  1.00 65.52  ? 247 PRO A CA  1 
ATOM   4908 C C   . PRO B 1 86  ? -66.334  28.580  70.364  1.00 64.02  ? 247 PRO A C   1 
ATOM   4909 O O   . PRO B 1 86  ? -66.934  29.070  69.409  1.00 63.31  ? 247 PRO A O   1 
ATOM   4910 C CB  . PRO B 1 86  ? -67.897  26.791  71.194  1.00 65.66  ? 247 PRO A CB  1 
ATOM   4911 C CG  . PRO B 1 86  ? -69.322  27.221  71.067  1.00 65.86  ? 247 PRO A CG  1 
ATOM   4912 C CD  . PRO B 1 86  ? -69.474  28.323  72.064  1.00 66.19  ? 247 PRO A CD  1 
ATOM   4913 N N   . ASN B 1 87  ? -65.007  28.479  70.428  1.00 63.59  ? 248 ASN A N   1 
ATOM   4914 C CA  . ASN B 1 87  ? -64.123  29.016  69.388  1.00 63.09  ? 248 ASN A CA  1 
ATOM   4915 C C   . ASN B 1 87  ? -63.416  27.944  68.553  1.00 62.51  ? 248 ASN A C   1 
ATOM   4916 O O   . ASN B 1 87  ? -62.460  28.233  67.829  1.00 63.41  ? 248 ASN A O   1 
ATOM   4917 C CB  . ASN B 1 87  ? -63.099  29.980  70.000  1.00 62.89  ? 248 ASN A CB  1 
ATOM   4918 C CG  . ASN B 1 87  ? -62.227  29.322  71.058  1.00 62.60  ? 248 ASN A CG  1 
ATOM   4919 O OD1 . ASN B 1 87  ? -62.267  28.107  71.261  1.00 61.43  ? 248 ASN A OD1 1 
ATOM   4920 N ND2 . ASN B 1 87  ? -61.429  30.133  71.742  1.00 63.72  ? 248 ASN A ND2 1 
ATOM   4921 N N   . THR B 1 88  ? -63.886  26.707  68.679  1.00 60.82  ? 249 THR A N   1 
ATOM   4922 C CA  . THR B 1 88  ? -63.405  25.587  67.877  1.00 58.79  ? 249 THR A CA  1 
ATOM   4923 C C   . THR B 1 88  ? -64.627  24.912  67.258  1.00 57.70  ? 249 THR A C   1 
ATOM   4924 O O   . THR B 1 88  ? -65.755  25.230  67.644  1.00 58.03  ? 249 THR A O   1 
ATOM   4925 C CB  . THR B 1 88  ? -62.610  24.579  68.731  1.00 58.83  ? 249 THR A CB  1 
ATOM   4926 O OG1 . THR B 1 88  ? -63.325  24.305  69.943  1.00 59.87  ? 249 THR A OG1 1 
ATOM   4927 C CG2 . THR B 1 88  ? -61.229  25.133  69.070  1.00 58.58  ? 249 THR A CG2 1 
ATOM   4928 N N   . PRO B 1 89  ? -64.426  24.005  66.280  1.00 56.72  ? 250 PRO A N   1 
ATOM   4929 C CA  . PRO B 1 89  ? -65.603  23.328  65.723  1.00 56.35  ? 250 PRO A CA  1 
ATOM   4930 C C   . PRO B 1 89  ? -66.340  22.467  66.752  1.00 55.63  ? 250 PRO A C   1 
ATOM   4931 O O   . PRO B 1 89  ? -65.721  21.916  67.666  1.00 55.42  ? 250 PRO A O   1 
ATOM   4932 C CB  . PRO B 1 89  ? -65.025  22.461  64.595  1.00 55.93  ? 250 PRO A CB  1 
ATOM   4933 C CG  . PRO B 1 89  ? -63.557  22.397  64.851  1.00 56.49  ? 250 PRO A CG  1 
ATOM   4934 C CD  . PRO B 1 89  ? -63.203  23.687  65.524  1.00 56.30  ? 250 PRO A CD  1 
ATOM   4935 N N   . LEU B 1 90  ? -67.658  22.377  66.599  1.00 55.06  ? 251 LEU A N   1 
ATOM   4936 C CA  . LEU B 1 90  ? -68.503  21.608  67.506  1.00 54.61  ? 251 LEU A CA  1 
ATOM   4937 C C   . LEU B 1 90  ? -68.658  20.168  67.037  1.00 54.95  ? 251 LEU A C   1 
ATOM   4938 O O   . LEU B 1 90  ? -68.987  19.916  65.875  1.00 55.29  ? 251 LEU A O   1 
ATOM   4939 C CB  . LEU B 1 90  ? -69.885  22.257  67.642  1.00 53.69  ? 251 LEU A CB  1 
ATOM   4940 C CG  . LEU B 1 90  ? -69.974  23.724  68.064  1.00 52.51  ? 251 LEU A CG  1 
ATOM   4941 C CD1 . LEU B 1 90  ? -71.428  24.160  68.101  1.00 52.68  ? 251 LEU A CD1 1 
ATOM   4942 C CD2 . LEU B 1 90  ? -69.316  23.942  69.414  1.00 52.12  ? 251 LEU A CD2 1 
ATOM   4943 N N   . SER B 1 91  ? -68.422  19.232  67.952  1.00 55.17  ? 252 SER A N   1 
ATOM   4944 C CA  . SER B 1 91  ? -68.537  17.804  67.669  1.00 55.19  ? 252 SER A CA  1 
ATOM   4945 C C   . SER B 1 91  ? -68.858  17.016  68.930  1.00 55.11  ? 252 SER A C   1 
ATOM   4946 O O   . SER B 1 91  ? -68.523  17.440  70.036  1.00 56.39  ? 252 SER A O   1 
ATOM   4947 C CB  . SER B 1 91  ? -67.238  17.277  67.058  1.00 55.37  ? 252 SER A CB  1 
ATOM   4948 O OG  . SER B 1 91  ? -67.333  15.890  66.791  1.00 56.18  ? 252 SER A OG  1 
ATOM   4949 N N   . GLU B 1 92  ? -69.507  15.869  68.756  1.00 55.26  ? 253 GLU A N   1 
ATOM   4950 C CA  . GLU B 1 92  ? -69.729  14.933  69.855  1.00 56.75  ? 253 GLU A CA  1 
ATOM   4951 C C   . GLU B 1 92  ? -68.397  14.328  70.287  1.00 57.27  ? 253 GLU A C   1 
ATOM   4952 O O   . GLU B 1 92  ? -68.187  14.027  71.464  1.00 57.78  ? 253 GLU A O   1 
ATOM   4953 C CB  . GLU B 1 92  ? -70.683  13.819  69.437  1.00 57.89  ? 253 GLU A CB  1 
ATOM   4954 C CG  . GLU B 1 92  ? -72.048  14.288  68.967  1.00 58.77  ? 253 GLU A CG  1 
ATOM   4955 C CD  . GLU B 1 92  ? -73.120  13.252  69.229  1.00 59.53  ? 253 GLU A CD  1 
ATOM   4956 O OE1 . GLU B 1 92  ? -73.608  12.637  68.259  1.00 60.56  ? 253 GLU A OE1 1 
ATOM   4957 O OE2 . GLU B 1 92  ? -73.459  13.042  70.412  1.00 58.91  ? 253 GLU A OE2 1 
ATOM   4958 N N   . ASP B 1 93  ? -67.512  14.146  69.309  1.00 57.39  ? 254 ASP A N   1 
ATOM   4959 C CA  . ASP B 1 93  ? -66.142  13.720  69.539  1.00 57.98  ? 254 ASP A CA  1 
ATOM   4960 C C   . ASP B 1 93  ? -65.371  14.912  70.095  1.00 58.15  ? 254 ASP A C   1 
ATOM   4961 O O   . ASP B 1 93  ? -64.776  15.688  69.342  1.00 58.90  ? 254 ASP A O   1 
ATOM   4962 C CB  . ASP B 1 93  ? -65.527  13.237  68.221  1.00 58.80  ? 254 ASP A CB  1 
ATOM   4963 C CG  . ASP B 1 93  ? -64.116  12.699  68.384  1.00 60.09  ? 254 ASP A CG  1 
ATOM   4964 O OD1 . ASP B 1 93  ? -63.628  12.589  69.532  1.00 60.89  ? 254 ASP A OD1 1 
ATOM   4965 O OD2 . ASP B 1 93  ? -63.492  12.381  67.349  1.00 60.33  ? 254 ASP A OD2 1 
ATOM   4966 N N   . CYS B 1 94  ? -65.393  15.052  71.418  1.00 57.46  ? 255 CYS A N   1 
ATOM   4967 C CA  . CYS B 1 94  ? -64.879  16.253  72.068  1.00 56.81  ? 255 CYS A CA  1 
ATOM   4968 C C   . CYS B 1 94  ? -64.155  15.989  73.384  1.00 55.32  ? 255 CYS A C   1 
ATOM   4969 O O   . CYS B 1 94  ? -63.644  16.919  74.010  1.00 54.68  ? 255 CYS A O   1 
ATOM   4970 C CB  . CYS B 1 94  ? -66.019  17.247  72.296  1.00 58.95  ? 255 CYS A CB  1 
ATOM   4971 S SG  . CYS B 1 94  ? -67.364  16.608  73.319  1.00 61.73  ? 255 CYS A SG  1 
ATOM   4972 N N   . LEU B 1 95  ? -64.102  14.724  73.792  1.00 54.26  ? 256 LEU A N   1 
ATOM   4973 C CA  . LEU B 1 95  ? -63.474  14.342  75.058  1.00 53.29  ? 256 LEU A CA  1 
ATOM   4974 C C   . LEU B 1 95  ? -61.948  14.311  74.942  1.00 52.84  ? 256 LEU A C   1 
ATOM   4975 O O   . LEU B 1 95  ? -61.346  13.273  74.655  1.00 52.57  ? 256 LEU A O   1 
ATOM   4976 C CB  . LEU B 1 95  ? -64.039  13.004  75.561  1.00 52.72  ? 256 LEU A CB  1 
ATOM   4977 C CG  . LEU B 1 95  ? -65.348  13.014  76.365  1.00 52.14  ? 256 LEU A CG  1 
ATOM   4978 C CD1 . LEU B 1 95  ? -66.519  13.612  75.601  1.00 52.50  ? 256 LEU A CD1 1 
ATOM   4979 C CD2 . LEU B 1 95  ? -65.700  11.609  76.815  1.00 52.35  ? 256 LEU A CD2 1 
ATOM   4980 N N   . TYR B 1 96  ? -61.336  15.471  75.165  1.00 53.57  ? 257 TYR A N   1 
ATOM   4981 C CA  . TYR B 1 96  ? -59.894  15.647  75.017  1.00 55.09  ? 257 TYR A CA  1 
ATOM   4982 C C   . TYR B 1 96  ? -59.326  16.494  76.151  1.00 54.95  ? 257 TYR A C   1 
ATOM   4983 O O   . TYR B 1 96  ? -60.027  17.332  76.720  1.00 57.08  ? 257 TYR A O   1 
ATOM   4984 C CB  . TYR B 1 96  ? -59.572  16.309  73.673  1.00 56.82  ? 257 TYR A CB  1 
ATOM   4985 C CG  . TYR B 1 96  ? -59.980  15.501  72.459  1.00 58.85  ? 257 TYR A CG  1 
ATOM   4986 C CD1 . TYR B 1 96  ? -59.105  14.580  71.887  1.00 59.53  ? 257 TYR A CD1 1 
ATOM   4987 C CD2 . TYR B 1 96  ? -61.238  15.664  71.876  1.00 60.04  ? 257 TYR A CD2 1 
ATOM   4988 C CE1 . TYR B 1 96  ? -59.475  13.838  70.776  1.00 61.48  ? 257 TYR A CE1 1 
ATOM   4989 C CE2 . TYR B 1 96  ? -61.619  14.925  70.767  1.00 60.80  ? 257 TYR A CE2 1 
ATOM   4990 C CZ  . TYR B 1 96  ? -60.733  14.014  70.221  1.00 61.75  ? 257 TYR A CZ  1 
ATOM   4991 O OH  . TYR B 1 96  ? -61.098  13.278  69.119  1.00 62.88  ? 257 TYR A OH  1 
ATOM   4992 N N   . ILE B 1 97  ? -58.055  16.273  76.475  1.00 53.45  ? 258 ILE A N   1 
ATOM   4993 C CA  . ILE B 1 97  ? -57.379  17.045  77.514  1.00 52.62  ? 258 ILE A CA  1 
ATOM   4994 C C   . ILE B 1 97  ? -56.295  17.916  76.893  1.00 52.45  ? 258 ILE A C   1 
ATOM   4995 O O   . ILE B 1 97  ? -55.750  17.589  75.837  1.00 51.96  ? 258 ILE A O   1 
ATOM   4996 C CB  . ILE B 1 97  ? -56.781  16.130  78.611  1.00 52.72  ? 258 ILE A CB  1 
ATOM   4997 C CG1 . ILE B 1 97  ? -57.898  15.489  79.435  1.00 53.18  ? 258 ILE A CG1 1 
ATOM   4998 C CG2 . ILE B 1 97  ? -55.854  16.906  79.539  1.00 51.88  ? 258 ILE A CG2 1 
ATOM   4999 C CD1 . ILE B 1 97  ? -57.441  14.345  80.316  1.00 54.13  ? 258 ILE A CD1 1 
ATOM   5000 N N   . ASN B 1 98  ? -56.012  19.037  77.552  1.00 52.86  ? 259 ASN A N   1 
ATOM   5001 C CA  . ASN B 1 98  ? -54.896  19.901  77.200  1.00 53.24  ? 259 ASN A CA  1 
ATOM   5002 C C   . ASN B 1 98  ? -53.920  20.008  78.367  1.00 54.12  ? 259 ASN A C   1 
ATOM   5003 O O   . ASN B 1 98  ? -54.330  20.202  79.512  1.00 54.65  ? 259 ASN A O   1 
ATOM   5004 C CB  . ASN B 1 98  ? -55.395  21.291  76.799  1.00 53.14  ? 259 ASN A CB  1 
ATOM   5005 C CG  . ASN B 1 98  ? -56.421  21.245  75.683  1.00 53.60  ? 259 ASN A CG  1 
ATOM   5006 O OD1 . ASN B 1 98  ? -56.199  20.627  74.643  1.00 54.72  ? 259 ASN A OD1 1 
ATOM   5007 N ND2 . ASN B 1 98  ? -57.551  21.906  75.894  1.00 53.65  ? 259 ASN A ND2 1 
ATOM   5008 N N   . VAL B 1 99  ? -52.633  19.861  78.076  1.00 55.43  ? 260 VAL A N   1 
ATOM   5009 C CA  . VAL B 1 99  ? -51.595  20.015  79.092  1.00 57.60  ? 260 VAL A CA  1 
ATOM   5010 C C   . VAL B 1 99  ? -50.625  21.112  78.662  1.00 59.11  ? 260 VAL A C   1 
ATOM   5011 O O   . VAL B 1 99  ? -50.169  21.136  77.516  1.00 59.04  ? 260 VAL A O   1 
ATOM   5012 C CB  . VAL B 1 99  ? -50.834  18.692  79.359  1.00 58.08  ? 260 VAL A CB  1 
ATOM   5013 C CG1 . VAL B 1 99  ? -49.740  18.890  80.402  1.00 57.89  ? 260 VAL A CG1 1 
ATOM   5014 C CG2 . VAL B 1 99  ? -51.791  17.597  79.812  1.00 58.06  ? 260 VAL A CG2 1 
ATOM   5015 N N   . VAL B 1 100 ? -50.333  22.029  79.580  1.00 60.57  ? 261 VAL A N   1 
ATOM   5016 C CA  . VAL B 1 100 ? -49.348  23.078  79.335  1.00 62.07  ? 261 VAL A CA  1 
ATOM   5017 C C   . VAL B 1 100 ? -48.315  23.103  80.460  1.00 63.99  ? 261 VAL A C   1 
ATOM   5018 O O   . VAL B 1 100 ? -48.640  23.377  81.617  1.00 65.98  ? 261 VAL A O   1 
ATOM   5019 C CB  . VAL B 1 100 ? -50.007  24.463  79.159  1.00 61.26  ? 261 VAL A CB  1 
ATOM   5020 C CG1 . VAL B 1 100 ? -48.950  25.540  78.957  1.00 61.60  ? 261 VAL A CG1 1 
ATOM   5021 C CG2 . VAL B 1 100 ? -50.971  24.447  77.982  1.00 61.08  ? 261 VAL A CG2 1 
ATOM   5022 N N   . ALA B 1 101 ? -47.071  22.798  80.104  1.00 65.67  ? 262 ALA A N   1 
ATOM   5023 C CA  . ALA B 1 101 ? -45.962  22.789  81.050  1.00 67.05  ? 262 ALA A CA  1 
ATOM   5024 C C   . ALA B 1 101 ? -45.104  24.035  80.859  1.00 68.33  ? 262 ALA A C   1 
ATOM   5025 O O   . ALA B 1 101 ? -45.000  24.544  79.741  1.00 67.77  ? 262 ALA A O   1 
ATOM   5026 C CB  . ALA B 1 101 ? -45.122  21.535  80.862  1.00 67.76  ? 262 ALA A CB  1 
ATOM   5027 N N   . PRO B 1 102 ? -44.491  24.537  81.947  1.00 70.69  ? 263 PRO A N   1 
ATOM   5028 C CA  . PRO B 1 102 ? -43.578  25.669  81.798  1.00 73.35  ? 263 PRO A CA  1 
ATOM   5029 C C   . PRO B 1 102 ? -42.195  25.237  81.312  1.00 75.90  ? 263 PRO A C   1 
ATOM   5030 O O   . PRO B 1 102 ? -41.816  24.075  81.474  1.00 77.09  ? 263 PRO A O   1 
ATOM   5031 C CB  . PRO B 1 102 ? -43.490  26.234  83.217  1.00 72.75  ? 263 PRO A CB  1 
ATOM   5032 C CG  . PRO B 1 102 ? -43.744  25.063  84.103  1.00 71.73  ? 263 PRO A CG  1 
ATOM   5033 C CD  . PRO B 1 102 ? -44.692  24.165  83.361  1.00 70.87  ? 263 PRO A CD  1 
ATOM   5034 N N   . ARG B 1 103 ? -41.467  26.170  80.705  1.00 77.61  ? 264 ARG A N   1 
ATOM   5035 C CA  . ARG B 1 103 ? -40.072  25.959  80.331  1.00 80.18  ? 264 ARG A CA  1 
ATOM   5036 C C   . ARG B 1 103 ? -39.216  26.948  81.132  1.00 80.11  ? 264 ARG A C   1 
ATOM   5037 O O   . ARG B 1 103 ? -39.488  28.151  81.110  1.00 80.85  ? 264 ARG A O   1 
ATOM   5038 C CB  . ARG B 1 103 ? -39.879  26.128  78.813  1.00 82.16  ? 264 ARG A CB  1 
ATOM   5039 C CG  . ARG B 1 103 ? -38.462  25.896  78.285  1.00 84.96  ? 264 ARG A CG  1 
ATOM   5040 C CD  . ARG B 1 103 ? -38.030  24.433  78.345  1.00 85.69  ? 264 ARG A CD  1 
ATOM   5041 N NE  . ARG B 1 103 ? -36.708  24.204  77.748  1.00 82.99  ? 264 ARG A NE  1 
ATOM   5042 C CZ  . ARG B 1 103 ? -35.547  24.254  78.401  1.00 78.75  ? 264 ARG A CZ  1 
ATOM   5043 N NH1 . ARG B 1 103 ? -35.502  24.532  79.697  1.00 76.12  ? 264 ARG A NH1 1 
ATOM   5044 N NH2 . ARG B 1 103 ? -34.417  24.027  77.748  1.00 76.60  ? 264 ARG A NH2 1 
ATOM   5045 N N   . PRO B 1 104 ? -38.190  26.452  81.857  1.00 79.82  ? 265 PRO A N   1 
ATOM   5046 C CA  . PRO B 1 104 ? -37.710  25.064  81.958  1.00 79.78  ? 265 PRO A CA  1 
ATOM   5047 C C   . PRO B 1 104 ? -38.717  24.104  82.587  1.00 80.55  ? 265 PRO A C   1 
ATOM   5048 O O   . PRO B 1 104 ? -39.409  24.469  83.541  1.00 81.57  ? 265 PRO A O   1 
ATOM   5049 C CB  . PRO B 1 104 ? -36.466  25.185  82.846  1.00 79.71  ? 265 PRO A CB  1 
ATOM   5050 C CG  . PRO B 1 104 ? -36.680  26.432  83.633  1.00 79.95  ? 265 PRO A CG  1 
ATOM   5051 C CD  . PRO B 1 104 ? -37.400  27.363  82.706  1.00 79.12  ? 265 PRO A CD  1 
ATOM   5052 N N   . ARG B 1 105 ? -38.792  22.889  82.048  1.00 80.73  ? 266 ARG A N   1 
ATOM   5053 C CA  . ARG B 1 105 ? -39.737  21.884  82.528  1.00 82.47  ? 266 ARG A CA  1 
ATOM   5054 C C   . ARG B 1 105 ? -39.343  21.352  83.906  1.00 84.96  ? 266 ARG A C   1 
ATOM   5055 O O   . ARG B 1 105 ? -38.212  20.903  84.096  1.00 85.39  ? 266 ARG A O   1 
ATOM   5056 C CB  . ARG B 1 105 ? -39.870  20.735  81.527  1.00 80.59  ? 266 ARG A CB  1 
ATOM   5057 C CG  . ARG B 1 105 ? -41.012  19.775  81.832  1.00 79.57  ? 266 ARG A CG  1 
ATOM   5058 C CD  . ARG B 1 105 ? -41.226  18.782  80.705  1.00 79.12  ? 266 ARG A CD  1 
ATOM   5059 N NE  . ARG B 1 105 ? -41.435  19.454  79.424  1.00 80.52  ? 266 ARG A NE  1 
ATOM   5060 C CZ  . ARG B 1 105 ? -41.478  18.838  78.246  1.00 82.48  ? 266 ARG A CZ  1 
ATOM   5061 N NH1 . ARG B 1 105 ? -41.668  19.542  77.138  1.00 82.63  ? 266 ARG A NH1 1 
ATOM   5062 N NH2 . ARG B 1 105 ? -41.331  17.520  78.169  1.00 83.00  ? 266 ARG A NH2 1 
ATOM   5063 N N   . PRO B 1 106 ? -40.279  21.411  84.872  1.00 87.71  ? 267 PRO A N   1 
ATOM   5064 C CA  . PRO B 1 106 ? -40.020  20.878  86.208  1.00 89.80  ? 267 PRO A CA  1 
ATOM   5065 C C   . PRO B 1 106 ? -40.061  19.351  86.236  1.00 91.70  ? 267 PRO A C   1 
ATOM   5066 O O   . PRO B 1 106 ? -40.724  18.728  85.401  1.00 90.30  ? 267 PRO A O   1 
ATOM   5067 C CB  . PRO B 1 106 ? -41.161  21.460  87.044  1.00 89.91  ? 267 PRO A CB  1 
ATOM   5068 C CG  . PRO B 1 106 ? -42.270  21.669  86.073  1.00 88.84  ? 267 PRO A CG  1 
ATOM   5069 C CD  . PRO B 1 106 ? -41.612  22.036  84.774  1.00 87.98  ? 267 PRO A CD  1 
ATOM   5070 N N   . LYS B 1 107 ? -39.341  18.770  87.192  1.00 94.01  ? 268 LYS A N   1 
ATOM   5071 C CA  . LYS B 1 107 ? -39.277  17.322  87.382  1.00 95.55  ? 268 LYS A CA  1 
ATOM   5072 C C   . LYS B 1 107 ? -40.560  16.827  88.051  1.00 94.93  ? 268 LYS A C   1 
ATOM   5073 O O   . LYS B 1 107 ? -41.083  15.757  87.716  1.00 93.62  ? 268 LYS A O   1 
ATOM   5074 C CB  . LYS B 1 107 ? -38.040  16.976  88.226  1.00 96.73  ? 268 LYS A CB  1 
ATOM   5075 C CG  . LYS B 1 107 ? -37.863  15.512  88.608  1.00 96.42  ? 268 LYS A CG  1 
ATOM   5076 C CD  . LYS B 1 107 ? -36.605  15.331  89.448  1.00 94.96  ? 268 LYS A CD  1 
ATOM   5077 C CE  . LYS B 1 107 ? -36.673  14.089  90.324  1.00 93.87  ? 268 LYS A CE  1 
ATOM   5078 N NZ  . LYS B 1 107 ? -36.624  12.825  89.540  1.00 93.59  ? 268 LYS A NZ  1 
ATOM   5079 N N   . ASN B 1 108 ? -41.060  17.631  88.986  1.00 94.02  ? 269 ASN A N   1 
ATOM   5080 C CA  . ASN B 1 108 ? -42.238  17.304  89.776  1.00 93.68  ? 269 ASN A CA  1 
ATOM   5081 C C   . ASN B 1 108 ? -42.783  18.578  90.423  1.00 91.88  ? 269 ASN A C   1 
ATOM   5082 O O   . ASN B 1 108 ? -42.188  19.108  91.364  1.00 93.65  ? 269 ASN A O   1 
ATOM   5083 C CB  . ASN B 1 108 ? -41.877  16.254  90.835  1.00 94.97  ? 269 ASN A CB  1 
ATOM   5084 C CG  . ASN B 1 108 ? -43.077  15.776  91.622  1.00 96.12  ? 269 ASN A CG  1 
ATOM   5085 O OD1 . ASN B 1 108 ? -43.582  16.482  92.494  1.00 97.60  ? 269 ASN A OD1 1 
ATOM   5086 N ND2 . ASN B 1 108 ? -43.528  14.561  91.331  1.00 95.93  ? 269 ASN A ND2 1 
ATOM   5087 N N   . ALA B 1 109 ? -43.906  19.071  89.906  1.00 87.94  ? 270 ALA A N   1 
ATOM   5088 C CA  . ALA B 1 109 ? -44.484  20.332  90.375  1.00 84.19  ? 270 ALA A CA  1 
ATOM   5089 C C   . ALA B 1 109 ? -45.995  20.242  90.568  1.00 81.20  ? 270 ALA A C   1 
ATOM   5090 O O   . ALA B 1 109 ? -46.601  19.201  90.307  1.00 81.18  ? 270 ALA A O   1 
ATOM   5091 C CB  . ALA B 1 109 ? -44.132  21.464  89.418  1.00 83.80  ? 270 ALA A CB  1 
ATOM   5092 N N   . ALA B 1 110 ? -46.590  21.340  91.031  1.00 77.32  ? 271 ALA A N   1 
ATOM   5093 C CA  . ALA B 1 110 ? -48.033  21.430  91.242  1.00 74.16  ? 271 ALA A CA  1 
ATOM   5094 C C   . ALA B 1 110 ? -48.798  21.348  89.923  1.00 72.65  ? 271 ALA A C   1 
ATOM   5095 O O   . ALA B 1 110 ? -48.292  21.760  88.875  1.00 73.84  ? 271 ALA A O   1 
ATOM   5096 C CB  . ALA B 1 110 ? -48.379  22.716  91.978  1.00 73.64  ? 271 ALA A CB  1 
ATOM   5097 N N   . VAL B 1 111 ? -50.010  20.800  89.983  1.00 69.66  ? 272 VAL A N   1 
ATOM   5098 C CA  . VAL B 1 111 ? -50.882  20.689  88.814  1.00 66.02  ? 272 VAL A CA  1 
ATOM   5099 C C   . VAL B 1 111 ? -52.191  21.431  89.072  1.00 64.97  ? 272 VAL A C   1 
ATOM   5100 O O   . VAL B 1 111 ? -52.949  21.072  89.978  1.00 66.32  ? 272 VAL A O   1 
ATOM   5101 C CB  . VAL B 1 111 ? -51.171  19.214  88.444  1.00 64.72  ? 272 VAL A CB  1 
ATOM   5102 C CG1 . VAL B 1 111 ? -52.130  19.126  87.266  1.00 63.85  ? 272 VAL A CG1 1 
ATOM   5103 C CG2 . VAL B 1 111 ? -49.881  18.478  88.120  1.00 64.70  ? 272 VAL A CG2 1 
ATOM   5104 N N   . MET B 1 112 ? -52.440  22.475  88.285  1.00 61.76  ? 273 MET A N   1 
ATOM   5105 C CA  . MET B 1 112 ? -53.693  23.217  88.362  1.00 59.37  ? 273 MET A CA  1 
ATOM   5106 C C   . MET B 1 112 ? -54.632  22.809  87.232  1.00 59.26  ? 273 MET A C   1 
ATOM   5107 O O   . MET B 1 112 ? -54.400  23.130  86.063  1.00 59.22  ? 273 MET A O   1 
ATOM   5108 C CB  . MET B 1 112 ? -53.440  24.724  88.357  1.00 58.20  ? 273 MET A CB  1 
ATOM   5109 C CG  . MET B 1 112 ? -53.049  25.275  89.716  1.00 58.74  ? 273 MET A CG  1 
ATOM   5110 S SD  . MET B 1 112 ? -52.714  27.048  89.715  1.00 61.29  ? 273 MET A SD  1 
ATOM   5111 C CE  . MET B 1 112 ? -54.373  27.727  89.708  1.00 60.36  ? 273 MET A CE  1 
ATOM   5112 N N   . LEU B 1 113 ? -55.689  22.089  87.600  1.00 58.75  ? 274 LEU A N   1 
ATOM   5113 C CA  . LEU B 1 113 ? -56.642  21.542  86.642  1.00 58.30  ? 274 LEU A CA  1 
ATOM   5114 C C   . LEU B 1 113 ? -57.889  22.418  86.550  1.00 59.59  ? 274 LEU A C   1 
ATOM   5115 O O   . LEU B 1 113 ? -58.604  22.601  87.539  1.00 61.37  ? 274 LEU A O   1 
ATOM   5116 C CB  . LEU B 1 113 ? -57.022  20.113  87.037  1.00 56.97  ? 274 LEU A CB  1 
ATOM   5117 C CG  . LEU B 1 113 ? -57.452  19.152  85.929  1.00 56.43  ? 274 LEU A CG  1 
ATOM   5118 C CD1 . LEU B 1 113 ? -57.198  17.723  86.370  1.00 56.24  ? 274 LEU A CD1 1 
ATOM   5119 C CD2 . LEU B 1 113 ? -58.909  19.345  85.537  1.00 56.66  ? 274 LEU A CD2 1 
ATOM   5120 N N   . TRP B 1 114 ? -58.146  22.945  85.355  1.00 59.35  ? 275 TRP A N   1 
ATOM   5121 C CA  . TRP B 1 114 ? -59.265  23.857  85.127  1.00 59.04  ? 275 TRP A CA  1 
ATOM   5122 C C   . TRP B 1 114 ? -60.502  23.160  84.558  1.00 58.99  ? 275 TRP A C   1 
ATOM   5123 O O   . TRP B 1 114 ? -60.509  22.724  83.403  1.00 61.00  ? 275 TRP A O   1 
ATOM   5124 C CB  . TRP B 1 114 ? -58.838  25.018  84.218  1.00 59.21  ? 275 TRP A CB  1 
ATOM   5125 C CG  . TRP B 1 114 ? -59.974  25.917  83.816  1.00 59.44  ? 275 TRP A CG  1 
ATOM   5126 C CD1 . TRP B 1 114 ? -60.607  25.946  82.608  1.00 59.63  ? 275 TRP A CD1 1 
ATOM   5127 C CD2 . TRP B 1 114 ? -60.619  26.905  84.629  1.00 59.39  ? 275 TRP A CD2 1 
ATOM   5128 N NE1 . TRP B 1 114 ? -61.602  26.893  82.616  1.00 59.46  ? 275 TRP A NE1 1 
ATOM   5129 C CE2 . TRP B 1 114 ? -61.631  27.497  83.845  1.00 59.23  ? 275 TRP A CE2 1 
ATOM   5130 C CE3 . TRP B 1 114 ? -60.435  27.352  85.944  1.00 59.58  ? 275 TRP A CE3 1 
ATOM   5131 C CZ2 . TRP B 1 114 ? -62.460  28.510  84.333  1.00 59.72  ? 275 TRP A CZ2 1 
ATOM   5132 C CZ3 . TRP B 1 114 ? -61.257  28.361  86.428  1.00 59.55  ? 275 TRP A CZ3 1 
ATOM   5133 C CH2 . TRP B 1 114 ? -62.258  28.928  85.623  1.00 59.79  ? 275 TRP A CH2 1 
ATOM   5134 N N   . ILE B 1 115 ? -61.546  23.062  85.375  1.00 57.89  ? 276 ILE A N   1 
ATOM   5135 C CA  . ILE B 1 115 ? -62.846  22.607  84.897  1.00 58.31  ? 276 ILE A CA  1 
ATOM   5136 C C   . ILE B 1 115 ? -63.681  23.839  84.563  1.00 58.98  ? 276 ILE A C   1 
ATOM   5137 O O   . ILE B 1 115 ? -64.049  24.602  85.457  1.00 58.75  ? 276 ILE A O   1 
ATOM   5138 C CB  . ILE B 1 115 ? -63.583  21.731  85.937  1.00 58.24  ? 276 ILE A CB  1 
ATOM   5139 C CG1 . ILE B 1 115 ? -62.724  20.526  86.336  1.00 58.83  ? 276 ILE A CG1 1 
ATOM   5140 C CG2 . ILE B 1 115 ? -64.929  21.267  85.391  1.00 57.94  ? 276 ILE A CG2 1 
ATOM   5141 C CD1 . ILE B 1 115 ? -63.296  19.697  87.468  1.00 59.47  ? 276 ILE A CD1 1 
ATOM   5142 N N   . PHE B 1 116 ? -63.966  24.035  83.276  1.00 59.39  ? 277 PHE A N   1 
ATOM   5143 C CA  . PHE B 1 116 ? -64.757  25.184  82.830  1.00 59.03  ? 277 PHE A CA  1 
ATOM   5144 C C   . PHE B 1 116 ? -66.216  25.077  83.264  1.00 59.37  ? 277 PHE A C   1 
ATOM   5145 O O   . PHE B 1 116 ? -66.699  23.993  83.588  1.00 59.98  ? 277 PHE A O   1 
ATOM   5146 C CB  . PHE B 1 116 ? -64.664  25.366  81.310  1.00 59.24  ? 277 PHE A CB  1 
ATOM   5147 C CG  . PHE B 1 116 ? -65.421  24.333  80.514  1.00 59.27  ? 277 PHE A CG  1 
ATOM   5148 C CD1 . PHE B 1 116 ? -66.810  24.380  80.417  1.00 59.02  ? 277 PHE A CD1 1 
ATOM   5149 C CD2 . PHE B 1 116 ? -64.740  23.332  79.831  1.00 59.73  ? 277 PHE A CD2 1 
ATOM   5150 C CE1 . PHE B 1 116 ? -67.502  23.433  79.680  1.00 59.20  ? 277 PHE A CE1 1 
ATOM   5151 C CE2 . PHE B 1 116 ? -65.428  22.385  79.084  1.00 59.08  ? 277 PHE A CE2 1 
ATOM   5152 C CZ  . PHE B 1 116 ? -66.810  22.437  79.008  1.00 59.07  ? 277 PHE A CZ  1 
ATOM   5153 N N   . GLY B 1 117 ? -66.911  26.209  83.258  1.00 60.11  ? 278 GLY A N   1 
ATOM   5154 C CA  . GLY B 1 117 ? -68.323  26.242  83.612  1.00 62.37  ? 278 GLY A CA  1 
ATOM   5155 C C   . GLY B 1 117 ? -69.155  26.985  82.590  1.00 63.63  ? 278 GLY A C   1 
ATOM   5156 O O   . GLY B 1 117 ? -68.695  27.958  81.998  1.00 66.18  ? 278 GLY A O   1 
ATOM   5157 N N   . GLY B 1 118 ? -70.381  26.517  82.378  1.00 63.41  ? 279 GLY A N   1 
ATOM   5158 C CA  . GLY B 1 118 ? -71.322  27.193  81.491  1.00 61.95  ? 279 GLY A CA  1 
ATOM   5159 C C   . GLY B 1 118 ? -72.761  26.860  81.823  1.00 61.56  ? 279 GLY A C   1 
ATOM   5160 O O   . GLY B 1 118 ? -73.603  26.780  80.930  1.00 61.76  ? 279 GLY A O   1 
ATOM   5161 N N   . GLY B 1 119 ? -73.037  26.669  83.113  1.00 60.85  ? 280 GLY A N   1 
ATOM   5162 C CA  . GLY B 1 119 ? -74.361  26.270  83.585  1.00 60.20  ? 280 GLY A CA  1 
ATOM   5163 C C   . GLY B 1 119 ? -74.739  24.868  83.146  1.00 60.85  ? 280 GLY A C   1 
ATOM   5164 O O   . GLY B 1 119 ? -75.922  24.568  82.952  1.00 61.27  ? 280 GLY A O   1 
ATOM   5165 N N   . PHE B 1 120 ? -73.726  24.013  82.987  1.00 60.73  ? 281 PHE A N   1 
ATOM   5166 C CA  . PHE B 1 120 ? -73.890  22.634  82.508  1.00 60.50  ? 281 PHE A CA  1 
ATOM   5167 C C   . PHE B 1 120 ? -74.654  22.529  81.182  1.00 62.29  ? 281 PHE A C   1 
ATOM   5168 O O   . PHE B 1 120 ? -75.245  21.486  80.884  1.00 64.21  ? 281 PHE A O   1 
ATOM   5169 C CB  . PHE B 1 120 ? -74.549  21.745  83.576  1.00 58.82  ? 281 PHE A CB  1 
ATOM   5170 C CG  . PHE B 1 120 ? -73.759  21.631  84.848  1.00 57.39  ? 281 PHE A CG  1 
ATOM   5171 C CD1 . PHE B 1 120 ? -72.612  20.846  84.903  1.00 56.69  ? 281 PHE A CD1 1 
ATOM   5172 C CD2 . PHE B 1 120 ? -74.167  22.300  85.995  1.00 56.92  ? 281 PHE A CD2 1 
ATOM   5173 C CE1 . PHE B 1 120 ? -71.883  20.736  86.076  1.00 55.94  ? 281 PHE A CE1 1 
ATOM   5174 C CE2 . PHE B 1 120 ? -73.442  22.192  87.172  1.00 56.64  ? 281 PHE A CE2 1 
ATOM   5175 C CZ  . PHE B 1 120 ? -72.298  21.410  87.211  1.00 56.09  ? 281 PHE A CZ  1 
ATOM   5176 N N   . TYR B 1 121 ? -74.636  23.604  80.393  1.00 61.72  ? 282 TYR A N   1 
ATOM   5177 C CA  . TYR B 1 121 ? -75.256  23.597  79.067  1.00 60.01  ? 282 TYR A CA  1 
ATOM   5178 C C   . TYR B 1 121 ? -74.328  24.103  77.960  1.00 58.06  ? 282 TYR A C   1 
ATOM   5179 O O   . TYR B 1 121 ? -74.592  23.883  76.777  1.00 58.57  ? 282 TYR A O   1 
ATOM   5180 C CB  . TYR B 1 121 ? -76.597  24.350  79.068  1.00 61.50  ? 282 TYR A CB  1 
ATOM   5181 C CG  . TYR B 1 121 ? -76.507  25.860  79.203  1.00 62.42  ? 282 TYR A CG  1 
ATOM   5182 C CD1 . TYR B 1 121 ? -76.250  26.669  78.092  1.00 62.36  ? 282 TYR A CD1 1 
ATOM   5183 C CD2 . TYR B 1 121 ? -76.715  26.481  80.432  1.00 62.90  ? 282 TYR A CD2 1 
ATOM   5184 C CE1 . TYR B 1 121 ? -76.176  28.047  78.209  1.00 62.88  ? 282 TYR A CE1 1 
ATOM   5185 C CE2 . TYR B 1 121 ? -76.645  27.860  80.559  1.00 63.84  ? 282 TYR A CE2 1 
ATOM   5186 C CZ  . TYR B 1 121 ? -76.375  28.637  79.446  1.00 64.30  ? 282 TYR A CZ  1 
ATOM   5187 O OH  . TYR B 1 121 ? -76.307  30.006  79.572  1.00 66.13  ? 282 TYR A OH  1 
ATOM   5188 N N   . SER B 1 122 ? -73.249  24.780  78.350  1.00 56.41  ? 283 SER A N   1 
ATOM   5189 C CA  . SER B 1 122 ? -72.314  25.374  77.395  1.00 56.51  ? 283 SER A CA  1 
ATOM   5190 C C   . SER B 1 122 ? -70.891  25.455  77.940  1.00 57.60  ? 283 SER A C   1 
ATOM   5191 O O   . SER B 1 122 ? -70.651  25.202  79.122  1.00 58.18  ? 283 SER A O   1 
ATOM   5192 C CB  . SER B 1 122 ? -72.784  26.775  76.998  1.00 56.67  ? 283 SER A CB  1 
ATOM   5193 O OG  . SER B 1 122 ? -72.754  27.655  78.110  1.00 55.92  ? 283 SER A OG  1 
ATOM   5194 N N   . GLY B 1 123 ? -69.955  25.817  77.066  1.00 59.10  ? 284 GLY A N   1 
ATOM   5195 C CA  . GLY B 1 123 ? -68.568  26.046  77.455  1.00 60.75  ? 284 GLY A CA  1 
ATOM   5196 C C   . GLY B 1 123 ? -67.569  25.147  76.753  1.00 62.13  ? 284 GLY A C   1 
ATOM   5197 O O   . GLY B 1 123 ? -67.929  24.106  76.197  1.00 63.86  ? 284 GLY A O   1 
ATOM   5198 N N   . THR B 1 124 ? -66.306  25.562  76.789  1.00 62.41  ? 285 THR A N   1 
ATOM   5199 C CA  . THR B 1 124 ? -65.198  24.806  76.206  1.00 61.81  ? 285 THR A CA  1 
ATOM   5200 C C   . THR B 1 124 ? -63.886  25.191  76.882  1.00 60.74  ? 285 THR A C   1 
ATOM   5201 O O   . THR B 1 124 ? -63.720  26.328  77.327  1.00 61.03  ? 285 THR A O   1 
ATOM   5202 C CB  . THR B 1 124 ? -65.090  25.014  74.673  1.00 63.01  ? 285 THR A CB  1 
ATOM   5203 O OG1 . THR B 1 124 ? -63.929  24.341  74.170  1.00 64.44  ? 285 THR A OG1 1 
ATOM   5204 C CG2 . THR B 1 124 ? -65.004  26.490  74.308  1.00 63.32  ? 285 THR A CG2 1 
ATOM   5205 N N   . ALA B 1 125 ? -62.959  24.240  76.955  1.00 59.55  ? 286 ALA A N   1 
ATOM   5206 C CA  . ALA B 1 125 ? -61.639  24.488  77.526  1.00 58.49  ? 286 ALA A CA  1 
ATOM   5207 C C   . ALA B 1 125 ? -60.793  25.387  76.620  1.00 58.65  ? 286 ALA A C   1 
ATOM   5208 O O   . ALA B 1 125 ? -59.784  25.946  77.054  1.00 59.36  ? 286 ALA A O   1 
ATOM   5209 C CB  . ALA B 1 125 ? -60.925  23.171  77.790  1.00 57.67  ? 286 ALA A CB  1 
ATOM   5210 N N   . THR B 1 126 ? -61.232  25.539  75.373  1.00 58.43  ? 287 THR A N   1 
ATOM   5211 C CA  . THR B 1 126 ? -60.450  26.214  74.338  1.00 58.60  ? 287 THR A CA  1 
ATOM   5212 C C   . THR B 1 126 ? -60.657  27.728  74.252  1.00 59.16  ? 287 THR A C   1 
ATOM   5213 O O   . THR B 1 126 ? -60.055  28.381  73.398  1.00 60.00  ? 287 THR A O   1 
ATOM   5214 C CB  . THR B 1 126 ? -60.718  25.602  72.948  1.00 59.00  ? 287 THR A CB  1 
ATOM   5215 O OG1 . THR B 1 126 ? -62.128  25.599  72.686  1.00 59.34  ? 287 THR A OG1 1 
ATOM   5216 C CG2 . THR B 1 126 ? -60.185  24.181  72.874  1.00 59.81  ? 287 THR A CG2 1 
ATOM   5217 N N   . LEU B 1 127 ? -61.494  28.286  75.127  1.00 59.57  ? 288 LEU A N   1 
ATOM   5218 C CA  . LEU B 1 127 ? -61.767  29.728  75.117  1.00 60.02  ? 288 LEU A CA  1 
ATOM   5219 C C   . LEU B 1 127 ? -60.496  30.552  75.270  1.00 61.85  ? 288 LEU A C   1 
ATOM   5220 O O   . LEU B 1 127 ? -59.592  30.175  76.019  1.00 61.85  ? 288 LEU A O   1 
ATOM   5221 C CB  . LEU B 1 127 ? -62.772  30.116  76.207  1.00 58.45  ? 288 LEU A CB  1 
ATOM   5222 C CG  . LEU B 1 127 ? -64.237  29.714  76.032  1.00 57.36  ? 288 LEU A CG  1 
ATOM   5223 C CD1 . LEU B 1 127 ? -65.085  30.295  77.151  1.00 56.82  ? 288 LEU A CD1 1 
ATOM   5224 C CD2 . LEU B 1 127 ? -64.774  30.153  74.680  1.00 57.70  ? 288 LEU A CD2 1 
ATOM   5225 N N   . ASP B 1 128 ? -60.438  31.673  74.551  1.00 64.29  ? 289 ASP A N   1 
ATOM   5226 C CA  . ASP B 1 128 ? -59.289  32.580  74.592  1.00 67.34  ? 289 ASP A CA  1 
ATOM   5227 C C   . ASP B 1 128 ? -59.042  33.164  75.987  1.00 68.69  ? 289 ASP A C   1 
ATOM   5228 O O   . ASP B 1 128 ? -57.903  33.489  76.334  1.00 67.57  ? 289 ASP A O   1 
ATOM   5229 C CB  . ASP B 1 128 ? -59.455  33.709  73.567  1.00 70.02  ? 289 ASP A CB  1 
ATOM   5230 C CG  . ASP B 1 128 ? -59.093  33.279  72.150  1.00 72.11  ? 289 ASP A CG  1 
ATOM   5231 O OD1 . ASP B 1 128 ? -57.959  32.798  71.935  1.00 73.33  ? 289 ASP A OD1 1 
ATOM   5232 O OD2 . ASP B 1 128 ? -59.938  33.439  71.243  1.00 73.03  ? 289 ASP A OD2 1 
ATOM   5233 N N   . VAL B 1 129 ? -60.110  33.288  76.777  1.00 71.06  ? 290 VAL A N   1 
ATOM   5234 C CA  . VAL B 1 129 ? -60.017  33.807  78.149  1.00 72.39  ? 290 VAL A CA  1 
ATOM   5235 C C   . VAL B 1 129 ? -59.272  32.870  79.100  1.00 72.66  ? 290 VAL A C   1 
ATOM   5236 O O   . VAL B 1 129 ? -58.573  33.333  80.003  1.00 74.05  ? 290 VAL A O   1 
ATOM   5237 C CB  . VAL B 1 129 ? -61.396  34.177  78.751  1.00 72.26  ? 290 VAL A CB  1 
ATOM   5238 C CG1 . VAL B 1 129 ? -61.905  35.484  78.157  1.00 73.14  ? 290 VAL A CG1 1 
ATOM   5239 C CG2 . VAL B 1 129 ? -62.408  33.055  78.557  1.00 72.57  ? 290 VAL A CG2 1 
ATOM   5240 N N   . TYR B 1 130 ? -59.424  31.561  78.891  1.00 71.92  ? 291 TYR A N   1 
ATOM   5241 C CA  . TYR B 1 130 ? -58.710  30.559  79.682  1.00 71.01  ? 291 TYR A CA  1 
ATOM   5242 C C   . TYR B 1 130 ? -57.283  30.408  79.156  1.00 72.72  ? 291 TYR A C   1 
ATOM   5243 O O   . TYR B 1 130 ? -56.932  29.391  78.552  1.00 73.53  ? 291 TYR A O   1 
ATOM   5244 C CB  . TYR B 1 130 ? -59.431  29.202  79.660  1.00 68.63  ? 291 TYR A CB  1 
ATOM   5245 C CG  . TYR B 1 130 ? -60.911  29.229  79.992  1.00 66.34  ? 291 TYR A CG  1 
ATOM   5246 C CD1 . TYR B 1 130 ? -61.413  30.037  81.012  1.00 65.97  ? 291 TYR A CD1 1 
ATOM   5247 C CD2 . TYR B 1 130 ? -61.805  28.413  79.303  1.00 65.45  ? 291 TYR A CD2 1 
ATOM   5248 C CE1 . TYR B 1 130 ? -62.768  30.052  81.314  1.00 65.41  ? 291 TYR A CE1 1 
ATOM   5249 C CE2 . TYR B 1 130 ? -63.159  28.417  79.603  1.00 65.13  ? 291 TYR A CE2 1 
ATOM   5250 C CZ  . TYR B 1 130 ? -63.636  29.237  80.608  1.00 65.14  ? 291 TYR A CZ  1 
ATOM   5251 O OH  . TYR B 1 130 ? -64.979  29.241  80.909  1.00 63.87  ? 291 TYR A OH  1 
ATOM   5252 N N   . ASP B 1 131 ? -56.467  31.432  79.386  1.00 75.08  ? 292 ASP A N   1 
ATOM   5253 C CA  . ASP B 1 131 ? -55.095  31.458  78.892  1.00 76.46  ? 292 ASP A CA  1 
ATOM   5254 C C   . ASP B 1 131 ? -54.179  30.591  79.754  1.00 74.41  ? 292 ASP A C   1 
ATOM   5255 O O   . ASP B 1 131 ? -53.735  31.005  80.830  1.00 72.88  ? 292 ASP A O   1 
ATOM   5256 C CB  . ASP B 1 131 ? -54.579  32.899  78.823  1.00 81.02  ? 292 ASP A CB  1 
ATOM   5257 C CG  . ASP B 1 131 ? -53.313  33.034  77.989  1.00 84.51  ? 292 ASP A CG  1 
ATOM   5258 O OD1 . ASP B 1 131 ? -53.034  32.145  77.149  1.00 85.55  ? 292 ASP A OD1 1 
ATOM   5259 O OD2 . ASP B 1 131 ? -52.601  34.044  78.171  1.00 84.66  ? 292 ASP A OD2 1 
ATOM   5260 N N   . HIS B 1 132 ? -53.910  29.385  79.262  1.00 71.98  ? 293 HIS A N   1 
ATOM   5261 C CA  . HIS B 1 132 ? -53.080  28.407  79.959  1.00 70.82  ? 293 HIS A CA  1 
ATOM   5262 C C   . HIS B 1 132 ? -51.626  28.849  80.013  1.00 71.27  ? 293 HIS A C   1 
ATOM   5263 O O   . HIS B 1 132 ? -50.960  28.696  81.038  1.00 72.42  ? 293 HIS A O   1 
ATOM   5264 C CB  . HIS B 1 132 ? -53.155  27.059  79.245  1.00 70.51  ? 293 HIS A CB  1 
ATOM   5265 C CG  . HIS B 1 132 ? -54.472  26.363  79.382  1.00 70.88  ? 293 HIS A CG  1 
ATOM   5266 N ND1 . HIS B 1 132 ? -55.660  27.035  79.577  1.00 71.18  ? 293 HIS A ND1 1 
ATOM   5267 C CD2 . HIS B 1 132 ? -54.791  25.049  79.320  1.00 70.48  ? 293 HIS A CD2 1 
ATOM   5268 C CE1 . HIS B 1 132 ? -56.650  26.165  79.647  1.00 70.68  ? 293 HIS A CE1 1 
ATOM   5269 N NE2 . HIS B 1 132 ? -56.149  24.953  79.491  1.00 70.37  ? 293 HIS A NE2 1 
ATOM   5270 N N   . ARG B 1 133 ? -51.150  29.397  78.899  1.00 71.24  ? 294 ARG A N   1 
ATOM   5271 C CA  . ARG B 1 133 ? -49.745  29.756  78.719  1.00 71.11  ? 294 ARG A CA  1 
ATOM   5272 C C   . ARG B 1 133 ? -49.260  30.807  79.713  1.00 71.59  ? 294 ARG A C   1 
ATOM   5273 O O   . ARG B 1 133 ? -48.130  30.729  80.196  1.00 71.46  ? 294 ARG A O   1 
ATOM   5274 C CB  . ARG B 1 133 ? -49.503  30.235  77.287  1.00 71.79  ? 294 ARG A CB  1 
ATOM   5275 C CG  . ARG B 1 133 ? -49.829  29.198  76.227  1.00 73.47  ? 294 ARG A CG  1 
ATOM   5276 C CD  . ARG B 1 133 ? -49.768  29.787  74.830  1.00 75.19  ? 294 ARG A CD  1 
ATOM   5277 N NE  . ARG B 1 133 ? -50.148  28.799  73.823  1.00 77.74  ? 294 ARG A NE  1 
ATOM   5278 C CZ  . ARG B 1 133 ? -50.284  29.054  72.524  1.00 79.62  ? 294 ARG A CZ  1 
ATOM   5279 N NH1 . ARG B 1 133 ? -50.074  30.276  72.050  1.00 80.71  ? 294 ARG A NH1 1 
ATOM   5280 N NH2 . ARG B 1 133 ? -50.636  28.082  71.694  1.00 80.24  ? 294 ARG A NH2 1 
ATOM   5281 N N   . ALA B 1 134 ? -50.117  31.780  80.017  1.00 71.86  ? 295 ALA A N   1 
ATOM   5282 C CA  . ALA B 1 134 ? -49.766  32.862  80.936  1.00 72.19  ? 295 ALA A CA  1 
ATOM   5283 C C   . ALA B 1 134 ? -49.684  32.395  82.389  1.00 72.27  ? 295 ALA A C   1 
ATOM   5284 O O   . ALA B 1 134 ? -48.788  32.814  83.123  1.00 73.33  ? 295 ALA A O   1 
ATOM   5285 C CB  . ALA B 1 134 ? -50.739  34.023  80.799  1.00 72.51  ? 295 ALA A CB  1 
ATOM   5286 N N   . LEU B 1 135 ? -50.611  31.526  82.792  1.00 71.40  ? 296 LEU A N   1 
ATOM   5287 C CA  . LEU B 1 135 ? -50.626  30.972  84.150  1.00 69.37  ? 296 LEU A CA  1 
ATOM   5288 C C   . LEU B 1 135 ? -49.465  30.006  84.396  1.00 69.40  ? 296 LEU A C   1 
ATOM   5289 O O   . LEU B 1 135 ? -48.823  30.058  85.447  1.00 69.83  ? 296 LEU A O   1 
ATOM   5290 C CB  . LEU B 1 135 ? -51.969  30.293  84.456  1.00 67.25  ? 296 LEU A CB  1 
ATOM   5291 C CG  . LEU B 1 135 ? -52.179  29.682  85.850  1.00 66.04  ? 296 LEU A CG  1 
ATOM   5292 C CD1 . LEU B 1 135 ? -52.085  30.733  86.946  1.00 66.36  ? 296 LEU A CD1 1 
ATOM   5293 C CD2 . LEU B 1 135 ? -53.511  28.954  85.928  1.00 65.23  ? 296 LEU A CD2 1 
ATOM   5294 N N   . ALA B 1 136 ? -49.204  29.135  83.422  1.00 69.31  ? 297 ALA A N   1 
ATOM   5295 C CA  . ALA B 1 136 ? -48.134  28.141  83.519  1.00 69.25  ? 297 ALA A CA  1 
ATOM   5296 C C   . ALA B 1 136 ? -46.746  28.779  83.564  1.00 70.31  ? 297 ALA A C   1 
ATOM   5297 O O   . ALA B 1 136 ? -45.896  28.372  84.361  1.00 70.62  ? 297 ALA A O   1 
ATOM   5298 C CB  . ALA B 1 136 ? -48.227  27.149  82.369  1.00 68.10  ? 297 ALA A CB  1 
ATOM   5299 N N   . SER B 1 137 ? -46.531  29.782  82.714  1.00 70.75  ? 298 SER A N   1 
ATOM   5300 C CA  . SER B 1 137 ? -45.235  30.447  82.597  1.00 71.18  ? 298 SER A CA  1 
ATOM   5301 C C   . SER B 1 137 ? -44.906  31.308  83.810  1.00 72.97  ? 298 SER A C   1 
ATOM   5302 O O   . SER B 1 137 ? -43.769  31.308  84.282  1.00 73.94  ? 298 SER A O   1 
ATOM   5303 C CB  . SER B 1 137 ? -45.177  31.299  81.326  1.00 69.81  ? 298 SER A CB  1 
ATOM   5304 O OG  . SER B 1 137 ? -46.211  32.269  81.308  1.00 68.51  ? 298 SER A OG  1 
ATOM   5305 N N   . GLU B 1 138 ? -45.908  32.024  84.314  1.00 75.41  ? 299 GLU A N   1 
ATOM   5306 C CA  . GLU B 1 138 ? -45.704  33.041  85.346  1.00 78.90  ? 299 GLU A CA  1 
ATOM   5307 C C   . GLU B 1 138 ? -45.686  32.481  86.771  1.00 79.51  ? 299 GLU A C   1 
ATOM   5308 O O   . GLU B 1 138 ? -45.286  33.174  87.711  1.00 78.93  ? 299 GLU A O   1 
ATOM   5309 C CB  . GLU B 1 138 ? -46.788  34.113  85.232  1.00 80.40  ? 299 GLU A CB  1 
ATOM   5310 C CG  . GLU B 1 138 ? -46.314  35.529  85.508  1.00 83.71  ? 299 GLU A CG  1 
ATOM   5311 C CD  . GLU B 1 138 ? -45.685  36.190  84.295  1.00 86.24  ? 299 GLU A CD  1 
ATOM   5312 O OE1 . GLU B 1 138 ? -45.797  35.646  83.171  1.00 85.63  ? 299 GLU A OE1 1 
ATOM   5313 O OE2 . GLU B 1 138 ? -45.082  37.271  84.467  1.00 89.44  ? 299 GLU A OE2 1 
ATOM   5314 N N   . GLU B 1 139 ? -46.118  31.232  86.927  1.00 80.38  ? 300 GLU A N   1 
ATOM   5315 C CA  . GLU B 1 139 ? -46.278  30.637  88.254  1.00 80.43  ? 300 GLU A CA  1 
ATOM   5316 C C   . GLU B 1 139 ? -45.578  29.287  88.419  1.00 80.02  ? 300 GLU A C   1 
ATOM   5317 O O   . GLU B 1 139 ? -45.562  28.730  89.520  1.00 80.01  ? 300 GLU A O   1 
ATOM   5318 C CB  . GLU B 1 139 ? -47.767  30.507  88.604  1.00 81.16  ? 300 GLU A CB  1 
ATOM   5319 C CG  . GLU B 1 139 ? -48.562  31.809  88.554  1.00 82.45  ? 300 GLU A CG  1 
ATOM   5320 C CD  . GLU B 1 139 ? -48.056  32.866  89.521  1.00 84.02  ? 300 GLU A CD  1 
ATOM   5321 O OE1 . GLU B 1 139 ? -47.697  32.516  90.666  1.00 85.65  ? 300 GLU A OE1 1 
ATOM   5322 O OE2 . GLU B 1 139 ? -48.025  34.055  89.138  1.00 84.80  ? 300 GLU A OE2 1 
ATOM   5323 N N   . ASN B 1 140 ? -44.997  28.777  87.332  1.00 79.63  ? 301 ASN A N   1 
ATOM   5324 C CA  . ASN B 1 140 ? -44.341  27.460  87.312  1.00 80.14  ? 301 ASN A CA  1 
ATOM   5325 C C   . ASN B 1 140 ? -45.252  26.318  87.766  1.00 80.97  ? 301 ASN A C   1 
ATOM   5326 O O   . ASN B 1 140 ? -44.927  25.568  88.693  1.00 83.77  ? 301 ASN A O   1 
ATOM   5327 C CB  . ASN B 1 140 ? -43.027  27.474  88.103  1.00 79.69  ? 301 ASN A CB  1 
ATOM   5328 C CG  . ASN B 1 140 ? -41.841  27.867  87.250  1.00 80.99  ? 301 ASN A CG  1 
ATOM   5329 O OD1 . ASN B 1 140 ? -41.405  27.106  86.385  1.00 80.80  ? 301 ASN A OD1 1 
ATOM   5330 N ND2 . ASN B 1 140 ? -41.308  29.060  87.490  1.00 82.39  ? 301 ASN A ND2 1 
ATOM   5331 N N   . VAL B 1 141 ? -46.397  26.205  87.099  1.00 78.54  ? 302 VAL A N   1 
ATOM   5332 C CA  . VAL B 1 141 ? -47.393  25.183  87.404  1.00 74.14  ? 302 VAL A CA  1 
ATOM   5333 C C   . VAL B 1 141 ? -47.796  24.479  86.110  1.00 71.29  ? 302 VAL A C   1 
ATOM   5334 O O   . VAL B 1 141 ? -47.929  25.121  85.066  1.00 70.88  ? 302 VAL A O   1 
ATOM   5335 C CB  . VAL B 1 141 ? -48.652  25.802  88.060  1.00 74.58  ? 302 VAL A CB  1 
ATOM   5336 C CG1 . VAL B 1 141 ? -49.606  24.717  88.532  1.00 76.54  ? 302 VAL A CG1 1 
ATOM   5337 C CG2 . VAL B 1 141 ? -48.280  26.705  89.228  1.00 74.52  ? 302 VAL A CG2 1 
ATOM   5338 N N   . ILE B 1 142 ? -47.977  23.163  86.175  1.00 68.49  ? 303 ILE A N   1 
ATOM   5339 C CA  . ILE B 1 142 ? -48.556  22.423  85.060  1.00 66.95  ? 303 ILE A CA  1 
ATOM   5340 C C   . ILE B 1 142 ? -50.054  22.724  85.025  1.00 66.10  ? 303 ILE A C   1 
ATOM   5341 O O   . ILE B 1 142 ? -50.803  22.293  85.905  1.00 66.35  ? 303 ILE A O   1 
ATOM   5342 C CB  . ILE B 1 142 ? -48.334  20.894  85.181  1.00 67.44  ? 303 ILE A CB  1 
ATOM   5343 C CG1 . ILE B 1 142 ? -46.883  20.558  85.562  1.00 68.16  ? 303 ILE A CG1 1 
ATOM   5344 C CG2 . ILE B 1 142 ? -48.768  20.179  83.904  1.00 67.46  ? 303 ILE A CG2 1 
ATOM   5345 C CD1 . ILE B 1 142 ? -45.860  20.749  84.459  1.00 69.30  ? 303 ILE A CD1 1 
ATOM   5346 N N   . VAL B 1 143 ? -50.477  23.486  84.020  1.00 64.62  ? 304 VAL A N   1 
ATOM   5347 C CA  . VAL B 1 143 ? -51.887  23.834  83.848  1.00 63.06  ? 304 VAL A CA  1 
ATOM   5348 C C   . VAL B 1 143 ? -52.567  22.819  82.933  1.00 64.00  ? 304 VAL A C   1 
ATOM   5349 O O   . VAL B 1 143 ? -52.125  22.582  81.805  1.00 65.49  ? 304 VAL A O   1 
ATOM   5350 C CB  . VAL B 1 143 ? -52.062  25.262  83.292  1.00 61.89  ? 304 VAL A CB  1 
ATOM   5351 C CG1 . VAL B 1 143 ? -53.535  25.587  83.083  1.00 61.24  ? 304 VAL A CG1 1 
ATOM   5352 C CG2 . VAL B 1 143 ? -51.428  26.275  84.232  1.00 62.20  ? 304 VAL A CG2 1 
ATOM   5353 N N   . VAL B 1 144 ? -53.640  22.216  83.437  1.00 63.76  ? 305 VAL A N   1 
ATOM   5354 C CA  . VAL B 1 144 ? -54.381  21.196  82.702  1.00 63.30  ? 305 VAL A CA  1 
ATOM   5355 C C   . VAL B 1 144 ? -55.845  21.606  82.576  1.00 63.32  ? 305 VAL A C   1 
ATOM   5356 O O   . VAL B 1 144 ? -56.429  22.143  83.517  1.00 64.57  ? 305 VAL A O   1 
ATOM   5357 C CB  . VAL B 1 144 ? -54.270  19.816  83.394  1.00 63.01  ? 305 VAL A CB  1 
ATOM   5358 C CG1 . VAL B 1 144 ? -55.132  18.774  82.695  1.00 62.84  ? 305 VAL A CG1 1 
ATOM   5359 C CG2 . VAL B 1 144 ? -52.822  19.354  83.436  1.00 62.57  ? 305 VAL A CG2 1 
ATOM   5360 N N   . SER B 1 145 ? -56.426  21.369  81.405  1.00 62.29  ? 306 SER A N   1 
ATOM   5361 C CA  . SER B 1 145 ? -57.854  21.586  81.198  1.00 62.08  ? 306 SER A CA  1 
ATOM   5362 C C   . SER B 1 145 ? -58.483  20.406  80.473  1.00 61.68  ? 306 SER A C   1 
ATOM   5363 O O   . SER B 1 145 ? -57.817  19.694  79.716  1.00 61.37  ? 306 SER A O   1 
ATOM   5364 C CB  . SER B 1 145 ? -58.108  22.879  80.425  1.00 62.37  ? 306 SER A CB  1 
ATOM   5365 O OG  . SER B 1 145 ? -57.541  22.818  79.127  1.00 62.99  ? 306 SER A OG  1 
ATOM   5366 N N   . LEU B 1 146 ? -59.773  20.206  80.710  1.00 60.76  ? 307 LEU A N   1 
ATOM   5367 C CA  . LEU B 1 146 ? -60.483  19.097  80.104  1.00 60.37  ? 307 LEU A CA  1 
ATOM   5368 C C   . LEU B 1 146 ? -61.763  19.567  79.440  1.00 60.66  ? 307 LEU A C   1 
ATOM   5369 O O   . LEU B 1 146 ? -62.306  20.620  79.785  1.00 61.76  ? 307 LEU A O   1 
ATOM   5370 C CB  . LEU B 1 146 ? -60.771  18.009  81.146  1.00 59.84  ? 307 LEU A CB  1 
ATOM   5371 C CG  . LEU B 1 146 ? -61.861  18.222  82.199  1.00 58.76  ? 307 LEU A CG  1 
ATOM   5372 C CD1 . LEU B 1 146 ? -63.162  17.571  81.755  1.00 58.14  ? 307 LEU A CD1 1 
ATOM   5373 C CD2 . LEU B 1 146 ? -61.418  17.635  83.526  1.00 58.79  ? 307 LEU A CD2 1 
ATOM   5374 N N   . GLN B 1 147 ? -62.222  18.775  78.478  1.00 60.39  ? 308 GLN A N   1 
ATOM   5375 C CA  . GLN B 1 147 ? -63.523  18.957  77.861  1.00 60.55  ? 308 GLN A CA  1 
ATOM   5376 C C   . GLN B 1 147 ? -64.441  17.876  78.404  1.00 59.60  ? 308 GLN A C   1 
ATOM   5377 O O   . GLN B 1 147 ? -64.098  16.693  78.371  1.00 60.40  ? 308 GLN A O   1 
ATOM   5378 C CB  . GLN B 1 147 ? -63.422  18.819  76.342  1.00 61.73  ? 308 GLN A CB  1 
ATOM   5379 C CG  . GLN B 1 147 ? -62.426  19.752  75.671  1.00 64.41  ? 308 GLN A CG  1 
ATOM   5380 C CD  . GLN B 1 147 ? -63.022  21.099  75.309  1.00 66.77  ? 308 GLN A CD  1 
ATOM   5381 O OE1 . GLN B 1 147 ? -63.738  21.717  76.101  1.00 68.23  ? 308 GLN A OE1 1 
ATOM   5382 N NE2 . GLN B 1 147 ? -62.722  21.567  74.102  1.00 68.13  ? 308 GLN A NE2 1 
ATOM   5383 N N   . TYR B 1 148 ? -65.595  18.281  78.923  1.00 57.50  ? 309 TYR A N   1 
ATOM   5384 C CA  . TYR B 1 148 ? -66.608  17.324  79.355  1.00 56.01  ? 309 TYR A CA  1 
ATOM   5385 C C   . TYR B 1 148 ? -67.910  17.569  78.605  1.00 55.82  ? 309 TYR A C   1 
ATOM   5386 O O   . TYR B 1 148 ? -68.225  18.709  78.257  1.00 56.41  ? 309 TYR A O   1 
ATOM   5387 C CB  . TYR B 1 148 ? -66.820  17.384  80.873  1.00 54.84  ? 309 TYR A CB  1 
ATOM   5388 C CG  . TYR B 1 148 ? -67.356  18.701  81.392  1.00 54.73  ? 309 TYR A CG  1 
ATOM   5389 C CD1 . TYR B 1 148 ? -66.498  19.760  81.685  1.00 54.16  ? 309 TYR A CD1 1 
ATOM   5390 C CD2 . TYR B 1 148 ? -68.722  18.882  81.606  1.00 54.50  ? 309 TYR A CD2 1 
ATOM   5391 C CE1 . TYR B 1 148 ? -66.988  20.964  82.166  1.00 54.41  ? 309 TYR A CE1 1 
ATOM   5392 C CE2 . TYR B 1 148 ? -69.221  20.081  82.084  1.00 54.51  ? 309 TYR A CE2 1 
ATOM   5393 C CZ  . TYR B 1 148 ? -68.351  21.120  82.362  1.00 54.96  ? 309 TYR A CZ  1 
ATOM   5394 O OH  . TYR B 1 148 ? -68.847  22.316  82.836  1.00 56.36  ? 309 TYR A OH  1 
ATOM   5395 N N   . ARG B 1 149 ? -68.656  16.498  78.348  1.00 55.83  ? 310 ARG A N   1 
ATOM   5396 C CA  . ARG B 1 149 ? -69.951  16.609  77.684  1.00 55.77  ? 310 ARG A CA  1 
ATOM   5397 C C   . ARG B 1 149 ? -70.893  17.509  78.466  1.00 55.85  ? 310 ARG A C   1 
ATOM   5398 O O   . ARG B 1 149 ? -70.934  17.477  79.698  1.00 55.92  ? 310 ARG A O   1 
ATOM   5399 C CB  . ARG B 1 149 ? -70.585  15.240  77.469  1.00 56.26  ? 310 ARG A CB  1 
ATOM   5400 C CG  . ARG B 1 149 ? -70.239  14.607  76.136  1.00 57.30  ? 310 ARG A CG  1 
ATOM   5401 C CD  . ARG B 1 149 ? -70.783  13.194  76.064  1.00 58.82  ? 310 ARG A CD  1 
ATOM   5402 N NE  . ARG B 1 149 ? -70.111  12.321  77.023  1.00 59.87  ? 310 ARG A NE  1 
ATOM   5403 C CZ  . ARG B 1 149 ? -70.570  11.135  77.408  1.00 61.25  ? 310 ARG A CZ  1 
ATOM   5404 N NH1 . ARG B 1 149 ? -71.714  10.667  76.922  1.00 61.87  ? 310 ARG A NH1 1 
ATOM   5405 N NH2 . ARG B 1 149 ? -69.885  10.418  78.288  1.00 62.03  ? 310 ARG A NH2 1 
ATOM   5406 N N   . VAL B 1 150 ? -71.651  18.309  77.729  1.00 55.62  ? 311 VAL A N   1 
ATOM   5407 C CA  . VAL B 1 150 ? -72.447  19.370  78.316  1.00 54.59  ? 311 VAL A CA  1 
ATOM   5408 C C   . VAL B 1 150 ? -73.891  19.272  77.805  1.00 53.64  ? 311 VAL A C   1 
ATOM   5409 O O   . VAL B 1 150 ? -74.152  18.572  76.821  1.00 53.82  ? 311 VAL A O   1 
ATOM   5410 C CB  . VAL B 1 150 ? -71.777  20.738  78.033  1.00 54.37  ? 311 VAL A CB  1 
ATOM   5411 C CG1 . VAL B 1 150 ? -72.260  21.347  76.723  1.00 54.55  ? 311 VAL A CG1 1 
ATOM   5412 C CG2 . VAL B 1 150 ? -71.971  21.689  79.199  1.00 55.07  ? 311 VAL A CG2 1 
ATOM   5413 N N   . ALA B 1 151 ? -74.817  19.947  78.490  1.00 52.31  ? 312 ALA A N   1 
ATOM   5414 C CA  . ALA B 1 151 ? -76.252  19.926  78.156  1.00 52.33  ? 312 ALA A CA  1 
ATOM   5415 C C   . ALA B 1 151 ? -76.870  18.519  78.242  1.00 53.19  ? 312 ALA A C   1 
ATOM   5416 O O   . ALA B 1 151 ? -76.420  17.692  79.042  1.00 54.38  ? 312 ALA A O   1 
ATOM   5417 C CB  . ALA B 1 151 ? -76.507  20.568  76.797  1.00 51.44  ? 312 ALA A CB  1 
ATOM   5418 N N   . SER B 1 152 ? -77.898  18.255  77.434  1.00 52.93  ? 313 SER A N   1 
ATOM   5419 C CA  . SER B 1 152 ? -78.581  16.957  77.440  1.00 52.51  ? 313 SER A CA  1 
ATOM   5420 C C   . SER B 1 152 ? -77.644  15.829  77.030  1.00 52.35  ? 313 SER A C   1 
ATOM   5421 O O   . SER B 1 152 ? -77.773  14.705  77.506  1.00 53.36  ? 313 SER A O   1 
ATOM   5422 C CB  . SER B 1 152 ? -79.815  16.969  76.532  1.00 52.82  ? 313 SER A CB  1 
ATOM   5423 O OG  . SER B 1 152 ? -79.458  17.154  75.172  1.00 53.43  ? 313 SER A OG  1 
ATOM   5424 N N   . LEU B 1 153 ? -76.695  16.144  76.151  1.00 52.01  ? 314 LEU A N   1 
ATOM   5425 C CA  . LEU B 1 153 ? -75.697  15.178  75.700  1.00 52.10  ? 314 LEU A CA  1 
ATOM   5426 C C   . LEU B 1 153 ? -74.780  14.720  76.834  1.00 53.09  ? 314 LEU A C   1 
ATOM   5427 O O   . LEU B 1 153 ? -74.147  13.661  76.747  1.00 53.05  ? 314 LEU A O   1 
ATOM   5428 C CB  . LEU B 1 153 ? -74.862  15.767  74.560  1.00 50.87  ? 314 LEU A CB  1 
ATOM   5429 C CG  . LEU B 1 153 ? -75.565  16.131  73.251  1.00 50.10  ? 314 LEU A CG  1 
ATOM   5430 C CD1 . LEU B 1 153 ? -74.540  16.644  72.258  1.00 49.88  ? 314 LEU A CD1 1 
ATOM   5431 C CD2 . LEU B 1 153 ? -76.322  14.950  72.664  1.00 50.21  ? 314 LEU A CD2 1 
ATOM   5432 N N   . GLY B 1 154 ? -74.721  15.523  77.895  1.00 53.57  ? 315 GLY A N   1 
ATOM   5433 C CA  . GLY B 1 154 ? -73.873  15.227  79.040  1.00 54.75  ? 315 GLY A CA  1 
ATOM   5434 C C   . GLY B 1 154 ? -74.606  14.958  80.340  1.00 55.38  ? 315 GLY A C   1 
ATOM   5435 O O   . GLY B 1 154 ? -73.995  14.492  81.303  1.00 55.67  ? 315 GLY A O   1 
ATOM   5436 N N   . PHE B 1 155 ? -75.906  15.251  80.382  1.00 55.29  ? 316 PHE A N   1 
ATOM   5437 C CA  . PHE B 1 155 ? -76.660  15.153  81.636  1.00 55.92  ? 316 PHE A CA  1 
ATOM   5438 C C   . PHE B 1 155 ? -78.107  14.671  81.505  1.00 56.91  ? 316 PHE A C   1 
ATOM   5439 O O   . PHE B 1 155 ? -78.922  14.907  82.402  1.00 57.43  ? 316 PHE A O   1 
ATOM   5440 C CB  . PHE B 1 155 ? -76.607  16.488  82.397  1.00 55.26  ? 316 PHE A CB  1 
ATOM   5441 C CG  . PHE B 1 155 ? -75.228  16.866  82.861  1.00 55.20  ? 316 PHE A CG  1 
ATOM   5442 C CD1 . PHE B 1 155 ? -74.684  16.296  84.008  1.00 55.31  ? 316 PHE A CD1 1 
ATOM   5443 C CD2 . PHE B 1 155 ? -74.465  17.783  82.146  1.00 55.28  ? 316 PHE A CD2 1 
ATOM   5444 C CE1 . PHE B 1 155 ? -73.409  16.636  84.435  1.00 54.69  ? 316 PHE A CE1 1 
ATOM   5445 C CE2 . PHE B 1 155 ? -73.189  18.126  82.567  1.00 55.19  ? 316 PHE A CE2 1 
ATOM   5446 C CZ  . PHE B 1 155 ? -72.660  17.552  83.713  1.00 54.57  ? 316 PHE A CZ  1 
ATOM   5447 N N   . LEU B 1 156 ? -78.424  13.982  80.410  1.00 57.76  ? 317 LEU A N   1 
ATOM   5448 C CA  . LEU B 1 156 ? -79.758  13.408  80.237  1.00 58.67  ? 317 LEU A CA  1 
ATOM   5449 C C   . LEU B 1 156 ? -79.964  12.290  81.247  1.00 60.36  ? 317 LEU A C   1 
ATOM   5450 O O   . LEU B 1 156 ? -79.111  11.412  81.390  1.00 62.37  ? 317 LEU A O   1 
ATOM   5451 C CB  . LEU B 1 156 ? -79.955  12.863  78.820  1.00 58.82  ? 317 LEU A CB  1 
