data_5XA0
# 
_entry.id   5XA0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5XA0         
WWPDB D_1300003168 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5X9Z unspecified 
PDB . 5XA1 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5XA0 
_pdbx_database_status.recvd_initial_deposition_date   2017-03-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Hamada, K.'    1 ? 
'Miyatake, H.'  2 ? 
'Terauchi, A.'  3 ? 
'Mikoshiba, K.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                4661 
_citation.page_last                 4666 
_citation.title                     
'IP3-mediated gating mechanism of the IP3 receptor revealed by mutagenesis and X-ray crystallography' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1701420114 
_citation.pdbx_database_id_PubMed   28416699 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hamada, K.'    1 
primary 'Miyatake, H.'  2 
primary 'Terauchi, A.'  3 
primary 'Mikoshiba, K.' 4 
# 
_cell.entry_id           5XA0 
_cell.length_a           128.164 
_cell.length_b           128.164 
_cell.length_c           369.486 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5XA0 
_symmetry.space_group_name_H-M             'P 42' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                77 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Inositol 1,4,5-trisphosphate receptor type 1' 
_entity.formula_weight             181007.500 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 1-1581' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;IP3 receptor isoform 1,InsP3R1,Inositol 1,4,5-trisphosphate-binding protein P400,Protein PCD-6,Purkinje cell protein 1,Type 1 inositol 1,5-trisphosphate receptor,Type 1 InsP3 receptor
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKLCPMNRYSAQKQFWKAAKPGA
NSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSW
FYIQPFYKLRSIGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVDP
DFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVH
STNIPIDKEEEKPVMLKIGTSPLKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYRVL
RHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVS
MNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDILSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQEQVTP
VKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYN
FSDLLRLTKILLAILDCVHVTTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQSSETSSGNSSQEGPSNVPGALDFEHIEEQAEGI
FGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLD
QLRSIVEKSELWVYKGQGPDEPMDGASGENEHKKTEEGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILEAVTMQHIFMNN
FQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRS
ERDRMDENSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQPVFVQLLQGVFRVYH
CNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKSHNIVQKTALNWRLSAR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKLCPMNRYSAQKQFWKAAKPGA
NSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSW
FYIQPFYKLRSIGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVDP
DFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVH
STNIPIDKEEEKPVMLKIGTSPLKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYRVL
RHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVS
MNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDILSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQEQVTP
VKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYN
FSDLLRLTKILLAILDCVHVTTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQSSETSSGNSSQEGPSNVPGALDFEHIEEQAEGI
FGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLD
QLRSIVEKSELWVYKGQGPDEPMDGASGENEHKKTEEGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILEAVTMQHIFMNN
FQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRS
ERDRMDENSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQPVFVQLLQGVFRVYH
CNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKSHNIVQKTALNWRLSAR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    SER n 
1 3    ASP n 
1 4    LYS n 
1 5    MET n 
1 6    SER n 
1 7    SER n 
1 8    PHE n 
1 9    LEU n 
1 10   HIS n 
1 11   ILE n 
1 12   GLY n 
1 13   ASP n 
1 14   ILE n 
1 15   CYS n 
1 16   SER n 
1 17   LEU n 
1 18   TYR n 
1 19   ALA n 
1 20   GLU n 
1 21   GLY n 
1 22   SER n 
1 23   THR n 
1 24   ASN n 
1 25   GLY n 
1 26   PHE n 
1 27   ILE n 
1 28   SER n 
1 29   THR n 
1 30   LEU n 
1 31   GLY n 
1 32   LEU n 
1 33   VAL n 
1 34   ASP n 
1 35   ASP n 
1 36   ARG n 
1 37   CYS n 
1 38   VAL n 
1 39   VAL n 
1 40   GLN n 
1 41   PRO n 
1 42   GLU n 
1 43   ALA n 
1 44   GLY n 
1 45   ASP n 
1 46   LEU n 
1 47   ASN n 
1 48   ASN n 
1 49   PRO n 
1 50   PRO n 
1 51   LYS n 
1 52   LYS n 
1 53   PHE n 
1 54   ARG n 
1 55   ASP n 
1 56   CYS n 
1 57   LEU n 
1 58   PHE n 
1 59   LYS n 
1 60   LEU n 
1 61   CYS n 
1 62   PRO n 
1 63   MET n 
1 64   ASN n 
1 65   ARG n 
1 66   TYR n 
1 67   SER n 
1 68   ALA n 
1 69   GLN n 
1 70   LYS n 
1 71   GLN n 
1 72   PHE n 
1 73   TRP n 
1 74   LYS n 
1 75   ALA n 
1 76   ALA n 
1 77   LYS n 
1 78   PRO n 
1 79   GLY n 
1 80   ALA n 
1 81   ASN n 
1 82   SER n 
1 83   THR n 
1 84   THR n 
1 85   ASP n 
1 86   ALA n 
1 87   VAL n 
1 88   LEU n 
1 89   LEU n 
1 90   ASN n 
1 91   LYS n 
1 92   LEU n 
1 93   HIS n 
1 94   HIS n 
1 95   ALA n 
1 96   ALA n 
1 97   ASP n 
1 98   LEU n 
1 99   GLU n 
1 100  LYS n 
1 101  LYS n 
1 102  GLN n 
1 103  ASN n 
1 104  GLU n 
1 105  THR n 
1 106  GLU n 
1 107  ASN n 
1 108  ARG n 
1 109  LYS n 
1 110  LEU n 
1 111  LEU n 
1 112  GLY n 
1 113  THR n 
1 114  VAL n 
1 115  ILE n 
1 116  GLN n 
1 117  TYR n 
1 118  GLY n 
1 119  ASN n 
1 120  VAL n 
1 121  ILE n 
1 122  GLN n 
1 123  LEU n 
1 124  LEU n 
1 125  HIS n 
1 126  LEU n 
1 127  LYS n 
1 128  SER n 
1 129  ASN n 
1 130  LYS n 
1 131  TYR n 
1 132  LEU n 
1 133  THR n 
1 134  VAL n 
1 135  ASN n 
1 136  LYS n 
1 137  ARG n 
1 138  LEU n 
1 139  PRO n 
1 140  ALA n 
1 141  LEU n 
1 142  LEU n 
1 143  GLU n 
1 144  LYS n 
1 145  ASN n 
1 146  ALA n 
1 147  MET n 
1 148  ARG n 
1 149  VAL n 
1 150  THR n 
1 151  LEU n 
1 152  ASP n 
1 153  GLU n 
1 154  ALA n 
1 155  GLY n 
1 156  ASN n 
1 157  GLU n 
1 158  GLY n 
1 159  SER n 
1 160  TRP n 
1 161  PHE n 
1 162  TYR n 
1 163  ILE n 
1 164  GLN n 
1 165  PRO n 
1 166  PHE n 
1 167  TYR n 
1 168  LYS n 
1 169  LEU n 
1 170  ARG n 
1 171  SER n 
1 172  ILE n 
1 173  GLY n 
1 174  ASP n 
1 175  SER n 
1 176  VAL n 
1 177  VAL n 
1 178  ILE n 
1 179  GLY n 
1 180  ASP n 
1 181  LYS n 
1 182  VAL n 
1 183  VAL n 
1 184  LEU n 
1 185  ASN n 
1 186  PRO n 
1 187  VAL n 
1 188  ASN n 
1 189  ALA n 
1 190  GLY n 
1 191  GLN n 
1 192  PRO n 
1 193  LEU n 
1 194  HIS n 
1 195  ALA n 
1 196  SER n 
1 197  SER n 
1 198  HIS n 
1 199  GLN n 
1 200  LEU n 
1 201  VAL n 
1 202  ASP n 
1 203  ASN n 
1 204  PRO n 
1 205  GLY n 
1 206  CYS n 
1 207  ASN n 
1 208  GLU n 
1 209  VAL n 
1 210  ASN n 
1 211  SER n 
1 212  VAL n 
1 213  ASN n 
1 214  CYS n 
1 215  ASN n 
1 216  THR n 
1 217  SER n 
1 218  TRP n 
1 219  LYS n 
1 220  ILE n 
1 221  VAL n 
1 222  LEU n 
1 223  PHE n 
1 224  MET n 
1 225  LYS n 
1 226  TRP n 
1 227  SER n 
1 228  ASP n 
1 229  ASN n 
1 230  LYS n 
1 231  ASP n 
1 232  ASP n 
1 233  ILE n 
1 234  LEU n 
1 235  LYS n 
1 236  GLY n 
1 237  GLY n 
1 238  ASP n 
1 239  VAL n 
1 240  VAL n 
1 241  ARG n 
1 242  LEU n 
1 243  PHE n 
1 244  HIS n 
1 245  ALA n 
1 246  GLU n 
1 247  GLN n 
1 248  GLU n 
1 249  LYS n 
1 250  PHE n 
1 251  LEU n 
1 252  THR n 
1 253  CYS n 
1 254  ASP n 
1 255  GLU n 
1 256  HIS n 
1 257  ARG n 
1 258  LYS n 
1 259  LYS n 
1 260  GLN n 
1 261  HIS n 
1 262  VAL n 
1 263  PHE n 
1 264  LEU n 
1 265  ARG n 
1 266  THR n 
1 267  THR n 
1 268  GLY n 
1 269  ARG n 
1 270  GLN n 
1 271  SER n 
1 272  ALA n 
1 273  THR n 
1 274  SER n 
1 275  ALA n 
1 276  THR n 
1 277  SER n 
1 278  SER n 
1 279  LYS n 
1 280  ALA n 
1 281  LEU n 
1 282  TRP n 
1 283  GLU n 
1 284  VAL n 
1 285  GLU n 
1 286  VAL n 
1 287  VAL n 
1 288  GLN n 
1 289  HIS n 
1 290  ASP n 
1 291  PRO n 
1 292  CYS n 
1 293  ARG n 
1 294  GLY n 
1 295  GLY n 
1 296  ALA n 
1 297  GLY n 
1 298  TYR n 
1 299  TRP n 
1 300  ASN n 
1 301  SER n 
1 302  LEU n 
1 303  PHE n 
1 304  ARG n 
1 305  PHE n 
1 306  LYS n 
1 307  HIS n 
1 308  LEU n 
1 309  ALA n 
1 310  THR n 
1 311  GLY n 
1 312  HIS n 
1 313  TYR n 
1 314  LEU n 
1 315  ALA n 
1 316  ALA n 
1 317  GLU n 
1 318  VAL n 
1 319  ASP n 
1 320  PRO n 
1 321  ASP n 
1 322  PHE n 
1 323  GLU n 
1 324  GLU n 
1 325  GLU n 
1 326  CYS n 
1 327  LEU n 
1 328  GLU n 
1 329  PHE n 
1 330  GLN n 
1 331  PRO n 
1 332  SER n 
1 333  VAL n 
1 334  ASP n 
1 335  PRO n 
1 336  ASP n 
1 337  GLN n 
1 338  ASP n 
1 339  ALA n 
1 340  SER n 
1 341  ARG n 
1 342  SER n 
1 343  ARG n 
1 344  LEU n 
1 345  ARG n 
1 346  ASN n 
1 347  ALA n 
1 348  GLN n 
1 349  GLU n 
1 350  LYS n 
1 351  MET n 
1 352  VAL n 
1 353  TYR n 
1 354  SER n 
1 355  LEU n 
1 356  VAL n 
1 357  SER n 
1 358  VAL n 
1 359  PRO n 
1 360  GLU n 
1 361  GLY n 
1 362  ASN n 
1 363  ASP n 
1 364  ILE n 
1 365  SER n 
1 366  SER n 
1 367  ILE n 
1 368  PHE n 
1 369  GLU n 
1 370  LEU n 
1 371  ASP n 
1 372  PRO n 
1 373  THR n 
1 374  THR n 
1 375  LEU n 
1 376  ARG n 
1 377  GLY n 
1 378  GLY n 
1 379  ASP n 
1 380  SER n 
1 381  LEU n 
1 382  VAL n 
1 383  PRO n 
1 384  ARG n 
1 385  ASN n 
1 386  SER n 
1 387  TYR n 
1 388  VAL n 
1 389  ARG n 
1 390  LEU n 
1 391  ARG n 
1 392  HIS n 
1 393  LEU n 
1 394  CYS n 
1 395  THR n 
1 396  ASN n 
1 397  THR n 
1 398  TRP n 
1 399  VAL n 
1 400  HIS n 
1 401  SER n 
1 402  THR n 
1 403  ASN n 
1 404  ILE n 
1 405  PRO n 
1 406  ILE n 
1 407  ASP n 
1 408  LYS n 
1 409  GLU n 
1 410  GLU n 
1 411  GLU n 
1 412  LYS n 
1 413  PRO n 
1 414  VAL n 
1 415  MET n 
1 416  LEU n 
1 417  LYS n 
1 418  ILE n 
1 419  GLY n 
1 420  THR n 
1 421  SER n 
1 422  PRO n 
1 423  LEU n 
1 424  LYS n 
1 425  GLU n 
1 426  ASP n 
1 427  LYS n 
1 428  GLU n 
1 429  ALA n 
1 430  PHE n 
1 431  ALA n 
1 432  ILE n 
1 433  VAL n 
1 434  PRO n 
1 435  VAL n 
1 436  SER n 
1 437  PRO n 
1 438  ALA n 
1 439  GLU n 
1 440  VAL n 
1 441  ARG n 
1 442  ASP n 
1 443  LEU n 
1 444  ASP n 
1 445  PHE n 
1 446  ALA n 
1 447  ASN n 
1 448  ASP n 
1 449  ALA n 
1 450  SER n 
1 451  LYS n 
1 452  VAL n 
1 453  LEU n 
1 454  GLY n 
1 455  SER n 
1 456  ILE n 
1 457  ALA n 
1 458  GLY n 
1 459  LYS n 
1 460  LEU n 
1 461  GLU n 
1 462  LYS n 
1 463  GLY n 
1 464  THR n 
1 465  ILE n 
1 466  THR n 
1 467  GLN n 
1 468  ASN n 
1 469  GLU n 
1 470  ARG n 
1 471  ARG n 
1 472  SER n 
1 473  VAL n 
1 474  THR n 
1 475  LYS n 
1 476  LEU n 
1 477  LEU n 
1 478  GLU n 
1 479  ASP n 
1 480  LEU n 
1 481  VAL n 
1 482  TYR n 
1 483  PHE n 
1 484  VAL n 
1 485  THR n 
1 486  GLY n 
1 487  GLY n 
1 488  THR n 
1 489  ASN n 
1 490  SER n 
1 491  GLY n 
1 492  GLN n 
1 493  ASP n 
1 494  VAL n 
1 495  LEU n 
1 496  GLU n 
1 497  VAL n 
1 498  VAL n 
1 499  PHE n 
1 500  SER n 
1 501  LYS n 
1 502  PRO n 
1 503  ASN n 
1 504  ARG n 
1 505  GLU n 
1 506  ARG n 
1 507  GLN n 
1 508  LYS n 
1 509  LEU n 
1 510  MET n 
1 511  ARG n 
1 512  GLU n 
1 513  GLN n 
1 514  ASN n 
1 515  ILE n 
1 516  LEU n 
1 517  LYS n 
1 518  GLN n 
1 519  ILE n 
1 520  PHE n 
1 521  LYS n 
1 522  LEU n 
1 523  LEU n 
1 524  GLN n 
1 525  ALA n 
1 526  PRO n 
1 527  PHE n 
1 528  THR n 
1 529  ASP n 
1 530  CYS n 
1 531  GLY n 
1 532  ASP n 
1 533  GLY n 
1 534  PRO n 
1 535  MET n 
1 536  LEU n 
1 537  ARG n 
1 538  LEU n 
1 539  GLU n 
1 540  GLU n 
1 541  LEU n 
1 542  GLY n 
1 543  ASP n 
1 544  GLN n 
1 545  ARG n 
1 546  HIS n 
1 547  ALA n 
1 548  PRO n 
1 549  PHE n 
1 550  ARG n 
1 551  HIS n 
1 552  ILE n 
1 553  CYS n 
1 554  ARG n 
1 555  LEU n 
1 556  CYS n 
1 557  TYR n 
1 558  ARG n 
1 559  VAL n 
1 560  LEU n 
1 561  ARG n 
1 562  HIS n 
1 563  SER n 
1 564  GLN n 
1 565  GLN n 
1 566  ASP n 
1 567  TYR n 
1 568  ARG n 
1 569  LYS n 
1 570  ASN n 
1 571  GLN n 
1 572  GLU n 
1 573  TYR n 
1 574  ILE n 
1 575  ALA n 
1 576  LYS n 
1 577  GLN n 
1 578  PHE n 
1 579  GLY n 
1 580  PHE n 
1 581  MET n 
1 582  GLN n 
1 583  LYS n 
1 584  GLN n 
1 585  ILE n 
1 586  GLY n 
1 587  TYR n 
1 588  ASP n 
1 589  VAL n 
1 590  LEU n 
1 591  ALA n 
1 592  GLU n 
1 593  ASP n 
1 594  THR n 
1 595  ILE n 
1 596  THR n 
1 597  ALA n 
1 598  LEU n 
1 599  LEU n 
1 600  HIS n 
1 601  ASN n 
1 602  ASN n 
1 603  ARG n 
1 604  LYS n 
1 605  LEU n 
1 606  LEU n 
1 607  GLU n 
1 608  LYS n 
1 609  HIS n 
1 610  ILE n 
1 611  THR n 
1 612  ALA n 
1 613  ALA n 
1 614  GLU n 
1 615  ILE n 
1 616  ASP n 
1 617  THR n 
1 618  PHE n 
1 619  VAL n 
1 620  SER n 
1 621  LEU n 
1 622  VAL n 
1 623  ARG n 
1 624  LYS n 
1 625  ASN n 
1 626  ARG n 
1 627  GLU n 
1 628  PRO n 
1 629  ARG n 
1 630  PHE n 
1 631  LEU n 
1 632  ASP n 
1 633  TYR n 
1 634  LEU n 
1 635  SER n 
1 636  ASP n 
1 637  LEU n 
1 638  CYS n 
1 639  VAL n 
1 640  SER n 
1 641  MET n 
1 642  ASN n 
1 643  LYS n 
1 644  SER n 
1 645  ILE n 
1 646  PRO n 
1 647  VAL n 
1 648  THR n 
1 649  GLN n 
1 650  GLU n 
1 651  LEU n 
1 652  ILE n 
1 653  CYS n 
1 654  LYS n 
1 655  ALA n 
1 656  VAL n 
1 657  LEU n 
1 658  ASN n 
1 659  PRO n 
1 660  THR n 
1 661  ASN n 
1 662  ALA n 
1 663  ASP n 
1 664  ILE n 
1 665  LEU n 
1 666  ILE n 
1 667  GLU n 
1 668  THR n 
1 669  LYS n 
1 670  LEU n 
1 671  VAL n 
1 672  LEU n 
1 673  SER n 
1 674  ARG n 
1 675  PHE n 
1 676  GLU n 
1 677  PHE n 
1 678  GLU n 
1 679  GLY n 
1 680  VAL n 
1 681  SER n 
1 682  THR n 
1 683  GLY n 
1 684  GLU n 
1 685  ASN n 
1 686  ALA n 
1 687  LEU n 
1 688  GLU n 
1 689  ALA n 
1 690  GLY n 
1 691  GLU n 
1 692  ASP n 
1 693  GLU n 
1 694  GLU n 
1 695  GLU n 
1 696  VAL n 
1 697  TRP n 
1 698  LEU n 
1 699  PHE n 
1 700  TRP n 
1 701  ARG n 
1 702  ASP n 
1 703  SER n 
1 704  ASN n 
1 705  LYS n 
1 706  GLU n 
1 707  ILE n 
1 708  ARG n 
1 709  SER n 
1 710  LYS n 
1 711  SER n 
1 712  VAL n 
1 713  ARG n 
1 714  GLU n 
1 715  LEU n 
1 716  ALA n 
1 717  GLN n 
1 718  ASP n 
1 719  ALA n 
1 720  LYS n 
1 721  GLU n 
1 722  GLY n 
1 723  GLN n 
1 724  LYS n 
1 725  GLU n 
1 726  ASP n 
1 727  ARG n 
1 728  ASP n 
1 729  ILE n 
1 730  LEU n 
1 731  SER n 
1 732  TYR n 
1 733  TYR n 
1 734  ARG n 
1 735  TYR n 
1 736  GLN n 
1 737  LEU n 
1 738  ASN n 
1 739  LEU n 
1 740  PHE n 
1 741  ALA n 
1 742  ARG n 
1 743  MET n 
1 744  CYS n 
1 745  LEU n 
1 746  ASP n 
1 747  ARG n 
1 748  GLN n 
1 749  TYR n 
1 750  LEU n 
1 751  ALA n 
1 752  ILE n 
1 753  ASN n 
1 754  GLU n 
1 755  ILE n 
1 756  SER n 
1 757  GLY n 
1 758  GLN n 
1 759  LEU n 
1 760  ASP n 
1 761  VAL n 
1 762  ASP n 
1 763  LEU n 
1 764  ILE n 
1 765  LEU n 
1 766  ARG n 
1 767  CYS n 
1 768  MET n 
1 769  SER n 
1 770  ASP n 
1 771  GLU n 
1 772  ASN n 
1 773  LEU n 
1 774  PRO n 
1 775  TYR n 
1 776  ASP n 
1 777  LEU n 
1 778  ARG n 
1 779  ALA n 
1 780  SER n 
1 781  PHE n 
1 782  CYS n 
1 783  ARG n 
1 784  LEU n 
1 785  MET n 
1 786  LEU n 
1 787  HIS n 
1 788  MET n 
1 789  HIS n 
1 790  VAL n 
1 791  ASP n 
1 792  ARG n 
1 793  ASP n 
1 794  PRO n 
1 795  GLN n 
1 796  GLU n 
1 797  GLN n 
1 798  VAL n 
1 799  THR n 
1 800  PRO n 
1 801  VAL n 
1 802  LYS n 
1 803  TYR n 
1 804  ALA n 
1 805  ARG n 
1 806  LEU n 
1 807  TRP n 
1 808  SER n 
1 809  GLU n 
1 810  ILE n 
1 811  PRO n 
1 812  SER n 
1 813  GLU n 
1 814  ILE n 
1 815  ALA n 
1 816  ILE n 
1 817  ASP n 
1 818  ASP n 
1 819  TYR n 
1 820  ASP n 
1 821  SER n 
1 822  SER n 
1 823  GLY n 
1 824  THR n 
1 825  SER n 
1 826  LYS n 
1 827  ASP n 
1 828  GLU n 
1 829  ILE n 
1 830  LYS n 
1 831  GLU n 
1 832  ARG n 
1 833  PHE n 
1 834  ALA n 
1 835  GLN n 
1 836  THR n 
1 837  MET n 
1 838  GLU n 
1 839  PHE n 
1 840  VAL n 
1 841  GLU n 
1 842  GLU n 
1 843  TYR n 
1 844  LEU n 
1 845  ARG n 
1 846  ASP n 
1 847  VAL n 
1 848  VAL n 
1 849  CYS n 
1 850  GLN n 
1 851  ARG n 
1 852  PHE n 
1 853  PRO n 
1 854  PHE n 
1 855  SER n 
1 856  ASP n 
1 857  LYS n 
1 858  GLU n 
1 859  LYS n 
1 860  ASN n 
1 861  LYS n 
1 862  LEU n 
1 863  THR n 
1 864  PHE n 
1 865  GLU n 
1 866  VAL n 
1 867  VAL n 
1 868  ASN n 
1 869  LEU n 
1 870  ALA n 
1 871  ARG n 
1 872  ASN n 
1 873  LEU n 
1 874  ILE n 
1 875  TYR n 
1 876  PHE n 
1 877  GLY n 
1 878  PHE n 
1 879  TYR n 
1 880  ASN n 
1 881  PHE n 
1 882  SER n 
1 883  ASP n 
1 884  LEU n 
1 885  LEU n 
1 886  ARG n 
1 887  LEU n 
1 888  THR n 
1 889  LYS n 
1 890  ILE n 
1 891  LEU n 
1 892  LEU n 
1 893  ALA n 
1 894  ILE n 
1 895  LEU n 
1 896  ASP n 
1 897  CYS n 
1 898  VAL n 
1 899  HIS n 
1 900  VAL n 
1 901  THR n 
1 902  THR n 
1 903  ILE n 
1 904  PHE n 
1 905  PRO n 
1 906  ILE n 
1 907  SER n 
1 908  LYS n 
1 909  MET n 
1 910  THR n 
1 911  LYS n 
1 912  GLY n 
1 913  GLU n 
1 914  GLU n 
1 915  ASN n 
1 916  LYS n 
1 917  GLY n 
1 918  SER n 
1 919  ASN n 
1 920  VAL n 
1 921  MET n 
1 922  ARG n 
1 923  SER n 
1 924  ILE n 
1 925  HIS n 
1 926  GLY n 
1 927  VAL n 
1 928  GLY n 
1 929  GLU n 
1 930  LEU n 
1 931  MET n 
1 932  THR n 
1 933  GLN n 
1 934  VAL n 
1 935  VAL n 
1 936  LEU n 
1 937  ARG n 
1 938  GLY n 
1 939  GLY n 
1 940  GLY n 
1 941  PHE n 
1 942  LEU n 
1 943  PRO n 
1 944  MET n 
1 945  THR n 
1 946  PRO n 
1 947  MET n 
1 948  ALA n 
1 949  ALA n 
1 950  ALA n 
1 951  PRO n 
1 952  GLU n 
1 953  GLY n 
1 954  ASN n 
1 955  VAL n 
1 956  LYS n 
1 957  GLN n 
1 958  ALA n 
1 959  GLU n 
1 960  PRO n 
1 961  GLU n 
1 962  LYS n 
1 963  GLU n 
1 964  ASP n 
1 965  ILE n 
1 966  MET n 
1 967  VAL n 
1 968  MET n 
1 969  ASP n 
1 970  THR n 
1 971  LYS n 
1 972  LEU n 
1 973  LYS n 
1 974  ILE n 
1 975  ILE n 
1 976  GLU n 
1 977  ILE n 
1 978  LEU n 
1 979  GLN n 
1 980  PHE n 
1 981  ILE n 
1 982  LEU n 
1 983  ASN n 
1 984  VAL n 
1 985  ARG n 
1 986  LEU n 
1 987  ASP n 
1 988  TYR n 
1 989  ARG n 
1 990  ILE n 
1 991  SER n 
1 992  CYS n 
1 993  LEU n 
1 994  LEU n 
1 995  CYS n 
1 996  ILE n 
1 997  PHE n 
1 998  LYS n 
1 999  ARG n 
1 1000 GLU n 
1 1001 PHE n 
1 1002 ASP n 
1 1003 GLU n 
1 1004 SER n 
1 1005 ASN n 
1 1006 SER n 
1 1007 GLN n 
1 1008 SER n 
1 1009 SER n 
1 1010 GLU n 
1 1011 THR n 
1 1012 SER n 
1 1013 SER n 
1 1014 GLY n 
1 1015 ASN n 
1 1016 SER n 
1 1017 SER n 
1 1018 GLN n 
1 1019 GLU n 
1 1020 GLY n 
1 1021 PRO n 
1 1022 SER n 
1 1023 ASN n 
1 1024 VAL n 
1 1025 PRO n 
1 1026 GLY n 
1 1027 ALA n 
1 1028 LEU n 
1 1029 ASP n 
1 1030 PHE n 
1 1031 GLU n 
1 1032 HIS n 
1 1033 ILE n 
1 1034 GLU n 
1 1035 GLU n 
1 1036 GLN n 
1 1037 ALA n 
1 1038 GLU n 
1 1039 GLY n 
1 1040 ILE n 
1 1041 PHE n 
1 1042 GLY n 
1 1043 GLY n 
1 1044 SER n 
1 1045 GLU n 
1 1046 GLU n 
1 1047 ASN n 
1 1048 THR n 
1 1049 PRO n 
1 1050 LEU n 
1 1051 ASP n 
1 1052 LEU n 
1 1053 ASP n 
1 1054 ASP n 
1 1055 HIS n 
1 1056 GLY n 
1 1057 GLY n 
1 1058 ARG n 
1 1059 THR n 
1 1060 PHE n 
1 1061 LEU n 
1 1062 ARG n 
1 1063 VAL n 
1 1064 LEU n 
1 1065 LEU n 
1 1066 HIS n 
1 1067 LEU n 
1 1068 THR n 
1 1069 MET n 
1 1070 HIS n 
1 1071 ASP n 
1 1072 TYR n 
1 1073 PRO n 
1 1074 PRO n 
1 1075 LEU n 
1 1076 VAL n 
1 1077 SER n 
1 1078 GLY n 
1 1079 ALA n 
1 1080 LEU n 
1 1081 GLN n 
1 1082 LEU n 
1 1083 LEU n 
1 1084 PHE n 
1 1085 ARG n 
1 1086 HIS n 
1 1087 PHE n 
1 1088 SER n 
1 1089 GLN n 
1 1090 ARG n 
1 1091 GLN n 
1 1092 GLU n 
1 1093 VAL n 
1 1094 LEU n 
1 1095 GLN n 
1 1096 ALA n 
1 1097 PHE n 
1 1098 LYS n 
1 1099 GLN n 
1 1100 VAL n 
1 1101 GLN n 
1 1102 LEU n 
1 1103 LEU n 
1 1104 VAL n 
1 1105 THR n 
1 1106 SER n 
1 1107 GLN n 
1 1108 ASP n 
1 1109 VAL n 
1 1110 ASP n 
1 1111 ASN n 
1 1112 TYR n 
1 1113 LYS n 
1 1114 GLN n 
1 1115 ILE n 
1 1116 LYS n 
1 1117 GLN n 
1 1118 ASP n 
1 1119 LEU n 
1 1120 ASP n 
1 1121 GLN n 
1 1122 LEU n 
1 1123 ARG n 
1 1124 SER n 
1 1125 ILE n 
1 1126 VAL n 
1 1127 GLU n 
1 1128 LYS n 
1 1129 SER n 
1 1130 GLU n 
1 1131 LEU n 
1 1132 TRP n 
1 1133 VAL n 
1 1134 TYR n 
1 1135 LYS n 
1 1136 GLY n 
1 1137 GLN n 
1 1138 GLY n 
1 1139 PRO n 
1 1140 ASP n 
1 1141 GLU n 
1 1142 PRO n 
1 1143 MET n 
1 1144 ASP n 
1 1145 GLY n 
1 1146 ALA n 
1 1147 SER n 
1 1148 GLY n 
1 1149 GLU n 
1 1150 ASN n 
1 1151 GLU n 
1 1152 HIS n 
1 1153 LYS n 
1 1154 LYS n 
1 1155 THR n 
1 1156 GLU n 
1 1157 GLU n 
1 1158 GLY n 
1 1159 THR n 
1 1160 SER n 
1 1161 LYS n 
1 1162 PRO n 
1 1163 LEU n 
1 1164 LYS n 
1 1165 HIS n 
1 1166 GLU n 
1 1167 SER n 
1 1168 THR n 
1 1169 SER n 
1 1170 SER n 
1 1171 TYR n 
1 1172 ASN n 
1 1173 TYR n 
1 1174 ARG n 
1 1175 VAL n 
1 1176 VAL n 
1 1177 LYS n 
1 1178 GLU n 
1 1179 ILE n 
1 1180 LEU n 
1 1181 ILE n 
1 1182 ARG n 
1 1183 LEU n 
1 1184 SER n 
1 1185 LYS n 
1 1186 LEU n 
1 1187 CYS n 
1 1188 VAL n 
1 1189 GLN n 
1 1190 GLU n 
1 1191 SER n 
1 1192 ALA n 
1 1193 SER n 
1 1194 VAL n 
1 1195 ARG n 
1 1196 LYS n 
1 1197 SER n 
1 1198 ARG n 
1 1199 LYS n 
1 1200 GLN n 
1 1201 GLN n 
1 1202 GLN n 
1 1203 ARG n 
1 1204 LEU n 
1 1205 LEU n 
1 1206 ARG n 
1 1207 ASN n 
1 1208 MET n 
1 1209 GLY n 
1 1210 ALA n 
1 1211 HIS n 
1 1212 ALA n 
1 1213 VAL n 
1 1214 VAL n 
1 1215 LEU n 
1 1216 GLU n 
1 1217 LEU n 
1 1218 LEU n 
1 1219 GLN n 
1 1220 ILE n 
1 1221 PRO n 
1 1222 TYR n 
1 1223 GLU n 
1 1224 LYS n 
1 1225 ALA n 
1 1226 GLU n 
1 1227 ASP n 
1 1228 THR n 
1 1229 LYS n 
1 1230 MET n 
1 1231 GLN n 
1 1232 GLU n 
1 1233 ILE n 
1 1234 MET n 
1 1235 ARG n 
1 1236 LEU n 
1 1237 ALA n 
1 1238 HIS n 
1 1239 GLU n 
1 1240 PHE n 
1 1241 LEU n 
1 1242 GLN n 
1 1243 ASN n 
1 1244 PHE n 
1 1245 CYS n 
1 1246 ALA n 
1 1247 GLY n 
1 1248 ASN n 
1 1249 GLN n 
1 1250 GLN n 
1 1251 ASN n 
1 1252 GLN n 
1 1253 ALA n 
1 1254 LEU n 
1 1255 LEU n 
1 1256 HIS n 
1 1257 LYS n 
1 1258 HIS n 
1 1259 ILE n 
1 1260 ASN n 
1 1261 LEU n 
1 1262 PHE n 
1 1263 LEU n 
1 1264 ASN n 
1 1265 PRO n 
1 1266 GLY n 
1 1267 ILE n 
1 1268 LEU n 
1 1269 GLU n 
1 1270 ALA n 
1 1271 VAL n 
1 1272 THR n 
1 1273 MET n 
1 1274 GLN n 
1 1275 HIS n 
1 1276 ILE n 
1 1277 PHE n 
1 1278 MET n 
1 1279 ASN n 
1 1280 ASN n 
1 1281 PHE n 
1 1282 GLN n 
1 1283 LEU n 
1 1284 CYS n 
1 1285 SER n 
1 1286 GLU n 
1 1287 ILE n 
1 1288 ASN n 
1 1289 GLU n 
1 1290 ARG n 
1 1291 VAL n 
1 1292 VAL n 
1 1293 GLN n 
1 1294 HIS n 
1 1295 PHE n 
1 1296 VAL n 
1 1297 HIS n 
1 1298 CYS n 
1 1299 ILE n 
1 1300 GLU n 
1 1301 THR n 
1 1302 HIS n 
1 1303 GLY n 
1 1304 ARG n 
1 1305 ASN n 
1 1306 VAL n 
1 1307 GLN n 
1 1308 TYR n 
1 1309 ILE n 
1 1310 LYS n 
1 1311 PHE n 
1 1312 LEU n 
1 1313 GLN n 
1 1314 THR n 
1 1315 ILE n 
1 1316 VAL n 
1 1317 LYS n 
1 1318 ALA n 
1 1319 GLU n 
1 1320 GLY n 
1 1321 LYS n 
1 1322 PHE n 
1 1323 ILE n 
1 1324 LYS n 
1 1325 LYS n 
1 1326 CYS n 
1 1327 GLN n 
1 1328 ASP n 
1 1329 MET n 
1 1330 VAL n 
1 1331 MET n 
1 1332 ALA n 
1 1333 GLU n 
1 1334 LEU n 
1 1335 VAL n 
1 1336 ASN n 
1 1337 SER n 
1 1338 GLY n 
1 1339 GLU n 
1 1340 ASP n 
1 1341 VAL n 
1 1342 LEU n 
1 1343 VAL n 
1 1344 PHE n 
1 1345 TYR n 
1 1346 ASN n 
1 1347 ASP n 
1 1348 ARG n 
1 1349 ALA n 
1 1350 SER n 
1 1351 PHE n 
1 1352 GLN n 
1 1353 THR n 
1 1354 LEU n 
1 1355 ILE n 
1 1356 GLN n 
1 1357 MET n 
1 1358 MET n 
1 1359 ARG n 
1 1360 SER n 
1 1361 GLU n 
1 1362 ARG n 
1 1363 ASP n 
1 1364 ARG n 
1 1365 MET n 
1 1366 ASP n 
1 1367 GLU n 
1 1368 ASN n 
1 1369 SER n 
1 1370 PRO n 
1 1371 LEU n 
1 1372 MET n 
1 1373 TYR n 
1 1374 HIS n 
1 1375 ILE n 
1 1376 HIS n 
1 1377 LEU n 
1 1378 VAL n 
1 1379 GLU n 
1 1380 LEU n 
1 1381 LEU n 
1 1382 ALA n 
1 1383 VAL n 
1 1384 CYS n 
1 1385 THR n 
1 1386 GLU n 
1 1387 GLY n 
1 1388 LYS n 
1 1389 ASN n 
1 1390 VAL n 
1 1391 TYR n 
1 1392 THR n 
1 1393 GLU n 
1 1394 ILE n 
1 1395 LYS n 
1 1396 CYS n 
1 1397 ASN n 
1 1398 SER n 
1 1399 LEU n 
1 1400 LEU n 
1 1401 PRO n 
1 1402 LEU n 
1 1403 ASP n 
1 1404 ASP n 
1 1405 ILE n 
1 1406 VAL n 
1 1407 ARG n 
1 1408 VAL n 
1 1409 VAL n 
1 1410 THR n 
1 1411 HIS n 
1 1412 GLU n 
1 1413 ASP n 
1 1414 CYS n 
1 1415 ILE n 
1 1416 PRO n 
1 1417 GLU n 
1 1418 VAL n 
1 1419 LYS n 
1 1420 ILE n 
1 1421 ALA n 
1 1422 TYR n 
1 1423 ILE n 
1 1424 ASN n 
1 1425 PHE n 
1 1426 LEU n 
1 1427 ASN n 
1 1428 HIS n 
1 1429 CYS n 
1 1430 TYR n 
1 1431 VAL n 
1 1432 ASP n 
1 1433 THR n 
1 1434 GLU n 
1 1435 VAL n 
1 1436 GLU n 
1 1437 MET n 
1 1438 LYS n 
1 1439 GLU n 
1 1440 ILE n 
1 1441 TYR n 
1 1442 THR n 
1 1443 SER n 
1 1444 ASN n 
1 1445 HIS n 
1 1446 MET n 
1 1447 TRP n 
1 1448 LYS n 
1 1449 LEU n 
1 1450 PHE n 
1 1451 GLU n 
1 1452 ASN n 
1 1453 PHE n 
1 1454 LEU n 
1 1455 VAL n 
1 1456 ASP n 
1 1457 ILE n 
1 1458 CYS n 
1 1459 ARG n 
1 1460 ALA n 
1 1461 CYS n 
1 1462 ASN n 
1 1463 ASN n 
1 1464 THR n 
1 1465 SER n 
1 1466 ASP n 
1 1467 ARG n 
1 1468 LYS n 
1 1469 HIS n 
1 1470 ALA n 
1 1471 ASP n 
1 1472 SER n 
1 1473 ILE n 
1 1474 LEU n 
1 1475 GLU n 
1 1476 LYS n 
1 1477 TYR n 
1 1478 VAL n 
1 1479 THR n 
1 1480 GLU n 
1 1481 ILE n 
1 1482 VAL n 
1 1483 MET n 
1 1484 SER n 
1 1485 ILE n 
1 1486 VAL n 
1 1487 THR n 
1 1488 THR n 
1 1489 PHE n 
1 1490 PHE n 
1 1491 SER n 
1 1492 SER n 
1 1493 PRO n 
1 1494 PHE n 
1 1495 SER n 
1 1496 ASP n 
1 1497 GLN n 
1 1498 SER n 
1 1499 THR n 
1 1500 THR n 
1 1501 LEU n 
1 1502 GLN n 
1 1503 THR n 
1 1504 ARG n 
1 1505 GLN n 
1 1506 PRO n 
1 1507 VAL n 
1 1508 PHE n 
1 1509 VAL n 
1 1510 GLN n 
1 1511 LEU n 
1 1512 LEU n 
1 1513 GLN n 
1 1514 GLY n 
1 1515 VAL n 
1 1516 PHE n 
1 1517 ARG n 
1 1518 VAL n 
1 1519 TYR n 
1 1520 HIS n 
1 1521 CYS n 
1 1522 ASN n 
1 1523 TRP n 
1 1524 LEU n 
1 1525 MET n 
1 1526 PRO n 
1 1527 SER n 
1 1528 GLN n 
1 1529 LYS n 
1 1530 ALA n 
1 1531 SER n 
1 1532 VAL n 
1 1533 GLU n 
1 1534 SER n 
1 1535 CYS n 
1 1536 ILE n 
1 1537 ARG n 
1 1538 VAL n 
1 1539 LEU n 
1 1540 SER n 
1 1541 ASP n 
1 1542 VAL n 
1 1543 ALA n 
1 1544 LYS n 
1 1545 SER n 
1 1546 ARG n 
1 1547 ALA n 
1 1548 ILE n 
1 1549 ALA n 
1 1550 ILE n 
1 1551 PRO n 
1 1552 VAL n 
1 1553 ASP n 
1 1554 LEU n 
1 1555 ASP n 
1 1556 SER n 
1 1557 GLN n 
1 1558 VAL n 
1 1559 ASN n 
1 1560 ASN n 
1 1561 LEU n 
1 1562 PHE n 
1 1563 LEU n 
1 1564 LYS n 
1 1565 SER n 
1 1566 HIS n 
1 1567 ASN n 
1 1568 ILE n 
1 1569 VAL n 
1 1570 GLN n 
1 1571 LYS n 
1 1572 THR n 
1 1573 ALA n 
1 1574 LEU n 
1 1575 ASN n 
1 1576 TRP n 
1 1577 ARG n 
1 1578 LEU n 
1 1579 SER n 
1 1580 ALA n 
1 1581 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   1581 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Itpr1, Insp3r, Pcd6, Pcp1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      Spodoptera 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7106 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITPR1_MOUSE 
_struct_ref.pdbx_db_accession          P11881 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKLCPMNRYSAQKQFWKAAKPGA
NSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSW
FYIQPFYKLRSIGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEVDP
DFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVH
STNIPIDKEEEKPVMLKIGTSPLKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYRVL
RHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVS
MNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDILSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQEQVTP
VKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYN
FSDLLRLTKILLAILDCVHVTTIFPISKMTKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQSSETSSGNSSQEGPSNVPGALDFEHIEEQAEGI
FGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLD
QLRSIVEKSELWVYKGQGPDEPMDGASGENEHKKTEEGTSKPLKHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNPGILEAVTMQHIFMNN
FQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRS
ERDRMDENSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTRQPVFVQLLQGVFRVYH
CNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKSHNIVQKTALNWRLSAR
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5XA0 A 1 ? 1581 ? P11881 1 ? 1581 ? 1 1581 
2 1 5XA0 B 1 ? 1581 ? P11881 1 ? 1581 ? 1 1581 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5XA0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.19 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         70.65 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'lithium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX225HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-01-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL26B2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL26B2 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5XA0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                5.81 
_reflns.d_resolution_low                 48.8 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       16347 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.27 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  5.812 
_reflns_shell.d_res_low                   6.02 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.22 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1614 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.5702 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             8.0 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5XA0 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     16347 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.48 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.807 
_refine.ls_d_res_high                            5.812 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_R_factor_obs                          0.2861 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2780 
_refine.ls_R_factor_R_free                       0.3417 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  818 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      '5X9Z chain A and 3UJ4 chain A' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            . 
_refine.pdbx_overall_phase_error                 28.33 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14949 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               14949 
_refine_hist.d_res_high                       5.812 
_refine_hist.d_res_low                        48.807 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.014  ? ? 15076 'X-RAY DIFFRACTION' ? 
f_angle_d          1.779  ? ? 20752 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.639 ? ? 8967  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.065  ? ? 2677  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.012  ? ? 2825  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 5.8127  6.1763  2562 0.1940 95.00 0.2629 . . 135 . . 
'X-RAY DIFFRACTION' . 6.1763  6.6520  2590 0.2037 95.00 0.2524 . . 137 . . 
'X-RAY DIFFRACTION' . 6.6520  7.3194  2577 0.2076 95.00 0.2792 . . 135 . . 
'X-RAY DIFFRACTION' . 7.3194  8.3739  2580 0.2338 95.00 0.3007 . . 136 . . 
'X-RAY DIFFRACTION' . 8.3739  10.5327 2608 0.2801 95.00 0.3404 . . 137 . . 
'X-RAY DIFFRACTION' . 10.5327 48.7043 2607 0.3810 95.00 0.4372 . . 138 . . 
# 
_struct.entry_id                     5XA0 
_struct.title                        'Crystal structure of inositol 1,4,5-trisphosphate receptor cytosolic domain' 
_struct.pdbx_descriptor              'Inositol 1,4,5-trisphosphate receptor type 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5XA0 
_struct_keywords.text            'receptor channel calcium, METAL TRANSPORT' 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 21   ? ASN A 24   ? GLY A 21   ASN A 24   5 ? 4  
HELX_P HELX_P2   AA2 SER A 67   ? ALA A 76   ? SER A 67   ALA A 76   1 ? 10 
HELX_P HELX_P3   AA3 ALA A 86   ? LEU A 110  ? ALA A 86   LEU A 110  1 ? 25 
HELX_P HELX_P4   AA4 SER A 277  ? LEU A 281  ? SER A 277  LEU A 281  5 ? 5  
HELX_P HELX_P5   AA5 ASP A 363  ? SER A 366  ? ASP A 363  SER A 366  5 ? 4  
HELX_P HELX_P6   AA6 SER A 436  ? GLY A 463  ? SER A 436  GLY A 463  1 ? 28 
HELX_P HELX_P7   AA7 THR A 466  ? VAL A 484  ? THR A 466  VAL A 484  1 ? 19 
HELX_P HELX_P8   AA8 ASN A 503  ? GLN A 513  ? ASN A 503  GLN A 513  1 ? 11 
HELX_P HELX_P9   AA9 ILE A 515  ? LEU A 523  ? ILE A 515  LEU A 523  1 ? 9  
HELX_P HELX_P10  AB1 ILE A 552  ? SER A 563  ? ILE A 552  SER A 563  1 ? 12 
HELX_P HELX_P11  AB2 LYS A 569  ? LYS A 576  ? LYS A 569  LYS A 576  5 ? 8  
HELX_P HELX_P12  AB3 GLN A 577  ? ASP A 588  ? GLN A 577  ASP A 588  1 ? 12 
HELX_P HELX_P13  AB4 VAL A 589  ? ASN A 602  ? VAL A 589  ASN A 602  1 ? 14 
HELX_P HELX_P14  AB5 LYS A 608  ? ARG A 626  ? LYS A 608  ARG A 626  1 ? 19 
HELX_P HELX_P15  AB6 PRO A 628  ? CYS A 638  ? PRO A 628  CYS A 638  1 ? 11 
HELX_P HELX_P16  AB7 SER A 640  ? ASN A 658  ? SER A 640  ASN A 658  1 ? 19 
HELX_P HELX_P17  AB8 THR A 668  ? GLY A 679  ? THR A 668  GLY A 679  1 ? 12 
HELX_P HELX_P18  AB9 ASN A 685  ? ASP A 702  ? ASN A 685  ASP A 702  1 ? 18 
HELX_P HELX_P19  AC1 SER A 709  ? GLU A 714  ? SER A 709  GLU A 714  1 ? 6  
HELX_P HELX_P20  AC2 GLU A 725  ? GLN A 736  ? GLU A 725  GLN A 736  1 ? 12 
HELX_P HELX_P21  AC3 TYR A 749  ? LEU A 759  ? TYR A 749  LEU A 759  1 ? 11 
HELX_P HELX_P22  AC4 ASP A 762  ? LEU A 773  ? ASP A 762  LEU A 773  1 ? 12 
HELX_P HELX_P23  AC5 TYR A 775  ? MET A 788  ? TYR A 775  MET A 788  1 ? 14 
HELX_P HELX_P24  AC6 ILE A 829  ? CYS A 849  ? ILE A 829  CYS A 849  1 ? 21 
HELX_P HELX_P25  AC7 SER A 855  ? GLY A 877  ? SER A 855  GLY A 877  1 ? 23 
HELX_P HELX_P26  AC8 SER A 882  ? CYS A 897  ? SER A 882  CYS A 897  1 ? 16 
HELX_P HELX_P27  AC9 PRO A 960  ? GLU A 963  ? PRO A 960  GLU A 963  5 ? 4  
HELX_P HELX_P28  AD1 ASP A 964  ? ARG A 989  ? ASP A 964  ARG A 989  1 ? 26 
HELX_P HELX_P29  AD2 SER A 991  ? PHE A 997  ? SER A 991  PHE A 997  1 ? 7  
HELX_P HELX_P30  AD3 ASP A 1029 ? GLU A 1031 ? ASP A 1029 GLU A 1031 5 ? 3  
HELX_P HELX_P31  AD4 HIS A 1032 ? SER A 1044 ? HIS A 1032 SER A 1044 1 ? 13 
HELX_P HELX_P32  AD5 PRO A 1049 ? ASP A 1054 ? PRO A 1049 ASP A 1054 1 ? 6  
HELX_P HELX_P33  AD6 PHE A 1060 ? LEU A 1067 ? PHE A 1060 LEU A 1067 1 ? 8  
HELX_P HELX_P34  AD7 LEU A 1075 ? ARG A 1085 ? LEU A 1075 ARG A 1085 1 ? 11 
HELX_P HELX_P35  AD8 HIS A 1086 ? SER A 1088 ? HIS A 1086 SER A 1088 5 ? 3  
HELX_P HELX_P36  AD9 LEU A 1094 ? LEU A 1103 ? LEU A 1094 LEU A 1103 1 ? 10 
HELX_P HELX_P37  AE1 GLN A 1107 ? LYS A 1116 ? GLN A 1107 LYS A 1116 1 ? 10 
HELX_P HELX_P38  AE2 ASP A 1118 ? TRP A 1132 ? ASP A 1118 TRP A 1132 1 ? 15 
HELX_P HELX_P39  AE3 LYS A 1177 ? ALA A 1192 ? LYS A 1177 ALA A 1192 1 ? 16 
HELX_P HELX_P40  AE4 ARG A 1195 ? GLN A 1200 ? ARG A 1195 GLN A 1200 1 ? 6  
HELX_P HELX_P41  AE5 ASN A 1207 ? ALA A 1212 ? ASN A 1207 ALA A 1212 1 ? 6  
HELX_P HELX_P42  AE6 ALA A 1212 ? ILE A 1220 ? ALA A 1212 ILE A 1220 1 ? 9  
HELX_P HELX_P43  AE7 MET A 1234 ? GLU A 1239 ? MET A 1234 GLU A 1239 1 ? 6  
HELX_P HELX_P44  AE8 THR A 1272 ? CYS A 1284 ? THR A 1272 CYS A 1284 1 ? 13 
HELX_P HELX_P45  AE9 VAL A 1291 ? CYS A 1298 ? VAL A 1291 CYS A 1298 1 ? 8  
HELX_P HELX_P46  AF1 GLY A 1303 ? LYS A 1310 ? GLY A 1303 LYS A 1310 1 ? 8  
HELX_P HELX_P47  AF2 LEU A 1312 ? LYS A 1321 ? LEU A 1312 LYS A 1321 1 ? 10 
HELX_P HELX_P48  AF3 ILE A 1323 ? VAL A 1335 ? ILE A 1323 VAL A 1335 1 ? 13 
HELX_P HELX_P49  AF4 GLN A 1356 ? ARG A 1362 ? GLN A 1356 ARG A 1362 1 ? 7  
HELX_P HELX_P50  AF5 MET A 1372 ? CYS A 1384 ? MET A 1372 CYS A 1384 1 ? 13 
HELX_P HELX_P51  AF6 GLY A 1387 ? THR A 1392 ? GLY A 1387 THR A 1392 1 ? 6  
HELX_P HELX_P52  AF7 LEU A 1400 ? ASP A 1413 ? LEU A 1400 ASP A 1413 1 ? 14 
HELX_P HELX_P53  AF8 GLU A 1417 ? ASP A 1432 ? GLU A 1417 ASP A 1432 1 ? 16 
HELX_P HELX_P54  AF9 VAL A 1435 ? TYR A 1441 ? VAL A 1435 TYR A 1441 1 ? 7  
HELX_P HELX_P55  AG1 LYS A 1448 ? LEU A 1454 ? LYS A 1448 LEU A 1454 1 ? 7  
HELX_P HELX_P56  AG2 ASP A 1471 ? PHE A 1489 ? ASP A 1471 PHE A 1489 1 ? 19 
HELX_P HELX_P57  AG3 TYR B 66   ? TRP B 73   ? TYR B 66   TRP B 73   1 ? 8  
HELX_P HELX_P58  AG4 ALA B 86   ? ASN B 107  ? ALA B 86   ASN B 107  1 ? 22 
HELX_P HELX_P59  AG5 ASN B 156  ? SER B 159  ? ASN B 156  SER B 159  5 ? 4  
HELX_P HELX_P60  AG6 SER B 436  ? GLY B 463  ? SER B 436  GLY B 463  1 ? 28 
HELX_P HELX_P61  AG7 THR B 466  ? PHE B 483  ? THR B 466  PHE B 483  1 ? 18 
HELX_P HELX_P62  AG8 ASN B 503  ? GLN B 513  ? ASN B 503  GLN B 513  1 ? 11 
HELX_P HELX_P63  AG9 ASN B 514  ? LEU B 522  ? ASN B 514  LEU B 522  1 ? 9  
HELX_P HELX_P64  AH1 ILE B 552  ? GLN B 565  ? ILE B 552  GLN B 565  1 ? 14 
HELX_P HELX_P65  AH2 LYS B 569  ? ILE B 574  ? LYS B 569  ILE B 574  1 ? 6  
HELX_P HELX_P66  AH3 GLN B 577  ? GLY B 579  ? GLN B 577  GLY B 579  5 ? 3  
HELX_P HELX_P67  AH4 PHE B 580  ? GLY B 586  ? PHE B 580  GLY B 586  1 ? 7  
HELX_P HELX_P68  AH5 ALA B 591  ? ARG B 603  ? ALA B 591  ARG B 603  1 ? 13 
HELX_P HELX_P69  AH6 LEU B 605  ? ASN B 625  ? LEU B 605  ASN B 625  1 ? 21 
HELX_P HELX_P70  AH7 ARG B 629  ? CYS B 638  ? ARG B 629  CYS B 638  1 ? 10 
HELX_P HELX_P71  AH8 LYS B 643  ? ASN B 658  ? LYS B 643  ASN B 658  1 ? 16 
HELX_P HELX_P72  AH9 GLU B 667  ? VAL B 680  ? GLU B 667  VAL B 680  1 ? 14 
HELX_P HELX_P73  AI1 ALA B 689  ? ARG B 701  ? ALA B 689  ARG B 701  1 ? 13 
HELX_P HELX_P74  AI2 ARG B 708  ? ARG B 713  ? ARG B 708  ARG B 713  1 ? 6  
HELX_P HELX_P75  AI3 ASP B 718  ? GLY B 722  ? ASP B 718  GLY B 722  5 ? 5  
HELX_P HELX_P76  AI4 ASP B 726  ? TYR B 735  ? ASP B 726  TYR B 735  1 ? 10 
HELX_P HELX_P77  AI5 LEU B 750  ? GLN B 758  ? LEU B 750  GLN B 758  1 ? 9  
HELX_P HELX_P78  AI6 LEU B 759  ? VAL B 761  ? LEU B 759  VAL B 761  5 ? 3  
HELX_P HELX_P79  AI7 ASP B 762  ? ASN B 772  ? ASP B 762  ASN B 772  1 ? 11 
HELX_P HELX_P80  AI8 TYR B 775  ? MET B 788  ? TYR B 775  MET B 788  1 ? 14 
HELX_P HELX_P81  AI9 LYS B 826  ? ASP B 846  ? LYS B 826  ASP B 846  1 ? 21 
HELX_P HELX_P82  AJ1 VAL B 847  ? CYS B 849  ? VAL B 847  CYS B 849  5 ? 3  
HELX_P HELX_P83  AJ2 ARG B 851  ? ASP B 856  ? ARG B 851  ASP B 856  1 ? 6  
HELX_P HELX_P84  AJ3 LYS B 857  ? GLY B 877  ? LYS B 857  GLY B 877  1 ? 21 
HELX_P HELX_P85  AJ4 SER B 882  ? ALA B 893  ? SER B 882  ALA B 893  1 ? 12 
HELX_P HELX_P86  AJ5 ASP B 964  ? LEU B 986  ? ASP B 964  LEU B 986  1 ? 23 
HELX_P HELX_P87  AJ6 CYS B 992  ? LYS B 998  ? CYS B 992  LYS B 998  1 ? 7  
HELX_P HELX_P88  AJ7 LEU B 1028 ? GLU B 1045 ? LEU B 1028 GLU B 1045 1 ? 18 
HELX_P HELX_P89  AJ8 PHE B 1060 ? THR B 1068 ? PHE B 1060 THR B 1068 1 ? 9  
HELX_P HELX_P90  AJ9 LEU B 1075 ? HIS B 1086 ? LEU B 1075 HIS B 1086 1 ? 12 
HELX_P HELX_P91  AK1 LEU B 1094 ? LEU B 1102 ? LEU B 1094 LEU B 1102 1 ? 9  
HELX_P HELX_P92  AK2 ASP B 1108 ? LYS B 1116 ? ASP B 1108 LYS B 1116 1 ? 9  
HELX_P HELX_P93  AK3 LEU B 1119 ? VAL B 1133 ? LEU B 1119 VAL B 1133 1 ? 15 
HELX_P HELX_P94  AK4 LYS B 1177 ? SER B 1191 ? LYS B 1177 SER B 1191 1 ? 15 
HELX_P HELX_P95  AK5 ARG B 1195 ? GLN B 1200 ? ARG B 1195 GLN B 1200 1 ? 6  
HELX_P HELX_P96  AK6 GLN B 1202 ? ARG B 1206 ? GLN B 1202 ARG B 1206 5 ? 5  
HELX_P HELX_P97  AK7 ASN B 1207 ? GLN B 1219 ? ASN B 1207 GLN B 1219 1 ? 13 
HELX_P HELX_P98  AK8 LYS B 1229 ? LEU B 1236 ? LYS B 1229 LEU B 1236 1 ? 8  
HELX_P HELX_P99  AK9 GLN B 1249 ? LEU B 1255 ? GLN B 1249 LEU B 1255 1 ? 7  
HELX_P HELX_P100 AL1 ALA B 1270 ? SER B 1285 ? ALA B 1270 SER B 1285 1 ? 16 
HELX_P HELX_P101 AL2 ARG B 1290 ? GLU B 1300 ? ARG B 1290 GLU B 1300 1 ? 11 
HELX_P HELX_P102 AL3 GLY B 1303 ? LYS B 1310 ? GLY B 1303 LYS B 1310 1 ? 8  
HELX_P HELX_P103 AL4 LEU B 1312 ? GLY B 1320 ? LEU B 1312 GLY B 1320 1 ? 9  
HELX_P HELX_P104 AL5 ILE B 1323 ? ASN B 1336 ? ILE B 1323 ASN B 1336 1 ? 14 
HELX_P HELX_P105 AL6 MET B 1358 ? MET B 1365 ? MET B 1358 MET B 1365 1 ? 8  
HELX_P HELX_P106 AL7 HIS B 1376 ? CYS B 1384 ? HIS B 1376 CYS B 1384 1 ? 9  
HELX_P HELX_P107 AL8 PRO B 1401 ? HIS B 1411 ? PRO B 1401 HIS B 1411 1 ? 11 
HELX_P HELX_P108 AL9 GLU B 1417 ? ASP B 1432 ? GLU B 1417 ASP B 1432 1 ? 16 
HELX_P HELX_P109 AM1 VAL B 1435 ? TYR B 1441 ? VAL B 1435 TYR B 1441 1 ? 7  
HELX_P HELX_P110 AM2 TRP B 1447 ? CYS B 1458 ? TRP B 1447 CYS B 1458 1 ? 12 
HELX_P HELX_P111 AM3 LEU B 1474 ? VAL B 1486 ? LEU B 1474 VAL B 1486 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 666  A . ? ILE 666  A GLU 667  A ? GLU 667  A 1 4.61   
2 ALA 1225 A . ? ALA 1225 A GLU 1226 A ? GLU 1226 A 1 4.51   
3 ASN 1243 A . ? ASN 1243 A PHE 1244 A ? PHE 1244 A 1 -12.96 
4 ILE 666  B . ? ILE 666  B GLU 667  B ? GLU 667  B 1 16.83  
5 LEU 1205 B . ? LEU 1205 B ARG 1206 B ? ARG 1206 B 1 -4.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 4 ? 
AB1 ? 2 ? 
AB2 ? 4 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 17  ? ALA A 19  ? LEU A 17  ALA A 19  
AA1 2 TRP A 218 ? ILE A 220 ? TRP A 218 ILE A 220 
AA2 1 PHE A 26  ? ILE A 27  ? PHE A 26  ILE A 27  
AA2 2 VAL A 39  ? GLN A 40  ? VAL A 39  GLN A 40  
AA3 1 PHE A 58  ? LEU A 60  ? PHE A 58  LEU A 60  
AA3 2 LEU A 123 ? HIS A 125 ? LEU A 123 HIS A 125 
AA4 1 LEU A 132 ? ASN A 135 ? LEU A 132 ASN A 135 
AA4 2 ARG A 148 ? LEU A 151 ? ARG A 148 LEU A 151 
AA5 1 ILE A 163 ? GLN A 164 ? ILE A 163 GLN A 164 
AA5 2 VAL A 183 ? LEU A 184 ? VAL A 183 LEU A 184 
AA6 1 LEU A 242 ? HIS A 244 ? LEU A 242 HIS A 244 
AA6 2 PHE A 430 ? ILE A 432 ? PHE A 430 ILE A 432 
AA7 1 LEU A 251 ? THR A 252 ? LEU A 251 THR A 252 
AA7 2 PHE A 263 ? LEU A 264 ? PHE A 263 LEU A 264 
AA8 1 GLU A 255 ? HIS A 256 ? GLU A 255 HIS A 256 
AA8 2 LYS A 259 ? GLN A 260 ? LYS A 259 GLN A 260 
AA9 1 VAL A 284 ? GLU A 285 ? VAL A 284 GLU A 285 
AA9 2 ARG A 304 ? HIS A 307 ? ARG A 304 HIS A 307 
AA9 3 HIS A 312 ? ALA A 316 ? HIS A 312 ALA A 316 
AA9 4 LEU A 355 ? SER A 357 ? LEU A 355 SER A 357 
AB1 1 PHE A 368 ? ASP A 371 ? PHE A 368 ASP A 371 
AB1 2 ARG A 389 ? HIS A 392 ? ARG A 389 HIS A 392 
AB2 1 GLN B 122 ? HIS B 125 ? GLN B 122 HIS B 125 
AB2 2 PHE B 58  ? CYS B 61  ? PHE B 58  CYS B 61  
AB2 3 ILE B 14  ? TYR B 18  ? ILE B 14  TYR B 18  
AB2 4 LYS B 219 ? VAL B 221 ? LYS B 219 VAL B 221 
AB3 1 ILE B 27  ? THR B 29  ? ILE B 27  THR B 29  
AB3 2 CYS B 37  ? VAL B 39  ? CYS B 37  VAL B 39  
AB4 1 PHE B 161 ? PRO B 165 ? PHE B 161 PRO B 165 
AB4 2 VAL B 182 ? PRO B 186 ? VAL B 182 PRO B 186 
AB5 1 ASP B 238 ? VAL B 239 ? ASP B 238 VAL B 239 
AB5 2 GLU B 283 ? VAL B 284 ? GLU B 283 VAL B 284 
AB6 1 LEU B 251 ? HIS B 256 ? LEU B 251 HIS B 256 
AB6 2 LYS B 259 ? LEU B 264 ? LYS B 259 LEU B 264 
AB7 1 TYR B 313 ? GLU B 317 ? TYR B 313 GLU B 317 
AB7 2 SER B 354 ? VAL B 358 ? SER B 354 VAL B 358 
AB8 1 LEU B 370 ? ASP B 371 ? LEU B 370 ASP B 371 
AB8 2 ARG B 389 ? LEU B 390 ? ARG B 389 LEU B 390 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N TYR A 18  ? N TYR A 18  O LYS A 219 ? O LYS A 219 
AA2 1 2 N PHE A 26  ? N PHE A 26  O GLN A 40  ? O GLN A 40  
AA3 1 2 N LYS A 59  ? N LYS A 59  O LEU A 124 ? O LEU A 124 
AA4 1 2 N THR A 133 ? N THR A 133 O THR A 150 ? O THR A 150 
AA5 1 2 N GLN A 164 ? N GLN A 164 O VAL A 183 ? O VAL A 183 
AA6 1 2 N PHE A 243 ? N PHE A 243 O ALA A 431 ? O ALA A 431 
AA7 1 2 N THR A 252 ? N THR A 252 O PHE A 263 ? O PHE A 263 
AA8 1 2 N HIS A 256 ? N HIS A 256 O LYS A 259 ? O LYS A 259 
AA9 1 2 N GLU A 285 ? N GLU A 285 O ARG A 304 ? O ARG A 304 
AA9 2 3 N PHE A 305 ? N PHE A 305 O LEU A 314 ? O LEU A 314 
AA9 3 4 N ALA A 315 ? N ALA A 315 O VAL A 356 ? O VAL A 356 
AB1 1 2 N ASP A 371 ? N ASP A 371 O ARG A 389 ? O ARG A 389 
AB2 1 2 O GLN B 122 ? O GLN B 122 N CYS B 61  ? N CYS B 61  
AB2 2 3 O PHE B 58  ? O PHE B 58  N CYS B 15  ? N CYS B 15  
AB2 3 4 N SER B 16  ? N SER B 16  O VAL B 221 ? O VAL B 221 
AB3 1 2 N SER B 28  ? N SER B 28  O VAL B 38  ? O VAL B 38  
AB4 1 2 N TYR B 162 ? N TYR B 162 O ASN B 185 ? O ASN B 185 
AB5 1 2 N ASP B 238 ? N ASP B 238 O VAL B 284 ? O VAL B 284 
AB6 1 2 N THR B 252 ? N THR B 252 O PHE B 263 ? O PHE B 263 
AB7 1 2 N TYR B 313 ? N TYR B 313 O VAL B 358 ? O VAL B 358 
AB8 1 2 N ASP B 371 ? N ASP B 371 O ARG B 389 ? O ARG B 389 
# 
_atom_sites.entry_id                    5XA0 
_atom_sites.fract_transf_matrix[1][1]   0.007803 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007803 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002706 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . SER A 1 7    ? 67.021  -30.741 11.719  1.00 8.96   ? 7    SER A N   1 
ATOM 2     C CA  . SER A 1 7    ? 66.025  -30.318 12.693  1.00 8.78   ? 7    SER A CA  1 
ATOM 3     C C   . SER A 1 7    ? 65.875  -31.281 13.840  1.00 8.78   ? 7    SER A C   1 
ATOM 4     O O   . SER A 1 7    ? 65.016  -32.151 13.853  1.00 8.78   ? 7    SER A O   1 
ATOM 5     C CB  . SER A 1 7    ? 64.682  -30.128 12.026  1.00 11.56  ? 7    SER A CB  1 
ATOM 6     O OG  . SER A 1 7    ? 64.443  -28.751 11.875  1.00 29.88  ? 7    SER A OG  1 
ATOM 7     N N   . PHE A 1 8    ? 66.730  -31.089 14.820  1.00 8.83   ? 8    PHE A N   1 
ATOM 8     C CA  . PHE A 1 8    ? 66.785  -31.930 15.997  1.00 12.74  ? 8    PHE A CA  1 
ATOM 9     C C   . PHE A 1 8    ? 66.094  -31.162 17.110  1.00 12.10  ? 8    PHE A C   1 
ATOM 10    O O   . PHE A 1 8    ? 66.453  -30.013 17.381  1.00 10.34  ? 8    PHE A O   1 
ATOM 11    C CB  . PHE A 1 8    ? 68.230  -32.249 16.392  1.00 19.12  ? 8    PHE A CB  1 
ATOM 12    C CG  . PHE A 1 8    ? 69.229  -32.261 15.242  1.00 15.96  ? 8    PHE A CG  1 
ATOM 13    C CD1 . PHE A 1 8    ? 69.464  -31.131 14.456  1.00 10.58  ? 8    PHE A CD1 1 
ATOM 14    C CD2 . PHE A 1 8    ? 69.983  -33.397 14.999  1.00 13.02  ? 8    PHE A CD2 1 
ATOM 15    C CE1 . PHE A 1 8    ? 70.374  -31.160 13.445  1.00 8.83   ? 8    PHE A CE1 1 
ATOM 16    C CE2 . PHE A 1 8    ? 70.907  -33.423 13.975  1.00 9.13   ? 8    PHE A CE2 1 
ATOM 17    C CZ  . PHE A 1 8    ? 71.102  -32.299 13.205  1.00 8.83   ? 8    PHE A CZ  1 
ATOM 18    N N   . LEU A 1 9    ? 65.099  -31.778 17.729  1.00 11.59  ? 9    LEU A N   1 
ATOM 19    C CA  . LEU A 1 9    ? 64.511  -31.185 18.919  1.00 14.52  ? 9    LEU A CA  1 
ATOM 20    C C   . LEU A 1 9    ? 65.525  -31.179 20.076  1.00 16.24  ? 9    LEU A C   1 
ATOM 21    O O   . LEU A 1 9    ? 66.576  -31.821 20.019  1.00 18.31  ? 9    LEU A O   1 
ATOM 22    C CB  . LEU A 1 9    ? 63.243  -31.939 19.309  1.00 13.82  ? 9    LEU A CB  1 
ATOM 23    C CG  . LEU A 1 9    ? 62.317  -32.223 18.123  1.00 12.05  ? 9    LEU A CG  1 
ATOM 24    C CD1 . LEU A 1 9    ? 62.845  -33.350 17.262  1.00 13.16  ? 9    LEU A CD1 1 
ATOM 25    C CD2 . LEU A 1 9    ? 60.929  -32.536 18.601  1.00 10.97  ? 9    LEU A CD2 1 
ATOM 26    N N   . HIS A 1 10   ? 65.197  -30.434 21.132  1.00 19.14  ? 10   HIS A N   1 
ATOM 27    C CA  . HIS A 1 10   ? 66.090  -30.233 22.268  1.00 16.91  ? 10   HIS A CA  1 
ATOM 28    C C   . HIS A 1 10   ? 65.228  -29.985 23.516  1.00 19.00  ? 10   HIS A C   1 
ATOM 29    O O   . HIS A 1 10   ? 63.999  -30.037 23.453  1.00 19.80  ? 10   HIS A O   1 
ATOM 30    C CB  . HIS A 1 10   ? 67.080  -29.105 21.942  1.00 14.11  ? 10   HIS A CB  1 
ATOM 31    C CG  . HIS A 1 10   ? 68.497  -29.558 21.841  1.00 11.86  ? 10   HIS A CG  1 
ATOM 32    N ND1 . HIS A 1 10   ? 69.096  -29.909 20.653  1.00 8.77   ? 10   HIS A ND1 1 
ATOM 33    C CD2 . HIS A 1 10   ? 69.435  -29.718 22.797  1.00 12.13  ? 10   HIS A CD2 1 
ATOM 34    C CE1 . HIS A 1 10   ? 70.346  -30.261 20.884  1.00 8.77   ? 10   HIS A CE1 1 
ATOM 35    N NE2 . HIS A 1 10   ? 70.578  -30.149 22.177  1.00 10.02  ? 10   HIS A NE2 1 
ATOM 36    N N   . ILE A 1 11   ? 65.867  -29.703 24.658  1.00 21.79  ? 11   ILE A N   1 
ATOM 37    C CA  . ILE A 1 11   ? 65.171  -29.645 25.936  1.00 23.24  ? 11   ILE A CA  1 
ATOM 38    C C   . ILE A 1 11   ? 64.953  -28.204 26.379  1.00 22.34  ? 11   ILE A C   1 
ATOM 39    O O   . ILE A 1 11   ? 65.756  -27.317 26.085  1.00 21.78  ? 11   ILE A O   1 
ATOM 40    C CB  . ILE A 1 11   ? 65.956  -30.372 27.041  1.00 36.26  ? 11   ILE A CB  1 
ATOM 41    C CG1 . ILE A 1 11   ? 66.112  -31.846 26.780  1.00 38.56  ? 11   ILE A CG1 1 
ATOM 42    C CG2 . ILE A 1 11   ? 65.177  -30.279 28.275  1.00 31.81  ? 11   ILE A CG2 1 
ATOM 43    C CD1 . ILE A 1 11   ? 66.549  -32.471 28.071  1.00 31.41  ? 11   ILE A CD1 1 
ATOM 44    N N   . GLY A 1 12   ? 63.912  -27.994 27.199  1.00 22.38  ? 12   GLY A N   1 
ATOM 45    C CA  . GLY A 1 12   ? 63.250  -26.706 27.216  1.00 20.65  ? 12   GLY A CA  1 
ATOM 46    C C   . GLY A 1 12   ? 62.741  -26.219 25.872  1.00 18.85  ? 12   GLY A C   1 
ATOM 47    O O   . GLY A 1 12   ? 62.398  -25.037 25.760  1.00 20.05  ? 12   GLY A O   1 
ATOM 48    N N   . ASP A 1 13   ? 62.711  -27.093 24.864  1.00 15.69  ? 13   ASP A N   1 
ATOM 49    C CA  . ASP A 1 13   ? 62.192  -26.914 23.514  1.00 23.20  ? 13   ASP A CA  1 
ATOM 50    C C   . ASP A 1 13   ? 61.089  -27.933 23.393  1.00 29.84  ? 13   ASP A C   1 
ATOM 51    O O   . ASP A 1 13   ? 61.239  -29.026 23.919  1.00 31.58  ? 13   ASP A O   1 
ATOM 52    C CB  . ASP A 1 13   ? 63.242  -27.259 22.465  1.00 27.81  ? 13   ASP A CB  1 
ATOM 53    C CG  . ASP A 1 13   ? 64.635  -26.883 22.908  1.00 30.67  ? 13   ASP A CG  1 
ATOM 54    O OD1 . ASP A 1 13   ? 65.183  -25.987 22.243  1.00 43.71  ? 13   ASP A OD1 1 
ATOM 55    O OD2 . ASP A 1 13   ? 65.147  -27.395 23.943  1.00 23.15  ? 13   ASP A OD2 1 
ATOM 56    N N   . ILE A 1 14   ? 59.966  -27.603 22.754  1.00 22.97  ? 14   ILE A N   1 
ATOM 57    C CA  . ILE A 1 14   ? 58.762  -28.430 22.910  1.00 23.36  ? 14   ILE A CA  1 
ATOM 58    C C   . ILE A 1 14   ? 57.689  -27.963 21.966  1.00 17.27  ? 14   ILE A C   1 
ATOM 59    O O   . ILE A 1 14   ? 57.670  -26.801 21.555  1.00 18.16  ? 14   ILE A O   1 
ATOM 60    C CB  . ILE A 1 14   ? 58.261  -28.406 24.377  1.00 43.81  ? 14   ILE A CB  1 
ATOM 61    C CG1 . ILE A 1 14   ? 59.161  -27.479 25.232  1.00 51.84  ? 14   ILE A CG1 1 
ATOM 62    C CG2 . ILE A 1 14   ? 57.801  -29.861 24.744  1.00 52.72  ? 14   ILE A CG2 1 
ATOM 63    C CD1 . ILE A 1 14   ? 58.953  -25.873 25.101  1.00 45.76  ? 14   ILE A CD1 1 
ATOM 64    N N   . CYS A 1 15   ? 56.715  -28.825 21.751  1.00 14.25  ? 15   CYS A N   1 
ATOM 65    C CA  . CYS A 1 15   ? 56.108  -28.960 20.445  1.00 15.68  ? 15   CYS A CA  1 
ATOM 66    C C   . CYS A 1 15   ? 54.996  -29.988 20.516  1.00 11.82  ? 15   CYS A C   1 
ATOM 67    O O   . CYS A 1 15   ? 54.881  -30.738 21.487  1.00 8.74   ? 15   CYS A O   1 
ATOM 68    C CB  . CYS A 1 15   ? 57.105  -29.386 19.359  1.00 20.73  ? 15   CYS A CB  1 
ATOM 69    S SG  . CYS A 1 15   ? 58.899  -29.393 19.708  1.00 29.44  ? 15   CYS A SG  1 
ATOM 70    N N   . SER A 1 16   ? 54.222  -30.035 19.446  1.00 10.71  ? 16   SER A N   1 
ATOM 71    C CA  . SER A 1 16   ? 52.940  -30.689 19.391  1.00 8.72   ? 16   SER A CA  1 
ATOM 72    C C   . SER A 1 16   ? 53.124  -32.024 18.729  1.00 12.93  ? 16   SER A C   1 
ATOM 73    O O   . SER A 1 16   ? 54.096  -32.249 18.027  1.00 16.05  ? 16   SER A O   1 
ATOM 74    C CB  . SER A 1 16   ? 51.975  -29.843 18.604  1.00 8.72   ? 16   SER A CB  1 
ATOM 75    O OG  . SER A 1 16   ? 51.829  -30.336 17.288  1.00 8.72   ? 16   SER A OG  1 
ATOM 76    N N   . LEU A 1 17   ? 52.188  -32.919 18.954  1.00 16.10  ? 17   LEU A N   1 
ATOM 77    C CA  . LEU A 1 17   ? 52.349  -34.300 18.554  1.00 20.24  ? 17   LEU A CA  1 
ATOM 78    C C   . LEU A 1 17   ? 51.057  -34.700 17.871  1.00 21.00  ? 17   LEU A C   1 
ATOM 79    O O   . LEU A 1 17   ? 50.049  -33.983 17.929  1.00 38.98  ? 17   LEU A O   1 
ATOM 80    C CB  . LEU A 1 17   ? 52.699  -35.168 19.784  1.00 24.14  ? 17   LEU A CB  1 
ATOM 81    C CG  . LEU A 1 17   ? 52.866  -36.699 19.852  1.00 23.25  ? 17   LEU A CG  1 
ATOM 82    C CD1 . LEU A 1 17   ? 51.757  -37.482 19.182  1.00 21.70  ? 17   LEU A CD1 1 
ATOM 83    C CD2 . LEU A 1 17   ? 54.218  -37.154 19.309  1.00 17.82  ? 17   LEU A CD2 1 
ATOM 84    N N   . TYR A 1 18   ? 51.091  -35.817 17.174  1.00 12.73  ? 18   TYR A N   1 
ATOM 85    C CA  . TYR A 1 18   ? 49.868  -36.209 16.505  1.00 9.74   ? 18   TYR A CA  1 
ATOM 86    C C   . TYR A 1 18   ? 49.875  -37.715 16.342  1.00 11.28  ? 18   TYR A C   1 
ATOM 87    O O   . TYR A 1 18   ? 50.945  -38.306 16.150  1.00 12.06  ? 18   TYR A O   1 
ATOM 88    C CB  . TYR A 1 18   ? 49.826  -35.476 15.187  1.00 8.71   ? 18   TYR A CB  1 
ATOM 89    C CG  . TYR A 1 18   ? 48.524  -34.935 14.819  1.00 8.71   ? 18   TYR A CG  1 
ATOM 90    C CD1 . TYR A 1 18   ? 47.452  -35.775 14.653  1.00 8.88   ? 18   TYR A CD1 1 
ATOM 91    C CD2 . TYR A 1 18   ? 48.363  -33.593 14.577  1.00 8.71   ? 18   TYR A CD2 1 
ATOM 92    C CE1 . TYR A 1 18   ? 46.265  -35.298 14.266  1.00 10.18  ? 18   TYR A CE1 1 
ATOM 93    C CE2 . TYR A 1 18   ? 47.179  -33.129 14.196  1.00 14.06  ? 18   TYR A CE2 1 
ATOM 94    C CZ  . TYR A 1 18   ? 46.118  -33.982 14.059  1.00 8.71   ? 18   TYR A CZ  1 
ATOM 95    O OH  . TYR A 1 18   ? 44.876  -33.577 13.681  1.00 12.31  ? 18   TYR A OH  1 
ATOM 96    N N   . ALA A 1 19   ? 48.703  -38.348 16.405  1.00 11.22  ? 19   ALA A N   1 
ATOM 97    C CA  . ALA A 1 19   ? 48.729  -39.811 16.329  1.00 13.31  ? 19   ALA A CA  1 
ATOM 98    C C   . ALA A 1 19   ? 49.181  -40.297 14.956  1.00 16.13  ? 19   ALA A C   1 
ATOM 99    O O   . ALA A 1 19   ? 49.332  -39.515 14.009  1.00 20.49  ? 19   ALA A O   1 
ATOM 100   C CB  . ALA A 1 19   ? 47.380  -40.419 16.699  1.00 15.13  ? 19   ALA A CB  1 
ATOM 101   N N   . GLU A 1 20   ? 49.540  -41.593 14.897  1.00 18.59  ? 20   GLU A N   1 
ATOM 102   C CA  . GLU A 1 20   ? 49.750  -42.257 13.607  1.00 21.26  ? 20   GLU A CA  1 
ATOM 103   C C   . GLU A 1 20   ? 48.641  -43.240 13.393  1.00 19.20  ? 20   GLU A C   1 
ATOM 104   O O   . GLU A 1 20   ? 47.878  -43.567 14.308  1.00 17.02  ? 20   GLU A O   1 
ATOM 105   C CB  . GLU A 1 20   ? 51.040  -43.059 13.466  1.00 25.22  ? 20   GLU A CB  1 
ATOM 106   C CG  . GLU A 1 20   ? 52.256  -42.427 13.812  1.00 19.18  ? 20   GLU A CG  1 
ATOM 107   C CD  . GLU A 1 20   ? 52.167  -41.774 15.123  1.00 17.11  ? 20   GLU A CD  1 
ATOM 108   O OE1 . GLU A 1 20   ? 51.035  -41.590 15.610  1.00 19.11  ? 20   GLU A OE1 1 
ATOM 109   O OE2 . GLU A 1 20   ? 53.231  -41.494 15.700  1.00 15.31  ? 20   GLU A OE2 1 
ATOM 110   N N   . GLY A 1 21   ? 48.610  -43.706 12.157  1.00 17.74  ? 21   GLY A N   1 
ATOM 111   C CA  . GLY A 1 21   ? 47.536  -44.501 11.654  1.00 19.55  ? 21   GLY A CA  1 
ATOM 112   C C   . GLY A 1 21   ? 46.323  -43.725 12.072  1.00 24.97  ? 21   GLY A C   1 
ATOM 113   O O   . GLY A 1 21   ? 46.385  -42.504 12.276  1.00 23.19  ? 21   GLY A O   1 
ATOM 114   N N   . SER A 1 22   ? 45.249  -44.459 12.327  1.00 31.49  ? 22   SER A N   1 
ATOM 115   C CA  . SER A 1 22   ? 43.917  -43.870 12.326  1.00 43.80  ? 22   SER A CA  1 
ATOM 116   C C   . SER A 1 22   ? 43.731  -42.879 13.453  1.00 29.52  ? 22   SER A C   1 
ATOM 117   O O   . SER A 1 22   ? 42.841  -42.020 13.401  1.00 31.75  ? 22   SER A O   1 
ATOM 118   C CB  . SER A 1 22   ? 42.881  -44.981 12.438  1.00 46.39  ? 22   SER A CB  1 
ATOM 119   O OG  . SER A 1 22   ? 43.208  -45.849 13.515  1.00 28.99  ? 22   SER A OG  1 
ATOM 120   N N   . THR A 1 23   ? 44.536  -42.989 14.480  1.00 22.47  ? 23   THR A N   1 
ATOM 121   C CA  . THR A 1 23   ? 44.154  -42.338 15.702  1.00 19.27  ? 23   THR A CA  1 
ATOM 122   C C   . THR A 1 23   ? 44.594  -40.896 15.762  1.00 19.16  ? 23   THR A C   1 
ATOM 123   O O   . THR A 1 23   ? 44.404  -40.252 16.793  1.00 31.84  ? 23   THR A O   1 
ATOM 124   C CB  . THR A 1 23   ? 44.719  -43.125 16.868  1.00 24.69  ? 23   THR A CB  1 
ATOM 125   O OG1 . THR A 1 23   ? 44.590  -44.523 16.579  1.00 25.30  ? 23   THR A OG1 1 
ATOM 126   C CG2 . THR A 1 23   ? 43.918  -42.808 18.065  1.00 28.65  ? 23   THR A CG2 1 
ATOM 127   N N   . ASN A 1 24   ? 45.145  -40.354 14.686  1.00 17.84  ? 24   ASN A N   1 
ATOM 128   C CA  . ASN A 1 24   ? 45.844  -39.086 14.800  1.00 14.89  ? 24   ASN A CA  1 
ATOM 129   C C   . ASN A 1 24   ? 44.886  -37.937 15.054  1.00 12.66  ? 24   ASN A C   1 
ATOM 130   O O   . ASN A 1 24   ? 43.928  -37.698 14.305  1.00 10.88  ? 24   ASN A O   1 
ATOM 131   C CB  . ASN A 1 24   ? 46.683  -38.817 13.564  1.00 15.30  ? 24   ASN A CB  1 
ATOM 132   C CG  . ASN A 1 24   ? 45.878  -38.232 12.431  1.00 10.89  ? 24   ASN A CG  1 
ATOM 133   O OD1 . ASN A 1 24   ? 45.369  -37.111 12.507  1.00 8.70   ? 24   ASN A OD1 1 
ATOM 134   N ND2 . ASN A 1 24   ? 45.768  -38.990 11.358  1.00 13.98  ? 24   ASN A ND2 1 
ATOM 135   N N   . GLY A 1 25   ? 45.156  -37.232 16.132  1.00 13.20  ? 25   GLY A N   1 
ATOM 136   C CA  . GLY A 1 25   ? 44.453  -36.003 16.419  1.00 13.41  ? 25   GLY A CA  1 
ATOM 137   C C   . GLY A 1 25   ? 45.413  -35.004 17.007  1.00 15.23  ? 25   GLY A C   1 
ATOM 138   O O   . GLY A 1 25   ? 46.469  -35.354 17.539  1.00 8.75   ? 25   GLY A O   1 
ATOM 139   N N   . PHE A 1 26   ? 45.072  -33.745 16.822  1.00 10.58  ? 26   PHE A N   1 
ATOM 140   C CA  . PHE A 1 26   ? 45.613  -32.715 17.670  1.00 15.48  ? 26   PHE A CA  1 
ATOM 141   C C   . PHE A 1 26   ? 45.142  -32.941 19.107  1.00 24.67  ? 26   PHE A C   1 
ATOM 142   O O   . PHE A 1 26   ? 44.051  -33.457 19.352  1.00 27.88  ? 26   PHE A O   1 
ATOM 143   C CB  . PHE A 1 26   ? 45.163  -31.356 17.155  1.00 17.11  ? 26   PHE A CB  1 
ATOM 144   C CG  . PHE A 1 26   ? 45.793  -30.958 15.842  1.00 16.37  ? 26   PHE A CG  1 
ATOM 145   C CD1 . PHE A 1 26   ? 45.072  -30.976 14.660  1.00 16.98  ? 26   PHE A CD1 1 
ATOM 146   C CD2 . PHE A 1 26   ? 47.109  -30.546 15.800  1.00 15.69  ? 26   PHE A CD2 1 
ATOM 147   C CE1 . PHE A 1 26   ? 45.673  -30.590 13.477  1.00 16.40  ? 26   PHE A CE1 1 
ATOM 148   C CE2 . PHE A 1 26   ? 47.699  -30.153 14.625  1.00 14.18  ? 26   PHE A CE2 1 
ATOM 149   C CZ  . PHE A 1 26   ? 46.981  -30.172 13.472  1.00 14.81  ? 26   PHE A CZ  1 
ATOM 150   N N   . ILE A 1 27   ? 45.985  -32.558 20.061  1.00 30.58  ? 27   ILE A N   1 
ATOM 151   C CA  . ILE A 1 27   ? 45.718  -32.705 21.488  1.00 32.26  ? 27   ILE A CA  1 
ATOM 152   C C   . ILE A 1 27   ? 45.547  -31.314 22.086  1.00 29.47  ? 27   ILE A C   1 
ATOM 153   O O   . ILE A 1 27   ? 46.284  -30.387 21.735  1.00 34.24  ? 27   ILE A O   1 
ATOM 154   C CB  . ILE A 1 27   ? 46.855  -33.489 22.183  1.00 32.08  ? 27   ILE A CB  1 
ATOM 155   C CG1 . ILE A 1 27   ? 46.726  -34.999 21.898  1.00 25.66  ? 27   ILE A CG1 1 
ATOM 156   C CG2 . ILE A 1 27   ? 46.955  -33.138 23.667  1.00 26.31  ? 27   ILE A CG2 1 
ATOM 157   C CD1 . ILE A 1 27   ? 45.338  -35.554 22.085  1.00 24.15  ? 27   ILE A CD1 1 
ATOM 158   N N   . SER A 1 28   ? 44.563  -31.157 22.968  1.00 36.20  ? 28   SER A N   1 
ATOM 159   C CA  . SER A 1 28   ? 44.149  -29.829 23.424  1.00 37.38  ? 28   SER A CA  1 
ATOM 160   C C   . SER A 1 28   ? 43.570  -29.968 24.829  1.00 43.04  ? 28   SER A C   1 
ATOM 161   O O   . SER A 1 28   ? 42.637  -30.751 25.029  1.00 49.62  ? 28   SER A O   1 
ATOM 162   C CB  . SER A 1 28   ? 43.121  -29.234 22.427  1.00 28.44  ? 28   SER A CB  1 
ATOM 163   O OG  . SER A 1 28   ? 42.825  -27.854 22.624  1.00 18.91  ? 28   SER A OG  1 
ATOM 164   N N   . THR A 1 29   ? 44.123  -29.239 25.807  1.00 42.96  ? 29   THR A N   1 
ATOM 165   C CA  . THR A 1 29   ? 43.558  -29.246 27.162  1.00 46.18  ? 29   THR A CA  1 
ATOM 166   C C   . THR A 1 29   ? 42.117  -28.741 27.145  1.00 55.26  ? 29   THR A C   1 
ATOM 167   O O   . THR A 1 29   ? 41.786  -27.792 26.425  1.00 53.52  ? 29   THR A O   1 
ATOM 168   C CB  . THR A 1 29   ? 44.394  -28.374 28.103  1.00 41.12  ? 29   THR A CB  1 
ATOM 169   O OG1 . THR A 1 29   ? 45.774  -28.583 27.826  1.00 39.75  ? 29   THR A OG1 1 
ATOM 170   C CG2 . THR A 1 29   ? 44.140  -28.750 29.555  1.00 45.24  ? 29   THR A CG2 1 
ATOM 171   N N   . LEU A 1 30   ? 41.256  -29.375 27.952  1.00 47.28  ? 30   LEU A N   1 
ATOM 172   C CA  . LEU A 1 30   ? 39.827  -29.064 27.889  1.00 42.94  ? 30   LEU A CA  1 
ATOM 173   C C   . LEU A 1 30   ? 39.513  -27.725 28.545  1.00 40.99  ? 30   LEU A C   1 
ATOM 174   O O   . LEU A 1 30   ? 38.654  -26.975 28.071  1.00 44.46  ? 30   LEU A O   1 
ATOM 175   C CB  . LEU A 1 30   ? 39.018  -30.175 28.543  1.00 31.06  ? 30   LEU A CB  1 
ATOM 176   C CG  . LEU A 1 30   ? 38.864  -31.465 27.770  1.00 32.45  ? 30   LEU A CG  1 
ATOM 177   C CD1 . LEU A 1 30   ? 38.065  -32.383 28.641  1.00 40.96  ? 30   LEU A CD1 1 
ATOM 178   C CD2 . LEU A 1 30   ? 38.142  -31.204 26.464  1.00 32.85  ? 30   LEU A CD2 1 
ATOM 179   N N   . GLY A 1 31   ? 40.205  -27.406 29.621  1.00 40.81  ? 31   GLY A N   1 
ATOM 180   C CA  . GLY A 1 31   ? 39.926  -26.201 30.370  1.00 30.66  ? 31   GLY A CA  1 
ATOM 181   C C   . GLY A 1 31   ? 40.052  -26.490 31.847  1.00 34.48  ? 31   GLY A C   1 
ATOM 182   O O   . GLY A 1 31   ? 40.381  -27.598 32.267  1.00 43.48  ? 31   GLY A O   1 
ATOM 183   N N   . LEU A 1 32   ? 39.770  -25.463 32.636  1.00 30.63  ? 32   LEU A N   1 
ATOM 184   C CA  . LEU A 1 32   ? 39.788  -25.650 34.078  1.00 42.91  ? 32   LEU A CA  1 
ATOM 185   C C   . LEU A 1 32   ? 38.546  -26.397 34.572  1.00 37.83  ? 32   LEU A C   1 
ATOM 186   O O   . LEU A 1 32   ? 38.639  -27.217 35.490  1.00 48.94  ? 32   LEU A O   1 
ATOM 187   C CB  . LEU A 1 32   ? 39.941  -24.298 34.747  1.00 40.81  ? 32   LEU A CB  1 
ATOM 188   C CG  . LEU A 1 32   ? 40.458  -23.265 33.748  1.00 36.01  ? 32   LEU A CG  1 
ATOM 189   C CD1 . LEU A 1 32   ? 40.090  -22.074 34.411  1.00 29.51  ? 32   LEU A CD1 1 
ATOM 190   C CD2 . LEU A 1 32   ? 41.969  -23.249 33.480  1.00 38.93  ? 32   LEU A CD2 1 
ATOM 191   N N   . VAL A 1 33   ? 37.384  -26.156 33.969  1.00 28.00  ? 33   VAL A N   1 
ATOM 192   C CA  . VAL A 1 33   ? 36.219  -26.998 34.241  1.00 28.33  ? 33   VAL A CA  1 
ATOM 193   C C   . VAL A 1 33   ? 36.464  -28.435 33.820  1.00 24.93  ? 33   VAL A C   1 
ATOM 194   O O   . VAL A 1 33   ? 35.948  -29.381 34.431  1.00 19.14  ? 33   VAL A O   1 
ATOM 195   C CB  . VAL A 1 33   ? 35.006  -26.434 33.504  1.00 30.21  ? 33   VAL A CB  1 
ATOM 196   C CG1 . VAL A 1 33   ? 34.442  -25.392 34.320  1.00 24.05  ? 33   VAL A CG1 1 
ATOM 197   C CG2 . VAL A 1 33   ? 35.475  -25.835 32.206  1.00 41.51  ? 33   VAL A CG2 1 
ATOM 198   N N   . ASP A 1 34   ? 37.178  -28.620 32.721  1.00 28.61  ? 34   ASP A N   1 
ATOM 199   C CA  . ASP A 1 34   ? 37.401  -29.935 32.149  1.00 29.07  ? 34   ASP A CA  1 
ATOM 200   C C   . ASP A 1 34   ? 38.898  -30.120 31.970  1.00 32.99  ? 34   ASP A C   1 
ATOM 201   O O   . ASP A 1 34   ? 39.498  -29.546 31.056  1.00 36.14  ? 34   ASP A O   1 
ATOM 202   C CB  . ASP A 1 34   ? 36.633  -30.075 30.839  1.00 22.34  ? 34   ASP A CB  1 
ATOM 203   C CG  . ASP A 1 34   ? 35.151  -29.808 31.022  1.00 15.46  ? 34   ASP A CG  1 
ATOM 204   O OD1 . ASP A 1 34   ? 34.475  -30.630 31.667  1.00 12.03  ? 34   ASP A OD1 1 
ATOM 205   O OD2 . ASP A 1 34   ? 34.658  -28.768 30.550  1.00 17.74  ? 34   ASP A OD2 1 
ATOM 206   N N   . ASP A 1 35   ? 39.504  -30.885 32.876  1.00 35.27  ? 35   ASP A N   1 
ATOM 207   C CA  . ASP A 1 35   ? 40.907  -31.257 32.794  1.00 30.27  ? 35   ASP A CA  1 
ATOM 208   C C   . ASP A 1 35   ? 41.001  -32.726 32.382  1.00 39.23  ? 35   ASP A C   1 
ATOM 209   O O   . ASP A 1 35   ? 41.295  -33.613 33.185  1.00 44.14  ? 35   ASP A O   1 
ATOM 210   C CB  . ASP A 1 35   ? 41.617  -30.971 34.145  1.00 21.43  ? 35   ASP A CB  1 
ATOM 211   C CG  . ASP A 1 35   ? 40.666  -31.017 35.334  1.00 16.50  ? 35   ASP A CG  1 
ATOM 212   O OD1 . ASP A 1 35   ? 39.584  -31.618 35.215  1.00 21.69  ? 35   ASP A OD1 1 
ATOM 213   O OD2 . ASP A 1 35   ? 41.004  -30.466 36.399  1.00 8.79   ? 35   ASP A OD2 1 
ATOM 214   N N   . ARG A 1 36   ? 40.725  -32.975 31.092  1.00 49.69  ? 36   ARG A N   1 
ATOM 215   C CA  . ARG A 1 36   ? 40.717  -34.317 30.513  1.00 66.08  ? 36   ARG A CA  1 
ATOM 216   C C   . ARG A 1 36   ? 41.290  -34.260 29.091  1.00 73.44  ? 36   ARG A C   1 
ATOM 217   O O   . ARG A 1 36   ? 41.165  -33.241 28.398  1.00 48.95  ? 36   ARG A O   1 
ATOM 218   C CB  . ARG A 1 36   ? 39.283  -34.933 30.516  1.00 62.42  ? 36   ARG A CB  1 
ATOM 219   C CG  . ARG A 1 36   ? 38.742  -35.463 31.877  1.00 43.50  ? 36   ARG A CG  1 
ATOM 220   C CD  . ARG A 1 36   ? 37.212  -35.603 31.844  1.00 40.01  ? 36   ARG A CD  1 
ATOM 221   N NE  . ARG A 1 36   ? 36.576  -34.290 31.721  1.00 44.74  ? 36   ARG A NE  1 
ATOM 222   C CZ  . ARG A 1 36   ? 35.352  -34.077 31.245  1.00 40.16  ? 36   ARG A CZ  1 
ATOM 223   N NH1 . ARG A 1 36   ? 34.608  -35.099 30.835  1.00 36.23  ? 36   ARG A NH1 1 
ATOM 224   N NH2 . ARG A 1 36   ? 34.878  -32.834 31.176  1.00 26.51  ? 36   ARG A NH2 1 
ATOM 225   N N   . CYS A 1 37   ? 41.923  -35.371 28.664  1.00 88.64  ? 37   CYS A N   1 
ATOM 226   C CA  . CYS A 1 37   ? 42.652  -35.447 27.391  1.00 81.87  ? 37   CYS A CA  1 
ATOM 227   C C   . CYS A 1 37   ? 41.710  -35.759 26.219  1.00 81.88  ? 37   CYS A C   1 
ATOM 228   O O   . CYS A 1 37   ? 40.900  -36.691 26.293  1.00 92.68  ? 37   CYS A O   1 
ATOM 229   C CB  . CYS A 1 37   ? 43.785  -36.493 27.478  1.00 70.98  ? 37   CYS A CB  1 
ATOM 230   S SG  . CYS A 1 37   ? 43.388  -38.283 27.361  1.00 46.64  ? 37   CYS A SG  1 
ATOM 231   N N   . VAL A 1 38   ? 41.813  -34.964 25.143  1.00 73.60  ? 38   VAL A N   1 
ATOM 232   C CA  . VAL A 1 38   ? 40.954  -35.064 23.963  1.00 50.32  ? 38   VAL A CA  1 
ATOM 233   C C   . VAL A 1 38   ? 41.836  -35.204 22.718  1.00 46.38  ? 38   VAL A C   1 
ATOM 234   O O   . VAL A 1 38   ? 42.712  -34.370 22.475  1.00 50.47  ? 38   VAL A O   1 
ATOM 235   C CB  . VAL A 1 38   ? 40.006  -33.836 23.835  1.00 34.88  ? 38   VAL A CB  1 
ATOM 236   C CG1 . VAL A 1 38   ? 38.781  -33.958 24.748  1.00 32.72  ? 38   VAL A CG1 1 
ATOM 237   C CG2 . VAL A 1 38   ? 40.719  -32.519 24.149  1.00 37.18  ? 38   VAL A CG2 1 
ATOM 238   N N   . VAL A 1 39   ? 41.621  -36.251 21.934  1.00 30.56  ? 39   VAL A N   1 
ATOM 239   C CA  . VAL A 1 39   ? 42.238  -36.369 20.610  1.00 28.04  ? 39   VAL A CA  1 
ATOM 240   C C   . VAL A 1 39   ? 41.154  -36.016 19.583  1.00 26.25  ? 39   VAL A C   1 
ATOM 241   O O   . VAL A 1 39   ? 39.992  -36.341 19.802  1.00 23.53  ? 39   VAL A O   1 
ATOM 242   C CB  . VAL A 1 39   ? 42.827  -37.783 20.406  1.00 27.94  ? 39   VAL A CB  1 
ATOM 243   C CG1 . VAL A 1 39   ? 43.328  -37.990 18.972  1.00 35.39  ? 39   VAL A CG1 1 
ATOM 244   C CG2 . VAL A 1 39   ? 43.967  -38.074 21.425  1.00 22.20  ? 39   VAL A CG2 1 
ATOM 245   N N   . GLN A 1 40   ? 41.507  -35.288 18.481  1.00 29.67  ? 40   GLN A N   1 
ATOM 246   C CA  . GLN A 1 40   ? 40.559  -34.911 17.405  1.00 21.36  ? 40   GLN A CA  1 
ATOM 247   C C   . GLN A 1 40   ? 41.162  -35.218 16.032  1.00 15.59  ? 40   GLN A C   1 
ATOM 248   O O   . GLN A 1 40   ? 42.176  -34.606 15.663  1.00 15.81  ? 40   GLN A O   1 
ATOM 249   C CB  . GLN A 1 40   ? 40.194  -33.405 17.484  1.00 22.50  ? 40   GLN A CB  1 
ATOM 250   C CG  . GLN A 1 40   ? 38.725  -33.009 17.890  1.00 16.59  ? 40   GLN A CG  1 
ATOM 251   C CD  . GLN A 1 40   ? 37.874  -32.424 16.755  1.00 10.80  ? 40   GLN A CD  1 
ATOM 252   O OE1 . GLN A 1 40   ? 38.295  -32.394 15.612  1.00 8.84   ? 40   GLN A OE1 1 
ATOM 253   N NE2 . GLN A 1 40   ? 36.677  -31.948 17.084  1.00 9.85   ? 40   GLN A NE2 1 
ATOM 254   N N   . PRO A 1 41   ? 40.623  -36.135 15.213  1.00 11.62  ? 41   PRO A N   1 
ATOM 255   C CA  . PRO A 1 41   ? 41.260  -36.261 13.921  1.00 11.43  ? 41   PRO A CA  1 
ATOM 256   C C   . PRO A 1 41   ? 40.572  -35.282 12.986  1.00 15.26  ? 41   PRO A C   1 
ATOM 257   O O   . PRO A 1 41   ? 41.179  -34.867 11.994  1.00 21.30  ? 41   PRO A O   1 
ATOM 258   C CB  . PRO A 1 41   ? 41.041  -37.733 13.558  1.00 9.31   ? 41   PRO A CB  1 
ATOM 259   C CG  . PRO A 1 41   ? 40.060  -38.275 14.625  1.00 10.18  ? 41   PRO A CG  1 
ATOM 260   C CD  . PRO A 1 41   ? 39.466  -37.045 15.231  1.00 10.86  ? 41   PRO A CD  1 
ATOM 261   N N   . GLU A 1 42   ? 39.349  -34.836 13.327  1.00 14.86  ? 42   GLU A N   1 
ATOM 262   C CA  . GLU A 1 42   ? 38.594  -34.002 12.384  1.00 14.87  ? 42   GLU A CA  1 
ATOM 263   C C   . GLU A 1 42   ? 38.995  -32.538 12.477  1.00 18.07  ? 42   GLU A C   1 
ATOM 264   O O   . GLU A 1 42   ? 39.115  -31.859 11.449  1.00 21.17  ? 42   GLU A O   1 
ATOM 265   C CB  . GLU A 1 42   ? 37.081  -34.106 12.595  1.00 11.34  ? 42   GLU A CB  1 
ATOM 266   C CG  . GLU A 1 42   ? 36.532  -35.385 13.157  1.00 10.82  ? 42   GLU A CG  1 
ATOM 267   C CD  . GLU A 1 42   ? 36.627  -35.417 14.662  1.00 12.22  ? 42   GLU A CD  1 
ATOM 268   O OE1 . GLU A 1 42   ? 36.717  -34.333 15.273  1.00 9.61   ? 42   GLU A OE1 1 
ATOM 269   O OE2 . GLU A 1 42   ? 36.620  -36.525 15.230  1.00 18.61  ? 42   GLU A OE2 1 
ATOM 270   N N   . ALA A 1 43   ? 39.186  -32.023 13.697  1.00 16.66  ? 43   ALA A N   1 
ATOM 271   C CA  . ALA A 1 43   ? 39.482  -30.603 13.831  1.00 15.03  ? 43   ALA A CA  1 
ATOM 272   C C   . ALA A 1 43   ? 40.716  -30.216 13.031  1.00 24.49  ? 43   ALA A C   1 
ATOM 273   O O   . ALA A 1 43   ? 40.808  -29.071 12.582  1.00 33.16  ? 43   ALA A O   1 
ATOM 274   C CB  . ALA A 1 43   ? 39.646  -30.215 15.303  1.00 8.75   ? 43   ALA A CB  1 
ATOM 275   N N   . GLY A 1 44   ? 41.655  -31.155 12.793  1.00 36.01  ? 44   GLY A N   1 
ATOM 276   C CA  . GLY A 1 44   ? 42.915  -30.774 12.182  1.00 25.75  ? 44   GLY A CA  1 
ATOM 277   C C   . GLY A 1 44   ? 43.725  -31.851 11.478  1.00 25.58  ? 44   GLY A C   1 
ATOM 278   O O   . GLY A 1 44   ? 43.455  -33.053 11.567  1.00 30.32  ? 44   GLY A O   1 
ATOM 279   N N   . ASP A 1 45   ? 44.761  -31.382 10.787  1.00 20.72  ? 45   ASP A N   1 
ATOM 280   C CA  . ASP A 1 45   ? 45.658  -32.225 10.010  1.00 17.78  ? 45   ASP A CA  1 
ATOM 281   C C   . ASP A 1 45   ? 47.078  -31.709 10.215  1.00 17.81  ? 45   ASP A C   1 
ATOM 282   O O   . ASP A 1 45   ? 47.327  -30.813 11.023  1.00 17.74  ? 45   ASP A O   1 
ATOM 283   C CB  . ASP A 1 45   ? 45.233  -32.223 8.535   1.00 18.29  ? 45   ASP A CB  1 
ATOM 284   C CG  . ASP A 1 45   ? 44.680  -30.888 8.114   1.00 17.62  ? 45   ASP A CG  1 
ATOM 285   O OD1 . ASP A 1 45   ? 44.529  -30.075 9.035   1.00 20.03  ? 45   ASP A OD1 1 
ATOM 286   O OD2 . ASP A 1 45   ? 44.399  -30.639 6.918   1.00 19.08  ? 45   ASP A OD2 1 
ATOM 287   N N   . LEU A 1 46   ? 48.029  -32.281 9.488   1.00 19.30  ? 46   LEU A N   1 
ATOM 288   C CA  . LEU A 1 46   ? 49.374  -31.720 9.496   1.00 18.35  ? 46   LEU A CA  1 
ATOM 289   C C   . LEU A 1 46   ? 49.386  -30.282 8.981   1.00 17.58  ? 46   LEU A C   1 
ATOM 290   O O   . LEU A 1 46   ? 50.108  -29.436 9.516   1.00 15.70  ? 46   LEU A O   1 
ATOM 291   C CB  . LEU A 1 46   ? 50.295  -32.592 8.656   1.00 21.08  ? 46   LEU A CB  1 
ATOM 292   C CG  . LEU A 1 46   ? 50.465  -33.993 9.217   1.00 21.36  ? 46   LEU A CG  1 
ATOM 293   C CD1 . LEU A 1 46   ? 51.121  -34.906 8.182   1.00 18.34  ? 46   LEU A CD1 1 
ATOM 294   C CD2 . LEU A 1 46   ? 51.269  -33.904 10.514  1.00 23.89  ? 46   LEU A CD2 1 
ATOM 295   N N   . ASN A 1 47   ? 48.590  -29.982 7.945   1.00 20.24  ? 47   ASN A N   1 
ATOM 296   C CA  . ASN A 1 47   ? 48.694  -28.676 7.292   1.00 17.56  ? 47   ASN A CA  1 
ATOM 297   C C   . ASN A 1 47   ? 47.987  -27.571 8.082   1.00 27.37  ? 47   ASN A C   1 
ATOM 298   O O   . ASN A 1 47   ? 48.497  -26.449 8.143   1.00 44.35  ? 47   ASN A O   1 
ATOM 299   C CB  . ASN A 1 47   ? 48.152  -28.735 5.861   1.00 8.74   ? 47   ASN A CB  1 
ATOM 300   C CG  . ASN A 1 47   ? 49.217  -29.087 4.852   1.00 8.74   ? 47   ASN A CG  1 
ATOM 301   O OD1 . ASN A 1 47   ? 50.339  -29.414 5.205   1.00 8.74   ? 47   ASN A OD1 1 
ATOM 302   N ND2 . ASN A 1 47   ? 48.860  -29.038 3.588   1.00 8.74   ? 47   ASN A ND2 1 
ATOM 303   N N   . ASN A 1 48   ? 46.826  -27.879 8.740   1.00 36.45  ? 48   ASN A N   1 
ATOM 304   C CA  . ASN A 1 48   ? 45.889  -26.894 9.336   1.00 34.62  ? 48   ASN A CA  1 
ATOM 305   C C   . ASN A 1 48   ? 46.086  -26.463 10.804  1.00 33.88  ? 48   ASN A C   1 
ATOM 306   O O   . ASN A 1 48   ? 45.702  -25.335 11.159  1.00 26.12  ? 48   ASN A O   1 
ATOM 307   C CB  . ASN A 1 48   ? 44.456  -27.424 9.180   1.00 30.41  ? 48   ASN A CB  1 
ATOM 308   C CG  . ASN A 1 48   ? 43.567  -26.482 8.392   1.00 27.26  ? 48   ASN A CG  1 
ATOM 309   O OD1 . ASN A 1 48   ? 43.692  -26.367 7.172   1.00 24.08  ? 48   ASN A OD1 1 
ATOM 310   N ND2 . ASN A 1 48   ? 42.682  -25.777 9.090   1.00 27.17  ? 48   ASN A ND2 1 
ATOM 311   N N   . PRO A 1 49   ? 46.693  -27.270 11.676  1.00 25.20  ? 49   PRO A N   1 
ATOM 312   C CA  . PRO A 1 49   ? 46.962  -26.875 13.088  1.00 18.34  ? 49   PRO A CA  1 
ATOM 313   C C   . PRO A 1 49   ? 45.889  -26.034 13.754  1.00 17.29  ? 49   PRO A C   1 
ATOM 314   O O   . PRO A 1 49   ? 46.207  -25.260 14.665  1.00 16.48  ? 49   PRO A O   1 
ATOM 315   C CB  . PRO A 1 49   ? 48.273  -26.073 12.964  1.00 17.86  ? 49   PRO A CB  1 
ATOM 316   C CG  . PRO A 1 49   ? 48.558  -26.077 11.495  1.00 18.89  ? 49   PRO A CG  1 
ATOM 317   C CD  . PRO A 1 49   ? 47.994  -27.425 11.058  1.00 24.96  ? 49   PRO A CD  1 
ATOM 318   N N   . PRO A 1 50   ? 44.657  -26.277 13.494  1.00 13.40  ? 50   PRO A N   1 
ATOM 319   C CA  . PRO A 1 50   ? 43.596  -25.481 14.121  1.00 19.81  ? 50   PRO A CA  1 
ATOM 320   C C   . PRO A 1 50   ? 43.822  -23.976 14.220  1.00 25.17  ? 50   PRO A C   1 
ATOM 321   O O   . PRO A 1 50   ? 44.945  -23.481 14.075  1.00 30.17  ? 50   PRO A O   1 
ATOM 322   C CB  . PRO A 1 50   ? 43.512  -26.117 15.510  1.00 17.00  ? 50   PRO A CB  1 
ATOM 323   C CG  . PRO A 1 50   ? 43.993  -27.572 15.269  1.00 18.06  ? 50   PRO A CG  1 
ATOM 324   C CD  . PRO A 1 50   ? 44.451  -27.684 13.807  1.00 16.18  ? 50   PRO A CD  1 
ATOM 325   N N   . LYS A 1 51   ? 42.729  -23.235 14.456  1.00 35.63  ? 51   LYS A N   1 
ATOM 326   C CA  . LYS A 1 51   ? 42.823  -21.780 14.608  1.00 50.05  ? 51   LYS A CA  1 
ATOM 327   C C   . LYS A 1 51   ? 43.583  -21.412 15.888  1.00 49.09  ? 51   LYS A C   1 
ATOM 328   O O   . LYS A 1 51   ? 44.384  -20.465 15.907  1.00 48.38  ? 51   LYS A O   1 
ATOM 329   C CB  . LYS A 1 51   ? 41.419  -21.137 14.614  1.00 45.34  ? 51   LYS A CB  1 
ATOM 330   C CG  . LYS A 1 51   ? 40.660  -21.038 13.255  1.00 25.33  ? 51   LYS A CG  1 
ATOM 331   C CD  . LYS A 1 51   ? 40.002  -22.353 12.848  1.00 15.17  ? 51   LYS A CD  1 
ATOM 332   C CE  . LYS A 1 51   ? 39.215  -22.218 11.562  1.00 8.99   ? 51   LYS A CE  1 
ATOM 333   N NZ  . LYS A 1 51   ? 38.615  -23.515 11.156  1.00 8.99   ? 51   LYS A NZ  1 
ATOM 334   N N   . LYS A 1 52   ? 43.331  -22.149 16.966  1.00 30.73  ? 52   LYS A N   1 
ATOM 335   C CA  . LYS A 1 52   ? 44.007  -21.976 18.245  1.00 27.78  ? 52   LYS A CA  1 
ATOM 336   C C   . LYS A 1 52   ? 44.632  -23.329 18.568  1.00 24.60  ? 52   LYS A C   1 
ATOM 337   O O   . LYS A 1 52   ? 44.082  -24.138 19.318  1.00 22.20  ? 52   LYS A O   1 
ATOM 338   C CB  . LYS A 1 52   ? 43.028  -21.486 19.339  1.00 25.02  ? 52   LYS A CB  1 
ATOM 339   N N   . PHE A 1 53   ? 45.775  -23.591 17.947  1.00 22.60  ? 53   PHE A N   1 
ATOM 340   C CA  . PHE A 1 53   ? 46.571  -24.745 18.328  1.00 19.17  ? 53   PHE A CA  1 
ATOM 341   C C   . PHE A 1 53   ? 47.297  -24.544 19.657  1.00 22.52  ? 53   PHE A C   1 
ATOM 342   O O   . PHE A 1 53   ? 47.747  -25.528 20.249  1.00 21.45  ? 53   PHE A O   1 
ATOM 343   C CB  . PHE A 1 53   ? 47.567  -25.036 17.217  1.00 18.69  ? 53   PHE A CB  1 
ATOM 344   C CG  . PHE A 1 53   ? 48.394  -26.252 17.444  1.00 13.09  ? 53   PHE A CG  1 
ATOM 345   C CD1 . PHE A 1 53   ? 49.496  -26.225 18.273  1.00 11.77  ? 53   PHE A CD1 1 
ATOM 346   C CD2 . PHE A 1 53   ? 48.094  -27.412 16.789  1.00 11.49  ? 53   PHE A CD2 1 
ATOM 347   C CE1 . PHE A 1 53   ? 50.234  -27.333 18.446  1.00 8.97   ? 53   PHE A CE1 1 
ATOM 348   C CE2 . PHE A 1 53   ? 48.848  -28.502 16.973  1.00 9.51   ? 53   PHE A CE2 1 
ATOM 349   C CZ  . PHE A 1 53   ? 49.887  -28.462 17.787  1.00 8.97   ? 53   PHE A CZ  1 
ATOM 350   N N   . ARG A 1 54   ? 47.404  -23.295 20.142  1.00 28.73  ? 54   ARG A N   1 
ATOM 351   C CA  . ARG A 1 54   ? 48.152  -22.994 21.369  1.00 26.76  ? 54   ARG A CA  1 
ATOM 352   C C   . ARG A 1 54   ? 47.627  -23.744 22.586  1.00 28.92  ? 54   ARG A C   1 
ATOM 353   O O   . ARG A 1 54   ? 48.305  -23.777 23.619  1.00 28.69  ? 54   ARG A O   1 
ATOM 354   C CB  . ARG A 1 54   ? 48.139  -21.484 21.654  1.00 26.95  ? 54   ARG A CB  1 
ATOM 355   C CG  . ARG A 1 54   ? 48.514  -21.078 23.090  1.00 20.39  ? 54   ARG A CG  1 
ATOM 356   C CD  . ARG A 1 54   ? 48.628  -19.553 23.236  1.00 19.34  ? 54   ARG A CD  1 
ATOM 357   N NE  . ARG A 1 54   ? 47.363  -18.843 23.486  1.00 18.29  ? 54   ARG A NE  1 
ATOM 358   C CZ  . ARG A 1 54   ? 46.485  -18.474 22.548  1.00 19.55  ? 54   ARG A CZ  1 
ATOM 359   N NH1 . ARG A 1 54   ? 46.705  -18.765 21.272  1.00 31.02  ? 54   ARG A NH1 1 
ATOM 360   N NH2 . ARG A 1 54   ? 45.373  -17.821 22.881  1.00 14.50  ? 54   ARG A NH2 1 
ATOM 361   N N   . ASP A 1 55   ? 46.425  -24.309 22.512  1.00 31.37  ? 55   ASP A N   1 
ATOM 362   C CA  . ASP A 1 55   ? 46.003  -25.239 23.545  1.00 28.79  ? 55   ASP A CA  1 
ATOM 363   C C   . ASP A 1 55   ? 46.767  -26.539 23.345  1.00 39.67  ? 55   ASP A C   1 
ATOM 364   O O   . ASP A 1 55   ? 46.919  -27.022 22.216  1.00 41.44  ? 55   ASP A O   1 
ATOM 365   C CB  . ASP A 1 55   ? 44.492  -25.451 23.487  1.00 20.74  ? 55   ASP A CB  1 
ATOM 366   C CG  . ASP A 1 55   ? 43.991  -26.292 24.604  1.00 18.96  ? 55   ASP A CG  1 
ATOM 367   O OD1 . ASP A 1 55   ? 44.508  -26.177 25.726  1.00 18.68  ? 55   ASP A OD1 1 
ATOM 368   O OD2 . ASP A 1 55   ? 43.084  -27.094 24.334  1.00 21.04  ? 55   ASP A OD2 1 
ATOM 369   N N   . CYS A 1 56   ? 47.286  -27.073 24.448  1.00 42.58  ? 56   CYS A N   1 
ATOM 370   C CA  . CYS A 1 56   ? 48.244  -28.182 24.459  1.00 41.58  ? 56   CYS A CA  1 
ATOM 371   C C   . CYS A 1 56   ? 49.616  -27.807 23.857  1.00 43.96  ? 56   CYS A C   1 
ATOM 372   O O   . CYS A 1 56   ? 50.361  -28.659 23.359  1.00 58.81  ? 56   CYS A O   1 
ATOM 373   C CB  . CYS A 1 56   ? 47.636  -29.446 23.850  1.00 32.00  ? 56   CYS A CB  1 
ATOM 374   S SG  . CYS A 1 56   ? 47.338  -30.554 25.300  1.00 8.95   ? 56   CYS A SG  1 
ATOM 375   N N   . LEU A 1 57   ? 50.006  -26.531 23.957  1.00 38.16  ? 57   LEU A N   1 
ATOM 376   C CA  . LEU A 1 57   ? 51.410  -26.180 23.763  1.00 29.56  ? 57   LEU A CA  1 
ATOM 377   C C   . LEU A 1 57   ? 52.217  -26.841 24.858  1.00 31.50  ? 57   LEU A C   1 
ATOM 378   O O   . LEU A 1 57   ? 52.119  -26.443 26.019  1.00 32.82  ? 57   LEU A O   1 
ATOM 379   C CB  . LEU A 1 57   ? 51.644  -24.673 23.842  1.00 24.80  ? 57   LEU A CB  1 
ATOM 380   C CG  . LEU A 1 57   ? 50.878  -23.770 22.898  1.00 22.02  ? 57   LEU A CG  1 
ATOM 381   C CD1 . LEU A 1 57   ? 51.638  -22.475 22.574  1.00 18.78  ? 57   LEU A CD1 1 
ATOM 382   C CD2 . LEU A 1 57   ? 50.628  -24.580 21.674  1.00 23.05  ? 57   LEU A CD2 1 
ATOM 383   N N   . PHE A 1 58   ? 53.057  -27.808 24.528  1.00 29.19  ? 58   PHE A N   1 
ATOM 384   C CA  . PHE A 1 58   ? 53.778  -28.469 25.600  1.00 37.30  ? 58   PHE A CA  1 
ATOM 385   C C   . PHE A 1 58   ? 55.264  -28.194 25.528  1.00 31.69  ? 58   PHE A C   1 
ATOM 386   O O   . PHE A 1 58   ? 55.796  -27.823 24.475  1.00 26.40  ? 58   PHE A O   1 
ATOM 387   C CB  . PHE A 1 58   ? 53.559  -29.970 25.585  1.00 51.28  ? 58   PHE A CB  1 
ATOM 388   C CG  . PHE A 1 58   ? 53.730  -30.604 26.937  1.00 54.58  ? 58   PHE A CG  1 
ATOM 389   C CD1 . PHE A 1 58   ? 52.695  -30.580 27.866  1.00 42.13  ? 58   PHE A CD1 1 
ATOM 390   C CD2 . PHE A 1 58   ? 54.921  -31.205 27.287  1.00 40.02  ? 58   PHE A CD2 1 
ATOM 391   C CE1 . PHE A 1 58   ? 52.836  -31.155 29.101  1.00 33.59  ? 58   PHE A CE1 1 
ATOM 392   C CE2 . PHE A 1 58   ? 55.055  -31.771 28.510  1.00 30.62  ? 58   PHE A CE2 1 
ATOM 393   C CZ  . PHE A 1 58   ? 54.007  -31.760 29.416  1.00 29.98  ? 58   PHE A CZ  1 
ATOM 394   N N   . LYS A 1 59   ? 55.902  -28.420 26.696  1.00 43.87  ? 59   LYS A N   1 
ATOM 395   C CA  . LYS A 1 59   ? 57.338  -28.276 26.978  1.00 75.91  ? 59   LYS A CA  1 
ATOM 396   C C   . LYS A 1 59   ? 57.969  -29.535 27.597  1.00 70.18  ? 59   LYS A C   1 
ATOM 397   O O   . LYS A 1 59   ? 57.389  -30.168 28.483  1.00 60.50  ? 59   LYS A O   1 
ATOM 398   C CB  . LYS A 1 59   ? 57.667  -26.990 27.820  1.00 52.09  ? 59   LYS A CB  1 
ATOM 399   C CG  . LYS A 1 59   ? 57.735  -26.963 29.375  1.00 35.73  ? 59   LYS A CG  1 
ATOM 400   C CD  . LYS A 1 59   ? 58.527  -25.704 29.834  1.00 21.14  ? 59   LYS A CD  1 
ATOM 401   C CE  . LYS A 1 59   ? 58.656  -25.663 31.328  1.00 8.81   ? 59   LYS A CE  1 
ATOM 402   N NZ  . LYS A 1 59   ? 59.489  -24.564 31.835  1.00 8.81   ? 59   LYS A NZ  1 
ATOM 403   N N   . LEU A 1 60   ? 59.168  -29.887 27.090  1.00 89.45  ? 60   LEU A N   1 
ATOM 404   C CA  . LEU A 1 60   ? 59.972  -31.007 27.587  1.00 73.53  ? 60   LEU A CA  1 
ATOM 405   C C   . LEU A 1 60   ? 60.843  -30.563 28.765  1.00 54.69  ? 60   LEU A C   1 
ATOM 406   O O   . LEU A 1 60   ? 61.596  -29.585 28.664  1.00 48.17  ? 60   LEU A O   1 
ATOM 407   C CB  . LEU A 1 60   ? 60.877  -31.547 26.471  1.00 79.75  ? 60   LEU A CB  1 
ATOM 408   C CG  . LEU A 1 60   ? 60.470  -32.640 25.473  1.00 78.51  ? 60   LEU A CG  1 
ATOM 409   C CD1 . LEU A 1 60   ? 59.848  -33.852 26.154  1.00 55.32  ? 60   LEU A CD1 1 
ATOM 410   C CD2 . LEU A 1 60   ? 59.557  -32.120 24.373  1.00 90.10  ? 60   LEU A CD2 1 
ATOM 411   N N   . CYS A 1 61   ? 60.760  -31.287 29.878  1.00 43.44  ? 61   CYS A N   1 
ATOM 412   C CA  . CYS A 1 61   ? 61.534  -30.963 31.065  1.00 30.33  ? 61   CYS A CA  1 
ATOM 413   C C   . CYS A 1 61   ? 62.247  -32.194 31.578  1.00 25.35  ? 61   CYS A C   1 
ATOM 414   O O   . CYS A 1 61   ? 61.942  -33.331 31.203  1.00 30.95  ? 61   CYS A O   1 
ATOM 415   C CB  . CYS A 1 61   ? 60.638  -30.358 32.166  1.00 34.55  ? 61   CYS A CB  1 
ATOM 416   S SG  . CYS A 1 61   ? 61.402  -30.029 33.838  1.00 18.52  ? 61   CYS A SG  1 
ATOM 417   N N   . PRO A 1 62   ? 63.232  -31.995 32.422  1.00 30.92  ? 62   PRO A N   1 
ATOM 418   C CA  . PRO A 1 62   ? 63.981  -33.120 32.989  1.00 38.92  ? 62   PRO A CA  1 
ATOM 419   C C   . PRO A 1 62   ? 63.370  -33.634 34.275  1.00 33.21  ? 62   PRO A C   1 
ATOM 420   O O   . PRO A 1 62   ? 62.403  -33.048 34.778  1.00 33.94  ? 62   PRO A O   1 
ATOM 421   C CB  . PRO A 1 62   ? 65.354  -32.514 33.296  1.00 61.18  ? 62   PRO A CB  1 
ATOM 422   C CG  . PRO A 1 62   ? 65.337  -31.157 32.740  1.00 49.85  ? 62   PRO A CG  1 
ATOM 423   C CD  . PRO A 1 62   ? 63.926  -30.720 32.623  1.00 34.25  ? 62   PRO A CD  1 
ATOM 424   N N   . MET A 1 63   ? 64.016  -34.629 34.884  1.00 24.40  ? 63   MET A N   1 
ATOM 425   C CA  . MET A 1 63   ? 63.458  -35.214 36.098  1.00 21.25  ? 63   MET A CA  1 
ATOM 426   C C   . MET A 1 63   ? 63.286  -34.115 37.148  1.00 23.34  ? 63   MET A C   1 
ATOM 427   O O   . MET A 1 63   ? 64.258  -33.606 37.722  1.00 24.34  ? 63   MET A O   1 
ATOM 428   C CB  . MET A 1 63   ? 64.293  -36.425 36.592  1.00 22.23  ? 63   MET A CB  1 
ATOM 429   C CG  . MET A 1 63   ? 63.619  -37.920 36.320  1.00 36.05  ? 63   MET A CG  1 
ATOM 430   S SD  . MET A 1 63   ? 63.344  -39.279 37.605  1.00 46.58  ? 63   MET A SD  1 
ATOM 431   C CE  . MET A 1 63   ? 62.099  -40.444 37.010  1.00 24.08  ? 63   MET A CE  1 
ATOM 432   N N   . ASN A 1 64   ? 62.011  -33.736 37.342  1.00 29.61  ? 64   ASN A N   1 
ATOM 433   C CA  . ASN A 1 64   ? 61.501  -32.837 38.395  1.00 34.01  ? 64   ASN A CA  1 
ATOM 434   C C   . ASN A 1 64   ? 61.167  -33.660 39.648  1.00 31.25  ? 64   ASN A C   1 
ATOM 435   O O   . ASN A 1 64   ? 60.034  -34.126 39.840  1.00 23.40  ? 64   ASN A O   1 
ATOM 436   C CB  . ASN A 1 64   ? 60.281  -32.090 37.857  1.00 34.24  ? 64   ASN A CB  1 
ATOM 437   C CG  . ASN A 1 64   ? 59.611  -31.203 38.903  1.00 35.93  ? 64   ASN A CG  1 
ATOM 438   O OD1 . ASN A 1 64   ? 59.861  -31.338 40.110  1.00 43.65  ? 64   ASN A OD1 1 
ATOM 439   N ND2 . ASN A 1 64   ? 58.753  -30.275 38.434  1.00 32.68  ? 64   ASN A ND2 1 
ATOM 440   N N   . ARG A 1 65   ? 62.170  -33.850 40.513  1.00 52.02  ? 65   ARG A N   1 
ATOM 441   C CA  . ARG A 1 65   ? 62.049  -34.758 41.653  1.00 54.36  ? 65   ARG A CA  1 
ATOM 442   C C   . ARG A 1 65   ? 61.112  -34.231 42.742  1.00 34.05  ? 65   ARG A C   1 
ATOM 443   O O   . ARG A 1 65   ? 61.183  -33.055 43.126  1.00 34.77  ? 65   ARG A O   1 
ATOM 444   C CB  . ARG A 1 65   ? 63.432  -35.068 42.261  1.00 81.98  ? 65   ARG A CB  1 
ATOM 445   C CG  . ARG A 1 65   ? 64.531  -34.057 42.032  1.00 83.02  ? 65   ARG A CG  1 
ATOM 446   C CD  . ARG A 1 65   ? 64.166  -32.741 42.600  1.00 57.20  ? 65   ARG A CD  1 
ATOM 447   N NE  . ARG A 1 65   ? 64.688  -31.817 41.630  1.00 58.06  ? 65   ARG A NE  1 
ATOM 448   C CZ  . ARG A 1 65   ? 64.526  -30.516 41.661  1.00 47.24  ? 65   ARG A CZ  1 
ATOM 449   N NH1 . ARG A 1 65   ? 63.893  -29.954 42.677  1.00 37.60  ? 65   ARG A NH1 1 
ATOM 450   N NH2 . ARG A 1 65   ? 65.080  -29.798 40.696  1.00 51.44  ? 65   ARG A NH2 1 
ATOM 451   N N   . TYR A 1 66   ? 60.262  -35.124 43.262  1.00 25.07  ? 66   TYR A N   1 
ATOM 452   C CA  . TYR A 1 66   ? 59.359  -34.762 44.346  1.00 23.61  ? 66   TYR A CA  1 
ATOM 453   C C   . TYR A 1 66   ? 59.307  -35.837 45.434  1.00 25.77  ? 66   TYR A C   1 
ATOM 454   O O   . TYR A 1 66   ? 58.244  -36.180 45.929  1.00 23.67  ? 66   TYR A O   1 
ATOM 455   C CB  . TYR A 1 66   ? 57.971  -34.444 43.806  1.00 24.09  ? 66   TYR A CB  1 
ATOM 456   C CG  . TYR A 1 66   ? 57.601  -33.002 44.056  1.00 29.70  ? 66   TYR A CG  1 
ATOM 457   C CD1 . TYR A 1 66   ? 58.411  -31.962 43.607  1.00 38.43  ? 66   TYR A CD1 1 
ATOM 458   C CD2 . TYR A 1 66   ? 56.426  -32.684 44.708  1.00 29.51  ? 66   TYR A CD2 1 
ATOM 459   C CE1 . TYR A 1 66   ? 58.066  -30.640 43.839  1.00 44.57  ? 66   TYR A CE1 1 
ATOM 460   C CE2 . TYR A 1 66   ? 56.100  -31.378 44.988  1.00 31.26  ? 66   TYR A CE2 1 
ATOM 461   C CZ  . TYR A 1 66   ? 56.881  -30.354 44.531  1.00 36.07  ? 66   TYR A CZ  1 
ATOM 462   O OH  . TYR A 1 66   ? 56.432  -29.081 44.869  1.00 34.78  ? 66   TYR A OH  1 
ATOM 463   N N   . SER A 1 67   ? 60.497  -36.310 45.885  1.00 32.64  ? 67   SER A N   1 
ATOM 464   C CA  . SER A 1 67   ? 60.683  -37.358 46.916  1.00 45.61  ? 67   SER A CA  1 
ATOM 465   C C   . SER A 1 67   ? 60.598  -36.875 48.383  1.00 61.92  ? 67   SER A C   1 
ATOM 466   O O   . SER A 1 67   ? 59.814  -37.431 49.185  1.00 62.14  ? 67   SER A O   1 
ATOM 467   C CB  . SER A 1 67   ? 62.029  -38.076 46.719  1.00 35.89  ? 67   SER A CB  1 
ATOM 468   O OG  . SER A 1 67   ? 61.985  -39.369 47.299  1.00 29.05  ? 67   SER A OG  1 
ATOM 469   N N   . ALA A 1 68   ? 61.405  -35.883 48.794  1.00 67.41  ? 68   ALA A N   1 
ATOM 470   C CA  . ALA A 1 68   ? 61.106  -35.164 50.045  1.00 60.55  ? 68   ALA A CA  1 
ATOM 471   C C   . ALA A 1 68   ? 59.639  -34.616 50.092  1.00 55.90  ? 68   ALA A C   1 