ATOM   5452 C CG  . LEU B 1 156 ? -81.384  12.473  78.423  1.00 59.52  ? 317 LEU A CG  1 
ATOM   5453 C CD1 . LEU B 1 156 ? -82.122  13.661  77.821  1.00 60.15  ? 317 LEU A CD1 1 
ATOM   5454 C CD2 . LEU B 1 156 ? -81.382  11.305  77.449  1.00 59.54  ? 317 LEU A CD2 1 
ATOM   5455 N N   . PHE B 1 157 ? -81.094  12.336  81.946  1.00 61.26  ? 318 PHE A N   1 
ATOM   5456 C CA  . PHE B 1 157 ? -81.445  11.307  82.919  1.00 62.01  ? 318 PHE A CA  1 
ATOM   5457 C C   . PHE B 1 157 ? -82.851  10.774  82.664  1.00 63.05  ? 318 PHE A C   1 
ATOM   5458 O O   . PHE B 1 157 ? -83.788  11.552  82.481  1.00 64.58  ? 318 PHE A O   1 
ATOM   5459 C CB  . PHE B 1 157 ? -81.341  11.858  84.344  1.00 61.20  ? 318 PHE A CB  1 
ATOM   5460 C CG  . PHE B 1 157 ? -81.713  10.865  85.408  1.00 60.58  ? 318 PHE A CG  1 
ATOM   5461 C CD1 . PHE B 1 157 ? -80.755  10.018  85.952  1.00 60.27  ? 318 PHE A CD1 1 
ATOM   5462 C CD2 . PHE B 1 157 ? -83.022  10.775  85.866  1.00 60.06  ? 318 PHE A CD2 1 
ATOM   5463 C CE1 . PHE B 1 157 ? -81.094  9.100   86.934  1.00 59.60  ? 318 PHE A CE1 1 
ATOM   5464 C CE2 . PHE B 1 157 ? -83.367  9.855   86.841  1.00 60.52  ? 318 PHE A CE2 1 
ATOM   5465 C CZ  . PHE B 1 157 ? -82.401  9.020   87.380  1.00 59.66  ? 318 PHE A CZ  1 
ATOM   5466 N N   . LEU B 1 158 ? -82.989  9.450   82.663  1.00 63.36  ? 319 LEU A N   1 
ATOM   5467 C CA  . LEU B 1 158 ? -84.293  8.808   82.494  1.00 63.69  ? 319 LEU A CA  1 
ATOM   5468 C C   . LEU B 1 158 ? -84.555  7.670   83.481  1.00 65.93  ? 319 LEU A C   1 
ATOM   5469 O O   . LEU B 1 158 ? -85.606  7.028   83.425  1.00 67.70  ? 319 LEU A O   1 
ATOM   5470 C CB  . LEU B 1 158 ? -84.484  8.321   81.054  1.00 62.95  ? 319 LEU A CB  1 
ATOM   5471 C CG  . LEU B 1 158 ? -85.171  9.297   80.094  1.00 63.67  ? 319 LEU A CG  1 
ATOM   5472 C CD1 . LEU B 1 158 ? -85.026  8.839   78.652  1.00 63.73  ? 319 LEU A CD1 1 
ATOM   5473 C CD2 . LEU B 1 158 ? -86.641  9.484   80.445  1.00 63.89  ? 319 LEU A CD2 1 
ATOM   5474 N N   . GLY B 1 159 ? -83.608  7.430   84.386  1.00 66.87  ? 320 GLY A N   1 
ATOM   5475 C CA  . GLY B 1 159 ? -83.734  6.353   85.365  1.00 67.15  ? 320 GLY A CA  1 
ATOM   5476 C C   . GLY B 1 159 ? -83.191  5.032   84.855  1.00 69.27  ? 320 GLY A C   1 
ATOM   5477 O O   . GLY B 1 159 ? -82.746  4.197   85.642  1.00 71.09  ? 320 GLY A O   1 
ATOM   5478 N N   . THR B 1 160 ? -83.234  4.846   83.535  1.00 70.01  ? 321 THR A N   1 
ATOM   5479 C CA  . THR B 1 160 ? -82.704  3.648   82.873  1.00 70.53  ? 321 THR A CA  1 
ATOM   5480 C C   . THR B 1 160 ? -81.171  3.680   82.811  1.00 70.04  ? 321 THR A C   1 
ATOM   5481 O O   . THR B 1 160 ? -80.569  4.729   83.050  1.00 68.94  ? 321 THR A O   1 
ATOM   5482 C CB  . THR B 1 160 ? -83.274  3.488   81.444  1.00 71.10  ? 321 THR A CB  1 
ATOM   5483 O OG1 . THR B 1 160 ? -83.093  4.705   80.709  1.00 72.72  ? 321 THR A OG1 1 
ATOM   5484 C CG2 . THR B 1 160 ? -84.752  3.129   81.484  1.00 71.07  ? 321 THR A CG2 1 
ATOM   5485 N N   . PRO B 1 161 ? -80.532  2.532   82.496  1.00 70.24  ? 322 PRO A N   1 
ATOM   5486 C CA  . PRO B 1 161 ? -79.072  2.525   82.412  1.00 71.16  ? 322 PRO A CA  1 
ATOM   5487 C C   . PRO B 1 161 ? -78.543  3.062   81.077  1.00 72.00  ? 322 PRO A C   1 
ATOM   5488 O O   . PRO B 1 161 ? -77.368  3.429   80.985  1.00 72.23  ? 322 PRO A O   1 
ATOM   5489 C CB  . PRO B 1 161 ? -78.721  1.046   82.583  1.00 70.95  ? 322 PRO A CB  1 
ATOM   5490 C CG  . PRO B 1 161 ? -79.904  0.312   82.052  1.00 71.11  ? 322 PRO A CG  1 
ATOM   5491 C CD  . PRO B 1 161 ? -81.106  1.200   82.217  1.00 70.58  ? 322 PRO A CD  1 
ATOM   5492 N N   . GLU B 1 162 ? -79.404  3.112   80.061  1.00 72.72  ? 323 GLU A N   1 
ATOM   5493 C CA  . GLU B 1 162 ? -79.028  3.654   78.754  1.00 73.66  ? 323 GLU A CA  1 
ATOM   5494 C C   . GLU B 1 162 ? -79.031  5.184   78.768  1.00 72.32  ? 323 GLU A C   1 
ATOM   5495 O O   . GLU B 1 162 ? -78.542  5.825   77.831  1.00 72.79  ? 323 GLU A O   1 
ATOM   5496 C CB  . GLU B 1 162 ? -79.935  3.105   77.649  1.00 76.72  ? 323 GLU A CB  1 
ATOM   5497 C CG  . GLU B 1 162 ? -79.832  1.595   77.468  1.00 80.97  ? 323 GLU A CG  1 
ATOM   5498 C CD  . GLU B 1 162 ? -80.259  1.117   76.089  1.00 83.90  ? 323 GLU A CD  1 
ATOM   5499 O OE1 . GLU B 1 162 ? -81.157  1.738   75.476  1.00 86.30  ? 323 GLU A OE1 1 
ATOM   5500 O OE2 . GLU B 1 162 ? -79.693  0.107   75.618  1.00 83.76  ? 323 GLU A OE2 1 
ATOM   5501 N N   . ALA B 1 163 ? -79.599  5.747   79.836  1.00 69.25  ? 324 ALA A N   1 
ATOM   5502 C CA  . ALA B 1 163 ? -79.500  7.170   80.160  1.00 65.84  ? 324 ALA A CA  1 
ATOM   5503 C C   . ALA B 1 163 ? -79.468  7.328   81.685  1.00 63.97  ? 324 ALA A C   1 
ATOM   5504 O O   . ALA B 1 163 ? -80.488  7.658   82.298  1.00 64.29  ? 324 ALA A O   1 
ATOM   5505 C CB  . ALA B 1 163 ? -80.662  7.945   79.557  1.00 64.66  ? 324 ALA A CB  1 
ATOM   5506 N N   . PRO B 1 164 ? -78.296  7.081   82.306  1.00 61.95  ? 325 PRO A N   1 
ATOM   5507 C CA  . PRO B 1 164 ? -78.187  7.047   83.764  1.00 61.39  ? 325 PRO A CA  1 
ATOM   5508 C C   . PRO B 1 164 ? -77.840  8.392   84.407  1.00 61.71  ? 325 PRO A C   1 
ATOM   5509 O O   . PRO B 1 164 ? -77.750  8.480   85.635  1.00 61.28  ? 325 PRO A O   1 
ATOM   5510 C CB  . PRO B 1 164 ? -77.050  6.051   83.990  1.00 60.83  ? 325 PRO A CB  1 
ATOM   5511 C CG  . PRO B 1 164 ? -76.183  6.187   82.779  1.00 60.88  ? 325 PRO A CG  1 
ATOM   5512 C CD  . PRO B 1 164 ? -77.002  6.786   81.664  1.00 61.04  ? 325 PRO A CD  1 
ATOM   5513 N N   . GLY B 1 165 ? -77.643  9.419   83.582  1.00 61.93  ? 326 GLY A N   1 
ATOM   5514 C CA  . GLY B 1 165 ? -77.306  10.757  84.063  1.00 60.81  ? 326 GLY A CA  1 
ATOM   5515 C C   . GLY B 1 165 ? -75.850  10.926  84.457  1.00 60.30  ? 326 GLY A C   1 
ATOM   5516 O O   . GLY B 1 165 ? -75.109  9.946   84.597  1.00 60.83  ? 326 GLY A O   1 
ATOM   5517 N N   . ASN B 1 166 ? -75.448  12.185  84.627  1.00 58.63  ? 327 ASN A N   1 
ATOM   5518 C CA  . ASN B 1 166 ? -74.104  12.558  85.085  1.00 56.95  ? 327 ASN A CA  1 
ATOM   5519 C C   . ASN B 1 166 ? -72.951  12.143  84.166  1.00 55.81  ? 327 ASN A C   1 
ATOM   5520 O O   . ASN B 1 166 ? -71.798  12.072  84.602  1.00 55.01  ? 327 ASN A O   1 
ATOM   5521 C CB  . ASN B 1 166 ? -73.857  12.070  86.521  1.00 57.07  ? 327 ASN A CB  1 
ATOM   5522 C CG  . ASN B 1 166 ? -74.728  12.781  87.540  1.00 57.32  ? 327 ASN A CG  1 
ATOM   5523 O OD1 . ASN B 1 166 ? -75.745  13.385  87.199  1.00 57.69  ? 327 ASN A OD1 1 
ATOM   5524 N ND2 . ASN B 1 166 ? -74.330  12.709  88.803  1.00 57.77  ? 327 ASN A ND2 1 
ATOM   5525 N N   . ALA B 1 167 ? -73.263  11.894  82.895  1.00 54.87  ? 328 ALA A N   1 
ATOM   5526 C CA  . ALA B 1 167 ? -72.246  11.541  81.904  1.00 54.91  ? 328 ALA A CA  1 
ATOM   5527 C C   . ALA B 1 167 ? -71.085  12.542  81.916  1.00 54.49  ? 328 ALA A C   1 
ATOM   5528 O O   . ALA B 1 167 ? -69.919  12.149  81.974  1.00 54.40  ? 328 ALA A O   1 
ATOM   5529 C CB  . ALA B 1 167 ? -72.862  11.434  80.515  1.00 54.34  ? 328 ALA A CB  1 
ATOM   5530 N N   . GLY B 1 168 ? -71.419  13.830  81.894  1.00 54.09  ? 329 GLY A N   1 
ATOM   5531 C CA  . GLY B 1 168 ? -70.427  14.901  81.933  1.00 53.97  ? 329 GLY A CA  1 
ATOM   5532 C C   . GLY B 1 168 ? -69.523  14.862  83.151  1.00 53.84  ? 329 GLY A C   1 
ATOM   5533 O O   . GLY B 1 168 ? -68.351  15.232  83.069  1.00 54.41  ? 329 GLY A O   1 
ATOM   5534 N N   . LEU B 1 169 ? -70.068  14.418  84.281  1.00 53.76  ? 330 LEU A N   1 
ATOM   5535 C CA  . LEU B 1 169 ? -69.296  14.295  85.517  1.00 54.99  ? 330 LEU A CA  1 
ATOM   5536 C C   . LEU B 1 169 ? -68.337  13.104  85.469  1.00 55.66  ? 330 LEU A C   1 
ATOM   5537 O O   . LEU B 1 169 ? -67.200  13.187  85.943  1.00 54.34  ? 330 LEU A O   1 
ATOM   5538 C CB  . LEU B 1 169 ? -70.231  14.204  86.729  1.00 54.80  ? 330 LEU A CB  1 
ATOM   5539 C CG  . LEU B 1 169 ? -70.531  15.468  87.550  1.00 54.67  ? 330 LEU A CG  1 
ATOM   5540 C CD1 . LEU B 1 169 ? -70.566  16.742  86.717  1.00 54.75  ? 330 LEU A CD1 1 
ATOM   5541 C CD2 . LEU B 1 169 ? -71.832  15.303  88.321  1.00 54.89  ? 330 LEU A CD2 1 
ATOM   5542 N N   . PHE B 1 170 ? -68.801  12.003  84.883  1.00 56.37  ? 331 PHE A N   1 
ATOM   5543 C CA  . PHE B 1 170 ? -67.962  10.828  84.686  1.00 57.04  ? 331 PHE A CA  1 
ATOM   5544 C C   . PHE B 1 170 ? -66.898  11.088  83.625  1.00 57.71  ? 331 PHE A C   1 
ATOM   5545 O O   . PHE B 1 170 ? -65.833  10.468  83.646  1.00 60.49  ? 331 PHE A O   1 
ATOM   5546 C CB  . PHE B 1 170 ? -68.812  9.606   84.333  1.00 57.44  ? 331 PHE A CB  1 
ATOM   5547 C CG  . PHE B 1 170 ? -69.468  8.965   85.522  1.00 58.38  ? 331 PHE A CG  1 
ATOM   5548 C CD1 . PHE B 1 170 ? -68.871  7.885   86.161  1.00 58.87  ? 331 PHE A CD1 1 
ATOM   5549 C CD2 . PHE B 1 170 ? -70.675  9.450   86.016  1.00 58.73  ? 331 PHE A CD2 1 
ATOM   5550 C CE1 . PHE B 1 170 ? -69.471  7.294   87.262  1.00 58.65  ? 331 PHE A CE1 1 
ATOM   5551 C CE2 . PHE B 1 170 ? -71.276  8.865   87.120  1.00 58.53  ? 331 PHE A CE2 1 
ATOM   5552 C CZ  . PHE B 1 170 ? -70.673  7.786   87.745  1.00 58.32  ? 331 PHE A CZ  1 
ATOM   5553 N N   . ASP B 1 171 ? -67.194  12.006  82.705  1.00 56.66  ? 332 ASP A N   1 
ATOM   5554 C CA  . ASP B 1 171 ? -66.203  12.503  81.754  1.00 55.36  ? 332 ASP A CA  1 
ATOM   5555 C C   . ASP B 1 171 ? -65.077  13.197  82.517  1.00 55.23  ? 332 ASP A C   1 
ATOM   5556 O O   . ASP B 1 171 ? -63.899  12.920  82.286  1.00 55.27  ? 332 ASP A O   1 
ATOM   5557 C CB  . ASP B 1 171 ? -66.839  13.475  80.749  1.00 54.80  ? 332 ASP A CB  1 
ATOM   5558 C CG  . ASP B 1 171 ? -67.732  12.780  79.728  1.00 54.57  ? 332 ASP A CG  1 
ATOM   5559 O OD1 . ASP B 1 171 ? -67.826  11.538  79.740  1.00 55.16  ? 332 ASP A OD1 1 
ATOM   5560 O OD2 . ASP B 1 171 ? -68.345  13.484  78.901  1.00 53.79  ? 332 ASP A OD2 1 
ATOM   5561 N N   . GLN B 1 172 ? -65.452  14.085  83.438  1.00 55.12  ? 333 GLN A N   1 
ATOM   5562 C CA  . GLN B 1 172 ? -64.492  14.800  84.276  1.00 55.42  ? 333 GLN A CA  1 
ATOM   5563 C C   . GLN B 1 172 ? -63.695  13.820  85.125  1.00 56.43  ? 333 GLN A C   1 
ATOM   5564 O O   . GLN B 1 172 ? -62.470  13.925  85.226  1.00 55.63  ? 333 GLN A O   1 
ATOM   5565 C CB  . GLN B 1 172 ? -65.205  15.796  85.192  1.00 54.18  ? 333 GLN A CB  1 
ATOM   5566 C CG  . GLN B 1 172 ? -65.873  16.959  84.483  1.00 52.52  ? 333 GLN A CG  1 
ATOM   5567 C CD  . GLN B 1 172 ? -66.611  17.868  85.443  1.00 51.89  ? 333 GLN A CD  1 
ATOM   5568 O OE1 . GLN B 1 172 ? -66.347  17.867  86.643  1.00 51.66  ? 333 GLN A OE1 1 
ATOM   5569 N NE2 . GLN B 1 172 ? -67.542  18.652  84.916  1.00 52.10  ? 333 GLN A NE2 1 
ATOM   5570 N N   . ASN B 1 173 ? -64.410  12.870  85.726  1.00 57.78  ? 334 ASN A N   1 
ATOM   5571 C CA  . ASN B 1 173 ? -63.813  11.851  86.582  1.00 58.71  ? 334 ASN A CA  1 
ATOM   5572 C C   . ASN B 1 173 ? -62.754  11.030  85.855  1.00 58.24  ? 334 ASN A C   1 
ATOM   5573 O O   . ASN B 1 173 ? -61.641  10.859  86.361  1.00 58.27  ? 334 ASN A O   1 
ATOM   5574 C CB  . ASN B 1 173 ? -64.896  10.933  87.153  1.00 59.52  ? 334 ASN A CB  1 
ATOM   5575 C CG  . ASN B 1 173 ? -64.319  9.728   87.870  1.00 59.74  ? 334 ASN A CG  1 
ATOM   5576 O OD1 . ASN B 1 173 ? -63.756  9.845   88.958  1.00 59.24  ? 334 ASN A OD1 1 
ATOM   5577 N ND2 . ASN B 1 173 ? -64.459  8.558   87.257  1.00 60.30  ? 334 ASN A ND2 1 
ATOM   5578 N N   . LEU B 1 174 ? -63.110  10.531  84.671  1.00 56.92  ? 335 LEU A N   1 
ATOM   5579 C CA  . LEU B 1 174 ? -62.186  9.761   83.845  1.00 56.78  ? 335 LEU A CA  1 
ATOM   5580 C C   . LEU B 1 174 ? -60.957  10.593  83.491  1.00 57.32  ? 335 LEU A C   1 
ATOM   5581 O O   . LEU B 1 174 ? -59.834  10.084  83.505  1.00 58.07  ? 335 LEU A O   1 
ATOM   5582 C CB  . LEU B 1 174 ? -62.877  9.241   82.579  1.00 56.12  ? 335 LEU A CB  1 
ATOM   5583 C CG  . LEU B 1 174 ? -62.039  8.414   81.592  1.00 56.55  ? 335 LEU A CG  1 
ATOM   5584 C CD1 . LEU B 1 174 ? -61.420  7.183   82.246  1.00 57.29  ? 335 LEU A CD1 1 
ATOM   5585 C CD2 . LEU B 1 174 ? -62.869  8.015   80.384  1.00 55.96  ? 335 LEU A CD2 1 
ATOM   5586 N N   . ALA B 1 175 ? -61.181  11.871  83.194  1.00 57.66  ? 336 ALA A N   1 
ATOM   5587 C CA  . ALA B 1 175 ? -60.102  12.803  82.879  1.00 58.08  ? 336 ALA A CA  1 
ATOM   5588 C C   . ALA B 1 175 ? -59.171  13.026  84.071  1.00 58.69  ? 336 ALA A C   1 
ATOM   5589 O O   . ALA B 1 175 ? -57.968  13.228  83.890  1.00 57.82  ? 336 ALA A O   1 
ATOM   5590 C CB  . ALA B 1 175 ? -60.668  14.124  82.382  1.00 58.13  ? 336 ALA A CB  1 
ATOM   5591 N N   . LEU B 1 176 ? -59.728  12.985  85.281  1.00 60.37  ? 337 LEU A N   1 
ATOM   5592 C CA  . LEU B 1 176 ? -58.929  13.091  86.503  1.00 62.75  ? 337 LEU A CA  1 
ATOM   5593 C C   . LEU B 1 176 ? -58.046  11.861  86.684  1.00 64.57  ? 337 LEU A C   1 
ATOM   5594 O O   . LEU B 1 176 ? -56.880  11.980  87.074  1.00 64.49  ? 337 LEU A O   1 
ATOM   5595 C CB  . LEU B 1 176 ? -59.812  13.293  87.742  1.00 62.58  ? 337 LEU A CB  1 
ATOM   5596 C CG  . LEU B 1 176 ? -60.618  14.584  87.921  1.00 62.40  ? 337 LEU A CG  1 
ATOM   5597 C CD1 . LEU B 1 176 ? -61.224  14.635  89.314  1.00 62.07  ? 337 LEU A CD1 1 
ATOM   5598 C CD2 . LEU B 1 176 ? -59.770  15.818  87.675  1.00 62.03  ? 337 LEU A CD2 1 
ATOM   5599 N N   . ARG B 1 177 ? -58.609  10.686  86.396  1.00 65.80  ? 338 ARG A N   1 
ATOM   5600 C CA  . ARG B 1 177 ? -57.864  9.428   86.456  1.00 66.67  ? 338 ARG A CA  1 
ATOM   5601 C C   . ARG B 1 177 ? -56.731  9.398   85.440  1.00 66.31  ? 338 ARG A C   1 
ATOM   5602 O O   . ARG B 1 177 ? -55.680  8.815   85.702  1.00 68.37  ? 338 ARG A O   1 
ATOM   5603 C CB  . ARG B 1 177 ? -58.787  8.226   86.258  1.00 68.88  ? 338 ARG A CB  1 
ATOM   5604 C CG  . ARG B 1 177 ? -59.381  7.691   87.552  1.00 72.56  ? 338 ARG A CG  1 
ATOM   5605 C CD  . ARG B 1 177 ? -60.277  6.484   87.322  1.00 75.46  ? 338 ARG A CD  1 
ATOM   5606 N NE  . ARG B 1 177 ? -61.372  6.784   86.401  1.00 77.75  ? 338 ARG A NE  1 
ATOM   5607 C CZ  . ARG B 1 177 ? -62.427  6.000   86.196  1.00 78.67  ? 338 ARG A CZ  1 
ATOM   5608 N NH1 . ARG B 1 177 ? -62.553  4.855   86.857  1.00 79.96  ? 338 ARG A NH1 1 
ATOM   5609 N NH2 . ARG B 1 177 ? -63.364  6.369   85.331  1.00 77.49  ? 338 ARG A NH2 1 
ATOM   5610 N N   . TRP B 1 178 ? -56.950  10.027  84.287  1.00 64.74  ? 339 TRP A N   1 
ATOM   5611 C CA  . TRP B 1 178 ? -55.903  10.174  83.285  1.00 63.08  ? 339 TRP A CA  1 
ATOM   5612 C C   . TRP B 1 178 ? -54.751  11.000  83.846  1.00 64.19  ? 339 TRP A C   1 
ATOM   5613 O O   . TRP B 1 178 ? -53.589  10.609  83.723  1.00 65.86  ? 339 TRP A O   1 
ATOM   5614 C CB  . TRP B 1 178 ? -56.442  10.823  82.008  1.00 61.49  ? 339 TRP A CB  1 
ATOM   5615 C CG  . TRP B 1 178 ? -55.429  10.868  80.903  1.00 60.10  ? 339 TRP A CG  1 
ATOM   5616 C CD1 . TRP B 1 178 ? -55.248  9.936   79.926  1.00 60.00  ? 339 TRP A CD1 1 
ATOM   5617 C CD2 . TRP B 1 178 ? -54.445  11.887  80.673  1.00 59.44  ? 339 TRP A CD2 1 
ATOM   5618 N NE1 . TRP B 1 178 ? -54.218  10.310  79.098  1.00 59.90  ? 339 TRP A NE1 1 
ATOM   5619 C CE2 . TRP B 1 178 ? -53.707  11.504  79.533  1.00 59.21  ? 339 TRP A CE2 1 
ATOM   5620 C CE3 . TRP B 1 178 ? -54.118  13.088  81.317  1.00 59.71  ? 339 TRP A CE3 1 
ATOM   5621 C CZ2 . TRP B 1 178 ? -52.662  12.278  79.020  1.00 59.15  ? 339 TRP A CZ2 1 
ATOM   5622 C CZ3 . TRP B 1 178 ? -53.077  13.856  80.808  1.00 60.26  ? 339 TRP A CZ3 1 
ATOM   5623 C CH2 . TRP B 1 178 ? -52.363  13.447  79.669  1.00 59.94  ? 339 TRP A CH2 1 
ATOM   5624 N N   . VAL B 1 179 ? -55.082  12.135  84.461  1.00 64.70  ? 340 VAL A N   1 
ATOM   5625 C CA  . VAL B 1 179 ? -54.082  13.029  85.053  1.00 66.45  ? 340 VAL A CA  1 
ATOM   5626 C C   . VAL B 1 179 ? -53.272  12.297  86.126  1.00 68.23  ? 340 VAL A C   1 
ATOM   5627 O O   . VAL B 1 179 ? -52.048  12.420  86.178  1.00 68.77  ? 340 VAL A O   1 
ATOM   5628 C CB  . VAL B 1 179 ? -54.728  14.326  85.603  1.00 65.78  ? 340 VAL A CB  1 
ATOM   5629 C CG1 . VAL B 1 179 ? -53.729  15.157  86.397  1.00 64.73  ? 340 VAL A CG1 1 
ATOM   5630 C CG2 . VAL B 1 179 ? -55.300  15.153  84.462  1.00 65.11  ? 340 VAL A CG2 1 
ATOM   5631 N N   . ARG B 1 180 ? -53.962  11.515  86.953  1.00 69.93  ? 341 ARG A N   1 
ATOM   5632 C CA  . ARG B 1 180 ? -53.329  10.672  87.965  1.00 71.65  ? 341 ARG A CA  1 
ATOM   5633 C C   . ARG B 1 180 ? -52.273  9.754   87.348  1.00 70.28  ? 341 ARG A C   1 
ATOM   5634 O O   . ARG B 1 180 ? -51.155  9.654   87.855  1.00 70.80  ? 341 ARG A O   1 
ATOM   5635 C CB  . ARG B 1 180 ? -54.396  9.830   88.674  1.00 74.95  ? 341 ARG A CB  1 
ATOM   5636 C CG  . ARG B 1 180 ? -53.953  9.161   89.967  1.00 78.70  ? 341 ARG A CG  1 
ATOM   5637 C CD  . ARG B 1 180 ? -54.242  10.038  91.176  1.00 81.71  ? 341 ARG A CD  1 
ATOM   5638 N NE  . ARG B 1 180 ? -54.546  9.234   92.359  1.00 85.90  ? 341 ARG A NE  1 
ATOM   5639 C CZ  . ARG B 1 180 ? -53.669  8.911   93.306  1.00 88.07  ? 341 ARG A CZ  1 
ATOM   5640 N NH1 . ARG B 1 180 ? -52.409  9.326   93.232  1.00 89.72  ? 341 ARG A NH1 1 
ATOM   5641 N NH2 . ARG B 1 180 ? -54.055  8.171   94.337  1.00 88.67  ? 341 ARG A NH2 1 
ATOM   5642 N N   . ASP B 1 181 ? -52.635  9.107   86.242  1.00 69.41  ? 342 ASP A N   1 
ATOM   5643 C CA  . ASP B 1 181 ? -51.801  8.086   85.610  1.00 69.23  ? 342 ASP A CA  1 
ATOM   5644 C C   . ASP B 1 181 ? -50.702  8.631   84.699  1.00 70.03  ? 342 ASP A C   1 
ATOM   5645 O O   . ASP B 1 181 ? -49.780  7.896   84.344  1.00 71.96  ? 342 ASP A O   1 
ATOM   5646 C CB  . ASP B 1 181 ? -52.675  7.107   84.814  1.00 69.56  ? 342 ASP A CB  1 
ATOM   5647 C CG  . ASP B 1 181 ? -53.623  6.302   85.696  1.00 71.30  ? 342 ASP A CG  1 
ATOM   5648 O OD1 . ASP B 1 181 ? -53.672  6.545   86.923  1.00 71.57  ? 342 ASP A OD1 1 
ATOM   5649 O OD2 . ASP B 1 181 ? -54.327  5.422   85.156  1.00 71.62  ? 342 ASP A OD2 1 
ATOM   5650 N N   . ASN B 1 182 ? -50.789  9.907   84.323  1.00 70.12  ? 343 ASN A N   1 
ATOM   5651 C CA  . ASN B 1 182 ? -49.935  10.438  83.255  1.00 69.85  ? 343 ASN A CA  1 
ATOM   5652 C C   . ASN B 1 182 ? -49.199  11.749  83.514  1.00 71.00  ? 343 ASN A C   1 
ATOM   5653 O O   . ASN B 1 182 ? -48.211  12.041  82.837  1.00 70.80  ? 343 ASN A O   1 
ATOM   5654 C CB  . ASN B 1 182 ? -50.738  10.562  81.960  1.00 69.10  ? 343 ASN A CB  1 
ATOM   5655 C CG  . ASN B 1 182 ? -51.146  9.218   81.403  1.00 70.50  ? 343 ASN A CG  1 
ATOM   5656 O OD1 . ASN B 1 182 ? -50.317  8.474   80.879  1.00 71.68  ? 343 ASN A OD1 1 
ATOM   5657 N ND2 . ASN B 1 182 ? -52.429  8.896   81.518  1.00 71.37  ? 343 ASN A ND2 1 
ATOM   5658 N N   . ILE B 1 183 ? -49.670  12.534  84.480  1.00 72.18  ? 344 ILE A N   1 
ATOM   5659 C CA  . ILE B 1 183 ? -49.173  13.903  84.657  1.00 73.42  ? 344 ILE A CA  1 
ATOM   5660 C C   . ILE B 1 183 ? -47.702  14.006  85.088  1.00 75.45  ? 344 ILE A C   1 
ATOM   5661 O O   . ILE B 1 183 ? -47.083  15.060  84.926  1.00 75.87  ? 344 ILE A O   1 
ATOM   5662 C CB  . ILE B 1 183 ? -50.096  14.747  85.576  1.00 72.97  ? 344 ILE A CB  1 
ATOM   5663 C CG1 . ILE B 1 183 ? -50.022  16.236  85.213  1.00 73.41  ? 344 ILE A CG1 1 
ATOM   5664 C CG2 . ILE B 1 183 ? -49.786  14.509  87.048  1.00 73.71  ? 344 ILE A CG2 1 
ATOM   5665 C CD1 . ILE B 1 183 ? -50.564  16.571  83.839  1.00 73.78  ? 344 ILE A CD1 1 
ATOM   5666 N N   . HIS B 1 184 ? -47.145  12.917  85.617  1.00 78.13  ? 345 HIS A N   1 
ATOM   5667 C CA  . HIS B 1 184 ? -45.734  12.901  86.009  1.00 81.13  ? 345 HIS A CA  1 
ATOM   5668 C C   . HIS B 1 184 ? -44.795  12.976  84.804  1.00 79.20  ? 345 HIS A C   1 
ATOM   5669 O O   . HIS B 1 184 ? -43.704  13.547  84.894  1.00 79.18  ? 345 HIS A O   1 
ATOM   5670 C CB  . HIS B 1 184 ? -45.403  11.681  86.875  1.00 85.49  ? 345 HIS A CB  1 
ATOM   5671 C CG  . HIS B 1 184 ? -44.042  11.741  87.501  1.00 91.99  ? 345 HIS A CG  1 
ATOM   5672 N ND1 . HIS B 1 184 ? -43.671  12.734  88.384  1.00 93.97  ? 345 HIS A ND1 1 
ATOM   5673 C CD2 . HIS B 1 184 ? -42.960  10.936  87.367  1.00 93.85  ? 345 HIS A CD2 1 
ATOM   5674 C CE1 . HIS B 1 184 ? -42.422  12.538  88.767  1.00 95.25  ? 345 HIS A CE1 1 
ATOM   5675 N NE2 . HIS B 1 184 ? -41.968  11.453  88.165  1.00 95.63  ? 345 HIS A NE2 1 
ATOM   5676 N N   . ARG B 1 185 ? -45.232  12.414  83.679  1.00 76.66  ? 346 ARG A N   1 
ATOM   5677 C CA  . ARG B 1 185 ? -44.453  12.422  82.440  1.00 74.31  ? 346 ARG A CA  1 
ATOM   5678 C C   . ARG B 1 185 ? -44.348  13.825  81.840  1.00 72.54  ? 346 ARG A C   1 
ATOM   5679 O O   . ARG B 1 185 ? -43.437  14.105  81.061  1.00 71.67  ? 346 ARG A O   1 
ATOM   5680 C CB  . ARG B 1 185 ? -45.056  11.461  81.415  1.00 75.19  ? 346 ARG A CB  1 
ATOM   5681 C CG  . ARG B 1 185 ? -45.536  10.135  81.982  1.00 77.00  ? 346 ARG A CG  1 
ATOM   5682 C CD  . ARG B 1 185 ? -45.997  9.217   80.865  1.00 79.00  ? 346 ARG A CD  1 
ATOM   5683 N NE  . ARG B 1 185 ? -47.107  8.355   81.269  1.00 79.96  ? 346 ARG A NE  1 
ATOM   5684 C CZ  . ARG B 1 185 ? -46.974  7.147   81.809  1.00 79.94  ? 346 ARG A CZ  1 
ATOM   5685 N NH1 . ARG B 1 185 ? -45.769  6.634   82.027  1.00 81.29  ? 346 ARG A NH1 1 
ATOM   5686 N NH2 . ARG B 1 185 ? -48.054  6.450   82.136  1.00 79.89  ? 346 ARG A NH2 1 
ATOM   5687 N N   . PHE B 1 186 ? -45.291  14.693  82.203  1.00 71.58  ? 347 PHE A N   1 
ATOM   5688 C CA  . PHE B 1 186 ? -45.281  16.096  81.788  1.00 69.74  ? 347 PHE A CA  1 
ATOM   5689 C C   . PHE B 1 186 ? -44.601  16.971  82.842  1.00 69.98  ? 347 PHE A C   1 
ATOM   5690 O O   . PHE B 1 186 ? -44.441  18.178  82.650  1.00 69.66  ? 347 PHE A O   1 
ATOM   5691 C CB  . PHE B 1 186 ? -46.706  16.598  81.539  1.00 68.27  ? 347 PHE A CB  1 
ATOM   5692 C CG  . PHE B 1 186 ? -47.455  15.825  80.491  1.00 67.93  ? 347 PHE A CG  1 
ATOM   5693 C CD1 . PHE B 1 186 ? -48.193  14.696  80.834  1.00 67.95  ? 347 PHE A CD1 1 
ATOM   5694 C CD2 . PHE B 1 186 ? -47.440  16.235  79.162  1.00 68.31  ? 347 PHE A CD2 1 
ATOM   5695 C CE1 . PHE B 1 186 ? -48.891  13.983  79.871  1.00 67.41  ? 347 PHE A CE1 1 
ATOM   5696 C CE2 . PHE B 1 186 ? -48.139  15.526  78.194  1.00 68.42  ? 347 PHE A CE2 1 
ATOM   5697 C CZ  . PHE B 1 186 ? -48.866  14.400  78.550  1.00 67.55  ? 347 PHE A CZ  1 
ATOM   5698 N N   . GLY B 1 187 ? -44.214  16.354  83.957  1.00 70.15  ? 348 GLY A N   1 
ATOM   5699 C CA  . GLY B 1 187 ? -43.497  17.048  85.023  1.00 71.53  ? 348 GLY A CA  1 
ATOM   5700 C C   . GLY B 1 187 ? -44.376  17.521  86.164  1.00 72.39  ? 348 GLY A C   1 
ATOM   5701 O O   . GLY B 1 187 ? -44.025  18.466  86.875  1.00 72.43  ? 348 GLY A O   1 
ATOM   5702 N N   . GLY B 1 188 ? -45.518  16.861  86.341  1.00 72.94  ? 349 GLY A N   1 
ATOM   5703 C CA  . GLY B 1 188 ? -46.440  17.185  87.425  1.00 74.05  ? 349 GLY A CA  1 
ATOM   5704 C C   . GLY B 1 188 ? -46.383  16.186  88.567  1.00 74.46  ? 349 GLY A C   1 
ATOM   5705 O O   . GLY B 1 188 ? -45.746  15.137  88.457  1.00 76.20  ? 349 GLY A O   1 
ATOM   5706 N N   . ASP B 1 189 ? -47.047  16.522  89.669  1.00 73.07  ? 350 ASP A N   1 
ATOM   5707 C CA  . ASP B 1 189 ? -47.132  15.639  90.823  1.00 71.18  ? 350 ASP A CA  1 
ATOM   5708 C C   . ASP B 1 189 ? -48.551  15.101  90.964  1.00 71.82  ? 350 ASP A C   1 
ATOM   5709 O O   . ASP B 1 189 ? -49.458  15.849  91.336  1.00 72.13  ? 350 ASP A O   1 
ATOM   5710 C CB  . ASP B 1 189 ? -46.727  16.380  92.096  1.00 71.45  ? 350 ASP A CB  1 
ATOM   5711 C CG  . ASP B 1 189 ? -46.543  15.452  93.283  1.00 72.46  ? 350 ASP A CG  1 
ATOM   5712 O OD1 . ASP B 1 189 ? -46.999  14.290  93.226  1.00 72.71  ? 350 ASP A OD1 1 
ATOM   5713 O OD2 . ASP B 1 189 ? -45.935  15.887  94.281  1.00 73.45  ? 350 ASP A OD2 1 
ATOM   5714 N N   . PRO B 1 190 ? -48.748  13.798  90.679  1.00 72.90  ? 351 PRO A N   1 
ATOM   5715 C CA  . PRO B 1 190 ? -50.076  13.169  90.729  1.00 74.18  ? 351 PRO A CA  1 
ATOM   5716 C C   . PRO B 1 190 ? -50.760  13.259  92.100  1.00 74.87  ? 351 PRO A C   1 
ATOM   5717 O O   . PRO B 1 190 ? -51.938  12.907  92.223  1.00 75.83  ? 351 PRO A O   1 
ATOM   5718 C CB  . PRO B 1 190 ? -49.786  11.705  90.372  1.00 73.56  ? 351 PRO A CB  1 
ATOM   5719 C CG  . PRO B 1 190 ? -48.514  11.749  89.598  1.00 73.03  ? 351 PRO A CG  1 
ATOM   5720 C CD  . PRO B 1 190 ? -47.713  12.846  90.237  1.00 73.10  ? 351 PRO A CD  1 
ATOM   5721 N N   . SER B 1 191 ? -50.025  13.729  93.107  1.00 74.02  ? 352 SER A N   1 
ATOM   5722 C CA  . SER B 1 191 ? -50.560  13.892  94.456  1.00 73.85  ? 352 SER A CA  1 
ATOM   5723 C C   . SER B 1 191 ? -50.834  15.359  94.800  1.00 74.01  ? 352 SER A C   1 
ATOM   5724 O O   . SER B 1 191 ? -51.441  15.652  95.832  1.00 75.87  ? 352 SER A O   1 
ATOM   5725 C CB  . SER B 1 191 ? -49.613  13.274  95.488  1.00 73.16  ? 352 SER A CB  1 
ATOM   5726 O OG  . SER B 1 191 ? -48.510  14.126  95.743  1.00 74.10  ? 352 SER A OG  1 
ATOM   5727 N N   . ARG B 1 192 ? -50.384  16.271  93.939  1.00 72.67  ? 353 ARG A N   1 
ATOM   5728 C CA  . ARG B 1 192 ? -50.583  17.709  94.152  1.00 70.93  ? 353 ARG A CA  1 
ATOM   5729 C C   . ARG B 1 192 ? -51.465  18.350  93.073  1.00 69.59  ? 353 ARG A C   1 
ATOM   5730 O O   . ARG B 1 192 ? -51.182  19.454  92.591  1.00 68.77  ? 353 ARG A O   1 
ATOM   5731 C CB  . ARG B 1 192 ? -49.237  18.430  94.248  1.00 70.92  ? 353 ARG A CB  1 
ATOM   5732 C CG  . ARG B 1 192 ? -48.405  18.034  95.454  1.00 72.08  ? 353 ARG A CG  1 
ATOM   5733 C CD  . ARG B 1 192 ? -47.031  18.675  95.388  1.00 72.32  ? 353 ARG A CD  1 
ATOM   5734 N NE  . ARG B 1 192 ? -47.070  20.098  95.710  1.00 72.46  ? 353 ARG A NE  1 
ATOM   5735 C CZ  . ARG B 1 192 ? -46.182  20.987  95.279  1.00 73.08  ? 353 ARG A CZ  1 
ATOM   5736 N NH1 . ARG B 1 192 ? -45.183  20.609  94.490  1.00 74.17  ? 353 ARG A NH1 1 
ATOM   5737 N NH2 . ARG B 1 192 ? -46.296  22.261  95.628  1.00 72.18  ? 353 ARG A NH2 1 
ATOM   5738 N N   . VAL B 1 193 ? -52.537  17.651  92.709  1.00 67.31  ? 354 VAL A N   1 
ATOM   5739 C CA  . VAL B 1 193 ? -53.498  18.147  91.730  1.00 64.68  ? 354 VAL A CA  1 
ATOM   5740 C C   . VAL B 1 193 ? -54.537  19.028  92.422  1.00 63.38  ? 354 VAL A C   1 
ATOM   5741 O O   . VAL B 1 193 ? -55.264  18.567  93.305  1.00 63.64  ? 354 VAL A O   1 
ATOM   5742 C CB  . VAL B 1 193 ? -54.195  16.986  90.984  1.00 64.49  ? 354 VAL A CB  1 
ATOM   5743 C CG1 . VAL B 1 193 ? -55.282  17.508  90.054  1.00 63.86  ? 354 VAL A CG1 1 
ATOM   5744 C CG2 . VAL B 1 193 ? -53.178  16.169  90.203  1.00 65.26  ? 354 VAL A CG2 1 
ATOM   5745 N N   . THR B 1 194 ? -54.588  20.297  92.019  1.00 61.42  ? 355 THR A N   1 
ATOM   5746 C CA  . THR B 1 194 ? -55.573  21.247  92.535  1.00 60.11  ? 355 THR A CA  1 
ATOM   5747 C C   . THR B 1 194 ? -56.639  21.538  91.484  1.00 59.57  ? 355 THR A C   1 
ATOM   5748 O O   . THR B 1 194 ? -56.342  22.091  90.421  1.00 59.84  ? 355 THR A O   1 
ATOM   5749 C CB  . THR B 1 194 ? -54.911  22.568  92.977  1.00 59.65  ? 355 THR A CB  1 
ATOM   5750 O OG1 . THR B 1 194 ? -53.946  22.299  94.000  1.00 59.97  ? 355 THR A OG1 1 
ATOM   5751 C CG2 . THR B 1 194 ? -55.951  23.553  93.514  1.00 58.61  ? 355 THR A CG2 1 
ATOM   5752 N N   . LEU B 1 195 ? -57.879  21.160  91.787  1.00 58.15  ? 356 LEU A N   1 
ATOM   5753 C CA  . LEU B 1 195 ? -59.001  21.432  90.896  1.00 57.30  ? 356 LEU A CA  1 
ATOM   5754 C C   . LEU B 1 195 ? -59.476  22.862  91.087  1.00 57.81  ? 356 LEU A C   1 
ATOM   5755 O O   . LEU B 1 195 ? -59.679  23.307  92.216  1.00 58.95  ? 356 LEU A O   1 
ATOM   5756 C CB  . LEU B 1 195 ? -60.160  20.465  91.157  1.00 56.15  ? 356 LEU A CB  1 
ATOM   5757 C CG  . LEU B 1 195 ? -59.912  18.956  91.103  1.00 56.36  ? 356 LEU A CG  1 
ATOM   5758 C CD1 . LEU B 1 195 ? -61.235  18.209  91.179  1.00 55.86  ? 356 LEU A CD1 1 
ATOM   5759 C CD2 . LEU B 1 195 ? -59.147  18.558  89.850  1.00 57.49  ? 356 LEU A CD2 1 
ATOM   5760 N N   . PHE B 1 196 ? -59.639  23.588  89.987  1.00 57.58  ? 357 PHE A N   1 
ATOM   5761 C CA  . PHE B 1 196 ? -60.218  24.927  90.056  1.00 57.76  ? 357 PHE A CA  1 
ATOM   5762 C C   . PHE B 1 196 ? -61.166  25.219  88.898  1.00 57.29  ? 357 PHE A C   1 
ATOM   5763 O O   . PHE B 1 196 ? -60.878  24.895  87.747  1.00 57.23  ? 357 PHE A O   1 
ATOM   5764 C CB  . PHE B 1 196 ? -59.145  26.019  90.261  1.00 58.67  ? 357 PHE A CB  1 
ATOM   5765 C CG  . PHE B 1 196 ? -58.346  26.371  89.030  1.00 59.41  ? 357 PHE A CG  1 
ATOM   5766 C CD1 . PHE B 1 196 ? -57.609  25.410  88.343  1.00 59.29  ? 357 PHE A CD1 1 
ATOM   5767 C CD2 . PHE B 1 196 ? -58.282  27.692  88.595  1.00 59.44  ? 357 PHE A CD2 1 
ATOM   5768 C CE1 . PHE B 1 196 ? -56.861  25.749  87.224  1.00 58.49  ? 357 PHE A CE1 1 
ATOM   5769 C CE2 . PHE B 1 196 ? -57.532  28.040  87.480  1.00 59.35  ? 357 PHE A CE2 1 
ATOM   5770 C CZ  . PHE B 1 196 ? -56.823  27.066  86.793  1.00 59.00  ? 357 PHE A CZ  1 
ATOM   5771 N N   . GLY B 1 197 ? -62.313  25.803  89.235  1.00 57.22  ? 358 GLY A N   1 
ATOM   5772 C CA  . GLY B 1 197 ? -63.368  26.080  88.268  1.00 57.38  ? 358 GLY A CA  1 
ATOM   5773 C C   . GLY B 1 197 ? -64.221  27.276  88.638  1.00 57.37  ? 358 GLY A C   1 
ATOM   5774 O O   . GLY B 1 197 ? -64.184  27.754  89.774  1.00 58.27  ? 358 GLY A O   1 
ATOM   5775 N N   . GLU B 1 198 ? -64.991  27.757  87.667  1.00 57.02  ? 359 GLU A N   1 
ATOM   5776 C CA  . GLU B 1 198 ? -65.875  28.898  87.862  1.00 57.46  ? 359 GLU A CA  1 
ATOM   5777 C C   . GLU B 1 198 ? -67.311  28.518  87.507  1.00 57.00  ? 359 GLU A C   1 
ATOM   5778 O O   . GLU B 1 198 ? -67.548  27.809  86.523  1.00 57.06  ? 359 GLU A O   1 
ATOM   5779 C CB  . GLU B 1 198 ? -65.398  30.086  87.022  1.00 58.93  ? 359 GLU A CB  1 
ATOM   5780 C CG  . GLU B 1 198 ? -65.919  31.444  87.476  1.00 61.57  ? 359 GLU A CG  1 
ATOM   5781 C CD  . GLU B 1 198 ? -67.274  31.804  86.886  1.00 63.05  ? 359 GLU A CD  1 
ATOM   5782 O OE1 . GLU B 1 198 ? -67.644  31.252  85.823  1.00 62.46  ? 359 GLU A OE1 1 
ATOM   5783 O OE2 . GLU B 1 198 ? -67.969  32.654  87.487  1.00 64.76  ? 359 GLU A OE2 1 
ATOM   5784 N N   . SER B 1 199 ? -68.256  28.996  88.317  1.00 56.04  ? 360 SER A N   1 
ATOM   5785 C CA  . SER B 1 199 ? -69.687  28.718  88.148  1.00 55.22  ? 360 SER A CA  1 
ATOM   5786 C C   . SER B 1 199 ? -69.978  27.211  88.174  1.00 55.42  ? 360 SER A C   1 
ATOM   5787 O O   . SER B 1 199 ? -69.748  26.558  89.193  1.00 55.39  ? 360 SER A O   1 
ATOM   5788 C CB  . SER B 1 199 ? -70.229  29.382  86.877  1.00 54.55  ? 360 SER A CB  1 
ATOM   5789 O OG  . SER B 1 199 ? -71.641  29.477  86.910  1.00 53.51  ? 360 SER A OG  1 
ATOM   5790 N N   . ALA B 1 200 ? -70.467  26.668  87.059  1.00 55.53  ? 361 ALA A N   1 
ATOM   5791 C CA  . ALA B 1 200 ? -70.729  25.231  86.933  1.00 55.78  ? 361 ALA A CA  1 
ATOM   5792 C C   . ALA B 1 200 ? -69.442  24.416  87.052  1.00 56.67  ? 361 ALA A C   1 
ATOM   5793 O O   . ALA B 1 200 ? -69.472  23.241  87.423  1.00 56.60  ? 361 ALA A O   1 
ATOM   5794 C CB  . ALA B 1 200 ? -71.430  24.931  85.619  1.00 55.71  ? 361 ALA A CB  1 
ATOM   5795 N N   . GLY B 1 201 ? -68.318  25.053  86.728  1.00 57.63  ? 362 GLY A N   1 
ATOM   5796 C CA  . GLY B 1 201 ? -66.998  24.473  86.938  1.00 58.12  ? 362 GLY A CA  1 
ATOM   5797 C C   . GLY B 1 201 ? -66.696  24.343  88.419  1.00 58.61  ? 362 GLY A C   1 
ATOM   5798 O O   . GLY B 1 201 ? -66.178  23.319  88.861  1.00 60.34  ? 362 GLY A O   1 
ATOM   5799 N N   . ALA B 1 202 ? -67.029  25.381  89.185  1.00 57.09  ? 363 ALA A N   1 
ATOM   5800 C CA  . ALA B 1 202 ? -66.872  25.349  90.636  1.00 56.42  ? 363 ALA A CA  1 
ATOM   5801 C C   . ALA B 1 202 ? -67.832  24.347  91.271  1.00 56.10  ? 363 ALA A C   1 
ATOM   5802 O O   . ALA B 1 202 ? -67.473  23.666  92.235  1.00 57.28  ? 363 ALA A O   1 
ATOM   5803 C CB  . ALA B 1 202 ? -67.072  26.732  91.230  1.00 56.79  ? 363 ALA A CB  1 
ATOM   5804 N N   . VAL B 1 203 ? -69.046  24.258  90.726  1.00 54.50  ? 364 VAL A N   1 
ATOM   5805 C CA  . VAL B 1 203 ? -70.023  23.258  91.158  1.00 53.19  ? 364 VAL A CA  1 
ATOM   5806 C C   . VAL B 1 203 ? -69.450  21.863  90.939  1.00 54.05  ? 364 VAL A C   1 
ATOM   5807 O O   . VAL B 1 203 ? -69.554  21.000  91.811  1.00 55.57  ? 364 VAL A O   1 
ATOM   5808 C CB  . VAL B 1 203 ? -71.373  23.406  90.423  1.00 52.15  ? 364 VAL A CB  1 
ATOM   5809 C CG1 . VAL B 1 203 ? -72.289  22.228  90.722  1.00 51.34  ? 364 VAL A CG1 1 
ATOM   5810 C CG2 . VAL B 1 203 ? -72.053  24.703  90.825  1.00 52.20  ? 364 VAL A CG2 1 
ATOM   5811 N N   . SER B 1 204 ? -68.832  21.660  89.777  1.00 54.24  ? 365 SER A N   1 
ATOM   5812 C CA  . SER B 1 204 ? -68.159  20.403  89.462  1.00 54.48  ? 365 SER A CA  1 
ATOM   5813 C C   . SER B 1 204 ? -67.028  20.115  90.453  1.00 54.64  ? 365 SER A C   1 
ATOM   5814 O O   . SER B 1 204 ? -66.984  19.036  91.050  1.00 55.67  ? 365 SER A O   1 
ATOM   5815 C CB  . SER B 1 204 ? -67.629  20.421  88.027  1.00 54.08  ? 365 SER A CB  1 
ATOM   5816 O OG  . SER B 1 204 ? -68.693  20.408  87.093  1.00 53.83  ? 365 SER A OG  1 
ATOM   5817 N N   . VAL B 1 205 ? -66.137  21.090  90.634  1.00 53.35  ? 366 VAL A N   1 
ATOM   5818 C CA  . VAL B 1 205 ? -65.029  20.986  91.585  1.00 52.80  ? 366 VAL A CA  1 
ATOM   5819 C C   . VAL B 1 205 ? -65.527  20.578  92.974  1.00 53.30  ? 366 VAL A C   1 
ATOM   5820 O O   . VAL B 1 205 ? -64.925  19.724  93.628  1.00 53.87  ? 366 VAL A O   1 
ATOM   5821 C CB  . VAL B 1 205 ? -64.226  22.306  91.660  1.00 52.75  ? 366 VAL A CB  1 
ATOM   5822 C CG1 . VAL B 1 205 ? -63.216  22.276  92.797  1.00 52.34  ? 366 VAL A CG1 1 
ATOM   5823 C CG2 . VAL B 1 205 ? -63.516  22.575  90.341  1.00 52.94  ? 366 VAL A CG2 1 
ATOM   5824 N N   . SER B 1 206 ? -66.636  21.177  93.404  1.00 53.95  ? 367 SER A N   1 
ATOM   5825 C CA  . SER B 1 206 ? -67.243  20.864  94.699  1.00 55.03  ? 367 SER A CA  1 
ATOM   5826 C C   . SER B 1 206 ? -67.853  19.468  94.736  1.00 55.28  ? 367 SER A C   1 
ATOM   5827 O O   . SER B 1 206 ? -67.806  18.796  95.767  1.00 56.22  ? 367 SER A O   1 
ATOM   5828 C CB  . SER B 1 206 ? -68.305  21.899  95.067  1.00 55.00  ? 367 SER A CB  1 
ATOM   5829 O OG  . SER B 1 206 ? -69.436  21.797  94.223  1.00 55.41  ? 367 SER A OG  1 
ATOM   5830 N N   . LEU B 1 207 ? -68.427  19.039  93.614  1.00 55.03  ? 368 LEU A N   1 
ATOM   5831 C CA  . LEU B 1 207 ? -69.009  17.703  93.519  1.00 55.38  ? 368 LEU A CA  1 
ATOM   5832 C C   . LEU B 1 207 ? -67.946  16.602  93.564  1.00 56.23  ? 368 LEU A C   1 
ATOM   5833 O O   . LEU B 1 207 ? -68.234  15.481  93.979  1.00 56.49  ? 368 LEU A O   1 
ATOM   5834 C CB  . LEU B 1 207 ? -69.892  17.568  92.273  1.00 54.62  ? 368 LEU A CB  1 
ATOM   5835 C CG  . LEU B 1 207 ? -71.265  18.255  92.292  1.00 53.83  ? 368 LEU A CG  1 
ATOM   5836 C CD1 . LEU B 1 207 ? -72.006  17.991  90.992  1.00 53.42  ? 368 LEU A CD1 1 
ATOM   5837 C CD2 . LEU B 1 207 ? -72.110  17.818  93.480  1.00 53.27  ? 368 LEU A CD2 1 
ATOM   5838 N N   . HIS B 1 208 ? -66.724  16.930  93.148  1.00 57.21  ? 369 HIS A N   1 
ATOM   5839 C CA  . HIS B 1 208 ? -65.593  16.004  93.250  1.00 57.60  ? 369 HIS A CA  1 
ATOM   5840 C C   . HIS B 1 208 ? -65.104  15.862  94.689  1.00 58.20  ? 369 HIS A C   1 
ATOM   5841 O O   . HIS B 1 208 ? -64.617  14.799  95.084  1.00 59.69  ? 369 HIS A O   1 
ATOM   5842 C CB  . HIS B 1 208 ? -64.444  16.430  92.334  1.00 56.56  ? 369 HIS A CB  1 
ATOM   5843 C CG  . HIS B 1 208 ? -64.731  16.233  90.879  1.00 56.34  ? 369 HIS A CG  1 
ATOM   5844 N ND1 . HIS B 1 208 ? -65.063  15.007  90.345  1.00 56.78  ? 369 HIS A ND1 1 
ATOM   5845 C CD2 . HIS B 1 208 ? -64.731  17.106  89.844  1.00 56.12  ? 369 HIS A CD2 1 
ATOM   5846 C CE1 . HIS B 1 208 ? -65.260  15.133  89.045  1.00 56.40  ? 369 HIS A CE1 1 
ATOM   5847 N NE2 . HIS B 1 208 ? -65.064  16.397  88.715  1.00 56.08  ? 369 HIS A NE2 1 
ATOM   5848 N N   . LEU B 1 209 ? -65.234  16.937  95.465  1.00 57.76  ? 370 LEU A N   1 
ATOM   5849 C CA  . LEU B 1 209 ? -64.939  16.898  96.894  1.00 58.46  ? 370 LEU A CA  1 
ATOM   5850 C C   . LEU B 1 209 ? -65.956  16.021  97.622  1.00 59.90  ? 370 LEU A C   1 
ATOM   5851 O O   . LEU B 1 209 ? -65.644  15.413  98.647  1.00 62.83  ? 370 LEU A O   1 
ATOM   5852 C CB  . LEU B 1 209 ? -64.944  18.307  97.488  1.00 57.04  ? 370 LEU A CB  1 
ATOM   5853 C CG  . LEU B 1 209 ? -63.856  19.287  97.048  1.00 56.29  ? 370 LEU A CG  1 
ATOM   5854 C CD1 . LEU B 1 209 ? -64.375  20.708  97.175  1.00 56.28  ? 370 LEU A CD1 1 
ATOM   5855 C CD2 . LEU B 1 209 ? -62.580  19.101  97.855  1.00 56.46  ? 370 LEU A CD2 1 
ATOM   5856 N N   . LEU B 1 210 ? -67.170  15.959  97.084  1.00 59.40  ? 371 LEU A N   1 
ATOM   5857 C CA  . LEU B 1 210 ? -68.224  15.135  97.656  1.00 59.74  ? 371 LEU A CA  1 
ATOM   5858 C C   . LEU B 1 210 ? -68.147  13.691  97.182  1.00 61.64  ? 371 LEU A C   1 
ATOM   5859 O O   . LEU B 1 210 ? -68.269  12.770  97.987  1.00 63.19  ? 371 LEU A O   1 
ATOM   5860 C CB  . LEU B 1 210 ? -69.600  15.718  97.331  1.00 57.81  ? 371 LEU A CB  1 
ATOM   5861 C CG  . LEU B 1 210 ? -70.278  16.612  98.371  1.00 57.00  ? 371 LEU A CG  1 
ATOM   5862 C CD1 . LEU B 1 210 ? -69.474  17.864  98.692  1.00 56.47  ? 371 LEU A CD1 1 
ATOM   5863 C CD2 . LEU B 1 210 ? -71.657  16.987  97.866  1.00 56.67  ? 371 LEU A CD2 1 
ATOM   5864 N N   . SER B 1 211 ? -67.928  13.505  95.881  1.00 63.40  ? 372 SER A N   1 
ATOM   5865 C CA  . SER B 1 211 ? -68.050  12.193  95.240  1.00 64.76  ? 372 SER A CA  1 
ATOM   5866 C C   . SER B 1 211 ? -67.182  11.103  95.840  1.00 65.05  ? 372 SER A C   1 
ATOM   5867 O O   . SER B 1 211 ? -66.023  11.333  96.207  1.00 64.85  ? 372 SER A O   1 
ATOM   5868 C CB  . SER B 1 211 ? -67.764  12.277  93.740  1.00 67.41  ? 372 SER A CB  1 
ATOM   5869 O OG  . SER B 1 211 ? -67.909  11.001  93.129  1.00 69.29  ? 372 SER A OG  1 
ATOM   5870 N N   . ALA B 1 212 ? -67.774  9.914   95.910  1.00 64.53  ? 373 ALA A N   1 
ATOM   5871 C CA  . ALA B 1 212 ? -67.099  8.702   96.344  1.00 64.29  ? 373 ALA A CA  1 
ATOM   5872 C C   . ALA B 1 212 ? -66.035  8.263   95.336  1.00 65.05  ? 373 ALA A C   1 
ATOM   5873 O O   . ALA B 1 212 ? -64.973  7.773   95.725  1.00 64.74  ? 373 ALA A O   1 
ATOM   5874 C CB  . ALA B 1 212 ? -68.118  7.593   96.550  1.00 62.89  ? 373 ALA A CB  1 
ATOM   5875 N N   . LEU B 1 213 ? -66.322  8.455   94.049  1.00 65.96  ? 374 LEU A N   1 
ATOM   5876 C CA  . LEU B 1 213 ? -65.466  7.941   92.979  1.00 67.89  ? 374 LEU A CA  1 
ATOM   5877 C C   . LEU B 1 213 ? -64.215  8.776   92.718  1.00 69.72  ? 374 LEU A C   1 
ATOM   5878 O O   . LEU B 1 213 ? -63.115  8.231   92.636  1.00 71.40  ? 374 LEU A O   1 
ATOM   5879 C CB  . LEU B 1 213 ? -66.261  7.740   91.682  1.00 68.17  ? 374 LEU A CB  1 
ATOM   5880 C CG  . LEU B 1 213 ? -67.313  6.622   91.644  1.00 69.35  ? 374 LEU A CG  1 
ATOM   5881 C CD1 . LEU B 1 213 ? -67.922  6.521   90.255  1.00 67.79  ? 374 LEU A CD1 1 
ATOM   5882 C CD2 . LEU B 1 213 ? -66.746  5.273   92.070  1.00 69.68  ? 374 LEU A CD2 1 
ATOM   5883 N N   . SER B 1 214 ? -64.380  10.089  92.586  1.00 72.18  ? 375 SER A N   1 
ATOM   5884 C CA  . SER B 1 214 ? -63.246  10.974  92.308  1.00 73.70  ? 375 SER A CA  1 
ATOM   5885 C C   . SER B 1 214 ? -62.608  11.531  93.583  1.00 74.97  ? 375 SER A C   1 
ATOM   5886 O O   . SER B 1 214 ? -61.967  12.585  93.558  1.00 75.57  ? 375 SER A O   1 
ATOM   5887 C CB  . SER B 1 214 ? -63.651  12.103  91.348  1.00 72.99  ? 375 SER A CB  1 
ATOM   5888 O OG  . SER B 1 214 ? -64.770  12.824  91.828  1.00 72.18  ? 375 SER A OG  1 
ATOM   5889 N N   . ARG B 1 215 ? -62.771  10.802  94.685  1.00 76.41  ? 376 ARG A N   1 
ATOM   5890 C CA  . ARG B 1 215 ? -62.281  11.229  95.993  1.00 79.17  ? 376 ARG A CA  1 
ATOM   5891 C C   . ARG B 1 215 ? -60.751  11.286  96.081  1.00 81.35  ? 376 ARG A C   1 
ATOM   5892 O O   . ARG B 1 215 ? -60.186  12.334  96.396  1.00 83.07  ? 376 ARG A O   1 
ATOM   5893 C CB  . ARG B 1 215 ? -62.855  10.335  97.102  1.00 78.24  ? 376 ARG A CB  1 
ATOM   5894 C CG  . ARG B 1 215 ? -62.392  10.690  98.510  1.00 76.63  ? 376 ARG A CG  1 
ATOM   5895 C CD  . ARG B 1 215 ? -62.788  12.107  98.896  1.00 76.76  ? 376 ARG A CD  1 
ATOM   5896 N NE  . ARG B 1 215 ? -64.188  12.205  99.301  1.00 76.54  ? 376 ARG A NE  1 
ATOM   5897 C CZ  . ARG B 1 215 ? -64.615  12.083  100.555 1.00 76.85  ? 376 ARG A CZ  1 
ATOM   5898 N NH1 . ARG B 1 215 ? -65.908  12.188  100.826 1.00 76.36  ? 376 ARG A NH1 1 
ATOM   5899 N NH2 . ARG B 1 215 ? -63.753  11.855  101.540 1.00 78.41  ? 376 ARG A NH2 1 
ATOM   5900 N N   . ASP B 1 216 ? -60.092  10.165  95.800  1.00 82.54  ? 377 ASP A N   1 
ATOM   5901 C CA  . ASP B 1 216 ? -58.634  10.072  95.921  1.00 83.49  ? 377 ASP A CA  1 
ATOM   5902 C C   . ASP B 1 216 ? -57.884  10.478  94.641  1.00 80.47  ? 377 ASP A C   1 
ATOM   5903 O O   . ASP B 1 216 ? -56.741  10.063  94.421  1.00 80.21  ? 377 ASP A O   1 
ATOM   5904 C CB  . ASP B 1 216 ? -58.220  8.663   96.388  1.00 87.75  ? 377 ASP A CB  1 
ATOM   5905 C CG  . ASP B 1 216 ? -58.796  7.545   95.514  1.00 91.59  ? 377 ASP A CG  1 
ATOM   5906 O OD1 . ASP B 1 216 ? -59.762  7.784   94.754  1.00 92.51  ? 377 ASP A OD1 1 
ATOM   5907 O OD2 . ASP B 1 216 ? -58.279  6.410   95.597  1.00 94.37  ? 377 ASP A OD2 1 
ATOM   5908 N N   . LEU B 1 217 ? -58.520  11.312  93.819  1.00 75.81  ? 378 LEU A N   1 
ATOM   5909 C CA  . LEU B 1 217 ? -57.963  11.691  92.518  1.00 71.70  ? 378 LEU A CA  1 
ATOM   5910 C C   . LEU B 1 217 ? -57.304  13.073  92.483  1.00 70.54  ? 378 LEU A C   1 
ATOM   5911 O O   . LEU B 1 217 ? -56.604  13.400  91.524  1.00 71.77  ? 378 LEU A O   1 
ATOM   5912 C CB  . LEU B 1 217 ? -59.029  11.579  91.420  1.00 69.68  ? 378 LEU A CB  1 
ATOM   5913 C CG  . LEU B 1 217 ? -59.654  10.207  91.137  1.00 68.46  ? 378 LEU A CG  1 
ATOM   5914 C CD1 . LEU B 1 217 ? -60.560  10.293  89.922  1.00 68.12  ? 378 LEU A CD1 1 
ATOM   5915 C CD2 . LEU B 1 217 ? -58.603  9.124   90.933  1.00 68.07  ? 378 LEU A CD2 1 
ATOM   5916 N N   . PHE B 1 218 ? -57.522  13.875  93.523  1.00 68.75  ? 379 PHE A N   1 
ATOM   5917 C CA  . PHE B 1 218 ? -56.944  15.222  93.602  1.00 66.98  ? 379 PHE A CA  1 
ATOM   5918 C C   . PHE B 1 218 ? -56.605  15.613  95.039  1.00 67.63  ? 379 PHE A C   1 
ATOM   5919 O O   . PHE B 1 218 ? -57.063  14.973  95.987  1.00 68.66  ? 379 PHE A O   1 
ATOM   5920 C CB  . PHE B 1 218 ? -57.889  16.254  92.968  1.00 64.63  ? 379 PHE A CB  1 
ATOM   5921 C CG  . PHE B 1 218 ? -59.175  16.456  93.724  1.00 62.36  ? 379 PHE A CG  1 
ATOM   5922 C CD1 . PHE B 1 218 ? -60.216  15.536  93.624  1.00 62.14  ? 379 PHE A CD1 1 
ATOM   5923 C CD2 . PHE B 1 218 ? -59.353  17.577  94.524  1.00 60.98  ? 379 PHE A CD2 1 
ATOM   5924 C CE1 . PHE B 1 218 ? -61.402  15.726  94.317  1.00 61.00  ? 379 PHE A CE1 1 
ATOM   5925 C CE2 . PHE B 1 218 ? -60.537  17.773  95.218  1.00 60.32  ? 379 PHE A CE2 1 
ATOM   5926 C CZ  . PHE B 1 218 ? -61.563  16.847  95.114  1.00 60.45  ? 379 PHE A CZ  1 
ATOM   5927 N N   . GLN B 1 219 ? -55.807  16.665  95.196  1.00 68.10  ? 380 GLN A N   1 
ATOM   5928 C CA  . GLN B 1 219 ? -55.433  17.142  96.524  1.00 69.82  ? 380 GLN A CA  1 
ATOM   5929 C C   . GLN B 1 219 ? -56.337  18.272  97.021  1.00 69.45  ? 380 GLN A C   1 
ATOM   5930 O O   . GLN B 1 219 ? -57.039  18.103  98.014  1.00 69.89  ? 380 GLN A O   1 
ATOM   5931 C CB  . GLN B 1 219 ? -53.965  17.569  96.559  1.00 72.27  ? 380 GLN A CB  1 
ATOM   5932 C CG  . GLN B 1 219 ? -53.427  17.828  97.959  1.00 75.43  ? 380 GLN A CG  1 
ATOM   5933 C CD  . GLN B 1 219 ? -51.980  18.287  97.962  1.00 78.75  ? 380 GLN A CD  1 
ATOM   5934 O OE1 . GLN B 1 219 ? -51.564  19.095  97.130  1.00 78.74  ? 380 GLN A OE1 1 
ATOM   5935 N NE2 . GLN B 1 219 ? -51.204  17.777  98.911  1.00 82.55  ? 380 GLN A NE2 1 
ATOM   5936 N N   . ARG B 1 220 ? -56.321  19.410  96.324  1.00 68.33  ? 381 ARG A N   1 
ATOM   5937 C CA  . ARG B 1 220 ? -57.014  20.626  96.774  1.00 65.56  ? 381 ARG A CA  1 
ATOM   5938 C C   . ARG B 1 220 ? -58.055  21.137  95.777  1.00 63.72  ? 381 ARG A C   1 
ATOM   5939 O O   . ARG B 1 220 ? -58.195  20.601  94.676  1.00 62.77  ? 381 ARG A O   1 
ATOM   5940 C CB  . ARG B 1 220 ? -56.001  21.736  97.071  1.00 66.43  ? 381 ARG A CB  1 
ATOM   5941 C CG  . ARG B 1 220 ? -54.989  21.376  98.140  1.00 69.26  ? 381 ARG A CG  1 
ATOM   5942 C CD  . ARG B 1 220 ? -54.071  22.538  98.461  1.00 71.31  ? 381 ARG A CD  1 
ATOM   5943 N NE  . ARG B 1 220 ? -52.980  22.111  99.334  1.00 74.53  ? 381 ARG A NE  1 
ATOM   5944 C CZ  . ARG B 1 220 ? -51.757  21.794  98.915  1.00 76.05  ? 381 ARG A CZ  1 
ATOM   5945 N NH1 . ARG B 1 220 ? -51.446  21.859  97.627  1.00 77.81  ? 381 ARG A NH1 1 
ATOM   5946 N NH2 . ARG B 1 220 ? -50.836  21.414  99.789  1.00 77.20  ? 381 ARG A NH2 1 
ATOM   5947 N N   . ALA B 1 221 ? -58.771  22.189  96.172  1.00 62.59  ? 382 ALA A N   1 
ATOM   5948 C CA  . ALA B 1 221 ? -59.832  22.767  95.351  1.00 61.02  ? 382 ALA A CA  1 
ATOM   5949 C C   . ALA B 1 221 ? -59.940  24.287  95.489  1.00 60.60  ? 382 ALA A C   1 
ATOM   5950 O O   . ALA B 1 221 ? -59.901  24.824  96.600  1.00 60.17  ? 382 ALA A O   1 
ATOM   5951 C CB  . ALA B 1 221 ? -61.166  22.112  95.681  1.00 59.83  ? 382 ALA A CB  1 
ATOM   5952 N N   . ILE B 1 222 ? -60.059  24.968  94.349  1.00 60.53  ? 383 ILE A N   1 
ATOM   5953 C CA  . ILE B 1 222 ? -60.417  26.390  94.302  1.00 59.71  ? 383 ILE A CA  1 
ATOM   5954 C C   . ILE B 1 222 ? -61.774  26.510  93.611  1.00 59.69  ? 383 ILE A C   1 
ATOM   5955 O O   . ILE B 1 222 ? -61.967  25.974  92.522  1.00 60.62  ? 383 ILE A O   1 
ATOM   5956 C CB  . ILE B 1 222 ? -59.368  27.252  93.563  1.00 58.60  ? 383 ILE A CB  1 
ATOM   5957 C CG1 . ILE B 1 222 ? -57.967  27.012  94.131  1.00 59.53  ? 383 ILE A CG1 1 
ATOM   5958 C CG2 . ILE B 1 222 ? -59.728  28.729  93.656  1.00 57.22  ? 383 ILE A CG2 1 
ATOM   5959 C CD1 . ILE B 1 222 ? -56.845  27.631  93.323  1.00 60.13  ? 383 ILE A CD1 1 
ATOM   5960 N N   . LEU B 1 223 ? -62.711  27.205  94.249  1.00 59.45  ? 384 LEU A N   1 
ATOM   5961 C CA  . LEU B 1 223 ? -64.086  27.266  93.758  1.00 59.96  ? 384 LEU A CA  1 
ATOM   5962 C C   . LEU B 1 223 ? -64.560  28.701  93.556  1.00 60.73  ? 384 LEU A C   1 
ATOM   5963 O O   . LEU B 1 223 ? -64.917  29.388  94.515  1.00 62.44  ? 384 LEU A O   1 
ATOM   5964 C CB  . LEU B 1 223 ? -65.030  26.531  94.713  1.00 59.66  ? 384 LEU A CB  1 
ATOM   5965 C CG  . LEU B 1 223 ? -64.730  25.076  95.074  1.00 59.64  ? 384 LEU A CG  1 
ATOM   5966 C CD1 . LEU B 1 223 ? -63.733  24.986  96.218  1.00 60.31  ? 384 LEU A CD1 1 
ATOM   5967 C CD2 . LEU B 1 223 ? -66.021  24.386  95.462  1.00 59.90  ? 384 LEU A CD2 1 
ATOM   5968 N N   . GLN B 1 224 ? -64.568  29.145  92.302  1.00 59.46  ? 385 GLN A N   1 
ATOM   5969 C CA  . GLN B 1 224 ? -64.972  30.507  91.972  1.00 58.18  ? 385 GLN A CA  1 
ATOM   5970 C C   . GLN B 1 224 ? -66.466  30.592  91.664  1.00 58.47  ? 385 GLN A C   1 
ATOM   5971 O O   . GLN B 1 224 ? -66.940  30.007  90.687  1.00 58.09  ? 385 GLN A O   1 
ATOM   5972 C CB  . GLN B 1 224 ? -64.156  31.032  90.791  1.00 57.59  ? 385 GLN A CB  1 
ATOM   5973 C CG  . GLN B 1 224 ? -62.657  31.072  91.035  1.00 58.05  ? 385 GLN A CG  1 
ATOM   5974 C CD  . GLN B 1 224 ? -61.857  31.385  89.782  1.00 59.68  ? 385 GLN A CD  1 
ATOM   5975 O OE1 . GLN B 1 224 ? -60.635  31.224  89.762  1.00 60.29  ? 385 GLN A OE1 1 
ATOM   5976 N NE2 . GLN B 1 224 ? -62.540  31.834  88.729  1.00 59.47  ? 385 GLN A NE2 1 
ATOM   5977 N N   . SER B 1 225 ? -67.196  31.319  92.513  1.00 58.60  ? 386 SER A N   1 
ATOM   5978 C CA  . SER B 1 225 ? -68.625  31.611  92.320  1.00 58.28  ? 386 SER A CA  1 
ATOM   5979 C C   . SER B 1 225 ? -69.482  30.365  92.072  1.00 58.05  ? 386 SER A C   1 
ATOM   5980 O O   . SER B 1 225 ? -70.205  30.288  91.079  1.00 58.44  ? 386 SER A O   1 
ATOM   5981 C CB  . SER B 1 225 ? -68.828  32.632  91.186  1.00 58.70  ? 386 SER A CB  1 
ATOM   5982 O OG  . SER B 1 225 ? -68.108  33.832  91.419  1.00 59.01  ? 386 SER A OG  1 
ATOM   5983 N N   . GLY B 1 226 ? -69.400  29.395  92.978  1.00 58.38  ? 387 GLY A N   1 
ATOM   5984 C CA  . GLY B 1 226 ? -70.180  28.167  92.853  1.00 59.61  ? 387 GLY A CA  1 
ATOM   5985 C C   . GLY B 1 226 ? -70.010  27.202  94.011  1.00 61.80  ? 387 GLY A C   1 
ATOM   5986 O O   . GLY B 1 226 ? -68.939  27.128  94.625  1.00 63.33  ? 387 GLY A O   1 
ATOM   5987 N N   . SER B 1 227 ? -71.081  26.467  94.306  1.00 61.83  ? 388 SER A N   1 
ATOM   5988 C CA  . SER B 1 227 ? -71.090  25.451  95.357  1.00 60.81  ? 388 SER A CA  1 
ATOM   5989 C C   . SER B 1 227 ? -72.195  24.431  95.069  1.00 60.32  ? 388 SER A C   1 
ATOM   5990 O O   . SER B 1 227 ? -73.169  24.759  94.387  1.00 59.39  ? 388 SER A O   1 
ATOM   5991 C CB  . SER B 1 227 ? -71.312  26.094  96.726  1.00 61.48  ? 388 SER A CB  1 
ATOM   5992 O OG  . SER B 1 227 ? -72.693  26.226  96.999  1.00 62.76  ? 388 SER A OG  1 
ATOM   5993 N N   . PRO B 1 228 ? -72.067  23.203  95.609  1.00 60.41  ? 389 PRO A N   1 
ATOM   5994 C CA  . PRO B 1 228 ? -72.992  22.132  95.231  1.00 59.92  ? 389 PRO A CA  1 
ATOM   5995 C C   . PRO B 1 228 ? -74.387  22.296  95.838  1.00 59.41  ? 389 PRO A C   1 
ATOM   5996 O O   . PRO B 1 228 ? -75.323  21.601  95.439  1.00 59.56  ? 389 PRO A O   1 
ATOM   5997 C CB  . PRO B 1 228 ? -72.311  20.880  95.783  1.00 60.49  ? 389 PRO A CB  1 
ATOM   5998 C CG  . PRO B 1 228 ? -71.547  21.361  96.970  1.00 60.50  ? 389 PRO A CG  1 
ATOM   5999 C CD  . PRO B 1 228 ? -71.178  22.796  96.716  1.00 60.26  ? 389 PRO A CD  1 
ATOM   6000 N N   . THR B 1 229 ? -74.514  23.218  96.788  1.00 58.81  ? 390 THR A N   1 
ATOM   6001 C CA  . THR B 1 229 ? -75.777  23.457  97.474  1.00 58.09  ? 390 THR A CA  1 
ATOM   6002 C C   . THR B 1 229 ? -76.634  24.516  96.760  1.00 57.18  ? 390 THR A C   1 
ATOM   6003 O O   . THR B 1 229 ? -77.763  24.792  97.173  1.00 56.77  ? 390 THR A O   1 
ATOM   6004 C CB  . THR B 1 229 ? -75.544  23.796  98.969  1.00 59.09  ? 390 THR A CB  1 
ATOM   6005 O OG1 . THR B 1 229 ? -76.800  23.875  99.653  1.00 61.19  ? 390 THR A OG1 1 
ATOM   6006 C CG2 . THR B 1 229 ? -74.777  25.108  99.140  1.00 58.48  ? 390 THR A CG2 1 
ATOM   6007 N N   . ALA B 1 230 ? -76.095  25.083  95.679  1.00 56.76  ? 391 ALA A N   1 
ATOM   6008 C CA  . ALA B 1 230 ? -76.803  26.063  94.846  1.00 57.06  ? 391 ALA A CA  1 
ATOM   6009 C C   . ALA B 1 230 ? -78.075  25.482  94.218  1.00 57.70  ? 391 ALA A C   1 
ATOM   6010 O O   . ALA B 1 230 ? -78.098  24.307  93.854  1.00 58.63  ? 391 ALA A O   1 
ATOM   6011 C CB  . ALA B 1 230 ? -75.876  26.600  93.765  1.00 56.51  ? 391 ALA A CB  1 
ATOM   6012 N N   . PRO B 1 231 ? -79.137  26.306  94.085  1.00 58.57  ? 392 PRO A N   1 
ATOM   6013 C CA  . PRO B 1 231 ? -80.435  25.838  93.572  1.00 59.15  ? 392 PRO A CA  1 
ATOM   6014 C C   . PRO B 1 231 ? -80.365  25.204  92.182  1.00 59.73  ? 392 PRO A C   1 
ATOM   6015 O O   . PRO B 1 231 ? -81.063  24.225  91.916  1.00 61.01  ? 392 PRO A O   1 
ATOM   6016 C CB  . PRO B 1 231 ? -81.276  27.121  93.511  1.00 59.11  ? 392 PRO A CB  1 
ATOM   6017 C CG  . PRO B 1 231 ? -80.639  28.046  94.486  1.00 59.31  ? 392 PRO A CG  1 
ATOM   6018 C CD  . PRO B 1 231 ? -79.172  27.741  94.426  1.00 59.18  ? 392 PRO A CD  1 
ATOM   6019 N N   . TRP B 1 232 ? -79.524  25.761  91.315  1.00 59.71  ? 393 TRP A N   1 
ATOM   6020 C CA  . TRP B 1 232 ? -79.426  25.331  89.920  1.00 59.47  ? 393 TRP A CA  1 
ATOM   6021 C C   . TRP B 1 232 ? -78.487  24.145  89.708  1.00 60.39  ? 393 TRP A C   1 
ATOM   6022 O O   . TRP B 1 232 ? -78.500  23.530  88.642  1.00 61.64  ? 393 TRP A O   1 
ATOM   6023 C CB  . TRP B 1 232 ? -78.988  26.501  89.036  1.00 58.84  ? 393 TRP A CB  1 
ATOM   6024 C CG  . TRP B 1 232 ? -77.768  27.218  89.542  1.00 58.23  ? 393 TRP A CG  1 
ATOM   6025 C CD1 . TRP B 1 232 ? -77.734  28.239  90.451  1.00 58.03  ? 393 TRP A CD1 1 
ATOM   6026 C CD2 . TRP B 1 232 ? -76.408  26.970  89.167  1.00 57.58  ? 393 TRP A CD2 1 
ATOM   6027 N NE1 . TRP B 1 232 ? -76.437  28.639  90.668  1.00 57.64  ? 393 TRP A NE1 1 
ATOM   6028 C CE2 . TRP B 1 232 ? -75.603  27.879  89.892  1.00 57.32  ? 393 TRP A CE2 1 
ATOM   6029 C CE3 . TRP B 1 232 ? -75.790  26.067  88.291  1.00 56.81  ? 393 TRP A CE3 1 
ATOM   6030 C CZ2 . TRP B 1 232 ? -74.210  27.911  89.768  1.00 56.44  ? 393 TRP A CZ2 1 
ATOM   6031 C CZ3 . TRP B 1 232 ? -74.405  26.101  88.169  1.00 57.15  ? 393 TRP A CZ3 1 
ATOM   6032 C CH2 . TRP B 1 232 ? -73.632  27.020  88.903  1.00 56.34  ? 393 TRP A CH2 1 
ATOM   6033 N N   . ALA B 1 233 ? -77.682  23.832  90.722  1.00 60.98  ? 394 ALA A N   1 
ATOM   6034 C CA  . ALA B 1 233 ? -76.662  22.783  90.629  1.00 61.28  ? 394 ALA A CA  1 
ATOM   6035 C C   . ALA B 1 233 ? -77.227  21.391  90.337  1.00 62.01  ? 394 ALA A C   1 
ATOM   6036 O O   . ALA B 1 233 ? -76.668  20.655  89.524  1.00 63.62  ? 394 ALA A O   1 
ATOM   6037 C CB  . ALA B 1 233 ? -75.812  22.756  91.890  1.00 61.39  ? 394 ALA A CB  1 
ATOM   6038 N N   . LEU B 1 234 ? -78.325  21.036  91.000  1.00 62.15  ? 395 LEU A N   1 
ATOM   6039 C CA  . LEU B 1 234 ? -78.942  19.721  90.831  1.00 62.67  ? 395 LEU A CA  1 
ATOM   6040 C C   . LEU B 1 234 ? -80.443  19.800  90.618  1.00 63.38  ? 395 LEU A C   1 
ATOM   6041 O O   . LEU B 1 234 ? -81.083  20.780  90.999  1.00 64.05  ? 395 LEU A O   1 
ATOM   6042 C CB  . LEU B 1 234 ? -78.666  18.832  92.045  1.00 63.09  ? 395 LEU A CB  1 
ATOM   6043 C CG  . LEU B 1 234 ? -77.394  17.988  92.052  1.00 64.02  ? 395 LEU A CG  1 
ATOM   6044 C CD1 . LEU B 1 234 ? -76.211  18.784  92.583  1.00 64.68  ? 395 LEU A CD1 1 
ATOM   6045 C CD2 . LEU B 1 234 ? -77.622  16.743  92.893  1.00 64.45  ? 395 LEU A CD2 1 
ATOM   6046 N N   . VAL B 1 235 ? -80.992  18.753  90.008  1.00 64.40  ? 396 VAL A N   1 
ATOM   6047 C CA  . VAL B 1 235 ? -82.439  18.580  89.896  1.00 66.40  ? 396 VAL A CA  1 
ATOM   6048 C C   . VAL B 1 235 ? -82.861  17.237  90.484  1.00 68.83  ? 396 VAL A C   1 
ATOM   6049 O O   . VAL B 1 235 ? -82.068  16.295  90.537  1.00 70.17  ? 396 VAL A O   1 
ATOM   6050 C CB  . VAL B 1 235 ? -82.947  18.684  88.437  1.00 65.21  ? 396 VAL A CB  1 
ATOM   6051 C CG1 . VAL B 1 235 ? -82.905  20.125  87.951  1.00 65.06  ? 396 VAL A CG1 1 
ATOM   6052 C CG2 . VAL B 1 235 ? -82.163  17.762  87.509  1.00 65.63  ? 396 VAL A CG2 1 
ATOM   6053 N N   . SER B 1 236 ? -84.108  17.163  90.938  1.00 71.56  ? 397 SER A N   1 
ATOM   6054 C CA  . SER B 1 236 ? -84.684  15.902  91.378  1.00 73.57  ? 397 SER A CA  1 
ATOM   6055 C C   . SER B 1 236 ? -84.767  14.962  90.184  1.00 73.97  ? 397 SER A C   1 
ATOM   6056 O O   . SER B 1 236 ? -85.107  15.386  89.080  1.00 74.67  ? 397 SER A O   1 
ATOM   6057 C CB  . SER B 1 236 ? -86.072  16.124  91.984  1.00 76.10  ? 397 SER A CB  1 
ATOM   6058 O OG  . SER B 1 236 ? -86.896  16.896  91.128  1.00 77.46  ? 397 SER A OG  1 
ATOM   6059 N N   . ARG B 1 237 ? -84.433  13.694  90.404  1.00 74.69  ? 398 ARG A N   1 
ATOM   6060 C CA  . ARG B 1 237 ? -84.481  12.690  89.339  1.00 74.67  ? 398 ARG A CA  1 
ATOM   6061 C C   . ARG B 1 237 ? -85.909  12.426  88.862  1.00 74.98  ? 398 ARG A C   1 
ATOM   6062 O O   . ARG B 1 237 ? -86.115  11.894  87.771  1.00 75.35  ? 398 ARG A O   1 
ATOM   6063 C CB  . ARG B 1 237 ? -83.765  11.399  89.753  1.00 74.47  ? 398 ARG A CB  1 
ATOM   6064 C CG  . ARG B 1 237 ? -83.990  10.964  91.188  1.00 76.06  ? 398 ARG A CG  1 
ATOM   6065 C CD  . ARG B 1 237 ? -82.742  10.329  91.779  1.00 76.14  ? 398 ARG A CD  1 
ATOM   6066 N NE  . ARG B 1 237 ? -82.440  9.031   91.182  1.00 77.09  ? 398 ARG A NE  1 
ATOM   6067 C CZ  . ARG B 1 237 ? -82.975  7.879   91.576  1.00 77.97  ? 398 ARG A CZ  1 
ATOM   6068 N NH1 . ARG B 1 237 ? -83.851  7.848   92.574  1.00 78.60  ? 398 ARG A NH1 1 
ATOM   6069 N NH2 . ARG B 1 237 ? -82.635  6.751   90.967  1.00 78.18  ? 398 ARG A NH2 1 
ATOM   6070 N N   . GLU B 1 238 ? -86.882  12.812  89.685  1.00 75.99  ? 399 GLU A N   1 
ATOM   6071 C CA  . GLU B 1 238 ? -88.288  12.798  89.302  1.00 78.73  ? 399 GLU A CA  1 
ATOM   6072 C C   . GLU B 1 238 ? -88.551  13.876  88.249  1.00 78.70  ? 399 GLU A C   1 
ATOM   6073 O O   . GLU B 1 238 ? -89.341  13.675  87.325  1.00 77.59  ? 399 GLU A O   1 
ATOM   6074 C CB  . GLU B 1 238 ? -89.170  13.019  90.533  1.00 82.17  ? 399 GLU A CB  1 
ATOM   6075 C CG  . GLU B 1 238 ? -90.664  12.840  90.289  1.00 86.52  ? 399 GLU A CG  1 
ATOM   6076 C CD  . GLU B 1 238 ? -91.505  13.121  91.523  1.00 89.16  ? 399 GLU A CD  1 
ATOM   6077 O OE1 . GLU B 1 238 ? -92.685  12.709  91.541  1.00 90.44  ? 399 GLU A OE1 1 
ATOM   6078 O OE2 . GLU B 1 238 ? -90.995  13.750  92.477  1.00 90.74  ? 399 GLU A OE2 1 
ATOM   6079 N N   . GLU B 1 239 ? -87.880  15.017  88.401  1.00 79.62  ? 400 GLU A N   1 
ATOM   6080 C CA  . GLU B 1 239 ? -87.965  16.117  87.442  1.00 80.25  ? 400 GLU A CA  1 
ATOM   6081 C C   . GLU B 1 239 ? -87.102  15.833  86.213  1.00 79.96  ? 400 GLU A C   1 
ATOM   6082 O O   . GLU B 1 239 ? -87.556  16.005  85.083  1.00 81.18  ? 400 GLU A O   1 
ATOM   6083 C CB  . GLU B 1 239 ? -87.554  17.440  88.106  1.00 80.58  ? 400 GLU A CB  1 
ATOM   6084 C CG  . GLU B 1 239 ? -87.513  18.656  87.186  1.00 82.67  ? 400 GLU A CG  1 
ATOM   6085 C CD  . GLU B 1 239 ? -88.883  19.090  86.693  1.00 84.77  ? 400 GLU A CD  1 
ATOM   6086 O OE1 . GLU B 1 239 ? -89.869  18.963  87.452  1.00 86.73  ? 400 GLU A OE1 1 
ATOM   6087 O OE2 . GLU B 1 239 ? -88.972  19.567  85.542  1.00 85.10  ? 400 GLU A OE2 1 
ATOM   6088 N N   . ALA B 1 240 ? -85.866  15.390  86.444  1.00 78.99  ? 401 ALA A N   1 
ATOM   6089 C CA  . ALA B 1 240 ? -84.909  15.094  85.374  1.00 77.63  ? 401 ALA A CA  1 
ATOM   6090 C C   . ALA B 1 240 ? -85.476  14.143  84.319  1.00 77.29  ? 401 ALA A C   1 
ATOM   6091 O O   . ALA B 1 240 ? -85.190  14.289  83.127  1.00 76.58  ? 401 ALA A O   1 
ATOM   6092 C CB  . ALA B 1 240 ? -83.619  14.536  85.958  1.00 77.97  ? 401 ALA A CB  1 
ATOM   6093 N N   . THR B 1 241 ? -86.276  13.176  84.770  1.00 76.45  ? 402 THR A N   1 
ATOM   6094 C CA  . THR B 1 241 ? -86.961  12.229  83.885  1.00 75.75  ? 402 THR A CA  1 
ATOM   6095 C C   . THR B 1 241 ? -88.038  12.920  83.049  1.00 74.46  ? 402 THR A C   1 
ATOM   6096 O O   . THR B 1 241 ? -88.265  12.552  81.896  1.00 74.40  ? 402 THR A O   1 
ATOM   6097 C CB  . THR B 1 241 ? -87.611  11.073  84.672  1.00 75.65  ? 402 THR A CB  1 
ATOM   6098 O OG1 . THR B 1 241 ? -88.267  11.596  85.831  1.00 80.15  ? 402 THR A OG1 1 
ATOM   6099 C CG2 . THR B 1 241 ? -86.572  10.055  85.110  1.00 74.03  ? 402 THR A CG2 1 
ATOM   6100 N N   . LEU B 1 242 ? -88.695  13.916  83.641  1.00 73.31  ? 403 LEU A N   1 
ATOM   6101 C CA  . LEU B 1 242 ? -89.724  14.699  82.956  1.00 72.21  ? 403 LEU A CA  1 
ATOM   6102 C C   . LEU B 1 242 ? -89.114  15.642  81.924  1.00 71.56  ? 403 LEU A C   1 
ATOM   6103 O O   . LEU B 1 242 ? -89.613  15.738  80.802  1.00 72.43  ? 403 LEU A O   1 
ATOM   6104 C CB  . LEU B 1 242 ? -90.568  15.487  83.965  1.00 72.29  ? 403 LEU A CB  1 
ATOM   6105 C CG  . LEU B 1 242 ? -91.855  14.889  84.548  1.00 72.12  ? 403 LEU A CG  1 
ATOM   6106 C CD1 . LEU B 1 242 ? -91.704  13.439  84.997  1.00 72.23  ? 403 LEU A CD1 1 
ATOM   6107 C CD2 . LEU B 1 242 ? -92.343  15.758  85.698  1.00 71.72  ? 403 LEU A CD2 1 
ATOM   6108 N N   . ARG B 1 243 ? -88.038  16.330  82.308  1.00 70.57  ? 404 ARG A N   1 
ATOM   6109 C CA  . ARG B 1 243 ? -87.302  17.220  81.404  1.00 71.29  ? 404 ARG A CA  1 
ATOM   6110 C C   . ARG B 1 243 ? -86.837  16.460  80.164  1.00 73.19  ? 404 ARG A C   1 
ATOM   6111 O O   . ARG B 1 243 ? -86.859  16.995  79.052  1.00 74.23  ? 404 ARG A O   1 
ATOM   6112 C CB  . ARG B 1 243 ? -86.080  17.824  82.105  1.00 70.95  ? 404 ARG A CB  1 
ATOM   6113 C CG  . ARG B 1 243 ? -86.352  18.500  83.439  1.00 70.70  ? 404 ARG A CG  1 
ATOM   6114 C CD  . ARG B 1 243 ? -86.499  20.004  83.301  1.00 70.43  ? 404 ARG A CD  1 
ATOM   6115 N NE  . ARG B 1 243 ? -86.504  20.658  84.609  1.00 70.64  ? 404 ARG A NE  1 
ATOM   6116 C CZ  . ARG B 1 243 ? -85.423  21.135  85.222  1.00 70.65  ? 404 ARG A CZ  1 
ATOM   6117 N NH1 . ARG B 1 243 ? -84.227  21.042  84.656  1.00 70.41  ? 404 ARG A NH1 1 
ATOM   6118 N NH2 . ARG B 1 243 ? -85.541  21.713  86.409  1.00 70.89  ? 404 ARG A NH2 1 
ATOM   6119 N N   . ALA B 1 244 ? -86.418  15.211  80.376  1.00 74.01  ? 405 ALA A N   1 
ATOM   6120 C CA  . ALA B 1 244 ? -85.948  14.331  79.307  1.00 73.14  ? 405 ALA A CA  1 
ATOM   6121 C C   . ALA B 1 244 ? -87.083  13.897  78.384  1.00 72.74  ? 405 ALA A C   1 
ATOM   6122 O O   . ALA B 1 244 ? -86.937  13.926  77.162  1.00 73.70  ? 405 ALA A O   1 
ATOM   6123 C CB  . ALA B 1 244 ? -85.242  13.118  79.893  1.00 72.05  ? 405 ALA A CB  1 
ATOM   6124 N N   . LEU B 1 245 ? -88.209  13.500  78.973  1.00 72.73  ? 406 LEU A N   1 
ATOM   6125 C CA  . LEU B 1 245 ? -89.389  13.102  78.204  1.00 74.29  ? 406 LEU A CA  1 
ATOM   6126 C C   . LEU B 1 245 ? -90.030  14.286  77.476  1.00 76.74  ? 406 LEU A C   1 
ATOM   6127 O O   . LEU B 1 245 ? -90.601  14.119  76.395  1.00 78.76  ? 406 LEU A O   1 
ATOM   6128 C CB  . LEU B 1 245 ? -90.417  12.405  79.102  1.00 72.93  ? 406 LEU A CB  1 
ATOM   6129 C CG  . LEU B 1 245 ? -90.076  11.001  79.613  1.00 72.49  ? 406 LEU A CG  1 
ATOM   6130 C CD1 . LEU B 1 245 ? -90.995  10.610  80.760  1.00 72.28  ? 406 LEU A CD1 1 
ATOM   6131 C CD2 . LEU B 1 245 ? -90.133  9.964   78.500  1.00 72.58  ? 406 LEU A CD2 1 
ATOM   6132 N N   . ARG B 1 246 ? -89.929  15.475  78.070  1.00 76.60  ? 407 ARG A N   1 
ATOM   6133 C CA  . ARG B 1 246 ? -90.422  16.694  77.437  1.00 76.78  ? 407 ARG A CA  1 
ATOM   6134 C C   . ARG B 1 246 ? -89.530  17.068  76.253  1.00 75.58  ? 407 ARG A C   1 
ATOM   6135 O O   . ARG B 1 246 ? -90.010  17.629  75.267  1.00 76.57  ? 407 ARG A O   1 
ATOM   6136 C CB  . ARG B 1 246 ? -90.495  17.843  78.444  1.00 80.50  ? 407 ARG A CB  1 
ATOM   6137 C CG  . ARG B 1 246 ? -91.594  18.858  78.153  1.00 85.99  ? 407 ARG A CG  1 
ATOM   6138 C CD  . ARG B 1 246 ? -91.564  20.044  79.114  1.00 90.28  ? 407 ARG A CD  1 
ATOM   6139 N NE  . ARG B 1 246 ? -91.834  19.668  80.506  1.00 92.94  ? 407 ARG A NE  1 
ATOM   6140 C CZ  . ARG B 1 246 ? -90.948  19.738  81.501  1.00 92.82  ? 407 ARG A CZ  1 
ATOM   6141 N NH1 . ARG B 1 246 ? -89.714  20.180  81.282  1.00 93.04  ? 407 ARG A NH1 1 
ATOM   6142 N NH2 . ARG B 1 246 ? -91.301  19.369  82.727  1.00 91.34  ? 407 ARG A NH2 1 
ATOM   6143 N N   . LEU B 1 247 ? -88.238  16.750  76.359  1.00 72.66  ? 408 LEU A N   1 
ATOM   6144 C CA  . LEU B 1 247 ? -87.285  16.933  75.261  1.00 70.11  ? 408 LEU A CA  1 
ATOM   6145 C C   . LEU B 1 247 ? -87.507  15.899  74.162  1.00 70.61  ? 408 LEU A C   1 
ATOM   6146 O O   . LEU B 1 247 ? -87.372  16.207  72.976  1.00 70.68  ? 408 LEU A O   1 
ATOM   6147 C CB  . LEU B 1 247 ? -85.837  16.866  75.766  1.00 68.05  ? 408 LEU A CB  1 
ATOM   6148 C CG  . LEU B 1 247 ? -84.707  16.798  74.726  1.00 66.62  ? 408 LEU A CG  1 
ATOM   6149 C CD1 . LEU B 1 247 ? -84.528  18.114  73.984  1.00 65.98  ? 408 LEU A CD1 1 
ATOM   6150 C CD2 . LEU B 1 247 ? -83.397  16.371  75.370  1.00 67.01  ? 408 LEU A CD2 1 
ATOM   6151 N N   . ALA B 1 248 ? -87.835  14.673  74.565  1.00 72.45  ? 409 ALA A N   1 
ATOM   6152 C CA  . ALA B 1 248 ? -88.176  13.612  73.623  1.00 74.52  ? 409 ALA A CA  1 
ATOM   6153 C C   . ALA B 1 248 ? -89.374  14.034  72.779  1.00 76.28  ? 409 ALA A C   1 
ATOM   6154 O O   . ALA B 1 248 ? -89.338  13.942  71.553  1.00 77.41  ? 409 ALA A O   1 
ATOM   6155 C CB  . ALA B 1 248 ? -88.466  12.314  74.361  1.00 73.91  ? 409 ALA A CB  1 
ATOM   6156 N N   . GLU B 1 249 ? -90.417  14.521  73.450  1.00 77.97  ? 410 GLU A N   1 
ATOM   6157 C CA  . GLU B 1 249 ? -91.620  15.024  72.791  1.00 80.44  ? 410 GLU A CA  1 
ATOM   6158 C C   . GLU B 1 249 ? -91.319  16.214  71.874  1.00 79.14  ? 410 GLU A C   1 
ATOM   6159 O O   . GLU B 1 249 ? -91.831  16.282  70.754  1.00 79.39  ? 410 GLU A O   1 
ATOM   6160 C CB  . GLU B 1 249 ? -92.666  15.411  73.841  1.00 83.91  ? 410 GLU A CB  1 
ATOM   6161 C CG  . GLU B 1 249 ? -94.009  15.849  73.275  1.00 88.03  ? 410 GLU A CG  1 
ATOM   6162 C CD  . GLU B 1 249 ? -94.957  16.375  74.338  1.00 91.05  ? 410 GLU A CD  1 
ATOM   6163 O OE1 . GLU B 1 249 ? -94.556  16.461  75.522  1.00 92.08  ? 410 GLU A OE1 1 
ATOM   6164 O OE2 . GLU B 1 249 ? -96.109  16.707  73.987  1.00 92.86  ? 410 GLU A OE2 1 
ATOM   6165 N N   . ALA B 1 250 ? -90.483  17.134  72.355  1.00 77.30  ? 411 ALA A N   1 
ATOM   6166 C CA  . ALA B 1 250 ? -90.130  18.351  71.617  1.00 76.51  ? 411 ALA A CA  1 
ATOM   6167 C C   . ALA B 1 250 ? -89.383  18.075  70.311  1.00 76.58  ? 411 ALA A C   1 
ATOM   6168 O O   . ALA B 1 250 ? -89.541  18.810  69.336  1.00 76.87  ? 411 ALA A O   1 
ATOM   6169 C CB  . ALA B 1 250 ? -89.323  19.294  72.500  1.00 75.62  ? 411 ALA A CB  1 
ATOM   6170 N N   . VAL B 1 251 ? -88.573  17.020  70.298  1.00 76.76  ? 412 VAL A N   1 
ATOM   6171 C CA  . VAL B 1 251 ? -87.803  16.653  69.110  1.00 76.99  ? 412 VAL A CA  1 
ATOM   6172 C C   . VAL B 1 251 ? -88.534  15.589  68.269  1.00 78.91  ? 412 VAL A C   1 
ATOM   6173 O O   . VAL B 1 251 ? -88.053  15.177  67.209  1.00 78.07  ? 412 VAL A O   1 
ATOM   6174 C CB  . VAL B 1 251 ? -86.355  16.240  69.483  1.00 76.16  ? 412 VAL A CB  1 
ATOM   6175 C CG1 . VAL B 1 251 ? -86.301  14.811  70.012  1.00 77.16  ? 412 VAL A CG1 1 
ATOM   6176 C CG2 . VAL B 1 251 ? -85.413  16.428  68.302  1.00 75.34  ? 412 VAL A CG2 1 
ATOM   6177 N N   . GLY B 1 252 ? -89.700  15.158  68.752  1.00 80.92  ? 413 GLY A N   1 
ATOM   6178 C CA  . GLY B 1 252 ? -90.567  14.234  68.016  1.00 83.32  ? 413 GLY A CA  1 
ATOM   6179 C C   . GLY B 1 252 ? -90.317  12.756  68.261  1.00 85.48  ? 413 GLY A C   1 
ATOM   6180 O O   . GLY B 1 252 ? -90.468  11.938  67.352  1.00 85.30  ? 413 GLY A O   1 
ATOM   6181 N N   . CYS B 1 253 ? -89.944  12.415  69.492  1.00 88.09  ? 414 CYS A N   1 
ATOM   6182 C CA  . CYS B 1 253 ? -89.675  11.033  69.882  1.00 90.20  ? 414 CYS A CA  1 
ATOM   6183 C C   . CYS B 1 253 ? -90.720  10.518  70.871  1.00 91.50  ? 414 CYS A C   1 
ATOM   6184 O O   . CYS B 1 253 ? -91.352  11.316  71.568  1.00 94.32  ? 414 CYS A O   1 
ATOM   6185 C CB  . CYS B 1 253 ? -88.278  10.921  70.497  1.00 91.73  ? 414 CYS A CB  1 
ATOM   6186 S SG  . CYS B 1 253 ? -86.933  11.010  69.296  1.00 97.92  ? 414 CYS A SG  1 
ATOM   6187 N N   . PRO B 1 254 ? -90.915  9.182   70.928  1.00 91.44  ? 415 PRO A N   1 
ATOM   6188 C CA  . PRO B 1 254 ? -91.777  8.570   71.944  1.00 90.95  ? 415 PRO A CA  1 
ATOM   6189 C C   . PRO B 1 254 ? -91.444  9.076   73.346  1.00 89.76  ? 415 PRO A C   1 
ATOM   6190 O O   . PRO B 1 254 ? -90.280  9.053   73.751  1.00 89.66  ? 415 PRO A O   1 
ATOM   6191 C CB  . PRO B 1 254 ? -91.446  7.083   71.827  1.00 91.87  ? 415 PRO A CB  1 
ATOM   6192 C CG  . PRO B 1 254 ? -91.070  6.902   70.398  1.00 92.09  ? 415 PRO A CG  1 
ATOM   6193 C CD  . PRO B 1 254 ? -90.432  8.188   69.948  1.00 91.18  ? 415 PRO A CD  1 
ATOM   6194 N N   . HIS B 1 255 ? -92.462  9.536   74.067  1.00 89.74  ? 416 HIS A N   1 
ATOM   6195 C CA  . HIS B 1 255 ? -92.263  10.143  75.380  1.00 91.34  ? 416 HIS A CA  1 
ATOM   6196 C C   . HIS B 1 255 ? -93.162  9.542   76.462  1.00 92.85  ? 416 HIS A C   1 
ATOM   6197 O O   . HIS B 1 255 ? -93.593  10.240  77.382  1.00 94.53  ? 416 HIS A O   1 
ATOM   6198 C CB  . HIS B 1 255 ? -92.452  11.663  75.298  1.00 92.01  ? 416 HIS A CB  1 
ATOM   6199 C CG  . HIS B 1 255 ? -93.782  12.081  74.753  1.00 93.56  ? 416 HIS A CG  1 
ATOM   6200 N ND1 . HIS B 1 255 ? -94.031  12.192  73.402  1.00 93.73  ? 416 HIS A ND1 1 
ATOM   6201 C CD2 . HIS B 1 255 ? -94.935  12.421  75.377  1.00 93.62  ? 416 HIS A CD2 1 
ATOM   6202 C CE1 . HIS B 1 255 ? -95.281  12.577  73.216  1.00 93.76  ? 416 HIS A CE1 1 
ATOM   6203 N NE2 . HIS B 1 255 ? -95.851  12.724  74.399  1.00 94.42  ? 416 HIS A NE2 1 
ATOM   6204 N N   . GLU B 1 256 ? -93.430  8.243   76.349  1.00 94.85  ? 417 GLU A N   1 
ATOM   6205 C CA  . GLU B 1 256 ? -94.247  7.531   77.329  1.00 96.56  ? 417 GLU A CA  1 
ATOM   6206 C C   . GLU B 1 256 ? -93.378  6.995   78.465  1.00 95.31  ? 417 GLU A C   1 
ATOM   6207 O O   . GLU B 1 256 ? -92.395  6.296   78.210  1.00 96.00  ? 417 GLU A O   1 
ATOM   6208 C CB  . GLU B 1 256 ? -95.019  6.388   76.665  1.00 100.55 ? 417 GLU A CB  1 
ATOM   6209 C CG  . GLU B 1 256 ? -96.086  6.844   75.679  1.00 105.42 ? 417 GLU A CG  1 
ATOM   6210 C CD  . GLU B 1 256 ? -96.753  5.691   74.948  1.00 110.47 ? 417 GLU A CD  1 
ATOM   6211 O OE1 . GLU B 1 256 ? -96.139  4.607   74.829  1.00 111.97 ? 417 GLU A OE1 1 
ATOM   6212 O OE2 . GLU B 1 256 ? -97.899  5.873   74.484  1.00 113.29 ? 417 GLU A OE2 1 
ATOM   6213 N N   . PRO B 1 257 ? -93.742  7.318   79.724  1.00 94.04  ? 418 PRO A N   1 
ATOM   6214 C CA  . PRO B 1 257 ? -92.973  6.938   80.919  1.00 93.64  ? 418 PRO A CA  1 
ATOM   6215 C C   . PRO B 1 257 ? -92.763  5.432   81.106  1.00 93.77  ? 418 PRO A C   1 
ATOM   6216 O O   . PRO B 1 257 ? -91.921  5.033   81.913  1.00 92.92  ? 418 PRO A O   1 
ATOM   6217 C CB  . PRO B 1 257 ? -93.809  7.506   82.076  1.00 93.19  ? 418 PRO A CB  1 
ATOM   6218 C CG  . PRO B 1 257 ? -95.166  7.744   81.505  1.00 93.54  ? 418 PRO A CG  1 
ATOM   6219 C CD  . PRO B 1 257 ? -94.923  8.123   80.078  1.00 93.48  ? 418 PRO A CD  1 
ATOM   6220 N N   . SER B 1 258 ? -93.518  4.613   80.371  1.00 95.20  ? 419 SER A N   1 
ATOM   6221 C CA  . SER B 1 258 ? -93.381  3.154   80.423  1.00 96.08  ? 419 SER A CA  1 
ATOM   6222 C C   . SER B 1 258 ? -92.264  2.654   79.511  1.00 96.88  ? 419 SER A C   1 
ATOM   6223 O O   . SER B 1 258 ? -91.403  1.878   79.935  1.00 96.35  ? 419 SER A O   1 
ATOM   6224 C CB  . SER B 1 258 ? -94.697  2.472   80.041  1.00 95.69  ? 419 SER A CB  1 
ATOM   6225 O OG  . SER B 1 258 ? -95.718  2.770   80.974  1.00 98.24  ? 419 SER A OG  1 
ATOM   6226 N N   . LYS B 1 259 ? -92.294  3.104   78.258  1.00 97.43  ? 420 LYS A N   1 
ATOM   6227 C CA  . LYS B 1 259 ? -91.330  2.685   77.244  1.00 96.57  ? 420 LYS A CA  1 
ATOM   6228 C C   . LYS B 1 259 ? -90.193  3.698   77.131  1.00 94.44  ? 420 LYS A C   1 
ATOM   6229 O O   . LYS B 1 259 ? -90.053  4.389   76.117  1.00 93.63  ? 420 LYS A O   1 
ATOM   6230 C CB  . LYS B 1 259 ? -92.028  2.489   75.891  1.00 97.71  ? 420 LYS A CB  1 
ATOM   6231 C CG  . LYS B 1 259 ? -93.151  1.462   75.910  1.00 99.14  ? 420 LYS A CG  1 
ATOM   6232 C CD  . LYS B 1 259 ? -94.124  1.680   74.763  1.00 99.28  ? 420 LYS A CD  1 
ATOM   6233 C CE  . LYS B 1 259 ? -95.374  0.833   74.935  1.00 98.53  ? 420 LYS A CE  1 
ATOM   6234 N NZ  . LYS B 1 259 ? -96.408  1.170   73.919  1.00 97.77  ? 420 LYS A NZ  1 
ATOM   6235 N N   . LEU B 1 260 ? -89.386  3.780   78.188  1.00 92.46  ? 421 LEU A N   1 
ATOM   6236 C CA  . LEU B 1 260 ? -88.235  4.684   78.235  1.00 90.93  ? 421 LEU A CA  1 
ATOM   6237 C C   . LEU B 1 260 ? -87.133  4.231   77.276  1.00 93.44  ? 421 LEU A C   1 
ATOM   6238 O O   . LEU B 1 260 ? -86.304  5.037   76.849  1.00 94.40  ? 421 LEU A O   1 
ATOM   6239 C CB  . LEU B 1 260 ? -87.688  4.794   79.664  1.00 86.86  ? 421 LEU A CB  1 
ATOM   6240 C CG  . LEU B 1 260 ? -88.653  5.195   80.787  1.00 84.56  ? 421 LEU A CG  1 
ATOM   6241 C CD1 . LEU B 1 260 ? -88.030  4.935   82.149  1.00 83.63  ? 421 LEU A CD1 1 
ATOM   6242 C CD2 . LEU B 1 260 ? -89.089  6.647   80.670  1.00 83.94  ? 421 LEU A CD2 1 
ATOM   6243 N N   . SER B 1 261 ? -87.137  2.940   76.949  1.00 95.23  ? 422 SER A N   1 
ATOM   6244 C CA  . SER B 1 261 ? -86.218  2.365   75.969  1.00 95.29  ? 422 SER A CA  1 
ATOM   6245 C C   . SER B 1 261 ? -86.498  2.894   74.562  1.00 94.96  ? 422 SER A C   1 
ATOM   6246 O O   . SER B 1 261 ? -85.574  3.067   73.767  1.00 97.87  ? 422 SER A O   1 
ATOM   6247 C CB  . SER B 1 261 ? -86.302  0.837   75.987  1.00 95.98  ? 422 SER A CB  1 
ATOM   6248 O OG  . SER B 1 261 ? -87.616  0.395   75.690  1.00 97.91  ? 422 SER A OG  1 
ATOM   6249 N N   . ASP B 1 262 ? -87.772  3.150   74.265  1.00 92.95  ? 423 ASP A N   1 
ATOM   6250 C CA  . ASP B 1 262 ? -88.177  3.749   72.991  1.00 91.23  ? 423 ASP A CA  1 
ATOM   6251 C C   . ASP B 1 262 ? -87.704  5.197   72.874  1.00 88.32  ? 423 ASP A C   1 
ATOM   6252 O O   . ASP B 1 262 ? -87.446  5.685   71.770  1.00 88.29  ? 423 ASP A O   1 
ATOM   6253 C CB  . ASP B 1 262 ? -89.700  3.693   72.821  1.00 92.90  ? 423 ASP A CB  1 
ATOM   6254 C CG  . ASP B 1 262 ? -90.209  2.302   72.464  1.00 93.36  ? 423 ASP A CG  1 
ATOM   6255 O OD1 . ASP B 1 262 ? -89.412  1.338   72.467  1.00 93.37  ? 423 ASP A OD1 1 
ATOM   6256 O OD2 . ASP B 1 262 ? -91.419  2.175   72.179  1.00 93.06  ? 423 ASP A OD2 1 
ATOM   6257 N N   . ALA B 1 263 ? -87.596  5.869   74.018  1.00 84.45  ? 424 ALA A N   1 
ATOM   6258 C CA  . ALA B 1 263 ? -87.188  7.270   74.073  1.00 81.79  ? 424 ALA A CA  1 
ATOM   6259 C C   . ALA B 1 263 ? -85.698  7.458   73.782  1.00 80.88  ? 424 ALA A C   1 
ATOM   6260 O O   . ALA B 1 263 ? -85.336  8.226   72.890  1.00 81.25  ? 424 ALA A O   1 
ATOM   6261 C CB  . ALA B 1 263 ? -87.556  7.878   75.418  1.00 81.34  ? 424 ALA A CB  1 
ATOM   6262 N N   . VAL B 1 264 ? -84.846  6.753   74.528  1.00 78.54  ? 425 VAL A N   1 
ATOM   6263 C CA  . VAL B 1 264 ? -83.389  6.856   74.364  1.00 76.65  ? 425 VAL A CA  1 
ATOM   6264 C C   . VAL B 1 264 ? -82.914  6.439   72.976  1.00 77.41  ? 425 VAL A C   1 
ATOM   6265 O O   . VAL B 1 264 ? -82.007  7.058   72.418  1.00 78.25  ? 425 VAL A O   1 
ATOM   6266 C CB  . VAL B 1 264 ? -82.604  6.058   75.431  1.00 75.92  ? 425 VAL A CB  1 
ATOM   6267 C CG1 . VAL B 1 264 ? -82.574  6.812   76.747  1.00 75.94  ? 425 VAL A CG1 1 
ATOM   6268 C CG2 . VAL B 1 264 ? -83.177  4.659   75.618  1.00 77.03  ? 425 VAL A CG2 1 
ATOM   6269 N N   . GLU B 1 265 ? -83.533  5.395   72.428  1.00 77.59  ? 426 GLU A N   1 
ATOM   6270 C CA  . GLU B 1 265 ? -83.186  4.892   71.102  1.00 78.68  ? 426 GLU A CA  1 
ATOM   6271 C C   . GLU B 1 265 ? -83.472  5.924   70.018  1.00 78.34  ? 426 GLU A C   1 
ATOM   6272 O O   . GLU B 1 265 ? -82.635  6.162   69.144  1.00 76.84  ? 426 GLU A O   1 
ATOM   6273 C CB  . GLU B 1 265 ? -83.927  3.589   70.806  1.00 80.57  ? 426 GLU A CB  1 
ATOM   6274 C CG  . GLU B 1 265 ? -83.306  2.360   71.453  1.00 83.40  ? 426 GLU A CG  1 
ATOM   6275 C CD  . GLU B 1 265 ? -84.043  1.078   71.108  1.00 85.78  ? 426 GLU A CD  1 
ATOM   6276 O OE1 . GLU B 1 265 ? -84.643  1.001   70.013  1.00 85.83  ? 426 GLU A OE1 1 
ATOM   6277 O OE2 . GLU B 1 265 ? -84.017  0.140   71.933  1.00 87.40  ? 426 GLU A OE2 1 
ATOM   6278 N N   . CYS B 1 266 ? -84.653  6.536   70.088  1.00 79.58  ? 427 CYS A N   1 
ATOM   6279 C CA  . CYS B 1 266 ? -85.031  7.601   69.165  1.00 81.63  ? 427 CYS A CA  1 
ATOM   6280 C C   . CYS B 1 266 ? -84.111  8.812   69.329  1.00 78.19  ? 427 CYS A C   1 
ATOM   6281 O O   . CYS B 1 266 ? -83.665  9.397   68.338  1.00 78.02  ? 427 CYS A O   1 
ATOM   6282 C CB  . CYS B 1 266 ? -86.496  8.001   69.372  1.00 87.40  ? 427 CYS A CB  1 
ATOM   6283 S SG  . CYS B 1 266 ? -87.103  9.276   68.237  1.00 98.16  ? 427 CYS A SG  1 
ATOM   6284 N N   . LEU B 1 267 ? -83.823  9.169   70.581  1.00 73.24  ? 428 LEU A N   1 
ATOM   6285 C CA  . LEU B 1 267 ? -82.950  10.300  70.896  1.00 69.09  ? 428 LEU A CA  1 
ATOM   6286 C C   . LEU B 1 267 ? -81.528  10.086  70.389  1.00 67.58  ? 428 LEU A C   1 
ATOM   6287 O O   . LEU B 1 267 ? -80.884  11.034  69.941  1.00 67.22  ? 428 LEU A O   1 
ATOM   6288 C CB  . LEU B 1 267 ? -82.937  10.587  72.401  1.00 67.93  ? 428 LEU A CB  1 
ATOM   6289 C CG  . LEU B 1 267 ? -84.167  11.247  73.034  1.00 67.30  ? 428 LEU A CG  1 
ATOM   6290 C CD1 . LEU B 1 267 ? -84.091  11.153  74.549  1.00 67.02  ? 428 LEU A CD1 1 
ATOM   6291 C CD2 . LEU B 1 267 ? -84.329  12.695  72.597  1.00 67.00  ? 428 LEU A CD2 1 
ATOM   6292 N N   . ARG B 1 268 ? -81.050  8.844   70.457  1.00 67.20  ? 429 ARG A N   1 
ATOM   6293 C CA  . ARG B 1 268 ? -79.736  8.484   69.921  1.00 67.64  ? 429 ARG A CA  1 
ATOM   6294 C C   . ARG B 1 268 ? -79.673  8.674   68.407  1.00 67.64  ? 429 ARG A C   1 
ATOM   6295 O O   . ARG B 1 268 ? -78.591  8.841   67.843  1.00 67.58  ? 429 ARG A O   1 
ATOM   6296 C CB  . ARG B 1 268 ? -79.371  7.039   70.277  1.00 68.59  ? 429 ARG A CB  1 
ATOM   6297 C CG  . ARG B 1 268 ? -78.709  6.868   71.637  1.00 70.50  ? 429 ARG A CG  1 
ATOM   6298 C CD  . ARG B 1 268 ? -78.042  5.504   71.773  1.00 72.17  ? 429 ARG A CD  1 
ATOM   6299 N NE  . ARG B 1 268 ? -79.009  4.414   71.911  1.00 73.68  ? 429 ARG A NE  1 
ATOM   6300 C CZ  . ARG B 1 268 ? -79.397  3.888   73.071  1.00 74.56  ? 429 ARG A CZ  1 
ATOM   6301 N NH1 . ARG B 1 268 ? -78.901  4.342   74.219  1.00 75.44  ? 429 ARG A NH1 1 
ATOM   6302 N NH2 . ARG B 1 268 ? -80.287  2.902   73.082  1.00 72.86  ? 429 ARG A NH2 1 
ATOM   6303 N N   . GLY B 1 269 ? -80.837  8.651   67.761  1.00 68.01  ? 430 GLY A N   1 
ATOM   6304 C CA  . GLY B 1 269 ? -80.929  8.777   66.309  1.00 68.87  ? 430 GLY A CA  1 
ATOM   6305 C C   . GLY B 1 269 ? -80.879  10.202  65.788  1.00 69.78  ? 430 GLY A C   1 
ATOM   6306 O O   . GLY B 1 269 ? -80.420  10.437  64.668  1.00 70.85  ? 430 GLY A O   1 
ATOM   6307 N N   . LYS B 1 270 ? -81.346  11.151  66.601  1.00 69.57  ? 431 LYS A N   1 
ATOM   6308 C CA  . LYS B 1 270 ? -81.438  12.563  66.203  1.00 67.99  ? 431 LYS A CA  1 
ATOM   6309 C C   . LYS B 1 270 ? -80.073  13.245  66.083  1.00 68.54  ? 431 LYS A C   1 
ATOM   6310 O O   . LYS B 1 270 ? -79.075  12.763  66.625  1.00 69.26  ? 431 LYS A O   1 
ATOM   6311 C CB  . LYS B 1 270 ? -82.330  13.343  67.179  1.00 65.97  ? 431 LYS A CB  1 
ATOM   6312 C CG  . LYS B 1 270 ? -83.772  12.858  67.265  1.00 64.83  ? 431 LYS A CG  1 
ATOM   6313 C CD  . LYS B 1 270 ? -84.548  13.129  65.984  1.00 63.68  ? 431 LYS A CD  1 
ATOM   6314 C CE  . LYS B 1 270 ? -85.945  12.533  66.050  1.00 61.65  ? 431 LYS A CE  1 
ATOM   6315 N NZ  . LYS B 1 270 ? -86.641  12.624  64.740  1.00 59.33  ? 431 LYS A NZ  1 
ATOM   6316 N N   . ASP B 1 271 ? -80.041  14.362  65.358  1.00 68.23  ? 432 ASP A N   1 
ATOM   6317 C CA  . ASP B 1 271 ? -78.839  15.187  65.236  1.00 68.24  ? 432 ASP A CA  1 
ATOM   6318 C C   . ASP B 1 271 ? -78.529  15.843  66.587  1.00 67.10  ? 432 ASP A C   1 
ATOM   6319 O O   . ASP B 1 271 ? -79.445  16.273  67.288  1.00 66.68  ? 432 ASP A O   1 
ATOM   6320 C CB  . ASP B 1 271 ? -79.033  16.238  64.134  1.00 69.83  ? 432 ASP A CB  1 
ATOM   6321 C CG  . ASP B 1 271 ? -77.793  17.088  63.897  1.00 71.85  ? 432 ASP A CG  1 
ATOM   6322 O OD1 . ASP B 1 271 ? -77.526  18.001  64.703  1.00 72.60  ? 432 ASP A OD1 1 
ATOM   6323 O OD2 . ASP B 1 271 ? -77.093  16.855  62.890  1.00 73.19  ? 432 ASP A OD2 1 
ATOM   6324 N N   . PRO B 1 272 ? -77.237  15.905  66.968  1.00 66.65  ? 433 PRO A N   1 
ATOM   6325 C CA  . PRO B 1 272 ? -76.890  16.479  68.269  1.00 66.97  ? 433 PRO A CA  1 
ATOM   6326 C C   . PRO B 1 272 ? -77.294  17.946  68.415  1.00 67.62  ? 433 PRO A C   1 
ATOM   6327 O O   . PRO B 1 272 ? -77.684  18.366  69.505  1.00 68.77  ? 433 PRO A O   1 
ATOM   6328 C CB  . PRO B 1 272 ? -75.361  16.333  68.327  1.00 66.30  ? 433 PRO A CB  1 
ATOM   6329 C CG  . PRO B 1 272 ? -74.930  16.161  66.911  1.00 66.20  ? 433 PRO A CG  1 
ATOM   6330 C CD  . PRO B 1 272 ? -76.046  15.399  66.264  1.00 66.94  ? 433 PRO A CD  1 
ATOM   6331 N N   . HIS B 1 273 ? -77.209  18.707  67.325  1.00 66.83  ? 434 HIS A N   1 
ATOM   6332 C CA  . HIS B 1 273 ? -77.515  20.137  67.353  1.00 65.53  ? 434 HIS A CA  1 
ATOM   6333 C C   . HIS B 1 273 ? -78.998  20.425  67.568  1.00 64.82  ? 434 HIS A C   1 
ATOM   6334 O O   . HIS B 1 273 ? -79.344  21.337  68.316  1.00 66.94  ? 434 HIS A O   1 
ATOM   6335 C CB  . HIS B 1 273 ? -77.006  20.837  66.092  1.00 65.16  ? 434 HIS A CB  1 
ATOM   6336 C CG  . HIS B 1 273 ? -75.525  21.041  66.075  1.00 64.93  ? 434 HIS A CG  1 
ATOM   6337 N ND1 . HIS B 1 273 ? -74.667  20.208  65.388  1.00 65.66  ? 434 HIS A ND1 1 
ATOM   6338 C CD2 . HIS B 1 273 ? -74.748  21.978  66.666  1.00 64.68  ? 434 HIS A CD2 1 
ATOM   6339 C CE1 . HIS B 1 273 ? -73.425  20.628  65.551  1.00 65.89  ? 434 HIS A CE1 1 
ATOM   6340 N NE2 . HIS B 1 273 ? -73.447  21.700  66.323  1.00 66.41  ? 434 HIS A NE2 1 
ATOM   6341 N N   . VAL B 1 274 ? -79.869  19.653  66.922  1.00 63.24  ? 435 VAL A N   1 
ATOM   6342 C CA  . VAL B 1 274 ? -81.313  19.808  67.130  1.00 62.77  ? 435 VAL A CA  1 
ATOM   6343 C C   . VAL B 1 274 ? -81.695  19.370  68.550  1.00 62.81  ? 435 VAL A C   1 
ATOM   6344 O O   . VAL B 1 274 ? -82.653  19.881  69.137  1.00 63.74  ? 435 VAL A O   1 
ATOM   6345 C CB  . VAL B 1 274 ? -82.157  19.102  66.031  1.00 61.36  ? 435 VAL A CB  1 
ATOM   6346 C CG1 . VAL B 1 274 ? -81.823  17.625  65.916  1.00 61.24  ? 435 VAL A CG1 1 
ATOM   6347 C CG2 . VAL B 1 274 ? -83.651  19.304  66.254  1.00 62.02  ? 435 VAL A CG2 1 
ATOM   6348 N N   . LEU B 1 275 ? -80.909  18.451  69.104  1.00 62.12  ? 436 LEU A N   1 
ATOM   6349 C CA  . LEU B 1 275 ? -81.138  17.943  70.446  1.00 61.84  ? 436 LEU A CA  1 
ATOM   6350 C C   . LEU B 1 275 ? -80.846  19.008  71.507  1.00 62.04  ? 436 LEU A C   1 
ATOM   6351 O O   . LEU B 1 275 ? -81.635  19.196  72.433  1.00 62.62  ? 436 LEU A O   1 
ATOM   6352 C CB  . LEU B 1 275 ? -80.296  16.684  70.680  1.00 61.10  ? 436 LEU A CB  1 
ATOM   6353 C CG  . LEU B 1 275 ? -80.955  15.499  71.388  1.00 60.23  ? 436 LEU A CG  1 
ATOM   6354 C CD1 . LEU B 1 275 ? -82.128  14.960  70.583  1.00 59.48  ? 436 LEU A CD1 1 
ATOM   6355 C CD2 . LEU B 1 275 ? -79.929  14.404  71.621  1.00 60.12  ? 436 LEU A CD2 1 
ATOM   6356 N N   . VAL B 1 276 ? -79.728  19.715  71.353  1.00 62.67  ? 437 VAL A N   1 
ATOM   6357 C CA  . VAL B 1 276 ? -79.320  20.744  72.318  1.00 62.86  ? 437 VAL A CA  1 
ATOM   6358 C C   . VAL B 1 276 ? -80.108  22.044  72.167  1.00 64.20  ? 437 VAL A C   1 
ATOM   6359 O O   . VAL B 1 276 ? -80.100  22.884  73.070  1.00 65.33  ? 437 VAL A O   1 
ATOM   6360 C CB  . VAL B 1 276 ? -77.798  21.043  72.272  1.00 62.20  ? 437 VAL A CB  1 
ATOM   6361 C CG1 . VAL B 1 276 ? -76.990  19.783  72.545  1.00 62.29  ? 437 VAL A CG1 1 
ATOM   6362 C CG2 . VAL B 1 276 ? -77.390  21.672  70.946  1.00 61.93  ? 437 VAL A CG2 1 
ATOM   6363 N N   . ASN B 1 277 ? -80.783  22.200  71.029  1.00 65.79  ? 438 ASN A N   1 
ATOM   6364 C CA  . ASN B 1 277 ? -81.525  23.424  70.723  1.00 67.25  ? 438 ASN A CA  1 
ATOM   6365 C C   . ASN B 1 277 ? -82.989  23.420  71.169  1.00 69.16  ? 438 ASN A C   1 
ATOM   6366 O O   . ASN B 1 277 ? -83.651  24.458  71.123  1.00 71.50  ? 438 ASN A O   1 
ATOM   6367 C CB  . ASN B 1 277 ? -81.417  23.766  69.232  1.00 66.51  ? 438 ASN A CB  1 
ATOM   6368 C CG  . ASN B 1 277 ? -80.162  24.558  68.903  1.00 67.72  ? 438 ASN A CG  1 
ATOM   6369 O OD1 . ASN B 1 277 ? -79.960  25.663  69.409  1.00 68.43  ? 438 ASN A OD1 1 
ATOM   6370 N ND2 . ASN B 1 277 ? -79.318  24.002  68.041  1.00 67.68  ? 438 ASN A ND2 1 
ATOM   6371 N N   . ASN B 1 278 ? -83.485  22.262  71.605  1.00 70.21  ? 439 ASN A N   1 
ATOM   6372 C CA  . ASN B 1 278 ? -84.879  22.124  72.041  1.00 70.20  ? 439 ASN A CA  1 
ATOM   6373 C C   . ASN B 1 278 ? -85.040  21.829  73.535  1.00 71.30  ? 439 ASN A C   1 
ATOM   6374 O O   . ASN B 1 278 ? -86.088  21.345  73.970  1.00 71.23  ? 439 ASN A O   1 
ATOM   6375 C CB  . ASN B 1 278 ? -85.593  21.050  71.214  1.00 70.39  ? 439 ASN A CB  1 
ATOM   6376 C CG  . ASN B 1 278 ? -85.688  21.405  69.741  1.00 71.15  ? 439 ASN A CG  1 
ATOM   6377 O OD1 . ASN B 1 278 ? -84.879  22.167  69.214  1.00 71.43  ? 439 ASN A OD1 1 
ATOM   6378 N ND2 . ASN B 1 278 ? -86.680  20.840  69.064  1.00 73.21  ? 439 ASN A ND2 1 
ATOM   6379 N N   . GLU B 1 279 ? -84.005  22.133  74.314  1.00 74.07  ? 440 GLU A N   1 
ATOM   6380 C CA  . GLU B 1 279 ? -84.000  21.875  75.757  1.00 77.13  ? 440 GLU A CA  1 
ATOM   6381 C C   . GLU B 1 279 ? -84.722  22.965  76.543  1.00 78.30  ? 440 GLU A C   1 
ATOM   6382 O O   . GLU B 1 279 ? -85.259  22.711  77.624  1.00 78.16  ? 440 GLU A O   1 
ATOM   6383 C CB  . GLU B 1 279 ? -82.565  21.767  76.277  1.00 79.32  ? 440 GLU A CB  1 
ATOM   6384 C CG  . GLU B 1 279 ? -81.705  20.719  75.591  1.00 80.75  ? 440 GLU A CG  1 
ATOM   6385 C CD  . GLU B 1 279 ? -80.261  20.745  76.057  1.00 82.31  ? 440 GLU A CD  1 
ATOM   6386 O OE1 . GLU B 1 279 ? -79.452  19.983  75.491  1.00 83.83  ? 440 GLU A OE1 1 
ATOM   6387 O OE2 . GLU B 1 279 ? -79.928  21.522  76.981  1.00 82.77  ? 440 GLU A OE2 1 
ATOM   6388 N N   . TRP B 1 280 ? -84.718  24.177  75.993  1.00 79.60  ? 441 TRP A N   1 
ATOM   6389 C CA  . TRP B 1 280 ? -85.233  25.354  76.685  1.00 80.72  ? 441 TRP A CA  1 
ATOM   6390 C C   . TRP B 1 280 ? -86.724  25.559  76.442  1.00 82.48  ? 441 TRP A C   1 
ATOM   6391 O O   . TRP B 1 280 ? -87.204  25.419  75.316  1.00 83.23  ? 441 TRP A O   1 
ATOM   6392 C CB  . TRP B 1 280 ? -84.441  26.598  76.271  1.00 79.03  ? 441 TRP A CB  1 
ATOM   6393 C CG  . TRP B 1 280 ? -82.959  26.440  76.456  1.00 77.78  ? 441 TRP A CG  1 
ATOM   6394 C CD1 . TRP B 1 280 ? -82.067  25.953  75.544  1.00 78.55  ? 441 TRP A CD1 1 
ATOM   6395 C CD2 . TRP B 1 280 ? -82.198  26.758  77.630  1.00 76.62  ? 441 TRP A CD2 1 
ATOM   6396 N NE1 . TRP B 1 280 ? -80.799  25.952  76.074  1.00 78.38  ? 441 TRP A NE1 1 
ATOM   6397 C CE2 . TRP B 1 280 ? -80.850  26.442  77.353  1.00 76.88  ? 441 TRP A CE2 1 
ATOM   6398 C CE3 . TRP B 1 280 ? -82.524  27.283  78.888  1.00 75.35  ? 441 TRP A CE3 1 
ATOM   6399 C CZ2 . TRP B 1 280 ? -79.826  26.633  78.288  1.00 75.28  ? 441 TRP A CZ2 1 
ATOM   6400 C CZ3 . TRP B 1 280 ? -81.504  27.474  79.818  1.00 74.11  ? 441 TRP A CZ3 1 
ATOM   6401 C CH2 . TRP B 1 280 ? -80.172  27.149  79.510  1.00 73.70  ? 441 TRP A CH2 1 
ATOM   6402 N N   . GLY B 1 281 ? -87.445  25.885  77.511  1.00 85.00  ? 442 GLY A N   1 
ATOM   6403 C CA  . GLY B 1 281 ? -88.879  26.152  77.440  1.00 88.86  ? 442 GLY A CA  1 
ATOM   6404 C C   . GLY B 1 281 ? -89.322  27.053  78.574  1.00 90.97  ? 442 GLY A C   1 
ATOM   6405 O O   . GLY B 1 281 ? -88.898  28.208  78.661  1.00 92.25  ? 442 GLY A O   1 
ATOM   6406 N N   . THR B 1 282 ? -90.181  26.523  79.441  1.00 92.27  ? 443 THR A N   1 
ATOM   6407 C CA  . THR B 1 282 ? -90.610  27.247  80.635  1.00 92.92  ? 443 THR A CA  1 
ATOM   6408 C C   . THR B 1 282 ? -89.630  27.002  81.783  1.00 90.07  ? 443 THR A C   1 
ATOM   6409 O O   . THR B 1 282 ? -89.773  26.052  82.559  1.00 89.58  ? 443 THR A O   1 
ATOM   6410 C CB  . THR B 1 282 ? -92.065  26.911  81.052  1.00 94.79  ? 443 THR A CB  1 
ATOM   6411 O OG1 . THR B 1 282 ? -92.278  25.494  80.992  1.00 96.62  ? 443 THR A OG1 1 
ATOM   6412 C CG2 . THR B 1 282 ? -93.069  27.614  80.140  1.00 92.89  ? 443 THR A CG2 1 
ATOM   6413 N N   . LEU B 1 283 ? -88.618  27.861  81.860  1.00 87.41  ? 444 LEU A N   1 
ATOM   6414 C CA  . LEU B 1 283 ? -87.623  27.811  82.922  1.00 86.12  ? 444 LEU A CA  1 
ATOM   6415 C C   . LEU B 1 283 ? -87.447  29.196  83.529  1.00 85.47  ? 444 LEU A C   1 
ATOM   6416 O O   . LEU B 1 283 ? -87.310  30.183  82.803  1.00 86.84  ? 444 LEU A O   1 
ATOM   6417 C CB  . LEU B 1 283 ? -86.285  27.302  82.382  1.00 87.24  ? 444 LEU A CB  1 
ATOM   6418 C CG  . LEU B 1 283 ? -86.169  25.816  82.025  1.00 88.93  ? 444 LEU A CG  1 
ATOM   6419 C CD1 . LEU B 1 283 ? -85.033  25.593  81.038  1.00 88.92  ? 444 LEU A CD1 1 
ATOM   6420 C CD2 . LEU B 1 283 ? -85.985  24.952  83.268  1.00 87.54  ? 444 LEU A CD2 1 
ATOM   6421 N N   . GLY B 1 284 ? -87.453  29.262  84.859  1.00 84.12  ? 445 GLY A N   1 
ATOM   6422 C CA  . GLY B 1 284 ? -87.244  30.517  85.587  1.00 81.37  ? 445 GLY A CA  1 
ATOM   6423 C C   . GLY B 1 284 ? -85.818  31.025  85.474  1.00 78.44  ? 445 GLY A C   1 
ATOM   6424 O O   . GLY B 1 284 ? -85.023  30.499  84.691  1.00 78.39  ? 445 GLY A O   1 
ATOM   6425 N N   . ILE B 1 285 ? -85.490  32.057  86.247  1.00 75.58  ? 446 ILE A N   1 
ATOM   6426 C CA  . ILE B 1 285 ? -84.128  32.591  86.251  1.00 73.79  ? 446 ILE A CA  1 
ATOM   6427 C C   . ILE B 1 285 ? -83.187  31.628  86.976  1.00 73.23  ? 446 ILE A C   1 
ATOM   6428 O O   . ILE B 1 285 ? -83.580  30.987  87.955  1.00 73.96  ? 446 ILE A O   1 
ATOM   6429 C CB  . ILE B 1 285 ? -84.049  34.028  86.833  1.00 73.03  ? 446 ILE A CB  1 
ATOM   6430 C CG1 . ILE B 1 285 ? -82.655  34.630  86.596  1.00 72.30  ? 446 ILE A CG1 1 
ATOM   6431 C CG2 . ILE B 1 285 ? -84.443  34.057  88.309  1.00 72.94  ? 446 ILE A CG2 1 
ATOM   6432 C CD1 . ILE B 1 285 ? -82.594  36.141  86.651  1.00 71.45  ? 446 ILE A CD1 1 
ATOM   6433 N N   . CYS B 1 286 ? -81.960  31.518  86.467  1.00 71.75  ? 447 CYS A N   1 
ATOM   6434 C CA  . CYS B 1 286 ? -80.921  30.659  87.041  1.00 71.15  ? 447 CYS A CA  1 
ATOM   6435 C C   . CYS B 1 286 ? -81.385  29.230  87.325  1.00 70.68  ? 447 CYS A C   1 
ATOM   6436 O O   . CYS B 1 286 ? -81.163  28.701  88.416  1.00 72.15  ? 447 CYS A O   1 
ATOM   6437 C CB  . CYS B 1 286 ? -80.326  31.288  88.304  1.00 72.08  ? 447 CYS A CB  1 
ATOM   6438 S SG  . CYS B 1 286 ? -79.218  32.674  87.990  1.00 75.92  ? 447 CYS A SG  1 
ATOM   6439 N N   . GLU B 1 287 ? -82.051  28.626  86.348  1.00 69.78  ? 448 GLU A N   1 
ATOM   6440 C CA  . GLU B 1 287 ? -82.325  27.191  86.372  1.00 69.06  ? 448 GLU A CA  1 
ATOM   6441 C C   . GLU B 1 287 ? -82.162  26.610  84.974  1.00 67.52  ? 448 GLU A C   1 
ATOM   6442 O O   . GLU B 1 287 ? -82.773  27.080  84.009  1.00 65.86  ? 448 GLU A O   1 
ATOM   6443 C CB  . GLU B 1 287 ? -83.690  26.854  86.996  1.00 70.75  ? 448 GLU A CB  1 
ATOM   6444 C CG  . GLU B 1 287 ? -84.872  27.680  86.512  1.00 72.91  ? 448 GLU A CG  1 
ATOM   6445 C CD  . GLU B 1 287 ? -86.184  27.260  87.156  1.00 74.56  ? 448 GLU A CD  1 
ATOM   6446 O OE1 . GLU B 1 287 ? -86.271  27.241  88.404  1.00 74.21  ? 448 GLU A OE1 1 
ATOM   6447 O OE2 . GLU B 1 287 ? -87.138  26.956  86.408  1.00 75.78  ? 448 GLU A OE2 1 
ATOM   6448 N N   . PHE B 1 288 ? -81.311  25.594  84.883  1.00 66.49  ? 449 PHE A N   1 
ATOM   6449 C CA  . PHE B 1 288 ? -80.872  25.050  83.605  1.00 65.08  ? 449 PHE A CA  1 
ATOM   6450 C C   . PHE B 1 288 ? -81.470  23.663  83.352  1.00 65.38  ? 449 PHE A C   1 
ATOM   6451 O O   . PHE B 1 288 ? -81.612  22.871  84.289  1.00 65.53  ? 449 PHE A O   1 
ATOM   6452 C CB  . PHE B 1 288 ? -79.340  25.039  83.554  1.00 64.20  ? 449 PHE A CB  1 
ATOM   6453 C CG  . PHE B 1 288 ? -78.713  26.332  84.012  1.00 63.63  ? 449 PHE A CG  1 
ATOM   6454 C CD1 . PHE B 1 288 ? -78.889  27.506  83.282  1.00 63.24  ? 449 PHE A CD1 1 
ATOM   6455 C CD2 . PHE B 1 288 ? -77.958  26.383  85.179  1.00 63.60  ? 449 PHE A CD2 1 
ATOM   6456 C CE1 . PHE B 1 288 ? -78.319  28.699  83.703  1.00 62.46  ? 449 PHE A CE1 1 
ATOM   6457 C CE2 . PHE B 1 288 ? -77.384  27.574  85.604  1.00 62.23  ? 449 PHE A CE2 1 
ATOM   6458 C CZ  . PHE B 1 288 ? -77.566  28.733  84.866  1.00 62.09  ? 449 PHE A CZ  1 
ATOM   6459 N N   . PRO B 1 289 ? -81.821  23.366  82.082  1.00 65.37  ? 450 PRO A N   1 
ATOM   6460 C CA  . PRO B 1 289 ? -82.648  22.202  81.742  1.00 65.96  ? 450 PRO A CA  1 
ATOM   6461 C C   . PRO B 1 289 ? -82.020  20.854  82.102  1.00 65.54  ? 450 PRO A C   1 
ATOM   6462 O O   . PRO B 1 289 ? -82.718  19.967  82.599  1.00 65.87  ? 450 PRO A O   1 
ATOM   6463 C CB  . PRO B 1 289 ? -82.823  22.326  80.224  1.00 66.21  ? 450 PRO A CB  1 
ATOM   6464 C CG  . PRO B 1 289 ? -81.625  23.087  79.770  1.00 66.42  ? 450 PRO A CG  1 
ATOM   6465 C CD  . PRO B 1 289 ? -81.343  24.064  80.874  1.00 65.69  ? 450 PRO A CD  1 
ATOM   6466 N N   . PHE B 1 290 ? -80.721  20.705  81.851  1.00 64.37  ? 451 PHE A N   1 
ATOM   6467 C CA  . PHE B 1 290 ? -80.027  19.458  82.138  1.00 62.57  ? 451 PHE A CA  1 
ATOM   6468 C C   . PHE B 1 290 ? -78.749  19.702  82.924  1.00 62.05  ? 451 PHE A C   1 
ATOM   6469 O O   . PHE B 1 290 ? -77.831  20.380  82.455  1.00 62.49  ? 451 PHE A O   1 
ATOM   6470 C CB  . PHE B 1 290 ? -79.756  18.681  80.850  1.00 62.76  ? 451 PHE A CB  1 
ATOM   6471 C CG  . PHE B 1 290 ? -81.006  18.268  80.128  1.00 62.92  ? 451 PHE A CG  1 
ATOM   6472 C CD1 . PHE B 1 290 ? -81.742  17.167  80.560  1.00 62.72  ? 451 PHE A CD1 1 
ATOM   6473 C CD2 . PHE B 1 290 ? -81.458  18.987  79.028  1.00 62.71  ? 451 PHE A CD2 1 
ATOM   6474 C CE1 . PHE B 1 290 ? -82.900  16.786  79.901  1.00 62.74  ? 451 PHE A CE1 1 
ATOM   6475 C CE2 . PHE B 1 290 ? -82.616  18.610  78.364  1.00 63.14  ? 451 PHE A CE2 1 
ATOM   6476 C CZ  . PHE B 1 290 ? -83.338  17.509  78.802  1.00 63.03  ? 451 PHE A CZ  1 
ATOM   6477 N N   . VAL B 1 291 ? -78.725  19.153  84.137  1.00 61.06  ? 452 VAL A N   1 
ATOM   6478 C CA  . VAL B 1 291 ? -77.630  19.339  85.089  1.00 60.19  ? 452 VAL A CA  1 
ATOM   6479 C C   . VAL B 1 291 ? -77.354  18.022  85.819  1.00 59.75  ? 452 VAL A C   1 
ATOM   6480 O O   . VAL B 1 291 ? -78.021  17.020  85.546  1.00 59.60  ? 452 VAL A O   1 
ATOM   6481 C CB  . VAL B 1 291 ? -77.944  20.453  86.123  1.00 60.06  ? 452 VAL A CB  1 
ATOM   6482 C CG1 . VAL B 1 291 ? -77.868  21.834  85.483  1.00 61.16  ? 452 VAL A CG1 1 
ATOM   6483 C CG2 . VAL B 1 291 ? -79.292  20.225  86.796  1.00 59.21  ? 452 VAL A CG2 1 
ATOM   6484 N N   . PRO B 1 292 ? -76.364  18.013  86.739  1.00 59.62  ? 453 PRO A N   1 
ATOM   6485 C CA  . PRO B 1 292 ? -76.110  16.845  87.584  1.00 59.98  ? 453 PRO A CA  1 
ATOM   6486 C C   . PRO B 1 292 ? -77.337  16.363  88.352  1.00 60.62  ? 453 PRO A C   1 
ATOM   6487 O O   . PRO B 1 292 ? -78.245  17.146  88.645  1.00 61.47  ? 453 PRO A O   1 
ATOM   6488 C CB  . PRO B 1 292 ? -75.059  17.355  88.567  1.00 59.35  ? 453 PRO A CB  1 
ATOM   6489 C CG  . PRO B 1 292 ? -74.294  18.353  87.781  1.00 59.70  ? 453 PRO A CG  1 
ATOM   6490 C CD  . PRO B 1 292 ? -75.295  19.021  86.882  1.00 59.28  ? 453 PRO A CD  1 
ATOM   6491 N N   . VAL B 1 293 ? -77.346  15.072  88.666  1.00 61.15  ? 454 VAL A N   1 
ATOM   6492 C CA  . VAL B 1 293 ? -78.410  14.458  89.447  1.00 61.32  ? 454 VAL A CA  1 
ATOM   6493 C C   . VAL B 1 293 ? -77.801  13.441  90.419  1.00 62.27  ? 454 VAL A C   1 
ATOM   6494 O O   . VAL B 1 293 ? -76.722  12.904  90.161  1.00 63.16  ? 454 VAL A O   1 
ATOM   6495 C CB  . VAL B 1 293 ? -79.475  13.814  88.525  1.00 59.90  ? 454 VAL A CB  1 
ATOM   6496 C CG1 . VAL B 1 293 ? -78.951  12.545  87.867  1.00 58.91  ? 454 VAL A CG1 1 
ATOM   6497 C CG2 . VAL B 1 293 ? -80.758  13.546  89.292  1.00 61.57  ? 454 VAL A CG2 1 
ATOM   6498 N N   . VAL B 1 294 ? -78.474  13.203  91.542  1.00 62.77  ? 455 VAL A N   1 
ATOM   6499 C CA  . VAL B 1 294 ? -78.034  12.178  92.493  1.00 63.25  ? 455 VAL A CA  1 
ATOM   6500 C C   . VAL B 1 294 ? -78.371  10.781  91.943  1.00 63.28  ? 455 VAL A C   1 
ATOM   6501 O O   . VAL B 1 294 ? -79.506  10.303  92.043  1.00 62.75  ? 455 VAL A O   1 
ATOM   6502 C CB  . VAL B 1 294 ? -78.570  12.436  93.929  1.00 63.19  ? 455 VAL A CB  1 
ATOM   6503 C CG1 . VAL B 1 294 ? -80.074  12.697  93.934  1.00 64.97  ? 455 VAL A CG1 1 
ATOM   6504 C CG2 . VAL B 1 294 ? -78.203  11.298  94.865  1.00 62.28  ? 455 VAL A CG2 1 
ATOM   6505 N N   . ASP B 1 295 ? -77.361  10.144  91.350  1.00 63.81  ? 456 ASP A N   1 
ATOM   6506 C CA  . ASP B 1 295 ? -77.544  8.938   90.532  1.00 62.96  ? 456 ASP A CA  1 
ATOM   6507 C C   . ASP B 1 295 ? -77.346  7.616   91.277  1.00 62.66  ? 456 ASP A C   1 
ATOM   6508 O O   . ASP B 1 295 ? -77.928  6.596   90.902  1.00 62.62  ? 456 ASP A O   1 
ATOM   6509 C CB  . ASP B 1 295 ? -76.624  8.989   89.302  1.00 62.71  ? 456 ASP A CB  1 
ATOM   6510 C CG  . ASP B 1 295 ? -75.140  8.970   89.666  1.00 62.69  ? 456 ASP A CG  1 
ATOM   6511 O OD1 . ASP B 1 295 ? -74.759  9.493   90.738  1.00 61.10  ? 456 ASP A OD1 1 
ATOM   6512 O OD2 . ASP B 1 295 ? -74.351  8.430   88.864  1.00 64.06  ? 456 ASP A OD2 1 
ATOM   6513 N N   . GLY B 1 296 ? -76.522  7.639   92.321  1.00 61.87  ? 457 GLY A N   1 
ATOM   6514 C CA  . GLY B 1 296 ? -76.200  6.436   93.080  1.00 60.47  ? 457 GLY A CA  1 
ATOM   6515 C C   . GLY B 1 296 ? -74.728  6.091   92.987  1.00 60.23  ? 457 GLY A C   1 
ATOM   6516 O O   . GLY B 1 296 ? -74.139  5.582   93.944  1.00 61.66  ? 457 GLY A O   1 
ATOM   6517 N N   . ALA B 1 297 ? -74.135  6.381   91.831  1.00 58.51  ? 458 ALA A N   1 
ATOM   6518 C CA  . ALA B 1 297 ? -72.733  6.069   91.575  1.00 57.70  ? 458 ALA A CA  1 
ATOM   6519 C C   . ALA B 1 297 ? -71.798  7.223   91.940  1.00 57.21  ? 458 ALA A C   1 
ATOM   6520 O O   . ALA B 1 297 ? -70.974  7.091   92.850  1.00 57.28  ? 458 ALA A O   1 
ATOM   6521 C CB  . ALA B 1 297 ? -72.541  5.660   90.126  1.00 57.91  ? 458 ALA A CB  1 
ATOM   6522 N N   . PHE B 1 298 ? -71.925  8.342   91.226  1.00 56.21  ? 459 PHE A N   1 
ATOM   6523 C CA  . PHE B 1 298 ? -71.106  9.527   91.477  1.00 55.21  ? 459 PHE A CA  1 
ATOM   6524 C C   . PHE B 1 298 ? -71.507  10.187  92.792  1.00 56.84  ? 459 PHE A C   1 
ATOM   6525 O O   . PHE B 1 298 ? -70.649  10.553  93.597  1.00 57.19  ? 459 PHE A O   1 
ATOM   6526 C CB  . PHE B 1 298 ? -71.225  10.522  90.322  1.00 53.18  ? 459 PHE A CB  1 
ATOM   6527 C CG  . PHE B 1 298 ? -70.177  11.595  90.336  1.00 52.26  ? 459 PHE A CG  1 
ATOM   6528 C CD1 . PHE B 1 298 ? -68.903  11.349  89.835  1.00 52.30  ? 459 PHE A CD1 1 
ATOM   6529 C CD2 . PHE B 1 298 ? -70.460  12.856  90.847  1.00 52.32  ? 459 PHE A CD2 1 
ATOM   6530 C CE1 . PHE B 1 298 ? -67.928  12.337  89.846  1.00 51.82  ? 459 PHE A CE1 1 
ATOM   6531 C CE2 . PHE B 1 298 ? -69.491  13.850  90.861  1.00 52.65  ? 459 PHE A CE2 1 
ATOM   6532 C CZ  . PHE B 1 298 ? -68.223  13.590  90.359  1.00 52.23  ? 459 PHE A CZ  1 
ATOM   6533 N N   . LEU B 1 299 ? -72.816  10.332  92.993  1.00 58.35  ? 460 LEU A N   1 
ATOM   6534 C CA  . LEU B 1 299 ? -73.385  10.822  94.247  1.00 58.89  ? 460 LEU A CA  1 
ATOM   6535 C C   . LEU B 1 299 ? -74.526  9.897   94.661  1.00 60.31  ? 460 LEU A C   1 
ATOM   6536 O O   . LEU B 1 299 ? -75.409  9.604   93.852  1.00 59.60  ? 460 LEU A O   1 
ATOM   6537 C CB  . LEU B 1 299 ? -73.915  12.251  94.085  1.00 58.60  ? 460 LEU A CB  1 
ATOM   6538 C CG  . LEU B 1 299 ? -73.008  13.363  93.546  1.00 58.13  ? 460 LEU A CG  1 
ATOM   6539 C CD1 . LEU B 1 299 ? -73.859  14.496  92.993  1.00 58.21  ? 460 LEU A CD1 1 
ATOM   6540 C CD2 . LEU B 1 299 ? -72.041  13.873  94.605  1.00 57.54  ? 460 LEU A CD2 1 