ATOM 472   O O   . ALA A 1 68   ? 58.917  -34.824 51.095  1.00 59.31  ? 68   ALA A O   1 
ATOM 473   C CB  . ALA A 1 68   ? 62.185  -34.085 50.269  1.00 38.81  ? 68   ALA A CB  1 
ATOM 474   N N   . GLN A 1 69   ? 59.193  -33.889 49.052  1.00 43.06  ? 69   GLN A N   1 
ATOM 475   C CA  . GLN A 1 69   ? 57.767  -33.651 48.934  1.00 28.87  ? 69   GLN A CA  1 
ATOM 476   C C   . GLN A 1 69   ? 57.084  -34.967 49.132  1.00 29.34  ? 69   GLN A C   1 
ATOM 477   O O   . GLN A 1 69   ? 56.072  -35.042 49.827  1.00 25.42  ? 69   GLN A O   1 
ATOM 478   C CB  . GLN A 1 69   ? 57.465  -33.140 47.556  1.00 23.94  ? 69   GLN A CB  1 
ATOM 479   C CG  . GLN A 1 69   ? 58.568  -32.153 47.201  1.00 28.98  ? 69   GLN A CG  1 
ATOM 480   C CD  . GLN A 1 69   ? 58.090  -30.792 47.247  1.00 32.73  ? 69   GLN A CD  1 
ATOM 481   O OE1 . GLN A 1 69   ? 56.929  -30.512 47.714  1.00 29.37  ? 69   GLN A OE1 1 
ATOM 482   N NE2 . GLN A 1 69   ? 58.944  -29.879 46.721  1.00 38.84  ? 69   GLN A NE2 1 
ATOM 483   N N   . LYS A 1 70   ? 57.670  -35.998 48.591  1.00 35.04  ? 70   LYS A N   1 
ATOM 484   C CA  . LYS A 1 70   ? 56.966  -37.248 48.460  1.00 33.01  ? 70   LYS A CA  1 
ATOM 485   C C   . LYS A 1 70   ? 56.244  -37.606 49.764  1.00 29.59  ? 70   LYS A C   1 
ATOM 486   O O   . LYS A 1 70   ? 55.000  -37.741 49.853  1.00 23.08  ? 70   LYS A O   1 
ATOM 487   C CB  . LYS A 1 70   ? 57.940  -38.390 48.095  1.00 34.86  ? 70   LYS A CB  1 
ATOM 488   N N   . GLN A 1 71   ? 57.089  -37.899 50.731  1.00 33.87  ? 71   GLN A N   1 
ATOM 489   C CA  . GLN A 1 71   ? 56.683  -37.990 52.105  1.00 32.76  ? 71   GLN A CA  1 
ATOM 490   C C   . GLN A 1 71   ? 55.883  -36.766 52.551  1.00 29.23  ? 71   GLN A C   1 
ATOM 491   O O   . GLN A 1 71   ? 54.973  -36.905 53.383  1.00 27.54  ? 71   GLN A O   1 
ATOM 492   C CB  . GLN A 1 71   ? 57.919  -38.243 52.977  1.00 22.79  ? 71   GLN A CB  1 
ATOM 493   C CG  . GLN A 1 71   ? 58.580  -39.575 52.570  1.00 12.57  ? 71   GLN A CG  1 
ATOM 494   C CD  . GLN A 1 71   ? 59.799  -39.778 53.303  1.00 8.84   ? 71   GLN A CD  1 
ATOM 495   O OE1 . GLN A 1 71   ? 60.710  -38.979 53.198  1.00 8.84   ? 71   GLN A OE1 1 
ATOM 496   N NE2 . GLN A 1 71   ? 59.803  -40.769 54.163  1.00 8.84   ? 71   GLN A NE2 1 
ATOM 497   N N   . PHE A 1 72   ? 56.069  -35.596 51.950  1.00 23.98  ? 72   PHE A N   1 
ATOM 498   C CA  . PHE A 1 72   ? 55.094  -34.571 52.306  1.00 19.31  ? 72   PHE A CA  1 
ATOM 499   C C   . PHE A 1 72   ? 53.702  -34.851 51.727  1.00 23.89  ? 72   PHE A C   1 
ATOM 500   O O   . PHE A 1 72   ? 52.701  -34.461 52.350  1.00 26.48  ? 72   PHE A O   1 
ATOM 501   C CB  . PHE A 1 72   ? 55.492  -33.175 51.919  1.00 17.83  ? 72   PHE A CB  1 
ATOM 502   C CG  . PHE A 1 72   ? 54.656  -32.132 52.645  1.00 20.19  ? 72   PHE A CG  1 
ATOM 503   C CD1 . PHE A 1 72   ? 53.359  -31.819 52.218  1.00 21.70  ? 72   PHE A CD1 1 
ATOM 504   C CD2 . PHE A 1 72   ? 55.074  -31.620 53.872  1.00 20.18  ? 72   PHE A CD2 1 
ATOM 505   C CE1 . PHE A 1 72   ? 52.580  -30.890 52.942  1.00 28.73  ? 72   PHE A CE1 1 
ATOM 506   C CE2 . PHE A 1 72   ? 54.336  -30.695 54.542  1.00 25.16  ? 72   PHE A CE2 1 
ATOM 507   C CZ  . PHE A 1 72   ? 53.099  -30.330 54.097  1.00 26.53  ? 72   PHE A CZ  1 
ATOM 508   N N   . TRP A 1 73   ? 53.597  -35.448 50.517  1.00 25.94  ? 73   TRP A N   1 
ATOM 509   C CA  . TRP A 1 73   ? 52.318  -35.463 49.810  1.00 30.17  ? 73   TRP A CA  1 
ATOM 510   C C   . TRP A 1 73   ? 51.450  -36.622 50.253  1.00 33.30  ? 73   TRP A C   1 
ATOM 511   O O   . TRP A 1 73   ? 50.219  -36.482 50.352  1.00 38.56  ? 73   TRP A O   1 
ATOM 512   C CB  . TRP A 1 73   ? 52.410  -35.528 48.263  1.00 29.35  ? 73   TRP A CB  1 
ATOM 513   C CG  . TRP A 1 73   ? 53.701  -35.762 47.455  1.00 28.87  ? 73   TRP A CG  1 
ATOM 514   C CD1 . TRP A 1 73   ? 54.630  -34.792 47.073  1.00 30.24  ? 73   TRP A CD1 1 
ATOM 515   C CD2 . TRP A 1 73   ? 54.199  -36.990 46.966  1.00 25.89  ? 73   TRP A CD2 1 
ATOM 516   N NE1 . TRP A 1 73   ? 55.621  -35.395 46.327  1.00 26.35  ? 73   TRP A NE1 1 
ATOM 517   C CE2 . TRP A 1 73   ? 55.349  -36.718 46.199  1.00 24.04  ? 73   TRP A CE2 1 
ATOM 518   C CE3 . TRP A 1 73   ? 53.705  -38.325 46.985  1.00 25.62  ? 73   TRP A CE3 1 
ATOM 519   C CZ2 . TRP A 1 73   ? 56.048  -37.701 45.556  1.00 21.40  ? 73   TRP A CZ2 1 
ATOM 520   C CZ3 . TRP A 1 73   ? 54.444  -39.307 46.368  1.00 24.42  ? 73   TRP A CZ3 1 
ATOM 521   C CH2 . TRP A 1 73   ? 55.604  -39.003 45.659  1.00 20.65  ? 73   TRP A CH2 1 
ATOM 522   N N   . LYS A 1 74   ? 52.050  -37.793 50.447  1.00 28.36  ? 74   LYS A N   1 
ATOM 523   C CA  . LYS A 1 74   ? 51.224  -38.942 50.779  1.00 32.65  ? 74   LYS A CA  1 
ATOM 524   C C   . LYS A 1 74   ? 50.281  -38.624 51.939  1.00 41.18  ? 74   LYS A C   1 
ATOM 525   O O   . LYS A 1 74   ? 49.055  -38.663 51.773  1.00 47.55  ? 74   LYS A O   1 
ATOM 526   C CB  . LYS A 1 74   ? 52.096  -40.147 51.090  1.00 30.90  ? 74   LYS A CB  1 
ATOM 527   C CG  . LYS A 1 74   ? 51.588  -41.397 50.401  1.00 36.34  ? 74   LYS A CG  1 
ATOM 528   C CD  . LYS A 1 74   ? 52.558  -42.555 50.562  1.00 34.13  ? 74   LYS A CD  1 
ATOM 529   C CE  . LYS A 1 74   ? 52.426  -43.224 51.922  1.00 37.79  ? 74   LYS A CE  1 
ATOM 530   N NZ  . LYS A 1 74   ? 53.641  -44.014 52.255  1.00 31.29  ? 74   LYS A NZ  1 
ATOM 531   N N   . ALA A 1 75   ? 50.832  -38.298 53.112  1.00 44.83  ? 75   ALA A N   1 
ATOM 532   C CA  . ALA A 1 75   ? 49.980  -37.976 54.255  1.00 49.97  ? 75   ALA A CA  1 
ATOM 533   C C   . ALA A 1 75   ? 49.202  -36.671 54.039  1.00 59.10  ? 75   ALA A C   1 
ATOM 534   O O   . ALA A 1 75   ? 48.011  -36.590 54.370  1.00 70.09  ? 75   ALA A O   1 
ATOM 535   C CB  . ALA A 1 75   ? 50.818  -37.909 55.535  1.00 40.77  ? 75   ALA A CB  1 
ATOM 536   N N   . ALA A 1 76   ? 49.850  -35.642 53.483  1.00 55.05  ? 76   ALA A N   1 
ATOM 537   C CA  . ALA A 1 76   ? 49.190  -34.351 53.222  1.00 43.96  ? 76   ALA A CA  1 
ATOM 538   C C   . ALA A 1 76   ? 48.029  -34.505 52.233  1.00 25.25  ? 76   ALA A C   1 
ATOM 539   O O   . ALA A 1 76   ? 47.032  -33.781 52.295  1.00 16.64  ? 76   ALA A O   1 
ATOM 540   C CB  . ALA A 1 76   ? 50.198  -33.322 52.699  1.00 32.73  ? 76   ALA A CB  1 
ATOM 541   N N   . ASP A 1 85   ? 53.440  -34.376 63.865  1.00 38.37  ? 85   ASP A N   1 
ATOM 542   C CA  . ASP A 1 85   ? 53.405  -33.225 64.750  1.00 34.91  ? 85   ASP A CA  1 
ATOM 543   C C   . ASP A 1 85   ? 53.648  -31.943 63.957  1.00 44.24  ? 85   ASP A C   1 
ATOM 544   O O   . ASP A 1 85   ? 53.873  -31.968 62.738  1.00 38.73  ? 85   ASP A O   1 
ATOM 545   C CB  . ASP A 1 85   ? 54.440  -33.374 65.870  1.00 27.36  ? 85   ASP A CB  1 
ATOM 546   N N   . ALA A 1 86   ? 53.600  -30.818 64.669  1.00 57.47  ? 86   ALA A N   1 
ATOM 547   C CA  . ALA A 1 86   ? 53.790  -29.522 64.027  1.00 57.32  ? 86   ALA A CA  1 
ATOM 548   C C   . ALA A 1 86   ? 55.195  -29.393 63.430  1.00 36.48  ? 86   ALA A C   1 
ATOM 549   O O   . ALA A 1 86   ? 55.365  -28.894 62.308  1.00 28.19  ? 86   ALA A O   1 
ATOM 550   C CB  . ALA A 1 86   ? 53.506  -28.407 65.039  1.00 71.30  ? 86   ALA A CB  1 
ATOM 551   N N   . VAL A 1 87   ? 56.213  -29.844 64.163  1.00 32.84  ? 87   VAL A N   1 
ATOM 552   C CA  . VAL A 1 87   ? 57.569  -29.783 63.637  1.00 20.35  ? 87   VAL A CA  1 
ATOM 553   C C   . VAL A 1 87   ? 57.652  -30.562 62.331  1.00 17.89  ? 87   VAL A C   1 
ATOM 554   O O   . VAL A 1 87   ? 58.200  -30.076 61.330  1.00 15.14  ? 87   VAL A O   1 
ATOM 555   C CB  . VAL A 1 87   ? 58.562  -30.287 64.695  1.00 20.12  ? 87   VAL A CB  1 
ATOM 556   C CG1 . VAL A 1 87   ? 59.912  -29.661 64.482  1.00 16.13  ? 87   VAL A CG1 1 
ATOM 557   C CG2 . VAL A 1 87   ? 58.044  -29.931 66.069  1.00 20.47  ? 87   VAL A CG2 1 
ATOM 558   N N   . LEU A 1 88   ? 57.041  -31.753 62.302  1.00 19.47  ? 88   LEU A N   1 
ATOM 559   C CA  . LEU A 1 88   ? 57.042  -32.577 61.098  1.00 17.31  ? 88   LEU A CA  1 
ATOM 560   C C   . LEU A 1 88   ? 56.599  -31.785 59.872  1.00 18.89  ? 88   LEU A C   1 
ATOM 561   O O   . LEU A 1 88   ? 57.115  -32.014 58.775  1.00 23.05  ? 88   LEU A O   1 
ATOM 562   C CB  . LEU A 1 88   ? 56.151  -33.815 61.280  1.00 16.75  ? 88   LEU A CB  1 
ATOM 563   C CG  . LEU A 1 88   ? 56.605  -34.978 62.168  1.00 13.54  ? 88   LEU A CG  1 
ATOM 564   C CD1 . LEU A 1 88   ? 56.398  -34.571 63.620  1.00 21.29  ? 88   LEU A CD1 1 
ATOM 565   C CD2 . LEU A 1 88   ? 55.850  -36.255 61.865  1.00 8.78   ? 88   LEU A CD2 1 
ATOM 566   N N   . LEU A 1 89   ? 55.649  -30.848 60.027  1.00 18.99  ? 89   LEU A N   1 
ATOM 567   C CA  . LEU A 1 89   ? 55.181  -30.087 58.865  1.00 19.68  ? 89   LEU A CA  1 
ATOM 568   C C   . LEU A 1 89   ? 56.185  -29.022 58.427  1.00 18.35  ? 89   LEU A C   1 
ATOM 569   O O   . LEU A 1 89   ? 56.259  -28.693 57.233  1.00 17.84  ? 89   LEU A O   1 
ATOM 570   C CB  . LEU A 1 89   ? 53.817  -29.443 59.135  1.00 22.17  ? 89   LEU A CB  1 
ATOM 571   C CG  . LEU A 1 89   ? 52.577  -30.293 58.817  1.00 20.13  ? 89   LEU A CG  1 
ATOM 572   C CD1 . LEU A 1 89   ? 51.770  -30.542 60.082  1.00 24.79  ? 89   LEU A CD1 1 
ATOM 573   C CD2 . LEU A 1 89   ? 51.709  -29.668 57.723  1.00 16.34  ? 89   LEU A CD2 1 
ATOM 574   N N   . ASN A 1 90   ? 56.952  -28.464 59.365  1.00 12.56  ? 90   ASN A N   1 
ATOM 575   C CA  . ASN A 1 90   ? 58.064  -27.606 58.972  1.00 14.88  ? 90   ASN A CA  1 
ATOM 576   C C   . ASN A 1 90   ? 59.141  -28.397 58.226  1.00 21.19  ? 90   ASN A C   1 
ATOM 577   O O   . ASN A 1 90   ? 59.685  -27.923 57.223  1.00 22.87  ? 90   ASN A O   1 
ATOM 578   C CB  . ASN A 1 90   ? 58.668  -26.919 60.196  1.00 10.63  ? 90   ASN A CB  1 
ATOM 579   C CG  . ASN A 1 90   ? 57.664  -26.679 61.284  1.00 8.62   ? 90   ASN A CG  1 
ATOM 580   O OD1 . ASN A 1 90   ? 57.253  -25.555 61.541  1.00 8.62   ? 90   ASN A OD1 1 
ATOM 581   N ND2 . ASN A 1 90   ? 57.262  -27.737 61.932  1.00 13.08  ? 90   ASN A ND2 1 
ATOM 582   N N   . LYS A 1 91   ? 59.479  -29.599 58.708  1.00 24.08  ? 91   LYS A N   1 
ATOM 583   C CA  . LYS A 1 91   ? 60.539  -30.385 58.072  1.00 28.81  ? 91   LYS A CA  1 
ATOM 584   C C   . LYS A 1 91   ? 60.119  -30.843 56.674  1.00 27.29  ? 91   LYS A C   1 
ATOM 585   O O   . LYS A 1 91   ? 60.746  -30.483 55.663  1.00 23.07  ? 91   LYS A O   1 
ATOM 586   C CB  . LYS A 1 91   ? 60.905  -31.586 58.967  1.00 28.77  ? 91   LYS A CB  1 
ATOM 587   C CG  . LYS A 1 91   ? 61.599  -31.189 60.308  1.00 29.01  ? 91   LYS A CG  1 
ATOM 588   C CD  . LYS A 1 91   ? 61.388  -32.188 61.481  1.00 19.08  ? 91   LYS A CD  1 
ATOM 589   C CE  . LYS A 1 91   ? 61.730  -31.576 62.866  1.00 17.26  ? 91   LYS A CE  1 
ATOM 590   N NZ  . LYS A 1 91   ? 62.901  -32.192 63.577  1.00 8.77   ? 91   LYS A NZ  1 
ATOM 591   N N   . LEU A 1 92   ? 59.049  -31.642 56.609  1.00 34.66  ? 92   LEU A N   1 
ATOM 592   C CA  . LEU A 1 92   ? 58.478  -32.079 55.338  1.00 30.05  ? 92   LEU A CA  1 
ATOM 593   C C   . LEU A 1 92   ? 58.253  -30.891 54.401  1.00 24.22  ? 92   LEU A C   1 
ATOM 594   O O   . LEU A 1 92   ? 58.472  -30.986 53.184  1.00 23.88  ? 92   LEU A O   1 
ATOM 595   C CB  . LEU A 1 92   ? 57.169  -32.828 55.619  1.00 27.19  ? 92   LEU A CB  1 
ATOM 596   C CG  . LEU A 1 92   ? 56.955  -34.283 55.256  1.00 20.78  ? 92   LEU A CG  1 
ATOM 597   C CD1 . LEU A 1 92   ? 55.450  -34.672 55.375  1.00 19.95  ? 92   LEU A CD1 1 
ATOM 598   C CD2 . LEU A 1 92   ? 57.634  -34.423 53.870  1.00 24.21  ? 92   LEU A CD2 1 
ATOM 599   N N   . HIS A 1 93   ? 57.845  -29.751 54.959  1.00 23.19  ? 93   HIS A N   1 
ATOM 600   C CA  . HIS A 1 93   ? 57.734  -28.556 54.141  1.00 20.54  ? 93   HIS A CA  1 
ATOM 601   C C   . HIS A 1 93   ? 59.099  -28.124 53.606  1.00 23.97  ? 93   HIS A C   1 
ATOM 602   O O   . HIS A 1 93   ? 59.215  -27.734 52.436  1.00 31.80  ? 93   HIS A O   1 
ATOM 603   C CB  . HIS A 1 93   ? 57.067  -27.450 54.949  1.00 18.99  ? 93   HIS A CB  1 
ATOM 604   C CG  . HIS A 1 93   ? 56.544  -26.338 54.109  1.00 24.08  ? 93   HIS A CG  1 
ATOM 605   N ND1 . HIS A 1 93   ? 57.265  -25.187 53.875  1.00 33.45  ? 93   HIS A ND1 1 
ATOM 606   C CD2 . HIS A 1 93   ? 55.386  -26.205 53.422  1.00 25.78  ? 93   HIS A CD2 1 
ATOM 607   C CE1 . HIS A 1 93   ? 56.570  -24.386 53.089  1.00 43.85  ? 93   HIS A CE1 1 
ATOM 608   N NE2 . HIS A 1 93   ? 55.425  -24.980 52.798  1.00 49.11  ? 93   HIS A NE2 1 
ATOM 609   N N   . HIS A 1 94   ? 60.151  -28.216 54.437  1.00 22.25  ? 94   HIS A N   1 
ATOM 610   C CA  . HIS A 1 94   ? 61.492  -27.808 54.010  1.00 22.20  ? 94   HIS A CA  1 
ATOM 611   C C   . HIS A 1 94   ? 61.987  -28.683 52.861  1.00 28.93  ? 94   HIS A C   1 
ATOM 612   O O   . HIS A 1 94   ? 62.665  -28.208 51.929  1.00 37.93  ? 94   HIS A O   1 
ATOM 613   C CB  . HIS A 1 94   ? 62.470  -27.862 55.184  1.00 12.10  ? 94   HIS A CB  1 
ATOM 614   C CG  . HIS A 1 94   ? 63.856  -27.502 54.783  1.00 9.53   ? 94   HIS A CG  1 
ATOM 615   N ND1 . HIS A 1 94   ? 64.980  -28.068 55.344  1.00 8.79   ? 94   HIS A ND1 1 
ATOM 616   C CD2 . HIS A 1 94   ? 64.295  -26.648 53.833  1.00 10.88  ? 94   HIS A CD2 1 
ATOM 617   C CE1 . HIS A 1 94   ? 66.054  -27.564 54.757  1.00 8.79   ? 94   HIS A CE1 1 
ATOM 618   N NE2 . HIS A 1 94   ? 65.664  -26.700 53.839  1.00 8.79   ? 94   HIS A NE2 1 
ATOM 619   N N   . ALA A 1 95   ? 61.638  -29.965 52.911  1.00 31.59  ? 95   ALA A N   1 
ATOM 620   C CA  . ALA A 1 95   ? 61.768  -30.828 51.749  1.00 39.16  ? 95   ALA A CA  1 
ATOM 621   C C   . ALA A 1 95   ? 61.024  -30.253 50.535  1.00 47.92  ? 95   ALA A C   1 
ATOM 622   O O   . ALA A 1 95   ? 61.574  -30.213 49.421  1.00 56.48  ? 95   ALA A O   1 
ATOM 623   C CB  . ALA A 1 95   ? 61.253  -32.215 52.121  1.00 38.36  ? 95   ALA A CB  1 
ATOM 624   N N   . ALA A 1 96   ? 59.786  -29.765 50.742  1.00 43.69  ? 96   ALA A N   1 
ATOM 625   C CA  . ALA A 1 96   ? 58.986  -29.225 49.635  1.00 43.53  ? 96   ALA A CA  1 
ATOM 626   C C   . ALA A 1 96   ? 59.670  -28.042 48.931  1.00 43.51  ? 96   ALA A C   1 
ATOM 627   O O   . ALA A 1 96   ? 59.753  -28.006 47.691  1.00 47.15  ? 96   ALA A O   1 
ATOM 628   C CB  . ALA A 1 96   ? 57.601  -28.813 50.139  1.00 47.31  ? 96   ALA A CB  1 
ATOM 629   N N   . ASP A 1 97   ? 60.145  -27.049 49.696  1.00 38.10  ? 97   ASP A N   1 
ATOM 630   C CA  . ASP A 1 97   ? 60.777  -25.887 49.063  1.00 34.94  ? 97   ASP A CA  1 
ATOM 631   C C   . ASP A 1 97   ? 62.116  -26.252 48.416  1.00 40.25  ? 97   ASP A C   1 
ATOM 632   O O   . ASP A 1 97   ? 62.492  -25.654 47.391  1.00 38.92  ? 97   ASP A O   1 
ATOM 633   C CB  . ASP A 1 97   ? 60.953  -24.754 50.077  1.00 31.47  ? 97   ASP A CB  1 
ATOM 634   N N   . LEU A 1 98   ? 62.843  -27.231 49.005  1.00 51.00  ? 98   LEU A N   1 
ATOM 635   C CA  . LEU A 1 98   ? 64.076  -27.757 48.405  1.00 56.36  ? 98   LEU A CA  1 
ATOM 636   C C   . LEU A 1 98   ? 63.818  -28.363 47.027  1.00 58.28  ? 98   LEU A C   1 
ATOM 637   O O   . LEU A 1 98   ? 64.595  -28.152 46.091  1.00 61.89  ? 98   LEU A O   1 
ATOM 638   C CB  . LEU A 1 98   ? 64.735  -28.793 49.343  1.00 42.39  ? 98   LEU A CB  1 
ATOM 639   C CG  . LEU A 1 98   ? 65.202  -28.300 50.729  1.00 22.52  ? 98   LEU A CG  1 
ATOM 640   C CD1 . LEU A 1 98   ? 65.840  -29.414 51.530  1.00 15.17  ? 98   LEU A CD1 1 
ATOM 641   C CD2 . LEU A 1 98   ? 66.132  -27.088 50.662  1.00 16.72  ? 98   LEU A CD2 1 
ATOM 642   N N   . GLU A 1 99   ? 62.718  -29.082 46.864  1.00 50.22  ? 99   GLU A N   1 
ATOM 643   C CA  . GLU A 1 99   ? 62.487  -29.704 45.570  1.00 39.33  ? 99   GLU A CA  1 
ATOM 644   C C   . GLU A 1 99   ? 61.789  -28.839 44.508  1.00 39.02  ? 99   GLU A C   1 
ATOM 645   O O   . GLU A 1 99   ? 62.141  -28.932 43.331  1.00 36.10  ? 99   GLU A O   1 
ATOM 646   C CB  . GLU A 1 99   ? 61.695  -30.935 45.797  1.00 35.48  ? 99   GLU A CB  1 
ATOM 647   C CG  . GLU A 1 99   ? 62.470  -32.094 45.633  1.00 31.21  ? 99   GLU A CG  1 
ATOM 648   C CD  . GLU A 1 99   ? 61.463  -33.136 45.775  1.00 35.99  ? 99   GLU A CD  1 
ATOM 649   O OE1 . GLU A 1 99   ? 60.273  -32.754 45.559  1.00 29.41  ? 99   GLU A OE1 1 
ATOM 650   O OE2 . GLU A 1 99   ? 61.817  -34.221 46.261  1.00 47.39  ? 99   GLU A OE2 1 
ATOM 651   N N   . LYS A 1 100  ? 60.774  -28.033 44.854  1.00 40.80  ? 100  LYS A N   1 
ATOM 652   C CA  . LYS A 1 100  ? 60.192  -27.110 43.861  1.00 36.17  ? 100  LYS A CA  1 
ATOM 653   C C   . LYS A 1 100  ? 61.174  -26.012 43.441  1.00 40.31  ? 100  LYS A C   1 
ATOM 654   O O   . LYS A 1 100  ? 61.254  -25.647 42.255  1.00 35.35  ? 100  LYS A O   1 
ATOM 655   C CB  . LYS A 1 100  ? 58.950  -26.421 44.411  1.00 35.76  ? 100  LYS A CB  1 
ATOM 656   C CG  . LYS A 1 100  ? 58.288  -27.102 45.463  1.00 42.33  ? 100  LYS A CG  1 
ATOM 657   C CD  . LYS A 1 100  ? 57.588  -26.195 46.509  1.00 52.39  ? 100  LYS A CD  1 
ATOM 658   C CE  . LYS A 1 100  ? 56.310  -25.549 45.897  1.00 52.88  ? 100  LYS A CE  1 
ATOM 659   N NZ  . LYS A 1 100  ? 55.443  -24.859 46.963  1.00 41.49  ? 100  LYS A NZ  1 
ATOM 660   N N   . LYS A 1 101  ? 61.915  -25.464 44.420  1.00 51.81  ? 101  LYS A N   1 
ATOM 661   C CA  . LYS A 1 101  ? 62.941  -24.447 44.178  1.00 61.06  ? 101  LYS A CA  1 
ATOM 662   C C   . LYS A 1 101  ? 64.208  -25.026 43.524  1.00 74.90  ? 101  LYS A C   1 
ATOM 663   O O   . LYS A 1 101  ? 64.776  -24.394 42.621  1.00 74.77  ? 101  LYS A O   1 
ATOM 664   C CB  . LYS A 1 101  ? 63.284  -23.737 45.495  1.00 45.99  ? 101  LYS A CB  1 
ATOM 665   N N   . GLN A 1 102  ? 64.680  -26.211 43.976  1.00 77.48  ? 102  GLN A N   1 
ATOM 666   C CA  . GLN A 1 102  ? 65.722  -26.966 43.250  1.00 60.77  ? 102  GLN A CA  1 
ATOM 667   C C   . GLN A 1 102  ? 65.298  -27.233 41.810  1.00 44.39  ? 102  GLN A C   1 
ATOM 668   O O   . GLN A 1 102  ? 66.146  -27.171 40.895  1.00 31.83  ? 102  GLN A O   1 
ATOM 669   C CB  . GLN A 1 102  ? 66.032  -28.330 43.901  1.00 52.58  ? 102  GLN A CB  1 
ATOM 670   C CG  . GLN A 1 102  ? 67.035  -28.350 45.008  1.00 53.17  ? 102  GLN A CG  1 
ATOM 671   C CD  . GLN A 1 102  ? 66.769  -29.469 46.009  1.00 46.22  ? 102  GLN A CD  1 
ATOM 672   O OE1 . GLN A 1 102  ? 66.190  -30.521 45.687  1.00 31.06  ? 102  GLN A OE1 1 
ATOM 673   N NE2 . GLN A 1 102  ? 67.171  -29.226 47.249  1.00 49.64  ? 102  GLN A NE2 1 
ATOM 674   N N   . ASN A 1 103  ? 64.018  -27.569 41.620  1.00 45.35  ? 103  ASN A N   1 
ATOM 675   C CA  . ASN A 1 103  ? 63.500  -27.582 40.273  1.00 38.57  ? 103  ASN A CA  1 
ATOM 676   C C   . ASN A 1 103  ? 63.798  -26.278 39.567  1.00 36.25  ? 103  ASN A C   1 
ATOM 677   O O   . ASN A 1 103  ? 64.662  -26.283 38.696  1.00 22.65  ? 103  ASN A O   1 
ATOM 678   C CB  . ASN A 1 103  ? 62.025  -27.842 40.221  1.00 33.74  ? 103  ASN A CB  1 
ATOM 679   C CG  . ASN A 1 103  ? 61.739  -29.241 40.495  1.00 34.72  ? 103  ASN A CG  1 
ATOM 680   O OD1 . ASN A 1 103  ? 62.215  -30.141 39.821  1.00 38.23  ? 103  ASN A OD1 1 
ATOM 681   N ND2 . ASN A 1 103  ? 60.947  -29.454 41.509  1.00 33.44  ? 103  ASN A ND2 1 
ATOM 682   N N   . GLU A 1 104  ? 63.102  -25.194 39.868  1.00 35.01  ? 104  GLU A N   1 
ATOM 683   C CA  . GLU A 1 104  ? 63.600  -23.925 39.357  1.00 25.17  ? 104  GLU A CA  1 
ATOM 684   C C   . GLU A 1 104  ? 65.055  -24.175 38.799  1.00 18.19  ? 104  GLU A C   1 
ATOM 685   O O   . GLU A 1 104  ? 65.228  -24.517 37.618  1.00 19.74  ? 104  GLU A O   1 
ATOM 686   C CB  . GLU A 1 104  ? 63.601  -22.821 40.461  1.00 25.85  ? 104  GLU A CB  1 
ATOM 687   N N   . THR A 1 105  ? 66.044  -24.066 39.673  1.00 17.36  ? 105  THR A N   1 
ATOM 688   C CA  . THR A 1 105  ? 67.424  -24.129 39.311  1.00 14.52  ? 105  THR A CA  1 
ATOM 689   C C   . THR A 1 105  ? 67.762  -25.183 38.210  1.00 15.55  ? 105  THR A C   1 
ATOM 690   O O   . THR A 1 105  ? 68.356  -24.855 37.145  1.00 19.54  ? 105  THR A O   1 
ATOM 691   C CB  . THR A 1 105  ? 68.320  -24.347 40.575  1.00 11.69  ? 105  THR A CB  1 
ATOM 692   O OG1 . THR A 1 105  ? 67.992  -23.372 41.591  1.00 12.63  ? 105  THR A OG1 1 
ATOM 693   C CG2 . THR A 1 105  ? 69.816  -24.114 40.278  1.00 14.74  ? 105  THR A CG2 1 
ATOM 694   N N   . GLU A 1 106  ? 67.341  -26.430 38.393  1.00 13.66  ? 106  GLU A N   1 
ATOM 695   C CA  . GLU A 1 106  ? 67.510  -27.463 37.368  1.00 15.30  ? 106  GLU A CA  1 
ATOM 696   C C   . GLU A 1 106  ? 66.812  -27.087 36.064  1.00 17.11  ? 106  GLU A C   1 
ATOM 697   O O   . GLU A 1 106  ? 67.466  -26.911 35.026  1.00 18.95  ? 106  GLU A O   1 
ATOM 698   C CB  . GLU A 1 106  ? 67.015  -28.807 37.872  1.00 16.00  ? 106  GLU A CB  1 
ATOM 699   C CG  . GLU A 1 106  ? 68.057  -29.478 38.734  1.00 15.04  ? 106  GLU A CG  1 
ATOM 700   C CD  . GLU A 1 106  ? 69.409  -28.836 38.539  1.00 8.68   ? 106  GLU A CD  1 
ATOM 701   O OE1 . GLU A 1 106  ? 70.127  -29.233 37.606  1.00 8.68   ? 106  GLU A OE1 1 
ATOM 702   O OE2 . GLU A 1 106  ? 69.711  -27.871 39.265  1.00 8.68   ? 106  GLU A OE2 1 
ATOM 703   N N   . ASN A 1 107  ? 65.480  -26.972 36.079  1.00 18.02  ? 107  ASN A N   1 
ATOM 704   C CA  . ASN A 1 107  ? 64.770  -26.772 34.813  1.00 25.35  ? 107  ASN A CA  1 
ATOM 705   C C   . ASN A 1 107  ? 65.223  -25.489 34.084  1.00 38.08  ? 107  ASN A C   1 
ATOM 706   O O   . ASN A 1 107  ? 65.630  -25.552 32.912  1.00 57.24  ? 107  ASN A O   1 
ATOM 707   C CB  . ASN A 1 107  ? 63.247  -26.805 35.018  1.00 26.84  ? 107  ASN A CB  1 
ATOM 708   C CG  . ASN A 1 107  ? 62.842  -27.111 36.436  1.00 20.66  ? 107  ASN A CG  1 
ATOM 709   O OD1 . ASN A 1 107  ? 62.763  -28.274 36.837  1.00 17.46  ? 107  ASN A OD1 1 
ATOM 710   N ND2 . ASN A 1 107  ? 62.527  -26.061 37.195  1.00 23.21  ? 107  ASN A ND2 1 
ATOM 711   N N   . ARG A 1 108  ? 65.168  -24.303 34.737  1.00 39.93  ? 108  ARG A N   1 
ATOM 712   C CA  . ARG A 1 108  ? 65.537  -23.107 33.956  1.00 37.91  ? 108  ARG A CA  1 
ATOM 713   C C   . ARG A 1 108  ? 66.952  -23.257 33.377  1.00 36.22  ? 108  ARG A C   1 
ATOM 714   O O   . ARG A 1 108  ? 67.157  -22.981 32.188  1.00 31.56  ? 108  ARG A O   1 
ATOM 715   C CB  . ARG A 1 108  ? 65.425  -21.760 34.715  1.00 23.58  ? 108  ARG A CB  1 
ATOM 716   C CG  . ARG A 1 108  ? 64.126  -21.222 35.394  1.00 19.20  ? 108  ARG A CG  1 
ATOM 717   C CD  . ARG A 1 108  ? 64.539  -21.178 36.832  1.00 12.02  ? 108  ARG A CD  1 
ATOM 718   N NE  . ARG A 1 108  ? 65.323  -22.349 36.671  1.00 15.91  ? 108  ARG A NE  1 
ATOM 719   C CZ  . ARG A 1 108  ? 66.604  -22.436 36.884  1.00 17.11  ? 108  ARG A CZ  1 
ATOM 720   N NH1 . ARG A 1 108  ? 67.226  -21.417 37.329  1.00 15.25  ? 108  ARG A NH1 1 
ATOM 721   N NH2 . ARG A 1 108  ? 67.250  -23.474 36.464  1.00 24.06  ? 108  ARG A NH2 1 
ATOM 722   N N   . LYS A 1 109  ? 67.922  -23.792 34.157  1.00 38.30  ? 109  LYS A N   1 
ATOM 723   C CA  . LYS A 1 109  ? 69.244  -23.975 33.569  1.00 27.31  ? 109  LYS A CA  1 
ATOM 724   C C   . LYS A 1 109  ? 69.254  -25.061 32.495  1.00 32.37  ? 109  LYS A C   1 
ATOM 725   O O   . LYS A 1 109  ? 70.260  -25.185 31.797  1.00 46.59  ? 109  LYS A O   1 
ATOM 726   C CB  . LYS A 1 109  ? 70.263  -24.275 34.674  1.00 13.86  ? 109  LYS A CB  1 
ATOM 727   C CG  . LYS A 1 109  ? 71.322  -25.278 34.287  1.00 8.76   ? 109  LYS A CG  1 
ATOM 728   C CD  . LYS A 1 109  ? 71.528  -26.172 35.413  1.00 8.76   ? 109  LYS A CD  1 
ATOM 729   C CE  . LYS A 1 109  ? 70.184  -26.643 35.903  1.00 11.48  ? 109  LYS A CE  1 
ATOM 730   N NZ  . LYS A 1 109  ? 70.321  -26.350 37.327  1.00 11.79  ? 109  LYS A NZ  1 
ATOM 731   N N   . LEU A 1 110  ? 68.146  -25.774 32.268  1.00 26.37  ? 110  LEU A N   1 
ATOM 732   C CA  . LEU A 1 110  ? 68.236  -26.977 31.433  1.00 23.27  ? 110  LEU A CA  1 
ATOM 733   C C   . LEU A 1 110  ? 68.078  -26.771 29.905  1.00 26.82  ? 110  LEU A C   1 
ATOM 734   O O   . LEU A 1 110  ? 68.268  -27.736 29.157  1.00 28.88  ? 110  LEU A O   1 
ATOM 735   C CB  . LEU A 1 110  ? 67.215  -27.989 31.924  1.00 20.45  ? 110  LEU A CB  1 
ATOM 736   C CG  . LEU A 1 110  ? 66.829  -28.906 30.787  1.00 21.21  ? 110  LEU A CG  1 
ATOM 737   C CD1 . LEU A 1 110  ? 67.482  -30.290 30.834  1.00 21.89  ? 110  LEU A CD1 1 
ATOM 738   C CD2 . LEU A 1 110  ? 65.334  -28.932 30.829  1.00 28.68  ? 110  LEU A CD2 1 
ATOM 739   N N   . LEU A 1 111  ? 67.796  -25.562 29.402  1.00 25.12  ? 111  LEU A N   1 
ATOM 740   C CA  . LEU A 1 111  ? 67.453  -25.382 27.982  1.00 23.19  ? 111  LEU A CA  1 
ATOM 741   C C   . LEU A 1 111  ? 68.641  -25.568 27.015  1.00 20.97  ? 111  LEU A C   1 
ATOM 742   O O   . LEU A 1 111  ? 69.742  -25.062 27.239  1.00 17.10  ? 111  LEU A O   1 
ATOM 743   C CB  . LEU A 1 111  ? 66.840  -24.003 27.800  1.00 21.56  ? 111  LEU A CB  1 
ATOM 744   C CG  . LEU A 1 111  ? 65.368  -24.038 27.454  1.00 19.36  ? 111  LEU A CG  1 
ATOM 745   C CD1 . LEU A 1 111  ? 64.946  -22.547 27.211  1.00 20.05  ? 111  LEU A CD1 1 
ATOM 746   C CD2 . LEU A 1 111  ? 65.193  -24.803 26.234  1.00 18.92  ? 111  LEU A CD2 1 
ATOM 747   N N   . GLY A 1 112  ? 68.423  -26.328 25.937  1.00 23.86  ? 112  GLY A N   1 
ATOM 748   C CA  . GLY A 1 112  ? 69.498  -26.652 25.006  1.00 20.15  ? 112  GLY A CA  1 
ATOM 749   C C   . GLY A 1 112  ? 70.223  -27.984 25.205  1.00 37.67  ? 112  GLY A C   1 
ATOM 750   O O   . GLY A 1 112  ? 71.337  -28.129 24.691  1.00 47.76  ? 112  GLY A O   1 
ATOM 751   N N   . THR A 1 113  ? 69.626  -28.948 25.930  1.00 44.94  ? 113  THR A N   1 
ATOM 752   C CA  . THR A 1 113  ? 70.226  -30.261 26.218  1.00 40.92  ? 113  THR A CA  1 
ATOM 753   C C   . THR A 1 113  ? 69.743  -31.334 25.240  1.00 24.92  ? 113  THR A C   1 
ATOM 754   O O   . THR A 1 113  ? 68.539  -31.479 25.009  1.00 29.98  ? 113  THR A O   1 
ATOM 755   C CB  . THR A 1 113  ? 69.921  -30.740 27.661  1.00 36.98  ? 113  THR A CB  1 
ATOM 756   O OG1 . THR A 1 113  ? 68.516  -30.703 27.929  1.00 32.57  ? 113  THR A OG1 1 
ATOM 757   C CG2 . THR A 1 113  ? 70.629  -29.881 28.703  1.00 33.70  ? 113  THR A CG2 1 
ATOM 758   N N   . VAL A 1 114  ? 70.690  -32.116 24.707  1.00 22.28  ? 114  VAL A N   1 
ATOM 759   C CA  . VAL A 1 114  ? 70.388  -33.160 23.732  1.00 18.74  ? 114  VAL A CA  1 
ATOM 760   C C   . VAL A 1 114  ? 69.830  -34.373 24.446  1.00 23.38  ? 114  VAL A C   1 
ATOM 761   O O   . VAL A 1 114  ? 70.332  -34.778 25.499  1.00 27.54  ? 114  VAL A O   1 
ATOM 762   C CB  . VAL A 1 114  ? 71.648  -33.556 22.942  1.00 21.35  ? 114  VAL A CB  1 
ATOM 763   C CG1 . VAL A 1 114  ? 71.280  -34.560 21.884  1.00 20.60  ? 114  VAL A CG1 1 
ATOM 764   C CG2 . VAL A 1 114  ? 72.297  -32.356 22.307  1.00 32.88  ? 114  VAL A CG2 1 
ATOM 765   N N   . ILE A 1 115  ? 68.824  -34.983 23.841  1.00 27.27  ? 115  ILE A N   1 
ATOM 766   C CA  . ILE A 1 115  ? 68.163  -36.156 24.396  1.00 36.35  ? 115  ILE A CA  1 
ATOM 767   C C   . ILE A 1 115  ? 68.205  -37.266 23.353  1.00 34.93  ? 115  ILE A C   1 
ATOM 768   O O   . ILE A 1 115  ? 68.047  -37.020 22.151  1.00 30.52  ? 115  ILE A O   1 
ATOM 769   C CB  . ILE A 1 115  ? 66.714  -35.870 24.812  1.00 32.44  ? 115  ILE A CB  1 
ATOM 770   C CG1 . ILE A 1 115  ? 66.633  -34.761 25.855  1.00 29.44  ? 115  ILE A CG1 1 
ATOM 771   C CG2 . ILE A 1 115  ? 66.077  -37.094 25.426  1.00 32.80  ? 115  ILE A CG2 1 
ATOM 772   C CD1 . ILE A 1 115  ? 65.515  -35.009 26.845  1.00 30.36  ? 115  ILE A CD1 1 
ATOM 773   N N   . GLN A 1 116  ? 68.407  -38.483 23.836  1.00 42.53  ? 116  GLN A N   1 
ATOM 774   C CA  . GLN A 1 116  ? 68.392  -39.676 23.006  1.00 43.08  ? 116  GLN A CA  1 
ATOM 775   C C   . GLN A 1 116  ? 67.020  -40.362 23.151  1.00 38.13  ? 116  GLN A C   1 
ATOM 776   O O   . GLN A 1 116  ? 66.007  -39.719 22.946  1.00 32.02  ? 116  GLN A O   1 
ATOM 777   C CB  . GLN A 1 116  ? 69.568  -40.594 23.396  1.00 42.67  ? 116  GLN A CB  1 
ATOM 778   C CG  . GLN A 1 116  ? 70.840  -40.417 22.522  1.00 32.42  ? 116  GLN A CG  1 
ATOM 779   C CD  . GLN A 1 116  ? 72.116  -40.112 23.291  1.00 18.30  ? 116  GLN A CD  1 
ATOM 780   O OE1 . GLN A 1 116  ? 72.218  -39.124 24.013  1.00 11.33  ? 116  GLN A OE1 1 
ATOM 781   N NE2 . GLN A 1 116  ? 73.103  -40.969 23.124  1.00 19.93  ? 116  GLN A NE2 1 
ATOM 782   N N   . TYR A 1 117  ? 67.013  -41.616 23.560  1.00 43.71  ? 117  TYR A N   1 
ATOM 783   C CA  . TYR A 1 117  ? 65.777  -42.328 23.830  1.00 44.13  ? 117  TYR A CA  1 
ATOM 784   C C   . TYR A 1 117  ? 65.984  -43.175 25.083  1.00 44.25  ? 117  TYR A C   1 
ATOM 785   O O   . TYR A 1 117  ? 67.126  -43.473 25.476  1.00 42.80  ? 117  TYR A O   1 
ATOM 786   C CB  . TYR A 1 117  ? 65.359  -43.182 22.631  1.00 53.16  ? 117  TYR A CB  1 
ATOM 787   C CG  . TYR A 1 117  ? 66.216  -43.122 21.400  1.00 45.69  ? 117  TYR A CG  1 
ATOM 788   C CD1 . TYR A 1 117  ? 65.776  -42.466 20.249  1.00 37.50  ? 117  TYR A CD1 1 
ATOM 789   C CD2 . TYR A 1 117  ? 67.433  -43.777 21.365  1.00 34.29  ? 117  TYR A CD2 1 
ATOM 790   C CE1 . TYR A 1 117  ? 66.564  -42.445 19.112  1.00 38.88  ? 117  TYR A CE1 1 
ATOM 791   C CE2 . TYR A 1 117  ? 68.188  -43.763 20.262  1.00 30.70  ? 117  TYR A CE2 1 
ATOM 792   C CZ  . TYR A 1 117  ? 67.785  -43.111 19.146  1.00 37.41  ? 117  TYR A CZ  1 
ATOM 793   O OH  . TYR A 1 117  ? 68.667  -43.214 18.103  1.00 25.38  ? 117  TYR A OH  1 
ATOM 794   N N   . GLY A 1 118  ? 64.884  -43.551 25.707  1.00 33.23  ? 118  GLY A N   1 
ATOM 795   C CA  . GLY A 1 118  ? 64.913  -44.241 26.984  1.00 29.12  ? 118  GLY A CA  1 
ATOM 796   C C   . GLY A 1 118  ? 65.082  -43.348 28.191  1.00 21.18  ? 118  GLY A C   1 
ATOM 797   O O   . GLY A 1 118  ? 64.815  -43.789 29.315  1.00 18.34  ? 118  GLY A O   1 
ATOM 798   N N   . ASN A 1 119  ? 65.511  -42.103 27.995  1.00 21.38  ? 119  ASN A N   1 
ATOM 799   C CA  . ASN A 1 119  ? 65.822  -41.257 29.131  1.00 23.13  ? 119  ASN A CA  1 
ATOM 800   C C   . ASN A 1 119  ? 64.555  -40.809 29.840  1.00 27.06  ? 119  ASN A C   1 
ATOM 801   O O   . ASN A 1 119  ? 63.463  -40.739 29.265  1.00 26.59  ? 119  ASN A O   1 
ATOM 802   C CB  . ASN A 1 119  ? 66.613  -40.026 28.711  1.00 24.54  ? 119  ASN A CB  1 
ATOM 803   C CG  . ASN A 1 119  ? 67.783  -39.725 29.646  1.00 15.30  ? 119  ASN A CG  1 
ATOM 804   O OD1 . ASN A 1 119  ? 68.248  -40.578 30.400  1.00 11.38  ? 119  ASN A OD1 1 
ATOM 805   N ND2 . ASN A 1 119  ? 68.275  -38.505 29.575  1.00 15.91  ? 119  ASN A ND2 1 
ATOM 806   N N   . VAL A 1 120  ? 64.736  -40.462 31.101  1.00 32.26  ? 120  VAL A N   1 
ATOM 807   C CA  . VAL A 1 120  ? 63.640  -40.264 32.027  1.00 36.13  ? 120  VAL A CA  1 
ATOM 808   C C   . VAL A 1 120  ? 63.458  -38.779 32.210  1.00 22.43  ? 120  VAL A C   1 
ATOM 809   O O   . VAL A 1 120  ? 64.288  -38.108 32.826  1.00 24.67  ? 120  VAL A O   1 
ATOM 810   C CB  . VAL A 1 120  ? 63.903  -40.911 33.387  1.00 56.10  ? 120  VAL A CB  1 
ATOM 811   C CG1 . VAL A 1 120  ? 63.054  -40.194 34.362  1.00 42.42  ? 120  VAL A CG1 1 
ATOM 812   C CG2 . VAL A 1 120  ? 63.506  -42.337 33.360  1.00 51.54  ? 120  VAL A CG2 1 
ATOM 813   N N   . ILE A 1 121  ? 62.378  -38.252 31.695  1.00 17.20  ? 121  ILE A N   1 
ATOM 814   C CA  . ILE A 1 121  ? 62.265  -36.819 31.680  1.00 16.17  ? 121  ILE A CA  1 
ATOM 815   C C   . ILE A 1 121  ? 60.823  -36.490 31.964  1.00 19.80  ? 121  ILE A C   1 
ATOM 816   O O   . ILE A 1 121  ? 59.926  -37.156 31.443  1.00 13.98  ? 121  ILE A O   1 
ATOM 817   C CB  . ILE A 1 121  ? 62.753  -36.274 30.328  1.00 19.30  ? 121  ILE A CB  1 
ATOM 818   C CG1 . ILE A 1 121  ? 61.777  -36.647 29.226  1.00 22.02  ? 121  ILE A CG1 1 
ATOM 819   C CG2 . ILE A 1 121  ? 64.111  -36.883 29.976  1.00 25.26  ? 121  ILE A CG2 1 
ATOM 820   C CD1 . ILE A 1 121  ? 60.808  -35.548 28.908  1.00 34.35  ? 121  ILE A CD1 1 
ATOM 821   N N   . GLN A 1 122  ? 60.601  -35.511 32.839  1.00 24.33  ? 122  GLN A N   1 
ATOM 822   C CA  . GLN A 1 122  ? 59.255  -35.002 33.072  1.00 35.23  ? 122  GLN A CA  1 
ATOM 823   C C   . GLN A 1 122  ? 58.844  -34.142 31.891  1.00 34.76  ? 122  GLN A C   1 
ATOM 824   O O   . GLN A 1 122  ? 59.634  -33.876 30.972  1.00 44.88  ? 122  GLN A O   1 
ATOM 825   C CB  . GLN A 1 122  ? 59.163  -34.177 34.364  1.00 44.41  ? 122  GLN A CB  1 
ATOM 826   C CG  . GLN A 1 122  ? 58.803  -35.013 35.606  1.00 41.07  ? 122  GLN A CG  1 
ATOM 827   C CD  . GLN A 1 122  ? 58.168  -34.260 36.799  1.00 32.40  ? 122  GLN A CD  1 
ATOM 828   O OE1 . GLN A 1 122  ? 58.484  -34.567 37.956  1.00 28.01  ? 122  GLN A OE1 1 
ATOM 829   N NE2 . GLN A 1 122  ? 57.269  -33.310 36.528  1.00 20.81  ? 122  GLN A NE2 1 
ATOM 830   N N   . LEU A 1 123  ? 57.617  -33.638 31.934  1.00 33.55  ? 123  LEU A N   1 
ATOM 831   C CA  . LEU A 1 123  ? 57.163  -32.834 30.811  1.00 28.65  ? 123  LEU A CA  1 
ATOM 832   C C   . LEU A 1 123  ? 56.094  -31.872 31.297  1.00 24.43  ? 123  LEU A C   1 
ATOM 833   O O   . LEU A 1 123  ? 55.111  -32.300 31.887  1.00 18.21  ? 123  LEU A O   1 
ATOM 834   C CB  . LEU A 1 123  ? 56.654  -33.746 29.701  1.00 27.13  ? 123  LEU A CB  1 
ATOM 835   C CG  . LEU A 1 123  ? 57.666  -34.652 29.013  1.00 24.89  ? 123  LEU A CG  1 
ATOM 836   C CD1 . LEU A 1 123  ? 57.623  -36.042 29.643  1.00 27.33  ? 123  LEU A CD1 1 
ATOM 837   C CD2 . LEU A 1 123  ? 57.354  -34.692 27.528  1.00 22.27  ? 123  LEU A CD2 1 
ATOM 838   N N   . LEU A 1 124  ? 56.277  -30.588 31.016  1.00 28.35  ? 124  LEU A N   1 
ATOM 839   C CA  . LEU A 1 124  ? 55.381  -29.513 31.427  1.00 23.36  ? 124  LEU A CA  1 
ATOM 840   C C   . LEU A 1 124  ? 54.563  -29.007 30.258  1.00 24.97  ? 124  LEU A C   1 
ATOM 841   O O   . LEU A 1 124  ? 54.972  -29.110 29.116  1.00 29.73  ? 124  LEU A O   1 
ATOM 842   C CB  . LEU A 1 124  ? 56.146  -28.316 31.985  1.00 26.26  ? 124  LEU A CB  1 
ATOM 843   C CG  . LEU A 1 124  ? 55.243  -27.303 32.661  1.00 30.07  ? 124  LEU A CG  1 
ATOM 844   C CD1 . LEU A 1 124  ? 54.223  -28.138 33.335  1.00 26.23  ? 124  LEU A CD1 1 
ATOM 845   C CD2 . LEU A 1 124  ? 56.042  -26.497 33.678  1.00 42.81  ? 124  LEU A CD2 1 
ATOM 846   N N   . HIS A 1 125  ? 53.422  -28.437 30.541  1.00 21.86  ? 125  HIS A N   1 
ATOM 847   C CA  . HIS A 1 125  ? 52.549  -28.013 29.471  1.00 29.65  ? 125  HIS A CA  1 
ATOM 848   C C   . HIS A 1 125  ? 52.683  -26.507 29.272  1.00 29.50  ? 125  HIS A C   1 
ATOM 849   O O   . HIS A 1 125  ? 52.671  -25.765 30.245  1.00 25.43  ? 125  HIS A O   1 
ATOM 850   C CB  . HIS A 1 125  ? 51.122  -28.417 29.797  1.00 38.38  ? 125  HIS A CB  1 
ATOM 851   C CG  . HIS A 1 125  ? 50.195  -28.188 28.670  1.00 46.74  ? 125  HIS A CG  1 
ATOM 852   N ND1 . HIS A 1 125  ? 48.828  -28.094 28.816  1.00 52.06  ? 125  HIS A ND1 1 
ATOM 853   C CD2 . HIS A 1 125  ? 50.455  -27.979 27.364  1.00 44.00  ? 125  HIS A CD2 1 
ATOM 854   C CE1 . HIS A 1 125  ? 48.285  -27.858 27.636  1.00 42.88  ? 125  HIS A CE1 1 
ATOM 855   N NE2 . HIS A 1 125  ? 49.251  -27.791 26.739  1.00 44.47  ? 125  HIS A NE2 1 
ATOM 856   N N   . LEU A 1 126  ? 52.882  -26.047 28.030  1.00 31.29  ? 126  LEU A N   1 
ATOM 857   C CA  . LEU A 1 126  ? 53.022  -24.599 27.848  1.00 36.74  ? 126  LEU A CA  1 
ATOM 858   C C   . LEU A 1 126  ? 51.714  -23.887 28.171  1.00 43.10  ? 126  LEU A C   1 
ATOM 859   O O   . LEU A 1 126  ? 51.692  -22.942 28.971  1.00 44.48  ? 126  LEU A O   1 
ATOM 860   C CB  . LEU A 1 126  ? 53.454  -24.216 26.424  1.00 42.29  ? 126  LEU A CB  1 
ATOM 861   C CG  . LEU A 1 126  ? 54.375  -25.046 25.535  1.00 46.74  ? 126  LEU A CG  1 
ATOM 862   C CD1 . LEU A 1 126  ? 54.648  -24.384 24.186  1.00 50.21  ? 126  LEU A CD1 1 
ATOM 863   C CD2 . LEU A 1 126  ? 55.657  -25.229 26.278  1.00 49.60  ? 126  LEU A CD2 1 
ATOM 864   N N   . LYS A 1 127  ? 50.608  -24.335 27.552  1.00 42.03  ? 127  LYS A N   1 
ATOM 865   C CA  . LYS A 1 127  ? 49.331  -23.616 27.643  1.00 40.80  ? 127  LYS A CA  1 
ATOM 866   C C   . LYS A 1 127  ? 48.767  -23.630 29.054  1.00 35.62  ? 127  LYS A C   1 
ATOM 867   O O   . LYS A 1 127  ? 48.092  -22.679 29.468  1.00 39.44  ? 127  LYS A O   1 
ATOM 868   C CB  . LYS A 1 127  ? 48.288  -24.201 26.689  1.00 28.03  ? 127  LYS A CB  1 
ATOM 869   C CG  . LYS A 1 127  ? 46.980  -23.409 26.736  1.00 21.91  ? 127  LYS A CG  1 
ATOM 870   C CD  . LYS A 1 127  ? 45.770  -24.256 26.562  1.00 14.73  ? 127  LYS A CD  1 
ATOM 871   C CE  . LYS A 1 127  ? 45.178  -24.647 27.890  1.00 11.29  ? 127  LYS A CE  1 
ATOM 872   N NZ  . LYS A 1 127  ? 46.225  -25.222 28.717  1.00 9.53   ? 127  LYS A NZ  1 
ATOM 873   N N   . SER A 1 128  ? 48.986  -24.723 29.791  1.00 37.37  ? 128  SER A N   1 
ATOM 874   C CA  . SER A 1 128  ? 48.585  -24.791 31.189  1.00 43.39  ? 128  SER A CA  1 
ATOM 875   C C   . SER A 1 128  ? 49.765  -25.045 32.148  1.00 42.88  ? 128  SER A C   1 
ATOM 876   O O   . SER A 1 128  ? 49.540  -25.200 33.354  1.00 58.29  ? 128  SER A O   1 
ATOM 877   C CB  . SER A 1 128  ? 47.468  -25.841 31.350  1.00 33.65  ? 128  SER A CB  1 
ATOM 878   O OG  . SER A 1 128  ? 46.295  -25.465 30.624  1.00 16.15  ? 128  SER A OG  1 
ATOM 879   N N   . ASN A 1 129  ? 51.017  -25.008 31.670  1.00 28.31  ? 129  ASN A N   1 
ATOM 880   C CA  . ASN A 1 129  ? 52.188  -25.240 32.525  1.00 22.18  ? 129  ASN A CA  1 
ATOM 881   C C   . ASN A 1 129  ? 51.934  -26.414 33.453  1.00 23.37  ? 129  ASN A C   1 
ATOM 882   O O   . ASN A 1 129  ? 52.123  -26.332 34.670  1.00 20.65  ? 129  ASN A O   1 
ATOM 883   C CB  . ASN A 1 129  ? 52.580  -23.994 33.315  1.00 16.24  ? 129  ASN A CB  1 
ATOM 884   C CG  . ASN A 1 129  ? 53.022  -22.851 32.424  1.00 13.07  ? 129  ASN A CG  1 
ATOM 885   O OD1 . ASN A 1 129  ? 53.458  -21.810 32.915  1.00 8.79   ? 129  ASN A OD1 1 
ATOM 886   N ND2 . ASN A 1 129  ? 52.884  -23.023 31.113  1.00 17.28  ? 129  ASN A ND2 1 
ATOM 887   N N   . LYS A 1 130  ? 51.499  -27.523 32.860  1.00 26.22  ? 130  LYS A N   1 
ATOM 888   C CA  . LYS A 1 130  ? 51.146  -28.721 33.603  1.00 34.24  ? 130  LYS A CA  1 
ATOM 889   C C   . LYS A 1 130  ? 51.812  -29.933 32.947  1.00 32.47  ? 130  LYS A C   1 
ATOM 890   O O   . LYS A 1 130  ? 51.725  -30.112 31.727  1.00 26.86  ? 130  LYS A O   1 
ATOM 891   C CB  . LYS A 1 130  ? 49.599  -28.878 33.687  1.00 40.54  ? 130  LYS A CB  1 
ATOM 892   C CG  . LYS A 1 130  ? 48.799  -27.593 34.145  1.00 43.74  ? 130  LYS A CG  1 
ATOM 893   C CD  . LYS A 1 130  ? 47.302  -27.845 34.539  1.00 50.56  ? 130  LYS A CD  1 
ATOM 894   C CE  . LYS A 1 130  ? 46.761  -26.731 35.472  1.00 46.28  ? 130  LYS A CE  1 
ATOM 895   N NZ  . LYS A 1 130  ? 45.542  -27.106 36.263  1.00 33.01  ? 130  LYS A NZ  1 
ATOM 896   N N   . TYR A 1 131  ? 52.520  -30.728 33.757  1.00 35.91  ? 131  TYR A N   1 
ATOM 897   C CA  . TYR A 1 131  ? 53.091  -31.995 33.313  1.00 29.68  ? 131  TYR A CA  1 
ATOM 898   C C   . TYR A 1 131  ? 52.008  -33.064 33.120  1.00 36.95  ? 131  TYR A C   1 
ATOM 899   O O   . TYR A 1 131  ? 51.018  -33.122 33.873  1.00 34.99  ? 131  TYR A O   1 
ATOM 900   C CB  . TYR A 1 131  ? 54.116  -32.529 34.329  1.00 25.17  ? 131  TYR A CB  1 
ATOM 901   C CG  . TYR A 1 131  ? 55.119  -31.547 34.876  1.00 18.27  ? 131  TYR A CG  1 
ATOM 902   C CD1 . TYR A 1 131  ? 55.841  -30.747 34.035  1.00 18.07  ? 131  TYR A CD1 1 
ATOM 903   C CD2 . TYR A 1 131  ? 55.328  -31.423 36.248  1.00 15.46  ? 131  TYR A CD2 1 
ATOM 904   C CE1 . TYR A 1 131  ? 56.740  -29.862 34.505  1.00 16.09  ? 131  TYR A CE1 1 
ATOM 905   C CE2 . TYR A 1 131  ? 56.253  -30.538 36.742  1.00 12.29  ? 131  TYR A CE2 1 
ATOM 906   C CZ  . TYR A 1 131  ? 56.960  -29.762 35.849  1.00 10.71  ? 131  TYR A CZ  1 
ATOM 907   O OH  . TYR A 1 131  ? 57.882  -28.835 36.252  1.00 9.92   ? 131  TYR A OH  1 
ATOM 908   N N   . LEU A 1 132  ? 52.234  -33.946 32.131  1.00 41.45  ? 132  LEU A N   1 
ATOM 909   C CA  . LEU A 1 132  ? 51.351  -35.095 31.920  1.00 51.71  ? 132  LEU A CA  1 
ATOM 910   C C   . LEU A 1 132  ? 51.532  -36.119 33.034  1.00 38.70  ? 132  LEU A C   1 
ATOM 911   O O   . LEU A 1 132  ? 52.653  -36.540 33.340  1.00 33.55  ? 132  LEU A O   1 
ATOM 912   C CB  . LEU A 1 132  ? 51.586  -35.773 30.561  1.00 64.57  ? 132  LEU A CB  1 
ATOM 913   C CG  . LEU A 1 132  ? 50.762  -37.050 30.232  1.00 48.34  ? 132  LEU A CG  1 
ATOM 914   C CD1 . LEU A 1 132  ? 49.248  -36.810 30.185  1.00 43.83  ? 132  LEU A CD1 1 
ATOM 915   C CD2 . LEU A 1 132  ? 51.194  -37.725 28.938  1.00 49.81  ? 132  LEU A CD2 1 
ATOM 916   N N   . THR A 1 133  ? 50.405  -36.529 33.620  1.00 47.40  ? 133  THR A N   1 
ATOM 917   C CA  . THR A 1 133  ? 50.349  -37.369 34.804  1.00 46.15  ? 133  THR A CA  1 
ATOM 918   C C   . THR A 1 133  ? 49.647  -38.683 34.439  1.00 57.71  ? 133  THR A C   1 
ATOM 919   O O   . THR A 1 133  ? 48.509  -38.656 33.948  1.00 74.88  ? 133  THR A O   1 
ATOM 920   C CB  . THR A 1 133  ? 49.581  -36.619 35.932  1.00 27.45  ? 133  THR A CB  1 
ATOM 921   O OG1 . THR A 1 133  ? 50.071  -35.275 36.095  1.00 16.86  ? 133  THR A OG1 1 
ATOM 922   C CG2 . THR A 1 133  ? 49.696  -37.336 37.244  1.00 27.70  ? 133  THR A CG2 1 
ATOM 923   N N   . VAL A 1 134  ? 50.313  -39.835 34.657  1.00 60.55  ? 134  VAL A N   1 
ATOM 924   C CA  . VAL A 1 134  ? 49.698  -41.166 34.480  1.00 38.14  ? 134  VAL A CA  1 
ATOM 925   C C   . VAL A 1 134  ? 49.558  -41.831 35.838  1.00 22.33  ? 134  VAL A C   1 
ATOM 926   O O   . VAL A 1 134  ? 50.560  -42.118 36.509  1.00 20.24  ? 134  VAL A O   1 
ATOM 927   C CB  . VAL A 1 134  ? 50.483  -42.085 33.531  1.00 32.37  ? 134  VAL A CB  1 
ATOM 928   C CG1 . VAL A 1 134  ? 49.863  -43.489 33.531  1.00 20.16  ? 134  VAL A CG1 1 
ATOM 929   C CG2 . VAL A 1 134  ? 50.504  -41.515 32.122  1.00 41.60  ? 134  VAL A CG2 1 
ATOM 930   N N   . ASN A 1 135  ? 48.320  -42.104 36.223  1.00 14.79  ? 135  ASN A N   1 
ATOM 931   C CA  . ASN A 1 135  ? 48.030  -42.711 37.511  1.00 11.32  ? 135  ASN A CA  1 
ATOM 932   C C   . ASN A 1 135  ? 47.749  -44.182 37.278  1.00 12.18  ? 135  ASN A C   1 
ATOM 933   O O   . ASN A 1 135  ? 46.781  -44.543 36.582  1.00 16.92  ? 135  ASN A O   1 
ATOM 934   C CB  . ASN A 1 135  ? 46.867  -42.005 38.217  1.00 10.29  ? 135  ASN A CB  1 
ATOM 935   C CG  . ASN A 1 135  ? 47.321  -40.751 38.950  1.00 8.83   ? 135  ASN A CG  1 
ATOM 936   O OD1 . ASN A 1 135  ? 48.487  -40.632 39.298  1.00 8.83   ? 135  ASN A OD1 1 
ATOM 937   N ND2 . ASN A 1 135  ? 46.402  -39.819 39.197  1.00 8.83   ? 135  ASN A ND2 1 
ATOM 938   N N   . LYS A 1 136  ? 48.623  -45.006 37.844  1.00 13.08  ? 136  LYS A N   1 
ATOM 939   C CA  . LYS A 1 136  ? 48.550  -46.462 37.817  1.00 16.72  ? 136  LYS A CA  1 
ATOM 940   C C   . LYS A 1 136  ? 47.718  -47.012 38.966  1.00 17.99  ? 136  LYS A C   1 
ATOM 941   O O   . LYS A 1 136  ? 47.529  -48.231 39.073  1.00 19.82  ? 136  LYS A O   1 
ATOM 942   C CB  . LYS A 1 136  ? 49.974  -47.043 37.863  1.00 20.56  ? 136  LYS A CB  1 
ATOM 943   N N   . ARG A 1 137  ? 47.286  -46.147 39.873  1.00 17.00  ? 137  ARG A N   1 
ATOM 944   C CA  . ARG A 1 137  ? 46.414  -46.652 40.912  1.00 16.80  ? 137  ARG A CA  1 
ATOM 945   C C   . ARG A 1 137  ? 44.962  -46.515 40.483  1.00 18.27  ? 137  ARG A C   1 
ATOM 946   O O   . ARG A 1 137  ? 44.217  -47.494 40.489  1.00 22.19  ? 137  ARG A O   1 
ATOM 947   C CB  . ARG A 1 137  ? 46.702  -45.922 42.212  1.00 21.92  ? 137  ARG A CB  1 
ATOM 948   N N   . LEU A 1 138  ? 44.545  -45.237 39.937  1.00 15.72  ? 138  LEU A N   1 
ATOM 949   C CA  . LEU A 1 138  ? 43.147  -44.989 39.595  1.00 14.43  ? 138  LEU A CA  1 
ATOM 950   C C   . LEU A 1 138  ? 42.895  -45.214 38.096  1.00 14.86  ? 138  LEU A C   1 
ATOM 951   O O   . LEU A 1 138  ? 43.778  -44.947 37.270  1.00 17.90  ? 138  LEU A O   1 
ATOM 952   C CB  . LEU A 1 138  ? 42.766  -43.563 40.008  1.00 8.86   ? 138  LEU A CB  1 
ATOM 953   C CG  . LEU A 1 138  ? 42.300  -43.299 41.446  1.00 8.86   ? 138  LEU A CG  1 
ATOM 954   C CD1 . LEU A 1 138  ? 41.808  -41.870 41.587  1.00 8.86   ? 138  LEU A CD1 1 
ATOM 955   C CD2 . LEU A 1 138  ? 41.231  -44.276 41.854  1.00 8.86   ? 138  LEU A CD2 1 
ATOM 956   N N   . PRO A 1 139  ? 41.745  -45.733 37.672  1.00 11.66  ? 139  PRO A N   1 
ATOM 957   C CA  . PRO A 1 139  ? 41.552  -46.003 36.249  1.00 10.80  ? 139  PRO A CA  1 
ATOM 958   C C   . PRO A 1 139  ? 40.696  -44.932 35.648  1.00 8.84   ? 139  PRO A C   1 
ATOM 959   O O   . PRO A 1 139  ? 39.650  -44.585 36.202  1.00 8.84   ? 139  PRO A O   1 
ATOM 960   C CB  . PRO A 1 139  ? 40.839  -47.343 36.249  1.00 12.25  ? 139  PRO A CB  1 
ATOM 961   C CG  . PRO A 1 139  ? 39.936  -47.228 37.415  1.00 15.39  ? 139  PRO A CG  1 
ATOM 962   C CD  . PRO A 1 139  ? 40.662  -46.349 38.450  1.00 16.34  ? 139  PRO A CD  1 
ATOM 963   N N   . ALA A 1 140  ? 41.163  -44.397 34.536  1.00 8.91   ? 140  ALA A N   1 
ATOM 964   C CA  . ALA A 1 140  ? 40.522  -43.290 33.859  1.00 11.62  ? 140  ALA A CA  1 
ATOM 965   C C   . ALA A 1 140  ? 39.017  -43.502 33.839  1.00 12.99  ? 140  ALA A C   1 
ATOM 966   O O   . ALA A 1 140  ? 38.531  -44.582 34.192  1.00 21.49  ? 140  ALA A O   1 
ATOM 967   C CB  . ALA A 1 140  ? 41.084  -43.144 32.442  1.00 24.09  ? 140  ALA A CB  1 
ATOM 968   N N   . LEU A 1 141  ? 38.267  -42.488 33.428  1.00 15.77  ? 141  LEU A N   1 
ATOM 969   C CA  . LEU A 1 141  ? 36.819  -42.647 33.396  1.00 15.45  ? 141  LEU A CA  1 
ATOM 970   C C   . LEU A 1 141  ? 36.346  -43.095 32.010  1.00 20.58  ? 141  LEU A C   1 
ATOM 971   O O   . LEU A 1 141  ? 35.361  -43.839 31.893  1.00 18.01  ? 141  LEU A O   1 
ATOM 972   C CB  . LEU A 1 141  ? 36.153  -41.344 33.849  1.00 13.53  ? 141  LEU A CB  1 
ATOM 973   C CG  . LEU A 1 141  ? 36.835  -40.620 35.021  1.00 10.29  ? 141  LEU A CG  1 
ATOM 974   C CD1 . LEU A 1 141  ? 35.864  -39.683 35.723  1.00 9.56   ? 141  LEU A CD1 1 
ATOM 975   C CD2 . LEU A 1 141  ? 37.430  -41.605 36.017  1.00 8.85   ? 141  LEU A CD2 1 
ATOM 976   N N   . LEU A 1 142  ? 37.081  -42.713 30.954  1.00 27.71  ? 142  LEU A N   1 
ATOM 977   C CA  . LEU A 1 142  ? 36.669  -43.044 29.589  1.00 29.87  ? 142  LEU A CA  1 
ATOM 978   C C   . LEU A 1 142  ? 37.051  -44.470 29.199  1.00 33.17  ? 142  LEU A C   1 
ATOM 979   O O   . LEU A 1 142  ? 36.208  -45.224 28.711  1.00 35.78  ? 142  LEU A O   1 
ATOM 980   C CB  . LEU A 1 142  ? 37.241  -42.034 28.587  1.00 27.60  ? 142  LEU A CB  1 
ATOM 981   C CG  . LEU A 1 142  ? 36.053  -41.580 27.735  1.00 35.59  ? 142  LEU A CG  1 
ATOM 982   C CD1 . LEU A 1 142  ? 36.362  -40.298 26.941  1.00 22.70  ? 142  LEU A CD1 1 
ATOM 983   C CD2 . LEU A 1 142  ? 35.543  -42.718 26.845  1.00 36.29  ? 142  LEU A CD2 1 
ATOM 984   N N   . GLU A 1 143  ? 38.309  -44.863 29.394  1.00 39.25  ? 143  GLU A N   1 
ATOM 985   C CA  . GLU A 1 143  ? 38.757  -46.240 29.168  1.00 44.47  ? 143  GLU A CA  1 
ATOM 986   C C   . GLU A 1 143  ? 39.001  -46.938 30.512  1.00 52.41  ? 143  GLU A C   1 
ATOM 987   O O   . GLU A 1 143  ? 39.917  -46.564 31.255  1.00 58.64  ? 143  GLU A O   1 
ATOM 988   C CB  . GLU A 1 143  ? 40.021  -46.251 28.316  1.00 41.52  ? 143  GLU A CB  1 
ATOM 989   C CG  . GLU A 1 143  ? 40.531  -47.650 28.055  1.00 36.19  ? 143  GLU A CG  1 
ATOM 990   C CD  . GLU A 1 143  ? 39.623  -48.366 27.117  1.00 31.25  ? 143  GLU A CD  1 
ATOM 991   O OE1 . GLU A 1 143  ? 39.581  -47.941 25.948  1.00 38.21  ? 143  GLU A OE1 1 
ATOM 992   O OE2 . GLU A 1 143  ? 38.924  -49.304 27.558  1.00 27.11  ? 143  GLU A OE2 1 
ATOM 993   N N   . LYS A 1 144  ? 38.204  -47.969 30.820  1.00 43.55  ? 144  LYS A N   1 
ATOM 994   C CA  . LYS A 1 144  ? 38.277  -48.578 32.146  1.00 36.90  ? 144  LYS A CA  1 
ATOM 995   C C   . LYS A 1 144  ? 39.629  -49.218 32.392  1.00 36.62  ? 144  LYS A C   1 
ATOM 996   O O   . LYS A 1 144  ? 40.051  -49.367 33.546  1.00 35.05  ? 144  LYS A O   1 
ATOM 997   C CB  . LYS A 1 144  ? 37.175  -49.620 32.311  1.00 38.33  ? 144  LYS A CB  1 
ATOM 998   N N   . ASN A 1 145  ? 40.334  -49.552 31.315  1.00 48.56  ? 145  ASN A N   1 
ATOM 999   C CA  . ASN A 1 145  ? 41.484  -50.445 31.374  1.00 71.58  ? 145  ASN A CA  1 
ATOM 1000  C C   . ASN A 1 145  ? 42.824  -49.719 31.465  1.00 61.71  ? 145  ASN A C   1 
ATOM 1001  O O   . ASN A 1 145  ? 43.802  -50.284 31.975  1.00 63.17  ? 145  ASN A O   1 
ATOM 1002  C CB  . ASN A 1 145  ? 41.476  -51.354 30.140  1.00 94.76  ? 145  ASN A CB  1 
ATOM 1003  N N   . ALA A 1 146  ? 42.916  -48.495 30.972  1.00 46.94  ? 146  ALA A N   1 
ATOM 1004  C CA  . ALA A 1 146  ? 44.201  -47.816 30.963  1.00 38.81  ? 146  ALA A CA  1 
ATOM 1005  C C   . ALA A 1 146  ? 44.424  -46.905 32.174  1.00 47.33  ? 146  ALA A C   1 
ATOM 1006  O O   . ALA A 1 146  ? 45.236  -45.977 32.082  1.00 51.98  ? 146  ALA A O   1 
ATOM 1007  C CB  . ALA A 1 146  ? 44.354  -47.028 29.663  1.00 30.48  ? 146  ALA A CB  1 
ATOM 1008  N N   . MET A 1 147  ? 43.728  -47.155 33.294  1.00 47.55  ? 147  MET A N   1 
ATOM 1009  C CA  . MET A 1 147  ? 43.821  -46.394 34.537  1.00 31.30  ? 147  MET A CA  1 
ATOM 1010  C C   . MET A 1 147  ? 43.768  -44.883 34.250  1.00 15.08  ? 147  MET A C   1 
ATOM 1011  O O   . MET A 1 147  ? 43.374  -44.487 33.147  1.00 15.45  ? 147  MET A O   1 
ATOM 1012  C CB  . MET A 1 147  ? 45.040  -46.934 35.291  1.00 29.93  ? 147  MET A CB  1 
ATOM 1013  C CG  . MET A 1 147  ? 44.889  -48.461 35.617  1.00 36.79  ? 147  MET A CG  1 
ATOM 1014  S SD  . MET A 1 147  ? 45.593  -49.067 37.168  1.00 8.97   ? 147  MET A SD  1 
ATOM 1015  C CE  . MET A 1 147  ? 47.202  -49.774 36.567  1.00 8.97   ? 147  MET A CE  1 
ATOM 1016  N N   . ARG A 1 148  ? 44.043  -44.009 35.216  1.00 14.31  ? 148  ARG A N   1 
ATOM 1017  C CA  . ARG A 1 148  ? 43.672  -42.613 35.003  1.00 12.28  ? 148  ARG A CA  1 
ATOM 1018  C C   . ARG A 1 148  ? 44.766  -41.909 34.231  1.00 12.09  ? 148  ARG A C   1 
ATOM 1019  O O   . ARG A 1 148  ? 45.960  -42.104 34.493  1.00 13.57  ? 148  ARG A O   1 
ATOM 1020  C CB  . ARG A 1 148  ? 43.444  -41.838 36.301  1.00 20.16  ? 148  ARG A CB  1 
ATOM 1021  C CG  . ARG A 1 148  ? 42.559  -42.427 37.354  1.00 16.77  ? 148  ARG A CG  1 
ATOM 1022  C CD  . ARG A 1 148  ? 41.111  -42.558 37.008  1.00 8.93   ? 148  ARG A CD  1 
ATOM 1023  N NE  . ARG A 1 148  ? 40.452  -43.197 38.138  1.00 8.93   ? 148  ARG A NE  1 
ATOM 1024  C CZ  . ARG A 1 148  ? 39.753  -42.509 39.023  1.00 8.93   ? 148  ARG A CZ  1 
ATOM 1025  N NH1 . ARG A 1 148  ? 39.606  -41.211 38.833  1.00 10.22  ? 148  ARG A NH1 1 
ATOM 1026  N NH2 . ARG A 1 148  ? 39.181  -43.098 40.058  1.00 8.93   ? 148  ARG A NH2 1 
ATOM 1027  N N   . VAL A 1 149  ? 44.355  -41.083 33.295  1.00 14.45  ? 149  VAL A N   1 
ATOM 1028  C CA  . VAL A 1 149  ? 45.243  -40.136 32.659  1.00 18.10  ? 149  VAL A CA  1 
ATOM 1029  C C   . VAL A 1 149  ? 44.774  -38.755 33.079  1.00 18.55  ? 149  VAL A C   1 
ATOM 1030  O O   . VAL A 1 149  ? 43.635  -38.366 32.801  1.00 14.75  ? 149  VAL A O   1 
ATOM 1031  C CB  . VAL A 1 149  ? 45.249  -40.306 31.137  1.00 24.98  ? 149  VAL A CB  1 
ATOM 1032  C CG1 . VAL A 1 149  ? 45.629  -39.007 30.473  1.00 25.83  ? 149  VAL A CG1 1 
ATOM 1033  C CG2 . VAL A 1 149  ? 46.218  -41.429 30.738  1.00 35.67  ? 149  VAL A CG2 1 
ATOM 1034  N N   . THR A 1 150  ? 45.635  -38.036 33.790  1.00 23.33  ? 150  THR A N   1 
ATOM 1035  C CA  . THR A 1 150  ? 45.298  -36.706 34.264  1.00 25.14  ? 150  THR A CA  1 
ATOM 1036  C C   . THR A 1 150  ? 46.567  -35.863 34.379  1.00 30.55  ? 150  THR A C   1 
ATOM 1037  O O   . THR A 1 150  ? 47.630  -36.362 34.769  1.00 36.16  ? 150  THR A O   1 
ATOM 1038  C CB  . THR A 1 150  ? 44.562  -36.787 35.603  1.00 23.57  ? 150  THR A CB  1 
ATOM 1039  O OG1 . THR A 1 150  ? 45.278  -37.665 36.481  1.00 19.75  ? 150  THR A OG1 1 
ATOM 1040  C CG2 . THR A 1 150  ? 43.157  -37.320 35.392  1.00 14.17  ? 150  THR A CG2 1 
ATOM 1041  N N   . LEU A 1 151  ? 46.457  -34.588 34.010  1.00 30.91  ? 151  LEU A N   1 
ATOM 1042  C CA  . LEU A 1 151  ? 47.579  -33.656 34.037  1.00 28.12  ? 151  LEU A CA  1 
ATOM 1043  C C   . LEU A 1 151  ? 47.722  -33.098 35.447  1.00 20.01  ? 151  LEU A C   1 
ATOM 1044  O O   . LEU A 1 151  ? 46.800  -32.455 35.958  1.00 21.47  ? 151  LEU A O   1 
ATOM 1045  C CB  . LEU A 1 151  ? 47.360  -32.524 33.020  1.00 30.24  ? 151  LEU A CB  1 
ATOM 1046  C CG  . LEU A 1 151  ? 47.850  -32.840 31.621  1.00 28.97  ? 151  LEU A CG  1 
ATOM 1047  C CD1 . LEU A 1 151  ? 48.749  -31.760 31.071  1.00 26.64  ? 151  LEU A CD1 1 
ATOM 1048  C CD2 . LEU A 1 151  ? 48.638  -34.037 31.955  1.00 27.78  ? 151  LEU A CD2 1 
ATOM 1049  N N   . ASP A 1 152  ? 48.857  -33.309 36.091  1.00 10.50  ? 152  ASP A N   1 
ATOM 1050  C CA  . ASP A 1 152  ? 48.922  -32.872 37.475  1.00 11.27  ? 152  ASP A CA  1 
ATOM 1051  C C   . ASP A 1 152  ? 50.153  -32.029 37.708  1.00 11.58  ? 152  ASP A C   1 
ATOM 1052  O O   . ASP A 1 152  ? 51.271  -32.545 37.642  1.00 16.00  ? 152  ASP A O   1 
ATOM 1053  C CB  . ASP A 1 152  ? 48.950  -34.030 38.433  1.00 8.77   ? 152  ASP A CB  1 
ATOM 1054  C CG  . ASP A 1 152  ? 49.658  -33.645 39.664  1.00 14.84  ? 152  ASP A CG  1 
ATOM 1055  O OD1 . ASP A 1 152  ? 49.207  -32.659 40.281  1.00 18.39  ? 152  ASP A OD1 1 
ATOM 1056  O OD2 . ASP A 1 152  ? 50.713  -34.229 39.960  1.00 17.73  ? 152  ASP A OD2 1 
ATOM 1057  N N   . GLU A 1 153  ? 49.942  -30.761 38.066  1.00 14.77  ? 153  GLU A N   1 
ATOM 1058  C CA  . GLU A 1 153  ? 51.031  -29.787 38.010  1.00 19.00  ? 153  GLU A CA  1 
ATOM 1059  C C   . GLU A 1 153  ? 52.054  -30.006 39.112  1.00 19.02  ? 153  GLU A C   1 
ATOM 1060  O O   . GLU A 1 153  ? 53.239  -29.705 38.929  1.00 18.14  ? 153  GLU A O   1 
ATOM 1061  C CB  . GLU A 1 153  ? 50.460  -28.368 38.077  1.00 17.48  ? 153  GLU A CB  1 
ATOM 1062  C CG  . GLU A 1 153  ? 51.207  -27.385 38.982  1.00 11.44  ? 153  GLU A CG  1 
ATOM 1063  C CD  . GLU A 1 153  ? 52.514  -26.935 38.401  1.00 8.74   ? 153  GLU A CD  1 
ATOM 1064  O OE1 . GLU A 1 153  ? 53.382  -26.456 39.163  1.00 8.74   ? 153  GLU A OE1 1 
ATOM 1065  O OE2 . GLU A 1 153  ? 52.670  -27.069 37.176  1.00 13.49  ? 153  GLU A OE2 1 
ATOM 1066  N N   . ALA A 1 154  ? 51.626  -30.533 40.258  1.00 21.28  ? 154  ALA A N   1 
ATOM 1067  C CA  . ALA A 1 154  ? 52.487  -30.476 41.429  1.00 23.03  ? 154  ALA A CA  1 
ATOM 1068  C C   . ALA A 1 154  ? 53.734  -31.318 41.255  1.00 20.04  ? 154  ALA A C   1 
ATOM 1069  O O   . ALA A 1 154  ? 54.775  -31.010 41.839  1.00 29.84  ? 154  ALA A O   1 
ATOM 1070  C CB  . ALA A 1 154  ? 51.725  -30.923 42.674  1.00 37.31  ? 154  ALA A CB  1 
ATOM 1071  N N   . GLY A 1 155  ? 53.657  -32.371 40.464  1.00 16.28  ? 155  GLY A N   1 
ATOM 1072  C CA  . GLY A 1 155  ? 54.787  -33.253 40.346  1.00 19.41  ? 155  GLY A CA  1 
ATOM 1073  C C   . GLY A 1 155  ? 54.284  -34.581 39.867  1.00 20.60  ? 155  GLY A C   1 
ATOM 1074  O O   . GLY A 1 155  ? 54.185  -34.797 38.661  1.00 22.29  ? 155  GLY A O   1 
ATOM 1075  N N   . ASN A 1 156  ? 53.952  -35.458 40.811  1.00 22.57  ? 156  ASN A N   1 
ATOM 1076  C CA  . ASN A 1 156  ? 53.366  -36.767 40.550  1.00 28.17  ? 156  ASN A CA  1 
ATOM 1077  C C   . ASN A 1 156  ? 54.472  -37.770 40.253  1.00 31.09  ? 156  ASN A C   1 
ATOM 1078  O O   . ASN A 1 156  ? 55.601  -37.374 39.943  1.00 37.91  ? 156  ASN A O   1 
ATOM 1079  C CB  . ASN A 1 156  ? 52.326  -36.694 39.414  1.00 31.09  ? 156  ASN A CB  1 
ATOM 1080  C CG  . ASN A 1 156  ? 52.894  -37.068 38.049  1.00 31.26  ? 156  ASN A CG  1 
ATOM 1081  O OD1 . ASN A 1 156  ? 52.383  -37.960 37.369  1.00 34.06  ? 156  ASN A OD1 1 
ATOM 1082  N ND2 . ASN A 1 156  ? 53.941  -36.375 37.637  1.00 30.17  ? 156  ASN A ND2 1 
ATOM 1083  N N   . GLU A 1 157  ? 54.177  -39.064 40.402  1.00 24.33  ? 157  GLU A N   1 
ATOM 1084  C CA  . GLU A 1 157  ? 55.114  -40.093 39.976  1.00 25.06  ? 157  GLU A CA  1 
ATOM 1085  C C   . GLU A 1 157  ? 55.060  -40.355 38.464  1.00 35.09  ? 157  GLU A C   1 
ATOM 1086  O O   . GLU A 1 157  ? 55.991  -40.968 37.928  1.00 41.03  ? 157  GLU A O   1 
ATOM 1087  C CB  . GLU A 1 157  ? 54.862  -41.390 40.761  1.00 24.76  ? 157  GLU A CB  1 
ATOM 1088  N N   . GLY A 1 158  ? 54.011  -39.910 37.759  1.00 33.20  ? 158  GLY A N   1 
ATOM 1089  C CA  . GLY A 1 158  ? 53.786  -40.326 36.377  1.00 30.75  ? 158  GLY A CA  1 
ATOM 1090  C C   . GLY A 1 158  ? 54.308  -39.426 35.267  1.00 27.97  ? 158  GLY A C   1 
ATOM 1091  O O   . GLY A 1 158  ? 54.545  -39.892 34.148  1.00 24.83  ? 158  GLY A O   1 
ATOM 1092  N N   . SER A 1 159  ? 54.450  -38.126 35.533  1.00 27.01  ? 159  SER A N   1 
ATOM 1093  C CA  . SER A 1 159  ? 55.084  -37.245 34.556  1.00 25.51  ? 159  SER A CA  1 
ATOM 1094  C C   . SER A 1 159  ? 56.423  -37.810 34.118  1.00 27.76  ? 159  SER A C   1 
ATOM 1095  O O   . SER A 1 159  ? 56.858  -37.599 32.979  1.00 26.95  ? 159  SER A O   1 
ATOM 1096  C CB  . SER A 1 159  ? 55.267  -35.852 35.157  1.00 24.78  ? 159  SER A CB  1 
ATOM 1097  O OG  . SER A 1 159  ? 55.747  -34.923 34.205  1.00 25.36  ? 159  SER A OG  1 
ATOM 1098  N N   . TRP A 1 160  ? 57.077  -38.543 35.013  1.00 29.26  ? 160  TRP A N   1 
ATOM 1099  C CA  . TRP A 1 160  ? 58.387  -39.113 34.762  1.00 26.01  ? 160  TRP A CA  1 
ATOM 1100  C C   . TRP A 1 160  ? 58.269  -40.387 33.977  1.00 28.26  ? 160  TRP A C   1 
ATOM 1101  O O   . TRP A 1 160  ? 57.562  -41.306 34.397  1.00 30.93  ? 160  TRP A O   1 
ATOM 1102  C CB  . TRP A 1 160  ? 59.075  -39.434 36.062  1.00 29.06  ? 160  TRP A CB  1 
ATOM 1103  C CG  . TRP A 1 160  ? 59.885  -38.394 36.396  1.00 27.75  ? 160  TRP A CG  1 
ATOM 1104  C CD1 . TRP A 1 160  ? 60.406  -37.483 35.545  1.00 26.69  ? 160  TRP A CD1 1 
ATOM 1105  C CD2 . TRP A 1 160  ? 60.360  -38.092 37.684  1.00 26.77  ? 160  TRP A CD2 1 
ATOM 1106  N NE1 . TRP A 1 160  ? 61.172  -36.600 36.242  1.00 31.57  ? 160  TRP A NE1 1 
ATOM 1107  C CE2 . TRP A 1 160  ? 61.165  -36.956 37.564  1.00 29.93  ? 160  TRP A CE2 1 
ATOM 1108  C CE3 . TRP A 1 160  ? 60.180  -38.671 38.943  1.00 26.17  ? 160  TRP A CE3 1 
ATOM 1109  C CZ2 . TRP A 1 160  ? 61.803  -36.401 38.640  1.00 29.83  ? 160  TRP A CZ2 1 
ATOM 1110  C CZ3 . TRP A 1 160  ? 60.801  -38.123 40.001  1.00 24.97  ? 160  TRP A CZ3 1 
ATOM 1111  C CH2 . TRP A 1 160  ? 61.597  -36.987 39.855  1.00 30.26  ? 160  TRP A CH2 1 
ATOM 1112  N N   . PHE A 1 161  ? 59.009  -40.485 32.881  1.00 29.96  ? 161  PHE A N   1 
ATOM 1113  C CA  . PHE A 1 161  ? 58.695  -41.526 31.902  1.00 34.56  ? 161  PHE A CA  1 
ATOM 1114  C C   . PHE A 1 161  ? 59.939  -42.024 31.173  1.00 34.30  ? 161  PHE A C   1 
ATOM 1115  O O   . PHE A 1 161  ? 60.648  -41.222 30.556  1.00 37.92  ? 161  PHE A O   1 
ATOM 1116  C CB  . PHE A 1 161  ? 57.667  -41.006 30.881  1.00 32.67  ? 161  PHE A CB  1 
ATOM 1117  N N   . TYR A 1 162  ? 60.179  -43.348 31.228  1.00 32.06  ? 162  TYR A N   1 
ATOM 1118  C CA  . TYR A 1 162  ? 61.067  -44.016 30.267  1.00 25.24  ? 162  TYR A CA  1 
ATOM 1119  C C   . TYR A 1 162  ? 60.498  -43.877 28.851  1.00 22.96  ? 162  TYR A C   1 
ATOM 1120  O O   . TYR A 1 162  ? 59.294  -44.004 28.639  1.00 20.05  ? 162  TYR A O   1 
ATOM 1121  C CB  . TYR A 1 162  ? 61.229  -45.515 30.591  1.00 16.89  ? 162  TYR A CB  1 
ATOM 1122  C CG  . TYR A 1 162  ? 61.964  -45.924 31.861  1.00 8.68   ? 162  TYR A CG  1 
ATOM 1123  C CD1 . TYR A 1 162  ? 62.171  -45.040 32.899  1.00 11.10  ? 162  TYR A CD1 1 
ATOM 1124  C CD2 . TYR A 1 162  ? 62.441  -47.222 32.008  1.00 8.68   ? 162  TYR A CD2 1 
ATOM 1125  C CE1 . TYR A 1 162  ? 62.843  -45.433 34.038  1.00 8.68   ? 162  TYR A CE1 1 
ATOM 1126  C CE2 . TYR A 1 162  ? 63.102  -47.619 33.138  1.00 8.68   ? 162  TYR A CE2 1 
ATOM 1127  C CZ  . TYR A 1 162  ? 63.296  -46.724 34.149  1.00 8.68   ? 162  TYR A CZ  1 
ATOM 1128  O OH  . TYR A 1 162  ? 63.962  -47.129 35.274  1.00 8.68   ? 162  TYR A OH  1 
ATOM 1129  N N   . ILE A 1 163  ? 61.369  -43.632 27.876  1.00 25.37  ? 163  ILE A N   1 
ATOM 1130  C CA  . ILE A 1 163  ? 60.955  -43.373 26.502  1.00 21.74  ? 163  ILE A CA  1 
ATOM 1131  C C   . ILE A 1 163  ? 61.544  -44.455 25.613  1.00 23.43  ? 163  ILE A C   1 
ATOM 1132  O O   . ILE A 1 163  ? 62.597  -45.011 25.928  1.00 28.23  ? 163  ILE A O   1 
ATOM 1133  C CB  . ILE A 1 163  ? 61.400  -41.971 26.035  1.00 20.65  ? 163  ILE A CB  1 
ATOM 1134  C CG1 . ILE A 1 163  ? 61.216  -41.852 24.537  1.00 21.94  ? 163  ILE A CG1 1 
ATOM 1135  C CG2 . ILE A 1 163  ? 62.848  -41.677 26.414  1.00 23.94  ? 163  ILE A CG2 1 
ATOM 1136  C CD1 . ILE A 1 163  ? 59.823  -42.095 24.152  1.00 19.32  ? 163  ILE A CD1 1 
ATOM 1137  N N   . GLN A 1 164  ? 60.846  -44.797 24.533  1.00 22.88  ? 164  GLN A N   1 
ATOM 1138  C CA  . GLN A 1 164  ? 61.333  -45.886 23.710  1.00 32.69  ? 164  GLN A CA  1 
ATOM 1139  C C   . GLN A 1 164  ? 61.106  -45.560 22.237  1.00 30.86  ? 164  GLN A C   1 
ATOM 1140  O O   . GLN A 1 164  ? 60.051  -44.999 21.875  1.00 23.10  ? 164  GLN A O   1 
ATOM 1141  C CB  . GLN A 1 164  ? 60.667  -47.223 24.084  1.00 39.06  ? 164  GLN A CB  1 
ATOM 1142  C CG  . GLN A 1 164  ? 60.624  -47.515 25.579  1.00 29.17  ? 164  GLN A CG  1 
ATOM 1143  C CD  . GLN A 1 164  ? 59.728  -46.543 26.323  1.00 24.45  ? 164  GLN A CD  1 
ATOM 1144  O OE1 . GLN A 1 164  ? 58.986  -45.758 25.713  1.00 23.40  ? 164  GLN A OE1 1 
ATOM 1145  N NE2 . GLN A 1 164  ? 59.834  -46.542 27.638  1.00 24.22  ? 164  GLN A NE2 1 
ATOM 1146  N N   . PRO A 1 165  ? 62.066  -45.912 21.374  1.00 45.76  ? 165  PRO A N   1 
ATOM 1147  C CA  . PRO A 1 165  ? 62.094  -45.421 19.982  1.00 42.42  ? 165  PRO A CA  1 
ATOM 1148  C C   . PRO A 1 165  ? 61.114  -46.165 19.086  1.00 45.26  ? 165  PRO A C   1 
ATOM 1149  O O   . PRO A 1 165  ? 61.242  -47.369 18.860  1.00 60.12  ? 165  PRO A O   1 
ATOM 1150  C CB  . PRO A 1 165  ? 63.542  -45.677 19.548  1.00 41.18  ? 165  PRO A CB  1 
ATOM 1151  C CG  . PRO A 1 165  ? 63.944  -46.900 20.337  1.00 36.19  ? 165  PRO A CG  1 
ATOM 1152  C CD  . PRO A 1 165  ? 63.212  -46.799 21.671  1.00 41.30  ? 165  PRO A CD  1 
ATOM 1153  N N   . PHE A 1 166  ? 60.160  -45.417 18.531  1.00 47.03  ? 166  PHE A N   1 
ATOM 1154  C CA  . PHE A 1 166  ? 59.193  -45.968 17.591  1.00 48.01  ? 166  PHE A CA  1 
ATOM 1155  C C   . PHE A 1 166  ? 59.846  -46.522 16.338  1.00 53.39  ? 166  PHE A C   1 
ATOM 1156  O O   . PHE A 1 166  ? 59.536  -47.634 15.887  1.00 50.95  ? 166  PHE A O   1 
ATOM 1157  C CB  . PHE A 1 166  ? 58.259  -44.865 17.161  1.00 44.98  ? 166  PHE A CB  1 
ATOM 1158  C CG  . PHE A 1 166  ? 56.890  -45.285 17.019  1.00 35.66  ? 166  PHE A CG  1 
ATOM 1159  C CD1 . PHE A 1 166  ? 56.569  -46.606 16.807  1.00 30.09  ? 166  PHE A CD1 1 
ATOM 1160  C CD2 . PHE A 1 166  ? 55.899  -44.355 17.139  1.00 26.20  ? 166  PHE A CD2 1 
ATOM 1161  C CE1 . PHE A 1 166  ? 55.271  -46.986 16.704  1.00 19.50  ? 166  PHE A CE1 1 
ATOM 1162  C CE2 . PHE A 1 166  ? 54.650  -44.734 17.054  1.00 21.28  ? 166  PHE A CE2 1 
ATOM 1163  C CZ  . PHE A 1 166  ? 54.318  -46.049 16.812  1.00 15.87  ? 166  PHE A CZ  1 
ATOM 1164  N N   . TYR A 1 167  ? 60.654  -45.692 15.693  1.00 47.48  ? 167  TYR A N   1 
ATOM 1165  C CA  . TYR A 1 167  ? 61.105  -45.983 14.354  1.00 42.36  ? 167  TYR A CA  1 
ATOM 1166  C C   . TYR A 1 167  ? 62.433  -46.704 14.471  1.00 42.63  ? 167  TYR A C   1 
ATOM 1167  O O   . TYR A 1 167  ? 63.193  -46.488 15.418  1.00 46.51  ? 167  TYR A O   1 
ATOM 1168  C CB  . TYR A 1 167  ? 61.171  -44.698 13.516  1.00 31.11  ? 167  TYR A CB  1 
ATOM 1169  C CG  . TYR A 1 167  ? 59.767  -44.266 13.116  1.00 29.40  ? 167  TYR A CG  1 
ATOM 1170  C CD1 . TYR A 1 167  ? 58.854  -45.181 12.610  1.00 33.12  ? 167  TYR A CD1 1 
ATOM 1171  C CD2 . TYR A 1 167  ? 59.329  -42.992 13.315  1.00 27.43  ? 167  TYR A CD2 1 
ATOM 1172  C CE1 . TYR A 1 167  ? 57.555  -44.810 12.273  1.00 28.09  ? 167  TYR A CE1 1 
ATOM 1173  C CE2 . TYR A 1 167  ? 58.075  -42.614 12.962  1.00 25.80  ? 167  TYR A CE2 1 
ATOM 1174  C CZ  . TYR A 1 167  ? 57.166  -43.517 12.471  1.00 22.80  ? 167  TYR A CZ  1 
ATOM 1175  O OH  . TYR A 1 167  ? 55.886  -43.097 12.158  1.00 15.95  ? 167  TYR A OH  1 
ATOM 1176  N N   . LYS A 1 168  ? 62.663  -47.611 13.528  1.00 37.56  ? 168  LYS A N   1 
ATOM 1177  C CA  . LYS A 1 168  ? 63.767  -48.555 13.634  1.00 37.47  ? 168  LYS A CA  1 
ATOM 1178  C C   . LYS A 1 168  ? 65.101  -47.952 13.218  1.00 48.86  ? 168  LYS A C   1 
ATOM 1179  O O   . LYS A 1 168  ? 66.155  -48.416 13.674  1.00 44.61  ? 168  LYS A O   1 
ATOM 1180  C CB  . LYS A 1 168  ? 63.454  -49.779 12.785  1.00 33.38  ? 168  LYS A CB  1 
ATOM 1181  C CG  . LYS A 1 168  ? 64.232  -51.002 13.169  1.00 38.80  ? 168  LYS A CG  1 
ATOM 1182  C CD  . LYS A 1 168  ? 65.127  -50.788 14.384  1.00 29.10  ? 168  LYS A CD  1 
ATOM 1183  C CE  . LYS A 1 168  ? 64.358  -50.798 15.686  1.00 33.51  ? 168  LYS A CE  1 
ATOM 1184  N NZ  . LYS A 1 168  ? 65.119  -51.582 16.697  1.00 20.29  ? 168  LYS A NZ  1 
ATOM 1185  N N   . LEU A 1 169  ? 65.078  -46.960 12.316  1.00 68.28  ? 169  LEU A N   1 
ATOM 1186  C CA  . LEU A 1 169  ? 66.277  -46.173 12.005  1.00 74.94  ? 169  LEU A CA  1 
ATOM 1187  C C   . LEU A 1 169  ? 66.771  -45.404 13.233  1.00 75.27  ? 169  LEU A C   1 
ATOM 1188  O O   . LEU A 1 169  ? 67.974  -45.404 13.535  1.00 77.33  ? 169  LEU A O   1 
ATOM 1189  C CB  . LEU A 1 169  ? 65.991  -45.206 10.849  1.00 74.05  ? 169  LEU A CB  1 
ATOM 1190  C CG  . LEU A 1 169  ? 67.095  -44.189 10.511  1.00 66.40  ? 169  LEU A CG  1 
ATOM 1191  C CD1 . LEU A 1 169  ? 68.071  -44.778 9.494   1.00 74.34  ? 169  LEU A CD1 1 
ATOM 1192  C CD2 . LEU A 1 169  ? 66.536  -42.839 10.032  1.00 49.73  ? 169  LEU A CD2 1 
ATOM 1193  N N   . ARG A 1 170  ? 65.858  -44.705 13.927  1.00 68.85  ? 170  ARG A N   1 
ATOM 1194  C CA  . ARG A 1 170  ? 66.125  -44.169 15.267  1.00 56.34  ? 170  ARG A CA  1 
ATOM 1195  C C   . ARG A 1 170  ? 65.853  -45.266 16.301  1.00 53.62  ? 170  ARG A C   1 
ATOM 1196  O O   . ARG A 1 170  ? 64.889  -45.219 17.073  1.00 47.10  ? 170  ARG A O   1 
ATOM 1197  C CB  . ARG A 1 170  ? 65.295  -42.908 15.522  1.00 34.00  ? 170  ARG A CB  1 
ATOM 1198  C CG  . ARG A 1 170  ? 66.052  -41.820 16.277  1.00 33.26  ? 170  ARG A CG  1 
ATOM 1199  C CD  . ARG A 1 170  ? 65.636  -40.444 15.838  1.00 26.95  ? 170  ARG A CD  1 
ATOM 1200  N NE  . ARG A 1 170  ? 65.399  -40.443 14.401  1.00 33.91  ? 170  ARG A NE  1 
ATOM 1201  C CZ  . ARG A 1 170  ? 66.312  -40.758 13.481  1.00 39.44  ? 170  ARG A CZ  1 
ATOM 1202  N NH1 . ARG A 1 170  ? 67.546  -41.113 13.835  1.00 34.36  ? 170  ARG A NH1 1 
ATOM 1203  N NH2 . ARG A 1 170  ? 65.984  -40.728 12.194  1.00 48.24  ? 170  ARG A NH2 1 
ATOM 1204  N N   . SER A 1 171  ? 66.724  -46.295 16.268  1.00 51.30  ? 171  SER A N   1 
ATOM 1205  C CA  . SER A 1 171  ? 66.792  -47.394 17.235  1.00 41.70  ? 171  SER A CA  1 
ATOM 1206  C C   . SER A 1 171  ? 67.408  -46.785 18.480  1.00 34.78  ? 171  SER A C   1 
ATOM 1207  O O   . SER A 1 171  ? 67.533  -45.567 18.535  1.00 33.43  ? 171  SER A O   1 
ATOM 1208  C CB  . SER A 1 171  ? 67.627  -48.569 16.699  1.00 28.31  ? 171  SER A CB  1 
ATOM 1209  O OG  . SER A 1 171  ? 67.031  -49.811 17.027  1.00 23.50  ? 171  SER A OG  1 
ATOM 1210  N N   . ILE A 1 172  ? 67.862  -47.575 19.446  1.00 33.48  ? 172  ILE A N   1 
ATOM 1211  C CA  . ILE A 1 172  ? 68.397  -46.974 20.663  1.00 28.07  ? 172  ILE A CA  1 
ATOM 1212  C C   . ILE A 1 172  ? 69.775  -46.342 20.384  1.00 26.14  ? 172  ILE A C   1 
ATOM 1213  O O   . ILE A 1 172  ? 70.501  -46.741 19.462  1.00 29.27  ? 172  ILE A O   1 
ATOM 1214  C CB  . ILE A 1 172  ? 68.430  -48.023 21.798  1.00 27.56  ? 172  ILE A CB  1 
ATOM 1215  C CG1 . ILE A 1 172  ? 67.067  -48.754 21.898  1.00 20.17  ? 172  ILE A CG1 1 
ATOM 1216  C CG2 . ILE A 1 172  ? 68.778  -47.392 23.137  1.00 19.13  ? 172  ILE A CG2 1 
ATOM 1217  C CD1 . ILE A 1 172  ? 66.543  -49.043 23.316  1.00 8.77   ? 172  ILE A CD1 1 
ATOM 1218  N N   . GLY A 1 173  ? 70.093  -45.289 21.133  1.00 21.89  ? 173  GLY A N   1 
ATOM 1219  C CA  . GLY A 1 173  ? 71.384  -44.633 21.034  1.00 19.91  ? 173  GLY A CA  1 
ATOM 1220  C C   . GLY A 1 173  ? 71.664  -43.602 19.943  1.00 19.78  ? 173  GLY A C   1 
ATOM 1221  O O   . GLY A 1 173  ? 72.834  -43.345 19.676  1.00 26.12  ? 173  GLY A O   1 
ATOM 1222  N N   . ASP A 1 174  ? 70.676  -42.981 19.303  1.00 17.68  ? 174  ASP A N   1 
ATOM 1223  C CA  . ASP A 1 174  ? 70.922  -41.715 18.605  1.00 18.24  ? 174  ASP A CA  1 
ATOM 1224  C C   . ASP A 1 174  ? 70.167  -40.578 19.283  1.00 38.80  ? 174  ASP A C   1 
ATOM 1225  O O   . ASP A 1 174  ? 69.240  -40.817 20.058  1.00 51.10  ? 174  ASP A O   1 
ATOM 1226  C CB  . ASP A 1 174  ? 70.482  -41.734 17.145  1.00 13.52  ? 174  ASP A CB  1 
ATOM 1227  C CG  . ASP A 1 174  ? 71.401  -42.467 16.287  1.00 8.75   ? 174  ASP A CG  1 
ATOM 1228  O OD1 . ASP A 1 174  ? 72.573  -42.577 16.653  1.00 8.75   ? 174  ASP A OD1 1 
ATOM 1229  O OD2 . ASP A 1 174  ? 70.942  -42.945 15.249  1.00 8.75   ? 174  ASP A OD2 1 
ATOM 1230  N N   . SER A 1 175  ? 70.542  -39.331 18.950  1.00 51.51  ? 175  SER A N   1 
ATOM 1231  C CA  . SER A 1 175  ? 69.780  -38.158 19.397  1.00 38.55  ? 175  SER A CA  1 
ATOM 1232  C C   . SER A 1 175  ? 68.593  -37.921 18.476  1.00 25.20  ? 175  SER A C   1 
ATOM 1233  O O   . SER A 1 175  ? 68.707  -38.018 17.249  1.00 21.85  ? 175  SER A O   1 
ATOM 1234  C CB  . SER A 1 175  ? 70.650  -36.895 19.447  1.00 33.37  ? 175  SER A CB  1 
ATOM 1235  O OG  . SER A 1 175  ? 69.859  -35.709 19.494  1.00 19.12  ? 175  SER A OG  1 
ATOM 1236  N N   . VAL A 1 176  ? 67.443  -37.632 19.070  1.00 17.03  ? 176  VAL A N   1 
ATOM 1237  C CA  . VAL A 1 176  ? 66.267  -37.499 18.242  1.00 13.52  ? 176  VAL A CA  1 
ATOM 1238  C C   . VAL A 1 176  ? 66.479  -36.335 17.305  1.00 10.37  ? 176  VAL A C   1 
ATOM 1239  O O   . VAL A 1 176  ? 66.971  -35.271 17.693  1.00 9.52   ? 176  VAL A O   1 
ATOM 1240  C CB  . VAL A 1 176  ? 65.008  -37.313 19.084  1.00 15.19  ? 176  VAL A CB  1 
ATOM 1241  C CG1 . VAL A 1 176  ? 63.796  -37.559 18.198  1.00 22.11  ? 176  VAL A CG1 1 
ATOM 1242  C CG2 . VAL A 1 176  ? 65.043  -38.254 20.259  1.00 19.89  ? 176  VAL A CG2 1 
ATOM 1243  N N   . VAL A 1 177  ? 66.137  -36.545 16.060  1.00 13.76  ? 177  VAL A N   1 
ATOM 1244  C CA  . VAL A 1 177  ? 66.315  -35.546 15.038  1.00 8.88   ? 177  VAL A CA  1 
ATOM 1245  C C   . VAL A 1 177  ? 64.998  -35.476 14.300  1.00 11.12  ? 177  VAL A C   1 
ATOM 1246  O O   . VAL A 1 177  ? 64.398  -36.517 14.017  1.00 14.81  ? 177  VAL A O   1 
ATOM 1247  C CB  . VAL A 1 177  ? 67.471  -35.938 14.103  1.00 15.19  ? 177  VAL A CB  1 
ATOM 1248  C CG1 . VAL A 1 177  ? 67.786  -34.819 13.129  1.00 22.87  ? 177  VAL A CG1 1 
ATOM 1249  C CG2 . VAL A 1 177  ? 68.699  -36.410 14.917  1.00 13.71  ? 177  VAL A CG2 1 
ATOM 1250  N N   . ILE A 1 178  ? 64.507  -34.267 14.055  1.00 11.00  ? 178  ILE A N   1 
ATOM 1251  C CA  . ILE A 1 178  ? 63.384  -34.132 13.137  1.00 9.79   ? 178  ILE A CA  1 
ATOM 1252  C C   . ILE A 1 178  ? 62.133  -34.747 13.749  1.00 15.59  ? 178  ILE A C   1 
ATOM 1253  O O   . ILE A 1 178  ? 61.241  -35.208 13.030  1.00 18.09  ? 178  ILE A O   1 
ATOM 1254  C CB  . ILE A 1 178  ? 63.695  -34.806 11.788  1.00 14.12  ? 178  ILE A CB  1 
ATOM 1255  C CG1 . ILE A 1 178  ? 65.072  -34.409 11.283  1.00 15.31  ? 178  ILE A CG1 1 
ATOM 1256  C CG2 . ILE A 1 178  ? 62.682  -34.420 10.732  1.00 19.11  ? 178  ILE A CG2 1 
ATOM 1257  C CD1 . ILE A 1 178  ? 65.197  -32.949 11.082  1.00 12.81  ? 178  ILE A CD1 1 
ATOM 1258  N N   . GLY A 1 179  ? 62.073  -34.784 15.073  1.00 17.60  ? 179  GLY A N   1 
ATOM 1259  C CA  . GLY A 1 179  ? 60.934  -35.328 15.794  1.00 18.93  ? 179  GLY A CA  1 
ATOM 1260  C C   . GLY A 1 179  ? 60.409  -36.659 15.309  1.00 18.83  ? 179  GLY A C   1 
ATOM 1261  O O   . GLY A 1 179  ? 59.288  -36.746 14.784  1.00 21.90  ? 179  GLY A O   1 
ATOM 1262  N N   . ASP A 1 180  ? 61.227  -37.694 15.530  1.00 17.19  ? 180  ASP A N   1 
ATOM 1263  C CA  . ASP A 1 180  ? 60.921  -39.076 15.172  1.00 17.30  ? 180  ASP A CA  1 
ATOM 1264  C C   . ASP A 1 180  ? 59.741  -39.605 15.976  1.00 19.85  ? 180  ASP A C   1 
ATOM 1265  O O   . ASP A 1 180  ? 59.847  -39.782 17.193  1.00 20.45  ? 180  ASP A O   1 
ATOM 1266  C CB  . ASP A 1 180  ? 62.138  -39.960 15.420  1.00 14.79  ? 180  ASP A CB  1 
ATOM 1267  C CG  . ASP A 1 180  ? 61.978  -41.278 14.774  1.00 13.51  ? 180  ASP A CG  1 
ATOM 1268  O OD1 . ASP A 1 180  ? 61.046  -41.372 13.953  1.00 17.10  ? 180  ASP A OD1 1 
ATOM 1269  O OD2 . ASP A 1 180  ? 62.781  -42.183 15.043  1.00 13.30  ? 180  ASP A OD2 1 
ATOM 1270  N N   . LYS A 1 181  ? 58.619  -39.868 15.289  1.00 22.01  ? 181  LYS A N   1 
ATOM 1271  C CA  . LYS A 1 181  ? 57.511  -40.627 15.889  1.00 22.12  ? 181  LYS A CA  1 
ATOM 1272  C C   . LYS A 1 181  ? 58.052  -41.739 16.769  1.00 30.54  ? 181  LYS A C   1 
ATOM 1273  O O   . LYS A 1 181  ? 58.801  -42.612 16.303  1.00 34.16  ? 181  LYS A O   1 
ATOM 1274  C CB  . LYS A 1 181  ? 56.595  -41.227 14.817  1.00 18.74  ? 181  LYS A CB  1 
ATOM 1275  C CG  . LYS A 1 181  ? 55.384  -40.549 14.665  1.00 13.95  ? 181  LYS A CG  1 
ATOM 1276  C CD  . LYS A 1 181  ? 54.631  -40.662 13.224  1.00 12.60  ? 181  LYS A CD  1 
ATOM 1277  C CE  . LYS A 1 181  ? 53.238  -39.940 13.123  1.00 10.05  ? 181  LYS A CE  1 
ATOM 1278  N NZ  . LYS A 1 181  ? 52.248  -39.404 14.176  1.00 11.54  ? 181  LYS A NZ  1 
ATOM 1279  N N   . VAL A 1 182  ? 57.744  -41.670 18.067  1.00 33.83  ? 182  VAL A N   1 
ATOM 1280  C CA  . VAL A 1 182  ? 58.198  -42.715 18.987  1.00 41.67  ? 182  VAL A CA  1 
ATOM 1281  C C   . VAL A 1 182  ? 57.370  -42.770 20.274  1.00 37.14  ? 182  VAL A C   1 
ATOM 1282  O O   . VAL A 1 182  ? 56.729  -41.784 20.664  1.00 32.70  ? 182  VAL A O   1 
ATOM 1283  C CB  . VAL A 1 182  ? 59.708  -42.554 19.313  1.00 49.13  ? 182  VAL A CB  1 
ATOM 1284  C CG1 . VAL A 1 182  ? 60.634  -42.637 18.038  1.00 35.49  ? 182  VAL A CG1 1 
ATOM 1285  C CG2 . VAL A 1 182  ? 59.903  -41.274 20.159  1.00 58.77  ? 182  VAL A CG2 1 
ATOM 1286  N N   . VAL A 1 183  ? 57.386  -43.971 20.958  1.00 37.84  ? 183  VAL A N   1 
ATOM 1287  C CA  . VAL A 1 183  ? 56.442  -44.212 22.056  1.00 37.53  ? 183  VAL A CA  1 
ATOM 1288  C C   . VAL A 1 183  ? 57.103  -43.838 23.380  1.00 28.88  ? 183  VAL A C   1 
ATOM 1289  O O   . VAL A 1 183  ? 58.288  -44.099 23.597  1.00 21.77  ? 183  VAL A O   1 
ATOM 1290  C CB  . VAL A 1 183  ? 55.906  -45.670 22.073  1.00 57.09  ? 183  VAL A CB  1 
ATOM 1291  C CG1 . VAL A 1 183  ? 54.649  -45.765 22.933  1.00 52.35  ? 183  VAL A CG1 1 
ATOM 1292  C CG2 . VAL A 1 183  ? 55.564  -46.168 20.665  1.00 53.90  ? 183  VAL A CG2 1 
ATOM 1293  N N   . LEU A 1 184  ? 56.345  -43.197 24.268  1.00 24.93  ? 184  LEU A N   1 
ATOM 1294  C CA  . LEU A 1 184  ? 56.874  -42.807 25.563  1.00 20.05  ? 184  LEU A CA  1 
ATOM 1295  C C   . LEU A 1 184  ? 56.003  -43.319 26.689  1.00 18.86  ? 184  LEU A C   1 
ATOM 1296  O O   . LEU A 1 184  ? 54.778  -43.261 26.632  1.00 21.89  ? 184  LEU A O   1 
ATOM 1297  C CB  . LEU A 1 184  ? 56.977  -41.322 25.706  1.00 20.01  ? 184  LEU A CB  1 
ATOM 1298  C CG  . LEU A 1 184  ? 57.546  -41.069 27.087  1.00 20.93  ? 184  LEU A CG  1 
ATOM 1299  C CD1 . LEU A 1 184  ? 58.536  -39.949 26.981  1.00 27.96  ? 184  LEU A CD1 1 
ATOM 1300  C CD2 . LEU A 1 184  ? 56.427  -40.719 28.033  1.00 21.97  ? 184  LEU A CD2 1 
ATOM 1301  N N   . ASN A 1 185  ? 56.646  -43.753 27.741  1.00 14.87  ? 185  ASN A N   1 
ATOM 1302  C CA  . ASN A 1 185  ? 55.964  -44.503 28.742  1.00 17.21  ? 185  ASN A CA  1 
ATOM 1303  C C   . ASN A 1 185  ? 56.287  -43.817 30.051  1.00 22.25  ? 185  ASN A C   1 
ATOM 1304  O O   . ASN A 1 185  ? 57.472  -43.585 30.321  1.00 24.83  ? 185  ASN A O   1 
ATOM 1305  C CB  . ASN A 1 185  ? 56.470  -45.925 28.791  1.00 17.93  ? 185  ASN A CB  1 
ATOM 1306  C CG  . ASN A 1 185  ? 56.741  -46.513 27.434  1.00 17.11  ? 185  ASN A CG  1 
ATOM 1307  O OD1 . ASN A 1 185  ? 56.735  -47.718 27.295  1.00 15.02  ? 185  ASN A OD1 1 
ATOM 1308  N ND2 . ASN A 1 185  ? 57.030  -45.693 26.445  1.00 18.97  ? 185  ASN A ND2 1 
ATOM 1309  N N   . PRO A 1 186  ? 55.314  -43.532 30.898  1.00 26.71  ? 186  PRO A N   1 
ATOM 1310  C CA  . PRO A 1 186  ? 55.656  -42.963 32.206  1.00 30.77  ? 186  PRO A CA  1 
ATOM 1311  C C   . PRO A 1 186  ? 56.355  -43.996 33.079  1.00 35.29  ? 186  PRO A C   1 
ATOM 1312  O O   . PRO A 1 186  ? 56.015  -45.179 33.057  1.00 44.17  ? 186  PRO A O   1 
ATOM 1313  C CB  . PRO A 1 186  ? 54.298  -42.575 32.800  1.00 36.38  ? 186  PRO A CB  1 
ATOM 1314  C CG  . PRO A 1 186  ? 53.323  -42.632 31.703  1.00 39.04  ? 186  PRO A CG  1 
ATOM 1315  C CD  . PRO A 1 186  ? 53.859  -43.581 30.670  1.00 32.00  ? 186  PRO A CD  1 
ATOM 1316  N N   . VAL A 1 187  ? 57.307  -43.547 33.898  1.00 31.76  ? 187  VAL A N   1 
ATOM 1317  C CA  . VAL A 1 187  ? 57.966  -44.527 34.750  1.00 28.58  ? 187  VAL A CA  1 
ATOM 1318  C C   . VAL A 1 187  ? 57.017  -44.954 35.866  1.00 49.02  ? 187  VAL A C   1 
ATOM 1319  O O   . VAL A 1 187  ? 57.379  -44.917 37.049  1.00 60.67  ? 187  VAL A O   1 
ATOM 1320  C CB  . VAL A 1 187  ? 59.296  -44.026 35.346  1.00 23.01  ? 187  VAL A CB  1 
ATOM 1321  C CG1 . VAL A 1 187  ? 60.227  -45.209 35.491  1.00 19.68  ? 187  VAL A CG1 1 
ATOM 1322  C CG2 . VAL A 1 187  ? 59.934  -42.953 34.492  1.00 24.80  ? 187  VAL A CG2 1 
ATOM 1323  N N   . ASN A 1 188  ? 55.807  -45.390 35.495  1.00 52.53  ? 188  ASN A N   1 
ATOM 1324  C CA  . ASN A 1 188  ? 54.771  -45.765 36.456  1.00 61.59  ? 188  ASN A CA  1 
ATOM 1325  C C   . ASN A 1 188  ? 53.921  -46.949 35.998  1.00 52.48  ? 188  ASN A C   1 
ATOM 1326  O O   . ASN A 1 188  ? 54.019  -48.057 36.542  1.00 55.89  ? 188  ASN A O   1 
ATOM 1327  C CB  . ASN A 1 188  ? 53.847  -44.571 36.730  1.00 54.15  ? 188  ASN A CB  1 
ATOM 1328  C CG  . ASN A 1 188  ? 53.987  -44.026 38.149  1.00 68.97  ? 188  ASN A CG  1 
ATOM 1329  O OD1 . ASN A 1 188  ? 54.475  -44.718 39.054  1.00 88.06  ? 188  ASN A OD1 1 
ATOM 1330  N ND2 . ASN A 1 188  ? 53.544  -42.783 38.352  1.00 57.01  ? 188  ASN A ND2 1 
ATOM 1331  N N   . ALA A 1 189  ? 53.062  -46.704 35.007  1.00 42.30  ? 189  ALA A N   1 
ATOM 1332  C CA  . ALA A 1 189  ? 52.031  -47.669 34.654  1.00 38.69  ? 189  ALA A CA  1 
ATOM 1333  C C   . ALA A 1 189  ? 52.611  -48.862 33.894  1.00 42.20  ? 189  ALA A C   1 
ATOM 1334  O O   . ALA A 1 189  ? 52.466  -50.013 34.317  1.00 36.88  ? 189  ALA A O   1 
ATOM 1335  C CB  . ALA A 1 189  ? 50.942  -46.969 33.841  1.00 31.55  ? 189  ALA A CB  1 
ATOM 1336  N N   . GLY A 1 190  ? 53.278  -48.602 32.784  1.00 28.90  ? 190  GLY A N   1 
ATOM 1337  C CA  . GLY A 1 190  ? 53.682  -49.642 31.861  1.00 14.09  ? 190  GLY A CA  1 
ATOM 1338  C C   . GLY A 1 190  ? 53.949  -49.013 30.506  1.00 12.74  ? 190  GLY A C   1 
ATOM 1339  O O   . GLY A 1 190  ? 53.958  -47.799 30.357  1.00 16.75  ? 190  GLY A O   1 
ATOM 1340  N N   . GLN A 1 191  ? 54.134  -49.845 29.504  1.00 10.09  ? 191  GLN A N   1 
ATOM 1341  C CA  . GLN A 1 191  ? 54.695  -49.205 28.312  1.00 11.34  ? 191  GLN A CA  1 
ATOM 1342  C C   . GLN A 1 191  ? 53.686  -48.685 27.283  1.00 11.52  ? 191  GLN A C   1 
ATOM 1343  O O   . GLN A 1 191  ? 52.469  -48.792 27.476  1.00 13.58  ? 191  GLN A O   1 
ATOM 1344  C CB  . GLN A 1 191  ? 55.704  -50.158 27.659  1.00 14.31  ? 191  GLN A CB  1 
ATOM 1345  C CG  . GLN A 1 191  ? 55.680  -51.577 28.097  1.00 16.18  ? 191  GLN A CG  1 
ATOM 1346  C CD  . GLN A 1 191  ? 57.078  -52.047 28.457  1.00 8.86   ? 191  GLN A CD  1 
ATOM 1347  O OE1 . GLN A 1 191  ? 57.865  -52.460 27.596  1.00 8.86   ? 191  GLN A OE1 1 
ATOM 1348  N NE2 . GLN A 1 191  ? 57.405  -51.959 29.738  1.00 8.86   ? 191  GLN A NE2 1 
ATOM 1349  N N   . PRO A 1 192  ? 54.178  -48.201 26.131  1.00 10.70  ? 192  PRO A N   1 
ATOM 1350  C CA  . PRO A 1 192  ? 53.396  -47.327 25.253  1.00 15.37  ? 192  PRO A CA  1 
ATOM 1351  C C   . PRO A 1 192  ? 52.230  -46.551 25.797  1.00 21.03  ? 192  PRO A C   1 
ATOM 1352  O O   . PRO A 1 192  ? 52.013  -46.374 26.991  1.00 20.44  ? 192  PRO A O   1 
ATOM 1353  C CB  . PRO A 1 192  ? 52.929  -48.312 24.191  1.00 14.12  ? 192  PRO A CB  1 
ATOM 1354  C CG  . PRO A 1 192  ? 54.114  -49.205 24.013  1.00 10.84  ? 192  PRO A CG  1 
ATOM 1355  C CD  . PRO A 1 192  ? 54.990  -49.049 25.256  1.00 11.92  ? 192  PRO A CD  1 
ATOM 1356  N N   . LEU A 1 193  ? 51.584  -45.966 24.802  1.00 25.63  ? 193  LEU A N   1 
ATOM 1357  C CA  . LEU A 1 193  ? 50.326  -45.253 24.868  1.00 36.94  ? 193  LEU A CA  1 
ATOM 1358  C C   . LEU A 1 193  ? 49.474  -45.879 23.774  1.00 52.06  ? 193  LEU A C   1 
ATOM 1359  O O   . LEU A 1 193  ? 50.020  -46.453 22.826  1.00 65.40  ? 193  LEU A O   1 
ATOM 1360  C CB  . LEU A 1 193  ? 50.528  -43.740 24.630  1.00 34.04  ? 193  LEU A CB  1 
ATOM 1361  C CG  . LEU A 1 193  ? 51.279  -42.908 25.658  1.00 34.95  ? 193  LEU A CG  1 
ATOM 1362  C CD1 . LEU A 1 193  ? 51.037  -41.457 25.349  1.00 35.32  ? 193  LEU A CD1 1 
ATOM 1363  C CD2 . LEU A 1 193  ? 50.716  -43.257 27.004  1.00 33.99  ? 193  LEU A CD2 1 
ATOM 1364  N N   . HIS A 1 194  ? 48.140  -45.762 23.911  1.00 58.78  ? 194  HIS A N   1 
ATOM 1365  C CA  . HIS A 1 194  ? 47.125  -46.469 23.112  1.00 49.28  ? 194  HIS A CA  1 
ATOM 1366  C C   . HIS A 1 194  ? 45.861  -45.627 22.980  1.00 31.43  ? 194  HIS A C   1 
ATOM 1367  O O   . HIS A 1 194  ? 45.404  -45.007 23.947  1.00 39.36  ? 194  HIS A O   1 
ATOM 1368  C CB  . HIS A 1 194  ? 46.753  -47.803 23.762  1.00 39.02  ? 194  HIS A CB  1 
ATOM 1369  C CG  . HIS A 1 194  ? 46.039  -48.786 22.865  1.00 21.22  ? 194  HIS A CG  1 
ATOM 1370  N ND1 . HIS A 1 194  ? 45.737  -50.063 23.280  1.00 19.57  ? 194  HIS A ND1 1 
ATOM 1371  C CD2 . HIS A 1 194  ? 45.601  -48.705 21.574  1.00 16.74  ? 194  HIS A CD2 1 
ATOM 1372  C CE1 . HIS A 1 194  ? 45.134  -50.717 22.311  1.00 22.13  ? 194  HIS A CE1 1 
ATOM 1373  N NE2 . HIS A 1 194  ? 45.117  -49.946 21.241  1.00 13.83  ? 194  HIS A NE2 1 
ATOM 1374  N N   . ALA A 1 195  ? 45.261  -45.645 21.814  1.00 17.47  ? 195  ALA A N   1 
ATOM 1375  C CA  . ALA A 1 195  ? 44.040  -44.887 21.672  1.00 14.98  ? 195  ALA A CA  1 
ATOM 1376  C C   . ALA A 1 195  ? 42.951  -45.797 21.146  1.00 14.31  ? 195  ALA A C   1 
ATOM 1377  O O   . ALA A 1 195  ? 43.222  -46.858 20.574  1.00 13.22  ? 195  ALA A O   1 
ATOM 1378  C CB  . ALA A 1 195  ? 44.252  -43.684 20.774  1.00 15.41  ? 195  ALA A CB  1 
ATOM 1379  N N   . SER A 1 196  ? 41.716  -45.345 21.345  1.00 20.44  ? 196  SER A N   1 
ATOM 1380  C CA  . SER A 1 196  ? 40.552  -46.219 21.328  1.00 22.07  ? 196  SER A CA  1 
ATOM 1381  C C   . SER A 1 196  ? 39.294  -45.450 20.952  1.00 12.78  ? 196  SER A C   1 
ATOM 1382  O O   . SER A 1 196  ? 39.169  -44.245 21.186  1.00 16.04  ? 196  SER A O   1 
ATOM 1383  C CB  . SER A 1 196  ? 40.369  -46.866 22.700  1.00 40.57  ? 196  SER A CB  1 
ATOM 1384  O OG  . SER A 1 196  ? 40.236  -45.846 23.688  1.00 27.06  ? 196  SER A OG  1 
ATOM 1385  N N   . SER A 1 197  ? 38.326  -46.181 20.407  1.00 8.96   ? 197  SER A N   1 
ATOM 1386  C CA  . SER A 1 197  ? 37.074  -45.583 19.974  1.00 8.96   ? 197  SER A CA  1 
ATOM 1387  C C   . SER A 1 197  ? 36.323  -45.123 21.212  1.00 10.36  ? 197  SER A C   1 
ATOM 1388  O O   . SER A 1 197  ? 35.406  -45.778 21.697  1.00 8.96   ? 197  SER A O   1 
ATOM 1389  C CB  . SER A 1 197  ? 36.246  -46.575 19.185  1.00 8.96   ? 197  SER A CB  1 
ATOM 1390  O OG  . SER A 1 197  ? 36.988  -47.055 18.092  1.00 8.96   ? 197  SER A OG  1 
ATOM 1391  N N   . HIS A 1 198  ? 36.751  -44.002 21.767  1.00 10.68  ? 198  HIS A N   1 
ATOM 1392  C CA  . HIS A 1 198  ? 35.925  -43.328 22.752  1.00 17.68  ? 198  HIS A CA  1 
ATOM 1393  C C   . HIS A 1 198  ? 35.821  -41.876 22.353  1.00 18.30  ? 198  HIS A C   1 
ATOM 1394  O O   . HIS A 1 198  ? 36.764  -41.308 21.802  1.00 19.23  ? 198  HIS A O   1 
ATOM 1395  C CB  . HIS A 1 198  ? 36.442  -43.402 24.188  1.00 20.54  ? 198  HIS A CB  1 
ATOM 1396  C CG  . HIS A 1 198  ? 37.056  -44.708 24.556  1.00 19.17  ? 198  HIS A CG  1 
ATOM 1397  N ND1 . HIS A 1 198  ? 37.244  -45.717 23.643  1.00 16.73  ? 198  HIS A ND1 1 
ATOM 1398  C CD2 . HIS A 1 198  ? 37.505  -45.182 25.742  1.00 24.36  ? 198  HIS A CD2 1 
ATOM 1399  C CE1 . HIS A 1 198  ? 37.795  -46.753 24.241  1.00 22.15  ? 198  HIS A CE1 1 
ATOM 1400  N NE2 . HIS A 1 198  ? 37.972  -46.453 25.515  1.00 25.80  ? 198  HIS A NE2 1 
ATOM 1401  N N   . GLN A 1 199  ? 34.666  -41.280 22.637  1.00 17.26  ? 199  GLN A N   1 
ATOM 1402  C CA  . GLN A 1 199  ? 34.358  -39.966 22.111  1.00 21.82  ? 199  GLN A CA  1 
ATOM 1403  C C   . GLN A 1 199  ? 33.442  -39.156 23.019  1.00 31.75  ? 199  GLN A C   1 
ATOM 1404  O O   . GLN A 1 199  ? 33.322  -37.943 22.828  1.00 41.34  ? 199  GLN A O   1 
ATOM 1405  C CB  . GLN A 1 199  ? 33.721  -40.092 20.721  1.00 18.77  ? 199  GLN A CB  1 
ATOM 1406  C CG  . GLN A 1 199  ? 34.586  -40.784 19.687  1.00 17.01  ? 199  GLN A CG  1 
ATOM 1407  C CD  . GLN A 1 199  ? 33.972  -40.724 18.304  1.00 14.98  ? 199  GLN A CD  1 
ATOM 1408  O OE1 . GLN A 1 199  ? 32.767  -40.528 18.155  1.00 11.92  ? 199  GLN A OE1 1 
ATOM 1409  N NE2 . GLN A 1 199  ? 34.801  -40.876 17.284  1.00 14.15  ? 199  GLN A NE2 1 
ATOM 1410  N N   . LEU A 1 200  ? 32.785  -39.785 23.996  1.00 28.40  ? 200  LEU A N   1 
ATOM 1411  C CA  . LEU A 1 200  ? 31.853  -39.048 24.848  1.00 41.38  ? 200  LEU A CA  1 
ATOM 1412  C C   . LEU A 1 200  ? 30.599  -38.683 24.049  1.00 46.87  ? 200  LEU A C   1 
ATOM 1413  O O   . LEU A 1 200  ? 30.483  -39.051 22.874  1.00 46.21  ? 200  LEU A O   1 
ATOM 1414  C CB  . LEU A 1 200  ? 32.527  -37.793 25.426  1.00 30.04  ? 200  LEU A CB  1 
ATOM 1415  C CG  . LEU A 1 200  ? 32.444  -37.459 26.920  1.00 25.90  ? 200  LEU A CG  1 
ATOM 1416  C CD1 . LEU A 1 200  ? 33.680  -37.943 27.641  1.00 20.89  ? 200  LEU A CD1 1 
ATOM 1417  C CD2 . LEU A 1 200  ? 32.288  -35.966 27.104  1.00 26.55  ? 200  LEU A CD2 1 
ATOM 1418  N N   . VAL A 1 201  ? 29.647  -37.980 24.677  1.00 52.31  ? 201  VAL A N   1 
ATOM 1419  C CA  . VAL A 1 201  ? 28.388  -37.594 24.035  1.00 39.04  ? 201  VAL A CA  1 
ATOM 1420  C C   . VAL A 1 201  ? 28.164  -36.100 24.272  1.00 28.66  ? 201  VAL A C   1 
ATOM 1421  O O   . VAL A 1 201  ? 27.940  -35.338 23.326  1.00 23.11  ? 201  VAL A O   1 
ATOM 1422  C CB  . VAL A 1 201  ? 27.197  -38.463 24.526  1.00 32.27  ? 201  VAL A CB  1 
ATOM 1423  C CG1 . VAL A 1 201  ? 27.262  -38.746 26.028  1.00 32.99  ? 201  VAL A CG1 1 
ATOM 1424  C CG2 . VAL A 1 201  ? 25.859  -37.830 24.181  1.00 30.07  ? 201  VAL A CG2 1 
ATOM 1425  N N   . ASP A 1 202  ? 28.254  -35.662 25.528  1.00 31.27  ? 202  ASP A N   1 
ATOM 1426  C CA  . ASP A 1 202  ? 28.105  -34.239 25.799  1.00 27.77  ? 202  ASP A CA  1 