ATOM   6541 N N   . ASP B 1 300 ? -74.504  9.445   95.915  1.00 62.96  ? 461 ASP A N   1 
ATOM   6542 C CA  . ASP B 1 300 ? -75.554  8.563   96.447  1.00 65.93  ? 461 ASP A CA  1 
ATOM   6543 C C   . ASP B 1 300 ? -76.519  9.292   97.393  1.00 66.90  ? 461 ASP A C   1 
ATOM   6544 O O   . ASP B 1 300 ? -77.471  8.698   97.908  1.00 67.04  ? 461 ASP A O   1 
ATOM   6545 C CB  . ASP B 1 300 ? -74.939  7.336   97.132  1.00 67.52  ? 461 ASP A CB  1 
ATOM   6546 C CG  . ASP B 1 300 ? -74.075  7.703   98.322  1.00 69.31  ? 461 ASP A CG  1 
ATOM   6547 O OD1 . ASP B 1 300 ? -74.623  7.896   99.427  1.00 68.37  ? 461 ASP A OD1 1 
ATOM   6548 O OD2 . ASP B 1 300 ? -72.842  7.793   98.152  1.00 71.56  ? 461 ASP A OD2 1 
ATOM   6549 N N   . GLU B 1 301 ? -76.257  10.579  97.613  1.00 67.90  ? 462 GLU A N   1 
ATOM   6550 C CA  . GLU B 1 301 ? -77.120  11.453  98.410  1.00 67.78  ? 462 GLU A CA  1 
ATOM   6551 C C   . GLU B 1 301 ? -76.976  12.892  97.919  1.00 69.04  ? 462 GLU A C   1 
ATOM   6552 O O   . GLU B 1 301 ? -75.987  13.231  97.263  1.00 69.75  ? 462 GLU A O   1 
ATOM   6553 C CB  . GLU B 1 301 ? -76.761  11.360  99.894  1.00 67.14  ? 462 GLU A CB  1 
ATOM   6554 C CG  . GLU B 1 301 ? -75.312  11.710  100.208 1.00 66.66  ? 462 GLU A CG  1 
ATOM   6555 C CD  . GLU B 1 301 ? -74.961  11.561  101.675 1.00 67.01  ? 462 GLU A CD  1 
ATOM   6556 O OE1 . GLU B 1 301 ? -75.831  11.137  102.467 1.00 66.53  ? 462 GLU A OE1 1 
ATOM   6557 O OE2 . GLU B 1 301 ? -73.804  11.868  102.036 1.00 67.64  ? 462 GLU A OE2 1 
ATOM   6558 N N   . THR B 1 302 ? -77.959  13.733  98.237  1.00 69.95  ? 463 THR A N   1 
ATOM   6559 C CA  . THR B 1 302 ? -77.906  15.154  97.882  1.00 70.85  ? 463 THR A CA  1 
ATOM   6560 C C   . THR B 1 302 ? -76.733  15.850  98.582  1.00 70.92  ? 463 THR A C   1 
ATOM   6561 O O   . THR B 1 302 ? -76.377  15.476  99.703  1.00 71.46  ? 463 THR A O   1 
ATOM   6562 C CB  . THR B 1 302 ? -79.216  15.892  98.239  1.00 71.00  ? 463 THR A CB  1 
ATOM   6563 O OG1 . THR B 1 302 ? -79.505  15.720  99.631  1.00 71.89  ? 463 THR A OG1 1 
ATOM   6564 C CG2 . THR B 1 302 ? -80.381  15.367  97.408  1.00 71.79  ? 463 THR A CG2 1 
ATOM   6565 N N   . PRO B 1 303 ? -76.120  16.854  97.919  1.00 70.89  ? 464 PRO A N   1 
ATOM   6566 C CA  . PRO B 1 303 ? -75.064  17.657  98.540  1.00 71.06  ? 464 PRO A CA  1 
ATOM   6567 C C   . PRO B 1 303 ? -75.440  18.215  99.914  1.00 72.67  ? 464 PRO A C   1 
ATOM   6568 O O   . PRO B 1 303 ? -74.562  18.416  100.753 1.00 72.24  ? 464 PRO A O   1 
ATOM   6569 C CB  . PRO B 1 303 ? -74.869  18.796  97.541  1.00 70.18  ? 464 PRO A CB  1 
ATOM   6570 C CG  . PRO B 1 303 ? -75.174  18.168  96.227  1.00 69.46  ? 464 PRO A CG  1 
ATOM   6571 C CD  . PRO B 1 303 ? -76.295  17.201  96.494  1.00 70.34  ? 464 PRO A CD  1 
ATOM   6572 N N   . GLN B 1 304 ? -76.733  18.453  100.133 1.00 76.09  ? 465 GLN A N   1 
ATOM   6573 C CA  . GLN B 1 304 ? -77.247  18.908  101.426 1.00 79.29  ? 465 GLN A CA  1 
ATOM   6574 C C   . GLN B 1 304 ? -76.963  17.893  102.532 1.00 80.28  ? 465 GLN A C   1 
ATOM   6575 O O   . GLN B 1 304 ? -76.375  18.244  103.559 1.00 82.26  ? 465 GLN A O   1 
ATOM   6576 C CB  . GLN B 1 304 ? -78.750  19.206  101.344 1.00 81.29  ? 465 GLN A CB  1 
ATOM   6577 C CG  . GLN B 1 304 ? -79.099  20.569  100.757 1.00 85.68  ? 465 GLN A CG  1 
ATOM   6578 C CD  . GLN B 1 304 ? -79.060  20.609  99.235  1.00 89.14  ? 465 GLN A CD  1 
ATOM   6579 O OE1 . GLN B 1 304 ? -78.046  20.287  98.611  1.00 90.34  ? 465 GLN A OE1 1 
ATOM   6580 N NE2 . GLN B 1 304 ? -80.168  21.026  98.630  1.00 89.72  ? 465 GLN A NE2 1 
ATOM   6581 N N   . ARG B 1 305 ? -77.367  16.641  102.312 1.00 79.41  ? 466 ARG A N   1 
ATOM   6582 C CA  . ARG B 1 305 ? -77.134  15.564  103.277 1.00 77.33  ? 466 ARG A CA  1 
ATOM   6583 C C   . ARG B 1 305 ? -75.653  15.215  103.410 1.00 74.31  ? 466 ARG A C   1 
ATOM   6584 O O   . ARG B 1 305 ? -75.208  14.796  104.478 1.00 73.43  ? 466 ARG A O   1 
ATOM   6585 C CB  . ARG B 1 305 ? -77.953  14.318  102.927 1.00 78.83  ? 466 ARG A CB  1 
ATOM   6586 C CG  . ARG B 1 305 ? -79.429  14.438  103.265 1.00 83.26  ? 466 ARG A CG  1 
ATOM   6587 C CD  . ARG B 1 305 ? -80.196  13.183  102.880 1.00 89.08  ? 466 ARG A CD  1 
ATOM   6588 N NE  . ARG B 1 305 ? -81.643  13.408  102.871 1.00 94.80  ? 466 ARG A NE  1 
ATOM   6589 C CZ  . ARG B 1 305 ? -82.345  13.814  101.812 1.00 96.58  ? 466 ARG A CZ  1 
ATOM   6590 N NH1 . ARG B 1 305 ? -83.656  13.987  101.914 1.00 96.85  ? 466 ARG A NH1 1 
ATOM   6591 N NH2 . ARG B 1 305 ? -81.747  14.049  100.649 1.00 98.27  ? 466 ARG A NH2 1 
ATOM   6592 N N   . SER B 1 306 ? -74.901  15.394  102.324 1.00 73.03  ? 467 SER A N   1 
ATOM   6593 C CA  . SER B 1 306 ? -73.451  15.192  102.334 1.00 72.19  ? 467 SER A CA  1 
ATOM   6594 C C   . SER B 1 306 ? -72.755  16.230  103.208 1.00 71.19  ? 467 SER A C   1 
ATOM   6595 O O   . SER B 1 306 ? -71.875  15.889  104.003 1.00 71.52  ? 467 SER A O   1 
ATOM   6596 C CB  . SER B 1 306 ? -72.878  15.235  100.915 1.00 71.83  ? 467 SER A CB  1 
ATOM   6597 O OG  . SER B 1 306 ? -73.155  14.039  100.209 1.00 71.93  ? 467 SER A OG  1 
ATOM   6598 N N   . LEU B 1 307 ? -73.155  17.491  103.058 1.00 69.64  ? 468 LEU A N   1 
ATOM   6599 C CA  . LEU B 1 307 ? -72.605  18.575  103.866 1.00 69.22  ? 468 LEU A CA  1 
ATOM   6600 C C   . LEU B 1 307 ? -72.991  18.414  105.332 1.00 70.09  ? 468 LEU A C   1 
ATOM   6601 O O   . LEU B 1 307 ? -72.146  18.568  106.215 1.00 70.60  ? 468 LEU A O   1 
ATOM   6602 C CB  . LEU B 1 307 ? -73.053  19.944  103.341 1.00 67.84  ? 468 LEU A CB  1 
ATOM   6603 C CG  . LEU B 1 307 ? -72.412  20.481  102.055 1.00 66.82  ? 468 LEU A CG  1 
ATOM   6604 C CD1 . LEU B 1 307 ? -73.136  21.733  101.584 1.00 66.87  ? 468 LEU A CD1 1 
ATOM   6605 C CD2 . LEU B 1 307 ? -70.927  20.760  102.241 1.00 66.97  ? 468 LEU A CD2 1 
ATOM   6606 N N   . ALA B 1 308 ? -74.262  18.083  105.571 1.00 70.24  ? 469 ALA A N   1 
ATOM   6607 C CA  . ALA B 1 308 ? -74.805  17.903  106.922 1.00 69.27  ? 469 ALA A CA  1 
ATOM   6608 C C   . ALA B 1 308 ? -74.052  16.838  107.719 1.00 69.45  ? 469 ALA A C   1 
ATOM   6609 O O   . ALA B 1 308 ? -73.610  17.092  108.839 1.00 69.46  ? 469 ALA A O   1 
ATOM   6610 C CB  . ALA B 1 308 ? -76.291  17.572  106.859 1.00 67.30  ? 469 ALA A CB  1 
ATOM   6611 N N   . SER B 1 309 ? -73.898  15.656  107.125 1.00 70.25  ? 470 SER A N   1 
ATOM   6612 C CA  . SER B 1 309 ? -73.210  14.537  107.767 1.00 69.74  ? 470 SER A CA  1 
ATOM   6613 C C   . SER B 1 309 ? -71.687  14.700  107.787 1.00 69.74  ? 470 SER A C   1 
ATOM   6614 O O   . SER B 1 309 ? -70.981  13.900  108.404 1.00 70.61  ? 470 SER A O   1 
ATOM   6615 C CB  . SER B 1 309 ? -73.587  13.221  107.081 1.00 69.90  ? 470 SER A CB  1 
ATOM   6616 O OG  . SER B 1 309 ? -73.142  13.200  105.735 1.00 69.83  ? 470 SER A OG  1 
ATOM   6617 N N   . GLY B 1 310 ? -71.186  15.731  107.110 1.00 69.32  ? 471 GLY A N   1 
ATOM   6618 C CA  . GLY B 1 310 ? -69.751  16.004  107.063 1.00 69.83  ? 471 GLY A CA  1 
ATOM   6619 C C   . GLY B 1 310 ? -68.975  15.076  106.144 1.00 69.35  ? 471 GLY A C   1 
ATOM   6620 O O   . GLY B 1 310 ? -67.743  15.015  106.209 1.00 69.01  ? 471 GLY A O   1 
ATOM   6621 N N   . ARG B 1 311 ? -69.695  14.356  105.285 1.00 68.06  ? 472 ARG A N   1 
ATOM   6622 C CA  . ARG B 1 311 ? -69.083  13.433  104.334 1.00 67.44  ? 472 ARG A CA  1 
ATOM   6623 C C   . ARG B 1 311 ? -68.522  14.160  103.110 1.00 66.79  ? 472 ARG A C   1 
ATOM   6624 O O   . ARG B 1 311 ? -69.165  14.223  102.056 1.00 67.00  ? 472 ARG A O   1 
ATOM   6625 C CB  . ARG B 1 311 ? -70.081  12.353  103.906 1.00 67.98  ? 472 ARG A CB  1 
ATOM   6626 C CG  . ARG B 1 311 ? -70.265  11.233  104.917 1.00 68.11  ? 472 ARG A CG  1 
ATOM   6627 C CD  . ARG B 1 311 ? -71.141  10.127  104.352 1.00 67.41  ? 472 ARG A CD  1 
ATOM   6628 N NE  . ARG B 1 311 ? -72.544  10.525  104.254 1.00 65.22  ? 472 ARG A NE  1 
ATOM   6629 C CZ  . ARG B 1 311 ? -73.479  10.209  105.145 1.00 64.30  ? 472 ARG A CZ  1 
ATOM   6630 N NH1 . ARG B 1 311 ? -73.172  9.488   106.215 1.00 64.46  ? 472 ARG A NH1 1 
ATOM   6631 N NH2 . ARG B 1 311 ? -74.725  10.620  104.968 1.00 63.51  ? 472 ARG A NH2 1 
ATOM   6632 N N   . PHE B 1 312 ? -67.323  14.715  103.272 1.00 64.78  ? 473 PHE A N   1 
ATOM   6633 C CA  . PHE B 1 312 ? -66.584  15.347  102.177 1.00 64.29  ? 473 PHE A CA  1 
ATOM   6634 C C   . PHE B 1 312 ? -65.087  15.358  102.472 1.00 64.45  ? 473 PHE A C   1 
ATOM   6635 O O   . PHE B 1 312 ? -64.681  15.292  103.634 1.00 65.47  ? 473 PHE A O   1 
ATOM   6636 C CB  . PHE B 1 312 ? -67.093  16.767  101.891 1.00 63.48  ? 473 PHE A CB  1 
ATOM   6637 C CG  . PHE B 1 312 ? -67.298  17.612  103.121 1.00 62.75  ? 473 PHE A CG  1 
ATOM   6638 C CD1 . PHE B 1 312 ? -66.220  18.208  103.767 1.00 62.14  ? 473 PHE A CD1 1 
ATOM   6639 C CD2 . PHE B 1 312 ? -68.579  17.831  103.619 1.00 62.45  ? 473 PHE A CD2 1 
ATOM   6640 C CE1 . PHE B 1 312 ? -66.415  18.993  104.891 1.00 62.34  ? 473 PHE A CE1 1 
ATOM   6641 C CE2 . PHE B 1 312 ? -68.781  18.617  104.743 1.00 61.73  ? 473 PHE A CE2 1 
ATOM   6642 C CZ  . PHE B 1 312 ? -67.697  19.198  105.378 1.00 62.17  ? 473 PHE A CZ  1 
ATOM   6643 N N   . LYS B 1 313 ? -64.277  15.451  101.417 1.00 63.91  ? 474 LYS A N   1 
ATOM   6644 C CA  . LYS B 1 313 ? -62.819  15.380  101.533 1.00 63.78  ? 474 LYS A CA  1 
ATOM   6645 C C   . LYS B 1 313 ? -62.259  16.414  102.509 1.00 65.20  ? 474 LYS A C   1 
ATOM   6646 O O   . LYS B 1 313 ? -62.611  17.593  102.449 1.00 65.89  ? 474 LYS A O   1 
ATOM   6647 C CB  . LYS B 1 313 ? -62.151  15.528  100.159 1.00 61.61  ? 474 LYS A CB  1 
ATOM   6648 C CG  . LYS B 1 313 ? -60.722  15.004  100.116 1.00 59.46  ? 474 LYS A CG  1 
ATOM   6649 C CD  . LYS B 1 313 ? -60.158  14.971  98.705  1.00 56.75  ? 474 LYS A CD  1 
ATOM   6650 C CE  . LYS B 1 313 ? -58.889  14.132  98.639  1.00 54.94  ? 474 LYS A CE  1 
ATOM   6651 N NZ  . LYS B 1 313 ? -57.741  14.732  99.373  1.00 53.32  ? 474 LYS A NZ  1 
ATOM   6652 N N   . LYS B 1 314 ? -61.400  15.953  103.413 1.00 66.55  ? 475 LYS A N   1 
ATOM   6653 C CA  . LYS B 1 314 ? -60.711  16.836  104.340 1.00 68.58  ? 475 LYS A CA  1 
ATOM   6654 C C   . LYS B 1 314 ? -59.550  17.517  103.631 1.00 69.11  ? 475 LYS A C   1 
ATOM   6655 O O   . LYS B 1 314 ? -58.468  16.938  103.502 1.00 69.10  ? 475 LYS A O   1 
ATOM   6656 C CB  . LYS B 1 314 ? -60.209  16.061  105.560 1.00 70.42  ? 475 LYS A CB  1 
ATOM   6657 C CG  . LYS B 1 314 ? -61.171  16.041  106.739 1.00 73.13  ? 475 LYS A CG  1 
ATOM   6658 C CD  . LYS B 1 314 ? -60.448  15.668  108.026 1.00 75.88  ? 475 LYS A CD  1 
ATOM   6659 C CE  . LYS B 1 314 ? -59.520  16.784  108.492 1.00 77.09  ? 475 LYS A CE  1 
ATOM   6660 N NZ  . LYS B 1 314 ? -58.362  16.259  109.266 1.00 79.13  ? 475 LYS A NZ  1 
ATOM   6661 N N   . THR B 1 315 ? -59.788  18.737  103.151 1.00 69.74  ? 476 THR A N   1 
ATOM   6662 C CA  . THR B 1 315 ? -58.757  19.519  102.464 1.00 70.92  ? 476 THR A CA  1 
ATOM   6663 C C   . THR B 1 315 ? -58.985  21.022  102.595 1.00 70.63  ? 476 THR A C   1 
ATOM   6664 O O   . THR B 1 315 ? -60.054  21.464  103.020 1.00 71.63  ? 476 THR A O   1 
ATOM   6665 C CB  . THR B 1 315 ? -58.670  19.188  100.958 1.00 71.68  ? 476 THR A CB  1 
ATOM   6666 O OG1 . THR B 1 315 ? -59.154  17.862  100.711 1.00 73.76  ? 476 THR A OG1 1 
ATOM   6667 C CG2 . THR B 1 315 ? -57.231  19.308  100.478 1.00 70.37  ? 476 THR A CG2 1 
ATOM   6668 N N   . GLU B 1 316 ? -57.966  21.793  102.218 1.00 70.03  ? 477 GLU A N   1 
ATOM   6669 C CA  . GLU B 1 316 ? -58.052  23.248  102.143 1.00 69.39  ? 477 GLU A CA  1 
ATOM   6670 C C   . GLU B 1 316 ? -58.948  23.675  100.978 1.00 67.17  ? 477 GLU A C   1 
ATOM   6671 O O   . GLU B 1 316 ? -59.083  22.952  99.988  1.00 66.54  ? 477 GLU A O   1 
ATOM   6672 C CB  . GLU B 1 316 ? -56.657  23.870  101.991 1.00 72.14  ? 477 GLU A CB  1 
ATOM   6673 C CG  . GLU B 1 316 ? -55.668  23.523  103.099 1.00 75.16  ? 477 GLU A CG  1 
ATOM   6674 C CD  . GLU B 1 316 ? -54.903  22.229  102.850 1.00 77.81  ? 477 GLU A CD  1 
ATOM   6675 O OE1 . GLU B 1 316 ? -55.010  21.655  101.742 1.00 77.48  ? 477 GLU A OE1 1 
ATOM   6676 O OE2 . GLU B 1 316 ? -54.182  21.784  103.771 1.00 80.19  ? 477 GLU A OE2 1 
ATOM   6677 N N   . ILE B 1 317 ? -59.553  24.853  101.112 1.00 65.05  ? 478 ILE A N   1 
ATOM   6678 C CA  . ILE B 1 317 ? -60.518  25.376  100.144 1.00 62.37  ? 478 ILE A CA  1 
ATOM   6679 C C   . ILE B 1 317 ? -60.269  26.867  99.904  1.00 61.67  ? 478 ILE A C   1 
ATOM   6680 O O   . ILE B 1 317 ? -60.141  27.640  100.853 1.00 62.68  ? 478 ILE A O   1 
ATOM   6681 C CB  . ILE B 1 317 ? -61.980  25.155  100.637 1.00 61.19  ? 478 ILE A CB  1 
ATOM   6682 C CG1 . ILE B 1 317 ? -62.373  23.672  100.588 1.00 61.02  ? 478 ILE A CG1 1 
ATOM   6683 C CG2 . ILE B 1 317 ? -62.984  25.999  99.860  1.00 60.71  ? 478 ILE A CG2 1 
ATOM   6684 C CD1 . ILE B 1 317 ? -62.297  23.022  99.220  1.00 61.26  ? 478 ILE A CD1 1 
ATOM   6685 N N   . LEU B 1 318 ? -60.180  27.260  98.636  1.00 60.42  ? 479 LEU A N   1 
ATOM   6686 C CA  . LEU B 1 318 ? -60.207  28.673  98.274  1.00 59.48  ? 479 LEU A CA  1 
ATOM   6687 C C   . LEU B 1 318 ? -61.485  28.940  97.488  1.00 60.28  ? 479 LEU A C   1 
ATOM   6688 O O   . LEU B 1 318 ? -61.734  28.312  96.459  1.00 61.48  ? 479 LEU A O   1 
ATOM   6689 C CB  . LEU B 1 318 ? -58.966  29.068  97.466  1.00 58.07  ? 479 LEU A CB  1 
ATOM   6690 C CG  . LEU B 1 318 ? -58.580  30.553  97.486  1.00 57.17  ? 479 LEU A CG  1 
ATOM   6691 C CD1 . LEU B 1 318 ? -57.070  30.719  97.433  1.00 56.61  ? 479 LEU A CD1 1 
ATOM   6692 C CD2 . LEU B 1 318 ? -59.249  31.336  96.364  1.00 57.19  ? 479 LEU A CD2 1 
ATOM   6693 N N   . THR B 1 319 ? -62.303  29.862  97.984  1.00 59.84  ? 480 THR A N   1 
ATOM   6694 C CA  . THR B 1 319 ? -63.609  30.122  97.383  1.00 59.78  ? 480 THR A CA  1 
ATOM   6695 C C   . THR B 1 319 ? -63.999  31.600  97.494  1.00 60.16  ? 480 THR A C   1 
ATOM   6696 O O   . THR B 1 319 ? -63.449  32.330  98.317  1.00 61.12  ? 480 THR A O   1 
ATOM   6697 C CB  . THR B 1 319 ? -64.693  29.194  97.990  1.00 59.24  ? 480 THR A CB  1 
ATOM   6698 O OG1 . THR B 1 319 ? -65.897  29.270  97.217  1.00 60.24  ? 480 THR A OG1 1 
ATOM   6699 C CG2 . THR B 1 319 ? -64.986  29.554  99.442  1.00 58.68  ? 480 THR A CG2 1 
ATOM   6700 N N   . GLY B 1 320 ? -64.932  32.043  96.655  1.00 59.83  ? 481 GLY A N   1 
ATOM   6701 C CA  . GLY B 1 320 ? -65.390  33.426  96.714  1.00 60.74  ? 481 GLY A CA  1 
ATOM   6702 C C   . GLY B 1 320 ? -66.374  33.853  95.645  1.00 62.34  ? 481 GLY A C   1 
ATOM   6703 O O   . GLY B 1 320 ? -66.523  33.191  94.614  1.00 62.62  ? 481 GLY A O   1 
ATOM   6704 N N   . SER B 1 321 ? -67.037  34.978  95.905  1.00 62.93  ? 482 SER A N   1 
ATOM   6705 C CA  . SER B 1 321 ? -68.042  35.537  95.008  1.00 62.55  ? 482 SER A CA  1 
ATOM   6706 C C   . SER B 1 321 ? -67.582  36.870  94.429  1.00 62.12  ? 482 SER A C   1 
ATOM   6707 O O   . SER B 1 321 ? -66.621  37.475  94.911  1.00 61.57  ? 482 SER A O   1 
ATOM   6708 C CB  . SER B 1 321 ? -69.363  35.751  95.756  1.00 62.76  ? 482 SER A CB  1 
ATOM   6709 O OG  . SER B 1 321 ? -69.656  34.665  96.615  1.00 64.86  ? 482 SER A OG  1 
ATOM   6710 N N   . ASN B 1 322 ? -68.275  37.310  93.383  1.00 61.48  ? 483 ASN A N   1 
ATOM   6711 C CA  . ASN B 1 322 ? -68.136  38.666  92.871  1.00 60.74  ? 483 ASN A CA  1 
ATOM   6712 C C   . ASN B 1 322 ? -69.272  39.521  93.428  1.00 60.47  ? 483 ASN A C   1 
ATOM   6713 O O   . ASN B 1 322 ? -70.240  38.981  93.969  1.00 60.62  ? 483 ASN A O   1 
ATOM   6714 C CB  . ASN B 1 322 ? -68.133  38.663  91.340  1.00 60.59  ? 483 ASN A CB  1 
ATOM   6715 C CG  . ASN B 1 322 ? -66.998  37.834  90.757  1.00 60.98  ? 483 ASN A CG  1 
ATOM   6716 O OD1 . ASN B 1 322 ? -66.275  37.144  91.481  1.00 60.94  ? 483 ASN A OD1 1 
ATOM   6717 N ND2 . ASN B 1 322 ? -66.840  37.895  89.439  1.00 61.17  ? 483 ASN A ND2 1 
ATOM   6718 N N   . THR B 1 323 ? -69.154  40.843  93.312  1.00 60.05  ? 484 THR A N   1 
ATOM   6719 C CA  . THR B 1 323 ? -70.132  41.760  93.916  1.00 59.53  ? 484 THR A CA  1 
ATOM   6720 C C   . THR B 1 323 ? -71.496  41.791  93.225  1.00 59.73  ? 484 THR A C   1 
ATOM   6721 O O   . THR B 1 323 ? -72.521  41.944  93.892  1.00 60.52  ? 484 THR A O   1 
ATOM   6722 C CB  . THR B 1 323 ? -69.595  43.202  94.035  1.00 59.08  ? 484 THR A CB  1 
ATOM   6723 O OG1 . THR B 1 323 ? -68.887  43.559  92.842  1.00 58.95  ? 484 THR A OG1 1 
ATOM   6724 C CG2 . THR B 1 323 ? -68.670  43.330  95.229  1.00 59.13  ? 484 THR A CG2 1 
ATOM   6725 N N   . GLU B 1 324 ? -71.505  41.648  91.901  1.00 59.82  ? 485 GLU A N   1 
ATOM   6726 C CA  . GLU B 1 324 ? -72.746  41.685  91.124  1.00 59.52  ? 485 GLU A CA  1 
ATOM   6727 C C   . GLU B 1 324 ? -72.966  40.396  90.337  1.00 59.60  ? 485 GLU A C   1 
ATOM   6728 O O   . GLU B 1 324 ? -72.938  40.395  89.103  1.00 59.85  ? 485 GLU A O   1 
ATOM   6729 C CB  . GLU B 1 324 ? -72.768  42.895  90.179  1.00 59.17  ? 485 GLU A CB  1 
ATOM   6730 C CG  . GLU B 1 324 ? -73.049  44.231  90.851  1.00 59.30  ? 485 GLU A CG  1 
ATOM   6731 C CD  . GLU B 1 324 ? -71.849  44.789  91.590  1.00 60.15  ? 485 GLU A CD  1 
ATOM   6732 O OE1 . GLU B 1 324 ? -70.749  44.843  90.998  1.00 60.32  ? 485 GLU A OE1 1 
ATOM   6733 O OE2 . GLU B 1 324 ? -72.010  45.178  92.765  1.00 60.93  ? 485 GLU A OE2 1 
ATOM   6734 N N   . GLU B 1 325 ? -73.197  39.302  91.059  1.00 60.18  ? 486 GLU A N   1 
ATOM   6735 C CA  . GLU B 1 325 ? -73.369  37.985  90.442  1.00 60.86  ? 486 GLU A CA  1 
ATOM   6736 C C   . GLU B 1 325 ? -74.634  37.917  89.595  1.00 60.67  ? 486 GLU A C   1 
ATOM   6737 O O   . GLU B 1 325 ? -74.627  37.337  88.508  1.00 60.91  ? 486 GLU A O   1 
ATOM   6738 C CB  . GLU B 1 325 ? -73.396  36.881  91.506  1.00 61.53  ? 486 GLU A CB  1 
ATOM   6739 C CG  . GLU B 1 325 ? -72.135  36.781  92.357  1.00 63.08  ? 486 GLU A CG  1 
ATOM   6740 C CD  . GLU B 1 325 ? -71.058  35.888  91.762  1.00 63.92  ? 486 GLU A CD  1 
ATOM   6741 O OE1 . GLU B 1 325 ? -70.368  35.207  92.550  1.00 65.00  ? 486 GLU A OE1 1 
ATOM   6742 O OE2 . GLU B 1 325 ? -70.891  35.858  90.523  1.00 63.81  ? 486 GLU A OE2 1 
ATOM   6743 N N   . GLY B 1 326 ? -75.704  38.533  90.096  1.00 60.66  ? 487 GLY A N   1 
ATOM   6744 C CA  . GLY B 1 326 ? -77.029  38.451  89.485  1.00 60.75  ? 487 GLY A CA  1 
ATOM   6745 C C   . GLY B 1 326 ? -77.187  39.077  88.111  1.00 61.10  ? 487 GLY A C   1 
ATOM   6746 O O   . GLY B 1 326 ? -77.693  38.429  87.192  1.00 61.29  ? 487 GLY A O   1 
ATOM   6747 N N   . TYR B 1 327 ? -76.752  40.330  87.970  1.00 61.45  ? 488 TYR A N   1 
ATOM   6748 C CA  . TYR B 1 327 ? -76.976  41.118  86.748  1.00 61.12  ? 488 TYR A CA  1 
ATOM   6749 C C   . TYR B 1 327 ? -76.908  40.310  85.454  1.00 61.62  ? 488 TYR A C   1 
ATOM   6750 O O   . TYR B 1 327 ? -77.869  40.304  84.683  1.00 62.25  ? 488 TYR A O   1 
ATOM   6751 C CB  . TYR B 1 327 ? -76.018  42.312  86.665  1.00 60.18  ? 488 TYR A CB  1 
ATOM   6752 C CG  . TYR B 1 327 ? -76.471  43.555  87.405  1.00 59.55  ? 488 TYR A CG  1 
ATOM   6753 C CD1 . TYR B 1 327 ? -77.782  44.027  87.299  1.00 59.28  ? 488 TYR A CD1 1 
ATOM   6754 C CD2 . TYR B 1 327 ? -75.576  44.276  88.190  1.00 59.08  ? 488 TYR A CD2 1 
ATOM   6755 C CE1 . TYR B 1 327 ? -78.186  45.172  87.971  1.00 59.20  ? 488 TYR A CE1 1 
ATOM   6756 C CE2 . TYR B 1 327 ? -75.967  45.420  88.861  1.00 58.81  ? 488 TYR A CE2 1 
ATOM   6757 C CZ  . TYR B 1 327 ? -77.269  45.864  88.750  1.00 59.22  ? 488 TYR A CZ  1 
ATOM   6758 O OH  . TYR B 1 327 ? -77.647  47.000  89.422  1.00 60.01  ? 488 TYR A OH  1 
ATOM   6759 N N   . TYR B 1 328 ? -75.785  39.625  85.231  1.00 61.40  ? 489 TYR A N   1 
ATOM   6760 C CA  . TYR B 1 328 ? -75.577  38.833  84.017  1.00 61.14  ? 489 TYR A CA  1 
ATOM   6761 C C   . TYR B 1 328 ? -76.798  37.982  83.659  1.00 60.17  ? 489 TYR A C   1 
ATOM   6762 O O   . TYR B 1 328 ? -77.235  37.966  82.508  1.00 59.81  ? 489 TYR A O   1 
ATOM   6763 C CB  . TYR B 1 328 ? -74.321  37.954  84.138  1.00 62.89  ? 489 TYR A CB  1 
ATOM   6764 C CG  . TYR B 1 328 ? -74.066  37.085  82.918  1.00 64.14  ? 489 TYR A CG  1 
ATOM   6765 C CD1 . TYR B 1 328 ? -73.323  37.564  81.837  1.00 63.75  ? 489 TYR A CD1 1 
ATOM   6766 C CD2 . TYR B 1 328 ? -74.578  35.786  82.843  1.00 64.13  ? 489 TYR A CD2 1 
ATOM   6767 C CE1 . TYR B 1 328 ? -73.097  36.776  80.718  1.00 64.43  ? 489 TYR A CE1 1 
ATOM   6768 C CE2 . TYR B 1 328 ? -74.360  34.993  81.728  1.00 64.55  ? 489 TYR A CE2 1 
ATOM   6769 C CZ  . TYR B 1 328 ? -73.620  35.490  80.671  1.00 64.95  ? 489 TYR A CZ  1 
ATOM   6770 O OH  . TYR B 1 328 ? -73.402  34.697  79.569  1.00 65.14  ? 489 TYR A OH  1 
ATOM   6771 N N   . PHE B 1 329 ? -77.342  37.284  84.651  1.00 59.82  ? 490 PHE A N   1 
ATOM   6772 C CA  . PHE B 1 329 ? -78.474  36.383  84.443  1.00 60.60  ? 490 PHE A CA  1 
ATOM   6773 C C   . PHE B 1 329 ? -79.801  37.124  84.307  1.00 61.80  ? 490 PHE A C   1 
ATOM   6774 O O   . PHE B 1 329 ? -80.728  36.632  83.656  1.00 63.03  ? 490 PHE A O   1 
ATOM   6775 C CB  . PHE B 1 329 ? -78.548  35.350  85.569  1.00 59.83  ? 490 PHE A CB  1 
ATOM   6776 C CG  . PHE B 1 329 ? -77.362  34.431  85.619  1.00 60.32  ? 490 PHE A CG  1 
ATOM   6777 C CD1 . PHE B 1 329 ? -77.366  33.232  84.915  1.00 60.64  ? 490 PHE A CD1 1 
ATOM   6778 C CD2 . PHE B 1 329 ? -76.235  34.766  86.365  1.00 60.52  ? 490 PHE A CD2 1 
ATOM   6779 C CE1 . PHE B 1 329 ? -76.271  32.384  84.957  1.00 61.25  ? 490 PHE A CE1 1 
ATOM   6780 C CE2 . PHE B 1 329 ? -75.135  33.925  86.407  1.00 60.50  ? 490 PHE A CE2 1 
ATOM   6781 C CZ  . PHE B 1 329 ? -75.154  32.731  85.704  1.00 61.38  ? 490 PHE A CZ  1 
ATOM   6782 N N   . ILE B 1 330 ? -79.888  38.304  84.917  1.00 61.29  ? 491 ILE A N   1 
ATOM   6783 C CA  . ILE B 1 330 ? -81.101  39.119  84.834  1.00 59.65  ? 491 ILE A CA  1 
ATOM   6784 C C   . ILE B 1 330 ? -81.157  39.887  83.509  1.00 58.84  ? 491 ILE A C   1 
ATOM   6785 O O   . ILE B 1 330 ? -82.205  40.417  83.145  1.00 60.95  ? 491 ILE A O   1 
ATOM   6786 C CB  . ILE B 1 330 ? -81.253  40.087  86.033  1.00 59.23  ? 491 ILE A CB  1 
ATOM   6787 C CG1 . ILE B 1 330 ? -80.722  39.454  87.319  1.00 59.94  ? 491 ILE A CG1 1 
ATOM   6788 C CG2 . ILE B 1 330 ? -82.714  40.471  86.230  1.00 58.49  ? 491 ILE A CG2 1 
ATOM   6789 C CD1 . ILE B 1 330 ? -80.573  40.430  88.464  1.00 60.95  ? 491 ILE A CD1 1 
ATOM   6790 N N   . ILE B 1 331 ? -80.037  39.942  82.791  1.00 56.59  ? 492 ILE A N   1 
ATOM   6791 C CA  . ILE B 1 331 ? -80.010  40.573  81.472  1.00 55.68  ? 492 ILE A CA  1 
ATOM   6792 C C   . ILE B 1 331 ? -80.602  39.637  80.417  1.00 58.57  ? 492 ILE A C   1 
ATOM   6793 O O   . ILE B 1 331 ? -81.403  40.065  79.584  1.00 59.81  ? 492 ILE A O   1 
ATOM   6794 C CB  . ILE B 1 331 ? -78.592  41.036  81.068  1.00 53.23  ? 492 ILE A CB  1 
ATOM   6795 C CG1 . ILE B 1 331 ? -78.089  42.117  82.028  1.00 52.36  ? 492 ILE A CG1 1 
ATOM   6796 C CG2 . ILE B 1 331 ? -78.587  41.579  79.646  1.00 51.80  ? 492 ILE A CG2 1 
ATOM   6797 C CD1 . ILE B 1 331 ? -76.595  42.362  81.968  1.00 52.11  ? 492 ILE A CD1 1 
ATOM   6798 N N   . TYR B 1 332 ? -80.215  38.363  80.469  1.00 61.75  ? 493 TYR A N   1 
ATOM   6799 C CA  . TYR B 1 332 ? -80.677  37.361  79.504  1.00 64.84  ? 493 TYR A CA  1 
ATOM   6800 C C   . TYR B 1 332 ? -82.133  36.969  79.745  1.00 66.20  ? 493 TYR A C   1 
ATOM   6801 O O   . TYR B 1 332 ? -82.966  37.095  78.849  1.00 67.61  ? 493 TYR A O   1 
ATOM   6802 C CB  . TYR B 1 332 ? -79.756  36.139  79.509  1.00 66.75  ? 493 TYR A CB  1 
ATOM   6803 C CG  . TYR B 1 332 ? -78.488  36.337  78.703  1.00 69.15  ? 493 TYR A CG  1 
ATOM   6804 C CD1 . TYR B 1 332 ? -77.508  37.245  79.112  1.00 69.85  ? 493 TYR A CD1 1 
ATOM   6805 C CD2 . TYR B 1 332 ? -78.268  35.616  77.530  1.00 70.41  ? 493 TYR A CD2 1 
ATOM   6806 C CE1 . TYR B 1 332 ? -76.350  37.430  78.375  1.00 71.10  ? 493 TYR A CE1 1 
ATOM   6807 C CE2 . TYR B 1 332 ? -77.110  35.792  76.788  1.00 71.04  ? 493 TYR A CE2 1 
ATOM   6808 C CZ  . TYR B 1 332 ? -76.157  36.700  77.214  1.00 71.93  ? 493 TYR A CZ  1 
ATOM   6809 O OH  . TYR B 1 332 ? -75.008  36.879  76.481  1.00 74.04  ? 493 TYR A OH  1 
ATOM   6810 N N   . TYR B 1 333 ? -82.427  36.492  80.952  1.00 67.84  ? 494 TYR A N   1 
ATOM   6811 C CA  . TYR B 1 333 ? -83.801  36.368  81.433  1.00 68.23  ? 494 TYR A CA  1 
ATOM   6812 C C   . TYR B 1 333 ? -84.296  37.788  81.669  1.00 69.52  ? 494 TYR A C   1 
ATOM   6813 O O   . TYR B 1 333 ? -83.480  38.689  81.859  1.00 70.59  ? 494 TYR A O   1 
ATOM   6814 C CB  . TYR B 1 333 ? -83.817  35.590  82.747  1.00 67.18  ? 494 TYR A CB  1 
ATOM   6815 C CG  . TYR B 1 333 ? -85.176  35.097  83.193  1.00 66.09  ? 494 TYR A CG  1 
ATOM   6816 C CD1 . TYR B 1 333 ? -85.682  33.882  82.732  1.00 65.79  ? 494 TYR A CD1 1 
ATOM   6817 C CD2 . TYR B 1 333 ? -85.943  35.828  84.099  1.00 66.00  ? 494 TYR A CD2 1 
ATOM   6818 C CE1 . TYR B 1 333 ? -86.920  33.418  83.145  1.00 65.44  ? 494 TYR A CE1 1 
ATOM   6819 C CE2 . TYR B 1 333 ? -87.184  35.372  84.518  1.00 66.04  ? 494 TYR A CE2 1 
ATOM   6820 C CZ  . TYR B 1 333 ? -87.666  34.166  84.039  1.00 66.14  ? 494 TYR A CZ  1 
ATOM   6821 O OH  . TYR B 1 333 ? -88.896  33.702  84.450  1.00 66.91  ? 494 TYR A OH  1 
ATOM   6822 N N   . LEU B 1 334 ? -85.613  37.996  81.647  1.00 69.89  ? 495 LEU A N   1 
ATOM   6823 C CA  . LEU B 1 334 ? -86.204  39.315  81.934  1.00 70.45  ? 495 LEU A CA  1 
ATOM   6824 C C   . LEU B 1 334 ? -85.613  40.393  81.014  1.00 69.96  ? 495 LEU A C   1 
ATOM   6825 O O   . LEU B 1 334 ? -85.073  41.400  81.477  1.00 66.79  ? 495 LEU A O   1 
ATOM   6826 C CB  . LEU B 1 334 ? -85.980  39.681  83.409  1.00 69.88  ? 495 LEU A CB  1 
ATOM   6827 C CG  . LEU B 1 334 ? -86.922  40.668  84.090  1.00 70.24  ? 495 LEU A CG  1 
ATOM   6828 C CD1 . LEU B 1 334 ? -88.026  39.918  84.816  1.00 70.80  ? 495 LEU A CD1 1 
ATOM   6829 C CD2 . LEU B 1 334 ? -86.141  41.533  85.063  1.00 70.23  ? 495 LEU A CD2 1 
ATOM   6830 N N   . THR B 1 335 ? -85.727  40.165  79.708  1.00 71.69  ? 496 THR A N   1 
ATOM   6831 C CA  . THR B 1 335 ? -84.989  40.939  78.707  1.00 72.33  ? 496 THR A CA  1 
ATOM   6832 C C   . THR B 1 335 ? -85.610  42.289  78.324  1.00 75.32  ? 496 THR A C   1 
ATOM   6833 O O   . THR B 1 335 ? -84.887  43.225  77.977  1.00 74.97  ? 496 THR A O   1 
ATOM   6834 C CB  . THR B 1 335 ? -84.706  40.098  77.440  1.00 70.29  ? 496 THR A CB  1 
ATOM   6835 O OG1 . THR B 1 335 ? -83.953  40.880  76.507  1.00 70.59  ? 496 THR A OG1 1 
ATOM   6836 C CG2 . THR B 1 335 ? -86.003  39.617  76.781  1.00 69.02  ? 496 THR A CG2 1 
ATOM   6837 N N   . GLU B 1 336 ? -86.939  42.375  78.381  1.00 80.84  ? 497 GLU A N   1 
ATOM   6838 C CA  . GLU B 1 336 ? -87.672  43.605  78.051  1.00 84.68  ? 497 GLU A CA  1 
ATOM   6839 C C   . GLU B 1 336 ? -87.231  44.784  78.933  1.00 84.51  ? 497 GLU A C   1 
ATOM   6840 O O   . GLU B 1 336 ? -86.918  45.865  78.430  1.00 85.84  ? 497 GLU A O   1 
ATOM   6841 C CB  . GLU B 1 336 ? -89.196  43.367  78.118  1.00 88.29  ? 497 GLU A CB  1 
ATOM   6842 C CG  . GLU B 1 336 ? -89.829  43.288  79.515  1.00 94.13  ? 497 GLU A CG  1 
ATOM   6843 C CD  . GLU B 1 336 ? -89.350  42.114  80.372  1.00 96.39  ? 497 GLU A CD  1 
ATOM   6844 O OE1 . GLU B 1 336 ? -89.009  41.043  79.820  1.00 97.78  ? 497 GLU A OE1 1 
ATOM   6845 O OE2 . GLU B 1 336 ? -89.324  42.264  81.615  1.00 95.39  ? 497 GLU A OE2 1 
ATOM   6846 N N   . LEU B 1 337 ? -87.201  44.548  80.244  1.00 83.45  ? 498 LEU A N   1 
ATOM   6847 C CA  . LEU B 1 337 ? -86.656  45.477  81.228  1.00 80.66  ? 498 LEU A CA  1 
ATOM   6848 C C   . LEU B 1 337 ? -85.176  45.158  81.408  1.00 80.45  ? 498 LEU A C   1 
ATOM   6849 O O   . LEU B 1 337 ? -84.756  44.025  81.165  1.00 83.02  ? 498 LEU A O   1 
ATOM   6850 C CB  . LEU B 1 337 ? -87.406  45.306  82.556  1.00 79.13  ? 498 LEU A CB  1 
ATOM   6851 C CG  . LEU B 1 337 ? -86.806  45.761  83.891  1.00 77.60  ? 498 LEU A CG  1 
ATOM   6852 C CD1 . LEU B 1 337 ? -86.817  47.278  84.018  1.00 78.78  ? 498 LEU A CD1 1 
ATOM   6853 C CD2 . LEU B 1 337 ? -87.554  45.121  85.049  1.00 75.89  ? 498 LEU A CD2 1 
ATOM   6854 N N   . LEU B 1 338 ? -84.390  46.154  81.822  1.00 77.85  ? 499 LEU A N   1 
ATOM   6855 C CA  . LEU B 1 338 ? -82.968  45.958  82.137  1.00 76.73  ? 499 LEU A CA  1 
ATOM   6856 C C   . LEU B 1 338 ? -82.162  45.524  80.899  1.00 76.56  ? 499 LEU A C   1 
ATOM   6857 O O   . LEU B 1 338 ? -81.445  44.519  80.918  1.00 74.87  ? 499 LEU A O   1 
ATOM   6858 C CB  . LEU B 1 338 ? -82.813  44.955  83.296  1.00 74.27  ? 499 LEU A CB  1 
ATOM   6859 C CG  . LEU B 1 338 ? -81.543  44.944  84.146  1.00 72.48  ? 499 LEU A CG  1 
ATOM   6860 C CD1 . LEU B 1 338 ? -81.508  46.141  85.081  1.00 73.88  ? 499 LEU A CD1 1 
ATOM   6861 C CD2 . LEU B 1 338 ? -81.465  43.657  84.943  1.00 70.79  ? 499 LEU A CD2 1 
ATOM   6862 N N   . ARG B 1 339 ? -82.293  46.300  79.826  1.00 77.80  ? 500 ARG A N   1 
ATOM   6863 C CA  . ARG B 1 339 ? -81.662  45.990  78.540  1.00 78.16  ? 500 ARG A CA  1 
ATOM   6864 C C   . ARG B 1 339 ? -80.199  46.440  78.461  1.00 76.72  ? 500 ARG A C   1 
ATOM   6865 O O   . ARG B 1 339 ? -79.715  47.167  79.331  1.00 76.75  ? 500 ARG A O   1 
ATOM   6866 C CB  . ARG B 1 339 ? -82.482  46.578  77.383  1.00 80.50  ? 500 ARG A CB  1 
ATOM   6867 C CG  . ARG B 1 339 ? -82.943  48.014  77.592  1.00 82.90  ? 500 ARG A CG  1 
ATOM   6868 C CD  . ARG B 1 339 ? -83.853  48.477  76.466  1.00 85.28  ? 500 ARG A CD  1 
ATOM   6869 N NE  . ARG B 1 339 ? -85.138  47.778  76.466  1.00 87.24  ? 500 ARG A NE  1 
ATOM   6870 C CZ  . ARG B 1 339 ? -86.044  47.865  75.496  1.00 88.84  ? 500 ARG A CZ  1 
ATOM   6871 N NH1 . ARG B 1 339 ? -85.819  48.622  74.428  1.00 89.92  ? 500 ARG A NH1 1 
ATOM   6872 N NH2 . ARG B 1 339 ? -87.182  47.190  75.591  1.00 89.13  ? 500 ARG A NH2 1 
ATOM   6873 N N   . LYS B 1 340 ? -79.510  46.005  77.407  1.00 74.79  ? 501 LYS A N   1 
ATOM   6874 C CA  . LYS B 1 340 ? -78.075  46.243  77.248  1.00 74.66  ? 501 LYS A CA  1 
ATOM   6875 C C   . LYS B 1 340 ? -77.763  47.667  76.772  1.00 76.83  ? 501 LYS A C   1 
ATOM   6876 O O   . LYS B 1 340 ? -77.445  47.889  75.600  1.00 78.84  ? 501 LYS A O   1 
ATOM   6877 C CB  . LYS B 1 340 ? -77.476  45.204  76.293  1.00 72.42  ? 501 LYS A CB  1 
ATOM   6878 C CG  . LYS B 1 340 ? -75.954  45.148  76.275  1.00 70.64  ? 501 LYS A CG  1 
ATOM   6879 C CD  . LYS B 1 340 ? -75.438  44.337  75.093  1.00 69.35  ? 501 LYS A CD  1 
ATOM   6880 C CE  . LYS B 1 340 ? -75.610  45.072  73.770  1.00 66.99  ? 501 LYS A CE  1 
ATOM   6881 N NZ  . LYS B 1 340 ? -74.648  46.199  73.626  1.00 65.33  ? 501 LYS A NZ  1 
ATOM   6882 N N   . GLU B 1 341 ? -77.856  48.623  77.694  1.00 78.71  ? 502 GLU A N   1 
ATOM   6883 C CA  . GLU B 1 341 ? -77.532  50.030  77.424  1.00 79.78  ? 502 GLU A CA  1 
ATOM   6884 C C   . GLU B 1 341 ? -77.258  50.779  78.726  1.00 79.92  ? 502 GLU A C   1 
ATOM   6885 O O   . GLU B 1 341 ? -77.793  50.416  79.779  1.00 81.46  ? 502 GLU A O   1 
ATOM   6886 C CB  . GLU B 1 341 ? -78.650  50.721  76.630  1.00 80.29  ? 502 GLU A CB  1 
ATOM   6887 C CG  . GLU B 1 341 ? -80.019  50.707  77.297  1.00 81.14  ? 502 GLU A CG  1 
ATOM   6888 C CD  . GLU B 1 341 ? -81.138  51.086  76.347  1.00 82.24  ? 502 GLU A CD  1 
ATOM   6889 O OE1 . GLU B 1 341 ? -82.009  51.887  76.746  1.00 82.76  ? 502 GLU A OE1 1 
ATOM   6890 O OE2 . GLU B 1 341 ? -81.149  50.586  75.201  1.00 83.35  ? 502 GLU A OE2 1 
ATOM   6891 N N   . GLU B 1 342 ? -76.432  51.820  78.646  1.00 77.80  ? 503 GLU A N   1 
ATOM   6892 C CA  . GLU B 1 342 ? -76.025  52.582  79.828  1.00 78.14  ? 503 GLU A CA  1 
ATOM   6893 C C   . GLU B 1 342 ? -77.166  53.336  80.508  1.00 78.66  ? 503 GLU A C   1 
ATOM   6894 O O   . GLU B 1 342 ? -78.120  53.767  79.856  1.00 78.93  ? 503 GLU A O   1 
ATOM   6895 C CB  . GLU B 1 342 ? -74.888  53.550  79.490  1.00 78.28  ? 503 GLU A CB  1 
ATOM   6896 C CG  . GLU B 1 342 ? -73.514  53.073  79.934  1.00 79.57  ? 503 GLU A CG  1 
ATOM   6897 C CD  . GLU B 1 342 ? -72.808  52.209  78.908  1.00 81.76  ? 503 GLU A CD  1 
ATOM   6898 O OE1 . GLU B 1 342 ? -73.449  51.779  77.925  1.00 85.20  ? 503 GLU A OE1 1 
ATOM   6899 O OE2 . GLU B 1 342 ? -71.598  51.958  79.088  1.00 82.13  ? 503 GLU A OE2 1 
ATOM   6900 N N   . GLY B 1 343 ? -77.053  53.470  81.829  1.00 78.77  ? 504 GLY A N   1 
ATOM   6901 C CA  . GLY B 1 343 ? -77.974  54.267  82.634  1.00 78.93  ? 504 GLY A CA  1 
ATOM   6902 C C   . GLY B 1 343 ? -79.421  53.808  82.663  1.00 79.64  ? 504 GLY A C   1 
ATOM   6903 O O   . GLY B 1 343 ? -80.329  54.636  82.757  1.00 81.10  ? 504 GLY A O   1 
ATOM   6904 N N   . VAL B 1 344 ? -79.644  52.498  82.581  1.00 79.18  ? 505 VAL A N   1 
ATOM   6905 C CA  . VAL B 1 344 ? -80.996  51.954  82.723  1.00 78.30  ? 505 VAL A CA  1 
ATOM   6906 C C   . VAL B 1 344 ? -81.373  51.920  84.208  1.00 76.64  ? 505 VAL A C   1 
ATOM   6907 O O   . VAL B 1 344 ? -80.508  51.744  85.072  1.00 75.73  ? 505 VAL A O   1 
ATOM   6908 C CB  . VAL B 1 344 ? -81.157  50.570  82.036  1.00 79.00  ? 505 VAL A CB  1 
ATOM   6909 C CG1 . VAL B 1 344 ? -80.651  49.440  82.919  1.00 77.28  ? 505 VAL A CG1 1 
ATOM   6910 C CG2 . VAL B 1 344 ? -82.610  50.328  81.647  1.00 79.88  ? 505 VAL A CG2 1 
ATOM   6911 N N   . THR B 1 345 ? -82.657  52.124  84.494  1.00 75.44  ? 506 THR A N   1 
ATOM   6912 C CA  . THR B 1 345 ? -83.153  52.162  85.872  1.00 73.38  ? 506 THR A CA  1 
ATOM   6913 C C   . THR B 1 345 ? -84.468  51.401  86.029  1.00 71.27  ? 506 THR A C   1 
ATOM   6914 O O   . THR B 1 345 ? -85.180  51.161  85.051  1.00 70.24  ? 506 THR A O   1 
ATOM   6915 C CB  . THR B 1 345 ? -83.342  53.609  86.381  1.00 73.81  ? 506 THR A CB  1 
ATOM   6916 O OG1 . THR B 1 345 ? -84.123  54.359  85.442  1.00 74.40  ? 506 THR A OG1 1 
ATOM   6917 C CG2 . THR B 1 345 ? -81.997  54.300  86.594  1.00 73.50  ? 506 THR A CG2 1 
ATOM   6918 N N   . VAL B 1 346 ? -84.774  51.026  87.269  1.00 69.93  ? 507 VAL A N   1 
ATOM   6919 C CA  . VAL B 1 346 ? -85.983  50.269  87.591  1.00 69.62  ? 507 VAL A CA  1 
ATOM   6920 C C   . VAL B 1 346 ? -86.848  51.061  88.574  1.00 70.55  ? 507 VAL A C   1 
ATOM   6921 O O   . VAL B 1 346 ? -86.354  51.540  89.598  1.00 70.48  ? 507 VAL A O   1 
ATOM   6922 C CB  . VAL B 1 346 ? -85.637  48.881  88.182  1.00 68.37  ? 507 VAL A CB  1 
ATOM   6923 C CG1 . VAL B 1 346 ? -86.896  48.084  88.491  1.00 67.59  ? 507 VAL A CG1 1 
ATOM   6924 C CG2 . VAL B 1 346 ? -84.745  48.096  87.231  1.00 68.08  ? 507 VAL A CG2 1 
ATOM   6925 N N   . THR B 1 347 ? -88.134  51.202  88.254  1.00 70.66  ? 508 THR A N   1 
ATOM   6926 C CA  . THR B 1 347 ? -89.082  51.886  89.138  1.00 70.76  ? 508 THR A CA  1 
ATOM   6927 C C   . THR B 1 347 ? -89.513  50.959  90.275  1.00 71.06  ? 508 THR A C   1 
ATOM   6928 O O   . THR B 1 347 ? -89.229  49.759  90.244  1.00 71.83  ? 508 THR A O   1 
ATOM   6929 C CB  . THR B 1 347 ? -90.335  52.379  88.376  1.00 70.28  ? 508 THR A CB  1 
ATOM   6930 O OG1 . THR B 1 347 ? -91.108  51.256  87.937  1.00 70.34  ? 508 THR A OG1 1 
ATOM   6931 C CG2 . THR B 1 347 ? -89.948  53.234  87.172  1.00 70.02  ? 508 THR A CG2 1 
ATOM   6932 N N   . ARG B 1 348 ? -90.196  51.517  91.274  1.00 70.76  ? 509 ARG A N   1 
ATOM   6933 C CA  . ARG B 1 348 ? -90.744  50.721  92.371  1.00 71.76  ? 509 ARG A CA  1 
ATOM   6934 C C   . ARG B 1 348 ? -91.854  49.795  91.870  1.00 74.50  ? 509 ARG A C   1 
ATOM   6935 O O   . ARG B 1 348 ? -92.040  48.698  92.399  1.00 75.07  ? 509 ARG A O   1 
ATOM   6936 C CB  . ARG B 1 348 ? -91.254  51.622  93.502  1.00 70.65  ? 509 ARG A CB  1 
ATOM   6937 C CG  . ARG B 1 348 ? -91.521  50.902  94.820  1.00 70.12  ? 509 ARG A CG  1 
ATOM   6938 C CD  . ARG B 1 348 ? -90.232  50.394  95.447  1.00 70.13  ? 509 ARG A CD  1 
ATOM   6939 N NE  . ARG B 1 348 ? -90.463  49.574  96.635  1.00 70.61  ? 509 ARG A NE  1 
ATOM   6940 C CZ  . ARG B 1 348 ? -89.510  48.901  97.279  1.00 71.67  ? 509 ARG A CZ  1 
ATOM   6941 N NH1 . ARG B 1 348 ? -88.254  48.942  96.849  1.00 72.69  ? 509 ARG A NH1 1 
ATOM   6942 N NH2 . ARG B 1 348 ? -89.811  48.181  98.354  1.00 70.96  ? 509 ARG A NH2 1 
ATOM   6943 N N   . GLU B 1 349 ? -92.580  50.244  90.848  1.00 78.13  ? 510 GLU A N   1 
ATOM   6944 C CA  . GLU B 1 349 ? -93.584  49.421  90.179  1.00 81.64  ? 510 GLU A CA  1 
ATOM   6945 C C   . GLU B 1 349 ? -92.943  48.203  89.520  1.00 80.12  ? 510 GLU A C   1 
ATOM   6946 O O   . GLU B 1 349 ? -93.432  47.078  89.662  1.00 80.07  ? 510 GLU A O   1 
ATOM   6947 C CB  . GLU B 1 349 ? -94.343  50.243  89.130  1.00 86.62  ? 510 GLU A CB  1 
ATOM   6948 C CG  . GLU B 1 349 ? -95.457  51.117  89.689  1.00 93.43  ? 510 GLU A CG  1 
ATOM   6949 C CD  . GLU B 1 349 ? -96.639  50.317  90.215  1.00 98.27  ? 510 GLU A CD  1 
ATOM   6950 O OE1 . GLU B 1 349 ? -96.932  49.231  89.665  1.00 101.52 ? 510 GLU A OE1 1 
ATOM   6951 O OE2 . GLU B 1 349 ? -97.284  50.779  91.181  1.00 101.22 ? 510 GLU A OE2 1 
ATOM   6952 N N   . GLU B 1 350 ? -91.843  48.443  88.809  1.00 77.77  ? 511 GLU A N   1 
ATOM   6953 C CA  . GLU B 1 350 ? -91.132  47.402  88.074  1.00 75.82  ? 511 GLU A CA  1 
ATOM   6954 C C   . GLU B 1 350 ? -90.384  46.447  88.998  1.00 75.22  ? 511 GLU A C   1 
ATOM   6955 O O   . GLU B 1 350 ? -90.304  45.251  88.717  1.00 76.82  ? 511 GLU A O   1 
ATOM   6956 C CB  . GLU B 1 350 ? -90.166  48.023  87.064  1.00 75.45  ? 511 GLU A CB  1 
ATOM   6957 C CG  . GLU B 1 350 ? -90.837  48.635  85.845  1.00 74.92  ? 511 GLU A CG  1 
ATOM   6958 C CD  . GLU B 1 350 ? -89.892  49.496  85.028  1.00 75.41  ? 511 GLU A CD  1 
ATOM   6959 O OE1 . GLU B 1 350 ? -89.009  50.157  85.620  1.00 75.19  ? 511 GLU A OE1 1 
ATOM   6960 O OE2 . GLU B 1 350 ? -90.039  49.519  83.788  1.00 75.83  ? 511 GLU A OE2 1 
ATOM   6961 N N   . PHE B 1 351 ? -89.836  46.979  90.091  1.00 73.13  ? 512 PHE A N   1 
ATOM   6962 C CA  . PHE B 1 351 ? -89.157  46.159  91.095  1.00 71.49  ? 512 PHE A CA  1 
ATOM   6963 C C   . PHE B 1 351 ? -90.121  45.171  91.748  1.00 71.69  ? 512 PHE A C   1 
ATOM   6964 O O   . PHE B 1 351 ? -89.782  44.004  91.947  1.00 71.89  ? 512 PHE A O   1 
ATOM   6965 C CB  . PHE B 1 351 ? -88.491  47.035  92.163  1.00 70.46  ? 512 PHE A CB  1 
ATOM   6966 C CG  . PHE B 1 351 ? -88.033  46.269  93.374  1.00 70.14  ? 512 PHE A CG  1 
ATOM   6967 C CD1 . PHE B 1 351 ? -86.800  45.627  93.383  1.00 70.58  ? 512 PHE A CD1 1 
ATOM   6968 C CD2 . PHE B 1 351 ? -88.837  46.185  94.506  1.00 69.58  ? 512 PHE A CD2 1 
ATOM   6969 C CE1 . PHE B 1 351 ? -86.379  44.915  94.495  1.00 70.01  ? 512 PHE A CE1 1 
ATOM   6970 C CE2 . PHE B 1 351 ? -88.421  45.475  95.620  1.00 69.88  ? 512 PHE A CE2 1 
ATOM   6971 C CZ  . PHE B 1 351 ? -87.190  44.841  95.614  1.00 70.08  ? 512 PHE A CZ  1 
ATOM   6972 N N   . LEU B 1 352 ? -91.316  45.652  92.081  1.00 72.76  ? 513 LEU A N   1 
ATOM   6973 C CA  . LEU B 1 352 ? -92.357  44.819  92.678  1.00 74.37  ? 513 LEU A CA  1 
ATOM   6974 C C   . LEU B 1 352 ? -92.810  43.710  91.732  1.00 76.78  ? 513 LEU A C   1 
ATOM   6975 O O   . LEU B 1 352 ? -93.131  42.604  92.171  1.00 78.97  ? 513 LEU A O   1 
ATOM   6976 C CB  . LEU B 1 352 ? -93.552  45.675  93.121  1.00 72.92  ? 513 LEU A CB  1 
ATOM   6977 C CG  . LEU B 1 352 ? -93.680  46.134  94.585  1.00 71.32  ? 513 LEU A CG  1 
ATOM   6978 C CD1 . LEU B 1 352 ? -94.051  44.971  95.497  1.00 72.07  ? 513 LEU A CD1 1 
ATOM   6979 C CD2 . LEU B 1 352 ? -92.434  46.843  95.104  1.00 70.31  ? 513 LEU A CD2 1 
ATOM   6980 N N   . GLN B 1 353 ? -92.828  44.010  90.436  1.00 78.91  ? 514 GLN A N   1 
ATOM   6981 C CA  . GLN B 1 353 ? -93.159  43.013  89.423  1.00 80.41  ? 514 GLN A CA  1 
ATOM   6982 C C   . GLN B 1 353 ? -92.036  42.006  89.198  1.00 78.54  ? 514 GLN A C   1 
ATOM   6983 O O   . GLN B 1 353 ? -92.296  40.844  88.888  1.00 79.37  ? 514 GLN A O   1 
ATOM   6984 C CB  . GLN B 1 353 ? -93.546  43.678  88.099  1.00 83.06  ? 514 GLN A CB  1 
ATOM   6985 C CG  . GLN B 1 353 ? -95.048  43.755  87.864  1.00 85.38  ? 514 GLN A CG  1 
ATOM   6986 C CD  . GLN B 1 353 ? -95.713  42.387  87.847  1.00 86.52  ? 514 GLN A CD  1 
ATOM   6987 O OE1 . GLN B 1 353 ? -95.198  41.435  87.254  1.00 85.96  ? 514 GLN A OE1 1 
ATOM   6988 N NE2 . GLN B 1 353 ? -96.864  42.284  88.501  1.00 87.49  ? 514 GLN A NE2 1 
ATOM   6989 N N   . ALA B 1 354 ? -90.794  42.458  89.356  1.00 76.86  ? 515 ALA A N   1 
ATOM   6990 C CA  . ALA B 1 354 ? -89.629  41.615  89.112  1.00 76.04  ? 515 ALA A CA  1 
ATOM   6991 C C   . ALA B 1 354 ? -89.479  40.521  90.166  1.00 76.93  ? 515 ALA A C   1 
ATOM   6992 O O   . ALA B 1 354 ? -89.283  39.357  89.819  1.00 78.00  ? 515 ALA A O   1 
ATOM   6993 C CB  . ALA B 1 354 ? -88.367  42.457  89.017  1.00 74.35  ? 515 ALA A CB  1 
ATOM   6994 N N   . VAL B 1 355 ? -89.592  40.889  91.443  1.00 77.33  ? 516 VAL A N   1 
ATOM   6995 C CA  . VAL B 1 355 ? -89.478  39.924  92.546  1.00 78.11  ? 516 VAL A CA  1 
ATOM   6996 C C   . VAL B 1 355 ? -90.518  38.808  92.425  1.00 80.46  ? 516 VAL A C   1 
ATOM   6997 O O   . VAL B 1 355 ? -90.314  37.704  92.930  1.00 83.74  ? 516 VAL A O   1 
ATOM   6998 C CB  . VAL B 1 355 ? -89.577  40.591  93.942  1.00 77.14  ? 516 VAL A CB  1 
ATOM   6999 C CG1 . VAL B 1 355 ? -88.501  41.653  94.116  1.00 77.03  ? 516 VAL A CG1 1 
ATOM   7000 C CG2 . VAL B 1 355 ? -90.956  41.190  94.173  1.00 77.74  ? 516 VAL A CG2 1 
ATOM   7001 N N   . ARG B 1 356 ? -91.625  39.110  91.750  1.00 81.77  ? 517 ARG A N   1 
ATOM   7002 C CA  . ARG B 1 356 ? -92.662  38.128  91.457  1.00 84.57  ? 517 ARG A CA  1 
ATOM   7003 C C   . ARG B 1 356 ? -92.172  37.139  90.394  1.00 81.72  ? 517 ARG A C   1 
ATOM   7004 O O   . ARG B 1 356 ? -92.413  35.934  90.497  1.00 80.47  ? 517 ARG A O   1 
ATOM   7005 C CB  . ARG B 1 356 ? -93.951  38.844  91.012  1.00 89.65  ? 517 ARG A CB  1 
ATOM   7006 C CG  . ARG B 1 356 ? -95.067  37.950  90.480  1.00 96.40  ? 517 ARG A CG  1 
ATOM   7007 C CD  . ARG B 1 356 ? -95.799  37.203  91.587  1.00 101.08 ? 517 ARG A CD  1 
ATOM   7008 N NE  . ARG B 1 356 ? -96.734  36.211  91.051  1.00 105.63 ? 517 ARG A NE  1 
ATOM   7009 C CZ  . ARG B 1 356 ? -96.431  34.938  90.798  1.00 107.04 ? 517 ARG A CZ  1 
ATOM   7010 N NH1 . ARG B 1 356 ? -95.209  34.470  91.028  1.00 107.75 ? 517 ARG A NH1 1 
ATOM   7011 N NH2 . ARG B 1 356 ? -97.359  34.125  90.312  1.00 107.52 ? 517 ARG A NH2 1 
ATOM   7012 N N   . GLU B 1 357 ? -91.468  37.657  89.390  1.00 80.24  ? 518 GLU A N   1 
ATOM   7013 C CA  . GLU B 1 357 ? -90.973  36.847  88.278  1.00 79.76  ? 518 GLU A CA  1 
ATOM   7014 C C   . GLU B 1 357 ? -89.658  36.141  88.594  1.00 78.31  ? 518 GLU A C   1 
ATOM   7015 O O   . GLU B 1 357 ? -89.417  35.030  88.117  1.00 80.78  ? 518 GLU A O   1 
ATOM   7016 C CB  . GLU B 1 357 ? -90.822  37.703  87.019  1.00 81.72  ? 518 GLU A CB  1 
ATOM   7017 C CG  . GLU B 1 357 ? -92.145  38.056  86.360  1.00 85.46  ? 518 GLU A CG  1 
ATOM   7018 C CD  . GLU B 1 357 ? -92.043  39.248  85.429  1.00 88.74  ? 518 GLU A CD  1 
ATOM   7019 O OE1 . GLU B 1 357 ? -91.265  39.187  84.453  1.00 91.42  ? 518 GLU A OE1 1 
ATOM   7020 O OE2 . GLU B 1 357 ? -92.755  40.246  85.669  1.00 90.07  ? 518 GLU A OE2 1 
ATOM   7021 N N   . LEU B 1 358 ? -88.814  36.785  89.395  1.00 74.30  ? 519 LEU A N   1 
ATOM   7022 C CA  . LEU B 1 358 ? -87.510  36.229  89.753  1.00 70.62  ? 519 LEU A CA  1 
ATOM   7023 C C   . LEU B 1 358 ? -87.589  35.188  90.877  1.00 70.20  ? 519 LEU A C   1 
ATOM   7024 O O   . LEU B 1 358 ? -86.638  34.438  91.093  1.00 70.58  ? 519 LEU A O   1 
ATOM   7025 C CB  . LEU B 1 358 ? -86.510  37.343  90.099  1.00 68.50  ? 519 LEU A CB  1 
ATOM   7026 C CG  . LEU B 1 358 ? -86.206  38.420  89.045  1.00 66.58  ? 519 LEU A CG  1 
ATOM   7027 C CD1 . LEU B 1 358 ? -85.176  39.413  89.559  1.00 65.57  ? 519 LEU A CD1 1 
ATOM   7028 C CD2 . LEU B 1 358 ? -85.746  37.821  87.725  1.00 66.05  ? 519 LEU A CD2 1 
ATOM   7029 N N   . ASN B 1 359 ? -88.715  35.159  91.592  1.00 70.87  ? 520 ASN A N   1 
ATOM   7030 C CA  . ASN B 1 359 ? -88.999  34.116  92.587  1.00 72.85  ? 520 ASN A CA  1 
ATOM   7031 C C   . ASN B 1 359 ? -90.430  33.611  92.420  1.00 76.22  ? 520 ASN A C   1 
ATOM   7032 O O   . ASN B 1 359 ? -91.313  33.983  93.196  1.00 78.06  ? 520 ASN A O   1 
ATOM   7033 C CB  . ASN B 1 359 ? -88.806  34.621  94.025  1.00 71.24  ? 520 ASN A CB  1 
ATOM   7034 C CG  . ASN B 1 359 ? -87.628  35.558  94.173  1.00 70.01  ? 520 ASN A CG  1 
ATOM   7035 O OD1 . ASN B 1 359 ? -87.606  36.635  93.583  1.00 70.29  ? 520 ASN A OD1 1 
ATOM   7036 N ND2 . ASN B 1 359 ? -86.650  35.163  94.979  1.00 68.98  ? 520 ASN A ND2 1 
ATOM   7037 N N   . PRO B 1 360 ? -90.670  32.758  91.407  1.00 78.96  ? 521 PRO A N   1 
ATOM   7038 C CA  . PRO B 1 360 ? -92.043  32.372  91.089  1.00 80.15  ? 521 PRO A CA  1 
ATOM   7039 C C   . PRO B 1 360 ? -92.549  31.144  91.858  1.00 81.63  ? 521 PRO A C   1 
ATOM   7040 O O   . PRO B 1 360 ? -93.520  30.514  91.433  1.00 82.19  ? 521 PRO A O   1 
ATOM   7041 C CB  . PRO B 1 360 ? -91.974  32.081  89.586  1.00 79.15  ? 521 PRO A CB  1 
ATOM   7042 C CG  . PRO B 1 360 ? -90.544  31.714  89.319  1.00 79.07  ? 521 PRO A CG  1 
ATOM   7043 C CD  . PRO B 1 360 ? -89.704  32.105  90.507  1.00 78.93  ? 521 PRO A CD  1 
ATOM   7044 N N   . TYR B 1 361 ? -91.910  30.821  92.981  1.00 83.37  ? 522 TYR A N   1 
ATOM   7045 C CA  . TYR B 1 361 ? -92.282  29.636  93.758  1.00 85.28  ? 522 TYR A CA  1 
ATOM   7046 C C   . TYR B 1 361 ? -92.632  29.939  95.219  1.00 86.60  ? 522 TYR A C   1 
ATOM   7047 O O   . TYR B 1 361 ? -92.910  29.024  95.997  1.00 88.79  ? 522 TYR A O   1 
ATOM   7048 C CB  . TYR B 1 361 ? -91.180  28.565  93.679  1.00 85.84  ? 522 TYR A CB  1 
ATOM   7049 C CG  . TYR B 1 361 ? -90.698  28.267  92.273  1.00 86.22  ? 522 TYR A CG  1 
ATOM   7050 C CD1 . TYR B 1 361 ? -91.531  27.636  91.344  1.00 85.53  ? 522 TYR A CD1 1 
ATOM   7051 C CD2 . TYR B 1 361 ? -89.408  28.614  91.872  1.00 86.49  ? 522 TYR A CD2 1 
ATOM   7052 C CE1 . TYR B 1 361 ? -91.092  27.366  90.056  1.00 84.92  ? 522 TYR A CE1 1 
ATOM   7053 C CE2 . TYR B 1 361 ? -88.959  28.345  90.587  1.00 85.98  ? 522 TYR A CE2 1 
ATOM   7054 C CZ  . TYR B 1 361 ? -89.804  27.722  89.685  1.00 85.71  ? 522 TYR A CZ  1 
ATOM   7055 O OH  . TYR B 1 361 ? -89.361  27.456  88.411  1.00 85.75  ? 522 TYR A OH  1 
ATOM   7056 N N   . VAL B 1 362 ? -92.626  31.219  95.585  1.00 87.27  ? 523 VAL A N   1 
ATOM   7057 C CA  . VAL B 1 362 ? -92.928  31.634  96.960  1.00 88.34  ? 523 VAL A CA  1 
ATOM   7058 C C   . VAL B 1 362 ? -94.322  32.255  97.089  1.00 90.54  ? 523 VAL A C   1 
ATOM   7059 O O   . VAL B 1 362 ? -94.745  33.040  96.237  1.00 88.85  ? 523 VAL A O   1 
ATOM   7060 C CB  . VAL B 1 362 ? -91.842  32.566  97.544  1.00 88.46  ? 523 VAL A CB  1 
ATOM   7061 C CG1 . VAL B 1 362 ? -90.602  31.766  97.919  1.00 87.88  ? 523 VAL A CG1 1 
ATOM   7062 C CG2 . VAL B 1 362 ? -91.495  33.691  96.576  1.00 88.13  ? 523 VAL A CG2 1 
ATOM   7063 N N   . ASN B 1 363 ? -95.011  31.906  98.173  1.00 94.55  ? 524 ASN A N   1 
ATOM   7064 C CA  . ASN B 1 363 ? -96.461  32.122  98.306  1.00 97.49  ? 524 ASN A CA  1 
ATOM   7065 C C   . ASN B 1 363 ? -96.995  33.562  98.321  1.00 97.18  ? 524 ASN A C   1 
ATOM   7066 O O   . ASN B 1 363 ? -98.163  33.784  98.000  1.00 101.28 ? 524 ASN A O   1 
ATOM   7067 C CB  . ASN B 1 363 ? -97.031  31.323  99.493  1.00 98.77  ? 524 ASN A CB  1 
ATOM   7068 C CG  . ASN B 1 363 ? -96.220  31.490  100.766 1.00 100.15 ? 524 ASN A CG  1 
ATOM   7069 O OD1 . ASN B 1 363 ? -95.668  30.521  101.288 1.00 102.18 ? 524 ASN A OD1 1 
ATOM   7070 N ND2 . ASN B 1 363 ? -96.146  32.718  101.273 1.00 99.13  ? 524 ASN A ND2 1 
ATOM   7071 N N   . GLY B 1 364 ? -96.163  34.531  98.690  1.00 93.29  ? 525 GLY A N   1 
ATOM   7072 C CA  . GLY B 1 364 ? -96.611  35.924  98.712  1.00 90.84  ? 525 GLY A CA  1 
ATOM   7073 C C   . GLY B 1 364 ? -96.320  36.647  100.010 1.00 90.05  ? 525 GLY A C   1 
ATOM   7074 O O   . GLY B 1 364 ? -96.004  37.838  100.003 1.00 91.45  ? 525 GLY A O   1 
ATOM   7075 N N   . ALA B 1 365 ? -96.446  35.933  101.127 1.00 88.25  ? 526 ALA A N   1 
ATOM   7076 C CA  . ALA B 1 365 ? -95.967  36.428  102.414 1.00 85.52  ? 526 ALA A CA  1 
ATOM   7077 C C   . ALA B 1 365 ? -94.444  36.427  102.383 1.00 84.36  ? 526 ALA A C   1 
ATOM   7078 O O   . ALA B 1 365 ? -93.791  37.223  103.063 1.00 83.84  ? 526 ALA A O   1 
ATOM   7079 C CB  . ALA B 1 365 ? -96.482  35.558  103.547 1.00 83.94  ? 526 ALA A CB  1 
ATOM   7080 N N   . ALA B 1 366 ? -93.898  35.521  101.572 1.00 83.45  ? 527 ALA A N   1 
ATOM   7081 C CA  . ALA B 1 366 ? -92.465  35.406  101.350 1.00 82.26  ? 527 ALA A CA  1 
ATOM   7082 C C   . ALA B 1 366 ? -91.953  36.482  100.395 1.00 81.67  ? 527 ALA A C   1 
ATOM   7083 O O   . ALA B 1 366 ? -90.838  36.976  100.561 1.00 82.50  ? 527 ALA A O   1 
ATOM   7084 C CB  . ALA B 1 366 ? -92.126  34.020  100.828 1.00 81.98  ? 527 ALA A CB  1 
ATOM   7085 N N   . ARG B 1 367 ? -92.765  36.841  99.400  1.00 80.43  ? 528 ARG A N   1 