ATOM 1427  C C   . ASP A 1 202  ? 29.258  -33.456 25.204  1.00 22.05  ? 202  ASP A C   1 
ATOM 1428  O O   . ASP A 1 202  ? 29.050  -32.384 24.632  1.00 24.17  ? 202  ASP A O   1 
ATOM 1429  C CB  . ASP A 1 202  ? 28.006  -33.979 27.303  1.00 37.50  ? 202  ASP A CB  1 
ATOM 1430  C CG  . ASP A 1 202  ? 27.748  -32.510 27.635  1.00 49.55  ? 202  ASP A CG  1 
ATOM 1431  O OD1 . ASP A 1 202  ? 26.954  -31.848 26.921  1.00 51.36  ? 202  ASP A OD1 1 
ATOM 1432  O OD2 . ASP A 1 202  ? 28.336  -32.024 28.628  1.00 60.67  ? 202  ASP A OD2 1 
ATOM 1433  N N   . ASN A 1 203  ? 30.474  -33.979 25.306  1.00 18.80  ? 203  ASN A N   1 
ATOM 1434  C CA  . ASN A 1 203  ? 31.660  -33.294 24.804  1.00 20.89  ? 203  ASN A CA  1 
ATOM 1435  C C   . ASN A 1 203  ? 32.305  -34.141 23.718  1.00 21.01  ? 203  ASN A C   1 
ATOM 1436  O O   . ASN A 1 203  ? 33.384  -34.708 23.923  1.00 22.50  ? 203  ASN A O   1 
ATOM 1437  C CB  . ASN A 1 203  ? 32.644  -33.005 25.935  1.00 31.36  ? 203  ASN A CB  1 
ATOM 1438  C CG  . ASN A 1 203  ? 32.100  -31.993 26.923  1.00 60.46  ? 203  ASN A CG  1 
ATOM 1439  O OD1 . ASN A 1 203  ? 32.101  -30.788 26.660  1.00 74.36  ? 203  ASN A OD1 1 
ATOM 1440  N ND2 . ASN A 1 203  ? 31.613  -32.479 28.060  1.00 71.83  ? 203  ASN A ND2 1 
ATOM 1441  N N   . PRO A 1 204  ? 31.647  -34.263 22.543  1.00 21.13  ? 204  PRO A N   1 
ATOM 1442  C CA  . PRO A 1 204  ? 32.231  -35.003 21.410  1.00 25.66  ? 204  PRO A CA  1 
ATOM 1443  C C   . PRO A 1 204  ? 33.209  -34.221 20.542  1.00 20.30  ? 204  PRO A C   1 
ATOM 1444  O O   . PRO A 1 204  ? 33.648  -33.119 20.897  1.00 23.83  ? 204  PRO A O   1 
ATOM 1445  C CB  . PRO A 1 204  ? 30.998  -35.416 20.583  1.00 21.51  ? 204  PRO A CB  1 
ATOM 1446  C CG  . PRO A 1 204  ? 29.844  -35.240 21.481  1.00 22.24  ? 204  PRO A CG  1 
ATOM 1447  C CD  . PRO A 1 204  ? 30.196  -34.107 22.386  1.00 19.98  ? 204  PRO A CD  1 
ATOM 1448  N N   . GLY A 1 205  ? 33.552  -34.753 19.381  1.00 17.73  ? 205  GLY A N   1 
ATOM 1449  C CA  . GLY A 1 205  ? 34.580  -34.152 18.579  1.00 13.81  ? 205  GLY A CA  1 
ATOM 1450  C C   . GLY A 1 205  ? 35.979  -34.653 18.864  1.00 14.94  ? 205  GLY A C   1 
ATOM 1451  O O   . GLY A 1 205  ? 36.788  -34.718 17.934  1.00 14.16  ? 205  GLY A O   1 
ATOM 1452  N N   . CYS A 1 206  ? 36.261  -35.074 20.116  1.00 20.96  ? 206  CYS A N   1 
ATOM 1453  C CA  . CYS A 1 206  ? 37.599  -35.409 20.629  1.00 22.01  ? 206  CYS A CA  1 
ATOM 1454  C C   . CYS A 1 206  ? 37.778  -36.932 20.831  1.00 27.39  ? 206  CYS A C   1 
ATOM 1455  O O   . CYS A 1 206  ? 37.190  -37.521 21.744  1.00 36.52  ? 206  CYS A O   1 
ATOM 1456  C CB  . CYS A 1 206  ? 37.847  -34.672 21.947  1.00 19.79  ? 206  CYS A CB  1 
ATOM 1457  S SG  . CYS A 1 206  ? 37.242  -32.952 22.133  1.00 8.90   ? 206  CYS A SG  1 
ATOM 1458  N N   . ASN A 1 207  ? 38.639  -37.546 20.008  1.00 20.82  ? 207  ASN A N   1 
ATOM 1459  C CA  . ASN A 1 207  ? 39.056  -38.936 20.152  1.00 21.16  ? 207  ASN A CA  1 
ATOM 1460  C C   . ASN A 1 207  ? 39.927  -39.090 21.402  1.00 28.86  ? 207  ASN A C   1 
ATOM 1461  O O   . ASN A 1 207  ? 40.347  -38.106 22.015  1.00 29.44  ? 207  ASN A O   1 
ATOM 1462  C CB  . ASN A 1 207  ? 39.817  -39.430 18.912  1.00 16.93  ? 207  ASN A CB  1 
ATOM 1463  C CG  . ASN A 1 207  ? 39.982  -38.375 17.857  1.00 14.29  ? 207  ASN A CG  1 
ATOM 1464  O OD1 . ASN A 1 207  ? 41.025  -38.279 17.199  1.00 13.10  ? 207  ASN A OD1 1 
ATOM 1465  N ND2 . ASN A 1 207  ? 38.927  -37.621 17.634  1.00 13.25  ? 207  ASN A ND2 1 
ATOM 1466  N N   . GLU A 1 208  ? 40.222  -40.351 21.756  1.00 41.41  ? 208  GLU A N   1 
ATOM 1467  C CA  . GLU A 1 208  ? 40.757  -40.722 23.068  1.00 51.52  ? 208  GLU A CA  1 
ATOM 1468  C C   . GLU A 1 208  ? 42.277  -40.781 23.127  1.00 46.49  ? 208  GLU A C   1 
ATOM 1469  O O   . GLU A 1 208  ? 42.953  -41.138 22.158  1.00 49.36  ? 208  GLU A O   1 
ATOM 1470  C CB  . GLU A 1 208  ? 40.243  -42.094 23.508  1.00 38.19  ? 208  GLU A CB  1 
ATOM 1471  C CG  . GLU A 1 208  ? 38.805  -42.158 23.594  1.00 25.36  ? 208  GLU A CG  1 
ATOM 1472  C CD  . GLU A 1 208  ? 38.311  -41.389 24.775  1.00 20.41  ? 208  GLU A CD  1 
ATOM 1473  O OE1 . GLU A 1 208  ? 38.716  -41.732 25.908  1.00 17.12  ? 208  GLU A OE1 1 
ATOM 1474  O OE2 . GLU A 1 208  ? 37.518  -40.456 24.551  1.00 20.35  ? 208  GLU A OE2 1 
ATOM 1475  N N   . VAL A 1 209  ? 42.792  -40.508 24.320  1.00 48.03  ? 209  VAL A N   1 
ATOM 1476  C CA  . VAL A 1 209  ? 44.167  -40.784 24.673  1.00 36.85  ? 209  VAL A CA  1 
ATOM 1477  C C   . VAL A 1 209  ? 44.143  -41.845 25.770  1.00 43.72  ? 209  VAL A C   1 
ATOM 1478  O O   . VAL A 1 209  ? 43.241  -41.860 26.620  1.00 40.96  ? 209  VAL A O   1 
ATOM 1479  C CB  . VAL A 1 209  ? 44.899  -39.503 25.110  1.00 24.74  ? 209  VAL A CB  1 
ATOM 1480  C CG1 . VAL A 1 209  ? 46.348  -39.681 24.959  1.00 24.15  ? 209  VAL A CG1 1 
ATOM 1481  C CG2 . VAL A 1 209  ? 44.468  -38.307 24.286  1.00 25.88  ? 209  VAL A CG2 1 
ATOM 1482  N N   . ASN A 1 210  ? 45.113  -42.755 25.712  1.00 50.79  ? 210  ASN A N   1 
ATOM 1483  C CA  . ASN A 1 210  ? 45.222  -43.943 26.556  1.00 57.46  ? 210  ASN A CA  1 
ATOM 1484  C C   . ASN A 1 210  ? 46.717  -44.253 26.690  1.00 49.91  ? 210  ASN A C   1 
ATOM 1485  O O   . ASN A 1 210  ? 47.531  -43.698 25.951  1.00 57.37  ? 210  ASN A O   1 
ATOM 1486  C CB  . ASN A 1 210  ? 44.458  -45.133 25.940  1.00 52.25  ? 210  ASN A CB  1 
ATOM 1487  C CG  . ASN A 1 210  ? 42.977  -45.165 26.323  1.00 45.28  ? 210  ASN A CG  1 
ATOM 1488  O OD1 . ASN A 1 210  ? 42.102  -44.688 25.588  1.00 31.22  ? 210  ASN A OD1 1 
ATOM 1489  N ND2 . ASN A 1 210  ? 42.697  -45.750 27.475  1.00 45.98  ? 210  ASN A ND2 1 
ATOM 1490  N N   . SER A 1 211  ? 47.101  -45.163 27.621  1.00 50.72  ? 211  SER A N   1 
ATOM 1491  C CA  . SER A 1 211  ? 48.521  -45.518 27.778  1.00 35.91  ? 211  SER A CA  1 
ATOM 1492  C C   . SER A 1 211  ? 48.841  -47.025 27.726  1.00 33.09  ? 211  SER A C   1 
ATOM 1493  O O   . SER A 1 211  ? 50.021  -47.381 27.781  1.00 28.18  ? 211  SER A O   1 
ATOM 1494  C CB  . SER A 1 211  ? 49.082  -44.929 29.091  1.00 28.33  ? 211  SER A CB  1 
ATOM 1495  O OG  . SER A 1 211  ? 50.504  -44.938 29.139  1.00 26.80  ? 211  SER A OG  1 
ATOM 1496  N N   . VAL A 1 212  ? 47.838  -47.900 27.583  1.00 29.46  ? 212  VAL A N   1 
ATOM 1497  C CA  . VAL A 1 212  ? 47.962  -49.361 27.684  1.00 17.70  ? 212  VAL A CA  1 
ATOM 1498  C C   . VAL A 1 212  ? 48.762  -49.988 26.540  1.00 13.05  ? 212  VAL A C   1 
ATOM 1499  O O   . VAL A 1 212  ? 49.062  -49.342 25.537  1.00 18.88  ? 212  VAL A O   1 
ATOM 1500  C CB  . VAL A 1 212  ? 46.557  -49.988 27.767  1.00 18.41  ? 212  VAL A CB  1 
ATOM 1501  C CG1 . VAL A 1 212  ? 46.044  -50.359 26.376  1.00 18.93  ? 212  VAL A CG1 1 
ATOM 1502  C CG2 . VAL A 1 212  ? 46.585  -51.182 28.647  1.00 24.35  ? 212  VAL A CG2 1 
ATOM 1503  N N   . ASN A 1 213  ? 49.101  -51.271 26.657  1.00 8.87   ? 213  ASN A N   1 
ATOM 1504  C CA  . ASN A 1 213  ? 49.733  -51.957 25.537  1.00 8.87   ? 213  ASN A CA  1 
ATOM 1505  C C   . ASN A 1 213  ? 48.925  -51.722 24.268  1.00 12.53  ? 213  ASN A C   1 
ATOM 1506  O O   . ASN A 1 213  ? 47.694  -51.728 24.298  1.00 8.87   ? 213  ASN A O   1 
ATOM 1507  C CB  . ASN A 1 213  ? 49.845  -53.437 25.860  1.00 8.87   ? 213  ASN A CB  1 
ATOM 1508  N N   . CYS A 1 214  ? 49.629  -51.439 23.153  1.00 32.62  ? 214  CYS A N   1 
ATOM 1509  C CA  . CYS A 1 214  ? 49.097  -50.569 22.063  1.00 50.55  ? 214  CYS A CA  1 
ATOM 1510  C C   . CYS A 1 214  ? 49.740  -50.762 20.670  1.00 74.97  ? 214  CYS A C   1 
ATOM 1511  O O   . CYS A 1 214  ? 50.975  -50.705 20.533  1.00 77.85  ? 214  CYS A O   1 
ATOM 1512  C CB  . CYS A 1 214  ? 49.260  -49.079 22.432  1.00 51.10  ? 214  CYS A CB  1 
ATOM 1513  N N   . ASN A 1 215  ? 48.889  -50.868 19.646  1.00 74.39  ? 215  ASN A N   1 
ATOM 1514  C CA  . ASN A 1 215  ? 49.284  -50.723 18.235  1.00 71.77  ? 215  ASN A CA  1 
ATOM 1515  C C   . ASN A 1 215  ? 48.951  -49.305 17.713  1.00 62.39  ? 215  ASN A C   1 
ATOM 1516  O O   . ASN A 1 215  ? 48.158  -49.119 16.797  1.00 64.79  ? 215  ASN A O   1 
ATOM 1517  C CB  . ASN A 1 215  ? 48.610  -51.819 17.404  1.00 50.42  ? 215  ASN A CB  1 
ATOM 1518  C CG  . ASN A 1 215  ? 48.965  -51.765 15.973  1.00 52.07  ? 215  ASN A CG  1 
ATOM 1519  O OD1 . ASN A 1 215  ? 49.727  -50.900 15.540  1.00 74.45  ? 215  ASN A OD1 1 
ATOM 1520  N ND2 . ASN A 1 215  ? 48.428  -52.699 15.206  1.00 26.60  ? 215  ASN A ND2 1 
ATOM 1521  N N   . THR A 1 216  ? 49.556  -48.283 18.345  1.00 41.63  ? 216  THR A N   1 
ATOM 1522  C CA  . THR A 1 216  ? 49.447  -46.910 17.853  1.00 21.80  ? 216  THR A CA  1 
ATOM 1523  C C   . THR A 1 216  ? 50.812  -46.308 17.715  1.00 9.40   ? 216  THR A C   1 
ATOM 1524  O O   . THR A 1 216  ? 51.853  -46.955 17.879  1.00 11.52  ? 216  THR A O   1 
ATOM 1525  C CB  . THR A 1 216  ? 48.654  -45.952 18.762  1.00 25.42  ? 216  THR A CB  1 
ATOM 1526  O OG1 . THR A 1 216  ? 48.202  -44.817 18.000  1.00 17.45  ? 216  THR A OG1 1 
ATOM 1527  C CG2 . THR A 1 216  ? 49.536  -45.407 19.888  1.00 26.37  ? 216  THR A CG2 1 
ATOM 1528  N N   . SER A 1 217  ? 50.758  -45.026 17.453  1.00 11.70  ? 217  SER A N   1 
ATOM 1529  C CA  . SER A 1 217  ? 51.941  -44.320 17.099  1.00 15.57  ? 217  SER A CA  1 
ATOM 1530  C C   . SER A 1 217  ? 51.775  -42.882 17.584  1.00 21.11  ? 217  SER A C   1 
ATOM 1531  O O   . SER A 1 217  ? 50.637  -42.399 17.723  1.00 20.16  ? 217  SER A O   1 
ATOM 1532  C CB  . SER A 1 217  ? 52.135  -44.526 15.601  1.00 15.78  ? 217  SER A CB  1 
ATOM 1533  O OG  . SER A 1 217  ? 52.232  -45.897 15.218  1.00 10.35  ? 217  SER A OG  1 
ATOM 1534  N N   . TRP A 1 218  ? 52.932  -42.187 17.774  1.00 23.25  ? 218  TRP A N   1 
ATOM 1535  C CA  . TRP A 1 218  ? 53.038  -40.798 18.280  1.00 20.30  ? 218  TRP A CA  1 
ATOM 1536  C C   . TRP A 1 218  ? 54.127  -39.987 17.554  1.00 16.55  ? 218  TRP A C   1 
ATOM 1537  O O   . TRP A 1 218  ? 55.308  -40.176 17.854  1.00 16.14  ? 218  TRP A O   1 
ATOM 1538  C CB  . TRP A 1 218  ? 53.361  -40.788 19.775  1.00 21.54  ? 218  TRP A CB  1 
ATOM 1539  C CG  . TRP A 1 218  ? 52.188  -40.852 20.619  1.00 15.32  ? 218  TRP A CG  1 
ATOM 1540  C CD1 . TRP A 1 218  ? 52.123  -41.312 21.912  1.00 11.34  ? 218  TRP A CD1 1 
ATOM 1541  C CD2 . TRP A 1 218  ? 50.857  -40.463 20.249  1.00 19.50  ? 218  TRP A CD2 1 
ATOM 1542  N NE1 . TRP A 1 218  ? 50.826  -41.237 22.356  1.00 12.85  ? 218  TRP A NE1 1 
ATOM 1543  C CE2 . TRP A 1 218  ? 50.033  -40.717 21.358  1.00 25.14  ? 218  TRP A CE2 1 
ATOM 1544  C CE3 . TRP A 1 218  ? 50.275  -39.930 19.082  1.00 17.41  ? 218  TRP A CE3 1 
ATOM 1545  C CZ2 . TRP A 1 218  ? 48.651  -40.446 21.334  1.00 34.66  ? 218  TRP A CZ2 1 
ATOM 1546  C CZ3 . TRP A 1 218  ? 48.922  -39.651 19.078  1.00 16.79  ? 218  TRP A CZ3 1 
ATOM 1547  C CH2 . TRP A 1 218  ? 48.122  -39.915 20.179  1.00 22.49  ? 218  TRP A CH2 1 
ATOM 1548  N N   . LYS A 1 219  ? 53.742  -39.029 16.679  1.00 13.20  ? 219  LYS A N   1 
ATOM 1549  C CA  . LYS A 1 219  ? 54.717  -38.246 15.912  1.00 12.88  ? 219  LYS A CA  1 
ATOM 1550  C C   . LYS A 1 219  ? 55.045  -36.889 16.493  1.00 13.32  ? 219  LYS A C   1 
ATOM 1551  O O   . LYS A 1 219  ? 54.162  -36.032 16.695  1.00 12.74  ? 219  LYS A O   1 
ATOM 1552  C CB  . LYS A 1 219  ? 54.359  -38.030 14.436  1.00 11.35  ? 219  LYS A CB  1 
ATOM 1553  C CG  . LYS A 1 219  ? 53.635  -36.829 13.961  1.00 8.75   ? 219  LYS A CG  1 
ATOM 1554  C CD  . LYS A 1 219  ? 52.549  -36.538 14.792  1.00 14.34  ? 219  LYS A CD  1 
ATOM 1555  C CE  . LYS A 1 219  ? 52.585  -35.107 14.677  1.00 8.75   ? 219  LYS A CE  1 
ATOM 1556  N NZ  . LYS A 1 219  ? 53.227  -34.602 15.854  1.00 9.32   ? 219  LYS A NZ  1 
ATOM 1557  N N   . ILE A 1 220  ? 56.356  -36.706 16.649  1.00 16.01  ? 220  ILE A N   1 
ATOM 1558  C CA  . ILE A 1 220  ? 57.002  -35.546 17.241  1.00 15.61  ? 220  ILE A CA  1 
ATOM 1559  C C   . ILE A 1 220  ? 56.943  -34.395 16.250  1.00 8.95   ? 220  ILE A C   1 
ATOM 1560  O O   . ILE A 1 220  ? 57.540  -34.415 15.168  1.00 8.79   ? 220  ILE A O   1 
ATOM 1561  C CB  . ILE A 1 220  ? 58.447  -35.875 17.649  1.00 13.98  ? 220  ILE A CB  1 
ATOM 1562  C CG1 . ILE A 1 220  ? 58.529  -37.024 18.663  1.00 13.46  ? 220  ILE A CG1 1 
ATOM 1563  C CG2 . ILE A 1 220  ? 59.077  -34.706 18.335  1.00 12.73  ? 220  ILE A CG2 1 
ATOM 1564  C CD1 . ILE A 1 220  ? 57.726  -38.278 18.344  1.00 16.58  ? 220  ILE A CD1 1 
ATOM 1565  N N   . VAL A 1 221  ? 56.188  -33.406 16.612  1.00 9.80   ? 221  VAL A N   1 
ATOM 1566  C CA  . VAL A 1 221  ? 56.074  -32.172 15.885  1.00 8.82   ? 221  VAL A CA  1 
ATOM 1567  C C   . VAL A 1 221  ? 56.895  -31.168 16.656  1.00 13.59  ? 221  VAL A C   1 
ATOM 1568  O O   . VAL A 1 221  ? 56.674  -31.025 17.860  1.00 14.99  ? 221  VAL A O   1 
ATOM 1569  C CB  . VAL A 1 221  ? 54.609  -31.728 15.848  1.00 12.99  ? 221  VAL A CB  1 
ATOM 1570  C CG1 . VAL A 1 221  ? 54.556  -30.237 15.869  1.00 18.14  ? 221  VAL A CG1 1 
ATOM 1571  C CG2 . VAL A 1 221  ? 53.897  -32.320 14.664  1.00 12.42  ? 221  VAL A CG2 1 
ATOM 1572  N N   . LEU A 1 222  ? 57.788  -30.457 15.969  1.00 12.42  ? 222  LEU A N   1 
ATOM 1573  C CA  . LEU A 1 222  ? 58.721  -29.486 16.532  1.00 12.39  ? 222  LEU A CA  1 
ATOM 1574  C C   . LEU A 1 222  ? 58.052  -28.167 16.965  1.00 16.71  ? 222  LEU A C   1 
ATOM 1575  O O   . LEU A 1 222  ? 57.005  -27.774 16.450  1.00 15.79  ? 222  LEU A O   1 
ATOM 1576  C CB  . LEU A 1 222  ? 59.805  -29.129 15.526  1.00 14.76  ? 222  LEU A CB  1 
ATOM 1577  C CG  . LEU A 1 222  ? 59.347  -28.226 14.376  1.00 14.28  ? 222  LEU A CG  1 
ATOM 1578  C CD1 . LEU A 1 222  ? 58.009  -28.696 13.832  1.00 12.46  ? 222  LEU A CD1 1 
ATOM 1579  C CD2 . LEU A 1 222  ? 59.309  -26.749 14.782  1.00 14.06  ? 222  LEU A CD2 1 
ATOM 1580  N N   . PHE A 1 223  ? 58.724  -27.448 17.883  1.00 17.87  ? 223  PHE A N   1 
ATOM 1581  C CA  . PHE A 1 223  ? 58.140  -26.269 18.511  1.00 20.87  ? 223  PHE A CA  1 
ATOM 1582  C C   . PHE A 1 223  ? 58.949  -25.778 19.707  1.00 18.19  ? 223  PHE A C   1 
ATOM 1583  O O   . PHE A 1 223  ? 59.717  -26.548 20.286  1.00 13.90  ? 223  PHE A O   1 
ATOM 1584  C CB  . PHE A 1 223  ? 56.737  -26.569 19.028  1.00 33.65  ? 223  PHE A CB  1 
ATOM 1585  C CG  . PHE A 1 223  ? 55.668  -25.659 18.574  1.00 36.06  ? 223  PHE A CG  1 
ATOM 1586  C CD1 . PHE A 1 223  ? 55.618  -24.337 18.989  1.00 40.02  ? 223  PHE A CD1 1 
ATOM 1587  C CD2 . PHE A 1 223  ? 54.643  -26.165 17.811  1.00 32.27  ? 223  PHE A CD2 1 
ATOM 1588  C CE1 . PHE A 1 223  ? 54.576  -23.527 18.605  1.00 40.84  ? 223  PHE A CE1 1 
ATOM 1589  C CE2 . PHE A 1 223  ? 53.606  -25.379 17.431  1.00 34.07  ? 223  PHE A CE2 1 
ATOM 1590  C CZ  . PHE A 1 223  ? 53.563  -24.053 17.818  1.00 42.80  ? 223  PHE A CZ  1 
ATOM 1591  N N   . MET A 1 224  ? 58.703  -24.517 20.126  1.00 20.79  ? 224  MET A N   1 
ATOM 1592  C CA  . MET A 1 224  ? 59.080  -23.968 21.423  1.00 18.02  ? 224  MET A CA  1 
ATOM 1593  C C   . MET A 1 224  ? 60.470  -24.452 21.790  1.00 19.08  ? 224  MET A C   1 
ATOM 1594  O O   . MET A 1 224  ? 60.576  -25.495 22.430  1.00 18.25  ? 224  MET A O   1 
ATOM 1595  C CB  . MET A 1 224  ? 58.054  -24.373 22.504  1.00 22.80  ? 224  MET A CB  1 
ATOM 1596  C CG  . MET A 1 224  ? 57.371  -23.275 23.316  1.00 24.34  ? 224  MET A CG  1 
ATOM 1597  S SD  . MET A 1 224  ? 56.827  -21.712 22.597  1.00 8.75   ? 224  MET A SD  1 
ATOM 1598  C CE  . MET A 1 224  ? 56.690  -20.913 24.192  1.00 8.85   ? 224  MET A CE  1 
ATOM 1599  N N   . LYS A 1 225  ? 61.524  -23.716 21.441  1.00 21.40  ? 225  LYS A N   1 
ATOM 1600  C CA  . LYS A 1 225  ? 62.904  -24.245 21.404  1.00 25.12  ? 225  LYS A CA  1 
ATOM 1601  C C   . LYS A 1 225  ? 63.724  -23.865 22.632  1.00 24.17  ? 225  LYS A C   1 
ATOM 1602  O O   . LYS A 1 225  ? 63.196  -23.466 23.672  1.00 22.03  ? 225  LYS A O   1 
ATOM 1603  C CB  . LYS A 1 225  ? 63.584  -23.763 20.124  1.00 28.67  ? 225  LYS A CB  1 
ATOM 1604  C CG  . LYS A 1 225  ? 62.678  -23.649 18.879  1.00 25.27  ? 225  LYS A CG  1 
ATOM 1605  C CD  . LYS A 1 225  ? 61.954  -22.310 18.862  1.00 29.57  ? 225  LYS A CD  1 
ATOM 1606  C CE  . LYS A 1 225  ? 62.140  -21.548 17.562  1.00 20.24  ? 225  LYS A CE  1 
ATOM 1607  N NZ  . LYS A 1 225  ? 61.467  -20.208 17.558  1.00 11.59  ? 225  LYS A NZ  1 
ATOM 1608  N N   . TRP A 1 226  ? 65.044  -24.064 22.573  1.00 26.06  ? 226  TRP A N   1 
ATOM 1609  C CA  . TRP A 1 226  ? 65.888  -23.683 23.730  1.00 21.92  ? 226  TRP A CA  1 
ATOM 1610  C C   . TRP A 1 226  ? 66.113  -22.196 23.703  1.00 20.68  ? 226  TRP A C   1 
ATOM 1611  O O   . TRP A 1 226  ? 66.038  -21.526 24.728  1.00 21.11  ? 226  TRP A O   1 
ATOM 1612  C CB  . TRP A 1 226  ? 67.204  -24.459 23.768  1.00 19.60  ? 226  TRP A CB  1 
ATOM 1613  C CG  . TRP A 1 226  ? 67.980  -24.383 22.509  1.00 17.59  ? 226  TRP A CG  1 
ATOM 1614  C CD1 . TRP A 1 226  ? 67.547  -24.783 21.288  1.00 21.43  ? 226  TRP A CD1 1 
ATOM 1615  C CD2 . TRP A 1 226  ? 69.310  -23.878 22.318  1.00 11.99  ? 226  TRP A CD2 1 
ATOM 1616  N NE1 . TRP A 1 226  ? 68.505  -24.566 20.345  1.00 18.75  ? 226  TRP A NE1 1 
ATOM 1617  C CE2 . TRP A 1 226  ? 69.601  -24.012 20.946  1.00 15.51  ? 226  TRP A CE2 1 
ATOM 1618  C CE3 . TRP A 1 226  ? 70.279  -23.332 23.161  1.00 8.65   ? 226  TRP A CE3 1 
ATOM 1619  C CZ2 . TRP A 1 226  ? 70.813  -23.624 20.393  1.00 13.54  ? 226  TRP A CZ2 1 
ATOM 1620  C CZ3 . TRP A 1 226  ? 71.488  -22.943 22.606  1.00 8.65   ? 226  TRP A CZ3 1 
ATOM 1621  C CH2 . TRP A 1 226  ? 71.742  -23.092 21.233  1.00 9.79   ? 226  TRP A CH2 1 
ATOM 1622  N N   . SER A 1 227  ? 66.363  -21.653 22.511  1.00 22.21  ? 227  SER A N   1 
ATOM 1623  C CA  . SER A 1 227  ? 65.783  -20.350 22.252  1.00 25.89  ? 227  SER A CA  1 
ATOM 1624  C C   . SER A 1 227  ? 64.342  -20.406 22.780  1.00 26.62  ? 227  SER A C   1 
ATOM 1625  O O   . SER A 1 227  ? 64.097  -20.100 23.949  1.00 24.00  ? 227  SER A O   1 
ATOM 1626  C CB  . SER A 1 227  ? 65.899  -20.016 20.760  1.00 29.02  ? 227  SER A CB  1 
ATOM 1627  O OG  . SER A 1 227  ? 67.243  -20.257 20.379  1.00 28.59  ? 227  SER A OG  1 
ATOM 1628  N N   . ASP A 1 228  ? 63.368  -20.796 21.979  1.00 32.50  ? 228  ASP A N   1 
ATOM 1629  C CA  . ASP A 1 228  ? 61.995  -20.659 22.481  1.00 32.97  ? 228  ASP A CA  1 
ATOM 1630  C C   . ASP A 1 228  ? 61.648  -19.185 22.662  1.00 32.46  ? 228  ASP A C   1 
ATOM 1631  O O   . ASP A 1 228  ? 62.116  -18.322 21.906  1.00 38.33  ? 228  ASP A O   1 
ATOM 1632  C CB  . ASP A 1 228  ? 61.783  -21.330 23.850  1.00 30.23  ? 228  ASP A CB  1 
ATOM 1633  C CG  . ASP A 1 228  ? 60.643  -22.269 23.871  1.00 25.21  ? 228  ASP A CG  1 
ATOM 1634  O OD1 . ASP A 1 228  ? 59.539  -21.909 23.422  1.00 22.80  ? 228  ASP A OD1 1 
ATOM 1635  O OD2 . ASP A 1 228  ? 60.893  -23.381 24.349  1.00 24.51  ? 228  ASP A OD2 1 
ATOM 1636  N N   . ASN A 1 229  ? 60.940  -18.881 23.760  1.00 34.91  ? 229  ASN A N   1 
ATOM 1637  C CA  . ASN A 1 229  ? 60.472  -17.519 23.996  1.00 33.69  ? 229  ASN A CA  1 
ATOM 1638  C C   . ASN A 1 229  ? 61.628  -16.543 24.041  1.00 23.15  ? 229  ASN A C   1 
ATOM 1639  O O   . ASN A 1 229  ? 61.563  -15.470 23.437  1.00 22.86  ? 229  ASN A O   1 
ATOM 1640  C CB  . ASN A 1 229  ? 59.678  -17.437 25.292  1.00 22.22  ? 229  ASN A CB  1 
ATOM 1641  C CG  . ASN A 1 229  ? 58.977  -18.725 25.601  1.00 22.53  ? 229  ASN A CG  1 
ATOM 1642  O OD1 . ASN A 1 229  ? 59.103  -19.702 24.864  1.00 27.59  ? 229  ASN A OD1 1 
ATOM 1643  N ND2 . ASN A 1 229  ? 58.245  -18.749 26.704  1.00 11.95  ? 229  ASN A ND2 1 
ATOM 1644  N N   . LYS A 1 230  ? 62.686  -16.881 24.765  1.00 20.48  ? 230  LYS A N   1 
ATOM 1645  C CA  . LYS A 1 230  ? 63.883  -16.061 24.759  1.00 25.91  ? 230  LYS A CA  1 
ATOM 1646  C C   . LYS A 1 230  ? 63.623  -14.649 25.239  1.00 24.89  ? 230  LYS A C   1 
ATOM 1647  O O   . LYS A 1 230  ? 64.374  -13.740 24.898  1.00 38.77  ? 230  LYS A O   1 
ATOM 1648  C CB  . LYS A 1 230  ? 64.504  -16.017 23.359  1.00 36.10  ? 230  LYS A CB  1 
ATOM 1649  C CG  . LYS A 1 230  ? 65.038  -17.356 22.901  1.00 36.15  ? 230  LYS A CG  1 
ATOM 1650  C CD  . LYS A 1 230  ? 66.110  -17.822 23.824  1.00 40.67  ? 230  LYS A CD  1 
ATOM 1651  C CE  . LYS A 1 230  ? 65.483  -18.399 25.147  1.00 27.58  ? 230  LYS A CE  1 
ATOM 1652  N NZ  . LYS A 1 230  ? 65.955  -17.955 26.440  1.00 27.48  ? 230  LYS A NZ  1 
ATOM 1653  N N   . ASP A 1 231  ? 62.541  -14.430 25.972  1.00 19.39  ? 231  ASP A N   1 
ATOM 1654  C CA  . ASP A 1 231  ? 62.268  -13.135 26.590  1.00 18.20  ? 231  ASP A CA  1 
ATOM 1655  C C   . ASP A 1 231  ? 62.703  -11.875 25.818  1.00 22.35  ? 231  ASP A C   1 
ATOM 1656  O O   . ASP A 1 231  ? 62.123  -10.811 26.036  1.00 34.21  ? 231  ASP A O   1 
ATOM 1657  C CB  . ASP A 1 231  ? 62.896  -13.106 27.987  1.00 9.00   ? 231  ASP A CB  1 
ATOM 1658  N N   . ASP A 1 232  ? 63.702  -11.939 24.922  1.00 24.53  ? 232  ASP A N   1 
ATOM 1659  C CA  . ASP A 1 232  ? 64.213  -10.718 24.283  1.00 22.08  ? 232  ASP A CA  1 
ATOM 1660  C C   . ASP A 1 232  ? 63.301  -10.211 23.171  1.00 19.18  ? 232  ASP A C   1 
ATOM 1661  O O   . ASP A 1 232  ? 63.245  -8.999  22.932  1.00 17.92  ? 232  ASP A O   1 
ATOM 1662  C CB  . ASP A 1 232  ? 65.617  -10.957 23.709  1.00 23.00  ? 232  ASP A CB  1 
ATOM 1663  C CG  . ASP A 1 232  ? 66.562  -9.766  23.898  1.00 15.38  ? 232  ASP A CG  1 
ATOM 1664  O OD1 . ASP A 1 232  ? 66.362  -8.967  24.837  1.00 8.84   ? 232  ASP A OD1 1 
ATOM 1665  O OD2 . ASP A 1 232  ? 67.534  -9.659  23.115  1.00 15.76  ? 232  ASP A OD2 1 
ATOM 1666  N N   . ILE A 1 233  ? 62.597  -11.113 22.475  1.00 18.94  ? 233  ILE A N   1 
ATOM 1667  C CA  . ILE A 1 233  ? 61.814  -10.785 21.285  1.00 18.13  ? 233  ILE A CA  1 
ATOM 1668  C C   . ILE A 1 233  ? 60.353  -11.180 21.485  1.00 17.39  ? 233  ILE A C   1 
ATOM 1669  O O   . ILE A 1 233  ? 60.050  -12.157 22.175  1.00 18.70  ? 233  ILE A O   1 
ATOM 1670  C CB  . ILE A 1 233  ? 62.410  -11.484 20.050  1.00 17.00  ? 233  ILE A CB  1 
ATOM 1671  C CG1 . ILE A 1 233  ? 63.088  -12.791 20.440  1.00 13.43  ? 233  ILE A CG1 1 
ATOM 1672  C CG2 . ILE A 1 233  ? 63.475  -10.643 19.455  1.00 19.43  ? 233  ILE A CG2 1 
ATOM 1673  C CD1 . ILE A 1 233  ? 64.287  -13.076 19.576  1.00 8.86   ? 233  ILE A CD1 1 
ATOM 1674  N N   . LEU A 1 234  ? 59.445  -10.417 20.865  1.00 13.41  ? 234  LEU A N   1 
ATOM 1675  C CA  . LEU A 1 234  ? 58.019  -10.670 21.055  1.00 14.77  ? 234  LEU A CA  1 
ATOM 1676  C C   . LEU A 1 234  ? 57.705  -12.115 20.727  1.00 16.15  ? 234  LEU A C   1 
ATOM 1677  O O   . LEU A 1 234  ? 57.970  -12.583 19.621  1.00 22.17  ? 234  LEU A O   1 
ATOM 1678  C CB  . LEU A 1 234  ? 57.167  -9.736  20.194  1.00 17.55  ? 234  LEU A CB  1 
ATOM 1679  C CG  . LEU A 1 234  ? 55.823  -9.305  20.805  1.00 18.70  ? 234  LEU A CG  1 
ATOM 1680  C CD1 . LEU A 1 234  ? 56.037  -8.774  22.205  1.00 17.08  ? 234  LEU A CD1 1 
ATOM 1681  C CD2 . LEU A 1 234  ? 55.151  -8.247  19.966  1.00 20.07  ? 234  LEU A CD2 1 
ATOM 1682  N N   . LYS A 1 235  ? 57.165  -12.822 21.705  1.00 16.80  ? 235  LYS A N   1 
ATOM 1683  C CA  . LYS A 1 235  ? 56.824  -14.226 21.543  1.00 20.15  ? 235  LYS A CA  1 
ATOM 1684  C C   . LYS A 1 235  ? 55.966  -14.446 20.300  1.00 24.00  ? 235  LYS A C   1 
ATOM 1685  O O   . LYS A 1 235  ? 55.039  -13.680 20.029  1.00 28.61  ? 235  LYS A O   1 
ATOM 1686  C CB  . LYS A 1 235  ? 56.100  -14.650 22.800  1.00 21.53  ? 235  LYS A CB  1 
ATOM 1687  C CG  . LYS A 1 235  ? 55.608  -13.419 23.454  1.00 21.57  ? 235  LYS A CG  1 
ATOM 1688  C CD  . LYS A 1 235  ? 55.662  -13.497 24.971  1.00 23.05  ? 235  LYS A CD  1 
ATOM 1689  C CE  . LYS A 1 235  ? 56.259  -12.291 25.423  1.00 19.74  ? 235  LYS A CE  1 
ATOM 1690  N NZ  . LYS A 1 235  ? 57.372  -12.182 24.458  1.00 17.54  ? 235  LYS A NZ  1 
ATOM 1691  N N   . GLY A 1 236  ? 56.292  -15.484 19.520  1.00 25.25  ? 236  GLY A N   1 
ATOM 1692  C CA  . GLY A 1 236  ? 55.608  -15.683 18.249  1.00 23.38  ? 236  GLY A CA  1 
ATOM 1693  C C   . GLY A 1 236  ? 54.115  -15.893 18.399  1.00 32.19  ? 236  GLY A C   1 
ATOM 1694  O O   . GLY A 1 236  ? 53.335  -15.541 17.503  1.00 28.52  ? 236  GLY A O   1 
ATOM 1695  N N   . GLY A 1 237  ? 53.700  -16.451 19.533  1.00 44.08  ? 237  GLY A N   1 
ATOM 1696  C CA  . GLY A 1 237  ? 52.300  -16.731 19.760  1.00 48.36  ? 237  GLY A CA  1 
ATOM 1697  C C   . GLY A 1 237  ? 51.671  -16.135 21.004  1.00 51.31  ? 237  GLY A C   1 
ATOM 1698  O O   . GLY A 1 237  ? 50.512  -16.434 21.293  1.00 57.99  ? 237  GLY A O   1 
ATOM 1699  N N   . ASP A 1 238  ? 52.383  -15.317 21.768  1.00 40.22  ? 238  ASP A N   1 
ATOM 1700  C CA  . ASP A 1 238  ? 51.748  -14.797 22.970  1.00 39.42  ? 238  ASP A CA  1 
ATOM 1701  C C   . ASP A 1 238  ? 50.816  -13.639 22.641  1.00 30.42  ? 238  ASP A C   1 
ATOM 1702  O O   . ASP A 1 238  ? 50.788  -13.112 21.528  1.00 30.15  ? 238  ASP A O   1 
ATOM 1703  C CB  . ASP A 1 238  ? 52.775  -14.335 23.989  1.00 38.69  ? 238  ASP A CB  1 
ATOM 1704  C CG  . ASP A 1 238  ? 53.618  -15.489 24.565  1.00 51.63  ? 238  ASP A CG  1 
ATOM 1705  O OD1 . ASP A 1 238  ? 54.056  -16.380 23.783  1.00 52.27  ? 238  ASP A OD1 1 
ATOM 1706  O OD2 . ASP A 1 238  ? 53.915  -15.459 25.798  1.00 56.30  ? 238  ASP A OD2 1 
ATOM 1707  N N   . VAL A 1 239  ? 50.017  -13.267 23.627  1.00 30.71  ? 239  VAL A N   1 
ATOM 1708  C CA  . VAL A 1 239  ? 48.913  -12.344 23.430  1.00 28.47  ? 239  VAL A CA  1 
ATOM 1709  C C   . VAL A 1 239  ? 49.305  -10.982 23.986  1.00 25.61  ? 239  VAL A C   1 
ATOM 1710  O O   . VAL A 1 239  ? 49.977  -10.895 25.020  1.00 26.92  ? 239  VAL A O   1 
ATOM 1711  C CB  . VAL A 1 239  ? 47.628  -12.899 24.074  1.00 36.99  ? 239  VAL A CB  1 
ATOM 1712  C CG1 . VAL A 1 239  ? 47.833  -13.189 25.554  1.00 28.90  ? 239  VAL A CG1 1 
ATOM 1713  C CG2 . VAL A 1 239  ? 46.475  -11.956 23.858  1.00 39.16  ? 239  VAL A CG2 1 
ATOM 1714  N N   . VAL A 1 240  ? 48.845  -9.922  23.320  1.00 24.41  ? 240  VAL A N   1 
ATOM 1715  C CA  . VAL A 1 240  ? 49.528  -8.634  23.347  1.00 21.67  ? 240  VAL A CA  1 
ATOM 1716  C C   . VAL A 1 240  ? 48.583  -7.476  22.967  1.00 19.34  ? 240  VAL A C   1 
ATOM 1717  O O   . VAL A 1 240  ? 48.184  -7.348  21.805  1.00 17.16  ? 240  VAL A O   1 
ATOM 1718  C CB  . VAL A 1 240  ? 50.764  -8.727  22.416  1.00 22.45  ? 240  VAL A CB  1 
ATOM 1719  N N   . ARG A 1 241  ? 48.161  -6.677  23.967  1.00 19.14  ? 241  ARG A N   1 
ATOM 1720  C CA  . ARG A 1 241  ? 47.584  -5.333  23.779  1.00 19.12  ? 241  ARG A CA  1 
ATOM 1721  C C   . ARG A 1 241  ? 48.456  -4.429  22.907  1.00 26.34  ? 241  ARG A C   1 
ATOM 1722  O O   . ARG A 1 241  ? 49.677  -4.508  22.976  1.00 37.89  ? 241  ARG A O   1 
ATOM 1723  C CB  . ARG A 1 241  ? 47.483  -4.672  25.132  1.00 17.52  ? 241  ARG A CB  1 
ATOM 1724  C CG  . ARG A 1 241  ? 46.740  -5.444  26.109  1.00 18.59  ? 241  ARG A CG  1 
ATOM 1725  C CD  . ARG A 1 241  ? 46.134  -4.420  26.953  1.00 20.28  ? 241  ARG A CD  1 
ATOM 1726  N NE  . ARG A 1 241  ? 46.174  -4.697  28.371  1.00 27.81  ? 241  ARG A NE  1 
ATOM 1727  C CZ  . ARG A 1 241  ? 45.155  -5.237  29.014  1.00 34.51  ? 241  ARG A CZ  1 
ATOM 1728  N NH1 . ARG A 1 241  ? 44.037  -5.364  28.325  1.00 47.08  ? 241  ARG A NH1 1 
ATOM 1729  N NH2 . ARG A 1 241  ? 45.129  -5.374  30.342  1.00 36.35  ? 241  ARG A NH2 1 
ATOM 1730  N N   . LEU A 1 242  ? 47.848  -3.450  22.210  1.00 28.91  ? 242  LEU A N   1 
ATOM 1731  C CA  . LEU A 1 242  ? 48.561  -2.653  21.192  1.00 40.20  ? 242  LEU A CA  1 
ATOM 1732  C C   . LEU A 1 242  ? 48.246  -1.145  21.228  1.00 33.61  ? 242  LEU A C   1 
ATOM 1733  O O   . LEU A 1 242  ? 47.123  -0.754  20.887  1.00 31.08  ? 242  LEU A O   1 
ATOM 1734  C CB  . LEU A 1 242  ? 48.239  -3.206  19.808  1.00 31.79  ? 242  LEU A CB  1 
ATOM 1735  C CG  . LEU A 1 242  ? 46.840  -3.367  19.187  1.00 21.32  ? 242  LEU A CG  1 
ATOM 1736  C CD1 . LEU A 1 242  ? 47.000  -4.083  17.891  1.00 15.55  ? 242  LEU A CD1 1 
ATOM 1737  C CD2 . LEU A 1 242  ? 45.932  -4.244  20.033  1.00 16.33  ? 242  LEU A CD2 1 
ATOM 1738  N N   . PHE A 1 243  ? 49.235  -0.278  21.483  1.00 31.58  ? 243  PHE A N   1 
ATOM 1739  C CA  . PHE A 1 243  ? 48.893  1.118   21.700  1.00 23.94  ? 243  PHE A CA  1 
ATOM 1740  C C   . PHE A 1 243  ? 49.984  2.061   21.177  1.00 22.67  ? 243  PHE A C   1 
ATOM 1741  O O   . PHE A 1 243  ? 50.952  1.590   20.570  1.00 22.81  ? 243  PHE A O   1 
ATOM 1742  C CB  . PHE A 1 243  ? 48.818  1.492   23.135  1.00 22.94  ? 243  PHE A CB  1 
ATOM 1743  C CG  . PHE A 1 243  ? 50.171  1.925   23.689  1.00 27.26  ? 243  PHE A CG  1 
ATOM 1744  C CD1 . PHE A 1 243  ? 51.314  1.087   23.647  1.00 34.91  ? 243  PHE A CD1 1 
ATOM 1745  C CD2 . PHE A 1 243  ? 50.315  3.174   24.259  1.00 41.94  ? 243  PHE A CD2 1 
ATOM 1746  C CE1 . PHE A 1 243  ? 52.552  1.530   24.211  1.00 50.95  ? 243  PHE A CE1 1 
ATOM 1747  C CE2 . PHE A 1 243  ? 51.540  3.617   24.819  1.00 48.30  ? 243  PHE A CE2 1 
ATOM 1748  C CZ  . PHE A 1 243  ? 52.652  2.794   24.797  1.00 50.64  ? 243  PHE A CZ  1 
ATOM 1749  N N   . HIS A 1 244  ? 49.868  3.401   21.402  1.00 23.50  ? 244  HIS A N   1 
ATOM 1750  C CA  . HIS A 1 244  ? 50.857  4.294   20.835  1.00 25.69  ? 244  HIS A CA  1 
ATOM 1751  C C   . HIS A 1 244  ? 51.692  5.068   21.860  1.00 30.58  ? 244  HIS A C   1 
ATOM 1752  O O   . HIS A 1 244  ? 51.148  5.620   22.810  1.00 44.65  ? 244  HIS A O   1 
ATOM 1753  C CB  . HIS A 1 244  ? 50.209  5.351   19.983  1.00 22.31  ? 244  HIS A CB  1 
ATOM 1754  C CG  . HIS A 1 244  ? 50.662  5.481   18.565  1.00 23.91  ? 244  HIS A CG  1 
ATOM 1755  N ND1 . HIS A 1 244  ? 50.365  6.648   17.903  1.00 23.49  ? 244  HIS A ND1 1 
ATOM 1756  C CD2 . HIS A 1 244  ? 51.131  4.639   17.595  1.00 24.16  ? 244  HIS A CD2 1 
ATOM 1757  C CE1 . HIS A 1 244  ? 50.583  6.511   16.582  1.00 23.75  ? 244  HIS A CE1 1 
ATOM 1758  N NE2 . HIS A 1 244  ? 51.015  5.271   16.359  1.00 27.49  ? 244  HIS A NE2 1 
ATOM 1759  N N   . ALA A 1 245  ? 53.022  5.268   21.669  1.00 24.13  ? 245  ALA A N   1 
ATOM 1760  C CA  . ALA A 1 245  ? 53.623  6.362   22.428  1.00 18.05  ? 245  ALA A CA  1 
ATOM 1761  C C   . ALA A 1 245  ? 52.915  7.685   22.088  1.00 15.10  ? 245  ALA A C   1 
ATOM 1762  O O   . ALA A 1 245  ? 52.564  8.486   22.970  1.00 13.38  ? 245  ALA A O   1 
ATOM 1763  C CB  . ALA A 1 245  ? 55.144  6.507   22.163  1.00 17.06  ? 245  ALA A CB  1 
ATOM 1764  N N   . GLU A 1 246  ? 52.671  7.881   20.799  1.00 13.77  ? 246  GLU A N   1 
ATOM 1765  C CA  . GLU A 1 246  ? 52.132  9.103   20.242  1.00 9.83   ? 246  GLU A CA  1 
ATOM 1766  C C   . GLU A 1 246  ? 50.657  9.257   20.589  1.00 12.12  ? 246  GLU A C   1 
ATOM 1767  O O   . GLU A 1 246  ? 50.295  10.092  21.421  1.00 8.61   ? 246  GLU A O   1 
ATOM 1768  C CB  . GLU A 1 246  ? 52.306  9.072   18.730  1.00 11.41  ? 246  GLU A CB  1 
ATOM 1769  N N   . GLN A 1 247  ? 49.782  8.416   20.008  1.00 13.04  ? 247  GLN A N   1 
ATOM 1770  C CA  . GLN A 1 247  ? 48.355  8.439   20.417  1.00 18.03  ? 247  GLN A CA  1 
ATOM 1771  C C   . GLN A 1 247  ? 47.800  7.094   20.911  1.00 24.30  ? 247  GLN A C   1 
ATOM 1772  O O   . GLN A 1 247  ? 46.809  6.609   20.370  1.00 21.79  ? 247  GLN A O   1 
ATOM 1773  C CB  . GLN A 1 247  ? 47.452  8.923   19.274  1.00 15.68  ? 247  GLN A CB  1 
ATOM 1774  C CG  . GLN A 1 247  ? 46.338  9.853   19.696  1.00 18.30  ? 247  GLN A CG  1 
ATOM 1775  C CD  . GLN A 1 247  ? 44.944  9.252   19.544  1.00 19.86  ? 247  GLN A CD  1 
ATOM 1776  O OE1 . GLN A 1 247  ? 44.759  8.036   19.636  1.00 18.54  ? 247  GLN A OE1 1 
ATOM 1777  N NE2 . GLN A 1 247  ? 43.956  10.112  19.303  1.00 15.79  ? 247  GLN A NE2 1 
ATOM 1778  N N   . GLU A 1 248  ? 48.371  6.498   21.973  1.00 31.01  ? 248  GLU A N   1 
ATOM 1779  C CA  . GLU A 1 248  ? 47.883  5.207   22.512  1.00 27.90  ? 248  GLU A CA  1 
ATOM 1780  C C   . GLU A 1 248  ? 47.244  4.231   21.519  1.00 20.79  ? 248  GLU A C   1 
ATOM 1781  O O   . GLU A 1 248  ? 47.310  3.023   21.696  1.00 19.48  ? 248  GLU A O   1 
ATOM 1782  C CB  . GLU A 1 248  ? 46.871  5.438   23.645  1.00 19.21  ? 248  GLU A CB  1 
ATOM 1783  C CG  . GLU A 1 248  ? 47.046  6.741   24.364  1.00 21.09  ? 248  GLU A CG  1 
ATOM 1784  C CD  . GLU A 1 248  ? 46.145  7.937   23.872  1.00 28.68  ? 248  GLU A CD  1 
ATOM 1785  O OE1 . GLU A 1 248  ? 45.787  8.034   22.659  1.00 35.13  ? 248  GLU A OE1 1 
ATOM 1786  O OE2 . GLU A 1 248  ? 45.802  8.774   24.763  1.00 28.43  ? 248  GLU A OE2 1 
ATOM 1787  N N   . LYS A 1 249  ? 46.742  4.771   20.418  1.00 19.69  ? 249  LYS A N   1 
ATOM 1788  C CA  . LYS A 1 249  ? 45.606  4.193   19.741  1.00 21.05  ? 249  LYS A CA  1 
ATOM 1789  C C   . LYS A 1 249  ? 45.523  2.673   19.998  1.00 31.06  ? 249  LYS A C   1 
ATOM 1790  O O   . LYS A 1 249  ? 45.972  1.828   19.216  1.00 38.64  ? 249  LYS A O   1 
ATOM 1791  C CB  . LYS A 1 249  ? 45.590  4.635   18.250  1.00 19.97  ? 249  LYS A CB  1 
ATOM 1792  C CG  . LYS A 1 249  ? 46.316  5.930   17.884  1.00 19.97  ? 249  LYS A CG  1 
ATOM 1793  C CD  . LYS A 1 249  ? 45.466  6.842   17.107  1.00 25.61  ? 249  LYS A CD  1 
ATOM 1794  C CE  . LYS A 1 249  ? 44.211  6.278   17.649  1.00 24.88  ? 249  LYS A CE  1 
ATOM 1795  N NZ  . LYS A 1 249  ? 43.219  6.738   16.715  1.00 32.50  ? 249  LYS A NZ  1 
ATOM 1796  N N   . PHE A 1 250  ? 44.945  2.315   21.130  1.00 42.15  ? 250  PHE A N   1 
ATOM 1797  C CA  . PHE A 1 250  ? 44.697  0.901   21.390  1.00 46.85  ? 250  PHE A CA  1 
ATOM 1798  C C   . PHE A 1 250  ? 43.455  0.512   20.569  1.00 40.06  ? 250  PHE A C   1 
ATOM 1799  O O   . PHE A 1 250  ? 42.384  1.104   20.738  1.00 33.25  ? 250  PHE A O   1 
ATOM 1800  C CB  . PHE A 1 250  ? 44.548  0.720   22.902  1.00 49.07  ? 250  PHE A CB  1 
ATOM 1801  C CG  . PHE A 1 250  ? 44.778  -0.666  23.393  1.00 45.10  ? 250  PHE A CG  1 
ATOM 1802  C CD1 . PHE A 1 250  ? 45.217  -1.676  22.562  1.00 40.00  ? 250  PHE A CD1 1 
ATOM 1803  C CD2 . PHE A 1 250  ? 44.524  -0.962  24.712  1.00 45.35  ? 250  PHE A CD2 1 
ATOM 1804  C CE1 . PHE A 1 250  ? 45.355  -2.962  23.040  1.00 30.57  ? 250  PHE A CE1 1 
ATOM 1805  C CE2 . PHE A 1 250  ? 44.692  -2.229  25.191  1.00 36.27  ? 250  PHE A CE2 1 
ATOM 1806  C CZ  . PHE A 1 250  ? 45.121  -3.229  24.349  1.00 28.75  ? 250  PHE A CZ  1 
ATOM 1807  N N   . LEU A 1 251  ? 43.624  -0.332  19.540  1.00 38.37  ? 251  LEU A N   1 
ATOM 1808  C CA  . LEU A 1 251  ? 42.482  -0.751  18.742  1.00 29.06  ? 251  LEU A CA  1 
ATOM 1809  C C   . LEU A 1 251  ? 41.888  -1.980  19.411  1.00 27.45  ? 251  LEU A C   1 
ATOM 1810  O O   . LEU A 1 251  ? 42.599  -2.934  19.719  1.00 32.18  ? 251  LEU A O   1 
ATOM 1811  C CB  . LEU A 1 251  ? 42.862  -1.032  17.276  1.00 27.22  ? 251  LEU A CB  1 
ATOM 1812  C CG  . LEU A 1 251  ? 44.128  -1.789  16.850  1.00 22.73  ? 251  LEU A CG  1 
ATOM 1813  C CD1 . LEU A 1 251  ? 45.400  -1.073  17.195  1.00 20.41  ? 251  LEU A CD1 1 
ATOM 1814  C CD2 . LEU A 1 251  ? 44.136  -3.110  17.538  1.00 30.79  ? 251  LEU A CD2 1 
ATOM 1815  N N   . THR A 1 252  ? 40.618  -1.921  19.731  1.00 24.69  ? 252  THR A N   1 
ATOM 1816  C CA  . THR A 1 252  ? 39.863  -3.094  20.111  1.00 27.92  ? 252  THR A CA  1 
ATOM 1817  C C   . THR A 1 252  ? 38.922  -3.426  18.963  1.00 33.84  ? 252  THR A C   1 
ATOM 1818  O O   . THR A 1 252  ? 38.520  -2.519  18.231  1.00 34.17  ? 252  THR A O   1 
ATOM 1819  C CB  . THR A 1 252  ? 39.093  -2.770  21.369  1.00 36.33  ? 252  THR A CB  1 
ATOM 1820  O OG1 . THR A 1 252  ? 38.587  -1.440  21.217  1.00 35.88  ? 252  THR A OG1 1 
ATOM 1821  C CG2 . THR A 1 252  ? 40.021  -2.759  22.570  1.00 43.12  ? 252  THR A CG2 1 
ATOM 1822  N N   . CYS A 1 253  ? 38.554  -4.710  18.800  1.00 32.59  ? 253  CYS A N   1 
ATOM 1823  C CA  . CYS A 1 253  ? 37.520  -5.095  17.823  1.00 54.88  ? 253  CYS A CA  1 
ATOM 1824  C C   . CYS A 1 253  ? 36.221  -5.471  18.574  1.00 66.21  ? 253  CYS A C   1 
ATOM 1825  O O   . CYS A 1 253  ? 36.038  -6.614  19.018  1.00 69.17  ? 253  CYS A O   1 
ATOM 1826  C CB  . CYS A 1 253  ? 38.039  -6.196  16.891  1.00 49.71  ? 253  CYS A CB  1 
ATOM 1827  S SG  . CYS A 1 253  ? 39.886  -6.159  16.385  1.00 18.78  ? 253  CYS A SG  1 
ATOM 1828  N N   . ASP A 1 254  ? 35.315  -4.477  18.693  1.00 59.67  ? 254  ASP A N   1 
ATOM 1829  C CA  . ASP A 1 254  ? 34.050  -4.530  19.418  1.00 50.14  ? 254  ASP A CA  1 
ATOM 1830  C C   . ASP A 1 254  ? 32.867  -4.396  18.468  1.00 34.34  ? 254  ASP A C   1 
ATOM 1831  O O   . ASP A 1 254  ? 32.947  -3.781  17.400  1.00 25.71  ? 254  ASP A O   1 
ATOM 1832  C CB  . ASP A 1 254  ? 33.964  -3.425  20.491  1.00 60.92  ? 254  ASP A CB  1 
ATOM 1833  C CG  . ASP A 1 254  ? 35.165  -3.436  21.453  1.00 72.72  ? 254  ASP A CG  1 
ATOM 1834  O OD1 . ASP A 1 254  ? 35.557  -4.545  21.905  1.00 71.66  ? 254  ASP A OD1 1 
ATOM 1835  O OD2 . ASP A 1 254  ? 35.719  -2.342  21.753  1.00 72.21  ? 254  ASP A OD2 1 
ATOM 1836  N N   . GLU A 1 255  ? 31.759  -4.954  18.952  1.00 32.75  ? 255  GLU A N   1 
ATOM 1837  C CA  . GLU A 1 255  ? 30.518  -5.207  18.227  1.00 35.16  ? 255  GLU A CA  1 
ATOM 1838  C C   . GLU A 1 255  ? 29.490  -4.128  18.594  1.00 27.80  ? 255  GLU A C   1 
ATOM 1839  O O   . GLU A 1 255  ? 29.286  -3.842  19.779  1.00 28.62  ? 255  GLU A O   1 
ATOM 1840  C CB  . GLU A 1 255  ? 30.033  -6.642  18.572  1.00 51.87  ? 255  GLU A CB  1 
ATOM 1841  C CG  . GLU A 1 255  ? 29.486  -7.479  17.391  1.00 41.42  ? 255  GLU A CG  1 
ATOM 1842  C CD  . GLU A 1 255  ? 29.174  -6.567  16.306  1.00 26.05  ? 255  GLU A CD  1 
ATOM 1843  O OE1 . GLU A 1 255  ? 28.046  -6.559  15.792  1.00 17.23  ? 255  GLU A OE1 1 
ATOM 1844  O OE2 . GLU A 1 255  ? 30.043  -5.746  16.022  1.00 29.13  ? 255  GLU A OE2 1 
ATOM 1845  N N   . HIS A 1 256  ? 28.881  -3.474  17.588  1.00 24.10  ? 256  HIS A N   1 
ATOM 1846  C CA  . HIS A 1 256  ? 28.010  -2.332  17.912  1.00 17.77  ? 256  HIS A CA  1 
ATOM 1847  C C   . HIS A 1 256  ? 26.883  -2.265  16.915  1.00 12.18  ? 256  HIS A C   1 
ATOM 1848  O O   . HIS A 1 256  ? 27.042  -2.706  15.786  1.00 9.15   ? 256  HIS A O   1 
ATOM 1849  C CB  . HIS A 1 256  ? 28.705  -0.966  17.867  1.00 24.68  ? 256  HIS A CB  1 
ATOM 1850  C CG  . HIS A 1 256  ? 27.803  0.155   18.296  1.00 27.73  ? 256  HIS A CG  1 
ATOM 1851  N ND1 . HIS A 1 256  ? 26.844  0.714   17.473  1.00 17.25  ? 256  HIS A ND1 1 
ATOM 1852  C CD2 . HIS A 1 256  ? 27.664  0.763   19.498  1.00 47.04  ? 256  HIS A CD2 1 
ATOM 1853  C CE1 . HIS A 1 256  ? 26.185  1.647   18.140  1.00 23.89  ? 256  HIS A CE1 1 
ATOM 1854  N NE2 . HIS A 1 256  ? 26.665  1.697   19.370  1.00 42.88  ? 256  HIS A NE2 1 
ATOM 1855  N N   . ARG A 1 257  ? 25.738  -1.728  17.315  1.00 8.68   ? 257  ARG A N   1 
ATOM 1856  C CA  . ARG A 1 257  ? 24.725  -1.523  16.295  1.00 13.50  ? 257  ARG A CA  1 
ATOM 1857  C C   . ARG A 1 257  ? 24.376  -2.868  15.662  1.00 8.86   ? 257  ARG A C   1 
ATOM 1858  O O   . ARG A 1 257  ? 23.589  -2.928  14.721  1.00 19.34  ? 257  ARG A O   1 
ATOM 1859  C CB  . ARG A 1 257  ? 25.227  -0.534  15.233  1.00 8.68   ? 257  ARG A CB  1 
ATOM 1860  C CG  . ARG A 1 257  ? 24.763  0.843   15.439  1.00 8.68   ? 257  ARG A CG  1 
ATOM 1861  C CD  . ARG A 1 257  ? 23.734  0.754   16.474  1.00 8.68   ? 257  ARG A CD  1 
ATOM 1862  N NE  . ARG A 1 257  ? 23.429  2.063   16.953  1.00 8.68   ? 257  ARG A NE  1 
ATOM 1863  C CZ  . ARG A 1 257  ? 22.518  2.818   16.388  1.00 8.68   ? 257  ARG A CZ  1 
ATOM 1864  N NH1 . ARG A 1 257  ? 21.855  2.367   15.341  1.00 8.68   ? 257  ARG A NH1 1 
ATOM 1865  N NH2 . ARG A 1 257  ? 22.274  4.010   16.872  1.00 8.68   ? 257  ARG A NH2 1 
ATOM 1866  N N   . LYS A 1 258  ? 25.023  -3.952  16.120  1.00 8.80   ? 258  LYS A N   1 
ATOM 1867  C CA  . LYS A 1 258  ? 24.689  -5.333  15.748  1.00 8.79   ? 258  LYS A CA  1 
ATOM 1868  C C   . LYS A 1 258  ? 25.576  -5.879  14.620  1.00 10.56  ? 258  LYS A C   1 
ATOM 1869  O O   . LYS A 1 258  ? 25.325  -6.973  14.098  1.00 10.47  ? 258  LYS A O   1 
ATOM 1870  C CB  . LYS A 1 258  ? 23.209  -5.479  15.347  1.00 12.41  ? 258  LYS A CB  1 
ATOM 1871  C CG  . LYS A 1 258  ? 22.193  -4.965  16.377  1.00 9.80   ? 258  LYS A CG  1 
ATOM 1872  C CD  . LYS A 1 258  ? 20.778  -5.555  16.206  1.00 8.72   ? 258  LYS A CD  1 
ATOM 1873  C CE  . LYS A 1 258  ? 19.815  -4.538  15.591  1.00 8.72   ? 258  LYS A CE  1 
ATOM 1874  N NZ  . LYS A 1 258  ? 18.400  -4.781  15.947  1.00 8.72   ? 258  LYS A NZ  1 
ATOM 1875  N N   . LYS A 1 259  ? 26.628  -5.131  14.269  1.00 11.47  ? 259  LYS A N   1 
ATOM 1876  C CA  . LYS A 1 259  ? 27.569  -5.432  13.184  1.00 14.19  ? 259  LYS A CA  1 
ATOM 1877  C C   . LYS A 1 259  ? 28.987  -5.209  13.716  1.00 18.53  ? 259  LYS A C   1 
ATOM 1878  O O   . LYS A 1 259  ? 29.202  -4.295  14.505  1.00 19.47  ? 259  LYS A O   1 
ATOM 1879  C CB  . LYS A 1 259  ? 27.356  -4.516  11.965  1.00 21.71  ? 259  LYS A CB  1 
ATOM 1880  C CG  . LYS A 1 259  ? 28.180  -3.196  12.117  1.00 18.65  ? 259  LYS A CG  1 
ATOM 1881  C CD  . LYS A 1 259  ? 27.282  -2.054  12.454  1.00 15.18  ? 259  LYS A CD  1 
ATOM 1882  C CE  . LYS A 1 259  ? 26.246  -2.499  13.428  1.00 14.14  ? 259  LYS A CE  1 
ATOM 1883  N NZ  . LYS A 1 259  ? 25.080  -3.188  12.795  1.00 19.61  ? 259  LYS A NZ  1 
ATOM 1884  N N   . GLN A 1 260  ? 29.927  -6.091  13.323  1.00 26.09  ? 260  GLN A N   1 
ATOM 1885  C CA  . GLN A 1 260  ? 31.258  -6.124  13.942  1.00 27.94  ? 260  GLN A CA  1 
ATOM 1886  C C   . GLN A 1 260  ? 32.018  -4.836  13.645  1.00 27.02  ? 260  GLN A C   1 
ATOM 1887  O O   . GLN A 1 260  ? 31.978  -4.306  12.536  1.00 31.93  ? 260  GLN A O   1 
ATOM 1888  C CB  . GLN A 1 260  ? 32.044  -7.368  13.459  1.00 26.16  ? 260  GLN A CB  1 
ATOM 1889  C CG  . GLN A 1 260  ? 33.289  -7.932  14.298  1.00 16.14  ? 260  GLN A CG  1 
ATOM 1890  C CD  . GLN A 1 260  ? 33.001  -8.135  15.752  1.00 16.42  ? 260  GLN A CD  1 
ATOM 1891  O OE1 . GLN A 1 260  ? 33.139  -7.209  16.521  1.00 18.29  ? 260  GLN A OE1 1 
ATOM 1892  N NE2 . GLN A 1 260  ? 32.610  -9.342  16.143  1.00 15.05  ? 260  GLN A NE2 1 
ATOM 1893  N N   . HIS A 1 261  ? 32.687  -4.309  14.651  1.00 27.63  ? 261  HIS A N   1 
ATOM 1894  C CA  . HIS A 1 261  ? 33.447  -3.082  14.509  1.00 30.85  ? 261  HIS A CA  1 
ATOM 1895  C C   . HIS A 1 261  ? 34.857  -3.373  14.941  1.00 30.79  ? 261  HIS A C   1 
ATOM 1896  O O   . HIS A 1 261  ? 35.080  -4.202  15.822  1.00 34.99  ? 261  HIS A O   1 
ATOM 1897  C CB  . HIS A 1 261  ? 32.867  -1.933  15.343  1.00 39.94  ? 261  HIS A CB  1 
ATOM 1898  C CG  . HIS A 1 261  ? 31.391  -1.815  15.205  1.00 33.66  ? 261  HIS A CG  1 
ATOM 1899  N ND1 . HIS A 1 261  ? 30.760  -0.799  14.517  1.00 28.89  ? 261  HIS A ND1 1 
ATOM 1900  C CD2 . HIS A 1 261  ? 30.416  -2.649  15.608  1.00 25.56  ? 261  HIS A CD2 1 
ATOM 1901  C CE1 . HIS A 1 261  ? 29.451  -0.996  14.545  1.00 19.55  ? 261  HIS A CE1 1 
ATOM 1902  N NE2 . HIS A 1 261  ? 29.217  -2.120  15.192  1.00 19.05  ? 261  HIS A NE2 1 
ATOM 1903  N N   . VAL A 1 262  ? 35.805  -2.729  14.283  1.00 30.03  ? 262  VAL A N   1 
ATOM 1904  C CA  . VAL A 1 262  ? 37.202  -2.794  14.674  1.00 39.75  ? 262  VAL A CA  1 
ATOM 1905  C C   . VAL A 1 262  ? 37.698  -1.365  14.723  1.00 32.47  ? 262  VAL A C   1 
ATOM 1906  O O   . VAL A 1 262  ? 37.364  -0.559  13.855  1.00 34.86  ? 262  VAL A O   1 
ATOM 1907  C CB  . VAL A 1 262  ? 38.028  -3.654  13.706  1.00 41.45  ? 262  VAL A CB  1 
ATOM 1908  C CG1 . VAL A 1 262  ? 37.606  -5.070  13.836  1.00 56.86  ? 262  VAL A CG1 1 
ATOM 1909  C CG2 . VAL A 1 262  ? 37.826  -3.195  12.313  1.00 33.40  ? 262  VAL A CG2 1 
ATOM 1910  N N   . PHE A 1 263  ? 38.419  -1.013  15.774  1.00 31.27  ? 263  PHE A N   1 
ATOM 1911  C CA  . PHE A 1 263  ? 38.413  0.419   15.998  1.00 25.20  ? 263  PHE A CA  1 
ATOM 1912  C C   . PHE A 1 263  ? 39.314  0.719   17.180  1.00 23.65  ? 263  PHE A C   1 
ATOM 1913  O O   . PHE A 1 263  ? 39.906  -0.180  17.775  1.00 22.33  ? 263  PHE A O   1 
ATOM 1914  C CB  . PHE A 1 263  ? 36.955  0.866   16.147  1.00 25.28  ? 263  PHE A CB  1 
ATOM 1915  C CG  . PHE A 1 263  ? 36.259  0.348   17.388  1.00 25.19  ? 263  PHE A CG  1 
ATOM 1916  C CD1 . PHE A 1 263  ? 36.325  -0.980  17.685  1.00 27.55  ? 263  PHE A CD1 1 
ATOM 1917  C CD2 . PHE A 1 263  ? 35.515  1.169   18.248  1.00 24.22  ? 263  PHE A CD2 1 
ATOM 1918  C CE1 . PHE A 1 263  ? 35.706  -1.442  18.737  1.00 28.92  ? 263  PHE A CE1 1 
ATOM 1919  C CE2 . PHE A 1 263  ? 34.926  0.660   19.349  1.00 23.35  ? 263  PHE A CE2 1 
ATOM 1920  C CZ  . PHE A 1 263  ? 35.046  -0.625  19.567  1.00 28.03  ? 263  PHE A CZ  1 
ATOM 1921  N N   . LEU A 1 264  ? 39.567  1.996   17.366  1.00 24.65  ? 264  LEU A N   1 
ATOM 1922  C CA  . LEU A 1 264  ? 40.545  2.427   18.344  1.00 28.83  ? 264  LEU A CA  1 
ATOM 1923  C C   . LEU A 1 264  ? 40.095  3.709   18.982  1.00 37.73  ? 264  LEU A C   1 
ATOM 1924  O O   . LEU A 1 264  ? 39.735  4.633   18.254  1.00 38.09  ? 264  LEU A O   1 
ATOM 1925  C CB  . LEU A 1 264  ? 41.807  2.712   17.651  1.00 25.78  ? 264  LEU A CB  1 
ATOM 1926  C CG  . LEU A 1 264  ? 42.985  2.530   18.509  1.00 31.35  ? 264  LEU A CG  1 
ATOM 1927  C CD1 . LEU A 1 264  ? 44.065  2.497   17.534  1.00 30.82  ? 264  LEU A CD1 1 
ATOM 1928  C CD2 . LEU A 1 264  ? 42.931  3.707   19.465  1.00 30.43  ? 264  LEU A CD2 1 
ATOM 1929  N N   . ARG A 1 265  ? 40.234  3.849   20.297  1.00 42.44  ? 265  ARG A N   1 
ATOM 1930  C CA  . ARG A 1 265  ? 39.777  5.152   20.794  1.00 42.55  ? 265  ARG A CA  1 
ATOM 1931  C C   . ARG A 1 265  ? 40.175  5.461   22.233  1.00 39.22  ? 265  ARG A C   1 
ATOM 1932  O O   . ARG A 1 265  ? 41.069  4.838   22.824  1.00 43.99  ? 265  ARG A O   1 
ATOM 1933  C CB  . ARG A 1 265  ? 38.272  5.257   20.691  1.00 52.13  ? 265  ARG A CB  1 
ATOM 1934  N N   . THR A 1 266  ? 39.452  6.453   22.762  1.00 35.66  ? 266  THR A N   1 
ATOM 1935  C CA  . THR A 1 266  ? 39.675  7.123   24.042  1.00 42.86  ? 266  THR A CA  1 
ATOM 1936  C C   . THR A 1 266  ? 38.927  6.411   25.184  1.00 54.23  ? 266  THR A C   1 
ATOM 1937  O O   . THR A 1 266  ? 37.800  5.941   24.996  1.00 57.68  ? 266  THR A O   1 
ATOM 1938  C CB  . THR A 1 266  ? 39.217  8.583   23.897  1.00 26.80  ? 266  THR A CB  1 
ATOM 1939  O OG1 . THR A 1 266  ? 39.532  9.059   22.576  1.00 20.53  ? 266  THR A OG1 1 
ATOM 1940  C CG2 . THR A 1 266  ? 39.944  9.441   24.844  1.00 43.58  ? 266  THR A CG2 1 
ATOM 1941  N N   . THR A 1 267  ? 39.567  6.314   26.363  1.00 61.96  ? 267  THR A N   1 
ATOM 1942  C CA  . THR A 1 267  ? 39.038  5.563   27.509  1.00 55.97  ? 267  THR A CA  1 
ATOM 1943  C C   . THR A 1 267  ? 38.844  6.472   28.728  1.00 42.51  ? 267  THR A C   1 
ATOM 1944  O O   . THR A 1 267  ? 39.807  7.054   29.243  1.00 46.76  ? 267  THR A O   1 
ATOM 1945  C CB  . THR A 1 267  ? 39.942  4.353   27.893  1.00 53.25  ? 267  THR A CB  1 
ATOM 1946  O OG1 . THR A 1 267  ? 41.135  4.782   28.577  1.00 61.06  ? 267  THR A OG1 1 
ATOM 1947  C CG2 . THR A 1 267  ? 40.303  3.469   26.664  1.00 44.77  ? 267  THR A CG2 1 
ATOM 1948  N N   . GLY A 1 268  ? 37.599  6.556   29.207  1.00 34.25  ? 268  GLY A N   1 
ATOM 1949  C CA  . GLY A 1 268  ? 37.234  7.392   30.341  1.00 17.99  ? 268  GLY A CA  1 
ATOM 1950  C C   . GLY A 1 268  ? 37.670  6.923   31.715  1.00 9.04   ? 268  GLY A C   1 
ATOM 1951  O O   . GLY A 1 268  ? 37.039  7.279   32.709  1.00 9.04   ? 268  GLY A O   1 
ATOM 1952  N N   . SER A 1 271  ? 46.242  3.189   30.566  1.00 54.39  ? 271  SER A N   1 
ATOM 1953  C CA  . SER A 1 271  ? 46.662  1.920   29.978  1.00 37.21  ? 271  SER A CA  1 
ATOM 1954  C C   . SER A 1 271  ? 48.179  1.646   30.163  1.00 27.54  ? 271  SER A C   1 
ATOM 1955  O O   . SER A 1 271  ? 48.589  0.494   30.239  1.00 30.77  ? 271  SER A O   1 
ATOM 1956  C CB  . SER A 1 271  ? 46.269  1.879   28.492  1.00 49.51  ? 271  SER A CB  1 
ATOM 1957  N N   . ALA A 1 272  ? 49.011  2.685   30.268  1.00 29.87  ? 272  ALA A N   1 
ATOM 1958  C CA  . ALA A 1 272  ? 50.430  2.454   30.538  1.00 19.63  ? 272  ALA A CA  1 
ATOM 1959  C C   . ALA A 1 272  ? 50.660  1.986   31.976  1.00 22.55  ? 272  ALA A C   1 
ATOM 1960  O O   . ALA A 1 272  ? 51.484  1.097   32.220  1.00 16.96  ? 272  ALA A O   1 
ATOM 1961  C CB  . ALA A 1 272  ? 51.234  3.717   30.223  1.00 13.83  ? 272  ALA A CB  1 
ATOM 1962  N N   . THR A 1 273  ? 49.939  2.565   32.941  1.00 25.04  ? 273  THR A N   1 
ATOM 1963  C CA  . THR A 1 273  ? 49.945  2.162   34.349  1.00 32.81  ? 273  THR A CA  1 
ATOM 1964  C C   . THR A 1 273  ? 48.675  1.350   34.686  1.00 47.63  ? 273  THR A C   1 
ATOM 1965  O O   . THR A 1 273  ? 47.658  1.439   33.994  1.00 50.99  ? 273  THR A O   1 
ATOM 1966  C CB  . THR A 1 273  ? 50.077  3.412   35.259  1.00 28.52  ? 273  THR A CB  1 
ATOM 1967  O OG1 . THR A 1 273  ? 49.170  4.440   34.832  1.00 29.09  ? 273  THR A OG1 1 
ATOM 1968  C CG2 . THR A 1 273  ? 51.507  4.005   35.212  1.00 20.04  ? 273  THR A CG2 1 
ATOM 1969  N N   . SER A 1 274  ? 48.774  0.508   35.733  1.00 37.77  ? 274  SER A N   1 
ATOM 1970  C CA  . SER A 1 274  ? 47.654  -0.173  36.437  1.00 21.10  ? 274  SER A CA  1 
ATOM 1971  C C   . SER A 1 274  ? 47.238  -1.380  35.575  1.00 24.35  ? 274  SER A C   1 
ATOM 1972  O O   . SER A 1 274  ? 48.114  -2.254  35.434  1.00 26.47  ? 274  SER A O   1 
ATOM 1973  C CB  . SER A 1 274  ? 46.609  0.866   36.848  1.00 30.07  ? 274  SER A CB  1 
ATOM 1974  N N   . ALA A 1 275  ? 46.048  -1.466  34.958  1.00 36.86  ? 275  ALA A N   1 
ATOM 1975  C CA  . ALA A 1 275  ? 45.662  -2.610  34.090  1.00 37.07  ? 275  ALA A CA  1 
ATOM 1976  C C   . ALA A 1 275  ? 44.675  -2.097  33.037  1.00 46.41  ? 275  ALA A C   1 
ATOM 1977  O O   . ALA A 1 275  ? 43.875  -1.209  33.334  1.00 48.89  ? 275  ALA A O   1 
ATOM 1978  C CB  . ALA A 1 275  ? 45.035  -3.814  34.863  1.00 43.17  ? 275  ALA A CB  1 
ATOM 1979  N N   . THR A 1 276  ? 44.800  -2.571  31.783  1.00 40.21  ? 276  THR A N   1 
ATOM 1980  C CA  . THR A 1 276  ? 43.956  -2.169  30.650  1.00 39.91  ? 276  THR A CA  1 
ATOM 1981  C C   . THR A 1 276  ? 42.739  -3.076  30.572  1.00 59.31  ? 276  THR A C   1 
ATOM 1982  O O   . THR A 1 276  ? 42.593  -3.992  31.378  1.00 67.15  ? 276  THR A O   1 
ATOM 1983  C CB  . THR A 1 276  ? 44.720  -2.267  29.337  1.00 36.35  ? 276  THR A CB  1 
ATOM 1984  O OG1 . THR A 1 276  ? 46.071  -2.528  29.677  1.00 33.53  ? 276  THR A OG1 1 
ATOM 1985  C CG2 . THR A 1 276  ? 44.670  -0.928  28.578  1.00 34.79  ? 276  THR A CG2 1 
ATOM 1986  N N   . SER A 1 277  ? 41.991  -2.965  29.465  1.00 79.29  ? 277  SER A N   1 
ATOM 1987  C CA  . SER A 1 277  ? 40.722  -3.678  29.257  1.00 95.04  ? 277  SER A CA  1 
ATOM 1988  C C   . SER A 1 277  ? 40.906  -5.127  28.774  1.00 83.88  ? 277  SER A C   1 
ATOM 1989  O O   . SER A 1 277  ? 41.889  -5.458  28.103  1.00 83.44  ? 277  SER A O   1 
ATOM 1990  C CB  . SER A 1 277  ? 39.849  -2.922  28.243  1.00 97.19  ? 277  SER A CB  1 
ATOM 1991  O OG  . SER A 1 277  ? 38.937  -2.044  28.899  1.00 66.27  ? 277  SER A OG  1 
ATOM 1992  N N   . SER A 1 278  ? 39.890  -5.977  29.048  1.00 89.36  ? 278  SER A N   1 
ATOM 1993  C CA  . SER A 1 278  ? 40.032  -7.432  28.897  1.00 67.43  ? 278  SER A CA  1 
ATOM 1994  C C   . SER A 1 278  ? 39.920  -7.896  27.446  1.00 53.74  ? 278  SER A C   1 
ATOM 1995  O O   . SER A 1 278  ? 40.620  -8.832  27.033  1.00 57.96  ? 278  SER A O   1 
ATOM 1996  C CB  . SER A 1 278  ? 38.992  -8.162  29.758  1.00 62.13  ? 278  SER A CB  1 
ATOM 1997  O OG  . SER A 1 278  ? 37.676  -8.067  29.230  1.00 59.99  ? 278  SER A OG  1 
ATOM 1998  N N   . LYS A 1 279  ? 39.035  -7.271  26.669  1.00 56.49  ? 279  LYS A N   1 
ATOM 1999  C CA  . LYS A 1 279  ? 38.875  -7.614  25.261  1.00 47.81  ? 279  LYS A CA  1 
ATOM 2000  C C   . LYS A 1 279  ? 40.063  -7.179  24.408  1.00 44.35  ? 279  LYS A C   1 
ATOM 2001  O O   . LYS A 1 279  ? 40.062  -7.429  23.204  1.00 33.55  ? 279  LYS A O   1 
ATOM 2002  C CB  . LYS A 1 279  ? 37.578  -6.999  24.720  1.00 36.50  ? 279  LYS A CB  1 
ATOM 2003  C CG  . LYS A 1 279  ? 37.112  -7.615  23.409  1.00 35.14  ? 279  LYS A CG  1 
ATOM 2004  C CD  . LYS A 1 279  ? 35.680  -7.246  23.082  1.00 32.37  ? 279  LYS A CD  1 
ATOM 2005  C CE  . LYS A 1 279  ? 34.719  -8.367  23.442  1.00 23.75  ? 279  LYS A CE  1 
ATOM 2006  N NZ  . LYS A 1 279  ? 33.324  -7.876  23.463  1.00 29.55  ? 279  LYS A NZ  1 
ATOM 2007  N N   . ALA A 1 280  ? 41.082  -6.553  24.993  1.00 43.29  ? 280  ALA A N   1 
ATOM 2008  C CA  . ALA A 1 280  ? 42.180  -5.996  24.211  1.00 43.40  ? 280  ALA A CA  1 
ATOM 2009  C C   . ALA A 1 280  ? 43.185  -7.057  23.790  1.00 33.15  ? 280  ALA A C   1 
ATOM 2010  O O   . ALA A 1 280  ? 43.745  -7.000  22.687  1.00 26.42  ? 280  ALA A O   1 
ATOM 2011  C CB  . ALA A 1 280  ? 42.877  -4.910  25.022  1.00 50.79  ? 280  ALA A CB  1 
ATOM 2012  N N   . LEU A 1 281  ? 43.460  -7.996  24.685  1.00 33.04  ? 281  LEU A N   1 
ATOM 2013  C CA  . LEU A 1 281  ? 44.360  -9.097  24.400  1.00 31.88  ? 281  LEU A CA  1 
ATOM 2014  C C   . LEU A 1 281  ? 44.008  -9.698  23.046  1.00 25.91  ? 281  LEU A C   1 
ATOM 2015  O O   . LEU A 1 281  ? 42.839  -9.965  22.783  1.00 20.65  ? 281  LEU A O   1 
ATOM 2016  C CB  . LEU A 1 281  ? 44.226  -10.140 25.519  1.00 30.73  ? 281  LEU A CB  1 
ATOM 2017  C CG  . LEU A 1 281  ? 43.722  -9.694  26.902  1.00 33.22  ? 281  LEU A CG  1 
ATOM 2018  C CD1 . LEU A 1 281  ? 43.242  -10.886 27.695  1.00 19.67  ? 281  LEU A CD1 1 
ATOM 2019  C CD2 . LEU A 1 281  ? 44.810  -8.974  27.707  1.00 43.85  ? 281  LEU A CD2 1 
ATOM 2020  N N   . TRP A 1 282  ? 45.022  -9.868  22.177  1.00 25.04  ? 282  TRP A N   1 
ATOM 2021  C CA  . TRP A 1 282  ? 44.865  -10.528 20.879  1.00 24.53  ? 282  TRP A CA  1 
ATOM 2022  C C   . TRP A 1 282  ? 46.005  -11.492 20.592  1.00 24.68  ? 282  TRP A C   1 
ATOM 2023  O O   . TRP A 1 282  ? 47.176  -11.186 20.821  1.00 26.47  ? 282  TRP A O   1 
ATOM 2024  C CB  . TRP A 1 282  ? 44.737  -9.512  19.757  1.00 24.04  ? 282  TRP A CB  1 
ATOM 2025  C CG  . TRP A 1 282  ? 43.518  -8.774  20.016  1.00 22.75  ? 282  TRP A CG  1 
ATOM 2026  C CD1 . TRP A 1 282  ? 43.337  -7.442  20.037  1.00 23.65  ? 282  TRP A CD1 1 
ATOM 2027  C CD2 . TRP A 1 282  ? 42.303  -9.348  20.405  1.00 22.31  ? 282  TRP A CD2 1 
ATOM 2028  N NE1 . TRP A 1 282  ? 42.055  -7.126  20.397  1.00 21.64  ? 282  TRP A NE1 1 
ATOM 2029  C CE2 . TRP A 1 282  ? 41.382  -8.296  20.601  1.00 22.50  ? 282  TRP A CE2 1 
ATOM 2030  C CE3 . TRP A 1 282  ? 41.881  -10.654 20.543  1.00 24.92  ? 282  TRP A CE3 1 
ATOM 2031  C CZ2 . TRP A 1 282  ? 40.046  -8.509  20.962  1.00 27.41  ? 282  TRP A CZ2 1 
ATOM 2032  C CZ3 . TRP A 1 282  ? 40.571  -10.872 20.937  1.00 24.70  ? 282  TRP A CZ3 1 
ATOM 2033  C CH2 . TRP A 1 282  ? 39.664  -9.795  21.160  1.00 29.31  ? 282  TRP A CH2 1 
ATOM 2034  N N   . GLU A 1 283  ? 45.652  -12.665 20.089  1.00 21.90  ? 283  GLU A N   1 
ATOM 2035  C CA  . GLU A 1 283  ? 46.626  -13.736 19.992  1.00 19.91  ? 283  GLU A CA  1 
ATOM 2036  C C   . GLU A 1 283  ? 47.489  -13.510 18.767  1.00 18.75  ? 283  GLU A C   1 
ATOM 2037  O O   . GLU A 1 283  ? 47.036  -12.951 17.775  1.00 17.64  ? 283  GLU A O   1 
ATOM 2038  C CB  . GLU A 1 283  ? 45.941  -15.082 19.862  1.00 17.36  ? 283  GLU A CB  1 
ATOM 2039  C CG  . GLU A 1 283  ? 45.811  -15.363 18.393  1.00 14.52  ? 283  GLU A CG  1 
ATOM 2040  C CD  . GLU A 1 283  ? 45.129  -16.609 18.094  1.00 12.52  ? 283  GLU A CD  1 
ATOM 2041  O OE1 . GLU A 1 283  ? 44.983  -16.870 16.901  1.00 13.35  ? 283  GLU A OE1 1 
ATOM 2042  O OE2 . GLU A 1 283  ? 44.694  -17.311 19.025  1.00 14.78  ? 283  GLU A OE2 1 
ATOM 2043  N N   . VAL A 1 284  ? 48.752  -13.906 18.859  1.00 21.95  ? 284  VAL A N   1 
ATOM 2044  C CA  . VAL A 1 284  ? 49.725  -13.675 17.802  1.00 28.16  ? 284  VAL A CA  1 
ATOM 2045  C C   . VAL A 1 284  ? 49.991  -14.995 17.111  1.00 29.99  ? 284  VAL A C   1 
ATOM 2046  O O   . VAL A 1 284  ? 50.210  -16.018 17.768  1.00 31.40  ? 284  VAL A O   1 
ATOM 2047  C CB  . VAL A 1 284  ? 51.038  -13.079 18.344  1.00 35.41  ? 284  VAL A CB  1 
ATOM 2048  C CG1 . VAL A 1 284  ? 52.071  -12.876 17.211  1.00 30.59  ? 284  VAL A CG1 1 
ATOM 2049  C CG2 . VAL A 1 284  ? 50.760  -11.773 19.038  1.00 41.63  ? 284  VAL A CG2 1 
ATOM 2050  N N   . GLU A 1 285  ? 49.971  -14.981 15.795  1.00 32.82  ? 285  GLU A N   1 
ATOM 2051  C CA  . GLU A 1 285  ? 50.475  -16.127 15.075  1.00 25.09  ? 285  GLU A CA  1 
ATOM 2052  C C   . GLU A 1 285  ? 51.690  -15.664 14.289  1.00 18.88  ? 285  GLU A C   1 
ATOM 2053  O O   . GLU A 1 285  ? 51.797  -14.491 13.901  1.00 17.51  ? 285  GLU A O   1 
ATOM 2054  C CB  . GLU A 1 285  ? 49.397  -16.738 14.172  1.00 29.38  ? 285  GLU A CB  1 
ATOM 2055  N N   . VAL A 1 286  ? 52.627  -16.575 14.103  1.00 16.28  ? 286  VAL A N   1 
ATOM 2056  C CA  . VAL A 1 286  ? 53.796  -16.327 13.279  1.00 15.01  ? 286  VAL A CA  1 
ATOM 2057  C C   . VAL A 1 286  ? 53.614  -17.111 11.993  1.00 13.98  ? 286  VAL A C   1 
ATOM 2058  O O   . VAL A 1 286  ? 53.333  -18.315 12.027  1.00 13.53  ? 286  VAL A O   1 
ATOM 2059  C CB  . VAL A 1 286  ? 55.077  -16.744 14.004  1.00 19.29  ? 286  VAL A CB  1 
ATOM 2060  C CG1 . VAL A 1 286  ? 54.914  -18.163 14.444  1.00 26.07  ? 286  VAL A CG1 1 
ATOM 2061  C CG2 . VAL A 1 286  ? 56.284  -16.602 13.090  1.00 20.74  ? 286  VAL A CG2 1 
ATOM 2062  N N   . VAL A 1 287  ? 53.768  -16.421 10.863  1.00 19.38  ? 287  VAL A N   1 
ATOM 2063  C CA  . VAL A 1 287  ? 53.617  -17.067 9.570   1.00 21.52  ? 287  VAL A CA  1 
ATOM 2064  C C   . VAL A 1 287  ? 54.453  -18.331 9.546   1.00 14.91  ? 287  VAL A C   1 
ATOM 2065  O O   . VAL A 1 287  ? 55.585  -18.383 10.050  1.00 13.43  ? 287  VAL A O   1 
ATOM 2066  C CB  . VAL A 1 287  ? 53.971  -16.084 8.443   1.00 26.56  ? 287  VAL A CB  1 
ATOM 2067  C CG1 . VAL A 1 287  ? 53.507  -16.596 7.059   1.00 39.59  ? 287  VAL A CG1 1 
ATOM 2068  C CG2 . VAL A 1 287  ? 53.280  -14.799 8.730   1.00 24.94  ? 287  VAL A CG2 1 
ATOM 2069  N N   . GLN A 1 288  ? 53.870  -19.373 8.993   1.00 13.83  ? 288  GLN A N   1 
ATOM 2070  C CA  . GLN A 1 288  ? 54.436  -20.684 9.153   1.00 11.06  ? 288  GLN A CA  1 
ATOM 2071  C C   . GLN A 1 288  ? 53.988  -21.555 8.002   1.00 13.15  ? 288  GLN A C   1 
ATOM 2072  O O   . GLN A 1 288  ? 52.808  -21.611 7.648   1.00 14.98  ? 288  GLN A O   1 
ATOM 2073  C CB  . GLN A 1 288  ? 54.049  -21.272 10.501  1.00 9.56   ? 288  GLN A CB  1 
ATOM 2074  C CG  . GLN A 1 288  ? 55.264  -21.743 11.233  1.00 8.98   ? 288  GLN A CG  1 
ATOM 2075  C CD  . GLN A 1 288  ? 56.381  -20.702 11.327  1.00 8.94   ? 288  GLN A CD  1 
ATOM 2076  O OE1 . GLN A 1 288  ? 56.775  -20.349 12.424  1.00 8.94   ? 288  GLN A OE1 1 
ATOM 2077  N NE2 . GLN A 1 288  ? 56.917  -20.245 10.192  1.00 8.94   ? 288  GLN A NE2 1 
ATOM 2078  N N   . HIS A 1 289  ? 54.962  -22.213 7.420   1.00 12.87  ? 289  HIS A N   1 
ATOM 2079  C CA  . HIS A 1 289  ? 54.708  -23.068 6.292   1.00 12.66  ? 289  HIS A CA  1 
ATOM 2080  C C   . HIS A 1 289  ? 54.065  -24.386 6.712   1.00 13.23  ? 289  HIS A C   1 
ATOM 2081  O O   . HIS A 1 289  ? 53.385  -25.015 5.896   1.00 11.27  ? 289  HIS A O   1 
ATOM 2082  C CB  . HIS A 1 289  ? 56.047  -23.207 5.582   1.00 14.73  ? 289  HIS A CB  1 
ATOM 2083  C CG  . HIS A 1 289  ? 56.186  -24.400 4.713   1.00 20.76  ? 289  HIS A CG  1 
ATOM 2084  N ND1 . HIS A 1 289  ? 56.214  -25.686 5.211   1.00 22.83  ? 289  HIS A ND1 1 
ATOM 2085  C CD2 . HIS A 1 289  ? 56.480  -24.499 3.400   1.00 17.99  ? 289  HIS A CD2 1 
ATOM 2086  C CE1 . HIS A 1 289  ? 56.406  -26.537 4.214   1.00 18.72  ? 289  HIS A CE1 1 
ATOM 2087  N NE2 . HIS A 1 289  ? 56.602  -25.839 3.111   1.00 19.05  ? 289  HIS A NE2 1 
ATOM 2088  N N   . ASP A 1 290  ? 54.196  -24.778 7.987   1.00 14.17  ? 290  ASP A N   1 
ATOM 2089  C CA  . ASP A 1 290  ? 53.675  -26.042 8.522   1.00 9.85   ? 290  ASP A CA  1 
ATOM 2090  C C   . ASP A 1 290  ? 52.753  -25.813 9.717   1.00 10.75  ? 290  ASP A C   1 
ATOM 2091  O O   . ASP A 1 290  ? 52.620  -24.679 10.193  1.00 9.42   ? 290  ASP A O   1 
ATOM 2092  C CB  . ASP A 1 290  ? 54.830  -26.959 8.938   1.00 16.84  ? 290  ASP A CB  1 
ATOM 2093  C CG  . ASP A 1 290  ? 54.890  -28.238 8.130   1.00 12.37  ? 290  ASP A CG  1 
ATOM 2094  O OD1 . ASP A 1 290  ? 53.813  -28.781 7.809   1.00 10.87  ? 290  ASP A OD1 1 
ATOM 2095  O OD2 . ASP A 1 290  ? 56.020  -28.696 7.825   1.00 10.13  ? 290  ASP A OD2 1 
ATOM 2096  N N   . PRO A 1 291  ? 52.113  -26.857 10.247  1.00 8.82   ? 291  PRO A N   1 
ATOM 2097  C CA  . PRO A 1 291  ? 51.152  -26.635 11.333  1.00 8.82   ? 291  PRO A CA  1 
ATOM 2098  C C   . PRO A 1 291  ? 51.685  -25.811 12.473  1.00 8.82   ? 291  PRO A C   1 
ATOM 2099  O O   . PRO A 1 291  ? 51.039  -24.860 12.928  1.00 8.82   ? 291  PRO A O   1 
ATOM 2100  C CB  . PRO A 1 291  ? 50.822  -28.060 11.790  1.00 8.82   ? 291  PRO A CB  1 
ATOM 2101  C CG  . PRO A 1 291  ? 51.960  -28.866 11.346  1.00 8.82   ? 291  PRO A CG  1 
ATOM 2102  C CD  . PRO A 1 291  ? 52.318  -28.290 10.022  1.00 8.82   ? 291  PRO A CD  1 
ATOM 2103  N N   . CYS A 1 292  ? 52.874  -26.142 12.932  1.00 9.08   ? 292  CYS A N   1 
ATOM 2104  C CA  . CYS A 1 292  ? 53.295  -25.870 14.293  1.00 10.25  ? 292  CYS A CA  1 
ATOM 2105  C C   . CYS A 1 292  ? 54.759  -25.439 14.329  1.00 9.94   ? 292  CYS A C   1 
ATOM 2106  O O   . CYS A 1 292  ? 55.536  -25.873 15.174  1.00 9.81   ? 292  CYS A O   1 
ATOM 2107  C CB  . CYS A 1 292  ? 53.082  -27.124 15.149  1.00 14.18  ? 292  CYS A CB  1 
ATOM 2108  S SG  . CYS A 1 292  ? 51.431  -27.863 15.080  1.00 9.00   ? 292  CYS A SG  1 
ATOM 2109  N N   . ARG A 1 293  ? 55.174  -24.611 13.374  1.00 8.86   ? 293  ARG A N   1 
ATOM 2110  C CA  . ARG A 1 293  ? 56.590  -24.301 13.435  1.00 9.48   ? 293  ARG A CA  1 
ATOM 2111  C C   . ARG A 1 293  ? 56.850  -23.365 14.597  1.00 13.92  ? 293  ARG A C   1 
ATOM 2112  O O   . ARG A 1 293  ? 55.925  -22.816 15.200  1.00 12.83  ? 293  ARG A O   1 
ATOM 2113  C CB  . ARG A 1 293  ? 57.093  -23.705 12.139  1.00 9.02   ? 293  ARG A CB  1 
ATOM 2114  N N   . GLY A 1 294  ? 58.121  -23.285 14.975  1.00 20.46  ? 294  GLY A N   1 
ATOM 2115  C CA  . GLY A 1 294  ? 58.542  -22.566 16.161  1.00 29.31  ? 294  GLY A CA  1 
ATOM 2116  C C   . GLY A 1 294  ? 59.365  -21.345 15.823  1.00 21.93  ? 294  GLY A C   1 
ATOM 2117  O O   . GLY A 1 294  ? 60.432  -21.424 15.204  1.00 22.42  ? 294  GLY A O   1 
ATOM 2118  N N   . GLY A 1 295  ? 58.865  -20.193 16.218  1.00 13.63  ? 295  GLY A N   1 
ATOM 2119  C CA  . GLY A 1 295  ? 59.585  -19.013 15.814  1.00 8.75   ? 295  GLY A CA  1 
ATOM 2120  C C   . GLY A 1 295  ? 59.023  -17.823 16.528  1.00 8.75   ? 295  GLY A C   1 
ATOM 2121  O O   . GLY A 1 295  ? 58.162  -17.928 17.403  1.00 8.75   ? 295  GLY A O   1 
ATOM 2122  N N   . ALA A 1 296  ? 59.541  -16.686 16.122  1.00 9.80   ? 296  ALA A N   1 
ATOM 2123  C CA  . ALA A 1 296  ? 59.136  -15.409 16.647  1.00 22.26  ? 296  ALA A CA  1 
ATOM 2124  C C   . ALA A 1 296  ? 58.917  -14.468 15.477  1.00 9.80   ? 296  ALA A C   1 
ATOM 2125  O O   . ALA A 1 296  ? 59.311  -14.746 14.342  1.00 10.00  ? 296  ALA A O   1 
ATOM 2126  C CB  . ALA A 1 296  ? 60.199  -14.859 17.605  1.00 69.53  ? 296  ALA A CB  1 
ATOM 2127  N N   . GLY A 1 297  ? 58.268  -13.355 15.752  1.00 13.46  ? 297  GLY A N   1 
ATOM 2128  C CA  . GLY A 1 297  ? 58.315  -12.307 14.767  1.00 15.28  ? 297  GLY A CA  1 
ATOM 2129  C C   . GLY A 1 297  ? 59.746  -11.878 14.544  1.00 20.55  ? 297  GLY A C   1 
ATOM 2130  O O   . GLY A 1 297  ? 60.435  -11.482 15.485  1.00 38.90  ? 297  GLY A O   1 
ATOM 2131  N N   . TYR A 1 298  ? 60.214  -11.965 13.315  1.00 12.22  ? 298  TYR A N   1 
ATOM 2132  C CA  . TYR A 1 298  ? 61.487  -11.391 12.923  1.00 19.68  ? 298  TYR A CA  1 
ATOM 2133  C C   . TYR A 1 298  ? 61.287  -10.605 11.629  1.00 26.49  ? 298  TYR A C   1 
ATOM 2134  O O   . TYR A 1 298  ? 60.333  -10.850 10.881  1.00 23.44  ? 298  TYR A O   1 
ATOM 2135  C CB  . TYR A 1 298  ? 62.555  -12.479 12.753  1.00 16.44  ? 298  TYR A CB  1 
ATOM 2136  C CG  . TYR A 1 298  ? 63.049  -13.156 14.006  1.00 18.63  ? 298  TYR A CG  1 
ATOM 2137  C CD1 . TYR A 1 298  ? 63.365  -12.422 15.158  1.00 17.46  ? 298  TYR A CD1 1 
ATOM 2138  C CD2 . TYR A 1 298  ? 63.287  -14.521 14.000  1.00 26.37  ? 298  TYR A CD2 1 
ATOM 2139  C CE1 . TYR A 1 298  ? 63.788  -13.023 16.279  1.00 16.47  ? 298  TYR A CE1 1 
ATOM 2140  C CE2 . TYR A 1 298  ? 63.757  -15.146 15.144  1.00 32.02  ? 298  TYR A CE2 1 
ATOM 2141  C CZ  . TYR A 1 298  ? 63.956  -14.368 16.292  1.00 22.33  ? 298  TYR A CZ  1 
ATOM 2142  O OH  . TYR A 1 298  ? 64.497  -14.918 17.411  1.00 16.64  ? 298  TYR A OH  1 
ATOM 2143  N N   . TRP A 1 299  ? 62.148  -9.588  11.417  1.00 36.43  ? 299  TRP A N   1 
ATOM 2144  C CA  . TRP A 1 299  ? 62.267  -8.939  10.106  1.00 36.98  ? 299  TRP A CA  1 
ATOM 2145  C C   . TRP A 1 299  ? 62.211  -10.019 9.061   1.00 26.66  ? 299  TRP A C   1 
ATOM 2146  O O   . TRP A 1 299  ? 62.967  -10.983 9.134   1.00 23.61  ? 299  TRP A O   1 
ATOM 2147  C CB  . TRP A 1 299  ? 63.589  -8.173  9.967   1.00 48.12  ? 299  TRP A CB  1 
ATOM 2148  C CG  . TRP A 1 299  ? 63.623  -6.716  10.365  1.00 39.57  ? 299  TRP A CG  1 
ATOM 2149  C CD1 . TRP A 1 299  ? 64.732  -5.928  10.389  1.00 44.14  ? 299  TRP A CD1 1 
ATOM 2150  C CD2 . TRP A 1 299  ? 62.527  -5.873  10.775  1.00 20.37  ? 299  TRP A CD2 1 
ATOM 2151  N NE1 . TRP A 1 299  ? 64.401  -4.660  10.784  1.00 32.31  ? 299  TRP A NE1 1 
ATOM 2152  C CE2 . TRP A 1 299  ? 63.057  -4.599  11.029  1.00 13.56  ? 299  TRP A CE2 1 
ATOM 2153  C CE3 . TRP A 1 299  ? 61.162  -6.073  10.956  1.00 19.81  ? 299  TRP A CE3 1 
ATOM 2154  C CZ2 . TRP A 1 299  ? 62.274  -3.535  11.449  1.00 8.82   ? 299  TRP A CZ2 1 
ATOM 2155  C CZ3 . TRP A 1 299  ? 60.387  -5.005  11.377  1.00 11.85  ? 299  TRP A CZ3 1 
ATOM 2156  C CH2 . TRP A 1 299  ? 60.947  -3.757  11.617  1.00 9.37   ? 299  TRP A CH2 1 
ATOM 2157  N N   . ASN A 1 300  ? 61.282  -9.882  8.131   1.00 22.89  ? 300  ASN A N   1 
ATOM 2158  C CA  . ASN A 1 300  ? 60.914  -10.949 7.213   1.00 24.69  ? 300  ASN A CA  1 
ATOM 2159  C C   . ASN A 1 300  ? 60.239  -12.165 7.894   1.00 30.71  ? 300  ASN A C   1 
ATOM 2160  O O   . ASN A 1 300  ? 59.590  -12.952 7.200   1.00 37.64  ? 300  ASN A O   1 
ATOM 2161  C CB  . ASN A 1 300  ? 62.138  -11.299 6.300   1.00 30.57  ? 300  ASN A CB  1 
ATOM 2162  C CG  . ASN A 1 300  ? 63.335  -11.995 7.010   1.00 35.02  ? 300  ASN A CG  1 
ATOM 2163  O OD1 . ASN A 1 300  ? 64.473  -11.941 6.518   1.00 32.12  ? 300  ASN A OD1 1 
ATOM 2164  N ND2 . ASN A 1 300  ? 63.075  -12.663 8.142   1.00 43.40  ? 300  ASN A ND2 1 
ATOM 2165  N N   . SER A 1 301  ? 60.249  -12.300 9.232   1.00 21.66  ? 301  SER A N   1 
ATOM 2166  C CA  . SER A 1 301  ? 59.499  -13.424 9.818   1.00 17.79  ? 301  SER A CA  1 
ATOM 2167  C C   . SER A 1 301  ? 58.051  -13.442 9.376   1.00 17.37  ? 301  SER A C   1 
ATOM 2168  O O   . SER A 1 301  ? 57.458  -14.522 9.241   1.00 16.57  ? 301  SER A O   1 
ATOM 2169  C CB  . SER A 1 301  ? 59.529  -13.379 11.323  1.00 12.74  ? 301  SER A CB  1 
ATOM 2170  O OG  . SER A 1 301  ? 60.679  -14.063 11.737  1.00 8.72   ? 301  SER A OG  1 
ATOM 2171  N N   . LEU A 1 302  ? 57.470  -12.257 9.189   1.00 19.26  ? 302  LEU A N   1 
ATOM 2172  C CA  . LEU A 1 302  ? 56.105  -12.084 8.715   1.00 19.02  ? 302  LEU A CA  1 
ATOM 2173  C C   . LEU A 1 302  ? 55.206  -11.893 9.925   1.00 25.18  ? 302  LEU A C   1 
ATOM 2174  O O   . LEU A 1 302  ? 55.670  -12.142 11.041  1.00 41.39  ? 302  LEU A O   1 
ATOM 2175  C CB  . LEU A 1 302  ? 55.691  -13.285 7.881   1.00 15.75  ? 302  LEU A CB  1 
ATOM 2176  C CG  . LEU A 1 302  ? 54.790  -12.884 6.757   1.00 15.17  ? 302  LEU A CG  1 
ATOM 2177  C CD1 . LEU A 1 302  ? 55.282  -11.503 6.521   1.00 13.89  ? 302  LEU A CD1 1 
ATOM 2178  C CD2 . LEU A 1 302  ? 55.121  -13.760 5.596   1.00 8.76   ? 302  LEU A CD2 1 
ATOM 2179  N N   . PHE A 1 303  ? 53.945  -11.468 9.776   1.00 21.57  ? 303  PHE A N   1 
ATOM 2180  C CA  . PHE A 1 303  ? 53.181  -11.210 10.997  1.00 23.22  ? 303  PHE A CA  1 
ATOM 2181  C C   . PHE A 1 303  ? 51.726  -11.646 10.965  1.00 17.73  ? 303  PHE A C   1 
ATOM 2182  O O   . PHE A 1 303  ? 51.039  -11.495 9.956   1.00 19.29  ? 303  PHE A O   1 
ATOM 2183  C CB  . PHE A 1 303  ? 53.270  -9.747  11.383  1.00 22.48  ? 303  PHE A CB  1 
ATOM 2184  C CG  . PHE A 1 303  ? 54.365  -9.514  12.325  1.00 24.48  ? 303  PHE A CG  1 
ATOM 2185  C CD1 . PHE A 1 303  ? 54.140  -9.383  13.691  1.00 26.82  ? 303  PHE A CD1 1 
ATOM 2186  C CD2 . PHE A 1 303  ? 55.649  -9.580  11.860  1.00 24.80  ? 303  PHE A CD2 1 
ATOM 2187  C CE1 . PHE A 1 303  ? 55.179  -9.203  14.538  1.00 29.14  ? 303  PHE A CE1 1 
ATOM 2188  C CE2 . PHE A 1 303  ? 56.700  -9.460  12.730  1.00 28.23  ? 303  PHE A CE2 1 
ATOM 2189  C CZ  . PHE A 1 303  ? 56.456  -9.298  14.068  1.00 32.70  ? 303  PHE A CZ  1 
ATOM 2190  N N   . ARG A 1 304  ? 51.257  -12.166 12.098  1.00 14.86  ? 304  ARG A N   1 
ATOM 2191  C CA  . ARG A 1 304  ? 49.923  -12.729 12.212  1.00 15.29  ? 304  ARG A CA  1 
ATOM 2192  C C   . ARG A 1 304  ? 49.258  -12.205 13.468  1.00 19.87  ? 304  ARG A C   1 
ATOM 2193  O O   . ARG A 1 304  ? 49.889  -12.179 14.531  1.00 20.83  ? 304  ARG A O   1 
ATOM 2194  C CB  . ARG A 1 304  ? 49.968  -14.244 12.299  1.00 20.89  ? 304  ARG A CB  1 
ATOM 2195  C CG  . ARG A 1 304  ? 49.776  -14.983 11.011  1.00 19.74  ? 304  ARG A CG  1 
ATOM 2196  C CD  . ARG A 1 304  ? 49.112  -14.154 9.978   1.00 10.01  ? 304  ARG A CD  1 
ATOM 2197  N NE  . ARG A 1 304  ? 48.487  -15.026 9.020   1.00 9.44   ? 304  ARG A NE  1 
ATOM 2198  C CZ  . ARG A 1 304  ? 47.585  -14.602 8.170   1.00 8.91   ? 304  ARG A CZ  1 
ATOM 2199  N NH1 . ARG A 1 304  ? 47.246  -13.341 8.195   1.00 13.04  ? 304  ARG A NH1 1 
ATOM 2200  N NH2 . ARG A 1 304  ? 47.059  -15.416 7.289   1.00 11.57  ? 304  ARG A NH2 1 
ATOM 2201  N N   . PHE A 1 305  ? 47.969  -11.859 13.358  1.00 28.92  ? 305  PHE A N   1 
ATOM 2202  C CA  . PHE A 1 305  ? 47.200  -11.224 14.423  1.00 26.47  ? 305  PHE A CA  1 
ATOM 2203  C C   . PHE A 1 305  ? 45.789  -11.815 14.468  1.00 34.54  ? 305  PHE A C   1 
ATOM 2204  O O   . PHE A 1 305  ? 44.998  -11.632 13.535  1.00 41.18  ? 305  PHE A O   1 
ATOM 2205  C CB  . PHE A 1 305  ? 47.167  -9.700  14.201  1.00 18.70  ? 305  PHE A CB  1 
ATOM 2206  C CG  . PHE A 1 305  ? 48.238  -9.215  13.276  1.00 9.27   ? 305  PHE A CG  1 
ATOM 2207  C CD1 . PHE A 1 305  ? 49.558  -9.365  13.613  1.00 10.12  ? 305  PHE A CD1 1 
ATOM 2208  C CD2 . PHE A 1 305  ? 47.918  -8.613  12.083  1.00 13.35  ? 305  PHE A CD2 1 
ATOM 2209  C CE1 . PHE A 1 305  ? 50.530  -8.966  12.785  1.00 11.28  ? 305  PHE A CE1 1 
ATOM 2210  C CE2 . PHE A 1 305  ? 48.891  -8.185  11.242  1.00 13.69  ? 305  PHE A CE2 1 
ATOM 2211  C CZ  . PHE A 1 305  ? 50.209  -8.358  11.596  1.00 17.32  ? 305  PHE A CZ  1 
ATOM 2212  N N   . LYS A 1 306  ? 45.463  -12.538 15.536  1.00 21.91  ? 306  LYS A N   1 
ATOM 2213  C CA  . LYS A 1 306  ? 44.110  -13.064 15.708  1.00 17.99  ? 306  LYS A CA  1 
ATOM 2214  C C   . LYS A 1 306  ? 43.399  -12.394 16.844  1.00 20.57  ? 306  LYS A C   1 
ATOM 2215  O O   . LYS A 1 306  ? 44.004  -11.808 17.750  1.00 23.38  ? 306  LYS A O   1 
ATOM 2216  C CB  . LYS A 1 306  ? 44.055  -14.556 16.041  1.00 15.11  ? 306  LYS A CB  1 
ATOM 2217  C CG  . LYS A 1 306  ? 42.615  -15.131 15.764  1.00 15.75  ? 306  LYS A CG  1 
ATOM 2218  C CD  . LYS A 1 306  ? 42.308  -16.583 16.240  1.00 17.47  ? 306  LYS A CD  1 
ATOM 2219  C CE  . LYS A 1 306  ? 42.928  -17.669 15.241  1.00 20.28  ? 306  LYS A CE  1 
ATOM 2220  N NZ  . LYS A 1 306  ? 44.230  -18.338 15.822  1.00 24.88  ? 306  LYS A NZ  1 
ATOM 2221  N N   . HIS A 1 307  ? 42.132  -12.670 16.869  1.00 21.55  ? 307  HIS A N   1 
ATOM 2222  C CA  . HIS A 1 307  ? 41.316  -12.240 17.998  1.00 25.38  ? 307  HIS A CA  1 
ATOM 2223  C C   . HIS A 1 307  ? 41.120  -13.455 18.864  1.00 24.44  ? 307  HIS A C   1 
ATOM 2224  O O   . HIS A 1 307  ? 40.177  -14.210 18.666  1.00 20.09  ? 307  HIS A O   1 
ATOM 2225  C CB  . HIS A 1 307  ? 40.017  -11.690 17.488  1.00 25.62  ? 307  HIS A CB  1 
ATOM 2226  C CG  . HIS A 1 307  ? 39.878  -10.198 17.639  1.00 25.89  ? 307  HIS A CG  1 
ATOM 2227  N ND1 . HIS A 1 307  ? 38.763  -9.681  18.239  1.00 29.42  ? 307  HIS A ND1 1 
ATOM 2228  C CD2 . HIS A 1 307  ? 40.743  -9.147  17.516  1.00 17.64  ? 307  HIS A CD2 1 
ATOM 2229  C CE1 . HIS A 1 307  ? 38.862  -8.385  18.306  1.00 23.55  ? 307  HIS A CE1 1 
ATOM 2230  N NE2 . HIS A 1 307  ? 40.033  -8.024  17.857  1.00 20.70  ? 307  HIS A NE2 1 
ATOM 2231  N N   . LEU A 1 308  ? 41.869  -13.456 19.967  1.00 27.13  ? 308  LEU A N   1 
ATOM 2232  C CA  . LEU A 1 308  ? 41.720  -14.441 21.032  1.00 21.20  ? 308  LEU A CA  1 
ATOM 2233  C C   . LEU A 1 308  ? 40.254  -14.693 21.347  1.00 20.64  ? 308  LEU A C   1 
ATOM 2234  O O   . LEU A 1 308  ? 39.716  -15.766 21.043  1.00 20.83  ? 308  LEU A O   1 
ATOM 2235  C CB  . LEU A 1 308  ? 42.499  -13.972 22.276  1.00 17.98  ? 308  LEU A CB  1 
ATOM 2236  C CG  . LEU A 1 308  ? 42.643  -12.602 22.974  1.00 17.41  ? 308  LEU A CG  1 
ATOM 2237  C CD1 . LEU A 1 308  ? 41.377  -12.207 23.573  1.00 18.96  ? 308  LEU A CD1 1 
ATOM 2238  C CD2 . LEU A 1 308  ? 43.542  -12.739 24.144  1.00 17.49  ? 308  LEU A CD2 1 
ATOM 2239  N N   . ALA A 1 309  ? 39.594  -13.699 21.943  1.00 20.12  ? 309  ALA A N   1 
ATOM 2240  C CA  . ALA A 1 309  ? 38.238  -13.899 22.434  1.00 20.05  ? 309  ALA A CA  1 
ATOM 2241  C C   . ALA A 1 309  ? 37.379  -14.532 21.360  1.00 18.32  ? 309  ALA A C   1 
ATOM 2242  O O   . ALA A 1 309  ? 36.693  -15.539 21.582  1.00 18.31  ? 309  ALA A O   1 
ATOM 2243  C CB  . ALA A 1 309  ? 37.644  -12.563 22.881  1.00 27.11  ? 309  ALA A CB  1 
ATOM 2244  N N   . THR A 1 310  ? 37.413  -13.956 20.184  1.00 16.83  ? 310  THR A N   1 
ATOM 2245  C CA  . THR A 1 310  ? 36.651  -14.521 19.105  1.00 19.15  ? 310  THR A CA  1 
ATOM 2246  C C   . THR A 1 310  ? 37.478  -15.486 18.258  1.00 21.61  ? 310  THR A C   1 
ATOM 2247  O O   . THR A 1 310  ? 36.899  -16.255 17.496  1.00 27.60  ? 310  THR A O   1 
ATOM 2248  C CB  . THR A 1 310  ? 36.053  -13.380 18.263  1.00 22.71  ? 310  THR A CB  1 
ATOM 2249  O OG1 . THR A 1 310  ? 37.111  -12.594 17.715  1.00 30.44  ? 310  THR A OG1 1 
ATOM 2250  C CG2 . THR A 1 310  ? 35.135  -12.451 19.113  1.00 23.04  ? 310  THR A CG2 1 
ATOM 2251  N N   . GLY A 1 311  ? 38.797  -15.533 18.403  1.00 17.36  ? 311  GLY A N   1 
ATOM 2252  C CA  . GLY A 1 311  ? 39.531  -16.390 17.483  1.00 17.40  ? 311  GLY A CA  1 
ATOM 2253  C C   . GLY A 1 311  ? 39.423  -15.895 16.058  1.00 21.59  ? 311  GLY A C   1 
ATOM 2254  O O   . GLY A 1 311  ? 39.317  -16.702 15.125  1.00 20.95  ? 311  GLY A O   1 
ATOM 2255  N N   . HIS A 1 312  ? 39.450  -14.575 15.868  1.00 20.47  ? 312  HIS A N   1 
ATOM 2256  C CA  . HIS A 1 312  ? 39.329  -13.954 14.552  1.00 22.06  ? 312  HIS A CA  1 
ATOM 2257  C C   . HIS A 1 312  ? 40.616  -13.203 14.225  1.00 18.16  ? 312  HIS A C   1 
ATOM 2258  O O   . HIS A 1 312  ? 40.980  -12.249 14.920  1.00 15.77  ? 312  HIS A O   1 
ATOM 2259  C CB  . HIS A 1 312  ? 38.155  -12.959 14.470  1.00 29.51  ? 312  HIS A CB  1 
ATOM 2260  C CG  . HIS A 1 312  ? 36.813  -13.482 14.917  1.00 34.50  ? 312  HIS A CG  1 
ATOM 2261  N ND1 . HIS A 1 312  ? 36.575  -14.794 15.265  1.00 37.50  ? 312  HIS A ND1 1 
ATOM 2262  C CD2 . HIS A 1 312  ? 35.628  -12.835 15.067  1.00 31.09  ? 312  HIS A CD2 1 
ATOM 2263  C CE1 . HIS A 1 312  ? 35.306  -14.931 15.618  1.00 39.26  ? 312  HIS A CE1 1 
ATOM 2264  N NE2 . HIS A 1 312  ? 34.706  -13.758 15.498  1.00 27.67  ? 312  HIS A NE2 1 
ATOM 2265  N N   . TYR A 1 313  ? 41.280  -13.595 13.146  1.00 18.08  ? 313  TYR A N   1 
ATOM 2266  C CA  . TYR A 1 313  ? 42.417  -12.809 12.691  1.00 21.35  ? 313  TYR A CA  1 
ATOM 2267  C C   . TYR A 1 313  ? 41.913  -11.452 12.181  1.00 20.59  ? 313  TYR A C   1 
ATOM 2268  O O   . TYR A 1 313  ? 40.761  -11.314 11.772  1.00 17.47  ? 313  TYR A O   1 
ATOM 2269  C CB  . TYR A 1 313  ? 43.203  -13.571 11.585  1.00 28.98  ? 313  TYR A CB  1 
ATOM 2270  C CG  . TYR A 1 313  ? 44.079  -14.792 12.030  1.00 22.43  ? 313  TYR A CG  1 
ATOM 2271  C CD1 . TYR A 1 313  ? 44.339  -15.004 13.370  1.00 17.99  ? 313  TYR A CD1 1 
ATOM 2272  C CD2 . TYR A 1 313  ? 44.657  -15.707 11.101  1.00 16.28  ? 313  TYR A CD2 1 
ATOM 2273  C CE1 . TYR A 1 313  ? 45.080  -16.073 13.828  1.00 14.04  ? 313  TYR A CE1 1 
ATOM 2274  C CE2 . TYR A 1 313  ? 45.448  -16.790 11.559  1.00 9.05   ? 313  TYR A CE2 1 
ATOM 2275  C CZ  . TYR A 1 313  ? 45.646  -16.937 12.940  1.00 9.81   ? 313  TYR A CZ  1 
ATOM 2276  O OH  . TYR A 1 313  ? 46.382  -17.933 13.524  1.00 8.76   ? 313  TYR A OH  1 
ATOM 2277  N N   . LEU A 1 314  ? 42.771  -10.439 12.221  1.00 22.47  ? 314  LEU A N   1 
ATOM 2278  C CA  . LEU A 1 314  ? 42.539  -9.215  11.447  1.00 29.73  ? 314  LEU A CA  1 
ATOM 2279  C C   . LEU A 1 314  ? 42.836  -9.449  9.953   1.00 30.35  ? 314  LEU A C   1 
ATOM 2280  O O   . LEU A 1 314  ? 43.744  -10.203 9.613   1.00 37.01  ? 314  LEU A O   1 
ATOM 2281  C CB  . LEU A 1 314  ? 43.429  -8.091  11.994  1.00 40.77  ? 314  LEU A CB  1 
ATOM 2282  C CG  . LEU A 1 314  ? 44.150  -7.127  11.018  1.00 49.36  ? 314  LEU A CG  1 
ATOM 2283  C CD1 . LEU A 1 314  ? 43.252  -5.974  10.554  1.00 38.16  ? 314  LEU A CD1 1 
ATOM 2284  C CD2 . LEU A 1 314  ? 45.475  -6.561  11.599  1.00 38.75  ? 314  LEU A CD2 1 
ATOM 2285  N N   . ALA A 1 315  ? 42.072  -8.797  9.024   1.00 32.44  ? 315  ALA A N   1 
ATOM 2286  C CA  . ALA A 1 315  ? 42.208  -8.910  7.519   1.00 23.20  ? 315  ALA A CA  1 
ATOM 2287  C C   . ALA A 1 315  ? 41.993  -7.562  6.780   1.00 22.41  ? 315  ALA A C   1 
ATOM 2288  O O   . ALA A 1 315  ? 40.920  -7.256  6.274   1.00 22.46  ? 315  ALA A O   1 
ATOM 2289  C CB  . ALA A 1 315  ? 41.218  -9.909  6.958   1.00 18.85  ? 315  ALA A CB  1 
ATOM 2290  N N   . ALA A 1 316  ? 43.040  -6.784  6.597   1.00 20.46  ? 316  ALA A N   1 
ATOM 2291  C CA  . ALA A 1 316  ? 42.888  -5.326  6.534   1.00 23.23  ? 316  ALA A CA  1 
ATOM 2292  C C   . ALA A 1 316  ? 43.202  -4.726  5.160   1.00 21.62  ? 316  ALA A C   1 
ATOM 2293  O O   . ALA A 1 316  ? 44.368  -4.652  4.743   1.00 17.87  ? 316  ALA A O   1 
ATOM 2294  C CB  . ALA A 1 316  ? 43.762  -4.760  7.625   1.00 20.09  ? 316  ALA A CB  1 
ATOM 2295  N N   . GLU A 1 317  ? 42.152  -4.315  4.443   1.00 31.26  ? 317  GLU A N   1 
ATOM 2296  C CA  . GLU A 1 317  ? 42.315  -3.968  3.043   1.00 29.32  ? 317  GLU A CA  1 
ATOM 2297  C C   . GLU A 1 317  ? 41.854  -2.534  2.832   1.00 31.07  ? 317  GLU A C   1 
ATOM 2298  O O   . GLU A 1 317  ? 42.663  -1.598  3.030   1.00 24.84  ? 317  GLU A O   1 
ATOM 2299  C CB  . GLU A 1 317  ? 41.607  -5.011  2.169   1.00 30.42  ? 317  GLU A CB  1 
ATOM 2300  C CG  . GLU A 1 317  ? 42.334  -6.367  2.027   1.00 25.27  ? 317  GLU A CG  1 
ATOM 2301  C CD  . GLU A 1 317  ? 42.409  -7.061  3.357   1.00 30.29  ? 317  GLU A CD  1 
ATOM 2302  O OE1 . GLU A 1 317  ? 41.590  -6.739  4.244   1.00 30.16  ? 317  GLU A OE1 1 
ATOM 2303  O OE2 . GLU A 1 317  ? 43.292  -7.911  3.518   1.00 32.88  ? 317  GLU A OE2 1 
ATOM 2304  N N   . VAL A 1 318  ? 40.572  -2.288  2.459   1.00 36.26  ? 318  VAL A N   1 
ATOM 2305  C CA  . VAL A 1 318  ? 40.067  -0.992  1.949   1.00 27.70  ? 318  VAL A CA  1 
ATOM 2306  C C   . VAL A 1 318  ? 38.714  -0.582  2.565   1.00 16.90  ? 318  VAL A C   1 
ATOM 2307  O O   . VAL A 1 318  ? 37.797  -1.402  2.714   1.00 10.47  ? 318  VAL A O   1 
ATOM 2308  C CB  . VAL A 1 318  ? 39.895  -0.985  0.408   1.00 33.13  ? 318  VAL A CB  1 
ATOM 2309  C CG1 . VAL A 1 318  ? 40.591  0.203   -0.288  1.00 27.69  ? 318  VAL A CG1 1 
ATOM 2310  C CG2 . VAL A 1 318  ? 40.200  -2.319  -0.237  1.00 42.42  ? 318  VAL A CG2 1 
ATOM 2311  N N   . ASP A 1 319  ? 38.572  0.715   2.847   1.00 15.01  ? 319  ASP A N   1 
ATOM 2312  C CA  . ASP A 1 319  ? 37.275  1.349   3.113   1.00 8.76   ? 319  ASP A CA  1 
ATOM 2313  C C   . ASP A 1 319  ? 36.342  1.139   1.930   1.00 8.76   ? 319  ASP A C   1 
ATOM 2314  O O   . ASP A 1 319  ? 36.215  2.001   1.064   1.00 8.76   ? 319  ASP A O   1 
ATOM 2315  C CB  . ASP A 1 319  ? 37.449  2.857   3.396   1.00 8.76   ? 319  ASP A CB  1 
ATOM 2316  C CG  . ASP A 1 319  ? 36.197  3.678   3.086   1.00 8.76   ? 319  ASP A CG  1 
ATOM 2317  O OD1 . ASP A 1 319  ? 35.226  3.594   3.860   1.00 8.76   ? 319  ASP A OD1 1 
ATOM 2318  O OD2 . ASP A 1 319  ? 36.190  4.419   2.076   1.00 8.76   ? 319  ASP A OD2 1 
ATOM 2319  N N   . VAL A 1 352  ? 41.386  5.753   1.795   1.00 8.73   ? 352  VAL A N   1 
ATOM 2320  C CA  . VAL A 1 352  ? 41.697  4.793   0.735   1.00 10.20  ? 352  VAL A CA  1 
ATOM 2321  C C   . VAL A 1 352  ? 41.513  3.358   1.233   1.00 18.46  ? 352  VAL A C   1 
ATOM 2322  O O   . VAL A 1 352  ? 40.440  2.789   1.075   1.00 27.21  ? 352  VAL A O   1 
ATOM 2323  C CB  . VAL A 1 352  ? 43.125  5.014   0.178   1.00 9.15   ? 352  VAL A CB  1 
ATOM 2324  C CG1 . VAL A 1 352  ? 43.347  4.258   -1.150  1.00 11.28  ? 352  VAL A CG1 1 
ATOM 2325  C CG2 . VAL A 1 352  ? 43.378  6.492   -0.017  1.00 8.73   ? 352  VAL A CG2 1 
ATOM 2326  N N   . TYR A 1 353  ? 42.552  2.774   1.839   1.00 19.40  ? 353  TYR A N   1 
ATOM 2327  C CA  . TYR A 1 353  ? 42.501  1.425   2.384   1.00 19.81  ? 353  TYR A CA  1 
ATOM 2328  C C   . TYR A 1 353  ? 42.343  1.496   3.904   1.00 19.01  ? 353  TYR A C   1 
ATOM 2329  O O   . TYR A 1 353  ? 42.816  2.435   4.552   1.00 16.86  ? 353  TYR A O   1 
ATOM 2330  C CB  . TYR A 1 353  ? 43.748  0.619   1.956   1.00 15.66  ? 353  TYR A CB  1 
ATOM 2331  C CG  . TYR A 1 353  ? 43.613  0.012   0.567   1.00 17.52  ? 353  TYR A CG  1 
ATOM 2332  C CD1 . TYR A 1 353  ? 43.768  0.789   -0.577  1.00 18.16  ? 353  TYR A CD1 1 
ATOM 2333  C CD2 . TYR A 1 353  ? 43.352  -1.344  0.395   1.00 20.95  ? 353  TYR A CD2 1 
ATOM 2334  C CE1 . TYR A 1 353  ? 43.592  0.247   -1.842  1.00 14.54  ? 353  TYR A CE1 1 
ATOM 2335  C CE2 . TYR A 1 353  ? 43.237  -1.903  -0.868  1.00 23.39  ? 353  TYR A CE2 1 
ATOM 2336  C CZ  . TYR A 1 353  ? 43.348  -1.090  -1.978  1.00 21.08  ? 353  TYR A CZ  1 
ATOM 2337  O OH  . TYR A 1 353  ? 43.236  -1.598  -3.244  1.00 27.26  ? 353  TYR A OH  1 
ATOM 2338  N N   . SER A 1 354  ? 41.583  0.548   4.455   1.00 22.84  ? 354  SER A N   1 
ATOM 2339  C CA  . SER A 1 354  ? 41.268  0.467   5.880   1.00 24.03  ? 354  SER A CA  1 
ATOM 2340  C C   . SER A 1 354  ? 41.163  -0.994  6.293   1.00 34.10  ? 354  SER A C   1 
ATOM 2341  O O   . SER A 1 354  ? 40.785  -1.853  5.481   1.00 40.74  ? 354  SER A O   1 
ATOM 2342  C CB  . SER A 1 354  ? 39.948  1.172   6.207   1.00 19.96  ? 354  SER A CB  1 
ATOM 2343  O OG  . SER A 1 354  ? 38.929  0.673   5.351   1.00 17.79  ? 354  SER A OG  1 
ATOM 2344  N N   . LEU A 1 355  ? 41.438  -1.251  7.582   1.00 33.29  ? 355  LEU A N   1 
ATOM 2345  C CA  . LEU A 1 355  ? 41.568  -2.635  8.109   1.00 29.73  ? 355  LEU A CA  1 
ATOM 2346  C C   . LEU A 1 355  ? 40.222  -3.349  8.240   1.00 31.40  ? 355  LEU A C   1 
ATOM 2347  O O   . LEU A 1 355  ? 39.348  -2.909  9.004   1.00 38.37  ? 355  LEU A O   1 
ATOM 2348  C CB  . LEU A 1 355  ? 42.290  -2.589  9.479   1.00 23.22  ? 355  LEU A CB  1 
ATOM 2349  C CG  . LEU A 1 355  ? 43.819  -2.693  9.521   1.00 21.50  ? 355  LEU A CG  1 
ATOM 2350  C CD1 . LEU A 1 355  ? 44.494  -1.573  8.813   1.00 29.00  ? 355  LEU A CD1 1 
ATOM 2351  C CD2 . LEU A 1 355  ? 44.415  -2.933  10.912  1.00 21.96  ? 355  LEU A CD2 1 
ATOM 2352  N N   . VAL A 1 356  ? 40.059  -4.526  7.568   1.00 32.13  ? 356  VAL A N   1 
ATOM 2353  C CA  . VAL A 1 356  ? 38.809  -5.332  7.658   1.00 42.86  ? 356  VAL A CA  1 
ATOM 2354  C C   . VAL A 1 356  ? 39.177  -6.656  8.315   1.00 46.88  ? 356  VAL A C   1 
ATOM 2355  O O   . VAL A 1 356  ? 40.356  -7.001  8.285   1.00 38.49  ? 356  VAL A O   1 
ATOM 2356  C CB  . VAL A 1 356  ? 38.148  -5.499  6.273   1.00 35.16  ? 356  VAL A CB  1 
ATOM 2357  C CG1 . VAL A 1 356  ? 37.298  -4.309  6.031   1.00 30.87  ? 356  VAL A CG1 1 
ATOM 2358  C CG2 . VAL A 1 356  ? 39.162  -5.549  5.092   1.00 34.23  ? 356  VAL A CG2 1 
ATOM 2359  N N   . SER A 1 357  ? 38.228  -7.361  8.962   1.00 73.42  ? 357  SER A N   1 
ATOM 2360  C CA  . SER A 1 357  ? 38.559  -8.532  9.824   1.00 69.06  ? 357  SER A CA  1 
ATOM 2361  C C   . SER A 1 357  ? 38.509  -9.863  9.052   1.00 40.58  ? 357  SER A C   1 
ATOM 2362  O O   . SER A 1 357  ? 37.525  -10.153 8.368   1.00 41.63  ? 357  SER A O   1 
ATOM 2363  C CB  . SER A 1 357  ? 37.615  -8.598  11.042  1.00 94.26  ? 357  SER A CB  1 
ATOM 2364  O OG  . SER A 1 357  ? 38.068  -7.801  12.138  1.00 141.50 ? 357  SER A OG  1 
ATOM 2365  N N   . VAL A 1 358  ? 39.567  -10.681 9.174   1.00 24.55  ? 358  VAL A N   1 
ATOM 2366  C CA  . VAL A 1 358  ? 39.538  -12.054 8.677   1.00 20.73  ? 358  VAL A CA  1 
ATOM 2367  C C   . VAL A 1 358  ? 38.938  -12.932 9.769   1.00 21.16  ? 358  VAL A C   1 
ATOM 2368  O O   . VAL A 1 358  ? 39.466  -12.955 10.894  1.00 20.07  ? 358  VAL A O   1 
ATOM 2369  C CB  . VAL A 1 358  ? 40.890  -12.618 8.228   1.00 14.24  ? 358  VAL A CB  1 
ATOM 2370  C CG1 . VAL A 1 358  ? 40.956  -12.675 6.719   1.00 11.64  ? 358  VAL A CG1 1 
ATOM 2371  C CG2 . VAL A 1 358  ? 42.030  -11.930 8.816   1.00 18.33  ? 358  VAL A CG2 1 
ATOM 2372  N N   . PRO A 1 359  ? 37.870  -13.629 9.496   1.00 23.02  ? 359  PRO A N   1 
ATOM 2373  C CA  . PRO A 1 359  ? 37.354  -14.619 10.450  1.00 24.36  ? 359  PRO A CA  1 
ATOM 2374  C C   . PRO A 1 359  ? 38.082  -15.969 10.403  1.00 33.11  ? 359  PRO A C   1 
ATOM 2375  O O   . PRO A 1 359  ? 38.144  -16.643 11.438  1.00 26.15  ? 359  PRO A O   1 
ATOM 2376  C CB  . PRO A 1 359  ? 35.882  -14.749 10.037  1.00 29.06  ? 359  PRO A CB  1 
ATOM 2377  C CG  . PRO A 1 359  ? 35.851  -14.292 8.571   1.00 34.00  ? 359  PRO A CG  1 
ATOM 2378  C CD  . PRO A 1 359  ? 36.883  -13.235 8.475   1.00 29.58  ? 359  PRO A CD  1 
ATOM 2379  N N   . GLU A 1 360  ? 38.639  -16.368 9.241   1.00 49.43  ? 360  GLU A N   1 
ATOM 2380  C CA  . GLU A 1 360  ? 39.152  -17.728 9.004   1.00 52.43  ? 360  GLU A CA  1 
ATOM 2381  C C   . GLU A 1 360  ? 40.647  -17.727 8.690   1.00 52.63  ? 360  GLU A C   1 