ATOM   7086 C CA  . ARG B 1 367 ? -92.423  37.930  98.480  1.00 80.75  ? 528 ARG A CA  1 
ATOM   7087 C C   . ARG B 1 367 ? -92.276  39.261  99.219  1.00 81.10  ? 528 ARG A C   1 
ATOM   7088 O O   . ARG B 1 367 ? -91.350  40.028  98.948  1.00 79.91  ? 528 ARG A O   1 
ATOM   7089 C CB  . ARG B 1 367 ? -93.459  38.058  97.363  1.00 80.57  ? 528 ARG A CB  1 
ATOM   7090 C CG  . ARG B 1 367 ? -93.307  37.044  96.242  1.00 81.78  ? 528 ARG A CG  1 
ATOM   7091 C CD  . ARG B 1 367 ? -94.139  37.430  95.026  1.00 83.73  ? 528 ARG A CD  1 
ATOM   7092 N NE  . ARG B 1 367 ? -95.576  37.409  95.300  1.00 85.27  ? 528 ARG A NE  1 
ATOM   7093 C CZ  . ARG B 1 367 ? -96.365  36.352  95.122  1.00 86.46  ? 528 ARG A CZ  1 
ATOM   7094 N NH1 . ARG B 1 367 ? -95.870  35.207  94.666  1.00 87.78  ? 528 ARG A NH1 1 
ATOM   7095 N NH2 . ARG B 1 367 ? -97.657  36.440  95.403  1.00 87.44  ? 528 ARG A NH2 1 
ATOM   7096 N N   . GLN B 1 368 ? -93.191  39.518  100.155 1.00 81.50  ? 529 GLN A N   1 
ATOM   7097 C CA  . GLN B 1 368 ? -93.139  40.705  101.009 1.00 80.98  ? 529 GLN A CA  1 
ATOM   7098 C C   . GLN B 1 368 ? -91.894  40.701  101.888 1.00 79.09  ? 529 GLN A C   1 
ATOM   7099 O O   . GLN B 1 368 ? -91.322  41.756  102.169 1.00 79.93  ? 529 GLN A O   1 
ATOM   7100 C CB  . GLN B 1 368 ? -94.381  40.794  101.891 1.00 83.58  ? 529 GLN A CB  1 
ATOM   7101 C CG  . GLN B 1 368 ? -95.658  41.163  101.156 1.00 86.70  ? 529 GLN A CG  1 
ATOM   7102 C CD  . GLN B 1 368 ? -96.900  40.895  101.988 1.00 89.95  ? 529 GLN A CD  1 
ATOM   7103 O OE1 . GLN B 1 368 ? -96.919  41.127  103.201 1.00 90.81  ? 529 GLN A OE1 1 
ATOM   7104 N NE2 . GLN B 1 368 ? -97.948  40.402  101.338 1.00 90.76  ? 529 GLN A NE2 1 
ATOM   7105 N N   . ALA B 1 369 ? -91.489  39.510  102.326 1.00 76.04  ? 530 ALA A N   1 
ATOM   7106 C CA  . ALA B 1 369 ? -90.261  39.340  103.098 1.00 73.77  ? 530 ALA A CA  1 
ATOM   7107 C C   . ALA B 1 369 ? -89.047  39.684  102.246 1.00 71.68  ? 530 ALA A C   1 
ATOM   7108 O O   . ALA B 1 369 ? -88.055  40.220  102.747 1.00 71.88  ? 530 ALA A O   1 
ATOM   7109 C CB  . ALA B 1 369 ? -90.155  37.920  103.628 1.00 73.94  ? 530 ALA A CB  1 
ATOM   7110 N N   . ILE B 1 370 ? -89.143  39.377  100.955 1.00 68.92  ? 531 ILE A N   1 
ATOM   7111 C CA  . ILE B 1 370 ? -88.085  39.682  100.005 1.00 66.89  ? 531 ILE A CA  1 
ATOM   7112 C C   . ILE B 1 370 ? -88.052  41.180  99.694  1.00 66.67  ? 531 ILE A C   1 
ATOM   7113 O O   . ILE B 1 370 ? -86.985  41.799  99.769  1.00 65.10  ? 531 ILE A O   1 
ATOM   7114 C CB  . ILE B 1 370 ? -88.210  38.839  98.717  1.00 65.52  ? 531 ILE A CB  1 
ATOM   7115 C CG1 . ILE B 1 370 ? -87.975  37.357  99.028  1.00 64.16  ? 531 ILE A CG1 1 
ATOM   7116 C CG2 . ILE B 1 370 ? -87.218  39.315  97.665  1.00 65.89  ? 531 ILE A CG2 1 
ATOM   7117 C CD1 . ILE B 1 370 ? -88.612  36.405  98.038  1.00 64.27  ? 531 ILE A CD1 1 
ATOM   7118 N N   . VAL B 1 371 ? -89.210  41.763  99.368  1.00 67.21  ? 532 VAL A N   1 
ATOM   7119 C CA  . VAL B 1 371 ? -89.270  43.197  99.039  1.00 67.57  ? 532 VAL A CA  1 
ATOM   7120 C C   . VAL B 1 371 ? -88.780  44.055  100.199 1.00 67.42  ? 532 VAL A C   1 
ATOM   7121 O O   . VAL B 1 371 ? -88.202  45.114  99.973  1.00 68.02  ? 532 VAL A O   1 
ATOM   7122 C CB  . VAL B 1 371 ? -90.659  43.700  98.542  1.00 67.41  ? 532 VAL A CB  1 
ATOM   7123 C CG1 . VAL B 1 371 ? -91.146  42.893  97.350  1.00 68.42  ? 532 VAL A CG1 1 
ATOM   7124 C CG2 . VAL B 1 371 ? -91.700  43.712  99.654  1.00 68.56  ? 532 VAL A CG2 1 
ATOM   7125 N N   . PHE B 1 372 ? -89.001  43.589  101.429 1.00 65.78  ? 533 PHE A N   1 
ATOM   7126 C CA  . PHE B 1 372 ? -88.522  44.300  102.608 1.00 65.18  ? 533 PHE A CA  1 
ATOM   7127 C C   . PHE B 1 372 ? -87.014  44.141  102.791 1.00 66.10  ? 533 PHE A C   1 
ATOM   7128 O O   . PHE B 1 372 ? -86.325  45.102  103.140 1.00 66.76  ? 533 PHE A O   1 
ATOM   7129 C CB  . PHE B 1 372 ? -89.259  43.864  103.880 1.00 64.38  ? 533 PHE A CB  1 
ATOM   7130 C CG  . PHE B 1 372 ? -88.678  44.455  105.135 1.00 64.72  ? 533 PHE A CG  1 
ATOM   7131 C CD1 . PHE B 1 372 ? -88.981  45.758  105.510 1.00 64.13  ? 533 PHE A CD1 1 
ATOM   7132 C CD2 . PHE B 1 372 ? -87.798  43.719  105.925 1.00 65.73  ? 533 PHE A CD2 1 
ATOM   7133 C CE1 . PHE B 1 372 ? -88.431  46.313  106.654 1.00 63.87  ? 533 PHE A CE1 1 
ATOM   7134 C CE2 . PHE B 1 372 ? -87.244  44.270  107.071 1.00 65.04  ? 533 PHE A CE2 1 
ATOM   7135 C CZ  . PHE B 1 372 ? -87.561  45.568  107.435 1.00 64.24  ? 533 PHE A CZ  1 
ATOM   7136 N N   . GLU B 1 373 ? -86.511  42.930  102.566 1.00 66.86  ? 534 GLU A N   1 
ATOM   7137 C CA  . GLU B 1 373 ? -85.088  42.648  102.742 1.00 67.26  ? 534 GLU A CA  1 
ATOM   7138 C C   . GLU B 1 373 ? -84.236  43.319  101.664 1.00 66.77  ? 534 GLU A C   1 
ATOM   7139 O O   . GLU B 1 373 ? -83.149  43.826  101.951 1.00 65.52  ? 534 GLU A O   1 
ATOM   7140 C CB  . GLU B 1 373 ? -84.833  41.137  102.784 1.00 68.60  ? 534 GLU A CB  1 
ATOM   7141 C CG  . GLU B 1 373 ? -83.388  40.733  103.060 1.00 70.44  ? 534 GLU A CG  1 
ATOM   7142 C CD  . GLU B 1 373 ? -82.825  41.325  104.345 1.00 72.29  ? 534 GLU A CD  1 
ATOM   7143 O OE1 . GLU B 1 373 ? -83.553  41.382  105.363 1.00 73.76  ? 534 GLU A OE1 1 
ATOM   7144 O OE2 . GLU B 1 373 ? -81.641  41.727  104.336 1.00 72.37  ? 534 GLU A OE2 1 
ATOM   7145 N N   . TYR B 1 374 ? -84.742  43.332  100.433 1.00 67.30  ? 535 TYR A N   1 
ATOM   7146 C CA  . TYR B 1 374 ? -84.004  43.900  99.308  1.00 67.83  ? 535 TYR A CA  1 
ATOM   7147 C C   . TYR B 1 374 ? -84.549  45.252  98.844  1.00 69.22  ? 535 TYR A C   1 
ATOM   7148 O O   . TYR B 1 374 ? -84.787  45.471  97.655  1.00 72.02  ? 535 TYR A O   1 
ATOM   7149 C CB  . TYR B 1 374 ? -83.906  42.891  98.157  1.00 66.71  ? 535 TYR A CB  1 
ATOM   7150 C CG  . TYR B 1 374 ? -82.965  41.754  98.472  1.00 65.53  ? 535 TYR A CG  1 
ATOM   7151 C CD1 . TYR B 1 374 ? -81.590  41.894  98.285  1.00 65.04  ? 535 TYR A CD1 1 
ATOM   7152 C CD2 . TYR B 1 374 ? -83.443  40.551  98.984  1.00 64.57  ? 535 TYR A CD2 1 
ATOM   7153 C CE1 . TYR B 1 374 ? -80.720  40.862  98.589  1.00 64.90  ? 535 TYR A CE1 1 
ATOM   7154 C CE2 . TYR B 1 374 ? -82.580  39.512  99.288  1.00 64.43  ? 535 TYR A CE2 1 
ATOM   7155 C CZ  . TYR B 1 374 ? -81.222  39.673  99.088  1.00 65.17  ? 535 TYR A CZ  1 
ATOM   7156 O OH  . TYR B 1 374 ? -80.360  38.645  99.387  1.00 66.55  ? 535 TYR A OH  1 
ATOM   7157 N N   . THR B 1 375 ? -84.741  46.155  99.799  1.00 69.10  ? 536 THR A N   1 
ATOM   7158 C CA  . THR B 1 375 ? -85.087  47.538  99.487  1.00 69.13  ? 536 THR A CA  1 
ATOM   7159 C C   . THR B 1 375 ? -84.314  48.499  100.384 1.00 68.75  ? 536 THR A C   1 
ATOM   7160 O O   . THR B 1 375 ? -84.248  48.320  101.601 1.00 69.19  ? 536 THR A O   1 
ATOM   7161 C CB  . THR B 1 375 ? -86.611  47.802  99.550  1.00 68.90  ? 536 THR A CB  1 
ATOM   7162 O OG1 . THR B 1 375 ? -86.879  49.173  99.238  1.00 71.25  ? 536 THR A OG1 1 
ATOM   7163 C CG2 . THR B 1 375 ? -87.169  47.497  100.915 1.00 67.42  ? 536 THR A CG2 1 
ATOM   7164 N N   . ASP B 1 376 ? -83.714  49.505  99.760  1.00 69.50  ? 537 ASP A N   1 
ATOM   7165 C CA  . ASP B 1 376 ? -82.972  50.536  100.468 1.00 70.93  ? 537 ASP A CA  1 
ATOM   7166 C C   . ASP B 1 376 ? -83.961  51.490  101.129 1.00 72.39  ? 537 ASP A C   1 
ATOM   7167 O O   . ASP B 1 376 ? -84.608  52.288  100.453 1.00 73.96  ? 537 ASP A O   1 
ATOM   7168 C CB  . ASP B 1 376 ? -82.064  51.275  99.485  1.00 70.54  ? 537 ASP A CB  1 
ATOM   7169 C CG  . ASP B 1 376 ? -81.339  52.442  100.113 1.00 70.91  ? 537 ASP A CG  1 
ATOM   7170 O OD1 . ASP B 1 376 ? -80.762  52.273  101.207 1.00 72.50  ? 537 ASP A OD1 1 
ATOM   7171 O OD2 . ASP B 1 376 ? -81.337  53.529  99.499  1.00 71.49  ? 537 ASP A OD2 1 
ATOM   7172 N N   . TRP B 1 377 ? -84.080  51.397  102.452 1.00 72.73  ? 538 TRP A N   1 
ATOM   7173 C CA  . TRP B 1 377 ? -85.115  52.128  103.186 1.00 71.64  ? 538 TRP A CA  1 
ATOM   7174 C C   . TRP B 1 377 ? -84.799  53.600  103.453 1.00 74.12  ? 538 TRP A C   1 
ATOM   7175 O O   . TRP B 1 377 ? -85.677  54.353  103.888 1.00 75.98  ? 538 TRP A O   1 
ATOM   7176 C CB  . TRP B 1 377 ? -85.472  51.410  104.488 1.00 68.70  ? 538 TRP A CB  1 
ATOM   7177 C CG  . TRP B 1 377 ? -86.325  50.194  104.289 1.00 67.17  ? 538 TRP A CG  1 
ATOM   7178 C CD1 . TRP B 1 377 ? -85.982  48.905  104.562 1.00 67.01  ? 538 TRP A CD1 1 
ATOM   7179 C CD2 . TRP B 1 377 ? -87.663  50.152  103.772 1.00 66.84  ? 538 TRP A CD2 1 
ATOM   7180 N NE1 . TRP B 1 377 ? -87.021  48.061  104.256 1.00 66.77  ? 538 TRP A NE1 1 
ATOM   7181 C CE2 . TRP B 1 377 ? -88.068  48.801  103.773 1.00 66.84  ? 538 TRP A CE2 1 
ATOM   7182 C CE3 . TRP B 1 377 ? -88.563  51.127  103.320 1.00 67.37  ? 538 TRP A CE3 1 
ATOM   7183 C CZ2 . TRP B 1 377 ? -89.332  48.394  103.330 1.00 67.15  ? 538 TRP A CZ2 1 
ATOM   7184 C CZ3 . TRP B 1 377 ? -89.821  50.722  102.880 1.00 67.55  ? 538 TRP A CZ3 1 
ATOM   7185 C CH2 . TRP B 1 377 ? -90.191  49.366  102.888 1.00 67.67  ? 538 TRP A CH2 1 
ATOM   7186 N N   . THR B 1 378 ? -83.557  54.007  103.190 1.00 75.42  ? 539 THR A N   1 
ATOM   7187 C CA  . THR B 1 378 ? -83.187  55.424  103.253 1.00 77.24  ? 539 THR A CA  1 
ATOM   7188 C C   . THR B 1 378 ? -83.789  56.187  102.067 1.00 79.53  ? 539 THR A C   1 
ATOM   7189 O O   . THR B 1 378 ? -84.021  57.396  102.150 1.00 82.48  ? 539 THR A O   1 
ATOM   7190 C CB  . THR B 1 378 ? -81.658  55.636  103.285 1.00 75.59  ? 539 THR A CB  1 
ATOM   7191 O OG1 . THR B 1 378 ? -81.088  55.229  102.036 1.00 76.09  ? 539 THR A OG1 1 
ATOM   7192 C CG2 . THR B 1 378 ? -81.017  54.847  104.422 1.00 74.91  ? 539 THR A CG2 1 
ATOM   7193 N N   . GLU B 1 379 ? -84.038  55.466  100.973 1.00 79.52  ? 540 GLU A N   1 
ATOM   7194 C CA  . GLU B 1 379 ? -84.676  56.017  99.779  1.00 79.22  ? 540 GLU A CA  1 
ATOM   7195 C C   . GLU B 1 379 ? -85.361  54.894  98.984  1.00 78.58  ? 540 GLU A C   1 
ATOM   7196 O O   . GLU B 1 379 ? -84.801  54.401  98.000  1.00 78.46  ? 540 GLU A O   1 
ATOM   7197 C CB  . GLU B 1 379 ? -83.639  56.740  98.918  1.00 80.44  ? 540 GLU A CB  1 
ATOM   7198 C CG  . GLU B 1 379 ? -84.222  57.760  97.956  1.00 82.40  ? 540 GLU A CG  1 
ATOM   7199 C CD  . GLU B 1 379 ? -83.161  58.660  97.353  1.00 83.60  ? 540 GLU A CD  1 
ATOM   7200 O OE1 . GLU B 1 379 ? -82.220  59.053  98.080  1.00 83.20  ? 540 GLU A OE1 1 
ATOM   7201 O OE2 . GLU B 1 379 ? -83.272  58.980  96.151  1.00 84.19  ? 540 GLU A OE2 1 
ATOM   7202 N N   . PRO B 1 380 ? -86.579  54.489  99.411  1.00 77.79  ? 541 PRO A N   1 
ATOM   7203 C CA  . PRO B 1 380 ? -87.268  53.285  98.916  1.00 77.35  ? 541 PRO A CA  1 
ATOM   7204 C C   . PRO B 1 380 ? -87.635  53.300  97.433  1.00 78.59  ? 541 PRO A C   1 
ATOM   7205 O O   . PRO B 1 380 ? -87.756  52.236  96.822  1.00 78.71  ? 541 PRO A O   1 
ATOM   7206 C CB  . PRO B 1 380 ? -88.547  53.230  99.764  1.00 75.79  ? 541 PRO A CB  1 
ATOM   7207 C CG  . PRO B 1 380 ? -88.277  54.103  100.941 1.00 77.14  ? 541 PRO A CG  1 
ATOM   7208 C CD  . PRO B 1 380 ? -87.395  55.193  100.415 1.00 77.93  ? 541 PRO A CD  1 
ATOM   7209 N N   . ASP B 1 381 ? -87.809  54.489  96.864  1.00 79.94  ? 542 ASP A N   1 
ATOM   7210 C CA  . ASP B 1 381 ? -88.243  54.611  95.474  1.00 80.33  ? 542 ASP A CA  1 
ATOM   7211 C C   . ASP B 1 381 ? -87.111  54.876  94.480  1.00 78.64  ? 542 ASP A C   1 
ATOM   7212 O O   . ASP B 1 381 ? -87.354  54.956  93.274  1.00 79.12  ? 542 ASP A O   1 
ATOM   7213 C CB  . ASP B 1 381 ? -89.343  55.671  95.347  1.00 83.07  ? 542 ASP A CB  1 
ATOM   7214 C CG  . ASP B 1 381 ? -90.684  55.190  95.881  1.00 85.29  ? 542 ASP A CG  1 
ATOM   7215 O OD1 . ASP B 1 381 ? -90.706  54.284  96.744  1.00 86.38  ? 542 ASP A OD1 1 
ATOM   7216 O OD2 . ASP B 1 381 ? -91.722  55.722  95.434  1.00 87.25  ? 542 ASP A OD2 1 
ATOM   7217 N N   . ASN B 1 382 ? -85.883  55.005  94.986  1.00 76.37  ? 543 ASN A N   1 
ATOM   7218 C CA  . ASN B 1 382 ? -84.717  55.290  94.144  1.00 74.86  ? 543 ASN A CA  1 
ATOM   7219 C C   . ASN B 1 382 ? -84.563  54.292  92.990  1.00 75.92  ? 543 ASN A C   1 
ATOM   7220 O O   . ASN B 1 382 ? -84.489  53.080  93.219  1.00 76.10  ? 543 ASN A O   1 
ATOM   7221 C CB  . ASN B 1 382 ? -83.438  55.360  94.986  1.00 72.54  ? 543 ASN A CB  1 
ATOM   7222 C CG  . ASN B 1 382 ? -82.231  55.832  94.190  1.00 70.97  ? 543 ASN A CG  1 
ATOM   7223 O OD1 . ASN B 1 382 ? -81.857  55.233  93.182  1.00 69.38  ? 543 ASN A OD1 1 
ATOM   7224 N ND2 . ASN B 1 382 ? -81.607  56.906  94.653  1.00 71.90  ? 543 ASN A ND2 1 
ATOM   7225 N N   . PRO B 1 383 ? -84.522  54.807  91.744  1.00 76.29  ? 544 PRO A N   1 
ATOM   7226 C CA  . PRO B 1 383 ? -84.454  53.997  90.525  1.00 75.60  ? 544 PRO A CA  1 
ATOM   7227 C C   . PRO B 1 383 ? -83.182  53.148  90.414  1.00 74.59  ? 544 PRO A C   1 
ATOM   7228 O O   . PRO B 1 383 ? -83.248  52.011  89.941  1.00 75.06  ? 544 PRO A O   1 
ATOM   7229 C CB  . PRO B 1 383 ? -84.511  55.042  89.403  1.00 75.97  ? 544 PRO A CB  1 
ATOM   7230 C CG  . PRO B 1 383 ? -85.134  56.243  90.027  1.00 75.95  ? 544 PRO A CG  1 
ATOM   7231 C CD  . PRO B 1 383 ? -84.608  56.245  91.429  1.00 76.22  ? 544 PRO A CD  1 
ATOM   7232 N N   . ASN B 1 384 ? -82.045  53.700  90.841  1.00 72.35  ? 545 ASN A N   1 
ATOM   7233 C CA  . ASN B 1 384 ? -80.785  52.953  90.891  1.00 71.18  ? 545 ASN A CA  1 
ATOM   7234 C C   . ASN B 1 384 ? -80.807  51.868  91.958  1.00 70.29  ? 545 ASN A C   1 
ATOM   7235 O O   . ASN B 1 384 ? -80.327  50.752  91.737  1.00 70.77  ? 545 ASN A O   1 
ATOM   7236 C CB  . ASN B 1 384 ? -79.606  53.893  91.146  1.00 71.11  ? 545 ASN A CB  1 
ATOM   7237 C CG  . ASN B 1 384 ? -79.199  54.668  89.913  1.00 71.87  ? 545 ASN A CG  1 
ATOM   7238 O OD1 . ASN B 1 384 ? -80.043  55.111  89.135  1.00 73.57  ? 545 ASN A OD1 1 
ATOM   7239 N ND2 . ASN B 1 384 ? -77.896  54.838  89.729  1.00 72.03  ? 545 ASN A ND2 1 
ATOM   7240 N N   . SER B 1 385 ? -81.370  52.214  93.114  1.00 67.82  ? 546 SER A N   1 
ATOM   7241 C CA  . SER B 1 385 ? -81.468  51.308  94.247  1.00 64.86  ? 546 SER A CA  1 
ATOM   7242 C C   . SER B 1 385 ? -82.307  50.085  93.894  1.00 63.00  ? 546 SER A C   1 
ATOM   7243 O O   . SER B 1 385 ? -81.906  48.956  94.168  1.00 61.76  ? 546 SER A O   1 
ATOM   7244 C CB  . SER B 1 385 ? -82.070  52.039  95.444  1.00 65.36  ? 546 SER A CB  1 
ATOM   7245 O OG  . SER B 1 385 ? -81.338  51.767  96.621  1.00 66.60  ? 546 SER A OG  1 
ATOM   7246 N N   . ASN B 1 386 ? -83.457  50.319  93.266  1.00 62.79  ? 547 ASN A N   1 
ATOM   7247 C CA  . ASN B 1 386 ? -84.355  49.242  92.846  1.00 63.84  ? 547 ASN A CA  1 
ATOM   7248 C C   . ASN B 1 386 ? -83.794  48.325  91.752  1.00 64.36  ? 547 ASN A C   1 
ATOM   7249 O O   . ASN B 1 386 ? -84.251  47.191  91.598  1.00 65.08  ? 547 ASN A O   1 
ATOM   7250 C CB  . ASN B 1 386 ? -85.717  49.806  92.430  1.00 63.89  ? 547 ASN A CB  1 
ATOM   7251 C CG  . ASN B 1 386 ? -86.645  50.022  93.611  1.00 64.86  ? 547 ASN A CG  1 
ATOM   7252 O OD1 . ASN B 1 386 ? -86.657  49.239  94.562  1.00 66.17  ? 547 ASN A OD1 1 
ATOM   7253 N ND2 . ASN B 1 386 ? -87.437  51.084  93.551  1.00 66.15  ? 547 ASN A ND2 1 
ATOM   7254 N N   . ARG B 1 387 ? -82.814  48.818  90.998  1.00 64.36  ? 548 ARG A N   1 
ATOM   7255 C CA  . ARG B 1 387 ? -82.116  48.000  90.008  1.00 64.21  ? 548 ARG A CA  1 
ATOM   7256 C C   . ARG B 1 387 ? -81.064  47.119  90.685  1.00 65.55  ? 548 ARG A C   1 
ATOM   7257 O O   . ARG B 1 387 ? -81.040  45.902  90.481  1.00 64.98  ? 548 ARG A O   1 
ATOM   7258 C CB  . ARG B 1 387 ? -81.478  48.881  88.928  1.00 63.23  ? 548 ARG A CB  1 
ATOM   7259 C CG  . ARG B 1 387 ? -80.484  48.152  88.034  1.00 62.16  ? 548 ARG A CG  1 
ATOM   7260 C CD  . ARG B 1 387 ? -79.820  49.066  87.013  1.00 61.88  ? 548 ARG A CD  1 
ATOM   7261 N NE  . ARG B 1 387 ? -79.447  50.374  87.554  1.00 62.35  ? 548 ARG A NE  1 
ATOM   7262 C CZ  . ARG B 1 387 ? -78.388  50.609  88.326  1.00 63.26  ? 548 ARG A CZ  1 
ATOM   7263 N NH1 . ARG B 1 387 ? -77.573  49.623  88.679  1.00 64.09  ? 548 ARG A NH1 1 
ATOM   7264 N NH2 . ARG B 1 387 ? -78.147  51.840  88.755  1.00 63.93  ? 548 ARG A NH2 1 
ATOM   7265 N N   . ASP B 1 388 ? -80.206  47.745  91.492  1.00 66.95  ? 549 ASP A N   1 
ATOM   7266 C CA  . ASP B 1 388 ? -79.151  47.044  92.227  1.00 67.37  ? 549 ASP A CA  1 
ATOM   7267 C C   . ASP B 1 388 ? -79.733  46.048  93.228  1.00 65.37  ? 549 ASP A C   1 
ATOM   7268 O O   . ASP B 1 388 ? -79.088  45.059  93.581  1.00 64.19  ? 549 ASP A O   1 
ATOM   7269 C CB  . ASP B 1 388 ? -78.242  48.047  92.943  1.00 70.18  ? 549 ASP A CB  1 
ATOM   7270 C CG  . ASP B 1 388 ? -76.898  47.450  93.321  1.00 73.23  ? 549 ASP A CG  1 
ATOM   7271 O OD1 . ASP B 1 388 ? -76.040  47.287  92.423  1.00 74.62  ? 549 ASP A OD1 1 
ATOM   7272 O OD2 . ASP B 1 388 ? -76.696  47.152  94.519  1.00 73.52  ? 549 ASP A OD2 1 
ATOM   7273 N N   . ALA B 1 389 ? -80.956  46.323  93.674  1.00 64.27  ? 550 ALA A N   1 
ATOM   7274 C CA  . ALA B 1 389 ? -81.696  45.424  94.550  1.00 63.39  ? 550 ALA A CA  1 
ATOM   7275 C C   . ALA B 1 389 ? -82.002  44.100  93.855  1.00 61.93  ? 550 ALA A C   1 
ATOM   7276 O O   . ALA B 1 389 ? -82.000  43.046  94.491  1.00 62.91  ? 550 ALA A O   1 
ATOM   7277 C CB  . ALA B 1 389 ? -82.980  46.086  95.023  1.00 63.61  ? 550 ALA A CB  1 
ATOM   7278 N N   . LEU B 1 390 ? -82.261  44.161  92.551  1.00 60.00  ? 551 LEU A N   1 
ATOM   7279 C CA  . LEU B 1 390 ? -82.554  42.965  91.770  1.00 59.95  ? 551 LEU A CA  1 
ATOM   7280 C C   . LEU B 1 390 ? -81.320  42.085  91.604  1.00 61.66  ? 551 LEU A C   1 
ATOM   7281 O O   . LEU B 1 390 ? -81.410  40.858  91.704  1.00 62.71  ? 551 LEU A O   1 
ATOM   7282 C CB  . LEU B 1 390 ? -83.142  43.330  90.405  1.00 58.49  ? 551 LEU A CB  1 
ATOM   7283 C CG  . LEU B 1 390 ? -84.528  43.977  90.394  1.00 57.54  ? 551 LEU A CG  1 
ATOM   7284 C CD1 . LEU B 1 390 ? -84.958  44.277  88.967  1.00 56.78  ? 551 LEU A CD1 1 
ATOM   7285 C CD2 . LEU B 1 390 ? -85.551  43.094  91.094  1.00 57.29  ? 551 LEU A CD2 1 
ATOM   7286 N N   . ASP B 1 391 ? -80.173  42.716  91.355  1.00 62.13  ? 552 ASP A N   1 
ATOM   7287 C CA  . ASP B 1 391 ? -78.904  42.001  91.242  1.00 62.44  ? 552 ASP A CA  1 
ATOM   7288 C C   . ASP B 1 391 ? -78.577  41.239  92.519  1.00 63.19  ? 552 ASP A C   1 
ATOM   7289 O O   . ASP B 1 391 ? -78.139  40.089  92.466  1.00 65.59  ? 552 ASP A O   1 
ATOM   7290 C CB  . ASP B 1 391 ? -77.761  42.962  90.916  1.00 62.99  ? 552 ASP A CB  1 
ATOM   7291 C CG  . ASP B 1 391 ? -76.399  42.383  91.266  1.00 63.86  ? 552 ASP A CG  1 
ATOM   7292 O OD1 . ASP B 1 391 ? -75.972  41.411  90.608  1.00 64.23  ? 552 ASP A OD1 1 
ATOM   7293 O OD2 . ASP B 1 391 ? -75.764  42.893  92.212  1.00 64.26  ? 552 ASP A OD2 1 
ATOM   7294 N N   . LYS B 1 392 ? -78.790  41.891  93.660  1.00 61.76  ? 553 LYS A N   1 
ATOM   7295 C CA  . LYS B 1 392 ? -78.443  41.313  94.954  1.00 60.57  ? 553 LYS A CA  1 
ATOM   7296 C C   . LYS B 1 392 ? -79.296  40.107  95.329  1.00 60.24  ? 553 LYS A C   1 
ATOM   7297 O O   . LYS B 1 392 ? -78.773  39.111  95.823  1.00 60.14  ? 553 LYS A O   1 
ATOM   7298 C CB  . LYS B 1 392 ? -78.477  42.379  96.055  1.00 59.37  ? 553 LYS A CB  1 
ATOM   7299 C CG  . LYS B 1 392 ? -77.110  42.954  96.402  1.00 57.86  ? 553 LYS A CG  1 
ATOM   7300 C CD  . LYS B 1 392 ? -76.517  43.758  95.261  1.00 57.21  ? 553 LYS A CD  1 
ATOM   7301 C CE  . LYS B 1 392 ? -75.014  43.894  95.409  1.00 57.26  ? 553 LYS A CE  1 
ATOM   7302 N NZ  . LYS B 1 392 ? -74.419  44.533  94.203  1.00 58.30  ? 553 LYS A NZ  1 
ATOM   7303 N N   . MET B 1 393 ? -80.598  40.181  95.079  1.00 59.85  ? 554 MET A N   1 
ATOM   7304 C CA  . MET B 1 393 ? -81.487  39.083  95.447  1.00 60.53  ? 554 MET A CA  1 
ATOM   7305 C C   . MET B 1 393 ? -81.273  37.837  94.590  1.00 60.41  ? 554 MET A C   1 
ATOM   7306 O O   . MET B 1 393 ? -81.433  36.717  95.074  1.00 61.91  ? 554 MET A O   1 
ATOM   7307 C CB  . MET B 1 393 ? -82.946  39.525  95.429  1.00 60.59  ? 554 MET A CB  1 
ATOM   7308 C CG  . MET B 1 393 ? -83.440  40.022  94.087  1.00 60.95  ? 554 MET A CG  1 
ATOM   7309 S SD  . MET B 1 393 ? -85.220  40.225  94.141  1.00 63.07  ? 554 MET A SD  1 
ATOM   7310 C CE  . MET B 1 393 ? -85.711  38.549  94.513  1.00 62.10  ? 554 MET A CE  1 
ATOM   7311 N N   . VAL B 1 394 ? -80.906  38.037  93.326  1.00 59.37  ? 555 VAL A N   1 
ATOM   7312 C CA  . VAL B 1 394 ? -80.546  36.926  92.446  1.00 58.75  ? 555 VAL A CA  1 
ATOM   7313 C C   . VAL B 1 394 ? -79.131  36.447  92.775  1.00 58.41  ? 555 VAL A C   1 
ATOM   7314 O O   . VAL B 1 394 ? -78.893  35.246  92.913  1.00 59.53  ? 555 VAL A O   1 
ATOM   7315 C CB  . VAL B 1 394 ? -80.675  37.302  90.951  1.00 58.10  ? 555 VAL A CB  1 
ATOM   7316 C CG1 . VAL B 1 394 ? -80.050  36.239  90.060  1.00 57.64  ? 555 VAL A CG1 1 
ATOM   7317 C CG2 . VAL B 1 394 ? -82.136  37.493  90.579  1.00 58.33  ? 555 VAL A CG2 1 
ATOM   7318 N N   . GLY B 1 395 ? -78.210  37.397  92.919  1.00 57.73  ? 556 GLY A N   1 
ATOM   7319 C CA  . GLY B 1 395 ? -76.815  37.103  93.241  1.00 57.67  ? 556 GLY A CA  1 
ATOM   7320 C C   . GLY B 1 395 ? -76.604  36.407  94.575  1.00 57.76  ? 556 GLY A C   1 
ATOM   7321 O O   . GLY B 1 395 ? -75.667  35.624  94.723  1.00 58.45  ? 556 GLY A O   1 
ATOM   7322 N N   . ASP B 1 396 ? -77.471  36.687  95.545  1.00 57.43  ? 557 ASP A N   1 
ATOM   7323 C CA  . ASP B 1 396 ? -77.352  36.085  96.871  1.00 57.09  ? 557 ASP A CA  1 
ATOM   7324 C C   . ASP B 1 396 ? -77.943  34.684  96.919  1.00 57.99  ? 557 ASP A C   1 
ATOM   7325 O O   . ASP B 1 396 ? -77.294  33.756  97.402  1.00 58.26  ? 557 ASP A O   1 
ATOM   7326 C CB  . ASP B 1 396 ? -77.995  36.971  97.944  1.00 55.86  ? 557 ASP A CB  1 
ATOM   7327 C CG  . ASP B 1 396 ? -77.234  38.269  98.172  1.00 54.67  ? 557 ASP A CG  1 
ATOM   7328 O OD1 . ASP B 1 396 ? -76.133  38.435  97.605  1.00 54.47  ? 557 ASP A OD1 1 
ATOM   7329 O OD2 . ASP B 1 396 ? -77.741  39.132  98.917  1.00 53.49  ? 557 ASP A OD2 1 
ATOM   7330 N N   . TYR B 1 397 ? -79.166  34.535  96.411  1.00 59.03  ? 558 TYR A N   1 
ATOM   7331 C CA  . TYR B 1 397 ? -79.888  33.261  96.477  1.00 59.58  ? 558 TYR A CA  1 
ATOM   7332 C C   . TYR B 1 397 ? -79.274  32.164  95.607  1.00 60.15  ? 558 TYR A C   1 
ATOM   7333 O O   . TYR B 1 397 ? -79.252  30.993  95.998  1.00 60.60  ? 558 TYR A O   1 
ATOM   7334 C CB  . TYR B 1 397 ? -81.369  33.453  96.125  1.00 59.28  ? 558 TYR A CB  1 
ATOM   7335 C CG  . TYR B 1 397 ? -82.159  32.162  96.063  1.00 59.90  ? 558 TYR A CG  1 
ATOM   7336 C CD1 . TYR B 1 397 ? -82.367  31.388  97.207  1.00 59.99  ? 558 TYR A CD1 1 
ATOM   7337 C CD2 . TYR B 1 397 ? -82.698  31.714  94.859  1.00 60.86  ? 558 TYR A CD2 1 
ATOM   7338 C CE1 . TYR B 1 397 ? -83.087  30.205  97.151  1.00 60.52  ? 558 TYR A CE1 1 
ATOM   7339 C CE2 . TYR B 1 397 ? -83.421  30.533  94.793  1.00 61.45  ? 558 TYR A CE2 1 
ATOM   7340 C CZ  . TYR B 1 397 ? -83.612  29.784  95.940  1.00 61.31  ? 558 TYR A CZ  1 
ATOM   7341 O OH  . TYR B 1 397 ? -84.329  28.614  95.874  1.00 62.76  ? 558 TYR A OH  1 
ATOM   7342 N N   . HIS B 1 398 ? -78.774  32.547  94.437  1.00 60.26  ? 559 HIS A N   1 
ATOM   7343 C CA  . HIS B 1 398 ? -78.231  31.581  93.493  1.00 60.98  ? 559 HIS A CA  1 
ATOM   7344 C C   . HIS B 1 398 ? -76.715  31.406  93.588  1.00 61.89  ? 559 HIS A C   1 
ATOM   7345 O O   . HIS B 1 398 ? -76.182  30.396  93.124  1.00 63.94  ? 559 HIS A O   1 
ATOM   7346 C CB  . HIS B 1 398 ? -78.637  31.941  92.061  1.00 61.64  ? 559 HIS A CB  1 
ATOM   7347 C CG  . HIS B 1 398 ? -80.112  31.864  91.810  1.00 62.07  ? 559 HIS A CG  1 
ATOM   7348 N ND1 . HIS B 1 398 ? -80.790  30.667  91.719  1.00 62.33  ? 559 HIS A ND1 1 
ATOM   7349 C CD2 . HIS B 1 398 ? -81.035  32.835  91.617  1.00 62.08  ? 559 HIS A CD2 1 
ATOM   7350 C CE1 . HIS B 1 398 ? -82.069  30.905  91.489  1.00 62.53  ? 559 HIS A CE1 1 
ATOM   7351 N NE2 . HIS B 1 398 ? -82.245  32.213  91.422  1.00 62.17  ? 559 HIS A NE2 1 
ATOM   7352 N N   . PHE B 1 399 ? -76.019  32.371  94.190  1.00 62.37  ? 560 PHE A N   1 
ATOM   7353 C CA  . PHE B 1 399 ? -74.550  32.346  94.194  1.00 63.77  ? 560 PHE A CA  1 
ATOM   7354 C C   . PHE B 1 399 ? -73.864  32.626  95.538  1.00 64.78  ? 560 PHE A C   1 
ATOM   7355 O O   . PHE B 1 399 ? -73.442  31.688  96.216  1.00 66.99  ? 560 PHE A O   1 
ATOM   7356 C CB  . PHE B 1 399 ? -73.990  33.246  93.082  1.00 63.01  ? 560 PHE A CB  1 
ATOM   7357 C CG  . PHE B 1 399 ? -74.398  32.814  91.704  1.00 63.42  ? 560 PHE A CG  1 
ATOM   7358 C CD1 . PHE B 1 399 ? -75.506  33.381  91.082  1.00 63.51  ? 560 PHE A CD1 1 
ATOM   7359 C CD2 . PHE B 1 399 ? -73.689  31.823  91.035  1.00 64.17  ? 560 PHE A CD2 1 
ATOM   7360 C CE1 . PHE B 1 399 ? -75.893  32.974  89.815  1.00 63.99  ? 560 PHE A CE1 1 
ATOM   7361 C CE2 . PHE B 1 399 ? -74.070  31.413  89.767  1.00 64.68  ? 560 PHE A CE2 1 
ATOM   7362 C CZ  . PHE B 1 399 ? -75.174  31.987  89.157  1.00 64.38  ? 560 PHE A CZ  1 
ATOM   7363 N N   . THR B 1 400 ? -73.757  33.903  95.912  1.00 64.94  ? 561 THR A N   1 
ATOM   7364 C CA  . THR B 1 400 ? -72.970  34.337  97.078  1.00 64.10  ? 561 THR A CA  1 
ATOM   7365 C C   . THR B 1 400 ? -73.255  33.551  98.359  1.00 64.30  ? 561 THR A C   1 
ATOM   7366 O O   . THR B 1 400 ? -72.329  33.197  99.089  1.00 63.90  ? 561 THR A O   1 
ATOM   7367 C CB  . THR B 1 400 ? -73.137  35.852  97.358  1.00 64.06  ? 561 THR A CB  1 
ATOM   7368 O OG1 . THR B 1 400 ? -72.988  36.594  96.142  1.00 63.97  ? 561 THR A OG1 1 
ATOM   7369 C CG2 . THR B 1 400 ? -72.098  36.342  98.362  1.00 63.72  ? 561 THR A CG2 1 
ATOM   7370 N N   . CYS B 1 401 ? -74.528  33.268  98.620  1.00 66.56  ? 562 CYS A N   1 
ATOM   7371 C CA  . CYS B 1 401 ? -74.921  32.605  99.864  1.00 69.21  ? 562 CYS A CA  1 
ATOM   7372 C C   . CYS B 1 401 ? -74.645  31.113  99.885  1.00 67.81  ? 562 CYS A C   1 
ATOM   7373 O O   . CYS B 1 401 ? -74.370  30.545  100.941 1.00 68.57  ? 562 CYS A O   1 
ATOM   7374 C CB  . CYS B 1 401 ? -76.382  32.901  100.200 1.00 73.20  ? 562 CYS A CB  1 
ATOM   7375 S SG  . CYS B 1 401 ? -76.617  34.615  100.729 1.00 81.14  ? 562 CYS A SG  1 
ATOM   7376 N N   . ASN B 1 402 ? -74.714  30.485  98.718  1.00 67.04  ? 563 ASN A N   1 
ATOM   7377 C CA  . ASN B 1 402 ? -74.390  29.072  98.587  1.00 66.60  ? 563 ASN A CA  1 
ATOM   7378 C C   . ASN B 1 402 ? -72.890  28.824  98.736  1.00 66.30  ? 563 ASN A C   1 
ATOM   7379 O O   . ASN B 1 402 ? -72.476  27.818  99.317  1.00 66.61  ? 563 ASN A O   1 
ATOM   7380 C CB  . ASN B 1 402 ? -74.915  28.539  97.259  1.00 67.55  ? 563 ASN A CB  1 
ATOM   7381 C CG  . ASN B 1 402 ? -76.410  28.734  97.114  1.00 69.42  ? 563 ASN A CG  1 
ATOM   7382 O OD1 . ASN B 1 402 ? -77.204  28.062  97.773  1.00 70.50  ? 563 ASN A OD1 1 
ATOM   7383 N ND2 . ASN B 1 402 ? -76.803  29.661  96.251  1.00 70.79  ? 563 ASN A ND2 1 
ATOM   7384 N N   . VAL B 1 403 ? -72.089  29.753  98.214  1.00 65.49  ? 564 VAL A N   1 
ATOM   7385 C CA  . VAL B 1 403 ? -70.636  29.756  98.399  1.00 65.42  ? 564 VAL A CA  1 
ATOM   7386 C C   . VAL B 1 403 ? -70.300  29.863  99.888  1.00 66.87  ? 564 VAL A C   1 
ATOM   7387 O O   . VAL B 1 403 ? -69.470  29.106  100.401 1.00 67.64  ? 564 VAL A O   1 
ATOM   7388 C CB  . VAL B 1 403 ? -69.971  30.917  97.621  1.00 64.40  ? 564 VAL A CB  1 
ATOM   7389 C CG1 . VAL B 1 403 ? -68.506  31.078  98.002  1.00 63.07  ? 564 VAL A CG1 1 
ATOM   7390 C CG2 . VAL B 1 403 ? -70.110  30.705  96.121  1.00 64.68  ? 564 VAL A CG2 1 
ATOM   7391 N N   . ASN B 1 404 ? -70.960  30.803  100.567 1.00 67.21  ? 565 ASN A N   1 
ATOM   7392 C CA  . ASN B 1 404 ? -70.791  31.014  102.003 1.00 66.92  ? 565 ASN A CA  1 
ATOM   7393 C C   . ASN B 1 404 ? -71.073  29.759  102.821 1.00 67.58  ? 565 ASN A C   1 
ATOM   7394 O O   . ASN B 1 404 ? -70.272  29.383  103.678 1.00 68.78  ? 565 ASN A O   1 
ATOM   7395 C CB  . ASN B 1 404 ? -71.680  32.165  102.487 1.00 66.91  ? 565 ASN A CB  1 
ATOM   7396 C CG  . ASN B 1 404 ? -71.118  33.533  102.141 1.00 67.72  ? 565 ASN A CG  1 
ATOM   7397 O OD1 . ASN B 1 404 ? -70.277  33.676  101.248 1.00 68.97  ? 565 ASN A OD1 1 
ATOM   7398 N ND2 . ASN B 1 404 ? -71.586  34.553  102.851 1.00 66.46  ? 565 ASN A ND2 1 
ATOM   7399 N N   . GLU B 1 405 ? -72.207  29.116  102.541 1.00 67.37  ? 566 GLU A N   1 
ATOM   7400 C CA  . GLU B 1 405 ? -72.618  27.898  103.236 1.00 67.44  ? 566 GLU A CA  1 
ATOM   7401 C C   . GLU B 1 405 ? -71.552  26.808  103.131 1.00 67.44  ? 566 GLU A C   1 
ATOM   7402 O O   . GLU B 1 405 ? -71.150  26.231  104.142 1.00 68.51  ? 566 GLU A O   1 
ATOM   7403 C CB  . GLU B 1 405 ? -73.953  27.394  102.686 1.00 68.86  ? 566 GLU A CB  1 
ATOM   7404 C CG  . GLU B 1 405 ? -74.558  26.237  103.467 1.00 72.22  ? 566 GLU A CG  1 
ATOM   7405 C CD  . GLU B 1 405 ? -75.839  25.703  102.847 1.00 74.87  ? 566 GLU A CD  1 
ATOM   7406 O OE1 . GLU B 1 405 ? -76.117  24.498  103.018 1.00 77.13  ? 566 GLU A OE1 1 
ATOM   7407 O OE2 . GLU B 1 405 ? -76.570  26.479  102.191 1.00 75.08  ? 566 GLU A OE2 1 
ATOM   7408 N N   . PHE B 1 406 ? -71.093  26.548  101.908 1.00 66.43  ? 567 PHE A N   1 
ATOM   7409 C CA  . PHE B 1 406 ? -70.065  25.541  101.644 1.00 64.96  ? 567 PHE A CA  1 
ATOM   7410 C C   . PHE B 1 406 ? -68.778  25.835  102.408 1.00 64.97  ? 567 PHE A C   1 
ATOM   7411 O O   . PHE B 1 406 ? -68.225  24.951  103.062 1.00 65.90  ? 567 PHE A O   1 
ATOM   7412 C CB  . PHE B 1 406 ? -69.785  25.451  100.139 1.00 64.02  ? 567 PHE A CB  1 
ATOM   7413 C CG  . PHE B 1 406 ? -68.945  24.268  99.738  1.00 62.15  ? 567 PHE A CG  1 
ATOM   7414 C CD1 . PHE B 1 406 ? -69.473  22.981  99.759  1.00 61.23  ? 567 PHE A CD1 1 
ATOM   7415 C CD2 . PHE B 1 406 ? -67.631  24.443  99.317  1.00 61.86  ? 567 PHE A CD2 1 
ATOM   7416 C CE1 . PHE B 1 406 ? -68.706  21.892  99.381  1.00 61.18  ? 567 PHE A CE1 1 
ATOM   7417 C CE2 . PHE B 1 406 ? -66.857  23.357  98.938  1.00 61.72  ? 567 PHE A CE2 1 
ATOM   7418 C CZ  . PHE B 1 406 ? -67.396  22.080  98.968  1.00 61.62  ? 567 PHE A CZ  1 
ATOM   7419 N N   . ALA B 1 407 ? -68.319  27.083  102.332 1.00 64.67  ? 568 ALA A N   1 
ATOM   7420 C CA  . ALA B 1 407 ? -67.100  27.515  103.013 1.00 64.74  ? 568 ALA A CA  1 
ATOM   7421 C C   . ALA B 1 407 ? -67.217  27.376  104.525 1.00 65.81  ? 568 ALA A C   1 
ATOM   7422 O O   . ALA B 1 407 ? -66.248  27.026  105.202 1.00 65.55  ? 568 ALA A O   1 
ATOM   7423 C CB  . ALA B 1 407 ? -66.773  28.950  102.642 1.00 64.08  ? 568 ALA A CB  1 
ATOM   7424 N N   . GLN B 1 408 ? -68.413  27.649  105.042 1.00 67.08  ? 569 GLN A N   1 
ATOM   7425 C CA  . GLN B 1 408 ? -68.677  27.586  106.473 1.00 68.18  ? 569 GLN A CA  1 
ATOM   7426 C C   . GLN B 1 408 ? -68.664  26.139  106.961 1.00 67.87  ? 569 GLN A C   1 
ATOM   7427 O O   . GLN B 1 408 ? -68.060  25.838  107.991 1.00 67.18  ? 569 GLN A O   1 
ATOM   7428 C CB  . GLN B 1 408 ? -70.011  28.267  106.798 1.00 69.43  ? 569 GLN A CB  1 
ATOM   7429 C CG  . GLN B 1 408 ? -70.045  28.978  108.144 1.00 72.24  ? 569 GLN A CG  1 
ATOM   7430 C CD  . GLN B 1 408 ? -70.288  28.037  109.310 1.00 74.38  ? 569 GLN A CD  1 
ATOM   7431 O OE1 . GLN B 1 408 ? -71.087  27.103  109.217 1.00 75.94  ? 569 GLN A OE1 1 
ATOM   7432 N NE2 . GLN B 1 408 ? -69.604  28.288  110.423 1.00 74.86  ? 569 GLN A NE2 1 
ATOM   7433 N N   . ARG B 1 409 ? -69.311  25.250  106.205 1.00 68.54  ? 570 ARG A N   1 
ATOM   7434 C CA  . ARG B 1 409 ? -69.371  23.825  106.545 1.00 68.75  ? 570 ARG A CA  1 
ATOM   7435 C C   . ARG B 1 409 ? -68.001  23.155  106.491 1.00 68.53  ? 570 ARG A C   1 
ATOM   7436 O O   . ARG B 1 409 ? -67.736  22.226  107.249 1.00 69.51  ? 570 ARG A O   1 
ATOM   7437 C CB  . ARG B 1 409 ? -70.364  23.072  105.649 1.00 69.72  ? 570 ARG A CB  1 
ATOM   7438 C CG  . ARG B 1 409 ? -71.829  23.464  105.823 1.00 72.25  ? 570 ARG A CG  1 
ATOM   7439 C CD  . ARG B 1 409 ? -72.367  23.200  107.224 1.00 73.55  ? 570 ARG A CD  1 
ATOM   7440 N NE  . ARG B 1 409 ? -72.502  21.774  107.523 1.00 76.71  ? 570 ARG A NE  1 
ATOM   7441 C CZ  . ARG B 1 409 ? -71.677  21.080  108.308 1.00 78.34  ? 570 ARG A CZ  1 
ATOM   7442 N NH1 . ARG B 1 409 ? -70.641  21.666  108.892 1.00 77.61  ? 570 ARG A NH1 1 
ATOM   7443 N NH2 . ARG B 1 409 ? -71.891  19.788  108.516 1.00 80.17  ? 570 ARG A NH2 1 
ATOM   7444 N N   . TYR B 1 410 ? -67.141  23.623  105.591 1.00 68.97  ? 571 TYR A N   1 
ATOM   7445 C CA  . TYR B 1 410 ? -65.754  23.167  105.545 1.00 69.64  ? 571 TYR A CA  1 
ATOM   7446 C C   . TYR B 1 410 ? -64.953  23.697  106.727 1.00 70.42  ? 571 TYR A C   1 
ATOM   7447 O O   . TYR B 1 410 ? -64.089  22.999  107.262 1.00 70.77  ? 571 TYR A O   1 
ATOM   7448 C CB  . TYR B 1 410 ? -65.085  23.566  104.226 1.00 70.30  ? 571 TYR A CB  1 
ATOM   7449 C CG  . TYR B 1 410 ? -64.838  22.396  103.306 1.00 71.48  ? 571 TYR A CG  1 
ATOM   7450 C CD1 . TYR B 1 410 ? -65.854  21.895  102.492 1.00 72.13  ? 571 TYR A CD1 1 
ATOM   7451 C CD2 . TYR B 1 410 ? -63.592  21.776  103.260 1.00 72.17  ? 571 TYR A CD2 1 
ATOM   7452 C CE1 . TYR B 1 410 ? -65.632  20.815  101.654 1.00 72.65  ? 571 TYR A CE1 1 
ATOM   7453 C CE2 . TYR B 1 410 ? -63.360  20.695  102.424 1.00 73.00  ? 571 TYR A CE2 1 
ATOM   7454 C CZ  . TYR B 1 410 ? -64.383  20.219  101.624 1.00 73.15  ? 571 TYR A CZ  1 
ATOM   7455 O OH  . TYR B 1 410 ? -64.163  19.146  100.793 1.00 74.70  ? 571 TYR A OH  1 
ATOM   7456 N N   . ALA B 1 411 ? -65.259  24.928  107.132 1.00 70.23  ? 572 ALA A N   1 
ATOM   7457 C CA  . ALA B 1 411 ? -64.556  25.594  108.225 1.00 69.76  ? 572 ALA A CA  1 
ATOM   7458 C C   . ALA B 1 411 ? -64.832  24.951  109.584 1.00 69.54  ? 572 ALA A C   1 
ATOM   7459 O O   . ALA B 1 411 ? -63.912  24.762  110.381 1.00 68.62  ? 572 ALA A O   1 
ATOM   7460 C CB  . ALA B 1 411 ? -64.901  27.075  108.252 1.00 69.39  ? 572 ALA A CB  1 
ATOM   7461 N N   . GLU B 1 412 ? -66.093  24.612  109.843 1.00 70.54  ? 573 GLU A N   1 
ATOM   7462 C CA  . GLU B 1 412 ? -66.465  24.008  111.124 1.00 72.13  ? 573 GLU A CA  1 
ATOM   7463 C C   . GLU B 1 412 ? -66.191  22.508  111.192 1.00 73.24  ? 573 GLU A C   1 
ATOM   7464 O O   . GLU B 1 412 ? -66.360  21.891  112.243 1.00 76.47  ? 573 GLU A O   1 
ATOM   7465 C CB  . GLU B 1 412 ? -67.909  24.351  111.528 1.00 71.95  ? 573 GLU A CB  1 
ATOM   7466 C CG  . GLU B 1 412 ? -68.994  23.959  110.538 1.00 73.01  ? 573 GLU A CG  1 
ATOM   7467 C CD  . GLU B 1 412 ? -70.354  24.545  110.890 1.00 73.83  ? 573 GLU A CD  1 
ATOM   7468 O OE1 . GLU B 1 412 ? -70.408  25.522  111.669 1.00 73.92  ? 573 GLU A OE1 1 
ATOM   7469 O OE2 . GLU B 1 412 ? -71.376  24.036  110.380 1.00 74.15  ? 573 GLU A OE2 1 
ATOM   7470 N N   . GLU B 1 413 ? -65.761  21.927  110.075 1.00 73.45  ? 574 GLU A N   1 
ATOM   7471 C CA  . GLU B 1 413 ? -65.274  20.549  110.071 1.00 73.20  ? 574 GLU A CA  1 
ATOM   7472 C C   . GLU B 1 413 ? -63.765  20.509  110.283 1.00 72.24  ? 574 GLU A C   1 
ATOM   7473 O O   . GLU B 1 413 ? -63.153  19.439  110.256 1.00 73.23  ? 574 GLU A O   1 
ATOM   7474 C CB  . GLU B 1 413 ? -65.655  19.825  108.779 1.00 75.09  ? 574 GLU A CB  1 
ATOM   7475 C CG  . GLU B 1 413 ? -67.115  19.407  108.712 1.00 78.17  ? 574 GLU A CG  1 
ATOM   7476 C CD  . GLU B 1 413 ? -67.550  18.562  109.892 1.00 80.51  ? 574 GLU A CD  1 
ATOM   7477 O OE1 . GLU B 1 413 ? -66.829  17.602  110.240 1.00 81.92  ? 574 GLU A OE1 1 
ATOM   7478 O OE2 . GLU B 1 413 ? -68.619  18.860  110.467 1.00 82.27  ? 574 GLU A OE2 1 
ATOM   7479 N N   . GLY B 1 414 ? -63.178  21.686  110.491 1.00 70.36  ? 575 GLY A N   1 
ATOM   7480 C CA  . GLY B 1 414 ? -61.762  21.813  110.818 1.00 68.55  ? 575 GLY A CA  1 
ATOM   7481 C C   . GLY B 1 414 ? -60.847  21.848  109.613 1.00 67.91  ? 575 GLY A C   1 
ATOM   7482 O O   . GLY B 1 414 ? -59.775  21.244  109.628 1.00 69.79  ? 575 GLY A O   1 
ATOM   7483 N N   . ASN B 1 415 ? -61.272  22.554  108.568 1.00 67.14  ? 576 ASN A N   1 
ATOM   7484 C CA  . ASN B 1 415 ? -60.463  22.729  107.365 1.00 66.01  ? 576 ASN A CA  1 
ATOM   7485 C C   . ASN B 1 415 ? -60.159  24.196  107.099 1.00 66.29  ? 576 ASN A C   1 
ATOM   7486 O O   . ASN B 1 415 ? -61.003  25.064  107.338 1.00 67.58  ? 576 ASN A O   1 
ATOM   7487 C CB  . ASN B 1 415 ? -61.157  22.108  106.154 1.00 65.39  ? 576 ASN A CB  1 
ATOM   7488 C CG  . ASN B 1 415 ? -61.097  20.593  106.163 1.00 65.95  ? 576 ASN A CG  1 
ATOM   7489 O OD1 . ASN B 1 415 ? -60.036  20.001  105.956 1.00 66.00  ? 576 ASN A OD1 1 
ATOM   7490 N ND2 . ASN B 1 415 ? -62.241  19.956  106.395 1.00 65.32  ? 576 ASN A ND2 1 
ATOM   7491 N N   . ASN B 1 416 ? -58.953  24.467  106.610 1.00 65.62  ? 577 ASN A N   1 
ATOM   7492 C CA  . ASN B 1 416 ? -58.538  25.831  106.293 1.00 66.10  ? 577 ASN A CA  1 
ATOM   7493 C C   . ASN B 1 416 ? -59.228  26.370  105.046 1.00 65.43  ? 577 ASN A C   1 
ATOM   7494 O O   . ASN B 1 416 ? -59.020  25.866  103.942 1.00 66.37  ? 577 ASN A O   1 
ATOM   7495 C CB  . ASN B 1 416 ? -57.018  25.915  106.137 1.00 67.43  ? 577 ASN A CB  1 
ATOM   7496 C CG  . ASN B 1 416 ? -56.283  25.589  107.418 1.00 68.12  ? 577 ASN A CG  1 
ATOM   7497 O OD1 . ASN B 1 416 ? -56.670  26.027  108.502 1.00 68.96  ? 577 ASN A OD1 1 
ATOM   7498 N ND2 . ASN B 1 416 ? -55.210  24.817  107.299 1.00 69.46  ? 577 ASN A ND2 1 
ATOM   7499 N N   . VAL B 1 417 ? -60.053  27.393  105.237 1.00 63.84  ? 578 VAL A N   1 
ATOM   7500 C CA  . VAL B 1 417 ? -60.798  28.006  104.144 1.00 62.93  ? 578 VAL A CA  1 
ATOM   7501 C C   . VAL B 1 417 ? -60.223  29.389  103.856 1.00 64.54  ? 578 VAL A C   1 
ATOM   7502 O O   . VAL B 1 417 ? -59.735  30.064  104.762 1.00 65.72  ? 578 VAL A O   1 
ATOM   7503 C CB  . VAL B 1 417 ? -62.302  28.116  104.481 1.00 61.63  ? 578 VAL A CB  1 
ATOM   7504 C CG1 . VAL B 1 417 ? -63.096  28.611  103.281 1.00 60.72  ? 578 VAL A CG1 1 
ATOM   7505 C CG2 . VAL B 1 417 ? -62.846  26.774  104.950 1.00 61.61  ? 578 VAL A CG2 1 
ATOM   7506 N N   . TYR B 1 418 ? -60.262  29.794  102.589 1.00 66.40  ? 579 TYR A N   1 
ATOM   7507 C CA  . TYR B 1 418 ? -59.839  31.133  102.190 1.00 67.71  ? 579 TYR A CA  1 
ATOM   7508 C C   . TYR B 1 418 ? -60.897  31.783  101.302 1.00 67.70  ? 579 TYR A C   1 
ATOM   7509 O O   . TYR B 1 418 ? -61.051  31.427  100.128 1.00 67.35  ? 579 TYR A O   1 
ATOM   7510 C CB  . TYR B 1 418 ? -58.456  31.097  101.525 1.00 68.86  ? 579 TYR A CB  1 
ATOM   7511 C CG  . TYR B 1 418 ? -57.366  30.698  102.491 1.00 70.90  ? 579 TYR A CG  1 
ATOM   7512 C CD1 . TYR B 1 418 ? -56.995  29.362  102.639 1.00 72.62  ? 579 TYR A CD1 1 
ATOM   7513 C CD2 . TYR B 1 418 ? -56.727  31.653  103.285 1.00 72.29  ? 579 TYR A CD2 1 
ATOM   7514 C CE1 . TYR B 1 418 ? -56.009  28.987  103.538 1.00 74.56  ? 579 TYR A CE1 1 
ATOM   7515 C CE2 . TYR B 1 418 ? -55.737  31.289  104.187 1.00 73.68  ? 579 TYR A CE2 1 
ATOM   7516 C CZ  . TYR B 1 418 ? -55.384  29.956  104.308 1.00 74.83  ? 579 TYR A CZ  1 
ATOM   7517 O OH  . TYR B 1 418 ? -54.408  29.585  105.201 1.00 75.48  ? 579 TYR A OH  1 
ATOM   7518 N N   . MET B 1 419 ? -61.632  32.725  101.892 1.00 66.88  ? 580 MET A N   1 
ATOM   7519 C CA  . MET B 1 419 ? -62.767  33.370  101.239 1.00 65.65  ? 580 MET A CA  1 
ATOM   7520 C C   . MET B 1 419 ? -62.375  34.716  100.641 1.00 64.97  ? 580 MET A C   1 
ATOM   7521 O O   . MET B 1 419 ? -61.670  35.502  101.277 1.00 65.76  ? 580 MET A O   1 
ATOM   7522 C CB  . MET B 1 419 ? -63.918  33.548  102.234 1.00 65.96  ? 580 MET A CB  1 
ATOM   7523 C CG  . MET B 1 419 ? -65.160  34.210  101.660 1.00 66.48  ? 580 MET A CG  1 
ATOM   7524 S SD  . MET B 1 419 ? -66.195  33.101  100.691 1.00 67.92  ? 580 MET A SD  1 
ATOM   7525 C CE  . MET B 1 419 ? -67.236  32.414  101.974 1.00 67.07  ? 580 MET A CE  1 
ATOM   7526 N N   . TYR B 1 420 ? -62.833  34.969  99.417  1.00 63.94  ? 581 TYR A N   1 
ATOM   7527 C CA  . TYR B 1 420 ? -62.598  36.251  98.756  1.00 63.52  ? 581 TYR A CA  1 
ATOM   7528 C C   . TYR B 1 420 ? -63.890  36.907  98.285  1.00 63.28  ? 581 TYR A C   1 
ATOM   7529 O O   . TYR B 1 420 ? -64.917  36.247  98.125  1.00 63.55  ? 581 TYR A O   1 
ATOM   7530 C CB  . TYR B 1 420 ? -61.611  36.110  97.582  1.00 63.46  ? 581 TYR A CB  1 
ATOM   7531 C CG  . TYR B 1 420 ? -62.171  35.466  96.326  1.00 63.61  ? 581 TYR A CG  1 
ATOM   7532 C CD1 . TYR B 1 420 ? -62.964  36.192  95.436  1.00 63.92  ? 581 TYR A CD1 1 
ATOM   7533 C CD2 . TYR B 1 420 ? -61.885  34.137  96.014  1.00 64.09  ? 581 TYR A CD2 1 
ATOM   7534 C CE1 . TYR B 1 420 ? -63.476  35.607  94.287  1.00 64.57  ? 581 TYR A CE1 1 
ATOM   7535 C CE2 . TYR B 1 420 ? -62.388  33.544  94.863  1.00 64.35  ? 581 TYR A CE2 1 
ATOM   7536 C CZ  . TYR B 1 420 ? -63.183  34.283  94.003  1.00 64.27  ? 581 TYR A CZ  1 
ATOM   7537 O OH  . TYR B 1 420 ? -63.688  33.703  92.859  1.00 63.08  ? 581 TYR A OH  1 
ATOM   7538 N N   . LEU B 1 421 ? -63.820  38.216  98.072  1.00 62.32  ? 582 LEU A N   1 
ATOM   7539 C CA  . LEU B 1 421 ? -64.875  38.955  97.403  1.00 61.93  ? 582 LEU A CA  1 
ATOM   7540 C C   . LEU B 1 421 ? -64.210  39.771  96.304  1.00 63.56  ? 582 LEU A C   1 
ATOM   7541 O O   . LEU B 1 421 ? -63.496  40.737  96.586  1.00 65.99  ? 582 LEU A O   1 
ATOM   7542 C CB  . LEU B 1 421 ? -65.628  39.854  98.392  1.00 59.69  ? 582 LEU A CB  1 
ATOM   7543 C CG  . LEU B 1 421 ? -66.791  40.725  97.898  1.00 58.19  ? 582 LEU A CG  1 
ATOM   7544 C CD1 . LEU B 1 421 ? -67.905  39.899  97.271  1.00 57.98  ? 582 LEU A CD1 1 
ATOM   7545 C CD2 . LEU B 1 421 ? -67.338  41.562  99.041  1.00 58.07  ? 582 LEU A CD2 1 
ATOM   7546 N N   . TYR B 1 422 ? -64.420  39.356  95.057  1.00 63.05  ? 583 TYR A N   1 
ATOM   7547 C CA  . TYR B 1 422 ? -63.811  40.022  93.908  1.00 62.53  ? 583 TYR A CA  1 
ATOM   7548 C C   . TYR B 1 422 ? -64.636  41.244  93.503  1.00 62.74  ? 583 TYR A C   1 
ATOM   7549 O O   . TYR B 1 422 ? -65.819  41.125  93.177  1.00 62.55  ? 583 TYR A O   1 
ATOM   7550 C CB  . TYR B 1 422 ? -63.647  39.039  92.745  1.00 62.09  ? 583 TYR A CB  1 
ATOM   7551 C CG  . TYR B 1 422 ? -62.915  39.605  91.552  1.00 62.35  ? 583 TYR A CG  1 
ATOM   7552 C CD1 . TYR B 1 422 ? -63.614  40.220  90.517  1.00 63.28  ? 583 TYR A CD1 1 
ATOM   7553 C CD2 . TYR B 1 422 ? -61.526  39.523  91.452  1.00 61.85  ? 583 TYR A CD2 1 
ATOM   7554 C CE1 . TYR B 1 422 ? -62.957  40.744  89.418  1.00 63.57  ? 583 TYR A CE1 1 
ATOM   7555 C CE2 . TYR B 1 422 ? -60.858  40.043  90.354  1.00 62.23  ? 583 TYR A CE2 1 
ATOM   7556 C CZ  . TYR B 1 422 ? -61.581  40.653  89.341  1.00 63.32  ? 583 TYR A CZ  1 
ATOM   7557 O OH  . TYR B 1 422 ? -60.943  41.176  88.242  1.00 63.96  ? 583 TYR A OH  1 
ATOM   7558 N N   . THR B 1 423 ? -63.998  42.415  93.529  1.00 63.17  ? 584 THR A N   1 
ATOM   7559 C CA  . THR B 1 423 ? -64.698  43.696  93.394  1.00 63.77  ? 584 THR A CA  1 
ATOM   7560 C C   . THR B 1 423 ? -64.127  44.611  92.303  1.00 65.57  ? 584 THR A C   1 
ATOM   7561 O O   . THR B 1 423 ? -64.377  45.820  92.317  1.00 67.80  ? 584 THR A O   1 
ATOM   7562 C CB  . THR B 1 423 ? -64.680  44.488  94.723  1.00 63.18  ? 584 THR A CB  1 
ATOM   7563 O OG1 . THR B 1 423 ? -63.342  44.910  95.015  1.00 62.36  ? 584 THR A OG1 1 
ATOM   7564 C CG2 . THR B 1 423 ? -65.207  43.650  95.882  1.00 63.08  ? 584 THR A CG2 1 
ATOM   7565 N N   . HIS B 1 424 ? -63.381  44.048  91.355  1.00 65.80  ? 585 HIS A N   1 
ATOM   7566 C CA  . HIS B 1 424 ? -62.678  44.864  90.363  1.00 66.27  ? 585 HIS A CA  1 
ATOM   7567 C C   . HIS B 1 424 ? -63.304  44.853  88.963  1.00 66.97  ? 585 HIS A C   1 
ATOM   7568 O O   . HIS B 1 424 ? -63.428  43.797  88.338  1.00 67.75  ? 585 HIS A O   1 
ATOM   7569 C CB  . HIS B 1 424 ? -61.194  44.473  90.308  1.00 66.67  ? 585 HIS A CB  1 
ATOM   7570 C CG  . HIS B 1 424 ? -60.451  45.067  89.151  1.00 67.40  ? 585 HIS A CG  1 
ATOM   7571 N ND1 . HIS B 1 424 ? -60.049  46.385  89.118  1.00 67.83  ? 585 HIS A ND1 1 
ATOM   7572 C CD2 . HIS B 1 424 ? -60.035  44.518  87.985  1.00 67.23  ? 585 HIS A CD2 1 
ATOM   7573 C CE1 . HIS B 1 424 ? -59.421  46.623  87.980  1.00 67.53  ? 585 HIS A CE1 1 
ATOM   7574 N NE2 . HIS B 1 424 ? -59.398  45.507  87.275  1.00 67.19  ? 585 HIS A NE2 1 
ATOM   7575 N N   . ARG B 1 425 ? -63.701  46.036  88.492  1.00 67.69  ? 586 ARG A N   1 
ATOM   7576 C CA  . ARG B 1 425 ? -64.135  46.247  87.107  1.00 69.09  ? 586 ARG A CA  1 
ATOM   7577 C C   . ARG B 1 425 ? -62.933  46.530  86.216  1.00 71.28  ? 586 ARG A C   1 
ATOM   7578 O O   . ARG B 1 425 ? -62.111  47.392  86.535  1.00 71.32  ? 586 ARG A O   1 
ATOM   7579 C CB  . ARG B 1 425 ? -65.084  47.446  87.016  1.00 68.52  ? 586 ARG A CB  1 
ATOM   7580 C CG  . ARG B 1 425 ? -66.567  47.124  87.081  1.00 68.99  ? 586 ARG A CG  1 
ATOM   7581 C CD  . ARG B 1 425 ? -67.174  46.868  85.707  1.00 69.19  ? 586 ARG A CD  1 
ATOM   7582 N NE  . ARG B 1 425 ? -67.217  48.056  84.851  1.00 68.70  ? 586 ARG A NE  1 
ATOM   7583 C CZ  . ARG B 1 425 ? -68.143  48.286  83.920  1.00 68.47  ? 586 ARG A CZ  1 
ATOM   7584 N NH1 . ARG B 1 425 ? -69.136  47.426  83.720  1.00 67.07  ? 586 ARG A NH1 1 
ATOM   7585 N NH2 . ARG B 1 425 ? -68.086  49.391  83.191  1.00 68.81  ? 586 ARG A NH2 1 
ATOM   7586 N N   . SER B 1 426 ? -62.833  45.807  85.102  1.00 74.24  ? 587 SER A N   1 
ATOM   7587 C CA  . SER B 1 426 ? -61.810  46.084  84.094  1.00 76.80  ? 587 SER A CA  1 
ATOM   7588 C C   . SER B 1 426 ? -62.095  47.439  83.457  1.00 78.41  ? 587 SER A C   1 
ATOM   7589 O O   . SER B 1 426 ? -63.258  47.793  83.239  1.00 78.79  ? 587 SER A O   1 
ATOM   7590 C CB  . SER B 1 426 ? -61.787  44.991  83.024  1.00 77.50  ? 587 SER A CB  1 
ATOM   7591 O OG  . SER B 1 426 ? -61.472  43.729  83.584  1.00 77.43  ? 587 SER A OG  1 
ATOM   7592 N N   . LYS B 1 427 ? -61.038  48.195  83.164  1.00 79.85  ? 588 LYS A N   1 
ATOM   7593 C CA  . LYS B 1 427 ? -61.191  49.560  82.658  1.00 81.89  ? 588 LYS A CA  1 
ATOM   7594 C C   . LYS B 1 427 ? -61.842  49.603  81.275  1.00 82.97  ? 588 LYS A C   1 
ATOM   7595 O O   . LYS B 1 427 ? -62.502  50.584  80.925  1.00 84.91  ? 588 LYS A O   1 
ATOM   7596 C CB  . LYS B 1 427 ? -59.851  50.300  82.643  1.00 83.33  ? 588 LYS A CB  1 
ATOM   7597 C CG  . LYS B 1 427 ? -59.990  51.805  82.841  1.00 85.11  ? 588 LYS A CG  1 
ATOM   7598 C CD  . LYS B 1 427 ? -58.787  52.581  82.320  1.00 86.18  ? 588 LYS A CD  1 
ATOM   7599 C CE  . LYS B 1 427 ? -58.863  52.801  80.815  1.00 85.52  ? 588 LYS A CE  1 
ATOM   7600 N NZ  . LYS B 1 427 ? -57.741  53.645  80.321  1.00 84.49  ? 588 LYS A NZ  1 
ATOM   7601 N N   . GLY B 1 428 ? -61.656  48.537  80.500  1.00 81.69  ? 589 GLY A N   1 
ATOM   7602 C CA  . GLY B 1 428 ? -62.258  48.433  79.176  1.00 80.14  ? 589 GLY A CA  1 
ATOM   7603 C C   . GLY B 1 428 ? -63.385  47.421  79.113  1.00 79.54  ? 589 GLY A C   1 
ATOM   7604 O O   . GLY B 1 428 ? -63.471  46.643  78.162  1.00 81.84  ? 589 GLY A O   1 
ATOM   7605 N N   . ASN B 1 429 ? -64.251  47.433  80.125  1.00 78.10  ? 590 ASN A N   1 
ATOM   7606 C CA  . ASN B 1 429 ? -65.389  46.517  80.185  1.00 77.11  ? 590 ASN A CA  1 
ATOM   7607 C C   . ASN B 1 429 ? -66.461  46.876  79.151  1.00 76.98  ? 590 ASN A C   1 
ATOM   7608 O O   . ASN B 1 429 ? -66.980  47.994  79.161  1.00 79.22  ? 590 ASN A O   1 
ATOM   7609 C CB  . ASN B 1 429 ? -65.984  46.495  81.596  1.00 75.93  ? 590 ASN A CB  1 
ATOM   7610 C CG  . ASN B 1 429 ? -66.838  45.267  81.853  1.00 75.70  ? 590 ASN A CG  1 
ATOM   7611 O OD1 . ASN B 1 429 ? -67.833  45.027  81.167  1.00 75.37  ? 590 ASN A OD1 1 
ATOM   7612 N ND2 . ASN B 1 429 ? -66.456  44.487  82.857  1.00 75.69  ? 590 ASN A ND2 1 
ATOM   7613 N N   . PRO B 1 430 ? -66.795  45.926  78.255  1.00 75.56  ? 591 PRO A N   1 
ATOM   7614 C CA  . PRO B 1 430 ? -67.736  46.188  77.160  1.00 74.59  ? 591 PRO A CA  1 
ATOM   7615 C C   . PRO B 1 430 ? -69.179  46.406  77.616  1.00 73.97  ? 591 PRO A C   1 
ATOM   7616 O O   . PRO B 1 430 ? -69.956  47.047  76.905  1.00 74.81  ? 591 PRO A O   1 
ATOM   7617 C CB  . PRO B 1 430 ? -67.639  44.922  76.302  1.00 75.74  ? 591 PRO A CB  1 
ATOM   7618 C CG  . PRO B 1 430 ? -67.187  43.858  77.242  1.00 76.18  ? 591 PRO A CG  1 
ATOM   7619 C CD  . PRO B 1 430 ? -66.281  44.543  78.223  1.00 76.01  ? 591 PRO A CD  1 
ATOM   7620 N N   . TRP B 1 431 ? -69.526  45.874  78.786  1.00 72.89  ? 592 TRP A N   1 
ATOM   7621 C CA  . TRP B 1 431 ? -70.884  45.976  79.321  1.00 72.11  ? 592 TRP A CA  1 
ATOM   7622 C C   . TRP B 1 431 ? -71.180  47.371  79.885  1.00 71.94  ? 592 TRP A C   1 
ATOM   7623 O O   . TRP B 1 431 ? -70.249  48.099  80.242  1.00 71.72  ? 592 TRP A O   1 
ATOM   7624 C CB  . TRP B 1 431 ? -71.109  44.912  80.400  1.00 70.91  ? 592 TRP A CB  1 
ATOM   7625 C CG  . TRP B 1 431 ? -71.055  43.503  79.890  1.00 70.02  ? 592 TRP A CG  1 
ATOM   7626 C CD1 . TRP B 1 431 ? -69.948  42.710  79.795  1.00 70.20  ? 592 TRP A CD1 1 
ATOM   7627 C CD2 . TRP B 1 431 ? -72.156  42.713  79.415  1.00 69.39  ? 592 TRP A CD2 1 
ATOM   7628 N NE1 . TRP B 1 431 ? -70.288  41.479  79.288  1.00 70.21  ? 592 TRP A NE1 1 
ATOM   7629 C CE2 . TRP B 1 431 ? -71.636  41.453  79.046  1.00 69.22  ? 592 TRP A CE2 1 
ATOM   7630 C CE3 . TRP B 1 431 ? -73.530  42.949  79.265  1.00 69.14  ? 592 TRP A CE3 1 
ATOM   7631 C CZ2 . TRP B 1 431 ? -72.443  40.429  78.535  1.00 68.46  ? 592 TRP A CZ2 1 
ATOM   7632 C CZ3 . TRP B 1 431 ? -74.332  41.930  78.754  1.00 67.71  ? 592 TRP A CZ3 1 
ATOM   7633 C CH2 . TRP B 1 431 ? -73.783  40.686  78.396  1.00 67.49  ? 592 TRP A CH2 1 
ATOM   7634 N N   . PRO B 1 432 ? -72.476  47.750  79.955  1.00 71.64  ? 593 PRO A N   1 
ATOM   7635 C CA  . PRO B 1 432 ? -72.911  48.987  80.614  1.00 72.40  ? 593 PRO A CA  1 
ATOM   7636 C C   . PRO B 1 432 ? -72.332  49.150  82.022  1.00 74.31  ? 593 PRO A C   1 
ATOM   7637 O O   . PRO B 1 432 ? -72.107  48.158  82.719  1.00 76.23  ? 593 PRO A O   1 
ATOM   7638 C CB  . PRO B 1 432 ? -74.425  48.817  80.690  1.00 71.03  ? 593 PRO A CB  1 
ATOM   7639 C CG  . PRO B 1 432 ? -74.761  48.004  79.492  1.00 70.74  ? 593 PRO A CG  1 
ATOM   7640 C CD  . PRO B 1 432 ? -73.599  47.076  79.272  1.00 71.06  ? 593 PRO A CD  1 
ATOM   7641 N N   . ARG B 1 433 ? -72.106  50.397  82.431  1.00 74.79  ? 594 ARG A N   1 
ATOM   7642 C CA  . ARG B 1 433 ? -71.413  50.692  83.689  1.00 74.15  ? 594 ARG A CA  1 
ATOM   7643 C C   . ARG B 1 433 ? -72.182  50.252  84.931  1.00 71.52  ? 594 ARG A C   1 
ATOM   7644 O O   . ARG B 1 433 ? -71.575  49.980  85.967  1.00 69.87  ? 594 ARG A O   1 
ATOM   7645 C CB  . ARG B 1 433 ? -71.074  52.181  83.789  1.00 78.00  ? 594 ARG A CB  1 
ATOM   7646 C CG  . ARG B 1 433 ? -70.189  52.691  82.666  1.00 84.26  ? 594 ARG A CG  1 
ATOM   7647 C CD  . ARG B 1 433 ? -69.986  54.194  82.751  1.00 89.78  ? 594 ARG A CD  1 
ATOM   7648 N NE  . ARG B 1 433 ? -69.964  54.796  81.419  1.00 94.83  ? 594 ARG A NE  1 
ATOM   7649 C CZ  . ARG B 1 433 ? -70.998  55.419  80.858  1.00 97.25  ? 594 ARG A CZ  1 
ATOM   7650 N NH1 . ARG B 1 433 ? -72.146  55.542  81.513  1.00 97.85  ? 594 ARG A NH1 1 
ATOM   7651 N NH2 . ARG B 1 433 ? -70.883  55.929  79.638  1.00 100.94 ? 594 ARG A NH2 1 
ATOM   7652 N N   . TRP B 1 434 ? -73.507  50.178  84.821  1.00 69.98  ? 595 TRP A N   1 
ATOM   7653 C CA  . TRP B 1 434 ? -74.355  49.805  85.957  1.00 69.25  ? 595 TRP A CA  1 
ATOM   7654 C C   . TRP B 1 434 ? -74.235  48.337  86.362  1.00 69.49  ? 595 TRP A C   1 
ATOM   7655 O O   . TRP B 1 434 ? -74.595  47.973  87.486  1.00 71.39  ? 595 TRP A O   1 
ATOM   7656 C CB  . TRP B 1 434 ? -75.824  50.181  85.713  1.00 68.43  ? 595 TRP A CB  1 
ATOM   7657 C CG  . TRP B 1 434 ? -76.420  49.628  84.454  1.00 67.70  ? 595 TRP A CG  1 
ATOM   7658 C CD1 . TRP B 1 434 ? -76.551  50.277  83.262  1.00 68.07  ? 595 TRP A CD1 1 
ATOM   7659 C CD2 . TRP B 1 434 ? -76.982  48.321  84.263  1.00 67.45  ? 595 TRP A CD2 1 
ATOM   7660 N NE1 . TRP B 1 434 ? -77.154  49.458  82.338  1.00 67.80  ? 595 TRP A NE1 1 
ATOM   7661 C CE2 . TRP B 1 434 ? -77.425  48.250  82.924  1.00 67.73  ? 595 TRP A CE2 1 
ATOM   7662 C CE3 . TRP B 1 434 ? -77.149  47.202  85.090  1.00 67.07  ? 595 TRP A CE3 1 
ATOM   7663 C CZ2 . TRP B 1 434 ? -78.027  47.103  82.390  1.00 67.64  ? 595 TRP A CZ2 1 
ATOM   7664 C CZ3 . TRP B 1 434 ? -77.747  46.061  84.556  1.00 66.91  ? 595 TRP A CZ3 1 
ATOM   7665 C CH2 . TRP B 1 434 ? -78.178  46.023  83.220  1.00 66.55  ? 595 TRP A CH2 1 
ATOM   7666 N N   . THR B 1 435 ? -73.727  47.503  85.453  1.00 67.53  ? 596 THR A N   1 
ATOM   7667 C CA  . THR B 1 435 ? -73.544  46.072  85.721  1.00 65.32  ? 596 THR A CA  1 
ATOM   7668 C C   . THR B 1 435 ? -72.502  45.805  86.809  1.00 65.08  ? 596 THR A C   1 
ATOM   7669 O O   . THR B 1 435 ? -72.628  44.846  87.570  1.00 64.63  ? 596 THR A O   1 
ATOM   7670 C CB  . THR B 1 435 ? -73.147  45.289  84.455  1.00 63.97  ? 596 THR A CB  1 
ATOM   7671 O OG1 . THR B 1 435 ? -71.943  45.840  83.906  1.00 64.23  ? 596 THR A OG1 1 
ATOM   7672 C CG2 . THR B 1 435 ? -74.257  45.336  83.414  1.00 63.37  ? 596 THR A CG2 1 
ATOM   7673 N N   . GLY B 1 436 ? -71.479  46.654  86.877  1.00 64.90  ? 597 GLY A N   1 
ATOM   7674 C CA  . GLY B 1 436 ? -70.412  46.507  87.863  1.00 64.45  ? 597 GLY A CA  1 
ATOM   7675 C C   . GLY B 1 436 ? -69.618  45.234  87.649  1.00 65.36  ? 597 GLY A C   1 
ATOM   7676 O O   . GLY B 1 436 ? -69.475  44.766  86.516  1.00 67.05  ? 597 GLY A O   1 
ATOM   7677 N N   . VAL B 1 437 ? -69.112  44.667  88.741  1.00 64.59  ? 598 VAL A N   1 
ATOM   7678 C CA  . VAL B 1 437 ? -68.306  43.448  88.684  1.00 63.32  ? 598 VAL A CA  1 
ATOM   7679 C C   . VAL B 1 437 ? -69.210  42.220  88.618  1.00 63.37  ? 598 VAL A C   1 
ATOM   7680 O O   . VAL B 1 437 ? -69.692  41.727  89.641  1.00 61.84  ? 598 VAL A O   1 
ATOM   7681 C CB  . VAL B 1 437 ? -67.340  43.355  89.878  1.00 63.40  ? 598 VAL A CB  1 
ATOM   7682 C CG1 . VAL B 1 437 ? -66.375  42.195  89.699  1.00 63.53  ? 598 VAL A CG1 1 
ATOM   7683 C CG2 . VAL B 1 437 ? -66.576  44.660  90.029  1.00 64.79  ? 598 VAL A CG2 1 
ATOM   7684 N N   . MET B 1 438 ? -69.426  41.737  87.399  1.00 64.80  ? 599 MET A N   1 
ATOM   7685 C CA  . MET B 1 438 ? -70.393  40.678  87.137  1.00 65.99  ? 599 MET A CA  1 
ATOM   7686 C C   . MET B 1 438 ? -69.847  39.270  87.352  1.00 65.77  ? 599 MET A C   1 
ATOM   7687 O O   . MET B 1 438 ? -68.702  39.088  87.773  1.00 65.47  ? 599 MET A O   1 
ATOM   7688 C CB  . MET B 1 438 ? -70.950  40.806  85.720  1.00 68.24  ? 599 MET A CB  1 
ATOM   7689 C CG  . MET B 1 438 ? -72.118  41.768  85.589  1.00 69.82  ? 599 MET A CG  1 
ATOM   7690 S SD  . MET B 1 438 ? -72.953  41.589  84.002  1.00 73.05  ? 599 MET A SD  1 
ATOM   7691 C CE  . MET B 1 438 ? -71.605  41.948  82.877  1.00 71.19  ? 599 MET A CE  1 
ATOM   7692 N N   . HIS B 1 439 ? -70.694  38.287  87.055  1.00 65.29  ? 600 HIS A N   1 
ATOM   7693 C CA  . HIS B 1 439 ? -70.366  36.873  87.176  1.00 65.01  ? 600 HIS A CA  1 
ATOM   7694 C C   . HIS B 1 439 ? -69.234  36.482  86.227  1.00 64.17  ? 600 HIS A C   1 
ATOM   7695 O O   . HIS B 1 439 ? -69.363  36.603  85.007  1.00 64.59  ? 600 HIS A O   1 
ATOM   7696 C CB  . HIS B 1 439 ? -71.620  36.041  86.894  1.00 65.94  ? 600 HIS A CB  1 
ATOM   7697 C CG  . HIS B 1 439 ? -71.461  34.581  87.176  1.00 66.78  ? 600 HIS A CG  1 
ATOM   7698 N ND1 . HIS B 1 439 ? -71.314  34.081  88.452  1.00 66.99  ? 600 HIS A ND1 1 
ATOM   7699 C CD2 . HIS B 1 439 ? -71.449  33.510  86.348  1.00 66.79  ? 600 HIS A CD2 1 
ATOM   7700 C CE1 . HIS B 1 439 ? -71.205  32.766  88.397  1.00 67.74  ? 600 HIS A CE1 1 
ATOM   7701 N NE2 . HIS B 1 439 ? -71.286  32.394  87.132  1.00 67.67  ? 600 HIS A NE2 1 
ATOM   7702 N N   . GLY B 1 440 ? -68.119  36.034  86.797  1.00 63.03  ? 601 GLY A N   1 
ATOM   7703 C CA  . GLY B 1 440 ? -66.987  35.561  86.008  1.00 62.70  ? 601 GLY A CA  1 
ATOM   7704 C C   . GLY B 1 440 ? -66.147  36.647  85.360  1.00 62.87  ? 601 GLY A C   1 
ATOM   7705 O O   . GLY B 1 440 ? -65.737  36.514  84.207  1.00 62.36  ? 601 GLY A O   1 
ATOM   7706 N N   . ASP B 1 441 ? -65.888  37.721  86.102  1.00 63.74  ? 602 ASP A N   1 
ATOM   7707 C CA  . ASP B 1 441 ? -64.993  38.783  85.639  1.00 64.00  ? 602 ASP A CA  1 
ATOM   7708 C C   . ASP B 1 441 ? -63.562  38.503  86.079  1.00 63.34  ? 602 ASP A C   1 
ATOM   7709 O O   . ASP B 1 441 ? -62.607  38.998  85.473  1.00 64.40  ? 602 ASP A O   1 
ATOM   7710 C CB  . ASP B 1 441 ? -65.443  40.146  86.172  1.00 64.30  ? 602 ASP A CB  1 
ATOM   7711 C CG  . ASP B 1 441 ? -66.710  40.654  85.504  1.00 64.85  ? 602 ASP A CG  1 
ATOM   7712 O OD1 . ASP B 1 441 ? -67.566  39.833  85.111  1.00 65.18  ? 602 ASP A OD1 1 
ATOM   7713 O OD2 . ASP B 1 441 ? -66.853  41.888  85.381  1.00 65.92  ? 602 ASP A OD2 1 
ATOM   7714 N N   . GLU B 1 442 ? -63.432  37.707  87.139  1.00 61.37  ? 603 GLU A N   1 
ATOM   7715 C CA  . GLU B 1 442 ? -62.140  37.348  87.721  1.00 59.52  ? 603 GLU A CA  1 
ATOM   7716 C C   . GLU B 1 442 ? -61.355  36.369  86.843  1.00 58.34  ? 603 GLU A C   1 
ATOM   7717 O O   . GLU B 1 442 ? -60.131  36.262  86.970  1.00 57.82  ? 603 GLU A O   1 
ATOM   7718 C CB  . GLU B 1 442 ? -62.332  36.781  89.139  1.00 60.14  ? 603 GLU A CB  1 
ATOM   7719 C CG  . GLU B 1 442 ? -62.791  35.325  89.237  1.00 62.13  ? 603 GLU A CG  1 
ATOM   7720 C CD  . GLU B 1 442 ? -64.218  35.091  88.759  1.00 64.07  ? 603 GLU A CD  1 
ATOM   7721 O OE1 . GLU B 1 442 ? -64.473  35.240  87.548  1.00 65.03  ? 603 GLU A OE1 1 
ATOM   7722 O OE2 . GLU B 1 442 ? -65.084  34.733  89.587  1.00 65.00  ? 603 GLU A OE2 1 
ATOM   7723 N N   . ILE B 1 443 ? -62.065  35.673  85.953  1.00 56.74  ? 604 ILE A N   1 
ATOM   7724 C CA  . ILE B 1 443 ? -61.472  34.644  85.091  1.00 54.75  ? 604 ILE A CA  1 
ATOM   7725 C C   . ILE B 1 443 ? -60.296  35.184  84.271  1.00 55.35  ? 604 ILE A C   1 
ATOM   7726 O O   . ILE B 1 443 ? -59.235  34.556  84.220  1.00 55.27  ? 604 ILE A O   1 
ATOM   7727 C CB  . ILE B 1 443 ? -62.525  33.971  84.175  1.00 52.68  ? 604 ILE A CB  1 
ATOM   7728 C CG1 . ILE B 1 443 ? -63.560  33.214  85.016  1.00 51.74  ? 604 ILE A CG1 1 
ATOM   7729 C CG2 . ILE B 1 443 ? -61.856  33.019  83.193  1.00 52.09  ? 604 ILE A CG2 1 
ATOM   7730 C CD1 . ILE B 1 443 ? -64.705  32.616  84.224  1.00 50.70  ? 604 ILE A CD1 1 
ATOM   7731 N N   . ASN B 1 444 ? -60.484  36.350  83.652  1.00 55.86  ? 605 ASN A N   1 
ATOM   7732 C CA  . ASN B 1 444 ? -59.425  36.998  82.873  1.00 56.18  ? 605 ASN A CA  1 
ATOM   7733 C C   . ASN B 1 444 ? -58.171  37.230  83.701  1.00 56.31  ? 605 ASN A C   1 
ATOM   7734 O O   . ASN B 1 444 ? -57.054  37.031  83.221  1.00 57.36  ? 605 ASN A O   1 
ATOM   7735 C CB  . ASN B 1 444 ? -59.897  38.333  82.291  1.00 55.99  ? 605 ASN A CB  1 
ATOM   7736 C CG  . ASN B 1 444 ? -61.234  38.226  81.595  1.00 56.49  ? 605 ASN A CG  1 
ATOM   7737 O OD1 . ASN B 1 444 ? -62.273  38.133  82.245  1.00 58.11  ? 605 ASN A OD1 1 
ATOM   7738 N ND2 . ASN B 1 444 ? -61.216  38.249  80.267  1.00 56.33  ? 605 ASN A ND2 1 
ATOM   7739 N N   . TYR B 1 445 ? -58.366  37.636  84.951  1.00 56.01  ? 606 TYR A N   1 
ATOM   7740 C CA  . TYR B 1 445 ? -57.257  37.988  85.823  1.00 56.20  ? 606 TYR A CA  1 
ATOM   7741 C C   . TYR B 1 445 ? -56.534  36.775  86.405  1.00 57.01  ? 606 TYR A C   1 
ATOM   7742 O O   . TYR B 1 445 ? -55.309  36.802  86.545  1.00 56.33  ? 606 TYR A O   1 
ATOM   7743 C CB  . TYR B 1 445 ? -57.720  38.957  86.913  1.00 55.54  ? 606 TYR A CB  1 
ATOM   7744 C CG  . TYR B 1 445 ? -58.014  40.345  86.388  1.00 55.49  ? 606 TYR A CG  1 
ATOM   7745 C CD1 . TYR B 1 445 ? -59.245  40.646  85.806  1.00 55.39  ? 606 TYR A CD1 1 
ATOM   7746 C CD2 . TYR B 1 445 ? -57.055  41.355  86.463  1.00 55.19  ? 606 TYR A CD2 1 
ATOM   7747 C CE1 . TYR B 1 445 ? -59.515  41.914  85.321  1.00 55.76  ? 606 TYR A CE1 1 
ATOM   7748 C CE2 . TYR B 1 445 ? -57.315  42.628  85.977  1.00 54.81  ? 606 TYR A CE2 1 
ATOM   7749 C CZ  . TYR B 1 445 ? -58.544  42.902  85.406  1.00 55.46  ? 606 TYR A CZ  1 
ATOM   7750 O OH  . TYR B 1 445 ? -58.808  44.163  84.922  1.00 55.48  ? 606 TYR A OH  1 
ATOM   7751 N N   . VAL B 1 446 ? -57.277  35.712  86.720  1.00 58.37  ? 607 VAL A N   1 
ATOM   7752 C CA  . VAL B 1 446 ? -56.661  34.474  87.227  1.00 59.92  ? 607 VAL A CA  1 
ATOM   7753 C C   . VAL B 1 446 ? -55.846  33.751  86.154  1.00 60.80  ? 607 VAL A C   1 
ATOM   7754 O O   . VAL B 1 446 ? -54.931  32.994  86.475  1.00 63.02  ? 607 VAL A O   1 
ATOM   7755 C CB  . VAL B 1 446 ? -57.671  33.483  87.873  1.00 60.17  ? 607 VAL A CB  1 
ATOM   7756 C CG1 . VAL B 1 446 ? -58.357  34.103  89.081  1.00 60.96  ? 607 VAL A CG1 1 
ATOM   7757 C CG2 . VAL B 1 446 ? -58.694  32.980  86.866  1.00 60.37  ? 607 VAL A CG2 1 
ATOM   7758 N N   . PHE B 1 447 ? -56.176  33.991  84.887  1.00 60.68  ? 608 PHE A N   1 
ATOM   7759 C CA  . PHE B 1 447 ? -55.461  33.360  83.780  1.00 61.37  ? 608 PHE A CA  1 
ATOM   7760 C C   . PHE B 1 447 ? -54.376  34.241  83.150  1.00 63.00  ? 608 PHE A C   1 
ATOM   7761 O O   . PHE B 1 447 ? -53.752  33.844  82.161  1.00 65.25  ? 608 PHE A O   1 
ATOM   7762 C CB  . PHE B 1 447 ? -56.442  32.853  82.717  1.00 60.27  ? 608 PHE A CB  1 
ATOM   7763 C CG  . PHE B 1 447 ? -57.004  31.493  83.014  1.00 58.99  ? 608 PHE A CG  1 
ATOM   7764 C CD1 . PHE B 1 447 ? -56.264  30.347  82.745  1.00 58.36  ? 608 PHE A CD1 1 
ATOM   7765 C CD2 . PHE B 1 447 ? -58.272  31.355  83.563  1.00 59.10  ? 608 PHE A CD2 1 
ATOM   7766 C CE1 . PHE B 1 447 ? -56.777  29.089  83.020  1.00 57.97  ? 608 PHE A CE1 1 
ATOM   7767 C CE2 . PHE B 1 447 ? -58.792  30.099  83.840  1.00 58.86  ? 608 PHE A CE2 1 
ATOM   7768 C CZ  . PHE B 1 447 ? -58.042  28.965  83.568  1.00 58.37  ? 608 PHE A CZ  1 
ATOM   7769 N N   . GLY B 1 448 ? -54.153  35.423  83.725  1.00 62.08  ? 609 GLY A N   1 
ATOM   7770 C CA  . GLY B 1 448 ? -53.091  36.325  83.274  1.00 61.63  ? 609 GLY A CA  1 
ATOM   7771 C C   . GLY B 1 448 ? -53.302  36.918  81.895  1.00 62.28  ? 609 GLY A C   1 
ATOM   7772 O O   . GLY B 1 448 ? -52.353  37.086  81.123  1.00 61.89  ? 609 GLY A O   1 
ATOM   7773 N N   . GLU B 1 449 ? -54.555  37.235  81.590  1.00 63.82  ? 610 GLU A N   1 
ATOM   7774 C CA  . GLU B 1 449 ? -54.917  37.862  80.324  1.00 64.84  ? 610 GLU A CA  1 
ATOM   7775 C C   . GLU B 1 449 ? -54.464  39.327  80.242  1.00 63.89  ? 610 GLU A C   1 
ATOM   7776 O O   . GLU B 1 449 ? -54.151  39.801  79.154  1.00 65.00  ? 610 GLU A O   1 
ATOM   7777 C CB  . GLU B 1 449 ? -56.426  37.745  80.077  1.00 65.81  ? 610 GLU A CB  1 
ATOM   7778 C CG  . GLU B 1 449 ? -56.836  37.811  78.615  1.00 67.05  ? 610 GLU A CG  1 
ATOM   7779 C CD  . GLU B 1 449 ? -58.298  38.170  78.437  1.00 68.42  ? 610 GLU A CD  1 
ATOM   7780 O OE1 . GLU B 1 449 ? -59.004  37.452  77.697  1.00 69.18  ? 610 GLU A OE1 1 
ATOM   7781 O OE2 . GLU B 1 449 ? -58.745  39.170  79.040  1.00 68.77  ? 610 GLU A OE2 1 
ATOM   7782 N N   . PRO B 1 450 ? -54.436  40.053  81.383  1.00 63.28  ? 611 PRO A N   1 
ATOM   7783 C CA  . PRO B 1 450 ? -53.914  41.422  81.361  1.00 63.70  ? 611 PRO A CA  1 
ATOM   7784 C C   . PRO B 1 450 ? -52.454  41.541  80.930  1.00 64.48  ? 611 PRO A C   1 
ATOM   7785 O O   . PRO B 1 450 ? -52.048  42.592  80.428  1.00 65.85  ? 611 PRO A O   1 
ATOM   7786 C CB  . PRO B 1 450 ? -54.068  41.872  82.812  1.00 63.48  ? 611 PRO A CB  1 
ATOM   7787 C CG  . PRO B 1 450 ? -55.262  41.128  83.282  1.00 63.39  ? 611 PRO A CG  1 
ATOM   7788 C CD  . PRO B 1 450 ? -55.107  39.769  82.667  1.00 63.73  ? 611 PRO A CD  1 
ATOM   7789 N N   . LEU B 1 451 ? -51.684  40.472  81.122  1.00 63.49  ? 612 LEU A N   1 
ATOM   7790 C CA  . LEU B 1 451 ? -50.269  40.450  80.756  1.00 62.29  ? 612 LEU A CA  1 
ATOM   7791 C C   . LEU B 1 451 ? -50.045  40.407  79.241  1.00 62.81  ? 612 LEU A C   1 
ATOM   7792 O O   . LEU B 1 451 ? -48.929  40.641  78.771  1.00 63.99  ? 612 LEU A O   1 
ATOM   7793 C CB  . LEU B 1 451 ? -49.553  39.281  81.441  1.00 60.97  ? 612 LEU A CB  1 
ATOM   7794 C CG  . LEU B 1 451 ? -49.229  39.443  82.929  1.00 60.36  ? 612 LEU A CG  1 
ATOM   7795 C CD1 . LEU B 1 451 ? -50.426  39.121  83.811  1.00 60.17  ? 612 LEU A CD1 1 
ATOM   7796 C CD2 . LEU B 1 451 ? -48.049  38.565  83.310  1.00 60.70  ? 612 LEU A CD2 1 
ATOM   7797 N N   . ASN B 1 452 ? -51.110  40.108  78.494  1.00 62.06  ? 613 ASN A N   1 
ATOM   7798 C CA  . ASN B 1 452 ? -51.097  40.096  77.029  1.00 60.83  ? 613 ASN A CA  1 
ATOM   7799 C C   . ASN B 1 452 ? -50.892  41.501  76.456  1.00 60.50  ? 613 ASN A C   1 
ATOM   7800 O O   . ASN B 1 452 ? -51.777  42.354  76.578  1.00 60.77  ? 613 ASN A O   1 
ATOM   7801 C CB  . ASN B 1 452 ? -52.403  39.486  76.501  1.00 60.86  ? 613 ASN A CB  1 
ATOM   7802 C CG  . ASN B 1 452 ? -52.400  39.269  74.997  1.00 60.91  ? 613 ASN A CG  1 
ATOM   7803 O OD1 . ASN B 1 452 ? -51.477  39.670  74.287  1.00 61.66  ? 613 ASN A OD1 1 
ATOM   7804 N ND2 . ASN B 1 452 ? -53.448  38.622  74.503  1.00 60.78  ? 613 ASN A ND2 1 
ATOM   7805 N N   . PRO B 1 453 ? -49.727  41.743  75.822  1.00 60.27  ? 614 PRO A N   1 
ATOM   7806 C CA  . PRO B 1 453 ? -49.376  43.077  75.325  1.00 60.75  ? 614 PRO A CA  1 
ATOM   7807 C C   . PRO B 1 453 ? -50.278  43.587  74.196  1.00 61.57  ? 614 PRO A C   1 
ATOM   7808 O O   . PRO B 1 453 ? -50.315  44.792  73.941  1.00 62.15  ? 614 PRO A O   1 
ATOM   7809 C CB  . PRO B 1 453 ? -47.936  42.903  74.831  1.00 59.73  ? 614 PRO A CB  1 
ATOM   7810 C CG  . PRO B 1 453 ? -47.809  41.452  74.529  1.00 59.09  ? 614 PRO A CG  1 
ATOM   7811 C CD  . PRO B 1 453 ? -48.662  40.760  75.546  1.00 59.18  ? 614 PRO A CD  1 
ATOM   7812 N N   . THR B 1 454 ? -51.002  42.681  73.539  1.00 62.14  ? 615 THR A N   1 
ATOM   7813 C CA  . THR B 1 454 ? -51.913  43.056  72.455  1.00 63.66  ? 615 THR A CA  1 
ATOM   7814 C C   . THR B 1 454 ? -53.250  43.589  72.976  1.00 65.24  ? 615 THR A C   1 
ATOM   7815 O O   . THR B 1 454 ? -54.084  44.061  72.198  1.00 66.64  ? 615 THR A O   1 
ATOM   7816 C CB  . THR B 1 454 ? -52.181  41.883  71.489  1.00 63.69  ? 615 THR A CB  1 
ATOM   7817 O OG1 . THR B 1 454 ? -52.712  40.771  72.217  1.00 64.24  ? 615 THR A OG1 1 
ATOM   7818 C CG2 . THR B 1 454 ? -50.905  41.459  70.777  1.00 65.04  ? 615 THR A CG2 1 
ATOM   7819 N N   . LEU B 1 455 ? -53.448  43.511  74.290  1.00 65.96  ? 616 LEU A N   1 
ATOM   7820 C CA  . LEU B 1 455 ? -54.684  43.977  74.916  1.00 66.80  ? 616 LEU A CA  1 
ATOM   7821 C C   . LEU B 1 455 ? -54.438  45.229  75.758  1.00 68.92  ? 616 LEU A C   1 
ATOM   7822 O O   . LEU B 1 455 ? -53.302  45.507  76.149  1.00 69.01  ? 616 LEU A O   1 
ATOM   7823 C CB  . LEU B 1 455 ? -55.321  42.861  75.749  1.00 65.20  ? 616 LEU A CB  1 
ATOM   7824 C CG  . LEU B 1 455 ? -55.562  41.522  75.041  1.00 64.29  ? 616 LEU A CG  1 
ATOM   7825 C CD1 . LEU B 1 455 ? -56.028  40.470  76.033  1.00 64.11  ? 616 LEU A CD1 1 
ATOM   7826 C CD2 . LEU B 1 455 ? -56.553  41.655  73.892  1.00 64.61  ? 616 LEU A CD2 1 
ATOM   7827 N N   . GLY B 1 456 ? -55.508  45.972  76.038  1.00 71.14  ? 617 GLY A N   1 
ATOM   7828 C CA  . GLY B 1 456 ? -55.395  47.306  76.632  1.00 73.24  ? 617 GLY A CA  1 
ATOM   7829 C C   . GLY B 1 456 ? -55.490  47.427  78.143  1.00 74.38  ? 617 GLY A C   1 
ATOM   7830 O O   . GLY B 1 456 ? -55.888  48.475  78.653  1.00 76.27  ? 617 GLY A O   1 
ATOM   7831 N N   . TYR B 1 457 ? -55.117  46.370  78.863  1.00 74.92  ? 618 TYR A N   1 
ATOM   7832 C CA  . TYR B 1 457 ? -55.119  46.391  80.327  1.00 73.78  ? 618 TYR A CA  1 
ATOM   7833 C C   . TYR B 1 457 ? -54.076  47.364  80.871  1.00 73.61  ? 618 TYR A C   1 
ATOM   7834 O O   . TYR B 1 457 ? -52.942  47.402  80.383  1.00 73.97  ? 618 TYR A O   1 
ATOM   7835 C CB  . TYR B 1 457 ? -54.863  44.990  80.884  1.00 73.42  ? 618 TYR A CB  1 
ATOM   7836 C CG  . TYR B 1 457 ? -56.036  44.044  80.756  1.00 73.57  ? 618 TYR A CG  1 
ATOM   7837 C CD1 . TYR B 1 457 ? -56.962  43.911  81.789  1.00 74.07  ? 618 TYR A CD1 1 
ATOM   7838 C CD2 . TYR B 1 457 ? -56.215  43.273  79.607  1.00 73.49  ? 618 TYR A CD2 1 
ATOM   7839 C CE1 . TYR B 1 457 ? -58.036  43.041  81.681  1.00 73.72  ? 618 TYR A CE1 1 
ATOM   7840 C CE2 . TYR B 1 457 ? -57.285  42.399  79.491  1.00 73.25  ? 618 TYR A CE2 1 
ATOM   7841 C CZ  . TYR B 1 457 ? -58.192  42.288  80.529  1.00 73.23  ? 618 TYR A CZ  1 
ATOM   7842 O OH  . TYR B 1 457 ? -59.256  41.426  80.420  1.00 73.11  ? 618 TYR A OH  1 
ATOM   7843 N N   . THR B 1 458 ? -54.465  48.144  81.880  1.00 72.86  ? 619 THR A N   1 
ATOM   7844 C CA  . THR B 1 458 ? -53.578  49.144  82.487  1.00 72.54  ? 619 THR A CA  1 
ATOM   7845 C C   . THR B 1 458 ? -52.462  48.490  83.297  1.00 73.79  ? 619 THR A C   1 
ATOM   7846 O O   . THR B 1 458 ? -52.520  47.295  83.600  1.00 74.71  ? 619 THR A O   1 
ATOM   7847 C CB  . THR B 1 458 ? -54.338  50.137  83.397  1.00 71.53  ? 619 THR A CB  1 
ATOM   7848 O OG1 . THR B 1 458 ? -54.601  49.532  84.669  1.00 70.83  ? 619 THR A OG1 1 
ATOM   7849 C CG2 . THR B 1 458 ? -55.647  50.584  82.756  1.00 71.56  ? 619 THR A CG2 1 
ATOM   7850 N N   . GLU B 1 459 ? -51.454  49.284  83.652  1.00 74.64  ? 620 GLU A N   1 
ATOM   7851 C CA  . GLU B 1 459 ? -50.304  48.787  84.399  1.00 75.59  ? 620 GLU A CA  1 
ATOM   7852 C C   . GLU B 1 459 ? -50.695  48.286  85.791  1.00 75.78  ? 620 GLU A C   1 
ATOM   7853 O O   . GLU B 1 459 ? -50.112  47.324  86.295  1.00 76.02  ? 620 GLU A O   1 
ATOM   7854 C CB  . GLU B 1 459 ? -49.221  49.863  84.496  1.00 76.34  ? 620 GLU A CB  1 
ATOM   7855 C CG  . GLU B 1 459 ? -47.803  49.311  84.523  1.00 77.69  ? 620 GLU A CG  1 
ATOM   7856 C CD  . GLU B 1 459 ? -47.443  48.545  83.259  1.00 78.72  ? 620 GLU A CD  1 
ATOM   7857 O OE1 . GLU B 1 459 ? -46.910  47.422  83.380  1.00 80.42  ? 620 GLU A OE1 1 
ATOM   7858 O OE2 . GLU B 1 459 ? -47.698  49.057  82.147  1.00 78.03  ? 620 GLU A OE2 1 
ATOM   7859 N N   . ASP B 1 460 ? -51.685  48.940  86.398  1.00 75.61  ? 621 ASP A N   1 
ATOM   7860 C CA  . ASP B 1 460 ? -52.228  48.527  87.692  1.00 75.66  ? 621 ASP A CA  1 
ATOM   7861 C C   . ASP B 1 460 ? -52.940  47.179  87.603  1.00 74.34  ? 621 ASP A C   1 
ATOM   7862 O O   . ASP B 1 460 ? -52.775  46.321  88.474  1.00 73.46  ? 621 ASP A O   1 
ATOM   7863 C CB  . ASP B 1 460 ? -53.189  49.589  88.239  1.00 77.64  ? 621 ASP A CB  1 
ATOM   7864 C CG  . ASP B 1 460 ? -52.489  50.644  89.086  1.00 78.88  ? 621 ASP A CG  1 
ATOM   7865 O OD1 . ASP B 1 460 ? -51.238  50.694  89.098  1.00 80.23  ? 621 ASP A OD1 1 
ATOM   7866 O OD2 . ASP B 1 460 ? -53.202  51.428  89.747  1.00 78.16  ? 621 ASP A OD2 1 
ATOM   7867 N N   . GLU B 1 461 ? -53.728  47.006  86.544  1.00 73.33  ? 622 GLU A N   1 
ATOM   7868 C CA  . GLU B 1 461 ? -54.461  45.765  86.304  1.00 72.36  ? 622 GLU A CA  1 
ATOM   7869 C C   . GLU B 1 461 ? -53.507  44.593  86.064  1.00 72.81  ? 622 GLU A C   1 
ATOM   7870 O O   . GLU B 1 461 ? -53.807  43.458  86.437  1.00 73.19  ? 622 GLU A O   1 
ATOM   7871 C CB  . GLU B 1 461 ? -55.438  45.932  85.133  1.00 71.78  ? 622 GLU A CB  1 
ATOM   7872 C CG  . GLU B 1 461 ? -56.579  46.904  85.418  1.00 72.55  ? 622 GLU A CG  1 
ATOM   7873 C CD  . GLU B 1 461 ? -57.484  47.164  84.220  1.00 73.59  ? 622 GLU A CD  1 
ATOM   7874 O OE1 . GLU B 1 461 ? -57.056  46.952  83.064  1.00 73.36  ? 622 GLU A OE1 1 
ATOM   7875 O OE2 . GLU B 1 461 ? -58.635  47.596  84.440  1.00 73.85  ? 622 GLU A OE2 1 
ATOM   7876 N N   . LYS B 1 462 ? -52.355  44.883  85.459  1.00 73.24  ? 623 LYS A N   1 
ATOM   7877 C CA  . LYS B 1 462 ? -51.316  43.877  85.221  1.00 73.37  ? 623 LYS A CA  1 
ATOM   7878 C C   . LYS B 1 462 ? -50.696  43.375  86.524  1.00 73.63  ? 623 LYS A C   1 
ATOM   7879 O O   . LYS B 1 462 ? -50.370  42.192  86.643  1.00 74.24  ? 623 LYS A O   1 
ATOM   7880 C CB  . LYS B 1 462 ? -50.226  44.421  84.290  1.00 72.96  ? 623 LYS A CB  1 
ATOM   7881 C CG  . LYS B 1 462 ? -50.656  44.553  82.837  1.00 73.05  ? 623 LYS A CG  1 
ATOM   7882 C CD  . LYS B 1 462 ? -49.497  44.960  81.941  1.00 72.61  ? 623 LYS A CD  1 
ATOM   7883 C CE  . LYS B 1 462 ? -49.967  45.223  80.518  1.00 71.17  ? 623 LYS A CE  1 
ATOM   7884 N NZ  . LYS B 1 462 ? -48.842  45.574  79.611  1.00 69.23  ? 623 LYS A NZ  1 
ATOM   7885 N N   . ASP B 1 463 ? -50.535  44.278  87.490  1.00 73.90  ? 624 ASP A N   1 
ATOM   7886 C CA  . ASP B 1 463 ? -50.043  43.923  88.822  1.00 73.86  ? 624 ASP A CA  1 
ATOM   7887 C C   . ASP B 1 463 ? -51.075  43.079  89.556  1.00 73.39  ? 624 ASP A C   1 
ATOM   7888 O O   . ASP B 1 463 ? -50.740  42.050  90.149  1.00 73.09  ? 624 ASP A O   1 
ATOM   7889 C CB  . ASP B 1 463 ? -49.734  45.180  89.641  1.00 74.36  ? 624 ASP A CB  1 
ATOM   7890 C CG  . ASP B 1 463 ? -48.508  45.922  89.146  1.00 74.87  ? 624 ASP A CG  1 
ATOM   7891 O OD1 . ASP B 1 463 ? -47.942  45.539  88.100  1.00 75.67  ? 624 ASP A OD1 1 
ATOM   7892 O OD2 . ASP B 1 463 ? -48.106  46.898  89.811  1.00 76.09  ? 624 ASP A OD2 1 
ATOM   7893 N N   . PHE B 1 464 ? -52.328  43.529  89.495  1.00 71.71  ? 625 PHE A N   1 
ATOM   7894 C CA  . PHE B 1 464 ? -53.459  42.873  90.149  1.00 70.64  ? 625 PHE A CA  1 
ATOM   7895 C C   . PHE B 1 464 ? -53.671  41.448  89.637  1.00 70.75  ? 625 PHE A C   1 
ATOM   7896 O O   . PHE B 1 464 ? -54.043  40.555  90.405  1.00 70.91  ? 625 PHE A O   1 
ATOM   7897 C CB  . PHE B 1 464 ? -54.726  43.715  89.958  1.00 69.72  ? 625 PHE A CB  1 
ATOM   7898 C CG  . PHE B 1 464 ? -55.937  43.175  90.666  1.00 68.27  ? 625 PHE A CG  1 
ATOM   7899 C CD1 . PHE B 1 464 ? -56.057  43.276  92.048  1.00 67.91  ? 625 PHE A CD1 1 
ATOM   7900 C CD2 . PHE B 1 464 ? -56.967  42.580  89.948  1.00 68.12  ? 625 PHE A CD2 1 
ATOM   7901 C CE1 . PHE B 1 464 ? -57.176  42.780  92.699  1.00 68.16  ? 625 PHE A CE1 1 
ATOM   7902 C CE2 . PHE B 1 464 ? -58.088  42.084  90.594  1.00 68.33  ? 625 PHE A CE2 1 
ATOM   7903 C CZ  . PHE B 1 464 ? -58.194  42.186  91.971  1.00 68.15  ? 625 PHE A CZ  1 
ATOM   7904 N N   . SER B 1 465 ? -53.431  41.246  88.342  1.00 69.77  ? 626 SER A N   1 
ATOM   7905 C CA  . SER B 1 465 ? -53.512  39.920  87.742  1.00 68.35  ? 626 SER A CA  1 
ATOM   7906 C C   . SER B 1 465 ? -52.407  39.019  88.286  1.00 68.84  ? 626 SER A C   1 
ATOM   7907 O O   . SER B 1 465 ? -52.688  37.925  88.774  1.00 70.14  ? 626 SER A O   1 
ATOM   7908 C CB  . SER B 1 465 ? -53.438  40.002  86.220  1.00 67.10  ? 626 SER A CB  1 
ATOM   7909 O OG  . SER B 1 465 ? -53.820  38.770  85.638  1.00 66.86  ? 626 SER A OG  1 
ATOM   7910 N N   . ARG B 1 466 ? -51.161  39.490  88.218  1.00 68.72  ? 627 ARG A N   1 
ATOM   7911 C CA  . ARG B 1 466 ? -50.021  38.762  88.783  1.00 69.39  ? 627 ARG A CA  1 
ATOM   7912 C C   . ARG B 1 466 ? -50.201  38.479  90.271  1.00 69.88  ? 627 ARG A C   1 
ATOM   7913 O O   . ARG B 1 466 ? -49.767  37.436  90.767  1.00 70.34  ? 627 ARG A O   1 
ATOM   7914 C CB  . ARG B 1 466 ? -48.712  39.519  88.554  1.00 69.71  ? 627 ARG A CB  1 
ATOM   7915 C CG  . ARG B 1 466 ? -48.018  39.181  87.243  1.00 72.18  ? 627 ARG A CG  1 
ATOM   7916 C CD  . ARG B 1 466 ? -46.642  39.825  87.151  1.00 73.10  ? 627 ARG A CD  1 
ATOM   7917 N NE  . ARG B 1 466 ? -46.707  41.278  87.312  1.00 73.77  ? 627 ARG A NE  1 
ATOM   7918 C CZ  . ARG B 1 466 ? -46.831  42.148  86.312  1.00 73.09  ? 627 ARG A CZ  1 
ATOM   7919 N NH1 . ARG B 1 466 ? -46.897  41.728  85.054  1.00 72.04  ? 627 ARG A NH1 1 
ATOM   7920 N NH2 . ARG B 1 466 ? -46.884  43.447  86.572  1.00 73.70  ? 627 ARG A NH2 1 
ATOM   7921 N N   . LYS B 1 467 ? -50.847  39.412  90.970  1.00 69.33  ? 628 LYS A N   1 
ATOM   7922 C CA  . LYS B 1 467 ? -51.122  39.275  92.399  1.00 69.32  ? 628 LYS A CA  1 
ATOM   7923 C C   . LYS B 1 467 ? -52.024  38.081  92.681  1.00 69.81  ? 628 LYS A C   1 
ATOM   7924 O O   . LYS B 1 467 ? -51.684  37.227  93.502  1.00 70.38  ? 628 LYS A O   1 
ATOM   7925 C CB  . LYS B 1 467 ? -51.742  40.562  92.958  1.00 68.98  ? 628 LYS A CB  1 
ATOM   7926 C CG  . LYS B 1 467 ? -52.162  40.502  94.423  1.00 67.59  ? 628 LYS A CG  1 
ATOM   7927 C CD  . LYS B 1 467 ? -52.690  41.854  94.883  1.00 67.66  ? 628 LYS A CD  1 
ATOM   7928 C CE  . LYS B 1 467 ? -53.457  41.751  96.190  1.00 66.21  ? 628 LYS A CE  1 
ATOM   7929 N NZ  . LYS B 1 467 ? -53.894  43.090  96.673  1.00 63.58  ? 628 LYS A NZ  1 
ATOM   7930 N N   . ILE B 1 468 ? -53.163  38.020  91.993  1.00 69.96  ? 629 ILE A N   1 
ATOM   7931 C CA  . ILE B 1 468 ? -54.141  36.960  92.242  1.00 69.89  ? 629 ILE A CA  1 
ATOM   7932 C C   . ILE B 1 468 ? -53.722  35.631  91.617  1.00 70.23  ? 629 ILE A C   1 
ATOM   7933 O O   . ILE B 1 468 ? -54.167  34.571  92.057  1.00 70.57  ? 629 ILE A O   1 
ATOM   7934 C CB  . ILE B 1 468 ? -55.585  37.352  91.838  1.00 68.72  ? 629 ILE A CB  1 
ATOM   7935 C CG1 . ILE B 1 468 ? -55.732  37.468  90.324  1.00 69.47  ? 629 ILE A CG1 1 
ATOM   7936 C CG2 . ILE B 1 468 ? -56.011  38.646  92.522  1.00 68.04  ? 629 ILE A CG2 1 
ATOM   7937 C CD1 . ILE B 1 468 ? -57.174  37.450  89.878  1.00 72.26  ? 629 ILE A CD1 1 
ATOM   7938 N N   . MET B 1 469 ? -52.858  35.694  90.605  1.00 71.16  ? 630 MET A N   1 
ATOM   7939 C CA  . MET B 1 469 ? -52.260  34.492  90.026  1.00 72.35  ? 630 MET A CA  1 
ATOM   7940 C C   . MET B 1 469 ? -51.341  33.821  91.033  1.00 72.80  ? 630 MET A C   1 
ATOM   7941 O O   . MET B 1 469 ? -51.311  32.595  91.129  1.00 72.23  ? 630 MET A O   1 
ATOM   7942 C CB  . MET B 1 469 ? -51.479  34.819  88.759  1.00 72.74  ? 630 MET A CB  1 
ATOM   7943 C CG  . MET B 1 469 ? -52.329  34.872  87.504  1.00 73.53  ? 630 MET A CG  1 
ATOM   7944 S SD  . MET B 1 469 ? -51.410  35.570  86.124  1.00 75.78  ? 630 MET A SD  1 
ATOM   7945 C CE  . MET B 1 469 ? -50.219  34.274  85.814  1.00 76.04  ? 630 MET A CE  1 
ATOM   7946 N N   . ARG B 1 470 ? -50.596  34.636  91.777  1.00 74.14  ? 631 ARG A N   1 
ATOM   7947 C CA  . ARG B 1 470 ? -49.743  34.138  92.848  1.00 75.98  ? 631 ARG A CA  1 
ATOM   7948 C C   . ARG B 1 470 ? -50.583  33.521  93.963  1.00 76.31  ? 631 ARG A C   1 
ATOM   7949 O O   . ARG B 1 470 ? -50.347  32.376  94.347  1.00 78.76  ? 631 ARG A O   1 
ATOM   7950 C CB  . ARG B 1 470 ? -48.840  35.247  93.396  1.00 77.06  ? 631 ARG A CB  1 
ATOM   7951 C CG  . ARG B 1 470 ? -47.858  34.796  94.472  1.00 78.36  ? 631 ARG A CG  1 
ATOM   7952 C CD  . ARG B 1 470 ? -46.809  33.838  93.926  1.00 78.91  ? 631 ARG A CD  1 
ATOM   7953 N NE  . ARG B 1 470 ? -45.974  34.471  92.908  1.00 80.17  ? 631 ARG A NE  1 
ATOM   7954 C CZ  . ARG B 1 470 ? -45.165  33.818  92.080  1.00 82.07  ? 631 ARG A CZ  1 
ATOM   7955 N NH1 . ARG B 1 470 ? -45.069  32.493  92.130  1.00 82.89  ? 631 ARG A NH1 1 
ATOM   7956 N NH2 . ARG B 1 470 ? -44.451  34.494  91.190  1.00 83.44  ? 631 ARG A NH2 1 
ATOM   7957 N N   . TYR B 1 471 ? -51.564  34.275  94.463  1.00 74.59  ? 632 TYR A N   1 
ATOM   7958 C CA  . TYR B 1 471 ? -52.491  33.782  95.485  1.00 73.15  ? 632 TYR A CA  1 
ATOM   7959 C C   . TYR B 1 471 ? -53.006  32.385  95.142  1.00 71.80  ? 632 TYR A C   1 
ATOM   7960 O O   . TYR B 1 471 ? -52.885  31.452  95.940  1.00 71.14  ? 632 TYR A O   1 
ATOM   7961 C CB  . TYR B 1 471 ? -53.686  34.727  95.641  1.00 73.93  ? 632 TYR A CB  1 
ATOM   7962 C CG  . TYR B 1 471 ? -53.466  35.947  96.510  1.00 74.28  ? 632 TYR A CG  1 
ATOM   7963 C CD1 . TYR B 1 471 ? -52.652  35.899  97.642  1.00 73.52  ? 632 TYR A CD1 1 
ATOM   7964 C CD2 . TYR B 1 471 ? -54.117  37.145  96.219  1.00 75.65  ? 632 TYR A CD2 1 
ATOM   7965 C CE1 . TYR B 1 471 ? -52.471  37.020  98.438  1.00 73.99  ? 632 TYR A CE1 1 
ATOM   7966 C CE2 . TYR B 1 471 ? -53.945  38.267  97.010  1.00 75.57  ? 632 TYR A CE2 1 
ATOM   7967 C CZ  . TYR B 1 471 ? -53.123  38.200  98.116  1.00 74.79  ? 632 TYR A CZ  1 
ATOM   7968 O OH  . TYR B 1 471 ? -52.958  39.319  98.896  1.00 75.29  ? 632 TYR A OH  1 
ATOM   7969 N N   . TRP B 1 472 ? -53.577  32.265  93.945  1.00 70.18  ? 633 TRP A N   1 
ATOM   7970 C CA  . TRP B 1 472 ? -54.117  31.009  93.434  1.00 69.39  ? 633 TRP A CA  1 
ATOM   7971 C C   . TRP B 1 472 ? -53.052  29.914  93.349  1.00 69.80  ? 633 TRP A C   1 
ATOM   7972 O O   . TRP B 1 472 ? -53.287  28.786  93.787  1.00 70.55  ? 633 TRP A O   1 
ATOM   7973 C CB  . TRP B 1 472 ? -54.746  31.235  92.055  1.00 68.12  ? 633 TRP A CB  1 
ATOM   7974 C CG  . TRP B 1 472 ? -56.249  31.427  92.038  1.00 67.27  ? 633 TRP A CG  1 
ATOM   7975 C CD1 . TRP B 1 472 ? -57.156  30.663  91.361  1.00 67.51  ? 633 TRP A CD1 1 
ATOM   7976 C CD2 . TRP B 1 472 ? -57.010  32.451  92.704  1.00 66.65  ? 633 TRP A CD2 1 
ATOM   7977 N NE1 . TRP B 1 472 ? -58.428  31.138  91.564  1.00 67.09  ? 633 TRP A NE1 1 
ATOM   7978 C CE2 . TRP B 1 472 ? -58.369  32.233  92.385  1.00 66.78  ? 633 TRP A CE2 1 
ATOM   7979 C CE3 . TRP B 1 472 ? -56.677  33.525  93.541  1.00 66.21  ? 633 TRP A CE3 1 
ATOM   7980 C CZ2 . TRP B 1 472 ? -59.396  33.049  92.874  1.00 65.87  ? 633 TRP A CZ2 1 
ATOM   7981 C CZ3 . TRP B 1 472 ? -57.700  34.336  94.025  1.00 65.83  ? 633 TRP A CZ3 1 
ATOM   7982 C CH2 . TRP B 1 472 ? -59.042  34.092  93.690  1.00 65.46  ? 633 TRP A CH2 1 
ATOM   7983 N N   . SER B 1 473 ? -51.884  30.257  92.804  1.00 69.58  ? 634 SER A N   1 
ATOM   7984 C CA  . SER B 1 473 ? -50.834  29.271  92.536  1.00 70.57  ? 634 SER A CA  1 
ATOM   7985 C C   . SER B 1 473 ? -50.248  28.657  93.806  1.00 72.34  ? 634 SER A C   1 
ATOM   7986 O O   . SER B 1 473 ? -50.235  27.436  93.951  1.00 73.38  ? 634 SER A O   1 
ATOM   7987 C CB  . SER B 1 473 ? -49.723  29.857  91.655  1.00 69.79  ? 634 SER A CB  1 
ATOM   7988 O OG  . SER B 1 473 ? -48.788  30.606  92.412  1.00 70.23  ? 634 SER A OG  1 
ATOM   7989 N N   . ASN B 1 474 ? -49.768  29.495  94.723  1.00 73.35  ? 635 ASN A N   1 
ATOM   7990 C CA  . ASN B 1 474 ? -49.158  28.977  95.948  1.00 73.73  ? 635 ASN A CA  1 
ATOM   7991 C C   . ASN B 1 474 ? -50.165  28.408  96.962  1.00 72.70  ? 635 ASN A C   1 
ATOM   7992 O O   . ASN B 1 474 ? -49.769  27.793  97.953  1.00 73.06  ? 635 ASN A O   1 
ATOM   7993 C CB  . ASN B 1 474 ? -48.165  29.974  96.579  1.00 74.34  ? 635 ASN A CB  1 
ATOM   7994 C CG  . ASN B 1 474 ? -48.765  31.345  96.820  1.00 74.53  ? 635 ASN A CG  1 
ATOM   7995 O OD1 . ASN B 1 474 ? -49.979  31.494  96.958  1.00 75.63  ? 635 ASN A OD1 1 
ATOM   7996 N ND2 . ASN B 1 474 ? -47.909  32.358  96.883  1.00 74.34  ? 635 ASN A ND2 1 
ATOM   7997 N N   . PHE B 1 475 ? -51.458  28.603  96.703  1.00 71.42  ? 636 PHE A N   1 
ATOM   7998 C CA  . PHE B 1 475 ? -52.487  27.828  97.395  1.00 70.94  ? 636 PHE A CA  1 
ATOM   7999 C C   . PHE B 1 475 ? -52.460  26.400  96.857  1.00 71.60  ? 636 PHE A C   1 
ATOM   8000 O O   . PHE B 1 475 ? -52.547  25.437  97.621  1.00 71.93  ? 636 PHE A O   1 
ATOM   8001 C CB  . PHE B 1 475 ? -53.885  28.437  97.222  1.00 69.14  ? 636 PHE A CB  1 
ATOM   8002 C CG  . PHE B 1 475 ? -54.994  27.569  97.762  1.00 67.81  ? 636 PHE A CG  1 
ATOM   8003 C CD1 . PHE B 1 475 ? -55.281  27.545  99.124  1.00 68.20  ? 636 PHE A CD1 1 
ATOM   8004 C CD2 . PHE B 1 475 ? -55.745  26.766  96.911  1.00 67.48  ? 636 PHE A CD2 1 
ATOM   8005 C CE1 . PHE B 1 475 ? -56.297  26.740  99.624  1.00 67.61  ? 636 PHE A CE1 1 
ATOM   8006 C CE2 . PHE B 1 475 ? -56.762  25.959  97.406  1.00 67.30  ? 636 PHE A CE2 1 
ATOM   8007 C CZ  . PHE B 1 475 ? -57.039  25.946  98.764  1.00 66.58  ? 636 PHE A CZ  1 
ATOM   8008 N N   . ALA B 1 476 ? -52.339  26.279  95.536  1.00 71.23  ? 637 ALA A N   1 
ATOM   8009 C CA  . ALA B 1 476 ? -52.215  24.983  94.876  1.00 70.85  ? 637 ALA A CA  1 
ATOM   8010 C C   . ALA B 1 476 ? -50.893  24.314  95.239  1.00 71.79  ? 637 ALA A C   1 
ATOM   8011 O O   . ALA B 1 476 ? -50.777  23.087  95.205  1.00 73.09  ? 637 ALA A O   1 
ATOM   8012 C CB  . ALA B 1 476 ? -52.331  25.145  93.369  1.00 69.69  ? 637 ALA A CB  1 
ATOM   8013 N N   . LYS B 1 477 ? -49.902  25.131  95.589  1.00 71.57  ? 638 LYS A N   1 
ATOM   8014 C CA  . LYS B 1 477 ? -48.589  24.632  95.982  1.00 71.28  ? 638 LYS A CA  1 
ATOM   8015 C C   . LYS B 1 477 ? -48.551  24.214  97.453  1.00 71.14  ? 638 LYS A C   1 
ATOM   8016 O O   . LYS B 1 477 ? -48.168  23.087  97.772  1.00 71.14  ? 638 LYS A O   1 
ATOM   8017 C CB  . LYS B 1 477 ? -47.501  25.676  95.702  1.00 70.42  ? 638 LYS A CB  1 
ATOM   8018 C CG  . LYS B 1 477 ? -47.239  25.958  94.229  1.00 69.34  ? 638 LYS A CG  1 
ATOM   8019 C CD  . LYS B 1 477 ? -46.246  27.099  94.066  1.00 68.42  ? 638 LYS A CD  1 
ATOM   8020 C CE  . LYS B 1 477 ? -46.083  27.498  92.609  1.00 67.00  ? 638 LYS A CE  1 
ATOM   8021 N NZ  . LYS B 1 477 ? -45.345  28.783  92.470  1.00 65.75  ? 638 LYS A NZ  1 
ATOM   8022 N N   . THR B 1 478 ? -48.962  25.120  98.339  1.00 71.06  ? 639 THR A N   1 
ATOM   8023 C CA  . THR B 1 478 ? -48.764  24.943  99.780  1.00 70.66  ? 639 THR A CA  1 
ATOM   8024 C C   . THR B 1 478 ? -50.040  24.631  100.566 1.00 70.61  ? 639 THR A C   1 
ATOM   8025 O O   . THR B 1 478 ? -49.986  23.951  101.591 1.00 70.67  ? 639 THR A O   1 
ATOM   8026 C CB  . THR B 1 478 ? -48.072  26.175  100.413 1.00 70.75  ? 639 THR A CB  1 
ATOM   8027 O OG1 . THR B 1 478 ? -48.933  27.318  100.323 1.00 69.88  ? 639 THR A OG1 1 
ATOM   8028 C CG2 . THR B 1 478 ? -46.742  26.480  99.719  1.00 70.07  ? 639 THR A CG2 1 
ATOM   8029 N N   . GLY B 1 479 ? -51.179  25.123  100.087 1.00 71.64  ? 640 GLY A N   1 
ATOM   8030 C CA  . GLY B 1 479 ? -52.439  25.020  100.827 1.00 72.76  ? 640 GLY A CA  1 
ATOM   8031 C C   . GLY B 1 479 ? -52.780  26.334  101.502 1.00 74.07  ? 640 GLY A C   1 
ATOM   8032 O O   . GLY B 1 479 ? -53.686  26.405  102.337 1.00 73.88  ? 640 GLY A O   1 
ATOM   8033 N N   . ASN B 1 480 ? -52.039  27.374  101.125 1.00 75.06  ? 641 ASN A N   1 
ATOM   8034 C CA  . ASN B 1 480 ? -52.184  28.711  101.679 1.00 76.07  ? 641 ASN A CA  1 
ATOM   8035 C C   . ASN B 1 480 ? -51.751  29.750  100.639 1.00 77.86  ? 641 ASN A C   1 
ATOM   8036 O O   . ASN B 1 480 ? -50.656  29.645  100.080 1.00 78.74  ? 641 ASN A O   1 
ATOM   8037 C CB  . ASN B 1 480 ? -51.356  28.837  102.964 1.00 76.57  ? 641 ASN A CB  1 
ATOM   8038 C CG  . ASN B 1 480 ? -51.469  30.205  103.610 1.00 78.70  ? 641 ASN A CG  1 
ATOM   8039 O OD1 . ASN B 1 480 ? -51.137  31.222  103.008 1.00 80.45  ? 641 ASN A OD1 1 
ATOM   8040 N ND2 . ASN B 1 480 ? -51.916  30.230  104.857 1.00 80.47  ? 641 ASN A ND2 1 
ATOM   8041 N N   . PRO B 1 481 ? -52.609  30.756  100.377 1.00 78.36  ? 642 PRO A N   1 
ATOM   8042 C CA  . PRO B 1 481 ? -52.345  31.774  99.352  1.00 78.55  ? 642 PRO A CA  1 
ATOM   8043 C C   . PRO B 1 481 ? -51.279  32.809  99.723  1.00 81.06  ? 642 PRO A C   1 
ATOM   8044 O O   . PRO B 1 481 ? -50.723  33.455  98.834  1.00 83.69  ? 642 PRO A O   1 
ATOM   8045 C CB  . PRO B 1 481 ? -53.703  32.458  99.184  1.00 77.58  ? 642 PRO A CB  1 
ATOM   8046 C CG  . PRO B 1 481 ? -54.375  32.279  100.500 1.00 78.35  ? 642 PRO A CG  1 
ATOM   8047 C CD  . PRO B 1 481 ? -53.931  30.938  101.004 1.00 78.33  ? 642 PRO A CD  1 
ATOM   8048 N N   . ASN B 1 482 ? -51.006  32.972  101.015 1.00 83.68  ? 643 ASN A N   1 
ATOM   8049 C CA  . ASN B 1 482 ? -50.042  33.970  101.488 1.00 87.52  ? 643 ASN A CA  1 
ATOM   8050 C C   . ASN B 1 482 ? -48.596  33.617  101.148 1.00 94.49  ? 643 ASN A C   1 
ATOM   8051 O O   . ASN B 1 482 ? -48.237  32.436  101.144 1.00 95.54  ? 643 ASN A O   1 
ATOM   8052 C CB  . ASN B 1 482 ? -50.185  34.173  102.995 1.00 84.35  ? 643 ASN A CB  1 
ATOM   8053 C CG  . ASN B 1 482 ? -51.510  34.796  103.371 1.00 82.51  ? 643 ASN A CG  1 
ATOM   8054 O OD1 . ASN B 1 482 ? -51.711  35.997  103.200 1.00 82.09  ? 643 ASN A OD1 1 
ATOM   8055 N ND2 . ASN B 1 482 ? -52.423  33.982  103.887 1.00 81.07  ? 643 ASN A ND2 1 
ATOM   8056 N N   . PRO B 1 483 ? -47.763  34.639  100.855 1.00 100.89 ? 644 PRO A N   1 
ATOM   8057 C CA  . PRO B 1 483 ? -46.336  34.411  100.603 1.00 104.52 ? 644 PRO A CA  1 
ATOM   8058 C C   . PRO B 1 483 ? -45.619  33.918  101.856 1.00 107.61 ? 644 PRO A C   1 
ATOM   8059 O O   . PRO B 1 483 ? -46.013  34.269  102.973 1.00 108.04 ? 644 PRO A O   1 
ATOM   8060 C CB  . PRO B 1 483 ? -45.814  35.799  100.213 1.00 104.66 ? 644 PRO A CB  1 
ATOM   8061 C CG  . PRO B 1 483 ? -47.020  36.571  99.806  1.00 105.12 ? 644 PRO A CG  1 
ATOM   8062 C CD  . PRO B 1 483 ? -48.123  36.057  100.679 1.00 102.65 ? 644 PRO A CD  1 
ATOM   8063 N N   . ASN B 1 484 ? -44.577  33.113  101.661 1.00 111.31 ? 645 ASN A N   1 
ATOM   8064 C CA  . ASN B 1 484 ? -43.823  32.519  102.766 1.00 115.60 ? 645 ASN A CA  1 
ATOM   8065 C C   . ASN B 1 484 ? -43.108  33.548  103.645 1.00 117.98 ? 645 ASN A C   1 
ATOM   8066 O O   . ASN B 1 484 ? -42.987  33.361  104.858 1.00 118.26 ? 645 ASN A O   1 
ATOM   8067 C CB  . ASN B 1 484 ? -42.822  31.486  102.231 1.00 115.70 ? 645 ASN A CB  1 
ATOM   8068 C CG  . ASN B 1 484 ? -42.205  30.636  103.331 1.00 115.59 ? 645 ASN A CG  1 
ATOM   8069 O OD1 . ASN B 1 484 ? -42.825  30.382  104.366 1.00 115.51 ? 645 ASN A OD1 1 
ATOM   8070 N ND2 . ASN B 1 484 ? -40.977  30.183  103.105 1.00 115.20 ? 645 ASN A ND2 1 
ATOM   8071 N N   . THR B 1 485 ? -42.648  34.635  103.025 1.00 119.42 ? 646 THR A N   1 
ATOM   8072 C CA  . THR B 1 485 ? -41.881  35.670  103.723 1.00 118.96 ? 646 THR A CA  1 
ATOM   8073 C C   . THR B 1 485 ? -42.728  36.881  104.147 1.00 119.25 ? 646 THR A C   1 
ATOM   8074 O O   . THR B 1 485 ? -42.186  37.885  104.613 1.00 120.16 ? 646 THR A O   1 
ATOM   8075 C CB  . THR B 1 485 ? -40.666  36.134  102.886 1.00 117.61 ? 646 THR A CB  1 
ATOM   8076 O OG1 . THR B 1 485 ? -41.101  36.516  101.575 1.00 116.96 ? 646 THR A OG1 1 
ATOM   8077 C CG2 . THR B 1 485 ? -39.627  35.018  102.768 1.00 114.74 ? 646 THR A CG2 1 
ATOM   8078 N N   . ALA B 1 486 ? -44.049  36.766  103.992 1.00 119.78 ? 647 ALA A N   1 
ATOM   8079 C CA  . ALA B 1 486 ? -45.018  37.806  104.384 1.00 121.12 ? 647 ALA A CA  1 
ATOM   8080 C C   . ALA B 1 486 ? -44.705  39.199  103.816 1.00 122.34 ? 647 ALA A C   1 
ATOM   8081 O O   . ALA B 1 486 ? -44.099  40.039  104.488 1.00 122.41 ? 647 ALA A O   1 
ATOM   8082 C CB  . ALA B 1 486 ? -45.187  37.851  105.902 1.00 118.60 ? 647 ALA A CB  1 
ATOM   8083 N N   . SER B 1 487 ? -45.133  39.430  102.577 1.00 123.92 ? 648 SER A N   1 
ATOM   8084 C CA  . SER B 1 487 ? -44.877  40.688  101.872 1.00 123.69 ? 648 SER A CA  1 
ATOM   8085 C C   . SER B 1 487 ? -45.906  41.777  102.219 1.00 125.29 ? 648 SER A C   1 
ATOM   8086 O O   . SER B 1 487 ? -46.879  41.517  102.933 1.00 124.60 ? 648 SER A O   1 
ATOM   8087 C CB  . SER B 1 487 ? -44.841  40.439  100.360 1.00 120.71 ? 648 SER A CB  1 
ATOM   8088 O OG  . SER B 1 487 ? -44.391  41.586  99.660  1.00 117.48 ? 648 SER A OG  1 
ATOM   8089 N N   . SER B 1 488 ? -45.674  42.991  101.717 1.00 125.53 ? 649 SER A N   1 
ATOM   8090 C CA  . SER B 1 488 ? -46.588  44.123  101.921 1.00 123.57 ? 649 SER A CA  1 
ATOM   8091 C C   . SER B 1 488 ? -47.391  44.461  100.661 1.00 120.92 ? 649 SER A C   1 
ATOM   8092 O O   . SER B 1 488 ? -48.537  44.904  100.751 1.00 118.68 ? 649 SER A O   1 
ATOM   8093 C CB  . SER B 1 488 ? -45.832  45.358  102.425 1.00 124.26 ? 649 SER A CB  1 
ATOM   8094 O OG  . SER B 1 488 ? -44.855  45.787  101.493 1.00 125.39 ? 649 SER A OG  1 
ATOM   8095 N N   . GLU B 1 489 ? -46.778  44.254  99.495  1.00 121.09 ? 650 GLU A N   1 
ATOM   8096 C CA  . GLU B 1 489 ? -47.471  44.372  98.206  1.00 120.82 ? 650 GLU A CA  1 
ATOM   8097 C C   . GLU B 1 489 ? -48.441  43.201  97.990  1.00 119.07 ? 650 GLU A C   1 
ATOM   8098 O O   . GLU B 1 489 ? -49.384  43.301  97.201  1.00 118.37 ? 650 GLU A O   1 
ATOM   8099 C CB  . GLU B 1 489 ? -46.470  44.472  97.047  1.00 122.30 ? 650 GLU A CB  1 
ATOM   8100 C CG  . GLU B 1 489 ? -45.454  43.337  96.977  1.00 124.24 ? 650 GLU A CG  1 
ATOM   8101 C CD  . GLU B 1 489 ? -44.791  43.212  95.618  1.00 126.27 ? 650 GLU A CD  1 
ATOM   8102 O OE1 . GLU B 1 489 ? -44.391  44.248  95.042  1.00 128.04 ? 650 GLU A OE1 1 
ATOM   8103 O OE2 . GLU B 1 489 ? -44.662  42.070  95.126  1.00 126.01 ? 650 GLU A OE2 1 
ATOM   8104 N N   . PHE B 1 490 ? -48.176  42.094  98.685  1.00 115.56 ? 651 PHE A N   1 
ATOM   8105 C CA  . PHE B 1 490 ? -49.104  40.972  98.802  1.00 108.21 ? 651 PHE A CA  1 
ATOM   8106 C C   . PHE B 1 490 ? -49.687  40.976  100.217 1.00 102.39 ? 651 PHE A C   1 
ATOM   8107 O O   . PHE B 1 490 ? -49.063  40.445  101.142 1.00 101.85 ? 651 PHE A O   1 
ATOM   8108 C CB  . PHE B 1 490 ? -48.388  39.640  98.548  1.00 108.09 ? 651 PHE A CB  1 
ATOM   8109 C CG  . PHE B 1 490 ? -48.149  39.336  97.097  1.00 109.28 ? 651 PHE A CG  1 
ATOM   8110 C CD1 . PHE B 1 490 ? -46.989  39.771  96.460  1.00 110.43 ? 651 PHE A CD1 1 
ATOM   8111 C CD2 . PHE B 1 490 ? -49.072  38.594  96.370  1.00 109.37 ? 651 PHE A CD2 1 
ATOM   8112 C CE1 . PHE B 1 490 ? -46.764  39.484  95.120  1.00 110.36 ? 651 PHE A CE1 1 
ATOM   8113 C CE2 . PHE B 1 490 ? -48.852  38.305  95.033  1.00 109.95 ? 651 PHE A CE2 1 
ATOM   8114 C CZ  . PHE B 1 490 ? -47.697  38.748  94.406  1.00 109.54 ? 651 PHE A CZ  1 
ATOM   8115 N N   . PRO B 1 491 ? -50.877  41.586  100.398 1.00 96.70  ? 652 PRO A N   1 
ATOM   8116 C CA  . PRO B 1 491 ? -51.536  41.644  101.708 1.00 92.11  ? 652 PRO A CA  1 
ATOM   8117 C C   . PRO B 1 491 ? -51.844  40.260  102.280 1.00 87.34  ? 652 PRO A C   1 
ATOM   8118 O O   . PRO B 1 491 ? -51.799  39.263  101.555 1.00 86.35  ? 652 PRO A O   1 
ATOM   8119 C CB  . PRO B 1 491 ? -52.840  42.389  101.410 1.00 93.02  ? 652 PRO A CB  1 
ATOM   8120 C CG  . PRO B 1 491 ? -52.547  43.191  100.190 1.00 93.94  ? 652 PRO A CG  1 
ATOM   8121 C CD  . PRO B 1 491 ? -51.640  42.323  99.375  1.00 95.42  ? 652 PRO A CD  1 
ATOM   8122 N N   . GLU B 1 492 ? -52.151  40.203  103.572 1.00 83.37  ? 653 GLU A N   1 
ATOM   8123 C CA  . GLU B 1 492 ? -52.450  38.931  104.213 1.00 80.36  ? 653 GLU A CA  1 
ATOM   8124 C C   . GLU B 1 492 ? -53.896  38.506  103.978 1.00 77.94  ? 653 GLU A C   1 
ATOM   8125 O O   . GLU B 1 492 ? -54.806  39.337  103.908 1.00 77.39  ? 653 GLU A O   1 
ATOM   8126 C CB  . GLU B 1 492 ? -52.132  38.968  105.709 1.00 82.17  ? 653 GLU A CB  1 
ATOM   8127 C CG  . GLU B 1 492 ? -51.813  37.596  106.286 1.00 85.28  ? 653 GLU A CG  1 
ATOM   8128 C CD  . GLU B 1 492 ? -51.839  37.555  107.802 1.00 89.06  ? 653 GLU A CD  1 
ATOM   8129 O OE1 . GLU B 1 492 ? -52.367  38.500  108.429 1.00 91.09  ? 653 GLU A OE1 1 
ATOM   8130 O OE2 . GLU B 1 492 ? -51.333  36.563  108.369 1.00 91.13  ? 653 GLU A OE2 1 
ATOM   8131 N N   . TRP B 1 493 ? -54.085  37.198  103.848 1.00 74.48  ? 654 TRP A N   1 
ATOM   8132 C CA  . TRP B 1 493 ? -55.389  36.604  103.623 1.00 71.13  ? 654 TRP A CA  1 
ATOM   8133 C C   . TRP B 1 493 ? -55.735  35.743  104.839 1.00 69.63  ? 654 TRP A C   1 
ATOM   8134 O O   . TRP B 1 493 ? -55.283  34.598  104.943 1.00 70.09  ? 654 TRP A O   1 
ATOM   8135 C CB  . TRP B 1 493 ? -55.350  35.749  102.353 1.00 70.69  ? 654 TRP A CB  1 
ATOM   8136 C CG  . TRP B 1 493 ? -56.687  35.409  101.743 1.00 69.83  ? 654 TRP A CG  1 
ATOM   8137 C CD1 . TRP B 1 493 ? -57.883  35.245  102.391 1.00 70.34  ? 654 TRP A CD1 1 
ATOM   8138 C CD2 . TRP B 1 493 ? -56.946  35.148  100.359 1.00 68.50  ? 654 TRP A CD2 1 
ATOM   8139 N NE1 . TRP B 1 493 ? -58.870  34.921  101.493 1.00 69.24  ? 654 TRP A NE1 1 
ATOM   8140 C CE2 . TRP B 1 493 ? -58.322  34.853  100.239 1.00 68.39  ? 654 TRP A CE2 1 
ATOM   8141 C CE3 . TRP B 1 493 ? -56.150  35.147  99.206  1.00 67.88  ? 654 TRP A CE3 1 
ATOM   8142 C CZ2 . TRP B 1 493 ? -58.918  34.554  99.012  1.00 68.04  ? 654 TRP A CZ2 1 
ATOM   8143 C CZ3 . TRP B 1 493 ? -56.743  34.850  97.986  1.00 67.75  ? 654 TRP A CZ3 1 
ATOM   8144 C CH2 . TRP B 1 493 ? -58.115  34.559  97.900  1.00 68.37  ? 654 TRP A CH2 1 
ATOM   8145 N N   . PRO B 1 494 ? -56.525  36.299  105.776 1.00 67.54  ? 655 PRO A N   1 
ATOM   8146 C CA  . PRO B 1 494 ? -56.948  35.546  106.955 1.00 66.20  ? 655 PRO A CA  1 
ATOM   8147 C C   . PRO B 1 494 ? -57.807  34.340  106.593 1.00 65.33  ? 655 PRO A C   1 
ATOM   8148 O O   . PRO B 1 494 ? -58.535  34.369  105.596 1.00 64.86  ? 655 PRO A O   1 
ATOM   8149 C CB  . PRO B 1 494 ? -57.777  36.564  107.749 1.00 66.50  ? 655 PRO A CB  1 
ATOM   8150 C CG  . PRO B 1 494 ? -58.176  37.600  106.757 1.00 66.33  ? 655 PRO A CG  1 
ATOM   8151 C CD  . PRO B 1 494 ? -57.029  37.684  105.801 1.00 66.97  ? 655 PRO A CD  1 
ATOM   8152 N N   . LYS B 1 495 ? -57.710  33.292  107.404 1.00 65.12  ? 656 LYS A N   1 
ATOM   8153 C CA  . LYS B 1 495 ? -58.504  32.085  107.207 1.00 65.94  ? 656 LYS A CA  1 
ATOM   8154 C C   . LYS B 1 495 ? -59.982  32.347  107.490 1.00 66.69  ? 656 LYS A C   1 
ATOM   8155 O O   . LYS B 1 495 ? -60.331  32.981  108.490 1.00 66.96  ? 656 LYS A O   1 
ATOM   8156 C CB  . LYS B 1 495 ? -57.987  30.947  108.092 1.00 65.98  ? 656 LYS A CB  1 
ATOM   8157 C CG  . LYS B 1 495 ? -56.569  30.503  107.772 1.00 66.55  ? 656 LYS A CG  1 
ATOM   8158 C CD  . LYS B 1 495 ? -56.041  29.525  108.810 1.00 66.21  ? 656 LYS A CD  1 
ATOM   8159 C CE  . LYS B 1 495 ? -54.591  29.166  108.525 1.00 65.69  ? 656 LYS A CE  1 
ATOM   8160 N NZ  . LYS B 1 495 ? -53.966  28.409  109.643 1.00 64.76  ? 656 LYS A NZ  1 
ATOM   8161 N N   . HIS B 1 496 ? -60.839  31.872  106.589 1.00 68.07  ? 657 HIS A N   1 
ATOM   8162 C CA  . HIS B 1 496 ? -62.284  31.932  106.778 1.00 68.97  ? 657 HIS A CA  1 
ATOM   8163 C C   . HIS B 1 496 ? -62.687  30.868  107.798 1.00 69.64  ? 657 HIS A C   1 
ATOM   8164 O O   . HIS B 1 496 ? -62.963  29.718  107.449 1.00 69.12  ? 657 HIS A O   1 
ATOM   8165 C CB  . HIS B 1 496 ? -63.011  31.734  105.444 1.00 68.80  ? 657 HIS A CB  1 
ATOM   8166 C CG  . HIS B 1 496 ? -64.498  31.885  105.531 1.00 69.51  ? 657 HIS A CG  1 
ATOM   8167 N ND1 . HIS B 1 496 ? -65.128  33.110  105.473 1.00 69.74  ? 657 HIS A ND1 1 
ATOM   8168 C CD2 . HIS B 1 496 ? -65.482  30.963  105.659 1.00 69.45  ? 657 HIS A CD2 1 
ATOM   8169 C CE1 . HIS B 1 496 ? -66.434  32.936  105.565 1.00 70.26  ? 657 HIS A CE1 1 
ATOM   8170 N NE2 . HIS B 1 496 ? -66.676  31.643  105.682 1.00 69.72  ? 657 HIS A NE2 1 
ATOM   8171 N N   . THR B 1 497 ? -62.696  31.267  109.066 1.00 70.89  ? 658 THR A N   1 
ATOM   8172 C CA  . THR B 1 497 ? -62.958  30.352  110.172 1.00 71.52  ? 658 THR A CA  1 
ATOM   8173 C C   . THR B 1 497 ? -64.430  30.363  110.582 1.00 72.29  ? 658 THR A C   1 
ATOM   8174 O O   . THR B 1 497 ? -65.106  31.382  110.456 1.00 72.34  ? 658 THR A O   1 