ATOM 2382  O O   . GLU A 1 360  ? 41.127  -16.936 7.867   1.00 37.61  ? 360  GLU A O   1 
ATOM 2383  C CB  . GLU A 1 360  ? 38.398  -18.447 7.848   1.00 40.52  ? 360  GLU A CB  1 
ATOM 2384  C CG  . GLU A 1 360  ? 38.845  -18.104 6.406   1.00 18.93  ? 360  GLU A CG  1 
ATOM 2385  C CD  . GLU A 1 360  ? 38.138  -18.942 5.343   1.00 9.08   ? 360  GLU A CD  1 
ATOM 2386  O OE1 . GLU A 1 360  ? 38.461  -18.753 4.155   1.00 9.08   ? 360  GLU A OE1 1 
ATOM 2387  O OE2 . GLU A 1 360  ? 37.270  -19.782 5.684   1.00 9.08   ? 360  GLU A OE2 1 
ATOM 2388  N N   . GLY A 1 361  ? 41.368  -18.649 9.316   1.00 44.65  ? 361  GLY A N   1 
ATOM 2389  C CA  . GLY A 1 361  ? 42.809  -18.599 9.308   1.00 25.39  ? 361  GLY A CA  1 
ATOM 2390  C C   . GLY A 1 361  ? 43.421  -18.990 7.981   1.00 25.68  ? 361  GLY A C   1 
ATOM 2391  O O   . GLY A 1 361  ? 42.759  -19.259 6.970   1.00 27.51  ? 361  GLY A O   1 
ATOM 2392  N N   . ASN A 1 362  ? 44.747  -19.022 8.008   1.00 23.41  ? 362  ASN A N   1 
ATOM 2393  C CA  . ASN A 1 362  ? 45.539  -19.461 6.873   1.00 23.80  ? 362  ASN A CA  1 
ATOM 2394  C C   . ASN A 1 362  ? 45.170  -18.672 5.622   1.00 20.54  ? 362  ASN A C   1 
ATOM 2395  O O   . ASN A 1 362  ? 44.908  -19.240 4.556   1.00 19.13  ? 362  ASN A O   1 
ATOM 2396  C CB  . ASN A 1 362  ? 45.371  -20.966 6.640   1.00 26.20  ? 362  ASN A CB  1 
ATOM 2397  C CG  . ASN A 1 362  ? 45.118  -21.748 7.924   1.00 21.85  ? 362  ASN A CG  1 
ATOM 2398  O OD1 . ASN A 1 362  ? 45.415  -21.280 9.028   1.00 22.83  ? 362  ASN A OD1 1 
ATOM 2399  N ND2 . ASN A 1 362  ? 44.568  -22.955 7.778   1.00 19.04  ? 362  ASN A ND2 1 
ATOM 2400  N N   . ASP A 1 363  ? 45.142  -17.343 5.747   1.00 18.41  ? 363  ASP A N   1 
ATOM 2401  C CA  . ASP A 1 363  ? 44.997  -16.481 4.575   1.00 19.47  ? 363  ASP A CA  1 
ATOM 2402  C C   . ASP A 1 363  ? 46.161  -15.493 4.521   1.00 15.32  ? 363  ASP A C   1 
ATOM 2403  O O   . ASP A 1 363  ? 46.308  -14.615 5.385   1.00 13.57  ? 363  ASP A O   1 
ATOM 2404  C CB  . ASP A 1 363  ? 43.628  -15.797 4.544   1.00 16.45  ? 363  ASP A CB  1 
ATOM 2405  C CG  . ASP A 1 363  ? 43.656  -14.404 5.099   1.00 11.20  ? 363  ASP A CG  1 
ATOM 2406  O OD1 . ASP A 1 363  ? 43.884  -14.292 6.314   1.00 13.17  ? 363  ASP A OD1 1 
ATOM 2407  O OD2 . ASP A 1 363  ? 43.455  -13.423 4.343   1.00 16.66  ? 363  ASP A OD2 1 
ATOM 2408  N N   . ILE A 1 364  ? 47.007  -15.687 3.516   1.00 16.26  ? 364  ILE A N   1 
ATOM 2409  C CA  . ILE A 1 364  ? 48.158  -14.832 3.294   1.00 11.94  ? 364  ILE A CA  1 
ATOM 2410  C C   . ILE A 1 364  ? 47.738  -13.403 3.027   1.00 12.95  ? 364  ILE A C   1 
ATOM 2411  O O   . ILE A 1 364  ? 48.404  -12.471 3.448   1.00 9.62   ? 364  ILE A O   1 
ATOM 2412  C CB  . ILE A 1 364  ? 49.010  -15.383 2.138   1.00 18.53  ? 364  ILE A CB  1 
ATOM 2413  C CG1 . ILE A 1 364  ? 49.936  -16.506 2.603   1.00 14.64  ? 364  ILE A CG1 1 
ATOM 2414  C CG2 . ILE A 1 364  ? 49.815  -14.272 1.534   1.00 22.69  ? 364  ILE A CG2 1 
ATOM 2415  C CD1 . ILE A 1 364  ? 49.554  -17.148 3.904   1.00 8.71   ? 364  ILE A CD1 1 
ATOM 2416  N N   . SER A 1 365  ? 46.667  -13.185 2.292   1.00 12.52  ? 365  SER A N   1 
ATOM 2417  C CA  . SER A 1 365  ? 46.311  -11.801 2.086   1.00 10.78  ? 365  SER A CA  1 
ATOM 2418  C C   . SER A 1 365  ? 45.776  -11.157 3.329   1.00 18.72  ? 365  SER A C   1 
ATOM 2419  O O   . SER A 1 365  ? 45.310  -10.024 3.242   1.00 45.52  ? 365  SER A O   1 
ATOM 2420  C CB  . SER A 1 365  ? 45.230  -11.594 1.073   1.00 12.46  ? 365  SER A CB  1 
ATOM 2421  O OG  . SER A 1 365  ? 44.042  -11.421 1.828   1.00 12.12  ? 365  SER A OG  1 
ATOM 2422  N N   . SER A 1 366  ? 45.726  -11.845 4.454   1.00 17.44  ? 366  SER A N   1 
ATOM 2423  C CA  . SER A 1 366  ? 45.441  -11.091 5.657   1.00 25.88  ? 366  SER A CA  1 
ATOM 2424  C C   . SER A 1 366  ? 46.702  -10.866 6.485   1.00 36.64  ? 366  SER A C   1 
ATOM 2425  O O   . SER A 1 366  ? 46.623  -10.221 7.539   1.00 68.33  ? 366  SER A O   1 
ATOM 2426  C CB  . SER A 1 366  ? 44.324  -11.753 6.485   1.00 20.58  ? 366  SER A CB  1 
ATOM 2427  O OG  . SER A 1 366  ? 43.117  -11.929 5.747   1.00 8.95   ? 366  SER A OG  1 
ATOM 2428  N N   . ILE A 1 367  ? 47.887  -11.298 5.988   1.00 27.52  ? 367  ILE A N   1 
ATOM 2429  C CA  . ILE A 1 367  ? 49.129  -11.066 6.728   1.00 25.94  ? 367  ILE A CA  1 
ATOM 2430  C C   . ILE A 1 367  ? 49.637  -9.630  6.520   1.00 19.27  ? 367  ILE A C   1 
ATOM 2431  O O   . ILE A 1 367  ? 49.316  -8.949  5.540   1.00 13.57  ? 367  ILE A O   1 
ATOM 2432  C CB  . ILE A 1 367  ? 50.242  -12.087 6.402   1.00 23.81  ? 367  ILE A CB  1 
ATOM 2433  C CG1 . ILE A 1 367  ? 49.881  -13.029 5.280   1.00 16.09  ? 367  ILE A CG1 1 
ATOM 2434  C CG2 . ILE A 1 367  ? 50.498  -12.962 7.599   1.00 24.80  ? 367  ILE A CG2 1 
ATOM 2435  C CD1 . ILE A 1 367  ? 49.152  -14.193 5.767   1.00 11.36  ? 367  ILE A CD1 1 
ATOM 2436  N N   . PHE A 1 368  ? 50.466  -9.190  7.478   1.00 24.05  ? 368  PHE A N   1 
ATOM 2437  C CA  . PHE A 1 368  ? 51.055  -7.857  7.599   1.00 18.43  ? 368  PHE A CA  1 
ATOM 2438  C C   . PHE A 1 368  ? 52.537  -8.011  7.984   1.00 14.21  ? 368  PHE A C   1 
ATOM 2439  O O   . PHE A 1 368  ? 52.914  -8.910  8.739   1.00 13.15  ? 368  PHE A O   1 
ATOM 2440  C CB  . PHE A 1 368  ? 50.319  -6.992  8.684   1.00 21.45  ? 368  PHE A CB  1 
ATOM 2441  C CG  . PHE A 1 368  ? 48.932  -6.474  8.297   1.00 16.95  ? 368  PHE A CG  1 
ATOM 2442  C CD1 . PHE A 1 368  ? 48.141  -7.131  7.404   1.00 13.65  ? 368  PHE A CD1 1 
ATOM 2443  C CD2 . PHE A 1 368  ? 48.437  -5.320  8.882   1.00 15.05  ? 368  PHE A CD2 1 
ATOM 2444  C CE1 . PHE A 1 368  ? 46.937  -6.591  7.020   1.00 15.81  ? 368  PHE A CE1 1 
ATOM 2445  C CE2 . PHE A 1 368  ? 47.206  -4.831  8.557   1.00 16.69  ? 368  PHE A CE2 1 
ATOM 2446  C CZ  . PHE A 1 368  ? 46.469  -5.473  7.626   1.00 14.92  ? 368  PHE A CZ  1 
ATOM 2447  N N   . GLU A 1 369  ? 53.401  -7.153  7.452   1.00 10.08  ? 369  GLU A N   1 
ATOM 2448  C CA  . GLU A 1 369  ? 54.815  -7.165  7.824   1.00 8.88   ? 369  GLU A CA  1 
ATOM 2449  C C   . GLU A 1 369  ? 55.131  -5.875  8.567   1.00 13.27  ? 369  GLU A C   1 
ATOM 2450  O O   . GLU A 1 369  ? 54.662  -4.804  8.185   1.00 18.35  ? 369  GLU A O   1 
ATOM 2451  C CB  . GLU A 1 369  ? 55.721  -7.303  6.593   1.00 10.47  ? 369  GLU A CB  1 
ATOM 2452  C CG  . GLU A 1 369  ? 56.907  -6.316  6.566   1.00 18.48  ? 369  GLU A CG  1 
ATOM 2453  C CD  . GLU A 1 369  ? 57.780  -6.403  5.300   1.00 24.75  ? 369  GLU A CD  1 
ATOM 2454  O OE1 . GLU A 1 369  ? 59.004  -6.119  5.370   1.00 27.87  ? 369  GLU A OE1 1 
ATOM 2455  O OE2 . GLU A 1 369  ? 57.245  -6.755  4.233   1.00 34.49  ? 369  GLU A OE2 1 
ATOM 2456  N N   . LEU A 1 370  ? 55.900  -5.964  9.642   1.00 13.70  ? 370  LEU A N   1 
ATOM 2457  C CA  . LEU A 1 370  ? 56.129  -4.786  10.476  1.00 19.17  ? 370  LEU A CA  1 
ATOM 2458  C C   . LEU A 1 370  ? 56.791  -3.650  9.712   1.00 19.78  ? 370  LEU A C   1 
ATOM 2459  O O   . LEU A 1 370  ? 57.533  -3.864  8.763   1.00 31.25  ? 370  LEU A O   1 
ATOM 2460  C CB  . LEU A 1 370  ? 57.049  -5.121  11.614  1.00 23.26  ? 370  LEU A CB  1 
ATOM 2461  C CG  . LEU A 1 370  ? 57.003  -6.534  12.037  1.00 22.46  ? 370  LEU A CG  1 
ATOM 2462  C CD1 . LEU A 1 370  ? 58.037  -6.637  13.145  1.00 21.15  ? 370  LEU A CD1 1 
ATOM 2463  C CD2 . LEU A 1 370  ? 55.715  -6.454  12.794  1.00 29.19  ? 370  LEU A CD2 1 
ATOM 2464  N N   . ASP A 1 371  ? 56.490  -2.433  10.113  1.00 15.35  ? 371  ASP A N   1 
ATOM 2465  C CA  . ASP A 1 371  ? 57.443  -1.367  9.937   1.00 12.11  ? 371  ASP A CA  1 
ATOM 2466  C C   . ASP A 1 371  ? 57.814  -1.013  11.374  1.00 18.41  ? 371  ASP A C   1 
ATOM 2467  O O   . ASP A 1 371  ? 57.207  -1.593  12.279  1.00 23.17  ? 371  ASP A O   1 
ATOM 2468  C CB  . ASP A 1 371  ? 56.864  -0.184  9.205   1.00 8.88   ? 371  ASP A CB  1 
ATOM 2469  C CG  . ASP A 1 371  ? 57.727  0.281   8.152   1.00 8.88   ? 371  ASP A CG  1 
ATOM 2470  O OD1 . ASP A 1 371  ? 58.461  -0.567  7.629   1.00 8.88   ? 371  ASP A OD1 1 
ATOM 2471  O OD2 . ASP A 1 371  ? 57.655  1.465   7.832   1.00 8.88   ? 371  ASP A OD2 1 
ATOM 2472  N N   . PRO A 1 372  ? 58.720  -0.088  11.664  1.00 15.15  ? 372  PRO A N   1 
ATOM 2473  C CA  . PRO A 1 372  ? 58.852  0.285   13.078  1.00 14.77  ? 372  PRO A CA  1 
ATOM 2474  C C   . PRO A 1 372  ? 59.753  1.497   13.249  1.00 12.99  ? 372  PRO A C   1 
ATOM 2475  O O   . PRO A 1 372  ? 60.805  1.513   12.616  1.00 18.31  ? 372  PRO A O   1 
ATOM 2476  C CB  . PRO A 1 372  ? 59.413  -0.992  13.709  1.00 16.01  ? 372  PRO A CB  1 
ATOM 2477  N N   . THR A 1 373  ? 59.374  2.519   14.036  1.00 11.84  ? 373  THR A N   1 
ATOM 2478  C CA  . THR A 1 373  ? 59.969  3.853   13.896  1.00 13.46  ? 373  THR A CA  1 
ATOM 2479  C C   . THR A 1 373  ? 61.342  4.037   14.580  1.00 19.19  ? 373  THR A C   1 
ATOM 2480  O O   . THR A 1 373  ? 62.036  5.020   14.276  1.00 26.60  ? 373  THR A O   1 
ATOM 2481  C CB  . THR A 1 373  ? 59.033  4.936   14.446  1.00 13.25  ? 373  THR A CB  1 
ATOM 2482  O OG1 . THR A 1 373  ? 59.088  4.938   15.872  1.00 15.67  ? 373  THR A OG1 1 
ATOM 2483  C CG2 . THR A 1 373  ? 57.625  4.813   13.969  1.00 11.58  ? 373  THR A CG2 1 
ATOM 2484  N N   . THR A 1 374  ? 61.725  3.186   15.549  1.00 17.69  ? 374  THR A N   1 
ATOM 2485  C CA  . THR A 1 374  ? 63.060  3.218   16.168  1.00 16.71  ? 374  THR A CA  1 
ATOM 2486  C C   . THR A 1 374  ? 63.754  1.890   15.918  1.00 14.27  ? 374  THR A C   1 
ATOM 2487  O O   . THR A 1 374  ? 63.410  0.888   16.551  1.00 12.58  ? 374  THR A O   1 
ATOM 2488  C CB  . THR A 1 374  ? 63.023  3.440   17.672  1.00 14.18  ? 374  THR A CB  1 
ATOM 2489  O OG1 . THR A 1 374  ? 62.831  2.167   18.291  1.00 12.61  ? 374  THR A OG1 1 
ATOM 2490  C CG2 . THR A 1 374  ? 61.909  4.319   18.042  1.00 14.33  ? 374  THR A CG2 1 
ATOM 2491  N N   . LEU A 1 375  ? 64.726  1.901   15.013  1.00 15.06  ? 375  LEU A N   1 
ATOM 2492  C CA  . LEU A 1 375  ? 65.525  0.748   14.649  1.00 12.75  ? 375  LEU A CA  1 
ATOM 2493  C C   . LEU A 1 375  ? 66.727  0.683   15.587  1.00 11.74  ? 375  LEU A C   1 
ATOM 2494  O O   . LEU A 1 375  ? 67.268  1.720   15.975  1.00 14.92  ? 375  LEU A O   1 
ATOM 2495  C CB  . LEU A 1 375  ? 65.939  0.878   13.181  1.00 14.24  ? 375  LEU A CB  1 
ATOM 2496  N N   . ARG A 1 376  ? 67.139  -0.539  15.955  1.00 14.47  ? 376  ARG A N   1 
ATOM 2497  C CA  . ARG A 1 376  ? 68.155  -0.741  16.987  1.00 16.26  ? 376  ARG A CA  1 
ATOM 2498  C C   . ARG A 1 376  ? 68.822  -2.109  16.825  1.00 18.36  ? 376  ARG A C   1 
ATOM 2499  O O   . ARG A 1 376  ? 68.152  -3.082  16.495  1.00 16.33  ? 376  ARG A O   1 
ATOM 2500  C CB  . ARG A 1 376  ? 67.540  -0.603  18.391  1.00 16.29  ? 376  ARG A CB  1 
ATOM 2501  N N   . GLY A 1 377  ? 70.121  -2.199  17.128  1.00 21.31  ? 377  GLY A N   1 
ATOM 2502  C CA  . GLY A 1 377  ? 70.925  -3.296  16.612  1.00 15.18  ? 377  GLY A CA  1 
ATOM 2503  C C   . GLY A 1 377  ? 71.243  -4.528  17.439  1.00 15.25  ? 377  GLY A C   1 
ATOM 2504  O O   . GLY A 1 377  ? 71.325  -5.628  16.886  1.00 13.84  ? 377  GLY A O   1 
ATOM 2505  N N   . GLY A 1 378  ? 71.494  -4.361  18.737  1.00 16.76  ? 378  GLY A N   1 
ATOM 2506  C CA  . GLY A 1 378  ? 71.764  -5.480  19.622  1.00 14.66  ? 378  GLY A CA  1 
ATOM 2507  C C   . GLY A 1 378  ? 70.994  -6.731  19.261  1.00 15.79  ? 378  GLY A C   1 
ATOM 2508  O O   . GLY A 1 378  ? 71.534  -7.842  19.274  1.00 12.72  ? 378  GLY A O   1 
ATOM 2509  N N   . ASP A 1 379  ? 69.775  -6.523  18.783  1.00 19.28  ? 379  ASP A N   1 
ATOM 2510  C CA  . ASP A 1 379  ? 68.774  -7.562  18.597  1.00 17.76  ? 379  ASP A CA  1 
ATOM 2511  C C   . ASP A 1 379  ? 68.175  -7.376  17.206  1.00 18.85  ? 379  ASP A C   1 
ATOM 2512  O O   . ASP A 1 379  ? 67.412  -6.433  16.970  1.00 19.26  ? 379  ASP A O   1 
ATOM 2513  C CB  . ASP A 1 379  ? 67.710  -7.480  19.693  1.00 18.46  ? 379  ASP A CB  1 
ATOM 2514  C CG  . ASP A 1 379  ? 67.665  -6.109  20.389  1.00 15.41  ? 379  ASP A CG  1 
ATOM 2515  O OD1 . ASP A 1 379  ? 68.044  -5.085  19.785  1.00 16.10  ? 379  ASP A OD1 1 
ATOM 2516  O OD2 . ASP A 1 379  ? 67.239  -6.055  21.561  1.00 16.77  ? 379  ASP A OD2 1 
ATOM 2517  N N   . SER A 1 380  ? 68.575  -8.228  16.270  1.00 17.86  ? 380  SER A N   1 
ATOM 2518  C CA  . SER A 1 380  ? 67.992  -8.197  14.938  1.00 16.18  ? 380  SER A CA  1 
ATOM 2519  C C   . SER A 1 380  ? 66.651  -8.842  14.921  1.00 12.59  ? 380  SER A C   1 
ATOM 2520  O O   . SER A 1 380  ? 66.139  -9.209  13.860  1.00 11.93  ? 380  SER A O   1 
ATOM 2521  C CB  . SER A 1 380  ? 68.884  -8.911  13.942  1.00 19.16  ? 380  SER A CB  1 
ATOM 2522  O OG  . SER A 1 380  ? 68.073  -9.455  12.918  1.00 9.23   ? 380  SER A OG  1 
ATOM 2523  N N   . LEU A 1 381  ? 66.077  -9.006  16.086  1.00 14.14  ? 381  LEU A N   1 
ATOM 2524  C CA  . LEU A 1 381  ? 64.987  -9.927  16.242  1.00 14.96  ? 381  LEU A CA  1 
ATOM 2525  C C   . LEU A 1 381  ? 63.701  -9.217  16.666  1.00 18.58  ? 381  LEU A C   1 
ATOM 2526  O O   . LEU A 1 381  ? 62.689  -9.890  16.850  1.00 22.65  ? 381  LEU A O   1 
ATOM 2527  C CB  . LEU A 1 381  ? 65.437  -11.029 17.211  1.00 14.50  ? 381  LEU A CB  1 
ATOM 2528  C CG  . LEU A 1 381  ? 66.680  -11.797 16.725  1.00 15.69  ? 381  LEU A CG  1 
ATOM 2529  C CD1 . LEU A 1 381  ? 66.861  -12.962 17.672  1.00 21.57  ? 381  LEU A CD1 1 
ATOM 2530  C CD2 . LEU A 1 381  ? 66.540  -12.351 15.315  1.00 13.80  ? 381  LEU A CD2 1 
ATOM 2531  N N   . VAL A 1 382  ? 63.678  -7.879  16.679  1.00 18.99  ? 382  VAL A N   1 
ATOM 2532  C CA  . VAL A 1 382  ? 62.574  -7.013  17.137  1.00 18.37  ? 382  VAL A CA  1 
ATOM 2533  C C   . VAL A 1 382  ? 62.577  -7.029  18.663  1.00 22.63  ? 382  VAL A C   1 
ATOM 2534  O O   . VAL A 1 382  ? 63.079  -7.987  19.262  1.00 29.61  ? 382  VAL A O   1 
ATOM 2535  C CB  . VAL A 1 382  ? 61.182  -7.410  16.587  1.00 14.15  ? 382  VAL A CB  1 
ATOM 2536  C CG1 . VAL A 1 382  ? 60.242  -6.224  16.622  1.00 10.05  ? 382  VAL A CG1 1 
ATOM 2537  C CG2 . VAL A 1 382  ? 61.248  -7.873  15.165  1.00 17.05  ? 382  VAL A CG2 1 
ATOM 2538  N N   . PRO A 1 383  ? 62.095  -5.991  19.338  1.00 24.53  ? 383  PRO A N   1 
ATOM 2539  C CA  . PRO A 1 383  ? 62.080  -6.018  20.811  1.00 26.56  ? 383  PRO A CA  1 
ATOM 2540  C C   . PRO A 1 383  ? 60.679  -6.090  21.404  1.00 33.93  ? 383  PRO A C   1 
ATOM 2541  O O   . PRO A 1 383  ? 59.814  -5.303  21.008  1.00 40.53  ? 383  PRO A O   1 
ATOM 2542  C CB  . PRO A 1 383  ? 62.767  -4.698  21.175  1.00 23.67  ? 383  PRO A CB  1 
ATOM 2543  C CG  . PRO A 1 383  ? 62.382  -3.779  20.042  1.00 23.23  ? 383  PRO A CG  1 
ATOM 2544  C CD  . PRO A 1 383  ? 62.104  -4.616  18.818  1.00 22.32  ? 383  PRO A CD  1 
ATOM 2545  N N   . ARG A 1 384  ? 60.438  -7.004  22.350  1.00 35.76  ? 384  ARG A N   1 
ATOM 2546  C CA  . ARG A 1 384  ? 59.116  -7.137  22.963  1.00 33.54  ? 384  ARG A CA  1 
ATOM 2547  C C   . ARG A 1 384  ? 58.750  -5.883  23.742  1.00 32.90  ? 384  ARG A C   1 
ATOM 2548  O O   . ARG A 1 384  ? 59.602  -5.240  24.367  1.00 38.80  ? 384  ARG A O   1 
ATOM 2549  C CB  . ARG A 1 384  ? 59.054  -8.347  23.903  1.00 31.52  ? 384  ARG A CB  1 
ATOM 2550  C CG  . ARG A 1 384  ? 58.362  -8.087  25.271  1.00 28.54  ? 384  ARG A CG  1 
ATOM 2551  C CD  . ARG A 1 384  ? 57.051  -8.889  25.515  1.00 26.07  ? 384  ARG A CD  1 
ATOM 2552  N NE  . ARG A 1 384  ? 56.490  -8.632  26.846  1.00 15.92  ? 384  ARG A NE  1 
ATOM 2553  C CZ  . ARG A 1 384  ? 56.366  -9.530  27.824  1.00 13.00  ? 384  ARG A CZ  1 
ATOM 2554  N NH1 . ARG A 1 384  ? 56.755  -10.783 27.663  1.00 15.02  ? 384  ARG A NH1 1 
ATOM 2555  N NH2 . ARG A 1 384  ? 55.858  -9.173  28.989  1.00 9.77   ? 384  ARG A NH2 1 
ATOM 2556  N N   . ASN A 1 385  ? 57.454  -5.558  23.728  1.00 30.23  ? 385  ASN A N   1 
ATOM 2557  C CA  . ASN A 1 385  ? 56.956  -4.341  24.368  1.00 36.45  ? 385  ASN A CA  1 
ATOM 2558  C C   . ASN A 1 385  ? 57.689  -3.115  23.857  1.00 42.26  ? 385  ASN A C   1 
ATOM 2559  O O   . ASN A 1 385  ? 57.995  -2.187  24.609  1.00 61.99  ? 385  ASN A O   1 
ATOM 2560  C CB  . ASN A 1 385  ? 57.082  -4.416  25.878  1.00 48.98  ? 385  ASN A CB  1 
ATOM 2561  C CG  . ASN A 1 385  ? 56.810  -5.779  26.391  1.00 32.01  ? 385  ASN A CG  1 
ATOM 2562  O OD1 . ASN A 1 385  ? 55.929  -6.468  25.881  1.00 24.83  ? 385  ASN A OD1 1 
ATOM 2563  N ND2 . ASN A 1 385  ? 57.590  -6.212  27.373  1.00 30.10  ? 385  ASN A ND2 1 
ATOM 2564  N N   . SER A 1 386  ? 58.031  -3.138  22.586  1.00 30.50  ? 386  SER A N   1 
ATOM 2565  C CA  . SER A 1 386  ? 58.682  -2.014  21.958  1.00 24.26  ? 386  SER A CA  1 
ATOM 2566  C C   . SER A 1 386  ? 57.718  -1.426  20.952  1.00 21.80  ? 386  SER A C   1 
ATOM 2567  O O   . SER A 1 386  ? 56.973  -2.145  20.283  1.00 19.75  ? 386  SER A O   1 
ATOM 2568  C CB  . SER A 1 386  ? 59.978  -2.432  21.277  1.00 22.51  ? 386  SER A CB  1 
ATOM 2569  O OG  . SER A 1 386  ? 60.826  -3.085  22.207  1.00 23.91  ? 386  SER A OG  1 
ATOM 2570  N N   . TYR A 1 387  ? 57.738  -0.113  20.862  1.00 27.28  ? 387  TYR A N   1 
ATOM 2571  C CA  . TYR A 1 387  ? 56.894  0.544   19.890  1.00 29.03  ? 387  TYR A CA  1 
ATOM 2572  C C   . TYR A 1 387  ? 57.109  -0.106  18.534  1.00 24.48  ? 387  TYR A C   1 
ATOM 2573  O O   . TYR A 1 387  ? 58.160  -0.690  18.270  1.00 22.12  ? 387  TYR A O   1 
ATOM 2574  C CB  . TYR A 1 387  ? 57.191  2.034   19.897  1.00 27.34  ? 387  TYR A CB  1 
ATOM 2575  N N   . VAL A 1 388  ? 56.081  -0.076  17.684  1.00 23.45  ? 388  VAL A N   1 
ATOM 2576  C CA  . VAL A 1 388  ? 56.121  -0.844  16.458  1.00 21.36  ? 388  VAL A CA  1 
ATOM 2577  C C   . VAL A 1 388  ? 54.958  -0.546  15.549  1.00 19.49  ? 388  VAL A C   1 
ATOM 2578  O O   . VAL A 1 388  ? 53.790  -0.494  15.974  1.00 17.47  ? 388  VAL A O   1 
ATOM 2579  C CB  . VAL A 1 388  ? 56.121  -2.337  16.772  1.00 21.52  ? 388  VAL A CB  1 
ATOM 2580  C CG1 . VAL A 1 388  ? 57.558  -2.860  16.949  1.00 23.91  ? 388  VAL A CG1 1 
ATOM 2581  C CG2 . VAL A 1 388  ? 55.293  -2.470  17.987  1.00 21.45  ? 388  VAL A CG2 1 
ATOM 2582  N N   . ARG A 1 389  ? 55.268  -0.455  14.261  1.00 21.83  ? 389  ARG A N   1 
ATOM 2583  C CA  . ARG A 1 389  ? 54.290  -0.158  13.260  1.00 21.89  ? 389  ARG A CA  1 
ATOM 2584  C C   . ARG A 1 389  ? 54.023  -1.404  12.463  1.00 15.22  ? 389  ARG A C   1 
ATOM 2585  O O   . ARG A 1 389  ? 54.810  -2.359  12.444  1.00 14.48  ? 389  ARG A O   1 
ATOM 2586  C CB  . ARG A 1 389  ? 54.704  0.999   12.323  1.00 34.14  ? 389  ARG A CB  1 
ATOM 2587  C CG  . ARG A 1 389  ? 56.181  1.250   12.036  1.00 22.12  ? 389  ARG A CG  1 
ATOM 2588  C CD  . ARG A 1 389  ? 56.791  2.283   12.957  1.00 13.04  ? 389  ARG A CD  1 
ATOM 2589  N NE  . ARG A 1 389  ? 56.316  2.094   14.334  1.00 14.51  ? 389  ARG A NE  1 
ATOM 2590  C CZ  . ARG A 1 389  ? 55.188  2.625   14.762  1.00 10.81  ? 389  ARG A CZ  1 
ATOM 2591  N NH1 . ARG A 1 389  ? 54.556  3.363   13.904  1.00 9.60   ? 389  ARG A NH1 1 
ATOM 2592  N NH2 . ARG A 1 389  ? 54.755  2.475   16.005  1.00 14.49  ? 389  ARG A NH2 1 
ATOM 2593  N N   . LEU A 1 390  ? 52.888  -1.402  11.816  1.00 14.96  ? 390  LEU A N   1 
ATOM 2594  C CA  . LEU A 1 390  ? 52.541  -2.622  11.130  1.00 18.21  ? 390  LEU A CA  1 
ATOM 2595  C C   . LEU A 1 390  ? 51.569  -2.258  10.036  1.00 27.89  ? 390  LEU A C   1 
ATOM 2596  O O   . LEU A 1 390  ? 50.921  -1.212  10.107  1.00 30.89  ? 390  LEU A O   1 
ATOM 2597  C CB  . LEU A 1 390  ? 51.963  -3.605  12.118  1.00 23.15  ? 390  LEU A CB  1 
ATOM 2598  C CG  . LEU A 1 390  ? 51.873  -4.969  11.482  1.00 34.13  ? 390  LEU A CG  1 
ATOM 2599  C CD1 . LEU A 1 390  ? 53.084  -5.162  10.580  1.00 24.03  ? 390  LEU A CD1 1 
ATOM 2600  C CD2 . LEU A 1 390  ? 51.897  -5.967  12.599  1.00 54.87  ? 390  LEU A CD2 1 
ATOM 2601  N N   . ARG A 1 391  ? 51.489  -3.119  9.030   1.00 34.84  ? 391  ARG A N   1 
ATOM 2602  C CA  . ARG A 1 391  ? 50.819  -2.791  7.749   1.00 31.09  ? 391  ARG A CA  1 
ATOM 2603  C C   . ARG A 1 391  ? 50.545  -4.053  6.931   1.00 27.02  ? 391  ARG A C   1 
ATOM 2604  O O   . ARG A 1 391  ? 51.269  -5.067  7.029   1.00 30.99  ? 391  ARG A O   1 
ATOM 2605  C CB  . ARG A 1 391  ? 51.654  -1.800  6.920   1.00 24.43  ? 391  ARG A CB  1 
ATOM 2606  C CG  . ARG A 1 391  ? 51.067  -1.594  5.603   1.00 17.90  ? 391  ARG A CG  1 
ATOM 2607  C CD  . ARG A 1 391  ? 51.867  -2.193  4.522   1.00 15.97  ? 391  ARG A CD  1 
ATOM 2608  N NE  . ARG A 1 391  ? 51.010  -3.130  3.800   1.00 15.67  ? 391  ARG A NE  1 
ATOM 2609  C CZ  . ARG A 1 391  ? 50.791  -3.126  2.489   1.00 15.44  ? 391  ARG A CZ  1 
ATOM 2610  N NH1 . ARG A 1 391  ? 51.455  -2.281  1.704   1.00 16.22  ? 391  ARG A NH1 1 
ATOM 2611  N NH2 . ARG A 1 391  ? 49.999  -4.084  1.976   1.00 12.93  ? 391  ARG A NH2 1 
ATOM 2612  N N   . HIS A 1 392  ? 49.541  -3.949  6.054   1.00 18.13  ? 392  HIS A N   1 
ATOM 2613  C CA  . HIS A 1 392  ? 49.076  -5.138  5.334   1.00 12.87  ? 392  HIS A CA  1 
ATOM 2614  C C   . HIS A 1 392  ? 50.177  -5.816  4.552   1.00 14.72  ? 392  HIS A C   1 
ATOM 2615  O O   . HIS A 1 392  ? 50.829  -5.218  3.708   1.00 8.78   ? 392  HIS A O   1 
ATOM 2616  C CB  . HIS A 1 392  ? 47.975  -4.817  4.375   1.00 10.78  ? 392  HIS A CB  1 
ATOM 2617  C CG  . HIS A 1 392  ? 47.285  -6.029  3.886   1.00 12.07  ? 392  HIS A CG  1 
ATOM 2618  N ND1 . HIS A 1 392  ? 46.234  -5.940  3.007   1.00 13.73  ? 392  HIS A ND1 1 
ATOM 2619  C CD2 . HIS A 1 392  ? 47.504  -7.358  4.085   1.00 14.54  ? 392  HIS A CD2 1 
ATOM 2620  C CE1 . HIS A 1 392  ? 45.825  -7.155  2.691   1.00 20.04  ? 392  HIS A CE1 1 
ATOM 2621  N NE2 . HIS A 1 392  ? 46.566  -8.033  3.335   1.00 26.79  ? 392  HIS A NE2 1 
ATOM 2622  N N   . LEU A 1 393  ? 50.358  -7.093  4.782   1.00 8.67   ? 393  LEU A N   1 
ATOM 2623  C CA  . LEU A 1 393  ? 51.331  -7.751  3.930   1.00 8.67   ? 393  LEU A CA  1 
ATOM 2624  C C   . LEU A 1 393  ? 50.888  -7.720  2.489   1.00 8.67   ? 393  LEU A C   1 
ATOM 2625  O O   . LEU A 1 393  ? 51.713  -7.619  1.584   1.00 8.67   ? 393  LEU A O   1 
ATOM 2626  C CB  . LEU A 1 393  ? 51.539  -9.182  4.379   1.00 8.67   ? 393  LEU A CB  1 
ATOM 2627  C CG  . LEU A 1 393  ? 52.996  -9.261  4.682   1.00 9.73   ? 393  LEU A CG  1 
ATOM 2628  C CD1 . LEU A 1 393  ? 53.485  -7.847  4.721   1.00 9.71   ? 393  LEU A CD1 1 
ATOM 2629  C CD2 . LEU A 1 393  ? 53.079  -9.880  6.023   1.00 14.47  ? 393  LEU A CD2 1 
ATOM 2630  N N   . CYS A 1 394  ? 49.586  -7.764  2.258   1.00 9.10   ? 394  CYS A N   1 
ATOM 2631  C CA  . CYS A 1 394  ? 49.071  -8.389  1.053   1.00 8.69   ? 394  CYS A CA  1 
ATOM 2632  C C   . CYS A 1 394  ? 48.326  -7.458  0.117   1.00 8.69   ? 394  CYS A C   1 
ATOM 2633  O O   . CYS A 1 394  ? 48.229  -7.754  -1.075  1.00 8.69   ? 394  CYS A O   1 
ATOM 2634  C CB  . CYS A 1 394  ? 48.176  -9.548  1.464   1.00 8.70   ? 394  CYS A CB  1 
ATOM 2635  S SG  . CYS A 1 394  ? 48.825  -10.046 2.989   1.00 13.71  ? 394  CYS A SG  1 
ATOM 2636  N N   . THR A 1 395  ? 47.791  -6.353  0.614   1.00 9.47   ? 395  THR A N   1 
ATOM 2637  C CA  . THR A 1 395  ? 47.280  -5.296  -0.246  1.00 10.02  ? 395  THR A CA  1 
ATOM 2638  C C   . THR A 1 395  ? 48.075  -4.037  0.054   1.00 13.35  ? 395  THR A C   1 
ATOM 2639  O O   . THR A 1 395  ? 48.017  -3.530  1.182   1.00 11.16  ? 395  THR A O   1 
ATOM 2640  C CB  . THR A 1 395  ? 45.791  -5.061  -0.011  1.00 10.26  ? 395  THR A CB  1 
ATOM 2641  O OG1 . THR A 1 395  ? 45.602  -4.393  1.248   1.00 10.58  ? 395  THR A OG1 1 
ATOM 2642  C CG2 . THR A 1 395  ? 45.033  -6.388  -0.036  1.00 13.82  ? 395  THR A CG2 1 
ATOM 2643  N N   . ASN A 1 396  ? 48.815  -3.537  -0.953  1.00 21.31  ? 396  ASN A N   1 
ATOM 2644  C CA  . ASN A 1 396  ? 49.723  -2.394  -0.800  1.00 17.84  ? 396  ASN A CA  1 
ATOM 2645  C C   . ASN A 1 396  ? 49.031  -1.268  -0.030  1.00 18.91  ? 396  ASN A C   1 
ATOM 2646  O O   . ASN A 1 396  ? 48.905  -0.135  -0.515  1.00 19.74  ? 396  ASN A O   1 
ATOM 2647  C CB  . ASN A 1 396  ? 50.243  -1.894  -2.157  1.00 14.36  ? 396  ASN A CB  1 
ATOM 2648  C CG  . ASN A 1 396  ? 51.606  -1.198  -2.057  1.00 8.78   ? 396  ASN A CG  1 
ATOM 2649  O OD1 . ASN A 1 396  ? 51.720  -0.002  -2.316  1.00 8.78   ? 396  ASN A OD1 1 
ATOM 2650  N ND2 . ASN A 1 396  ? 52.647  -1.961  -1.717  1.00 8.78   ? 396  ASN A ND2 1 
ATOM 2651  N N   . THR A 1 397  ? 48.670  -1.576  1.219   1.00 17.29  ? 397  THR A N   1 
ATOM 2652  C CA  . THR A 1 397  ? 47.802  -0.772  2.076   1.00 14.94  ? 397  THR A CA  1 
ATOM 2653  C C   . THR A 1 397  ? 48.452  -0.699  3.473   1.00 15.29  ? 397  THR A C   1 
ATOM 2654  O O   . THR A 1 397  ? 48.452  -1.697  4.188   1.00 15.74  ? 397  THR A O   1 
ATOM 2655  C CB  . THR A 1 397  ? 46.440  -1.425  2.158   1.00 10.82  ? 397  THR A CB  1 
ATOM 2656  O OG1 . THR A 1 397  ? 46.573  -2.725  2.750   1.00 8.92   ? 397  THR A OG1 1 
ATOM 2657  C CG2 . THR A 1 397  ? 46.031  -1.681  0.829   1.00 12.87  ? 397  THR A CG2 1 
ATOM 2658  N N   . TRP A 1 398  ? 49.050  0.460   3.787   1.00 13.84  ? 398  TRP A N   1 
ATOM 2659  C CA  . TRP A 1 398  ? 49.816  0.670   5.021   1.00 16.12  ? 398  TRP A CA  1 
ATOM 2660  C C   . TRP A 1 398  ? 48.911  1.131   6.160   1.00 24.43  ? 398  TRP A C   1 
ATOM 2661  O O   . TRP A 1 398  ? 48.121  2.062   5.986   1.00 24.90  ? 398  TRP A O   1 
ATOM 2662  C CB  . TRP A 1 398  ? 50.969  1.671   4.806   1.00 12.45  ? 398  TRP A CB  1 
ATOM 2663  C CG  . TRP A 1 398  ? 52.223  1.009   4.286   1.00 8.94   ? 398  TRP A CG  1 
ATOM 2664  C CD1 . TRP A 1 398  ? 52.393  0.501   3.048   1.00 9.51   ? 398  TRP A CD1 1 
ATOM 2665  C CD2 . TRP A 1 398  ? 53.463  0.766   4.993   1.00 8.90   ? 398  TRP A CD2 1 
ATOM 2666  N NE1 . TRP A 1 398  ? 53.646  -0.045  2.925   1.00 8.90   ? 398  TRP A NE1 1 
ATOM 2667  C CE2 . TRP A 1 398  ? 54.324  0.105   4.102   1.00 8.90   ? 398  TRP A CE2 1 
ATOM 2668  C CE3 . TRP A 1 398  ? 53.921  1.043   6.281   1.00 8.90   ? 398  TRP A CE3 1 
ATOM 2669  C CZ2 . TRP A 1 398  ? 55.615  -0.287  4.454   1.00 8.90   ? 398  TRP A CZ2 1 
ATOM 2670  C CZ3 . TRP A 1 398  ? 55.203  0.648   6.628   1.00 8.90   ? 398  TRP A CZ3 1 
ATOM 2671  C CH2 . TRP A 1 398  ? 56.034  -0.009  5.717   1.00 8.90   ? 398  TRP A CH2 1 
ATOM 2672  N N   . VAL A 1 399  ? 49.033  0.488   7.331   1.00 40.33  ? 399  VAL A N   1 
ATOM 2673  C CA  . VAL A 1 399  ? 48.161  0.773   8.475   1.00 51.08  ? 399  VAL A CA  1 
ATOM 2674  C C   . VAL A 1 399  ? 48.421  2.185   9.000   1.00 50.78  ? 399  VAL A C   1 
ATOM 2675  O O   . VAL A 1 399  ? 49.564  2.665   9.013   1.00 54.25  ? 399  VAL A O   1 
ATOM 2676  C CB  . VAL A 1 399  ? 48.361  -0.285  9.577   1.00 52.91  ? 399  VAL A CB  1 
ATOM 2677  C CG1 . VAL A 1 399  ? 47.389  -0.063  10.750  1.00 52.94  ? 399  VAL A CG1 1 
ATOM 2678  C CG2 . VAL A 1 399  ? 48.188  -1.688  9.015   1.00 41.13  ? 399  VAL A CG2 1 
ATOM 2679  N N   . HIS A 1 400  ? 47.360  2.859   9.455   1.00 49.64  ? 400  HIS A N   1 
ATOM 2680  C CA  . HIS A 1 400  ? 47.422  4.272   9.820   1.00 49.67  ? 400  HIS A CA  1 
ATOM 2681  C C   . HIS A 1 400  ? 46.716  4.497   11.150  1.00 43.17  ? 400  HIS A C   1 
ATOM 2682  O O   . HIS A 1 400  ? 45.535  4.149   11.282  1.00 35.88  ? 400  HIS A O   1 
ATOM 2683  C CB  . HIS A 1 400  ? 46.775  5.143   8.726   1.00 41.82  ? 400  HIS A CB  1 
ATOM 2684  C CG  . HIS A 1 400  ? 47.609  6.316   8.319   1.00 38.60  ? 400  HIS A CG  1 
ATOM 2685  N ND1 . HIS A 1 400  ? 48.732  6.190   7.531   1.00 33.44  ? 400  HIS A ND1 1 
ATOM 2686  C CD2 . HIS A 1 400  ? 47.499  7.634   8.611   1.00 37.67  ? 400  HIS A CD2 1 
ATOM 2687  C CE1 . HIS A 1 400  ? 49.283  7.379   7.361   1.00 26.93  ? 400  HIS A CE1 1 
ATOM 2688  N NE2 . HIS A 1 400  ? 48.549  8.274   7.998   1.00 29.27  ? 400  HIS A NE2 1 
ATOM 2689  N N   . SER A 1 401  ? 47.425  5.127   12.107  1.00 47.09  ? 401  SER A N   1 
ATOM 2690  C CA  . SER A 1 401  ? 46.956  5.342   13.487  1.00 42.63  ? 401  SER A CA  1 
ATOM 2691  C C   . SER A 1 401  ? 46.831  6.837   13.798  1.00 51.23  ? 401  SER A C   1 
ATOM 2692  O O   . SER A 1 401  ? 47.848  7.539   13.911  1.00 50.44  ? 401  SER A O   1 
ATOM 2693  C CB  . SER A 1 401  ? 47.897  4.642   14.474  1.00 27.66  ? 401  SER A CB  1 
ATOM 2694  O OG  . SER A 1 401  ? 47.764  5.158   15.783  1.00 25.26  ? 401  SER A OG  1 
ATOM 2695  N N   . THR A 1 402  ? 45.592  7.299   14.032  1.00 52.93  ? 402  THR A N   1 
ATOM 2696  C CA  . THR A 1 402  ? 45.193  8.719   13.983  1.00 52.57  ? 402  THR A CA  1 
ATOM 2697  C C   . THR A 1 402  ? 43.950  8.995   14.846  1.00 44.08  ? 402  THR A C   1 
ATOM 2698  O O   . THR A 1 402  ? 43.244  8.075   15.277  1.00 42.54  ? 402  THR A O   1 
ATOM 2699  C CB  . THR A 1 402  ? 44.924  9.135   12.533  1.00 54.70  ? 402  THR A CB  1 
ATOM 2700  O OG1 . THR A 1 402  ? 44.049  8.180   11.901  1.00 45.05  ? 402  THR A OG1 1 
ATOM 2701  C CG2 . THR A 1 402  ? 46.226  9.209   11.761  1.00 59.59  ? 402  THR A CG2 1 
ATOM 2702  N N   . ASN A 1 403  ? 43.677  10.296  15.052  1.00 35.41  ? 403  ASN A N   1 
ATOM 2703  C CA  . ASN A 1 403  ? 42.559  10.786  15.876  1.00 27.19  ? 403  ASN A CA  1 
ATOM 2704  C C   . ASN A 1 403  ? 41.189  10.550  15.247  1.00 23.02  ? 403  ASN A C   1 
ATOM 2705  O O   . ASN A 1 403  ? 40.192  10.502  15.973  1.00 19.67  ? 403  ASN A O   1 
ATOM 2706  C CB  . ASN A 1 403  ? 42.711  12.286  16.138  1.00 22.72  ? 403  ASN A CB  1 
ATOM 2707  C CG  . ASN A 1 403  ? 43.448  12.579  17.414  1.00 23.35  ? 403  ASN A CG  1 
ATOM 2708  O OD1 . ASN A 1 403  ? 43.593  11.706  18.270  1.00 20.44  ? 403  ASN A OD1 1 
ATOM 2709  N ND2 . ASN A 1 403  ? 43.931  13.812  17.555  1.00 16.62  ? 403  ASN A ND2 1 
ATOM 2710  N N   . ILE A 1 404  ? 41.122  10.452  13.932  1.00 23.20  ? 404  ILE A N   1 
ATOM 2711  C CA  . ILE A 1 404  ? 39.852  10.182  13.254  1.00 25.79  ? 404  ILE A CA  1 
ATOM 2712  C C   . ILE A 1 404  ? 39.240  8.907   13.807  1.00 29.83  ? 404  ILE A C   1 
ATOM 2713  O O   . ILE A 1 404  ? 39.971  7.925   14.022  1.00 31.61  ? 404  ILE A O   1 
ATOM 2714  C CB  . ILE A 1 404  ? 40.084  10.059  11.750  1.00 34.96  ? 404  ILE A CB  1 
ATOM 2715  C CG1 . ILE A 1 404  ? 41.198  11.021  11.347  1.00 42.03  ? 404  ILE A CG1 1 
ATOM 2716  C CG2 . ILE A 1 404  ? 38.804  10.370  11.001  1.00 40.27  ? 404  ILE A CG2 1 
ATOM 2717  C CD1 . ILE A 1 404  ? 42.330  10.398  10.562  1.00 49.49  ? 404  ILE A CD1 1 
ATOM 2718  N N   . PRO A 1 405  ? 37.933  8.887   14.122  1.00 32.01  ? 405  PRO A N   1 
ATOM 2719  C CA  . PRO A 1 405  ? 37.195  7.667   14.537  1.00 38.30  ? 405  PRO A CA  1 
ATOM 2720  C C   . PRO A 1 405  ? 36.250  6.975   13.512  1.00 50.03  ? 405  PRO A C   1 
ATOM 2721  O O   . PRO A 1 405  ? 35.485  7.691   12.843  1.00 57.73  ? 405  PRO A O   1 
ATOM 2722  C CB  . PRO A 1 405  ? 36.377  8.200   15.723  1.00 29.94  ? 405  PRO A CB  1 
ATOM 2723  C CG  . PRO A 1 405  ? 37.150  9.395   16.231  1.00 23.45  ? 405  PRO A CG  1 
ATOM 2724  C CD  . PRO A 1 405  ? 37.640  10.046  14.987  1.00 23.53  ? 405  PRO A CD  1 
ATOM 2725  N N   . ILE A 1 406  ? 36.203  5.615   13.403  1.00 39.96  ? 406  ILE A N   1 
ATOM 2726  C CA  . ILE A 1 406  ? 35.335  4.996   12.379  1.00 30.08  ? 406  ILE A CA  1 
ATOM 2727  C C   . ILE A 1 406  ? 33.879  5.141   12.768  1.00 29.34  ? 406  ILE A C   1 
ATOM 2728  O O   . ILE A 1 406  ? 33.053  5.546   11.951  1.00 45.11  ? 406  ILE A O   1 
ATOM 2729  C CB  . ILE A 1 406  ? 35.625  3.506   12.101  1.00 24.57  ? 406  ILE A CB  1 
ATOM 2730  C CG1 . ILE A 1 406  ? 36.986  3.028   12.522  1.00 30.22  ? 406  ILE A CG1 1 
ATOM 2731  C CG2 . ILE A 1 406  ? 35.485  3.225   10.626  1.00 23.03  ? 406  ILE A CG2 1 
ATOM 2732  C CD1 . ILE A 1 406  ? 37.104  2.813   13.943  1.00 30.98  ? 406  ILE A CD1 1 
ATOM 2733  N N   . ASP A 1 407  ? 33.549  4.779   14.011  1.00 26.84  ? 407  ASP A N   1 
ATOM 2734  C CA  . ASP A 1 407  ? 32.229  4.968   14.617  1.00 36.01  ? 407  ASP A CA  1 
ATOM 2735  C C   . ASP A 1 407  ? 31.485  6.212   14.122  1.00 60.41  ? 407  ASP A C   1 
ATOM 2736  O O   . ASP A 1 407  ? 32.089  7.260   13.848  1.00 67.95  ? 407  ASP A O   1 
ATOM 2737  C CB  . ASP A 1 407  ? 32.432  5.051   16.126  1.00 36.12  ? 407  ASP A CB  1 
ATOM 2738  C CG  . ASP A 1 407  ? 33.765  5.671   16.469  1.00 37.14  ? 407  ASP A CG  1 
ATOM 2739  O OD1 . ASP A 1 407  ? 34.455  6.152   15.537  1.00 33.68  ? 407  ASP A OD1 1 
ATOM 2740  O OD2 . ASP A 1 407  ? 34.127  5.668   17.654  1.00 45.46  ? 407  ASP A OD2 1 
ATOM 2741  N N   . LYS A 1 408  ? 30.151  6.083   14.022  1.00 61.90  ? 408  LYS A N   1 
ATOM 2742  C CA  . LYS A 1 408  ? 29.241  7.199   13.790  1.00 40.63  ? 408  LYS A CA  1 
ATOM 2743  C C   . LYS A 1 408  ? 28.113  7.157   14.806  1.00 31.08  ? 408  LYS A C   1 
ATOM 2744  O O   . LYS A 1 408  ? 27.751  6.092   15.313  1.00 31.12  ? 408  LYS A O   1 
ATOM 2745  C CB  . LYS A 1 408  ? 28.662  7.199   12.369  1.00 27.91  ? 408  LYS A CB  1 
ATOM 2746  C CG  . LYS A 1 408  ? 29.333  8.255   11.511  1.00 40.60  ? 408  LYS A CG  1 
ATOM 2747  C CD  . LYS A 1 408  ? 30.571  8.815   12.247  1.00 38.27  ? 408  LYS A CD  1 
ATOM 2748  C CE  . LYS A 1 408  ? 31.033  10.173  11.728  1.00 24.54  ? 408  LYS A CE  1 
ATOM 2749  N NZ  . LYS A 1 408  ? 32.314  10.609  12.351  1.00 8.90   ? 408  LYS A NZ  1 
ATOM 2750  N N   . GLU A 1 409  ? 27.573  8.331   15.117  1.00 25.07  ? 409  GLU A N   1 
ATOM 2751  C CA  . GLU A 1 409  ? 26.493  8.440   16.086  1.00 25.46  ? 409  GLU A CA  1 
ATOM 2752  C C   . GLU A 1 409  ? 26.931  8.012   17.479  1.00 27.28  ? 409  GLU A C   1 
ATOM 2753  O O   . GLU A 1 409  ? 26.099  7.627   18.303  1.00 28.15  ? 409  GLU A O   1 
ATOM 2754  C CB  . GLU A 1 409  ? 25.277  7.617   15.644  1.00 31.54  ? 409  GLU A CB  1 
ATOM 2755  C CG  . GLU A 1 409  ? 24.365  8.296   14.631  1.00 30.46  ? 409  GLU A CG  1 
ATOM 2756  C CD  . GLU A 1 409  ? 23.087  8.866   15.259  1.00 30.68  ? 409  GLU A CD  1 
ATOM 2757  O OE1 . GLU A 1 409  ? 22.944  8.815   16.500  1.00 26.93  ? 409  GLU A OE1 1 
ATOM 2758  O OE2 . GLU A 1 409  ? 22.215  9.365   14.511  1.00 22.19  ? 409  GLU A OE2 1 
ATOM 2759  N N   . GLU A 1 410  ? 28.230  8.036   17.751  1.00 28.17  ? 410  GLU A N   1 
ATOM 2760  C CA  . GLU A 1 410  ? 28.768  7.734   19.070  1.00 34.94  ? 410  GLU A CA  1 
ATOM 2761  C C   . GLU A 1 410  ? 29.593  8.925   19.548  1.00 42.14  ? 410  GLU A C   1 
ATOM 2762  O O   . GLU A 1 410  ? 30.313  9.542   18.757  1.00 47.92  ? 410  GLU A O   1 
ATOM 2763  C CB  . GLU A 1 410  ? 29.651  6.460   19.058  1.00 34.80  ? 410  GLU A CB  1 
ATOM 2764  C CG  . GLU A 1 410  ? 28.943  5.107   19.078  1.00 26.50  ? 410  GLU A CG  1 
ATOM 2765  C CD  . GLU A 1 410  ? 29.614  4.130   20.037  1.00 26.39  ? 410  GLU A CD  1 
ATOM 2766  O OE1 . GLU A 1 410  ? 28.921  3.647   20.958  1.00 28.01  ? 410  GLU A OE1 1 
ATOM 2767  O OE2 . GLU A 1 410  ? 30.833  3.868   19.891  1.00 25.05  ? 410  GLU A OE2 1 
ATOM 2768  N N   . GLU A 1 411  ? 29.480  9.252   20.836  1.00 35.76  ? 411  GLU A N   1 
ATOM 2769  C CA  . GLU A 1 411  ? 30.208  10.362  21.445  1.00 30.28  ? 411  GLU A CA  1 
ATOM 2770  C C   . GLU A 1 411  ? 31.352  9.829   22.303  1.00 18.58  ? 411  GLU A C   1 
ATOM 2771  O O   . GLU A 1 411  ? 31.167  8.890   23.082  1.00 15.77  ? 411  GLU A O   1 
ATOM 2772  C CB  . GLU A 1 411  ? 29.267  11.213  22.296  1.00 25.10  ? 411  GLU A CB  1 
ATOM 2773  C CG  . GLU A 1 411  ? 28.784  10.490  23.531  1.00 24.03  ? 411  GLU A CG  1 
ATOM 2774  C CD  . GLU A 1 411  ? 27.606  11.170  24.169  1.00 22.90  ? 411  GLU A CD  1 
ATOM 2775  O OE1 . GLU A 1 411  ? 27.759  11.694  25.291  1.00 26.14  ? 411  GLU A OE1 1 
ATOM 2776  O OE2 . GLU A 1 411  ? 26.530  11.184  23.541  1.00 17.45  ? 411  GLU A OE2 1 
ATOM 2777  N N   . LYS A 1 412  ? 32.518  10.448  22.190  1.00 17.17  ? 412  LYS A N   1 
ATOM 2778  C CA  . LYS A 1 412  ? 33.673  9.879   22.858  1.00 12.65  ? 412  LYS A CA  1 
ATOM 2779  C C   . LYS A 1 412  ? 33.650  8.393   22.573  1.00 13.57  ? 412  LYS A C   1 
ATOM 2780  O O   . LYS A 1 412  ? 33.831  7.590   23.490  1.00 13.69  ? 412  LYS A O   1 
ATOM 2781  C CB  . LYS A 1 412  ? 33.637  10.122  24.365  1.00 11.68  ? 412  LYS A CB  1 
ATOM 2782  C CG  . LYS A 1 412  ? 33.575  11.586  24.738  1.00 17.04  ? 412  LYS A CG  1 
ATOM 2783  C CD  . LYS A 1 412  ? 33.574  11.824  26.248  1.00 14.16  ? 412  LYS A CD  1 
ATOM 2784  C CE  . LYS A 1 412  ? 34.058  13.251  26.554  1.00 13.73  ? 412  LYS A CE  1 
ATOM 2785  N NZ  . LYS A 1 412  ? 33.782  13.732  27.940  1.00 9.51   ? 412  LYS A NZ  1 
ATOM 2786  N N   . PRO A 1 413  ? 33.397  7.996   21.331  1.00 18.62  ? 413  PRO A N   1 
ATOM 2787  C CA  . PRO A 1 413  ? 33.111  6.581   21.031  1.00 29.14  ? 413  PRO A CA  1 
ATOM 2788  C C   . PRO A 1 413  ? 34.365  5.734   21.092  1.00 44.47  ? 413  PRO A C   1 
ATOM 2789  O O   . PRO A 1 413  ? 35.471  6.261   21.223  1.00 62.32  ? 413  PRO A O   1 
ATOM 2790  C CB  . PRO A 1 413  ? 32.570  6.646   19.609  1.00 35.96  ? 413  PRO A CB  1 
ATOM 2791  C CG  . PRO A 1 413  ? 33.362  7.812   19.014  1.00 28.91  ? 413  PRO A CG  1 
ATOM 2792  C CD  . PRO A 1 413  ? 33.559  8.810   20.112  1.00 20.85  ? 413  PRO A CD  1 
ATOM 2793  N N   . VAL A 1 414  ? 34.196  4.406   20.952  1.00 42.43  ? 414  VAL A N   1 
ATOM 2794  C CA  . VAL A 1 414  ? 35.310  3.505   21.301  1.00 46.42  ? 414  VAL A CA  1 
ATOM 2795  C C   . VAL A 1 414  ? 36.182  3.325   20.070  1.00 41.56  ? 414  VAL A C   1 
ATOM 2796  O O   . VAL A 1 414  ? 36.998  2.414   19.984  1.00 43.89  ? 414  VAL A O   1 
ATOM 2797  C CB  . VAL A 1 414  ? 34.843  2.160   21.884  1.00 22.82  ? 414  VAL A CB  1 
ATOM 2798  C CG1 . VAL A 1 414  ? 35.119  2.204   23.325  1.00 26.50  ? 414  VAL A CG1 1 
ATOM 2799  C CG2 . VAL A 1 414  ? 33.378  1.871   21.644  1.00 23.68  ? 414  VAL A CG2 1 
ATOM 2800  N N   . MET A 1 415  ? 35.994  4.137   19.042  1.00 49.66  ? 415  MET A N   1 
ATOM 2801  C CA  . MET A 1 415  ? 36.901  4.056   17.904  1.00 48.75  ? 415  MET A CA  1 
ATOM 2802  C C   . MET A 1 415  ? 37.193  5.427   17.353  1.00 49.14  ? 415  MET A C   1 
ATOM 2803  O O   . MET A 1 415  ? 36.301  6.291   17.218  1.00 43.79  ? 415  MET A O   1 
ATOM 2804  C CB  . MET A 1 415  ? 36.458  3.118   16.767  1.00 34.30  ? 415  MET A CB  1 
ATOM 2805  C CG  . MET A 1 415  ? 34.913  3.079   16.107  1.00 21.68  ? 415  MET A CG  1 
ATOM 2806  S SD  . MET A 1 415  ? 33.342  2.300   16.891  1.00 14.70  ? 415  MET A SD  1 
ATOM 2807  C CE  . MET A 1 415  ? 32.357  1.852   15.471  1.00 21.01  ? 415  MET A CE  1 
ATOM 2808  N N   . LEU A 1 416  ? 38.506  5.612   17.217  1.00 42.06  ? 416  LEU A N   1 
ATOM 2809  C CA  . LEU A 1 416  ? 39.281  6.625   16.522  1.00 37.48  ? 416  LEU A CA  1 
ATOM 2810  C C   . LEU A 1 416  ? 40.129  5.916   15.478  1.00 33.22  ? 416  LEU A C   1 
ATOM 2811  O O   . LEU A 1 416  ? 41.330  6.120   15.352  1.00 30.23  ? 416  LEU A O   1 
ATOM 2812  C CB  . LEU A 1 416  ? 40.121  7.466   17.528  1.00 36.49  ? 416  LEU A CB  1 
ATOM 2813  C CG  . LEU A 1 416  ? 40.643  7.447   19.017  1.00 25.17  ? 416  LEU A CG  1 
ATOM 2814  C CD1 . LEU A 1 416  ? 41.722  6.431   19.238  1.00 24.30  ? 416  LEU A CD1 1 
ATOM 2815  C CD2 . LEU A 1 416  ? 41.391  8.693   19.427  1.00 18.31  ? 416  LEU A CD2 1 
ATOM 2816  N N   . LYS A 1 417  ? 39.452  4.991   14.782  1.00 35.21  ? 417  LYS A N   1 
ATOM 2817  C CA  . LYS A 1 417  ? 39.740  4.617   13.394  1.00 33.67  ? 417  LYS A CA  1 
ATOM 2818  C C   . LYS A 1 417  ? 41.127  4.089   13.147  1.00 26.37  ? 417  LYS A C   1 
ATOM 2819  O O   . LYS A 1 417  ? 41.421  2.932   13.451  1.00 27.48  ? 417  LYS A O   1 
ATOM 2820  C CB  . LYS A 1 417  ? 39.582  5.811   12.455  1.00 40.02  ? 417  LYS A CB  1 
ATOM 2821  C CG  . LYS A 1 417  ? 38.527  5.661   11.348  1.00 44.66  ? 417  LYS A CG  1 
ATOM 2822  C CD  . LYS A 1 417  ? 38.609  4.360   10.494  1.00 29.07  ? 417  LYS A CD  1 
ATOM 2823  C CE  . LYS A 1 417  ? 39.957  3.840   10.189  1.00 26.50  ? 417  LYS A CE  1 
ATOM 2824  N NZ  . LYS A 1 417  ? 39.973  3.619   8.721   1.00 16.36  ? 417  LYS A NZ  1 
ATOM 2825  N N   . ILE A 1 418  ? 41.948  4.949   12.536  1.00 23.15  ? 418  ILE A N   1 
ATOM 2826  C CA  . ILE A 1 418  ? 43.329  4.684   12.154  1.00 25.81  ? 418  ILE A CA  1 
ATOM 2827  C C   . ILE A 1 418  ? 43.472  3.538   11.149  1.00 28.45  ? 418  ILE A C   1 
ATOM 2828  O O   . ILE A 1 418  ? 44.153  2.549   11.417  1.00 43.23  ? 418  ILE A O   1 
ATOM 2829  C CB  . ILE A 1 418  ? 44.159  4.474   13.429  1.00 31.82  ? 418  ILE A CB  1 
ATOM 2830  C CG1 . ILE A 1 418  ? 43.741  3.284   14.263  1.00 31.63  ? 418  ILE A CG1 1 
ATOM 2831  C CG2 . ILE A 1 418  ? 43.761  5.483   14.308  1.00 28.86  ? 418  ILE A CG2 1 
ATOM 2832  C CD1 . ILE A 1 418  ? 42.994  3.797   15.456  1.00 27.21  ? 418  ILE A CD1 1 
ATOM 2833  N N   . GLY A 1 419  ? 42.894  3.707   9.949   1.00 23.24  ? 419  GLY A N   1 
ATOM 2834  C CA  . GLY A 1 419  ? 42.810  2.617   8.976   1.00 25.14  ? 419  GLY A CA  1 
ATOM 2835  C C   . GLY A 1 419  ? 43.814  2.745   7.842   1.00 20.84  ? 419  GLY A C   1 
ATOM 2836  O O   . GLY A 1 419  ? 44.183  3.841   7.442   1.00 22.77  ? 419  GLY A O   1 
ATOM 2837  N N   . THR A 1 420  ? 44.209  1.604   7.288   1.00 20.24  ? 420  THR A N   1 
ATOM 2838  C CA  . THR A 1 420  ? 45.462  1.456   6.538   1.00 22.35  ? 420  THR A CA  1 
ATOM 2839  C C   . THR A 1 420  ? 45.384  2.065   5.148   1.00 15.87  ? 420  THR A C   1 
ATOM 2840  O O   . THR A 1 420  ? 45.018  1.396   4.177   1.00 10.60  ? 420  THR A O   1 
ATOM 2841  C CB  . THR A 1 420  ? 45.820  -0.017  6.428   1.00 27.97  ? 420  THR A CB  1 
ATOM 2842  N N   . SER A 1 421  ? 45.774  3.297   5.050   1.00 15.35  ? 421  SER A N   1 
ATOM 2843  C CA  . SER A 1 421  ? 45.966  4.038   3.815   1.00 10.44  ? 421  SER A CA  1 
ATOM 2844  C C   . SER A 1 421  ? 47.280  3.656   3.135   1.00 11.48  ? 421  SER A C   1 
ATOM 2845  O O   . SER A 1 421  ? 48.241  3.261   3.800   1.00 9.49   ? 421  SER A O   1 
ATOM 2846  C CB  . SER A 1 421  ? 45.964  5.543   4.079   1.00 11.53  ? 421  SER A CB  1 
ATOM 2847  N N   . PRO A 1 422  ? 47.333  3.779   1.800   1.00 9.34   ? 422  PRO A N   1 
ATOM 2848  C CA  . PRO A 1 422  ? 48.583  3.465   1.077   1.00 11.22  ? 422  PRO A CA  1 
ATOM 2849  C C   . PRO A 1 422  ? 49.779  4.276   1.548   1.00 10.11  ? 422  PRO A C   1 
ATOM 2850  O O   . PRO A 1 422  ? 50.875  3.718   1.652   1.00 11.68  ? 422  PRO A O   1 
ATOM 2851  C CB  . PRO A 1 422  ? 48.236  3.777   -0.386  1.00 8.96   ? 422  PRO A CB  1 
ATOM 2852  N N   . LEU A 1 423  ? 49.588  5.572   1.829   1.00 13.80  ? 423  LEU A N   1 
ATOM 2853  C CA  . LEU A 1 423  ? 50.585  6.530   2.329   1.00 18.95  ? 423  LEU A CA  1 
ATOM 2854  C C   . LEU A 1 423  ? 52.015  5.979   2.370   1.00 17.74  ? 423  LEU A C   1 
ATOM 2855  O O   . LEU A 1 423  ? 52.557  5.604   1.323   1.00 15.56  ? 423  LEU A O   1 
ATOM 2856  C CB  . LEU A 1 423  ? 50.126  7.042   3.708   1.00 21.43  ? 423  LEU A CB  1 
ATOM 2857  C CG  . LEU A 1 423  ? 48.655  7.501   3.626   1.00 16.55  ? 423  LEU A CG  1 
ATOM 2858  C CD1 . LEU A 1 423  ? 48.040  8.052   4.894   1.00 13.69  ? 423  LEU A CD1 1 
ATOM 2859  C CD2 . LEU A 1 423  ? 48.544  8.551   2.565   1.00 18.97  ? 423  LEU A CD2 1 
ATOM 2860  N N   . LYS A 1 424  ? 52.646  5.972   3.551   1.00 22.19  ? 424  LYS A N   1 
ATOM 2861  C CA  . LYS A 1 424  ? 53.922  5.295   3.791   1.00 14.03  ? 424  LYS A CA  1 
ATOM 2862  C C   . LYS A 1 424  ? 54.566  5.871   5.051   1.00 8.96   ? 424  LYS A C   1 
ATOM 2863  O O   . LYS A 1 424  ? 55.399  5.224   5.692   1.00 8.96   ? 424  LYS A O   1 
ATOM 2864  C CB  . LYS A 1 424  ? 54.863  5.411   2.578   1.00 8.96   ? 424  LYS A CB  1 
ATOM 2865  C CG  . LYS A 1 424  ? 55.829  4.235   2.400   1.00 8.96   ? 424  LYS A CG  1 
ATOM 2866  C CD  . LYS A 1 424  ? 56.375  4.164   0.983   1.00 8.96   ? 424  LYS A CD  1 
ATOM 2867  C CE  . LYS A 1 424  ? 55.244  4.083   -0.017  1.00 8.96   ? 424  LYS A CE  1 
ATOM 2868  N NZ  . LYS A 1 424  ? 55.187  5.262   -0.909  1.00 8.96   ? 424  LYS A NZ  1 
ATOM 2869  N N   . GLU A 1 425  ? 54.160  7.076   5.428   1.00 9.08   ? 425  GLU A N   1 
ATOM 2870  C CA  . GLU A 1 425  ? 54.727  7.726   6.590   1.00 9.08   ? 425  GLU A CA  1 
ATOM 2871  C C   . GLU A 1 425  ? 53.898  7.420   7.812   1.00 9.08   ? 425  GLU A C   1 
ATOM 2872  O O   . GLU A 1 425  ? 52.938  8.125   8.082   1.00 9.08   ? 425  GLU A O   1 
ATOM 2873  C CB  . GLU A 1 425  ? 54.799  9.233   6.371   1.00 9.08   ? 425  GLU A CB  1 
ATOM 2874  N N   . GLU A 1 428  ? 52.406  4.516   13.619  1.00 8.85   ? 428  GLU A N   1 
ATOM 2875  C CA  . GLU A 1 428  ? 53.233  5.690   13.889  1.00 8.75   ? 428  GLU A CA  1 
ATOM 2876  C C   . GLU A 1 428  ? 54.127  5.510   15.173  1.00 12.16  ? 428  GLU A C   1 
ATOM 2877  O O   . GLU A 1 428  ? 55.358  5.349   15.063  1.00 8.75   ? 428  GLU A O   1 
ATOM 2878  C CB  . GLU A 1 428  ? 52.313  6.894   13.976  1.00 12.20  ? 428  GLU A CB  1 
ATOM 2879  C CG  . GLU A 1 428  ? 52.946  8.248   14.147  1.00 11.34  ? 428  GLU A CG  1 
ATOM 2880  C CD  . GLU A 1 428  ? 52.049  9.203   14.958  1.00 8.75   ? 428  GLU A CD  1 
ATOM 2881  O OE1 . GLU A 1 428  ? 51.597  10.217  14.382  1.00 8.75   ? 428  GLU A OE1 1 
ATOM 2882  O OE2 . GLU A 1 428  ? 51.776  8.934   16.154  1.00 10.07  ? 428  GLU A OE2 1 
ATOM 2883  N N   . ALA A 1 429  ? 53.527  5.386   16.346  1.00 11.53  ? 429  ALA A N   1 
ATOM 2884  C CA  . ALA A 1 429  ? 54.232  5.419   17.622  1.00 12.91  ? 429  ALA A CA  1 
ATOM 2885  C C   . ALA A 1 429  ? 53.714  4.354   18.586  1.00 16.46  ? 429  ALA A C   1 
ATOM 2886  O O   . ALA A 1 429  ? 53.735  4.483   19.853  1.00 16.24  ? 429  ALA A O   1 
ATOM 2887  C CB  . ALA A 1 429  ? 54.151  6.834   18.220  1.00 15.34  ? 429  ALA A CB  1 
ATOM 2888  N N   . PHE A 1 430  ? 53.236  3.256   17.973  1.00 16.45  ? 430  PHE A N   1 
ATOM 2889  C CA  . PHE A 1 430  ? 52.710  2.126   18.768  1.00 21.34  ? 430  PHE A CA  1 
ATOM 2890  C C   . PHE A 1 430  ? 53.831  1.181   19.217  1.00 23.20  ? 430  PHE A C   1 
ATOM 2891  O O   . PHE A 1 430  ? 54.595  0.674   18.402  1.00 22.43  ? 430  PHE A O   1 
ATOM 2892  C CB  . PHE A 1 430  ? 51.655  1.312   18.055  1.00 24.07  ? 430  PHE A CB  1 
ATOM 2893  C CG  . PHE A 1 430  ? 50.364  1.945   17.804  1.00 24.60  ? 430  PHE A CG  1 
ATOM 2894  C CD1 . PHE A 1 430  ? 49.773  2.650   18.748  1.00 21.70  ? 430  PHE A CD1 1 
ATOM 2895  C CD2 . PHE A 1 430  ? 49.698  1.819   16.668  1.00 23.64  ? 430  PHE A CD2 1 
ATOM 2896  C CE1 . PHE A 1 430  ? 48.376  3.307   18.599  1.00 18.84  ? 430  PHE A CE1 1 
ATOM 2897  C CE2 . PHE A 1 430  ? 48.528  2.254   16.494  1.00 25.81  ? 430  PHE A CE2 1 
ATOM 2898  C CZ  . PHE A 1 430  ? 47.830  3.191   17.395  1.00 20.66  ? 430  PHE A CZ  1 
ATOM 2899  N N   . ALA A 1 431  ? 53.662  0.682   20.432  1.00 27.94  ? 431  ALA A N   1 
ATOM 2900  C CA  . ALA A 1 431  ? 54.525  -0.299  21.044  1.00 28.33  ? 431  ALA A CA  1 
ATOM 2901  C C   . ALA A 1 431  ? 53.794  -1.569  21.489  1.00 25.58  ? 431  ALA A C   1 
ATOM 2902  O O   . ALA A 1 431  ? 52.960  -1.515  22.399  1.00 23.62  ? 431  ALA A O   1 
ATOM 2903  C CB  . ALA A 1 431  ? 55.230  0.323   22.257  1.00 28.43  ? 431  ALA A CB  1 
ATOM 2904  N N   . ILE A 1 432  ? 54.131  -2.720  20.884  1.00 20.52  ? 432  ILE A N   1 
ATOM 2905  C CA  . ILE A 1 432  ? 53.413  -3.947  21.193  1.00 20.91  ? 432  ILE A CA  1 
ATOM 2906  C C   . ILE A 1 432  ? 53.620  -4.323  22.648  1.00 17.90  ? 432  ILE A C   1 
ATOM 2907  O O   . ILE A 1 432  ? 54.747  -4.381  23.146  1.00 16.27  ? 432  ILE A O   1 
ATOM 2908  C CB  . ILE A 1 432  ? 53.854  -5.103  20.293  1.00 25.20  ? 432  ILE A CB  1 
ATOM 2909  C CG1 . ILE A 1 432  ? 53.857  -4.727  18.810  1.00 33.64  ? 432  ILE A CG1 1 
ATOM 2910  C CG2 . ILE A 1 432  ? 52.936  -6.312  20.562  1.00 19.96  ? 432  ILE A CG2 1 
ATOM 2911  C CD1 . ILE A 1 432  ? 52.539  -4.245  18.237  1.00 36.23  ? 432  ILE A CD1 1 
ATOM 2912  N N   . VAL A 1 433  ? 52.518  -4.659  23.298  1.00 21.40  ? 433  VAL A N   1 
ATOM 2913  C CA  . VAL A 1 433  ? 52.395  -5.058  24.695  1.00 27.54  ? 433  VAL A CA  1 
ATOM 2914  C C   . VAL A 1 433  ? 51.754  -6.444  24.677  1.00 28.62  ? 433  VAL A C   1 
ATOM 2915  O O   . VAL A 1 433  ? 50.885  -6.684  23.845  1.00 24.92  ? 433  VAL A O   1 
ATOM 2916  C CB  . VAL A 1 433  ? 51.533  -4.037  25.464  1.00 28.58  ? 433  VAL A CB  1 
ATOM 2917  C CG1 . VAL A 1 433  ? 51.707  -4.169  26.961  1.00 35.74  ? 433  VAL A CG1 1 
ATOM 2918  C CG2 . VAL A 1 433  ? 51.848  -2.605  25.009  1.00 21.03  ? 433  VAL A CG2 1 
ATOM 2919  N N   . PRO A 1 434  ? 52.203  -7.409  25.461  1.00 33.59  ? 434  PRO A N   1 
ATOM 2920  C CA  . PRO A 1 434  ? 51.447  -8.671  25.562  1.00 31.56  ? 434  PRO A CA  1 
ATOM 2921  C C   . PRO A 1 434  ? 50.699  -8.924  26.881  1.00 32.69  ? 434  PRO A C   1 
ATOM 2922  O O   . PRO A 1 434  ? 50.919  -8.231  27.878  1.00 38.80  ? 434  PRO A O   1 
ATOM 2923  C CB  . PRO A 1 434  ? 52.531  -9.736  25.332  1.00 32.17  ? 434  PRO A CB  1 
ATOM 2924  C CG  . PRO A 1 434  ? 53.814  -9.074  25.689  1.00 30.90  ? 434  PRO A CG  1 
ATOM 2925  C CD  . PRO A 1 434  ? 53.657  -7.625  25.403  1.00 27.97  ? 434  PRO A CD  1 
ATOM 2926  N N   . VAL A 1 435  ? 49.811  -9.938  26.885  1.00 27.72  ? 435  VAL A N   1 
ATOM 2927  C CA  . VAL A 1 435  ? 48.992  -10.316 28.042  1.00 33.58  ? 435  VAL A CA  1 
ATOM 2928  C C   . VAL A 1 435  ? 49.772  -11.195 29.009  1.00 46.28  ? 435  VAL A C   1 
ATOM 2929  O O   . VAL A 1 435  ? 50.401  -12.181 28.603  1.00 34.46  ? 435  VAL A O   1 
ATOM 2930  C CB  . VAL A 1 435  ? 47.743  -11.059 27.562  1.00 26.78  ? 435  VAL A CB  1 
ATOM 2931  C CG1 . VAL A 1 435  ? 46.750  -11.276 28.706  1.00 28.13  ? 435  VAL A CG1 1 
ATOM 2932  C CG2 . VAL A 1 435  ? 47.168  -10.325 26.398  1.00 28.36  ? 435  VAL A CG2 1 
ATOM 2933  N N   . SER A 1 436  ? 49.651  -10.894 30.337  1.00 55.15  ? 436  SER A N   1 
ATOM 2934  C CA  . SER A 1 436  ? 50.455  -11.482 31.420  1.00 62.44  ? 436  SER A CA  1 
ATOM 2935  C C   . SER A 1 436  ? 49.995  -12.905 31.746  1.00 53.06  ? 436  SER A C   1 
ATOM 2936  O O   . SER A 1 436  ? 48.796  -13.149 31.873  1.00 61.46  ? 436  SER A O   1 
ATOM 2937  C CB  . SER A 1 436  ? 50.372  -10.622 32.696  1.00 62.10  ? 436  SER A CB  1 
ATOM 2938  O OG  . SER A 1 436  ? 49.506  -11.190 33.681  1.00 46.88  ? 436  SER A OG  1 
ATOM 2939  N N   . PRO A 1 437  ? 50.925  -13.857 31.922  1.00 50.88  ? 437  PRO A N   1 
ATOM 2940  C CA  . PRO A 1 437  ? 50.495  -15.220 32.286  1.00 48.98  ? 437  PRO A CA  1 
ATOM 2941  C C   . PRO A 1 437  ? 49.767  -15.315 33.629  1.00 51.26  ? 437  PRO A C   1 
ATOM 2942  O O   . PRO A 1 437  ? 48.823  -16.111 33.737  1.00 50.40  ? 437  PRO A O   1 
ATOM 2943  C CB  . PRO A 1 437  ? 51.813  -16.010 32.273  1.00 42.39  ? 437  PRO A CB  1 
ATOM 2944  C CG  . PRO A 1 437  ? 52.682  -15.262 31.312  1.00 42.09  ? 437  PRO A CG  1 
ATOM 2945  C CD  . PRO A 1 437  ? 52.352  -13.816 31.557  1.00 47.45  ? 437  PRO A CD  1 
ATOM 2946  N N   . ALA A 1 438  ? 50.161  -14.545 34.654  1.00 40.88  ? 438  ALA A N   1 
ATOM 2947  C CA  . ALA A 1 438  ? 49.369  -14.506 35.885  1.00 26.97  ? 438  ALA A CA  1 
ATOM 2948  C C   . ALA A 1 438  ? 47.916  -14.172 35.565  1.00 29.27  ? 438  ALA A C   1 
ATOM 2949  O O   . ALA A 1 438  ? 46.993  -14.935 35.889  1.00 27.03  ? 438  ALA A O   1 
ATOM 2950  C CB  . ALA A 1 438  ? 49.961  -13.488 36.860  1.00 16.08  ? 438  ALA A CB  1 
ATOM 2951  N N   . GLU A 1 439  ? 47.714  -13.066 34.844  1.00 32.55  ? 439  GLU A N   1 
ATOM 2952  C CA  . GLU A 1 439  ? 46.379  -12.627 34.443  1.00 44.32  ? 439  GLU A CA  1 
ATOM 2953  C C   . GLU A 1 439  ? 45.661  -13.594 33.481  1.00 59.62  ? 439  GLU A C   1 
ATOM 2954  O O   . GLU A 1 439  ? 44.423  -13.648 33.506  1.00 56.96  ? 439  GLU A O   1 
ATOM 2955  C CB  . GLU A 1 439  ? 46.462  -11.223 33.828  1.00 44.82  ? 439  GLU A CB  1 
ATOM 2956  C CG  . GLU A 1 439  ? 45.717  -10.154 34.613  1.00 34.81  ? 439  GLU A CG  1 
ATOM 2957  C CD  . GLU A 1 439  ? 46.436  -8.819  34.630  1.00 22.38  ? 439  GLU A CD  1 
ATOM 2958  O OE1 . GLU A 1 439  ? 45.997  -7.922  35.374  1.00 14.41  ? 439  GLU A OE1 1 
ATOM 2959  O OE2 . GLU A 1 439  ? 47.439  -8.665  33.907  1.00 29.07  ? 439  GLU A OE2 1 
ATOM 2960  N N   . VAL A 1 440  ? 46.387  -14.355 32.627  1.00 72.51  ? 440  VAL A N   1 
ATOM 2961  C CA  . VAL A 1 440  ? 45.748  -15.255 31.635  1.00 78.87  ? 440  VAL A CA  1 
ATOM 2962  C C   . VAL A 1 440  ? 45.358  -16.645 32.235  1.00 63.36  ? 440  VAL A C   1 
ATOM 2963  O O   . VAL A 1 440  ? 44.377  -17.269 31.788  1.00 53.82  ? 440  VAL A O   1 
ATOM 2964  C CB  . VAL A 1 440  ? 46.629  -15.444 30.366  1.00 79.57  ? 440  VAL A CB  1 
ATOM 2965  C CG1 . VAL A 1 440  ? 45.797  -16.000 29.195  1.00 93.97  ? 440  VAL A CG1 1 
ATOM 2966  C CG2 . VAL A 1 440  ? 47.307  -14.145 29.913  1.00 55.47  ? 440  VAL A CG2 1 
ATOM 2967  N N   . ARG A 1 441  ? 46.111  -17.174 33.214  1.00 50.12  ? 441  ARG A N   1 
ATOM 2968  C CA  . ARG A 1 441  ? 45.637  -18.363 33.925  1.00 33.70  ? 441  ARG A CA  1 
ATOM 2969  C C   . ARG A 1 441  ? 44.501  -18.030 34.881  1.00 40.65  ? 441  ARG A C   1 
ATOM 2970  O O   . ARG A 1 441  ? 43.549  -18.813 35.007  1.00 36.30  ? 441  ARG A O   1 
ATOM 2971  C CB  . ARG A 1 441  ? 46.777  -19.012 34.689  1.00 27.11  ? 441  ARG A CB  1 
ATOM 2972  C CG  . ARG A 1 441  ? 48.077  -18.651 34.098  1.00 26.07  ? 441  ARG A CG  1 
ATOM 2973  C CD  . ARG A 1 441  ? 48.948  -19.823 34.050  1.00 21.98  ? 441  ARG A CD  1 
ATOM 2974  N NE  . ARG A 1 441  ? 50.342  -19.467 33.871  1.00 16.82  ? 441  ARG A NE  1 
ATOM 2975  C CZ  . ARG A 1 441  ? 51.278  -20.377 33.667  1.00 9.63   ? 441  ARG A CZ  1 
ATOM 2976  N NH1 . ARG A 1 441  ? 50.923  -21.640 33.620  1.00 14.24  ? 441  ARG A NH1 1 
ATOM 2977  N NH2 . ARG A 1 441  ? 52.544  -20.045 33.514  1.00 9.04   ? 441  ARG A NH2 1 
ATOM 2978  N N   . ASP A 1 442  ? 44.584  -16.877 35.568  1.00 46.53  ? 442  ASP A N   1 
ATOM 2979  C CA  . ASP A 1 442  ? 43.498  -16.461 36.463  1.00 50.65  ? 442  ASP A CA  1 
ATOM 2980  C C   . ASP A 1 442  ? 42.200  -16.151 35.682  1.00 44.69  ? 442  ASP A C   1 
ATOM 2981  O O   . ASP A 1 442  ? 41.123  -16.710 35.970  1.00 38.52  ? 442  ASP A O   1 
ATOM 2982  C CB  . ASP A 1 442  ? 43.978  -15.260 37.305  1.00 40.96  ? 442  ASP A CB  1 
ATOM 2983  C CG  . ASP A 1 442  ? 45.398  -15.462 37.875  1.00 23.82  ? 442  ASP A CG  1 
ATOM 2984  O OD1 . ASP A 1 442  ? 46.036  -16.463 37.487  1.00 23.36  ? 442  ASP A OD1 1 
ATOM 2985  O OD2 . ASP A 1 442  ? 45.891  -14.622 38.672  1.00 15.67  ? 442  ASP A OD2 1 
ATOM 2986  N N   . LEU A 1 443  ? 42.283  -15.253 34.693  1.00 46.42  ? 443  LEU A N   1 
ATOM 2987  C CA  . LEU A 1 443  ? 41.162  -15.019 33.784  1.00 34.00  ? 443  LEU A CA  1 
ATOM 2988  C C   . LEU A 1 443  ? 40.668  -16.333 33.182  1.00 31.25  ? 443  LEU A C   1 
ATOM 2989  O O   . LEU A 1 443  ? 39.483  -16.680 33.296  1.00 26.06  ? 443  LEU A O   1 
ATOM 2990  C CB  . LEU A 1 443  ? 41.599  -14.027 32.699  1.00 31.26  ? 443  LEU A CB  1 
ATOM 2991  C CG  . LEU A 1 443  ? 40.622  -13.242 31.835  1.00 23.54  ? 443  LEU A CG  1 
ATOM 2992  C CD1 . LEU A 1 443  ? 39.250  -13.388 32.406  1.00 34.50  ? 443  LEU A CD1 1 
ATOM 2993  C CD2 . LEU A 1 443  ? 41.041  -11.784 31.808  1.00 26.06  ? 443  LEU A CD2 1 
ATOM 2994  N N   . ASP A 1 444  ? 41.573  -17.096 32.562  1.00 30.93  ? 444  ASP A N   1 
ATOM 2995  C CA  . ASP A 1 444  ? 41.207  -18.435 32.119  1.00 23.58  ? 444  ASP A CA  1 
ATOM 2996  C C   . ASP A 1 444  ? 40.353  -19.127 33.168  1.00 24.02  ? 444  ASP A C   1 
ATOM 2997  O O   . ASP A 1 444  ? 39.330  -19.745 32.839  1.00 25.98  ? 444  ASP A O   1 
ATOM 2998  C CB  . ASP A 1 444  ? 42.460  -19.255 31.806  1.00 26.23  ? 444  ASP A CB  1 
ATOM 2999  N N   . PHE A 1 445  ? 40.710  -19.000 34.450  1.00 23.29  ? 445  PHE A N   1 
ATOM 3000  C CA  . PHE A 1 445  ? 39.943  -19.778 35.410  1.00 22.40  ? 445  PHE A CA  1 
ATOM 3001  C C   . PHE A 1 445  ? 38.546  -19.258 35.550  1.00 21.24  ? 445  PHE A C   1 
ATOM 3002  O O   . PHE A 1 445  ? 37.583  -20.033 35.535  1.00 22.09  ? 445  PHE A O   1 
ATOM 3003  C CB  . PHE A 1 445  ? 40.541  -19.841 36.792  1.00 21.82  ? 445  PHE A CB  1 
ATOM 3004  C CG  . PHE A 1 445  ? 39.819  -20.828 37.677  1.00 18.50  ? 445  PHE A CG  1 
ATOM 3005  C CD1 . PHE A 1 445  ? 38.832  -21.689 37.181  1.00 18.29  ? 445  PHE A CD1 1 
ATOM 3006  C CD2 . PHE A 1 445  ? 40.156  -20.926 38.988  1.00 17.53  ? 445  PHE A CD2 1 
ATOM 3007  C CE1 . PHE A 1 445  ? 38.196  -22.593 37.996  1.00 15.43  ? 445  PHE A CE1 1 
ATOM 3008  C CE2 . PHE A 1 445  ? 39.530  -21.810 39.807  1.00 18.00  ? 445  PHE A CE2 1 
ATOM 3009  C CZ  . PHE A 1 445  ? 38.553  -22.660 39.312  1.00 16.59  ? 445  PHE A CZ  1 
ATOM 3010  N N   . ALA A 1 446  ? 38.417  -17.971 35.817  1.00 20.61  ? 446  ALA A N   1 
ATOM 3011  C CA  . ALA A 1 446  ? 37.068  -17.479 35.917  1.00 19.51  ? 446  ALA A CA  1 
ATOM 3012  C C   . ALA A 1 446  ? 36.237  -18.011 34.754  1.00 19.21  ? 446  ALA A C   1 
ATOM 3013  O O   . ALA A 1 446  ? 35.072  -18.387 34.928  1.00 17.16  ? 446  ALA A O   1 
ATOM 3014  C CB  . ALA A 1 446  ? 37.059  -15.956 35.986  1.00 18.34  ? 446  ALA A CB  1 
ATOM 3015  N N   . ASN A 1 447  ? 36.831  -18.109 33.566  1.00 20.98  ? 447  ASN A N   1 
ATOM 3016  C CA  . ASN A 1 447  ? 36.036  -18.587 32.440  1.00 19.63  ? 447  ASN A CA  1 
ATOM 3017  C C   . ASN A 1 447  ? 35.601  -20.028 32.662  1.00 16.03  ? 447  ASN A C   1 
ATOM 3018  O O   . ASN A 1 447  ? 34.402  -20.345 32.640  1.00 11.73  ? 447  ASN A O   1 
ATOM 3019  C CB  . ASN A 1 447  ? 36.807  -18.443 31.132  1.00 24.30  ? 447  ASN A CB  1 
ATOM 3020  C CG  . ASN A 1 447  ? 36.441  -17.167 30.364  1.00 25.08  ? 447  ASN A CG  1 
ATOM 3021  O OD1 . ASN A 1 447  ? 35.571  -16.385 30.774  1.00 27.81  ? 447  ASN A OD1 1 
ATOM 3022  N ND2 . ASN A 1 447  ? 37.134  -16.941 29.258  1.00 27.08  ? 447  ASN A ND2 1 
ATOM 3023  N N   . ASP A 1 448  ? 36.553  -20.921 32.893  1.00 18.65  ? 448  ASP A N   1 
ATOM 3024  C CA  . ASP A 1 448  ? 36.145  -22.307 33.000  1.00 17.35  ? 448  ASP A CA  1 
ATOM 3025  C C   . ASP A 1 448  ? 35.160  -22.482 34.133  1.00 13.52  ? 448  ASP A C   1 
ATOM 3026  O O   . ASP A 1 448  ? 34.010  -22.884 33.902  1.00 13.55  ? 448  ASP A O   1 
ATOM 3027  C CB  . ASP A 1 448  ? 37.351  -23.218 33.130  1.00 21.96  ? 448  ASP A CB  1 
ATOM 3028  C CG  . ASP A 1 448  ? 37.872  -23.623 31.768  1.00 23.50  ? 448  ASP A CG  1 
ATOM 3029  O OD1 . ASP A 1 448  ? 37.043  -23.746 30.847  1.00 28.71  ? 448  ASP A OD1 1 
ATOM 3030  O OD2 . ASP A 1 448  ? 39.092  -23.787 31.589  1.00 23.05  ? 448  ASP A OD2 1 
ATOM 3031  N N   . ALA A 1 449  ? 35.568  -22.153 35.356  1.00 14.08  ? 449  ALA A N   1 
ATOM 3032  C CA  . ALA A 1 449  ? 34.549  -21.971 36.370  1.00 12.13  ? 449  ALA A CA  1 
ATOM 3033  C C   . ALA A 1 449  ? 33.238  -21.642 35.673  1.00 12.82  ? 449  ALA A C   1 
ATOM 3034  O O   . ALA A 1 449  ? 32.296  -22.440 35.708  1.00 15.19  ? 449  ALA A O   1 
ATOM 3035  C CB  . ALA A 1 449  ? 34.955  -20.880 37.355  1.00 14.31  ? 449  ALA A CB  1 
ATOM 3036  N N   . SER A 1 450  ? 33.214  -20.574 34.882  1.00 8.61   ? 450  SER A N   1 
ATOM 3037  C CA  . SER A 1 450  ? 31.954  -20.209 34.249  1.00 8.61   ? 450  SER A CA  1 
ATOM 3038  C C   . SER A 1 450  ? 31.314  -21.400 33.596  1.00 12.37  ? 450  SER A C   1 
ATOM 3039  O O   . SER A 1 450  ? 30.195  -21.785 33.943  1.00 10.48  ? 450  SER A O   1 
ATOM 3040  C CB  . SER A 1 450  ? 32.134  -19.130 33.214  1.00 11.08  ? 450  SER A CB  1 
ATOM 3041  O OG  . SER A 1 450  ? 33.477  -18.886 33.005  1.00 11.14  ? 450  SER A OG  1 
ATOM 3042  N N   . LYS A 1 451  ? 31.980  -21.991 32.614  1.00 8.60   ? 451  LYS A N   1 
ATOM 3043  C CA  . LYS A 1 451  ? 31.240  -23.008 31.892  1.00 8.60   ? 451  LYS A CA  1 
ATOM 3044  C C   . LYS A 1 451  ? 30.661  -23.987 32.888  1.00 10.84  ? 451  LYS A C   1 
ATOM 3045  O O   . LYS A 1 451  ? 29.503  -24.404 32.748  1.00 12.59  ? 451  LYS A O   1 
ATOM 3046  C CB  . LYS A 1 451  ? 32.092  -23.703 30.840  1.00 9.12   ? 451  LYS A CB  1 
ATOM 3047  C CG  . LYS A 1 451  ? 33.496  -23.896 31.232  1.00 13.46  ? 451  LYS A CG  1 
ATOM 3048  C CD  . LYS A 1 451  ? 34.318  -22.676 30.885  1.00 12.47  ? 451  LYS A CD  1 
ATOM 3049  C CE  . LYS A 1 451  ? 33.510  -21.703 30.073  1.00 11.85  ? 451  LYS A CE  1 
ATOM 3050  N NZ  . LYS A 1 451  ? 33.246  -20.475 30.843  1.00 14.89  ? 451  LYS A NZ  1 
ATOM 3051  N N   . VAL A 1 452  ? 31.392  -24.277 33.974  1.00 12.08  ? 452  VAL A N   1 
ATOM 3052  C CA  . VAL A 1 452  ? 30.823  -25.262 34.884  1.00 14.43  ? 452  VAL A CA  1 
ATOM 3053  C C   . VAL A 1 452  ? 29.519  -24.645 35.352  1.00 13.91  ? 452  VAL A C   1 
ATOM 3054  O O   . VAL A 1 452  ? 28.445  -25.043 34.886  1.00 15.02  ? 452  VAL A O   1 
ATOM 3055  C CB  . VAL A 1 452  ? 31.697  -25.692 36.091  1.00 16.54  ? 452  VAL A CB  1 
ATOM 3056  C CG1 . VAL A 1 452  ? 32.322  -27.053 35.838  1.00 18.45  ? 452  VAL A CG1 1 
ATOM 3057  C CG2 . VAL A 1 452  ? 32.772  -24.734 36.427  1.00 15.71  ? 452  VAL A CG2 1 
ATOM 3058  N N   . LEU A 1 453  ? 29.609  -23.613 36.199  1.00 12.01  ? 453  LEU A N   1 
ATOM 3059  C CA  . LEU A 1 453  ? 28.419  -23.156 36.905  1.00 11.51  ? 453  LEU A CA  1 
ATOM 3060  C C   . LEU A 1 453  ? 27.213  -23.046 35.988  1.00 14.62  ? 453  LEU A C   1 
ATOM 3061  O O   . LEU A 1 453  ? 26.097  -23.322 36.439  1.00 12.52  ? 453  LEU A O   1 
ATOM 3062  C CB  . LEU A 1 453  ? 28.640  -21.818 37.640  1.00 12.14  ? 453  LEU A CB  1 
ATOM 3063  C CG  . LEU A 1 453  ? 29.977  -21.148 37.968  1.00 15.34  ? 453  LEU A CG  1 
ATOM 3064  C CD1 . LEU A 1 453  ? 30.957  -22.023 38.721  1.00 21.30  ? 453  LEU A CD1 1 
ATOM 3065  C CD2 . LEU A 1 453  ? 30.552  -20.845 36.658  1.00 12.42  ? 453  LEU A CD2 1 
ATOM 3066  N N   . GLY A 1 454  ? 27.420  -22.583 34.750  1.00 8.58   ? 454  GLY A N   1 
ATOM 3067  C CA  . GLY A 1 454  ? 26.289  -22.368 33.884  1.00 14.33  ? 454  GLY A CA  1 
ATOM 3068  C C   . GLY A 1 454  ? 25.673  -23.686 33.515  1.00 15.68  ? 454  GLY A C   1 
ATOM 3069  O O   . GLY A 1 454  ? 24.431  -23.793 33.467  1.00 17.26  ? 454  GLY A O   1 
ATOM 3070  N N   . SER A 1 455  ? 26.542  -24.696 33.232  1.00 15.38  ? 455  SER A N   1 
ATOM 3071  C CA  . SER A 1 455  ? 26.267  -26.121 32.952  1.00 19.07  ? 455  SER A CA  1 
ATOM 3072  C C   . SER A 1 455  ? 25.683  -26.896 34.132  1.00 22.61  ? 455  SER A C   1 
ATOM 3073  O O   . SER A 1 455  ? 24.815  -27.784 33.882  1.00 24.45  ? 455  SER A O   1 
ATOM 3074  C CB  . SER A 1 455  ? 27.561  -26.791 32.533  1.00 17.70  ? 455  SER A CB  1 
ATOM 3075  O OG  . SER A 1 455  ? 27.354  -28.189 32.549  1.00 11.81  ? 455  SER A OG  1 
ATOM 3076  N N   . ILE A 1 456  ? 25.984  -26.418 35.363  1.00 24.16  ? 456  ILE A N   1 
ATOM 3077  C CA  . ILE A 1 456  ? 25.536  -26.985 36.661  1.00 28.86  ? 456  ILE A CA  1 
ATOM 3078  C C   . ILE A 1 456  ? 24.284  -26.316 37.295  1.00 24.89  ? 456  ILE A C   1 
ATOM 3079  O O   . ILE A 1 456  ? 23.460  -27.042 37.868  1.00 23.15  ? 456  ILE A O   1 
ATOM 3080  C CB  . ILE A 1 456  ? 26.733  -26.976 37.655  1.00 41.60  ? 456  ILE A CB  1 
ATOM 3081  C CG1 . ILE A 1 456  ? 27.793  -28.042 37.289  1.00 32.09  ? 456  ILE A CG1 1 
ATOM 3082  C CG2 . ILE A 1 456  ? 26.257  -27.235 39.092  1.00 41.93  ? 456  ILE A CG2 1 
ATOM 3083  C CD1 . ILE A 1 456  ? 29.168  -27.478 37.028  1.00 29.31  ? 456  ILE A CD1 1 
ATOM 3084  N N   . ALA A 1 457  ? 24.024  -24.997 37.099  1.00 22.88  ? 457  ALA A N   1 
ATOM 3085  C CA  . ALA A 1 457  ? 22.673  -24.417 37.309  1.00 22.40  ? 457  ALA A CA  1 
ATOM 3086  C C   . ALA A 1 457  ? 21.609  -24.827 36.291  1.00 30.52  ? 457  ALA A C   1 
ATOM 3087  O O   . ALA A 1 457  ? 20.630  -25.475 36.657  1.00 32.08  ? 457  ALA A O   1 
ATOM 3088  C CB  . ALA A 1 457  ? 22.692  -22.886 37.291  1.00 16.21  ? 457  ALA A CB  1 
ATOM 3089  N N   . GLY A 1 458  ? 21.700  -24.347 35.032  1.00 33.32  ? 458  GLY A N   1 
ATOM 3090  C CA  . GLY A 1 458  ? 20.801  -24.850 33.981  1.00 26.05  ? 458  GLY A CA  1 
ATOM 3091  C C   . GLY A 1 458  ? 20.318  -26.294 34.165  1.00 25.06  ? 458  GLY A C   1 
ATOM 3092  O O   . GLY A 1 458  ? 19.120  -26.499 34.394  1.00 22.39  ? 458  GLY A O   1 
ATOM 3093  N N   . LYS A 1 459  ? 21.211  -27.315 34.120  1.00 27.61  ? 459  LYS A N   1 
ATOM 3094  C CA  . LYS A 1 459  ? 20.820  -28.549 34.809  1.00 24.06  ? 459  LYS A CA  1 
ATOM 3095  C C   . LYS A 1 459  ? 19.995  -28.381 36.090  1.00 24.70  ? 459  LYS A C   1 
ATOM 3096  O O   . LYS A 1 459  ? 18.936  -29.004 36.188  1.00 26.24  ? 459  LYS A O   1 
ATOM 3097  C CB  . LYS A 1 459  ? 22.008  -29.429 35.202  1.00 24.61  ? 459  LYS A CB  1 
ATOM 3098  C CG  . LYS A 1 459  ? 23.302  -28.756 35.204  1.00 21.92  ? 459  LYS A CG  1 
ATOM 3099  C CD  . LYS A 1 459  ? 23.112  -27.122 35.284  1.00 28.37  ? 459  LYS A CD  1 
ATOM 3100  C CE  . LYS A 1 459  ? 23.333  -26.003 34.062  1.00 28.23  ? 459  LYS A CE  1 
ATOM 3101  N NZ  . LYS A 1 459  ? 24.006  -24.946 34.678  1.00 23.09  ? 459  LYS A NZ  1 
ATOM 3102  N N   . LEU A 1 460  ? 20.493  -27.692 37.128  1.00 26.27  ? 460  LEU A N   1 
ATOM 3103  C CA  . LEU A 1 460  ? 19.727  -27.646 38.382  1.00 27.51  ? 460  LEU A CA  1 
ATOM 3104  C C   . LEU A 1 460  ? 18.249  -27.316 38.157  1.00 26.61  ? 460  LEU A C   1 
ATOM 3105  O O   . LEU A 1 460  ? 17.353  -28.015 38.658  1.00 26.69  ? 460  LEU A O   1 
ATOM 3106  C CB  . LEU A 1 460  ? 20.313  -26.621 39.353  1.00 30.97  ? 460  LEU A CB  1 
ATOM 3107  C CG  . LEU A 1 460  ? 19.654  -26.698 40.745  1.00 27.61  ? 460  LEU A CG  1 
ATOM 3108  C CD1 . LEU A 1 460  ? 18.170  -26.278 40.809  1.00 19.86  ? 460  LEU A CD1 1 
ATOM 3109  C CD2 . LEU A 1 460  ? 19.821  -28.108 41.267  1.00 27.18  ? 460  LEU A CD2 1 
ATOM 3110  N N   . GLU A 1 461  ? 17.978  -26.189 37.500  1.00 25.42  ? 461  GLU A N   1 
ATOM 3111  C CA  . GLU A 1 461  ? 16.605  -25.844 37.161  1.00 23.31  ? 461  GLU A CA  1 
ATOM 3112  C C   . GLU A 1 461  ? 15.972  -26.970 36.379  1.00 23.14  ? 461  GLU A C   1 
ATOM 3113  O O   . GLU A 1 461  ? 14.754  -27.181 36.436  1.00 16.19  ? 461  GLU A O   1 
ATOM 3114  C CB  . GLU A 1 461  ? 16.564  -24.556 36.343  1.00 21.54  ? 461  GLU A CB  1 
ATOM 3115  N N   . LYS A 1 462  ? 16.803  -27.711 35.650  1.00 25.27  ? 462  LYS A N   1 
ATOM 3116  C CA  . LYS A 1 462  ? 16.315  -28.770 34.781  1.00 34.92  ? 462  LYS A CA  1 
ATOM 3117  C C   . LYS A 1 462  ? 16.061  -30.060 35.558  1.00 43.31  ? 462  LYS A C   1 
ATOM 3118  O O   . LYS A 1 462  ? 14.969  -30.631 35.481  1.00 55.12  ? 462  LYS A O   1 
ATOM 3119  C CB  . LYS A 1 462  ? 17.307  -29.009 33.642  1.00 35.12  ? 462  LYS A CB  1 
ATOM 3120  C CG  . LYS A 1 462  ? 17.260  -27.963 32.527  1.00 37.06  ? 462  LYS A CG  1 
ATOM 3121  C CD  . LYS A 1 462  ? 17.668  -28.581 31.194  1.00 43.85  ? 462  LYS A CD  1 
ATOM 3122  C CE  . LYS A 1 462  ? 19.149  -28.916 31.156  1.00 40.06  ? 462  LYS A CE  1 
ATOM 3123  N NZ  . LYS A 1 462  ? 19.944  -27.762 30.661  1.00 36.40  ? 462  LYS A NZ  1 
ATOM 3124  N N   . GLY A 1 463  ? 17.052  -30.548 36.305  1.00 31.63  ? 463  GLY A N   1 
ATOM 3125  C CA  . GLY A 1 463  ? 16.835  -31.810 36.990  1.00 22.32  ? 463  GLY A CA  1 
ATOM 3126  C C   . GLY A 1 463  ? 17.770  -32.107 38.144  1.00 21.48  ? 463  GLY A C   1 
ATOM 3127  O O   . GLY A 1 463  ? 17.724  -31.433 39.179  1.00 23.31  ? 463  GLY A O   1 
ATOM 3128  N N   . THR A 1 464  ? 18.615  -33.130 37.967  1.00 19.11  ? 464  THR A N   1 
ATOM 3129  C CA  . THR A 1 464  ? 19.571  -33.602 38.966  1.00 18.18  ? 464  THR A CA  1 
ATOM 3130  C C   . THR A 1 464  ? 21.001  -33.413 38.453  1.00 23.92  ? 464  THR A C   1 
ATOM 3131  O O   . THR A 1 464  ? 21.254  -33.516 37.249  1.00 33.01  ? 464  THR A O   1 
ATOM 3132  C CB  . THR A 1 464  ? 19.319  -35.093 39.307  1.00 11.66  ? 464  THR A CB  1 
ATOM 3133  O OG1 . THR A 1 464  ? 19.855  -35.407 40.597  1.00 8.93   ? 464  THR A OG1 1 
ATOM 3134  C CG2 . THR A 1 464  ? 19.960  -36.003 38.271  1.00 11.61  ? 464  THR A CG2 1 
ATOM 3135  N N   . ILE A 1 465  ? 21.945  -33.132 39.371  1.00 24.77  ? 465  ILE A N   1 
ATOM 3136  C CA  . ILE A 1 465  ? 23.327  -32.812 38.979  1.00 15.96  ? 465  ILE A CA  1 
ATOM 3137  C C   . ILE A 1 465  ? 24.126  -34.068 38.676  1.00 13.43  ? 465  ILE A C   1 
ATOM 3138  O O   . ILE A 1 465  ? 25.167  -33.996 38.016  1.00 9.33   ? 465  ILE A O   1 
ATOM 3139  C CB  . ILE A 1 465  ? 24.052  -31.992 40.064  1.00 9.13   ? 465  ILE A CB  1 
ATOM 3140  C CG1 . ILE A 1 465  ? 23.593  -32.450 41.444  1.00 10.03  ? 465  ILE A CG1 1 
ATOM 3141  C CG2 . ILE A 1 465  ? 23.891  -30.483 39.857  1.00 8.87   ? 465  ILE A CG2 1 
ATOM 3142  C CD1 . ILE A 1 465  ? 24.670  -33.082 42.248  1.00 8.87   ? 465  ILE A CD1 1 
ATOM 3143  N N   . THR A 1 466  ? 23.686  -35.222 39.183  1.00 15.27  ? 466  THR A N   1 
ATOM 3144  C CA  . THR A 1 466  ? 24.296  -36.524 38.917  1.00 18.09  ? 466  THR A CA  1 
ATOM 3145  C C   . THR A 1 466  ? 25.540  -36.742 39.780  1.00 17.95  ? 466  THR A C   1 
ATOM 3146  O O   . THR A 1 466  ? 26.304  -35.804 40.025  1.00 13.37  ? 466  THR A O   1 
ATOM 3147  C CB  . THR A 1 466  ? 24.610  -36.682 37.423  1.00 15.86  ? 466  THR A CB  1 
ATOM 3148  O OG1 . THR A 1 466  ? 25.399  -35.582 36.968  1.00 10.52  ? 466  THR A OG1 1 
ATOM 3149  C CG2 . THR A 1 466  ? 23.322  -36.714 36.617  1.00 10.57  ? 466  THR A CG2 1 
ATOM 3150  N N   . GLN A 1 467  ? 25.738  -37.985 40.239  1.00 19.83  ? 467  GLN A N   1 
ATOM 3151  C CA  . GLN A 1 467  ? 26.712  -38.279 41.290  1.00 14.93  ? 467  GLN A CA  1 
ATOM 3152  C C   . GLN A 1 467  ? 28.133  -38.051 40.813  1.00 18.70  ? 467  GLN A C   1 
ATOM 3153  O O   . GLN A 1 467  ? 28.914  -37.357 41.468  1.00 15.16  ? 467  GLN A O   1 
ATOM 3154  C CB  . GLN A 1 467  ? 26.554  -39.723 41.764  1.00 14.11  ? 467  GLN A CB  1 
ATOM 3155  N N   . ASN A 1 468  ? 28.505  -38.689 39.701  1.00 25.78  ? 468  ASN A N   1 
ATOM 3156  C CA  . ASN A 1 468  ? 29.808  -38.441 39.089  1.00 34.52  ? 468  ASN A CA  1 
ATOM 3157  C C   . ASN A 1 468  ? 29.967  -36.960 38.735  1.00 25.94  ? 468  ASN A C   1 
ATOM 3158  O O   . ASN A 1 468  ? 31.019  -36.358 38.985  1.00 24.95  ? 468  ASN A O   1 
ATOM 3159  C CB  . ASN A 1 468  ? 29.977  -39.327 37.849  1.00 36.04  ? 468  ASN A CB  1 
ATOM 3160  N N   . GLU A 1 469  ? 28.929  -36.365 38.138  1.00 23.77  ? 469  GLU A N   1 
ATOM 3161  C CA  . GLU A 1 469  ? 28.916  -34.922 37.929  1.00 19.87  ? 469  GLU A CA  1 
ATOM 3162  C C   . GLU A 1 469  ? 28.833  -34.202 39.262  1.00 24.99  ? 469  GLU A C   1 
ATOM 3163  O O   . GLU A 1 469  ? 29.430  -33.132 39.443  1.00 35.85  ? 469  GLU A O   1 
ATOM 3164  C CB  . GLU A 1 469  ? 27.734  -34.522 37.040  1.00 14.82  ? 469  GLU A CB  1 
ATOM 3165  C CG  . GLU A 1 469  ? 27.977  -33.375 36.064  1.00 13.32  ? 469  GLU A CG  1 
ATOM 3166  C CD  . GLU A 1 469  ? 26.698  -32.867 35.425  1.00 8.83   ? 469  GLU A CD  1 
ATOM 3167  O OE1 . GLU A 1 469  ? 25.609  -33.301 35.843  1.00 8.83   ? 469  GLU A OE1 1 
ATOM 3168  O OE2 . GLU A 1 469  ? 26.782  -32.029 34.506  1.00 8.83   ? 469  GLU A OE2 1 
ATOM 3169  N N   . ARG A 1 470  ? 28.090  -34.786 40.208  1.00 20.78  ? 470  ARG A N   1 
ATOM 3170  C CA  . ARG A 1 470  ? 28.021  -34.249 41.562  1.00 26.47  ? 470  ARG A CA  1 
ATOM 3171  C C   . ARG A 1 470  ? 29.422  -33.966 42.103  1.00 38.39  ? 470  ARG A C   1 
ATOM 3172  O O   . ARG A 1 470  ? 29.711  -32.860 42.596  1.00 46.80  ? 470  ARG A O   1 
ATOM 3173  C CB  . ARG A 1 470  ? 27.266  -35.232 42.465  1.00 14.64  ? 470  ARG A CB  1 
ATOM 3174  N N   . ARG A 1 471  ? 30.322  -34.944 41.974  1.00 38.72  ? 471  ARG A N   1 
ATOM 3175  C CA  . ARG A 1 471  ? 31.678  -34.795 42.490  1.00 36.64  ? 471  ARG A CA  1 
ATOM 3176  C C   . ARG A 1 471  ? 32.398  -33.607 41.848  1.00 33.31  ? 471  ARG A C   1 
ATOM 3177  O O   . ARG A 1 471  ? 33.068  -32.832 42.541  1.00 28.32  ? 471  ARG A O   1 
ATOM 3178  C CB  . ARG A 1 471  ? 32.458  -36.092 42.270  1.00 32.82  ? 471  ARG A CB  1 
ATOM 3179  N N   . SER A 1 472  ? 32.249  -33.433 40.529  1.00 28.60  ? 472  SER A N   1 
ATOM 3180  C CA  . SER A 1 472  ? 32.977  -32.394 39.805  1.00 26.52  ? 472  SER A CA  1 
ATOM 3181  C C   . SER A 1 472  ? 32.435  -30.985 40.054  1.00 26.47  ? 472  SER A C   1 
ATOM 3182  O O   . SER A 1 472  ? 33.210  -30.021 40.031  1.00 28.86  ? 472  SER A O   1 
ATOM 3183  C CB  . SER A 1 472  ? 32.954  -32.701 38.310  1.00 23.13  ? 472  SER A CB  1 
ATOM 3184  O OG  . SER A 1 472  ? 31.641  -33.049 37.924  1.00 26.81  ? 472  SER A OG  1 
ATOM 3185  N N   . VAL A 1 473  ? 31.125  -30.826 40.261  1.00 26.44  ? 473  VAL A N   1 
ATOM 3186  C CA  . VAL A 1 473  ? 30.605  -29.510 40.628  1.00 26.83  ? 473  VAL A CA  1 
ATOM 3187  C C   . VAL A 1 473  ? 30.998  -29.145 42.063  1.00 27.26  ? 473  VAL A C   1 
ATOM 3188  O O   . VAL A 1 473  ? 31.565  -28.068 42.298  1.00 30.26  ? 473  VAL A O   1 
ATOM 3189  C CB  . VAL A 1 473  ? 29.082  -29.438 40.427  1.00 37.65  ? 473  VAL A CB  1 
ATOM 3190  C CG1 . VAL A 1 473  ? 28.436  -30.764 40.740  1.00 42.75  ? 473  VAL A CG1 1 
ATOM 3191  C CG2 . VAL A 1 473  ? 28.501  -28.368 41.325  1.00 39.46  ? 473  VAL A CG2 1 
ATOM 3192  N N   . THR A 1 474  ? 30.699  -30.014 43.050  1.00 21.16  ? 474  THR A N   1 
ATOM 3193  C CA  . THR A 1 474  ? 31.143  -29.704 44.413  1.00 17.64  ? 474  THR A CA  1 
ATOM 3194  C C   . THR A 1 474  ? 32.639  -29.392 44.448  1.00 28.31  ? 474  THR A C   1 
ATOM 3195  O O   . THR A 1 474  ? 33.060  -28.374 45.033  1.00 47.76  ? 474  THR A O   1 
ATOM 3196  C CB  . THR A 1 474  ? 30.840  -30.839 45.387  1.00 9.07   ? 474  THR A CB  1 
ATOM 3197  O OG1 . THR A 1 474  ? 31.505  -32.020 44.947  1.00 10.99  ? 474  THR A OG1 1 
ATOM 3198  C CG2 . THR A 1 474  ? 29.380  -31.094 45.463  1.00 8.86   ? 474  THR A CG2 1 
ATOM 3199  N N   . LYS A 1 475  ? 33.468  -30.250 43.835  1.00 28.61  ? 475  LYS A N   1 
ATOM 3200  C CA  . LYS A 1 475  ? 34.887  -29.914 43.696  1.00 30.42  ? 475  LYS A CA  1 
ATOM 3201  C C   . LYS A 1 475  ? 35.059  -28.488 43.155  1.00 31.72  ? 475  LYS A C   1 
ATOM 3202  O O   . LYS A 1 475  ? 35.645  -27.629 43.827  1.00 26.47  ? 475  LYS A O   1 
ATOM 3203  C CB  . LYS A 1 475  ? 35.614  -30.947 42.819  1.00 20.65  ? 475  LYS A CB  1 
ATOM 3204  C CG  . LYS A 1 475  ? 37.143  -30.999 42.992  1.00 13.59  ? 475  LYS A CG  1 
ATOM 3205  C CD  . LYS A 1 475  ? 37.607  -30.791 44.448  1.00 13.78  ? 475  LYS A CD  1 
ATOM 3206  C CE  . LYS A 1 475  ? 37.025  -31.803 45.432  1.00 9.59   ? 475  LYS A CE  1 
ATOM 3207  N NZ  . LYS A 1 475  ? 37.473  -33.179 45.142  1.00 8.87   ? 475  LYS A NZ  1 
ATOM 3208  N N   . LEU A 1 476  ? 34.522  -28.210 41.952  1.00 32.73  ? 476  LEU A N   1 
ATOM 3209  C CA  . LEU A 1 476  ? 34.584  -26.869 41.367  1.00 27.91  ? 476  LEU A CA  1 
ATOM 3210  C C   . LEU A 1 476  ? 34.448  -25.784 42.415  1.00 17.67  ? 476  LEU A C   1 
ATOM 3211  O O   . LEU A 1 476  ? 35.273  -24.866 42.503  1.00 11.69  ? 476  LEU A O   1 
ATOM 3212  C CB  . LEU A 1 476  ? 33.479  -26.699 40.327  1.00 25.33  ? 476  LEU A CB  1 
ATOM 3213  C CG  . LEU A 1 476  ? 32.974  -25.270 40.159  1.00 20.47  ? 476  LEU A CG  1 
ATOM 3214  C CD1 . LEU A 1 476  ? 34.078  -24.318 39.732  1.00 18.43  ? 476  LEU A CD1 1 
ATOM 3215  C CD2 . LEU A 1 476  ? 31.890  -25.280 39.140  1.00 19.96  ? 476  LEU A CD2 1 
ATOM 3216  N N   . LEU A 1 477  ? 33.401  -25.855 43.221  1.00 18.40  ? 477  LEU A N   1 
ATOM 3217  C CA  . LEU A 1 477  ? 33.169  -24.713 44.088  1.00 13.24  ? 477  LEU A CA  1 
ATOM 3218  C C   . LEU A 1 477  ? 34.144  -24.647 45.265  1.00 12.14  ? 477  LEU A C   1 
ATOM 3219  O O   . LEU A 1 477  ? 34.471  -23.549 45.765  1.00 11.60  ? 477  LEU A O   1 
ATOM 3220  C CB  . LEU A 1 477  ? 31.710  -24.700 44.526  1.00 17.84  ? 477  LEU A CB  1 
ATOM 3221  C CG  . LEU A 1 477  ? 30.846  -25.872 44.122  1.00 22.88  ? 477  LEU A CG  1 
ATOM 3222  C CD1 . LEU A 1 477  ? 29.850  -25.998 45.233  1.00 24.39  ? 477  LEU A CD1 1 
ATOM 3223  C CD2 . LEU A 1 477  ? 30.165  -25.567 42.824  1.00 23.14  ? 477  LEU A CD2 1 
ATOM 3224  N N   . GLU A 1 478  ? 34.631  -25.781 45.762  1.00 13.20  ? 478  GLU A N   1 
ATOM 3225  C CA  . GLU A 1 478  ? 35.639  -25.620 46.829  1.00 11.19  ? 478  GLU A CA  1 
ATOM 3226  C C   . GLU A 1 478  ? 36.948  -25.129 46.240  1.00 12.76  ? 478  GLU A C   1 
ATOM 3227  O O   . GLU A 1 478  ? 37.607  -24.283 46.844  1.00 14.04  ? 478  GLU A O   1 
ATOM 3228  C CB  . GLU A 1 478  ? 35.843  -26.896 47.629  1.00 12.33  ? 478  GLU A CB  1 
ATOM 3229  C CG  . GLU A 1 478  ? 34.618  -27.365 48.398  1.00 12.43  ? 478  GLU A CG  1 
ATOM 3230  C CD  . GLU A 1 478  ? 34.411  -26.677 49.734  1.00 8.79   ? 478  GLU A CD  1 
ATOM 3231  O OE1 . GLU A 1 478  ? 34.563  -27.339 50.772  1.00 8.79   ? 478  GLU A OE1 1 
ATOM 3232  O OE2 . GLU A 1 478  ? 34.098  -25.489 49.773  1.00 8.79   ? 478  GLU A OE2 1 
ATOM 3233  N N   . ASP A 1 479  ? 37.348  -25.628 45.052  1.00 15.02  ? 479  ASP A N   1 
ATOM 3234  C CA  . ASP A 1 479  ? 38.536  -25.028 44.447  1.00 15.26  ? 479  ASP A CA  1 
ATOM 3235  C C   . ASP A 1 479  ? 38.364  -23.525 44.296  1.00 18.35  ? 479  ASP A C   1 
ATOM 3236  O O   . ASP A 1 479  ? 39.318  -22.792 44.528  1.00 13.39  ? 479  ASP A O   1 
ATOM 3237  C CB  . ASP A 1 479  ? 38.929  -25.604 43.071  1.00 12.85  ? 479  ASP A CB  1 
ATOM 3238  C CG  . ASP A 1 479  ? 38.251  -26.885 42.722  1.00 15.11  ? 479  ASP A CG  1 
ATOM 3239  O OD1 . ASP A 1 479  ? 37.111  -26.804 42.248  1.00 15.65  ? 479  ASP A OD1 1 
ATOM 3240  O OD2 . ASP A 1 479  ? 38.876  -27.960 42.829  1.00 16.24  ? 479  ASP A OD2 1 
ATOM 3241  N N   . LEU A 1 480  ? 37.176  -23.032 43.888  1.00 26.71  ? 480  LEU A N   1 
ATOM 3242  C CA  . LEU A 1 480  ? 37.072  -21.573 43.713  1.00 32.98  ? 480  LEU A CA  1 
ATOM 3243  C C   . LEU A 1 480  ? 37.286  -20.850 45.038  1.00 19.09  ? 480  LEU A C   1 
ATOM 3244  O O   . LEU A 1 480  ? 37.977  -19.822 45.082  1.00 12.56  ? 480  LEU A O   1 
ATOM 3245  C CB  . LEU A 1 480  ? 35.748  -21.086 43.075  1.00 37.57  ? 480  LEU A CB  1 
ATOM 3246  C CG  . LEU A 1 480  ? 34.740  -21.921 42.306  1.00 28.34  ? 480  LEU A CG  1 
ATOM 3247  C CD1 . LEU A 1 480  ? 34.406  -22.411 43.550  1.00 20.57  ? 480  LEU A CD1 1 
ATOM 3248  C CD2 . LEU A 1 480  ? 33.459  -21.348 41.833  1.00 22.28  ? 480  LEU A CD2 1 
ATOM 3249  N N   . VAL A 1 481  ? 36.746  -21.374 46.140  1.00 15.77  ? 481  VAL A N   1 
ATOM 3250  C CA  . VAL A 1 481  ? 37.226  -20.789 47.384  1.00 10.47  ? 481  VAL A CA  1 
ATOM 3251  C C   . VAL A 1 481  ? 38.737  -20.790 47.386  1.00 9.95   ? 481  VAL A C   1 
ATOM 3252  O O   . VAL A 1 481  ? 39.369  -19.790 47.728  1.00 8.79   ? 481  VAL A O   1 
ATOM 3253  C CB  . VAL A 1 481  ? 36.686  -21.518 48.611  1.00 10.80  ? 481  VAL A CB  1 
ATOM 3254  C CG1 . VAL A 1 481  ? 36.627  -20.550 49.776  1.00 8.79   ? 481  VAL A CG1 1 
ATOM 3255  C CG2 . VAL A 1 481  ? 35.367  -21.975 48.300  1.00 13.04  ? 481  VAL A CG2 1 
ATOM 3256  N N   . TYR A 1 482  ? 39.351  -21.907 47.015  1.00 8.66   ? 482  TYR A N   1 
ATOM 3257  C CA  . TYR A 1 482  ? 40.800  -21.882 47.040  1.00 8.66   ? 482  TYR A CA  1 
ATOM 3258  C C   . TYR A 1 482  ? 41.305  -20.787 46.125  1.00 8.66   ? 482  TYR A C   1 
ATOM 3259  O O   . TYR A 1 482  ? 42.078  -19.924 46.539  1.00 10.23  ? 482  TYR A O   1 
ATOM 3260  C CB  . TYR A 1 482  ? 41.422  -23.222 46.660  1.00 8.66   ? 482  TYR A CB  1 
ATOM 3261  C CG  . TYR A 1 482  ? 42.878  -23.241 47.106  1.00 8.66   ? 482  TYR A CG  1 
ATOM 3262  C CD1 . TYR A 1 482  ? 43.821  -22.443 46.484  1.00 8.66   ? 482  TYR A CD1 1 
ATOM 3263  C CD2 . TYR A 1 482  ? 43.297  -24.007 48.181  1.00 8.66   ? 482  TYR A CD2 1 
ATOM 3264  C CE1 . TYR A 1 482  ? 45.141  -22.421 46.895  1.00 8.66   ? 482  TYR A CE1 1 
ATOM 3265  C CE2 . TYR A 1 482  ? 44.626  -23.991 48.600  1.00 8.66   ? 482  TYR A CE2 1 
ATOM 3266  C CZ  . TYR A 1 482  ? 45.537  -23.192 47.948  1.00 8.66   ? 482  TYR A CZ  1 
ATOM 3267  O OH  . TYR A 1 482  ? 46.850  -23.151 48.332  1.00 8.66   ? 482  TYR A OH  1 
ATOM 3268  N N   . PHE A 1 483  ? 40.844  -20.785 44.888  1.00 9.68   ? 483  PHE A N   1 
ATOM 3269  C CA  . PHE A 1 483  ? 41.403  -19.938 43.869  1.00 9.14   ? 483  PHE A CA  1 
ATOM 3270  C C   . PHE A 1 483  ? 41.154  -18.506 44.190  1.00 11.10  ? 483  PHE A C   1 
ATOM 3271  O O   . PHE A 1 483  ? 41.622  -17.625 43.462  1.00 17.68  ? 483  PHE A O   1 
ATOM 3272  C CB  . PHE A 1 483  ? 40.781  -20.276 42.533  1.00 14.43  ? 483  PHE A CB  1 
ATOM 3273  C CG  . PHE A 1 483  ? 41.237  -19.408 41.420  1.00 18.50  ? 483  PHE A CG  1 
ATOM 3274  C CD1 . PHE A 1 483  ? 40.471  -18.333 40.991  1.00 23.86  ? 483  PHE A CD1 1 
ATOM 3275  C CD2 . PHE A 1 483  ? 42.442  -19.665 40.804  1.00 27.98  ? 483  PHE A CD2 1 
ATOM 3276  C CE1 . PHE A 1 483  ? 40.895  -17.550 39.944  1.00 28.78  ? 483  PHE A CE1 1 
ATOM 3277  C CE2 . PHE A 1 483  ? 42.871  -18.897 39.758  1.00 38.02  ? 483  PHE A CE2 1 
ATOM 3278  C CZ  . PHE A 1 483  ? 42.103  -17.832 39.327  1.00 39.93  ? 483  PHE A CZ  1 
ATOM 3279  N N   . VAL A 1 484  ? 40.398  -18.255 45.245  1.00 10.08  ? 484  VAL A N   1 
ATOM 3280  C CA  . VAL A 1 484  ? 40.015  -16.891 45.491  1.00 14.49  ? 484  VAL A CA  1 
ATOM 3281  C C   . VAL A 1 484  ? 41.162  -16.121 46.141  1.00 15.48  ? 484  VAL A C   1 
ATOM 3282  O O   . VAL A 1 484  ? 41.200  -14.890 46.039  1.00 17.89  ? 484  VAL A O   1 
ATOM 3283  C CB  . VAL A 1 484  ? 38.716  -16.890 46.306  1.00 12.36  ? 484  VAL A CB  1 
ATOM 3284  C CG1 . VAL A 1 484  ? 39.007  -17.267 47.681  1.00 10.71  ? 484  VAL A CG1 1 
ATOM 3285  C CG2 . VAL A 1 484  ? 37.981  -15.569 46.177  1.00 18.66  ? 484  VAL A CG2 1 
ATOM 3286  N N   . THR A 1 485  ? 42.132  -16.809 46.788  1.00 17.20  ? 485  THR A N   1 
ATOM 3287  C CA  . THR A 1 485  ? 43.380  -16.149 47.316  1.00 13.40  ? 485  THR A CA  1 
ATOM 3288  C C   . THR A 1 485  ? 44.563  -16.022 46.335  1.00 13.75  ? 485  THR A C   1 
ATOM 3289  O O   . THR A 1 485  ? 45.741  -16.047 46.742  1.00 8.90   ? 485  THR A O   1 
ATOM 3290  C CB  . THR A 1 485  ? 43.991  -16.865 48.558  1.00 8.90   ? 485  THR A CB  1 
ATOM 3291  O OG1 . THR A 1 485  ? 44.277  -18.233 48.247  1.00 8.90   ? 485  THR A OG1 1 
ATOM 3292  C CG2 . THR A 1 485  ? 43.080  -16.782 49.762  1.00 8.90   ? 485  THR A CG2 1 
ATOM 3293  N N   . LYS A 1 501  ? 40.994  -10.713 50.563  1.00 13.07  ? 501  LYS A N   1 
ATOM 3294  C CA  . LYS A 1 501  ? 41.433  -9.513  49.859  1.00 14.01  ? 501  LYS A CA  1 
ATOM 3295  C C   . LYS A 1 501  ? 42.794  -9.745  49.218  1.00 8.92   ? 501  LYS A C   1 
ATOM 3296  O O   . LYS A 1 501  ? 43.713  -8.968  49.398  1.00 12.63  ? 501  LYS A O   1 
ATOM 3297  C CB  . LYS A 1 501  ? 41.483  -8.322  50.820  1.00 18.18  ? 501  LYS A CB  1 
ATOM 3298  N N   . PRO A 1 502  ? 42.915  -10.792 48.456  1.00 8.90   ? 502  PRO A N   1 
ATOM 3299  C CA  . PRO A 1 502  ? 44.240  -11.261 48.063  1.00 8.90   ? 502  PRO A CA  1 
ATOM 3300  C C   . PRO A 1 502  ? 44.802  -10.499 46.880  1.00 8.90   ? 502  PRO A C   1 
ATOM 3301  O O   . PRO A 1 502  ? 46.005  -10.236 46.828  1.00 8.90   ? 502  PRO A O   1 
ATOM 3302  C CB  . PRO A 1 502  ? 43.965  -12.712 47.694  1.00 9.90   ? 502  PRO A CB  1 
ATOM 3303  C CG  . PRO A 1 502  ? 42.687  -12.573 46.975  1.00 8.90   ? 502  PRO A CG  1 
ATOM 3304  C CD  . PRO A 1 502  ? 41.875  -11.579 47.796  1.00 8.90   ? 502  PRO A CD  1 
ATOM 3305  N N   . ASN A 1 503  ? 43.959  -10.157 45.911  1.00 8.87   ? 503  ASN A N   1 
ATOM 3306  C CA  . ASN A 1 503  ? 44.467  -9.478  44.730  1.00 12.35  ? 503  ASN A CA  1 
ATOM 3307  C C   . ASN A 1 503  ? 43.301  -8.904  43.935  1.00 20.21  ? 503  ASN A C   1 
ATOM 3308  O O   . ASN A 1 503  ? 42.166  -9.375  44.059  1.00 20.59  ? 503  ASN A O   1 
ATOM 3309  C CB  . ASN A 1 503  ? 45.304  -10.423 43.871  1.00 8.87   ? 503  ASN A CB  1 
ATOM 3310  C CG  . ASN A 1 503  ? 46.135  -9.686  42.857  1.00 8.87   ? 503  ASN A CG  1 
ATOM 3311  O OD1 . ASN A 1 503  ? 46.297  -8.470  42.939  1.00 8.87   ? 503  ASN A OD1 1 
ATOM 3312  N ND2 . ASN A 1 503  ? 46.666  -10.411 41.889  1.00 8.87   ? 503  ASN A ND2 1 
ATOM 3313  N N   . ARG A 1 504  ? 43.611  -7.886  43.100  1.00 22.25  ? 504  ARG A N   1 
ATOM 3314  C CA  . ARG A 1 504  ? 42.608  -7.042  42.429  1.00 22.85  ? 504  ARG A CA  1 
ATOM 3315  C C   . ARG A 1 504  ? 42.042  -7.700  41.168  1.00 27.66  ? 504  ARG A C   1 
ATOM 3316  O O   . ARG A 1 504  ? 40.847  -7.563  40.850  1.00 48.01  ? 504  ARG A O   1 
ATOM 3317  C CB  . ARG A 1 504  ? 43.223  -5.680  42.068  1.00 12.81  ? 504  ARG A CB  1 
ATOM 3318  C CG  . ARG A 1 504  ? 42.218  -4.541  41.890  1.00 8.94   ? 504  ARG A CG  1 
ATOM 3319  C CD  . ARG A 1 504  ? 42.291  -3.623  43.096  1.00 8.94   ? 504  ARG A CD  1 
ATOM 3320  N NE  . ARG A 1 504  ? 40.993  -3.156  43.567  1.00 8.94   ? 504  ARG A NE  1 
ATOM 3321  C CZ  . ARG A 1 504  ? 40.761  -2.769  44.817  1.00 8.94   ? 504  ARG A CZ  1 
ATOM 3322  N NH1 . ARG A 1 504  ? 41.733  -2.813  45.713  1.00 8.94   ? 504  ARG A NH1 1 
ATOM 3323  N NH2 . ARG A 1 504  ? 39.560  -2.348  45.179  1.00 10.03  ? 504  ARG A NH2 1 
ATOM 3324  N N   . GLU A 1 505  ? 42.886  -8.416  40.445  1.00 17.43  ? 505  GLU A N   1 
ATOM 3325  C CA  . GLU A 1 505  ? 42.458  -9.064  39.218  1.00 17.36  ? 505  GLU A CA  1 
ATOM 3326  C C   . GLU A 1 505  ? 41.575  -10.291 39.505  1.00 21.40  ? 505  GLU A C   1 
ATOM 3327  O O   . GLU A 1 505  ? 40.646  -10.582 38.741  1.00 18.40  ? 505  GLU A O   1 
ATOM 3328  C CB  . GLU A 1 505  ? 43.713  -9.404  38.418  1.00 14.12  ? 505  GLU A CB  1 
ATOM 3329  C CG  . GLU A 1 505  ? 44.983  -9.604  39.304  1.00 11.14  ? 505  GLU A CG  1 
ATOM 3330  C CD  . GLU A 1 505  ? 45.484  -8.338  40.010  1.00 8.86   ? 505  GLU A CD  1 
ATOM 3331  O OE1 . GLU A 1 505  ? 44.728  -7.348  40.083  1.00 8.86   ? 505  GLU A OE1 1 
ATOM 3332  O OE2 . GLU A 1 505  ? 46.623  -8.346  40.510  1.00 8.86   ? 505  GLU A OE2 1 
ATOM 3333  N N   . ARG A 1 506  ? 41.826  -10.994 40.628  1.00 23.04  ? 506  ARG A N   1 
ATOM 3334  C CA  . ARG A 1 506  ? 41.077  -12.205 40.987  1.00 17.20  ? 506  ARG A CA  1 
ATOM 3335  C C   . ARG A 1 506  ? 39.648  -11.880 41.372  1.00 16.13  ? 506  ARG A C   1 
ATOM 3336  O O   . ARG A 1 506  ? 38.702  -12.515 40.897  1.00 12.23  ? 506  ARG A O   1 