ATOM   8175 C CB  . THR B 1 497 ? -62.050  30.658  111.381 1.00 71.46  ? 658 THR A CB  1 
ATOM   8176 O OG1 . THR B 1 497 ? -62.402  29.803  112.475 1.00 73.48  ? 658 THR A OG1 1 
ATOM   8177 C CG2 . THR B 1 497 ? -62.179  32.117  111.806 1.00 71.25  ? 658 THR A CG2 1 
ATOM   8178 N N   . ALA B 1 498 ? -64.906  29.222  111.077 1.00 74.37  ? 659 ALA A N   1 
ATOM   8179 C CA  . ALA B 1 498 ? -66.319  29.016  111.410 1.00 76.93  ? 659 ALA A CA  1 
ATOM   8180 C C   . ALA B 1 498 ? -66.935  30.147  112.235 1.00 80.52  ? 659 ALA A C   1 
ATOM   8181 O O   . ALA B 1 498 ? -68.027  30.625  111.921 1.00 81.38  ? 659 ALA A O   1 
ATOM   8182 C CB  . ALA B 1 498 ? -66.503  27.684  112.119 1.00 75.82  ? 659 ALA A CB  1 
ATOM   8183 N N   . HIS B 1 499 ? -66.226  30.568  113.280 1.00 84.50  ? 660 HIS A N   1 
ATOM   8184 C CA  . HIS B 1 499 ? -66.707  31.614  114.182 1.00 87.33  ? 660 HIS A CA  1 
ATOM   8185 C C   . HIS B 1 499 ? -66.470  33.031  113.657 1.00 85.35  ? 660 HIS A C   1 
ATOM   8186 O O   . HIS B 1 499 ? -67.265  33.930  113.927 1.00 85.08  ? 660 HIS A O   1 
ATOM   8187 C CB  . HIS B 1 499 ? -66.120  31.445  115.595 1.00 94.86  ? 660 HIS A CB  1 
ATOM   8188 C CG  . HIS B 1 499 ? -64.666  31.068  115.621 1.00 103.26 ? 660 HIS A CG  1 
ATOM   8189 N ND1 . HIS B 1 499 ? -64.233  29.759  115.561 1.00 105.29 ? 660 HIS A ND1 1 
ATOM   8190 C CD2 . HIS B 1 499 ? -63.547  31.827  115.722 1.00 104.70 ? 660 HIS A CD2 1 
ATOM   8191 C CE1 . HIS B 1 499 ? -62.913  29.729  115.614 1.00 104.11 ? 660 HIS A CE1 1 
ATOM   8192 N NE2 . HIS B 1 499 ? -62.472  30.971  115.711 1.00 103.89 ? 660 HIS A NE2 1 
ATOM   8193 N N   . GLY B 1 500 ? -65.390  33.219  112.900 1.00 85.14  ? 661 GLY A N   1 
ATOM   8194 C CA  . GLY B 1 500 ? -64.974  34.550  112.439 1.00 84.21  ? 661 GLY A CA  1 
ATOM   8195 C C   . GLY B 1 500 ? -65.452  34.958  111.057 1.00 82.49  ? 661 GLY A C   1 
ATOM   8196 O O   . GLY B 1 500 ? -65.775  36.125  110.829 1.00 82.17  ? 661 GLY A O   1 
ATOM   8197 N N   . ARG B 1 501 ? -65.473  33.993  110.137 1.00 81.55  ? 662 ARG A N   1 
ATOM   8198 C CA  . ARG B 1 501 ? -65.969  34.172  108.761 1.00 79.80  ? 662 ARG A CA  1 
ATOM   8199 C C   . ARG B 1 501 ? -65.275  35.273  107.956 1.00 78.22  ? 662 ARG A C   1 
ATOM   8200 O O   . ARG B 1 501 ? -65.915  35.979  107.175 1.00 76.47  ? 662 ARG A O   1 
ATOM   8201 C CB  . ARG B 1 501 ? -67.494  34.352  108.737 1.00 80.43  ? 662 ARG A CB  1 
ATOM   8202 C CG  . ARG B 1 501 ? -68.273  33.121  109.169 1.00 83.66  ? 662 ARG A CG  1 
ATOM   8203 C CD  . ARG B 1 501 ? -69.672  33.124  108.576 1.00 86.84  ? 662 ARG A CD  1 
ATOM   8204 N NE  . ARG B 1 501 ? -70.592  32.270  109.325 1.00 89.54  ? 662 ARG A NE  1 
ATOM   8205 C CZ  . ARG B 1 501 ? -71.307  32.668  110.376 1.00 91.15  ? 662 ARG A CZ  1 
ATOM   8206 N NH1 . ARG B 1 501 ? -71.222  33.917  110.822 1.00 90.96  ? 662 ARG A NH1 1 
ATOM   8207 N NH2 . ARG B 1 501 ? -72.113  31.812  110.988 1.00 93.34  ? 662 ARG A NH2 1 
ATOM   8208 N N   . HIS B 1 502 ? -63.963  35.398  108.135 1.00 79.16  ? 663 HIS A N   1 
ATOM   8209 C CA  . HIS B 1 502 ? -63.188  36.467  107.503 1.00 79.86  ? 663 HIS A CA  1 
ATOM   8210 C C   . HIS B 1 502 ? -62.950  36.257  106.007 1.00 77.88  ? 663 HIS A C   1 
ATOM   8211 O O   . HIS B 1 502 ? -62.618  35.151  105.567 1.00 78.83  ? 663 HIS A O   1 
ATOM   8212 C CB  . HIS B 1 502 ? -61.856  36.665  108.232 1.00 82.46  ? 663 HIS A CB  1 
ATOM   8213 C CG  . HIS B 1 502 ? -61.983  37.412  109.522 1.00 84.84  ? 663 HIS A CG  1 
ATOM   8214 N ND1 . HIS B 1 502 ? -61.814  38.777  109.610 1.00 85.35  ? 663 HIS A ND1 1 
ATOM   8215 C CD2 . HIS B 1 502 ? -62.275  36.988  110.773 1.00 86.80  ? 663 HIS A CD2 1 
ATOM   8216 C CE1 . HIS B 1 502 ? -61.990  39.161  110.861 1.00 86.34  ? 663 HIS A CE1 1 
ATOM   8217 N NE2 . HIS B 1 502 ? -62.271  38.095  111.588 1.00 87.88  ? 663 HIS A NE2 1 
ATOM   8218 N N   . TYR B 1 503 ? -63.123  37.332  105.236 1.00 73.78  ? 664 TYR A N   1 
ATOM   8219 C CA  . TYR B 1 503 ? -62.866  37.316  103.794 1.00 70.03  ? 664 TYR A CA  1 
ATOM   8220 C C   . TYR B 1 503 ? -61.949  38.458  103.364 1.00 67.82  ? 664 TYR A C   1 
ATOM   8221 O O   . TYR B 1 503 ? -61.895  39.496  104.021 1.00 67.78  ? 664 TYR A O   1 
ATOM   8222 C CB  . TYR B 1 503 ? -64.179  37.347  102.995 1.00 68.78  ? 664 TYR A CB  1 
ATOM   8223 C CG  . TYR B 1 503 ? -64.866  38.697  102.911 1.00 67.84  ? 664 TYR A CG  1 
ATOM   8224 C CD1 . TYR B 1 503 ? -64.430  39.673  102.009 1.00 67.20  ? 664 TYR A CD1 1 
ATOM   8225 C CD2 . TYR B 1 503 ? -65.968  38.990  103.712 1.00 67.26  ? 664 TYR A CD2 1 
ATOM   8226 C CE1 . TYR B 1 503 ? -65.057  40.905  101.926 1.00 65.91  ? 664 TYR A CE1 1 
ATOM   8227 C CE2 . TYR B 1 503 ? -66.602  40.221  103.632 1.00 66.58  ? 664 TYR A CE2 1 
ATOM   8228 C CZ  . TYR B 1 503 ? -66.143  41.171  102.739 1.00 65.84  ? 664 TYR A CZ  1 
ATOM   8229 O OH  . TYR B 1 503 ? -66.770  42.390  102.655 1.00 65.59  ? 664 TYR A OH  1 
ATOM   8230 N N   . LEU B 1 504 ? -61.244  38.262  102.254 1.00 66.38  ? 665 LEU A N   1 
ATOM   8231 C CA  . LEU B 1 504 ? -60.379  39.296  101.695 1.00 66.59  ? 665 LEU A CA  1 
ATOM   8232 C C   . LEU B 1 504 ? -61.001  39.923  100.451 1.00 68.01  ? 665 LEU A C   1 
ATOM   8233 O O   . LEU B 1 504 ? -61.397  39.217  99.522  1.00 69.42  ? 665 LEU A O   1 
ATOM   8234 C CB  . LEU B 1 504 ? -58.994  38.722  101.367 1.00 65.82  ? 665 LEU A CB  1 
ATOM   8235 C CG  . LEU B 1 504 ? -57.962  39.616  100.665 1.00 65.47  ? 665 LEU A CG  1 
ATOM   8236 C CD1 . LEU B 1 504 ? -57.543  40.797  101.531 1.00 64.55  ? 665 LEU A CD1 1 
ATOM   8237 C CD2 . LEU B 1 504 ? -56.747  38.796  100.256 1.00 65.75  ? 665 LEU A CD2 1 
ATOM   8238 N N   . GLU B 1 505 ? -61.086  41.250  100.441 1.00 68.47  ? 666 GLU A N   1 
ATOM   8239 C CA  . GLU B 1 505 ? -61.559  41.980  99.270  1.00 68.88  ? 666 GLU A CA  1 
ATOM   8240 C C   . GLU B 1 505 ? -60.461  42.044  98.212  1.00 68.87  ? 666 GLU A C   1 
ATOM   8241 O O   . GLU B 1 505 ? -59.338  42.471  98.492  1.00 69.78  ? 666 GLU A O   1 
ATOM   8242 C CB  . GLU B 1 505 ? -62.017  43.393  99.650  1.00 69.61  ? 666 GLU A CB  1 
ATOM   8243 C CG  . GLU B 1 505 ? -62.468  44.235  98.463  1.00 71.82  ? 666 GLU A CG  1 
ATOM   8244 C CD  . GLU B 1 505 ? -62.975  45.613  98.850  1.00 73.99  ? 666 GLU A CD  1 
ATOM   8245 O OE1 . GLU B 1 505 ? -63.156  45.881  100.057 1.00 76.84  ? 666 GLU A OE1 1 
ATOM   8246 O OE2 . GLU B 1 505 ? -63.202  46.433  97.936  1.00 74.71  ? 666 GLU A OE2 1 
ATOM   8247 N N   . LEU B 1 506 ? -60.789  41.609  97.000  1.00 67.49  ? 667 LEU A N   1 
ATOM   8248 C CA  . LEU B 1 506 ? -59.848  41.668  95.891  1.00 66.86  ? 667 LEU A CA  1 
ATOM   8249 C C   . LEU B 1 506 ? -60.206  42.796  94.921  1.00 68.55  ? 667 LEU A C   1 
ATOM   8250 O O   . LEU B 1 506 ? -61.067  42.644  94.051  1.00 68.52  ? 667 LEU A O   1 
ATOM   8251 C CB  . LEU B 1 506 ? -59.750  40.314  95.176  1.00 65.66  ? 667 LEU A CB  1 
ATOM   8252 C CG  . LEU B 1 506 ? -59.142  39.133  95.943  1.00 64.36  ? 667 LEU A CG  1 
ATOM   8253 C CD1 . LEU B 1 506 ? -59.327  37.841  95.162  1.00 63.63  ? 667 LEU A CD1 1 
ATOM   8254 C CD2 . LEU B 1 506 ? -57.670  39.358  96.260  1.00 64.00  ? 667 LEU A CD2 1 
ATOM   8255 N N   . GLY B 1 507 ? -59.544  43.934  95.106  1.00 70.89  ? 668 GLY A N   1 
ATOM   8256 C CA  . GLY B 1 507 ? -59.681  45.095  94.227  1.00 72.65  ? 668 GLY A CA  1 
ATOM   8257 C C   . GLY B 1 507 ? -58.333  45.773  94.076  1.00 73.63  ? 668 GLY A C   1 
ATOM   8258 O O   . GLY B 1 507 ? -57.350  45.338  94.678  1.00 74.45  ? 668 GLY A O   1 
ATOM   8259 N N   . LEU B 1 508 ? -58.283  46.841  93.287  1.00 74.76  ? 669 LEU A N   1 
ATOM   8260 C CA  . LEU B 1 508 ? -57.013  47.491  92.950  1.00 76.40  ? 669 LEU A CA  1 
ATOM   8261 C C   . LEU B 1 508 ? -56.298  48.162  94.128  1.00 78.38  ? 669 LEU A C   1 
ATOM   8262 O O   . LEU B 1 508 ? -55.127  47.879  94.391  1.00 78.85  ? 669 LEU A O   1 
ATOM   8263 C CB  . LEU B 1 508 ? -57.198  48.489  91.801  1.00 75.85  ? 669 LEU A CB  1 
ATOM   8264 C CG  . LEU B 1 508 ? -57.159  47.956  90.367  1.00 75.22  ? 669 LEU A CG  1 
ATOM   8265 C CD1 . LEU B 1 508 ? -57.490  49.077  89.393  1.00 75.63  ? 669 LEU A CD1 1 
ATOM   8266 C CD2 . LEU B 1 508 ? -55.808  47.339  90.033  1.00 74.44  ? 669 LEU A CD2 1 
ATOM   8267 N N   . ASN B 1 509 ? -56.999  49.050  94.826  1.00 79.85  ? 670 ASN A N   1 
ATOM   8268 C CA  . ASN B 1 509 ? -56.390  49.833  95.895  1.00 81.16  ? 670 ASN A CA  1 
ATOM   8269 C C   . ASN B 1 509 ? -56.938  49.435  97.262  1.00 81.31  ? 670 ASN A C   1 
ATOM   8270 O O   . ASN B 1 509 ? -57.452  50.274  98.008  1.00 83.76  ? 670 ASN A O   1 
ATOM   8271 C CB  . ASN B 1 509 ? -56.592  51.333  95.634  1.00 82.91  ? 670 ASN A CB  1 
ATOM   8272 C CG  . ASN B 1 509 ? -55.637  52.205  96.433  1.00 84.28  ? 670 ASN A CG  1 
ATOM   8273 O OD1 . ASN B 1 509 ? -54.483  51.838  96.666  1.00 84.88  ? 670 ASN A OD1 1 
ATOM   8274 N ND2 . ASN B 1 509 ? -56.114  53.376  96.848  1.00 83.92  ? 670 ASN A ND2 1 
ATOM   8275 N N   . THR B 1 510 ? -56.826  48.151  97.588  1.00 79.17  ? 671 THR A N   1 
ATOM   8276 C CA  . THR B 1 510 ? -57.393  47.635  98.833  1.00 78.88  ? 671 THR A CA  1 
ATOM   8277 C C   . THR B 1 510 ? -56.698  46.385  99.366  1.00 77.40  ? 671 THR A C   1 
ATOM   8278 O O   . THR B 1 510 ? -56.164  45.577  98.605  1.00 77.89  ? 671 THR A O   1 
ATOM   8279 C CB  . THR B 1 510 ? -58.919  47.381  98.712  1.00 79.68  ? 671 THR A CB  1 
ATOM   8280 O OG1 . THR B 1 510 ? -59.406  46.769  99.912  1.00 79.91  ? 671 THR A OG1 1 
ATOM   8281 C CG2 . THR B 1 510 ? -59.241  46.479  97.528  1.00 80.33  ? 671 THR A CG2 1 
ATOM   8282 N N   . SER B 1 511 ? -56.707  46.258  100.689 1.00 75.82  ? 672 SER A N   1 
ATOM   8283 C CA  . SER B 1 511 ? -56.299  45.042  101.379 1.00 73.94  ? 672 SER A CA  1 
ATOM   8284 C C   . SER B 1 511 ? -57.356  44.723  102.436 1.00 72.74  ? 672 SER A C   1 
ATOM   8285 O O   . SER B 1 511 ? -57.110  43.952  103.368 1.00 73.70  ? 672 SER A O   1 
ATOM   8286 C CB  . SER B 1 511 ? -54.919  45.219  102.017 1.00 73.52  ? 672 SER A CB  1 
ATOM   8287 O OG  . SER B 1 511 ? -54.941  46.195  103.043 1.00 75.42  ? 672 SER A OG  1 
ATOM   8288 N N   . PHE B 1 512 ? -58.536  45.320  102.261 1.00 70.36  ? 673 PHE A N   1 
ATOM   8289 C CA  . PHE B 1 512 ? -59.639  45.235  103.218 1.00 69.61  ? 673 PHE A CA  1 
ATOM   8290 C C   . PHE B 1 512 ? -60.055  43.806  103.532 1.00 68.85  ? 673 PHE A C   1 
ATOM   8291 O O   . PHE B 1 512 ? -60.163  42.964  102.638 1.00 69.64  ? 673 PHE A O   1 
ATOM   8292 C CB  . PHE B 1 512 ? -60.849  46.032  102.716 1.00 70.04  ? 673 PHE A CB  1 
ATOM   8293 C CG  . PHE B 1 512 ? -62.064  45.922  103.597 1.00 70.75  ? 673 PHE A CG  1 
ATOM   8294 C CD1 . PHE B 1 512 ? -62.167  46.674  104.763 1.00 71.76  ? 673 PHE A CD1 1 
ATOM   8295 C CD2 . PHE B 1 512 ? -63.113  45.074  103.255 1.00 71.37  ? 673 PHE A CD2 1 
ATOM   8296 C CE1 . PHE B 1 512 ? -63.288  46.576  105.575 1.00 72.43  ? 673 PHE A CE1 1 
ATOM   8297 C CE2 . PHE B 1 512 ? -64.236  44.972  104.062 1.00 72.15  ? 673 PHE A CE2 1 
ATOM   8298 C CZ  . PHE B 1 512 ? -64.324  45.724  105.224 1.00 72.19  ? 673 PHE A CZ  1 
ATOM   8299 N N   . VAL B 1 513 ? -60.281  43.553  104.816 1.00 67.55  ? 674 VAL A N   1 
ATOM   8300 C CA  . VAL B 1 513 ? -60.772  42.269  105.289 1.00 66.36  ? 674 VAL A CA  1 
ATOM   8301 C C   . VAL B 1 513 ? -62.131  42.485  105.948 1.00 67.12  ? 674 VAL A C   1 
ATOM   8302 O O   . VAL B 1 513 ? -62.259  43.279  106.881 1.00 68.73  ? 674 VAL A O   1 
ATOM   8303 C CB  . VAL B 1 513 ? -59.779  41.605  106.271 1.00 64.96  ? 674 VAL A CB  1 
ATOM   8304 C CG1 . VAL B 1 513 ? -60.411  40.406  106.958 1.00 64.94  ? 674 VAL A CG1 1 
ATOM   8305 C CG2 . VAL B 1 513 ? -58.507  41.191  105.547 1.00 64.17  ? 674 VAL A CG2 1 
ATOM   8306 N N   . GLY B 1 514 ? -63.144  41.790  105.440 1.00 67.20  ? 675 GLY A N   1 
ATOM   8307 C CA  . GLY B 1 514 ? -64.489  41.875  105.996 1.00 67.47  ? 675 GLY A CA  1 
ATOM   8308 C C   . GLY B 1 514 ? -64.928  40.562  106.611 1.00 67.85  ? 675 GLY A C   1 
ATOM   8309 O O   . GLY B 1 514 ? -64.113  39.663  106.832 1.00 67.05  ? 675 GLY A O   1 
ATOM   8310 N N   . ARG B 1 515 ? -66.225  40.457  106.887 1.00 68.08  ? 676 ARG A N   1 
ATOM   8311 C CA  . ARG B 1 515 ? -66.794  39.241  107.453 1.00 68.66  ? 676 ARG A CA  1 
ATOM   8312 C C   . ARG B 1 515 ? -68.047  38.823  106.690 1.00 67.83  ? 676 ARG A C   1 
ATOM   8313 O O   . ARG B 1 515 ? -69.033  39.559  106.640 1.00 68.41  ? 676 ARG A O   1 
ATOM   8314 C CB  . ARG B 1 515 ? -67.080  39.419  108.948 1.00 71.28  ? 676 ARG A CB  1 
ATOM   8315 C CG  . ARG B 1 515 ? -65.821  39.531  109.799 1.00 74.40  ? 676 ARG A CG  1 
ATOM   8316 C CD  . ARG B 1 515 ? -66.124  39.788  111.265 1.00 76.95  ? 676 ARG A CD  1 
ATOM   8317 N NE  . ARG B 1 515 ? -66.606  38.588  111.947 1.00 79.50  ? 676 ARG A NE  1 
ATOM   8318 C CZ  . ARG B 1 515 ? -66.695  38.454  113.268 1.00 81.67  ? 676 ARG A CZ  1 
ATOM   8319 N NH1 . ARG B 1 515 ? -66.332  39.447  114.072 1.00 83.44  ? 676 ARG A NH1 1 
ATOM   8320 N NH2 . ARG B 1 515 ? -67.150  37.323  113.788 1.00 81.25  ? 676 ARG A NH2 1 
ATOM   8321 N N   . GLY B 1 516 ? -67.987  37.640  106.087 1.00 67.27  ? 677 GLY A N   1 
ATOM   8322 C CA  . GLY B 1 516 ? -69.091  37.111  105.295 1.00 65.74  ? 677 GLY A CA  1 
ATOM   8323 C C   . GLY B 1 516 ? -68.631  36.552  103.961 1.00 64.63  ? 677 GLY A C   1 
ATOM   8324 O O   . GLY B 1 516 ? -68.041  35.471  103.919 1.00 64.28  ? 677 GLY A O   1 
ATOM   8325 N N   . PRO B 1 517 ? -68.899  37.281  102.858 1.00 64.02  ? 678 PRO A N   1 
ATOM   8326 C CA  . PRO B 1 517 ? -69.607  38.565  102.816 1.00 63.59  ? 678 PRO A CA  1 
ATOM   8327 C C   . PRO B 1 517 ? -71.126  38.411  102.882 1.00 63.86  ? 678 PRO A C   1 
ATOM   8328 O O   . PRO B 1 517 ? -71.644  37.304  102.713 1.00 64.69  ? 678 PRO A O   1 
ATOM   8329 C CB  . PRO B 1 517 ? -69.207  39.130  101.454 1.00 62.71  ? 678 PRO A CB  1 
ATOM   8330 C CG  . PRO B 1 517 ? -69.006  37.924  100.605 1.00 62.92  ? 678 PRO A CG  1 
ATOM   8331 C CD  . PRO B 1 517 ? -68.471  36.850  101.513 1.00 63.58  ? 678 PRO A CD  1 
ATOM   8332 N N   . ARG B 1 518 ? -71.817  39.524  103.131 1.00 63.18  ? 679 ARG A N   1 
ATOM   8333 C CA  . ARG B 1 518 ? -73.283  39.588  103.092 1.00 62.85  ? 679 ARG A CA  1 
ATOM   8334 C C   . ARG B 1 518 ? -73.946  38.569  104.018 1.00 63.02  ? 679 ARG A C   1 
ATOM   8335 O O   . ARG B 1 518 ? -74.722  37.719  103.573 1.00 63.16  ? 679 ARG A O   1 
ATOM   8336 C CB  . ARG B 1 518 ? -73.797  39.429  101.654 1.00 61.96  ? 679 ARG A CB  1 
ATOM   8337 C CG  . ARG B 1 518 ? -73.224  40.439  100.673 1.00 61.75  ? 679 ARG A CG  1 
ATOM   8338 C CD  . ARG B 1 518 ? -73.911  40.359  99.321  1.00 61.48  ? 679 ARG A CD  1 
ATOM   8339 N NE  . ARG B 1 518 ? -75.353  40.582  99.415  1.00 61.49  ? 679 ARG A NE  1 
ATOM   8340 C CZ  . ARG B 1 518 ? -75.930  41.776  99.528  1.00 61.95  ? 679 ARG A CZ  1 
ATOM   8341 N NH1 . ARG B 1 518 ? -75.196  42.881  99.569  1.00 62.58  ? 679 ARG A NH1 1 
ATOM   8342 N NH2 . ARG B 1 518 ? -77.249  41.866  99.601  1.00 62.80  ? 679 ARG A NH2 1 
ATOM   8343 N N   . LEU B 1 519 ? -73.640  38.671  105.308 1.00 63.30  ? 680 LEU A N   1 
ATOM   8344 C CA  . LEU B 1 519 ? -74.122  37.707  106.293 1.00 63.06  ? 680 LEU A CA  1 
ATOM   8345 C C   . LEU B 1 519 ? -75.625  37.783  106.564 1.00 63.67  ? 680 LEU A C   1 
ATOM   8346 O O   . LEU B 1 519 ? -76.279  36.746  106.695 1.00 64.20  ? 680 LEU A O   1 
ATOM   8347 C CB  . LEU B 1 519 ? -73.324  37.823  107.594 1.00 63.09  ? 680 LEU A CB  1 
ATOM   8348 C CG  . LEU B 1 519 ? -71.947  37.154  107.584 1.00 63.04  ? 680 LEU A CG  1 
ATOM   8349 C CD1 . LEU B 1 519 ? -71.058  37.692  108.695 1.00 63.39  ? 680 LEU A CD1 1 
ATOM   8350 C CD2 . LEU B 1 519 ? -72.077  35.640  107.681 1.00 62.67  ? 680 LEU A CD2 1 
ATOM   8351 N N   . ARG B 1 520 ? -76.166  38.999  106.635 1.00 64.22  ? 681 ARG A N   1 
ATOM   8352 C CA  . ARG B 1 520 ? -77.586  39.197  106.940 1.00 65.95  ? 681 ARG A CA  1 
ATOM   8353 C C   . ARG B 1 520 ? -78.503  38.620  105.865 1.00 66.41  ? 681 ARG A C   1 
ATOM   8354 O O   . ARG B 1 520 ? -79.553  38.056  106.179 1.00 67.44  ? 681 ARG A O   1 
ATOM   8355 C CB  . ARG B 1 520 ? -77.910  40.679  107.144 1.00 68.12  ? 681 ARG A CB  1 
ATOM   8356 C CG  . ARG B 1 520 ? -79.160  40.924  107.985 1.00 71.42  ? 681 ARG A CG  1 
ATOM   8357 C CD  . ARG B 1 520 ? -80.066  41.986  107.378 1.00 73.35  ? 681 ARG A CD  1 
ATOM   8358 N NE  . ARG B 1 520 ? -79.347  43.219  107.059 1.00 76.49  ? 681 ARG A NE  1 
ATOM   8359 C CZ  . ARG B 1 520 ? -79.796  44.169  106.241 1.00 78.55  ? 681 ARG A CZ  1 
ATOM   8360 N NH1 . ARG B 1 520 ? -80.975  44.046  105.644 1.00 79.79  ? 681 ARG A NH1 1 
ATOM   8361 N NH2 . ARG B 1 520 ? -79.059  45.250  106.016 1.00 78.72  ? 681 ARG A NH2 1 
ATOM   8362 N N   . GLN B 1 521 ? -78.103  38.765  104.604 1.00 66.01  ? 682 GLN A N   1 
ATOM   8363 C CA  . GLN B 1 521 ? -78.908  38.297  103.476 1.00 65.68  ? 682 GLN A CA  1 
ATOM   8364 C C   . GLN B 1 521 ? -78.869  36.782  103.342 1.00 66.96  ? 682 GLN A C   1 
ATOM   8365 O O   . GLN B 1 521 ? -79.857  36.161  102.951 1.00 67.72  ? 682 GLN A O   1 
ATOM   8366 C CB  . GLN B 1 521 ? -78.449  38.947  102.170 1.00 64.34  ? 682 GLN A CB  1 
ATOM   8367 C CG  . GLN B 1 521 ? -78.771  40.429  102.057 1.00 63.19  ? 682 GLN A CG  1 
ATOM   8368 C CD  . GLN B 1 521 ? -77.831  41.309  102.862 1.00 62.91  ? 682 GLN A CD  1 
ATOM   8369 O OE1 . GLN B 1 521 ? -76.743  40.888  103.261 1.00 62.03  ? 682 GLN A OE1 1 
ATOM   8370 N NE2 . GLN B 1 521 ? -78.250  42.544  103.104 1.00 63.52  ? 682 GLN A NE2 1 
ATOM   8371 N N   . CYS B 1 522 ? -77.722  36.193  103.665 1.00 67.70  ? 683 CYS A N   1 
ATOM   8372 C CA  . CYS B 1 522 ? -77.568  34.747  103.607 1.00 69.64  ? 683 CYS A CA  1 
ATOM   8373 C C   . CYS B 1 522 ? -78.391  34.059  104.679 1.00 68.98  ? 683 CYS A C   1 
ATOM   8374 O O   . CYS B 1 522 ? -79.001  33.017  104.428 1.00 69.70  ? 683 CYS A O   1 
ATOM   8375 C CB  . CYS B 1 522 ? -76.096  34.367  103.697 1.00 73.55  ? 683 CYS A CB  1 
ATOM   8376 S SG  . CYS B 1 522 ? -75.220  34.860  102.200 1.00 81.29  ? 683 CYS A SG  1 
ATOM   8377 N N   . ALA B 1 523 ? -78.419  34.664  105.863 1.00 67.02  ? 684 ALA A N   1 
ATOM   8378 C CA  . ALA B 1 523 ? -79.278  34.217  106.949 1.00 64.35  ? 684 ALA A CA  1 
ATOM   8379 C C   . ALA B 1 523 ? -80.753  34.371  106.582 1.00 63.15  ? 684 ALA A C   1 
ATOM   8380 O O   . ALA B 1 523 ? -81.595  33.612  107.060 1.00 63.92  ? 684 ALA A O   1 
ATOM   8381 C CB  . ALA B 1 523 ? -78.963  34.988  108.215 1.00 63.81  ? 684 ALA A CB  1 
ATOM   8382 N N   . PHE B 1 524 ? -81.058  35.352  105.735 1.00 61.20  ? 685 PHE A N   1 
ATOM   8383 C CA  . PHE B 1 524 ? -82.418  35.546  105.241 1.00 60.59  ? 685 PHE A CA  1 
ATOM   8384 C C   . PHE B 1 524 ? -82.860  34.359  104.391 1.00 62.04  ? 685 PHE A C   1 
ATOM   8385 O O   . PHE B 1 524 ? -83.934  33.795  104.617 1.00 62.74  ? 685 PHE A O   1 
ATOM   8386 C CB  . PHE B 1 524 ? -82.538  36.855  104.448 1.00 59.01  ? 685 PHE A CB  1 
ATOM   8387 C CG  . PHE B 1 524 ? -83.850  37.013  103.730 1.00 57.56  ? 685 PHE A CG  1 
ATOM   8388 C CD1 . PHE B 1 524 ? -85.007  37.342  104.427 1.00 56.95  ? 685 PHE A CD1 1 
ATOM   8389 C CD2 . PHE B 1 524 ? -83.929  36.832  102.354 1.00 56.97  ? 685 PHE A CD2 1 
ATOM   8390 C CE1 . PHE B 1 524 ? -86.217  37.484  103.766 1.00 56.75  ? 685 PHE A CE1 1 
ATOM   8391 C CE2 . PHE B 1 524 ? -85.137  36.971  101.688 1.00 56.75  ? 685 PHE A CE2 1 
ATOM   8392 C CZ  . PHE B 1 524 ? -86.281  37.299  102.395 1.00 56.58  ? 685 PHE A CZ  1 
ATOM   8393 N N   . TRP B 1 525 ? -82.022  33.985  103.425 1.00 62.67  ? 686 TRP A N   1 
ATOM   8394 C CA  . TRP B 1 525 ? -82.341  32.908  102.488 1.00 62.98  ? 686 TRP A CA  1 
ATOM   8395 C C   . TRP B 1 525 ? -82.215  31.512  103.102 1.00 65.10  ? 686 TRP A C   1 
ATOM   8396 O O   . TRP B 1 525 ? -83.006  30.623  102.784 1.00 65.15  ? 686 TRP A O   1 
ATOM   8397 C CB  . TRP B 1 525 ? -81.474  33.005  101.228 1.00 59.63  ? 686 TRP A CB  1 
ATOM   8398 C CG  . TRP B 1 525 ? -81.755  34.206  100.366 1.00 57.10  ? 686 TRP A CG  1 
ATOM   8399 C CD1 . TRP B 1 525 ? -80.953  35.299  100.201 1.00 56.54  ? 686 TRP A CD1 1 
ATOM   8400 C CD2 . TRP B 1 525 ? -82.907  34.427  99.542  1.00 55.48  ? 686 TRP A CD2 1 
ATOM   8401 N NE1 . TRP B 1 525 ? -81.533  36.188  99.330  1.00 55.06  ? 686 TRP A NE1 1 
ATOM   8402 C CE2 . TRP B 1 525 ? -82.734  35.680  98.911  1.00 54.93  ? 686 TRP A CE2 1 
ATOM   8403 C CE3 . TRP B 1 525 ? -84.068  33.692  99.277  1.00 54.41  ? 686 TRP A CE3 1 
ATOM   8404 C CZ2 . TRP B 1 525 ? -83.679  36.213  98.030  1.00 54.21  ? 686 TRP A CZ2 1 
ATOM   8405 C CZ3 . TRP B 1 525 ? -85.008  34.224  98.400  1.00 53.94  ? 686 TRP A CZ3 1 
ATOM   8406 C CH2 . TRP B 1 525 ? -84.807  35.473  97.790  1.00 53.72  ? 686 TRP A CH2 1 
ATOM   8407 N N   . LYS B 1 526 ? -81.225  31.323  103.973 1.00 67.45  ? 687 LYS A N   1 
ATOM   8408 C CA  . LYS B 1 526 ? -80.977  30.012  104.572 1.00 71.73  ? 687 LYS A CA  1 
ATOM   8409 C C   . LYS B 1 526 ? -81.821  29.754  105.822 1.00 72.74  ? 687 LYS A C   1 
ATOM   8410 O O   . LYS B 1 526 ? -82.342  28.651  106.000 1.00 73.87  ? 687 LYS A O   1 
ATOM   8411 C CB  . LYS B 1 526 ? -79.477  29.810  104.863 1.00 74.65  ? 687 LYS A CB  1 
ATOM   8412 C CG  . LYS B 1 526 ? -79.113  28.511  105.585 1.00 78.33  ? 687 LYS A CG  1 
ATOM   8413 C CD  . LYS B 1 526 ? -79.420  27.269  104.751 1.00 80.14  ? 687 LYS A CD  1 
ATOM   8414 C CE  . LYS B 1 526 ? -79.414  25.997  105.591 1.00 79.67  ? 687 LYS A CE  1 
ATOM   8415 N NZ  . LYS B 1 526 ? -78.047  25.603  106.033 1.00 78.69  ? 687 LYS A NZ  1 
ATOM   8416 N N   . LYS B 1 527 ? -81.957  30.765  106.678 1.00 73.60  ? 688 LYS A N   1 
ATOM   8417 C CA  . LYS B 1 527 ? -82.633  30.586  107.964 1.00 74.06  ? 688 LYS A CA  1 
ATOM   8418 C C   . LYS B 1 527 ? -84.071  31.106  107.978 1.00 72.55  ? 688 LYS A C   1 
ATOM   8419 O O   . LYS B 1 527 ? -85.008  30.332  108.193 1.00 71.75  ? 688 LYS A O   1 
ATOM   8420 C CB  . LYS B 1 527 ? -81.817  31.210  109.108 1.00 76.14  ? 688 LYS A CB  1 
ATOM   8421 C CG  . LYS B 1 527 ? -80.463  30.555  109.355 1.00 79.91  ? 688 LYS A CG  1 
ATOM   8422 C CD  . LYS B 1 527 ? -80.585  29.302  110.215 1.00 83.57  ? 688 LYS A CD  1 
ATOM   8423 C CE  . LYS B 1 527 ? -79.379  28.385  110.056 1.00 86.23  ? 688 LYS A CE  1 
ATOM   8424 N NZ  . LYS B 1 527 ? -78.106  29.003  110.524 1.00 87.06  ? 688 LYS A NZ  1 
ATOM   8425 N N   . TYR B 1 528 ? -84.245  32.405  107.737 1.00 71.51  ? 689 TYR A N   1 
ATOM   8426 C CA  . TYR B 1 528 ? -85.549  33.045  107.917 1.00 71.28  ? 689 TYR A CA  1 
ATOM   8427 C C   . TYR B 1 528 ? -86.615  32.651  106.889 1.00 71.44  ? 689 TYR A C   1 
ATOM   8428 O O   . TYR B 1 528 ? -87.696  32.194  107.269 1.00 72.01  ? 689 TYR A O   1 
ATOM   8429 C CB  . TYR B 1 528 ? -85.427  34.576  108.013 1.00 70.99  ? 689 TYR A CB  1 
ATOM   8430 C CG  . TYR B 1 528 ? -86.772  35.263  108.140 1.00 70.92  ? 689 TYR A CG  1 
ATOM   8431 C CD1 . TYR B 1 528 ? -87.571  35.069  109.267 1.00 71.14  ? 689 TYR A CD1 1 
ATOM   8432 C CD2 . TYR B 1 528 ? -87.257  36.088  107.124 1.00 70.78  ? 689 TYR A CD2 1 
ATOM   8433 C CE1 . TYR B 1 528 ? -88.809  35.679  109.382 1.00 71.81  ? 689 TYR A CE1 1 
ATOM   8434 C CE2 . TYR B 1 528 ? -88.493  36.708  107.233 1.00 70.71  ? 689 TYR A CE2 1 
ATOM   8435 C CZ  . TYR B 1 528 ? -89.265  36.499  108.364 1.00 71.43  ? 689 TYR A CZ  1 
ATOM   8436 O OH  . TYR B 1 528 ? -90.493  37.107  108.483 1.00 71.34  ? 689 TYR A OH  1 
ATOM   8437 N N   . LEU B 1 529 ? -86.318  32.831  105.602 1.00 70.69  ? 690 LEU A N   1 
ATOM   8438 C CA  . LEU B 1 529 ? -87.317  32.601  104.551 1.00 71.12  ? 690 LEU A CA  1 
ATOM   8439 C C   . LEU B 1 529 ? -87.857  31.159  104.461 1.00 73.94  ? 690 LEU A C   1 
ATOM   8440 O O   . LEU B 1 529 ? -89.047  30.979  104.190 1.00 72.99  ? 690 LEU A O   1 
ATOM   8441 C CB  . LEU B 1 529 ? -86.830  33.094  103.180 1.00 68.82  ? 690 LEU A CB  1 
ATOM   8442 C CG  . LEU B 1 529 ? -87.928  33.298  102.127 1.00 67.41  ? 690 LEU A CG  1 
ATOM   8443 C CD1 . LEU B 1 529 ? -88.752  34.541  102.421 1.00 67.53  ? 690 LEU A CD1 1 
ATOM   8444 C CD2 . LEU B 1 529 ? -87.358  33.362  100.722 1.00 66.03  ? 690 LEU A CD2 1 
ATOM   8445 N N   . PRO B 1 530 ? -86.997  30.134  104.681 1.00 76.72  ? 691 PRO A N   1 
ATOM   8446 C CA  . PRO B 1 530 ? -87.536  28.769  104.672 1.00 77.92  ? 691 PRO A CA  1 
ATOM   8447 C C   . PRO B 1 530 ? -88.587  28.525  105.754 1.00 81.09  ? 691 PRO A C   1 
ATOM   8448 O O   . PRO B 1 530 ? -89.619  27.910  105.470 1.00 82.91  ? 691 PRO A O   1 
ATOM   8449 C CB  . PRO B 1 530 ? -86.300  27.901  104.922 1.00 76.15  ? 691 PRO A CB  1 
ATOM   8450 C CG  . PRO B 1 530 ? -85.173  28.713  104.398 1.00 75.67  ? 691 PRO A CG  1 
ATOM   8451 C CD  . PRO B 1 530 ? -85.524  30.123  104.771 1.00 76.39  ? 691 PRO A CD  1 
ATOM   8452 N N   . GLN B 1 531 ? -88.338  29.013  106.970 1.00 83.44  ? 692 GLN A N   1 
ATOM   8453 C CA  . GLN B 1 531 ? -89.271  28.810  108.082 1.00 85.93  ? 692 GLN A CA  1 
ATOM   8454 C C   . GLN B 1 531 ? -90.530  29.679  107.984 1.00 85.55  ? 692 GLN A C   1 
ATOM   8455 O O   . GLN B 1 531 ? -91.521  29.417  108.667 1.00 86.66  ? 692 GLN A O   1 
ATOM   8456 C CB  . GLN B 1 531 ? -88.576  28.973  109.443 1.00 88.05  ? 692 GLN A CB  1 
ATOM   8457 C CG  . GLN B 1 531 ? -88.351  30.406  109.903 1.00 91.42  ? 692 GLN A CG  1 
ATOM   8458 C CD  . GLN B 1 531 ? -87.544  30.494  111.189 1.00 94.23  ? 692 GLN A CD  1 
ATOM   8459 O OE1 . GLN B 1 531 ? -86.710  29.633  111.480 1.00 95.03  ? 692 GLN A OE1 1 
ATOM   8460 N NE2 . GLN B 1 531 ? -87.782  31.546  111.962 1.00 94.25  ? 692 GLN A NE2 1 
ATOM   8461 N N   . LEU B 1 532 ? -90.485  30.704  107.134 1.00 84.76  ? 693 LEU A N   1 
ATOM   8462 C CA  . LEU B 1 532 ? -91.664  31.517  106.852 1.00 85.79  ? 693 LEU A CA  1 
ATOM   8463 C C   . LEU B 1 532 ? -92.616  30.765  105.921 1.00 86.48  ? 693 LEU A C   1 
ATOM   8464 O O   . LEU B 1 532 ? -93.817  30.694  106.189 1.00 88.23  ? 693 LEU A O   1 
ATOM   8465 C CB  . LEU B 1 532 ? -91.271  32.869  106.243 1.00 86.63  ? 693 LEU A CB  1 
ATOM   8466 C CG  . LEU B 1 532 ? -92.258  34.047  106.325 1.00 87.16  ? 693 LEU A CG  1 
ATOM   8467 C CD1 . LEU B 1 532 ? -91.554  35.340  105.958 1.00 88.06  ? 693 LEU A CD1 1 
ATOM   8468 C CD2 . LEU B 1 532 ? -93.487  33.874  105.444 1.00 86.97  ? 693 LEU A CD2 1 
ATOM   8469 N N   . VAL B 1 533 ? -92.074  30.206  104.837 1.00 87.11  ? 694 VAL A N   1 
ATOM   8470 C CA  . VAL B 1 533 ? -92.874  29.463  103.853 1.00 88.83  ? 694 VAL A CA  1 
ATOM   8471 C C   . VAL B 1 533 ? -93.502  28.217  104.486 1.00 90.81  ? 694 VAL A C   1 
ATOM   8472 O O   . VAL B 1 533 ? -94.601  27.806  104.106 1.00 90.77  ? 694 VAL A O   1 
ATOM   8473 C CB  . VAL B 1 533 ? -92.055  29.089  102.592 1.00 88.33  ? 694 VAL A CB  1 
ATOM   8474 C CG1 . VAL B 1 533 ? -92.942  28.439  101.536 1.00 87.98  ? 694 VAL A CG1 1 
ATOM   8475 C CG2 . VAL B 1 533 ? -91.382  30.320  102.002 1.00 88.24  ? 694 VAL A CG2 1 
ATOM   8476 N N   . ALA B 1 534 ? -92.803  27.632  105.458 1.00 91.83  ? 695 ALA A N   1 
ATOM   8477 C CA  . ALA B 1 534 ? -93.344  26.530  106.251 1.00 92.37  ? 695 ALA A CA  1 
ATOM   8478 C C   . ALA B 1 534 ? -94.522  27.000  107.107 1.00 93.18  ? 695 ALA A C   1 
ATOM   8479 O O   . ALA B 1 534 ? -95.554  26.329  107.173 1.00 94.92  ? 695 ALA A O   1 
ATOM   8480 C CB  . ALA B 1 534 ? -92.259  25.913  107.122 1.00 90.75  ? 695 ALA A CB  1 
ATOM   8481 N N   . ALA B 1 535 ? -94.361  28.163  107.741 1.00 92.75  ? 696 ALA A N   1 
ATOM   8482 C CA  . ALA B 1 535 ? -95.384  28.734  108.622 1.00 92.11  ? 696 ALA A CA  1 
ATOM   8483 C C   . ALA B 1 535 ? -96.615  29.250  107.871 1.00 92.73  ? 696 ALA A C   1 
ATOM   8484 O O   . ALA B 1 535 ? -97.701  29.342  108.446 1.00 93.75  ? 696 ALA A O   1 
ATOM   8485 C CB  . ALA B 1 535 ? -94.785  29.835  109.486 1.00 89.68  ? 696 ALA A CB  1 
ATOM   8486 N N   . THR B 1 536 ? -96.444  29.579  106.593 1.00 93.17  ? 697 THR A N   1 
ATOM   8487 C CA  . THR B 1 536 ? -97.539  30.116  105.781 1.00 94.19  ? 697 THR A CA  1 
ATOM   8488 C C   . THR B 1 536 ? -98.082  29.110  104.757 1.00 98.21  ? 697 THR A C   1 
ATOM   8489 O O   . THR B 1 536 ? -98.760  29.493  103.799 1.00 99.73  ? 697 THR A O   1 
ATOM   8490 C CB  . THR B 1 536 ? -97.136  31.430  105.076 1.00 91.93  ? 697 THR A CB  1 
ATOM   8491 O OG1 . THR B 1 536 ? -95.961  31.214  104.286 1.00 90.98  ? 697 THR A OG1 1 
ATOM   8492 C CG2 . THR B 1 536 ? -96.868  32.527  106.100 1.00 90.79  ? 697 THR A CG2 1 
ATOM   8493 N N   . SER B 1 537 ? -97.789  27.828  104.967 1.00 102.33 ? 698 SER A N   1 
ATOM   8494 C CA  . SER B 1 537 ? -98.312  26.761  104.113 1.00 105.84 ? 698 SER A CA  1 
ATOM   8495 C C   . SER B 1 537 ? -98.726  25.546  104.935 1.00 107.34 ? 698 SER A C   1 
ATOM   8496 O O   . SER B 1 537 ? -99.749  24.920  104.658 1.00 109.83 ? 698 SER A O   1 
ATOM   8497 C CB  . SER B 1 537 ? -97.287  26.354  103.050 1.00 105.93 ? 698 SER A CB  1 
ATOM   8498 O OG  . SER B 1 537 ? -97.009  27.430  102.170 1.00 105.54 ? 698 SER A OG  1 
HETATM 8499 C C1  . NAG C 2 .   ? -46.565  -4.111  115.283 1.00 113.26 ? 1   NAG C C1  1 
HETATM 8500 C C2  . NAG C 2 .   ? -45.153  -3.792  115.757 1.00 115.11 ? 1   NAG C C2  1 
HETATM 8501 C C3  . NAG C 2 .   ? -45.119  -3.572  117.265 1.00 115.26 ? 1   NAG C C3  1 
HETATM 8502 C C4  . NAG C 2 .   ? -46.208  -2.599  117.700 1.00 113.34 ? 1   NAG C C4  1 
HETATM 8503 C C5  . NAG C 2 .   ? -47.557  -2.989  117.109 1.00 111.72 ? 1   NAG C C5  1 
HETATM 8504 C C6  . NAG C 2 .   ? -48.631  -1.972  117.480 1.00 107.98 ? 1   NAG C C6  1 
HETATM 8505 C C7  . NAG C 2 .   ? -43.006  -4.919  115.855 1.00 118.81 ? 1   NAG C C7  1 
HETATM 8506 C C8  . NAG C 2 .   ? -42.277  -6.208  115.617 1.00 116.89 ? 1   NAG C C8  1 
HETATM 8507 N N2  . NAG C 2 .   ? -44.252  -4.868  115.393 1.00 117.53 ? 1   NAG C N2  1 
HETATM 8508 O O3  . NAG C 2 .   ? -43.838  -3.056  117.643 1.00 120.27 ? 1   NAG C O3  1 
HETATM 8509 O O4  . NAG C 2 .   ? -46.297  -2.590  119.129 1.00 112.35 ? 1   NAG C O4  1 
HETATM 8510 O O5  . NAG C 2 .   ? -47.450  -3.068  115.689 1.00 114.61 ? 1   NAG C O5  1 
HETATM 8511 O O6  . NAG C 2 .   ? -48.683  -1.833  118.904 1.00 104.54 ? 1   NAG C O6  1 
HETATM 8512 O O7  . NAG C 2 .   ? -42.490  -3.979  116.436 1.00 118.73 ? 1   NAG C O7  1 
HETATM 8513 C C1  . NAG C 2 .   ? -43.728  -3.535  118.714 1.00 124.69 ? 2   NAG C C1  1 
HETATM 8514 C C2  . NAG C 2 .   ? -42.234  -3.436  119.052 1.00 125.29 ? 2   NAG C C2  1 
HETATM 8515 C C3  . NAG C 2 .   ? -41.976  -3.785  120.523 1.00 126.24 ? 2   NAG C C3  1 
HETATM 8516 C C4  . NAG C 2 .   ? -42.950  -3.116  121.491 1.00 128.01 ? 2   NAG C C4  1 
HETATM 8517 C C5  . NAG C 2 .   ? -44.390  -3.182  120.976 1.00 127.02 ? 2   NAG C C5  1 
HETATM 8518 C C6  . NAG C 2 .   ? -45.325  -2.321  121.819 1.00 125.09 ? 2   NAG C C6  1 
HETATM 8519 C C7  . NAG C 2 .   ? -40.266  -4.005  117.642 1.00 123.59 ? 2   NAG C C7  1 
HETATM 8520 C C8  . NAG C 2 .   ? -39.715  -2.614  117.794 1.00 121.67 ? 2   NAG C C8  1 
HETATM 8521 N N2  . NAG C 2 .   ? -41.427  -4.325  118.232 1.00 124.96 ? 2   NAG C N2  1 
HETATM 8522 O O3  . NAG C 2 .   ? -40.660  -3.420  120.875 1.00 125.61 ? 2   NAG C O3  1 
HETATM 8523 O O4  . NAG C 2 .   ? -42.854  -3.757  122.745 1.00 130.47 ? 2   NAG C O4  1 
HETATM 8524 O O5  . NAG C 2 .   ? -44.441  -2.728  119.637 1.00 126.41 ? 2   NAG C O5  1 
HETATM 8525 O O6  . NAG C 2 .   ? -46.063  -3.144  122.692 1.00 124.00 ? 2   NAG C O6  1 
HETATM 8526 O O7  . NAG C 2 .   ? -39.643  -4.826  116.970 1.00 123.24 ? 2   NAG C O7  1 
HETATM 8527 C C1  . NAG D 2 .   ? -46.953  15.290  62.772  1.00 84.26  ? 1   NAG D C1  1 
HETATM 8528 C C2  . NAG D 2 .   ? -45.454  15.156  62.536  1.00 86.64  ? 1   NAG D C2  1 
HETATM 8529 C C3  . NAG D 2 .   ? -45.166  14.648  61.128  1.00 88.98  ? 1   NAG D C3  1 
HETATM 8530 C C4  . NAG D 2 .   ? -46.007  13.418  60.809  1.00 89.38  ? 1   NAG D C4  1 
HETATM 8531 C C5  . NAG D 2 .   ? -47.474  13.656  61.149  1.00 86.93  ? 1   NAG D C5  1 
HETATM 8532 C C6  . NAG D 2 .   ? -48.302  12.401  60.901  1.00 84.37  ? 1   NAG D C6  1 
HETATM 8533 C C7  . NAG D 2 .   ? -43.559  16.513  63.211  1.00 88.37  ? 1   NAG D C7  1 
HETATM 8534 C C8  . NAG D 2 .   ? -43.093  17.888  63.588  1.00 88.11  ? 1   NAG D C8  1 
HETATM 8535 N N2  . NAG D 2 .   ? -44.802  16.435  62.745  1.00 87.47  ? 1   NAG D N2  1 
HETATM 8536 O O3  . NAG D 2 .   ? -43.777  14.319  61.014  1.00 93.99  ? 1   NAG D O3  1 
HETATM 8537 O O4  . NAG D 2 .   ? -45.885  13.105  59.417  1.00 92.94  ? 1   NAG D O4  1 
HETATM 8538 O O5  . NAG D 2 .   ? -47.588  14.039  62.518  1.00 86.46  ? 1   NAG D O5  1 
HETATM 8539 O O6  . NAG D 2 .   ? -49.652  12.630  61.321  1.00 83.46  ? 1   NAG D O6  1 
HETATM 8540 O O7  . NAG D 2 .   ? -42.844  15.531  63.324  1.00 90.04  ? 1   NAG D O7  1 
HETATM 8541 C C1  . NAG D 2 .   ? -43.323  14.654  59.743  1.00 98.44  ? 2   NAG D C1  1 
HETATM 8542 C C2  . NAG D 2 .   ? -41.797  14.687  59.647  1.00 99.67  ? 2   NAG D C2  1 
HETATM 8543 C C3  . NAG D 2 .   ? -41.396  15.253  58.284  1.00 101.96 ? 2   NAG D C3  1 
HETATM 8544 C C4  . NAG D 2 .   ? -42.046  14.472  57.142  1.00 104.01 ? 2   NAG D C4  1 
HETATM 8545 C C5  . NAG D 2 .   ? -43.544  14.256  57.382  1.00 102.97 ? 2   NAG D C5  1 
HETATM 8546 C C6  . NAG D 2 .   ? -44.108  13.220  56.415  1.00 102.24 ? 2   NAG D C6  1 
HETATM 8547 C C7  . NAG D 2 .   ? -40.209  14.915  61.483  1.00 99.50  ? 2   NAG D C7  1 
HETATM 8548 C C8  . NAG D 2 .   ? -39.615  15.809  62.533  1.00 98.12  ? 2   NAG D C8  1 
HETATM 8549 N N2  . NAG D 2 .   ? -41.157  15.448  60.706  1.00 99.57  ? 2   NAG D N2  1 
HETATM 8550 O O3  . NAG D 2 .   ? -39.995  15.217  58.135  1.00 101.87 ? 2   NAG D O3  1 
HETATM 8551 O O4  . NAG D 2 .   ? -41.843  15.172  55.934  1.00 106.46 ? 2   NAG D O4  1 
HETATM 8552 O O5  . NAG D 2 .   ? -43.779  13.803  58.704  1.00 101.12 ? 2   NAG D O5  1 
HETATM 8553 O O6  . NAG D 2 .   ? -45.159  13.792  55.668  1.00 103.11 ? 2   NAG D O6  1 
HETATM 8554 O O7  . NAG D 2 .   ? -39.817  13.752  61.380  1.00 99.94  ? 2   NAG D O7  1 
HETATM 8555 S S   . SO4 E 3 .   ? -60.335  -1.392  74.294  1.00 79.39  ? 801 SO4 B S   1 
HETATM 8556 O O1  . SO4 E 3 .   ? -59.052  -0.807  73.845  1.00 79.84  ? 801 SO4 B O1  1 
HETATM 8557 O O2  . SO4 E 3 .   ? -61.195  -1.671  73.117  1.00 80.25  ? 801 SO4 B O2  1 
HETATM 8558 O O3  . SO4 E 3 .   ? -60.066  -2.647  75.030  1.00 78.94  ? 801 SO4 B O3  1 
HETATM 8559 O O4  . SO4 E 3 .   ? -61.013  -0.434  75.193  1.00 79.30  ? 801 SO4 B O4  1 
HETATM 8560 S S   . SO4 F 3 .   ? -41.127  -11.611 84.154  1.00 102.67 ? 802 SO4 B S   1 
HETATM 8561 O O1  . SO4 F 3 .   ? -41.359  -10.513 83.188  1.00 101.81 ? 802 SO4 B O1  1 
HETATM 8562 O O2  . SO4 F 3 .   ? -40.937  -12.883 83.421  1.00 102.58 ? 802 SO4 B O2  1 
HETATM 8563 O O3  . SO4 F 3 .   ? -39.924  -11.314 84.963  1.00 103.19 ? 802 SO4 B O3  1 
HETATM 8564 O O4  . SO4 F 3 .   ? -42.299  -11.734 85.051  1.00 105.22 ? 802 SO4 B O4  1 
HETATM 8565 S S   . SO4 G 3 .   ? -75.225  -1.645  69.119  1.00 113.72 ? 803 SO4 B S   1 
HETATM 8566 O O1  . SO4 G 3 .   ? -73.970  -1.032  68.627  1.00 113.97 ? 803 SO4 B O1  1 
HETATM 8567 O O2  . SO4 G 3 .   ? -75.709  -2.636  68.132  1.00 115.55 ? 803 SO4 B O2  1 
HETATM 8568 O O3  . SO4 G 3 .   ? -74.973  -2.321  70.410  1.00 112.53 ? 803 SO4 B O3  1 
HETATM 8569 O O4  . SO4 G 3 .   ? -76.252  -0.597  69.308  1.00 113.78 ? 803 SO4 B O4  1 
HETATM 8570 S S   . SO4 H 3 .   ? -84.632  -5.205  83.526  1.00 123.99 ? 804 SO4 B S   1 
HETATM 8571 O O1  . SO4 H 3 .   ? -84.453  -3.867  82.920  1.00 123.78 ? 804 SO4 B O1  1 
HETATM 8572 O O2  . SO4 H 3 .   ? -85.221  -6.132  82.532  1.00 125.58 ? 804 SO4 B O2  1 
HETATM 8573 O O3  . SO4 H 3 .   ? -83.315  -5.716  83.965  1.00 123.08 ? 804 SO4 B O3  1 
HETATM 8574 O O4  . SO4 H 3 .   ? -85.538  -5.105  84.692  1.00 121.70 ? 804 SO4 B O4  1 
HETATM 8575 S S   . SO4 I 3 .   ? -34.724  -15.681 101.736 1.00 156.39 ? 805 SO4 B S   1 
HETATM 8576 O O1  . SO4 I 3 .   ? -34.213  -14.638 100.819 1.00 158.62 ? 805 SO4 B O1  1 
HETATM 8577 O O2  . SO4 I 3 .   ? -35.991  -16.226 101.199 1.00 157.42 ? 805 SO4 B O2  1 
HETATM 8578 O O3  . SO4 I 3 .   ? -33.727  -16.768 101.855 1.00 156.01 ? 805 SO4 B O3  1 
HETATM 8579 O O4  . SO4 I 3 .   ? -34.971  -15.087 103.070 1.00 155.23 ? 805 SO4 B O4  1 
HETATM 8580 S S   . SO4 J 3 .   ? -66.515  -33.736 77.530  1.00 120.84 ? 806 SO4 B S   1 
HETATM 8581 O O1  . SO4 J 3 .   ? -66.573  -33.167 76.162  1.00 120.71 ? 806 SO4 B O1  1 
HETATM 8582 O O2  . SO4 J 3 .   ? -65.331  -34.614 77.661  1.00 120.45 ? 806 SO4 B O2  1 
HETATM 8583 O O3  . SO4 J 3 .   ? -67.744  -34.523 77.781  1.00 120.47 ? 806 SO4 B O3  1 
HETATM 8584 O O4  . SO4 J 3 .   ? -66.414  -32.639 78.519  1.00 120.51 ? 806 SO4 B O4  1 
HETATM 8585 S S   . SO4 K 3 .   ? -46.561  10.015  110.771 1.00 148.23 ? 807 SO4 B S   1 
HETATM 8586 O O1  . SO4 K 3 .   ? -45.497  10.655  109.965 1.00 147.24 ? 807 SO4 B O1  1 
HETATM 8587 O O2  . SO4 K 3 .   ? -46.742  8.616   110.324 1.00 149.43 ? 807 SO4 B O2  1 
HETATM 8588 O O3  . SO4 K 3 .   ? -46.181  10.029  112.202 1.00 147.68 ? 807 SO4 B O3  1 
HETATM 8589 O O4  . SO4 K 3 .   ? -47.829  10.758  110.589 1.00 147.21 ? 807 SO4 B O4  1 
HETATM 8590 S S   . SO4 L 3 .   ? -83.630  -22.255 98.713  1.00 127.24 ? 808 SO4 B S   1 
HETATM 8591 O O1  . SO4 L 3 .   ? -84.005  -21.445 97.533  1.00 126.96 ? 808 SO4 B O1  1 
HETATM 8592 O O2  . SO4 L 3 .   ? -82.299  -22.872 98.501  1.00 127.52 ? 808 SO4 B O2  1 
HETATM 8593 O O3  . SO4 L 3 .   ? -84.636  -23.320 98.913  1.00 128.43 ? 808 SO4 B O3  1 
HETATM 8594 O O4  . SO4 L 3 .   ? -83.583  -21.381 99.908  1.00 127.32 ? 808 SO4 B O4  1 
HETATM 8595 N N   . NH4 M 4 .   ? -66.293  -22.764 95.476  1.00 8.61   ? 809 NH4 B N   1 
HETATM 8596 N N1  . EPE N 5 .   ? -78.726  -23.023 101.093 1.00 130.92 ? 810 EPE B N1  1 
HETATM 8597 C C2  . EPE N 5 .   ? -80.055  -22.401 101.136 1.00 128.84 ? 810 EPE B C2  1 
HETATM 8598 C C3  . EPE N 5 .   ? -80.600  -22.474 102.555 1.00 127.81 ? 810 EPE B C3  1 
HETATM 8599 N N4  . EPE N 5 .   ? -79.667  -21.772 103.438 1.00 126.91 ? 810 EPE B N4  1 
HETATM 8600 C C5  . EPE N 5 .   ? -78.369  -22.445 103.434 1.00 128.58 ? 810 EPE B C5  1 
HETATM 8601 C C6  . EPE N 5 .   ? -77.801  -22.374 102.023 1.00 130.15 ? 810 EPE B C6  1 
HETATM 8602 C C7  . EPE N 5 .   ? -80.185  -21.799 104.800 1.00 122.70 ? 810 EPE B C7  1 
HETATM 8603 C C8  . EPE N 5 .   ? -80.585  -20.399 105.219 1.00 120.67 ? 810 EPE B C8  1 
HETATM 8604 O O8  . EPE N 5 .   ? -80.636  -20.355 106.646 1.00 118.62 ? 810 EPE B O8  1 
HETATM 8605 C C9  . EPE N 5 .   ? -78.165  -22.913 99.744  1.00 133.01 ? 810 EPE B C9  1 
HETATM 8606 C C10 . EPE N 5 .   ? -76.900  -23.745 99.687  1.00 138.16 ? 810 EPE B C10 1 
HETATM 8607 S S   . EPE N 5 .   ? -75.968  -23.313 98.394  1.00 140.09 ? 810 EPE B S   1 
HETATM 8608 O O1S . EPE N 5 .   ? -76.294  -24.065 97.228  1.00 141.01 ? 810 EPE B O1S 1 
HETATM 8609 O O2S . EPE N 5 .   ? -76.221  -21.951 98.132  1.00 139.75 ? 810 EPE B O2S 1 
HETATM 8610 O O3S . EPE N 5 .   ? -74.385  -23.481 98.744  1.00 138.42 ? 810 EPE B O3S 1 
HETATM 8611 S S   . SO4 O 3 .   ? -76.267  10.349  108.214 1.00 117.72 ? 801 SO4 A S   1 
HETATM 8612 O O1  . SO4 O 3 .   ? -76.413  11.440  107.225 1.00 118.90 ? 801 SO4 A O1  1 
HETATM 8613 O O2  . SO4 O 3 .   ? -77.110  9.202   107.805 1.00 116.05 ? 801 SO4 A O2  1 
HETATM 8614 O O3  . SO4 O 3 .   ? -76.688  10.836  109.547 1.00 116.59 ? 801 SO4 A O3  1 
HETATM 8615 O O4  . SO4 O 3 .   ? -74.851  9.923   108.280 1.00 118.05 ? 801 SO4 A O4  1 
HETATM 8616 S S   . SO4 P 3 .   ? -42.988  24.039  94.663  1.00 107.80 ? 802 SO4 A S   1 
HETATM 8617 O O1  . SO4 P 3 .   ? -42.220  23.263  93.663  1.00 107.44 ? 802 SO4 A O1  1 
HETATM 8618 O O2  . SO4 P 3 .   ? -44.422  24.024  94.301  1.00 108.65 ? 802 SO4 A O2  1 
HETATM 8619 O O3  . SO4 P 3 .   ? -42.810  23.429  95.999  1.00 106.75 ? 802 SO4 A O3  1 
HETATM 8620 O O4  . SO4 P 3 .   ? -42.507  25.439  94.685  1.00 107.50 ? 802 SO4 A O4  1 
HETATM 8621 S S   . SO4 Q 3 .   ? -74.356  55.816  83.932  1.00 134.94 ? 803 SO4 A S   1 
HETATM 8622 O O1  . SO4 Q 3 .   ? -74.497  54.350  83.770  1.00 136.73 ? 803 SO4 A O1  1 
HETATM 8623 O O2  . SO4 Q 3 .   ? -74.861  56.490  82.716  1.00 134.54 ? 803 SO4 A O2  1 
HETATM 8624 O O3  . SO4 Q 3 .   ? -72.931  56.161  84.141  1.00 132.78 ? 803 SO4 A O3  1 
HETATM 8625 O O4  . SO4 Q 3 .   ? -75.147  56.262  85.101  1.00 134.96 ? 803 SO4 A O4  1 
HETATM 8626 S S   . SO4 R 3 .   ? -100.064 33.785  95.344  1.00 155.70 ? 804 SO4 A S   1 
HETATM 8627 O O1  . SO4 R 3 .   ? -98.768  33.993  94.660  1.00 155.44 ? 804 SO4 A O1  1 
HETATM 8628 O O2  . SO4 R 3 .   ? -101.152 33.772  94.340  1.00 157.11 ? 804 SO4 A O2  1 
HETATM 8629 O O3  . SO4 R 3 .   ? -100.036 32.492  96.063  1.00 154.95 ? 804 SO4 A O3  1 
HETATM 8630 O O4  . SO4 R 3 .   ? -100.300 34.884  96.308  1.00 153.61 ? 804 SO4 A O4  1 
HETATM 8631 S S   . SO4 S 3 .   ? -85.372  12.814  93.889  1.00 143.90 ? 805 SO4 A S   1 
HETATM 8632 O O1  . SO4 S 3 .   ? -84.063  13.399  93.516  1.00 143.72 ? 805 SO4 A O1  1 
HETATM 8633 O O2  . SO4 S 3 .   ? -86.290  12.847  92.727  1.00 141.19 ? 805 SO4 A O2  1 
HETATM 8634 O O3  . SO4 S 3 .   ? -85.171  11.413  94.323  1.00 144.24 ? 805 SO4 A O3  1 
HETATM 8635 O O4  . SO4 S 3 .   ? -85.960  13.592  95.002  1.00 145.36 ? 805 SO4 A O4  1 
HETATM 8636 S S   . SO4 T 3 .   ? -81.353  50.485  104.581 1.00 124.53 ? 806 SO4 A S   1 
HETATM 8637 O O1  . SO4 T 3 .   ? -80.147  50.910  103.836 1.00 125.85 ? 806 SO4 A O1  1 
HETATM 8638 O O2  . SO4 T 3 .   ? -82.215  49.657  103.708 1.00 123.93 ? 806 SO4 A O2  1 
HETATM 8639 O O3  . SO4 T 3 .   ? -80.951  49.694  105.766 1.00 124.26 ? 806 SO4 A O3  1 
HETATM 8640 O O4  . SO4 T 3 .   ? -82.101  51.688  105.008 1.00 126.63 ? 806 SO4 A O4  1 
HETATM 8641 S S   . SO4 U 3 .   ? -96.858  40.984  96.431  1.00 174.59 ? 807 SO4 A S   1 
HETATM 8642 O O1  . SO4 U 3 .   ? -97.899  41.957  96.029  1.00 175.25 ? 807 SO4 A O1  1 
HETATM 8643 O O2  . SO4 U 3 .   ? -96.721  39.954  95.377  1.00 173.41 ? 807 SO4 A O2  1 
HETATM 8644 O O3  . SO4 U 3 .   ? -97.252  40.337  97.703  1.00 174.06 ? 807 SO4 A O3  1 
HETATM 8645 O O4  . SO4 U 3 .   ? -95.568  41.687  96.613  1.00 172.78 ? 807 SO4 A O4  1 
HETATM 8646 S S   . SO4 V 3 .   ? -61.255  34.655  114.376 1.00 158.08 ? 808 SO4 A S   1 
HETATM 8647 O O1  . SO4 V 3 .   ? -61.118  34.927  112.927 1.00 157.21 ? 808 SO4 A O1  1 
HETATM 8648 O O2  . SO4 V 3 .   ? -60.829  33.268  114.666 1.00 154.61 ? 808 SO4 A O2  1 
HETATM 8649 O O3  . SO4 V 3 .   ? -62.666  34.829  114.786 1.00 157.79 ? 808 SO4 A O3  1 
HETATM 8650 O O4  . SO4 V 3 .   ? -60.407  35.605  115.131 1.00 158.95 ? 808 SO4 A O4  1 
HETATM 8651 N N   . NH4 W 4 .   ? -69.638  32.240  81.868  1.00 21.84  ? 809 NH4 A N   1 
HETATM 8652 N N1  . EPE X 5 .   ? -81.944  30.512  75.161  1.00 137.90 ? 810 EPE A N1  1 
HETATM 8653 C C2  . EPE X 5 .   ? -80.976  30.355  74.068  1.00 136.06 ? 810 EPE A C2  1 
HETATM 8654 C C3  . EPE X 5 .   ? -81.411  29.182  73.196  1.00 135.39 ? 810 EPE A C3  1 
HETATM 8655 N N4  . EPE X 5 .   ? -82.737  29.444  72.632  1.00 133.44 ? 810 EPE A N4  1 
HETATM 8656 C C5  . EPE X 5 .   ? -83.730  29.729  73.672  1.00 134.82 ? 810 EPE A C5  1 
HETATM 8657 C C6  . EPE X 5 .   ? -83.253  30.853  74.590  1.00 136.58 ? 810 EPE A C6  1 
HETATM 8658 C C7  . EPE X 5 .   ? -83.164  28.233  71.944  1.00 128.68 ? 810 EPE A C7  1 
HETATM 8659 C C8  . EPE X 5 .   ? -82.934  28.400  70.453  1.00 125.74 ? 810 EPE A C8  1 
HETATM 8660 O O8  . EPE X 5 .   ? -81.729  29.133  70.245  1.00 123.56 ? 810 EPE A O8  1 
HETATM 8661 C C9  . EPE X 5 .   ? -81.535  31.573  76.093  1.00 139.94 ? 810 EPE A C9  1 
HETATM 8662 C C10 . EPE X 5 .   ? -80.110  31.374  76.588  1.00 144.88 ? 810 EPE A C10 1 
HETATM 8663 S S   . EPE X 5 .   ? -80.113  31.312  78.239  1.00 148.76 ? 810 EPE A S   1 
HETATM 8664 O O1S . EPE X 5 .   ? -80.300  29.961  78.625  1.00 148.99 ? 810 EPE A O1S 1 
HETATM 8665 O O2S . EPE X 5 .   ? -78.866  31.780  78.755  1.00 147.58 ? 810 EPE A O2S 1 
HETATM 8666 O O3S . EPE X 5 .   ? -81.361  32.165  78.846  1.00 150.13 ? 810 EPE A O3S 1 
HETATM 8667 O O   . HOH Y 6 .   ? -66.495  -0.701  74.521  1.00 27.21  ? 901 HOH B O   1 
HETATM 8668 O O   . HOH Y 6 .   ? -69.563  -20.106 93.704  1.00 37.06  ? 902 HOH B O   1 
HETATM 8669 O O   . HOH Y 6 .   ? -69.266  -47.206 93.968  1.00 57.31  ? 903 HOH B O   1 
HETATM 8670 O O   . HOH Y 6 .   ? -81.530  -5.107  81.973  1.00 69.84  ? 904 HOH B O   1 
HETATM 8671 O O   . HOH Z 6 .   ? -71.991  28.893  84.236  1.00 45.90  ? 901 HOH A O   1 
HETATM 8672 O O   . HOH Z 6 .   ? -87.470  21.683  80.541  1.00 37.51  ? 902 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   162 162 ASP ASP B . n 
A 1 2   ASN 2   163 163 ASN ASN B . n 
A 1 3   ASP 3   164 164 ASP ASP B . n 
A 1 4   PRO 4   165 165 PRO PRO B . n 
A 1 5   LEU 5   166 166 LEU LEU B . n 
A 1 6   VAL 6   167 167 VAL VAL B . n 
A 1 7   VAL 7   168 168 VAL VAL B . n 
A 1 8   ASN 8   169 169 ASN ASN B . n 
A 1 9   THR 9   170 170 THR THR B . n 
A 1 10  ASP 10  171 171 ASP ASP B . n 
A 1 11  LYS 11  172 172 LYS LYS B . n 
A 1 12  GLY 12  173 173 GLY GLY B . n 
A 1 13  ARG 13  174 174 ARG ARG B . n 
A 1 14  ILE 14  175 175 ILE ILE B . n 
A 1 15  ARG 15  176 176 ARG ARG B . n 
A 1 16  GLY 16  177 177 GLY GLY B . n 
A 1 17  ILE 17  178 178 ILE ILE B . n 
A 1 18  THR 18  179 179 THR THR B . n 
A 1 19  VAL 19  180 180 VAL VAL B . n 
A 1 20  ASP 20  181 181 ASP ASP B . n 
A 1 21  ALA 21  182 182 ALA ALA B . n 
A 1 22  PRO 22  183 183 PRO PRO B . n 
A 1 23  SER 23  184 184 SER SER B . n 
A 1 24  GLY 24  185 185 GLY GLY B . n 
A 1 25  LYS 25  186 186 LYS LYS B . n 
A 1 26  LYS 26  187 187 LYS LYS B . n 
A 1 27  VAL 27  188 188 VAL VAL B . n 
A 1 28  ASP 28  189 189 ASP ASP B . n 
A 1 29  VAL 29  190 190 VAL VAL B . n 
A 1 30  TRP 30  191 191 TRP TRP B . n 
A 1 31  LEU 31  192 192 LEU LEU B . n 
A 1 32  GLY 32  193 193 GLY GLY B . n 
A 1 33  ILE 33  194 194 ILE ILE B . n 
A 1 34  PRO 34  195 195 PRO PRO B . n 
A 1 35  TYR 35  196 196 TYR TYR B . n 
A 1 36  ALA 36  197 197 ALA ALA B . n 
A 1 37  GLN 37  198 198 GLN GLN B . n 
A 1 38  PRO 38  199 199 PRO PRO B . n 
A 1 39  PRO 39  200 200 PRO PRO B . n 
A 1 40  VAL 40  201 201 VAL VAL B . n 
A 1 41  GLY 41  202 202 GLY GLY B . n 
A 1 42  PRO 42  203 203 PRO PRO B . n 
A 1 43  LEU 43  204 204 LEU LEU B . n 
A 1 44  ARG 44  205 205 ARG ARG B . n 
A 1 45  PHE 45  206 206 PHE PHE B . n 
A 1 46  ARG 46  207 207 ARG ARG B . n 
A 1 47  HIS 47  208 208 HIS HIS B . n 
A 1 48  PRO 48  209 209 PRO PRO B . n 
A 1 49  ARG 49  210 210 ARG ARG B . n 
A 1 50  PRO 50  211 211 PRO PRO B . n 
A 1 51  ALA 51  212 212 ALA ALA B . n 
A 1 52  GLU 52  213 213 GLU GLU B . n 
A 1 53  LYS 53  214 214 LYS LYS B . n 
A 1 54  TRP 54  215 215 TRP TRP B . n 
A 1 55  THR 55  216 216 THR THR B . n 
A 1 56  GLY 56  217 217 GLY GLY B . n 
A 1 57  VAL 57  218 218 VAL VAL B . n 
A 1 58  LEU 58  219 219 LEU LEU B . n 
A 1 59  ASN 59  220 220 ASN ASN B . n 
A 1 60  THR 60  221 221 THR THR B . n 
A 1 61  THR 61  222 222 THR THR B . n 
A 1 62  THR 62  223 223 THR THR B . n 
A 1 63  PRO 63  224 224 PRO PRO B . n 
A 1 64  PRO 64  225 225 PRO PRO B . n 
A 1 65  ASN 65  226 226 ASN ASN B . n 
A 1 66  SER 66  227 227 SER SER B . n 
A 1 67  CYS 67  228 228 CYS CYS B . n 
A 1 68  VAL 68  229 229 VAL VAL B . n 
A 1 69  GLN 69  230 230 GLN GLN B . n 
A 1 70  ILE 70  231 231 ILE ILE B . n 
A 1 71  VAL 71  232 232 VAL VAL B . n 
A 1 72  ASP 72  233 233 ASP ASP B . n 
A 1 73  THR 73  234 234 THR THR B . n 
A 1 74  VAL 74  235 235 VAL VAL B . n 
A 1 75  PHE 75  236 236 PHE PHE B . n 
A 1 76  GLY 76  237 237 GLY GLY B . n 
A 1 77  ASP 77  238 238 ASP ASP B . n 
A 1 78  PHE 78  239 239 PHE PHE B . n 
A 1 79  PRO 79  240 240 PRO PRO B . n 
A 1 80  GLY 80  241 241 GLY GLY B . n 
A 1 81  ALA 81  242 242 ALA ALA B . n 
A 1 82  THR 82  243 243 THR THR B . n 
A 1 83  MET 83  244 244 MET MET B . n 
A 1 84  TRP 84  245 245 TRP TRP B . n 
A 1 85  ASN 85  246 246 ASN ASN B . n 
A 1 86  PRO 86  247 247 PRO PRO B . n 
A 1 87  ASN 87  248 248 ASN ASN B . n 
A 1 88  THR 88  249 249 THR THR B . n 
A 1 89  PRO 89  250 250 PRO PRO B . n 
A 1 90  LEU 90  251 251 LEU LEU B . n 
A 1 91  SER 91  252 252 SER SER B . n 
A 1 92  GLU 92  253 253 GLU GLU B . n 
A 1 93  ASP 93  254 254 ASP ASP B . n 
A 1 94  CYS 94  255 255 CYS CYS B . n 
A 1 95  LEU 95  256 256 LEU LEU B . n 
A 1 96  TYR 96  257 257 TYR TYR B . n 
A 1 97  ILE 97  258 258 ILE ILE B . n 
A 1 98  ASN 98  259 259 ASN ASN B . n 
A 1 99  VAL 99  260 260 VAL VAL B . n 
A 1 100 VAL 100 261 261 VAL VAL B . n 
A 1 101 ALA 101 262 262 ALA ALA B . n 
A 1 102 PRO 102 263 263 PRO PRO B . n 
A 1 103 ARG 103 264 264 ARG ARG B . n 
A 1 104 PRO 104 265 265 PRO PRO B . n 
A 1 105 ARG 105 266 266 ARG ARG B . n 
A 1 106 PRO 106 267 267 PRO PRO B . n 