ATOM 3337  C CB  . ARG A 1 506  ? 41.741  -12.921 42.167  1.00 13.94  ? 506  ARG A CB  1 
ATOM 3338  C CG  . ARG A 1 506  ? 43.253  -12.991 42.124  1.00 15.04  ? 506  ARG A CG  1 
ATOM 3339  C CD  . ARG A 1 506  ? 43.734  -14.319 41.567  1.00 16.48  ? 506  ARG A CD  1 
ATOM 3340  N NE  . ARG A 1 506  ? 45.062  -14.192 40.989  1.00 12.55  ? 506  ARG A NE  1 
ATOM 3341  C CZ  . ARG A 1 506  ? 46.186  -14.350 41.668  1.00 8.88   ? 506  ARG A CZ  1 
ATOM 3342  N NH1 . ARG A 1 506  ? 46.153  -14.656 42.957  1.00 8.88   ? 506  ARG A NH1 1 
ATOM 3343  N NH2 . ARG A 1 506  ? 47.341  -14.204 41.045  1.00 13.21  ? 506  ARG A NH2 1 
ATOM 3344  N N   . GLN A 1 507  ? 39.494  -10.933 42.299  1.00 18.45  ? 507  GLN A N   1 
ATOM 3345  C CA  . GLN A 1 507  ? 38.182  -10.472 42.733  1.00 23.96  ? 507  GLN A CA  1 
ATOM 3346  C C   . GLN A 1 507  ? 37.425  -9.794  41.605  1.00 34.66  ? 507  GLN A C   1 
ATOM 3347  O O   . GLN A 1 507  ? 36.209  -9.982  41.467  1.00 42.55  ? 507  GLN A O   1 
ATOM 3348  C CB  . GLN A 1 507  ? 38.343  -9.495  43.884  1.00 22.68  ? 507  GLN A CB  1 
ATOM 3349  C CG  . GLN A 1 507  ? 39.498  -9.823  44.748  1.00 18.98  ? 507  GLN A CG  1 
ATOM 3350  C CD  . GLN A 1 507  ? 39.021  -10.300 46.053  1.00 21.35  ? 507  GLN A CD  1 
ATOM 3351  O OE1 . GLN A 1 507  ? 38.161  -9.665  46.672  1.00 35.17  ? 507  GLN A OE1 1 
ATOM 3352  N NE2 . GLN A 1 507  ? 39.502  -11.462 46.463  1.00 17.60  ? 507  GLN A NE2 1 
ATOM 3353  N N   . LYS A 1 508  ? 38.111  -8.950  40.824  1.00 39.19  ? 508  LYS A N   1 
ATOM 3354  C CA  . LYS A 1 508  ? 37.475  -8.422  39.620  1.00 33.94  ? 508  LYS A CA  1 
ATOM 3355  C C   . LYS A 1 508  ? 36.993  -9.558  38.722  1.00 31.58  ? 508  LYS A C   1 
ATOM 3356  O O   . LYS A 1 508  ? 35.921  -9.461  38.096  1.00 32.90  ? 508  LYS A O   1 
ATOM 3357  C CB  . LYS A 1 508  ? 38.459  -7.515  38.887  1.00 25.96  ? 508  LYS A CB  1 
ATOM 3358  C CG  . LYS A 1 508  ? 37.849  -6.763  37.770  1.00 21.18  ? 508  LYS A CG  1 
ATOM 3359  C CD  . LYS A 1 508  ? 38.778  -6.751  36.596  1.00 24.55  ? 508  LYS A CD  1 
ATOM 3360  C CE  . LYS A 1 508  ? 37.987  -6.450  35.354  1.00 37.66  ? 508  LYS A CE  1 
ATOM 3361  N NZ  . LYS A 1 508  ? 36.957  -5.438  35.678  1.00 56.90  ? 508  LYS A NZ  1 
ATOM 3362  N N   . LEU A 1 509  ? 37.753  -10.665 38.705  1.00 30.56  ? 509  LEU A N   1 
ATOM 3363  C CA  . LEU A 1 509  ? 37.478  -11.798 37.823  1.00 25.65  ? 509  LEU A CA  1 
ATOM 3364  C C   . LEU A 1 509  ? 36.057  -12.339 38.002  1.00 28.02  ? 509  LEU A C   1 
ATOM 3365  O O   . LEU A 1 509  ? 35.292  -12.444 37.036  1.00 26.37  ? 509  LEU A O   1 
ATOM 3366  C CB  . LEU A 1 509  ? 38.523  -12.888 38.055  1.00 16.06  ? 509  LEU A CB  1 
ATOM 3367  C CG  . LEU A 1 509  ? 38.593  -13.578 36.711  1.00 18.14  ? 509  LEU A CG  1 
ATOM 3368  C CD1 . LEU A 1 509  ? 38.171  -12.557 35.708  1.00 23.23  ? 509  LEU A CD1 1 
ATOM 3369  C CD2 . LEU A 1 509  ? 39.980  -14.006 36.421  1.00 22.52  ? 509  LEU A CD2 1 
ATOM 3370  N N   . MET A 1 510  ? 35.711  -12.735 39.225  1.00 31.99  ? 510  MET A N   1 
ATOM 3371  C CA  . MET A 1 510  ? 34.326  -12.886 39.648  1.00 27.38  ? 510  MET A CA  1 
ATOM 3372  C C   . MET A 1 510  ? 33.358  -12.068 38.780  1.00 19.39  ? 510  MET A C   1 
ATOM 3373  O O   . MET A 1 510  ? 32.655  -12.602 37.919  1.00 16.36  ? 510  MET A O   1 
ATOM 3374  C CB  . MET A 1 510  ? 34.225  -12.426 41.109  1.00 35.84  ? 510  MET A CB  1 
ATOM 3375  C CG  . MET A 1 510  ? 33.726  -13.448 42.092  1.00 43.32  ? 510  MET A CG  1 
ATOM 3376  S SD  . MET A 1 510  ? 32.568  -14.372 41.151  1.00 49.35  ? 510  MET A SD  1 
ATOM 3377  C CE  . MET A 1 510  ? 32.304  -15.805 42.125  1.00 54.93  ? 510  MET A CE  1 
ATOM 3378  N N   . ARG A 1 511  ? 33.327  -10.766 39.014  1.00 17.25  ? 511  ARG A N   1 
ATOM 3379  C CA  . ARG A 1 511  ? 32.274  -9.958  38.460  1.00 15.25  ? 511  ARG A CA  1 
ATOM 3380  C C   . ARG A 1 511  ? 32.344  -9.960  36.944  1.00 16.24  ? 511  ARG A C   1 
ATOM 3381  O O   . ARG A 1 511  ? 31.434  -10.455 36.273  1.00 14.12  ? 511  ARG A O   1 
ATOM 3382  C CB  . ARG A 1 511  ? 32.342  -8.540  39.035  1.00 17.77  ? 511  ARG A CB  1 
ATOM 3383  C CG  . ARG A 1 511  ? 31.002  -7.818  39.013  1.00 25.96  ? 511  ARG A CG  1 
ATOM 3384  C CD  . ARG A 1 511  ? 31.013  -6.385  38.387  1.00 27.79  ? 511  ARG A CD  1 
ATOM 3385  N NE  . ARG A 1 511  ? 29.802  -6.075  37.606  1.00 22.87  ? 511  ARG A NE  1 
ATOM 3386  C CZ  . ARG A 1 511  ? 28.967  -5.064  37.850  1.00 12.54  ? 511  ARG A CZ  1 
ATOM 3387  N NH1 . ARG A 1 511  ? 29.188  -4.233  38.856  1.00 8.69   ? 511  ARG A NH1 1 
ATOM 3388  N NH2 . ARG A 1 511  ? 27.907  -4.879  37.077  1.00 9.46   ? 511  ARG A NH2 1 
ATOM 3389  N N   . GLU A 1 512  ? 33.444  -9.459  36.390  1.00 17.73  ? 512  GLU A N   1 
ATOM 3390  C CA  . GLU A 1 512  ? 33.537  -9.340  34.944  1.00 17.98  ? 512  GLU A CA  1 
ATOM 3391  C C   . GLU A 1 512  ? 33.521  -10.708 34.306  1.00 17.76  ? 512  GLU A C   1 
ATOM 3392  O O   . GLU A 1 512  ? 32.821  -10.949 33.321  1.00 22.20  ? 512  GLU A O   1 
ATOM 3393  C CB  . GLU A 1 512  ? 34.803  -8.587  34.572  1.00 22.14  ? 512  GLU A CB  1 
ATOM 3394  C CG  . GLU A 1 512  ? 35.002  -7.489  35.578  1.00 22.30  ? 512  GLU A CG  1 
ATOM 3395  C CD  . GLU A 1 512  ? 33.688  -6.822  35.889  1.00 19.81  ? 512  GLU A CD  1 
ATOM 3396  O OE1 . GLU A 1 512  ? 33.254  -5.949  35.112  1.00 28.20  ? 512  GLU A OE1 1 
ATOM 3397  O OE2 . GLU A 1 512  ? 33.063  -7.229  36.884  1.00 20.13  ? 512  GLU A OE2 1 
ATOM 3398  N N   . GLN A 1 513  ? 34.296  -11.614 34.851  1.00 18.41  ? 513  GLN A N   1 
ATOM 3399  C CA  . GLN A 1 513  ? 34.264  -12.922 34.278  1.00 17.78  ? 513  GLN A CA  1 
ATOM 3400  C C   . GLN A 1 513  ? 33.033  -13.636 34.759  1.00 16.05  ? 513  GLN A C   1 
ATOM 3401  O O   . GLN A 1 513  ? 32.209  -13.120 35.520  1.00 15.74  ? 513  GLN A O   1 
ATOM 3402  C CB  . GLN A 1 513  ? 35.525  -13.687 34.637  1.00 19.96  ? 513  GLN A CB  1 
ATOM 3403  C CG  . GLN A 1 513  ? 36.454  -13.961 33.500  1.00 21.68  ? 513  GLN A CG  1 
ATOM 3404  C CD  . GLN A 1 513  ? 36.326  -15.383 33.118  1.00 20.44  ? 513  GLN A CD  1 
ATOM 3405  O OE1 . GLN A 1 513  ? 37.282  -16.157 33.211  1.00 22.52  ? 513  GLN A OE1 1 
ATOM 3406  N NE2 . GLN A 1 513  ? 35.101  -15.780 32.764  1.00 17.74  ? 513  GLN A NE2 1 
ATOM 3407  N N   . ASN A 1 514  ? 32.892  -14.827 34.247  1.00 14.61  ? 514  ASN A N   1 
ATOM 3408  C CA  . ASN A 1 514  ? 31.745  -15.643 34.512  1.00 14.88  ? 514  ASN A CA  1 
ATOM 3409  C C   . ASN A 1 514  ? 32.017  -16.490 35.750  1.00 19.33  ? 514  ASN A C   1 
ATOM 3410  O O   . ASN A 1 514  ? 31.871  -17.720 35.719  1.00 17.69  ? 514  ASN A O   1 
ATOM 3411  C CB  . ASN A 1 514  ? 31.517  -16.453 33.226  1.00 9.98   ? 514  ASN A CB  1 
ATOM 3412  C CG  . ASN A 1 514  ? 30.082  -16.520 32.838  1.00 8.82   ? 514  ASN A CG  1 
ATOM 3413  O OD1 . ASN A 1 514  ? 29.730  -16.594 31.650  1.00 8.62   ? 514  ASN A OD1 1 
ATOM 3414  N ND2 . ASN A 1 514  ? 29.229  -16.436 33.826  1.00 8.62   ? 514  ASN A ND2 1 
ATOM 3415  N N   . ILE A 1 515  ? 32.501  -15.849 36.834  1.00 26.33  ? 515  ILE A N   1 
ATOM 3416  C CA  . ILE A 1 515  ? 32.590  -16.448 38.188  1.00 26.57  ? 515  ILE A CA  1 
ATOM 3417  C C   . ILE A 1 515  ? 31.277  -16.017 38.830  1.00 27.56  ? 515  ILE A C   1 
ATOM 3418  O O   . ILE A 1 515  ? 30.404  -16.857 39.075  1.00 27.28  ? 515  ILE A O   1 
ATOM 3419  C CB  . ILE A 1 515  ? 33.829  -16.042 39.000  1.00 21.62  ? 515  ILE A CB  1 
ATOM 3420  C CG1 . ILE A 1 515  ? 35.051  -16.326 38.181  1.00 19.19  ? 515  ILE A CG1 1 
ATOM 3421  C CG2 . ILE A 1 515  ? 34.162  -17.065 40.137  1.00 12.11  ? 515  ILE A CG2 1 
ATOM 3422  C CD1 . ILE A 1 515  ? 35.156  -17.800 37.972  1.00 17.20  ? 515  ILE A CD1 1 
ATOM 3423  N N   . LEU A 1 516  ? 31.081  -14.717 39.028  1.00 25.08  ? 516  LEU A N   1 
ATOM 3424  C CA  . LEU A 1 516  ? 29.845  -14.321 39.672  1.00 19.94  ? 516  LEU A CA  1 
ATOM 3425  C C   . LEU A 1 516  ? 28.703  -14.353 38.703  1.00 18.32  ? 516  LEU A C   1 
ATOM 3426  O O   . LEU A 1 516  ? 27.672  -14.951 38.993  1.00 17.68  ? 516  LEU A O   1 
ATOM 3427  C CB  . LEU A 1 516  ? 29.906  -12.947 40.315  1.00 13.11  ? 516  LEU A CB  1 
ATOM 3428  C CG  . LEU A 1 516  ? 30.538  -11.665 39.868  1.00 11.41  ? 516  LEU A CG  1 
ATOM 3429  C CD1 . LEU A 1 516  ? 29.627  -10.444 39.899  1.00 11.33  ? 516  LEU A CD1 1 
ATOM 3430  C CD2 . LEU A 1 516  ? 31.470  -11.489 40.976  1.00 11.18  ? 516  LEU A CD2 1 
ATOM 3431  N N   . LYS A 1 517  ? 28.821  -13.617 37.601  1.00 17.49  ? 517  LYS A N   1 
ATOM 3432  C CA  . LYS A 1 517  ? 27.844  -13.763 36.536  1.00 18.52  ? 517  LYS A CA  1 
ATOM 3433  C C   . LYS A 1 517  ? 27.340  -15.206 36.478  1.00 18.27  ? 517  LYS A C   1 
ATOM 3434  O O   . LYS A 1 517  ? 26.144  -15.485 36.610  1.00 21.09  ? 517  LYS A O   1 
ATOM 3435  C CB  . LYS A 1 517  ? 28.484  -13.332 35.226  1.00 17.08  ? 517  LYS A CB  1 
ATOM 3436  N N   . GLN A 1 518  ? 28.259  -16.148 36.421  1.00 15.57  ? 518  GLN A N   1 
ATOM 3437  C CA  . GLN A 1 518  ? 27.819  -17.523 36.393  1.00 15.16  ? 518  GLN A CA  1 
ATOM 3438  C C   . GLN A 1 518  ? 27.027  -17.873 37.648  1.00 14.73  ? 518  GLN A C   1 
ATOM 3439  O O   . GLN A 1 518  ? 25.838  -18.214 37.566  1.00 15.88  ? 518  GLN A O   1 
ATOM 3440  C CB  . GLN A 1 518  ? 29.037  -18.394 36.203  1.00 15.97  ? 518  GLN A CB  1 
ATOM 3441  C CG  . GLN A 1 518  ? 29.059  -18.922 34.875  1.00 12.56  ? 518  GLN A CG  1 
ATOM 3442  C CD  . GLN A 1 518  ? 28.095  -20.011 34.892  1.00 12.16  ? 518  GLN A CD  1 
ATOM 3443  O OE1 . GLN A 1 518  ? 28.480  -21.148 34.792  1.00 11.63  ? 518  GLN A OE1 1 
ATOM 3444  N NE2 . GLN A 1 518  ? 26.852  -19.711 35.234  1.00 13.26  ? 518  GLN A NE2 1 
ATOM 3445  N N   . ILE A 1 519  ? 27.651  -17.751 38.819  1.00 15.06  ? 519  ILE A N   1 
ATOM 3446  C CA  . ILE A 1 519  ? 26.954  -18.010 40.074  1.00 11.59  ? 519  ILE A CA  1 
ATOM 3447  C C   . ILE A 1 519  ? 25.539  -17.465 39.983  1.00 16.99  ? 519  ILE A C   1 
ATOM 3448  O O   . ILE A 1 519  ? 24.562  -18.182 40.224  1.00 22.33  ? 519  ILE A O   1 
ATOM 3449  C CB  . ILE A 1 519  ? 27.730  -17.406 41.258  1.00 11.11  ? 519  ILE A CB  1 
ATOM 3450  C CG1 . ILE A 1 519  ? 28.933  -18.294 41.585  1.00 12.30  ? 519  ILE A CG1 1 
ATOM 3451  C CG2 . ILE A 1 519  ? 26.838  -17.184 42.457  1.00 8.63   ? 519  ILE A CG2 1 
ATOM 3452  C CD1 . ILE A 1 519  ? 28.814  -19.742 41.118  1.00 8.63   ? 519  ILE A CD1 1 
ATOM 3453  N N   . PHE A 1 520  ? 25.422  -16.222 39.527  1.00 17.41  ? 520  PHE A N   1 
ATOM 3454  C CA  . PHE A 1 520  ? 24.142  -15.526 39.469  1.00 20.13  ? 520  PHE A CA  1 
ATOM 3455  C C   . PHE A 1 520  ? 23.185  -16.157 38.481  1.00 21.65  ? 520  PHE A C   1 
ATOM 3456  O O   . PHE A 1 520  ? 21.990  -15.858 38.517  1.00 20.04  ? 520  PHE A O   1 
ATOM 3457  C CB  . PHE A 1 520  ? 24.288  -14.081 39.019  1.00 21.93  ? 520  PHE A CB  1 
ATOM 3458  C CG  . PHE A 1 520  ? 25.385  -13.308 39.636  1.00 19.16  ? 520  PHE A CG  1 
ATOM 3459  C CD1 . PHE A 1 520  ? 25.885  -13.584 40.894  1.00 16.78  ? 520  PHE A CD1 1 
ATOM 3460  C CD2 . PHE A 1 520  ? 25.882  -12.244 38.934  1.00 18.34  ? 520  PHE A CD2 1 
ATOM 3461  C CE1 . PHE A 1 520  ? 26.885  -12.805 41.405  1.00 14.98  ? 520  PHE A CE1 1 
ATOM 3462  C CE2 . PHE A 1 520  ? 26.849  -11.484 39.428  1.00 16.75  ? 520  PHE A CE2 1 
ATOM 3463  C CZ  . PHE A 1 520  ? 27.333  -11.738 40.688  1.00 14.16  ? 520  PHE A CZ  1 
ATOM 3464  N N   . LYS A 1 521  ? 23.696  -16.877 37.490  1.00 20.45  ? 521  LYS A N   1 
ATOM 3465  C CA  . LYS A 1 521  ? 22.753  -17.654 36.705  1.00 23.70  ? 521  LYS A CA  1 
ATOM 3466  C C   . LYS A 1 521  ? 22.321  -18.884 37.487  1.00 22.94  ? 521  LYS A C   1 
ATOM 3467  O O   . LYS A 1 521  ? 21.154  -19.283 37.433  1.00 28.89  ? 521  LYS A O   1 
ATOM 3468  C CB  . LYS A 1 521  ? 23.371  -18.020 35.354  1.00 23.47  ? 521  LYS A CB  1 
ATOM 3469  N N   . LEU A 1 522  ? 23.221  -19.419 38.300  1.00 19.91  ? 522  LEU A N   1 
ATOM 3470  C CA  . LEU A 1 522  ? 23.004  -20.718 38.905  1.00 16.50  ? 522  LEU A CA  1 
ATOM 3471  C C   . LEU A 1 522  ? 22.234  -20.680 40.212  1.00 22.21  ? 522  LEU A C   1 
ATOM 3472  O O   . LEU A 1 522  ? 21.856  -21.759 40.685  1.00 18.55  ? 522  LEU A O   1 
ATOM 3473  C CB  . LEU A 1 522  ? 24.337  -21.420 39.117  1.00 12.54  ? 522  LEU A CB  1 
ATOM 3474  C CG  . LEU A 1 522  ? 25.168  -21.520 37.857  1.00 12.38  ? 522  LEU A CG  1 
ATOM 3475  C CD1 . LEU A 1 522  ? 24.682  -20.882 36.519  1.00 14.16  ? 522  LEU A CD1 1 
ATOM 3476  C CD2 . LEU A 1 522  ? 26.282  -20.734 38.403  1.00 11.62  ? 522  LEU A CD2 1 
ATOM 3477  N N   . LEU A 1 523  ? 21.962  -19.483 40.787  1.00 29.77  ? 523  LEU A N   1 
ATOM 3478  C CA  . LEU A 1 523  ? 21.390  -19.386 42.143  1.00 41.64  ? 523  LEU A CA  1 
ATOM 3479  C C   . LEU A 1 523  ? 19.967  -19.912 42.242  1.00 37.41  ? 523  LEU A C   1 
ATOM 3480  O O   . LEU A 1 523  ? 19.431  -19.980 43.355  1.00 30.07  ? 523  LEU A O   1 
ATOM 3481  C CB  . LEU A 1 523  ? 21.361  -17.957 42.729  1.00 31.39  ? 523  LEU A CB  1 
ATOM 3482  C CG  . LEU A 1 523  ? 21.868  -16.642 42.188  1.00 27.97  ? 523  LEU A CG  1 
ATOM 3483  C CD1 . LEU A 1 523  ? 23.416  -16.648 42.284  1.00 25.35  ? 523  LEU A CD1 1 
ATOM 3484  C CD2 . LEU A 1 523  ? 21.261  -16.493 40.818  1.00 20.66  ? 523  LEU A CD2 1 
ATOM 3485  N N   . GLN A 1 524  ? 19.349  -20.284 41.129  1.00 39.31  ? 524  GLN A N   1 
ATOM 3486  C CA  . GLN A 1 524  ? 17.979  -20.787 41.166  1.00 50.39  ? 524  GLN A CA  1 
ATOM 3487  C C   . GLN A 1 524  ? 17.881  -22.158 40.470  1.00 52.76  ? 524  GLN A C   1 
ATOM 3488  O O   . GLN A 1 524  ? 16.937  -22.938 40.677  1.00 49.56  ? 524  GLN A O   1 
ATOM 3489  C CB  . GLN A 1 524  ? 17.026  -19.768 40.521  1.00 55.27  ? 524  GLN A CB  1 
ATOM 3490  C CG  . GLN A 1 524  ? 17.152  -18.325 41.091  1.00 47.47  ? 524  GLN A CG  1 
ATOM 3491  C CD  . GLN A 1 524  ? 18.404  -17.562 40.628  1.00 35.67  ? 524  GLN A CD  1 
ATOM 3492  O OE1 . GLN A 1 524  ? 19.286  -18.126 39.980  1.00 34.38  ? 524  GLN A OE1 1 
ATOM 3493  N NE2 . GLN A 1 524  ? 18.473  -16.272 40.962  1.00 29.01  ? 524  GLN A NE2 1 
ATOM 3494  N N   . HIS A 1 551  ? 28.128  -27.956 51.768  1.00 26.40  ? 551  HIS A N   1 
ATOM 3495  C CA  . HIS A 1 551  ? 27.647  -28.290 50.423  1.00 30.43  ? 551  HIS A CA  1 
ATOM 3496  C C   . HIS A 1 551  ? 28.072  -27.199 49.392  1.00 33.20  ? 551  HIS A C   1 
ATOM 3497  O O   . HIS A 1 551  ? 29.085  -26.522 49.600  1.00 33.99  ? 551  HIS A O   1 
ATOM 3498  C CB  . HIS A 1 551  ? 26.119  -28.493 50.456  1.00 27.05  ? 551  HIS A CB  1 
ATOM 3499  C CG  . HIS A 1 551  ? 25.629  -29.606 49.577  1.00 22.39  ? 551  HIS A CG  1 
ATOM 3500  N ND1 . HIS A 1 551  ? 25.444  -29.449 48.222  1.00 26.17  ? 551  HIS A ND1 1 
ATOM 3501  C CD2 . HIS A 1 551  ? 25.281  -30.888 49.857  1.00 18.76  ? 551  HIS A CD2 1 
ATOM 3502  C CE1 . HIS A 1 551  ? 25.006  -30.584 47.705  1.00 22.17  ? 551  HIS A CE1 1 
ATOM 3503  N NE2 . HIS A 1 551  ? 24.898  -31.474 48.675  1.00 13.05  ? 551  HIS A NE2 1 
ATOM 3504  N N   . ILE A 1 552  ? 27.297  -27.040 48.307  1.00 24.34  ? 552  ILE A N   1 
ATOM 3505  C CA  . ILE A 1 552  ? 27.611  -26.108 47.213  1.00 19.14  ? 552  ILE A CA  1 
ATOM 3506  C C   . ILE A 1 552  ? 27.427  -24.641 47.642  1.00 28.81  ? 552  ILE A C   1 
ATOM 3507  O O   . ILE A 1 552  ? 28.185  -23.740 47.222  1.00 29.74  ? 552  ILE A O   1 
ATOM 3508  C CB  . ILE A 1 552  ? 26.733  -26.485 46.003  1.00 9.17   ? 552  ILE A CB  1 
ATOM 3509  C CG1 . ILE A 1 552  ? 27.001  -27.942 45.597  1.00 10.71  ? 552  ILE A CG1 1 
ATOM 3510  C CG2 . ILE A 1 552  ? 26.899  -25.523 44.840  1.00 8.85   ? 552  ILE A CG2 1 
ATOM 3511  C CD1 . ILE A 1 552  ? 28.348  -28.473 45.996  1.00 9.75   ? 552  ILE A CD1 1 
ATOM 3512  N N   . CYS A 1 553  ? 26.424  -24.378 48.490  1.00 43.49  ? 553  CYS A N   1 
ATOM 3513  C CA  . CYS A 1 553  ? 26.224  -23.045 49.069  1.00 48.82  ? 553  CYS A CA  1 
ATOM 3514  C C   . CYS A 1 553  ? 27.483  -22.523 49.770  1.00 45.06  ? 553  CYS A C   1 
ATOM 3515  O O   . CYS A 1 553  ? 27.852  -21.353 49.602  1.00 39.58  ? 553  CYS A O   1 
ATOM 3516  C CB  . CYS A 1 553  ? 25.046  -23.068 50.056  1.00 76.82  ? 553  CYS A CB  1 
ATOM 3517  S SG  . CYS A 1 553  ? 23.368  -23.269 49.326  1.00 104.21 ? 553  CYS A SG  1 
ATOM 3518  N N   . ARG A 1 554  ? 28.136  -23.365 50.583  1.00 47.44  ? 554  ARG A N   1 
ATOM 3519  C CA  . ARG A 1 554  ? 29.379  -22.965 51.245  1.00 43.69  ? 554  ARG A CA  1 
ATOM 3520  C C   . ARG A 1 554  ? 30.375  -22.373 50.253  1.00 44.38  ? 554  ARG A C   1 
ATOM 3521  O O   . ARG A 1 554  ? 31.005  -21.342 50.524  1.00 54.05  ? 554  ARG A O   1 
ATOM 3522  C CB  . ARG A 1 554  ? 30.006  -24.163 51.971  1.00 40.85  ? 554  ARG A CB  1 
ATOM 3523  N N   . LEU A 1 555  ? 30.523  -23.004 49.092  1.00 39.10  ? 555  LEU A N   1 
ATOM 3524  C CA  . LEU A 1 555  ? 31.462  -22.511 48.094  1.00 29.95  ? 555  LEU A CA  1 
ATOM 3525  C C   . LEU A 1 555  ? 31.042  -21.152 47.555  1.00 37.08  ? 555  LEU A C   1 
ATOM 3526  O O   . LEU A 1 555  ? 31.869  -20.228 47.463  1.00 32.53  ? 555  LEU A O   1 
ATOM 3527  C CB  . LEU A 1 555  ? 31.568  -23.535 46.988  1.00 20.58  ? 555  LEU A CB  1 
ATOM 3528  C CG  . LEU A 1 555  ? 32.121  -24.617 47.873  1.00 17.81  ? 555  LEU A CG  1 
ATOM 3529  C CD1 . LEU A 1 555  ? 32.174  -26.066 47.297  1.00 26.18  ? 555  LEU A CD1 1 
ATOM 3530  C CD2 . LEU A 1 555  ? 33.451  -23.973 48.188  1.00 10.92  ? 555  LEU A CD2 1 
ATOM 3531  N N   . CYS A 1 556  ? 29.760  -21.007 47.192  1.00 40.47  ? 556  CYS A N   1 
ATOM 3532  C CA  . CYS A 1 556  ? 29.301  -19.691 46.749  1.00 30.83  ? 556  CYS A CA  1 
ATOM 3533  C C   . CYS A 1 556  ? 29.653  -18.611 47.776  1.00 35.95  ? 556  CYS A C   1 
ATOM 3534  O O   . CYS A 1 556  ? 30.240  -17.575 47.431  1.00 33.63  ? 556  CYS A O   1 
ATOM 3535  C CB  . CYS A 1 556  ? 27.797  -19.710 46.462  1.00 19.43  ? 556  CYS A CB  1 
ATOM 3536  S SG  . CYS A 1 556  ? 27.405  -19.774 44.703  1.00 9.01   ? 556  CYS A SG  1 
ATOM 3537  N N   . TYR A 1 557  ? 29.338  -18.856 49.056  1.00 45.64  ? 557  TYR A N   1 
ATOM 3538  C CA  . TYR A 1 557  ? 29.548  -17.835 50.087  1.00 41.94  ? 557  TYR A CA  1 
ATOM 3539  C C   . TYR A 1 557  ? 31.028  -17.494 50.259  1.00 35.75  ? 557  TYR A C   1 
ATOM 3540  O O   . TYR A 1 557  ? 31.390  -16.314 50.366  1.00 30.84  ? 557  TYR A O   1 
ATOM 3541  C CB  . TYR A 1 557  ? 28.948  -18.292 51.422  1.00 35.61  ? 557  TYR A CB  1 
ATOM 3542  N N   . ARG A 1 558  ? 31.894  -18.516 50.306  1.00 37.95  ? 558  ARG A N   1 
ATOM 3543  C CA  . ARG A 1 558  ? 33.320  -18.277 50.531  1.00 25.61  ? 558  ARG A CA  1 
ATOM 3544  C C   . ARG A 1 558  ? 33.935  -17.503 49.378  1.00 23.15  ? 558  ARG A C   1 
ATOM 3545  O O   . ARG A 1 558  ? 34.678  -16.529 49.589  1.00 27.17  ? 558  ARG A O   1 
ATOM 3546  C CB  . ARG A 1 558  ? 34.044  -19.604 50.733  1.00 20.84  ? 558  ARG A CB  1 
ATOM 3547  N N   . VAL A 1 559  ? 33.622  -17.906 48.148  1.00 18.32  ? 559  VAL A N   1 
ATOM 3548  C CA  . VAL A 1 559  ? 34.057  -17.114 47.010  1.00 18.47  ? 559  VAL A CA  1 
ATOM 3549  C C   . VAL A 1 559  ? 33.567  -15.676 47.151  1.00 20.86  ? 559  VAL A C   1 
ATOM 3550  O O   . VAL A 1 559  ? 34.330  -14.726 46.957  1.00 21.25  ? 559  VAL A O   1 
ATOM 3551  C CB  . VAL A 1 559  ? 33.579  -17.758 45.702  1.00 18.22  ? 559  VAL A CB  1 
ATOM 3552  C CG1 . VAL A 1 559  ? 34.320  -17.164 44.535  1.00 17.78  ? 559  VAL A CG1 1 
ATOM 3553  C CG2 . VAL A 1 559  ? 33.829  -19.233 45.757  1.00 19.53  ? 559  VAL A CG2 1 
ATOM 3554  N N   . LEU A 1 560  ? 32.295  -15.493 47.516  1.00 21.63  ? 560  LEU A N   1 
ATOM 3555  C CA  . LEU A 1 560  ? 31.741  -14.141 47.584  1.00 25.82  ? 560  LEU A CA  1 
ATOM 3556  C C   . LEU A 1 560  ? 32.528  -13.270 48.566  1.00 31.65  ? 560  LEU A C   1 
ATOM 3557  O O   . LEU A 1 560  ? 33.082  -12.235 48.185  1.00 33.09  ? 560  LEU A O   1 
ATOM 3558  C CB  . LEU A 1 560  ? 30.248  -14.187 47.955  1.00 27.63  ? 560  LEU A CB  1 
ATOM 3559  C CG  . LEU A 1 560  ? 29.350  -13.044 47.455  1.00 22.49  ? 560  LEU A CG  1 
ATOM 3560  C CD1 . LEU A 1 560  ? 28.088  -12.900 48.277  1.00 22.22  ? 560  LEU A CD1 1 
ATOM 3561  C CD2 . LEU A 1 560  ? 30.121  -11.769 47.512  1.00 24.38  ? 560  LEU A CD2 1 
ATOM 3562  N N   . ARG A 1 561  ? 32.588  -13.668 49.841  1.00 43.39  ? 561  ARG A N   1 
ATOM 3563  C CA  . ARG A 1 561  ? 33.169  -12.783 50.854  1.00 46.17  ? 561  ARG A CA  1 
ATOM 3564  C C   . ARG A 1 561  ? 34.643  -12.524 50.586  1.00 23.66  ? 561  ARG A C   1 
ATOM 3565  O O   . ARG A 1 561  ? 35.132  -11.390 50.732  1.00 12.25  ? 561  ARG A O   1 
ATOM 3566  C CB  . ARG A 1 561  ? 32.986  -13.386 52.246  1.00 69.21  ? 561  ARG A CB  1 
ATOM 3567  N N   . HIS A 1 562  ? 35.374  -13.574 50.213  1.00 24.96  ? 562  HIS A N   1 
ATOM 3568  C CA  . HIS A 1 562  ? 36.770  -13.365 49.892  1.00 19.31  ? 562  HIS A CA  1 
ATOM 3569  C C   . HIS A 1 562  ? 36.896  -12.382 48.745  1.00 21.24  ? 562  HIS A C   1 
ATOM 3570  O O   . HIS A 1 562  ? 37.655  -11.416 48.819  1.00 25.97  ? 562  HIS A O   1 
ATOM 3571  C CB  . HIS A 1 562  ? 37.438  -14.692 49.550  1.00 18.02  ? 562  HIS A CB  1 
ATOM 3572  C CG  . HIS A 1 562  ? 38.832  -14.534 49.043  1.00 12.31  ? 562  HIS A CG  1 
ATOM 3573  N ND1 . HIS A 1 562  ? 39.901  -15.234 49.557  1.00 11.94  ? 562  HIS A ND1 1 
ATOM 3574  C CD2 . HIS A 1 562  ? 39.333  -13.739 48.079  1.00 11.07  ? 562  HIS A CD2 1 
ATOM 3575  C CE1 . HIS A 1 562  ? 40.998  -14.878 48.914  1.00 8.84   ? 562  HIS A CE1 1 
ATOM 3576  N NE2 . HIS A 1 562  ? 40.669  -13.995 47.994  1.00 8.84   ? 562  HIS A NE2 1 
ATOM 3577  N N   . SER A 1 563  ? 36.161  -12.627 47.675  1.00 24.20  ? 563  SER A N   1 
ATOM 3578  C CA  . SER A 1 563  ? 36.295  -11.850 46.457  1.00 34.78  ? 563  SER A CA  1 
ATOM 3579  C C   . SER A 1 563  ? 35.400  -10.616 46.419  1.00 31.70  ? 563  SER A C   1 
ATOM 3580  O O   . SER A 1 563  ? 35.221  -10.019 45.352  1.00 35.32  ? 563  SER A O   1 
ATOM 3581  C CB  . SER A 1 563  ? 36.007  -12.747 45.259  1.00 43.52  ? 563  SER A CB  1 
ATOM 3582  O OG  . SER A 1 563  ? 37.187  -13.377 44.785  1.00 36.42  ? 563  SER A OG  1 
ATOM 3583  N N   . GLN A 1 564  ? 34.874  -10.197 47.565  1.00 22.60  ? 564  GLN A N   1 
ATOM 3584  C CA  . GLN A 1 564  ? 34.038  -9.020  47.636  1.00 20.38  ? 564  GLN A CA  1 
ATOM 3585  C C   . GLN A 1 564  ? 34.449  -8.192  48.829  1.00 17.16  ? 564  GLN A C   1 
ATOM 3586  O O   . GLN A 1 564  ? 33.661  -7.820  49.700  1.00 8.98   ? 564  GLN A O   1 
ATOM 3587  C CB  . GLN A 1 564  ? 32.568  -9.391  47.661  1.00 25.44  ? 564  GLN A CB  1 
ATOM 3588  C CG  . GLN A 1 564  ? 31.753  -8.174  47.327  1.00 34.87  ? 564  GLN A CG  1 
ATOM 3589  C CD  . GLN A 1 564  ? 30.348  -8.436  46.835  1.00 28.40  ? 564  GLN A CD  1 
ATOM 3590  O OE1 . GLN A 1 564  ? 30.043  -9.447  46.177  1.00 24.54  ? 564  GLN A OE1 1 
ATOM 3591  N NE2 . GLN A 1 564  ? 29.473  -7.485  47.141  1.00 32.42  ? 564  GLN A NE2 1 
ATOM 3592  N N   . GLN A 1 565  ? 35.735  -7.890  48.860  1.00 16.19  ? 565  GLN A N   1 
ATOM 3593  C CA  . GLN A 1 565  ? 36.224  -6.947  49.841  1.00 22.20  ? 565  GLN A CA  1 
ATOM 3594  C C   . GLN A 1 565  ? 35.913  -5.513  49.429  1.00 31.24  ? 565  GLN A C   1 
ATOM 3595  O O   . GLN A 1 565  ? 35.487  -4.718  50.268  1.00 39.38  ? 565  GLN A O   1 
ATOM 3596  C CB  . GLN A 1 565  ? 37.721  -7.134  50.051  1.00 29.71  ? 565  GLN A CB  1 
ATOM 3597  N N   . ASP A 1 566  ? 36.111  -5.153  48.151  1.00 33.94  ? 566  ASP A N   1 
ATOM 3598  C CA  . ASP A 1 566  ? 35.976  -3.760  47.711  1.00 41.63  ? 566  ASP A CA  1 
ATOM 3599  C C   . ASP A 1 566  ? 34.735  -3.502  46.849  1.00 44.34  ? 566  ASP A C   1 
ATOM 3600  O O   . ASP A 1 566  ? 34.564  -2.382  46.341  1.00 28.11  ? 566  ASP A O   1 
ATOM 3601  C CB  . ASP A 1 566  ? 37.226  -3.309  46.947  1.00 37.42  ? 566  ASP A CB  1 
ATOM 3602  N N   . TYR A 1 567  ? 33.859  -4.499  46.696  1.00 46.86  ? 567  TYR A N   1 
ATOM 3603  C CA  . TYR A 1 567  ? 32.722  -4.452  45.779  1.00 53.34  ? 567  TYR A CA  1 
ATOM 3604  C C   . TYR A 1 567  ? 31.405  -4.354  46.560  1.00 53.23  ? 567  TYR A C   1 
ATOM 3605  O O   . TYR A 1 567  ? 30.965  -5.338  47.171  1.00 54.97  ? 567  TYR A O   1 
ATOM 3606  C CB  . TYR A 1 567  ? 32.734  -5.688  44.876  1.00 60.82  ? 567  TYR A CB  1 
ATOM 3607  H HA  . TYR A 1 567  ? 32.799  -3.666  45.216  1.00 64.00  ? 567  TYR A HA  1 
ATOM 3608  N N   . ARG A 1 568  ? 30.756  -3.183  46.502  1.00 36.64  ? 568  ARG A N   1 
ATOM 3609  C CA  . ARG A 1 568  ? 29.498  -2.933  47.196  1.00 26.46  ? 568  ARG A CA  1 
ATOM 3610  C C   . ARG A 1 568  ? 28.279  -3.178  46.317  1.00 28.50  ? 568  ARG A C   1 
ATOM 3611  O O   . ARG A 1 568  ? 27.185  -2.706  46.653  1.00 24.80  ? 568  ARG A O   1 
ATOM 3612  C CB  . ARG A 1 568  ? 29.463  -1.495  47.718  1.00 21.83  ? 568  ARG A CB  1 
ATOM 3613  H H   . ARG A 1 568  ? 31.038  -2.504  46.055  1.00 43.97  ? 568  ARG A H   1 
ATOM 3614  H HA  . ARG A 1 568  ? 29.438  -3.529  47.959  1.00 31.75  ? 568  ARG A HA  1 
ATOM 3615  N N   . LYS A 1 569  ? 28.455  -3.879  45.190  1.00 30.82  ? 569  LYS A N   1 
ATOM 3616  C CA  . LYS A 1 569  ? 27.332  -4.212  44.323  1.00 35.48  ? 569  LYS A CA  1 
ATOM 3617  C C   . LYS A 1 569  ? 26.444  -5.301  44.930  1.00 38.69  ? 569  LYS A C   1 
ATOM 3618  O O   . LYS A 1 569  ? 25.218  -5.232  44.799  1.00 43.63  ? 569  LYS A O   1 
ATOM 3619  C CB  . LYS A 1 569  ? 27.855  -4.640  42.950  1.00 20.06  ? 569  LYS A CB  1 
ATOM 3620  H H   . LYS A 1 569  ? 29.214  -4.171  44.912  1.00 36.98  ? 569  LYS A H   1 
ATOM 3621  H HA  . LYS A 1 569  ? 26.787  -3.419  44.199  1.00 42.58  ? 569  LYS A HA  1 
ATOM 3622  N N   . ASN A 1 570  ? 27.031  -6.306  45.597  1.00 33.02  ? 570  ASN A N   1 
ATOM 3623  C CA  . ASN A 1 570  ? 26.227  -7.445  46.045  1.00 26.48  ? 570  ASN A CA  1 
ATOM 3624  C C   . ASN A 1 570  ? 25.119  -7.020  47.006  1.00 27.71  ? 570  ASN A C   1 
ATOM 3625  O O   . ASN A 1 570  ? 24.121  -7.735  47.142  1.00 22.93  ? 570  ASN A O   1 
ATOM 3626  C CB  . ASN A 1 570  ? 27.101  -8.511  46.709  1.00 21.31  ? 570  ASN A CB  1 
ATOM 3627  H H   . ASN A 1 570  ? 27.867  -6.350  45.795  1.00 39.62  ? 570  ASN A H   1 
ATOM 3628  H HA  . ASN A 1 570  ? 25.806  -7.851  45.271  1.00 31.78  ? 570  ASN A HA  1 
ATOM 3629  N N   . GLN A 1 571  ? 25.291  -5.885  47.699  1.00 33.62  ? 571  GLN A N   1 
ATOM 3630  C CA  . GLN A 1 571  ? 24.229  -5.381  48.560  1.00 34.13  ? 571  GLN A CA  1 
ATOM 3631  C C   . GLN A 1 571  ? 22.915  -5.351  47.808  1.00 30.52  ? 571  GLN A C   1 
ATOM 3632  O O   . GLN A 1 571  ? 21.883  -5.793  48.324  1.00 32.83  ? 571  GLN A O   1 
ATOM 3633  C CB  . GLN A 1 571  ? 24.571  -3.974  49.065  1.00 33.75  ? 571  GLN A CB  1 
ATOM 3634  H H   . GLN A 1 571  ? 26.001  -5.401  47.685  1.00 40.34  ? 571  GLN A H   1 
ATOM 3635  H HA  . GLN A 1 571  ? 24.130  -5.967  49.327  1.00 40.96  ? 571  GLN A HA  1 
ATOM 3636  N N   . GLU A 1 572  ? 22.954  -4.874  46.569  1.00 29.80  ? 572  GLU A N   1 
ATOM 3637  C CA  . GLU A 1 572  ? 21.748  -4.740  45.775  1.00 32.71  ? 572  GLU A CA  1 
ATOM 3638  C C   . GLU A 1 572  ? 20.988  -6.059  45.648  1.00 26.87  ? 572  GLU A C   1 
ATOM 3639  O O   . GLU A 1 572  ? 19.779  -6.038  45.399  1.00 32.21  ? 572  GLU A O   1 
ATOM 3640  C CB  . GLU A 1 572  ? 22.118  -4.194  44.395  1.00 29.61  ? 572  GLU A CB  1 
ATOM 3641  H H   . GLU A 1 572  ? 23.671  -4.622  46.166  1.00 35.76  ? 572  GLU A H   1 
ATOM 3642  H HA  . GLU A 1 572  ? 21.160  -4.098  46.203  1.00 39.26  ? 572  GLU A HA  1 
ATOM 3643  N N   . TYR A 1 573  ? 21.662  -7.202  45.809  1.00 17.71  ? 573  TYR A N   1 
ATOM 3644  C CA  . TYR A 1 573  ? 20.978  -8.486  45.749  1.00 13.24  ? 573  TYR A CA  1 
ATOM 3645  C C   . TYR A 1 573  ? 19.812  -8.548  46.718  1.00 18.42  ? 573  TYR A C   1 
ATOM 3646  O O   . TYR A 1 573  ? 18.807  -9.202  46.430  1.00 20.43  ? 573  TYR A O   1 
ATOM 3647  C CB  . TYR A 1 573  ? 21.962  -9.607  46.058  1.00 8.99   ? 573  TYR A CB  1 
ATOM 3648  H H   . TYR A 1 573  ? 22.508  -7.256  45.952  1.00 21.25  ? 573  TYR A H   1 
ATOM 3649  H HA  . TYR A 1 573  ? 20.635  -8.623  44.852  1.00 15.89  ? 573  TYR A HA  1 
ATOM 3650  N N   . ILE A 1 574  ? 19.911  -7.843  47.848  1.00 20.84  ? 574  ILE A N   1 
ATOM 3651  C CA  . ILE A 1 574  ? 18.972  -8.011  48.948  1.00 24.20  ? 574  ILE A CA  1 
ATOM 3652  C C   . ILE A 1 574  ? 17.551  -7.577  48.623  1.00 30.28  ? 574  ILE A C   1 
ATOM 3653  O O   . ILE A 1 574  ? 16.628  -7.934  49.361  1.00 30.73  ? 574  ILE A O   1 
ATOM 3654  C CB  . ILE A 1 574  ? 19.471  -7.239  50.185  1.00 18.15  ? 574  ILE A CB  1 
ATOM 3655  H H   . ILE A 1 574  ? 20.521  -7.256  47.998  1.00 25.00  ? 574  ILE A H   1 
ATOM 3656  H HA  . ILE A 1 574  ? 18.942  -8.952  49.184  1.00 29.03  ? 574  ILE A HA  1 
ATOM 3657  N N   . ALA A 1 575  ? 17.338  -6.773  47.577  1.00 32.52  ? 575  ALA A N   1 
ATOM 3658  C CA  . ALA A 1 575  ? 15.978  -6.338  47.285  1.00 33.92  ? 575  ALA A CA  1 
ATOM 3659  C C   . ALA A 1 575  ? 15.118  -7.495  46.766  1.00 41.27  ? 575  ALA A C   1 
ATOM 3660  O O   . ALA A 1 575  ? 14.018  -7.721  47.279  1.00 50.27  ? 575  ALA A O   1 
ATOM 3661  C CB  . ALA A 1 575  ? 15.990  -5.158  46.307  1.00 43.98  ? 575  ALA A CB  1 
ATOM 3662  H H   . ALA A 1 575  ? 17.942  -6.477  47.042  1.00 39.02  ? 575  ALA A H   1 
ATOM 3663  H HA  . ALA A 1 575  ? 15.574  -6.026  48.110  1.00 40.70  ? 575  ALA A HA  1 
ATOM 3664  H HB1 . ALA A 1 575  ? 15.076  -4.887  46.129  1.00 52.78  ? 575  ALA A HB1 1 
ATOM 3665  H HB2 . ALA A 1 575  ? 16.481  -4.423  46.706  1.00 52.78  ? 575  ALA A HB2 1 
ATOM 3666  H HB3 . ALA A 1 575  ? 16.420  -5.435  45.483  1.00 52.78  ? 575  ALA A HB3 1 
ATOM 3667  N N   . LYS A 1 576  ? 15.587  -8.238  45.751  1.00 38.78  ? 576  LYS A N   1 
ATOM 3668  C CA  . LYS A 1 576  ? 14.855  -9.413  45.257  1.00 41.87  ? 576  LYS A CA  1 
ATOM 3669  C C   . LYS A 1 576  ? 15.479  -10.749 45.659  1.00 45.36  ? 576  LYS A C   1 
ATOM 3670  O O   . LYS A 1 576  ? 14.745  -11.738 45.811  1.00 41.93  ? 576  LYS A O   1 
ATOM 3671  C CB  . LYS A 1 576  ? 14.743  -9.375  43.728  1.00 40.06  ? 576  LYS A CB  1 
ATOM 3672  H H   . LYS A 1 576  ? 16.324  -8.083  45.335  1.00 46.53  ? 576  LYS A H   1 
ATOM 3673  H HA  . LYS A 1 576  ? 13.955  -9.389  45.619  1.00 50.24  ? 576  LYS A HA  1 
ATOM 3674  N N   . GLN A 1 577  ? 16.810  -10.817 45.786  1.00 41.53  ? 577  GLN A N   1 
ATOM 3675  C CA  . GLN A 1 577  ? 17.478  -12.037 46.231  1.00 38.03  ? 577  GLN A CA  1 
ATOM 3676  C C   . GLN A 1 577  ? 17.173  -12.359 47.683  1.00 36.44  ? 577  GLN A C   1 
ATOM 3677  O O   . GLN A 1 577  ? 17.280  -13.525 48.084  1.00 30.77  ? 577  GLN A O   1 
ATOM 3678  C CB  . GLN A 1 577  ? 18.993  -11.905 46.055  1.00 32.46  ? 577  GLN A CB  1 
ATOM 3679  H H   . GLN A 1 577  ? 17.347  -10.165 45.620  1.00 49.83  ? 577  GLN A H   1 
ATOM 3680  H HA  . GLN A 1 577  ? 17.175  -12.781 45.687  1.00 45.63  ? 577  GLN A HA  1 
ATOM 3681  N N   . PHE A 1 578  ? 16.812  -11.346 48.476  1.00 48.66  ? 578  PHE A N   1 
ATOM 3682  C CA  . PHE A 1 578  ? 16.525  -11.565 49.887  1.00 48.85  ? 578  PHE A CA  1 
ATOM 3683  C C   . PHE A 1 578  ? 15.420  -12.593 50.077  1.00 53.56  ? 578  PHE A C   1 
ATOM 3684  O O   . PHE A 1 578  ? 15.437  -13.334 51.064  1.00 64.41  ? 578  PHE A O   1 
ATOM 3685  C CB  . PHE A 1 578  ? 16.142  -10.248 50.575  1.00 42.43  ? 578  PHE A CB  1 
ATOM 3686  H H   . PHE A 1 578  ? 16.728  -10.529 48.219  1.00 58.40  ? 578  PHE A H   1 
ATOM 3687  H HA  . PHE A 1 578  ? 17.324  -11.904 50.319  1.00 58.62  ? 578  PHE A HA  1 
ATOM 3688  N N   . GLY A 1 579  ? 14.435  -12.639 49.171  1.00 52.47  ? 579  GLY A N   1 
ATOM 3689  C CA  . GLY A 1 579  ? 13.427  -13.683 49.270  1.00 46.75  ? 579  GLY A CA  1 
ATOM 3690  C C   . GLY A 1 579  ? 14.077  -15.033 49.486  1.00 57.23  ? 579  GLY A C   1 
ATOM 3691  O O   . GLY A 1 579  ? 13.749  -15.750 50.441  1.00 81.17  ? 579  GLY A O   1 
ATOM 3692  H H   . GLY A 1 579  ? 14.335  -12.095 48.513  1.00 62.96  ? 579  GLY A H   1 
ATOM 3693  H HA2 . GLY A 1 579  ? 12.834  -13.498 50.016  1.00 56.10  ? 579  GLY A HA2 1 
ATOM 3694  H HA3 . GLY A 1 579  ? 12.904  -13.714 48.454  1.00 56.10  ? 579  GLY A HA3 1 
ATOM 3695  N N   . PHE A 1 580  ? 15.092  -15.339 48.678  1.00 42.69  ? 580  PHE A N   1 
ATOM 3696  C CA  . PHE A 1 580  ? 15.782  -16.620 48.767  1.00 48.09  ? 580  PHE A CA  1 
ATOM 3697  C C   . PHE A 1 580  ? 16.226  -16.922 50.205  1.00 58.44  ? 580  PHE A C   1 
ATOM 3698  O O   . PHE A 1 580  ? 16.055  -18.052 50.697  1.00 64.85  ? 580  PHE A O   1 
ATOM 3699  C CB  . PHE A 1 580  ? 16.981  -16.606 47.821  1.00 48.25  ? 580  PHE A CB  1 
ATOM 3700  H H   . PHE A 1 580  ? 15.400  -14.817 48.067  1.00 51.23  ? 580  PHE A H   1 
ATOM 3701  H HA  . PHE A 1 580  ? 15.180  -17.326 48.483  1.00 57.71  ? 580  PHE A HA  1 
ATOM 3702  N N   . MET A 1 581  ? 16.742  -15.907 50.904  1.00 51.75  ? 581  MET A N   1 
ATOM 3703  C CA  . MET A 1 581  ? 17.340  -16.113 52.218  1.00 52.54  ? 581  MET A CA  1 
ATOM 3704  C C   . MET A 1 581  ? 16.396  -16.807 53.204  1.00 64.60  ? 581  MET A C   1 
ATOM 3705  O O   . MET A 1 581  ? 16.868  -17.552 54.072  1.00 54.64  ? 581  MET A O   1 
ATOM 3706  C CB  . MET A 1 581  ? 17.800  -14.776 52.793  1.00 55.01  ? 581  MET A CB  1 
ATOM 3707  H H   . MET A 1 581  ? 16.757  -15.090 50.635  1.00 62.10  ? 581  MET A H   1 
ATOM 3708  H HA  . MET A 1 581  ? 18.128  -16.668 52.111  1.00 63.05  ? 581  MET A HA  1 
ATOM 3709  N N   . GLN A 1 582  ? 15.072  -16.558 53.122  1.00 88.39  ? 582  GLN A N   1 
ATOM 3710  C CA  . GLN A 1 582  ? 14.138  -17.222 54.043  1.00 89.02  ? 582  GLN A CA  1 
ATOM 3711  C C   . GLN A 1 582  ? 14.243  -18.741 53.905  1.00 67.90  ? 582  GLN A C   1 
ATOM 3712  O O   . GLN A 1 582  ? 14.547  -19.458 54.875  1.00 49.66  ? 582  GLN A O   1 
ATOM 3713  C CB  . GLN A 1 582  ? 12.702  -16.730 53.795  1.00 96.71  ? 582  GLN A CB  1 
ATOM 3714  H H   . GLN A 1 582  ? 14.704  -16.025 52.557  1.00 106.07 ? 582  GLN A H   1 
ATOM 3715  H HA  . GLN A 1 582  ? 14.378  -16.989 54.954  1.00 106.83 ? 582  GLN A HA  1 
ATOM 3716  N N   . LYS A 1 583  ? 14.031  -19.250 52.688  1.00 65.17  ? 583  LYS A N   1 
ATOM 3717  C CA  . LYS A 1 583  ? 14.418  -20.623 52.426  1.00 48.58  ? 583  LYS A CA  1 
ATOM 3718  C C   . LYS A 1 583  ? 15.849  -20.817 52.917  1.00 46.56  ? 583  LYS A C   1 
ATOM 3719  O O   . LYS A 1 583  ? 16.105  -21.650 53.790  1.00 54.26  ? 583  LYS A O   1 
ATOM 3720  C CB  . LYS A 1 583  ? 14.276  -20.944 50.934  1.00 47.02  ? 583  LYS A CB  1 
ATOM 3721  H HA  . LYS A 1 583  ? 13.840  -21.221 52.924  1.00 58.30  ? 583  LYS A HA  1 
ATOM 3722  N N   . GLN A 1 584  ? 16.774  -19.964 52.446  1.00 43.82  ? 584  GLN A N   1 
ATOM 3723  C CA  . GLN A 1 584  ? 18.164  -20.056 52.862  1.00 36.69  ? 584  GLN A CA  1 
ATOM 3724  C C   . GLN A 1 584  ? 18.285  -20.028 54.387  1.00 39.31  ? 584  GLN A C   1 
ATOM 3725  O O   . GLN A 1 584  ? 19.087  -20.770 54.963  1.00 44.47  ? 584  GLN A O   1 
ATOM 3726  C CB  . GLN A 1 584  ? 18.982  -18.924 52.234  1.00 29.12  ? 584  GLN A CB  1 
ATOM 3727  H H   . GLN A 1 584  ? 16.613  -19.329 51.888  1.00 52.58  ? 584  GLN A H   1 
ATOM 3728  H HA  . GLN A 1 584  ? 18.531  -20.898 52.549  1.00 44.02  ? 584  GLN A HA  1 
ATOM 3729  N N   . ILE A 1 585  ? 17.462  -19.219 55.062  1.00 33.19  ? 585  ILE A N   1 
ATOM 3730  C CA  . ILE A 1 585  ? 17.636  -19.044 56.496  1.00 31.29  ? 585  ILE A CA  1 
ATOM 3731  C C   . ILE A 1 585  ? 17.397  -20.358 57.215  1.00 29.90  ? 585  ILE A C   1 
ATOM 3732  O O   . ILE A 1 585  ? 17.979  -20.614 58.274  1.00 29.40  ? 585  ILE A O   1 
ATOM 3733  C CB  . ILE A 1 585  ? 16.702  -17.945 57.035  1.00 30.18  ? 585  ILE A CB  1 
ATOM 3734  H H   . ILE A 1 585  ? 16.812  -18.772 54.719  1.00 39.83  ? 585  ILE A H   1 
ATOM 3735  H HA  . ILE A 1 585  ? 18.551  -18.771 56.670  1.00 37.54  ? 585  ILE A HA  1 
ATOM 3736  N N   . GLY A 1 586  ? 16.547  -21.212 56.652  1.00 30.85  ? 586  GLY A N   1 
ATOM 3737  C CA  . GLY A 1 586  ? 16.265  -22.482 57.289  1.00 34.54  ? 586  GLY A CA  1 
ATOM 3738  C C   . GLY A 1 586  ? 17.382  -23.509 57.169  1.00 44.10  ? 586  GLY A C   1 
ATOM 3739  O O   . GLY A 1 586  ? 17.420  -24.482 57.932  1.00 41.43  ? 586  GLY A O   1 
ATOM 3740  H H   . GLY A 1 586  ? 16.129  -21.078 55.912  1.00 37.02  ? 586  GLY A H   1 
ATOM 3741  H HA2 . GLY A 1 586  ? 16.096  -22.332 58.233  1.00 41.45  ? 586  GLY A HA2 1 
ATOM 3742  H HA3 . GLY A 1 586  ? 15.464  -22.862 56.896  1.00 41.45  ? 586  GLY A HA3 1 
ATOM 3743  N N   . TYR A 1 587  ? 18.286  -23.331 56.195  1.00 55.47  ? 587  TYR A N   1 
ATOM 3744  C CA  . TYR A 1 587  ? 19.272  -24.373 55.904  1.00 64.56  ? 587  TYR A CA  1 
ATOM 3745  C C   . TYR A 1 587  ? 20.548  -24.219 56.734  1.00 73.89  ? 587  TYR A C   1 
ATOM 3746  O O   . TYR A 1 587  ? 21.181  -25.231 57.070  1.00 98.52  ? 587  TYR A O   1 
ATOM 3747  C CB  . TYR A 1 587  ? 19.610  -24.378 54.408  1.00 67.82  ? 587  TYR A CB  1 
ATOM 3748  H HA  . TYR A 1 587  ? 18.884  -25.235 56.120  1.00 77.47  ? 587  TYR A HA  1 
ATOM 3749  N N   . ASP A 1 588  ? 20.942  -22.986 57.069  1.00 61.30  ? 588  ASP A N   1 
ATOM 3750  C CA  . ASP A 1 588  ? 22.139  -22.730 57.876  1.00 48.35  ? 588  ASP A CA  1 
ATOM 3751  C C   . ASP A 1 588  ? 22.215  -21.234 58.197  1.00 34.15  ? 588  ASP A C   1 
ATOM 3752  O O   . ASP A 1 588  ? 21.315  -20.456 57.874  1.00 31.65  ? 588  ASP A O   1 
ATOM 3753  C CB  . ASP A 1 588  ? 23.399  -23.217 57.155  1.00 48.42  ? 588  ASP A CB  1 
ATOM 3754  H HA  . ASP A 1 588  ? 22.066  -23.214 58.713  1.00 58.02  ? 588  ASP A HA  1 
ATOM 3755  N N   . VAL A 1 589  ? 23.294  -20.843 58.864  1.00 30.14  ? 589  VAL A N   1 
ATOM 3756  C CA  . VAL A 1 589  ? 23.524  -19.451 59.216  1.00 25.50  ? 589  VAL A CA  1 
ATOM 3757  C C   . VAL A 1 589  ? 24.542  -18.804 58.281  1.00 28.93  ? 589  VAL A C   1 
ATOM 3758  O O   . VAL A 1 589  ? 25.139  -17.783 58.623  1.00 25.19  ? 589  VAL A O   1 
ATOM 3759  C CB  . VAL A 1 589  ? 23.966  -19.316 60.672  1.00 22.29  ? 589  VAL A CB  1 
ATOM 3760  H HA  . VAL A 1 589  ? 22.689  -18.967 59.118  1.00 30.60  ? 589  VAL A HA  1 
ATOM 3761  N N   . LEU A 1 590  ? 24.779  -19.423 57.116  1.00 46.60  ? 590  LEU A N   1 
ATOM 3762  C CA  . LEU A 1 590  ? 25.804  -18.957 56.190  1.00 53.75  ? 590  LEU A CA  1 
ATOM 3763  C C   . LEU A 1 590  ? 25.522  -17.531 55.718  1.00 47.48  ? 590  LEU A C   1 
ATOM 3764  O O   . LEU A 1 590  ? 26.440  -16.705 55.636  1.00 50.25  ? 590  LEU A O   1 
ATOM 3765  C CB  . LEU A 1 590  ? 25.904  -19.925 55.001  1.00 56.22  ? 590  LEU A CB  1 
ATOM 3766  H H   . LEU A 1 590  ? 24.354  -20.119 56.844  1.00 55.92  ? 590  LEU A H   1 
ATOM 3767  H HA  . LEU A 1 590  ? 26.661  -18.955 56.645  1.00 64.50  ? 590  LEU A HA  1 
ATOM 3768  N N   . ALA A 1 591  ? 24.262  -17.223 55.401  1.00 34.56  ? 591  ALA A N   1 
ATOM 3769  C CA  . ALA A 1 591  ? 23.938  -15.860 55.011  1.00 27.66  ? 591  ALA A CA  1 
ATOM 3770  C C   . ALA A 1 591  ? 24.433  -14.904 56.081  1.00 27.28  ? 591  ALA A C   1 
ATOM 3771  O O   . ALA A 1 591  ? 24.850  -13.780 55.790  1.00 30.07  ? 591  ALA A O   1 
ATOM 3772  C CB  . ALA A 1 591  ? 22.436  -15.728 54.785  1.00 18.99  ? 591  ALA A CB  1 
ATOM 3773  H H   . ALA A 1 591  ? 23.599  -17.770 55.404  1.00 41.47  ? 591  ALA A H   1 
ATOM 3774  H HA  . ALA A 1 591  ? 24.391  -15.648 54.180  1.00 33.19  ? 591  ALA A HA  1 
ATOM 3775  H HB1 . ALA A 1 591  ? 22.236  -14.815 54.527  1.00 22.79  ? 591  ALA A HB1 1 
ATOM 3776  H HB2 . ALA A 1 591  ? 22.169  -16.338 54.081  1.00 22.79  ? 591  ALA A HB2 1 
ATOM 3777  H HB3 . ALA A 1 591  ? 21.973  -15.948 55.609  1.00 22.79  ? 591  ALA A HB3 1 
ATOM 3778  N N   . GLU A 1 592  ? 24.449  -15.384 57.317  1.00 23.18  ? 592  GLU A N   1 
ATOM 3779  C CA  . GLU A 1 592  ? 25.120  -14.722 58.422  1.00 27.30  ? 592  GLU A CA  1 
ATOM 3780  C C   . GLU A 1 592  ? 26.486  -14.164 58.031  1.00 35.86  ? 592  GLU A C   1 
ATOM 3781  O O   . GLU A 1 592  ? 26.695  -12.951 58.082  1.00 59.36  ? 592  GLU A O   1 
ATOM 3782  C CB  . GLU A 1 592  ? 25.266  -15.715 59.575  1.00 23.12  ? 592  GLU A CB  1 
ATOM 3783  H HA  . GLU A 1 592  ? 24.570  -13.983 58.729  1.00 32.76  ? 592  GLU A HA  1 
ATOM 3784  N N   . ASP A 1 593  ? 27.440  -15.025 57.671  1.00 26.71  ? 593  ASP A N   1 
ATOM 3785  C CA  . ASP A 1 593  ? 28.778  -14.543 57.350  1.00 24.86  ? 593  ASP A CA  1 
ATOM 3786  C C   . ASP A 1 593  ? 28.714  -13.365 56.396  1.00 43.32  ? 593  ASP A C   1 
ATOM 3787  O O   . ASP A 1 593  ? 29.416  -12.365 56.593  1.00 54.49  ? 593  ASP A O   1 
ATOM 3788  C CB  . ASP A 1 593  ? 29.619  -15.657 56.735  1.00 23.41  ? 593  ASP A CB  1 
ATOM 3789  H H   . ASP A 1 593  ? 27.338  -15.877 57.607  1.00 32.05  ? 593  ASP A H   1 
ATOM 3790  H HA  . ASP A 1 593  ? 29.215  -14.249 58.165  1.00 29.84  ? 593  ASP A HA  1 
ATOM 3791  N N   . THR A 1 594  ? 27.840  -13.439 55.386  1.00 53.92  ? 594  THR A N   1 
ATOM 3792  C CA  . THR A 1 594  ? 27.641  -12.312 54.479  1.00 77.30  ? 594  THR A CA  1 
ATOM 3793  C C   . THR A 1 594  ? 27.122  -11.071 55.223  1.00 86.64  ? 594  THR A C   1 
ATOM 3794  O O   . THR A 1 594  ? 27.764  -10.008 55.198  1.00 89.59  ? 594  THR A O   1 
ATOM 3795  C CB  . THR A 1 594  ? 26.690  -12.735 53.356  1.00 86.44  ? 594  THR A CB  1 
ATOM 3796  H H   . THR A 1 594  ? 27.357  -14.128 55.208  1.00 64.70  ? 594  THR A H   1 
ATOM 3797  H HA  . THR A 1 594  ? 28.492  -12.081 54.075  1.00 92.76  ? 594  THR A HA  1 
ATOM 3798  N N   . ILE A 1 595  ? 25.962  -11.181 55.891  1.00 74.43  ? 595  ILE A N   1 
ATOM 3799  C CA  . ILE A 1 595  ? 25.486  -10.092 56.744  1.00 55.92  ? 595  ILE A CA  1 
ATOM 3800  C C   . ILE A 1 595  ? 26.627  -9.581  57.636  1.00 71.43  ? 595  ILE A C   1 
ATOM 3801  O O   . ILE A 1 595  ? 26.774  -8.365  57.839  1.00 66.89  ? 595  ILE A O   1 
ATOM 3802  C CB  . ILE A 1 595  ? 24.269  -10.559 57.567  1.00 31.07  ? 595  ILE A CB  1 
ATOM 3803  H H   . ILE A 1 595  ? 25.444  -11.867 55.865  1.00 89.32  ? 595  ILE A H   1 
ATOM 3804  H HA  . ILE A 1 595  ? 25.198  -9.357  56.181  1.00 67.10  ? 595  ILE A HA  1 
ATOM 3805  N N   . THR A 1 596  ? 27.507  -10.497 58.109  1.00 86.65  ? 596  THR A N   1 
ATOM 3806  C CA  . THR A 1 596  ? 28.572  -10.133 59.048  1.00 80.06  ? 596  THR A CA  1 
ATOM 3807  C C   . THR A 1 596  ? 29.658  -9.282  58.386  1.00 81.46  ? 596  THR A C   1 
ATOM 3808  O O   . THR A 1 596  ? 30.232  -8.392  59.029  1.00 75.21  ? 596  THR A O   1 
ATOM 3809  C CB  . THR A 1 596  ? 29.197  -11.397 59.652  1.00 70.77  ? 596  THR A CB  1 
ATOM 3810  H H   . THR A 1 596  ? 27.499  -11.330 57.896  1.00 103.98 ? 596  THR A H   1 
ATOM 3811  H HA  . THR A 1 596  ? 28.188  -9.615  59.772  1.00 96.07  ? 596  THR A HA  1 
ATOM 3812  N N   . ALA A 1 597  ? 29.980  -9.546  57.114  1.00 81.37  ? 597  ALA A N   1 
ATOM 3813  C CA  . ALA A 1 597  ? 30.898  -8.659  56.416  1.00 61.82  ? 597  ALA A CA  1 
ATOM 3814  C C   . ALA A 1 597  ? 30.267  -7.290  56.193  1.00 63.02  ? 597  ALA A C   1 
ATOM 3815  O O   . ALA A 1 597  ? 30.985  -6.282  56.230  1.00 54.17  ? 597  ALA A O   1 
ATOM 3816  C CB  . ALA A 1 597  ? 31.329  -9.270  55.079  1.00 56.86  ? 597  ALA A CB  1 
ATOM 3817  H H   . ALA A 1 597  ? 29.688  -10.210 56.651  1.00 97.64  ? 597  ALA A H   1 
ATOM 3818  H HA  . ALA A 1 597  ? 31.692  -8.538  56.959  1.00 74.18  ? 597  ALA A HA  1 
ATOM 3819  H HB1 . ALA A 1 597  ? 31.940  -8.660  54.636  1.00 68.23  ? 597  ALA A HB1 1 
ATOM 3820  H HB2 . ALA A 1 597  ? 31.771  -10.117 55.247  1.00 68.23  ? 597  ALA A HB2 1 
ATOM 3821  H HB3 . ALA A 1 597  ? 30.543  -9.411  54.528  1.00 68.23  ? 597  ALA A HB3 1 
ATOM 3822  N N   . LEU A 1 598  ? 28.921  -7.244  56.002  1.00 77.23  ? 598  LEU A N   1 
ATOM 3823  C CA  . LEU A 1 598  ? 28.195  -6.043  55.571  1.00 78.70  ? 598  LEU A CA  1 
ATOM 3824  C C   . LEU A 1 598  ? 27.854  -5.073  56.715  1.00 70.87  ? 598  LEU A C   1 
ATOM 3825  O O   . LEU A 1 598  ? 27.645  -3.872  56.469  1.00 71.51  ? 598  LEU A O   1 
ATOM 3826  C CB  . LEU A 1 598  ? 26.897  -6.455  54.858  1.00 64.32  ? 598  LEU A CB  1 
ATOM 3827  H H   . LEU A 1 598  ? 28.405  -7.922  56.122  1.00 92.67  ? 598  LEU A H   1 
ATOM 3828  H HA  . LEU A 1 598  ? 28.743  -5.562  54.932  1.00 94.44  ? 598  LEU A HA  1 
ATOM 3829  N N   . LEU A 1 599  ? 27.730  -5.568  57.947  1.00 58.81  ? 599  LEU A N   1 
ATOM 3830  C CA  . LEU A 1 599  ? 27.412  -4.704  59.073  1.00 25.62  ? 599  LEU A CA  1 
ATOM 3831  C C   . LEU A 1 599  ? 28.604  -3.839  59.497  1.00 24.31  ? 599  LEU A C   1 
ATOM 3832  O O   . LEU A 1 599  ? 28.426  -2.664  59.833  1.00 21.42  ? 599  LEU A O   1 
ATOM 3833  C CB  . LEU A 1 599  ? 26.933  -5.573  60.213  1.00 20.80  ? 599  LEU A CB  1 
ATOM 3834  H H   . LEU A 1 599  ? 27.825  -6.398  58.153  1.00 70.57  ? 599  LEU A H   1 
ATOM 3835  H HA  . LEU A 1 599  ? 26.686  -4.111  58.822  1.00 30.74  ? 599  LEU A HA  1 
ATOM 3836  N N   . HIS A 1 600  ? 29.824  -4.407  59.504  1.00 32.01  ? 600  HIS A N   1 
ATOM 3837  C CA  . HIS A 1 600  ? 31.026  -3.653  59.864  1.00 29.47  ? 600  HIS A CA  1 
ATOM 3838  C C   . HIS A 1 600  ? 31.473  -2.712  58.749  1.00 27.57  ? 600  HIS A C   1 
ATOM 3839  O O   . HIS A 1 600  ? 31.812  -1.551  59.005  1.00 27.46  ? 600  HIS A O   1 
ATOM 3840  C CB  . HIS A 1 600  ? 32.158  -4.623  60.204  1.00 28.87  ? 600  HIS A CB  1 
ATOM 3841  H H   . HIS A 1 600  ? 29.976  -5.229  59.303  1.00 38.41  ? 600  HIS A H   1 
ATOM 3842  H HA  . HIS A 1 600  ? 30.840  -3.118  60.652  1.00 35.36  ? 600  HIS A HA  1 
ATOM 3843  N N   . ASN A 1 601  ? 31.535  -3.206  57.515  1.00 26.55  ? 601  ASN A N   1 
ATOM 3844  C CA  . ASN A 1 601  ? 31.934  -2.353  56.400  1.00 24.47  ? 601  ASN A CA  1 
ATOM 3845  C C   . ASN A 1 601  ? 30.850  -1.324  56.017  1.00 30.20  ? 601  ASN A C   1 
ATOM 3846  O O   . ASN A 1 601  ? 31.192  -0.203  55.627  1.00 32.09  ? 601  ASN A O   1 
ATOM 3847  C CB  . ASN A 1 601  ? 32.317  -3.230  55.211  1.00 25.39  ? 601  ASN A CB  1 
ATOM 3848  H H   . ASN A 1 601  ? 31.355  -4.019  57.299  1.00 31.86  ? 601  ASN A H   1 
ATOM 3849  H HA  . ASN A 1 601  ? 32.725  -1.856  56.662  1.00 29.36  ? 601  ASN A HA  1 
ATOM 3850  N N   . ASN A 1 602  ? 29.547  -1.666  56.118  1.00 30.42  ? 602  ASN A N   1 
ATOM 3851  C CA  . ASN A 1 602  ? 28.434  -0.807  55.670  1.00 15.84  ? 602  ASN A CA  1 
ATOM 3852  C C   . ASN A 1 602  ? 27.519  -0.457  56.829  1.00 12.28  ? 602  ASN A C   1 
ATOM 3853  O O   . ASN A 1 602  ? 27.055  -1.339  57.556  1.00 17.57  ? 602  ASN A O   1 
ATOM 3854  C CB  . ASN A 1 602  ? 27.582  -1.475  54.587  1.00 14.58  ? 602  ASN A CB  1 
ATOM 3855  H HA  . ASN A 1 602  ? 28.794  0.018   55.308  1.00 19.00  ? 602  ASN A HA  1 
ATOM 3856  N N   . ARG A 1 603  ? 27.224  0.826   56.964  1.00 9.04   ? 603  ARG A N   1 
ATOM 3857  C CA  . ARG A 1 603  ? 26.481  1.272   58.122  1.00 9.04   ? 603  ARG A CA  1 
ATOM 3858  C C   . ARG A 1 603  ? 25.738  2.535   57.749  1.00 9.04   ? 603  ARG A C   1 
ATOM 3859  O O   . ARG A 1 603  ? 26.063  3.194   56.760  1.00 9.04   ? 603  ARG A O   1 
ATOM 3860  C CB  . ARG A 1 603  ? 27.402  1.528   59.312  1.00 11.30  ? 603  ARG A CB  1 
ATOM 3861  H HA  . ARG A 1 603  ? 25.833  0.596   58.373  1.00 10.85  ? 603  ARG A HA  1 
ATOM 3862  N N   . LYS A 1 604  ? 24.744  2.864   58.575  1.00 13.84  ? 604  LYS A N   1 
ATOM 3863  C CA  . LYS A 1 604  ? 23.854  3.999   58.362  1.00 21.71  ? 604  LYS A CA  1 
ATOM 3864  C C   . LYS A 1 604  ? 22.985  3.810   57.115  1.00 45.16  ? 604  LYS A C   1 
ATOM 3865  O O   . LYS A 1 604  ? 23.423  4.141   56.010  1.00 45.29  ? 604  LYS A O   1 
ATOM 3866  C CB  . LYS A 1 604  ? 24.668  5.290   58.251  1.00 14.82  ? 604  LYS A CB  1 
ATOM 3867  H HA  . LYS A 1 604  ? 23.264  4.083   59.127  1.00 26.05  ? 604  LYS A HA  1 
ATOM 3868  N N   . LEU A 1 605  ? 21.757  3.285   57.285  1.00 53.29  ? 605  LEU A N   1 
ATOM 3869  C CA  . LEU A 1 605  ? 20.775  3.080   56.196  1.00 40.21  ? 605  LEU A CA  1 
ATOM 3870  C C   . LEU A 1 605  ? 21.267  2.097   55.108  1.00 38.72  ? 605  LEU A C   1 
ATOM 3871  O O   . LEU A 1 605  ? 21.301  2.416   53.916  1.00 24.87  ? 605  LEU A O   1 
ATOM 3872  C CB  . LEU A 1 605  ? 20.368  4.422   55.578  1.00 28.12  ? 605  LEU A CB  1 
ATOM 3873  H H   . LEU A 1 605  ? 21.459  3.031   58.051  1.00 63.95  ? 605  LEU A H   1 
ATOM 3874  H HA  . LEU A 1 605  ? 19.975  2.693   56.584  1.00 48.25  ? 605  LEU A HA  1 
ATOM 3875  N N   . LEU A 1 606  ? 21.629  0.872   55.526  1.00 43.63  ? 606  LEU A N   1 
ATOM 3876  C CA  . LEU A 1 606  ? 21.854  -0.264  54.623  1.00 22.96  ? 606  LEU A CA  1 
ATOM 3877  C C   . LEU A 1 606  ? 20.757  -1.280  54.931  1.00 24.23  ? 606  LEU A C   1 
ATOM 3878  O O   . LEU A 1 606  ? 20.839  -2.024  55.918  1.00 22.29  ? 606  LEU A O   1 
ATOM 3879  C CB  . LEU A 1 606  ? 23.249  -0.864  54.793  1.00 17.51  ? 606  LEU A CB  1 
ATOM 3880  H H   . LEU A 1 606  ? 21.753  0.674   56.353  1.00 52.35  ? 606  LEU A H   1 
ATOM 3881  H HA  . LEU A 1 606  ? 21.755  0.028   53.703  1.00 27.55  ? 606  LEU A HA  1 
ATOM 3882  N N   . GLU A 1 607  ? 19.731  -1.294  54.083  1.00 33.61  ? 607  GLU A N   1 
ATOM 3883  C CA  . GLU A 1 607  ? 18.503  -2.076  54.292  1.00 35.62  ? 607  GLU A CA  1 
ATOM 3884  C C   . GLU A 1 607  ? 17.832  -1.744  55.630  1.00 31.68  ? 607  GLU A C   1 
ATOM 3885  O O   . GLU A 1 607  ? 17.500  -2.629  56.422  1.00 32.08  ? 607  GLU A O   1 
ATOM 3886  C CB  . GLU A 1 607  ? 18.789  -3.570  54.189  1.00 41.53  ? 607  GLU A CB  1 
ATOM 3887  H H   . GLU A 1 607  ? 19.719  -0.842  53.352  1.00 40.33  ? 607  GLU A H   1 
ATOM 3888  H HA  . GLU A 1 607  ? 17.874  -1.852  53.589  1.00 42.75  ? 607  GLU A HA  1 
ATOM 3889  N N   . LYS A 1 608  ? 17.606  -0.450  55.865  1.00 37.10  ? 608  LYS A N   1 
ATOM 3890  C CA  . LYS A 1 608  ? 16.983  -0.028  57.111  1.00 34.65  ? 608  LYS A CA  1 
ATOM 3891  C C   . LYS A 1 608  ? 15.596  -0.653  57.279  1.00 29.17  ? 608  LYS A C   1 
ATOM 3892  O O   . LYS A 1 608  ? 15.288  -1.202  58.345  1.00 26.74  ? 608  LYS A O   1 
ATOM 3893  C CB  . LYS A 1 608  ? 16.915  1.506   57.162  1.00 28.60  ? 608  LYS A CB  1 
ATOM 3894  H H   . LYS A 1 608  ? 17.801  0.191   55.326  1.00 44.51  ? 608  LYS A H   1 
ATOM 3895  H HA  . LYS A 1 608  ? 17.534  -0.325  57.852  1.00 41.58  ? 608  LYS A HA  1 
ATOM 3896  N N   . HIS A 1 609  ? 14.754  -0.607  56.236  1.00 25.97  ? 609  HIS A N   1 
ATOM 3897  C CA  . HIS A 1 609  ? 13.422  -1.185  56.348  1.00 23.11  ? 609  HIS A CA  1 
ATOM 3898  C C   . HIS A 1 609  ? 13.524  -2.605  56.832  1.00 23.22  ? 609  HIS A C   1 
ATOM 3899  O O   . HIS A 1 609  ? 12.618  -3.110  57.501  1.00 21.75  ? 609  HIS A O   1 
ATOM 3900  C CB  . HIS A 1 609  ? 12.708  -1.137  54.999  1.00 15.14  ? 609  HIS A CB  1 
ATOM 3901  H H   . HIS A 1 609  ? 14.932  -0.253  55.472  1.00 31.16  ? 609  HIS A H   1 
ATOM 3902  H HA  . HIS A 1 609  ? 12.902  -0.678  56.990  1.00 27.73  ? 609  HIS A HA  1 
ATOM 3903  N N   . ILE A 1 610  ? 14.647  -3.245  56.520  1.00 24.27  ? 610  ILE A N   1 
ATOM 3904  C CA  . ILE A 1 610  ? 14.945  -4.566  57.027  1.00 31.18  ? 610  ILE A CA  1 
ATOM 3905  C C   . ILE A 1 610  ? 15.098  -4.579  58.536  1.00 34.41  ? 610  ILE A C   1 
ATOM 3906  O O   . ILE A 1 610  ? 15.026  -5.647  59.132  1.00 40.36  ? 610  ILE A O   1 
ATOM 3907  C CB  . ILE A 1 610  ? 16.222  -5.106  56.356  1.00 42.51  ? 610  ILE A CB  1 
ATOM 3908  H HA  . ILE A 1 610  ? 14.214  -5.161  56.798  1.00 37.42  ? 610  ILE A HA  1 
ATOM 3909  N N   . THR A 1 611  ? 15.326  -3.430  59.178  1.00 33.81  ? 611  THR A N   1 
ATOM 3910  C CA  . THR A 1 611  ? 15.544  -3.454  60.624  1.00 36.05  ? 611  THR A CA  1 
ATOM 3911  C C   . THR A 1 611  ? 14.269  -3.822  61.368  1.00 33.51  ? 611  THR A C   1 
ATOM 3912  O O   . THR A 1 611  ? 14.293  -4.669  62.274  1.00 28.70  ? 611  THR A O   1 
ATOM 3913  C CB  . THR A 1 611  ? 16.074  -2.103  61.099  1.00 36.69  ? 611  THR A CB  1 
ATOM 3914  H HA  . THR A 1 611  ? 16.213  -4.126  60.830  1.00 43.26  ? 611  THR A HA  1 
ATOM 3915  N N   . ALA A 1 612  ? 13.147  -3.197  61.006  1.00 30.40  ? 612  ALA A N   1 
ATOM 3916  C CA  . ALA A 1 612  ? 11.865  -3.674  61.504  1.00 32.47  ? 612  ALA A CA  1 
ATOM 3917  C C   . ALA A 1 612  ? 11.757  -5.186  61.315  1.00 43.11  ? 612  ALA A C   1 
ATOM 3918  O O   . ALA A 1 612  ? 11.391  -5.905  62.251  1.00 51.02  ? 612  ALA A O   1 
ATOM 3919  C CB  . ALA A 1 612  ? 10.725  -2.923  60.805  1.00 23.79  ? 612  ALA A CB  1 
ATOM 3920  H HA  . ALA A 1 612  ? 11.808  -3.487  62.454  1.00 38.96  ? 612  ALA A HA  1 
ATOM 3921  H HB1 . ALA A 1 612  ? 9.878   -3.249  61.146  1.00 28.54  ? 612  ALA A HB1 1 
ATOM 3922  H HB2 . ALA A 1 612  ? 10.814  -1.974  60.989  1.00 28.54  ? 612  ALA A HB2 1 
ATOM 3923  H HB3 . ALA A 1 612  ? 10.782  -3.082  59.850  1.00 28.54  ? 612  ALA A HB3 1 
ATOM 3924  N N   . ALA A 1 613  ? 12.122  -5.693  60.129  1.00 38.32  ? 613  ALA A N   1 
ATOM 3925  C CA  . ALA A 1 613  ? 12.103  -7.139  59.879  1.00 34.66  ? 613  ALA A CA  1 
ATOM 3926  C C   . ALA A 1 613  ? 13.110  -7.878  60.778  1.00 27.99  ? 613  ALA A C   1 
ATOM 3927  O O   . ALA A 1 613  ? 12.921  -9.065  61.118  1.00 28.93  ? 613  ALA A O   1 
ATOM 3928  C CB  . ALA A 1 613  ? 12.382  -7.385  58.389  1.00 31.13  ? 613  ALA A CB  1 
ATOM 3929  H HA  . ALA A 1 613  ? 11.217  -7.481  60.078  1.00 41.60  ? 613  ALA A HA  1 
ATOM 3930  H HB1 . ALA A 1 613  ? 12.370  -8.339  58.219  1.00 37.35  ? 613  ALA A HB1 1 
ATOM 3931  H HB2 . ALA A 1 613  ? 11.695  -6.946  57.862  1.00 37.35  ? 613  ALA A HB2 1 
ATOM 3932  H HB3 . ALA A 1 613  ? 13.253  -7.019  58.167  1.00 37.35  ? 613  ALA A HB3 1 
ATOM 3933  N N   . GLU A 1 614  ? 14.154  -7.170  61.213  1.00 24.93  ? 614  GLU A N   1 
ATOM 3934  C CA  . GLU A 1 614  ? 15.267  -7.802  61.892  1.00 26.39  ? 614  GLU A CA  1 
ATOM 3935  C C   . GLU A 1 614  ? 14.825  -8.375  63.213  1.00 30.30  ? 614  GLU A C   1 
ATOM 3936  O O   . GLU A 1 614  ? 15.461  -9.297  63.735  1.00 39.83  ? 614  GLU A O   1 
ATOM 3937  C CB  . GLU A 1 614  ? 16.402  -6.796  62.104  1.00 28.60  ? 614  GLU A CB  1 
ATOM 3938  H H   . GLU A 1 614  ? 14.236  -6.318  61.122  1.00 29.91  ? 614  GLU A H   1 
ATOM 3939  H HA  . GLU A 1 614  ? 15.604  -8.528  61.345  1.00 31.67  ? 614  GLU A HA  1 
ATOM 3940  N N   . ILE A 1 615  ? 13.736  -7.839  63.764  1.00 25.38  ? 615  ILE A N   1 
ATOM 3941  C CA  . ILE A 1 615  ? 13.174  -8.381  64.991  1.00 44.51  ? 615  ILE A CA  1 
ATOM 3942  C C   . ILE A 1 615  ? 12.631  -9.796  64.758  1.00 46.05  ? 615  ILE A C   1 
ATOM 3943  O O   . ILE A 1 615  ? 13.017  -10.751 65.451  1.00 54.97  ? 615  ILE A O   1 
ATOM 3944  C CB  . ILE A 1 615  ? 12.088  -7.435  65.544  1.00 51.12  ? 615  ILE A CB  1 
ATOM 3945  H H   . ILE A 1 615  ? 13.308  -7.164  63.446  1.00 30.46  ? 615  ILE A H   1 
ATOM 3946  H HA  . ILE A 1 615  ? 13.878  -8.441  65.656  1.00 53.41  ? 615  ILE A HA  1 
ATOM 3947  N N   . ASP A 1 616  ? 11.737  -9.964  63.776  1.00 33.60  ? 616  ASP A N   1 
ATOM 3948  C CA  . ASP A 1 616  ? 11.173  -11.284 63.538  1.00 29.49  ? 616  ASP A CA  1 
ATOM 3949  C C   . ASP A 1 616  ? 12.244  -12.288 63.139  1.00 30.57  ? 616  ASP A C   1 
ATOM 3950  O O   . ASP A 1 616  ? 12.045  -13.492 63.350  1.00 31.35  ? 616  ASP A O   1 
ATOM 3951  C CB  . ASP A 1 616  ? 10.085  -11.227 62.460  1.00 28.00  ? 616  ASP A CB  1 
ATOM 3952  H H   . ASP A 1 616  ? 11.452  -9.345  63.251  1.00 40.32  ? 616  ASP A H   1 
ATOM 3953  H HA  . ASP A 1 616  ? 10.762  -11.600 64.358  1.00 35.38  ? 616  ASP A HA  1 
ATOM 3954  N N   . THR A 1 617  ? 13.381  -11.819 62.589  1.00 32.82  ? 617  THR A N   1 
ATOM 3955  C CA  . THR A 1 617  ? 14.465  -12.732 62.213  1.00 39.66  ? 617  THR A CA  1 
ATOM 3956  C C   . THR A 1 617  ? 15.508  -13.008 63.305  1.00 34.92  ? 617  THR A C   1 
ATOM 3957  O O   . THR A 1 617  ? 16.260  -13.985 63.182  1.00 31.73  ? 617  THR A O   1 
ATOM 3958  C CB  . THR A 1 617  ? 15.212  -12.198 60.984  1.00 45.01  ? 617  THR A CB  1 
ATOM 3959  H H   . THR A 1 617  ? 13.542  -10.990 62.428  1.00 39.39  ? 617  THR A H   1 
ATOM 3960  H HA  . THR A 1 617  ? 14.073  -13.584 61.966  1.00 47.59  ? 617  THR A HA  1 
ATOM 3961  N N   . PHE A 1 618  ? 15.647  -12.155 64.319  1.00 30.46  ? 618  PHE A N   1 
ATOM 3962  C CA  . PHE A 1 618  ? 16.552  -12.484 65.417  1.00 28.29  ? 618  PHE A CA  1 
ATOM 3963  C C   . PHE A 1 618  ? 15.839  -13.313 66.475  1.00 28.13  ? 618  PHE A C   1 
ATOM 3964  O O   . PHE A 1 618  ? 16.449  -14.193 67.086  1.00 23.54  ? 618  PHE A O   1 
ATOM 3965  C CB  . PHE A 1 618  ? 17.130  -11.208 66.030  1.00 28.60  ? 618  PHE A CB  1 
ATOM 3966  H H   . PHE A 1 618  ? 15.241  -11.400 64.394  1.00 36.55  ? 618  PHE A H   1 
ATOM 3967  H HA  . PHE A 1 618  ? 17.289  -13.010 65.072  1.00 33.95  ? 618  PHE A HA  1 
ATOM 3968  N N   . VAL A 1 619  ? 14.561  -13.012 66.732  1.00 36.05  ? 619  VAL A N   1 
ATOM 3969  C CA  . VAL A 1 619  ? 13.750  -13.877 67.584  1.00 39.42  ? 619  VAL A CA  1 
ATOM 3970  C C   . VAL A 1 619  ? 13.481  -15.201 66.880  1.00 46.64  ? 619  VAL A C   1 
ATOM 3971  O O   . VAL A 1 619  ? 13.746  -16.277 67.434  1.00 47.15  ? 619  VAL A O   1 
ATOM 3972  C CB  . VAL A 1 619  ? 12.434  -13.178 67.972  1.00 46.31  ? 619  VAL A CB  1 
ATOM 3973  H H   . VAL A 1 619  ? 14.149  -12.321 66.429  1.00 43.26  ? 619  VAL A H   1 
ATOM 3974  H HA  . VAL A 1 619  ? 14.240  -14.066 68.399  1.00 47.31  ? 619  VAL A HA  1 
ATOM 3975  N N   . SER A 1 620  ? 12.945  -15.147 65.652  1.00 52.28  ? 620  SER A N   1 
ATOM 3976  C CA  . SER A 1 620  ? 12.696  -16.383 64.916  1.00 60.97  ? 620  SER A CA  1 
ATOM 3977  C C   . SER A 1 620  ? 14.013  -17.111 64.594  1.00 67.65  ? 620  SER A C   1 
ATOM 3978  O O   . SER A 1 620  ? 14.067  -18.351 64.641  1.00 75.53  ? 620  SER A O   1 
ATOM 3979  C CB  . SER A 1 620  ? 11.896  -16.073 63.644  1.00 52.38  ? 620  SER A CB  1 
ATOM 3980  H H   . SER A 1 620  ? 12.725  -14.427 65.237  1.00 62.74  ? 620  SER A H   1 
ATOM 3981  H HA  . SER A 1 620  ? 12.159  -16.972 65.468  1.00 73.17  ? 620  SER A HA  1 
ATOM 3982  N N   . LEU A 1 621  ? 15.087  -16.349 64.291  1.00 58.21  ? 621  LEU A N   1 
ATOM 3983  C CA  . LEU A 1 621  ? 16.387  -16.925 63.935  1.00 45.65  ? 621  LEU A CA  1 
ATOM 3984  C C   . LEU A 1 621  ? 17.081  -17.531 65.145  1.00 33.70  ? 621  LEU A C   1 
ATOM 3985  O O   . LEU A 1 621  ? 17.847  -18.489 65.015  1.00 26.33  ? 621  LEU A O   1 
ATOM 3986  C CB  . LEU A 1 621  ? 17.279  -15.850 63.314  1.00 32.08  ? 621  LEU A CB  1 
ATOM 3987  H H   . LEU A 1 621  ? 15.079  -15.489 64.287  1.00 69.85  ? 621  LEU A H   1 
ATOM 3988  H HA  . LEU A 1 621  ? 16.255  -17.627 63.278  1.00 54.78  ? 621  LEU A HA  1 
ATOM 3989  N N   . VAL A 1 622  ? 16.880  -16.935 66.313  1.00 37.11  ? 622  VAL A N   1 
ATOM 3990  C CA  . VAL A 1 622  ? 17.343  -17.543 67.550  1.00 39.73  ? 622  VAL A CA  1 
ATOM 3991  C C   . VAL A 1 622  ? 16.592  -18.840 67.837  1.00 44.62  ? 622  VAL A C   1 
ATOM 3992  O O   . VAL A 1 622  ? 17.207  -19.895 68.017  1.00 46.44  ? 622  VAL A O   1 
ATOM 3993  C CB  . VAL A 1 622  ? 17.204  -16.531 68.701  1.00 42.11  ? 622  VAL A CB  1 
ATOM 3994  H H   . VAL A 1 622  ? 16.479  -16.182 66.415  1.00 44.53  ? 622  VAL A H   1 
ATOM 3995  H HA  . VAL A 1 622  ? 18.284  -17.760 67.459  1.00 47.67  ? 622  VAL A HA  1 
ATOM 3996  N N   . ARG A 1 623  ? 15.255  -18.793 67.858  1.00 48.52  ? 623  ARG A N   1 
ATOM 3997  C CA  . ARG A 1 623  ? 14.469  -19.950 68.298  1.00 40.39  ? 623  ARG A CA  1 
ATOM 3998  C C   . ARG A 1 623  ? 14.657  -21.163 67.380  1.00 43.34  ? 623  ARG A C   1 
ATOM 3999  O O   . ARG A 1 623  ? 14.858  -22.291 67.854  1.00 32.60  ? 623  ARG A O   1 
ATOM 4000  C CB  . ARG A 1 623  ? 12.990  -19.563 68.379  1.00 43.38  ? 623  ARG A CB  1 
ATOM 4001  H H   . ARG A 1 623  ? 14.785  -18.111 67.625  1.00 58.22  ? 623  ARG A H   1 
ATOM 4002  H HA  . ARG A 1 623  ? 14.759  -20.205 69.188  1.00 48.47  ? 623  ARG A HA  1 
ATOM 4003  N N   . LYS A 1 624  ? 14.552  -20.957 66.063  1.00 48.66  ? 624  LYS A N   1 
ATOM 4004  C CA  . LYS A 1 624  ? 14.732  -22.062 65.124  1.00 41.51  ? 624  LYS A CA  1 
ATOM 4005  C C   . LYS A 1 624  ? 16.191  -22.509 65.078  1.00 40.51  ? 624  LYS A C   1 
ATOM 4006  O O   . LYS A 1 624  ? 16.486  -23.708 65.158  1.00 40.19  ? 624  LYS A O   1 
ATOM 4007  C CB  . LYS A 1 624  ? 14.241  -21.648 63.736  1.00 35.66  ? 624  LYS A CB  1 
ATOM 4008  H H   . LYS A 1 624  ? 14.379  -20.199 65.695  1.00 58.39  ? 624  LYS A H   1 
ATOM 4009  H HA  . LYS A 1 624  ? 14.197  -22.817 65.417  1.00 49.82  ? 624  LYS A HA  1 
ATOM 4010  N N   . ASN A 1 625  ? 17.118  -21.551 64.953  1.00 42.72  ? 625  ASN A N   1 
ATOM 4011  C CA  . ASN A 1 625  ? 18.539  -21.880 64.961  1.00 41.95  ? 625  ASN A CA  1 
ATOM 4012  C C   . ASN A 1 625  ? 18.916  -22.668 66.203  1.00 43.49  ? 625  ASN A C   1 
ATOM 4013  O O   . ASN A 1 625  ? 19.816  -23.518 66.151  1.00 40.56  ? 625  ASN A O   1 
ATOM 4014  C CB  . ASN A 1 625  ? 19.388  -20.607 64.885  1.00 35.32  ? 625  ASN A CB  1 
ATOM 4015  H HA  . ASN A 1 625  ? 18.742  -22.425 64.185  1.00 50.33  ? 625  ASN A HA  1 
ATOM 4016  N N   . ARG A 1 626  ? 18.226  -22.412 67.315  1.00 49.48  ? 626  ARG A N   1 
ATOM 4017  C CA  . ARG A 1 626  ? 18.603  -22.921 68.629  1.00 48.32  ? 626  ARG A CA  1 
ATOM 4018  C C   . ARG A 1 626  ? 19.788  -22.109 69.152  1.00 49.19  ? 626  ARG A C   1 
ATOM 4019  O O   . ARG A 1 626  ? 19.729  -21.580 70.270  1.00 49.22  ? 626  ARG A O   1 
ATOM 4020  C CB  . ARG A 1 626  ? 18.922  -24.420 68.559  1.00 38.36  ? 626  ARG A CB  1 
ATOM 4021  H H   . ARG A 1 626  ? 17.514  -21.930 67.331  1.00 59.38  ? 626  ARG A H   1 
ATOM 4022  H HA  . ARG A 1 626  ? 17.860  -22.799 69.242  1.00 57.98  ? 626  ARG A HA  1 
ATOM 4023  N N   . GLU A 1 627  ? 20.853  -21.976 68.338  1.00 43.87  ? 627  GLU A N   1 
ATOM 4024  C CA  . GLU A 1 627  ? 22.066  -21.247 68.695  1.00 29.27  ? 627  GLU A CA  1 
ATOM 4025  C C   . GLU A 1 627  ? 21.951  -19.789 68.281  1.00 19.32  ? 627  GLU A C   1 
ATOM 4026  O O   . GLU A 1 627  ? 22.889  -19.009 68.482  1.00 15.84  ? 627  GLU A O   1 
ATOM 4027  C CB  . GLU A 1 627  ? 23.285  -21.896 68.034  1.00 28.19  ? 627  GLU A CB  1 
ATOM 4028  H H   . GLU A 1 627  ? 20.886  -22.314 67.548  1.00 52.65  ? 627  GLU A H   1 
ATOM 4029  H HA  . GLU A 1 627  ? 22.188  -21.281 69.657  1.00 35.13  ? 627  GLU A HA  1 
ATOM 4030  N N   . PRO A 1 628  ? 20.833  -19.390 67.693  1.00 21.43  ? 628  PRO A N   1 
ATOM 4031  C CA  . PRO A 1 628  ? 20.662  -17.968 67.408  1.00 19.36  ? 628  PRO A CA  1 
ATOM 4032  C C   . PRO A 1 628  ? 21.760  -17.423 66.558  1.00 14.34  ? 628  PRO A C   1 
ATOM 4033  O O   . PRO A 1 628  ? 22.240  -16.304 66.751  1.00 18.41  ? 628  PRO A O   1 
ATOM 4034  C CB  . PRO A 1 628  ? 20.674  -17.330 68.795  1.00 22.95  ? 628  PRO A CB  1 
ATOM 4035  H HA  . PRO A 1 628  ? 19.806  -17.805 66.981  1.00 23.23  ? 628  PRO A HA  1 
ATOM 4036  N N   . ARG A 1 629  ? 22.086  -18.190 65.535  1.00 12.16  ? 629  ARG A N   1 
ATOM 4037  C CA  . ARG A 1 629  ? 23.049  -17.702 64.582  1.00 17.55  ? 629  ARG A CA  1 
ATOM 4038  C C   . ARG A 1 629  ? 22.674  -16.298 64.157  1.00 18.69  ? 629  ARG A C   1 
ATOM 4039  O O   . ARG A 1 629  ? 23.350  -15.318 64.516  1.00 16.35  ? 629  ARG A O   1 
ATOM 4040  C CB  . ARG A 1 629  ? 23.093  -18.646 63.388  1.00 26.86  ? 629  ARG A CB  1 
ATOM 4041  H H   . ARG A 1 629  ? 21.772  -18.975 65.376  1.00 14.59  ? 629  ARG A H   1 
ATOM 4042  H HA  . ARG A 1 629  ? 23.928  -17.678 64.990  1.00 21.06  ? 629  ARG A HA  1 
ATOM 4043  N N   . PHE A 1 630  ? 21.532  -16.186 63.479  1.00 17.38  ? 630  PHE A N   1 
ATOM 4044  C CA  . PHE A 1 630  ? 21.171  -14.939 62.821  1.00 19.46  ? 630  PHE A CA  1 
ATOM 4045  C C   . PHE A 1 630  ? 21.216  -13.776 63.803  1.00 17.63  ? 630  PHE A C   1 
ATOM 4046  O O   . PHE A 1 630  ? 21.852  -12.738 63.547  1.00 13.83  ? 630  PHE A O   1 
ATOM 4047  C CB  . PHE A 1 630  ? 19.787  -15.074 62.193  1.00 23.23  ? 630  PHE A CB  1 
ATOM 4048  H H   . PHE A 1 630  ? 20.954  -16.817 63.387  1.00 20.86  ? 630  PHE A H   1 
ATOM 4049  H HA  . PHE A 1 630  ? 21.807  -14.759 62.112  1.00 23.35  ? 630  PHE A HA  1 
ATOM 4050  N N   . LEU A 1 631  ? 20.592  -13.950 64.958  1.00 18.92  ? 631  LEU A N   1 
ATOM 4051  C CA  . LEU A 1 631  ? 20.644  -12.889 65.936  1.00 19.79  ? 631  LEU A CA  1 
ATOM 4052  C C   . LEU A 1 631  ? 22.089  -12.593 66.299  1.00 16.64  ? 631  LEU A C   1 
ATOM 4053  O O   . LEU A 1 631  ? 22.510  -11.434 66.275  1.00 15.43  ? 631  LEU A O   1 
ATOM 4054  C CB  . LEU A 1 631  ? 19.819  -13.277 67.162  1.00 25.13  ? 631  LEU A CB  1 
ATOM 4055  H H   . LEU A 1 631  ? 20.148  -14.649 65.190  1.00 22.71  ? 631  LEU A H   1 
ATOM 4056  H HA  . LEU A 1 631  ? 20.258  -12.085 65.554  1.00 23.75  ? 631  LEU A HA  1 
ATOM 4057  N N   . ASP A 1 632  ? 22.881  -13.637 66.569  1.00 15.62  ? 632  ASP A N   1 
ATOM 4058  C CA  . ASP A 1 632  ? 24.253  -13.449 67.022  1.00 17.36  ? 632  ASP A CA  1 
ATOM 4059  C C   . ASP A 1 632  ? 25.011  -12.495 66.106  1.00 22.13  ? 632  ASP A C   1 
ATOM 4060  O O   . ASP A 1 632  ? 25.506  -11.444 66.544  1.00 18.59  ? 632  ASP A O   1 
ATOM 4061  C CB  . ASP A 1 632  ? 24.954  -14.811 67.092  1.00 15.87  ? 632  ASP A CB  1 
ATOM 4062  H H   . ASP A 1 632  ? 22.643  -14.460 66.497  1.00 18.75  ? 632  ASP A H   1 
ATOM 4063  H HA  . ASP A 1 632  ? 24.244  -13.068 67.914  1.00 20.83  ? 632  ASP A HA  1 
ATOM 4064  N N   . TYR A 1 633  ? 25.105  -12.832 64.827  1.00 15.90  ? 633  TYR A N   1 
ATOM 4065  C CA  . TYR A 1 633  ? 25.791  -11.906 63.936  1.00 15.68  ? 633  TYR A CA  1 
ATOM 4066  C C   . TYR A 1 633  ? 25.167  -10.532 64.057  1.00 14.18  ? 633  TYR A C   1 
ATOM 4067  O O   . TYR A 1 633  ? 25.876  -9.509  64.030  1.00 11.17  ? 633  TYR A O   1 
ATOM 4068  C CB  . TYR A 1 633  ? 25.722  -12.395 62.494  1.00 36.22  ? 633  TYR A CB  1 
ATOM 4069  H H   . TYR A 1 633  ? 24.800  -13.550 64.465  1.00 19.08  ? 633  TYR A H   1 
ATOM 4070  H HA  . TYR A 1 633  ? 26.724  -11.843 64.194  1.00 18.82  ? 633  TYR A HA  1 
ATOM 4071  N N   . LEU A 1 634  ? 23.836  -10.510 64.247  1.00 12.92  ? 634  LEU A N   1 
ATOM 4072  C CA  . LEU A 1 634  ? 23.102  -9.260  64.379  1.00 21.91  ? 634  LEU A CA  1 
ATOM 4073  C C   . LEU A 1 634  ? 23.659  -8.396  65.507  1.00 27.89  ? 634  LEU A C   1 
ATOM 4074  O O   . LEU A 1 634  ? 23.859  -7.190  65.339  1.00 55.81  ? 634  LEU A O   1 
ATOM 4075  C CB  . LEU A 1 634  ? 21.616  -9.555  64.606  1.00 16.09  ? 634  LEU A CB  1 
ATOM 4076  H H   . LEU A 1 634  ? 23.343  -11.212 64.302  1.00 15.51  ? 634  LEU A H   1 
ATOM 4077  H HA  . LEU A 1 634  ? 23.183  -8.760  63.553  1.00 26.29  ? 634  LEU A HA  1 
ATOM 4078  N N   . SER A 1 635  ? 23.907  -8.982  66.668  1.00 21.94  ? 635  SER A N   1 
ATOM 4079  C CA  . SER A 1 635  ? 24.548  -8.210  67.723  1.00 24.21  ? 635  SER A CA  1 
ATOM 4080  C C   . SER A 1 635  ? 25.984  -7.819  67.347  1.00 17.24  ? 635  SER A C   1 
ATOM 4081  O O   . SER A 1 635  ? 26.428  -6.712  67.674  1.00 8.86   ? 635  SER A O   1 
ATOM 4082  C CB  . SER A 1 635  ? 24.522  -9.002  69.026  1.00 40.25  ? 635  SER A CB  1 
ATOM 4083  H H   . SER A 1 635  ? 23.722  -9.798  66.868  1.00 26.33  ? 635  SER A H   1 
ATOM 4084  H HA  . SER A 1 635  ? 24.044  -7.392  67.861  1.00 29.05  ? 635  SER A HA  1 
ATOM 4085  N N   . ASP A 1 636  ? 26.710  -8.694  66.645  1.00 16.65  ? 636  ASP A N   1 
ATOM 4086  C CA  . ASP A 1 636  ? 28.085  -8.372  66.296  1.00 8.81   ? 636  ASP A CA  1 
ATOM 4087  C C   . ASP A 1 636  ? 28.145  -7.026  65.608  1.00 8.81   ? 636  ASP A C   1 
ATOM 4088  O O   . ASP A 1 636  ? 28.891  -6.131  66.022  1.00 8.81   ? 636  ASP A O   1 
ATOM 4089  C CB  . ASP A 1 636  ? 28.658  -9.460  65.388  1.00 8.81   ? 636  ASP A CB  1 
ATOM 4090  H H   . ASP A 1 636  ? 26.434  -9.460  66.368  1.00 19.98  ? 636  ASP A H   1 
ATOM 4091  H HA  . ASP A 1 636  ? 28.622  -8.330  67.103  1.00 10.57  ? 636  ASP A HA  1 
ATOM 4092  N N   . LEU A 1 637  ? 27.289  -6.844  64.607  1.00 10.60  ? 637  LEU A N   1 
ATOM 4093  C CA  . LEU A 1 637  ? 27.369  -5.678  63.735  1.00 10.54  ? 637  LEU A CA  1 
ATOM 4094  C C   . LEU A 1 637  ? 27.365  -4.379  64.515  1.00 8.86   ? 637  LEU A C   1 
ATOM 4095  O O   . LEU A 1 637  ? 28.208  -3.508  64.284  1.00 8.86   ? 637  LEU A O   1 
ATOM 4096  C CB  . LEU A 1 637  ? 26.196  -5.690  62.776  1.00 16.57  ? 637  LEU A CB  1 
ATOM 4097  H H   . LEU A 1 637  ? 26.649  -7.384  64.411  1.00 12.72  ? 637  LEU A H   1 
ATOM 4098  H HA  . LEU A 1 637  ? 28.188  -5.721  63.217  1.00 12.65  ? 637  LEU A HA  1 
ATOM 4099  N N   . CYS A 1 638  ? 26.384  -4.197  65.393  1.00 8.91   ? 638  CYS A N   1 
ATOM 4100  C CA  . CYS A 1 638  ? 26.292  -2.964  66.153  1.00 8.91   ? 638  CYS A CA  1 
ATOM 4101  C C   . CYS A 1 638  ? 25.968  -1.752  65.273  1.00 8.91   ? 638  CYS A C   1 
ATOM 4102  O O   . CYS A 1 638  ? 24.848  -1.623  64.762  1.00 8.91   ? 638  CYS A O   1 
ATOM 4103  C CB  . CYS A 1 638  ? 27.613  -2.780  66.890  1.00 12.98  ? 638  CYS A CB  1 
ATOM 4104  H H   . CYS A 1 638  ? 25.765  -4.769  65.564  1.00 10.69  ? 638  CYS A H   1 
ATOM 4105  H HA  . CYS A 1 638  ? 25.588  -3.051  66.815  1.00 10.69  ? 638  CYS A HA  1 
ATOM 4106  N N   . VAL A 1 639  ? 26.930  -0.825  65.174  1.00 18.46  ? 639  VAL A N   1 
ATOM 4107  C CA  . VAL A 1 639  ? 27.031  0.211   64.142  1.00 29.91  ? 639  VAL A CA  1 
ATOM 4108  C C   . VAL A 1 639  ? 26.863  1.623   64.696  1.00 37.59  ? 639  VAL A C   1 
ATOM 4109  O O   . VAL A 1 639  ? 27.218  1.917   65.843  1.00 35.79  ? 639  VAL A O   1 
ATOM 4110  C CB  . VAL A 1 639  ? 26.011  -0.036  63.018  1.00 22.00  ? 639  VAL A CB  1 
ATOM 4111  H HA  . VAL A 1 639  ? 27.915  0.161   63.746  1.00 35.89  ? 639  VAL A HA  1 
ATOM 4112  N N   . SER A 1 640  ? 26.374  2.525   63.859  1.00 45.65  ? 640  SER A N   1 
ATOM 4113  C CA  . SER A 1 640  ? 26.071  3.863   64.334  1.00 51.76  ? 640  SER A CA  1 
ATOM 4114  C C   . SER A 1 640  ? 24.767  3.801   65.126  1.00 60.43  ? 640  SER A C   1 
ATOM 4115  O O   . SER A 1 640  ? 24.382  2.733   65.620  1.00 46.02  ? 640  SER A O   1 
ATOM 4116  C CB  . SER A 1 640  ? 25.999  4.836   63.154  1.00 61.54  ? 640  SER A CB  1 
ATOM 4117  H HA  . SER A 1 640  ? 26.776  4.159   64.931  1.00 62.11  ? 640  SER A HA  1 
ATOM 4118  N N   . MET A 1 641  ? 24.084  4.942   65.253  1.00 77.23  ? 641  MET A N   1 
ATOM 4119  C CA  . MET A 1 641  ? 22.812  5.017   65.972  1.00 76.94  ? 641  MET A CA  1 
ATOM 4120  C C   . MET A 1 641  ? 21.663  4.295   65.251  1.00 78.81  ? 641  MET A C   1 
ATOM 4121  O O   . MET A 1 641  ? 20.645  3.989   65.887  1.00 65.86  ? 641  MET A O   1 
ATOM 4122  C CB  . MET A 1 641  ? 22.455  6.494   66.195  1.00 72.92  ? 641  MET A CB  1 
ATOM 4123  H H   . MET A 1 641  ? 24.341  5.695   64.927  1.00 92.68  ? 641  MET A H   1 
ATOM 4124  H HA  . MET A 1 641  ? 22.929  4.610   66.845  1.00 92.32  ? 641  MET A HA  1 
ATOM 4125  N N   . ASN A 1 642  ? 21.809  4.002   63.950  1.00 91.45  ? 642  ASN A N   1 
ATOM 4126  C CA  . ASN A 1 642  ? 20.681  3.536   63.138  1.00 78.60  ? 642  ASN A CA  1 
ATOM 4127  C C   . ASN A 1 642  ? 20.214  2.149   63.560  1.00 48.76  ? 642  ASN A C   1 
ATOM 4128  O O   . ASN A 1 642  ? 19.004  1.881   63.610  1.00 36.50  ? 642  ASN A O   1 
ATOM 4129  C CB  . ASN A 1 642  ? 21.069  3.536   61.656  1.00 74.73  ? 642  ASN A CB  1 
ATOM 4130  H HA  . ASN A 1 642  ? 19.937  4.148   63.252  1.00 94.32  ? 642  ASN A HA  1 
ATOM 4131  N N   . LYS A 1 643  ? 21.156  1.249   63.837  1.00 37.44  ? 643  LYS A N   1 
ATOM 4132  C CA  . LYS A 1 643  ? 20.786  -0.000  64.475  1.00 27.00  ? 643  LYS A CA  1 
ATOM 4133  C C   . LYS A 1 643  ? 19.827  0.277   65.629  1.00 24.63  ? 643  LYS A C   1 
ATOM 4134  O O   . LYS A 1 643  ? 18.712  -0.249  65.662  1.00 20.70  ? 643  LYS A O   1 
ATOM 4135  C CB  . LYS A 1 643  ? 22.049  -0.727  64.950  1.00 21.77  ? 643  LYS A CB  1 
ATOM 4136  H HA  . LYS A 1 643  ? 20.333  -0.567  63.832  1.00 32.40  ? 643  LYS A HA  1 
ATOM 4137  N N   . SER A 1 644  ? 20.195  1.209   66.509  1.00 21.99  ? 644  SER A N   1 
ATOM 4138  C CA  . SER A 1 644  ? 19.555  1.307   67.811  1.00 14.08  ? 644  SER A CA  1 
ATOM 4139  C C   . SER A 1 644  ? 18.070  1.588   67.680  1.00 9.08   ? 644  SER A C   1 
ATOM 4140  O O   . SER A 1 644  ? 17.239  0.768   68.077  1.00 12.60  ? 644  SER A O   1 
ATOM 4141  C CB  . SER A 1 644  ? 20.239  2.396   68.639  1.00 16.53  ? 644  SER A CB  1 
ATOM 4142  H H   . SER A 1 644  ? 20.811  1.793   66.372  1.00 26.39  ? 644  SER A H   1 
ATOM 4143  H HA  . SER A 1 644  ? 19.660  0.464   68.279  1.00 16.90  ? 644  SER A HA  1 
ATOM 4144  N N   . ILE A 1 645  ? 17.720  2.745   67.133  1.00 8.68   ? 645  ILE A N   1 
ATOM 4145  C CA  . ILE A 1 645  ? 16.317  3.110   67.057  1.00 8.68   ? 645  ILE A CA  1 
ATOM 4146  C C   . ILE A 1 645  ? 15.526  1.931   66.540  1.00 14.63  ? 645  ILE A C   1 
ATOM 4147  O O   . ILE A 1 645  ? 14.582  1.496   67.215  1.00 25.17  ? 645  ILE A O   1 
ATOM 4148  C CB  . ILE A 1 645  ? 16.141  4.367   66.192  1.00 8.68   ? 645  ILE A CB  1 
ATOM 4149  H H   . ILE A 1 645  ? 18.264  3.324   66.805  1.00 10.42  ? 645  ILE A H   1 
ATOM 4150  H HA  . ILE A 1 645  ? 15.997  3.315   67.950  1.00 10.42  ? 645  ILE A HA  1 
ATOM 4151  N N   . PRO A 1 646  ? 15.865  1.348   65.398  1.00 19.54  ? 646  PRO A N   1 
ATOM 4152  C CA  . PRO A 1 646  ? 15.101  0.189   64.929  1.00 41.52  ? 646  PRO A CA  1 
ATOM 4153  C C   . PRO A 1 646  ? 15.449  -1.082  65.680  1.00 31.35  ? 646  PRO A C   1 
ATOM 4154  O O   . PRO A 1 646  ? 14.542  -1.798  66.134  1.00 30.74  ? 646  PRO A O   1 
ATOM 4155  C CB  . PRO A 1 646  ? 15.484  0.116   63.444  1.00 54.44  ? 646  PRO A CB  1 
ATOM 4156  H HA  . PRO A 1 646  ? 14.149  0.358   65.008  1.00 49.83  ? 646  PRO A HA  1 
ATOM 4157  N N   . VAL A 1 647  ? 16.735  -1.368  65.849  1.00 26.50  ? 647  VAL A N   1 
ATOM 4158  C CA  . VAL A 1 647  ? 17.107  -2.620  66.486  1.00 27.02  ? 647  VAL A CA  1 
ATOM 4159  C C   . VAL A 1 647  ? 16.500  -2.668  67.874  1.00 24.44  ? 647  VAL A C   1 
ATOM 4160  O O   . VAL A 1 647  ? 16.026  -3.717  68.319  1.00 28.77  ? 647  VAL A O   1 
ATOM 4161  C CB  . VAL A 1 647  ? 18.641  -2.783  66.520  1.00 32.66  ? 647  VAL A CB  1 
ATOM 4162  H H   . VAL A 1 647  ? 17.393  -0.868  65.611  1.00 31.80  ? 647  VAL A H   1 
ATOM 4163  H HA  . VAL A 1 647  ? 16.740  -3.356  65.973  1.00 32.43  ? 647  VAL A HA  1 
ATOM 4164  N N   . THR A 1 648  ? 16.441  -1.519  68.549  1.00 18.02  ? 648  THR A N   1 
ATOM 4165  C CA  . THR A 1 648  ? 16.039  -1.511  69.940  1.00 20.50  ? 648  THR A CA  1 
ATOM 4166  C C   . THR A 1 648  ? 14.760  -2.300  70.137  1.00 22.13  ? 648  THR A C   1 
ATOM 4167  O O   . THR A 1 648  ? 14.646  -3.074  71.093  1.00 28.11  ? 648  THR A O   1 
ATOM 4168  C CB  . THR A 1 648  ? 15.863  -0.074  70.405  1.00 21.56  ? 648  THR A CB  1 
ATOM 4169  H H   . THR A 1 648  ? 16.627  -0.745  68.223  1.00 21.62  ? 648  THR A H   1 
ATOM 4170  H HA  . THR A 1 648  ? 16.735  -1.922  70.477  1.00 24.60  ? 648  THR A HA  1 
ATOM 4171  N N   . GLN A 1 649  ? 13.809  -2.151  69.218  1.00 21.09  ? 649  GLN A N   1 
ATOM 4172  C CA  . GLN A 1 649  ? 12.526  -2.810  69.371  1.00 33.95  ? 649  GLN A CA  1 
ATOM 4173  C C   . GLN A 1 649  ? 12.719  -4.283  69.722  1.00 34.91  ? 649  GLN A C   1 
ATOM 4174  O O   . GLN A 1 649  ? 12.204  -4.768  70.741  1.00 59.38  ? 649  GLN A O   1 
ATOM 4175  C CB  . GLN A 1 649  ? 11.719  -2.639  68.082  1.00 38.39  ? 649  GLN A CB  1 
ATOM 4176  H H   . GLN A 1 649  ? 13.885  -1.677  68.504  1.00 25.30  ? 649  GLN A H   1 
ATOM 4177  H HA  . GLN A 1 649  ? 12.035  -2.389  70.094  1.00 40.75  ? 649  GLN A HA  1 
ATOM 4178  N N   . GLU A 1 650  ? 13.533  -4.979  68.941  1.00 22.70  ? 650  GLU A N   1 
ATOM 4179  C CA  . GLU A 1 650  ? 13.673  -6.415  69.108  1.00 25.20  ? 650  GLU A CA  1 
ATOM 4180  C C   . GLU A 1 650  ? 13.827  -6.803  70.575  1.00 39.62  ? 650  GLU A C   1 
ATOM 4181  O O   . GLU A 1 650  ? 13.236  -7.791  71.030  1.00 47.48  ? 650  GLU A O   1 
ATOM 4182  C CB  . GLU A 1 650  ? 14.871  -6.888  68.299  1.00 36.66  ? 650  GLU A CB  1 
ATOM 4183  H H   . GLU A 1 650  ? 14.014  -4.644  68.311  1.00 27.24  ? 650  GLU A H   1 
ATOM 4184  H HA  . GLU A 1 650  ? 12.880  -6.854  68.760  1.00 30.25  ? 650  GLU A HA  1 
ATOM 4185  N N   . LEU A 1 651  ? 14.574  -6.007  71.345  1.00 41.49  ? 651  LEU A N   1 
ATOM 4186  C CA  . LEU A 1 651  ? 14.937  -6.397  72.708  1.00 60.30  ? 651  LEU A CA  1 
ATOM 4187  C C   . LEU A 1 651  ? 13.709  -6.648  73.589  1.00 65.61  ? 651  LEU A C   1 
ATOM 4188  O O   . LEU A 1 651  ? 13.650  -7.665  74.297  1.00 64.46  ? 651  LEU A O   1 
ATOM 4189  C CB  . LEU A 1 651  ? 15.841  -5.327  73.330  1.00 70.14  ? 651  LEU A CB  1 
ATOM 4190  H H   . LEU A 1 651  ? 14.881  -5.241  71.102  1.00 49.79  ? 651  LEU A H   1 
ATOM 4191  H HA  . LEU A 1 651  ? 15.444  -7.223  72.669  1.00 72.36  ? 651  LEU A HA  1 
ATOM 4192  N N   . ILE A 1 652  ? 12.734  -5.723  73.599  1.00 60.90  ? 652  ILE A N   1 
ATOM 4193  C CA  . ILE A 1 652  ? 11.565  -5.947  74.453  1.00 43.02  ? 652  ILE A CA  1 
ATOM 4194  C C   . ILE A 1 652  ? 10.895  -7.249  74.044  1.00 41.91  ? 652  ILE A C   1 
ATOM 4195  O O   . ILE A 1 652  ? 10.532  -8.077  74.892  1.00 38.46  ? 652  ILE A O   1 
ATOM 4196  C CB  . ILE A 1 652  ? 10.593  -4.752  74.400  1.00 29.26  ? 652  ILE A CB  1 
ATOM 4197  H H   . ILE A 1 652  ? 12.726  -4.994  73.143  1.00 73.08  ? 652  ILE A H   1 
ATOM 4198  H HA  . ILE A 1 652  ? 11.864  -6.044  75.371  1.00 51.62  ? 652  ILE A HA  1 
ATOM 4199  N N   . CYS A 1 653  ? 10.803  -7.484  72.728  1.00 59.51  ? 653  CYS A N   1 
ATOM 4200  C CA  . CYS A 1 653  ? 10.337  -8.763  72.218  1.00 65.78  ? 653  CYS A CA  1 
ATOM 4201  C C   . CYS A 1 653  ? 11.160  -9.904  72.819  1.00 60.89  ? 653  CYS A C   1 
ATOM 4202  O O   . CYS A 1 653  ? 10.601  -10.866 73.360  1.00 67.93  ? 653  CYS A O   1 
ATOM 4203  C CB  . CYS A 1 653  ? 10.409  -8.763  70.684  1.00 63.53  ? 653  CYS A CB  1 
ATOM 4204  H H   . CYS A 1 653  ? 11.006  -6.914  72.117  1.00 71.41  ? 653  CYS A H   1 
ATOM 4205  H HA  . CYS A 1 653  ? 9.411   -8.890  72.477  1.00 78.93  ? 653  CYS A HA  1 
ATOM 4206  N N   . LYS A 1 654  ? 12.496  -9.786  72.773  1.00 57.36  ? 654  LYS A N   1 
ATOM 4207  C CA  . LYS A 1 654  ? 13.358  -10.839 73.298  1.00 41.40  ? 654  LYS A CA  1 
ATOM 4208  C C   . LYS A 1 654  ? 12.878  -11.294 74.662  1.00 36.45  ? 654  LYS A C   1 
ATOM 4209  O O   . LYS A 1 654  ? 12.854  -12.494 74.953  1.00 50.53  ? 654  LYS A O   1 
ATOM 4210  C CB  . LYS A 1 654  ? 14.807  -10.357 73.381  1.00 32.13  ? 654  LYS A CB  1 
ATOM 4211  H H   . LYS A 1 654  ? 12.917  -9.112  72.445  1.00 68.84  ? 654  LYS A H   1 
ATOM 4212  H HA  . LYS A 1 654  ? 13.329  -11.601 72.699  1.00 49.68  ? 654  LYS A HA  1 
ATOM 4213  N N   . ALA A 1 655  ? 12.387  -10.366 75.472  1.00 33.12  ? 655  ALA A N   1 
ATOM 4214  C CA  . ALA A 1 655  ? 12.008  -10.735 76.825  1.00 32.59  ? 655  ALA A CA  1 
ATOM 4215  C C   . ALA A 1 655  ? 10.933  -11.826 76.829  1.00 37.77  ? 655  ALA A C   1 
ATOM 4216  O O   . ALA A 1 655  ? 11.059  -12.823 77.549  1.00 47.99  ? 655  ALA A O   1 
ATOM 4217  C CB  . ALA A 1 655  ? 11.545  -9.502  77.576  1.00 38.45  ? 655  ALA A CB  1 
ATOM 4218  H HA  . ALA A 1 655  ? 12.787  -11.086 77.284  1.00 39.11  ? 655  ALA A HA  1 
ATOM 4219  H HB1 . ALA A 1 655  ? 11.294  -9.757  78.477  1.00 46.14  ? 655  ALA A HB1 1 
ATOM 4220  H HB2 . ALA A 1 655  ? 12.270  -8.859  77.603  1.00 46.14  ? 655  ALA A HB2 1 
ATOM 4221  H HB3 . ALA A 1 655  ? 10.781  -9.120  77.115  1.00 46.14  ? 655  ALA A HB3 1 
ATOM 4222  N N   . VAL A 1 656  ? 9.867   -11.665 76.038  1.00 36.27  ? 656  VAL A N   1 
ATOM 4223  C CA  . VAL A 1 656  ? 8.869   -12.729 75.943  1.00 27.81  ? 656  VAL A CA  1 
ATOM 4224  C C   . VAL A 1 656  ? 9.351   -13.887 75.052  1.00 37.54  ? 656  VAL A C   1 
ATOM 4225  O O   . VAL A 1 656  ? 8.983   -15.045 75.297  1.00 32.37  ? 656  VAL A O   1 
ATOM 4226  C CB  . VAL A 1 656  ? 7.522   -12.168 75.444  1.00 17.22  ? 656  VAL A CB  1 
ATOM 4227  H H   . VAL A 1 656  ? 9.703   -10.969 75.560  1.00 43.52  ? 656  VAL A H   1 
ATOM 4228  H HA  . VAL A 1 656  ? 8.722   -13.089 76.832  1.00 33.38  ? 656  VAL A HA  1 
ATOM 4229  N N   . LEU A 1 657  ? 10.173  -13.617 74.016  1.00 40.36  ? 657  LEU A N   1 
ATOM 4230  C CA  . LEU A 1 657  ? 10.550  -14.653 73.049  1.00 44.61  ? 657  LEU A CA  1 
ATOM 4231  C C   . LEU A 1 657  ? 11.821  -15.397 73.456  1.00 41.59  ? 657  LEU A C   1 
ATOM 4232  O O   . LEU A 1 657  ? 11.915  -16.613 73.231  1.00 32.36  ? 657  LEU A O   1 
ATOM 4233  C CB  . LEU A 1 657  ? 10.727  -14.047 71.647  1.00 32.16  ? 657  LEU A CB  1 
ATOM 4234  H H   . LEU A 1 657  ? 10.519  -12.846 73.859  1.00 48.43  ? 657  LEU A H   1 
ATOM 4235  H HA  . LEU A 1 657  ? 9.832   -15.304 72.999  1.00 53.54  ? 657  LEU A HA  1 
ATOM 4236  N N   . ASN A 1 658  ? 12.805  -14.677 74.023  1.00 48.82  ? 658  ASN A N   1 
ATOM 4237  C CA  . ASN A 1 658  ? 13.982  -15.319 74.608  1.00 37.42  ? 658  ASN A CA  1 
ATOM 4238  C C   . ASN A 1 658  ? 13.569  -16.342 75.653  1.00 29.21  ? 658  ASN A C   1 
ATOM 4239  O O   . ASN A 1 658  ? 14.086  -17.472 75.621  1.00 28.40  ? 658  ASN A O   1 
ATOM 4240  C CB  . ASN A 1 658  ? 14.930  -14.257 75.185  1.00 29.11  ? 658  ASN A CB  1 
ATOM 4241  H H   . ASN A 1 658  ? 12.809  -13.819 74.078  1.00 58.59  ? 658  ASN A H   1 
ATOM 4242  H HA  . ASN A 1 658  ? 14.460  -15.791 73.907  1.00 44.90  ? 658  ASN A HA  1 
ATOM 4243  N N   . PRO A 1 659  ? 12.636  -16.050 76.555  1.00 28.30  ? 659  PRO A N   1 
ATOM 4244  C CA  . PRO A 1 659  ? 12.142  -17.098 77.453  1.00 24.53  ? 659  PRO A CA  1 
ATOM 4245  C C   . PRO A 1 659  ? 13.292  -17.865 78.080  1.00 26.36  ? 659  PRO A C   1 
ATOM 4246  O O   . PRO A 1 659  ? 13.347  -19.095 78.001  1.00 27.23  ? 659  PRO A O   1 
ATOM 4247  C CB  . PRO A 1 659  ? 11.294  -17.978 76.526  1.00 22.66  ? 659  PRO A CB  1 
ATOM 4248  H HA  . PRO A 1 659  ? 11.581  -16.719 78.148  1.00 29.43  ? 659  PRO A HA  1 
ATOM 4249  N N   . THR A 1 660  ? 14.240  -17.133 78.665  1.00 22.07  ? 660  THR A N   1 
ATOM 4250  C CA  . THR A 1 660  ? 15.452  -17.723 79.230  1.00 24.78  ? 660  THR A CA  1 
ATOM 4251  C C   . THR A 1 660  ? 15.164  -18.135 80.668  1.00 38.05  ? 660  THR A C   1 
ATOM 4252  O O   . THR A 1 660  ? 15.302  -17.331 81.593  1.00 26.23  ? 660  THR A O   1 
ATOM 4253  C CB  . THR A 1 660  ? 16.606  -16.729 79.163  1.00 18.55  ? 660  THR A CB  1 
ATOM 4254  H HA  . THR A 1 660  ? 15.695  -18.514 78.724  1.00 29.73  ? 660  THR A HA  1 
ATOM 4255  N N   . ASN A 1 661  ? 14.790  -19.422 80.855  1.00 68.62  ? 661  ASN A N   1 
ATOM 4256  C CA  . ASN A 1 661  ? 14.221  -19.941 82.109  1.00 90.57  ? 661  ASN A CA  1 
ATOM 4257  C C   . ASN A 1 661  ? 14.901  -21.207 82.669  1.00 85.24  ? 661  ASN A C   1 
ATOM 4258  O O   . ASN A 1 661  ? 14.352  -21.817 83.602  1.00 86.51  ? 661  ASN A O   1 
ATOM 4259  C CB  . ASN A 1 661  ? 12.728  -20.246 81.924  1.00 99.30  ? 661  ASN A CB  1 
ATOM 4260  H HA  . ASN A 1 661  ? 14.295  -19.250 82.786  1.00 108.69 ? 661  ASN A HA  1 
ATOM 4261  N N   . ALA A 1 662  ? 16.069  -21.618 82.145  1.00 70.72  ? 662  ALA A N   1 
ATOM 4262  C CA  . ALA A 1 662  ? 16.734  -22.855 82.561  1.00 46.24  ? 662  ALA A CA  1 
ATOM 4263  C C   . ALA A 1 662  ? 18.021  -22.541 83.317  1.00 21.63  ? 662  ALA A C   1 
ATOM 4264  O O   . ALA A 1 662  ? 19.034  -22.183 82.709  1.00 11.12  ? 662  ALA A O   1 
ATOM 4265  C CB  . ALA A 1 662  ? 17.034  -23.757 81.363  1.00 29.36  ? 662  ALA A CB  1 
ATOM 4266  H HA  . ALA A 1 662  ? 16.146  -23.342 83.161  1.00 55.49  ? 662  ALA A HA  1 
ATOM 4267  H HB1 . ALA A 1 662  ? 17.473  -24.563 81.678  1.00 35.24  ? 662  ALA A HB1 1 
ATOM 4268  H HB2 . ALA A 1 662  ? 16.201  -23.984 80.922  1.00 35.24  ? 662  ALA A HB2 1 
ATOM 4269  H HB3 . ALA A 1 662  ? 17.615  -23.282 80.749  1.00 35.24  ? 662  ALA A HB3 1 
ATOM 4270  N N   . ASP A 1 663  ? 17.972  -22.674 84.645  1.00 24.13  ? 663  ASP A N   1 
ATOM 4271  C CA  . ASP A 1 663  ? 19.169  -22.636 85.456  1.00 17.80  ? 663  ASP A CA  1 
ATOM 4272  C C   . ASP A 1 663  ? 19.846  -21.269 85.403  1.00 16.93  ? 663  ASP A C   1 
ATOM 4273  O O   . ASP A 1 663  ? 20.793  -21.106 84.632  1.00 19.50  ? 663  ASP A O   1 
ATOM 4274  C CB  . ASP A 1 663  ? 20.137  -23.721 84.975  1.00 8.91   ? 663  ASP A CB  1 
ATOM 4275  H H   . ASP A 1 663  ? 17.247  -22.787 85.094  1.00 28.95  ? 663  ASP A H   1 
ATOM 4276  H HA  . ASP A 1 663  ? 18.935  -22.824 86.378  1.00 21.36  ? 663  ASP A HA  1 
ATOM 4277  N N   . ILE A 1 664  ? 19.419  -20.295 86.223  1.00 21.05  ? 664  ILE A N   1 
ATOM 4278  C CA  . ILE A 1 664  ? 20.091  -18.992 86.328  1.00 22.70  ? 664  ILE A CA  1 
ATOM 4279  C C   . ILE A 1 664  ? 19.705  -18.272 87.625  1.00 26.20  ? 664  ILE A C   1 
ATOM 4280  O O   . ILE A 1 664  ? 18.777  -17.456 87.639  1.00 22.17  ? 664  ILE A O   1 
ATOM 4281  C CB  . ILE A 1 664  ? 19.775  -18.089 85.123  1.00 29.53  ? 664  ILE A CB  1 
ATOM 4282  H HA  . ILE A 1 664  ? 21.050  -19.137 86.345  1.00 27.24  ? 664  ILE A HA  1 
ATOM 4283  N N   . LEU A 1 665  ? 20.403  -18.557 88.721  1.00 26.44  ? 665  LEU A N   1 
ATOM 4284  C CA  . LEU A 1 665  ? 20.185  -17.825 89.964  1.00 25.93  ? 665  LEU A CA  1 
ATOM 4285  C C   . LEU A 1 665  ? 21.115  -18.373 91.040  1.00 29.32  ? 665  LEU A C   1 
ATOM 4286  O O   . LEU A 1 665  ? 21.722  -19.439 90.875  1.00 42.99  ? 665  LEU A O   1 
ATOM 4287  C CB  . LEU A 1 665  ? 18.736  -17.906 90.448  1.00 30.82  ? 665  LEU A CB  1 
ATOM 4288  H H   . LEU A 1 665  ? 21.006  -19.168 88.770  1.00 31.73  ? 665  LEU A H   1 
ATOM 4289  H HA  . LEU A 1 665  ? 20.403  -16.890 89.824  1.00 31.12  ? 665  LEU A HA  1 
ATOM 4290  N N   . ILE A 1 666  ? 21.196  -17.638 92.156  1.00 29.90  ? 666  ILE A N   1 
ATOM 4291  C CA  . ILE A 1 666  ? 22.193  -17.931 93.195  1.00 30.18  ? 666  ILE A CA  1 
ATOM 4292  C C   . ILE A 1 666  ? 22.131  -17.164 94.544  1.00 27.20  ? 666  ILE A C   1 
ATOM 4293  O O   . ILE A 1 666  ? 21.968  -17.803 95.584  1.00 37.28  ? 666  ILE A O   1 
ATOM 4294  C CB  . ILE A 1 666  ? 23.581  -17.736 92.612  1.00 30.25  ? 666  ILE A CB  1 
ATOM 4295  H HA  . ILE A 1 666  ? 22.113  -18.872 93.413  1.00 36.22  ? 666  ILE A HA  1 
ATOM 4296  N N   . GLU A 1 667  ? 22.315  -15.839 94.577  1.00 14.38  ? 667  GLU A N   1 
ATOM 4297  C CA  . GLU A 1 667  ? 22.487  -14.983 93.411  1.00 10.15  ? 667  GLU A CA  1 
ATOM 4298  C C   . GLU A 1 667  ? 23.921  -14.990 92.897  1.00 9.50   ? 667  GLU A C   1 
ATOM 4299  O O   . GLU A 1 667  ? 24.178  -15.141 91.706  1.00 9.33   ? 667  GLU A O   1 
ATOM 4300  C CB  . GLU A 1 667  ? 22.073  -13.553 93.764  1.00 9.06   ? 667  GLU A CB  1 
ATOM 4301  H HA  . GLU A 1 667  ? 21.910  -15.297 92.698  1.00 12.18  ? 667  GLU A HA  1 
ATOM 4302  N N   . THR A 1 668  ? 24.868  -14.890 93.810  1.00 11.49  ? 668  THR A N   1 
ATOM 4303  C CA  . THR A 1 668  ? 26.265  -14.837 93.403  1.00 16.54  ? 668  THR A CA  1 
ATOM 4304  C C   . THR A 1 668  ? 26.977  -16.188 93.445  1.00 21.67  ? 668  THR A C   1 
ATOM 4305  O O   . THR A 1 668  ? 27.810  -16.466 92.579  1.00 23.63  ? 668  THR A O   1 
ATOM 4306  C CB  . THR A 1 668  ? 27.014  -13.852 94.295  1.00 20.48  ? 668  THR A CB  1 
ATOM 4307  H H   . THR A 1 668  ? 24.736  -14.853 94.659  1.00 13.79  ? 668  THR A H   1 
ATOM 4308  H HA  . THR A 1 668  ? 26.312  -14.506 92.492  1.00 19.85  ? 668  THR A HA  1 
ATOM 4309  N N   . LYS A 1 669  ? 26.696  -17.018 94.450  1.00 23.03  ? 669  LYS A N   1 
ATOM 4310  C CA  . LYS A 1 669  ? 27.494  -18.225 94.666  1.00 28.48  ? 669  LYS A CA  1 
ATOM 4311  C C   . LYS A 1 669  ? 27.325  -19.247 93.530  1.00 37.25  ? 669  LYS A C   1 
ATOM 4312  O O   . LYS A 1 669  ? 28.296  -19.912 93.136  1.00 34.30  ? 669  LYS A O   1 
ATOM 4313  C CB  . LYS A 1 669  ? 27.115  -18.850 96.007  1.00 29.83  ? 669  LYS A CB  1 
ATOM 4314  H H   . LYS A 1 669  ? 26.057  -16.908 95.014  1.00 27.64  ? 669  LYS A H   1 
ATOM 4315  H HA  . LYS A 1 669  ? 28.431  -17.978 94.706  1.00 34.17  ? 669  LYS A HA  1 
ATOM 4316  N N   . LEU A 1 670  ? 26.093  -19.413 93.026  1.00 48.42  ? 670  LEU A N   1 
ATOM 4317  C CA  . LEU A 1 670  ? 25.819  -20.409 91.982  1.00 48.98  ? 670  LEU A CA  1 
ATOM 4318  C C   . LEU A 1 670  ? 26.384  -19.992 90.640  1.00 41.69  ? 670  LEU A C   1 
ATOM 4319  O O   . LEU A 1 670  ? 26.545  -20.834 89.740  1.00 25.73  ? 670  LEU A O   1 
ATOM 4320  C CB  . LEU A 1 670  ? 24.314  -20.641 91.821  1.00 48.20  ? 670  LEU A CB  1 
ATOM 4321  H H   . LEU A 1 670  ? 25.403  -18.962 93.271  1.00 58.10  ? 670  LEU A H   1 
ATOM 4322  H HA  . LEU A 1 670  ? 26.228  -21.252 92.233  1.00 58.77  ? 670  LEU A HA  1 
ATOM 4323  N N   . VAL A 1 671  ? 26.597  -18.686 90.467  1.00 50.68  ? 671  VAL A N   1 
ATOM 4324  C CA  . VAL A 1 671  ? 27.448  -18.208 89.396  1.00 68.58  ? 671  VAL A CA  1 
ATOM 4325  C C   . VAL A 1 671  ? 28.816  -18.882 89.490  1.00 88.40  ? 671  VAL A C   1 
ATOM 4326  O O   . VAL A 1 671  ? 29.306  -19.459 88.510  1.00 112.55 ? 671  VAL A O   1 
ATOM 4327  C CB  . VAL A 1 671  ? 27.554  -16.669 89.451  1.00 47.30  ? 671  VAL A CB  1 
ATOM 4328  H H   . VAL A 1 671  ? 26.260  -18.065 90.958  1.00 60.82  ? 671  VAL A H   1 
ATOM 4329  H HA  . VAL A 1 671  ? 27.051  -18.452 88.545  1.00 82.30  ? 671  VAL A HA  1 
ATOM 4330  N N   . LEU A 1 672  ? 29.434  -18.857 90.682  1.00 80.47  ? 672  LEU A N   1 
ATOM 4331  C CA  . LEU A 1 672  ? 30.743  -19.492 90.874  1.00 84.34  ? 672  LEU A CA  1 
ATOM 4332  C C   . LEU A 1 672  ? 30.690  -21.004 90.604  1.00 68.99  ? 672  LEU A C   1 
ATOM 4333  O O   . LEU A 1 672  ? 31.521  -21.552 89.852  1.00 67.69  ? 672  LEU A O   1 
ATOM 4334  C CB  . LEU A 1 672  ? 31.243  -19.198 92.295  1.00 76.35  ? 672  LEU A CB  1 
ATOM 4335  H H   . LEU A 1 672  ? 29.117  -18.482 91.388  1.00 96.57  ? 672  LEU A H   1 
ATOM 4336  H HA  . LEU A 1 672  ? 31.374  -19.101 90.250  1.00 101.20 ? 672  LEU A HA  1 
ATOM 4337  N N   . SER A 1 673  ? 29.726  -21.702 91.206  1.00 44.14  ? 673  SER A N   1 
ATOM 4338  C CA  . SER A 1 673  ? 29.563  -23.104 90.868  1.00 33.07  ? 673  SER A CA  1 
ATOM 4339  C C   . SER A 1 673  ? 29.540  -23.277 89.350  1.00 36.36  ? 673  SER A C   1 
ATOM 4340  O O   . SER A 1 673  ? 30.263  -24.120 88.798  1.00 40.42  ? 673  SER A O   1 
ATOM 4341  C CB  . SER A 1 673  ? 28.282  -23.634 91.503  1.00 35.34  ? 673  SER A CB  1 
ATOM 4342  H H   . SER A 1 673  ? 29.175  -21.396 91.792  1.00 52.97  ? 673  SER A H   1 
ATOM 4343  H HA  . SER A 1 673  ? 30.312  -23.610 91.222  1.00 39.68  ? 673  SER A HA  1 
ATOM 4344  N N   . ARG A 1 674  ? 28.771  -22.421 88.653  1.00 41.17  ? 674  ARG A N   1 
ATOM 4345  C CA  . ARG A 1 674  ? 28.591  -22.539 87.204  1.00 36.71  ? 674  ARG A CA  1 
ATOM 4346  C C   . ARG A 1 674  ? 29.896  -22.312 86.418  1.00 33.78  ? 674  ARG A C   1 
ATOM 4347  O O   . ARG A 1 674  ? 30.133  -22.979 85.395  1.00 28.51  ? 674  ARG A O   1 
ATOM 4348  C CB  . ARG A 1 674  ? 27.502  -21.560 86.752  1.00 34.69  ? 674  ARG A CB  1 
ATOM 4349  H H   . ARG A 1 674  ? 28.343  -21.763 89.004  1.00 49.40  ? 674  ARG A H   1 
ATOM 4350  H HA  . ARG A 1 674  ? 28.281  -23.436 87.003  1.00 44.06  ? 674  ARG A HA  1 
ATOM 4351  N N   . PHE A 1 675  ? 30.753  -21.377 86.859  1.00 34.70  ? 675  PHE A N   1 
ATOM 4352  C CA  . PHE A 1 675  ? 32.059  -21.234 86.226  1.00 26.94  ? 675  PHE A CA  1 
ATOM 4353  C C   . PHE A 1 675  ? 32.880  -22.497 86.415  1.00 30.57  ? 675  PHE A C   1 
ATOM 4354  O O   . PHE A 1 675  ? 33.674  -22.858 85.532  1.00 37.94  ? 675  PHE A O   1 
ATOM 4355  C CB  . PHE A 1 675  ? 32.823  -20.029 86.789  1.00 17.47  ? 675  PHE A CB  1 
ATOM 4356  H H   . PHE A 1 675  ? 30.601  -20.830 87.506  1.00 41.64  ? 675  PHE A H   1 
ATOM 4357  H HA  . PHE A 1 675  ? 31.936  -21.094 85.274  1.00 32.33  ? 675  PHE A HA  1 
ATOM 4358  N N   . GLU A 1 676  ? 32.678  -23.196 87.543  1.00 34.01  ? 676  GLU A N   1 
ATOM 4359  C CA  . GLU A 1 676  ? 33.387  -24.450 87.783  1.00 44.43  ? 676  GLU A CA  1 
ATOM 4360  C C   . GLU A 1 676  ? 32.952  -25.556 86.816  1.00 49.84  ? 676  GLU A C   1 
ATOM 4361  O O   . GLU A 1 676  ? 33.802  -26.218 86.201  1.00 57.50  ? 676  GLU A O   1 
ATOM 4362  C CB  . GLU A 1 676  ? 33.184  -24.884 89.240  1.00 32.23  ? 676  GLU A CB  1 
ATOM 4363  H H   . GLU A 1 676  ? 32.141  -22.965 88.174  1.00 40.81  ? 676  GLU A H   1 
ATOM 4364  H HA  . GLU A 1 676  ? 34.336  -24.300 87.650  1.00 53.31  ? 676  GLU A HA  1 
ATOM 4365  N N   . PHE A 1 677  ? 31.645  -25.799 86.678  1.00 44.92  ? 677  PHE A N   1 
ATOM 4366  C CA  . PHE A 1 677  ? 31.205  -26.876 85.784  1.00 35.01  ? 677  PHE A CA  1 
ATOM 4367  C C   . PHE A 1 677  ? 31.560  -26.578 84.330  1.00 34.23  ? 677  PHE A C   1 
ATOM 4368  O O   . PHE A 1 677  ? 31.987  -27.482 83.594  1.00 23.03  ? 677  PHE A O   1 
ATOM 4369  C CB  . PHE A 1 677  ? 29.703  -27.098 85.927  1.00 35.17  ? 677  PHE A CB  1 
ATOM 4370  H H   . PHE A 1 677  ? 31.014  -25.372 87.076  1.00 53.91  ? 677  PHE A H   1 
ATOM 4371  H HA  . PHE A 1 677  ? 31.653  -27.697 86.038  1.00 42.02  ? 677  PHE A HA  1 
ATOM 4372  N N   . GLU A 1 678  ? 31.380  -25.322 83.893  1.00 47.85  ? 678  GLU A N   1 
ATOM 4373  C CA  . GLU A 1 678  ? 31.740  -24.939 82.528  1.00 49.97  ? 678  GLU A CA  1 
ATOM 4374  C C   . GLU A 1 678  ? 33.250  -25.001 82.266  1.00 47.67  ? 678  GLU A C   1 
ATOM 4375  O O   . GLU A 1 678  ? 33.658  -25.153 81.105  1.00 40.64  ? 678  GLU A O   1 
ATOM 4376  C CB  . GLU A 1 678  ? 31.200  -23.534 82.244  1.00 43.82  ? 678  GLU A CB  1 
ATOM 4377  H H   . GLU A 1 678  ? 31.054  -24.682 84.366  1.00 57.42  ? 678  GLU A H   1 
ATOM 4378  H HA  . GLU A 1 678  ? 31.309  -25.551 81.911  1.00 59.96  ? 678  GLU A HA  1 
ATOM 4379  N N   . GLY A 1 679  ? 34.087  -24.921 83.309  1.00 52.92  ? 679  GLY A N   1 
ATOM 4380  C CA  . GLY A 1 679  ? 35.530  -24.824 83.100  1.00 44.30  ? 679  GLY A CA  1 
ATOM 4381  C C   . GLY A 1 679  ? 36.149  -25.935 82.259  1.00 32.17  ? 679  GLY A C   1 
ATOM 4382  O O   . GLY A 1 679  ? 37.274  -25.768 81.773  1.00 26.60  ? 679  GLY A O   1 
ATOM 4383  H H   . GLY A 1 679  ? 33.846  -24.920 84.134  1.00 63.51  ? 679  GLY A H   1 
ATOM 4384  H HA2 . GLY A 1 679  ? 35.727  -23.979 82.665  1.00 53.16  ? 679  GLY A HA2 1 
ATOM 4385  H HA3 . GLY A 1 679  ? 35.972  -24.825 83.963  1.00 53.16  ? 679  GLY A HA3 1 
ATOM 4386  N N   . VAL A 1 680  ? 35.438  -27.054 82.067  1.00 29.81  ? 680  VAL A N   1 
ATOM 4387  C CA  . VAL A 1 680  ? 36.035  -28.254 81.490  1.00 25.00  ? 680  VAL A CA  1 
ATOM 4388  C C   . VAL A 1 680  ? 36.387  -28.044 80.020  1.00 19.81  ? 680  VAL A C   1 
ATOM 4389  O O   . VAL A 1 680  ? 35.587  -27.510 79.235  1.00 19.93  ? 680  VAL A O   1 
ATOM 4390  C CB  . VAL A 1 680  ? 35.087  -29.452 81.673  1.00 19.93  ? 680  VAL A CB  1 
ATOM 4391  H H   . VAL A 1 680  ? 34.606  -27.139 82.265  1.00 35.77  ? 680  VAL A H   1 
ATOM 4392  H HA  . VAL A 1 680  ? 36.857  -28.452 81.965  1.00 30.00  ? 680  VAL A HA  1 
ATOM 4393  N N   . SER A 1 681  ? 37.582  -28.515 79.635  1.00 14.94  ? 681  SER A N   1 
ATOM 4394  C CA  . SER A 1 681  ? 38.177  -28.228 78.334  1.00 11.77  ? 681  SER A CA  1 
ATOM 4395  C C   . SER A 1 681  ? 37.809  -29.251 77.272  1.00 8.88   ? 681  SER A C   1 
ATOM 4396  O O   . SER A 1 681  ? 37.756  -28.912 76.086  1.00 8.88   ? 681  SER A O   1 
ATOM 4397  C CB  . SER A 1 681  ? 39.703  -28.175 78.461  1.00 8.88   ? 681  SER A CB  1 
ATOM 4398  H HA  . SER A 1 681  ? 37.871  -27.359 78.032  1.00 14.12  ? 681  SER A HA  1 
ATOM 4399  N N   . THR A 1 682  ? 37.567  -30.497 77.668  1.00 10.79  ? 682  THR A N   1 
ATOM 4400  C CA  . THR A 1 682  ? 37.465  -31.580 76.697  1.00 12.18  ? 682  THR A CA  1 
ATOM 4401  C C   . THR A 1 682  ? 36.178  -31.487 75.884  1.00 14.43  ? 682  THR A C   1 
ATOM 4402  O O   . THR A 1 682  ? 36.207  -31.638 74.657  1.00 12.25  ? 682  THR A O   1 
ATOM 4403  C CB  . THR A 1 682  ? 37.550  -32.934 77.407  1.00 11.77  ? 682  THR A CB  1 
ATOM 4404  H HA  . THR A 1 682  ? 38.211  -31.520 76.080  1.00 14.61  ? 682  THR A HA  1 
ATOM 4405  N N   . GLY A 1 683  ? 35.045  -31.261 76.549  1.00 24.78  ? 683  GLY A N   1 
ATOM 4406  C CA  . GLY A 1 683  ? 33.752  -31.243 75.862  1.00 27.18  ? 683  GLY A CA  1 
ATOM 4407  C C   . GLY A 1 683  ? 32.598  -30.981 76.812  1.00 27.08  ? 683  GLY A C   1 
ATOM 4408  O O   . GLY A 1 683  ? 32.743  -31.059 78.039  1.00 26.60  ? 683  GLY A O   1 
ATOM 4409  H HA2 . GLY A 1 683  ? 33.756  -30.550 75.184  1.00 32.61  ? 683  GLY A HA2 1 
ATOM 4410  H HA3 . GLY A 1 683  ? 33.605  -32.098 75.428  1.00 32.61  ? 683  GLY A HA3 1 
ATOM 4411  N N   . GLU A 1 684  ? 31.441  -30.663 76.205  1.00 20.54  ? 684  GLU A N   1 
ATOM 4412  C CA  . GLU A 1 684  ? 30.199  -30.383 76.920  1.00 10.04  ? 684  GLU A CA  1 
ATOM 4413  C C   . GLU A 1 684  ? 30.527  -29.693 78.233  1.00 15.50  ? 684  GLU A C   1 
ATOM 4414  O O   . GLU A 1 684  ? 30.011  -30.078 79.284  1.00 16.91  ? 684  GLU A O   1 
ATOM 4415  C CB  . GLU A 1 684  ? 29.405  -31.666 77.155  1.00 8.91   ? 684  GLU A CB  1 
ATOM 4416  H HA  . GLU A 1 684  ? 29.653  -29.782 76.389  1.00 12.05  ? 684  GLU A HA  1 
ATOM 4417  N N   . ASN A 1 685  ? 31.445  -28.732 78.187  1.00 16.89  ? 685  ASN A N   1 
ATOM 4418  C CA  . ASN A 1 685  ? 31.708  -27.861 79.320  1.00 20.63  ? 685  ASN A CA  1 
ATOM 4419  C C   . ASN A 1 685  ? 32.066  -26.463 78.803  1.00 26.62  ? 685  ASN A C   1 
ATOM 4420  O O   . ASN A 1 685  ? 31.179  -25.662 78.453  1.00 36.27  ? 685  ASN A O   1 
ATOM 4421  C CB  . ASN A 1 685  ? 32.824  -28.437 80.194  1.00 18.11  ? 685  ASN A CB  1 
ATOM 4422  H H   . ASN A 1 685  ? 31.934  -28.565 77.499  1.00 20.26  ? 685  ASN A H   1 
ATOM 4423  H HA  . ASN A 1 685  ? 30.906  -27.789 79.860  1.00 24.76  ? 685  ASN A HA  1 
ATOM 4424  N N   . ALA A 1 686  ? 33.365  -26.183 78.700  1.00 21.69  ? 686  ALA A N   1 
ATOM 4425  C CA  . ALA A 1 686  ? 33.792  -24.833 78.358  1.00 22.18  ? 686  ALA A CA  1 
ATOM 4426  C C   . ALA A 1 686  ? 33.194  -24.383 77.038  1.00 24.72  ? 686  ALA A C   1 
ATOM 4427  O O   . ALA A 1 686  ? 32.774  -23.225 76.900  1.00 26.62  ? 686  ALA A O   1 
ATOM 4428  C CB  . ALA A 1 686  ? 35.312  -24.770 78.303  1.00 23.96  ? 686  ALA A CB  1 
ATOM 4429  H H   . ALA A 1 686  ? 34.004  -26.746 78.819  1.00 26.03  ? 686  ALA A H   1 
ATOM 4430  H HA  . ALA A 1 686  ? 33.491  -24.222 79.049  1.00 26.62  ? 686  ALA A HA  1 
ATOM 4431  H HB1 . ALA A 1 686  ? 35.582  -23.866 78.075  1.00 28.76  ? 686  ALA A HB1 1 
ATOM 4432  H HB2 . ALA A 1 686  ? 35.670  -25.013 79.171  1.00 28.76  ? 686  ALA A HB2 1 
ATOM 4433  H HB3 . ALA A 1 686  ? 35.629  -25.390 77.628  1.00 28.76  ? 686  ALA A HB3 1 
ATOM 4434  N N   . LEU A 1 687  ? 33.109  -25.295 76.071  1.00 25.77  ? 687  LEU A N   1 
ATOM 4435  C CA  . LEU A 1 687  ? 32.642  -24.934 74.742  1.00 31.73  ? 687  LEU A CA  1 
ATOM 4436  C C   . LEU A 1 687  ? 31.175  -24.532 74.758  1.00 31.64  ? 687  LEU A C   1 
ATOM 4437  O O   . LEU A 1 687  ? 30.810  -23.463 74.252  1.00 26.38  ? 687  LEU A O   1 
ATOM 4438  C CB  . LEU A 1 687  ? 32.867  -26.102 73.785  1.00 33.89  ? 687  LEU A CB  1 
ATOM 4439  H H   . LEU A 1 687  ? 33.314  -26.125 76.161  1.00 30.92  ? 687  LEU A H   1 
ATOM 4440  H HA  . LEU A 1 687  ? 33.157  -24.178 74.420  1.00 38.07  ? 687  LEU A HA  1 
ATOM 4441  N N   . GLU A 1 688  ? 30.315  -25.379 75.329  1.00 36.57  ? 688  GLU A N   1 
ATOM 4442  C CA  . GLU A 1 688  ? 28.882  -25.101 75.347  1.00 36.32  ? 688  GLU A CA  1 
ATOM 4443  C C   . GLU A 1 688  ? 28.575  -23.798 76.086  1.00 43.38  ? 688  GLU A C   1 
ATOM 4444  O O   . GLU A 1 688  ? 27.788  -22.974 75.599  1.00 38.25  ? 688  GLU A O   1 
ATOM 4445  C CB  . GLU A 1 688  ? 28.128  -26.280 75.971  1.00 32.19  ? 688  GLU A CB  1 
ATOM 4446  H H   . GLU A 1 688  ? 30.537  -26.118 75.711  1.00 43.89  ? 688  GLU A H   1 
ATOM 4447  H HA  . GLU A 1 688  ? 28.572  -25.002 74.433  1.00 43.58  ? 688  GLU A HA  1 
ATOM 4448  N N   . ALA A 1 689  ? 29.183  -23.579 77.262  1.00 46.18  ? 689  ALA A N   1 
ATOM 4449  C CA  . ALA A 1 689  ? 28.876  -22.337 77.981  1.00 33.16  ? 689  ALA A CA  1 
ATOM 4450  C C   . ALA A 1 689  ? 29.432  -21.112 77.249  1.00 28.69  ? 689  ALA A C   1 
ATOM 4451  O O   . ALA A 1 689  ? 28.815  -20.027 77.258  1.00 26.70  ? 689  ALA A O   1 
ATOM 4452  C CB  . ALA A 1 689  ? 29.410  -22.402 79.415  1.00 29.47  ? 689  ALA A CB  1 
ATOM 4453  H H   . ALA A 1 689  ? 29.747  -24.103 77.646  1.00 55.42  ? 689  ALA A H   1 
ATOM 4454  H HA  . ALA A 1 689  ? 27.912  -22.238 78.030  1.00 39.79  ? 689  ALA A HA  1 
ATOM 4455  H HB1 . ALA A 1 689  ? 29.196  -21.572 79.870  1.00 35.37  ? 689  ALA A HB1 1 
ATOM 4456  H HB2 . ALA A 1 689  ? 28.993  -23.148 79.874  1.00 35.37  ? 689  ALA A HB2 1 
ATOM 4457  H HB3 . ALA A 1 689  ? 30.372  -22.526 79.388  1.00 35.37  ? 689  ALA A HB3 1 
ATOM 4458  N N   . GLY A 1 690  ? 30.574  -21.278 76.581  1.00 29.36  ? 690  GLY A N   1 
ATOM 4459  C CA  . GLY A 1 690  ? 31.253  -20.133 76.002  1.00 32.47  ? 690  GLY A CA  1 
ATOM 4460  C C   . GLY A 1 690  ? 30.362  -19.299 75.100  1.00 27.65  ? 690  GLY A C   1 
ATOM 4461  O O   . GLY A 1 690  ? 30.339  -18.066 75.204  1.00 33.41  ? 690  GLY A O   1 
ATOM 4462  H H   . GLY A 1 690  ? 30.967  -22.032 76.452  1.00 35.23  ? 690  GLY A H   1 
ATOM 4463  H HA2 . GLY A 1 690  ? 31.583  -19.564 76.715  1.00 38.97  ? 690  GLY A HA2 1 
ATOM 4464  H HA3 . GLY A 1 690  ? 32.011  -20.440 75.481  1.00 38.97  ? 690  GLY A HA3 1 
ATOM 4465  N N   . GLU A 1 691  ? 29.615  -19.951 74.206  1.00 18.30  ? 691  GLU A N   1 
ATOM 4466  C CA  . GLU A 1 691  ? 28.810  -19.220 73.238  1.00 10.00  ? 691  GLU A CA  1 
ATOM 4467  C C   . GLU A 1 691  ? 27.984  -18.164 73.947  1.00 12.45  ? 691  GLU A C   1 
ATOM 4468  O O   . GLU A 1 691  ? 28.149  -16.949 73.728  1.00 18.24  ? 691  GLU A O   1 
ATOM 4469  C CB  . GLU A 1 691  ? 27.915  -20.200 72.484  1.00 8.80   ? 691  GLU A CB  1 
ATOM 4470  H H   . GLU A 1 691  ? 29.560  -20.807 74.143  1.00 21.96  ? 691  GLU A H   1 
ATOM 4471  H HA  . GLU A 1 691  ? 29.391  -18.779 72.599  1.00 12.00  ? 691  GLU A HA  1 
ATOM 4472  N N   . ASP A 1 692  ? 27.154  -18.622 74.876  1.00 13.70  ? 692  ASP A N   1 
ATOM 4473  C CA  . ASP A 1 692  ? 26.345  -17.707 75.646  1.00 17.40  ? 692  ASP A CA  1 
ATOM 4474  C C   . ASP A 1 692  ? 27.212  -16.627 76.274  1.00 28.39  ? 692  ASP A C   1 
ATOM 4475  O O   . ASP A 1 692  ? 26.848  -15.448 76.248  1.00 38.85  ? 692  ASP A O   1 
ATOM 4476  C CB  . ASP A 1 692  ? 25.567  -18.475 76.713  1.00 12.47  ? 692  ASP A CB  1 
ATOM 4477  H H   . ASP A 1 692  ? 27.046  -19.452 75.074  1.00 16.45  ? 692  ASP A H   1 
ATOM 4478  H HA  . ASP A 1 692  ? 25.705  -17.276 75.058  1.00 20.88  ? 692  ASP A HA  1 
ATOM 4479  N N   . GLU A 1 693  ? 28.385  -17.001 76.806  1.00 27.83  ? 693  GLU A N   1 
ATOM 4480  C CA  . GLU A 1 693  ? 29.188  -16.045 77.576  1.00 36.99  ? 693  GLU A CA  1 
ATOM 4481  C C   . GLU A 1 693  ? 29.692  -14.882 76.725  1.00 38.63  ? 693  GLU A C   1 
ATOM 4482  O O   . GLU A 1 693  ? 29.365  -13.706 76.985  1.00 43.80  ? 693  GLU A O   1 
ATOM 4483  C CB  . GLU A 1 693  ? 30.376  -16.765 78.217  1.00 41.71  ? 693  GLU A CB  1 
ATOM 4484  H H   . GLU A 1 693  ? 28.730  -17.785 76.737  1.00 33.40  ? 693  GLU A H   1 
ATOM 4485  H HA  . GLU A 1 693  ? 28.641  -15.678 78.288  1.00 44.39  ? 693  GLU A HA  1 
ATOM 4486  N N   . GLU A 1 694  ? 30.541  -15.182 75.741  1.00 40.42  ? 694  GLU A N   1 
ATOM 4487  C CA  . GLU A 1 694  ? 31.105  -14.117 74.933  1.00 38.79  ? 694  GLU A CA  1 
ATOM 4488  C C   . GLU A 1 694  ? 29.987  -13.234 74.377  1.00 65.63  ? 694  GLU A C   1 
ATOM 4489  O O   . GLU A 1 694  ? 30.105  -11.990 74.399  1.00 83.50  ? 694  GLU A O   1 
ATOM 4490  C CB  . GLU A 1 694  ? 31.968  -14.719 73.822  1.00 29.99  ? 694  GLU A CB  1 
ATOM 4491  H H   . GLU A 1 694  ? 30.797  -15.975 75.529  1.00 48.50  ? 694  GLU A H   1 
ATOM 4492  H HA  . GLU A 1 694  ? 31.675  -13.565 75.490  1.00 46.55  ? 694  GLU A HA  1 
ATOM 4493  N N   . GLU A 1 695  ? 28.844  -13.859 73.979  1.00 73.65  ? 695  GLU A N   1 
ATOM 4494  C CA  . GLU A 1 695  ? 27.733  -13.124 73.351  1.00 95.47  ? 695  GLU A CA  1 
ATOM 4495  C C   . GLU A 1 695  ? 26.999  -12.165 74.318  1.00 79.89  ? 695  GLU A C   1 
ATOM 4496  O O   . GLU A 1 695  ? 26.749  -10.990 73.981  1.00 82.47  ? 695  GLU A O   1 
ATOM 4497  C CB  . GLU A 1 695  ? 26.748  -14.131 72.749  1.00 87.82  ? 695  GLU A CB  1 
ATOM 4498  H H   . GLU A 1 695  ? 28.698  -14.702 74.066  1.00 88.38  ? 695  GLU A H   1 
ATOM 4499  H HA  . GLU A 1 695  ? 28.088  -12.590 72.623  1.00 114.57 ? 695  GLU A HA  1 
ATOM 4500  N N   . VAL A 1 696  ? 26.591  -12.654 75.497  1.00 62.35  ? 696  VAL A N   1 
ATOM 4501  C CA  . VAL A 1 696  ? 25.869  -11.792 76.423  1.00 36.14  ? 696  VAL A CA  1 
ATOM 4502  C C   . VAL A 1 696  ? 26.764  -10.650 76.901  1.00 44.78  ? 696  VAL A C   1 
ATOM 4503  O O   . VAL A 1 696  ? 26.263  -9.548  77.151  1.00 33.68  ? 696  VAL A O   1 
ATOM 4504  C CB  . VAL A 1 696  ? 25.305  -12.603 77.605  1.00 23.60  ? 696  VAL A CB  1 
ATOM 4505  H H   . VAL A 1 696  ? 26.718  -13.459 75.772  1.00 74.82  ? 696  VAL A H   1 
ATOM 4506  H HA  . VAL A 1 696  ? 25.117  -11.397 75.955  1.00 43.36  ? 696  VAL A HA  1 
ATOM 4507  N N   . TRP A 1 697  ? 28.095  -10.873 77.008  1.00 54.13  ? 697  TRP A N   1 
ATOM 4508  C CA  . TRP A 1 697  ? 29.022  -9.789  77.361  1.00 55.11  ? 697  TRP A CA  1 
ATOM 4509  C C   . TRP A 1 697  ? 29.065  -8.657  76.321  1.00 56.85  ? 697  TRP A C   1 
ATOM 4510  O O   . TRP A 1 697  ? 28.608  -7.531  76.605  1.00 44.87  ? 697  TRP A O   1 
ATOM 4511  C CB  . TRP A 1 697  ? 30.443  -10.343 77.577  1.00 44.83  ? 697  TRP A CB  1 
ATOM 4512  H H   . TRP A 1 697  ? 28.474  -11.634 76.880  1.00 64.96  ? 697  TRP A H   1 
ATOM 4513  H HA  . TRP A 1 697  ? 28.731  -9.400  78.201  1.00 66.13  ? 697  TRP A HA  1 
ATOM 4514  N N   . LEU A 1 698  ? 29.611  -8.913  75.121  1.00 65.68  ? 698  LEU A N   1 
ATOM 4515  C CA  . LEU A 1 698  ? 29.689  -7.826  74.143  1.00 44.94  ? 698  LEU A CA  1 
ATOM 4516  C C   . LEU A 1 698  ? 28.314  -7.198  73.923  1.00 29.66  ? 698  LEU A C   1 
ATOM 4517  O O   . LEU A 1 698  ? 28.132  -5.991  74.137  1.00 17.28  ? 698  LEU A O   1 
ATOM 4518  C CB  . LEU A 1 698  ? 30.274  -8.343  72.826  1.00 45.96  ? 698  LEU A CB  1 
ATOM 4519  H H   . LEU A 1 698  ? 29.926  -9.670  74.862  1.00 78.81  ? 698  LEU A H   1 
ATOM 4520  H HA  . LEU A 1 698  ? 30.281  -7.138  74.484  1.00 53.93  ? 698  LEU A HA  1 
ATOM 4521  N N   . PHE A 1 699  ? 27.320  -8.020  73.558  1.00 29.30  ? 699  PHE A N   1 
ATOM 4522  C CA  . PHE A 1 699  ? 26.010  -7.493  73.210  1.00 25.98  ? 699  PHE A CA  1 
ATOM 4523  C C   . PHE A 1 699  ? 25.430  -6.688  74.359  1.00 23.38  ? 699  PHE A C   1 
ATOM 4524  O O   . PHE A 1 699  ? 24.979  -5.558  74.172  1.00 22.84  ? 699  PHE A O   1 
ATOM 4525  C CB  . PHE A 1 699  ? 25.074  -8.642  72.833  1.00 32.05  ? 699  PHE A CB  1 
ATOM 4526  H H   . PHE A 1 699  ? 27.385  -8.876  73.506  1.00 35.16  ? 699  PHE A H   1 
ATOM 4527  H HA  . PHE A 1 699  ? 26.095  -6.906  72.442  1.00 31.18  ? 699  PHE A HA  1 
ATOM 4528  N N   . TRP A 1 700  ? 25.438  -7.249  75.558  1.00 25.86  ? 700  TRP A N   1 
ATOM 4529  C CA  . TRP A 1 700  ? 24.804  -6.556  76.665  1.00 25.71  ? 700  TRP A CA  1 
ATOM 4530  C C   . TRP A 1 700  ? 25.471  -5.216  76.922  1.00 18.43  ? 700  TRP A C   1 
ATOM 4531  O O   . TRP A 1 700  ? 24.797  -4.234  77.256  1.00 13.20  ? 700  TRP A O   1 
ATOM 4532  C CB  . TRP A 1 700  ? 24.838  -7.437  77.910  1.00 36.54  ? 700  TRP A CB  1 
ATOM 4533  H H   . TRP A 1 700  ? 25.792  -8.008  75.754  1.00 31.03  ? 700  TRP A H   1 
ATOM 4534  H HA  . TRP A 1 700  ? 23.875  -6.390  76.442  1.00 30.86  ? 700  TRP A HA  1 
ATOM 4535  N N   . ARG A 1 701  ? 26.793  -5.146  76.758  1.00 18.97  ? 701  ARG A N   1 
ATOM 4536  C CA  . ARG A 1 701  ? 27.440  -3.855  76.885  1.00 18.06  ? 701  ARG A CA  1 
ATOM 4537  C C   . ARG A 1 701  ? 26.730  -2.869  75.980  1.00 21.75  ? 701  ARG A C   1 
ATOM 4538  O O   . ARG A 1 701  ? 26.278  -1.809  76.424  1.00 27.69  ? 701  ARG A O   1 
ATOM 4539  C CB  . ARG A 1 701  ? 28.921  -3.972  76.529  1.00 15.36  ? 701  ARG A CB  1 
ATOM 4540  H H   . ARG A 1 701  ? 27.314  -5.807  76.580  1.00 22.77  ? 701  ARG A H   1 
ATOM 4541  H HA  . ARG A 1 701  ? 27.366  -3.543  77.801  1.00 21.67  ? 701  ARG A HA  1 
ATOM 4542  N N   . ASP A 1 702  ? 26.545  -3.269  74.725  1.00 20.12  ? 702  ASP A N   1 
ATOM 4543  C CA  . ASP A 1 702  ? 25.768  -2.564  73.710  1.00 35.51  ? 702  ASP A CA  1 
ATOM 4544  C C   . ASP A 1 702  ? 25.579  -1.067  73.906  1.00 31.44  ? 702  ASP A C   1 
ATOM 4545  O O   . ASP A 1 702  ? 26.485  -0.261  73.644  1.00 24.02  ? 702  ASP A O   1 
ATOM 4546  C CB  . ASP A 1 702  ? 24.368  -3.174  73.608  1.00 36.99  ? 702  ASP A CB  1 
ATOM 4547  H H   . ASP A 1 702  ? 26.886  -3.998  74.421  1.00 24.14  ? 702  ASP A H   1 
ATOM 4548  H HA  . ASP A 1 702  ? 26.203  -2.690  72.852  1.00 42.61  ? 702  ASP A HA  1 
ATOM 4549  N N   . SER A 1 703  ? 24.389  -0.700  74.374  1.00 29.06  ? 703  SER A N   1 
ATOM 4550  C CA  . SER A 1 703  ? 23.925  0.673   74.310  1.00 26.02  ? 703  SER A CA  1 
ATOM 4551  C C   . SER A 1 703  ? 24.764  1.474   75.292  1.00 21.39  ? 703  SER A C   1 
ATOM 4552  O O   . SER A 1 703  ? 24.491  1.505   76.499  1.00 18.73  ? 703  SER A O   1 
ATOM 4553  C CB  . SER A 1 703  ? 22.428  0.726   74.619  1.00 23.56  ? 703  SER A CB  1 
ATOM 4554  H H   . SER A 1 703  ? 23.827  -1.240  74.737  1.00 34.87  ? 703  SER A H   1 
ATOM 4555  H HA  . SER A 1 703  ? 24.070  1.026   73.419  1.00 31.22  ? 703  SER A HA  1 
ATOM 4556  N N   . ASN A 1 704  ? 25.838  2.088   74.776  1.00 14.88  ? 704  ASN A N   1 
ATOM 4557  C CA  . ASN A 1 704  ? 26.801  2.728   75.667  1.00 12.66  ? 704  ASN A CA  1 
ATOM 4558  C C   . ASN A 1 704  ? 26.350  4.147   76.029  1.00 14.02  ? 704  ASN A C   1 
ATOM 4559  O O   . ASN A 1 704  ? 26.622  4.612   77.138  1.00 16.78  ? 704  ASN A O   1 
ATOM 4560  C CB  . ASN A 1 704  ? 28.208  2.745   75.033  1.00 9.10   ? 704  ASN A CB  1 
ATOM 4561  H HA  . ASN A 1 704  ? 26.854  2.216   76.488  1.00 15.19  ? 704  ASN A HA  1 
ATOM 4562  N N   . LYS A 1 705  ? 25.644  4.842   75.106  1.00 17.92  ? 705  LYS A N   1 
ATOM 4563  C CA  . LYS A 1 705  ? 25.408  6.294   75.182  1.00 15.71  ? 705  LYS A CA  1 
ATOM 4564  C C   . LYS A 1 705  ? 24.133  6.684   75.949  1.00 11.68  ? 705  LYS A C   1 
ATOM 4565  O O   . LYS A 1 705  ? 24.008  7.830   76.416  1.00 11.08  ? 705  LYS A O   1 
ATOM 4566  C CB  . LYS A 1 705  ? 25.310  6.894   73.772  1.00 10.77  ? 705  LYS A CB  1 
ATOM 4567  H HA  . LYS A 1 705  ? 26.162  6.709   75.630  1.00 18.86  ? 705  LYS A HA  1 
ATOM 4568  N N   . GLU A 1 706  ? 23.177  5.773   76.057  1.00 16.29  ? 706  GLU A N   1 
ATOM 4569  C CA  . GLU A 1 706  ? 21.891  6.056   76.681  1.00 20.18  ? 706  GLU A CA  1 
ATOM 4570  C C   . GLU A 1 706  ? 21.880  5.447   78.081  1.00 18.48  ? 706  GLU A C   1 
ATOM 4571  O O   . GLU A 1 706  ? 22.114  4.243   78.243  1.00 26.73  ? 706  GLU A O   1 
ATOM 4572  C CB  . GLU A 1 706  ? 20.752  5.492   75.832  1.00 37.97  ? 706  GLU A CB  1 
ATOM 4573  H H   . GLU A 1 706  ? 23.249  4.965   75.771  1.00 19.55  ? 706  GLU A H   1 
ATOM 4574  H HA  . GLU A 1 706  ? 21.772  7.015   76.760  1.00 24.22  ? 706  GLU A HA  1 
ATOM 4575  N N   . ILE A 1 707  ? 21.613  6.262   79.090  1.00 8.89   ? 707  ILE A N   1 
ATOM 4576  C CA  . ILE A 1 707  ? 21.595  5.780   80.465  1.00 8.91   ? 707  ILE A CA  1 
ATOM 4577  C C   . ILE A 1 707  ? 20.163  5.793   80.943  1.00 9.87   ? 707  ILE A C   1 
ATOM 4578  O O   . ILE A 1 707  ? 19.510  6.837   80.903  1.00 8.89   ? 707  ILE A O   1 
ATOM 4579  C CB  . ILE A 1 707  ? 22.474  6.627   81.381  1.00 8.89   ? 707  ILE A CB  1 
ATOM 4580  H H   . ILE A 1 707  ? 21.439  7.100   79.007  1.00 10.67  ? 707  ILE A H   1 
ATOM 4581  H HA  . ILE A 1 707  ? 21.918  4.866   80.491  1.00 10.69  ? 707  ILE A HA  1 
ATOM 4582  N N   . ARG A 1 708  ? 19.695  4.638   81.399  1.00 15.48  ? 708  ARG A N   1 
ATOM 4583  C CA  . ARG A 1 708  ? 18.306  4.366   81.754  1.00 22.37  ? 708  ARG A CA  1 
ATOM 4584  C C   . ARG A 1 708  ? 17.882  3.061   81.091  1.00 37.34  ? 708  ARG A C   1 
ATOM 4585  O O   . ARG A 1 708  ? 17.302  2.197   81.749  1.00 52.38  ? 708  ARG A O   1 
ATOM 4586  C CB  . ARG A 1 708  ? 17.357  5.487   81.337  1.00 23.03  ? 708  ARG A CB  1 
ATOM 4587  H HA  . ARG A 1 708  ? 18.238  4.254   82.715  1.00 26.85  ? 708  ARG A HA  1 
ATOM 4588  N N   . SER A 1 709  ? 18.128  2.917   79.785  1.00 35.74  ? 709  SER A N   1 
ATOM 4589  C CA  . SER A 1 709  ? 18.017  1.598   79.165  1.00 37.47  ? 709  SER A CA  1 
ATOM 4590  C C   . SER A 1 709  ? 19.093  0.675   79.734  1.00 43.48  ? 709  SER A C   1 
ATOM 4591  O O   . SER A 1 709  ? 18.784  -0.311  80.422  1.00 50.50  ? 709  SER A O   1 
ATOM 4592  C CB  . SER A 1 709  ? 18.123  1.708   77.634  1.00 25.61  ? 709  SER A CB  1 
ATOM 4593  H HA  . SER A 1 709  ? 17.151  1.218   79.380  1.00 44.96  ? 709  SER A HA  1 
ATOM 4594  N N   . LYS A 1 710  ? 20.367  1.036   79.535  1.00 36.86  ? 710  LYS A N   1 
ATOM 4595  C CA  . LYS A 1 710  ? 21.512  0.239   79.964  1.00 32.95  ? 710  LYS A CA  1 
ATOM 4596  C C   . LYS A 1 710  ? 21.919  0.518   81.410  1.00 37.44  ? 710  LYS A C   1 
ATOM 4597  O O   . LYS A 1 710  ? 22.133  -0.416  82.183  1.00 39.26  ? 710  LYS A O   1 
ATOM 4598  C CB  . LYS A 1 710  ? 22.709  0.495   79.044  1.00 25.95  ? 710  LYS A CB  1 
ATOM 4599  H H   . LYS A 1 710  ? 20.594  1.765   79.138  1.00 44.24  ? 710  LYS A H   1 
ATOM 4600  H HA  . LYS A 1 710  ? 21.281  -0.701  79.897  1.00 39.54  ? 710  LYS A HA  1 
ATOM 4601  N N   . SER A 1 711  ? 22.053  1.786   81.791  1.00 38.48  ? 711  SER A N   1 
ATOM 4602  C CA  . SER A 1 711  ? 22.419  2.097   83.167  1.00 44.82  ? 711  SER A CA  1 
ATOM 4603  C C   . SER A 1 711  ? 21.350  1.619   84.149  1.00 60.47  ? 711  SER A C   1 
ATOM 4604  O O   . SER A 1 711  ? 21.670  0.962   85.150  1.00 63.54  ? 711  SER A O   1 
ATOM 4605  C CB  . SER A 1 711  ? 22.656  3.602   83.313  1.00 38.28  ? 711  SER A CB  1 
ATOM 4606  H H   . SER A 1 711  ? 21.940  2.471   81.284  1.00 46.18  ? 711  SER A H   1 
ATOM 4607  H HA  . SER A 1 711  ? 23.247  1.642   83.383  1.00 53.79  ? 711  SER A HA  1 
ATOM 4608  N N   . VAL A 1 712  ? 20.075  1.941   83.874  1.00 73.41  ? 712  VAL A N   1 
ATOM 4609  C CA  . VAL A 1 712  ? 18.967  1.596   84.776  1.00 84.32  ? 712  VAL A CA  1 
ATOM 4610  C C   . VAL A 1 712  ? 18.524  0.123   84.623  1.00 64.57  ? 712  VAL A C   1 
ATOM 4611  O O   . VAL A 1 712  ? 18.222  -0.548  85.623  1.00 55.62  ? 712  VAL A O   1 
ATOM 4612  C CB  . VAL A 1 712  ? 17.795  2.576   84.560  1.00 78.91  ? 712  VAL A CB  1 
ATOM 4613  H H   . VAL A 1 712  ? 19.826  2.361   83.166  1.00 88.09  ? 712  VAL A H   1 
ATOM 4614  H HA  . VAL A 1 712  ? 19.273  1.710   85.690  1.00 101.19 ? 712  VAL A HA  1 
ATOM 4615  N N   . ARG A 1 713  ? 18.430  -0.401  83.391  1.00 51.79  ? 713  ARG A N   1 
ATOM 4616  C CA  . ARG A 1 713  ? 18.135  -1.823  83.272  1.00 31.83  ? 713  ARG A CA  1 
ATOM 4617  C C   . ARG A 1 713  ? 19.283  -2.646  83.848  1.00 36.09  ? 713  ARG A C   1 
ATOM 4618  O O   . ARG A 1 713  ? 19.045  -3.632  84.555  1.00 33.92  ? 713  ARG A O   1 
ATOM 4619  C CB  . ARG A 1 713  ? 17.867  -2.198  81.814  1.00 31.73  ? 713  ARG A CB  1 
ATOM 4620  H H   . ARG A 1 713  ? 18.528  0.024   82.650  1.00 62.14  ? 713  ARG A H   1 
ATOM 4621  H HA  . ARG A 1 713  ? 17.337  -2.024  83.785  1.00 38.19  ? 713  ARG A HA  1 
ATOM 4622  N N   . GLU A 1 714  ? 20.532  -2.231  83.583  1.00 43.93  ? 714  GLU A N   1 
ATOM 4623  C CA  . GLU A 1 714  ? 21.728  -2.904  84.095  1.00 44.90  ? 714  GLU A CA  1 
ATOM 4624  C C   . GLU A 1 714  ? 22.020  -2.449  85.527  1.00 38.87  ? 714  GLU A C   1 
ATOM 4625  O O   . GLU A 1 714  ? 23.064  -1.869  85.845  1.00 30.06  ? 714  GLU A O   1 
ATOM 4626  C CB  . GLU A 1 714  ? 22.930  -2.656  83.188  1.00 41.72  ? 714  GLU A CB  1 
ATOM 4627  H H   . GLU A 1 714  ? 20.712  -1.545  83.096  1.00 52.72  ? 714  GLU A H   1 
ATOM 4628  H HA  . GLU A 1 714  ? 21.564  -3.860  84.115  1.00 53.87  ? 714  GLU A HA  1 
ATOM 4629  N N   . LEU A 1 715  ? 21.041  -2.715  86.392  1.00 38.03  ? 715  LEU A N   1 
ATOM 4630  C CA  . LEU A 1 715  ? 21.261  -2.585  87.825  1.00 34.77  ? 715  LEU A CA  1 
ATOM 4631  C C   . LEU A 1 715  ? 22.389  -3.496  88.290  1.00 38.08  ? 715  LEU A C   1 
ATOM 4632  O O   . LEU A 1 715  ? 23.066  -3.183  89.274  1.00 37.39  ? 715  LEU A O   1 
ATOM 4633  C CB  . LEU A 1 715  ? 19.969  -2.907  88.585  1.00 25.04  ? 715  LEU A CB  1 
ATOM 4634  H HA  . LEU A 1 715  ? 21.510  -1.670  88.027  1.00 41.72  ? 715  LEU A HA  1 
ATOM 4635  N N   . ALA A 1 716  ? 22.642  -4.592  87.552  1.00 48.61  ? 716  ALA A N   1 
ATOM 4636  C CA  . ALA A 1 716  ? 23.422  -5.727  88.052  1.00 43.43  ? 716  ALA A CA  1 
ATOM 4637  C C   . ALA A 1 716  ? 24.939  -5.496  88.044  1.00 29.64  ? 716  ALA A C   1 
ATOM 4638  O O   . ALA A 1 716  ? 25.636  -6.042  88.908  1.00 25.97  ? 716  ALA A O   1 
ATOM 4639  C CB  . ALA A 1 716  ? 23.099  -6.988  87.238  1.00 32.80  ? 716  ALA A CB  1 
ATOM 4640  H HA  . ALA A 1 716  ? 23.160  -5.898  88.970  1.00 52.11  ? 716  ALA A HA  1 
ATOM 4641  H HB1 . ALA A 1 716  ? 23.623  -7.728  87.581  1.00 39.36  ? 716  ALA A HB1 1 
ATOM 4642  H HB2 . ALA A 1 716  ? 22.153  -7.184  87.322  1.00 39.36  ? 716  ALA A HB2 1 
ATOM 4643  H HB3 . ALA A 1 716  ? 23.322  -6.828  86.307  1.00 39.36  ? 716  ALA A HB3 1 
ATOM 4644  N N   . GLN A 1 717  ? 25.466  -4.722  87.088  1.00 22.27  ? 717  GLN A N   1 
ATOM 4645  C CA  . GLN A 1 717  ? 26.903  -4.507  86.911  1.00 10.50  ? 717  GLN A CA  1 
ATOM 4646  C C   . GLN A 1 717  ? 27.727  -4.649  88.194  1.00 9.46   ? 717  GLN A C   1 
ATOM 4647  O O   . GLN A 1 717  ? 28.468  -3.734  88.558  1.00 9.93   ? 717  GLN A O   1 
ATOM 4648  C CB  . GLN A 1 717  ? 27.130  -3.116  86.319  1.00 8.82   ? 717  GLN A CB  1 
ATOM 4649  H H   . GLN A 1 717  ? 24.991  -4.297  86.511  1.00 26.72  ? 717  GLN A H   1 
ATOM 4650  H HA  . GLN A 1 717  ? 27.237  -5.157  86.273  1.00 12.60  ? 717  GLN A HA  1 
ATOM 4651  N N   . ASP A 1 718  ? 27.635  -5.789  88.868  1.00 8.73   ? 718  ASP A N   1 
ATOM 4652  C CA  . ASP A 1 718  ? 28.306  -5.990  90.147  1.00 8.73   ? 718  ASP A CA  1 
ATOM 4653  C C   . ASP A 1 718  ? 29.285  -7.139  90.060  1.00 8.73   ? 718  ASP A C   1 
ATOM 4654  O O   . ASP A 1 718  ? 29.681  -7.682  91.090  1.00 8.73   ? 718  ASP A O   1 
ATOM 4655  C CB  . ASP A 1 718  ? 27.294  -6.242  91.266  1.00 8.73   ? 718  ASP A CB  1 
ATOM 4656  H H   . ASP A 1 718  ? 27.184  -6.471  88.603  1.00 10.48  ? 718  ASP A H   1 
ATOM 4657  H HA  . ASP A 1 718  ? 28.805  -5.188  90.370  1.00 10.48  ? 718  ASP A HA  1 
ATOM 4658  N N   . ALA A 1 719  ? 29.695  -7.500  88.851  1.00 8.83   ? 719  ALA A N   1 
ATOM 4659  C CA  . ALA A 1 719  ? 30.475  -8.713  88.658  1.00 8.83   ? 719  ALA A CA  1 
ATOM 4660  C C   . ALA A 1 719  ? 31.818  -8.619  89.362  1.00 8.83   ? 719  ALA A C   1 
ATOM 4661  O O   . ALA A 1 719  ? 32.447  -7.558  89.385  1.00 8.83   ? 719  ALA A O   1 
ATOM 4662  C CB  . ALA A 1 719  ? 30.687  -8.983  87.174  1.00 8.83   ? 719  ALA A CB  1 
ATOM 4663  H HA  . ALA A 1 719  ? 29.990  -9.465  89.034  1.00 10.60  ? 719  ALA A HA  1 
ATOM 4664  H HB1 . ALA A 1 719  ? 31.208  -9.795  87.072  1.00 10.60  ? 719  ALA A HB1 1 
ATOM 4665  H HB2 . ALA A 1 719  ? 29.824  -9.088  86.745  1.00 10.60  ? 719  ALA A HB2 1 
ATOM 4666  H HB3 . ALA A 1 719  ? 31.163  -8.234  86.782  1.00 10.60  ? 719  ALA A HB3 1 
ATOM 4667  N N   . LYS A 1 720  ? 32.259  -9.751  89.915  1.00 9.42   ? 720  LYS A N   1 
ATOM 4668  C CA  . LYS A 1 720  ? 33.491  -9.853  90.683  1.00 8.96   ? 720  LYS A CA  1 
ATOM 4669  C C   . LYS A 1 720  ? 34.490  -10.681 89.895  1.00 8.96   ? 720  LYS A C   1 
ATOM 4670  O O   . LYS A 1 720  ? 34.210  -11.827 89.536  1.00 8.96   ? 720  LYS A O   1 
ATOM 4671  C CB  . LYS A 1 720  ? 33.239  -10.491 92.051  1.00 8.96   ? 720  LYS A CB  1 
ATOM 4672  H H   . LYS A 1 720  ? 31.841  -10.499 89.852  1.00 11.30  ? 720  LYS A H   1 
ATOM 4673  H HA  . LYS A 1 720  ? 33.863  -8.968  90.820  1.00 10.75  ? 720  LYS A HA  1 
ATOM 4674  N N   . GLU A 1 721  ? 35.653  -10.109 89.639  1.00 8.76   ? 721  GLU A N   1 
ATOM 4675  C CA  . GLU A 1 721  ? 36.687  -10.828 88.924  1.00 8.76   ? 721  GLU A CA  1 
ATOM 4676  C C   . GLU A 1 721  ? 36.186  -11.266 87.552  1.00 8.76   ? 721  GLU A C   1 
ATOM 4677  O O   . GLU A 1 721  ? 36.411  -12.396 87.134  1.00 8.76   ? 721  GLU A O   1 
ATOM 4678  C CB  . GLU A 1 721  ? 37.163  -12.035 89.730  1.00 8.76   ? 721  GLU A CB  1 
ATOM 4679  H HA  . GLU A 1 721  ? 37.446  -10.238 88.792  1.00 10.51  ? 721  GLU A HA  1 
ATOM 4680  N N   . GLY A 1 722  ? 35.498  -10.371 86.846  1.00 8.53   ? 722  GLY A N   1 
ATOM 4681  C CA  . GLY A 1 722  ? 35.031  -10.668 85.498  1.00 8.53   ? 722  GLY A CA  1 
ATOM 4682  C C   . GLY A 1 722  ? 36.165  -10.960 84.538  1.00 8.53   ? 722  GLY A C   1 
ATOM 4683  O O   . GLY A 1 722  ? 37.307  -11.053 84.990  1.00 8.53   ? 722  GLY A O   1 
ATOM 4684  H H   . GLY A 1 722  ? 35.290  -9.585  87.126  1.00 10.24  ? 722  GLY A H   1 
ATOM 4685  H HA2 . GLY A 1 722  ? 34.444  -11.441 85.523  1.00 10.24  ? 722  GLY A HA2 1 
ATOM 4686  H HA3 . GLY A 1 722  ? 34.528  -9.912  85.157  1.00 10.24  ? 722  GLY A HA3 1 
ATOM 4687  N N   . GLN A 1 723  ? 35.911  -11.126 83.243  1.00 8.48   ? 723  GLN A N   1 
ATOM 4688  C CA  . GLN A 1 723  ? 36.998  -11.284 82.276  1.00 8.48   ? 723  GLN A CA  1 
ATOM 4689  C C   . GLN A 1 723  ? 36.491  -10.861 80.903  1.00 8.48   ? 723  GLN A C   1 
ATOM 4690  O O   . GLN A 1 723  ? 35.338  -10.464 80.743  1.00 8.48   ? 723  GLN A O   1 
ATOM 4691  C CB  . GLN A 1 723  ? 37.535  -12.718 82.267  1.00 8.48   ? 723  GLN A CB  1 
ATOM 4692  H HA  . GLN A 1 723  ? 37.727  -10.693 82.521  1.00 10.18  ? 723  GLN A HA  1 
ATOM 4693  N N   . LYS A 1 724  ? 37.372  -10.909 79.913  1.00 8.45   ? 724  LYS A N   1 
ATOM 4694  C CA  . LYS A 1 724  ? 36.988  -10.654 78.530  1.00 8.45   ? 724  LYS A CA  1 
ATOM 4695  C C   . LYS A 1 724  ? 36.495  -9.244  78.323  1.00 8.45   ? 724  LYS A C   1 
ATOM 4696  O O   . LYS A 1 724  ? 35.752  -8.966  77.376  1.00 8.45   ? 724  LYS A O   1 
ATOM 4697  C CB  . LYS A 1 724  ? 35.907  -11.630 78.062  1.00 8.45   ? 724  LYS A CB  1 
ATOM 4698  H HA  . LYS A 1 724  ? 37.765  -10.781 77.964  1.00 10.14  ? 724  LYS A HA  1 
ATOM 4699  N N   . GLU A 1 725  ? 36.881  -8.361  79.224  1.00 8.63   ? 725  GLU A N   1 
ATOM 4700  C CA  . GLU A 1 725  ? 36.650  -6.943  79.053  1.00 8.63   ? 725  GLU A CA  1 
ATOM 4701  C C   . GLU A 1 725  ? 35.191  -6.616  78.784  1.00 8.63   ? 725  GLU A C   1 
ATOM 4702  O O   . GLU A 1 725  ? 34.891  -5.517  78.330  1.00 16.18  ? 725  GLU A O   1 
ATOM 4703  C CB  . GLU A 1 725  ? 37.513  -6.396  77.919  1.00 8.63   ? 725  GLU A CB  1 
ATOM 4704  H HA  . GLU A 1 725  ? 36.910  -6.486  79.868  1.00 10.36  ? 725  GLU A HA  1 
ATOM 4705  N N   . ASP A 1 726  ? 34.252  -7.525  79.038  1.00 9.59   ? 726  ASP A N   1 
ATOM 4706  C CA  . ASP A 1 726  ? 32.850  -7.145  78.906  1.00 11.14  ? 726  ASP A CA  1 
ATOM 4707  C C   . ASP A 1 726  ? 32.517  -5.920  79.768  1.00 13.48  ? 726  ASP A C   1 
ATOM 4708  O O   . ASP A 1 726  ? 31.844  -4.979  79.307  1.00 11.49  ? 726  ASP A O   1 
ATOM 4709  C CB  . ASP A 1 726  ? 31.978  -8.340  79.285  1.00 13.33  ? 726  ASP A CB  1 
ATOM 4710  H H   . ASP A 1 726  ? 34.393  -8.338  79.280  1.00 11.51  ? 726  ASP A H   1 
ATOM 4711  H HA  . ASP A 1 726  ? 32.667  -6.921  77.980  1.00 13.37  ? 726  ASP A HA  1 
ATOM 4712  N N   . ARG A 1 727  ? 33.023  -5.897  81.008  1.00 18.12  ? 727  ARG A N   1 
ATOM 4713  C CA  . ARG A 1 727  ? 32.602  -4.907  81.992  1.00 19.64  ? 727  ARG A CA  1 
ATOM 4714  C C   . ARG A 1 727  ? 32.932  -3.488  81.555  1.00 15.81  ? 727  ARG A C   1 
ATOM 4715  O O   . ARG A 1 727  ? 32.096  -2.602  81.677  1.00 14.34  ? 727  ARG A O   1 
ATOM 4716  C CB  . ARG A 1 727  ? 33.248  -5.209  83.347  1.00 29.25  ? 727  ARG A CB  1 
ATOM 4717  H H   . ARG A 1 727  ? 33.615  -6.450  81.300  1.00 21.74  ? 727  ARG A H   1 
ATOM 4718  H HA  . ARG A 1 727  ? 31.640  -4.966  82.102  1.00 23.57  ? 727  ARG A HA  1 
ATOM 4719  N N   . ASP A 1 728  ? 34.146  -3.239  81.076  1.00 13.70  ? 728  ASP A N   1 
ATOM 4720  C CA  . ASP A 1 728  ? 34.508  -1.870  80.732  1.00 12.51  ? 728  ASP A CA  1 
ATOM 4721  C C   . ASP A 1 728  ? 33.510  -1.282  79.757  1.00 12.70  ? 728  ASP A C   1 
ATOM 4722  O O   . ASP A 1 728  ? 33.132  -0.112  79.876  1.00 13.41  ? 728  ASP A O   1 
ATOM 4723  C CB  . ASP A 1 728  ? 35.913  -1.825  80.134  1.00 23.37  ? 728  ASP A CB  1 
ATOM 4724  H H   . ASP A 1 728  ? 34.762  -3.825  80.944  1.00 16.44  ? 728  ASP A H   1 
ATOM 4725  H HA  . ASP A 1 728  ? 34.503  -1.328  81.535  1.00 15.01  ? 728  ASP A HA  1 
ATOM 4726  N N   . ILE A 1 729  ? 33.083  -2.084  78.784  1.00 10.12  ? 729  ILE A N   1 
ATOM 4727  C CA  . ILE A 1 729  ? 32.088  -1.635  77.831  1.00 12.27  ? 729  ILE A CA  1 
ATOM 4728  C C   . ILE A 1 729  ? 30.760  -1.431  78.530  1.00 18.18  ? 729  ILE A C   1 
ATOM 4729  O O   . ILE A 1 729  ? 30.084  -0.413  78.323  1.00 30.07  ? 729  ILE A O   1 
ATOM 4730  C CB  . ILE A 1 729  ? 31.962  -2.639  76.674  1.00 8.85   ? 729  ILE A CB  1 
ATOM 4731  H H   . ILE A 1 729  ? 33.355  -2.890  78.659  1.00 12.14  ? 729  ILE A H   1 
ATOM 4732  H HA  . ILE A 1 729  ? 32.366  -0.782  77.460  1.00 14.72  ? 729  ILE A HA  1 
ATOM 4733  N N   . LEU A 1 730  ? 30.363  -2.381  79.378  1.00 14.99  ? 730  LEU A N   1 
ATOM 4734  C CA  . LEU A 1 730  ? 29.145  -2.181  80.153  1.00 20.98  ? 730  LEU A CA  1 
ATOM 4735  C C   . LEU A 1 730  ? 29.204  -0.844  80.893  1.00 33.79  ? 730  LEU A C   1 
ATOM 4736  O O   . LEU A 1 730  ? 28.261  -0.031  80.841  1.00 45.18  ? 730  LEU A O   1 
ATOM 4737  C CB  . LEU A 1 730  ? 28.969  -3.338  81.133  1.00 17.90  ? 730  LEU A CB  1 
ATOM 4738  H H   . LEU A 1 730  ? 30.769  -3.127  79.519  1.00 17.99  ? 730  LEU A H   1 
ATOM 4739  H HA  . LEU A 1 730  ? 28.382  -2.167  79.555  1.00 25.18  ? 730  LEU A HA  1 
ATOM 4740  N N   . SER A 1 731  ? 30.331  -0.600  81.568  1.00 37.45  ? 731  SER A N   1 
ATOM 4741  C CA  . SER A 1 731  ? 30.558  0.627   82.319  1.00 48.15  ? 731  SER A CA  1 
ATOM 4742  C C   . SER A 1 731  ? 30.329  1.843   81.440  1.00 37.37  ? 731  SER A C   1 
ATOM 4743  O O   . SER A 1 731  ? 29.652  2.796   81.844  1.00 26.94  ? 731  SER A O   1 
ATOM 4744  C CB  . SER A 1 731  ? 31.986  0.628   82.883  1.00 36.76  ? 731  SER A CB  1 
ATOM 4745  H H   . SER A 1 731  ? 30.993  -1.149  81.604  1.00 44.94  ? 731  SER A H   1 
ATOM 4746  H HA  . SER A 1 731  ? 29.936  0.668   83.063  1.00 57.78  ? 731  SER A HA  1 
ATOM 4747  N N   . TYR A 1 732  ? 30.906  1.828   80.235  1.00 45.39  ? 732  TYR A N   1 
ATOM 4748  C CA  . TYR A 1 732  ? 30.628  2.885   79.271  1.00 39.61  ? 732  TYR A CA  1 
ATOM 4749  C C   . TYR A 1 732  ? 29.127  3.097   79.152  1.00 19.49  ? 732  TYR A C   1 
ATOM 4750  O O   . TYR A 1 732  ? 28.626  4.231   79.207  1.00 12.12  ? 732  TYR A O   1 
ATOM 4751  C CB  . TYR A 1 732  ? 31.249  2.534   77.909  1.00 45.53  ? 732  TYR A CB  1 
ATOM 4752  H H   . TYR A 1 732  ? 31.454  1.226   79.959  1.00 54.46  ? 732  TYR A H   1 
ATOM 4753  H HA  . TYR A 1 732  ? 31.027  3.713   79.582  1.00 47.53  ? 732  TYR A HA  1 
ATOM 4754  N N   . TYR A 1 733  ? 28.389  2.002   79.006  1.00 17.69  ? 733  TYR A N   1 
ATOM 4755  C CA  . TYR A 1 733  ? 26.942  2.123   78.943  1.00 14.14  ? 733  TYR A CA  1 
ATOM 4756  C C   . TYR A 1 733  ? 26.442  2.974   80.080  1.00 15.40  ? 733  TYR A C   1 
ATOM 4757  O O   . TYR A 1 733  ? 25.905  4.057   79.854  1.00 16.54  ? 733  TYR A O   1 
ATOM 4758  C CB  . TYR A 1 733  ? 26.266  0.757   78.987  1.00 17.22  ? 733  TYR A CB  1 
ATOM 4759  H H   . TYR A 1 733  ? 28.693  1.199   78.942  1.00 21.23  ? 733  TYR A H   1 
ATOM 4760  H HA  . TYR A 1 733  ? 26.695  2.555   78.111  1.00 16.96  ? 733  TYR A HA  1 
ATOM 4761  N N   . ARG A 1 734  ? 26.645  2.536   81.315  1.00 17.33  ? 734  ARG A N   1 
ATOM 4762  C CA  . ARG A 1 734  ? 26.160  3.338   82.420  1.00 17.50  ? 734  ARG A CA  1 
ATOM 4763  C C   . ARG A 1 734  ? 26.725  4.742   82.357  1.00 13.67  ? 734  ARG A C   1 
ATOM 4764  O O   . ARG A 1 734  ? 26.082  5.694   82.812  1.00 15.28  ? 734  ARG A O   1 
ATOM 4765  C CB  . ARG A 1 734  ? 26.519  2.677   83.751  1.00 17.52  ? 734  ARG A CB  1 
ATOM 4766  H H   . ARG A 1 734  ? 27.045  1.807   81.532  1.00 20.80  ? 734  ARG A H   1 
ATOM 4767  H HA  . ARG A 1 734  ? 25.194  3.400   82.366  1.00 21.00  ? 734  ARG A HA  1 
ATOM 4768  N N   . TYR A 1 735  ? 27.885  4.900   81.737  1.00 13.56  ? 735  TYR A N   1 
ATOM 4769  C CA  . TYR A 1 735  ? 28.640  6.127   81.868  1.00 15.27  ? 735  TYR A CA  1 
ATOM 4770  C C   . TYR A 1 735  ? 28.065  7.259   81.030  1.00 16.48  ? 735  TYR A C   1 
ATOM 4771  O O   . TYR A 1 735  ? 28.134  8.421   81.441  1.00 19.22  ? 735  TYR A O   1 
ATOM 4772  C CB  . TYR A 1 735  ? 30.088  5.875   81.473  1.00 27.72  ? 735  TYR A CB  1 
ATOM 4773  H H   . TYR A 1 735  ? 28.254  4.308   81.235  1.00 16.27  ? 735  TYR A H   1 
ATOM 4774  H HA  . TYR A 1 735  ? 28.628  6.407   82.797  1.00 18.33  ? 735  TYR A HA  1 
ATOM 4775  N N   . GLN A 1 736  ? 27.518  6.947   79.855  1.00 18.29  ? 736  GLN A N   1 
ATOM 4776  C CA  . GLN A 1 736  ? 27.132  8.007   78.927  1.00 19.08  ? 736  GLN A CA  1 
ATOM 4777  C C   . GLN A 1 736  ? 26.250  9.052   79.591  1.00 12.86  ? 736  GLN A C   1 
ATOM 4778  O O   . GLN A 1 736  ? 26.300  10.232  79.229  1.00 10.95  ? 736  GLN A O   1 
ATOM 4779  C CB  . GLN A 1 736  ? 26.397  7.410   77.748  1.00 19.26  ? 736  GLN A CB  1 
ATOM 4780  H H   . GLN A 1 736  ? 27.364  6.148   79.577  1.00 21.94  ? 736  GLN A H   1 
ATOM 4781  H HA  . GLN A 1 736  ? 27.929  8.449   78.596  1.00 22.89  ? 736  GLN A HA  1 
ATOM 4782  N N   . LEU A 1 737  ? 25.393  8.626   80.516  1.00 12.24  ? 737  LEU A N   1 
ATOM 4783  C CA  . LEU A 1 737  ? 24.619  9.578   81.284  1.00 11.64  ? 737  LEU A CA  1 
ATOM 4784  C C   . LEU A 1 737  ? 25.555  10.443  82.084  1.00 12.02  ? 737  LEU A C   1 
ATOM 4785  O O   . LEU A 1 737  ? 26.533  9.963   82.661  1.00 11.70  ? 737  LEU A O   1 
ATOM 4786  C CB  . LEU A 1 737  ? 23.667  8.889   82.243  1.00 14.35  ? 737  LEU A CB  1 
ATOM 4787  H H   . LEU A 1 737  ? 25.247  7.801   80.711  1.00 14.69  ? 737  LEU A H   1 
ATOM 4788  H HA  . LEU A 1 737  ? 24.105  10.143  80.686  1.00 13.96  ? 737  LEU A HA  1 
ATOM 4789  N N   . ASN A 1 738  ? 25.239  11.721  82.144  1.00 13.09  ? 738  ASN A N   1 
ATOM 4790  C CA  . ASN A 1 738  ? 26.096  12.618  82.876  1.00 16.79  ? 738  ASN A CA  1 
ATOM 4791  C C   . ASN A 1 738  ? 27.466  12.521  82.204  1.00 16.70  ? 738  ASN A C   1 
ATOM 4792  O O   . ASN A 1 738  ? 27.535  12.634  80.970  1.00 21.57  ? 738  ASN A O   1 
ATOM 4793  C CB  . ASN A 1 738  ? 26.038  12.215  84.344  1.00 31.22  ? 738  ASN A CB  1 
ATOM 4794  H H   . ASN A 1 738  ? 24.550  12.084  81.779  1.00 15.71  ? 738  ASN A H   1 
ATOM 4795  H HA  . ASN A 1 738  ? 25.770  13.528  82.790  1.00 20.15  ? 738  ASN A HA  1 
ATOM 4796  N N   . LEU A 1 739  ? 28.547  12.280  82.946  1.00 15.32  ? 739  LEU A N   1 
ATOM 4797  C CA  . LEU A 1 739  ? 29.871  12.078  82.374  1.00 16.76  ? 739  LEU A CA  1 
ATOM 4798  C C   . LEU A 1 739  ? 30.194  13.103  81.291  1.00 21.24  ? 739  LEU A C   1 
ATOM 4799  O O   . LEU A 1 739  ? 31.016  13.991  81.532  1.00 23.26  ? 739  LEU A O   1 
ATOM 4800  C CB  . LEU A 1 739  ? 29.982  10.660  81.816  1.00 21.01  ? 739  LEU A CB  1 
ATOM 4801  H HA  . LEU A 1 739  ? 30.532  12.172  83.077  1.00 20.11  ? 739  LEU A HA  1 
ATOM 4802  N N   . PHE A 1 740  ? 29.549  12.997  80.113  1.00 21.26  ? 740  PHE A N   1 
ATOM 4803  C CA  . PHE A 1 740  ? 29.906  13.769  78.921  1.00 21.98  ? 740  PHE A CA  1 
ATOM 4804  C C   . PHE A 1 740  ? 30.397  15.150  79.330  1.00 25.49  ? 740  PHE A C   1 
ATOM 4805  O O   . PHE A 1 740  ? 29.710  16.155  79.127  1.00 27.82  ? 740  PHE A O   1 
ATOM 4806  C CB  . PHE A 1 740  ? 28.720  13.867  77.957  1.00 14.91  ? 740  PHE A CB  1 
ATOM 4807  H H   . PHE A 1 740  ? 28.885  12.467  79.984  1.00 25.51  ? 740  PHE A H   1 
ATOM 4808  H HA  . PHE A 1 740  ? 30.630  13.318  78.459  1.00 26.38  ? 740  PHE A HA  1 
ATOM 4809  N N   . ALA A 1 741  ? 31.582  15.187  79.947  1.00 28.90  ? 741  ALA A N   1 
ATOM 4810  C CA  . ALA A 1 741  ? 32.144  16.414  80.493  1.00 28.99  ? 741  ALA A CA  1 
ATOM 4811  C C   . ALA A 1 741  ? 32.847  17.257  79.423  1.00 45.26  ? 741  ALA A C   1 
ATOM 4812  O O   . ALA A 1 741  ? 32.782  18.489  79.479  1.00 61.65  ? 741  ALA A O   1 
ATOM 4813  C CB  . ALA A 1 741  ? 33.103  16.074  81.639  1.00 33.26  ? 741  ALA A CB  1 
ATOM 4814  H H   . ALA A 1 741  ? 32.085  14.499  80.061  1.00 34.68  ? 741  ALA A H   1 
ATOM 4815  H HA  . ALA A 1 741  ? 31.423  16.949  80.861  1.00 34.78  ? 741  ALA A HA  1 
ATOM 4816  H HB1 . ALA A 1 741  ? 33.472  16.897  81.997  1.00 39.91  ? 741  ALA A HB1 1 
ATOM 4817  H HB2 . ALA A 1 741  ? 32.613  15.603  82.331  1.00 39.91  ? 741  ALA A HB2 1 
ATOM 4818  H HB3 . ALA A 1 741  ? 33.816  15.512  81.298  1.00 39.91  ? 741  ALA A HB3 1 
ATOM 4819  N N   . ARG A 1 742  ? 33.530  16.627  78.449  1.00 46.86  ? 742  ARG A N   1 
ATOM 4820  C CA  . ARG A 1 742  ? 34.214  17.332  77.350  1.00 45.49  ? 742  ARG A CA  1 
ATOM 4821  C C   . ARG A 1 742  ? 35.522  17.995  77.786  1.00 47.03  ? 742  ARG A C   1 
ATOM 4822  O O   . ARG A 1 742  ? 35.937  17.849  78.938  1.00 69.35  ? 742  ARG A O   1 
ATOM 4823  C CB  . ARG A 1 742  ? 33.292  18.385  76.737  1.00 44.72  ? 742  ARG A CB  1 
ATOM 4824  H HA  . ARG A 1 742  ? 34.429  16.689  76.656  1.00 54.59  ? 742  ARG A HA  1 
ATOM 4825  N N   . MET A 1 743  ? 36.189  18.730  76.891  1.00 52.90  ? 743  MET A N   1 
ATOM 4826  C CA  . MET A 1 743  ? 37.454  19.369  77.266  1.00 62.35  ? 743  MET A CA  1 
ATOM 4827  C C   . MET A 1 743  ? 37.837  20.438  76.251  1.00 70.74  ? 743  MET A C   1 
ATOM 4828  O O   . MET A 1 743  ? 37.540  20.298  75.057  1.00 88.75  ? 743  MET A O   1 
ATOM 4829  C CB  . MET A 1 743  ? 38.576  18.335  77.371  1.00 66.82  ? 743  MET A CB  1 
ATOM 4830  H H   . MET A 1 743  ? 35.938  18.871  76.080  1.00 63.47  ? 743  MET A H   1 
ATOM 4831  H HA  . MET A 1 743  ? 37.349  19.785  78.136  1.00 74.83  ? 743  MET A HA  1 
ATOM 4832  N N   . CYS A 1 744  ? 38.538  21.481  76.740  1.00 65.34  ? 744  CYS A N   1 
ATOM 4833  C CA  . CYS A 1 744  ? 38.815  22.732  76.015  1.00 55.15  ? 744  CYS A CA  1 
ATOM 4834  C C   . CYS A 1 744  ? 40.295  22.918  75.668  1.00 42.41  ? 744  CYS A C   1 
ATOM 4835  O O   . CYS A 1 744  ? 40.697  24.010  75.243  1.00 38.61  ? 744  CYS A O   1 
ATOM 4836  C CB  . CYS A 1 744  ? 38.325  23.939  76.819  1.00 47.14  ? 744  CYS A CB  1 
ATOM 4837  N N   . LEU A 1 745  ? 41.096  21.859  75.805  1.00 39.92  ? 745  LEU A N   1 
ATOM 4838  C CA  . LEU A 1 745  ? 42.531  21.946  75.614  1.00 31.66  ? 745  LEU A CA  1 
ATOM 4839  C C   . LEU A 1 745  ? 43.134  22.510  76.888  1.00 25.69  ? 745  LEU A C   1 
ATOM 4840  O O   . LEU A 1 745  ? 42.494  23.295  77.592  1.00 25.24  ? 745  LEU A O   1 
ATOM 4841  C CB  . LEU A 1 745  ? 42.898  22.813  74.406  1.00 26.24  ? 745  LEU A CB  1 
ATOM 4842  H HA  . LEU A 1 745  ? 42.891  21.056  75.473  1.00 38.00  ? 745  LEU A HA  1 
ATOM 4843  N N   . ASP A 1 746  ? 44.362  22.113  77.189  1.00 21.41  ? 746  ASP A N   1 
ATOM 4844  C CA  . ASP A 1 746  ? 44.962  22.480  78.455  1.00 19.51  ? 746  ASP A CA  1 
ATOM 4845  C C   . ASP A 1 746  ? 45.449  23.913  78.459  1.00 10.32  ? 746  ASP A C   1 
ATOM 4846  O O   . ASP A 1 746  ? 45.451  24.550  79.515  1.00 8.83   ? 746  ASP A O   1 
ATOM 4847  C CB  . ASP A 1 746  ? 46.131  21.549  78.749  1.00 45.19  ? 746  ASP A CB  1 
ATOM 4848  H H   . ASP A 1 746  ? 44.863  21.635  76.680  1.00 25.69  ? 746  ASP A H   1 
ATOM 4849  H HA  . ASP A 1 746  ? 44.306  22.379  79.162  1.00 23.42  ? 746  ASP A HA  1 
ATOM 4850  N N   . ARG A 1 747  ? 45.866  24.423  77.307  1.00 8.73   ? 747  ARG A N   1 
ATOM 4851  C CA  . ARG A 1 747  ? 46.557  25.689  77.201  1.00 8.73   ? 747  ARG A CA  1 
ATOM 4852  C C   . ARG A 1 747  ? 45.732  26.581  76.291  1.00 8.73   ? 747  ARG A C   1 
ATOM 4853  O O   . ARG A 1 747  ? 45.507  26.232  75.130  1.00 8.73   ? 747  ARG A O   1 
ATOM 4854  C CB  . ARG A 1 747  ? 47.965  25.474  76.649  1.00 8.73   ? 747  ARG A CB  1 
ATOM 4855  H H   . ARG A 1 747  ? 45.752  24.034  76.548  1.00 10.48  ? 747  ARG A H   1 
ATOM 4856  H HA  . ARG A 1 747  ? 46.622  26.105  78.075  1.00 10.48  ? 747  ARG A HA  1 
ATOM 4857  N N   . GLN A 1 748  ? 45.264  27.715  76.818  1.00 11.77  ? 748  GLN A N   1 
ATOM 4858  C CA  . GLN A 1 748  ? 44.392  28.589  76.041  1.00 12.83  ? 748  GLN A CA  1 
ATOM 4859  C C   . GLN A 1 748  ? 44.569  30.054  76.472  1.00 15.56  ? 748  GLN A C   1 
ATOM 4860  O O   . GLN A 1 748  ? 43.598  30.816  76.539  1.00 19.21  ? 748  GLN A O   1 
ATOM 4861  C CB  . GLN A 1 748  ? 42.935  28.130  76.148  1.00 10.82  ? 748  GLN A CB  1 
ATOM 4862  H HA  . GLN A 1 748  ? 44.648  28.528  75.108  1.00 15.40  ? 748  GLN A HA  1 
ATOM 4863  N N   . TYR A 1 749  ? 45.825  30.460  76.730  1.00 15.71  ? 749  TYR A N   1 
ATOM 4864  C CA  . TYR A 1 749  ? 46.219  31.838  77.051  1.00 14.15  ? 749  TYR A CA  1 
ATOM 4865  C C   . TYR A 1 749  ? 47.656  32.070  76.571  1.00 14.74  ? 749  TYR A C   1 
ATOM 4866  O O   . TYR A 1 749  ? 48.259  31.219  75.917  1.00 15.10  ? 749  TYR A O   1 
ATOM 4867  C CB  . TYR A 1 749  ? 46.105  32.129  78.554  1.00 8.67   ? 749  TYR A CB  1 
ATOM 4868  H HA  . TYR A 1 749  ? 45.638  32.454  76.578  1.00 16.98  ? 749  TYR A HA  1 
ATOM 4869  N N   . LEU A 1 750  ? 48.198  33.251  76.884  1.00 18.88  ? 750  LEU A N   1 
ATOM 4870  C CA  . LEU A 1 750  ? 49.599  33.518  76.572  1.00 22.49  ? 750  LEU A CA  1 
ATOM 4871  C C   . LEU A 1 750  ? 50.529  32.741  77.493  1.00 25.37  ? 750  LEU A C   1 
ATOM 4872  O O   . LEU A 1 750  ? 51.613  32.321  77.074  1.00 24.66  ? 750  LEU A O   1 
ATOM 4873  C CB  . LEU A 1 750  ? 49.897  35.011  76.685  1.00 25.49  ? 750  LEU A CB  1 
ATOM 4874  H H   . LEU A 1 750  ? 47.784  33.899  77.268  1.00 22.65  ? 750  LEU A H   1 
ATOM 4875  H HA  . LEU A 1 750  ? 49.779  33.242  75.659  1.00 26.99  ? 750  LEU A HA  1 
ATOM 4876  N N   . ALA A 1 751  ? 50.124  32.554  78.754  1.00 31.82  ? 751  ALA A N   1 
ATOM 4877  C CA  . ALA A 1 751  ? 50.967  31.885  79.740  1.00 35.47  ? 751  ALA A CA  1 
ATOM 4878  C C   . ALA A 1 751  ? 51.267  30.448  79.335  1.00 31.03  ? 751  ALA A C   1 
ATOM 4879  O O   . ALA A 1 751  ? 52.370  29.941  79.575  1.00 25.83  ? 751  ALA A O   1 
ATOM 4880  C CB  . ALA A 1 751  ? 50.275  31.899  81.104  1.00 42.51  ? 751  ALA A CB  1 
ATOM 4881  H H   . ALA A 1 751  ? 49.361  32.807  79.060  1.00 38.18  ? 751  ALA A H   1 
ATOM 4882  H HA  . ALA A 1 751  ? 51.808  32.362  79.819  1.00 42.56  ? 751  ALA A HA  1 
ATOM 4883  H HB1 . ALA A 1 751  ? 50.844  31.453  81.751  1.00 51.02  ? 751  ALA A HB1 1 
ATOM 4884  H HB2 . ALA A 1 751  ? 50.126  32.819  81.373  1.00 51.02  ? 751  ALA A HB2 1 
ATOM 4885  H HB3 . ALA A 1 751  ? 49.427  31.434  81.032  1.00 51.02  ? 751  ALA A HB3 1 
ATOM 4886  N N   . ILE A 1 752  ? 50.271  29.769  78.761  1.00 38.65  ? 752  ILE A N   1 
ATOM 4887  C CA  . ILE A 1 752  ? 50.390  28.353  78.414  1.00 35.34  ? 752  ILE A CA  1 
ATOM 4888  C C   . ILE A 1 752  ? 51.426  28.136  77.314  1.00 28.04  ? 752  ILE A C   1 
ATOM 4889  O O   . ILE A 1 752  ? 52.082  27.085  77.254  1.00 20.31  ? 752  ILE A O   1 
ATOM 4890  C CB  . ILE A 1 752  ? 49.014  27.807  77.997  1.00 44.03  ? 752  ILE A CB  1 
ATOM 4891  H H   . ILE A 1 752  ? 49.508  30.112  78.561  1.00 46.38  ? 752  ILE A H   1 
ATOM 4892  H HA  . ILE A 1 752  ? 50.680  27.861  79.198  1.00 42.41  ? 752  ILE A HA  1 
ATOM 4893  N N   . ASN A 1 753  ? 51.549  29.094  76.395  1.00 28.79  ? 753  ASN A N   1 
ATOM 4894  C CA  . ASN A 1 753  ? 52.647  29.046  75.452  1.00 21.32  ? 753  ASN A CA  1 
ATOM 4895  C C   . ASN A 1 753  ? 53.969  29.046  76.208  1.00 33.51  ? 753  ASN A C   1 
ATOM 4896  O O   . ASN A 1 753  ? 54.826  28.190  75.964  1.00 37.17  ? 753  ASN A O   1 
ATOM 4897  C CB  . ASN A 1 753  ? 52.554  30.227  74.482  1.00 22.36  ? 753  ASN A CB  1 
ATOM 4898  H H   . ASN A 1 753  ? 51.019  29.765  76.302  1.00 34.55  ? 753  ASN A H   1 
ATOM 4899  H HA  . ASN A 1 753  ? 52.591  28.225  74.938  1.00 25.59  ? 753  ASN A HA  1 
ATOM 4900  N N   . GLU A 1 754  ? 54.120  29.958  77.185  1.00 38.47  ? 754  GLU A N   1 
ATOM 4901  C CA  . GLU A 1 754  ? 55.363  30.068  77.956  1.00 34.98  ? 754  GLU A CA  1 
ATOM 4902  C C   . GLU A 1 754  ? 55.633  28.813  78.781  1.00 31.32  ? 754  GLU A C   1 
ATOM 4903  O O   . GLU A 1 754  ? 56.796  28.443  79.015  1.00 26.81  ? 754  GLU A O   1 
ATOM 4904  C CB  . GLU A 1 754  ? 55.293  31.296  78.866  1.00 26.54  ? 754  GLU A CB  1 
ATOM 4905  H H   . GLU A 1 754  ? 53.514  30.522  77.418  1.00 46.17  ? 754  GLU A H   1 
ATOM 4906  H HA  . GLU A 1 754  ? 56.105  30.190  77.343  1.00 41.98  ? 754  GLU A HA  1 
ATOM 4907  N N   . ILE A 1 755  ? 54.566  28.160  79.243  1.00 29.99  ? 755  ILE A N   1 
ATOM 4908  C CA  . ILE A 1 755  ? 54.684  26.913  79.986  1.00 34.75  ? 755  ILE A CA  1 
ATOM 4909  C C   . ILE A 1 755  ? 55.118  25.773  79.069  1.00 31.96  ? 755  ILE A C   1 
ATOM 4910  O O   . ILE A 1 755  ? 56.134  25.110  79.313  1.00 27.22  ? 755  ILE A O   1 
ATOM 4911  C CB  . ILE A 1 755  ? 53.346  26.589  80.674  1.00 42.55  ? 755  ILE A CB  1 
ATOM 4912  H H   . ILE A 1 755  ? 53.755  28.425  79.136  1.00 35.98  ? 755  ILE A H   1 
ATOM 4913  H HA  . ILE A 1 755  ? 55.359  27.018  80.675  1.00 41.70  ? 755  ILE A HA  1 
ATOM 4914  N N   . SER A 1 756  ? 54.340  25.513  78.014  1.00 26.45  ? 756  SER A N   1 
ATOM 4915  C CA  . SER A 1 756  ? 54.714  24.485  77.061  1.00 24.22  ? 756  SER A CA  1 
ATOM 4916  C C   . SER A 1 756  ? 56.178  24.653  76.639  1.00 32.57  ? 756  SER A C   1 
ATOM 4917  O O   . SER A 1 756  ? 56.914  23.664  76.526  1.00 25.29  ? 756  SER A O   1 
ATOM 4918  C CB  . SER A 1 756  ? 53.756  24.546  75.868  1.00 22.89  ? 756  SER A CB  1 
ATOM 4919  H H   . SER A 1 756  ? 53.602  25.917  77.836  1.00 31.74  ? 756  SER A H   1 
ATOM 4920  H HA  . SER A 1 756  ? 54.619  23.615  77.479  1.00 29.07  ? 756  SER A HA  1 
ATOM 4921  N N   . GLY A 1 757  ? 56.629  25.906  76.448  1.00 45.19  ? 757  GLY A N   1 
ATOM 4922  C CA  . GLY A 1 757  ? 58.027  26.163  76.102  1.00 36.31  ? 757  GLY A CA  1 
ATOM 4923  C C   . GLY A 1 757  ? 59.011  25.869  77.222  1.00 27.98  ? 757  GLY A C   1 
ATOM 4924  O O   . GLY A 1 757  ? 60.116  25.382  76.970  1.00 35.74  ? 757  GLY A O   1 
ATOM 4925  H H   . GLY A 1 757  ? 56.145  26.613  76.514  1.00 54.23  ? 757  GLY A H   1 
ATOM 4926  H HA2 . GLY A 1 757  ? 58.270  25.618  75.337  1.00 43.57  ? 757  GLY A HA2 1 
ATOM 4927  H HA3 . GLY A 1 757  ? 58.125  27.095  75.852  1.00 43.57  ? 757  GLY A HA3 1 
ATOM 4928  N N   . GLN A 1 758  ? 58.645  26.187  78.466  1.00 19.15  ? 758  GLN A N   1 
ATOM 4929  C CA  . GLN A 1 758  ? 59.494  25.810  79.585  1.00 14.72  ? 758  GLN A CA  1 
ATOM 4930  C C   . GLN A 1 758  ? 59.581  24.295  79.748  1.00 14.20  ? 758  GLN A C   1 
ATOM 4931  O O   . GLN A 1 758  ? 60.585  23.790  80.255  1.00 12.84  ? 758  GLN A O   1 
ATOM 4932  C CB  . GLN A 1 758  ? 58.970  26.458  80.861  1.00 8.70   ? 758  GLN A CB  1 
ATOM 4933  H H   . GLN A 1 758  ? 57.928  26.611  78.680  1.00 22.99  ? 758  GLN A H   1 
ATOM 4934  H HA  . GLN A 1 758  ? 60.391  26.145  79.427  1.00 17.67  ? 758  GLN A HA  1 
ATOM 4935  N N   . LEU A 1 759  ? 58.563  23.550  79.309  1.00 12.29  ? 759  LEU A N   1 
ATOM 4936  C CA  . LEU A 1 759  ? 58.505  22.114  79.556  1.00 9.07   ? 759  LEU A CA  1 
ATOM 4937  C C   . LEU A 1 759  ? 59.368  21.291  78.607  1.00 8.79   ? 759  LEU A C   1 
ATOM 4938  O O   . LEU A 1 759  ? 59.536  20.093  78.852  1.00 8.79   ? 759  LEU A O   1 
ATOM 4939  C CB  . LEU A 1 759  ? 57.055  21.641  79.461  1.00 11.81  ? 759  LEU A CB  1 
ATOM 4940  H H   . LEU A 1 759  ? 57.894  23.857  78.865  1.00 14.75  ? 759  LEU A H   1 
ATOM 4941  H HA  . LEU A 1 759  ? 58.814  21.941  80.459  1.00 10.89  ? 759  LEU A HA  1 
ATOM 4942  N N   . ASP A 1 760  ? 59.902  21.888  77.539  1.00 9.61   ? 760  ASP A N   1 
ATOM 4943  C CA  . ASP A 1 760  ? 60.769  21.193  76.585  1.00 8.90   ? 760  ASP A CA  1 
ATOM 4944  C C   . ASP A 1 760  ? 59.960  20.344  75.602  1.00 8.90   ? 760  ASP A C   1 
ATOM 4945  O O   . ASP A 1 760  ? 60.402  19.277  75.189  1.00 8.90   ? 760  ASP A O   1 
ATOM 4946  C CB  . ASP A 1 760  ? 61.803  20.334  77.311  1.00 8.90   ? 760  ASP A CB  1 
ATOM 4947  H HA  . ASP A 1 760  ? 61.253  21.857  76.069  1.00 10.68  ? 760  ASP A HA  1 
ATOM 4948  N N   . VAL A 1 761  ? 58.775  20.824  75.224  1.00 9.12   ? 761  VAL A N   1 
ATOM 4949  C CA  . VAL A 1 761  ? 57.913  20.133  74.263  1.00 15.78  ? 761  VAL A CA  1 
ATOM 4950  C C   . VAL A 1 761  ? 57.329  18.837  74.837  1.00 48.34  ? 761  VAL A C   1 
ATOM 4951  O O   . VAL A 1 761  ? 56.615  18.887  75.842  1.00 81.34  ? 761  VAL A O   1 
ATOM 4952  C CB  . VAL A 1 761  ? 58.674  19.853  72.960  1.00 9.12   ? 761  VAL A CB  1 
ATOM 4953  H H   . VAL A 1 761  ? 58.442  21.562  75.515  1.00 10.94  ? 761  VAL A H   1 
ATOM 4954  H HA  . VAL A 1 761  ? 57.168  20.715  74.046  1.00 18.94  ? 761  VAL A HA  1 
ATOM 4955  N N   . ASP A 1 762  ? 57.584  17.675  74.182  1.00 56.02  ? 762  ASP A N   1 
ATOM 4956  C CA  . ASP A 1 762  ? 57.182  16.326  74.640  1.00 62.38  ? 762  ASP A CA  1 
ATOM 4957  C C   . ASP A 1 762  ? 55.924  15.745  73.973  1.00 58.81  ? 762  ASP A C   1 
ATOM 4958  O O   . ASP A 1 762  ? 55.820  14.519  73.764  1.00 51.85  ? 762  ASP A O   1 
ATOM 4959  C CB  . ASP A 1 762  ? 56.962  16.307  76.154  1.00 75.41  ? 762  ASP A CB  1 
ATOM 4960  H H   . ASP A 1 762  ? 58.010  17.651  73.435  1.00 67.23  ? 762  ASP A H   1 
ATOM 4961  H HA  . ASP A 1 762  ? 57.911  15.716  74.449  1.00 74.85  ? 762  ASP A HA  1 
ATOM 4962  N N   . LEU A 1 763  ? 54.953  16.613  73.667  1.00 61.32  ? 763  LEU A N   1 
ATOM 4963  C CA  . LEU A 1 763  ? 53.746  16.173  72.976  1.00 61.42  ? 763  LEU A CA  1 
ATOM 4964  C C   . LEU A 1 763  ? 54.088  15.457  71.670  1.00 58.68  ? 763  LEU A C   1 
ATOM 4965  O O   . LEU A 1 763  ? 53.396  14.510  71.274  1.00 42.08  ? 763  LEU A O   1 
ATOM 4966  C CB  . LEU A 1 763  ? 52.833  17.377  72.717  1.00 47.01  ? 763  LEU A CB  1 
ATOM 4967  H H   . LEU A 1 763  ? 54.972  17.454  73.849  1.00 73.59  ? 763  LEU A H   1 
ATOM 4968  H HA  . LEU A 1 763  ? 53.267  15.549  73.544  1.00 73.71  ? 763  LEU A HA  1 
ATOM 4969  N N   . ILE A 1 764  ? 55.153  15.901  70.989  1.00 78.51  ? 764  ILE A N   1 
ATOM 4970  C CA  . ILE A 1 764  ? 55.604  15.249  69.764  1.00 70.62  ? 764  ILE A CA  1 
ATOM 4971  C C   . ILE A 1 764  ? 56.192  13.882  70.077  1.00 60.37  ? 764  ILE A C   1 
ATOM 4972  O O   . ILE A 1 764  ? 55.900  12.899  69.388  1.00 51.13  ? 764  ILE A O   1 
ATOM 4973  C CB  . ILE A 1 764  ? 56.623  16.145  69.031  1.00 90.24  ? 764  ILE A CB  1 
ATOM 4974  H H   . ILE A 1 764  ? 55.629  16.579  71.221  1.00 94.21  ? 764  ILE A H   1 
ATOM 4975  H HA  . ILE A 1 764  ? 54.843  15.120  69.177  1.00 84.74  ? 764  ILE A HA  1 
ATOM 4976  N N   . LEU A 1 765  ? 57.028  13.800  71.120  1.00 59.37  ? 765  LEU A N   1 
ATOM 4977  C CA  . LEU A 1 765  ? 57.630  12.534  71.510  1.00 54.12  ? 765  LEU A CA  1 
ATOM 4978  C C   . LEU A 1 765  ? 56.566  11.461  71.682  1.00 52.74  ? 765  LEU A C   1 
ATOM 4979  O O   . LEU A 1 765  ? 56.729  10.341  71.188  1.00 56.33  ? 765  LEU A O   1 
ATOM 4980  C CB  . LEU A 1 765  ? 58.435  12.718  72.798  1.00 48.23  ? 765  LEU A CB  1 
ATOM 4981  H H   . LEU A 1 765  ? 57.259  14.466  71.613  1.00 71.25  ? 765  LEU A H   1 
ATOM 4982  H HA  . LEU A 1 765  ? 58.239  12.245  70.813  1.00 64.94  ? 765  LEU A HA  1 
ATOM 4983  N N   . ARG A 1 766  ? 55.470  11.775  72.385  1.00 52.15  ? 766  ARG A N   1 
ATOM 4984  C CA  . ARG A 1 766  ? 54.344  10.836  72.427  1.00 50.57  ? 766  ARG A CA  1 
ATOM 4985  C C   . ARG A 1 766  ? 53.670  10.703  71.052  1.00 39.01  ? 766  ARG A C   1 
ATOM 4986  O O   . ARG A 1 766  ? 53.269  9.597   70.616  1.00 36.64  ? 766  ARG A O   1 
ATOM 4987  C CB  . ARG A 1 766  ? 53.322  11.301  73.467  1.00 39.67  ? 766  ARG A CB  1 
ATOM 4988  H H   . ARG A 1 766  ? 55.356  12.501  72.832  1.00 62.58  ? 766  ARG A H   1 
ATOM 4989  H HA  . ARG A 1 766  ? 54.668  9.960   72.691  1.00 60.68  ? 766  ARG A HA  1 
ATOM 4990  N N   . CYS A 1 767  ? 53.578  11.829  70.350  1.00 29.67  ? 767  CYS A N   1 
ATOM 4991  C CA  . CYS A 1 767  ? 52.705  11.967  69.208  1.00 26.71  ? 767  CYS A CA  1 
ATOM 4992  C C   . CYS A 1 767  ? 53.215  11.257  67.958  1.00 37.43  ? 767  CYS A C   1 
ATOM 4993  O O   . CYS A 1 767  ? 52.424  11.045  67.036  1.00 40.69  ? 767  CYS A O   1 
ATOM 4994  C CB  . CYS A 1 767  ? 52.490  13.453  68.912  1.00 23.87  ? 767  CYS A CB  1 
ATOM 4995  H H   . CYS A 1 767  ? 54.026  12.542  70.527  1.00 35.60  ? 767  CYS A H   1 
ATOM 4996  H HA  . CYS A 1 767  ? 51.842  11.583  69.430  1.00 32.06  ? 767  CYS A HA  1 
ATOM 4997  N N   . MET A 1 768  ? 54.509  10.897  67.892  1.00 41.00  ? 768  MET A N   1 
ATOM 4998  C CA  . MET A 1 768  ? 55.043  10.191  66.723  1.00 38.03  ? 768  MET A CA  1 
ATOM 4999  C C   . MET A 1 768  ? 54.638  8.705   66.719  1.00 35.99  ? 768  MET A C   1 
ATOM 5000  O O   . MET A 1 768  ? 53.973  8.229   65.788  1.00 29.69  ? 768  MET A O   1 
ATOM 5001  C CB  . MET A 1 768  ? 56.572  10.344  66.672  1.00 31.70  ? 768  MET A CB  1 
ATOM 5002  H H   . MET A 1 768  ? 55.090  11.051  68.507  1.00 49.20  ? 768  MET A H   1 
ATOM 5003  H HA  . MET A 1 768  ? 54.684  10.607  65.924  1.00 45.64  ? 768  MET A HA  1 
ATOM 5004  N N   . SER A 1 769  ? 55.066  7.946   67.737  1.00 33.46  ? 769  SER A N   1 
ATOM 5005  C CA  . SER A 1 769  ? 54.589  6.580   67.917  1.00 17.23  ? 769  SER A CA  1 
ATOM 5006  C C   . SER A 1 769  ? 53.114  6.528   67.693  1.00 12.40  ? 769  SER A C   1 
ATOM 5007  O O   . SER A 1 769  ? 52.628  5.905   66.751  1.00 8.84   ? 769  SER A O   1 
ATOM 5008  C CB  . SER A 1 769  ? 54.862  6.105   69.340  1.00 19.30  ? 769  SER A CB  1 
ATOM 5009  H H   . SER A 1 769  ? 55.631  8.204   68.331  1.00 40.16  ? 769  SER A H   1 
ATOM 5010  H HA  . SER A 1 769  ? 55.030  5.985   67.291  1.00 20.68  ? 769  SER A HA  1 
ATOM 5011  N N   . ASP A 1 770  ? 52.380  7.214   68.545  1.00 17.81  ? 770  ASP A N   1 
ATOM 5012  C CA  . ASP A 1 770  ? 50.952  7.118   68.409  1.00 25.03  ? 770  ASP A CA  1 
ATOM 5013  C C   . ASP A 1 770  ? 50.552  7.409   66.974  1.00 26.82  ? 770  ASP A C   1 
ATOM 5014  O O   . ASP A 1 770  ? 50.048  6.528   66.267  1.00 27.64  ? 770  ASP A O   1 
ATOM 5015  C CB  . ASP A 1 770  ? 50.288  8.088   69.376  1.00 45.44  ? 770  ASP A CB  1 
ATOM 5016  H H   . ASP A 1 770  ? 52.669  7.718   69.180  1.00 21.37  ? 770  ASP A H   1 
ATOM 5017  H HA  . ASP A 1 770  ? 50.665  6.218   68.631  1.00 30.03  ? 770  ASP A HA  1 
ATOM 5018  N N   . GLU A 1 771  ? 50.912  8.597   66.488  1.00 32.04  ? 771  GLU A N   1 
ATOM 5019  C CA  . GLU A 1 771  ? 50.258  9.140   65.308  1.00 34.49  ? 771  GLU A CA  1 
ATOM 5020  C C   . GLU A 1 771  ? 50.604  8.312   64.084  1.00 41.19  ? 771  GLU A C   1 
ATOM 5021  O O   . GLU A 1 771  ? 49.713  7.892   63.335  1.00 44.99  ? 771  GLU A O   1 
ATOM 5022  C CB  . GLU A 1 771  ? 50.667  10.603  65.115  1.00 39.45  ? 771  GLU A CB  1 
ATOM 5023  H H   . GLU A 1 771  ? 51.525  9.100   66.821  1.00 38.45  ? 771  GLU A H   1 
ATOM 5024  H HA  . GLU A 1 771  ? 49.297  9.109   65.433  1.00 41.38  ? 771  GLU A HA  1 
ATOM 5025  N N   . ASN A 1 772  ? 51.895  8.046   63.887  1.00 43.59  ? 772  ASN A N   1 
ATOM 5026  C CA  . ASN A 1 772  ? 52.378  7.270   62.761  1.00 41.41  ? 772  ASN A CA  1 
ATOM 5027  C C   . ASN A 1 772  ? 52.999  5.970   63.227  1.00 24.21  ? 772  ASN A C   1 
ATOM 5028  O O   . ASN A 1 772  ? 53.682  5.317   62.436  1.00 27.09  ? 772  ASN A O   1 
ATOM 5029  C CB  . ASN A 1 772  ? 53.386  8.078   61.933  1.00 59.45  ? 772  ASN A CB  1 
ATOM 5030  H H   . ASN A 1 772  ? 52.522  8.315   64.410  1.00 52.31  ? 772  ASN A H   1 
ATOM 5031  H HA  . ASN A 1 772  ? 51.628  7.052   62.186  1.00 49.69  ? 772  ASN A HA  1 
ATOM 5032  N N   . LEU A 1 773  ? 52.786  5.568   64.487  1.00 15.49  ? 773  LEU A N   1 
ATOM 5033  C CA  . LEU A 1 773  ? 53.325  4.274   64.888  1.00 13.16  ? 773  LEU A CA  1 
ATOM 5034  C C   . LEU A 1 773  ? 53.404  3.297   63.739  1.00 16.66  ? 773  LEU A C   1 
ATOM 5035  O O   . LEU A 1 773  ? 54.471  2.737   63.516  1.00 25.34  ? 773  LEU A O   1 
ATOM 5036  C CB  . LEU A 1 773  ? 52.524  3.640   66.025  1.00 11.27  ? 773  LEU A CB  1 
ATOM 5037  H HA  . LEU A 1 773  ? 54.229  4.410   65.213  1.00 15.80  ? 773  LEU A HA  1 
ATOM 5038  N N   . PRO A 1 774  ? 52.353  3.075   62.937  1.00 12.15  ? 774  PRO A N   1 
ATOM 5039  C CA  . PRO A 1 774  ? 52.460  2.020   61.927  1.00 16.42  ? 774  PRO A CA  1 
ATOM 5040  C C   . PRO A 1 774  ? 52.959  0.728   62.561  1.00 20.94  ? 774  PRO A C   1 
ATOM 5041  O O   . PRO A 1 774  ? 52.343  0.239   63.510  1.00 19.79  ? 774  PRO A O   1 
ATOM 5042  C CB  . PRO A 1 774  ? 53.470  2.591   60.932  1.00 18.44  ? 774  PRO A CB  1 
ATOM 5043  H HA  . PRO A 1 774  ? 51.608  1.869   61.488  1.00 19.71  ? 774  PRO A HA  1 
ATOM 5044  N N   . TYR A 1 775  ? 54.094  0.190   62.098  1.00 45.25  ? 775  TYR A N   1 
ATOM 5045  C CA  . TYR A 1 775  ? 54.696  -0.966  62.755  1.00 43.80  ? 775  TYR A CA  1 
ATOM 5046  C C   . TYR A 1 775  ? 55.071  -0.596  64.183  1.00 40.11  ? 775  TYR A C   1 
ATOM 5047  O O   . TYR A 1 775  ? 55.129  0.578   64.554  1.00 44.14  ? 775  TYR A O   1 
ATOM 5048  C CB  . TYR A 1 775  ? 55.938  -1.459  61.994  1.00 55.22  ? 775  TYR A CB  1 
ATOM 5049  H H   . TYR A 1 775  ? 54.527  0.475   61.412  1.00 54.30  ? 775  TYR A H   1 
ATOM 5050  H HA  . TYR A 1 775  ? 54.050  -1.690  62.787  1.00 52.56  ? 775  TYR A HA  1 
ATOM 5051  N N   . ASP A 1 776  ? 55.336  -1.615  64.991  1.00 27.85  ? 776  ASP A N   1 
ATOM 5052  C CA  . ASP A 1 776  ? 55.641  -1.350  66.387  1.00 37.23  ? 776  ASP A CA  1 
ATOM 5053  C C   . ASP A 1 776  ? 56.873  -0.428  66.557  1.00 45.91  ? 776  ASP A C   1 
ATOM 5054  O O   . ASP A 1 776  ? 56.874  0.453   67.435  1.00 40.52  ? 776  ASP A O   1 
ATOM 5055  C CB  . ASP A 1 776  ? 55.816  -2.691  67.101  1.00 32.01  ? 776  ASP A CB  1 
ATOM 5056  H HA  . ASP A 1 776  ? 54.881  -0.900  66.789  1.00 44.68  ? 776  ASP A HA  1 
ATOM 5057  N N   . LEU A 1 777  ? 57.908  -0.578  65.709  1.00 37.00  ? 777  LEU A N   1 
ATOM 5058  C CA  . LEU A 1 777  ? 59.216  0.014   66.013  1.00 25.62  ? 777  LEU A CA  1 
ATOM 5059  C C   . LEU A 1 777  ? 59.135  1.524   66.235  1.00 15.41  ? 777  LEU A C   1 
ATOM 5060  O O   . LEU A 1 777  ? 59.748  2.066   67.172  1.00 16.02  ? 777  LEU A O   1 
ATOM 5061  C CB  . LEU A 1 777  ? 60.208  -0.320  64.895  1.00 23.73  ? 777  LEU A CB  1 
ATOM 5062  H H   . LEU A 1 777  ? 57.876  -1.009  64.966  1.00 44.40  ? 777  LEU A H   1 
ATOM 5063  H HA  . LEU A 1 777  ? 59.552  -0.384  66.832  1.00 30.75  ? 777  LEU A HA  1 
ATOM 5064  N N   . ARG A 1 778  ? 58.380  2.218   65.389  1.00 12.05  ? 778  ARG A N   1 
ATOM 5065  C CA  . ARG A 1 778  ? 58.296  3.659   65.509  1.00 8.86   ? 778  ARG A CA  1 
ATOM 5066  C C   . ARG A 1 778  ? 57.978  4.037   66.937  1.00 13.28  ? 778  ARG A C   1 
ATOM 5067  O O   . ARG A 1 778  ? 58.659  4.875   67.525  1.00 16.49  ? 778  ARG A O   1 
ATOM 5068  C CB  . ARG A 1 778  ? 57.244  4.207   64.552  1.00 8.86   ? 778  ARG A CB  1 
ATOM 5069  H H   . ARG A 1 778  ? 57.915  1.881   64.749  1.00 14.46  ? 778  ARG A H   1 
ATOM 5070  H HA  . ARG A 1 778  ? 59.152  4.050   65.274  1.00 10.63  ? 778  ARG A HA  1 
ATOM 5071  N N   . ALA A 1 779  ? 56.978  3.401   67.533  1.00 10.07  ? 779  ALA A N   1 
ATOM 5072  C CA  . ALA A 1 779  ? 56.671  3.716   68.920  1.00 13.75  ? 779  ALA A CA  1 
ATOM 5073  C C   . ALA A 1 779  ? 57.769  3.229   69.854  1.00 19.42  ? 779  ALA A C   1 
ATOM 5074  O O   . ALA A 1 779  ? 58.060  3.877   70.876  1.00 24.26  ? 779  ALA A O   1 
ATOM 5075  C CB  . ALA A 1 779  ? 55.311  3.121   69.311  1.00 13.08  ? 779  ALA A CB  1 
ATOM 5076  H H   . ALA A 1 779  ? 56.477  2.803   67.171  1.00 12.08  ? 779  ALA A H   1 
ATOM 5077  H HA  . ALA A 1 779  ? 56.610  4.679   69.014  1.00 16.50  ? 779  ALA A HA  1 
ATOM 5078  H HB1 . ALA A 1 779  ? 55.125  3.341   70.237  1.00 15.69  ? 779  ALA A HB1 1 
ATOM 5079  H HB2 . ALA A 1 779  ? 54.625  3.497   68.737  1.00 15.69  ? 779  ALA A HB2 1 
ATOM 5080  H HB3 . ALA A 1 779  ? 55.344  2.158   69.200  1.00 15.69  ? 779  ALA A HB3 1 
ATOM 5081  N N   . SER A 1 780  ? 58.420  2.120   69.509  1.00 22.39  ? 780  SER A N   1 
ATOM 5082  C CA  . SER A 1 780  ? 59.449  1.593   70.395  1.00 27.98  ? 780  SER A CA  1 
ATOM 5083  C C   . SER A 1 780  ? 60.526  2.622   70.676  1.00 32.10  ? 780  SER A C   1 
ATOM 5084  O O   . SER A 1 780  ? 60.998  2.744   71.818  1.00 47.63  ? 780  SER A O   1 
ATOM 5085  C CB  . SER A 1 780  ? 60.088  0.347   69.784  1.00 54.81  ? 780  SER A CB  1 
ATOM 5086  H H   . SER A 1 780  ? 58.289  1.667   68.790  1.00 26.87  ? 780  SER A H   1 
ATOM 5087  H HA  . SER A 1 780  ? 59.044  1.342   71.239  1.00 33.57  ? 780  SER A HA  1 
ATOM 5088  N N   . PHE A 1 781  ? 60.956  3.345   69.647  1.00 31.58  ? 781  PHE A N   1 
ATOM 5089  C CA  . PHE A 1 781  ? 62.007  4.333   69.864  1.00 50.02  ? 781  PHE A CA  1 
ATOM 5090  C C   . PHE A 1 781  ? 61.637  5.284   71.014  1.00 61.99  ? 781  PHE A C   1 
ATOM 5091  O O   . PHE A 1 781  ? 62.461  5.560   71.912  1.00 69.20  ? 781  PHE A O   1 
ATOM 5092  C CB  . PHE A 1 781  ? 62.259  5.106   68.569  1.00 52.16  ? 781  PHE A CB  1 
ATOM 5093  H H   . PHE A 1 781  ? 60.668  3.287   68.839  1.00 37.90  ? 781  PHE A H   1 
ATOM 5094  H HA  . PHE A 1 781  ? 62.827  3.875   70.105  1.00 60.02  ? 781  PHE A HA  1 
ATOM 5095  N N   . CYS A 1 782  ? 60.389  5.769   71.022  1.00 53.67  ? 782  CYS A N   1 
ATOM 5096  C CA  . CYS A 1 782  ? 59.946  6.634   72.101  1.00 37.45  ? 782  CYS A CA  1 
ATOM 5097  C C   . CYS A 1 782  ? 59.974  5.892   73.418  1.00 38.78  ? 782  CYS A C   1 
ATOM 5098  O O   . CYS A 1 782  ? 60.189  6.505   74.473  1.00 37.43  ? 782  CYS A O   1 
ATOM 5099  C CB  . CYS A 1 782  ? 58.535  7.149   71.834  1.00 39.52  ? 782  CYS A CB  1 
ATOM 5100  H H   . CYS A 1 782  ? 59.794  5.611   70.420  1.00 64.40  ? 782  CYS A H   1 
ATOM 5101  H HA  . CYS A 1 782  ? 60.542  7.396   72.168  1.00 44.94  ? 782  CYS A HA  1 
ATOM 5102  N N   . ARG A 1 783  ? 59.767  4.570   73.372  1.00 47.09  ? 783  ARG A N   1 
ATOM 5103  C CA  . ARG A 1 783  ? 59.942  3.768   74.575  1.00 74.73  ? 783  ARG A CA  1 
ATOM 5104  C C   . ARG A 1 783  ? 61.354  3.916   75.146  1.00 77.06  ? 783  ARG A C   1 
ATOM 5105  O O   . ARG A 1 783  ? 61.515  4.329   76.301  1.00 67.47  ? 783  ARG A O   1 
ATOM 5106  C CB  . ARG A 1 783  ? 59.609  2.301   74.280  1.00 67.48  ? 783  ARG A CB  1 
ATOM 5107  H H   . ARG A 1 783  ? 59.530  4.129   72.672  1.00 56.51  ? 783  ARG A H   1 
ATOM 5108  H HA  . ARG A 1 783  ? 59.318  4.081   75.249  1.00 89.67  ? 783  ARG A HA  1 
ATOM 5109  N N   . LEU A 1 784  ? 62.393  3.584   74.367  1.00 88.76  ? 784  LEU A N   1 
ATOM 5110  C CA  . LEU A 1 784  ? 63.762  3.651   74.900  1.00 78.44  ? 784  LEU A CA  1 
ATOM 5111  C C   . LEU A 1 784  ? 64.025  5.012   75.554  1.00 53.08  ? 784  LEU A C   1 
ATOM 5112  O O   . LEU A 1 784  ? 64.376  5.112   76.754  1.00 46.53  ? 784  LEU A O   1 
ATOM 5113  C CB  . LEU A 1 784  ? 64.779  3.372   73.783  1.00 97.57  ? 784  LEU A CB  1 
ATOM 5114  H HA  . LEU A 1 784  ? 63.869  2.968   75.579  1.00 94.13  ? 784  LEU A HA  1 
ATOM 5115  N N   . MET A 1 785  ? 63.815  6.083   74.786  1.00 46.14  ? 785  MET A N   1 
ATOM 5116  C CA  . MET A 1 785  ? 64.047  7.391   75.365  1.00 31.31  ? 785  MET A CA  1 
ATOM 5117  C C   . MET A 1 785  ? 63.301  7.490   76.689  1.00 27.91  ? 785  MET A C   1 
ATOM 5118  O O   . MET A 1 785  ? 63.902  7.773   77.729  1.00 26.56  ? 785  MET A O   1 
ATOM 5119  C CB  . MET A 1 785  ? 63.614  8.475   74.383  1.00 36.47  ? 785  MET A CB  1 
ATOM 5120  H H   . MET A 1 785  ? 63.552  6.077   73.967  1.00 55.37  ? 785  MET A H   1 
ATOM 5121  H HA  . MET A 1 785  ? 64.997  7.499   75.530  1.00 37.57  ? 785  MET A HA  1 
ATOM 5122  N N   . LEU A 1 786  ? 62.012  7.148   76.690  1.00 30.28  ? 786  LEU A N   1 
ATOM 5123  C CA  . LEU A 1 786  ? 61.227  7.276   77.908  1.00 29.00  ? 786  LEU A CA  1 
ATOM 5124  C C   . LEU A 1 786  ? 61.842  6.483   79.039  1.00 28.14  ? 786  LEU A C   1 
ATOM 5125  O O   . LEU A 1 786  ? 61.733  6.872   80.205  1.00 23.42  ? 786  LEU A O   1 
ATOM 5126  C CB  . LEU A 1 786  ? 59.801  6.802   77.662  1.00 30.50  ? 786  LEU A CB  1 
ATOM 5127  H H   . LEU A 1 786  ? 61.580  6.846   76.011  1.00 36.33  ? 786  LEU A H   1 
ATOM 5128  H HA  . LEU A 1 786  ? 61.196  8.209   78.172  1.00 34.80  ? 786  LEU A HA  1 
ATOM 5129  N N   . HIS A 1 787  ? 62.502  5.383   78.706  1.00 33.10  ? 787  HIS A N   1 
ATOM 5130  C CA  . HIS A 1 787  ? 63.065  4.516   79.722  1.00 54.04  ? 787  HIS A CA  1 
ATOM 5131  C C   . HIS A 1 787  ? 64.158  5.240   80.484  1.00 69.50  ? 787  HIS A C   1 
ATOM 5132  O O   . HIS A 1 787  ? 64.300  5.050   81.700  1.00 71.38  ? 787  HIS A O   1 
ATOM 5133  C CB  . HIS A 1 787  ? 63.597  3.232   79.078  1.00 64.30  ? 787  HIS A CB  1 
ATOM 5134  H H   . HIS A 1 787  ? 62.637  5.118   77.899  1.00 39.72  ? 787  HIS A H   1 
ATOM 5135  H HA  . HIS A 1 787  ? 62.370  4.272   80.352  1.00 64.85  ? 787  HIS A HA  1 
ATOM 5136  N N   . MET A 1 788  ? 64.942  6.078   79.794  1.00 71.84  ? 788  MET A N   1 
ATOM 5137  C CA  . MET A 1 788  ? 66.027  6.797   80.484  1.00 78.60  ? 788  MET A CA  1 
ATOM 5138  C C   . MET A 1 788  ? 65.497  8.069   81.170  1.00 64.82  ? 788  MET A C   1 
ATOM 5139  O O   . MET A 1 788  ? 65.730  9.193   80.724  1.00 67.20  ? 788  MET A O   1 
ATOM 5140  C CB  . MET A 1 788  ? 67.158  7.126   79.511  1.00 82.13  ? 788  MET A CB  1 
ATOM 5141  H H   . MET A 1 788  ? 64.872  6.245   78.953  1.00 86.21  ? 788  MET A H   1 
ATOM 5142  H HA  . MET A 1 788  ? 66.394  6.213   81.167  1.00 94.33  ? 788  MET A HA  1 
ATOM 5143  N N   . HIS A 1 789  ? 64.802  7.886   82.302  1.00 49.63  ? 789  HIS A N   1 
ATOM 5144  C CA  . HIS A 1 789  ? 64.175  9.002   83.027  1.00 44.82  ? 789  HIS A CA  1 
ATOM 5145  C C   . HIS A 1 789  ? 64.498  8.968   84.531  1.00 45.11  ? 789  HIS A C   1 
ATOM 5146  O O   . HIS A 1 789  ? 65.197  8.071   85.020  1.00 51.91  ? 789  HIS A O   1 
ATOM 5147  C CB  . HIS A 1 789  ? 62.656  8.994   82.800  1.00 54.94  ? 789  HIS A CB  1 
ATOM 5148  H H   . HIS A 1 789  ? 64.678  7.120   82.673  1.00 59.56  ? 789  HIS A H   1 
ATOM 5149  H HA  . HIS A 1 789  ? 64.521  9.835   82.671  1.00 53.78  ? 789  HIS A HA  1 
ATOM 5150  N N   . VAL A 1 790  ? 63.985  9.963   85.275  1.00 30.20  ? 790  VAL A N   1 
ATOM 5151  C CA  . VAL A 1 790  ? 64.167  10.078  86.722  1.00 22.63  ? 790  VAL A CA  1 
ATOM 5152  C C   . VAL A 1 790  ? 62.806  10.250  87.395  1.00 21.91  ? 790  VAL A C   1 
ATOM 5153  O O   . VAL A 1 790  ? 61.804  10.574  86.749  1.00 21.75  ? 790  VAL A O   1 
ATOM 5154  C CB  . VAL A 1 790  ? 65.110  11.242  87.099  1.00 9.20   ? 790  VAL A CB  1 
ATOM 5155  H H   . VAL A 1 790  ? 63.513  10.602  84.945  1.00 36.24  ? 790  VAL A H   1 
ATOM 5156  H HA  . VAL A 1 790  ? 64.561  9.256   87.055  1.00 27.16  ? 790  VAL A HA  1 
ATOM 5157  N N   . ASP A 1 791  ? 62.770  10.023  88.703  1.00 21.50  ? 791  ASP A N   1 
ATOM 5158  C CA  . ASP A 1 791  ? 61.514  9.996   89.457  1.00 25.07  ? 791  ASP A CA  1 
ATOM 5159  C C   . ASP A 1 791  ? 60.582  11.188  89.149  1.00 24.57  ? 791  ASP A C   1 
ATOM 5160  O O   . ASP A 1 791  ? 60.845  12.333  89.538  1.00 21.50  ? 791  ASP A O   1 
ATOM 5161  C CB  . ASP A 1 791  ? 61.825  9.939   90.957  1.00 35.31  ? 791  ASP A CB  1 
ATOM 5162  H H   . ASP A 1 791  ? 63.467  9.879   89.186  1.00 25.80  ? 791  ASP A H   1 
ATOM 5163  H HA  . ASP A 1 791  ? 61.034  9.185   89.227  1.00 30.08  ? 791  ASP A HA  1 
ATOM 5164  N N   . SER A 1 825  ? 35.753  11.105  96.446  1.00 35.59  ? 825  SER A N   1 
ATOM 5165  C CA  . SER A 1 825  ? 34.372  10.692  96.227  1.00 36.41  ? 825  SER A CA  1 
ATOM 5166  C C   . SER A 1 825  ? 33.594  11.810  95.516  1.00 44.72  ? 825  SER A C   1 
ATOM 5167  O O   . SER A 1 825  ? 32.773  12.519  96.120  1.00 38.20  ? 825  SER A O   1 
ATOM 5168  C CB  . SER A 1 825  ? 33.702  10.319  97.549  1.00 34.49  ? 825  SER A CB  1 
ATOM 5169  H HA  . SER A 1 825  ? 34.363  9.909   95.655  1.00 43.69  ? 825  SER A HA  1 
ATOM 5170  N N   . LYS A 1 826  ? 33.890  11.974  94.224  1.00 61.63  ? 826  LYS A N   1 
ATOM 5171  C CA  . LYS A 1 826  ? 33.164  12.914  93.376  1.00 55.21  ? 826  LYS A CA  1 
ATOM 5172  C C   . LYS A 1 826  ? 31.825  12.353  92.865  1.00 65.83  ? 826  LYS A C   1 
ATOM 5173  O O   . LYS A 1 826  ? 30.900  13.140  92.611  1.00 56.77  ? 826  LYS A O   1 
ATOM 5174  C CB  . LYS A 1 826  ? 34.046  13.334  92.195  1.00 48.96  ? 826  LYS A CB  1 
ATOM 5175  H H   . LYS A 1 826  ? 34.513  11.548  93.814  1.00 73.96  ? 826  LYS A H   1 
ATOM 5176  H HA  . LYS A 1 826  ? 32.970  13.711  93.894  1.00 66.25  ? 826  LYS A HA  1 
ATOM 5177  N N   . ASP A 1 827  ? 31.692  11.022  92.695  1.00 87.94  ? 827  ASP A N   1 
ATOM 5178  C CA  . ASP A 1 827  ? 30.476  10.412  92.138  1.00 73.01  ? 827  ASP A CA  1 
ATOM 5179  C C   . ASP A 1 827  ? 30.326  8.940   92.579  1.00 44.97  ? 827  ASP A C   1 
ATOM 5180  O O   . ASP A 1 827  ? 31.157  8.394   93.316  1.00 38.16  ? 827  ASP A O   1 
ATOM 5181  C CB  . ASP A 1 827  ? 30.470  10.521  90.606  1.00 54.81  ? 827  ASP A CB  1 
ATOM 5182  H H   . ASP A 1 827  ? 32.302  10.450  92.898  1.00 105.53 ? 827  ASP A H   1 
ATOM 5183  H HA  . ASP A 1 827  ? 29.705  10.899  92.471  1.00 87.61  ? 827  ASP A HA  1 
ATOM 5184  N N   . GLU A 1 828  ? 29.240  8.294   92.110  1.00 31.98  ? 828  GLU A N   1 
ATOM 5185  C CA  . GLU A 1 828  ? 28.955  6.913   92.480  1.00 9.15   ? 828  GLU A CA  1 
ATOM 5186  C C   . GLU A 1 828  ? 29.988  5.965   91.905  1.00 8.98   ? 828  GLU A C   1 
ATOM 5187  O O   . GLU A 1 828  ? 30.157  4.861   92.425  1.00 8.98   ? 828  GLU A O   1 
ATOM 5188  C CB  . GLU A 1 828  ? 27.565  6.505   91.997  1.00 8.98   ? 828  GLU A CB  1 
ATOM 5189  H H   . GLU A 1 828  ? 28.660  8.642   91.578  1.00 38.38  ? 828  GLU A H   1 
ATOM 5190  H HA  . GLU A 1 828  ? 28.975  6.831   93.446  1.00 10.98  ? 828  GLU A HA  1 
ATOM 5191  N N   . ILE A 1 829  ? 30.676  6.378   90.835  1.00 8.95   ? 829  ILE A N   1 
ATOM 5192  C CA  . ILE A 1 829  ? 31.674  5.545   90.178  1.00 8.95   ? 829  ILE A CA  1 
ATOM 5193  C C   . ILE A 1 829  ? 32.989  5.445   90.929  1.00 9.15   ? 829  ILE A C   1 
ATOM 5194  O O   . ILE A 1 829  ? 33.831  4.618   90.562  1.00 8.95   ? 829  ILE A O   1 
ATOM 5195  C CB  . ILE A 1 829  ? 31.983  6.087   88.766  1.00 8.95   ? 829  ILE A CB  1 
ATOM 5196  H H   . ILE A 1 829  ? 30.578  7.150   90.470  1.00 10.74  ? 829  ILE A H   1 
ATOM 5197  H HA  . ILE A 1 829  ? 31.318  4.648   90.082  1.00 10.74  ? 829  ILE A HA  1 
ATOM 5198  N N   . LYS A 1 830  ? 33.202  6.273   91.953  1.00 13.15  ? 830  LYS A N   1 
ATOM 5199  C CA  . LYS A 1 830  ? 34.467  6.244   92.681  1.00 16.34  ? 830  LYS A CA  1 
ATOM 5200  C C   . LYS A 1 830  ? 34.730  4.860   93.265  1.00 18.72  ? 830  LYS A C   1 
ATOM 5201  O O   . LYS A 1 830  ? 35.791  4.252   93.031  1.00 18.58  ? 830  LYS A O   1 
ATOM 5202  C CB  . LYS A 1 830  ? 34.439  7.302   93.787  1.00 18.35  ? 830  LYS A CB  1 
ATOM 5203  H H   . LYS A 1 830  ? 32.637  6.853   92.241  1.00 15.78  ? 830  LYS A H   1 
ATOM 5204  H HA  . LYS A 1 830  ? 35.191  6.459   92.072  1.00 19.60  ? 830  LYS A HA  1 
ATOM 5205  N N   . GLU A 1 831  ? 33.764  4.349   94.031  1.00 22.46  ? 831  GLU A N   1 
ATOM 5206  C CA  . GLU A 1 831  ? 33.916  3.050   94.672  1.00 29.45  ? 831  GLU A CA  1 
ATOM 5207  C C   . GLU A 1 831  ? 34.402  1.998   93.681  1.00 25.28  ? 831  GLU A C   1 
ATOM 5208  O O   . GLU A 1 831  ? 35.307  1.218   93.995  1.00 26.16  ? 831  GLU A O   1 
ATOM 5209  C CB  . GLU A 1 831  ? 32.583  2.624   95.290  1.00 50.63  ? 831  GLU A CB  1 
ATOM 5210  H H   . GLU A 1 831  ? 33.014  4.737   94.194  1.00 26.95  ? 831  GLU A H   1 
ATOM 5211  H HA  . GLU A 1 831  ? 34.571  3.121   95.384  1.00 35.34  ? 831  GLU A HA  1 
ATOM 5212  N N   . ARG A 1 832  ? 33.812  1.954   92.487  1.00 23.58  ? 832  ARG A N   1 
ATOM 5213  C CA  . ARG A 1 832  ? 34.309  1.034   91.480  1.00 18.40  ? 832  ARG A CA  1 
ATOM 5214  C C   . ARG A 1 832  ? 35.742  1.377   91.121  1.00 15.84  ? 832  ARG A C   1 
ATOM 5215  O O   . ARG A 1 832  ? 36.534  0.478   90.818  1.00 16.20  ? 832  ARG A O   1 
ATOM 5216  C CB  . ARG A 1 832  ? 33.420  1.074   90.242  1.00 13.41  ? 832  ARG A CB  1 
ATOM 5217  H H   . ARG A 1 832  ? 33.140  2.433   92.244  1.00 28.30  ? 832  ARG A H   1 
ATOM 5218  H HA  . ARG A 1 832  ? 34.294  0.132   91.836  1.00 22.08  ? 832  ARG A HA  1 
ATOM 5219  N N   . PHE A 1 833  ? 36.100  2.667   91.194  1.00 15.56  ? 833  PHE A N   1 
ATOM 5220  C CA  . PHE A 1 833  ? 37.445  3.096   90.836  1.00 20.86  ? 833  PHE A CA  1 
ATOM 5221  C C   . PHE A 1 833  ? 38.503  2.477   91.753  1.00 28.96  ? 833  PHE A C   1 
ATOM 5222  O O   . PHE A 1 833  ? 39.600  2.149   91.286  1.00 28.91  ? 833  PHE A O   1 
ATOM 5223  C CB  . PHE A 1 833  ? 37.526  4.625   90.855  1.00 15.96  ? 833  PHE A CB  1 
ATOM 5224  H H   . PHE A 1 833  ? 35.581  3.304   91.447  1.00 18.67  ? 833  PHE A H   1 
ATOM 5225  H HA  . PHE A 1 833  ? 37.634  2.802   89.931  1.00 25.03  ? 833  PHE A HA  1 
ATOM 5226  N N   . ALA A 1 834  ? 38.214  2.319   93.056  1.00 34.14  ? 834  ALA A N   1 
ATOM 5227  C CA  . ALA A 1 834  ? 39.211  1.711   93.959  1.00 35.09  ? 834  ALA A CA  1 
ATOM 5228  C C   . ALA A 1 834  ? 39.539  0.268   93.561  1.00 26.97  ? 834  ALA A C   1 
ATOM 5229  O O   . ALA A 1 834  ? 40.717  -0.121  93.487  1.00 15.61  ? 834  ALA A O   1 
ATOM 5230  C CB  . ALA A 1 834  ? 38.724  1.754   95.409  1.00 37.18  ? 834  ALA A CB  1 
ATOM 5231  H H   . ALA A 1 834  ? 37.475  2.547   93.432  1.00 40.97  ? 834  ALA A H   1 
ATOM 5232  H HA  . ALA A 1 834  ? 40.032  2.225   93.907  1.00 42.11  ? 834  ALA A HA  1 
ATOM 5233  H HB1 . ALA A 1 834  ? 39.395  1.349   95.980  1.00 44.61  ? 834  ALA A HB1 1 
ATOM 5234  H HB2 . ALA A 1 834  ? 38.583  2.678   95.667  1.00 44.61  ? 834  ALA A HB2 1 
ATOM 5235  H HB3 . ALA A 1 834  ? 37.891  1.261   95.477  1.00 44.61  ? 834  ALA A HB3 1 
ATOM 5236  N N   . GLN A 1 835  ? 38.500  -0.547  93.335  1.00 32.60  ? 835  GLN A N   1 
ATOM 5237  C CA  . GLN A 1 835  ? 38.699  -1.895  92.821  1.00 26.29  ? 835  GLN A CA  1 
ATOM 5238  C C   . GLN A 1 835  ? 39.426  -1.850  91.486  1.00 17.08  ? 835  GLN A C   1 
ATOM 5239  O O   . GLN A 1 835  ? 40.226  -2.737  91.183  1.00 13.00  ? 835  GLN A O   1 
ATOM 5240  C CB  . GLN A 1 835  ? 37.348  -2.610  92.679  1.00 19.05  ? 835  GLN A CB  1 
ATOM 5241  H H   . GLN A 1 835  ? 37.677  -0.339  93.473  1.00 39.12  ? 835  GLN A H   1 
ATOM 5242  H HA  . GLN A 1 835  ? 39.245  -2.398  93.446  1.00 31.55  ? 835  GLN A HA  1 
ATOM 5243  N N   . THR A 1 836  ? 39.162  -0.816  90.679  1.00 15.78  ? 836  THR A N   1 
ATOM 5244  C CA  . THR A 1 836  ? 39.881  -0.643  89.426  1.00 12.70  ? 836  THR A CA  1 
ATOM 5245  C C   . THR A 1 836  ? 41.363  -0.468  89.671  1.00 8.71   ? 836  THR A C   1 
ATOM 5246  O O   . THR A 1 836  ? 42.185  -1.140  89.049  1.00 10.20  ? 836  THR A O   1 