A 1 107 LYS 107 268 268 LYS LYS B . n 
A 1 108 ASN 108 269 269 ASN ASN B . n 
A 1 109 ALA 109 270 270 ALA ALA B . n 
A 1 110 ALA 110 271 271 ALA ALA B . n 
A 1 111 VAL 111 272 272 VAL VAL B . n 
A 1 112 MET 112 273 273 MET MET B . n 
A 1 113 LEU 113 274 274 LEU LEU B . n 
A 1 114 TRP 114 275 275 TRP TRP B . n 
A 1 115 ILE 115 276 276 ILE ILE B . n 
A 1 116 PHE 116 277 277 PHE PHE B . n 
A 1 117 GLY 117 278 278 GLY GLY B . n 
A 1 118 GLY 118 279 279 GLY GLY B . n 
A 1 119 GLY 119 280 280 GLY GLY B . n 
A 1 120 PHE 120 281 281 PHE PHE B . n 
A 1 121 TYR 121 282 282 TYR TYR B . n 
A 1 122 SER 122 283 283 SER SER B . n 
A 1 123 GLY 123 284 284 GLY GLY B . n 
A 1 124 THR 124 285 285 THR THR B . n 
A 1 125 ALA 125 286 286 ALA ALA B . n 
A 1 126 THR 126 287 287 THR THR B . n 
A 1 127 LEU 127 288 288 LEU LEU B . n 
A 1 128 ASP 128 289 289 ASP ASP B . n 
A 1 129 VAL 129 290 290 VAL VAL B . n 
A 1 130 TYR 130 291 291 TYR TYR B . n 
A 1 131 ASP 131 292 292 ASP ASP B . n 
A 1 132 HIS 132 293 293 HIS HIS B . n 
A 1 133 ARG 133 294 294 ARG ARG B . n 
A 1 134 ALA 134 295 295 ALA ALA B . n 
A 1 135 LEU 135 296 296 LEU LEU B . n 
A 1 136 ALA 136 297 297 ALA ALA B . n 
A 1 137 SER 137 298 298 SER SER B . n 
A 1 138 GLU 138 299 299 GLU GLU B . n 
A 1 139 GLU 139 300 300 GLU GLU B . n 
A 1 140 ASN 140 301 301 ASN ASN B . n 
A 1 141 VAL 141 302 302 VAL VAL B . n 
A 1 142 ILE 142 303 303 ILE ILE B . n 
A 1 143 VAL 143 304 304 VAL VAL B . n 
A 1 144 VAL 144 305 305 VAL VAL B . n 
A 1 145 SER 145 306 306 SER SER B . n 
A 1 146 LEU 146 307 307 LEU LEU B . n 
A 1 147 GLN 147 308 308 GLN GLN B . n 
A 1 148 TYR 148 309 309 TYR TYR B . n 
A 1 149 ARG 149 310 310 ARG ARG B . n 
A 1 150 VAL 150 311 311 VAL VAL B . n 
A 1 151 ALA 151 312 312 ALA ALA B . n 
A 1 152 SER 152 313 313 SER SER B . n 
A 1 153 LEU 153 314 314 LEU LEU B . n 
A 1 154 GLY 154 315 315 GLY GLY B . n 
A 1 155 PHE 155 316 316 PHE PHE B . n 
A 1 156 LEU 156 317 317 LEU LEU B . n 
A 1 157 PHE 157 318 318 PHE PHE B . n 
A 1 158 LEU 158 319 319 LEU LEU B . n 
A 1 159 GLY 159 320 320 GLY GLY B . n 
A 1 160 THR 160 321 321 THR THR B . n 
A 1 161 PRO 161 322 322 PRO PRO B . n 
A 1 162 GLU 162 323 323 GLU GLU B . n 
A 1 163 ALA 163 324 324 ALA ALA B . n 
A 1 164 PRO 164 325 325 PRO PRO B . n 
A 1 165 GLY 165 326 326 GLY GLY B . n 
A 1 166 ASN 166 327 327 ASN ASN B . n 
A 1 167 ALA 167 328 328 ALA ALA B . n 
A 1 168 GLY 168 329 329 GLY GLY B . n 
A 1 169 LEU 169 330 330 LEU LEU B . n 
A 1 170 PHE 170 331 331 PHE PHE B . n 
A 1 171 ASP 171 332 332 ASP ASP B . n 
A 1 172 GLN 172 333 333 GLN GLN B . n 
A 1 173 ASN 173 334 334 ASN ASN B . n 
A 1 174 LEU 174 335 335 LEU LEU B . n 
A 1 175 ALA 175 336 336 ALA ALA B . n 
A 1 176 LEU 176 337 337 LEU LEU B . n 
A 1 177 ARG 177 338 338 ARG ARG B . n 
A 1 178 TRP 178 339 339 TRP TRP B . n 
A 1 179 VAL 179 340 340 VAL VAL B . n 
A 1 180 ARG 180 341 341 ARG ARG B . n 
A 1 181 ASP 181 342 342 ASP ASP B . n 
A 1 182 ASN 182 343 343 ASN ASN B . n 
A 1 183 ILE 183 344 344 ILE ILE B . n 
A 1 184 HIS 184 345 345 HIS HIS B . n 
A 1 185 ARG 185 346 346 ARG ARG B . n 
A 1 186 PHE 186 347 347 PHE PHE B . n 
A 1 187 GLY 187 348 348 GLY GLY B . n 
A 1 188 GLY 188 349 349 GLY GLY B . n 
A 1 189 ASP 189 350 350 ASP ASP B . n 
A 1 190 PRO 190 351 351 PRO PRO B . n 
A 1 191 SER 191 352 352 SER SER B . n 
A 1 192 ARG 192 353 353 ARG ARG B . n 
A 1 193 VAL 193 354 354 VAL VAL B . n 
A 1 194 THR 194 355 355 THR THR B . n 
A 1 195 LEU 195 356 356 LEU LEU B . n 
A 1 196 PHE 196 357 357 PHE PHE B . n 
A 1 197 GLY 197 358 358 GLY GLY B . n 
A 1 198 GLU 198 359 359 GLU GLU B . n 
A 1 199 SER 199 360 360 SER SER B . n 
A 1 200 ALA 200 361 361 ALA ALA B . n 
A 1 201 GLY 201 362 362 GLY GLY B . n 
A 1 202 ALA 202 363 363 ALA ALA B . n 
A 1 203 VAL 203 364 364 VAL VAL B . n 
A 1 204 SER 204 365 365 SER SER B . n 
A 1 205 VAL 205 366 366 VAL VAL B . n 
A 1 206 SER 206 367 367 SER SER B . n 
A 1 207 LEU 207 368 368 LEU LEU B . n 
A 1 208 HIS 208 369 369 HIS HIS B . n 
A 1 209 LEU 209 370 370 LEU LEU B . n 
A 1 210 LEU 210 371 371 LEU LEU B . n 
A 1 211 SER 211 372 372 SER SER B . n 
A 1 212 ALA 212 373 373 ALA ALA B . n 
A 1 213 LEU 213 374 374 LEU LEU B . n 
A 1 214 SER 214 375 375 SER SER B . n 
A 1 215 ARG 215 376 376 ARG ARG B . n 
A 1 216 ASP 216 377 377 ASP ASP B . n 
A 1 217 LEU 217 378 378 LEU LEU B . n 
A 1 218 PHE 218 379 379 PHE PHE B . n 
A 1 219 GLN 219 380 380 GLN GLN B . n 
A 1 220 ARG 220 381 381 ARG ARG B . n 
A 1 221 ALA 221 382 382 ALA ALA B . n 
A 1 222 ILE 222 383 383 ILE ILE B . n 
A 1 223 LEU 223 384 384 LEU LEU B . n 
A 1 224 GLN 224 385 385 GLN GLN B . n 
A 1 225 SER 225 386 386 SER SER B . n 
A 1 226 GLY 226 387 387 GLY GLY B . n 
A 1 227 SER 227 388 388 SER SER B . n 
A 1 228 PRO 228 389 389 PRO PRO B . n 
A 1 229 THR 229 390 390 THR THR B . n 
A 1 230 ALA 230 391 391 ALA ALA B . n 
A 1 231 PRO 231 392 392 PRO PRO B . n 
A 1 232 TRP 232 393 393 TRP TRP B . n 
A 1 233 ALA 233 394 394 ALA ALA B . n 
A 1 234 LEU 234 395 395 LEU LEU B . n 
A 1 235 VAL 235 396 396 VAL VAL B . n 
A 1 236 SER 236 397 397 SER SER B . n 
A 1 237 ARG 237 398 398 ARG ARG B . n 
A 1 238 GLU 238 399 399 GLU GLU B . n 
A 1 239 GLU 239 400 400 GLU GLU B . n 
A 1 240 ALA 240 401 401 ALA ALA B . n 
A 1 241 THR 241 402 402 THR THR B . n 
A 1 242 LEU 242 403 403 LEU LEU B . n 
A 1 243 ARG 243 404 404 ARG ARG B . n 
A 1 244 ALA 244 405 405 ALA ALA B . n 
A 1 245 LEU 245 406 406 LEU LEU B . n 
A 1 246 ARG 246 407 407 ARG ARG B . n 
A 1 247 LEU 247 408 408 LEU LEU B . n 
A 1 248 ALA 248 409 409 ALA ALA B . n 
A 1 249 GLU 249 410 410 GLU GLU B . n 
A 1 250 ALA 250 411 411 ALA ALA B . n 
A 1 251 VAL 251 412 412 VAL VAL B . n 
A 1 252 GLY 252 413 413 GLY GLY B . n 
A 1 253 CYS 253 414 414 CYS CYS B . n 
A 1 254 PRO 254 415 415 PRO PRO B . n 
A 1 255 HIS 255 416 416 HIS HIS B . n 
A 1 256 GLU 256 417 417 GLU GLU B . n 
A 1 257 PRO 257 418 418 PRO PRO B . n 
A 1 258 SER 258 419 419 SER SER B . n 
A 1 259 LYS 259 420 420 LYS LYS B . n 
A 1 260 LEU 260 421 421 LEU LEU B . n 
A 1 261 SER 261 422 422 SER SER B . n 
A 1 262 ASP 262 423 423 ASP ASP B . n 
A 1 263 ALA 263 424 424 ALA ALA B . n 
A 1 264 VAL 264 425 425 VAL VAL B . n 
A 1 265 GLU 265 426 426 GLU GLU B . n 
A 1 266 CYS 266 427 427 CYS CYS B . n 
A 1 267 LEU 267 428 428 LEU LEU B . n 
A 1 268 ARG 268 429 429 ARG ARG B . n 
A 1 269 GLY 269 430 430 GLY GLY B . n 
A 1 270 LYS 270 431 431 LYS LYS B . n 
A 1 271 ASP 271 432 432 ASP ASP B . n 
A 1 272 PRO 272 433 433 PRO PRO B . n 
A 1 273 HIS 273 434 434 HIS HIS B . n 
A 1 274 VAL 274 435 435 VAL VAL B . n 
A 1 275 LEU 275 436 436 LEU LEU B . n 
A 1 276 VAL 276 437 437 VAL VAL B . n 
A 1 277 ASN 277 438 438 ASN ASN B . n 
A 1 278 ASN 278 439 439 ASN ASN B . n 
A 1 279 GLU 279 440 440 GLU GLU B . n 
A 1 280 TRP 280 441 441 TRP TRP B . n 
A 1 281 GLY 281 442 442 GLY GLY B . n 
A 1 282 THR 282 443 443 THR THR B . n 
A 1 283 LEU 283 444 444 LEU LEU B . n 
A 1 284 GLY 284 445 445 GLY GLY B . n 
A 1 285 ILE 285 446 446 ILE ILE B . n 
A 1 286 CYS 286 447 447 CYS CYS B . n 
A 1 287 GLU 287 448 448 GLU GLU B . n 
A 1 288 PHE 288 449 449 PHE PHE B . n 
A 1 289 PRO 289 450 450 PRO PRO B . n 
A 1 290 PHE 290 451 451 PHE PHE B . n 
A 1 291 VAL 291 452 452 VAL VAL B . n 
A 1 292 PRO 292 453 453 PRO PRO B . n 
A 1 293 VAL 293 454 454 VAL VAL B . n 
A 1 294 VAL 294 455 455 VAL VAL B . n 
A 1 295 ASP 295 456 456 ASP ASP B . n 
A 1 296 GLY 296 457 457 GLY GLY B . n 
A 1 297 ALA 297 458 458 ALA ALA B . n 
A 1 298 PHE 298 459 459 PHE PHE B . n 
A 1 299 LEU 299 460 460 LEU LEU B . n 
A 1 300 ASP 300 461 461 ASP ASP B . n 
A 1 301 GLU 301 462 462 GLU GLU B . n 
A 1 302 THR 302 463 463 THR THR B . n 
A 1 303 PRO 303 464 464 PRO PRO B . n 
A 1 304 GLN 304 465 465 GLN GLN B . n 
A 1 305 ARG 305 466 466 ARG ARG B . n 
A 1 306 SER 306 467 467 SER SER B . n 
A 1 307 LEU 307 468 468 LEU LEU B . n 
A 1 308 ALA 308 469 469 ALA ALA B . n 
A 1 309 SER 309 470 470 SER SER B . n 
A 1 310 GLY 310 471 471 GLY GLY B . n 
A 1 311 ARG 311 472 472 ARG ARG B . n 
A 1 312 PHE 312 473 473 PHE PHE B . n 
A 1 313 LYS 313 474 474 LYS LYS B . n 
A 1 314 LYS 314 475 475 LYS LYS B . n 
A 1 315 THR 315 476 476 THR THR B . n 
A 1 316 GLU 316 477 477 GLU GLU B . n 
A 1 317 ILE 317 478 478 ILE ILE B . n 
A 1 318 LEU 318 479 479 LEU LEU B . n 
A 1 319 THR 319 480 480 THR THR B . n 
A 1 320 GLY 320 481 481 GLY GLY B . n 
A 1 321 SER 321 482 482 SER SER B . n 
A 1 322 ASN 322 483 483 ASN ASN B . n 
A 1 323 THR 323 484 484 THR THR B . n 
A 1 324 GLU 324 485 485 GLU GLU B . n 
A 1 325 GLU 325 486 486 GLU GLU B . n 
A 1 326 GLY 326 487 487 GLY GLY B . n 
A 1 327 TYR 327 488 488 TYR TYR B . n 
A 1 328 TYR 328 489 489 TYR TYR B . n 
A 1 329 PHE 329 490 490 PHE PHE B . n 
A 1 330 ILE 330 491 491 ILE ILE B . n 
A 1 331 ILE 331 492 492 ILE ILE B . n 
A 1 332 TYR 332 493 493 TYR TYR B . n 
A 1 333 TYR 333 494 494 TYR TYR B . n 
A 1 334 LEU 334 495 495 LEU LEU B . n 
A 1 335 THR 335 496 496 THR THR B . n 
A 1 336 GLU 336 497 497 GLU GLU B . n 
A 1 337 LEU 337 498 498 LEU LEU B . n 
A 1 338 LEU 338 499 499 LEU LEU B . n 
A 1 339 ARG 339 500 500 ARG ARG B . n 
A 1 340 LYS 340 501 501 LYS LYS B . n 
A 1 341 GLU 341 502 502 GLU GLU B . n 
A 1 342 GLU 342 503 503 GLU GLU B . n 
A 1 343 GLY 343 504 504 GLY GLY B . n 
A 1 344 VAL 344 505 505 VAL VAL B . n 
A 1 345 THR 345 506 506 THR THR B . n 
A 1 346 VAL 346 507 507 VAL VAL B . n 
A 1 347 THR 347 508 508 THR THR B . n 
A 1 348 ARG 348 509 509 ARG ARG B . n 
A 1 349 GLU 349 510 510 GLU GLU B . n 
A 1 350 GLU 350 511 511 GLU GLU B . n 
A 1 351 PHE 351 512 512 PHE PHE B . n 
A 1 352 LEU 352 513 513 LEU LEU B . n 
A 1 353 GLN 353 514 514 GLN GLN B . n 
A 1 354 ALA 354 515 515 ALA ALA B . n 
A 1 355 VAL 355 516 516 VAL VAL B . n 
A 1 356 ARG 356 517 517 ARG ARG B . n 
A 1 357 GLU 357 518 518 GLU GLU B . n 
A 1 358 LEU 358 519 519 LEU LEU B . n 
A 1 359 ASN 359 520 520 ASN ASN B . n 
A 1 360 PRO 360 521 521 PRO PRO B . n 
A 1 361 TYR 361 522 522 TYR TYR B . n 
A 1 362 VAL 362 523 523 VAL VAL B . n 
A 1 363 ASN 363 524 524 ASN ASN B . n 
A 1 364 GLY 364 525 525 GLY GLY B . n 
A 1 365 ALA 365 526 526 ALA ALA B . n 
A 1 366 ALA 366 527 527 ALA ALA B . n 
A 1 367 ARG 367 528 528 ARG ARG B . n 
A 1 368 GLN 368 529 529 GLN GLN B . n 
A 1 369 ALA 369 530 530 ALA ALA B . n 
A 1 370 ILE 370 531 531 ILE ILE B . n 
A 1 371 VAL 371 532 532 VAL VAL B . n 
A 1 372 PHE 372 533 533 PHE PHE B . n 
A 1 373 GLU 373 534 534 GLU GLU B . n 
A 1 374 TYR 374 535 535 TYR TYR B . n 
A 1 375 THR 375 536 536 THR THR B . n 
A 1 376 ASP 376 537 537 ASP ASP B . n 
A 1 377 TRP 377 538 538 TRP TRP B . n 
A 1 378 THR 378 539 539 THR THR B . n 
A 1 379 GLU 379 540 540 GLU GLU B . n 
A 1 380 PRO 380 541 541 PRO PRO B . n 
A 1 381 ASP 381 542 542 ASP ASP B . n 
A 1 382 ASN 382 543 543 ASN ASN B . n 
A 1 383 PRO 383 544 544 PRO PRO B . n 
A 1 384 ASN 384 545 545 ASN ASN B . n 
A 1 385 SER 385 546 546 SER SER B . n 
A 1 386 ASN 386 547 547 ASN ASN B . n 
A 1 387 ARG 387 548 548 ARG ARG B . n 
A 1 388 ASP 388 549 549 ASP ASP B . n 
A 1 389 ALA 389 550 550 ALA ALA B . n 
A 1 390 LEU 390 551 551 LEU LEU B . n 
A 1 391 ASP 391 552 552 ASP ASP B . n 
A 1 392 LYS 392 553 553 LYS LYS B . n 
A 1 393 MET 393 554 554 MET MET B . n 
A 1 394 VAL 394 555 555 VAL VAL B . n 
A 1 395 GLY 395 556 556 GLY GLY B . n 
A 1 396 ASP 396 557 557 ASP ASP B . n 
A 1 397 TYR 397 558 558 TYR TYR B . n 
A 1 398 HIS 398 559 559 HIS HIS B . n 
A 1 399 PHE 399 560 560 PHE PHE B . n 
A 1 400 THR 400 561 561 THR THR B . n 
A 1 401 CYS 401 562 562 CYS CYS B . n 
A 1 402 ASN 402 563 563 ASN ASN B . n 
A 1 403 VAL 403 564 564 VAL VAL B . n 
A 1 404 ASN 404 565 565 ASN ASN B . n 
A 1 405 GLU 405 566 566 GLU GLU B . n 
A 1 406 PHE 406 567 567 PHE PHE B . n 
A 1 407 ALA 407 568 568 ALA ALA B . n 
A 1 408 GLN 408 569 569 GLN GLN B . n 
A 1 409 ARG 409 570 570 ARG ARG B . n 
A 1 410 TYR 410 571 571 TYR TYR B . n 
A 1 411 ALA 411 572 572 ALA ALA B . n 
A 1 412 GLU 412 573 573 GLU GLU B . n 
A 1 413 GLU 413 574 574 GLU GLU B . n 
A 1 414 GLY 414 575 575 GLY GLY B . n 
A 1 415 ASN 415 576 576 ASN ASN B . n 
A 1 416 ASN 416 577 577 ASN ASN B . n 
A 1 417 VAL 417 578 578 VAL VAL B . n 
A 1 418 TYR 418 579 579 TYR TYR B . n 
A 1 419 MET 419 580 580 MET MET B . n 
A 1 420 TYR 420 581 581 TYR TYR B . n 
A 1 421 LEU 421 582 582 LEU LEU B . n 
A 1 422 TYR 422 583 583 TYR TYR B . n 
A 1 423 THR 423 584 584 THR THR B . n 
A 1 424 HIS 424 585 585 HIS HIS B . n 
A 1 425 ARG 425 586 586 ARG ARG B . n 
A 1 426 SER 426 587 587 SER SER B . n 
A 1 427 LYS 427 588 588 LYS LYS B . n 
A 1 428 GLY 428 589 589 GLY GLY B . n 
A 1 429 ASN 429 590 590 ASN ASN B . n 
A 1 430 PRO 430 591 591 PRO PRO B . n 
A 1 431 TRP 431 592 592 TRP TRP B . n 
A 1 432 PRO 432 593 593 PRO PRO B . n 
A 1 433 ARG 433 594 594 ARG ARG B . n 
A 1 434 TRP 434 595 595 TRP TRP B . n 
A 1 435 THR 435 596 596 THR THR B . n 
A 1 436 GLY 436 597 597 GLY GLY B . n 
A 1 437 VAL 437 598 598 VAL VAL B . n 
A 1 438 MET 438 599 599 MET MET B . n 
A 1 439 HIS 439 600 600 HIS HIS B . n 
A 1 440 GLY 440 601 601 GLY GLY B . n 
A 1 441 ASP 441 602 602 ASP ASP B . n 
A 1 442 GLU 442 603 603 GLU GLU B . n 
A 1 443 ILE 443 604 604 ILE ILE B . n 
A 1 444 ASN 444 605 605 ASN ASN B . n 
A 1 445 TYR 445 606 606 TYR TYR B . n 
A 1 446 VAL 446 607 607 VAL VAL B . n 
A 1 447 PHE 447 608 608 PHE PHE B . n 
A 1 448 GLY 448 609 609 GLY GLY B . n 
A 1 449 GLU 449 610 610 GLU GLU B . n 
A 1 450 PRO 450 611 611 PRO PRO B . n 
A 1 451 LEU 451 612 612 LEU LEU B . n 
A 1 452 ASN 452 613 613 ASN ASN B . n 
A 1 453 PRO 453 614 614 PRO PRO B . n 
A 1 454 THR 454 615 615 THR THR B . n 
A 1 455 LEU 455 616 616 LEU LEU B . n 
A 1 456 GLY 456 617 617 GLY GLY B . n 
A 1 457 TYR 457 618 618 TYR TYR B . n 
A 1 458 THR 458 619 619 THR THR B . n 
A 1 459 GLU 459 620 620 GLU GLU B . n 
A 1 460 ASP 460 621 621 ASP ASP B . n 
A 1 461 GLU 461 622 622 GLU GLU B . n 
A 1 462 LYS 462 623 623 LYS LYS B . n 
A 1 463 ASP 463 624 624 ASP ASP B . n 
A 1 464 PHE 464 625 625 PHE PHE B . n 
A 1 465 SER 465 626 626 SER SER B . n 
A 1 466 ARG 466 627 627 ARG ARG B . n 
A 1 467 LYS 467 628 628 LYS LYS B . n 
A 1 468 ILE 468 629 629 ILE ILE B . n 
A 1 469 MET 469 630 630 MET MET B . n 
A 1 470 ARG 470 631 631 ARG ARG B . n 
A 1 471 TYR 471 632 632 TYR TYR B . n 
A 1 472 TRP 472 633 633 TRP TRP B . n 
A 1 473 SER 473 634 634 SER SER B . n 
A 1 474 ASN 474 635 635 ASN ASN B . n 
A 1 475 PHE 475 636 636 PHE PHE B . n 
A 1 476 ALA 476 637 637 ALA ALA B . n 
A 1 477 LYS 477 638 638 LYS LYS B . n 
A 1 478 THR 478 639 639 THR THR B . n 
A 1 479 GLY 479 640 640 GLY GLY B . n 
A 1 480 ASN 480 641 641 ASN ASN B . n 
A 1 481 PRO 481 642 642 PRO PRO B . n 
A 1 482 ASN 482 643 643 ASN ASN B . n 
A 1 483 PRO 483 644 644 PRO PRO B . n 
A 1 484 ASN 484 645 645 ASN ASN B . n 
A 1 485 THR 485 646 646 THR THR B . n 
A 1 486 ALA 486 647 647 ALA ALA B . n 
A 1 487 SER 487 648 648 SER SER B . n 
A 1 488 SER 488 649 649 SER SER B . n 
A 1 489 GLU 489 650 650 GLU GLU B . n 
A 1 490 PHE 490 651 651 PHE PHE B . n 
A 1 491 PRO 491 652 652 PRO PRO B . n 
A 1 492 GLU 492 653 653 GLU GLU B . n 
A 1 493 TRP 493 654 654 TRP TRP B . n 
A 1 494 PRO 494 655 655 PRO PRO B . n 
A 1 495 LYS 495 656 656 LYS LYS B . n 
A 1 496 HIS 496 657 657 HIS HIS B . n 
A 1 497 THR 497 658 658 THR THR B . n 
A 1 498 ALA 498 659 659 ALA ALA B . n 
A 1 499 HIS 499 660 660 HIS HIS B . n 
A 1 500 GLY 500 661 661 GLY GLY B . n 
A 1 501 ARG 501 662 662 ARG ARG B . n 
A 1 502 HIS 502 663 663 HIS HIS B . n 
A 1 503 TYR 503 664 664 TYR TYR B . n 
A 1 504 LEU 504 665 665 LEU LEU B . n 
A 1 505 GLU 505 666 666 GLU GLU B . n 
A 1 506 LEU 506 667 667 LEU LEU B . n 
A 1 507 GLY 507 668 668 GLY GLY B . n 
A 1 508 LEU 508 669 669 LEU LEU B . n 
A 1 509 ASN 509 670 670 ASN ASN B . n 
A 1 510 THR 510 671 671 THR THR B . n 
A 1 511 SER 511 672 672 SER SER B . n 
A 1 512 PHE 512 673 673 PHE PHE B . n 
A 1 513 VAL 513 674 674 VAL VAL B . n 
A 1 514 GLY 514 675 675 GLY GLY B . n 
A 1 515 ARG 515 676 676 ARG ARG B . n 
A 1 516 GLY 516 677 677 GLY GLY B . n 
A 1 517 PRO 517 678 678 PRO PRO B . n 
A 1 518 ARG 518 679 679 ARG ARG B . n 
A 1 519 LEU 519 680 680 LEU LEU B . n 
A 1 520 ARG 520 681 681 ARG ARG B . n 
A 1 521 GLN 521 682 682 GLN GLN B . n 
A 1 522 CYS 522 683 683 CYS CYS B . n 
A 1 523 ALA 523 684 684 ALA ALA B . n 
A 1 524 PHE 524 685 685 PHE PHE B . n 
A 1 525 TRP 525 686 686 TRP TRP B . n 
A 1 526 LYS 526 687 687 LYS LYS B . n 
A 1 527 LYS 527 688 688 LYS LYS B . n 
A 1 528 TYR 528 689 689 TYR TYR B . n 
A 1 529 LEU 529 690 690 LEU LEU B . n 
A 1 530 PRO 530 691 691 PRO PRO B . n 
A 1 531 GLN 531 692 692 GLN GLN B . n 
A 1 532 LEU 532 693 693 LEU LEU B . n 
A 1 533 VAL 533 694 694 VAL VAL B . n 
A 1 534 ALA 534 695 695 ALA ALA B . n 
A 1 535 ALA 535 696 696 ALA ALA B . n 
A 1 536 THR 536 697 697 THR THR B . n 
A 1 537 SER 537 698 698 SER SER B . n 
A 1 538 ASN 538 699 ?   ?   ?   B . n 
A 1 539 LEU 539 700 ?   ?   ?   B . n 
A 1 540 PRO 540 701 ?   ?   ?   B . n 
A 1 541 GLY 541 702 ?   ?   ?   B . n 
A 1 542 PRO 542 703 ?   ?   ?   B . n 
A 1 543 ALA 543 704 ?   ?   ?   B . n 
A 1 544 PRO 544 705 ?   ?   ?   B . n 
A 1 545 PRO 545 706 ?   ?   ?   B . n 
A 1 546 SER 546 707 ?   ?   ?   B . n 
A 1 547 GLU 547 708 ?   ?   ?   B . n 
A 1 548 PRO 548 709 ?   ?   ?   B . n 
A 1 549 CYS 549 710 ?   ?   ?   B . n 
A 1 550 GLU 550 711 ?   ?   ?   B . n 
A 1 551 SER 551 712 ?   ?   ?   B . n 
A 1 552 SER 552 713 ?   ?   ?   B . n 
A 1 553 ALA 553 714 ?   ?   ?   B . n 
B 1 1   ASP 1   162 162 ASP ASP A . n 
B 1 2   ASN 2   163 163 ASN ASN A . n 
B 1 3   ASP 3   164 164 ASP ASP A . n 
B 1 4   PRO 4   165 165 PRO PRO A . n 
B 1 5   LEU 5   166 166 LEU LEU A . n 
B 1 6   VAL 6   167 167 VAL VAL A . n 
B 1 7   VAL 7   168 168 VAL VAL A . n 
B 1 8   ASN 8   169 169 ASN ASN A . n 
B 1 9   THR 9   170 170 THR THR A . n 
B 1 10  ASP 10  171 171 ASP ASP A . n 
B 1 11  LYS 11  172 172 LYS LYS A . n 
B 1 12  GLY 12  173 173 GLY GLY A . n 
B 1 13  ARG 13  174 174 ARG ARG A . n 
B 1 14  ILE 14  175 175 ILE ILE A . n 
B 1 15  ARG 15  176 176 ARG ARG A . n 
B 1 16  GLY 16  177 177 GLY GLY A . n 
B 1 17  ILE 17  178 178 ILE ILE A . n 
B 1 18  THR 18  179 179 THR THR A . n 
B 1 19  VAL 19  180 180 VAL VAL A . n 
B 1 20  ASP 20  181 181 ASP ASP A . n 
B 1 21  ALA 21  182 182 ALA ALA A . n 
B 1 22  PRO 22  183 183 PRO PRO A . n 
B 1 23  SER 23  184 184 SER SER A . n 
B 1 24  GLY 24  185 185 GLY GLY A . n 
B 1 25  LYS 25  186 186 LYS LYS A . n 
B 1 26  LYS 26  187 187 LYS LYS A . n 
B 1 27  VAL 27  188 188 VAL VAL A . n 
B 1 28  ASP 28  189 189 ASP ASP A . n 
B 1 29  VAL 29  190 190 VAL VAL A . n 
B 1 30  TRP 30  191 191 TRP TRP A . n 
B 1 31  LEU 31  192 192 LEU LEU A . n 
B 1 32  GLY 32  193 193 GLY GLY A . n 
B 1 33  ILE 33  194 194 ILE ILE A . n 
B 1 34  PRO 34  195 195 PRO PRO A . n 
B 1 35  TYR 35  196 196 TYR TYR A . n 
B 1 36  ALA 36  197 197 ALA ALA A . n 
B 1 37  GLN 37  198 198 GLN GLN A . n 
B 1 38  PRO 38  199 199 PRO PRO A . n 
B 1 39  PRO 39  200 200 PRO PRO A . n 
B 1 40  VAL 40  201 201 VAL VAL A . n 
B 1 41  GLY 41  202 202 GLY GLY A . n 
B 1 42  PRO 42  203 203 PRO PRO A . n 
B 1 43  LEU 43  204 204 LEU LEU A . n 
B 1 44  ARG 44  205 205 ARG ARG A . n 
B 1 45  PHE 45  206 206 PHE PHE A . n 
B 1 46  ARG 46  207 207 ARG ARG A . n 
B 1 47  HIS 47  208 208 HIS HIS A . n 
B 1 48  PRO 48  209 209 PRO PRO A . n 
B 1 49  ARG 49  210 210 ARG ARG A . n 
B 1 50  PRO 50  211 211 PRO PRO A . n 
B 1 51  ALA 51  212 212 ALA ALA A . n 
B 1 52  GLU 52  213 213 GLU GLU A . n 
B 1 53  LYS 53  214 214 LYS LYS A . n 
B 1 54  TRP 54  215 215 TRP TRP A . n 
B 1 55  THR 55  216 216 THR THR A . n 
B 1 56  GLY 56  217 217 GLY GLY A . n 
B 1 57  VAL 57  218 218 VAL VAL A . n 
B 1 58  LEU 58  219 219 LEU LEU A . n 
B 1 59  ASN 59  220 220 ASN ASN A . n 
B 1 60  THR 60  221 221 THR THR A . n 
B 1 61  THR 61  222 222 THR THR A . n 
B 1 62  THR 62  223 223 THR THR A . n 
B 1 63  PRO 63  224 224 PRO PRO A . n 
B 1 64  PRO 64  225 225 PRO PRO A . n 
B 1 65  ASN 65  226 226 ASN ASN A . n 
B 1 66  SER 66  227 227 SER SER A . n 
B 1 67  CYS 67  228 228 CYS CYS A . n 
B 1 68  VAL 68  229 229 VAL VAL A . n 
B 1 69  GLN 69  230 230 GLN GLN A . n 
B 1 70  ILE 70  231 231 ILE ILE A . n 
B 1 71  VAL 71  232 232 VAL VAL A . n 
B 1 72  ASP 72  233 233 ASP ASP A . n 
B 1 73  THR 73  234 234 THR THR A . n 
B 1 74  VAL 74  235 235 VAL VAL A . n 
B 1 75  PHE 75  236 236 PHE PHE A . n 
B 1 76  GLY 76  237 237 GLY GLY A . n 
B 1 77  ASP 77  238 238 ASP ASP A . n 
B 1 78  PHE 78  239 239 PHE PHE A . n 
B 1 79  PRO 79  240 240 PRO PRO A . n 
B 1 80  GLY 80  241 241 GLY GLY A . n 
B 1 81  ALA 81  242 242 ALA ALA A . n 
B 1 82  THR 82  243 243 THR THR A . n 
B 1 83  MET 83  244 244 MET MET A . n 
B 1 84  TRP 84  245 245 TRP TRP A . n 
B 1 85  ASN 85  246 246 ASN ASN A . n 
B 1 86  PRO 86  247 247 PRO PRO A . n 
B 1 87  ASN 87  248 248 ASN ASN A . n 
B 1 88  THR 88  249 249 THR THR A . n 
B 1 89  PRO 89  250 250 PRO PRO A . n 
B 1 90  LEU 90  251 251 LEU LEU A . n 
B 1 91  SER 91  252 252 SER SER A . n 
B 1 92  GLU 92  253 253 GLU GLU A . n 
B 1 93  ASP 93  254 254 ASP ASP A . n 
B 1 94  CYS 94  255 255 CYS CYS A . n 
B 1 95  LEU 95  256 256 LEU LEU A . n 
B 1 96  TYR 96  257 257 TYR TYR A . n 
B 1 97  ILE 97  258 258 ILE ILE A . n 
B 1 98  ASN 98  259 259 ASN ASN A . n 
B 1 99  VAL 99  260 260 VAL VAL A . n 
B 1 100 VAL 100 261 261 VAL VAL A . n 
B 1 101 ALA 101 262 262 ALA ALA A . n 
B 1 102 PRO 102 263 263 PRO PRO A . n 
B 1 103 ARG 103 264 264 ARG ARG A . n 
B 1 104 PRO 104 265 265 PRO PRO A . n 
B 1 105 ARG 105 266 266 ARG ARG A . n 
B 1 106 PRO 106 267 267 PRO PRO A . n 
B 1 107 LYS 107 268 268 LYS LYS A . n 
B 1 108 ASN 108 269 269 ASN ASN A . n 
B 1 109 ALA 109 270 270 ALA ALA A . n 
B 1 110 ALA 110 271 271 ALA ALA A . n 
B 1 111 VAL 111 272 272 VAL VAL A . n 
B 1 112 MET 112 273 273 MET MET A . n 
B 1 113 LEU 113 274 274 LEU LEU A . n 
B 1 114 TRP 114 275 275 TRP TRP A . n 
B 1 115 ILE 115 276 276 ILE ILE A . n 
B 1 116 PHE 116 277 277 PHE PHE A . n 
B 1 117 GLY 117 278 278 GLY GLY A . n 
B 1 118 GLY 118 279 279 GLY GLY A . n 
B 1 119 GLY 119 280 280 GLY GLY A . n 
B 1 120 PHE 120 281 281 PHE PHE A . n 
B 1 121 TYR 121 282 282 TYR TYR A . n 
B 1 122 SER 122 283 283 SER SER A . n 
B 1 123 GLY 123 284 284 GLY GLY A . n 
B 1 124 THR 124 285 285 THR THR A . n 
B 1 125 ALA 125 286 286 ALA ALA A . n 
B 1 126 THR 126 287 287 THR THR A . n 
B 1 127 LEU 127 288 288 LEU LEU A . n 
B 1 128 ASP 128 289 289 ASP ASP A . n 
B 1 129 VAL 129 290 290 VAL VAL A . n 
B 1 130 TYR 130 291 291 TYR TYR A . n 
B 1 131 ASP 131 292 292 ASP ASP A . n 
B 1 132 HIS 132 293 293 HIS HIS A . n 
B 1 133 ARG 133 294 294 ARG ARG A . n 
B 1 134 ALA 134 295 295 ALA ALA A . n 
B 1 135 LEU 135 296 296 LEU LEU A . n 
B 1 136 ALA 136 297 297 ALA ALA A . n 
B 1 137 SER 137 298 298 SER SER A . n 
B 1 138 GLU 138 299 299 GLU GLU A . n 
B 1 139 GLU 139 300 300 GLU GLU A . n 
B 1 140 ASN 140 301 301 ASN ASN A . n 
B 1 141 VAL 141 302 302 VAL VAL A . n 
B 1 142 ILE 142 303 303 ILE ILE A . n 
B 1 143 VAL 143 304 304 VAL VAL A . n 
B 1 144 VAL 144 305 305 VAL VAL A . n 
B 1 145 SER 145 306 306 SER SER A . n 
B 1 146 LEU 146 307 307 LEU LEU A . n 
B 1 147 GLN 147 308 308 GLN GLN A . n 
B 1 148 TYR 148 309 309 TYR TYR A . n 
B 1 149 ARG 149 310 310 ARG ARG A . n 
B 1 150 VAL 150 311 311 VAL VAL A . n 
B 1 151 ALA 151 312 312 ALA ALA A . n 
B 1 152 SER 152 313 313 SER SER A . n 
B 1 153 LEU 153 314 314 LEU LEU A . n 
B 1 154 GLY 154 315 315 GLY GLY A . n 
B 1 155 PHE 155 316 316 PHE PHE A . n 
B 1 156 LEU 156 317 317 LEU LEU A . n 
B 1 157 PHE 157 318 318 PHE PHE A . n 
B 1 158 LEU 158 319 319 LEU LEU A . n 
B 1 159 GLY 159 320 320 GLY GLY A . n 
B 1 160 THR 160 321 321 THR THR A . n 
B 1 161 PRO 161 322 322 PRO PRO A . n 
B 1 162 GLU 162 323 323 GLU GLU A . n 
B 1 163 ALA 163 324 324 ALA ALA A . n 
B 1 164 PRO 164 325 325 PRO PRO A . n 
B 1 165 GLY 165 326 326 GLY GLY A . n 
B 1 166 ASN 166 327 327 ASN ASN A . n 
B 1 167 ALA 167 328 328 ALA ALA A . n 
B 1 168 GLY 168 329 329 GLY GLY A . n 
B 1 169 LEU 169 330 330 LEU LEU A . n 
B 1 170 PHE 170 331 331 PHE PHE A . n 
B 1 171 ASP 171 332 332 ASP ASP A . n 
B 1 172 GLN 172 333 333 GLN GLN A . n 
B 1 173 ASN 173 334 334 ASN ASN A . n 
B 1 174 LEU 174 335 335 LEU LEU A . n 
B 1 175 ALA 175 336 336 ALA ALA A . n 
B 1 176 LEU 176 337 337 LEU LEU A . n 
B 1 177 ARG 177 338 338 ARG ARG A . n 
B 1 178 TRP 178 339 339 TRP TRP A . n 
B 1 179 VAL 179 340 340 VAL VAL A . n 
B 1 180 ARG 180 341 341 ARG ARG A . n 
B 1 181 ASP 181 342 342 ASP ASP A . n 
B 1 182 ASN 182 343 343 ASN ASN A . n 
B 1 183 ILE 183 344 344 ILE ILE A . n 
B 1 184 HIS 184 345 345 HIS HIS A . n 
B 1 185 ARG 185 346 346 ARG ARG A . n 
B 1 186 PHE 186 347 347 PHE PHE A . n 
B 1 187 GLY 187 348 348 GLY GLY A . n 
B 1 188 GLY 188 349 349 GLY GLY A . n 
B 1 189 ASP 189 350 350 ASP ASP A . n 
B 1 190 PRO 190 351 351 PRO PRO A . n 
B 1 191 SER 191 352 352 SER SER A . n 
B 1 192 ARG 192 353 353 ARG ARG A . n 
B 1 193 VAL 193 354 354 VAL VAL A . n 
B 1 194 THR 194 355 355 THR THR A . n 
B 1 195 LEU 195 356 356 LEU LEU A . n 
B 1 196 PHE 196 357 357 PHE PHE A . n 
B 1 197 GLY 197 358 358 GLY GLY A . n 
B 1 198 GLU 198 359 359 GLU GLU A . n 
B 1 199 SER 199 360 360 SER SER A . n 
B 1 200 ALA 200 361 361 ALA ALA A . n 
B 1 201 GLY 201 362 362 GLY GLY A . n 
B 1 202 ALA 202 363 363 ALA ALA A . n 
B 1 203 VAL 203 364 364 VAL VAL A . n 
B 1 204 SER 204 365 365 SER SER A . n 
B 1 205 VAL 205 366 366 VAL VAL A . n 
B 1 206 SER 206 367 367 SER SER A . n 
B 1 207 LEU 207 368 368 LEU LEU A . n 
B 1 208 HIS 208 369 369 HIS HIS A . n 
B 1 209 LEU 209 370 370 LEU LEU A . n 
B 1 210 LEU 210 371 371 LEU LEU A . n 
B 1 211 SER 211 372 372 SER SER A . n 
B 1 212 ALA 212 373 373 ALA ALA A . n 
B 1 213 LEU 213 374 374 LEU LEU A . n 
B 1 214 SER 214 375 375 SER SER A . n 
B 1 215 ARG 215 376 376 ARG ARG A . n 
B 1 216 ASP 216 377 377 ASP ASP A . n 
B 1 217 LEU 217 378 378 LEU LEU A . n 
B 1 218 PHE 218 379 379 PHE PHE A . n 
B 1 219 GLN 219 380 380 GLN GLN A . n 
B 1 220 ARG 220 381 381 ARG ARG A . n 
B 1 221 ALA 221 382 382 ALA ALA A . n 
B 1 222 ILE 222 383 383 ILE ILE A . n 
B 1 223 LEU 223 384 384 LEU LEU A . n 
B 1 224 GLN 224 385 385 GLN GLN A . n 
B 1 225 SER 225 386 386 SER SER A . n 
B 1 226 GLY 226 387 387 GLY GLY A . n 
B 1 227 SER 227 388 388 SER SER A . n 
B 1 228 PRO 228 389 389 PRO PRO A . n 
B 1 229 THR 229 390 390 THR THR A . n 
B 1 230 ALA 230 391 391 ALA ALA A . n 
B 1 231 PRO 231 392 392 PRO PRO A . n 
B 1 232 TRP 232 393 393 TRP TRP A . n 
B 1 233 ALA 233 394 394 ALA ALA A . n 
B 1 234 LEU 234 395 395 LEU LEU A . n 
B 1 235 VAL 235 396 396 VAL VAL A . n 
B 1 236 SER 236 397 397 SER SER A . n 
B 1 237 ARG 237 398 398 ARG ARG A . n 
B 1 238 GLU 238 399 399 GLU GLU A . n 
B 1 239 GLU 239 400 400 GLU GLU A . n 
B 1 240 ALA 240 401 401 ALA ALA A . n 
B 1 241 THR 241 402 402 THR THR A . n 
B 1 242 LEU 242 403 403 LEU LEU A . n 
B 1 243 ARG 243 404 404 ARG ARG A . n 
B 1 244 ALA 244 405 405 ALA ALA A . n 
B 1 245 LEU 245 406 406 LEU LEU A . n 
B 1 246 ARG 246 407 407 ARG ARG A . n 
B 1 247 LEU 247 408 408 LEU LEU A . n 
B 1 248 ALA 248 409 409 ALA ALA A . n 
B 1 249 GLU 249 410 410 GLU GLU A . n 
B 1 250 ALA 250 411 411 ALA ALA A . n 
B 1 251 VAL 251 412 412 VAL VAL A . n 
B 1 252 GLY 252 413 413 GLY GLY A . n 
B 1 253 CYS 253 414 414 CYS CYS A . n 
B 1 254 PRO 254 415 415 PRO PRO A . n 
B 1 255 HIS 255 416 416 HIS HIS A . n 
B 1 256 GLU 256 417 417 GLU GLU A . n 
B 1 257 PRO 257 418 418 PRO PRO A . n 
B 1 258 SER 258 419 419 SER SER A . n 
B 1 259 LYS 259 420 420 LYS LYS A . n 
B 1 260 LEU 260 421 421 LEU LEU A . n 
B 1 261 SER 261 422 422 SER SER A . n 
B 1 262 ASP 262 423 423 ASP ASP A . n 
B 1 263 ALA 263 424 424 ALA ALA A . n 
B 1 264 VAL 264 425 425 VAL VAL A . n 
B 1 265 GLU 265 426 426 GLU GLU A . n 
B 1 266 CYS 266 427 427 CYS CYS A . n 
B 1 267 LEU 267 428 428 LEU LEU A . n 
B 1 268 ARG 268 429 429 ARG ARG A . n 
B 1 269 GLY 269 430 430 GLY GLY A . n 
B 1 270 LYS 270 431 431 LYS LYS A . n 
B 1 271 ASP 271 432 432 ASP ASP A . n 
B 1 272 PRO 272 433 433 PRO PRO A . n 
B 1 273 HIS 273 434 434 HIS HIS A . n 
B 1 274 VAL 274 435 435 VAL VAL A . n 
B 1 275 LEU 275 436 436 LEU LEU A . n 
B 1 276 VAL 276 437 437 VAL VAL A . n 
B 1 277 ASN 277 438 438 ASN ASN A . n 
B 1 278 ASN 278 439 439 ASN ASN A . n 
B 1 279 GLU 279 440 440 GLU GLU A . n 
B 1 280 TRP 280 441 441 TRP TRP A . n 
B 1 281 GLY 281 442 442 GLY GLY A . n 
B 1 282 THR 282 443 443 THR THR A . n 
B 1 283 LEU 283 444 444 LEU LEU A . n 
B 1 284 GLY 284 445 445 GLY GLY A . n 
B 1 285 ILE 285 446 446 ILE ILE A . n 
B 1 286 CYS 286 447 447 CYS CYS A . n 
B 1 287 GLU 287 448 448 GLU GLU A . n 
B 1 288 PHE 288 449 449 PHE PHE A . n 
B 1 289 PRO 289 450 450 PRO PRO A . n 
B 1 290 PHE 290 451 451 PHE PHE A . n 
B 1 291 VAL 291 452 452 VAL VAL A . n 
B 1 292 PRO 292 453 453 PRO PRO A . n 
B 1 293 VAL 293 454 454 VAL VAL A . n 
B 1 294 VAL 294 455 455 VAL VAL A . n 
B 1 295 ASP 295 456 456 ASP ASP A . n 
B 1 296 GLY 296 457 457 GLY GLY A . n 
B 1 297 ALA 297 458 458 ALA ALA A . n 
B 1 298 PHE 298 459 459 PHE PHE A . n 
B 1 299 LEU 299 460 460 LEU LEU A . n 
B 1 300 ASP 300 461 461 ASP ASP A . n 
B 1 301 GLU 301 462 462 GLU GLU A . n 
B 1 302 THR 302 463 463 THR THR A . n 
B 1 303 PRO 303 464 464 PRO PRO A . n 
B 1 304 GLN 304 465 465 GLN GLN A . n 
B 1 305 ARG 305 466 466 ARG ARG A . n 
B 1 306 SER 306 467 467 SER SER A . n 
B 1 307 LEU 307 468 468 LEU LEU A . n 
B 1 308 ALA 308 469 469 ALA ALA A . n 
B 1 309 SER 309 470 470 SER SER A . n 
B 1 310 GLY 310 471 471 GLY GLY A . n 
B 1 311 ARG 311 472 472 ARG ARG A . n 
B 1 312 PHE 312 473 473 PHE PHE A . n 
B 1 313 LYS 313 474 474 LYS LYS A . n 
B 1 314 LYS 314 475 475 LYS LYS A . n 
B 1 315 THR 315 476 476 THR THR A . n 
B 1 316 GLU 316 477 477 GLU GLU A . n 
B 1 317 ILE 317 478 478 ILE ILE A . n 
B 1 318 LEU 318 479 479 LEU LEU A . n 
B 1 319 THR 319 480 480 THR THR A . n 
B 1 320 GLY 320 481 481 GLY GLY A . n 
B 1 321 SER 321 482 482 SER SER A . n 
B 1 322 ASN 322 483 483 ASN ASN A . n 
B 1 323 THR 323 484 484 THR THR A . n 
B 1 324 GLU 324 485 485 GLU GLU A . n 
B 1 325 GLU 325 486 486 GLU GLU A . n 
B 1 326 GLY 326 487 487 GLY GLY A . n 
B 1 327 TYR 327 488 488 TYR TYR A . n 
B 1 328 TYR 328 489 489 TYR TYR A . n 
B 1 329 PHE 329 490 490 PHE PHE A . n 
B 1 330 ILE 330 491 491 ILE ILE A . n 
B 1 331 ILE 331 492 492 ILE ILE A . n 
B 1 332 TYR 332 493 493 TYR TYR A . n 
B 1 333 TYR 333 494 494 TYR TYR A . n 
B 1 334 LEU 334 495 495 LEU LEU A . n 
B 1 335 THR 335 496 496 THR THR A . n 
B 1 336 GLU 336 497 497 GLU GLU A . n 
B 1 337 LEU 337 498 498 LEU LEU A . n 
B 1 338 LEU 338 499 499 LEU LEU A . n 
B 1 339 ARG 339 500 500 ARG ARG A . n 
B 1 340 LYS 340 501 501 LYS LYS A . n 
B 1 341 GLU 341 502 502 GLU GLU A . n 
B 1 342 GLU 342 503 503 GLU GLU A . n 
B 1 343 GLY 343 504 504 GLY GLY A . n 
B 1 344 VAL 344 505 505 VAL VAL A . n 
B 1 345 THR 345 506 506 THR THR A . n 
B 1 346 VAL 346 507 507 VAL VAL A . n 
B 1 347 THR 347 508 508 THR THR A . n 
B 1 348 ARG 348 509 509 ARG ARG A . n 
B 1 349 GLU 349 510 510 GLU GLU A . n 
B 1 350 GLU 350 511 511 GLU GLU A . n 
B 1 351 PHE 351 512 512 PHE PHE A . n 
B 1 352 LEU 352 513 513 LEU LEU A . n 
B 1 353 GLN 353 514 514 GLN GLN A . n 
B 1 354 ALA 354 515 515 ALA ALA A . n 
B 1 355 VAL 355 516 516 VAL VAL A . n 
B 1 356 ARG 356 517 517 ARG ARG A . n 
B 1 357 GLU 357 518 518 GLU GLU A . n 
B 1 358 LEU 358 519 519 LEU LEU A . n 
B 1 359 ASN 359 520 520 ASN ASN A . n 
B 1 360 PRO 360 521 521 PRO PRO A . n 
B 1 361 TYR 361 522 522 TYR TYR A . n 
B 1 362 VAL 362 523 523 VAL VAL A . n 
B 1 363 ASN 363 524 524 ASN ASN A . n 
B 1 364 GLY 364 525 525 GLY GLY A . n 
B 1 365 ALA 365 526 526 ALA ALA A . n 
B 1 366 ALA 366 527 527 ALA ALA A . n 
B 1 367 ARG 367 528 528 ARG ARG A . n 
B 1 368 GLN 368 529 529 GLN GLN A . n 
B 1 369 ALA 369 530 530 ALA ALA A . n 
B 1 370 ILE 370 531 531 ILE ILE A . n 
B 1 371 VAL 371 532 532 VAL VAL A . n 
B 1 372 PHE 372 533 533 PHE PHE A . n 
B 1 373 GLU 373 534 534 GLU GLU A . n 
B 1 374 TYR 374 535 535 TYR TYR A . n 
B 1 375 THR 375 536 536 THR THR A . n 
B 1 376 ASP 376 537 537 ASP ASP A . n 
B 1 377 TRP 377 538 538 TRP TRP A . n 
B 1 378 THR 378 539 539 THR THR A . n 
B 1 379 GLU 379 540 540 GLU GLU A . n 
B 1 380 PRO 380 541 541 PRO PRO A . n 
B 1 381 ASP 381 542 542 ASP ASP A . n 
B 1 382 ASN 382 543 543 ASN ASN A . n 
B 1 383 PRO 383 544 544 PRO PRO A . n 
B 1 384 ASN 384 545 545 ASN ASN A . n 
B 1 385 SER 385 546 546 SER SER A . n 
B 1 386 ASN 386 547 547 ASN ASN A . n 
B 1 387 ARG 387 548 548 ARG ARG A . n 
B 1 388 ASP 388 549 549 ASP ASP A . n 
B 1 389 ALA 389 550 550 ALA ALA A . n 
B 1 390 LEU 390 551 551 LEU LEU A . n 
B 1 391 ASP 391 552 552 ASP ASP A . n 
B 1 392 LYS 392 553 553 LYS LYS A . n 
B 1 393 MET 393 554 554 MET MET A . n 
B 1 394 VAL 394 555 555 VAL VAL A . n 
B 1 395 GLY 395 556 556 GLY GLY A . n 
B 1 396 ASP 396 557 557 ASP ASP A . n 
B 1 397 TYR 397 558 558 TYR TYR A . n 
B 1 398 HIS 398 559 559 HIS HIS A . n 
B 1 399 PHE 399 560 560 PHE PHE A . n 
B 1 400 THR 400 561 561 THR THR A . n 
B 1 401 CYS 401 562 562 CYS CYS A . n 
B 1 402 ASN 402 563 563 ASN ASN A . n 
B 1 403 VAL 403 564 564 VAL VAL A . n 
B 1 404 ASN 404 565 565 ASN ASN A . n 
B 1 405 GLU 405 566 566 GLU GLU A . n 
B 1 406 PHE 406 567 567 PHE PHE A . n 
B 1 407 ALA 407 568 568 ALA ALA A . n 
B 1 408 GLN 408 569 569 GLN GLN A . n 
B 1 409 ARG 409 570 570 ARG ARG A . n 
B 1 410 TYR 410 571 571 TYR TYR A . n 
B 1 411 ALA 411 572 572 ALA ALA A . n 
B 1 412 GLU 412 573 573 GLU GLU A . n 
B 1 413 GLU 413 574 574 GLU GLU A . n 
B 1 414 GLY 414 575 575 GLY GLY A . n 
B 1 415 ASN 415 576 576 ASN ASN A . n 
B 1 416 ASN 416 577 577 ASN ASN A . n 
B 1 417 VAL 417 578 578 VAL VAL A . n 
B 1 418 TYR 418 579 579 TYR TYR A . n 
B 1 419 MET 419 580 580 MET MET A . n 
B 1 420 TYR 420 581 581 TYR TYR A . n 
B 1 421 LEU 421 582 582 LEU LEU A . n 
B 1 422 TYR 422 583 583 TYR TYR A . n 
B 1 423 THR 423 584 584 THR THR A . n 
B 1 424 HIS 424 585 585 HIS HIS A . n 
B 1 425 ARG 425 586 586 ARG ARG A . n 
B 1 426 SER 426 587 587 SER SER A . n 
B 1 427 LYS 427 588 588 LYS LYS A . n 
B 1 428 GLY 428 589 589 GLY GLY A . n 
B 1 429 ASN 429 590 590 ASN ASN A . n 
B 1 430 PRO 430 591 591 PRO PRO A . n 
B 1 431 TRP 431 592 592 TRP TRP A . n 
B 1 432 PRO 432 593 593 PRO PRO A . n 
B 1 433 ARG 433 594 594 ARG ARG A . n 
B 1 434 TRP 434 595 595 TRP TRP A . n 
B 1 435 THR 435 596 596 THR THR A . n 
B 1 436 GLY 436 597 597 GLY GLY A . n 
B 1 437 VAL 437 598 598 VAL VAL A . n 
B 1 438 MET 438 599 599 MET MET A . n 
B 1 439 HIS 439 600 600 HIS HIS A . n 
B 1 440 GLY 440 601 601 GLY GLY A . n 
B 1 441 ASP 441 602 602 ASP ASP A . n 
B 1 442 GLU 442 603 603 GLU GLU A . n 
B 1 443 ILE 443 604 604 ILE ILE A . n 
B 1 444 ASN 444 605 605 ASN ASN A . n 
B 1 445 TYR 445 606 606 TYR TYR A . n 
B 1 446 VAL 446 607 607 VAL VAL A . n 
B 1 447 PHE 447 608 608 PHE PHE A . n 
B 1 448 GLY 448 609 609 GLY GLY A . n 
B 1 449 GLU 449 610 610 GLU GLU A . n 
B 1 450 PRO 450 611 611 PRO PRO A . n 
B 1 451 LEU 451 612 612 LEU LEU A . n 
B 1 452 ASN 452 613 613 ASN ASN A . n 
B 1 453 PRO 453 614 614 PRO PRO A . n 
B 1 454 THR 454 615 615 THR THR A . n 
B 1 455 LEU 455 616 616 LEU LEU A . n 
B 1 456 GLY 456 617 617 GLY GLY A . n 
B 1 457 TYR 457 618 618 TYR TYR A . n 
B 1 458 THR 458 619 619 THR THR A . n 
B 1 459 GLU 459 620 620 GLU GLU A . n 
B 1 460 ASP 460 621 621 ASP ASP A . n 
B 1 461 GLU 461 622 622 GLU GLU A . n 
B 1 462 LYS 462 623 623 LYS LYS A . n 
B 1 463 ASP 463 624 624 ASP ASP A . n 
B 1 464 PHE 464 625 625 PHE PHE A . n 
B 1 465 SER 465 626 626 SER SER A . n 
B 1 466 ARG 466 627 627 ARG ARG A . n 
B 1 467 LYS 467 628 628 LYS LYS A . n 
B 1 468 ILE 468 629 629 ILE ILE A . n 
B 1 469 MET 469 630 630 MET MET A . n 
B 1 470 ARG 470 631 631 ARG ARG A . n 
B 1 471 TYR 471 632 632 TYR TYR A . n 
B 1 472 TRP 472 633 633 TRP TRP A . n 
B 1 473 SER 473 634 634 SER SER A . n 
B 1 474 ASN 474 635 635 ASN ASN A . n 
B 1 475 PHE 475 636 636 PHE PHE A . n 
B 1 476 ALA 476 637 637 ALA ALA A . n 
B 1 477 LYS 477 638 638 LYS LYS A . n 
B 1 478 THR 478 639 639 THR THR A . n 
B 1 479 GLY 479 640 640 GLY GLY A . n 
B 1 480 ASN 480 641 641 ASN ASN A . n 
B 1 481 PRO 481 642 642 PRO PRO A . n 
B 1 482 ASN 482 643 643 ASN ASN A . n 
B 1 483 PRO 483 644 644 PRO PRO A . n 
B 1 484 ASN 484 645 645 ASN ASN A . n 
B 1 485 THR 485 646 646 THR THR A . n 
B 1 486 ALA 486 647 647 ALA ALA A . n 
B 1 487 SER 487 648 648 SER SER A . n 
B 1 488 SER 488 649 649 SER SER A . n 
B 1 489 GLU 489 650 650 GLU GLU A . n 
B 1 490 PHE 490 651 651 PHE PHE A . n 
B 1 491 PRO 491 652 652 PRO PRO A . n 
B 1 492 GLU 492 653 653 GLU GLU A . n 
B 1 493 TRP 493 654 654 TRP TRP A . n 
B 1 494 PRO 494 655 655 PRO PRO A . n 
B 1 495 LYS 495 656 656 LYS LYS A . n 
B 1 496 HIS 496 657 657 HIS HIS A . n 
B 1 497 THR 497 658 658 THR THR A . n 
B 1 498 ALA 498 659 659 ALA ALA A . n 
B 1 499 HIS 499 660 660 HIS HIS A . n 
B 1 500 GLY 500 661 661 GLY GLY A . n 
B 1 501 ARG 501 662 662 ARG ARG A . n 
B 1 502 HIS 502 663 663 HIS HIS A . n 
B 1 503 TYR 503 664 664 TYR TYR A . n 
B 1 504 LEU 504 665 665 LEU LEU A . n 
B 1 505 GLU 505 666 666 GLU GLU A . n 
B 1 506 LEU 506 667 667 LEU LEU A . n 
B 1 507 GLY 507 668 668 GLY GLY A . n 
B 1 508 LEU 508 669 669 LEU LEU A . n 
B 1 509 ASN 509 670 670 ASN ASN A . n 
B 1 510 THR 510 671 671 THR THR A . n 
B 1 511 SER 511 672 672 SER SER A . n 
B 1 512 PHE 512 673 673 PHE PHE A . n 
B 1 513 VAL 513 674 674 VAL VAL A . n 
B 1 514 GLY 514 675 675 GLY GLY A . n 
B 1 515 ARG 515 676 676 ARG ARG A . n 
B 1 516 GLY 516 677 677 GLY GLY A . n 
B 1 517 PRO 517 678 678 PRO PRO A . n 
B 1 518 ARG 518 679 679 ARG ARG A . n 
B 1 519 LEU 519 680 680 LEU LEU A . n 
B 1 520 ARG 520 681 681 ARG ARG A . n 
B 1 521 GLN 521 682 682 GLN GLN A . n 
B 1 522 CYS 522 683 683 CYS CYS A . n 
B 1 523 ALA 523 684 684 ALA ALA A . n 
B 1 524 PHE 524 685 685 PHE PHE A . n 
B 1 525 TRP 525 686 686 TRP TRP A . n 
B 1 526 LYS 526 687 687 LYS LYS A . n 
B 1 527 LYS 527 688 688 LYS LYS A . n 
B 1 528 TYR 528 689 689 TYR TYR A . n 
B 1 529 LEU 529 690 690 LEU LEU A . n 
B 1 530 PRO 530 691 691 PRO PRO A . n 
B 1 531 GLN 531 692 692 GLN GLN A . n 
B 1 532 LEU 532 693 693 LEU LEU A . n 
B 1 533 VAL 533 694 694 VAL VAL A . n 
B 1 534 ALA 534 695 695 ALA ALA A . n 
B 1 535 ALA 535 696 696 ALA ALA A . n 
B 1 536 THR 536 697 697 THR THR A . n 
B 1 537 SER 537 698 698 SER SER A . n 
B 1 538 ASN 538 699 ?   ?   ?   A . n 
B 1 539 LEU 539 700 ?   ?   ?   A . n 
B 1 540 PRO 540 701 ?   ?   ?   A . n 
B 1 541 GLY 541 702 ?   ?   ?   A . n 
B 1 542 PRO 542 703 ?   ?   ?   A . n 
B 1 543 ALA 543 704 ?   ?   ?   A . n 
B 1 544 PRO 544 705 ?   ?   ?   A . n 
B 1 545 PRO 545 706 ?   ?   ?   A . n 
B 1 546 SER 546 707 ?   ?   ?   A . n 
B 1 547 GLU 547 708 ?   ?   ?   A . n 
B 1 548 PRO 548 709 ?   ?   ?   A . n 
B 1 549 CYS 549 710 ?   ?   ?   A . n 
B 1 550 GLU 550 711 ?   ?   ?   A . n 
B 1 551 SER 551 712 ?   ?   ?   A . n 
B 1 552 SER 552 713 ?   ?   ?   A . n 
B 1 553 ALA 553 714 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 SO4 1 801 801 SO4 SO4 B . 
F 3 SO4 1 802 802 SO4 SO4 B . 
G 3 SO4 1 803 803 SO4 SO4 B . 
H 3 SO4 1 804 804 SO4 SO4 B . 
I 3 SO4 1 805 805 SO4 SO4 B . 
J 3 SO4 1 806 806 SO4 SO4 B . 
K 3 SO4 1 807 807 SO4 SO4 B . 
L 3 SO4 1 808 808 SO4 SO4 B . 
M 4 NH4 1 809 811 NH4 NH4 B . 
N 5 EPE 1 810 812 EPE EPE B . 
O 3 SO4 1 801 801 SO4 SO4 A . 
P 3 SO4 1 802 802 SO4 SO4 A . 
Q 3 SO4 1 803 803 SO4 SO4 A . 
R 3 SO4 1 804 804 SO4 SO4 A . 
S 3 SO4 1 805 805 SO4 SO4 A . 
T 3 SO4 1 806 806 SO4 SO4 A . 
U 3 SO4 1 807 807 SO4 SO4 A . 
V 3 SO4 1 808 808 SO4 SO4 A . 
W 4 NH4 1 809 811 NH4 NH4 A . 
X 5 EPE 1 810 812 EPE EPE A . 
Y 6 HOH 1 901 901 HOH HOH B . 
Y 6 HOH 2 902 902 HOH HOH B . 
Y 6 HOH 3 903 903 HOH HOH B . 
Y 6 HOH 4 904 904 HOH HOH B . 
Z 6 HOH 1 901 901 HOH HOH A . 
Z 6 HOH 2 902 902 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B ASN 59 A ASN 220 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 59 B ASN 220 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 B,D,O,P,Q,R,S,T,U,V,W,X,Z 
1 2 A,C,E,F,G,H,I,J,K,L,M,N,Y 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6550  ? 
1 MORE         -176  ? 
1 'SSA (A^2)'  40740 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 6_565 x-y,x+1,z+1/6 0.5000000000 -0.8660254038 0.0000000000 -74.3615000000 0.8660254038 
0.5000000000 0.0000000000 128.7978961270 0.0000000000 0.0000000000 1.0000000000 37.6326666667 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-03-15 
2 'Structure model' 1 1 2017-10-18 
3 'Structure model' 2 0 2020-07-29 
4 'Structure model' 3 0 2021-06-02 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Author supporting evidence' 
2  3 'Structure model' Advisory                     
3  3 'Structure model' 'Atomic model'               
4  3 'Structure model' 'Data collection'            
5  3 'Structure model' 'Derived calculations'       
6  3 'Structure model' 'Structure summary'          
7  4 'Structure model' 'Atomic model'               
8  4 'Structure model' 'Data collection'            
9  4 'Structure model' 'Derived calculations'       
10 4 'Structure model' 'Structure summary'          
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' pdbx_audit_support            
2  3 'Structure model' atom_site                     
3  3 'Structure model' chem_comp                     
4  3 'Structure model' entity                        
5  3 'Structure model' pdbx_branch_scheme            
6  3 'Structure model' pdbx_chem_comp_identifier     
7  3 'Structure model' pdbx_entity_branch            
8  3 'Structure model' pdbx_entity_branch_descriptor 
9  3 'Structure model' pdbx_entity_branch_link       
10 3 'Structure model' pdbx_entity_branch_list       
11 3 'Structure model' pdbx_entity_nonpoly           
12 3 'Structure model' pdbx_nonpoly_scheme           
13 3 'Structure model' pdbx_struct_assembly_gen      
14 3 'Structure model' pdbx_validate_close_contact   
15 3 'Structure model' struct_asym                   
16 3 'Structure model' struct_conn                   
17 3 'Structure model' struct_site                   
18 3 'Structure model' struct_site_gen               
19 4 'Structure model' atom_site                     
20 4 'Structure model' chem_comp                     
21 4 'Structure model' pdbx_nonpoly_scheme           
22 4 'Structure model' pdbx_struct_assembly_gen      
23 4 'Structure model' pdbx_struct_assembly_prop     
24 4 'Structure model' pdbx_struct_oper_list         
25 4 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_pdbx_audit_support.funding_organization'    
2  3 'Structure model' '_atom_site.B_iso_or_equiv'                   
3  3 'Structure model' '_atom_site.Cartn_x'                          
4  3 'Structure model' '_atom_site.Cartn_y'                          
5  3 'Structure model' '_atom_site.Cartn_z'                          
6  3 'Structure model' '_atom_site.auth_asym_id'                     
7  3 'Structure model' '_atom_site.auth_atom_id'                     
8  3 'Structure model' '_atom_site.auth_comp_id'                     
9  3 'Structure model' '_atom_site.auth_seq_id'                      
10 3 'Structure model' '_atom_site.label_asym_id'                    
11 3 'Structure model' '_atom_site.label_atom_id'                    
12 3 'Structure model' '_atom_site.label_comp_id'                    
13 3 'Structure model' '_atom_site.label_entity_id'                  
14 3 'Structure model' '_atom_site.type_symbol'                      
15 3 'Structure model' '_chem_comp.name'                             
16 3 'Structure model' '_chem_comp.type'                             
17 3 'Structure model' '_entity.formula_weight'                      
18 3 'Structure model' '_entity.pdbx_description'                    
19 3 'Structure model' '_entity.pdbx_number_of_molecules'            
20 3 'Structure model' '_entity.src_method'                          
21 3 'Structure model' '_entity.type'                                
22 3 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
23 3 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1' 
24 3 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 
25 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'  
26 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'  
27 3 'Structure model' '_struct_conn.pdbx_dist_value'                
28 3 'Structure model' '_struct_conn.pdbx_role'                      
29 3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
30 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
31 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
32 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
33 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
34 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
35 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
36 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
37 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
38 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
39 4 'Structure model' '_atom_site.auth_seq_id'                      
40 4 'Structure model' '_chem_comp.pdbx_synonyms'                    
41 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num'            
42 4 'Structure model' '_pdbx_struct_assembly_prop.value'            
43 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.7.0029 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA    ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASES   ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 A ASN 220 ? ? O5 D NAG 1 ? ? 1.86 
2 1 ND2 B ASN 220 ? ? O5 C NAG 1 ? ? 1.91 
3 1 O4  C NAG 1   ? ? O5 C NAG 2 ? ? 1.93 
4 1 C3  C NAG 1   ? ? C1 C NAG 2 ? ? 2.01 
5 1 OD1 B ASN 220 ? ? C1 C NAG 1 ? ? 2.01 
6 1 O3  C NAG 1   ? ? O5 C NAG 2 ? ? 2.11 
7 1 O7  C NAG 1   ? ? N2 C NAG 2 ? ? 2.12 
8 1 O3  C NAG 1   ? ? C2 C NAG 2 ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE B 206 ? ? 73.12   -15.40  
2  1 ASN B 220 ? ? -67.31  98.59   
3  1 ASP B 238 ? ? -92.99  50.03   
4  1 CYS B 255 ? ? -141.96 -6.08   
5  1 ALA B 312 ? ? 58.48   -157.12 
6  1 PHE B 316 ? ? -142.39 16.61   
7  1 ARG B 353 ? ? -117.11 58.49   
8  1 SER B 360 ? ? 60.26   -117.49 
9  1 GLN B 380 ? ? -103.32 -65.43  
10 1 PRO B 418 ? ? -68.52  5.41    
11 1 TYR B 494 ? ? -76.42  -70.68  
12 1 LYS B 501 ? ? -75.85  42.89   
13 1 PHE B 560 ? ? -134.31 -78.38  
14 1 ALA B 647 ? ? 60.88   77.75   
15 1 SER B 672 ? ? -154.78 16.60   
16 1 LYS B 688 ? ? -108.17 -60.98  
17 1 PHE A 206 ? ? 75.59   -21.28  
18 1 CYS A 255 ? ? -142.62 -1.35   
19 1 ASN A 269 ? ? -162.70 106.61  
20 1 ALA A 312 ? ? 61.08   -150.41 
21 1 PHE A 316 ? ? -144.19 21.56   
22 1 PRO A 351 ? ? -58.69  -8.23   
23 1 SER A 360 ? ? 57.90   -116.03 
24 1 GLN A 380 ? ? -94.93  -63.42  
25 1 ALA A 458 ? ? -91.79  -65.01  
26 1 TYR A 535 ? ? -106.07 49.67   
27 1 GLU A 540 ? ? -155.48 80.79   
28 1 PHE A 560 ? ? -133.83 -79.97  
29 1 ALA A 647 ? ? 52.20   83.62   
30 1 ASN A 670 ? ? -111.75 56.11   
31 1 LYS A 688 ? ? -101.20 -60.75  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B ASN 699 ? A ASN 538 
2  1 Y 1 B LEU 700 ? A LEU 539 
3  1 Y 1 B PRO 701 ? A PRO 540 
4  1 Y 1 B GLY 702 ? A GLY 541 
5  1 Y 1 B PRO 703 ? A PRO 542 
6  1 Y 1 B ALA 704 ? A ALA 543 
7  1 Y 1 B PRO 705 ? A PRO 544 
8  1 Y 1 B PRO 706 ? A PRO 545 
9  1 Y 1 B SER 707 ? A SER 546 
10 1 Y 1 B GLU 708 ? A GLU 547 
11 1 Y 1 B PRO 709 ? A PRO 548 
12 1 Y 1 B CYS 710 ? A CYS 549 
13 1 Y 1 B GLU 711 ? A GLU 550 
14 1 Y 1 B SER 712 ? A SER 551 
15 1 Y 1 B SER 713 ? A SER 552 
16 1 Y 1 B ALA 714 ? A ALA 553 
17 1 Y 1 A ASN 699 ? B ASN 538 
18 1 Y 1 A LEU 700 ? B LEU 539 
19 1 Y 1 A PRO 701 ? B PRO 540 
20 1 Y 1 A GLY 702 ? B GLY 541 
21 1 Y 1 A PRO 703 ? B PRO 542 
22 1 Y 1 A ALA 704 ? B ALA 543 
23 1 Y 1 A PRO 705 ? B PRO 544 
24 1 Y 1 A PRO 706 ? B PRO 545 
25 1 Y 1 A SER 707 ? B SER 546 
26 1 Y 1 A GLU 708 ? B GLU 547 
27 1 Y 1 A PRO 709 ? B PRO 548 
28 1 Y 1 A CYS 710 ? B CYS 549 
29 1 Y 1 A GLU 711 ? B GLU 550 
30 1 Y 1 A SER 712 ? B SER 551 
31 1 Y 1 A SER 713 ? B SER 552 
32 1 Y 1 A ALA 714 ? B ALA 553 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute Of Allergy and Infectious Diseases' 'United States' AI082581 1 
'the National Natural Science Foundation of China'                                    China           31472186 2 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 B NAG 809 n 
C 2 NAG 2 C NAG 2 B NAG 810 n 
D 2 NAG 1 D NAG 1 A NAG 809 n 
D 2 NAG 2 D NAG 2 A NAG 810 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-3DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a3-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(3+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O3 
_pdbx_entity_branch_link.leaving_atom_id_2          HO3 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'                                         SO4 
4 'AMMONIUM ION'                                        NH4 
5 '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' EPE 
6 water                                                 HOH 
#