ATOM 5247  C CB  . THR A 1 836  ? 39.339  0.570   88.670  1.00 13.23  ? 836  THR A CB  1 
ATOM 5248  H H   . THR A 1 836  ? 38.574  -0.209  90.839  1.00 18.94  ? 836  THR A H   1 
ATOM 5249  H HA  . THR A 1 836  ? 39.754  -1.429  88.872  1.00 15.24  ? 836  THR A HA  1 
ATOM 5250  N N   . MET A 1 837  ? 41.721  0.451   90.556  1.00 8.99   ? 837  MET A N   1 
ATOM 5251  C CA  . MET A 1 837  ? 43.119  0.648   90.881  1.00 8.72   ? 837  MET A CA  1 
ATOM 5252  C C   . MET A 1 837  ? 43.732  -0.657  91.345  1.00 9.78   ? 837  MET A C   1 
ATOM 5253  O O   . MET A 1 837  ? 44.825  -1.028  90.907  1.00 11.84  ? 837  MET A O   1 
ATOM 5254  C CB  . MET A 1 837  ? 43.263  1.730   91.952  1.00 8.72   ? 837  MET A CB  1 
ATOM 5255  H H   . MET A 1 837  ? 41.178  0.967   90.978  1.00 10.79  ? 837  MET A H   1 
ATOM 5256  H HA  . MET A 1 837  ? 43.587  0.950   90.087  1.00 10.46  ? 837  MET A HA  1 
ATOM 5257  N N   . GLU A 1 838  ? 43.025  -1.390  92.201  1.00 8.60   ? 838  GLU A N   1 
ATOM 5258  C CA  . GLU A 1 838  ? 43.562  -2.656  92.674  1.00 10.28  ? 838  GLU A CA  1 
ATOM 5259  C C   . GLU A 1 838  ? 43.731  -3.650  91.529  1.00 9.42   ? 838  GLU A C   1 
ATOM 5260  O O   . GLU A 1 838  ? 44.749  -4.342  91.453  1.00 9.89   ? 838  GLU A O   1 
ATOM 5261  C CB  . GLU A 1 838  ? 42.658  -3.229  93.764  1.00 16.57  ? 838  GLU A CB  1 
ATOM 5262  H H   . GLU A 1 838  ? 42.252  -1.182  92.515  1.00 10.32  ? 838  GLU A H   1 
ATOM 5263  H HA  . GLU A 1 838  ? 44.436  -2.500  93.063  1.00 12.34  ? 838  GLU A HA  1 
ATOM 5264  N N   . PHE A 1 839  ? 42.749  -3.736  90.632  1.00 9.16   ? 839  PHE A N   1 
ATOM 5265  C CA  . PHE A 1 839  ? 42.858  -4.636  89.494  1.00 8.52   ? 839  PHE A CA  1 
ATOM 5266  C C   . PHE A 1 839  ? 44.015  -4.226  88.608  1.00 9.30   ? 839  PHE A C   1 
ATOM 5267  O O   . PHE A 1 839  ? 44.689  -5.078  88.032  1.00 8.90   ? 839  PHE A O   1 
ATOM 5268  C CB  . PHE A 1 839  ? 41.554  -4.645  88.701  1.00 8.52   ? 839  PHE A CB  1 
ATOM 5269  H H   . PHE A 1 839  ? 42.016  -3.287  90.661  1.00 10.99  ? 839  PHE A H   1 
ATOM 5270  H HA  . PHE A 1 839  ? 43.025  -5.536  89.814  1.00 10.22  ? 839  PHE A HA  1 
ATOM 5271  N N   . VAL A 1 840  ? 44.250  -2.924  88.479  1.00 8.49   ? 840  VAL A N   1 
ATOM 5272  C CA  . VAL A 1 840  ? 45.410  -2.427  87.753  1.00 10.24  ? 840  VAL A CA  1 
ATOM 5273  C C   . VAL A 1 840  ? 46.683  -2.901  88.424  1.00 10.50  ? 840  VAL A C   1 
ATOM 5274  O O   . VAL A 1 840  ? 47.661  -3.248  87.757  1.00 13.16  ? 840  VAL A O   1 
ATOM 5275  C CB  . VAL A 1 840  ? 45.361  -0.891  87.674  1.00 23.72  ? 840  VAL A CB  1 
ATOM 5276  H H   . VAL A 1 840  ? 43.749  -2.306  88.805  1.00 10.19  ? 840  VAL A H   1 
ATOM 5277  H HA  . VAL A 1 840  ? 45.395  -2.778  86.848  1.00 12.29  ? 840  VAL A HA  1 
ATOM 5278  N N   . GLU A 1 841  ? 46.698  -2.891  89.754  1.00 11.61  ? 841  GLU A N   1 
ATOM 5279  C CA  . GLU A 1 841  ? 47.834  -3.423  90.482  1.00 13.75  ? 841  GLU A CA  1 
ATOM 5280  C C   . GLU A 1 841  ? 48.008  -4.908  90.213  1.00 16.22  ? 841  GLU A C   1 
ATOM 5281  O O   . GLU A 1 841  ? 49.137  -5.398  90.185  1.00 17.25  ? 841  GLU A O   1 
ATOM 5282  C CB  . GLU A 1 841  ? 47.651  -3.175  91.977  1.00 15.43  ? 841  GLU A CB  1 
ATOM 5283  H H   . GLU A 1 841  ? 46.066  -2.585  90.250  1.00 13.93  ? 841  GLU A H   1 
ATOM 5284  H HA  . GLU A 1 841  ? 48.639  -2.966  90.194  1.00 16.50  ? 841  GLU A HA  1 
ATOM 5285  N N   . GLU A 1 842  ? 46.901  -5.643  90.041  1.00 18.47  ? 842  GLU A N   1 
ATOM 5286  C CA  . GLU A 1 842  ? 46.978  -7.079  89.770  1.00 25.08  ? 842  GLU A CA  1 
ATOM 5287  C C   . GLU A 1 842  ? 47.417  -7.354  88.340  1.00 23.76  ? 842  GLU A C   1 
ATOM 5288  O O   . GLU A 1 842  ? 47.964  -8.430  88.055  1.00 17.15  ? 842  GLU A O   1 
ATOM 5289  C CB  . GLU A 1 842  ? 45.623  -7.746  90.025  1.00 27.27  ? 842  GLU A CB  1 
ATOM 5290  H H   . GLU A 1 842  ? 46.099  -5.334  90.076  1.00 22.16  ? 842  GLU A H   1 
ATOM 5291  H HA  . GLU A 1 842  ? 47.629  -7.480  90.367  1.00 30.10  ? 842  GLU A HA  1 
ATOM 5292  N N   . TYR A 1 843  ? 47.123  -6.419  87.431  1.00 26.47  ? 843  TYR A N   1 
ATOM 5293  C CA  . TYR A 1 843  ? 47.754  -6.404  86.128  1.00 22.05  ? 843  TYR A CA  1 
ATOM 5294  C C   . TYR A 1 843  ? 49.239  -6.160  86.269  1.00 21.06  ? 843  TYR A C   1 
ATOM 5295  O O   . TYR A 1 843  ? 50.026  -6.813  85.592  1.00 16.28  ? 843  TYR A O   1 
ATOM 5296  C CB  . TYR A 1 843  ? 47.119  -5.322  85.252  1.00 20.09  ? 843  TYR A CB  1 
ATOM 5297  H H   . TYR A 1 843  ? 46.556  -5.784  87.553  1.00 31.77  ? 843  TYR A H   1 
ATOM 5298  H HA  . TYR A 1 843  ? 47.624  -7.263  85.696  1.00 26.46  ? 843  TYR A HA  1 
ATOM 5299  N N   . LEU A 1 844  ? 49.636  -5.216  87.136  1.00 26.46  ? 844  LEU A N   1 
ATOM 5300  C CA  . LEU A 1 844  ? 51.049  -4.943  87.381  1.00 32.48  ? 844  LEU A CA  1 
ATOM 5301  C C   . LEU A 1 844  ? 51.748  -6.159  87.973  1.00 30.52  ? 844  LEU A C   1 
ATOM 5302  O O   . LEU A 1 844  ? 52.915  -6.426  87.661  1.00 38.16  ? 844  LEU A O   1 
ATOM 5303  C CB  . LEU A 1 844  ? 51.192  -3.730  88.308  1.00 23.54  ? 844  LEU A CB  1 
ATOM 5304  H H   . LEU A 1 844  ? 49.101  -4.723  87.594  1.00 31.75  ? 844  LEU A H   1 
ATOM 5305  H HA  . LEU A 1 844  ? 51.480  -4.729  86.538  1.00 38.98  ? 844  LEU A HA  1 
ATOM 5306  N N   . ARG A 1 845  ? 51.065  -6.882  88.858  1.00 20.83  ? 845  ARG A N   1 
ATOM 5307  C CA  . ARG A 1 845  ? 51.537  -8.183  89.294  1.00 21.73  ? 845  ARG A CA  1 
ATOM 5308  C C   . ARG A 1 845  ? 51.598  -9.146  88.121  1.00 19.30  ? 845  ARG A C   1 
ATOM 5309  O O   . ARG A 1 845  ? 52.529  -9.949  88.011  1.00 21.09  ? 845  ARG A O   1 
ATOM 5310  C CB  . ARG A 1 845  ? 50.615  -8.725  90.384  1.00 20.00  ? 845  ARG A CB  1 
ATOM 5311  H H   . ARG A 1 845  ? 50.324  -6.636  89.218  1.00 25.00  ? 845  ARG A H   1 
ATOM 5312  H HA  . ARG A 1 845  ? 52.430  -8.095  89.664  1.00 26.07  ? 845  ARG A HA  1 
ATOM 5313  N N   . ASP A 1 846  ? 50.606  -9.086  87.242  1.00 14.52  ? 846  ASP A N   1 
ATOM 5314  C CA  . ASP A 1 846  ? 50.716  -9.779  85.978  1.00 13.97  ? 846  ASP A CA  1 
ATOM 5315  C C   . ASP A 1 846  ? 51.964  -9.330  85.224  1.00 15.65  ? 846  ASP A C   1 
ATOM 5316  O O   . ASP A 1 846  ? 52.629  -10.141 84.575  1.00 15.91  ? 846  ASP A O   1 
ATOM 5317  C CB  . ASP A 1 846  ? 49.453  -9.529  85.160  1.00 11.51  ? 846  ASP A CB  1 
ATOM 5318  H H   . ASP A 1 846  ? 49.871  -8.654  87.354  1.00 17.42  ? 846  ASP A H   1 
ATOM 5319  H HA  . ASP A 1 846  ? 50.788  -10.733 86.142  1.00 16.77  ? 846  ASP A HA  1 
ATOM 5320  N N   . VAL A 1 847  ? 52.321  -8.052  85.343  1.00 15.43  ? 847  VAL A N   1 
ATOM 5321  C CA  . VAL A 1 847  ? 53.410  -7.467  84.578  1.00 17.48  ? 847  VAL A CA  1 
ATOM 5322  C C   . VAL A 1 847  ? 54.745  -8.000  85.070  1.00 16.86  ? 847  VAL A C   1 
ATOM 5323  O O   . VAL A 1 847  ? 55.639  -8.317  84.274  1.00 16.29  ? 847  VAL A O   1 
ATOM 5324  C CB  . VAL A 1 847  ? 53.337  -5.930  84.676  1.00 27.00  ? 847  VAL A CB  1 
ATOM 5325  H H   . VAL A 1 847  ? 51.936  -7.495  85.874  1.00 18.52  ? 847  VAL A H   1 
ATOM 5326  H HA  . VAL A 1 847  ? 53.312  -7.715  83.645  1.00 20.98  ? 847  VAL A HA  1 
ATOM 5327  N N   . VAL A 1 848  ? 54.895  -8.108  86.389  1.00 18.67  ? 848  VAL A N   1 
ATOM 5328  C CA  . VAL A 1 848  ? 56.127  -8.636  86.960  1.00 19.62  ? 848  VAL A CA  1 
ATOM 5329  C C   . VAL A 1 848  ? 56.419  -10.007 86.373  1.00 15.77  ? 848  VAL A C   1 
ATOM 5330  O O   . VAL A 1 848  ? 57.573  -10.357 86.107  1.00 13.86  ? 848  VAL A O   1 
ATOM 5331  C CB  . VAL A 1 848  ? 56.023  -8.683  88.497  1.00 24.90  ? 848  VAL A CB  1 
ATOM 5332  H H   . VAL A 1 848  ? 54.302  -7.884  86.970  1.00 22.41  ? 848  VAL A H   1 
ATOM 5333  H HA  . VAL A 1 848  ? 56.861  -8.047  86.727  1.00 23.55  ? 848  VAL A HA  1 
ATOM 5334  N N   . CYS A 1 849  ? 55.380  -10.801 86.163  1.00 15.18  ? 849  CYS A N   1 
ATOM 5335  C CA  . CYS A 1 849  ? 55.496  -11.910 85.236  1.00 15.87  ? 849  CYS A CA  1 
ATOM 5336  C C   . CYS A 1 849  ? 55.609  -11.327 83.830  1.00 15.35  ? 849  CYS A C   1 
ATOM 5337  O O   . CYS A 1 849  ? 54.731  -10.583 83.392  1.00 13.85  ? 849  CYS A O   1 
ATOM 5338  C CB  . CYS A 1 849  ? 54.293  -12.840 85.353  1.00 17.82  ? 849  CYS A CB  1 
ATOM 5339  H HA  . CYS A 1 849  ? 56.301  -12.416 85.428  1.00 19.05  ? 849  CYS A HA  1 
ATOM 5340  N N   . GLN A 1 850  ? 56.696  -11.627 83.139  1.00 20.17  ? 850  GLN A N   1 
ATOM 5341  C CA  . GLN A 1 850  ? 56.930  -11.104 81.797  1.00 17.86  ? 850  GLN A CA  1 
ATOM 5342  C C   . GLN A 1 850  ? 56.910  -12.270 80.821  1.00 26.86  ? 850  GLN A C   1 
ATOM 5343  O O   . GLN A 1 850  ? 57.739  -13.183 80.921  1.00 42.31  ? 850  GLN A O   1 
ATOM 5344  C CB  . GLN A 1 850  ? 58.259  -10.350 81.717  1.00 37.51  ? 850  GLN A CB  1 
ATOM 5345  H H   . GLN A 1 850  ? 57.324  -12.139 83.426  1.00 24.21  ? 850  GLN A H   1 
ATOM 5346  H HA  . GLN A 1 850  ? 56.215  -10.493 81.560  1.00 21.43  ? 850  GLN A HA  1 
ATOM 5347  N N   . ARG A 1 851  ? 55.973  -12.243 79.881  1.00 26.34  ? 851  ARG A N   1 
ATOM 5348  C CA  . ARG A 1 851  ? 55.814  -13.363 78.962  1.00 31.97  ? 851  ARG A CA  1 
ATOM 5349  C C   . ARG A 1 851  ? 55.131  -12.906 77.680  1.00 26.36  ? 851  ARG A C   1 
ATOM 5350  O O   . ARG A 1 851  ? 54.261  -12.030 77.704  1.00 20.51  ? 851  ARG A O   1 
ATOM 5351  C CB  . ARG A 1 851  ? 55.003  -14.488 79.607  1.00 40.77  ? 851  ARG A CB  1 
ATOM 5352  H H   . ARG A 1 851  ? 55.421  -11.595 79.755  1.00 31.60  ? 851  ARG A H   1 
ATOM 5353  H HA  . ARG A 1 851  ? 56.688  -13.713 78.731  1.00 38.37  ? 851  ARG A HA  1 
ATOM 5354  N N   . PHE A 1 852  ? 55.501  -13.550 76.567  1.00 27.32  ? 852  PHE A N   1 
ATOM 5355  C CA  . PHE A 1 852  ? 55.009  -13.166 75.250  1.00 21.43  ? 852  PHE A CA  1 
ATOM 5356  C C   . PHE A 1 852  ? 54.212  -14.310 74.658  1.00 25.92  ? 852  PHE A C   1 
ATOM 5357  O O   . PHE A 1 852  ? 54.161  -14.435 73.431  1.00 27.14  ? 852  PHE A O   1 
ATOM 5358  C CB  . PHE A 1 852  ? 56.147  -12.814 74.294  1.00 16.07  ? 852  PHE A CB  1 
ATOM 5359  H H   . PHE A 1 852  ? 56.042  -14.219 76.554  1.00 32.79  ? 852  PHE A H   1 
ATOM 5360  H HA  . PHE A 1 852  ? 54.426  -12.395 75.333  1.00 25.72  ? 852  PHE A HA  1 
ATOM 5361  N N   . PRO A 1 853  ? 53.598  -15.173 75.498  1.00 32.93  ? 853  PRO A N   1 
ATOM 5362  C CA  . PRO A 1 853  ? 52.807  -16.294 74.965  1.00 44.03  ? 853  PRO A CA  1 
ATOM 5363  C C   . PRO A 1 853  ? 51.335  -15.941 74.877  1.00 48.01  ? 853  PRO A C   1 
ATOM 5364  O O   . PRO A 1 853  ? 50.965  -14.766 74.736  1.00 36.96  ? 853  PRO A O   1 
ATOM 5365  C CB  . PRO A 1 853  ? 53.044  -17.427 75.978  1.00 26.90  ? 853  PRO A CB  1 
ATOM 5366  H HA  . PRO A 1 853  ? 53.134  -16.561 74.092  1.00 52.84  ? 853  PRO A HA  1 
ATOM 5367  N N   . PHE A 1 854  ? 50.480  -16.955 74.975  1.00 44.27  ? 854  PHE A N   1 
ATOM 5368  C CA  . PHE A 1 854  ? 49.050  -16.740 74.851  1.00 37.02  ? 854  PHE A CA  1 
ATOM 5369  C C   . PHE A 1 854  ? 48.624  -15.811 75.979  1.00 28.17  ? 854  PHE A C   1 
ATOM 5370  O O   . PHE A 1 854  ? 49.442  -15.139 76.620  1.00 22.99  ? 854  PHE A O   1 
ATOM 5371  C CB  . PHE A 1 854  ? 48.301  -18.070 74.879  1.00 33.63  ? 854  PHE A CB  1 
ATOM 5372  H HA  . PHE A 1 854  ? 48.863  -16.302 74.007  1.00 44.43  ? 854  PHE A HA  1 
ATOM 5373  N N   . SER A 1 855  ? 47.324  -15.726 76.195  1.00 29.19  ? 855  SER A N   1 
ATOM 5374  C CA  . SER A 1 855  ? 46.732  -15.006 77.309  1.00 29.39  ? 855  SER A CA  1 
ATOM 5375  C C   . SER A 1 855  ? 46.831  -13.519 77.072  1.00 19.07  ? 855  SER A C   1 
ATOM 5376  O O   . SER A 1 855  ? 46.206  -12.745 77.804  1.00 16.95  ? 855  SER A O   1 
ATOM 5377  C CB  . SER A 1 855  ? 47.390  -15.347 78.658  1.00 41.95  ? 855  SER A CB  1 
ATOM 5378  H H   . SER A 1 855  ? 46.738  -16.094 75.685  1.00 35.02  ? 855  SER A H   1 
ATOM 5379  H HA  . SER A 1 855  ? 45.792  -15.237 77.369  1.00 35.27  ? 855  SER A HA  1 
ATOM 5380  N N   . ASP A 1 856  ? 47.591  -13.082 76.072  1.00 14.11  ? 856  ASP A N   1 
ATOM 5381  C CA  . ASP A 1 856  ? 47.700  -11.675 75.804  1.00 13.40  ? 856  ASP A CA  1 
ATOM 5382  C C   . ASP A 1 856  ? 46.386  -11.047 75.329  1.00 12.15  ? 856  ASP A C   1 
ATOM 5383  O O   . ASP A 1 856  ? 46.248  -9.829  75.401  1.00 11.92  ? 856  ASP A O   1 
ATOM 5384  C CB  . ASP A 1 856  ? 48.821  -11.475 74.784  1.00 13.84  ? 856  ASP A CB  1 
ATOM 5385  H H   . ASP A 1 856  ? 48.046  -13.585 75.543  1.00 16.93  ? 856  ASP A H   1 
ATOM 5386  H HA  . ASP A 1 856  ? 47.962  -11.223 76.621  1.00 16.08  ? 856  ASP A HA  1 
ATOM 5387  N N   . LYS A 1 857  ? 45.425  -11.818 74.827  1.00 12.36  ? 857  LYS A N   1 
ATOM 5388  C CA  . LYS A 1 857  ? 44.154  -11.216 74.425  1.00 9.07   ? 857  LYS A CA  1 
ATOM 5389  C C   . LYS A 1 857  ? 43.060  -11.337 75.475  1.00 8.47   ? 857  LYS A C   1 
ATOM 5390  O O   . LYS A 1 857  ? 42.013  -10.702 75.322  1.00 8.47   ? 857  LYS A O   1 
ATOM 5391  C CB  . LYS A 1 857  ? 43.652  -11.837 73.119  1.00 13.47  ? 857  LYS A CB  1 
ATOM 5392  H H   . LYS A 1 857  ? 45.479  -12.668 74.710  1.00 14.83  ? 857  LYS A H   1 
ATOM 5393  H HA  . LYS A 1 857  ? 44.299  -10.271 74.263  1.00 10.88  ? 857  LYS A HA  1 
ATOM 5394  N N   . GLU A 1 858  ? 43.230  -12.171 76.492  1.00 9.14   ? 858  GLU A N   1 
ATOM 5395  C CA  . GLU A 1 858  ? 42.316  -12.141 77.625  1.00 8.50   ? 858  GLU A CA  1 
ATOM 5396  C C   . GLU A 1 858  ? 42.765  -11.071 78.605  1.00 8.50   ? 858  GLU A C   1 
ATOM 5397  O O   . GLU A 1 858  ? 41.956  -10.252 79.055  1.00 8.50   ? 858  GLU A O   1 
ATOM 5398  C CB  . GLU A 1 858  ? 42.251  -13.519 78.295  1.00 8.50   ? 858  GLU A CB  1 
ATOM 5399  H HA  . GLU A 1 858  ? 41.426  -11.913 77.312  1.00 10.20  ? 858  GLU A HA  1 
ATOM 5400  N N   . LYS A 1 859  ? 44.061  -11.047 78.915  1.00 8.53   ? 859  LYS A N   1 
ATOM 5401  C CA  . LYS A 1 859  ? 44.607  -9.954  79.692  1.00 8.53   ? 859  LYS A CA  1 
ATOM 5402  C C   . LYS A 1 859  ? 44.587  -8.661  78.887  1.00 8.53   ? 859  LYS A C   1 
ATOM 5403  O O   . LYS A 1 859  ? 44.256  -7.605  79.421  1.00 13.44  ? 859  LYS A O   1 
ATOM 5404  C CB  . LYS A 1 859  ? 46.034  -10.286 80.124  1.00 10.96  ? 859  LYS A CB  1 
ATOM 5405  H H   . LYS A 1 859  ? 44.633  -11.647 78.687  1.00 10.24  ? 859  LYS A H   1 
ATOM 5406  H HA  . LYS A 1 859  ? 44.069  -9.826  80.488  1.00 10.24  ? 859  LYS A HA  1 
ATOM 5407  N N   . ASN A 1 860  ? 44.942  -8.731  77.602  1.00 8.55   ? 860  ASN A N   1 
ATOM 5408  C CA  . ASN A 1 860  ? 45.017  -7.554  76.729  1.00 8.92   ? 860  ASN A CA  1 
ATOM 5409  C C   . ASN A 1 860  ? 43.676  -7.199  76.139  1.00 9.10   ? 860  ASN A C   1 
ATOM 5410  O O   . ASN A 1 860  ? 43.547  -6.131  75.522  1.00 8.55   ? 860  ASN A O   1 
ATOM 5411  C CB  . ASN A 1 860  ? 45.995  -7.769  75.563  1.00 8.55   ? 860  ASN A CB  1 
ATOM 5412  H HA  . ASN A 1 860  ? 45.328  -6.795  77.247  1.00 10.70  ? 860  ASN A HA  1 
ATOM 5413  N N   . LYS A 1 861  ? 42.724  -8.120  76.230  1.00 8.59   ? 861  LYS A N   1 
ATOM 5414  C CA  . LYS A 1 861  ? 41.335  -7.820  75.940  1.00 11.53  ? 861  LYS A CA  1 
ATOM 5415  C C   . LYS A 1 861  ? 40.683  -7.098  77.114  1.00 10.43  ? 861  LYS A C   1 
ATOM 5416  O O   . LYS A 1 861  ? 40.248  -5.942  76.996  1.00 8.59   ? 861  LYS A O   1 
ATOM 5417  C CB  . LYS A 1 861  ? 40.598  -9.123  75.633  1.00 13.74  ? 861  LYS A CB  1 
ATOM 5418  H H   . LYS A 1 861  ? 42.863  -8.937  76.461  1.00 10.31  ? 861  LYS A H   1 
ATOM 5419  H HA  . LYS A 1 861  ? 41.284  -7.246  75.159  1.00 13.84  ? 861  LYS A HA  1 
ATOM 5420  N N   . LEU A 1 862  ? 40.587  -7.786  78.257  1.00 8.61   ? 862  LEU A N   1 
ATOM 5421  C CA  . LEU A 1 862  ? 40.128  -7.136  79.469  1.00 8.53   ? 862  LEU A CA  1 
ATOM 5422  C C   . LEU A 1 862  ? 40.775  -5.766  79.557  1.00 8.53   ? 862  LEU A C   1 
ATOM 5423  O O   . LEU A 1 862  ? 40.088  -4.754  79.698  1.00 8.53   ? 862  LEU A O   1 
ATOM 5424  C CB  . LEU A 1 862  ? 40.492  -7.998  80.675  1.00 10.52  ? 862  LEU A CB  1 
ATOM 5425  H H   . LEU A 1 862  ? 40.782  -8.618  78.349  1.00 10.33  ? 862  LEU A H   1 
ATOM 5426  H HA  . LEU A 1 862  ? 39.164  -7.027  79.440  1.00 10.24  ? 862  LEU A HA  1 
ATOM 5427  N N   . THR A 1 863  ? 42.100  -5.732  79.370  1.00 12.45  ? 863  THR A N   1 
ATOM 5428  C CA  . THR A 1 863  ? 42.897  -4.523  79.527  1.00 14.30  ? 863  THR A CA  1 
ATOM 5429  C C   . THR A 1 863  ? 42.698  -3.541  78.386  1.00 13.79  ? 863  THR A C   1 
ATOM 5430  O O   . THR A 1 863  ? 42.858  -2.338  78.580  1.00 15.85  ? 863  THR A O   1 
ATOM 5431  C CB  . THR A 1 863  ? 44.382  -4.879  79.621  1.00 15.50  ? 863  THR A CB  1 
ATOM 5432  H H   . THR A 1 863  ? 42.566  -6.419  79.145  1.00 14.95  ? 863  THR A H   1 
ATOM 5433  H HA  . THR A 1 863  ? 42.641  -4.081  80.351  1.00 17.17  ? 863  THR A HA  1 
ATOM 5434  N N   . PHE A 1 864  ? 42.440  -4.015  77.172  1.00 12.92  ? 864  PHE A N   1 
ATOM 5435  C CA  . PHE A 1 864  ? 42.190  -3.059  76.107  1.00 12.03  ? 864  PHE A CA  1 
ATOM 5436  C C   . PHE A 1 864  ? 40.924  -2.274  76.423  1.00 13.01  ? 864  PHE A C   1 
ATOM 5437  O O   . PHE A 1 864  ? 40.962  -1.038  76.592  1.00 17.21  ? 864  PHE A O   1 
ATOM 5438  C CB  . PHE A 1 864  ? 42.104  -3.783  74.761  1.00 10.01  ? 864  PHE A CB  1 
ATOM 5439  H H   . PHE A 1 864  ? 42.405  -4.844  76.948  1.00 15.51  ? 864  PHE A H   1 
ATOM 5440  H HA  . PHE A 1 864  ? 42.929  -2.432  76.065  1.00 14.44  ? 864  PHE A HA  1 
ATOM 5441  N N   . GLU A 1 865  ? 39.807  -2.993  76.595  1.00 8.67   ? 865  GLU A N   1 
ATOM 5442  C CA  . GLU A 1 865  ? 38.569  -2.342  76.995  1.00 12.24  ? 865  GLU A CA  1 
ATOM 5443  C C   . GLU A 1 865  ? 38.832  -1.451  78.187  1.00 16.32  ? 865  GLU A C   1 
ATOM 5444  O O   . GLU A 1 865  ? 38.545  -0.239  78.183  1.00 21.20  ? 865  GLU A O   1 
ATOM 5445  C CB  . GLU A 1 865  ? 37.537  -3.402  77.358  1.00 12.52  ? 865  GLU A CB  1 
ATOM 5446  H H   . GLU A 1 865  ? 39.746  -3.844  76.486  1.00 10.40  ? 865  GLU A H   1 
ATOM 5447  H HA  . GLU A 1 865  ? 38.226  -1.802  76.266  1.00 14.69  ? 865  GLU A HA  1 
ATOM 5448  N N   . VAL A 1 866  ? 39.474  -2.041  79.183  1.00 14.44  ? 866  VAL A N   1 
ATOM 5449  C CA  . VAL A 1 866  ? 39.686  -1.390  80.455  1.00 23.33  ? 866  VAL A CA  1 
ATOM 5450  C C   . VAL A 1 866  ? 40.542  -0.143  80.299  1.00 26.97  ? 866  VAL A C   1 
ATOM 5451  O O   . VAL A 1 866  ? 40.369  0.828   81.036  1.00 38.53  ? 866  VAL A O   1 
ATOM 5452  C CB  . VAL A 1 866  ? 40.321  -2.395  81.431  1.00 21.52  ? 866  VAL A CB  1 
ATOM 5453  H H   . VAL A 1 866  ? 39.802  -2.835  79.142  1.00 17.33  ? 866  VAL A H   1 
ATOM 5454  H HA  . VAL A 1 866  ? 38.828  -1.120  80.819  1.00 28.00  ? 866  VAL A HA  1 
ATOM 5455  N N   . VAL A 1 867  ? 41.483  -0.160  79.357  1.00 25.42  ? 867  VAL A N   1 
ATOM 5456  C CA  . VAL A 1 867  ? 42.551  0.835   79.287  1.00 25.77  ? 867  VAL A CA  1 
ATOM 5457  C C   . VAL A 1 867  ? 42.067  2.111   78.606  1.00 22.85  ? 867  VAL A C   1 
ATOM 5458  O O   . VAL A 1 867  ? 42.253  3.230   79.123  1.00 20.01  ? 867  VAL A O   1 
ATOM 5459  C CB  . VAL A 1 867  ? 43.768  0.225   78.560  1.00 34.04  ? 867  VAL A CB  1 
ATOM 5460  H H   . VAL A 1 867  ? 41.524  -0.751  78.733  1.00 30.51  ? 867  VAL A H   1 
ATOM 5461  H HA  . VAL A 1 867  ? 42.826  1.064   80.188  1.00 30.92  ? 867  VAL A HA  1 
ATOM 5462  N N   . ASN A 1 868  ? 41.441  1.976   77.439  1.00 20.45  ? 868  ASN A N   1 
ATOM 5463  C CA  . ASN A 1 868  ? 40.730  3.138   76.939  1.00 18.69  ? 868  ASN A CA  1 
ATOM 5464  C C   . ASN A 1 868  ? 39.874  3.692   78.074  1.00 20.46  ? 868  ASN A C   1 
ATOM 5465  O O   . ASN A 1 868  ? 39.986  4.876   78.443  1.00 17.96  ? 868  ASN A O   1 
ATOM 5466  C CB  . ASN A 1 868  ? 39.878  2.759   75.727  1.00 16.93  ? 868  ASN A CB  1 
ATOM 5467  H H   . ASN A 1 868  ? 41.414  1.270   76.948  1.00 24.54  ? 868  ASN A H   1 
ATOM 5468  H HA  . ASN A 1 868  ? 41.366  3.819   76.670  1.00 22.43  ? 868  ASN A HA  1 
ATOM 5469  N N   . LEU A 1 869  ? 39.106  2.799   78.727  1.00 25.04  ? 869  LEU A N   1 
ATOM 5470  C CA  . LEU A 1 869  ? 38.243  3.238   79.814  1.00 25.85  ? 869  LEU A CA  1 
ATOM 5471  C C   . LEU A 1 869  ? 39.026  3.904   80.941  1.00 23.47  ? 869  LEU A C   1 
ATOM 5472  O O   . LEU A 1 869  ? 38.480  4.768   81.616  1.00 21.22  ? 869  LEU A O   1 
ATOM 5473  C CB  . LEU A 1 869  ? 37.429  2.056   80.354  1.00 19.45  ? 869  LEU A CB  1 
ATOM 5474  H H   . LEU A 1 869  ? 39.073  1.957   78.557  1.00 30.05  ? 869  LEU A H   1 
ATOM 5475  H HA  . LEU A 1 869  ? 37.616  3.892   79.467  1.00 31.02  ? 869  LEU A HA  1 
ATOM 5476  N N   . ALA A 1 870  ? 40.284  3.522   81.179  1.00 22.98  ? 870  ALA A N   1 
ATOM 5477  C CA  . ALA A 1 870  ? 41.017  4.123   82.280  1.00 19.07  ? 870  ALA A CA  1 
ATOM 5478  C C   . ALA A 1 870  ? 41.359  5.549   81.936  1.00 18.12  ? 870  ALA A C   1 
ATOM 5479  O O   . ALA A 1 870  ? 41.190  6.450   82.764  1.00 15.54  ? 870  ALA A O   1 
ATOM 5480  C CB  . ALA A 1 870  ? 42.279  3.320   82.605  1.00 26.92  ? 870  ALA A CB  1 
ATOM 5481  H H   . ALA A 1 870  ? 40.720  2.933   80.728  1.00 27.58  ? 870  ALA A H   1 
ATOM 5482  H HA  . ALA A 1 870  ? 40.454  4.130   83.070  1.00 22.89  ? 870  ALA A HA  1 
ATOM 5483  H HB1 . ALA A 1 870  ? 42.744  3.746   83.341  1.00 32.31  ? 870  ALA A HB1 1 
ATOM 5484  H HB2 . ALA A 1 870  ? 42.024  2.417   82.852  1.00 32.31  ? 870  ALA A HB2 1 
ATOM 5485  H HB3 . ALA A 1 870  ? 42.850  3.299   81.821  1.00 32.31  ? 870  ALA A HB3 1 
ATOM 5486  N N   . ARG A 1 871  ? 41.805  5.786   80.705  1.00 18.18  ? 871  ARG A N   1 
ATOM 5487  C CA  . ARG A 1 871  ? 41.889  7.159   80.258  1.00 17.45  ? 871  ARG A CA  1 
ATOM 5488  C C   . ARG A 1 871  ? 40.639  7.881   80.677  1.00 15.13  ? 871  ARG A C   1 
ATOM 5489  O O   . ARG A 1 871  ? 40.669  8.814   81.499  1.00 16.46  ? 871  ARG A O   1 
ATOM 5490  C CB  . ARG A 1 871  ? 42.032  7.200   78.743  1.00 18.92  ? 871  ARG A CB  1 
ATOM 5491  H H   . ARG A 1 871  ? 42.053  5.192   80.135  1.00 21.81  ? 871  ARG A H   1 
ATOM 5492  H HA  . ARG A 1 871  ? 42.657  7.594   80.661  1.00 20.94  ? 871  ARG A HA  1 
ATOM 5493  N N   . ASN A 1 872  ? 39.515  7.376   80.197  1.00 16.82  ? 872  ASN A N   1 
ATOM 5494  C CA  . ASN A 1 872  ? 38.258  8.062   80.413  1.00 23.91  ? 872  ASN A CA  1 
ATOM 5495  C C   . ASN A 1 872  ? 37.861  8.115   81.887  1.00 24.20  ? 872  ASN A C   1 
ATOM 5496  O O   . ASN A 1 872  ? 37.038  8.954   82.272  1.00 27.20  ? 872  ASN A O   1 
ATOM 5497  C CB  . ASN A 1 872  ? 37.160  7.376   79.606  1.00 33.85  ? 872  ASN A CB  1 
ATOM 5498  H H   . ASN A 1 872  ? 39.454  6.645   79.747  1.00 20.18  ? 872  ASN A H   1 
ATOM 5499  H HA  . ASN A 1 872  ? 38.339  8.974   80.093  1.00 28.70  ? 872  ASN A HA  1 
ATOM 5500  N N   . LEU A 1 873  ? 38.385  7.199   82.699  1.00 19.09  ? 873  LEU A N   1 
ATOM 5501  C CA  . LEU A 1 873  ? 38.010  7.070   84.102  1.00 21.35  ? 873  LEU A CA  1 
ATOM 5502  C C   . LEU A 1 873  ? 38.784  8.050   84.955  1.00 20.80  ? 873  LEU A C   1 
ATOM 5503  O O   . LEU A 1 873  ? 38.240  8.677   85.875  1.00 30.58  ? 873  LEU A O   1 
ATOM 5504  C CB  . LEU A 1 873  ? 38.278  5.641   84.580  1.00 19.85  ? 873  LEU A CB  1 
ATOM 5505  H H   . LEU A 1 873  ? 38.976  6.625   82.451  1.00 22.91  ? 873  LEU A H   1 
ATOM 5506  H HA  . LEU A 1 873  ? 37.063  7.255   84.202  1.00 25.62  ? 873  LEU A HA  1 
ATOM 5507  N N   . ILE A 1 874  ? 40.060  8.189   84.642  1.00 17.59  ? 874  ILE A N   1 
ATOM 5508  C CA  . ILE A 1 874  ? 40.877  9.189   85.290  1.00 20.20  ? 874  ILE A CA  1 
ATOM 5509  C C   . ILE A 1 874  ? 40.329  10.573  84.982  1.00 35.81  ? 874  ILE A C   1 
ATOM 5510  O O   . ILE A 1 874  ? 40.194  11.404  85.886  1.00 44.89  ? 874  ILE A O   1 
ATOM 5511  C CB  . ILE A 1 874  ? 42.341  9.054   84.846  1.00 22.08  ? 874  ILE A CB  1 
ATOM 5512  H H   . ILE A 1 874  ? 40.476  7.715   84.057  1.00 21.10  ? 874  ILE A H   1 
ATOM 5513  H HA  . ILE A 1 874  ? 40.839  9.056   86.250  1.00 24.24  ? 874  ILE A HA  1 
ATOM 5514  N N   . TYR A 1 875  ? 39.980  10.844  83.705  1.00 33.34  ? 875  TYR A N   1 
ATOM 5515  C CA  . TYR A 1 875  ? 39.463  12.178  83.360  1.00 40.86  ? 875  TYR A CA  1 
ATOM 5516  C C   . TYR A 1 875  ? 38.000  12.407  83.797  1.00 41.87  ? 875  TYR A C   1 
ATOM 5517  O O   . TYR A 1 875  ? 37.631  13.549  84.098  1.00 46.34  ? 875  TYR A O   1 
ATOM 5518  C CB  . TYR A 1 875  ? 39.603  12.430  81.855  1.00 36.31  ? 875  TYR A CB  1 
ATOM 5519  H H   . TYR A 1 875  ? 40.033  10.292  83.047  1.00 40.00  ? 875  TYR A H   1 
ATOM 5520  H HA  . TYR A 1 875  ? 40.006  12.840  83.815  1.00 49.03  ? 875  TYR A HA  1 
ATOM 5521  N N   . PHE A 1 876  ? 37.149  11.367  83.813  1.00 34.76  ? 876  PHE A N   1 
ATOM 5522  C CA  . PHE A 1 876  ? 35.748  11.539  84.213  1.00 25.83  ? 876  PHE A CA  1 
ATOM 5523  C C   . PHE A 1 876  ? 35.586  11.663  85.735  1.00 25.71  ? 876  PHE A C   1 
ATOM 5524  O O   . PHE A 1 876  ? 34.624  12.288  86.206  1.00 22.30  ? 876  PHE A O   1 
ATOM 5525  C CB  . PHE A 1 876  ? 34.903  10.376  83.675  1.00 22.43  ? 876  PHE A CB  1 
ATOM 5526  H H   . PHE A 1 876  ? 37.359  10.561  83.599  1.00 41.72  ? 876  PHE A H   1 
ATOM 5527  H HA  . PHE A 1 876  ? 35.411  12.356  83.814  1.00 30.99  ? 876  PHE A HA  1 
ATOM 5528  N N   . GLY A 1 877  ? 36.488  11.063  86.520  1.00 33.79  ? 877  GLY A N   1 
ATOM 5529  C CA  . GLY A 1 877  ? 36.519  11.307  87.957  1.00 29.33  ? 877  GLY A CA  1 
ATOM 5530  C C   . GLY A 1 877  ? 37.935  11.456  88.501  1.00 27.10  ? 877  GLY A C   1 
ATOM 5531  O O   . GLY A 1 877  ? 38.803  10.621  88.222  1.00 27.62  ? 877  GLY A O   1 
ATOM 5532  H H   . GLY A 1 877  ? 37.088  10.513  86.242  1.00 40.54  ? 877  GLY A H   1 
ATOM 5533  H HA2 . GLY A 1 877  ? 36.028  12.120  88.156  1.00 35.19  ? 877  GLY A HA2 1 
ATOM 5534  H HA3 . GLY A 1 877  ? 36.090  10.569  88.418  1.00 35.19  ? 877  GLY A HA3 1 
ATOM 5535  N N   . PHE A 1 878  ? 38.187  12.486  89.304  1.00 23.69  ? 878  PHE A N   1 
ATOM 5536  C CA  . PHE A 1 878  ? 39.546  12.778  89.753  1.00 24.70  ? 878  PHE A CA  1 
ATOM 5537  C C   . PHE A 1 878  ? 39.471  13.469  91.102  1.00 29.26  ? 878  PHE A C   1 
ATOM 5538  O O   . PHE A 1 878  ? 38.389  13.707  91.644  1.00 35.38  ? 878  PHE A O   1 
ATOM 5539  C CB  . PHE A 1 878  ? 40.318  13.647  88.755  1.00 19.04  ? 878  PHE A CB  1 
ATOM 5540  H H   . PHE A 1 878  ? 37.591  13.029  89.602  1.00 28.43  ? 878  PHE A H   1 
ATOM 5541  H HA  . PHE A 1 878  ? 40.029  11.945  89.866  1.00 29.64  ? 878  PHE A HA  1 
ATOM 5542  N N   . TYR A 1 879  ? 40.636  13.777  91.644  1.00 24.13  ? 879  TYR A N   1 
ATOM 5543  C CA  . TYR A 1 879  ? 40.739  14.315  92.983  1.00 30.85  ? 879  TYR A CA  1 
ATOM 5544  C C   . TYR A 1 879  ? 41.658  15.517  92.936  1.00 25.37  ? 879  TYR A C   1 
ATOM 5545  O O   . TYR A 1 879  ? 42.639  15.539  92.190  1.00 18.89  ? 879  TYR A O   1 
ATOM 5546  C CB  . TYR A 1 879  ? 41.253  13.261  93.960  1.00 26.16  ? 879  TYR A CB  1 
ATOM 5547  H HA  . TYR A 1 879  ? 39.864  14.609  93.281  1.00 37.02  ? 879  TYR A HA  1 
ATOM 5548  N N   . ASN A 1 880  ? 41.314  16.524  93.712  1.00 30.04  ? 880  ASN A N   1 
ATOM 5549  C CA  . ASN A 1 880  ? 42.083  17.748  93.719  1.00 30.84  ? 880  ASN A CA  1 
ATOM 5550  C C   . ASN A 1 880  ? 43.003  17.778  94.943  1.00 26.51  ? 880  ASN A C   1 
ATOM 5551  O O   . ASN A 1 880  ? 43.114  16.800  95.696  1.00 32.12  ? 880  ASN A O   1 
ATOM 5552  C CB  . ASN A 1 880  ? 41.140  18.951  93.683  1.00 33.22  ? 880  ASN A CB  1 
ATOM 5553  H HA  . ASN A 1 880  ? 42.639  17.778  92.924  1.00 37.01  ? 880  ASN A HA  1 
ATOM 5554  N N   . PHE A 1 881  ? 43.652  18.929  95.158  1.00 33.51  ? 881  PHE A N   1 
ATOM 5555  C CA  . PHE A 1 881  ? 44.681  19.091  96.190  1.00 22.94  ? 881  PHE A CA  1 
ATOM 5556  C C   . PHE A 1 881  ? 45.727  17.988  96.097  1.00 25.97  ? 881  PHE A C   1 
ATOM 5557  O O   . PHE A 1 881  ? 46.326  17.600  97.104  1.00 23.79  ? 881  PHE A O   1 
ATOM 5558  C CB  . PHE A 1 881  ? 44.073  19.122  97.593  1.00 25.13  ? 881  PHE A CB  1 
ATOM 5559  H HA  . PHE A 1 881  ? 45.132  19.937  96.046  1.00 27.53  ? 881  PHE A HA  1 
ATOM 5560  N N   . SER A 1 882  ? 45.938  17.480  94.878  1.00 28.85  ? 882  SER A N   1 
ATOM 5561  C CA  . SER A 1 882  ? 46.926  16.453  94.550  1.00 29.52  ? 882  SER A CA  1 
ATOM 5562  C C   . SER A 1 882  ? 46.442  15.030  94.825  1.00 31.52  ? 882  SER A C   1 
ATOM 5563  O O   . SER A 1 882  ? 47.267  14.117  94.923  1.00 37.50  ? 882  SER A O   1 
ATOM 5564  C CB  . SER A 1 882  ? 48.246  16.702  95.291  1.00 30.05  ? 882  SER A CB  1 
ATOM 5565  H HA  . SER A 1 882  ? 47.116  16.512  93.600  1.00 35.42  ? 882  SER A HA  1 
ATOM 5566  N N   . ASP A 1 883  ? 45.132  14.782  94.960  1.00 27.05  ? 883  ASP A N   1 
ATOM 5567  C CA  . ASP A 1 883  ? 44.678  13.399  95.126  1.00 21.21  ? 883  ASP A CA  1 
ATOM 5568  C C   . ASP A 1 883  ? 44.550  12.697  93.774  1.00 22.78  ? 883  ASP A C   1 
ATOM 5569  O O   . ASP A 1 883  ? 44.911  11.516  93.651  1.00 22.20  ? 883  ASP A O   1 
ATOM 5570  C CB  . ASP A 1 883  ? 43.364  13.373  95.909  1.00 23.34  ? 883  ASP A CB  1 
ATOM 5571  H H   . ASP A 1 883  ? 44.509  15.375  94.959  1.00 32.46  ? 883  ASP A H   1 
ATOM 5572  H HA  . ASP A 1 883  ? 45.339  12.915  95.645  1.00 25.45  ? 883  ASP A HA  1 
ATOM 5573  N N   . LEU A 1 884  ? 44.078  13.414  92.740  1.00 29.94  ? 884  LEU A N   1 
ATOM 5574  C CA  . LEU A 1 884  ? 44.173  12.903  91.377  1.00 31.49  ? 884  LEU A CA  1 
ATOM 5575  C C   . LEU A 1 884  ? 45.633  12.763  90.958  1.00 40.14  ? 884  LEU A C   1 
ATOM 5576  O O   . LEU A 1 884  ? 46.023  11.738  90.377  1.00 33.42  ? 884  LEU A O   1 
ATOM 5577  C CB  . LEU A 1 884  ? 43.422  13.828  90.409  1.00 20.18  ? 884  LEU A CB  1 
ATOM 5578  H H   . LEU A 1 884  ? 43.706  14.186  92.807  1.00 35.93  ? 884  LEU A H   1 
ATOM 5579  H HA  . LEU A 1 884  ? 43.762  12.025  91.337  1.00 37.78  ? 884  LEU A HA  1 
ATOM 5580  N N   . LEU A 1 885  ? 46.456  13.783  91.257  1.00 43.91  ? 885  LEU A N   1 
ATOM 5581  C CA  . LEU A 1 885  ? 47.881  13.748  90.936  1.00 43.37  ? 885  LEU A CA  1 
ATOM 5582  C C   . LEU A 1 885  ? 48.595  12.608  91.664  1.00 44.64  ? 885  LEU A C   1 
ATOM 5583  O O   . LEU A 1 885  ? 49.579  12.059  91.151  1.00 39.34  ? 885  LEU A O   1 
ATOM 5584  C CB  . LEU A 1 885  ? 48.518  15.102  91.281  1.00 30.82  ? 885  LEU A CB  1 
ATOM 5585  H H   . LEU A 1 885  ? 46.204  14.507  91.647  1.00 52.69  ? 885  LEU A H   1 
ATOM 5586  H HA  . LEU A 1 885  ? 47.984  13.604  89.983  1.00 52.04  ? 885  LEU A HA  1 
ATOM 5587  N N   . ARG A 1 886  ? 48.138  12.263  92.872  1.00 48.35  ? 886  ARG A N   1 
ATOM 5588  C CA  . ARG A 1 886  ? 48.683  11.113  93.585  1.00 42.81  ? 886  ARG A CA  1 
ATOM 5589  C C   . ARG A 1 886  ? 48.309  9.809   92.879  1.00 31.40  ? 886  ARG A C   1 
ATOM 5590  O O   . ARG A 1 886  ? 49.184  8.973   92.575  1.00 25.72  ? 886  ARG A O   1 
ATOM 5591  C CB  . ARG A 1 886  ? 48.171  11.126  95.030  1.00 55.77  ? 886  ARG A CB  1 
ATOM 5592  H H   . ARG A 1 886  ? 47.515  12.678  93.295  1.00 58.02  ? 886  ARG A H   1 
ATOM 5593  H HA  . ARG A 1 886  ? 49.650  11.179  93.605  1.00 51.38  ? 886  ARG A HA  1 
ATOM 5594  N N   . LEU A 1 887  ? 47.008  9.633   92.590  1.00 29.35  ? 887  LEU A N   1 
ATOM 5595  C CA  . LEU A 1 887  ? 46.581  8.535   91.738  1.00 28.18  ? 887  LEU A CA  1 
ATOM 5596  C C   . LEU A 1 887  ? 47.415  8.502   90.474  1.00 25.70  ? 887  LEU A C   1 
ATOM 5597  O O   . LEU A 1 887  ? 47.534  7.450   89.831  1.00 31.84  ? 887  LEU A O   1 
ATOM 5598  C CB  . LEU A 1 887  ? 45.092  8.680   91.401  1.00 23.55  ? 887  LEU A CB  1 
ATOM 5599  H H   . LEU A 1 887  ? 46.369  10.133  92.875  1.00 35.22  ? 887  LEU A H   1 
ATOM 5600  H HA  . LEU A 1 887  ? 46.707  7.696   92.208  1.00 33.82  ? 887  LEU A HA  1 
ATOM 5601  N N   . THR A 1 888  ? 48.040  9.632   90.151  1.00 25.75  ? 888  THR A N   1 
ATOM 5602  C CA  . THR A 1 888  ? 48.935  9.739   89.013  1.00 30.61  ? 888  THR A CA  1 
ATOM 5603  C C   . THR A 1 888  ? 50.372  9.300   89.343  1.00 26.63  ? 888  THR A C   1 
ATOM 5604  O O   . THR A 1 888  ? 51.033  8.693   88.504  1.00 30.35  ? 888  THR A O   1 
ATOM 5605  C CB  . THR A 1 888  ? 48.923  11.178  88.498  1.00 42.20  ? 888  THR A CB  1 
ATOM 5606  H HA  . THR A 1 888  ? 48.606  9.166   88.302  1.00 36.73  ? 888  THR A HA  1 
ATOM 5607  N N   . LYS A 1 889  ? 50.912  9.630   90.511  1.00 14.69  ? 889  LYS A N   1 
ATOM 5608  C CA  . LYS A 1 889  ? 52.244  9.133   90.817  1.00 10.11  ? 889  LYS A CA  1 
ATOM 5609  C C   . LYS A 1 889  ? 52.241  7.618   90.847  1.00 11.54  ? 889  LYS A C   1 
ATOM 5610  O O   . LYS A 1 889  ? 53.188  6.983   90.376  1.00 8.84   ? 889  LYS A O   1 
ATOM 5611  C CB  . LYS A 1 889  ? 52.726  9.701   92.143  1.00 8.84   ? 889  LYS A CB  1 
ATOM 5612  H H   . LYS A 1 889  ? 50.546  10.118  91.117  1.00 17.63  ? 889  LYS A H   1 
ATOM 5613  H HA  . LYS A 1 889  ? 52.859  9.421   90.124  1.00 12.13  ? 889  LYS A HA  1 
ATOM 5614  N N   . ILE A 1 890  ? 51.166  7.021   91.369  1.00 11.19  ? 890  ILE A N   1 
ATOM 5615  C CA  . ILE A 1 890  ? 51.015  5.573   91.284  1.00 15.63  ? 890  ILE A CA  1 
ATOM 5616  C C   . ILE A 1 890  ? 50.807  5.138   89.828  1.00 27.75  ? 890  ILE A C   1 
ATOM 5617  O O   . ILE A 1 890  ? 51.418  4.160   89.366  1.00 33.01  ? 890  ILE A O   1 
ATOM 5618  C CB  . ILE A 1 890  ? 49.859  5.102   92.188  1.00 12.43  ? 890  ILE A CB  1 
ATOM 5619  H H   . ILE A 1 890  ? 50.523  7.427   91.771  1.00 13.42  ? 890  ILE A H   1 
ATOM 5620  H HA  . ILE A 1 890  ? 51.829  5.155   91.604  1.00 18.75  ? 890  ILE A HA  1 
ATOM 5621  N N   . LEU A 1 891  ? 49.954  5.847   89.074  1.00 32.94  ? 891  LEU A N   1 
ATOM 5622  C CA  . LEU A 1 891  ? 49.746  5.484   87.675  1.00 30.79  ? 891  LEU A CA  1 
ATOM 5623  C C   . LEU A 1 891  ? 51.031  5.600   86.856  1.00 29.11  ? 891  LEU A C   1 
ATOM 5624  O O   . LEU A 1 891  ? 51.120  5.003   85.780  1.00 27.11  ? 891  LEU A O   1 
ATOM 5625  C CB  . LEU A 1 891  ? 48.647  6.359   87.064  1.00 26.83  ? 891  LEU A CB  1 
ATOM 5626  H H   . LEU A 1 891  ? 49.498  6.524   89.345  1.00 39.52  ? 891  LEU A H   1 
ATOM 5627  H HA  . LEU A 1 891  ? 49.449  4.562   87.632  1.00 36.94  ? 891  LEU A HA  1 
ATOM 5628  N N   . LEU A 1 892  ? 52.013  6.371   87.331  1.00 28.41  ? 892  LEU A N   1 
ATOM 5629  C CA  . LEU A 1 892  ? 53.299  6.457   86.661  1.00 33.27  ? 892  LEU A CA  1 
ATOM 5630  C C   . LEU A 1 892  ? 54.029  5.127   86.718  1.00 34.66  ? 892  LEU A C   1 
ATOM 5631  O O   . LEU A 1 892  ? 54.782  4.775   85.804  1.00 39.33  ? 892  LEU A O   1 
ATOM 5632  C CB  . LEU A 1 892  ? 54.143  7.550   87.318  1.00 36.24  ? 892  LEU A CB  1 
ATOM 5633  H H   . LEU A 1 892  ? 51.953  6.852   88.042  1.00 34.09  ? 892  LEU A H   1 
ATOM 5634  H HA  . LEU A 1 892  ? 53.162  6.692   85.730  1.00 39.92  ? 892  LEU A HA  1 
ATOM 5635  N N   . ALA A 1 893  ? 53.844  4.398   87.808  1.00 34.44  ? 893  ALA A N   1 
ATOM 5636  C CA  . ALA A 1 893  ? 54.459  3.093   87.963  1.00 43.74  ? 893  ALA A CA  1 
ATOM 5637  C C   . ALA A 1 893  ? 53.647  1.975   87.338  1.00 41.01  ? 893  ALA A C   1 
ATOM 5638  O O   . ALA A 1 893  ? 54.209  0.922   87.013  1.00 36.40  ? 893  ALA A O   1 
ATOM 5639  C CB  . ALA A 1 893  ? 54.635  2.767   89.434  1.00 52.24  ? 893  ALA A CB  1 
ATOM 5640  H H   . ALA A 1 893  ? 53.363  4.641   88.478  1.00 41.33  ? 893  ALA A H   1 
ATOM 5641  H HA  . ALA A 1 893  ? 55.335  3.101   87.547  1.00 52.48  ? 893  ALA A HA  1 
ATOM 5642  H HB1 . ALA A 1 893  ? 55.047  1.892   89.516  1.00 62.69  ? 893  ALA A HB1 1 
ATOM 5643  H HB2 . ALA A 1 893  ? 55.204  3.439   89.840  1.00 62.69  ? 893  ALA A HB2 1 
ATOM 5644  H HB3 . ALA A 1 893  ? 53.766  2.765   89.863  1.00 62.69  ? 893  ALA A HB3 1 
ATOM 5645  N N   . ILE A 1 894  ? 52.332  2.137   87.233  1.00 45.16  ? 894  ILE A N   1 
ATOM 5646  C CA  . ILE A 1 894  ? 51.568  1.164   86.467  1.00 47.06  ? 894  ILE A CA  1 
ATOM 5647  C C   . ILE A 1 894  ? 51.917  1.299   84.988  1.00 50.48  ? 894  ILE A C   1 
ATOM 5648  O O   . ILE A 1 894  ? 52.218  0.303   84.321  1.00 41.82  ? 894  ILE A O   1 
ATOM 5649  C CB  . ILE A 1 894  ? 50.059  1.341   86.718  1.00 55.44  ? 894  ILE A CB  1 
ATOM 5650  H H   . ILE A 1 894  ? 51.874  2.776   87.582  1.00 54.19  ? 894  ILE A H   1 
ATOM 5651  H HA  . ILE A 1 894  ? 51.816  0.271   86.753  1.00 56.47  ? 894  ILE A HA  1 
ATOM 5652  N N   . LEU A 1 895  ? 51.878  2.544   84.467  1.00 62.19  ? 895  LEU A N   1 
ATOM 5653  C CA  . LEU A 1 895  ? 52.341  2.877   83.116  1.00 66.02  ? 895  LEU A CA  1 
ATOM 5654  C C   . LEU A 1 895  ? 53.804  2.521   82.918  1.00 60.85  ? 895  LEU A C   1 
ATOM 5655  O O   . LEU A 1 895  ? 54.235  2.235   81.790  1.00 62.28  ? 895  LEU A O   1 
ATOM 5656  C CB  . LEU A 1 895  ? 52.137  4.377   82.862  1.00 53.05  ? 895  LEU A CB  1 
ATOM 5657  H H   . LEU A 1 895  ? 51.576  3.226   84.896  1.00 74.63  ? 895  LEU A H   1 
ATOM 5658  H HA  . LEU A 1 895  ? 51.816  2.383   82.467  1.00 79.23  ? 895  LEU A HA  1 
ATOM 5659  N N   . ASP A 1 896  ? 54.581  2.582   83.994  1.00 55.24  ? 896  ASP A N   1 
ATOM 5660  C CA  . ASP A 1 896  ? 55.953  2.113   83.962  1.00 70.60  ? 896  ASP A CA  1 
ATOM 5661  C C   . ASP A 1 896  ? 56.025  0.583   84.001  1.00 93.44  ? 896  ASP A C   1 
ATOM 5662  O O   . ASP A 1 896  ? 57.030  0.019   83.550  1.00 140.72 ? 896  ASP A O   1 
ATOM 5663  C CB  . ASP A 1 896  ? 56.736  2.733   85.132  1.00 52.46  ? 896  ASP A CB  1 
ATOM 5664  H H   . ASP A 1 896  ? 54.333  2.892   84.756  1.00 66.29  ? 896  ASP A H   1 
ATOM 5665  H HA  . ASP A 1 896  ? 56.367  2.409   83.137  1.00 84.72  ? 896  ASP A HA  1 
ATOM 5666  N N   . CYS A 1 897  ? 54.961  -0.109  84.490  1.00 73.07  ? 897  CYS A N   1 
ATOM 5667  C CA  . CYS A 1 897  ? 54.934  -1.571  84.646  1.00 59.21  ? 897  CYS A CA  1 
ATOM 5668  C C   . CYS A 1 897  ? 53.684  -2.094  83.925  1.00 43.66  ? 897  CYS A C   1 
ATOM 5669  O O   . CYS A 1 897  ? 52.710  -2.512  84.553  1.00 33.35  ? 897  CYS A O   1 
ATOM 5670  C CB  . CYS A 1 897  ? 54.956  -1.987  86.134  1.00 34.89  ? 897  CYS A CB  1 
ATOM 5671  H H   . CYS A 1 897  ? 54.229  0.268   84.741  1.00 87.68  ? 897  CYS A H   1 
ATOM 5672  H HA  . CYS A 1 897  ? 55.714  -1.952  84.214  1.00 71.05  ? 897  CYS A HA  1 
ATOM 5673  N N   . VAL A 1 898  ? 53.727  -2.039  82.592  1.00 64.42  ? 898  VAL A N   1 
ATOM 5674  C CA  . VAL A 1 898  ? 52.649  -2.493  81.720  1.00 72.11  ? 898  VAL A CA  1 
ATOM 5675  C C   . VAL A 1 898  ? 53.191  -3.472  80.670  1.00 108.25 ? 898  VAL A C   1 
ATOM 5676  O O   . VAL A 1 898  ? 54.289  -4.030  80.830  1.00 104.95 ? 898  VAL A O   1 
ATOM 5677  C CB  . VAL A 1 898  ? 51.962  -1.284  81.055  1.00 60.24  ? 898  VAL A CB  1 
ATOM 5678  H H   . VAL A 1 898  ? 54.400  -1.729  82.156  1.00 77.30  ? 898  VAL A H   1 
ATOM 5679  H HA  . VAL A 1 898  ? 51.986  -2.960  82.253  1.00 86.53  ? 898  VAL A HA  1 
ATOM 5680  N N   . HIS A 1 899  ? 52.411  -3.679  79.593  1.00 155.95 ? 899  HIS A N   1 
ATOM 5681  C CA  . HIS A 1 899  ? 52.736  -4.541  78.423  1.00 157.61 ? 899  HIS A CA  1 
ATOM 5682  C C   . HIS A 1 899  ? 51.921  -4.166  77.151  1.00 156.24 ? 899  HIS A C   1 
ATOM 5683  O O   . HIS A 1 899  ? 51.818  -2.992  76.737  1.00 161.45 ? 899  HIS A O   1 
ATOM 5684  C CB  . HIS A 1 899  ? 52.492  -6.027  78.748  1.00 119.61 ? 899  HIS A CB  1 
ATOM 5685  H HA  . HIS A 1 899  ? 53.677  -4.436  78.212  1.00 189.14 ? 899  HIS A HA  1 
ATOM 5686  N N   . PRO A 1 960  ? 55.377  -6.592  62.521  1.00 48.15  ? 960  PRO A N   1 
ATOM 5687  C CA  . PRO A 1 960  ? 56.382  -7.545  63.006  1.00 47.23  ? 960  PRO A CA  1 
ATOM 5688  C C   . PRO A 1 960  ? 56.014  -9.007  62.724  1.00 36.06  ? 960  PRO A C   1 
ATOM 5689  O O   . PRO A 1 960  ? 55.801  -9.763  63.667  1.00 39.10  ? 960  PRO A O   1 
ATOM 5690  C CB  . PRO A 1 960  ? 56.421  -7.269  64.515  1.00 43.12  ? 960  PRO A CB  1 
ATOM 5691  H HA  . PRO A 1 960  ? 57.249  -7.348  62.619  1.00 56.68  ? 960  PRO A HA  1 
ATOM 5692  N N   . GLU A 1 961  ? 55.948  -9.380  61.447  1.00 27.55  ? 961  GLU A N   1 
ATOM 5693  C CA  . GLU A 1 961  ? 55.579  -10.735 61.037  1.00 27.60  ? 961  GLU A CA  1 
ATOM 5694  C C   . GLU A 1 961  ? 54.216  -11.076 61.616  1.00 28.64  ? 961  GLU A C   1 
ATOM 5695  O O   . GLU A 1 961  ? 53.222  -10.447 61.243  1.00 27.61  ? 961  GLU A O   1 
ATOM 5696  C CB  . GLU A 1 961  ? 56.649  -11.731 61.477  1.00 29.37  ? 961  GLU A CB  1 
ATOM 5697  H HA  . GLU A 1 961  ? 55.514  -10.769 60.070  1.00 33.12  ? 961  GLU A HA  1 
ATOM 5698  N N   . LYS A 1 962  ? 54.146  -12.057 62.521  1.00 37.15  ? 962  LYS A N   1 
ATOM 5699  C CA  . LYS A 1 962  ? 52.891  -12.383 63.188  1.00 45.16  ? 962  LYS A CA  1 
ATOM 5700  C C   . LYS A 1 962  ? 52.283  -11.184 63.922  1.00 44.26  ? 962  LYS A C   1 
ATOM 5701  O O   . LYS A 1 962  ? 51.067  -11.146 64.147  1.00 36.14  ? 962  LYS A O   1 
ATOM 5702  C CB  . LYS A 1 962  ? 53.137  -13.537 64.169  1.00 56.56  ? 962  LYS A CB  1 
ATOM 5703  H H   . LYS A 1 962  ? 54.811  -12.545 62.763  1.00 44.58  ? 962  LYS A H   1 
ATOM 5704  H HA  . LYS A 1 962  ? 52.250  -12.685 62.525  1.00 54.20  ? 962  LYS A HA  1 
ATOM 5705  N N   . GLU A 1 963  ? 53.115  -10.208 64.294  1.00 43.88  ? 963  GLU A N   1 
ATOM 5706  C CA  . GLU A 1 963  ? 52.721  -9.096  65.147  1.00 34.67  ? 963  GLU A CA  1 
ATOM 5707  C C   . GLU A 1 963  ? 51.994  -8.006  64.393  1.00 28.64  ? 963  GLU A C   1 
ATOM 5708  O O   . GLU A 1 963  ? 51.845  -6.902  64.925  1.00 25.08  ? 963  GLU A O   1 
ATOM 5709  C CB  . GLU A 1 963  ? 53.952  -8.511  65.847  1.00 36.32  ? 963  GLU A CB  1 
ATOM 5710  H H   . GLU A 1 963  ? 53.940  -10.172 64.053  1.00 52.66  ? 963  GLU A H   1 
ATOM 5711  H HA  . GLU A 1 963  ? 52.121  -9.429  65.833  1.00 41.60  ? 963  GLU A HA  1 
ATOM 5712  N N   . ASP A 1 964  ? 51.592  -8.266  63.152  1.00 26.54  ? 964  ASP A N   1 
ATOM 5713  C CA  . ASP A 1 964  ? 50.560  -7.448  62.537  1.00 26.55  ? 964  ASP A CA  1 
ATOM 5714  C C   . ASP A 1 964  ? 49.192  -7.903  63.035  1.00 26.76  ? 964  ASP A C   1 
ATOM 5715  O O   . ASP A 1 964  ? 48.484  -7.150  63.718  1.00 27.90  ? 964  ASP A O   1 
ATOM 5716  C CB  . ASP A 1 964  ? 50.663  -7.530  61.012  1.00 36.96  ? 964  ASP A CB  1 
ATOM 5717  H H   . ASP A 1 964  ? 51.896  -8.898  62.655  1.00 31.85  ? 964  ASP A H   1 
ATOM 5718  H HA  . ASP A 1 964  ? 50.686  -6.523  62.800  1.00 31.86  ? 964  ASP A HA  1 
ATOM 5719  N N   . ILE A 1 965  ? 48.836  -9.163  62.741  1.00 25.61  ? 965  ILE A N   1 
ATOM 5720  C CA  . ILE A 1 965  ? 47.603  -9.756  63.249  1.00 25.65  ? 965  ILE A CA  1 
ATOM 5721  C C   . ILE A 1 965  ? 47.542  -9.598  64.763  1.00 30.15  ? 965  ILE A C   1 
ATOM 5722  O O   . ILE A 1 965  ? 46.521  -9.182  65.322  1.00 39.00  ? 965  ILE A O   1 
ATOM 5723  C CB  . ILE A 1 965  ? 47.504  -11.232 62.815  1.00 15.58  ? 965  ILE A CB  1 
ATOM 5724  H H   . ILE A 1 965  ? 49.298  -9.692  62.245  1.00 30.74  ? 965  ILE A H   1 
ATOM 5725  H HA  . ILE A 1 965  ? 46.846  -9.282  62.870  1.00 30.78  ? 965  ILE A HA  1 
ATOM 5726  N N   . MET A 1 966  ? 48.645  -9.889  65.446  1.00 27.61  ? 966  MET A N   1 
ATOM 5727  C CA  . MET A 1 966  ? 48.757  -9.527  66.853  1.00 33.78  ? 966  MET A CA  1 
ATOM 5728  C C   . MET A 1 966  ? 48.846  -8.008  67.047  1.00 27.13  ? 966  MET A C   1 
ATOM 5729  O O   . MET A 1 966  ? 48.460  -7.486  68.111  1.00 24.08  ? 966  MET A O   1 
ATOM 5730  C CB  . MET A 1 966  ? 49.980  -10.228 67.445  1.00 38.39  ? 966  MET A CB  1 
ATOM 5731  H H   . MET A 1 966  ? 49.334  -10.289 65.123  1.00 33.13  ? 966  MET A H   1 
ATOM 5732  H HA  . MET A 1 966  ? 47.973  -9.855  67.321  1.00 40.53  ? 966  MET A HA  1 
ATOM 5733  N N   . VAL A 1 967  ? 49.287  -7.288  66.015  1.00 23.75  ? 967  VAL A N   1 
ATOM 5734  C CA  . VAL A 1 967  ? 49.631  -5.889  66.179  1.00 26.60  ? 967  VAL A CA  1 
ATOM 5735  C C   . VAL A 1 967  ? 48.409  -4.995  66.248  1.00 27.71  ? 967  VAL A C   1 
ATOM 5736  O O   . VAL A 1 967  ? 48.530  -3.857  66.704  1.00 32.46  ? 967  VAL A O   1 
ATOM 5737  C CB  . VAL A 1 967  ? 50.538  -5.366  65.049  1.00 27.73  ? 967  VAL A CB  1 
ATOM 5738  H H   . VAL A 1 967  ? 49.395  -7.589  65.217  1.00 28.49  ? 967  VAL A H   1 
ATOM 5739  H HA  . VAL A 1 967  ? 50.115  -5.787  67.013  1.00 31.92  ? 967  VAL A HA  1 
ATOM 5740  N N   . MET A 1 968  ? 47.243  -5.438  65.776  1.00 23.79  ? 968  MET A N   1 
ATOM 5741  C CA  . MET A 1 968  ? 46.050  -4.661  66.070  1.00 24.49  ? 968  MET A CA  1 
ATOM 5742  C C   . MET A 1 968  ? 45.816  -4.604  67.578  1.00 31.36  ? 968  MET A C   1 
ATOM 5743  O O   . MET A 1 968  ? 45.636  -3.520  68.146  1.00 36.13  ? 968  MET A O   1 
ATOM 5744  C CB  . MET A 1 968  ? 44.842  -5.239  65.340  1.00 18.41  ? 968  MET A CB  1 
ATOM 5745  H H   . MET A 1 968  ? 47.122  -6.149  65.308  1.00 28.54  ? 968  MET A H   1 
ATOM 5746  H HA  . MET A 1 968  ? 46.183  -3.757  65.745  1.00 29.38  ? 968  MET A HA  1 
ATOM 5747  N N   . ASP A 1 969  ? 45.849  -5.759  68.256  1.00 28.76  ? 969  ASP A N   1 
ATOM 5748  C CA  . ASP A 1 969  ? 45.679  -5.769  69.714  1.00 28.99  ? 969  ASP A CA  1 
ATOM 5749  C C   . ASP A 1 969  ? 46.756  -4.939  70.404  1.00 31.53  ? 969  ASP A C   1 
ATOM 5750  O O   . ASP A 1 969  ? 46.470  -4.173  71.348  1.00 37.86  ? 969  ASP A O   1 
ATOM 5751  C CB  . ASP A 1 969  ? 45.713  -7.204  70.236  1.00 24.40  ? 969  ASP A CB  1 
ATOM 5752  H HA  . ASP A 1 969  ? 44.815  -5.387  69.936  1.00 34.79  ? 969  ASP A HA  1 
ATOM 5753  N N   . THR A 1 970  ? 48.003  -5.084  69.942  1.00 39.97  ? 970  THR A N   1 
ATOM 5754  C CA  . THR A 1 970  ? 49.117  -4.331  70.511  1.00 59.78  ? 970  THR A CA  1 
ATOM 5755  C C   . THR A 1 970  ? 48.957  -2.817  70.315  1.00 64.63  ? 970  THR A C   1 
ATOM 5756  O O   . THR A 1 970  ? 49.314  -2.020  71.202  1.00 71.36  ? 970  THR A O   1 
ATOM 5757  C CB  . THR A 1 970  ? 50.423  -4.812  69.877  1.00 67.36  ? 970  THR A CB  1 
ATOM 5758  H H   . THR A 1 970  ? 48.227  -5.613  69.301  1.00 47.96  ? 970  THR A H   1 
ATOM 5759  H HA  . THR A 1 970  ? 49.164  -4.506  71.464  1.00 71.74  ? 970  THR A HA  1 
ATOM 5760  N N   . LYS A 1 971  ? 48.460  -2.398  69.152  1.00 53.85  ? 971  LYS A N   1 
ATOM 5761  C CA  . LYS A 1 971  ? 48.232  -0.982  68.922  1.00 44.32  ? 971  LYS A CA  1 
ATOM 5762  C C   . LYS A 1 971  ? 47.094  -0.458  69.798  1.00 50.01  ? 971  LYS A C   1 
ATOM 5763  O O   . LYS A 1 971  ? 47.096  0.729   70.158  1.00 50.67  ? 971  LYS A O   1 
ATOM 5764  C CB  . LYS A 1 971  ? 47.946  -0.749  67.439  1.00 44.11  ? 971  LYS A CB  1 
ATOM 5765  H H   . LYS A 1 971  ? 48.251  -2.908  68.492  1.00 64.62  ? 971  LYS A H   1 
ATOM 5766  H HA  . LYS A 1 971  ? 49.037  -0.492  69.151  1.00 53.19  ? 971  LYS A HA  1 
ATOM 5767  N N   . LEU A 1 972  ? 46.126  -1.326  70.154  1.00 54.12  ? 972  LEU A N   1 
ATOM 5768  C CA  . LEU A 1 972  ? 45.068  -0.944  71.091  1.00 55.66  ? 972  LEU A CA  1 
ATOM 5769  C C   . LEU A 1 972  ? 45.614  -0.688  72.495  1.00 59.16  ? 972  LEU A C   1 
ATOM 5770  O O   . LEU A 1 972  ? 45.132  0.215   73.199  1.00 56.62  ? 972  LEU A O   1 
ATOM 5771  C CB  . LEU A 1 972  ? 43.990  -2.031  71.140  1.00 45.02  ? 972  LEU A CB  1 
ATOM 5772  H H   . LEU A 1 972  ? 46.066  -2.134  69.867  1.00 64.95  ? 972  LEU A H   1 
ATOM 5773  H HA  . LEU A 1 972  ? 44.652  -0.125  70.778  1.00 66.80  ? 972  LEU A HA  1 
ATOM 5774  N N   . LYS A 1 973  ? 46.606  -1.480  72.930  1.00 68.68  ? 973  LYS A N   1 
ATOM 5775  C CA  . LYS A 1 973  ? 47.210  -1.250  74.249  1.00 78.39  ? 973  LYS A CA  1 
ATOM 5776  C C   . LYS A 1 973  ? 48.221  -0.076  74.287  1.00 70.67  ? 973  LYS A C   1 
ATOM 5777  O O   . LYS A 1 973  ? 48.346  0.594   75.328  1.00 66.35  ? 973  LYS A O   1 
ATOM 5778  C CB  . LYS A 1 973  ? 47.871  -2.539  74.734  1.00 86.24  ? 973  LYS A CB  1 
ATOM 5779  H H   . LYS A 1 973  ? 46.939  -2.141  72.492  1.00 82.42  ? 973  LYS A H   1 
ATOM 5780  H HA  . LYS A 1 973  ? 46.500  -1.036  74.875  1.00 94.07  ? 973  LYS A HA  1 
ATOM 5781  N N   . ILE A 1 974  ? 48.970  0.185   73.206  1.00 66.06  ? 974  ILE A N   1 
ATOM 5782  C CA  . ILE A 1 974  ? 49.780  1.398   73.185  1.00 50.42  ? 974  ILE A CA  1 
ATOM 5783  C C   . ILE A 1 974  ? 48.883  2.648   73.104  1.00 51.63  ? 974  ILE A C   1 
ATOM 5784  O O   . ILE A 1 974  ? 49.159  3.659   73.765  1.00 43.66  ? 974  ILE A O   1 
ATOM 5785  C CB  . ILE A 1 974  ? 50.798  1.328   72.030  1.00 34.62  ? 974  ILE A CB  1 
ATOM 5786  H H   . ILE A 1 974  ? 49.022  -0.306  72.501  1.00 79.27  ? 974  ILE A H   1 
ATOM 5787  H HA  . ILE A 1 974  ? 50.281  1.450   74.014  1.00 60.50  ? 974  ILE A HA  1 
ATOM 5788  N N   . ILE A 1 975  ? 47.790  2.594   72.317  1.00 46.12  ? 975  ILE A N   1 
ATOM 5789  C CA  . ILE A 1 975  ? 46.872  3.730   72.184  1.00 27.83  ? 975  ILE A CA  1 
ATOM 5790  C C   . ILE A 1 975  ? 46.106  3.985   73.476  1.00 27.37  ? 975  ILE A C   1 
ATOM 5791  O O   . ILE A 1 975  ? 45.749  5.127   73.766  1.00 24.81  ? 975  ILE A O   1 
ATOM 5792  C CB  . ILE A 1 975  ? 45.904  3.496   71.012  1.00 27.13  ? 975  ILE A CB  1 
ATOM 5793  H H   . ILE A 1 975  ? 47.564  1.908   71.851  1.00 55.34  ? 975  ILE A H   1 
ATOM 5794  H HA  . ILE A 1 975  ? 47.389  4.526   71.986  1.00 33.39  ? 975  ILE A HA  1 
ATOM 5795  N N   . GLU A 1 976  ? 45.786  2.936   74.241  1.00 31.67  ? 976  GLU A N   1 
ATOM 5796  C CA  . GLU A 1 976  ? 45.137  3.149   75.533  1.00 30.58  ? 976  GLU A CA  1 
ATOM 5797  C C   . GLU A 1 976  ? 46.129  3.636   76.590  1.00 32.12  ? 976  GLU A C   1 
ATOM 5798  O O   . GLU A 1 976  ? 45.767  4.447   77.452  1.00 29.29  ? 976  GLU A O   1 
ATOM 5799  C CB  . GLU A 1 976  ? 44.445  1.864   75.984  1.00 30.15  ? 976  GLU A CB  1 
ATOM 5800  H H   . GLU A 1 976  ? 45.930  2.112   74.040  1.00 38.00  ? 976  GLU A H   1 
ATOM 5801  H HA  . GLU A 1 976  ? 44.455  3.832   75.430  1.00 36.70  ? 976  GLU A HA  1 
ATOM 5802  N N   . ILE A 1 977  ? 47.375  3.142   76.569  1.00 33.49  ? 977  ILE A N   1 
ATOM 5803  C CA  . ILE A 1 977  ? 48.413  3.743   77.401  1.00 30.19  ? 977  ILE A CA  1 
ATOM 5804  C C   . ILE A 1 977  ? 48.520  5.225   77.087  1.00 28.84  ? 977  ILE A C   1 
ATOM 5805  O O   . ILE A 1 977  ? 48.608  6.074   77.985  1.00 27.00  ? 977  ILE A O   1 
ATOM 5806  C CB  . ILE A 1 977  ? 49.755  3.024   77.175  1.00 28.02  ? 977  ILE A CB  1 
ATOM 5807  H H   . ILE A 1 977  ? 47.635  2.475   76.092  1.00 40.19  ? 977  ILE A H   1 
ATOM 5808  H HA  . ILE A 1 977  ? 48.170  3.647   78.336  1.00 36.23  ? 977  ILE A HA  1 
ATOM 5809  N N   . LEU A 1 978  ? 48.470  5.552   75.804  1.00 29.89  ? 978  LEU A N   1 
ATOM 5810  C CA  . LEU A 1 978  ? 48.509  6.929   75.369  1.00 41.17  ? 978  LEU A CA  1 
ATOM 5811  C C   . LEU A 1 978  ? 47.218  7.682   75.694  1.00 54.90  ? 978  LEU A C   1 
ATOM 5812  O O   . LEU A 1 978  ? 47.243  8.913   75.774  1.00 64.87  ? 978  LEU A O   1 
ATOM 5813  C CB  . LEU A 1 978  ? 48.786  6.957   73.868  1.00 46.16  ? 978  LEU A CB  1 
ATOM 5814  H H   . LEU A 1 978  ? 48.411  4.984   75.161  1.00 35.87  ? 978  LEU A H   1 
ATOM 5815  H HA  . LEU A 1 978  ? 49.241  7.381   75.817  1.00 49.40  ? 978  LEU A HA  1 
ATOM 5816  N N   . GLN A 1 979  ? 46.081  6.978   75.847  1.00 58.72  ? 979  GLN A N   1 
ATOM 5817  C CA  . GLN A 1 979  ? 44.790  7.626   76.113  1.00 60.43  ? 979  GLN A CA  1 
ATOM 5818  C C   . GLN A 1 979  ? 44.639  7.976   77.587  1.00 49.61  ? 979  GLN A C   1 
ATOM 5819  O O   . GLN A 1 979  ? 44.074  9.023   77.937  1.00 43.91  ? 979  GLN A O   1 
ATOM 5820  C CB  . GLN A 1 979  ? 43.635  6.715   75.671  1.00 52.76  ? 979  GLN A CB  1 
ATOM 5821  H H   . GLN A 1 979  ? 46.036  6.120   75.800  1.00 70.47  ? 979  GLN A H   1 
ATOM 5822  H HA  . GLN A 1 979  ? 44.737  8.449   75.602  1.00 72.52  ? 979  GLN A HA  1 
ATOM 5823  N N   . PHE A 1 980  ? 45.072  7.065   78.451  1.00 40.06  ? 980  PHE A N   1 
ATOM 5824  C CA  . PHE A 1 980  ? 45.280  7.392   79.848  1.00 37.53  ? 980  PHE A CA  1 
ATOM 5825  C C   . PHE A 1 980  ? 46.257  8.559   79.979  1.00 36.23  ? 980  PHE A C   1 
ATOM 5826  O O   . PHE A 1 980  ? 45.914  9.614   80.535  1.00 35.61  ? 980  PHE A O   1 
ATOM 5827  C CB  . PHE A 1 980  ? 45.800  6.146   80.568  1.00 37.89  ? 980  PHE A CB  1 
ATOM 5828  H H   . PHE A 1 980  ? 45.253  6.248   78.249  1.00 48.08  ? 980  PHE A H   1 
ATOM 5829  H HA  . PHE A 1 980  ? 44.436  7.650   80.250  1.00 45.03  ? 980  PHE A HA  1 
ATOM 5830  N N   . ILE A 1 981  ? 47.469  8.394   79.433  1.00 34.68  ? 981  ILE A N   1 
ATOM 5831  C CA  . ILE A 1 981  ? 48.523  9.392   79.576  1.00 35.42  ? 981  ILE A CA  1 
ATOM 5832  C C   . ILE A 1 981  ? 48.124  10.712  78.934  1.00 33.17  ? 981  ILE A C   1 
ATOM 5833  O O   . ILE A 1 981  ? 48.625  11.777  79.313  1.00 28.88  ? 981  ILE A O   1 
ATOM 5834  C CB  . ILE A 1 981  ? 49.833  8.854   78.967  1.00 28.64  ? 981  ILE A CB  1 
ATOM 5835  H H   . ILE A 1 981  ? 47.701  7.706   78.972  1.00 41.62  ? 981  ILE A H   1 
ATOM 5836  H HA  . ILE A 1 981  ? 48.677  9.553   80.520  1.00 42.50  ? 981  ILE A HA  1 
ATOM 5837  N N   . LEU A 1 982  ? 47.205  10.662  77.976  1.00 34.69  ? 982  LEU A N   1 
ATOM 5838  C CA  . LEU A 1 982  ? 46.785  11.841  77.238  1.00 39.52  ? 982  LEU A CA  1 
ATOM 5839  C C   . LEU A 1 982  ? 45.612  12.566  77.907  1.00 42.59  ? 982  LEU A C   1 
ATOM 5840  O O   . LEU A 1 982  ? 45.542  13.800  77.875  1.00 40.59  ? 982  LEU A O   1 
ATOM 5841  C CB  . LEU A 1 982  ? 46.416  11.429  75.814  1.00 49.21  ? 982  LEU A CB  1 
ATOM 5842  H H   . LEU A 1 982  ? 46.805  9.941   77.732  1.00 41.63  ? 982  LEU A H   1 
ATOM 5843  H HA  . LEU A 1 982  ? 47.529  12.462  77.187  1.00 47.42  ? 982  LEU A HA  1 
ATOM 5844  N N   . ASN A 1 983  ? 44.654  11.829  78.476  1.00 41.98  ? 983  ASN A N   1 
ATOM 5845  C CA  . ASN A 1 983  ? 43.561  12.486  79.186  1.00 38.56  ? 983  ASN A CA  1 
ATOM 5846  C C   . ASN A 1 983  ? 44.037  13.053  80.520  1.00 30.02  ? 983  ASN A C   1 
ATOM 5847  O O   . ASN A 1 983  ? 43.727  14.197  80.866  1.00 24.91  ? 983  ASN A O   1 
ATOM 5848  C CB  . ASN A 1 983  ? 42.405  11.504  79.385  1.00 37.16  ? 983  ASN A CB  1 
ATOM 5849  H H   . ASN A 1 983  ? 44.615  10.970  78.464  1.00 50.37  ? 983  ASN A H   1 
ATOM 5850  H HA  . ASN A 1 983  ? 43.235  13.224  78.648  1.00 46.28  ? 983  ASN A HA  1 
ATOM 5851  N N   . VAL A 1 984  ? 44.812  12.285  81.282  1.00 28.18  ? 984  VAL A N   1 
ATOM 5852  C CA  . VAL A 1 984  ? 45.354  12.838  82.517  1.00 25.03  ? 984  VAL A CA  1 
ATOM 5853  C C   . VAL A 1 984  ? 46.447  13.869  82.205  1.00 28.74  ? 984  VAL A C   1 
ATOM 5854  O O   . VAL A 1 984  ? 46.362  15.029  82.631  1.00 22.60  ? 984  VAL A O   1 
ATOM 5855  C CB  . VAL A 1 984  ? 45.865  11.706  83.425  1.00 20.71  ? 984  VAL A CB  1 
ATOM 5856  H H   . VAL A 1 984  ? 45.031  11.471  81.115  1.00 33.82  ? 984  VAL A H   1 
ATOM 5857  H HA  . VAL A 1 984  ? 44.642  13.297  82.991  1.00 30.04  ? 984  VAL A HA  1 
ATOM 5858  N N   . ARG A 1 985  ? 47.470  13.469  81.431  1.00 32.66  ? 985  ARG A N   1 
ATOM 5859  C CA  . ARG A 1 985  ? 48.606  14.349  81.133  1.00 32.38  ? 985  ARG A CA  1 
ATOM 5860  C C   . ARG A 1 985  ? 48.141  15.608  80.404  1.00 23.67  ? 985  ARG A C   1 
ATOM 5861  O O   . ARG A 1 985  ? 48.363  16.735  80.864  1.00 16.75  ? 985  ARG A O   1 
ATOM 5862  C CB  . ARG A 1 985  ? 49.641  13.596  80.292  1.00 30.82  ? 985  ARG A CB  1 
ATOM 5863  H H   . ARG A 1 985  ? 47.526  12.691  81.068  1.00 39.19  ? 985  ARG A H   1 
ATOM 5864  H HA  . ARG A 1 985  ? 49.028  14.618  81.964  1.00 38.86  ? 985  ARG A HA  1 
ATOM 5865  N N   . LEU A 1 986  ? 47.489  15.419  79.253  1.00 30.72  ? 986  LEU A N   1 
ATOM 5866  C CA  . LEU A 1 986  ? 47.053  16.516  78.400  1.00 33.83  ? 986  LEU A CA  1 
ATOM 5867  C C   . LEU A 1 986  ? 45.746  17.151  78.875  1.00 28.26  ? 986  LEU A C   1 
ATOM 5868  O O   . LEU A 1 986  ? 45.623  18.378  78.859  1.00 32.40  ? 986  LEU A O   1 
ATOM 5869  C CB  . LEU A 1 986  ? 46.893  16.019  76.964  1.00 45.55  ? 986  LEU A CB  1 
ATOM 5870  H H   . LEU A 1 986  ? 47.284  14.643  78.942  1.00 36.87  ? 986  LEU A H   1 
ATOM 5871  H HA  . LEU A 1 986  ? 47.736  17.204  78.403  1.00 40.59  ? 986  LEU A HA  1 
ATOM 5872  N N   . ASP A 1 987  ? 44.743  16.354  79.269  1.00 27.52  ? 987  ASP A N   1 
ATOM 5873  C CA  . ASP A 1 987  ? 43.462  16.971  79.594  1.00 23.97  ? 987  ASP A CA  1 
ATOM 5874  C C   . ASP A 1 987  ? 43.586  17.836  80.839  1.00 23.22  ? 987  ASP A C   1 
ATOM 5875  O O   . ASP A 1 987  ? 43.015  18.928  80.893  1.00 27.32  ? 987  ASP A O   1 
ATOM 5876  C CB  . ASP A 1 987  ? 42.355  15.927  79.768  1.00 22.32  ? 987  ASP A CB  1 
ATOM 5877  H H   . ASP A 1 987  ? 44.778  15.499  79.352  1.00 33.02  ? 987  ASP A H   1 
ATOM 5878  H HA  . ASP A 1 987  ? 43.204  17.550  78.860  1.00 28.77  ? 987  ASP A HA  1 
ATOM 5879  N N   . TYR A 1 988  ? 44.342  17.391  81.840  1.00 20.60  ? 988  TYR A N   1 
ATOM 5880  C CA  . TYR A 1 988  ? 44.578  18.263  82.981  1.00 17.25  ? 988  TYR A CA  1 
ATOM 5881  C C   . TYR A 1 988  ? 45.754  17.800  83.810  1.00 14.44  ? 988  TYR A C   1 
ATOM 5882  O O   . TYR A 1 988  ? 45.550  17.372  84.950  1.00 17.16  ? 988  TYR A O   1 
ATOM 5883  C CB  . TYR A 1 988  ? 43.343  18.325  83.878  1.00 19.12  ? 988  TYR A CB  1 
ATOM 5884  H H   . TYR A 1 988  ? 44.717  16.618  81.882  1.00 24.72  ? 988  TYR A H   1 
ATOM 5885  H HA  . TYR A 1 988  ? 44.767  19.160  82.662  1.00 20.70  ? 988  TYR A HA  1 
ATOM 5886  N N   . ARG A 1 989  ? 46.960  17.884  83.289  1.00 12.17  ? 989  ARG A N   1 
ATOM 5887  C CA  . ARG A 1 989  ? 48.120  17.490  84.065  1.00 11.96  ? 989  ARG A CA  1 
ATOM 5888  C C   . ARG A 1 989  ? 49.199  18.559  84.026  1.00 13.36  ? 989  ARG A C   1 
ATOM 5889  O O   . ARG A 1 989  ? 49.398  19.215  83.004  1.00 13.00  ? 989  ARG A O   1 
ATOM 5890  C CB  . ARG A 1 989  ? 48.711  16.200  83.562  1.00 13.97  ? 989  ARG A CB  1 
ATOM 5891  H H   . ARG A 1 989  ? 47.136  18.164  82.495  1.00 14.61  ? 989  ARG A H   1 
ATOM 5892  H HA  . ARG A 1 989  ? 47.856  17.361  84.990  1.00 14.35  ? 989  ARG A HA  1 
ATOM 5893  N N   . ILE A 1 990  ? 49.896  18.689  85.157  1.00 19.61  ? 990  ILE A N   1 
ATOM 5894  C CA  . ILE A 1 990  ? 51.153  19.422  85.312  1.00 19.85  ? 990  ILE A CA  1 
ATOM 5895  C C   . ILE A 1 990  ? 50.964  20.922  85.127  1.00 11.26  ? 990  ILE A C   1 
ATOM 5896  O O   . ILE A 1 990  ? 51.810  21.592  84.530  1.00 8.78   ? 990  ILE A O   1 
ATOM 5897  C CB  . ILE A 1 990  ? 52.222  18.897  84.335  1.00 28.80  ? 990  ILE A CB  1 
ATOM 5898  H HA  . ILE A 1 990  ? 51.484  19.278  86.213  1.00 23.82  ? 990  ILE A HA  1 
ATOM 5899  N N   . SER A 1 991  ? 49.882  21.467  85.665  1.00 9.42   ? 991  SER A N   1 
ATOM 5900  C CA  . SER A 1 991  ? 49.536  22.855  85.430  1.00 8.82   ? 991  SER A CA  1 
ATOM 5901  C C   . SER A 1 991  ? 49.491  23.712  86.689  1.00 8.82   ? 991  SER A C   1 
ATOM 5902  O O   . SER A 1 991  ? 49.178  24.900  86.593  1.00 8.82   ? 991  SER A O   1 
ATOM 5903  C CB  . SER A 1 991  ? 48.175  22.923  84.732  1.00 8.82   ? 991  SER A CB  1 
ATOM 5904  H H   . SER A 1 991  ? 49.328  21.048  86.173  1.00 11.30  ? 991  SER A H   1 
ATOM 5905  H HA  . SER A 1 991  ? 50.195  23.243  84.833  1.00 10.58  ? 991  SER A HA  1 
ATOM 5906  N N   . CYS A 1 992  ? 49.785  23.165  87.857  1.00 8.88   ? 992  CYS A N   1 
ATOM 5907  C CA  . CYS A 1 992  ? 49.527  23.918  89.071  1.00 11.69  ? 992  CYS A CA  1 
ATOM 5908  C C   . CYS A 1 992  ? 50.744  24.653  89.615  1.00 15.06  ? 992  CYS A C   1 
ATOM 5909  O O   . CYS A 1 992  ? 50.562  25.637  90.331  1.00 20.60  ? 992  CYS A O   1 
ATOM 5910  C CB  . CYS A 1 992  ? 48.964  22.990  90.155  1.00 15.91  ? 992  CYS A CB  1 
ATOM 5911  H H   . CYS A 1 992  ? 50.125  22.384  87.973  1.00 10.66  ? 992  CYS A H   1 
ATOM 5912  H HA  . CYS A 1 992  ? 48.849  24.585  88.879  1.00 14.03  ? 992  CYS A HA  1 
ATOM 5913  N N   . LEU A 1 993  ? 51.975  24.230  89.302  1.00 12.62  ? 993  LEU A N   1 
ATOM 5914  C CA  . LEU A 1 993  ? 53.132  24.870  89.928  1.00 13.99  ? 993  LEU A CA  1 
ATOM 5915  C C   . LEU A 1 993  ? 53.084  26.377  89.737  1.00 10.38  ? 993  LEU A C   1 
ATOM 5916  O O   . LEU A 1 993  ? 53.404  27.135  90.658  1.00 9.79   ? 993  LEU A O   1 
ATOM 5917  C CB  . LEU A 1 993  ? 54.436  24.309  89.359  1.00 15.86  ? 993  LEU A CB  1 
ATOM 5918  H H   . LEU A 1 993  ? 52.160  23.598  88.750  1.00 15.15  ? 993  LEU A H   1 
ATOM 5919  H HA  . LEU A 1 993  ? 53.117  24.688  90.881  1.00 16.79  ? 993  LEU A HA  1 
ATOM 5920  N N   . LEU A 1 994  ? 52.685  26.826  88.548  1.00 8.84   ? 994  LEU A N   1 
ATOM 5921  C CA  . LEU A 1 994  ? 52.599  28.249  88.272  1.00 8.84   ? 994  LEU A CA  1 
ATOM 5922  C C   . LEU A 1 994  ? 51.296  28.850  88.783  1.00 9.36   ? 994  LEU A C   1 
ATOM 5923  O O   . LEU A 1 994  ? 51.303  29.879  89.464  1.00 9.67   ? 994  LEU A O   1 
ATOM 5924  C CB  . LEU A 1 994  ? 52.741  28.479  86.771  1.00 14.17  ? 994  LEU A CB  1 
ATOM 5925  H H   . LEU A 1 994  ? 52.460  26.324  87.888  1.00 10.61  ? 994  LEU A H   1 
ATOM 5926  H HA  . LEU A 1 994  ? 53.333  28.703  88.716  1.00 10.61  ? 994  LEU A HA  1 
ATOM 5927  N N   . CYS A 1 995  ? 50.163  28.238  88.446  1.00 8.87   ? 995  CYS A N   1 
ATOM 5928  C CA  . CYS A 1 995  ? 48.890  28.740  88.945  1.00 11.98  ? 995  CYS A CA  1 
ATOM 5929  C C   . CYS A 1 995  ? 48.833  28.645  90.464  1.00 24.84  ? 995  CYS A C   1 
ATOM 5930  O O   . CYS A 1 995  ? 48.364  29.575  91.132  1.00 22.74  ? 995  CYS A O   1 
ATOM 5931  C CB  . CYS A 1 995  ? 47.739  27.961  88.314  1.00 8.87   ? 995  CYS A CB  1 
ATOM 5932  H H   . CYS A 1 995  ? 50.105  27.546  87.939  1.00 10.64  ? 995  CYS A H   1 
ATOM 5933  H HA  . CYS A 1 995  ? 48.796  29.672  88.697  1.00 14.37  ? 995  CYS A HA  1 
ATOM 5934  N N   . ILE A 1 996  ? 49.335  27.536  91.025  1.00 33.63  ? 996  ILE A N   1 
ATOM 5935  C CA  . ILE A 1 996  ? 49.209  27.268  92.459  1.00 49.81  ? 996  ILE A CA  1 
ATOM 5936  C C   . ILE A 1 996  ? 50.263  28.036  93.261  1.00 46.28  ? 996  ILE A C   1 
ATOM 5937  O O   . ILE A 1 996  ? 49.988  28.503  94.374  1.00 41.39  ? 996  ILE A O   1 
ATOM 5938  C CB  . ILE A 1 996  ? 49.290  25.748  92.733  1.00 52.02  ? 996  ILE A CB  1 
ATOM 5939  H HA  . ILE A 1 996  ? 48.337  27.572  92.755  1.00 59.77  ? 996  ILE A HA  1 
ATOM 5940  N N   . PHE A 1 997  ? 51.480  28.166  92.727  1.00 37.42  ? 997  PHE A N   1 
ATOM 5941  C CA  . PHE A 1 997  ? 52.557  28.906  93.373  1.00 26.40  ? 997  PHE A CA  1 
ATOM 5942  C C   . PHE A 1 997  ? 52.764  30.222  92.637  1.00 17.47  ? 997  PHE A C   1 
ATOM 5943  O O   . PHE A 1 997  ? 52.845  30.242  91.407  1.00 12.87  ? 997  PHE A O   1 
ATOM 5944  C CB  . PHE A 1 997  ? 53.853  28.091  93.387  1.00 23.09  ? 997  PHE A CB  1 
ATOM 5945  H H   . PHE A 1 997  ? 51.708  27.823  91.971  1.00 44.91  ? 997  PHE A H   1 
ATOM 5946  H HA  . PHE A 1 997  ? 52.309  29.103  94.290  1.00 31.69  ? 997  PHE A HA  1 
ATOM 5947  N N   . LYS A 1 998  ? 52.831  31.315  93.388  1.00 14.35  ? 998  LYS A N   1 
ATOM 5948  C CA  . LYS A 1 998  ? 52.928  32.629  92.784  1.00 11.84  ? 998  LYS A CA  1 
ATOM 5949  C C   . LYS A 1 998  ? 53.697  33.549  93.718  1.00 15.73  ? 998  LYS A C   1 
ATOM 5950  O O   . LYS A 1 998  ? 53.721  33.353  94.935  1.00 15.12  ? 998  LYS A O   1 
ATOM 5951  C CB  . LYS A 1 998  ? 51.538  33.199  92.477  1.00 12.16  ? 998  LYS A CB  1 
ATOM 5952  H HA  . LYS A 1 998  ? 53.420  32.563  91.950  1.00 14.21  ? 998  LYS A HA  1 
ATOM 5953  N N   . ARG A 1 999  ? 54.335  34.549  93.129  1.00 22.82  ? 999  ARG A N   1 
ATOM 5954  C CA  . ARG A 1 999  ? 55.079  35.553  93.868  1.00 18.92  ? 999  ARG A CA  1 
ATOM 5955  C C   . ARG A 1 999  ? 54.269  36.839  93.894  1.00 17.66  ? 999  ARG A C   1 
ATOM 5956  O O   . ARG A 1 999  ? 53.715  37.255  92.871  1.00 18.23  ? 999  ARG A O   1 
ATOM 5957  C CB  . ARG A 1 999  ? 56.455  35.795  93.242  1.00 13.77  ? 999  ARG A CB  1 
ATOM 5958  H HA  . ARG A 1 999  ? 55.207  35.253  94.782  1.00 22.70  ? 999  ARG A HA  1 
ATOM 5959  N N   . GLU A 1 1000 ? 54.196  37.448  95.063  1.00 16.72  ? 1000 GLU A N   1 
ATOM 5960  C CA  . GLU A 1 1000 ? 53.433  38.659  95.284  1.00 18.36  ? 1000 GLU A CA  1 
ATOM 5961  C C   . GLU A 1 1000 ? 54.405  39.815  95.559  1.00 25.52  ? 1000 GLU A C   1 
ATOM 5962  O O   . GLU A 1 1000 ? 54.941  39.923  96.667  1.00 23.31  ? 1000 GLU A O   1 
ATOM 5963  C CB  . GLU A 1 1000 ? 52.473  38.389  96.439  1.00 14.05  ? 1000 GLU A CB  1 
ATOM 5964  H H   . GLU A 1 1000 ? 54.597  37.167  95.770  1.00 20.07  ? 1000 GLU A H   1 
ATOM 5965  H HA  . GLU A 1 1000 ? 52.915  38.869  94.491  1.00 22.04  ? 1000 GLU A HA  1 
ATOM 5966  N N   . PHE A 1 1001 ? 54.628  40.689  94.552  1.00 27.08  ? 1001 PHE A N   1 
ATOM 5967  C CA  . PHE A 1 1001 ? 55.663  41.728  94.613  1.00 17.48  ? 1001 PHE A CA  1 
ATOM 5968  C C   . PHE A 1 1001 ? 55.177  43.066  94.062  1.00 11.01  ? 1001 PHE A C   1 
ATOM 5969  O O   . PHE A 1 1001 ? 54.374  43.119  93.128  1.00 12.52  ? 1001 PHE A O   1 
ATOM 5970  C CB  . PHE A 1 1001 ? 56.911  41.331  93.816  1.00 15.31  ? 1001 PHE A CB  1 
ATOM 5971  H H   . PHE A 1 1001 ? 54.183  40.693  93.817  1.00 32.50  ? 1001 PHE A H   1 
ATOM 5972  H HA  . PHE A 1 1001 ? 55.925  41.860  95.538  1.00 20.98  ? 1001 PHE A HA  1 
ATOM 5973  N N   . ASP A 1 1002 ? 55.701  44.148  94.653  1.00 10.28  ? 1002 ASP A N   1 
ATOM 5974  C CA  . ASP A 1 1002 ? 55.556  45.506  94.137  1.00 8.60   ? 1002 ASP A CA  1 
ATOM 5975  C C   . ASP A 1 1002 ? 54.235  46.142  94.542  1.00 8.60   ? 1002 ASP A C   1 
ATOM 5976  O O   . ASP A 1 1002 ? 54.214  47.030  95.403  1.00 17.63  ? 1002 ASP A O   1 
ATOM 5977  C CB  . ASP A 1 1002 ? 55.694  45.501  92.615  1.00 8.60   ? 1002 ASP A CB  1 
ATOM 5978  H HA  . ASP A 1 1002 ? 56.271  46.054  94.497  1.00 10.32  ? 1002 ASP A HA  1 
ATOM 5979  N N   . GLU A 1 1003 ? 53.145  45.703  93.909  1.00 8.65   ? 1003 GLU A N   1 
ATOM 5980  C CA  . GLU A 1 1003 ? 51.824  46.296  94.085  1.00 8.65   ? 1003 GLU A CA  1 
ATOM 5981  C C   . GLU A 1 1003 ? 50.994  45.419  95.012  1.00 8.65   ? 1003 GLU A C   1 
ATOM 5982  O O   . GLU A 1 1003 ? 50.046  44.755  94.606  1.00 8.65   ? 1003 GLU A O   1 
ATOM 5983  C CB  . GLU A 1 1003 ? 51.134  46.472  92.735  1.00 8.65   ? 1003 GLU A CB  1 
ATOM 5984  H H   . GLU A 1 1003 ? 53.149  45.043  93.358  1.00 10.38  ? 1003 GLU A H   1 
ATOM 5985  H HA  . GLU A 1 1003 ? 51.917  47.170  94.496  1.00 10.38  ? 1003 GLU A HA  1 
ATOM 5986  N N   . SER A 1 1004 ? 51.384  45.440  96.283  1.00 8.61   ? 1004 SER A N   1 
ATOM 5987  C CA  . SER A 1 1004 ? 50.647  44.775  97.354  1.00 8.61   ? 1004 SER A CA  1 
ATOM 5988  C C   . SER A 1 1004 ? 50.363  43.321  97.009  1.00 17.01  ? 1004 SER A C   1 
ATOM 5989  O O   . SER A 1 1004 ? 49.228  42.844  97.066  1.00 21.19  ? 1004 SER A O   1 
ATOM 5990  C CB  . SER A 1 1004 ? 49.352  45.525  97.659  1.00 8.61   ? 1004 SER A CB  1 
ATOM 5991  H HA  . SER A 1 1004 ? 51.190  44.786  98.158  1.00 10.33  ? 1004 SER A HA  1 
ATOM 5992  N N   . ASN A 1 1005 ? 51.429  42.612  96.656  1.00 20.97  ? 1005 ASN A N   1 
ATOM 5993  C CA  . ASN A 1 1005 ? 51.374  41.166  96.420  1.00 24.67  ? 1005 ASN A CA  1 
ATOM 5994  C C   . ASN A 1 1005 ? 50.892  40.841  95.004  1.00 38.21  ? 1005 ASN A C   1 
ATOM 5995  O O   . ASN A 1 1005 ? 51.230  41.575  94.068  1.00 44.95  ? 1005 ASN A O   1 
ATOM 5996  C CB  . ASN A 1 1005 ? 50.501  40.515  97.499  1.00 25.70  ? 1005 ASN A CB  1 
ATOM 5997  H H   . ASN A 1 1005 ? 52.213  42.949  96.545  1.00 25.16  ? 1005 ASN A H   1 
ATOM 5998  H HA  . ASN A 1 1005 ? 52.269  40.805  96.512  1.00 29.61  ? 1005 ASN A HA  1 
ATOM 5999  N N   . SER A 1 1006 ? 50.199  39.703  94.828  1.00 26.41  ? 1006 SER A N   1 
ATOM 6000  C CA  . SER A 1 1006 ? 49.473  39.292  93.612  1.00 22.49  ? 1006 SER A CA  1 
ATOM 6001  C C   . SER A 1 1006 ? 49.675  37.806  93.376  1.00 11.64  ? 1006 SER A C   1 
ATOM 6002  O O   . SER A 1 1006 ? 49.968  37.384  92.255  1.00 8.69   ? 1006 SER A O   1 
ATOM 6003  C CB  . SER A 1 1006 ? 49.912  40.039  92.352  1.00 25.44  ? 1006 SER A CB  1 
ATOM 6004  H HA  . SER A 1 1006 ? 48.524  39.450  93.741  1.00 26.98  ? 1006 SER A HA  1 
ATOM 6005  N N   . GLN A 1 1007 ? 49.529  37.012  94.419  1.00 10.59  ? 1007 GLN A N   1 
ATOM 6006  C CA  . GLN A 1 1007 ? 49.697  35.581  94.287  1.00 12.50  ? 1007 GLN A CA  1 
ATOM 6007  C C   . GLN A 1 1007 ? 48.393  34.892  94.657  1.00 14.11  ? 1007 GLN A C   1 
ATOM 6008  O O   . GLN A 1 1007 ? 47.493  35.502  95.241  1.00 14.91  ? 1007 GLN A O   1 
ATOM 6009  C CB  . GLN A 1 1007 ? 50.856  35.086  95.161  1.00 13.47  ? 1007 GLN A CB  1 
ATOM 6010  H H   . GLN A 1 1007 ? 49.332  37.276  95.213  1.00 12.71  ? 1007 GLN A H   1 
ATOM 6011  H HA  . GLN A 1 1007 ? 49.902  35.367  93.363  1.00 15.00  ? 1007 GLN A HA  1 
ATOM 6012  N N   . SER A 1 1008 ? 48.300  33.611  94.287  1.00 16.19  ? 1008 SER A N   1 
ATOM 6013  C CA  . SER A 1 1008 ? 47.140  32.780  94.585  1.00 19.08  ? 1008 SER A CA  1 
ATOM 6014  C C   . SER A 1 1008 ? 47.558  31.600  95.448  1.00 22.84  ? 1008 SER A C   1 
ATOM 6015  O O   . SER A 1 1008 ? 47.182  30.456  95.174  1.00 23.38  ? 1008 SER A O   1 
ATOM 6016  C CB  . SER A 1 1008 ? 46.477  32.279  93.299  1.00 19.95  ? 1008 SER A CB  1 
ATOM 6017  H H   . SER A 1 1008 ? 48.914  33.195  93.851  1.00 19.43  ? 1008 SER A H   1 
ATOM 6018  H HA  . SER A 1 1008 ? 46.490  33.303  95.079  1.00 22.89  ? 1008 SER A HA  1 
ATOM 6019  N N   . SER A 1 1009 ? 48.360  31.882  96.473  1.00 25.73  ? 1009 SER A N   1 
ATOM 6020  C CA  . SER A 1 1009 ? 48.777  30.912  97.486  1.00 30.38  ? 1009 SER A CA  1 
ATOM 6021  C C   . SER A 1 1009 ? 49.434  31.669  98.631  1.00 29.22  ? 1009 SER A C   1 
ATOM 6022  O O   . SER A 1 1009 ? 50.044  32.719  98.415  1.00 29.53  ? 1009 SER A O   1 
ATOM 6023  C CB  . SER A 1 1009 ? 49.748  29.874  96.918  1.00 27.41  ? 1009 SER A CB  1 
ATOM 6024  H HA  . SER A 1 1009 ? 47.997  30.449  97.830  1.00 36.46  ? 1009 SER A HA  1 
ATOM 6025  N N   . GLY A 1 1026 ? 37.081  39.047  83.486  1.00 50.99  ? 1026 GLY A N   1 
ATOM 6026  C CA  . GLY A 1 1026 ? 36.213  39.873  82.663  1.00 63.54  ? 1026 GLY A CA  1 
ATOM 6027  C C   . GLY A 1 1026 ? 35.132  40.601  83.455  1.00 69.95  ? 1026 GLY A C   1 
ATOM 6028  O O   . GLY A 1 1026 ? 33.937  40.354  83.252  1.00 64.75  ? 1026 GLY A O   1 
ATOM 6029  H HA2 . GLY A 1 1026 ? 36.748  40.537  82.201  1.00 76.24  ? 1026 GLY A HA2 1 
ATOM 6030  H HA3 . GLY A 1 1026 ? 35.778  39.316  81.999  1.00 76.24  ? 1026 GLY A HA3 1 
ATOM 6031  N N   . ALA A 1 1027 ? 35.555  41.500  84.346  1.00 76.93  ? 1027 ALA A N   1 
ATOM 6032  C CA  . ALA A 1 1027 ? 34.656  42.262  85.238  1.00 73.20  ? 1027 ALA A CA  1 
ATOM 6033  C C   . ALA A 1 1027 ? 33.859  41.247  86.059  1.00 75.18  ? 1027 ALA A C   1 
ATOM 6034  O O   . ALA A 1 1027 ? 34.474  40.347  86.654  1.00 83.27  ? 1027 ALA A O   1 
ATOM 6035  C CB  . ALA A 1 1027 ? 33.823  43.238  84.420  1.00 79.20  ? 1027 ALA A CB  1 
ATOM 6036  H H   . ALA A 1 1027 ? 36.384  41.696  84.460  1.00 92.31  ? 1027 ALA A H   1 
ATOM 6037  H HA  . ALA A 1 1027 ? 35.195  42.781  85.855  1.00 87.84  ? 1027 ALA A HA  1 
ATOM 6038  H HB1 . ALA A 1 1027 ? 33.238  43.731  85.016  1.00 95.03  ? 1027 ALA A HB1 1 
ATOM 6039  H HB2 . ALA A 1 1027 ? 34.418  43.849  83.958  1.00 95.03  ? 1027 ALA A HB2 1 
ATOM 6040  H HB3 . ALA A 1 1027 ? 33.296  42.739  83.776  1.00 95.03  ? 1027 ALA A HB3 1 
ATOM 6041  N N   . LEU A 1 1028 ? 32.523  41.345  86.124  1.00 74.12  ? 1028 LEU A N   1 
ATOM 6042  C CA  . LEU A 1 1028 ? 31.688  40.370  86.832  1.00 67.52  ? 1028 LEU A CA  1 
ATOM 6043  C C   . LEU A 1 1028 ? 31.471  39.120  85.965  1.00 48.85  ? 1028 LEU A C   1 
ATOM 6044  O O   . LEU A 1 1028 ? 30.350  38.716  85.652  1.00 33.52  ? 1028 LEU A O   1 
ATOM 6045  C CB  . LEU A 1 1028 ? 30.362  41.010  87.240  1.00 51.31  ? 1028 LEU A CB  1 
ATOM 6046  H HA  . LEU A 1 1028 ? 32.146  40.094  87.642  1.00 81.03  ? 1028 LEU A HA  1 
ATOM 6047  N N   . ASP A 1 1029 ? 32.591  38.494  85.584  1.00 50.49  ? 1029 ASP A N   1 
ATOM 6048  C CA  . ASP A 1 1029 ? 32.534  37.295  84.761  1.00 33.86  ? 1029 ASP A CA  1 
ATOM 6049  C C   . ASP A 1 1029 ? 31.939  36.121  85.534  1.00 24.12  ? 1029 ASP A C   1 
ATOM 6050  O O   . ASP A 1 1029 ? 31.042  35.437  85.027  1.00 19.96  ? 1029 ASP A O   1 
ATOM 6051  C CB  . ASP A 1 1029 ? 33.936  36.963  84.250  1.00 46.96  ? 1029 ASP A CB  1 
ATOM 6052  H H   . ASP A 1 1029 ? 33.387  38.746  85.791  1.00 60.58  ? 1029 ASP A H   1 
ATOM 6053  H HA  . ASP A 1 1029 ? 31.967  37.466  83.993  1.00 40.63  ? 1029 ASP A HA  1 
ATOM 6054  N N   . PHE A 1 1030 ? 32.406  35.888  86.776  1.00 22.42  ? 1030 PHE A N   1 
ATOM 6055  C CA  . PHE A 1 1030 ? 31.990  34.711  87.527  1.00 15.53  ? 1030 PHE A CA  1 
ATOM 6056  C C   . PHE A 1 1030 ? 30.493  34.527  87.450  1.00 17.02  ? 1030 PHE A C   1 
ATOM 6057  O O   . PHE A 1 1030 ? 30.007  33.399  87.347  1.00 19.27  ? 1030 PHE A O   1 
ATOM 6058  C CB  . PHE A 1 1030 ? 32.421  34.830  88.987  1.00 9.02   ? 1030 PHE A CB  1 
ATOM 6059  H H   . PHE A 1 1030 ? 32.959  36.398  87.194  1.00 26.91  ? 1030 PHE A H   1 
ATOM 6060  H HA  . PHE A 1 1030 ? 32.412  33.924  87.149  1.00 18.64  ? 1030 PHE A HA  1 
ATOM 6061  N N   . GLU A 1 1031 ? 29.748  35.631  87.467  1.00 19.09  ? 1031 GLU A N   1 
ATOM 6062  C CA  . GLU A 1 1031 ? 28.296  35.559  87.436  1.00 24.20  ? 1031 GLU A CA  1 
ATOM 6063  C C   . GLU A 1 1031 ? 27.772  35.049  86.102  1.00 25.47  ? 1031 GLU A C   1 
ATOM 6064  O O   . GLU A 1 1031 ? 26.654  34.523  86.048  1.00 28.14  ? 1031 GLU A O   1 
ATOM 6065  C CB  . GLU A 1 1031 ? 27.707  36.937  87.731  1.00 26.21  ? 1031 GLU A CB  1 
ATOM 6066  H H   . GLU A 1 1031 ? 30.062  36.431  87.497  1.00 22.91  ? 1031 GLU A H   1 
ATOM 6067  H HA  . GLU A 1 1031 ? 27.995  34.950  88.129  1.00 29.04  ? 1031 GLU A HA  1 
ATOM 6068  N N   . HIS A 1 1032 ? 28.539  35.214  85.021  1.00 24.79  ? 1032 HIS A N   1 
ATOM 6069  C CA  . HIS A 1 1032 ? 28.093  34.757  83.713  1.00 26.81  ? 1032 HIS A CA  1 
ATOM 6070  C C   . HIS A 1 1032 ? 28.196  33.248  83.528  1.00 27.64  ? 1032 HIS A C   1 
ATOM 6071  O O   . HIS A 1 1032 ? 27.555  32.717  82.615  1.00 34.56  ? 1032 HIS A O   1 
ATOM 6072  C CB  . HIS A 1 1032 ? 28.905  35.456  82.626  1.00 24.76  ? 1032 HIS A CB  1 
ATOM 6073  H H   . HIS A 1 1032 ? 29.315  35.586  85.022  1.00 29.75  ? 1032 HIS A H   1 
ATOM 6074  H HA  . HIS A 1 1032 ? 27.163  35.006  83.596  1.00 32.17  ? 1032 HIS A HA  1 
ATOM 6075  N N   . ILE A 1 1033 ? 28.988  32.547  84.350  1.00 29.14  ? 1033 ILE A N   1 
ATOM 6076  C CA  . ILE A 1 1033 ? 29.280  31.137  84.094  1.00 40.01  ? 1033 ILE A CA  1 
ATOM 6077  C C   . ILE A 1 1033 ? 28.158  30.164  84.501  1.00 50.25  ? 1033 ILE A C   1 
ATOM 6078  O O   . ILE A 1 1033 ? 28.197  29.001  84.078  1.00 45.46  ? 1033 ILE A O   1 
ATOM 6079  C CB  . ILE A 1 1033 ? 30.591  30.739  84.801  1.00 28.89  ? 1033 ILE A CB  1 
ATOM 6080  H H   . ILE A 1 1033 ? 29.364  32.865  85.055  1.00 34.97  ? 1033 ILE A H   1 
ATOM 6081  H HA  . ILE A 1 1033 ? 29.423  31.026  83.141  1.00 48.01  ? 1033 ILE A HA  1 
ATOM 6082  N N   . GLU A 1 1034 ? 27.186  30.569  85.341  1.00 49.65  ? 1034 GLU A N   1 
ATOM 6083  C CA  . GLU A 1 1034 ? 26.043  29.696  85.630  1.00 36.44  ? 1034 GLU A CA  1 
ATOM 6084  C C   . GLU A 1 1034 ? 25.243  29.422  84.361  1.00 50.20  ? 1034 GLU A C   1 
ATOM 6085  O O   . GLU A 1 1034 ? 24.654  28.345  84.216  1.00 43.04  ? 1034 GLU A O   1 
ATOM 6086  C CB  . GLU A 1 1034 ? 25.150  30.326  86.702  1.00 28.26  ? 1034 GLU A CB  1 
ATOM 6087  H H   . GLU A 1 1034 ? 27.169  31.328  85.745  1.00 59.59  ? 1034 GLU A H   1 
ATOM 6088  H HA  . GLU A 1 1034 ? 26.369  28.848  85.969  1.00 43.73  ? 1034 GLU A HA  1 
ATOM 6089  N N   . GLU A 1 1035 ? 25.187  30.404  83.446  1.00 64.15  ? 1035 GLU A N   1 
ATOM 6090  C CA  . GLU A 1 1035 ? 24.641  30.185  82.107  1.00 72.81  ? 1035 GLU A CA  1 
ATOM 6091  C C   . GLU A 1 1035 ? 25.446  29.129  81.342  1.00 63.20  ? 1035 GLU A C   1 
ATOM 6092  O O   . GLU A 1 1035 ? 24.872  28.307  80.609  1.00 55.96  ? 1035 GLU A O   1 
ATOM 6093  C CB  . GLU A 1 1035 ? 24.614  31.518  81.346  1.00 76.86  ? 1035 GLU A CB  1 
ATOM 6094  H H   . GLU A 1 1035 ? 25.462  31.207  83.583  1.00 76.98  ? 1035 GLU A H   1 
ATOM 6095  H HA  . GLU A 1 1035 ? 23.728  29.867  82.186  1.00 87.37  ? 1035 GLU A HA  1 
ATOM 6096  N N   . GLN A 1 1036 ? 26.777  29.146  81.491  1.00 59.50  ? 1036 GLN A N   1 
ATOM 6097  C CA  . GLN A 1 1036 ? 27.597  28.057  80.982  1.00 49.40  ? 1036 GLN A CA  1 
ATOM 6098  C C   . GLN A 1 1036 ? 27.072  26.723  81.493  1.00 43.92  ? 1036 GLN A C   1 
ATOM 6099  O O   . GLN A 1 1036 ? 26.978  25.745  80.742  1.00 38.41  ? 1036 GLN A O   1 
ATOM 6100  C CB  . GLN A 1 1036 ? 29.057  28.274  81.400  1.00 49.31  ? 1036 GLN A CB  1 
ATOM 6101  H H   . GLN A 1 1036 ? 27.219  29.772  81.880  1.00 71.40  ? 1036 GLN A H   1 
ATOM 6102  H HA  . GLN A 1 1036 ? 27.555  28.050  80.013  1.00 59.28  ? 1036 GLN A HA  1 
ATOM 6103  N N   . ALA A 1 1037 ? 26.711  26.675  82.774  1.00 47.31  ? 1037 ALA A N   1 
ATOM 6104  C CA  . ALA A 1 1037 ? 26.092  25.479  83.315  1.00 43.06  ? 1037 ALA A CA  1 
ATOM 6105  C C   . ALA A 1 1037 ? 24.833  25.116  82.528  1.00 36.89  ? 1037 ALA A C   1 
ATOM 6106  O O   . ALA A 1 1037 ? 24.586  23.938  82.248  1.00 41.31  ? 1037 ALA A O   1 
ATOM 6107  C CB  . ALA A 1 1037 ? 25.795  25.677  84.807  1.00 38.18  ? 1037 ALA A CB  1 
ATOM 6108  H H   . ALA A 1 1037 ? 26.814  27.314  83.341  1.00 56.77  ? 1037 ALA A H   1 
ATOM 6109  H HA  . ALA A 1 1037 ? 26.715  24.740  83.233  1.00 51.67  ? 1037 ALA A HA  1 
ATOM 6110  H HB1 . ALA A 1 1037 ? 25.382  24.872  85.156  1.00 45.82  ? 1037 ALA A HB1 1 
ATOM 6111  H HB2 . ALA A 1 1037 ? 26.627  25.851  85.274  1.00 45.82  ? 1037 ALA A HB2 1 
ATOM 6112  H HB3 . ALA A 1 1037 ? 25.192  26.430  84.911  1.00 45.82  ? 1037 ALA A HB3 1 
ATOM 6113  N N   . GLU A 1 1038 ? 24.045  26.114  82.124  1.00 33.11  ? 1038 GLU A N   1 
ATOM 6114  C CA  . GLU A 1 1038 ? 22.897  25.830  81.275  1.00 28.25  ? 1038 GLU A CA  1 
ATOM 6115  C C   . GLU A 1 1038 ? 23.337  25.205  79.967  1.00 27.31  ? 1038 GLU A C   1 
ATOM 6116  O O   . GLU A 1 1038 ? 22.583  24.444  79.348  1.00 30.31  ? 1038 GLU A O   1 
ATOM 6117  C CB  . GLU A 1 1038 ? 22.099  27.104  80.997  1.00 28.01  ? 1038 GLU A CB  1 
ATOM 6118  H H   . GLU A 1 1038 ? 24.152  26.943  82.324  1.00 39.73  ? 1038 GLU A H   1 
ATOM 6119  H HA  . GLU A 1 1038 ? 22.313  25.201  81.728  1.00 33.90  ? 1038 GLU A HA  1 
ATOM 6120  N N   . GLY A 1 1039 ? 24.548  25.528  79.523  1.00 25.36  ? 1039 GLY A N   1 
ATOM 6121  C CA  . GLY A 1 1039 ? 25.102  24.852  78.368  1.00 39.47  ? 1039 GLY A CA  1 
ATOM 6122  C C   . GLY A 1 1039 ? 25.440  23.394  78.631  1.00 51.47  ? 1039 GLY A C   1 
ATOM 6123  O O   . GLY A 1 1039 ? 25.145  22.515  77.811  1.00 65.40  ? 1039 GLY A O   1 
ATOM 6124  H H   . GLY A 1 1039 ? 25.058  26.127  79.870  1.00 30.44  ? 1039 GLY A H   1 
ATOM 6125  H HA2 . GLY A 1 1039 ? 24.463  24.889  77.638  1.00 47.37  ? 1039 GLY A HA2 1 
ATOM 6126  H HA3 . GLY A 1 1039 ? 25.911  25.307  78.088  1.00 47.37  ? 1039 GLY A HA3 1 
ATOM 6127  N N   . ILE A 1 1040 ? 26.086  23.115  79.762  1.00 54.06  ? 1040 ILE A N   1 
ATOM 6128  C CA  . ILE A 1 1040 ? 26.423  21.733  80.091  1.00 67.59  ? 1040 ILE A CA  1 
ATOM 6129  C C   . ILE A 1 1040 ? 25.152  20.891  80.207  1.00 73.73  ? 1040 ILE A C   1 
ATOM 6130  O O   . ILE A 1 1040 ? 25.150  19.691  79.890  1.00 65.43  ? 1040 ILE A O   1 
ATOM 6131  C CB  . ILE A 1 1040 ? 27.258  21.686  81.385  1.00 73.76  ? 1040 ILE A CB  1 
ATOM 6132  H H   . ILE A 1 1040 ? 26.335  23.695  80.345  1.00 64.87  ? 1040 ILE A H   1 
ATOM 6133  H HA  . ILE A 1 1040 ? 26.961  21.362  79.375  1.00 81.11  ? 1040 ILE A HA  1 
ATOM 6134  N N   . PHE A 1 1041 ? 24.052  21.509  80.659  1.00 79.04  ? 1041 PHE A N   1 
ATOM 6135  C CA  . PHE A 1 1041 ? 22.760  20.832  80.666  1.00 88.15  ? 1041 PHE A CA  1 
ATOM 6136  C C   . PHE A 1 1041 ? 22.234  20.609  79.244  1.00 97.34  ? 1041 PHE A C   1 
ATOM 6137  O O   . PHE A 1 1041 ? 21.620  19.568  78.967  1.00 92.51  ? 1041 PHE A O   1 
ATOM 6138  C CB  . PHE A 1 1041 ? 21.765  21.648  81.496  1.00 87.46  ? 1041 PHE A CB  1 
ATOM 6139  H H   . PHE A 1 1041 ? 24.032  22.314  80.962  1.00 94.85  ? 1041 PHE A H   1 
ATOM 6140  H HA  . PHE A 1 1041 ? 22.862  19.965  81.088  1.00 105.78 ? 1041 PHE A HA  1 
ATOM 6141  N N   . GLY A 1 1042 ? 22.452  21.576  78.334  1.00 101.12 ? 1042 GLY A N   1 
ATOM 6142  C CA  . GLY A 1 1042 ? 22.027  21.404  76.944  1.00 89.19  ? 1042 GLY A CA  1 
ATOM 6143  C C   . GLY A 1 1042 ? 22.796  20.345  76.157  1.00 68.78  ? 1042 GLY A C   1 
ATOM 6144  O O   . GLY A 1 1042 ? 22.289  19.819  75.159  1.00 59.98  ? 1042 GLY A O   1 
ATOM 6145  H H   . GLY A 1 1042 ? 22.837  22.328  78.499  1.00 121.34 ? 1042 GLY A H   1 
ATOM 6146  H HA2 . GLY A 1 1042 ? 21.088  21.163  76.931  1.00 107.03 ? 1042 GLY A HA2 1 
ATOM 6147  H HA3 . GLY A 1 1042 ? 22.125  22.250  76.479  1.00 107.03 ? 1042 GLY A HA3 1 
ATOM 6148  N N   . GLY A 1 1043 ? 24.035  20.040  76.564  1.00 60.25  ? 1043 GLY A N   1 
ATOM 6149  C CA  . GLY A 1 1043 ? 24.777  18.980  75.895  1.00 36.74  ? 1043 GLY A CA  1 
ATOM 6150  C C   . GLY A 1 1043 ? 24.189  17.596  76.127  1.00 36.84  ? 1043 GLY A C   1 
ATOM 6151  O O   . GLY A 1 1043 ? 24.151  16.768  75.212  1.00 28.98  ? 1043 GLY A O   1 
ATOM 6152  H H   . GLY A 1 1043 ? 24.454  20.424  77.208  1.00 72.30  ? 1043 GLY A H   1 
ATOM 6153  H HA2 . GLY A 1 1043 ? 24.788  19.149  74.940  1.00 44.09  ? 1043 GLY A HA2 1 
ATOM 6154  H HA3 . GLY A 1 1043 ? 25.693  18.979  76.215  1.00 44.09  ? 1043 GLY A HA3 1 
ATOM 6155  N N   . SER A 1 1044 ? 23.739  17.322  77.354  1.00 41.38  ? 1044 SER A N   1 
ATOM 6156  C CA  . SER A 1 1044 ? 23.166  16.029  77.727  1.00 30.73  ? 1044 SER A CA  1 
ATOM 6157  C C   . SER A 1 1044 ? 21.638  16.074  77.593  1.00 40.49  ? 1044 SER A C   1 
ATOM 6158  O O   . SER A 1 1044 ? 20.903  16.117  78.580  1.00 37.00  ? 1044 SER A O   1 
ATOM 6159  C CB  . SER A 1 1044 ? 23.590  15.666  79.149  1.00 30.79  ? 1044 SER A CB  1 
ATOM 6160  H H   . SER A 1 1044 ? 23.756  17.886  78.004  1.00 49.65  ? 1044 SER A H   1 
ATOM 6161  H HA  . SER A 1 1044 ? 23.502  15.346  77.127  1.00 36.87  ? 1044 SER A HA  1 
ATOM 6162  N N   . GLU A 1 1045 ? 21.158  16.053  76.343  1.00 40.72  ? 1045 GLU A N   1 
ATOM 6163  C CA  . GLU A 1 1045 ? 19.729  16.202  76.042  1.00 40.10  ? 1045 GLU A CA  1 
ATOM 6164  C C   . GLU A 1 1045 ? 19.185  15.019  75.242  1.00 34.00  ? 1045 GLU A C   1 
ATOM 6165  O O   . GLU A 1 1045 ? 19.705  14.697  74.169  1.00 29.36  ? 1045 GLU A O   1 
ATOM 6166  C CB  . GLU A 1 1045 ? 19.465  17.491  75.264  1.00 44.12  ? 1045 GLU A CB  1 
ATOM 6167  H H   . GLU A 1 1045 ? 21.647  15.952  75.643  1.00 48.86  ? 1045 GLU A H   1 
ATOM 6168  H HA  . GLU A 1 1045 ? 19.236  16.250  76.876  1.00 48.12  ? 1045 GLU A HA  1 
ATOM 6169  N N   . GLU A 1 1046 ? 18.112  14.412  75.752  1.00 35.25  ? 1046 GLU A N   1 
ATOM 6170  C CA  . GLU A 1 1046 ? 17.395  13.328  75.097  1.00 25.18  ? 1046 GLU A CA  1 
ATOM 6171  C C   . GLU A 1 1046 ? 16.077  13.853  74.539  1.00 20.06  ? 1046 GLU A C   1 
ATOM 6172  O O   . GLU A 1 1046 ? 15.476  14.780  75.089  1.00 20.50  ? 1046 GLU A O   1 
ATOM 6173  C CB  . GLU A 1 1046 ? 17.141  12.163  76.069  1.00 23.66  ? 1046 GLU A CB  1 
ATOM 6174  H HA  . GLU A 1 1046 ? 17.926  12.995  74.357  1.00 30.22  ? 1046 GLU A HA  1 
ATOM 6175  N N   . ASN A 1 1047 ? 15.638  13.247  73.445  1.00 15.83  ? 1047 ASN A N   1 
ATOM 6176  C CA  . ASN A 1 1047 ? 14.497  13.738  72.692  1.00 14.72  ? 1047 ASN A CA  1 
ATOM 6177  C C   . ASN A 1 1047 ? 13.185  13.074  73.129  1.00 10.94  ? 1047 ASN A C   1 
ATOM 6178  O O   . ASN A 1 1047 ? 13.163  12.053  73.819  1.00 14.67  ? 1047 ASN A O   1 
ATOM 6179  C CB  . ASN A 1 1047 ? 14.732  13.507  71.201  1.00 13.24  ? 1047 ASN A CB  1 
ATOM 6180  H HA  . ASN A 1 1047 ? 14.411  14.693  72.837  1.00 17.67  ? 1047 ASN A HA  1 
ATOM 6181  N N   . THR A 1 1048 ? 12.074  13.672  72.702  1.00 9.14   ? 1048 THR A N   1 
ATOM 6182  C CA  . THR A 1 1048 ? 10.745  13.150  72.978  1.00 9.14   ? 1048 THR A CA  1 
ATOM 6183  C C   . THR A 1 1048 ? 10.464  13.190  74.476  1.00 9.14   ? 1048 THR A C   1 
ATOM 6184  O O   . THR A 1 1048 ? 9.841   12.263  74.999  1.00 9.14   ? 1048 THR A O   1 
ATOM 6185  C CB  . THR A 1 1048 ? 10.610  11.716  72.458  1.00 9.14   ? 1048 THR A CB  1 
ATOM 6186  H HA  . THR A 1 1048 ? 10.085  13.701  72.530  1.00 10.97  ? 1048 THR A HA  1 
ATOM 6187  N N   . PRO A 1 1049 ? 10.911  14.237  75.200  1.00 9.10   ? 1049 PRO A N   1 
ATOM 6188  C CA  . PRO A 1 1049 ? 10.604  14.337  76.638  1.00 9.10   ? 1049 PRO A CA  1 
ATOM 6189  C C   . PRO A 1 1049 ? 10.042  15.691  77.031  1.00 12.08  ? 1049 PRO A C   1 
ATOM 6190  O O   . PRO A 1 1049 ? 10.708  16.705  76.826  1.00 16.37  ? 1049 PRO A O   1 
ATOM 6191  C CB  . PRO A 1 1049 ? 11.960  14.096  77.309  1.00 9.72   ? 1049 PRO A CB  1 
ATOM 6192  H HA  . PRO A 1 1049 ? 9.984   13.639  76.902  1.00 10.92  ? 1049 PRO A HA  1 
ATOM 6193  N N   . LEU A 1 1050 ? 8.853   15.713  77.639  1.00 15.26  ? 1050 LEU A N   1 
ATOM 6194  C CA  . LEU A 1 1050 ? 8.098   16.955  77.767  1.00 22.87  ? 1050 LEU A CA  1 
ATOM 6195  C C   . LEU A 1 1050 ? 8.879   18.016  78.548  1.00 41.53  ? 1050 LEU A C   1 
ATOM 6196  O O   . LEU A 1 1050 ? 9.175   19.091  78.016  1.00 57.50  ? 1050 LEU A O   1 
ATOM 6197  C CB  . LEU A 1 1050 ? 6.739   16.676  78.416  1.00 19.76  ? 1050 LEU A CB  1 
ATOM 6198  H HA  . LEU A 1 1050 ? 7.932   17.309  76.879  1.00 27.44  ? 1050 LEU A HA  1 
ATOM 6199  N N   . ASP A 1 1051 ? 9.228   17.730  79.805  1.00 33.81  ? 1051 ASP A N   1 
ATOM 6200  C CA  . ASP A 1 1051 ? 9.877   18.689  80.711  1.00 35.08  ? 1051 ASP A CA  1 
ATOM 6201  C C   . ASP A 1 1051 ? 9.790   20.157  80.272  1.00 38.94  ? 1051 ASP A C   1 
ATOM 6202  O O   . ASP A 1 1051 ? 8.751   20.795  80.481  1.00 60.43  ? 1051 ASP A O   1 
ATOM 6203  C CB  . ASP A 1 1051 ? 11.348  18.312  80.901  1.00 24.56  ? 1051 ASP A CB  1 
ATOM 6204  H H   . ASP A 1 1051 ? 9.096   16.962  80.168  1.00 40.57  ? 1051 ASP A H   1 
ATOM 6205  H HA  . ASP A 1 1051 ? 9.449   18.623  81.578  1.00 42.09  ? 1051 ASP A HA  1 
ATOM 6206  N N   . LEU A 1 1052 ? 10.861  20.718  79.684  1.00 26.91  ? 1052 LEU A N   1 
ATOM 6207  C CA  . LEU A 1 1052 ? 10.871  22.133  79.326  1.00 23.41  ? 1052 LEU A CA  1 
ATOM 6208  C C   . LEU A 1 1052 ? 11.366  22.395  77.898  1.00 20.90  ? 1052 LEU A C   1 
ATOM 6209  O O   . LEU A 1 1052 ? 11.684  23.541  77.567  1.00 20.01  ? 1052 LEU A O   1 
ATOM 6210  C CB  . LEU A 1 1052 ? 11.718  22.916  80.339  1.00 14.04  ? 1052 LEU A CB  1 
ATOM 6211  H H   . LEU A 1 1052 ? 11.584  20.297  79.485  1.00 32.29  ? 1052 LEU A H   1 
ATOM 6212  H HA  . LEU A 1 1052 ? 9.964   22.470  79.385  1.00 28.09  ? 1052 LEU A HA  1 
ATOM 6213  N N   . ASP A 1 1053 ? 11.403  21.382  77.022  1.00 23.95  ? 1053 ASP A N   1 
ATOM 6214  C CA  . ASP A 1 1053 ? 12.032  21.535  75.705  1.00 11.82  ? 1053 ASP A CA  1 
ATOM 6215  C C   . ASP A 1 1053 ? 11.190  22.309  74.698  1.00 8.90   ? 1053 ASP A C   1 
ATOM 6216  O O   . ASP A 1 1053 ? 11.716  22.717  73.662  1.00 8.90   ? 1053 ASP A O   1 
ATOM 6217  C CB  . ASP A 1 1053 ? 12.349  20.168  75.099  1.00 16.13  ? 1053 ASP A CB  1 
ATOM 6218  H HA  . ASP A 1 1053 ? 12.871  22.011  75.816  1.00 14.18  ? 1053 ASP A HA  1 
ATOM 6219  N N   . ASP A 1 1054 ? 9.897   22.486  74.952  1.00 8.99   ? 1054 ASP A N   1 
ATOM 6220  C CA  . ASP A 1 1054 ? 9.029   23.113  73.975  1.00 8.99   ? 1054 ASP A CA  1 
ATOM 6221  C C   . ASP A 1 1054 ? 9.319   24.604  73.832  1.00 8.99   ? 1054 ASP A C   1 
ATOM 6222  O O   . ASP A 1 1054 ? 9.503   25.103  72.719  1.00 8.99   ? 1054 ASP A O   1 
ATOM 6223  C CB  . ASP A 1 1054 ? 7.576   22.898  74.380  1.00 16.83  ? 1054 ASP A CB  1 
ATOM 6224  H H   . ASP A 1 1054 ? 9.504   22.251  75.680  1.00 10.79  ? 1054 ASP A H   1 
ATOM 6225  H HA  . ASP A 1 1054 ? 9.167   22.695  73.111  1.00 10.79  ? 1054 ASP A HA  1 
ATOM 6226  N N   . HIS A 1 1055 ? 9.379   25.327  74.943  1.00 9.06   ? 1055 HIS A N   1 
ATOM 6227  C CA  . HIS A 1 1055 ? 9.446   26.777  74.902  1.00 9.06   ? 1055 HIS A CA  1 
ATOM 6228  C C   . HIS A 1 1055 ? 10.510  27.394  75.792  1.00 9.06   ? 1055 HIS A C   1 
ATOM 6229  O O   . HIS A 1 1055 ? 10.911  28.535  75.539  1.00 9.06   ? 1055 HIS A O   1 
ATOM 6230  C CB  . HIS A 1 1055 ? 8.095   27.381  75.298  1.00 9.06   ? 1055 HIS A CB  1 
ATOM 6231  H H   . HIS A 1 1055 ? 9.382   24.998  75.738  1.00 10.87  ? 1055 HIS A H   1 
ATOM 6232  H HA  . HIS A 1 1055 ? 9.633   27.050  73.990  1.00 10.87  ? 1055 HIS A HA  1 
ATOM 6233  N N   . GLY A 1 1056 ? 10.929  26.701  76.851  1.00 13.20  ? 1056 GLY A N   1 
ATOM 6234  C CA  . GLY A 1 1056 ? 11.848  27.253  77.826  1.00 19.59  ? 1056 GLY A CA  1 
ATOM 6235  C C   . GLY A 1 1056 ? 13.262  27.306  77.320  1.00 17.37  ? 1056 GLY A C   1 
ATOM 6236  O O   . GLY A 1 1056 ? 13.898  28.365  77.396  1.00 17.74  ? 1056 GLY A O   1 
ATOM 6237  H H   . GLY A 1 1056 ? 10.687  25.895  77.024  1.00 15.84  ? 1056 GLY A H   1 
ATOM 6238  H HA2 . GLY A 1 1056 ? 11.571  28.153  78.058  1.00 23.51  ? 1056 GLY A HA2 1 
ATOM 6239  H HA3 . GLY A 1 1056 ? 11.830  26.710  78.630  1.00 23.51  ? 1056 GLY A HA3 1 
ATOM 6240  N N   . GLY A 1 1057 ? 13.764  26.172  76.816  1.00 21.94  ? 1057 GLY A N   1 
ATOM 6241  C CA  . GLY A 1 1057 ? 15.060  26.098  76.189  1.00 21.36  ? 1057 GLY A CA  1 
ATOM 6242  C C   . GLY A 1 1057 ? 15.149  27.302  75.296  1.00 29.66  ? 1057 GLY A C   1 
ATOM 6243  O O   . GLY A 1 1057 ? 16.166  27.990  75.272  1.00 33.34  ? 1057 GLY A O   1 
ATOM 6244  H H   . GLY A 1 1057 ? 13.350  25.418  76.833  1.00 26.33  ? 1057 GLY A H   1 
ATOM 6245  H HA2 . GLY A 1 1057 ? 15.766  26.129  76.853  1.00 25.63  ? 1057 GLY A HA2 1 
ATOM 6246  H HA3 . GLY A 1 1057 ? 15.141  25.289  75.660  1.00 25.63  ? 1057 GLY A HA3 1 
ATOM 6247  N N   . ARG A 1 1058 ? 14.035  27.572  74.592  1.00 31.51  ? 1058 ARG A N   1 
ATOM 6248  C CA  . ARG A 1 1058 ? 13.894  28.719  73.708  1.00 41.82  ? 1058 ARG A CA  1 
ATOM 6249  C C   . ARG A 1 1058 ? 15.130  28.900  72.851  1.00 41.21  ? 1058 ARG A C   1 
ATOM 6250  O O   . ARG A 1 1058 ? 15.016  29.046  71.632  1.00 35.69  ? 1058 ARG A O   1 
ATOM 6251  C CB  . ARG A 1 1058 ? 13.631  29.996  74.505  1.00 48.22  ? 1058 ARG A CB  1 
ATOM 6252  H HA  . ARG A 1 1058 ? 13.138  28.572  73.118  1.00 50.19  ? 1058 ARG A HA  1 
ATOM 6253  N N   . THR A 1 1059 ? 16.301  28.884  73.474  1.00 34.64  ? 1059 THR A N   1 
ATOM 6254  C CA  . THR A 1 1059 ? 17.528  29.295  72.820  1.00 28.49  ? 1059 THR A CA  1 
ATOM 6255  C C   . THR A 1 1059 ? 17.943  30.659  73.350  1.00 27.28  ? 1059 THR A C   1 
ATOM 6256  O O   . THR A 1 1059 ? 17.359  31.681  72.984  1.00 25.65  ? 1059 THR A O   1 
ATOM 6257  C CB  . THR A 1 1059 ? 17.364  29.365  71.309  1.00 24.59  ? 1059 THR A CB  1 
ATOM 6258  H HA  . THR A 1 1059 ? 18.232  28.658  73.023  1.00 34.19  ? 1059 THR A HA  1 
ATOM 6259  N N   . PHE A 1 1060 ? 18.968  30.711  74.187  1.00 31.00  ? 1060 PHE A N   1 
ATOM 6260  C CA  . PHE A 1 1060 ? 19.431  31.999  74.686  1.00 33.61  ? 1060 PHE A CA  1 
ATOM 6261  C C   . PHE A 1 1060 ? 20.329  32.646  73.626  1.00 32.97  ? 1060 PHE A C   1 
ATOM 6262  O O   . PHE A 1 1060 ? 21.510  32.933  73.837  1.00 34.07  ? 1060 PHE A O   1 
ATOM 6263  C CB  . PHE A 1 1060 ? 20.141  31.834  76.023  1.00 46.30  ? 1060 PHE A CB  1 
ATOM 6264  H H   . PHE A 1 1060 ? 19.407  30.031  74.477  1.00 37.20  ? 1060 PHE A H   1 
ATOM 6265  H HA  . PHE A 1 1060 ? 18.665  32.578  74.823  1.00 40.33  ? 1060 PHE A HA  1 
ATOM 6266  N N   . LEU A 1 1061 ? 19.747  32.821  72.436  1.00 31.68  ? 1061 LEU A N   1 
ATOM 6267  C CA  . LEU A 1 1061 ? 20.494  33.415  71.338  1.00 32.93  ? 1061 LEU A CA  1 
ATOM 6268  C C   . LEU A 1 1061 ? 21.054  34.772  71.747  1.00 24.96  ? 1061 LEU A C   1 
ATOM 6269  O O   . LEU A 1 1061 ? 22.271  34.993  71.733  1.00 21.29  ? 1061 LEU A O   1 
ATOM 6270  C CB  . LEU A 1 1061 ? 19.599  33.540  70.099  1.00 33.83  ? 1061 LEU A CB  1 
ATOM 6271  H H   . LEU A 1 1061 ? 18.935  32.607  72.246  1.00 38.01  ? 1061 LEU A H   1 
ATOM 6272  H HA  . LEU A 1 1061 ? 21.239  32.837  71.113  1.00 39.52  ? 1061 LEU A HA  1 
ATOM 6273  N N   . ARG A 1 1062 ? 20.176  35.669  72.184  1.00 22.09  ? 1062 ARG A N   1 
ATOM 6274  C CA  . ARG A 1 1062 ? 20.598  37.004  72.564  1.00 19.34  ? 1062 ARG A CA  1 
ATOM 6275  C C   . ARG A 1 1062 ? 21.840  36.941  73.432  1.00 17.75  ? 1062 ARG A C   1 
ATOM 6276  O O   . ARG A 1 1062 ? 22.925  37.359  73.018  1.00 14.40  ? 1062 ARG A O   1 
ATOM 6277  C CB  . ARG A 1 1062 ? 19.450  37.700  73.295  1.00 34.82  ? 1062 ARG A CB  1 
ATOM 6278  H H   . ARG A 1 1062 ? 19.332  35.526  72.269  1.00 26.51  ? 1062 ARG A H   1 
ATOM 6279  H HA  . ARG A 1 1062 ? 20.808  37.515  71.766  1.00 23.21  ? 1062 ARG A HA  1 
ATOM 6280  N N   . VAL A 1 1063 ? 21.712  36.353  74.620  1.00 19.05  ? 1063 VAL A N   1 
ATOM 6281  C CA  . VAL A 1 1063 ? 22.826  36.333  75.554  1.00 19.33  ? 1063 VAL A CA  1 
ATOM 6282  C C   . VAL A 1 1063 ? 24.049  35.720  74.893  1.00 21.35  ? 1063 VAL A C   1 
ATOM 6283  O O   . VAL A 1 1063 ? 25.150  36.266  74.977  1.00 26.31  ? 1063 VAL A O   1 
ATOM 6284  C CB  . VAL A 1 1063 ? 22.446  35.573  76.834  1.00 22.72  ? 1063 VAL A CB  1 
ATOM 6285  H H   . VAL A 1 1063 ? 20.999  35.964  74.903  1.00 22.86  ? 1063 VAL A H   1 
ATOM 6286  H HA  . VAL A 1 1063 ? 23.046  37.245  75.802  1.00 23.19  ? 1063 VAL A HA  1 
ATOM 6287  N N   . LEU A 1 1064 ? 23.883  34.582  74.218  1.00 21.05  ? 1064 LEU A N   1 
ATOM 6288  C CA  . LEU A 1 1064 ? 25.052  33.963  73.619  1.00 21.24  ? 1064 LEU A CA  1 
ATOM 6289  C C   . LEU A 1 1064 ? 25.462  34.685  72.339  1.00 22.47  ? 1064 LEU A C   1 
ATOM 6290  O O   . LEU A 1 1064 ? 26.659  34.870  72.089  1.00 25.52  ? 1064 LEU A O   1 
ATOM 6291  C CB  . LEU A 1 1064 ? 24.780  32.484  73.356  1.00 18.16  ? 1064 LEU A CB  1 
ATOM 6292  H H   . LEU A 1 1064 ? 23.138  34.169  74.099  1.00 25.26  ? 1064 LEU A H   1 
ATOM 6293  H HA  . LEU A 1 1064 ? 25.792  34.022  74.243  1.00 25.49  ? 1064 LEU A HA  1 
ATOM 6294  N N   . LEU A 1 1065 ? 24.485  35.096  71.517  1.00 22.41  ? 1065 LEU A N   1 
ATOM 6295  C CA  . LEU A 1 1065 ? 24.773  35.803  70.273  1.00 19.49  ? 1065 LEU A CA  1 
ATOM 6296  C C   . LEU A 1 1065 ? 25.205  37.245  70.492  1.00 20.19  ? 1065 LEU A C   1 
ATOM 6297  O O   . LEU A 1 1065 ? 25.788  37.837  69.577  1.00 21.34  ? 1065 LEU A O   1 
ATOM 6298  C CB  . LEU A 1 1065 ? 23.551  35.795  69.350  1.00 17.47  ? 1065 LEU A CB  1 
ATOM 6299  H H   . LEU A 1 1065 ? 23.647  34.974  71.663  1.00 26.89  ? 1065 LEU A H   1 
ATOM 6300  H HA  . LEU A 1 1065 ? 25.494  35.345  69.814  1.00 23.38  ? 1065 LEU A HA  1 
ATOM 6301  N N   . HIS A 1 1066 ? 24.910  37.829  71.662  1.00 22.74  ? 1066 HIS A N   1 
ATOM 6302  C CA  . HIS A 1 1066 ? 25.281  39.220  71.941  1.00 22.94  ? 1066 HIS A CA  1 
ATOM 6303  C C   . HIS A 1 1066 ? 26.736  39.387  72.409  1.00 18.61  ? 1066 HIS A C   1 
ATOM 6304  O O   . HIS A 1 1066 ? 27.400  40.364  72.034  1.00 12.16  ? 1066 HIS A O   1 
ATOM 6305  C CB  . HIS A 1 1066 ? 24.331  39.802  72.989  1.00 25.72  ? 1066 HIS A CB  1 
ATOM 6306  H H   . HIS A 1 1066 ? 24.497  37.441  72.308  1.00 27.29  ? 1066 HIS A H   1 
ATOM 6307  H HA  . HIS A 1 1066 ? 25.173  39.737  71.127  1.00 27.53  ? 1066 HIS A HA  1 
ATOM 6308  N N   . LEU A 1 1067 ? 27.242  38.480  73.243  1.00 18.50  ? 1067 LEU A N   1 
ATOM 6309  C CA  . LEU A 1 1067 ? 28.583  38.622  73.803  1.00 11.23  ? 1067 LEU A CA  1 
ATOM 6310  C C   . LEU A 1 1067 ? 29.583  38.848  72.690  1.00 9.22   ? 1067 LEU A C   1 
ATOM 6311  O O   . LEU A 1 1067 ? 29.764  37.995  71.824  1.00 15.53  ? 1067 LEU A O   1 
ATOM 6312  C CB  . LEU A 1 1067 ? 28.957  37.373  74.595  1.00 17.17  ? 1067 LEU A CB  1 
ATOM 6313  H H   . LEU A 1 1067 ? 26.827  37.772  73.500  1.00 22.20  ? 1067 LEU A H   1 
ATOM 6314  H HA  . LEU A 1 1067 ? 28.607  39.386  74.400  1.00 13.48  ? 1067 LEU A HA  1 
ATOM 6315  N N   . THR A 1 1068 ? 30.237  39.992  72.703  1.00 9.24   ? 1068 THR A N   1 
ATOM 6316  C CA  . THR A 1 1068 ? 31.033  40.366  71.556  1.00 9.91   ? 1068 THR A CA  1 
ATOM 6317  C C   . THR A 1 1068 ? 32.325  40.968  72.045  1.00 13.70  ? 1068 THR A C   1 
ATOM 6318  O O   . THR A 1 1068 ? 32.478  41.290  73.222  1.00 11.08  ? 1068 THR A O   1 
ATOM 6319  C CB  . THR A 1 1068 ? 30.310  41.361  70.637  1.00 9.24   ? 1068 THR A CB  1 
ATOM 6320  H H   . THR A 1 1068 ? 30.238  40.558  73.350  1.00 11.09  ? 1068 THR A H   1 
ATOM 6321  H HA  . THR A 1 1068 ? 31.243  39.573  71.039  1.00 11.90  ? 1068 THR A HA  1 
ATOM 6322  N N   . MET A 1 1069 ? 33.269  41.055  71.116  1.00 22.14  ? 1069 MET A N   1 
ATOM 6323  C CA  . MET A 1 1069 ? 34.491  41.830  71.292  1.00 40.67  ? 1069 MET A CA  1 
ATOM 6324  C C   . MET A 1 1069 ? 35.224  41.486  72.598  1.00 45.83  ? 1069 MET A C   1 
ATOM 6325  O O   . MET A 1 1069 ? 35.765  42.360  73.277  1.00 63.28  ? 1069 MET A O   1 
ATOM 6326  C CB  . MET A 1 1069 ? 34.180  43.330  71.217  1.00 37.90  ? 1069 MET A CB  1 
ATOM 6327  H H   . MET A 1 1069 ? 33.222  40.662  70.352  1.00 26.56  ? 1069 MET A H   1 
ATOM 6328  H HA  . MET A 1 1069 ? 35.085  41.626  70.553  1.00 48.81  ? 1069 MET A HA  1 
ATOM 6329  N N   . HIS A 1 1070 ? 35.280  40.203  72.938  1.00 39.59  ? 1070 HIS A N   1 
ATOM 6330  C CA  . HIS A 1 1070 ? 36.058  39.730  74.083  1.00 37.73  ? 1070 HIS A CA  1 
ATOM 6331  C C   . HIS A 1 1070 ? 37.202  38.840  73.579  1.00 72.95  ? 1070 HIS A C   1 
ATOM 6332  O O   . HIS A 1 1070 ? 37.295  38.555  72.385  1.00 96.94  ? 1070 HIS A O   1 
ATOM 6333  C CB  . HIS A 1 1070 ? 35.154  38.990  75.077  1.00 27.63  ? 1070 HIS A CB  1 
ATOM 6334  H H   . HIS A 1 1070 ? 34.870  39.576  72.516  1.00 47.51  ? 1070 HIS A H   1 
ATOM 6335  H HA  . HIS A 1 1070 ? 36.448  40.492  74.539  1.00 45.27  ? 1070 HIS A HA  1 
ATOM 6336  N N   . ASP A 1 1071 ? 38.109  38.433  74.486  1.00 86.63  ? 1071 ASP A N   1 
ATOM 6337  C CA  . ASP A 1 1071 ? 39.264  37.579  74.145  1.00 77.25  ? 1071 ASP A CA  1 
ATOM 6338  C C   . ASP A 1 1071 ? 38.964  36.099  74.369  1.00 50.90  ? 1071 ASP A C   1 
ATOM 6339  O O   . ASP A 1 1071 ? 38.259  35.737  75.318  1.00 57.57  ? 1071 ASP A O   1 
ATOM 6340  C CB  . ASP A 1 1071 ? 40.488  37.950  74.985  1.00 88.28  ? 1071 ASP A CB  1 
ATOM 6341  H HA  . ASP A 1 1071 ? 39.488  37.705  73.210  1.00 92.70  ? 1071 ASP A HA  1 
ATOM 6342  N N   . TYR A 1 1072 ? 39.536  35.236  73.508  1.00 22.29  ? 1072 TYR A N   1 
ATOM 6343  C CA  . TYR A 1 1072 ? 39.326  33.812  73.694  1.00 10.11  ? 1072 TYR A CA  1 
ATOM 6344  C C   . TYR A 1 1072 ? 39.700  33.488  75.120  1.00 11.23  ? 1072 TYR A C   1 
ATOM 6345  O O   . TYR A 1 1072 ? 40.884  33.337  75.429  1.00 9.11   ? 1072 TYR A O   1 
ATOM 6346  C CB  . TYR A 1 1072 ? 40.160  32.982  72.726  1.00 9.11   ? 1072 TYR A CB  1 
ATOM 6347  H HA  . TYR A 1 1072 ? 38.389  33.599  73.560  1.00 12.13  ? 1072 TYR A HA  1 
ATOM 6348  N N   . PRO A 1 1073 ? 38.724  33.423  76.018  1.00 19.30  ? 1073 PRO A N   1 
ATOM 6349  C CA  . PRO A 1 1073 ? 39.020  33.311  77.448  1.00 26.17  ? 1073 PRO A CA  1 
ATOM 6350  C C   . PRO A 1 1073 ? 39.499  31.915  77.799  1.00 24.91  ? 1073 PRO A C   1 
ATOM 6351  O O   . PRO A 1 1073 ? 39.072  31.326  78.805  1.00 29.70  ? 1073 PRO A O   1 
ATOM 6352  C CB  . PRO A 1 1073 ? 37.677  33.627  78.112  1.00 40.34  ? 1073 PRO A CB  1 
ATOM 6353  H HA  . PRO A 1 1073 ? 39.683  33.966  77.717  1.00 31.40  ? 1073 PRO A HA  1 
ATOM 6354  N N   . PRO A 1 1074 ? 40.367  31.360  76.990  1.00 17.30  ? 1074 PRO A N   1 
ATOM 6355  C CA  . PRO A 1 1074 ? 40.945  30.046  77.280  1.00 13.26  ? 1074 PRO A CA  1 
ATOM 6356  C C   . PRO A 1 1074 ? 39.990  28.876  77.094  1.00 20.26  ? 1074 PRO A C   1 
ATOM 6357  O O   . PRO A 1 1074 ? 40.361  27.716  77.313  1.00 19.53  ? 1074 PRO A O   1 
ATOM 6358  C CB  . PRO A 1 1074 ? 41.388  30.159  78.741  1.00 12.37  ? 1074 PRO A CB  1 
ATOM 6359  H HA  . PRO A 1 1074 ? 41.728  29.902  76.726  1.00 15.92  ? 1074 PRO A HA  1 
ATOM 6360  N N   . LEU A 1 1075 ? 38.768  29.176  76.656  1.00 42.53  ? 1075 LEU A N   1 
ATOM 6361  C CA  . LEU A 1 1075 ? 37.690  28.192  76.516  1.00 54.68  ? 1075 LEU A CA  1 
ATOM 6362  C C   . LEU A 1 1075 ? 37.171  28.130  75.091  1.00 51.32  ? 1075 LEU A C   1 
ATOM 6363  O O   . LEU A 1 1075 ? 35.993  27.802  74.878  1.00 51.40  ? 1075 LEU A O   1 
ATOM 6364  C CB  . LEU A 1 1075 ? 36.523  28.505  77.455  1.00 77.80  ? 1075 LEU A CB  1 
ATOM 6365  H H   . LEU A 1 1075 ? 38.531  29.970  76.425  1.00 51.03  ? 1075 LEU A H   1 
ATOM 6366  H HA  . LEU A 1 1075 ? 38.033  27.315  76.748  1.00 65.61  ? 1075 LEU A HA  1 
ATOM 6367  N N   . VAL A 1 1076 ? 37.998  28.512  74.116  1.00 46.84  ? 1076 VAL A N   1 
ATOM 6368  C CA  . VAL A 1 1076 ? 37.585  28.372  72.730  1.00 44.54  ? 1076 VAL A CA  1 
ATOM 6369  C C   . VAL A 1 1076 ? 37.117  26.954  72.520  1.00 25.87  ? 1076 VAL A C   1 
ATOM 6370  O O   . VAL A 1 1076 ? 36.009  26.690  72.036  1.00 25.91  ? 1076 VAL A O   1 
ATOM 6371  C CB  . VAL A 1 1076 ? 38.748  28.733  71.788  1.00 40.99  ? 1076 VAL A CB  1 
ATOM 6372  H H   . VAL A 1 1076 ? 38.781  28.847  74.231  1.00 56.21  ? 1076 VAL A H   1 
ATOM 6373  H HA  . VAL A 1 1076 ? 36.844  28.972  72.549  1.00 53.45  ? 1076 VAL A HA  1 
ATOM 6374  N N   . SER A 1 1077 ? 37.925  26.032  72.987  1.00 23.45  ? 1077 SER A N   1 
ATOM 6375  C CA  . SER A 1 1077 ? 37.512  24.654  72.955  1.00 33.58  ? 1077 SER A CA  1 
ATOM 6376  C C   . SER A 1 1077 ? 36.342  24.421  73.919  1.00 44.01  ? 1077 SER A C   1 
ATOM 6377  O O   . SER A 1 1077 ? 35.421  23.670  73.594  1.00 61.17  ? 1077 SER A O   1 
ATOM 6378  C CB  . SER A 1 1077 ? 38.728  23.781  73.246  1.00 36.49  ? 1077 SER A CB  1 
ATOM 6379  H HA  . SER A 1 1077 ? 37.203  24.441  72.060  1.00 40.29  ? 1077 SER A HA  1 
ATOM 6380  N N   . GLY A 1 1078 ? 36.317  25.086  75.077  1.00 29.56  ? 1078 GLY A N   1 
ATOM 6381  C CA  . GLY A 1 1078 ? 35.100  25.062  75.887  1.00 23.41  ? 1078 GLY A CA  1 
ATOM 6382  C C   . GLY A 1 1078 ? 33.891  25.446  75.061  1.00 25.23  ? 1078 GLY A C   1 
ATOM 6383  O O   . GLY A 1 1078 ? 32.879  24.730  75.040  1.00 21.83  ? 1078 GLY A O   1 
ATOM 6384  H H   . GLY A 1 1078 ? 36.968  25.543  75.405  1.00 35.47  ? 1078 GLY A H   1 
ATOM 6385  H HA2 . GLY A 1 1078 ? 34.962  24.171  76.246  1.00 28.09  ? 1078 GLY A HA2 1 
ATOM 6386  H HA3 . GLY A 1 1078 ? 35.184  25.686  76.625  1.00 28.09  ? 1078 GLY A HA3 1 
ATOM 6387  N N   . ALA A 1 1079 ? 34.011  26.541  74.308  1.00 27.04  ? 1079 ALA A N   1 
ATOM 6388  C CA  . ALA A 1 1079 ? 32.995  26.873  73.318  1.00 38.63  ? 1079 ALA A CA  1 
ATOM 6389  C C   . ALA A 1 1079 ? 32.733  25.677  72.419  1.00 34.09  ? 1079 ALA A C   1 
ATOM 6390  O O   . ALA A 1 1079 ? 31.600  25.194  72.309  1.00 26.33  ? 1079 ALA A O   1 
ATOM 6391  C CB  . ALA A 1 1079 ? 33.447  28.077  72.481  1.00 49.99  ? 1079 ALA A CB  1 
ATOM 6392  H H   . ALA A 1 1079 ? 34.663  27.099  74.352  1.00 32.45  ? 1079 ALA A H   1 
ATOM 6393  H HA  . ALA A 1 1079 ? 32.168  27.105  73.768  1.00 46.36  ? 1079 ALA A HA  1 
ATOM 6394  H HB1 . ALA A 1 1079 ? 32.760  28.284  71.828  1.00 59.99  ? 1079 ALA A HB1 1 
ATOM 6395  H HB2 . ALA A 1 1079 ? 33.584  28.836  73.069  1.00 59.99  ? 1079 ALA A HB2 1 
ATOM 6396  H HB3 . ALA A 1 1079 ? 34.276  27.854  72.029  1.00 59.99  ? 1079 ALA A HB3 1 
ATOM 6397  N N   . LEU A 1 1080 ? 33.800  25.170  71.805  1.00 39.21  ? 1080 LEU A N   1 
ATOM 6398  C CA  . LEU A 1 1080 ? 33.703  24.035  70.902  1.00 44.93  ? 1080 LEU A CA  1 
ATOM 6399  C C   . LEU A 1 1080 ? 32.916  22.871  71.513  1.00 34.95  ? 1080 LEU A C   1 
ATOM 6400  O O   . LEU A 1 1080 ? 32.179  22.179  70.800  1.00 33.67  ? 1080 LEU A O   1 
ATOM 6401  C CB  . LEU A 1 1080 ? 35.115  23.588  70.504  1.00 48.02  ? 1080 LEU A CB  1 
ATOM 6402  H H   . LEU A 1 1080 ? 34.600  25.472  71.899  1.00 47.05  ? 1080 LEU A H   1 
ATOM 6403  H HA  . LEU A 1 1080 ? 33.242  24.315  70.096  1.00 53.92  ? 1080 LEU A HA  1 
ATOM 6404  N N   . GLN A 1 1081 ? 33.053  22.628  72.823  1.00 29.05  ? 1081 GLN A N   1 
ATOM 6405  C CA  . GLN A 1 1081 ? 32.348  21.486  73.380  1.00 22.51  ? 1081 GLN A CA  1 
ATOM 6406  C C   . GLN A 1 1081 ? 30.880  21.624  73.069  1.00 22.43  ? 1081 GLN A C   1 
ATOM 6407  O O   . GLN A 1 1081 ? 30.265  20.730  72.481  1.00 25.10  ? 1081 GLN A O   1 
ATOM 6408  C CB  . GLN A 1 1081 ? 32.569  21.396  74.885  1.00 28.68  ? 1081 GLN A CB  1 
ATOM 6409  H H   . GLN A 1 1081 ? 33.523  23.086  73.379  1.00 34.86  ? 1081 GLN A H   1 
ATOM 6410  H HA  . GLN A 1 1081 ? 32.675  20.671  72.970  1.00 27.01  ? 1081 GLN A HA  1 
ATOM 6411  N N   . LEU A 1 1082 ? 30.344  22.806  73.335  1.00 18.25  ? 1082 LEU A N   1 
ATOM 6412  C CA  . LEU A 1 1082 ? 28.947  23.071  73.096  1.00 23.75  ? 1082 LEU A CA  1 
ATOM 6413  C C   . LEU A 1 1082 ? 28.528  22.704  71.674  1.00 37.23  ? 1082 LEU A C   1 
ATOM 6414  O O   . LEU A 1 1082 ? 27.439  22.157  71.472  1.00 53.38  ? 1082 LEU A O   1 
ATOM 6415  C CB  . LEU A 1 1082 ? 28.683  24.545  73.372  1.00 22.16  ? 1082 LEU A CB  1 
ATOM 6416  H H   . LEU A 1 1082 ? 30.778  23.475  73.659  1.00 21.90  ? 1082 LEU A H   1 
ATOM 6417  H HA  . LEU A 1 1082 ? 28.412  22.547  73.713  1.00 28.50  ? 1082 LEU A HA  1 
ATOM 6418  N N   . LEU A 1 1083 ? 29.372  22.977  70.677  1.00 42.46  ? 1083 LEU A N   1 
ATOM 6419  C CA  . LEU A 1 1083 ? 28.946  22.796  69.289  1.00 48.02  ? 1083 LEU A CA  1 
ATOM 6420  C C   . LEU A 1 1083 ? 28.762  21.331  68.909  1.00 52.00  ? 1083 LEU A C   1 
ATOM 6421  O O   . LEU A 1 1083 ? 27.985  21.027  67.990  1.00 36.15  ? 1083 LEU A O   1 
ATOM 6422  C CB  . LEU A 1 1083 ? 29.959  23.434  68.343  1.00 60.37  ? 1083 LEU A CB  1 
ATOM 6423  H H   . LEU A 1 1083 ? 30.178  23.261  70.774  1.00 50.95  ? 1083 LEU A H   1 
ATOM 6424  H HA  . LEU A 1 1083 ? 28.096  23.245  69.161  1.00 57.63  ? 1083 LEU A HA  1 
ATOM 6425  N N   . PHE A 1 1084 ? 29.467  20.417  69.591  1.00 65.81  ? 1084 PHE A N   1 
ATOM 6426  C CA  . PHE A 1 1084 ? 29.543  19.027  69.136  1.00 82.95  ? 1084 PHE A CA  1 
ATOM 6427  C C   . PHE A 1 1084 ? 28.234  18.250  69.329  1.00 79.74  ? 1084 PHE A C   1 
ATOM 6428  O O   . PHE A 1 1084 ? 27.949  17.320  68.558  1.00 81.12  ? 1084 PHE A O   1 
ATOM 6429  C CB  . PHE A 1 1084 ? 30.690  18.315  69.857  1.00 100.95 ? 1084 PHE A CB  1 
ATOM 6430  H H   . PHE A 1 1084 ? 29.905  20.577  70.313  1.00 78.97  ? 1084 PHE A H   1 
ATOM 6431  H HA  . PHE A 1 1084 ? 29.747  19.024  68.187  1.00 99.54  ? 1084 PHE A HA  1 
ATOM 6432  N N   . ARG A 1 1085 ? 27.435  18.592  70.347  1.00 72.33  ? 1085 ARG A N   1 
ATOM 6433  C CA  . ARG A 1 1085 ? 26.249  17.791  70.645  1.00 59.01  ? 1085 ARG A CA  1 
ATOM 6434  C C   . ARG A 1 1085 ? 25.195  17.945  69.559  1.00 38.73  ? 1085 ARG A C   1 
ATOM 6435  O O   . ARG A 1 1085 ? 24.376  17.039  69.356  1.00 35.84  ? 1085 ARG A O   1 
ATOM 6436  C CB  . ARG A 1 1085 ? 25.674  18.184  72.010  1.00 52.51  ? 1085 ARG A CB  1 
ATOM 6437  H H   . ARG A 1 1085 ? 27.556  19.266  70.867  1.00 86.79  ? 1085 ARG A H   1 
ATOM 6438  H HA  . ARG A 1 1085 ? 26.503  16.856  70.684  1.00 70.81  ? 1085 ARG A HA  1 
ATOM 6439  N N   . HIS A 1 1086 ? 25.207  19.072  68.848  1.00 29.52  ? 1086 HIS A N   1 
ATOM 6440  C CA  . HIS A 1 1086 ? 24.194  19.390  67.864  1.00 22.61  ? 1086 HIS A CA  1 
ATOM 6441  C C   . HIS A 1 1086 ? 24.422  18.732  66.516  1.00 20.50  ? 1086 HIS A C   1 
ATOM 6442  O O   . HIS A 1 1086 ? 23.700  19.057  65.573  1.00 20.32  ? 1086 HIS A O   1 
ATOM 6443  C CB  . HIS A 1 1086 ? 24.132  20.904  67.675  1.00 16.77  ? 1086 HIS A CB  1 
ATOM 6444  H H   . HIS A 1 1086 ? 25.811  19.679  68.926  1.00 35.42  ? 1086 HIS A H   1 
ATOM 6445  H HA  . HIS A 1 1086 ? 23.331  19.096  68.196  1.00 27.14  ? 1086 HIS A HA  1 
ATOM 6446  N N   . PHE A 1 1087 ? 25.388  17.833  66.372  1.00 22.86  ? 1087 PHE A N   1 
ATOM 6447  C CA  . PHE A 1 1087 ? 25.657  17.290  65.045  1.00 19.39  ? 1087 PHE A CA  1 
ATOM 6448  C C   . PHE A 1 1087 ? 24.663  16.216  64.626  1.00 14.57  ? 1087 PHE A C   1 
ATOM 6449  O O   . PHE A 1 1087 ? 24.677  15.815  63.455  1.00 10.91  ? 1087 PHE A O   1 
ATOM 6450  C CB  . PHE A 1 1087 ? 27.073  16.709  64.973  1.00 19.52  ? 1087 PHE A CB  1 
ATOM 6451  H HA  . PHE A 1 1087 ? 25.601  18.011  64.398  1.00 23.26  ? 1087 PHE A HA  1 
ATOM 6452  N N   . SER A 1 1088 ? 23.810  15.748  65.545  1.00 14.92  ? 1088 SER A N   1 
ATOM 6453  C CA  . SER A 1 1088 ? 22.867  14.679  65.227  1.00 12.22  ? 1088 SER A CA  1 
ATOM 6454  C C   . SER A 1 1088 ? 22.042  15.023  63.989  1.00 17.31  ? 1088 SER A C   1 
ATOM 6455  O O   . SER A 1 1088 ? 22.044  14.280  63.002  1.00 23.46  ? 1088 SER A O   1 
ATOM 6456  C CB  . SER A 1 1088 ? 21.962  14.407  66.432  1.00 8.71   ? 1088 SER A CB  1 
ATOM 6457  H HA  . SER A 1 1088 ? 23.365  13.868  65.038  1.00 14.66  ? 1088 SER A HA  1 
ATOM 6458  N N   . GLN A 1 1089 ? 21.338  16.154  64.015  1.00 16.29  ? 1089 GLN A N   1 
ATOM 6459  C CA  . GLN A 1 1089 ? 20.614  16.631  62.838  1.00 19.97  ? 1089 GLN A CA  1 
ATOM 6460  C C   . GLN A 1 1089 ? 20.324  18.122  63.016  1.00 26.21  ? 1089 GLN A C   1 
ATOM 6461  O O   . GLN A 1 1089 ? 20.002  18.559  64.123  1.00 29.61  ? 1089 GLN A O   1 
ATOM 6462  C CB  . GLN A 1 1089 ? 19.314  15.852  62.626  1.00 15.06  ? 1089 GLN A CB  1 
ATOM 6463  H HA  . GLN A 1 1089 ? 21.169  16.519  62.050  1.00 23.96  ? 1089 GLN A HA  1 
ATOM 6464  N N   . ARG A 1 1090 ? 20.430  18.883  61.922  1.00 35.52  ? 1090 ARG A N   1 
ATOM 6465  C CA  . ARG A 1 1090 ? 20.397  20.344  61.954  1.00 30.39  ? 1090 ARG A CA  1 
ATOM 6466  C C   . ARG A 1 1090 ? 19.069  20.894  61.461  1.00 21.90  ? 1090 ARG A C   1 
ATOM 6467  O O   . ARG A 1 1090 ? 18.992  22.046  61.029  1.00 24.36  ? 1090 ARG A O   1 
ATOM 6468  C CB  . ARG A 1 1090 ? 21.531  20.922  61.105  1.00 36.58  ? 1090 ARG A CB  1 
ATOM 6469  H H   . ARG A 1 1090 ? 20.524  18.564  61.130  1.00 42.62  ? 1090 ARG A H   1 
ATOM 6470  H HA  . ARG A 1 1090 ? 20.525  20.642  62.868  1.00 36.47  ? 1090 ARG A HA  1 
ATOM 6471  N N   . GLN A 1 1091 ? 18.019  20.086  61.531  1.00 17.59  ? 1091 GLN A N   1 
ATOM 6472  C CA  . GLN A 1 1091 ? 16.822  20.306  60.731  1.00 17.66  ? 1091 GLN A CA  1 
ATOM 6473  C C   . GLN A 1 1091 ? 15.576  20.509  61.582  1.00 17.25  ? 1091 GLN A C   1 
ATOM 6474  O O   . GLN A 1 1091 ? 14.471  20.593  61.030  1.00 14.10  ? 1091 GLN A O   1 
ATOM 6475  C CB  . GLN A 1 1091 ? 16.630  19.123  59.782  1.00 17.35  ? 1091 GLN A CB  1 
ATOM 6476  H H   . GLN A 1 1091 ? 17.976  19.394  62.040  1.00 21.11  ? 1091 GLN A H   1 
ATOM 6477  H HA  . GLN A 1 1091 ? 16.947  21.103  60.193  1.00 21.20  ? 1091 GLN A HA  1 
ATOM 6478  N N   . GLU A 1 1092 ? 15.741  20.654  62.898  1.00 20.37  ? 1092 GLU A N   1 
ATOM 6479  C CA  . GLU A 1 1092 ? 14.640  20.497  63.841  1.00 20.74  ? 1092 GLU A CA  1 
ATOM 6480  C C   . GLU A 1 1092 ? 13.716  21.699  63.909  1.00 24.15  ? 1092 GLU A C   1 
ATOM 6481  O O   . GLU A 1 1092 ? 12.820  21.704  64.761  1.00 21.78  ? 1092 GLU A O   1 
ATOM 6482  C CB  . GLU A 1 1092 ? 15.196  20.215  65.235  1.00 17.72  ? 1092 GLU A CB  1 
ATOM 6483  H H   . GLU A 1 1092 ? 16.491  20.846  63.271  1.00 24.45  ? 1092 GLU A H   1 
ATOM 6484  H HA  . GLU A 1 1092 ? 14.109  19.731  63.574  1.00 24.89  ? 1092 GLU A HA  1 
ATOM 6485  N N   . VAL A 1 1093 ? 13.926  22.716  63.070  1.00 27.65  ? 1093 VAL A N   1 
ATOM 6486  C CA  . VAL A 1 1093 ? 12.992  23.824  62.907  1.00 27.97  ? 1093 VAL A CA  1 
ATOM 6487  C C   . VAL A 1 1093 ? 13.303  24.973  63.868  1.00 32.16  ? 1093 VAL A C   1 
ATOM 6488  O O   . VAL A 1 1093 ? 12.975  26.128  63.574  1.00 34.90  ? 1093 VAL A O   1 
ATOM 6489  C CB  . VAL A 1 1093 ? 11.541  23.338  63.067  1.00 34.06  ? 1093 VAL A CB  1 
ATOM 6490  H H   . VAL A 1 1093 ? 14.624  22.784  62.571  1.00 33.18  ? 1093 VAL A H   1 
ATOM 6491  H HA  . VAL A 1 1093 ? 13.083  24.169  62.005  1.00 33.56  ? 1093 VAL A HA  1 
ATOM 6492  N N   . LEU A 1 1094 ? 13.949  24.698  65.003  1.00 29.48  ? 1094 LEU A N   1 
ATOM 6493  C CA  . LEU A 1 1094 ? 14.281  25.761  65.946  1.00 35.12  ? 1094 LEU A CA  1 
ATOM 6494  C C   . LEU A 1 1094 ? 15.771  25.896  66.244  1.00 47.19  ? 1094 LEU A C   1 
ATOM 6495  O O   . LEU A 1 1094 ? 16.188  26.953  66.747  1.00 53.64  ? 1094 LEU A O   1 
ATOM 6496  C CB  . LEU A 1 1094 ? 13.521  25.540  67.261  1.00 35.84  ? 1094 LEU A CB  1 
ATOM 6497  H H   . LEU A 1 1094 ? 14.204  23.913  65.246  1.00 35.38  ? 1094 LEU A H   1 
ATOM 6498  H HA  . LEU A 1 1094 ? 13.981  26.605  65.573  1.00 42.15  ? 1094 LEU A HA  1 
ATOM 6499  N N   . GLN A 1 1095 ? 16.582  24.881  65.918  1.00 44.41  ? 1095 GLN A N   1 
ATOM 6500  C CA  . GLN A 1 1095 ? 17.990  24.881  66.301  1.00 35.78  ? 1095 GLN A CA  1 
ATOM 6501  C C   . GLN A 1 1095 ? 18.626  26.253  66.084  1.00 45.85  ? 1095 GLN A C   1 
ATOM 6502  O O   . GLN A 1 1095 ? 19.305  26.774  66.979  1.00 44.24  ? 1095 GLN A O   1 
ATOM 6503  C CB  . GLN A 1 1095 ? 18.741  23.797  65.515  1.00 24.67  ? 1095 GLN A CB  1 
ATOM 6504  H H   . GLN A 1 1095 ? 16.337  24.184  65.477  1.00 53.29  ? 1095 GLN A H   1 
ATOM 6505  H HA  . GLN A 1 1095 ? 18.059  24.666  67.244  1.00 42.93  ? 1095 GLN A HA  1 
ATOM 6506  N N   . ALA A 1 1096 ? 18.344  26.886  64.935  1.00 53.84  ? 1096 ALA A N   1 
ATOM 6507  C CA  . ALA A 1 1096 ? 19.035  28.114  64.545  1.00 49.41  ? 1096 ALA A CA  1 
ATOM 6508  C C   . ALA A 1 1096 ? 18.935  29.190  65.623  1.00 38.75  ? 1096 ALA A C   1 
ATOM 6509  O O   . ALA A 1 1096 ? 19.944  29.799  65.999  1.00 37.16  ? 1096 ALA A O   1 
ATOM 6510  C CB  . ALA A 1 1096 ? 18.483  28.628  63.209  1.00 40.17  ? 1096 ALA A CB  1 
ATOM 6511  H H   . ALA A 1 1096 ? 17.755  26.620  64.367  1.00 64.61  ? 1096 ALA A H   1 
ATOM 6512  H HA  . ALA A 1 1096 ? 19.975  27.913  64.417  1.00 59.29  ? 1096 ALA A HA  1 
ATOM 6513  H HB1 . ALA A 1 1096 ? 18.952  29.442  62.967  1.00 48.20  ? 1096 ALA A HB1 1 
ATOM 6514  H HB2 . ALA A 1 1096 ? 18.621  27.951  62.529  1.00 48.20  ? 1096 ALA A HB2 1 
ATOM 6515  H HB3 . ALA A 1 1096 ? 17.535  28.809  63.309  1.00 48.20  ? 1096 ALA A HB3 1 
ATOM 6516  N N   . PHE A 1 1097 ? 17.734  29.445  66.142  1.00 35.67  ? 1097 PHE A N   1 
ATOM 6517  C CA  . PHE A 1 1097 ? 17.619  30.463  67.179  1.00 28.01  ? 1097 PHE A CA  1 
ATOM 6518  C C   . PHE A 1 1097 ? 18.554  30.144  68.337  1.00 26.70  ? 1097 PHE A C   1 
ATOM 6519  O O   . PHE A 1 1097 ? 19.356  30.986  68.757  1.00 24.70  ? 1097 PHE A O   1 
ATOM 6520  C CB  . PHE A 1 1097 ? 16.170  30.562  67.656  1.00 40.02  ? 1097 PHE A CB  1 
ATOM 6521  H H   . PHE A 1 1097 ? 16.999  29.058  65.921  1.00 42.81  ? 1097 PHE A H   1 
ATOM 6522  H HA  . PHE A 1 1097 ? 17.875  31.323  66.811  1.00 33.61  ? 1097 PHE A HA  1 
ATOM 6523  N N   . LYS A 1 1098 ? 18.489  28.914  68.843  1.00 27.20  ? 1098 LYS A N   1 
ATOM 6524  C CA  . LYS A 1 1098 ? 19.487  28.458  69.798  1.00 28.99  ? 1098 LYS A CA  1 
ATOM 6525  C C   . LYS A 1 1098 ? 20.869  28.498  69.183  1.00 28.20  ? 1098 LYS A C   1 
ATOM 6526  O O   . LYS A 1 1098 ? 21.804  29.050  69.778  1.00 24.90  ? 1098 LYS A O   1 
ATOM 6527  C CB  . LYS A 1 1098 ? 19.130  27.046  70.265  1.00 30.25  ? 1098 LYS A CB  1 
ATOM 6528  H H   . LYS A 1 1098 ? 17.884  28.334  68.651  1.00 32.65  ? 1098 LYS A H   1 
ATOM 6529  H HA  . LYS A 1 1098 ? 19.482  29.044  70.571  1.00 34.78  ? 1098 LYS A HA  1 
ATOM 6530  N N   . GLN A 1 1099 ? 21.018  27.926  67.994  1.00 32.94  ? 1099 GLN A N   1 
ATOM 6531  C CA  . GLN A 1 1099 ? 22.278  28.035  67.298  1.00 33.63  ? 1099 GLN A CA  1 
ATOM 6532  C C   . GLN A 1 1099 ? 22.617  29.495  67.029  1.00 35.72  ? 1099 GLN A C   1 
ATOM 6533  O O   . GLN A 1 1099 ? 23.802  29.830  66.919  1.00 36.55  ? 1099 GLN A O   1 
ATOM 6534  C CB  . GLN A 1 1099 ? 22.241  27.235  65.989  1.00 34.38  ? 1099 GLN A CB  1 
ATOM 6535  H H   . GLN A 1 1099 ? 20.412  27.478  67.579  1.00 39.53  ? 1099 GLN A H   1 
ATOM 6536  H HA  . GLN A 1 1099 ? 22.979  27.663  67.856  1.00 40.36  ? 1099 GLN A HA  1 
ATOM 6537  N N   . VAL A 1 1100 ? 21.608  30.376  66.983  1.00 35.99  ? 1100 VAL A N   1 
ATOM 6538  C CA  . VAL A 1 1100 ? 21.876  31.786  66.748  1.00 36.24  ? 1100 VAL A CA  1 
ATOM 6539  C C   . VAL A 1 1100 ? 22.739  32.315  67.883  1.00 37.10  ? 1100 VAL A C   1 
ATOM 6540  O O   . VAL A 1 1100 ? 23.626  33.158  67.669  1.00 28.79  ? 1100 VAL A O   1 
ATOM 6541  C CB  . VAL A 1 1100 ? 20.553  32.575  66.614  1.00 32.27  ? 1100 VAL A CB  1 
ATOM 6542  H H   . VAL A 1 1100 ? 20.777  30.180  67.083  1.00 43.19  ? 1100 VAL A H   1 
ATOM 6543  H HA  . VAL A 1 1100 ? 22.372  31.884  65.920  1.00 43.48  ? 1100 VAL A HA  1 
ATOM 6544  N N   . GLN A 1 1101 ? 22.527  31.777  69.095  1.00 40.00  ? 1101 GLN A N   1 
ATOM 6545  C CA  . GLN A 1 1101 ? 23.362  32.102  70.241  1.00 34.09  ? 1101 GLN A CA  1 
ATOM 6546  C C   . GLN A 1 1101 ? 24.826  32.100  69.860  1.00 34.61  ? 1101 GLN A C   1 
ATOM 6547  O O   . GLN A 1 1101 ? 25.559  33.048  70.170  1.00 27.52  ? 1101 GLN A O   1 
ATOM 6548  C CB  . GLN A 1 1101 ? 23.102  31.088  71.360  1.00 24.51  ? 1101 GLN A CB  1 
ATOM 6549  H H   . GLN A 1 1101 ? 21.898  31.217  69.271  1.00 47.99  ? 1101 GLN A H   1 
ATOM 6550  H HA  . GLN A 1 1101 ? 23.132  32.985  70.568  1.00 40.91  ? 1101 GLN A HA  1 
ATOM 6551  N N   . LEU A 1 1102 ? 25.262  31.052  69.167  1.00 40.27  ? 1102 LEU A N   1 
ATOM 6552  C CA  . LEU A 1 1102 ? 26.664  30.942  68.801  1.00 40.86  ? 1102 LEU A CA  1 
ATOM 6553  C C   . LEU A 1 1102 ? 27.190  32.260  68.224  1.00 20.97  ? 1102 LEU A C   1 
ATOM 6554  O O   . LEU A 1 1102 ? 28.159  32.826  68.740  1.00 17.94  ? 1102 LEU A O   1 
ATOM 6555  C CB  . LEU A 1 1102 ? 26.843  29.781  67.815  1.00 36.68  ? 1102 LEU A CB  1 
ATOM 6556  H H   . LEU A 1 1102 ? 24.770  30.399  68.899  1.00 48.32  ? 1102 LEU A H   1 
ATOM 6557  H HA  . LEU A 1 1102 ? 27.180  30.739  69.597  1.00 49.03  ? 1102 LEU A HA  1 
ATOM 6558  N N   . LEU A 1 1103 ? 26.521  32.787  67.199  1.00 14.29  ? 1103 LEU A N   1 
ATOM 6559  C CA  . LEU A 1 1103 ? 26.977  33.972  66.480  1.00 9.07   ? 1103 LEU A CA  1 
ATOM 6560  C C   . LEU A 1 1103 ? 28.417  34.360  66.833  1.00 9.07   ? 1103 LEU A C   1 
ATOM 6561  O O   . LEU A 1 1103 ? 29.354  33.642  66.475  1.00 9.07   ? 1103 LEU A O   1 
ATOM 6562  C CB  . LEU A 1 1103 ? 26.019  35.133  66.758  1.00 9.07   ? 1103 LEU A CB  1 
ATOM 6563  H H   . LEU A 1 1103 ? 25.783  32.467  66.896  1.00 17.15  ? 1103 LEU A H   1 
ATOM 6564  H HA  . LEU A 1 1103 ? 26.948  33.788  65.528  1.00 10.88  ? 1103 LEU A HA  1 
ATOM 6565  N N   . VAL A 1 1104 ? 28.603  35.500  67.501  1.00 9.07   ? 1104 VAL A N   1 
ATOM 6566  C CA  . VAL A 1 1104 ? 29.836  35.875  68.208  1.00 9.07   ? 1104 VAL A CA  1 
ATOM 6567  C C   . VAL A 1 1104 ? 31.126  35.792  67.393  1.00 9.07   ? 1104 VAL A C   1 
ATOM 6568  O O   . VAL A 1 1104 ? 32.199  35.510  67.946  1.00 9.07   ? 1104 VAL A O   1 
ATOM 6569  C CB  . VAL A 1 1104 ? 29.994  35.017  69.472  1.00 16.36  ? 1104 VAL A CB  1 
ATOM 6570  H H   . VAL A 1 1104 ? 27.995  36.105  67.563  1.00 10.88  ? 1104 VAL A H   1 
ATOM 6571  H HA  . VAL A 1 1104 ? 29.744  36.796  68.498  1.00 10.88  ? 1104 VAL A HA  1 
ATOM 6572  N N   . THR A 1 1105 ? 31.062  36.124  66.107  1.00 9.11   ? 1105 THR A N   1 
ATOM 6573  C CA  . THR A 1 1105 ? 32.201  35.933  65.227  1.00 9.11   ? 1105 THR A CA  1 
ATOM 6574  C C   . THR A 1 1105 ? 33.206  37.040  65.509  1.00 9.11   ? 1105 THR A C   1 
ATOM 6575  O O   . THR A 1 1105 ? 33.277  38.054  64.816  1.00 9.11   ? 1105 THR A O   1 
ATOM 6576  C CB  . THR A 1 1105 ? 31.760  35.937  63.769  1.00 9.11   ? 1105 THR A CB  1 
ATOM 6577  H H   . THR A 1 1105 ? 30.371  36.462  65.723  1.00 10.93  ? 1105 THR A H   1 
ATOM 6578  H HA  . THR A 1 1105 ? 32.620  35.080  65.419  1.00 10.93  ? 1105 THR A HA  1 
ATOM 6579  N N   . SER A 1 1106 ? 33.967  36.850  66.581  1.00 9.15   ? 1106 SER A N   1 
ATOM 6580  C CA  . SER A 1 1106 ? 35.041  37.770  66.867  1.00 9.15   ? 1106 SER A CA  1 
ATOM 6581  C C   . SER A 1 1106 ? 36.379  37.121  67.193  1.00 9.15   ? 1106 SER A C   1 
ATOM 6582  O O   . SER A 1 1106 ? 37.348  37.857  67.375  1.00 12.65  ? 1106 SER A O   1 
ATOM 6583  C CB  . SER A 1 1106 ? 34.624  38.690  68.017  1.00 9.15   ? 1106 SER A CB  1 
ATOM 6584  H H   . SER A 1 1106 ? 33.880  36.206  67.145  1.00 10.98  ? 1106 SER A H   1 
ATOM 6585  H HA  . SER A 1 1106 ? 35.176  38.328  66.085  1.00 10.98  ? 1106 SER A HA  1 
ATOM 6586  N N   . GLN A 1 1107 ? 36.494  35.789  67.242  1.00 9.17   ? 1107 GLN A N   1 
ATOM 6587  C CA  . GLN A 1 1107 ? 37.762  35.133  67.635  1.00 16.36  ? 1107 GLN A CA  1 
ATOM 6588  C C   . GLN A 1 1107 ? 38.090  33.954  66.704  1.00 21.89  ? 1107 GLN A C   1 
ATOM 6589  O O   . GLN A 1 1107 ? 38.148  32.812  67.159  1.00 23.75  ? 1107 GLN A O   1 
ATOM 6590  C CB  . GLN A 1 1107 ? 37.698  34.668  69.090  1.00 16.38  ? 1107 GLN A CB  1 
ATOM 6591  H HA  . GLN A 1 1107 ? 38.483  35.778  67.561  1.00 19.63  ? 1107 GLN A HA  1 
ATOM 6592  N N   . ASP A 1 1108 ? 38.397  34.246  65.432  1.00 27.67  ? 1108 ASP A N   1 
ATOM 6593  C CA  . ASP A 1 1108 ? 38.458  33.193  64.408  1.00 27.25  ? 1108 ASP A CA  1 
ATOM 6594  C C   . ASP A 1 1108 ? 39.623  32.238  64.618  1.00 19.33  ? 1108 ASP A C   1 
ATOM 6595  O O   . ASP A 1 1108 ? 39.509  31.040  64.325  1.00 18.64  ? 1108 ASP A O   1 
ATOM 6596  C CB  . ASP A 1 1108 ? 38.554  33.813  63.013  1.00 38.24  ? 1108 ASP A CB  1 
ATOM 6597  H HA  . ASP A 1 1108 ? 37.639  32.674  64.446  1.00 32.70  ? 1108 ASP A HA  1 
ATOM 6598  N N   . VAL A 1 1109 ? 40.760  32.735  65.082  1.00 12.36  ? 1109 VAL A N   1 
ATOM 6599  C CA  . VAL A 1 1109 ? 41.906  31.868  65.257  1.00 12.23  ? 1109 VAL A CA  1 
ATOM 6600  C C   . VAL A 1 1109 ? 41.504  30.766  66.230  1.00 14.54  ? 1109 VAL A C   1 
ATOM 6601  O O   . VAL A 1 1109 ? 41.280  29.602  65.839  1.00 13.71  ? 1109 VAL A O   1 
ATOM 6602  C CB  . VAL A 1 1109 ? 43.117  32.678  65.753  1.00 8.94   ? 1109 VAL A CB  1 
ATOM 6603  H H   . VAL A 1 1109 ? 40.890  33.556  65.300  1.00 14.83  ? 1109 VAL A H   1 
ATOM 6604  H HA  . VAL A 1 1109 ? 42.136  31.459  64.408  1.00 14.67  ? 1109 VAL A HA  1 
ATOM 6605  N N   . ASP A 1 1110 ? 41.347  31.157  67.494  1.00 11.03  ? 1110 ASP A N   1 
ATOM 6606  C CA  . ASP A 1 1110 ? 41.175  30.189  68.566  1.00 17.92  ? 1110 ASP A CA  1 
ATOM 6607  C C   . ASP A 1 1110 ? 40.145  29.129  68.197  1.00 16.43  ? 1110 ASP A C   1 
ATOM 6608  O O   . ASP A 1 1110 ? 40.443  27.929  68.216  1.00 15.59  ? 1110 ASP A O   1 
ATOM 6609  C CB  . ASP A 1 1110 ? 40.776  30.924  69.848  1.00 24.51  ? 1110 ASP A CB  1 
ATOM 6610  H H   . ASP A 1 1110 ? 41.337  31.977  67.753  1.00 13.24  ? 1110 ASP A H   1 
ATOM 6611  H HA  . ASP A 1 1110 ? 42.021  29.743  68.727  1.00 21.50  ? 1110 ASP A HA  1 
ATOM 6612  N N   . ASN A 1 1111 ? 38.941  29.553  67.825  1.00 16.65  ? 1111 ASN A N   1 
ATOM 6613  C CA  . ASN A 1 1111 ? 37.906  28.586  67.497  1.00 18.89  ? 1111 ASN A CA  1 
ATOM 6614  C C   . ASN A 1 1111 ? 38.337  27.745  66.309  1.00 17.25  ? 1111 ASN A C   1 
ATOM 6615  O O   . ASN A 1 1111 ? 38.122  26.525  66.291  1.00 20.19  ? 1111 ASN A O   1 
ATOM 6616  C CB  . ASN A 1 1111 ? 36.586  29.299  67.202  1.00 35.71  ? 1111 ASN A CB  1 
ATOM 6617  H H   . ASN A 1 1111 ? 38.704  30.377  67.757  1.00 19.98  ? 1111 ASN A H   1 
ATOM 6618  H HA  . ASN A 1 1111 ? 37.768  27.995  68.254  1.00 22.66  ? 1111 ASN A HA  1 
ATOM 6619  N N   . TYR A 1 1112 ? 38.999  28.372  65.333  1.00 15.63  ? 1112 TYR A N   1 
ATOM 6620  C CA  . TYR A 1 1112 ? 39.284  27.682  64.089  1.00 15.98  ? 1112 TYR A CA  1 
ATOM 6621  C C   . TYR A 1 1112 ? 40.089  26.427  64.356  1.00 16.87  ? 1112 TYR A C   1 
ATOM 6622  O O   . TYR A 1 1112 ? 39.781  25.354  63.817  1.00 20.29  ? 1112 TYR A O   1 
ATOM 6623  C CB  . TYR A 1 1112 ? 40.023  28.617  63.128  1.00 13.43  ? 1112 TYR A CB  1 
ATOM 6624  H H   . TYR A 1 1112 ? 39.287  29.181  65.372  1.00 18.76  ? 1112 TYR A H   1 
ATOM 6625  H HA  . TYR A 1 1112 ? 38.448  27.421  63.672  1.00 19.18  ? 1112 TYR A HA  1 
ATOM 6626  N N   . LYS A 1 1113 ? 41.107  26.530  65.211  1.00 15.01  ? 1113 LYS A N   1 
ATOM 6627  C CA  . LYS A 1 1113 ? 41.917  25.345  65.484  1.00 18.72  ? 1113 LYS A CA  1 
ATOM 6628  C C   . LYS A 1 1113 ? 41.044  24.187  65.937  1.00 17.05  ? 1113 LYS A C   1 
ATOM 6629  O O   . LYS A 1 1113 ? 41.191  23.054  65.461  1.00 13.59  ? 1113 LYS A O   1 
ATOM 6630  C CB  . LYS A 1 1113 ? 42.971  25.658  66.547  1.00 25.03  ? 1113 LYS A CB  1 
ATOM 6631  H H   . LYS A 1 1113 ? 41.342  27.244  65.630  1.00 18.01  ? 1113 LYS A H   1 
ATOM 6632  H HA  . LYS A 1 1113 ? 42.376  25.079  64.672  1.00 22.46  ? 1113 LYS A HA  1 
ATOM 6633  N N   . GLN A 1 1114 ? 40.127  24.460  66.853  1.00 17.94  ? 1114 GLN A N   1 
ATOM 6634  C CA  . GLN A 1 1114 ? 39.223  23.422  67.302  1.00 16.44  ? 1114 GLN A CA  1 
ATOM 6635  C C   . GLN A 1 1114 ? 38.427  22.872  66.137  1.00 17.66  ? 1114 GLN A C   1 
ATOM 6636  O O   . GLN A 1 1114 ? 38.275  21.655  65.998  1.00 16.75  ? 1114 GLN A O   1 
ATOM 6637  C CB  . GLN A 1 1114 ? 38.295  23.983  68.375  1.00 22.05  ? 1114 GLN A CB  1 
ATOM 6638  H H   . GLN A 1 1114 ? 40.010  25.227  67.224  1.00 21.53  ? 1114 GLN A H   1 
ATOM 6639  H HA  . GLN A 1 1114 ? 39.736  22.696  67.691  1.00 19.73  ? 1114 GLN A HA  1 
ATOM 6640  N N   . ILE A 1 1115 ? 37.940  23.762  65.274  1.00 21.23  ? 1115 ILE A N   1 
ATOM 6641  C CA  . ILE A 1 1115 ? 37.071  23.396  64.156  1.00 35.08  ? 1115 ILE A CA  1 
ATOM 6642  C C   . ILE A 1 1115 ? 37.878  22.613  63.118  1.00 41.87  ? 1115 ILE A C   1 
ATOM 6643  O O   . ILE A 1 1115 ? 37.323  22.098  62.131  1.00 63.17  ? 1115 ILE A O   1 
ATOM 6644  C CB  . ILE A 1 1115 ? 36.415  24.646  63.540  1.00 29.44  ? 1115 ILE A CB  1 
ATOM 6645  H H   . ILE A 1 1115 ? 38.103  24.605  65.316  1.00 25.48  ? 1115 ILE A H   1 
ATOM 6646  H HA  . ILE A 1 1115 ? 36.364  22.817  64.483  1.00 42.09  ? 1115 ILE A HA  1 
ATOM 6647  N N   . LYS A 1 1116 ? 39.194  22.487  63.344  1.00 31.32  ? 1116 LYS A N   1 
ATOM 6648  C CA  . LYS A 1 1116 ? 40.060  21.882  62.336  1.00 31.42  ? 1116 LYS A CA  1 
ATOM 6649  C C   . LYS A 1 1116 ? 39.817  20.380  62.191  1.00 24.85  ? 1116 LYS A C   1 
ATOM 6650  O O   . LYS A 1 1116 ? 39.855  19.845  61.075  1.00 27.43  ? 1116 LYS A O   1 
ATOM 6651  C CB  . LYS A 1 1116 ? 41.528  22.149  62.676  1.00 29.37  ? 1116 LYS A CB  1 
ATOM 6652  H HA  . LYS A 1 1116 ? 39.875  22.295  61.478  1.00 37.71  ? 1116 LYS A HA  1 
ATOM 6653  N N   . GLN A 1 1117 ? 39.594  19.675  63.302  1.00 19.46  ? 1117 GLN A N   1 
ATOM 6654  C CA  . GLN A 1 1117 ? 39.306  18.247  63.205  1.00 20.11  ? 1117 GLN A CA  1 
ATOM 6655  C C   . GLN A 1 1117 ? 38.061  17.996  62.371  1.00 21.70  ? 1117 GLN A C   1 
ATOM 6656  O O   . GLN A 1 1117 ? 37.993  17.021  61.614  1.00 20.02  ? 1117 GLN A O   1 
ATOM 6657  C CB  . GLN A 1 1117 ? 39.124  17.644  64.595  1.00 20.50  ? 1117 GLN A CB  1 
ATOM 6658  H HA  . GLN A 1 1117 ? 40.053  17.800  62.776  1.00 24.13  ? 1117 GLN A HA  1 
ATOM 6659  N N   . ASP A 1 1118 ? 37.070  18.866  62.498  1.00 26.49  ? 1118 ASP A N   1 
ATOM 6660  C CA  . ASP A 1 1118 ? 35.770  18.694  61.871  1.00 23.11  ? 1118 ASP A CA  1 
ATOM 6661  C C   . ASP A 1 1118 ? 35.621  19.443  60.558  1.00 20.09  ? 1118 ASP A C   1 
ATOM 6662  O O   . ASP A 1 1118 ? 34.509  19.517  60.048  1.00 15.80  ? 1118 ASP A O   1 
ATOM 6663  C CB  . ASP A 1 1118 ? 34.665  19.154  62.827  1.00 28.11  ? 1118 ASP A CB  1 
ATOM 6664  H HA  . ASP A 1 1118 ? 35.633  17.751  61.690  1.00 27.73  ? 1118 ASP A HA  1 
ATOM 6665  N N   . LEU A 1 1119 ? 36.676  20.045  60.014  1.00 20.35  ? 1119 LEU A N   1 
ATOM 6666  C CA  . LEU A 1 1119 ? 36.525  20.640  58.691  1.00 18.56  ? 1119 LEU A CA  1 
ATOM 6667  C C   . LEU A 1 1119 ? 35.996  19.602  57.703  1.00 16.10  ? 1119 LEU A C   1 
ATOM 6668  O O   . LEU A 1 1119 ? 34.921  19.780  57.122  1.00 14.00  ? 1119 LEU A O   1 
ATOM 6669  C CB  . LEU A 1 1119 ? 37.857  21.238  58.221  1.00 20.32  ? 1119 LEU A CB  1 
ATOM 6670  H HA  . LEU A 1 1119 ? 35.877  21.360  58.742  1.00 22.27  ? 1119 LEU A HA  1 
ATOM 6671  N N   . ASP A 1 1120 ? 36.723  18.491  57.536  1.00 19.89  ? 1120 ASP A N   1 
ATOM 6672  C CA  . ASP A 1 1120 ? 36.331  17.475  56.562  1.00 18.74  ? 1120 ASP A CA  1 
ATOM 6673  C C   . ASP A 1 1120 ? 34.919  16.988  56.839  1.00 17.85  ? 1120 ASP A C   1 
ATOM 6674  O O   . ASP A 1 1120 ? 34.087  16.892  55.926  1.00 18.53  ? 1120 ASP A O   1 
ATOM 6675  C CB  . ASP A 1 1120 ? 37.322  16.303  56.595  1.00 10.43  ? 1120 ASP A CB  1 
ATOM 6676  H H   . ASP A 1 1120 ? 37.440  18.306  57.972  1.00 23.87  ? 1120 ASP A H   1 
ATOM 6677  H HA  . ASP A 1 1120 ? 36.349  17.862  55.672  1.00 22.49  ? 1120 ASP A HA  1 
ATOM 6678  N N   . GLN A 1 1121 ? 34.630  16.691  58.103  1.00 16.23  ? 1121 GLN A N   1 
ATOM 6679  C CA  . GLN A 1 1121 ? 33.287  16.286  58.471  1.00 17.36  ? 1121 GLN A CA  1 
ATOM 6680  C C   . GLN A 1 1121 ? 32.280  17.389  58.185  1.00 19.40  ? 1121 GLN A C   1 
ATOM 6681  O O   . GLN A 1 1121 ? 31.122  17.098  57.875  1.00 22.41  ? 1121 GLN A O   1 
ATOM 6682  C CB  . GLN A 1 1121 ? 33.247  15.912  59.949  1.00 14.21  ? 1121 GLN A CB  1 
ATOM 6683  H H   . GLN A 1 1121 ? 35.189  16.718  58.756  1.00 19.48  ? 1121 GLN A H   1 
ATOM 6684  H HA  . GLN A 1 1121 ? 33.037  15.505  57.954  1.00 20.83  ? 1121 GLN A HA  1 
ATOM 6685  N N   . LEU A 1 1122 ? 32.703  18.651  58.285  1.00 16.68  ? 1122 LEU A N   1 
ATOM 6686  C CA  . LEU A 1 1122 ? 31.822  19.790  58.083  1.00 16.19  ? 1122 LEU A CA  1 
ATOM 6687  C C   . LEU A 1 1122 ? 31.548  19.983  56.610  1.00 19.12  ? 1122 LEU A C   1 
ATOM 6688  O O   . LEU A 1 1122 ? 30.537  20.585  56.223  1.00 23.21  ? 1122 LEU A O   1 
ATOM 6689  C CB  . LEU A 1 1122 ? 32.458  21.046  58.673  1.00 14.33  ? 1122 LEU A CB  1 
ATOM 6690  H H   . LEU A 1 1122 ? 33.513  18.871  58.473  1.00 20.02  ? 1122 LEU A H   1 
ATOM 6691  H HA  . LEU A 1 1122 ? 30.978  19.632  58.535  1.00 19.43  ? 1122 LEU A HA  1 
ATOM 6692  N N   . ARG A 1 1123 ? 32.466  19.489  55.788  1.00 18.08  ? 1123 ARG A N   1 
ATOM 6693  C CA  . ARG A 1 1123 ? 32.243  19.378  54.363  1.00 28.29  ? 1123 ARG A CA  1 
ATOM 6694  C C   . ARG A 1 1123 ? 31.282  18.236  54.013  1.00 36.54  ? 1123 ARG A C   1 
ATOM 6695  O O   . ARG A 1 1123 ? 30.517  18.354  53.055  1.00 44.39  ? 1123 ARG A O   1 
ATOM 6696  C CB  . ARG A 1 1123 ? 33.588  19.189  53.662  1.00 21.34  ? 1123 ARG A CB  1 
ATOM 6697  H H   . ARG A 1 1123 ? 33.238  19.209  56.041  1.00 21.69  ? 1123 ARG A H   1 
ATOM 6698  H HA  . ARG A 1 1123 ? 31.853  20.205  54.040  1.00 33.95  ? 1123 ARG A HA  1 
ATOM 6699  N N   . SER A 1 1124 ? 31.332  17.097  54.719  1.00 33.95  ? 1124 SER A N   1 
ATOM 6700  C CA  . SER A 1 1124 ? 30.366  16.034  54.412  1.00 26.96  ? 1124 SER A CA  1 
ATOM 6701  C C   . SER A 1 1124 ? 28.954  16.405  54.871  1.00 24.31  ? 1124 SER A C   1 
ATOM 6702  O O   . SER A 1 1124 ? 27.980  16.164  54.148  1.00 20.17  ? 1124 SER A O   1 
ATOM 6703  C CB  . SER A 1 1124 ? 30.793  14.709  55.049  1.00 22.63  ? 1124 SER A CB  1 
ATOM 6704  H H   . SER A 1 1124 ? 31.887  16.922  55.352  1.00 40.73  ? 1124 SER A H   1 
ATOM 6705  H HA  . SER A 1 1124 ? 30.340  15.905  53.451  1.00 32.35  ? 1124 SER A HA  1 
ATOM 6706  N N   . ILE A 1 1125 ? 28.827  16.958  56.085  1.00 31.14  ? 1125 ILE A N   1 
ATOM 6707  C CA  . ILE A 1 1125 ? 27.553  17.477  56.577  1.00 31.63  ? 1125 ILE A CA  1 
ATOM 6708  C C   . ILE A 1 1125 ? 27.103  18.683  55.760  1.00 23.87  ? 1125 ILE A C   1 
ATOM 6709  O O   . ILE A 1 1125 ? 25.902  18.973  55.681  1.00 25.40  ? 1125 ILE A O   1 
ATOM 6710  C CB  . ILE A 1 1125 ? 27.659  17.826  58.080  1.00 35.03  ? 1125 ILE A CB  1 
ATOM 6711  H H   . ILE A 1 1125 ? 29.474  17.044  56.644  1.00 37.37  ? 1125 ILE A H   1 
ATOM 6712  H HA  . ILE A 1 1125 ? 26.879  16.786  56.481  1.00 37.95  ? 1125 ILE A HA  1 
ATOM 6713  N N   . VAL A 1 1126 ? 28.040  19.433  55.175  1.00 23.12  ? 1126 VAL A N   1 
ATOM 6714  C CA  . VAL A 1 1126 ? 27.647  20.379  54.142  1.00 19.48  ? 1126 VAL A CA  1 
ATOM 6715  C C   . VAL A 1 1126 ? 27.118  19.620  52.932  1.00 21.72  ? 1126 VAL A C   1 
ATOM 6716  O O   . VAL A 1 1126 ? 25.988  19.837  52.497  1.00 23.39  ? 1126 VAL A O   1 
ATOM 6717  C CB  . VAL A 1 1126 ? 28.821  21.308  53.778  1.00 18.41  ? 1126 VAL A CB  1 
ATOM 6718  H H   . VAL A 1 1126 ? 28.881  19.413  55.354  1.00 27.74  ? 1126 VAL A H   1 
ATOM 6719  H HA  . VAL A 1 1126 ? 26.926  20.932  54.482  1.00 23.37  ? 1126 VAL A HA  1 
ATOM 6720  N N   . GLU A 1 1127 ? 27.896  18.667  52.416  1.00 23.30  ? 1127 GLU A N   1 
ATOM 6721  C CA  . GLU A 1 1127 ? 27.524  17.959  51.197  1.00 27.05  ? 1127 GLU A CA  1 
ATOM 6722  C C   . GLU A 1 1127 ? 26.098  17.426  51.283  1.00 39.08  ? 1127 GLU A C   1 
ATOM 6723  O O   . GLU A 1 1127 ? 25.270  17.707  50.415  1.00 57.44  ? 1127 GLU A O   1 
ATOM 6724  C CB  . GLU A 1 1127 ? 28.520  16.825  50.926  1.00 23.29  ? 1127 GLU A CB  1 
ATOM 6725  H H   . GLU A 1 1127 ? 28.645  18.414  52.755  1.00 27.96  ? 1127 GLU A H   1 
ATOM 6726  H HA  . GLU A 1 1127 ? 27.566  18.577  50.450  1.00 32.46  ? 1127 GLU A HA  1 
ATOM 6727  N N   . LYS A 1 1128 ? 25.772  16.670  52.328  1.00 40.82  ? 1128 LYS A N   1 
ATOM 6728  C CA  . LYS A 1 1128 ? 24.381  16.249  52.483  1.00 38.43  ? 1128 LYS A CA  1 
ATOM 6729  C C   . LYS A 1 1128 ? 23.482  17.436  52.822  1.00 43.67  ? 1128 LYS A C   1 
ATOM 6730  O O   . LYS A 1 1128 ? 22.408  17.592  52.228  1.00 36.18  ? 1128 LYS A O   1 
ATOM 6731  C CB  . LYS A 1 1128 ? 24.277  15.162  53.553  1.00 45.72  ? 1128 LYS A CB  1 
ATOM 6732  H H   . LYS A 1 1128 ? 26.311  16.397  52.939  1.00 48.99  ? 1128 LYS A H   1 
ATOM 6733  H HA  . LYS A 1 1128 ? 24.072  15.872  51.644  1.00 46.12  ? 1128 LYS A HA  1 
ATOM 6734  N N   . SER A 1 1129 ? 23.905  18.275  53.781  1.00 37.82  ? 1129 SER A N   1 
ATOM 6735  C CA  . SER A 1 1129 ? 23.186  19.498  54.150  1.00 34.23  ? 1129 SER A CA  1 
ATOM 6736  C C   . SER A 1 1129 ? 23.434  20.639  53.151  1.00 32.50  ? 1129 SER A C   1 
ATOM 6737  O O   . SER A 1 1129 ? 22.507  21.104  52.480  1.00 40.89  ? 1129 SER A O   1 
ATOM 6738  C CB  . SER A 1 1129 ? 23.593  19.922  55.566  1.00 22.82  ? 1129 SER A CB  1 
ATOM 6739  H H   . SER A 1 1129 ? 24.622  18.151  54.239  1.00 45.38  ? 1129 SER A H   1 
ATOM 6740  H HA  . SER A 1 1129 ? 22.234  19.311  54.157  1.00 41.08  ? 1129 SER A HA  1 
ATOM 6741  N N   . GLU A 1 1130 ? 24.671  21.123  53.063  1.00 25.00  ? 1130 GLU A N   1 
ATOM 6742  C CA  . GLU A 1 1130 ? 24.981  22.224  52.151  1.00 25.81  ? 1130 GLU A CA  1 
ATOM 6743  C C   . GLU A 1 1130 ? 24.566  21.942  50.699  1.00 33.68  ? 1130 GLU A C   1 
ATOM 6744  O O   . GLU A 1 1130 ? 24.320  22.886  49.941  1.00 39.19  ? 1130 GLU A O   1 
ATOM 6745  C CB  . GLU A 1 1130 ? 26.475  22.565  52.216  1.00 20.00  ? 1130 GLU A CB  1 
ATOM 6746  H H   . GLU A 1 1130 ? 25.344  20.835  53.516  1.00 30.00  ? 1130 GLU A H   1 
ATOM 6747  H HA  . GLU A 1 1130 ? 24.492  23.009  52.444  1.00 30.97  ? 1130 GLU A HA  1 
ATOM 6748  N N   . LEU A 1 1131 ? 24.481  20.675  50.277  1.00 38.46  ? 1131 LEU A N   1 
ATOM 6749  C CA  . LEU A 1 1131 ? 24.071  20.413  48.893  1.00 42.58  ? 1131 LEU A CA  1 
ATOM 6750  C C   . LEU A 1 1131 ? 22.672  20.945  48.638  1.00 38.76  ? 1131 LEU A C   1 
ATOM 6751  O O   . LEU A 1 1131 ? 22.436  21.676  47.668  1.00 36.90  ? 1131 LEU A O   1 
ATOM 6752  C CB  . LEU A 1 1131 ? 24.108  18.920  48.563  1.00 55.74  ? 1131 LEU A CB  1 
ATOM 6753  H HA  . LEU A 1 1131 ? 24.680  20.869  48.291  1.00 51.10  ? 1131 LEU A HA  1 
ATOM 6754  N N   . TRP A 1 1132 ? 21.732  20.578  49.504  1.00 50.08  ? 1132 TRP A N   1 
ATOM 6755  C CA  . TRP A 1 1132 ? 20.368  21.079  49.446  1.00 68.70  ? 1132 TRP A CA  1 
ATOM 6756  C C   . TRP A 1 1132 ? 20.049  21.988  50.633  1.00 86.23  ? 1132 TRP A C   1 
ATOM 6757  O O   . TRP A 1 1132 ? 19.832  23.185  50.422  1.00 99.80  ? 1132 TRP A O   1 
ATOM 6758  C CB  . TRP A 1 1132 ? 19.382  19.898  49.360  1.00 73.62  ? 1132 TRP A CB  1 
ATOM 6759  H H   . TRP A 1 1132 ? 21.866  20.025  50.149  1.00 60.10  ? 1132 TRP A H   1 
ATOM 6760  H HA  . TRP A 1 1132 ? 20.266  21.606  48.638  1.00 82.44  ? 1132 TRP A HA  1 
ATOM 6761  N N   . VAL A 1 1133 ? 20.090  21.474  51.879  1.00 88.29  ? 1133 VAL A N   1 
ATOM 6762  C CA  . VAL A 1 1133 ? 19.607  22.132  53.109  1.00 75.98  ? 1133 VAL A CA  1 
ATOM 6763  C C   . VAL A 1 1133 ? 18.988  23.506  52.850  1.00 83.15  ? 1133 VAL A C   1 
ATOM 6764  O O   . VAL A 1 1133 ? 17.895  23.601  52.275  1.00 110.61 ? 1133 VAL A O   1 
ATOM 6765  C CB  . VAL A 1 1133 ? 20.725  22.253  54.169  1.00 42.84  ? 1133 VAL A CB  1 
ATOM 6766  H H   . VAL A 1 1133 ? 20.416  20.695  52.041  1.00 105.95 ? 1133 VAL A H   1 
ATOM 6767  H HA  . VAL A 1 1133 ? 18.911  21.575  53.492  1.00 91.17  ? 1133 VAL A HA  1 
ATOM 6768  N N   . TYR A 1 1134 ? 19.667  24.572  53.298  1.00 68.53  ? 1134 TYR A N   1 
ATOM 6769  C CA  . TYR A 1 1134 ? 19.212  25.959  53.087  1.00 58.08  ? 1134 TYR A CA  1 
ATOM 6770  C C   . TYR A 1 1134 ? 19.743  26.541  51.767  1.00 31.05  ? 1134 TYR A C   1 
ATOM 6771  O O   . TYR A 1 1134 ? 20.856  27.071  51.696  1.00 16.86  ? 1134 TYR A O   1 
ATOM 6772  C CB  . TYR A 1 1134 ? 19.645  26.864  54.248  1.00 44.63  ? 1134 TYR A CB  1 
ATOM 6773  H HA  . TYR A 1 1134 ? 18.243  25.969  53.048  1.00 69.69  ? 1134 TYR A HA  1 
ATOM 6774  N N   . VAL A 1 1176 ? 14.345  23.110  57.512  1.00 8.94   ? 1176 VAL A N   1 
ATOM 6775  C CA  . VAL A 1 1176 ? 15.210  22.211  58.254  1.00 12.47  ? 1176 VAL A CA  1 
ATOM 6776  C C   . VAL A 1 1176 ? 16.619  22.401  57.730  1.00 18.35  ? 1176 VAL A C   1 
ATOM 6777  O O   . VAL A 1 1176 ? 17.384  21.447  57.567  1.00 25.71  ? 1176 VAL A O   1 
ATOM 6778  C CB  . VAL A 1 1176 ? 14.748  20.767  58.126  1.00 10.34  ? 1176 VAL A CB  1 
ATOM 6779  H H   . VAL A 1 1176 ? 14.434  23.938  57.727  1.00 10.73  ? 1176 VAL A H   1 
ATOM 6780  H HA  . VAL A 1 1176 ? 15.197  22.454  59.193  1.00 14.96  ? 1176 VAL A HA  1 
ATOM 6781  N N   . LYS A 1 1177 ? 16.968  23.667  57.512  1.00 21.49  ? 1177 LYS A N   1 
ATOM 6782  C CA  . LYS A 1 1177 ? 18.044  24.035  56.609  1.00 32.29  ? 1177 LYS A CA  1 
ATOM 6783  C C   . LYS A 1 1177 ? 19.131  24.892  57.258  1.00 25.33  ? 1177 LYS A C   1 
ATOM 6784  O O   . LYS A 1 1177 ? 19.939  25.494  56.549  1.00 29.25  ? 1177 LYS A O   1 
ATOM 6785  C CB  . LYS A 1 1177 ? 17.429  24.758  55.412  1.00 35.63  ? 1177 LYS A CB  1 
ATOM 6786  H H   . LYS A 1 1177 ? 16.586  24.341  57.885  1.00 25.79  ? 1177 LYS A H   1 
ATOM 6787  H HA  . LYS A 1 1177 ? 18.465  23.225  56.281  1.00 38.75  ? 1177 LYS A HA  1 
ATOM 6788  N N   . GLU A 1 1178 ? 19.214  24.928  58.589  1.00 19.61  ? 1178 GLU A N   1 
ATOM 6789  C CA  . GLU A 1 1178 ? 20.225  25.776  59.200  1.00 16.78  ? 1178 GLU A CA  1 
ATOM 6790  C C   . GLU A 1 1178 ? 21.596  25.493  58.618  1.00 17.46  ? 1178 GLU A C   1 
ATOM 6791  O O   . GLU A 1 1178 ? 22.353  26.428  58.382  1.00 16.80  ? 1178 GLU A O   1 
ATOM 6792  C CB  . GLU A 1 1178 ? 20.234  25.582  60.711  1.00 17.62  ? 1178 GLU A CB  1 
ATOM 6793  H H   . GLU A 1 1178 ? 18.718  24.489  59.137  1.00 23.53  ? 1178 GLU A H   1 
ATOM 6794  H HA  . GLU A 1 1178 ? 20.009  26.704  59.019  1.00 20.14  ? 1178 GLU A HA  1 
ATOM 6795  N N   . ILE A 1 1179 ? 21.904  24.231  58.296  1.00 17.10  ? 1179 ILE A N   1 
ATOM 6796  C CA  . ILE A 1 1179 ? 23.277  23.866  57.974  1.00 16.46  ? 1179 ILE A CA  1 
ATOM 6797  C C   . ILE A 1 1179 ? 23.796  24.623  56.756  1.00 22.19  ? 1179 ILE A C   1 
ATOM 6798  O O   . ILE A 1 1179 ? 25.010  24.814  56.623  1.00 29.45  ? 1179 ILE A O   1 
ATOM 6799  C CB  . ILE A 1 1179 ? 23.389  22.340  57.777  1.00 13.55  ? 1179 ILE A CB  1 
ATOM 6800  H H   . ILE A 1 1179 ? 21.342  23.581  58.259  1.00 20.52  ? 1179 ILE A H   1 
ATOM 6801  H HA  . ILE A 1 1179 ? 23.841  24.104  58.726  1.00 19.75  ? 1179 ILE A HA  1 
ATOM 6802  N N   . LEU A 1 1180 ? 22.915  25.057  55.850  1.00 20.99  ? 1180 LEU A N   1 
ATOM 6803  C CA  . LEU A 1 1180 ? 23.372  25.804  54.679  1.00 20.82  ? 1180 LEU A CA  1 
ATOM 6804  C C   . LEU A 1 1180 ? 23.648  27.261  55.012  1.00 16.48  ? 1180 LEU A C   1 
ATOM 6805  O O   . LEU A 1 1180 ? 24.725  27.788  54.706  1.00 16.65  ? 1180 LEU A O   1 
ATOM 6806  C CB  . LEU A 1 1180 ? 22.341  25.706  53.559  1.00 25.08  ? 1180 LEU A CB  1 
ATOM 6807  H H   . LEU A 1 1180 ? 22.064  24.935  55.890  1.00 25.19  ? 1180 LEU A H   1 
ATOM 6808  H HA  . LEU A 1 1180 ? 24.199  25.409  54.359  1.00 24.98  ? 1180 LEU A HA  1 
ATOM 6809  N N   . ILE A 1 1181 ? 22.684  27.936  55.617  1.00 13.06  ? 1181 ILE A N   1 
ATOM 6810  C CA  . ILE A 1 1181 ? 22.937  29.295  56.054  1.00 14.85  ? 1181 ILE A CA  1 
ATOM 6811  C C   . ILE A 1 1181 ? 24.163  29.308  56.951  1.00 20.39  ? 1181 ILE A C   1 
ATOM 6812  O O   . ILE A 1 1181 ? 25.122  30.049  56.711  1.00 25.48  ? 1181 ILE A O   1 
ATOM 6813  C CB  . ILE A 1 1181 ? 21.697  29.863  56.766  1.00 14.95  ? 1181 ILE A CB  1 
ATOM 6814  H H   . ILE A 1 1181 ? 21.895  27.639  55.784  1.00 15.67  ? 1181 ILE A H   1 
ATOM 6815  H HA  . ILE A 1 1181 ? 23.122  29.850  55.280  1.00 17.82  ? 1181 ILE A HA  1 
ATOM 6816  N N   . ARG A 1 1182 ? 24.179  28.426  57.951  1.00 20.09  ? 1182 ARG A N   1 
ATOM 6817  C CA  . ARG A 1 1182 ? 25.252  28.387  58.936  1.00 25.19  ? 1182 ARG A CA  1 
ATOM 6818  C C   . ARG A 1 1182 ? 26.584  28.084  58.281  1.00 19.75  ? 1182 ARG A C   1 
ATOM 6819  O O   . ARG A 1 1182 ? 27.597  28.718  58.596  1.00 18.50  ? 1182 ARG A O   1 
ATOM 6820  C CB  . ARG A 1 1182 ? 24.935  27.327  59.990  1.00 34.26  ? 1182 ARG A CB  1 
ATOM 6821  H H   . ARG A 1 1182 ? 23.570  27.833  58.079  1.00 24.11  ? 1182 ARG A H   1 
ATOM 6822  H HA  . ARG A 1 1182 ? 25.317  29.248  59.377  1.00 30.22  ? 1182 ARG A HA  1 
ATOM 6823  N N   . LEU A 1 1183 ? 26.606  27.098  57.390  1.00 21.13  ? 1183 LEU A N   1 
ATOM 6824  C CA  . LEU A 1 1183 ? 27.819  26.839  56.640  1.00 27.41  ? 1183 LEU A CA  1 
ATOM 6825  C C   . LEU A 1 1183 ? 28.276  28.103  55.932  1.00 31.11  ? 1183 LEU A C   1 
ATOM 6826  O O   . LEU A 1 1183 ? 29.480  28.349  55.816  1.00 40.13  ? 1183 LEU A O   1 
ATOM 6827  C CB  . LEU A 1 1183 ? 27.584  25.701  55.644  1.00 36.54  ? 1183 LEU A CB  1 
ATOM 6828  H H   . LEU A 1 1183 ? 25.946  26.579  57.206  1.00 25.36  ? 1183 LEU A H   1 
ATOM 6829  H HA  . LEU A 1 1183 ? 28.519  26.565  57.253  1.00 32.89  ? 1183 LEU A HA  1 
ATOM 6830  N N   . SER A 1 1184 ? 27.329  28.925  55.464  1.00 27.53  ? 1184 SER A N   1 
ATOM 6831  C CA  . SER A 1 1184 ? 27.686  30.187  54.820  1.00 36.60  ? 1184 SER A CA  1 
ATOM 6832  C C   . SER A 1 1184 ? 28.346  31.156  55.804  1.00 26.89  ? 1184 SER A C   1 
ATOM 6833  O O   . SER A 1 1184 ? 29.408  31.732  55.518  1.00 22.77  ? 1184 SER A O   1 
ATOM 6834  C CB  . SER A 1 1184 ? 26.434  30.810  54.194  1.00 33.22  ? 1184 SER A CB  1 
ATOM 6835  H H   . SER A 1 1184 ? 26.483  28.774  55.508  1.00 33.04  ? 1184 SER A H   1 
ATOM 6836  H HA  . SER A 1 1184 ? 28.319  30.009  54.107  1.00 43.92  ? 1184 SER A HA  1 
ATOM 6837  N N   . LYS A 1 1185 ? 27.725  31.360  56.966  1.00 21.34  ? 1185 LYS A N   1 
ATOM 6838  C CA  . LYS A 1 1185 ? 28.355  32.194  57.970  1.00 16.92  ? 1185 LYS A CA  1 
ATOM 6839  C C   . LYS A 1 1185 ? 29.768  31.710  58.200  1.00 22.38  ? 1185 LYS A C   1 
ATOM 6840  O O   . LYS A 1 1185 ? 30.708  32.513  58.232  1.00 26.48  ? 1185 LYS A O   1 
ATOM 6841  C CB  . LYS A 1 1185 ? 27.556  32.143  59.267  1.00 16.11  ? 1185 LYS A CB  1 
ATOM 6842  H H   . LYS A 1 1185 ? 26.960  31.035  57.187  1.00 25.61  ? 1185 LYS A H   1 
ATOM 6843  H HA  . LYS A 1 1185 ? 28.387  33.112  57.660  1.00 20.30  ? 1185 LYS A HA  1 
ATOM 6844  N N   . LEU A 1 1186 ? 29.930  30.382  58.279  1.00 27.44  ? 1186 LEU A N   1 
ATOM 6845  C CA  . LEU A 1 1186 ? 31.201  29.740  58.603  1.00 38.93  ? 1186 LEU A CA  1 
ATOM 6846  C C   . LEU A 1 1186 ? 32.250  29.897  57.499  1.00 40.84  ? 1186 LEU A C   1 
ATOM 6847  O O   . LEU A 1 1186 ? 33.457  29.967  57.773  1.00 38.44  ? 1186 LEU A O   1 
ATOM 6848  C CB  . LEU A 1 1186 ? 30.956  28.255  58.871  1.00 48.03  ? 1186 LEU A CB  1 
ATOM 6849  H H   . LEU A 1 1186 ? 29.293  29.819  58.143  1.00 32.93  ? 1186 LEU A H   1 
ATOM 6850  H HA  . LEU A 1 1186 ? 31.558  30.137  59.413  1.00 46.72  ? 1186 LEU A HA  1 
ATOM 6851  N N   . CYS A 1 1187 ? 31.825  29.892  56.248  1.00 32.58  ? 1187 CYS A N   1 
ATOM 6852  C CA  . CYS A 1 1187 ? 32.783  30.113  55.183  1.00 26.27  ? 1187 CYS A CA  1 
ATOM 6853  C C   . CYS A 1 1187 ? 33.190  31.579  55.124  1.00 26.50  ? 1187 CYS A C   1 
ATOM 6854  O O   . CYS A 1 1187 ? 34.338  31.893  54.804  1.00 28.59  ? 1187 CYS A O   1 
ATOM 6855  C CB  . CYS A 1 1187 ? 32.195  29.646  53.857  1.00 33.14  ? 1187 CYS A CB  1 
ATOM 6856  H H   . CYS A 1 1187 ? 31.013  29.768  55.994  1.00 39.10  ? 1187 CYS A H   1 
ATOM 6857  H HA  . CYS A 1 1187 ? 33.579  29.587  55.360  1.00 31.53  ? 1187 CYS A HA  1 
ATOM 6858  N N   . VAL A 1 1188 ? 32.270  32.494  55.452  1.00 23.58  ? 1188 VAL A N   1 
ATOM 6859  C CA  . VAL A 1 1188 ? 32.595  33.915  55.401  1.00 25.76  ? 1188 VAL A CA  1 
ATOM 6860  C C   . VAL A 1 1188 ? 33.579  34.282  56.507  1.00 33.54  ? 1188 VAL A C   1 
ATOM 6861  O O   . VAL A 1 1188 ? 34.555  35.003  56.268  1.00 33.33  ? 1188 VAL A O   1 
ATOM 6862  C CB  . VAL A 1 1188 ? 31.313  34.761  55.486  1.00 21.84  ? 1188 VAL A CB  1 
ATOM 6863  H H   . VAL A 1 1188 ? 31.466  32.318  55.703  1.00 28.30  ? 1188 VAL A H   1 
ATOM 6864  H HA  . VAL A 1 1188 ? 33.020  34.107  54.551  1.00 30.92  ? 1188 VAL A HA  1 
ATOM 6865  N N   . GLN A 1 1189 ? 33.331  33.810  57.734  1.00 49.08  ? 1189 GLN A N   1 
ATOM 6866  C CA  . GLN A 1 1189 ? 34.267  34.052  58.838  1.00 52.56  ? 1189 GLN A CA  1 
ATOM 6867  C C   . GLN A 1 1189 ? 35.588  33.294  58.644  1.00 33.85  ? 1189 GLN A C   1 
ATOM 6868  O O   . GLN A 1 1189 ? 36.667  33.843  58.906  1.00 29.35  ? 1189 GLN A O   1 
ATOM 6869  C CB  . GLN A 1 1189 ? 33.611  33.662  60.165  1.00 65.66  ? 1189 GLN A CB  1 
ATOM 6870  H H   . GLN A 1 1189 ? 32.636  33.353  57.952  1.00 58.90  ? 1189 GLN A H   1 
ATOM 6871  H HA  . GLN A 1 1189 ? 34.471  34.999  58.874  1.00 63.07  ? 1189 GLN A HA  1 
ATOM 6872  N N   . GLU A 1 1190 ? 35.522  32.026  58.209  1.00 31.24  ? 1190 GLU A N   1 
ATOM 6873  C CA  . GLU A 1 1190 ? 36.735  31.243  58.029  1.00 25.88  ? 1190 GLU A CA  1 
ATOM 6874  C C   . GLU A 1 1190 ? 37.574  31.805  56.903  1.00 30.50  ? 1190 GLU A C   1 
ATOM 6875  O O   . GLU A 1 1190 ? 38.807  31.714  56.937  1.00 34.23  ? 1190 GLU A O   1 
ATOM 6876  C CB  . GLU A 1 1190 ? 36.380  29.780  57.743  1.00 23.84  ? 1190 GLU A CB  1 
ATOM 6877  H H   . GLU A 1 1190 ? 34.795  31.610  58.015  1.00 37.49  ? 1190 GLU A H   1 
ATOM 6878  H HA  . GLU A 1 1190 ? 37.260  31.274  58.844  1.00 31.05  ? 1190 GLU A HA  1 
ATOM 6879  N N   . SER A 1 1191 ? 36.913  32.398  55.909  1.00 33.42  ? 1191 SER A N   1 
ATOM 6880  C CA  . SER A 1 1191 ? 37.608  32.929  54.747  1.00 46.44  ? 1191 SER A CA  1 
ATOM 6881  C C   . SER A 1 1191 ? 38.568  34.044  55.150  1.00 48.33  ? 1191 SER A C   1 
ATOM 6882  O O   . SER A 1 1191 ? 39.739  34.053  54.744  1.00 45.04  ? 1191 SER A O   1 
ATOM 6883  C CB  . SER A 1 1191 ? 36.582  33.425  53.722  1.00 44.34  ? 1191 SER A CB  1 
ATOM 6884  H H   . SER A 1 1191 ? 36.060  32.504  55.887  1.00 40.10  ? 1191 SER A H   1 
ATOM 6885  H HA  . SER A 1 1191 ? 38.126  32.219  54.335  1.00 55.73  ? 1191 SER A HA  1 
ATOM 6886  N N   . ALA A 1 1192 ? 38.087  34.990  55.954  1.00 48.62  ? 1192 ALA A N   1 
ATOM 6887  C CA  . ALA A 1 1192 ? 38.916  36.055  56.523  1.00 44.72  ? 1192 ALA A CA  1 
ATOM 6888  C C   . ALA A 1 1192 ? 39.517  35.624  57.858  1.00 37.47  ? 1192 ALA A C   1 
ATOM 6889  O O   . ALA A 1 1192 ? 39.544  36.368  58.843  1.00 34.29  ? 1192 ALA A O   1 
ATOM 6890  C CB  . ALA A 1 1192 ? 38.091  37.324  56.680  1.00 49.63  ? 1192 ALA A CB  1 
ATOM 6891  H HA  . ALA A 1 1192 ? 39.646  36.246  55.914  1.00 53.67  ? 1192 ALA A HA  1 
ATOM 6892  H HB1 . ALA A 1 1192 ? 38.651  38.020  57.057  1.00 59.55  ? 1192 ALA A HB1 1 
ATOM 6893  H HB2 . ALA A 1 1192 ? 37.764  37.598  55.809  1.00 59.55  ? 1192 ALA A HB2 1 
ATOM 6894  H HB3 . ALA A 1 1192 ? 37.344  37.143  57.272  1.00 59.55  ? 1192 ALA A HB3 1 
ATOM 6895  N N   . SER A 1 1193 ? 40.000  34.376  57.869  1.00 38.31  ? 1193 SER A N   1 
ATOM 6896  C CA  . SER A 1 1193 ? 40.516  33.707  59.046  1.00 34.86  ? 1193 SER A CA  1 
ATOM 6897  C C   . SER A 1 1193 ? 41.822  33.028  58.641  1.00 36.81  ? 1193 SER A C   1 
ATOM 6898  O O   . SER A 1 1193 ? 41.891  31.804  58.519  1.00 35.72  ? 1193 SER A O   1 
ATOM 6899  C CB  . SER A 1 1193 ? 39.509  32.701  59.604  1.00 28.04  ? 1193 SER A CB  1 
ATOM 6900  H HA  . SER A 1 1193 ? 40.709  34.363  59.733  1.00 41.83  ? 1193 SER A HA  1 
ATOM 6901  N N   . VAL A 1 1194 ? 42.846  33.850  58.409  1.00 32.05  ? 1194 VAL A N   1 
ATOM 6902  C CA  . VAL A 1 1194 ? 44.190  33.381  58.088  1.00 43.83  ? 1194 VAL A CA  1 
ATOM 6903  C C   . VAL A 1 1194 ? 44.313  33.060  56.600  1.00 48.42  ? 1194 VAL A C   1 
ATOM 6904  O O   . VAL A 1 1194 ? 43.306  32.876  55.900  1.00 39.49  ? 1194 VAL A O   1 
ATOM 6905  C CB  . VAL A 1 1194 ? 44.562  32.154  58.937  1.00 55.56  ? 1194 VAL A CB  1 
ATOM 6906  H HA  . VAL A 1 1194 ? 44.824  34.086  58.293  1.00 52.59  ? 1194 VAL A HA  1 
ATOM 6907  N N   . ARG A 1 1195 ? 45.558  33.003  56.120  1.00 56.72  ? 1195 ARG A N   1 
ATOM 6908  C CA  . ARG A 1 1195 ? 45.854  32.539  54.771  1.00 61.18  ? 1195 ARG A CA  1 
ATOM 6909  C C   . ARG A 1 1195 ? 45.989  31.013  54.728  1.00 51.63  ? 1195 ARG A C   1 
ATOM 6910  O O   . ARG A 1 1195 ? 45.243  30.315  54.011  1.00 37.34  ? 1195 ARG A O   1 
ATOM 6911  C CB  . ARG A 1 1195 ? 47.147  33.209  54.287  1.00 66.34  ? 1195 ARG A CB  1 
ATOM 6912  H H   . ARG A 1 1195 ? 46.257  33.232  56.567  1.00 68.06  ? 1195 ARG A H   1 
ATOM 6913  H HA  . ARG A 1 1195 ? 45.133  32.800  54.176  1.00 73.42  ? 1195 ARG A HA  1 
ATOM 6914  N N   . LYS A 1 1196 ? 46.938  30.484  55.512  1.00 43.08  ? 1196 LYS A N   1 
ATOM 6915  C CA  . LYS A 1 1196 ? 47.251  29.067  55.449  1.00 30.38  ? 1196 LYS A CA  1 
ATOM 6916  C C   . LYS A 1 1196 ? 45.994  28.215  55.580  1.00 26.97  ? 1196 LYS A C   1 
ATOM 6917  O O   . LYS A 1 1196 ? 45.943  27.107  55.034  1.00 25.49  ? 1196 LYS A O   1 
ATOM 6918  C CB  . LYS A 1 1196 ? 48.274  28.722  56.537  1.00 23.36  ? 1196 LYS A CB  1 
ATOM 6919  H H   . LYS A 1 1196 ? 47.407  30.927  56.081  1.00 51.70  ? 1196 LYS A H   1 
ATOM 6920  H HA  . LYS A 1 1196 ? 47.654  28.872  54.589  1.00 36.46  ? 1196 LYS A HA  1 
ATOM 6921  N N   . SER A 1 1197 ? 44.957  28.728  56.260  1.00 28.14  ? 1197 SER A N   1 
ATOM 6922  C CA  . SER A 1 1197 ? 43.734  27.963  56.481  1.00 26.02  ? 1197 SER A CA  1 
ATOM 6923  C C   . SER A 1 1197 ? 42.877  27.879  55.226  1.00 23.42  ? 1197 SER A C   1 
ATOM 6924  O O   . SER A 1 1197 ? 42.281  26.834  54.943  1.00 32.62  ? 1197 SER A O   1 
ATOM 6925  C CB  . SER A 1 1197 ? 42.914  28.582  57.613  1.00 30.14  ? 1197 SER A CB  1 
ATOM 6926  H H   . SER A 1 1197 ? 44.944  29.518  56.602  1.00 33.76  ? 1197 SER A H   1 
ATOM 6927  H HA  . SER A 1 1197 ? 43.970  27.059  56.743  1.00 31.22  ? 1197 SER A HA  1 
ATOM 6928  N N   . ARG A 1 1198 ? 42.746  28.978  54.493  1.00 18.66  ? 1198 ARG A N   1 
ATOM 6929  C CA  . ARG A 1 1198 ? 42.027  28.901  53.241  1.00 16.65  ? 1198 ARG A CA  1 
ATOM 6930  C C   . ARG A 1 1198 ? 42.777  28.066  52.209  1.00 18.43  ? 1198 ARG A C   1 
ATOM 6931  O O   . ARG A 1 1198 ? 42.134  27.425  51.372  1.00 19.12  ? 1198 ARG A O   1 
ATOM 6932  C CB  . ARG A 1 1198 ? 41.760  30.309  52.721  1.00 14.23  ? 1198 ARG A CB  1 
ATOM 6933  H H   . ARG A 1 1198 ? 43.055  29.756  54.694  1.00 22.39  ? 1198 ARG A H   1 
ATOM 6934  H HA  . ARG A 1 1198 ? 41.169  28.476  53.399  1.00 19.98  ? 1198 ARG A HA  1 
ATOM 6935  N N   . LYS A 1 1199 ? 44.125  28.049  52.243  1.00 19.34  ? 1199 LYS A N   1 
ATOM 6936  C CA  . LYS A 1 1199 ? 44.881  27.221  51.287  1.00 19.08  ? 1199 LYS A CA  1 
ATOM 6937  C C   . LYS A 1 1199 ? 45.108  25.760  51.714  1.00 22.75  ? 1199 LYS A C   1 
ATOM 6938  O O   . LYS A 1 1199 ? 45.569  24.959  50.885  1.00 19.61  ? 1199 LYS A O   1 
ATOM 6939  C CB  . LYS A 1 1199 ? 46.253  27.834  51.019  1.00 17.15  ? 1199 LYS A CB  1 
ATOM 6940  H H   . LYS A 1 1199 ? 44.610  28.495  52.795  1.00 23.21  ? 1199 LYS A H   1 
ATOM 6941  H HA  . LYS A 1 1199 ? 44.398  27.206  50.446  1.00 22.90  ? 1199 LYS A HA  1 
ATOM 6942  N N   . GLN A 1 1200 ? 44.827  25.403  52.977  1.00 33.88  ? 1200 GLN A N   1 
ATOM 6943  C CA  . GLN A 1 1200 ? 45.160  24.088  53.551  1.00 37.07  ? 1200 GLN A CA  1 
ATOM 6944  C C   . GLN A 1 1200 ? 44.085  23.012  53.373  1.00 26.91  ? 1200 GLN A C   1 
ATOM 6945  O O   . GLN A 1 1200 ? 44.339  21.845  53.721  1.00 14.99  ? 1200 GLN A O   1 
ATOM 6946  C CB  . GLN A 1 1200 ? 45.438  24.230  55.048  1.00 40.61  ? 1200 GLN A CB  1 
ATOM 6947  H H   . GLN A 1 1200 ? 44.432  25.922  53.537  1.00 40.65  ? 1200 GLN A H   1 
ATOM 6948  H HA  . GLN A 1 1200 ? 45.972  23.764  53.130  1.00 44.49  ? 1200 GLN A HA  1 
ATOM 6949  N N   . GLN A 1 1201 ? 42.890  23.362  52.884  1.00 30.13  ? 1201 GLN A N   1 
ATOM 6950  C CA  . GLN A 1 1201 ? 41.882  22.355  52.606  1.00 19.96  ? 1201 GLN A CA  1 
ATOM 6951  C C   . GLN A 1 1201 ? 42.372  21.389  51.546  1.00 19.98  ? 1201 GLN A C   1 
ATOM 6952  O O   . GLN A 1 1201 ? 41.718  20.374  51.313  1.00 23.06  ? 1201 GLN A O   1 
ATOM 6953  C CB  . GLN A 1 1201 ? 40.570  23.017  52.165  1.00 17.57  ? 1201 GLN A CB  1 
ATOM 6954  H H   . GLN A 1 1201 ? 42.648  24.168  52.709  1.00 36.16  ? 1201 GLN A H   1 
ATOM 6955  H HA  . GLN A 1 1201 ? 41.707  21.849  53.415  1.00 23.95  ? 1201 GLN A HA  1 
ATOM 6956  N N   . GLN A 1 1202 ? 43.490  21.712  50.892  1.00 20.30  ? 1202 GLN A N   1 
ATOM 6957  C CA  . GLN A 1 1202 ? 44.223  20.833  49.987  1.00 23.07  ? 1202 GLN A CA  1 
ATOM 6958  C C   . GLN A 1 1202 ? 43.405  20.383  48.765  1.00 41.49  ? 1202 GLN A C   1 
ATOM 6959  O O   . GLN A 1 1202 ? 43.706  19.330  48.185  1.00 46.25  ? 1202 GLN A O   1 
ATOM 6960  C CB  . GLN A 1 1202 ? 44.751  19.607  50.742  1.00 29.53  ? 1202 GLN A CB  1 
ATOM 6961  H HA  . GLN A 1 1202 ? 44.994  21.318  49.653  1.00 27.69  ? 1202 GLN A HA  1 
ATOM 6962  N N   . ARG A 1 1203 ? 42.391  21.156  48.336  1.00 37.82  ? 1203 ARG A N   1 
ATOM 6963  C CA  . ARG A 1 1203 ? 41.521  20.837  47.189  1.00 25.21  ? 1203 ARG A CA  1 
ATOM 6964  C C   . ARG A 1 1203 ? 41.191  19.341  46.976  1.00 23.57  ? 1203 ARG A C   1 
ATOM 6965  O O   . ARG A 1 1203 ? 40.174  19.029  46.352  1.00 19.94  ? 1203 ARG A O   1 
ATOM 6966  C CB  . ARG A 1 1203 ? 42.140  21.412  45.912  1.00 24.06  ? 1203 ARG A CB  1 
ATOM 6967  H H   . ARG A 1 1203 ? 42.182  21.901  48.710  1.00 45.38  ? 1203 ARG A H   1 
ATOM 6968  H HA  . ARG A 1 1203 ? 40.675  21.293  47.324  1.00 30.26  ? 1203 ARG A HA  1 
ATOM 6969  N N   . LEU A 1 1204 ? 42.048  18.405  47.431  1.00 25.97  ? 1204 LEU A N   1 
ATOM 6970  C CA  . LEU A 1 1204 ? 41.704  16.977  47.414  1.00 12.33  ? 1204 LEU A CA  1 
ATOM 6971  C C   . LEU A 1 1204 ? 40.493  16.705  48.283  1.00 11.38  ? 1204 LEU A C   1 
ATOM 6972  O O   . LEU A 1 1204 ? 39.733  15.769  48.013  1.00 8.77   ? 1204 LEU A O   1 
ATOM 6973  C CB  . LEU A 1 1204 ? 42.876  16.126  47.907  1.00 8.77   ? 1204 LEU A CB  1 
ATOM 6974  H HA  . LEU A 1 1204 ? 41.493  16.709  46.506  1.00 14.79  ? 1204 LEU A HA  1 
ATOM 6975  N N   . LEU A 1 1205 ? 40.352  17.454  49.369  1.00 16.27  ? 1205 LEU A N   1 
ATOM 6976  C CA  . LEU A 1 1205 ? 39.033  17.763  49.891  1.00 19.11  ? 1205 LEU A CA  1 
ATOM 6977  C C   . LEU A 1 1205 ? 38.144  18.117  48.714  1.00 25.42  ? 1205 LEU A C   1 
ATOM 6978  O O   . LEU A 1 1205 ? 38.477  18.990  47.912  1.00 29.20  ? 1205 LEU A O   1 
ATOM 6979  C CB  . LEU A 1 1205 ? 39.098  18.939  50.868  1.00 28.66  ? 1205 LEU A CB  1 
ATOM 6980  H HA  . LEU A 1 1205 ? 38.665  16.990  50.347  1.00 22.94  ? 1205 LEU A HA  1 
ATOM 6981  N N   . ARG A 1 1206 ? 37.012  17.443  48.613  1.00 32.46  ? 1206 ARG A N   1 
ATOM 6982  C CA  . ARG A 1 1206 ? 36.152  17.590  47.446  1.00 49.82  ? 1206 ARG A CA  1 
ATOM 6983  C C   . ARG A 1 1206 ? 35.810  19.059  47.135  1.00 49.85  ? 1206 ARG A C   1 
ATOM 6984  O O   . ARG A 1 1206 ? 35.433  19.824  48.030  1.00 50.86  ? 1206 ARG A O   1 
ATOM 6985  C CB  . ARG A 1 1206 ? 34.877  16.779  47.679  1.00 65.77  ? 1206 ARG A CB  1 
ATOM 6986  H HA  . ARG A 1 1206 ? 36.605  17.219  46.673  1.00 59.78  ? 1206 ARG A HA  1 
ATOM 6987  N N   . ASN A 1 1207 ? 35.939  19.443  45.856  1.00 44.63  ? 1207 ASN A N   1 
ATOM 6988  C CA  . ASN A 1 1207 ? 35.551  20.775  45.378  1.00 33.36  ? 1207 ASN A CA  1 
ATOM 6989  C C   . ASN A 1 1207 ? 34.624  20.687  44.157  1.00 36.18  ? 1207 ASN A C   1 
ATOM 6990  O O   . ASN A 1 1207 ? 33.603  21.396  44.056  1.00 39.15  ? 1207 ASN A O   1 
ATOM 6991  C CB  . ASN A 1 1207 ? 36.802  21.583  45.030  1.00 28.60  ? 1207 ASN A CB  1 
ATOM 6992  H H   . ASN A 1 1207 ? 36.257  18.938  45.236  1.00 53.56  ? 1207 ASN A H   1 
ATOM 6993  H HA  . ASN A 1 1207 ? 35.076  21.240  46.084  1.00 40.03  ? 1207 ASN A HA  1 
ATOM 6994  N N   . MET A 1 1208 ? 34.981  19.811  43.211  1.00 34.02  ? 1208 MET A N   1 
ATOM 6995  C CA  . MET A 1 1208 ? 34.223  19.653  41.982  1.00 31.59  ? 1208 MET A CA  1 
ATOM 6996  C C   . MET A 1 1208 ? 32.815  19.118  42.208  1.00 32.92  ? 1208 MET A C   1 
ATOM 6997  O O   . MET A 1 1208 ? 31.977  19.250  41.308  1.00 28.24  ? 1208 MET A O   1 
ATOM 6998  C CB  . MET A 1 1208 ? 34.975  18.722  41.025  1.00 29.06  ? 1208 MET A CB  1 
ATOM 6999  H H   . MET A 1 1208 ? 35.667  19.295  43.265  1.00 40.82  ? 1208 MET A H   1 
ATOM 7000  H HA  . MET A 1 1208 ? 34.155  20.520  41.551  1.00 37.91  ? 1208 MET A HA  1 
ATOM 7001  N N   . GLY A 1 1209 ? 32.554  18.498  43.367  1.00 40.83  ? 1209 GLY A N   1 
ATOM 7002  C CA  . GLY A 1 1209 ? 31.254  17.932  43.723  1.00 47.20  ? 1209 GLY A CA  1 
ATOM 7003  C C   . GLY A 1 1209 ? 30.263  18.867  44.407  1.00 45.57  ? 1209 GLY A C   1 
ATOM 7004  O O   . GLY A 1 1209 ? 29.053  18.596  44.443  1.00 40.51  ? 1209 GLY A O   1 
ATOM 7005  H H   . GLY A 1 1209 ? 33.143  18.392  43.984  1.00 48.99  ? 1209 GLY A H   1 
ATOM 7006  H HA2 . GLY A 1 1209 ? 30.831  17.598  42.917  1.00 56.64  ? 1209 GLY A HA2 1 
ATOM 7007  H HA3 . GLY A 1 1209 ? 31.399  17.176  44.314  1.00 56.64  ? 1209 GLY A HA3 1 
ATOM 7008  N N   . ALA A 1 1210 ? 30.786  19.949  44.998  1.00 51.09  ? 1210 ALA A N   1 
ATOM 7009  C CA  . ALA A 1 1210 ? 29.967  21.087  45.397  1.00 47.13  ? 1210 ALA A CA  1 
ATOM 7010  C C   . ALA A 1 1210 ? 29.741  22.064  44.240  1.00 45.43  ? 1210 ALA A C   1 
ATOM 7011  O O   . ALA A 1 1210 ? 28.730  22.780  44.242  1.00 30.94  ? 1210 ALA A O   1 
ATOM 7012  C CB  . ALA A 1 1210 ? 30.614  21.831  46.570  1.00 46.92  ? 1210 ALA A CB  1 
ATOM 7013  H H   . ALA A 1 1210 ? 31.622  20.044  45.178  1.00 61.31  ? 1210 ALA A H   1 
ATOM 7014  H HA  . ALA A 1 1210 ? 29.100  20.764  45.689  1.00 56.56  ? 1210 ALA A HA  1 
ATOM 7015  H HB1 . ALA A 1 1210 ? 30.051  22.581  46.816  1.00 56.30  ? 1210 ALA A HB1 1 
ATOM 7016  H HB2 . ALA A 1 1210 ? 30.701  21.222  47.320  1.00 56.30  ? 1210 ALA A HB2 1 
ATOM 7017  H HB3 . ALA A 1 1210 ? 31.489  22.148  46.297  1.00 56.30  ? 1210 ALA A HB3 1 
ATOM 7018  N N   . HIS A 1 1211 ? 30.672  22.133  43.261  1.00 52.06  ? 1211 HIS A N   1 
ATOM 7019  C CA  . HIS A 1 1211 ? 30.438  22.987  42.093  1.00 40.22  ? 1211 HIS A CA  1 
ATOM 7020  C C   . HIS A 1 1211 ? 29.608  22.280  41.019  1.00 29.99  ? 1211 HIS A C   1 
ATOM 7021  O O   . HIS A 1 1211 ? 28.817  22.921  40.320  1.00 25.54  ? 1211 HIS A O   1 
ATOM 7022  C CB  . HIS A 1 1211 ? 31.772  23.470  41.504  1.00 31.15  ? 1211 HIS A CB  1 
ATOM 7023  H H   . HIS A 1 1211 ? 31.419  21.708  43.255  1.00 62.47  ? 1211 HIS A H   1 
ATOM 7024  H HA  . HIS A 1 1211 ? 29.942  23.771  42.377  1.00 48.26  ? 1211 HIS A HA  1 
ATOM 7025  N N   . ALA A 1 1212 ? 29.792  20.974  40.844  1.00 22.55  ? 1212 ALA A N   1 
ATOM 7026  C CA  . ALA A 1 1212 ? 28.911  20.211  39.971  1.00 21.26  ? 1212 ALA A CA  1 
ATOM 7027  C C   . ALA A 1 1212 ? 27.634  19.810  40.697  1.00 23.86  ? 1212 ALA A C   1 
ATOM 7028  O O   . ALA A 1 1212 ? 26.536  20.066  40.199  1.00 22.38  ? 1212 ALA A O   1 
ATOM 7029  C CB  . ALA A 1 1212 ? 29.642  18.983  39.450  1.00 20.49  ? 1212 ALA A CB  1 
ATOM 7030  H H   . ALA A 1 1212 ? 30.414  20.512  41.216  1.00 27.06  ? 1212 ALA A H   1 
ATOM 7031  H HA  . ALA A 1 1212 ? 28.665  20.760  39.210  1.00 25.51  ? 1212 ALA A HA  1 
ATOM 7032  H HB1 . ALA A 1 1212 ? 29.046  18.484  38.870  1.00 24.59  ? 1212 ALA A HB1 1 
ATOM 7033  H HB2 . ALA A 1 1212 ? 30.424  19.270  38.952  1.00 24.59  ? 1212 ALA A HB2 1 
ATOM 7034  H HB3 . ALA A 1 1212 ? 29.911  18.433  40.202  1.00 24.59  ? 1212 ALA A HB3 1 
ATOM 7035  N N   . VAL A 1 1213 ? 27.755  19.178  41.871  1.00 28.19  ? 1213 VAL A N   1 
ATOM 7036  C CA  . VAL A 1 1213 ? 26.571  18.850  42.659  1.00 26.40  ? 1213 VAL A CA  1 
ATOM 7037  C C   . VAL A 1 1213 ? 25.800  20.124  42.970  1.00 23.16  ? 1213 VAL A C   1 
ATOM 7038  O O   . VAL A 1 1213 ? 24.620  20.252  42.628  1.00 22.34  ? 1213 VAL A O   1 
ATOM 7039  C CB  . VAL A 1 1213 ? 26.964  18.087  43.939  1.00 21.84  ? 1213 VAL A CB  1 
ATOM 7040  H H   . VAL A 1 1213 ? 28.500  18.934  42.224  1.00 33.83  ? 1213 VAL A H   1 
ATOM 7041  H HA  . VAL A 1 1213 ? 25.994  18.273  42.134  1.00 31.68  ? 1213 VAL A HA  1 
ATOM 7042  N N   . VAL A 1 1214 ? 26.459  21.102  43.587  1.00 20.68  ? 1214 VAL A N   1 
ATOM 7043  C CA  . VAL A 1 1214 ? 25.793  22.372  43.787  1.00 18.15  ? 1214 VAL A CA  1 
ATOM 7044  C C   . VAL A 1 1214 ? 25.369  22.934  42.449  1.00 17.06  ? 1214 VAL A C   1 
ATOM 7045  O O   . VAL A 1 1214 ? 24.306  23.538  42.341  1.00 18.23  ? 1214 VAL A O   1 
ATOM 7046  C CB  . VAL A 1 1214 ? 26.703  23.351  44.547  1.00 17.72  ? 1214 VAL A CB  1 
ATOM 7047  H H   . VAL A 1 1214 ? 27.264  21.054  43.886  1.00 24.82  ? 1214 VAL A H   1 
ATOM 7048  H HA  . VAL A 1 1214 ? 24.994  22.230  44.320  1.00 21.79  ? 1214 VAL A HA  1 
ATOM 7049  N N   . LEU A 1 1215 ? 26.161  22.701  41.400  1.00 18.87  ? 1215 LEU A N   1 
ATOM 7050  C CA  . LEU A 1 1215 ? 25.946  23.388  40.136  1.00 20.17  ? 1215 LEU A CA  1 
ATOM 7051  C C   . LEU A 1 1215 ? 24.694  22.922  39.417  1.00 20.50  ? 1215 LEU A C   1 
ATOM 7052  O O   . LEU A 1 1215 ? 24.152  23.671  38.598  1.00 23.64  ? 1215 LEU A O   1 
ATOM 7053  C CB  . LEU A 1 1215 ? 27.151  23.174  39.231  1.00 23.26  ? 1215 LEU A CB  1 
ATOM 7054  H H   . LEU A 1 1215 ? 26.823  22.153  41.398  1.00 22.64  ? 1215 LEU A H   1 
ATOM 7055  H HA  . LEU A 1 1215 ? 25.860  24.340  40.303  1.00 24.20  ? 1215 LEU A HA  1 
ATOM 7056  N N   . GLU A 1 1216 ? 24.273  21.676  39.641  1.00 20.21  ? 1216 GLU A N   1 
ATOM 7057  C CA  . GLU A 1 1216 ? 23.111  21.133  38.945  1.00 25.81  ? 1216 GLU A CA  1 
ATOM 7058  C C   . GLU A 1 1216 ? 21.788  21.638  39.531  1.00 31.52  ? 1216 GLU A C   1 
ATOM 7059  O O   . GLU A 1 1216 ? 20.822  21.839  38.789  1.00 40.36  ? 1216 GLU A O   1 
ATOM 7060  C CB  . GLU A 1 1216 ? 23.154  19.605  38.976  1.00 32.37  ? 1216 GLU A CB  1 
ATOM 7061  H H   . GLU A 1 1216 ? 24.643  21.127  40.190  1.00 24.25  ? 1216 GLU A H   1 
ATOM 7062  H HA  . GLU A 1 1216 ? 23.146  21.411  38.017  1.00 30.97  ? 1216 GLU A HA  1 
ATOM 7063  N N   . LEU A 1 1217 ? 21.697  21.792  40.856  1.00 30.39  ? 1217 LEU A N   1 
ATOM 7064  C CA  . LEU A 1 1217 ? 20.502  22.381  41.461  1.00 31.75  ? 1217 LEU A CA  1 
ATOM 7065  C C   . LEU A 1 1217 ? 20.581  23.911  41.543  1.00 36.59  ? 1217 LEU A C   1 
ATOM 7066  O O   . LEU A 1 1217 ? 19.542  24.573  41.702  1.00 24.78  ? 1217 LEU A O   1 
ATOM 7067  C CB  . LEU A 1 1217 ? 20.287  21.778  42.853  1.00 28.60  ? 1217 LEU A CB  1 
ATOM 7068  H H   . LEU A 1 1217 ? 22.306  21.566  41.419  1.00 36.46  ? 1217 LEU A H   1 
ATOM 7069  H HA  . LEU A 1 1217 ? 19.732  22.153  40.917  1.00 38.10  ? 1217 LEU A HA  1 
ATOM 7070  N N   . LEU A 1 1218 ? 21.787  24.476  41.400  1.00 37.07  ? 1218 LEU A N   1 
ATOM 7071  C CA  . LEU A 1 1218 ? 22.126  25.891  41.570  1.00 38.92  ? 1218 LEU A CA  1 
ATOM 7072  C C   . LEU A 1 1218 ? 22.176  26.665  40.248  1.00 39.96  ? 1218 LEU A C   1 
ATOM 7073  O O   . LEU A 1 1218 ? 21.893  27.870  40.231  1.00 33.37  ? 1218 LEU A O   1 
ATOM 7074  C CB  . LEU A 1 1218 ? 23.483  26.019  42.276  1.00 55.95  ? 1218 LEU A CB  1 
ATOM 7075  H HA  . LEU A 1 1218 ? 21.456  26.308  42.134  1.00 46.70  ? 1218 LEU A HA  1 
ATOM 7076  N N   . GLN A 1 1219 ? 22.588  26.037  39.146  1.00 40.97  ? 1219 GLN A N   1 
ATOM 7077  C CA  . GLN A 1 1219 ? 22.422  26.693  37.856  1.00 31.26  ? 1219 GLN A CA  1 
ATOM 7078  C C   . GLN A 1 1219 ? 20.934  26.939  37.606  1.00 34.95  ? 1219 GLN A C   1 
ATOM 7079  O O   . GLN A 1 1219 ? 20.520  28.069  37.322  1.00 33.02  ? 1219 GLN A O   1 
ATOM 7080  C CB  . GLN A 1 1219 ? 23.070  25.857  36.740  1.00 24.46  ? 1219 GLN A CB  1 
ATOM 7081  H H   . GLN A 1 1219 ? 22.954  25.259  39.119  1.00 49.16  ? 1219 GLN A H   1 
ATOM 7082  H HA  . GLN A 1 1219 ? 22.868  27.555  37.881  1.00 37.51  ? 1219 GLN A HA  1 
ATOM 7083  N N   . ILE A 1 1220 ? 20.102  25.905  37.777  1.00 40.59  ? 1220 ILE A N   1 
ATOM 7084  C CA  . ILE A 1 1220 ? 18.654  26.088  37.648  1.00 33.35  ? 1220 ILE A CA  1 
ATOM 7085  C C   . ILE A 1 1220 ? 18.158  27.164  38.602  1.00 29.23  ? 1220 ILE A C   1 
ATOM 7086  O O   . ILE A 1 1220 ? 17.497  28.107  38.142  1.00 24.04  ? 1220 ILE A O   1 
ATOM 7087  C CB  . ILE A 1 1220 ? 17.925  24.750  37.858  1.00 43.81  ? 1220 ILE A CB  1 
ATOM 7088  H H   . ILE A 1 1220 ? 20.346  25.102  37.965  1.00 48.70  ? 1220 ILE A H   1 
ATOM 7089  H HA  . ILE A 1 1220 ? 18.461  26.388  36.746  1.00 40.02  ? 1220 ILE A HA  1 
ATOM 7090  N N   . PRO A 1 1221 ? 18.436  27.102  39.903  1.00 27.56  ? 1221 PRO A N   1 
ATOM 7091  C CA  . PRO A 1 1221 ? 17.930  28.134  40.816  1.00 32.40  ? 1221 PRO A CA  1 
ATOM 7092  C C   . PRO A 1 1221 ? 18.933  29.264  41.017  1.00 38.32  ? 1221 PRO A C   1 
ATOM 7093  O O   . PRO A 1 1221 ? 20.131  28.990  41.090  1.00 32.96  ? 1221 PRO A O   1 
ATOM 7094  C CB  . PRO A 1 1221 ? 17.680  27.348  42.113  1.00 24.19  ? 1221 PRO A CB  1 
ATOM 7095  H HA  . PRO A 1 1221 ? 17.091  28.496  40.489  1.00 38.89  ? 1221 PRO A HA  1 
ATOM 7096  N N   . TYR A 1 1222 ? 18.483  30.525  41.103  1.00 57.57  ? 1222 TYR A N   1 
ATOM 7097  C CA  . TYR A 1 1222 ? 19.373  31.676  41.289  1.00 59.32  ? 1222 TYR A CA  1 
ATOM 7098  C C   . TYR A 1 1222 ? 18.874  32.582  42.423  1.00 43.46  ? 1222 TYR A C   1 
ATOM 7099  O O   . TYR A 1 1222 ? 17.689  32.580  42.770  1.00 36.28  ? 1222 TYR A O   1 
ATOM 7100  C CB  . TYR A 1 1222 ? 19.502  32.486  39.991  1.00 65.45  ? 1222 TYR A CB  1 
ATOM 7101  H HA  . TYR A 1 1222 ? 20.256  31.355  41.529  1.00 71.18  ? 1222 TYR A HA  1 
ATOM 7102  N N   . GLU A 1 1223 ? 19.793  33.360  43.003  1.00 33.13  ? 1223 GLU A N   1 
ATOM 7103  C CA  . GLU A 1 1223 ? 19.488  34.231  44.136  1.00 23.03  ? 1223 GLU A CA  1 
ATOM 7104  C C   . GLU A 1 1223 ? 19.815  35.684  43.804  1.00 21.56  ? 1223 GLU A C   1 
ATOM 7105  O O   . GLU A 1 1223 ? 20.924  36.000  43.351  1.00 17.58  ? 1223 GLU A O   1 
ATOM 7106  C CB  . GLU A 1 1223 ? 20.255  33.804  45.386  1.00 21.05  ? 1223 GLU A CB  1 
ATOM 7107  H H   . GLU A 1 1223 ? 20.614  33.399  42.752  1.00 39.75  ? 1223 GLU A H   1 
ATOM 7108  H HA  . GLU A 1 1223 ? 18.540  34.174  44.332  1.00 27.64  ? 1223 GLU A HA  1 
ATOM 7109  N N   . LYS A 1 1224 ? 18.863  36.565  44.085  1.00 29.26  ? 1224 LYS A N   1 
ATOM 7110  C CA  . LYS A 1 1224 ? 18.977  37.984  43.770  1.00 28.77  ? 1224 LYS A CA  1 
ATOM 7111  C C   . LYS A 1 1224 ? 18.730  38.821  45.034  1.00 37.08  ? 1224 LYS A C   1 
ATOM 7112  O O   . LYS A 1 1224 ? 18.141  38.346  46.010  1.00 66.02  ? 1224 LYS A O   1 
ATOM 7113  C CB  . LYS A 1 1224 ? 17.990  38.396  42.663  1.00 33.04  ? 1224 LYS A CB  1 
ATOM 7114  H H   . LYS A 1 1224 ? 18.121  36.359  44.468  1.00 35.11  ? 1224 LYS A H   1 
ATOM 7115  H HA  . LYS A 1 1224 ? 19.876  38.169  43.457  1.00 34.53  ? 1224 LYS A HA  1 
ATOM 7116  N N   . ALA A 1 1225 ? 19.155  40.083  45.011  1.00 26.16  ? 1225 ALA A N   1 
ATOM 7117  C CA  . ALA A 1 1225 ? 18.965  40.955  46.166  1.00 23.25  ? 1225 ALA A CA  1 
ATOM 7118  C C   . ALA A 1 1225 ? 17.462  41.202  46.331  1.00 26.18  ? 1225 ALA A C   1 
ATOM 7119  O O   . ALA A 1 1225 ? 16.723  41.089  45.361  1.00 27.36  ? 1225 ALA A O   1 
ATOM 7120  C CB  . ALA A 1 1225 ? 19.709  42.251  45.988  1.00 23.43  ? 1225 ALA A CB  1 
ATOM 7121  H H   . ALA A 1 1225 ? 19.553  40.455  44.345  1.00 31.39  ? 1225 ALA A H   1 
ATOM 7122  H HA  . ALA A 1 1225 ? 19.296  40.516  46.965  1.00 27.90  ? 1225 ALA A HA  1 
ATOM 7123  H HB1 . ALA A 1 1225 ? 19.564  42.808  46.769  1.00 28.12  ? 1225 ALA A HB1 1 
ATOM 7124  H HB2 . ALA A 1 1225 ? 20.655  42.060  45.888  1.00 28.12  ? 1225 ALA A HB2 1 
ATOM 7125  H HB3 . ALA A 1 1225 ? 19.376  42.699  45.195  1.00 28.12  ? 1225 ALA A HB3 1 
ATOM 7126  N N   . GLU A 1 1226 ? 16.990  41.519  47.531  1.00 29.89  ? 1226 GLU A N   1 
ATOM 7127  C CA  . GLU A 1 1226 ? 17.812  41.744  48.703  1.00 38.86  ? 1226 GLU A CA  1 
ATOM 7128  C C   . GLU A 1 1226 ? 18.439  40.465  49.259  1.00 34.70  ? 1226 GLU A C   1 
ATOM 7129  O O   . GLU A 1 1226 ? 17.871  39.375  49.158  1.00 34.32  ? 1226 GLU A O   1 
ATOM 7130  C CB  . GLU A 1 1226 ? 16.956  42.418  49.777  1.00 56.53  ? 1226 GLU A CB  1 
ATOM 7131  H HA  . GLU A 1 1226 ? 18.532  42.352  48.470  1.00 46.63  ? 1226 GLU A HA  1 
ATOM 7132  N N   . ASP A 1 1227 ? 19.637  40.615  49.823  1.00 35.77  ? 1227 ASP A N   1 
ATOM 7133  C CA  . ASP A 1 1227 ? 20.278  39.558  50.600  1.00 36.44  ? 1227 ASP A CA  1 
ATOM 7134  C C   . ASP A 1 1227 ? 20.591  38.346  49.726  1.00 24.43  ? 1227 ASP A C   1 
ATOM 7135  O O   . ASP A 1 1227 ? 20.349  37.197  50.107  1.00 23.72  ? 1227 ASP A O   1 
ATOM 7136  C CB  . ASP A 1 1227 ? 19.403  39.163  51.795  1.00 48.55  ? 1227 ASP A CB  1 
ATOM 7137  H HA  . ASP A 1 1227 ? 21.118  39.894  50.949  1.00 43.72  ? 1227 ASP A HA  1 
ATOM 7138  N N   . THR A 1 1228 ? 21.137  38.611  48.540  1.00 19.21  ? 1228 THR A N   1 
ATOM 7139  C CA  . THR A 1 1228 ? 21.456  37.527  47.628  1.00 15.48  ? 1228 THR A CA  1 
ATOM 7140  C C   . THR A 1 1228 ? 22.117  36.406  48.401  1.00 11.88  ? 1228 THR A C   1 
ATOM 7141  O O   . THR A 1 1228 ? 23.134  36.606  49.059  1.00 11.02  ? 1228 THR A O   1 
ATOM 7142  C CB  . THR A 1 1228 ? 22.367  38.019  46.500  1.00 11.50  ? 1228 THR A CB  1 
ATOM 7143  H HA  . THR A 1 1228 ? 20.638  37.186  47.234  1.00 18.57  ? 1228 THR A HA  1 
ATOM 7144  N N   . LYS A 1 1229 ? 21.486  35.246  48.390  1.00 11.39  ? 1229 LYS A N   1 
ATOM 7145  C CA  . LYS A 1 1229 ? 21.969  34.167  49.236  1.00 18.14  ? 1229 LYS A CA  1 
ATOM 7146  C C   . LYS A 1 1229 ? 23.245  33.561  48.688  1.00 19.22  ? 1229 LYS A C   1 
ATOM 7147  O O   . LYS A 1 1229 ? 24.165  33.251  49.453  1.00 20.84  ? 1229 LYS A O   1 
ATOM 7148  C CB  . LYS A 1 1229 ? 20.901  33.089  49.354  1.00 65.02  ? 1229 LYS A CB  1 
ATOM 7149  H HA  . LYS A 1 1229 ? 22.153  34.513  50.123  1.00 21.77  ? 1229 LYS A HA  1 
ATOM 7150  N N   . MET A 1 1230 ? 23.299  33.359  47.372  1.00 24.74  ? 1230 MET A N   1 
ATOM 7151  C CA  . MET A 1 1230 ? 24.411  32.680  46.723  1.00 38.90  ? 1230 MET A CA  1 
ATOM 7152  C C   . MET A 1 1230 ? 25.567  33.642  46.500  1.00 43.09  ? 1230 MET A C   1 
ATOM 7153  O O   . MET A 1 1230 ? 26.085  33.751  45.384  1.00 48.44  ? 1230 MET A O   1 
ATOM 7154  C CB  . MET A 1 1230 ? 23.972  32.074  45.385  1.00 43.25  ? 1230 MET A CB  1 
ATOM 7155  H H   . MET A 1 1230 ? 22.687  33.614  46.824  1.00 29.69  ? 1230 MET A H   1 
ATOM 7156  H HA  . MET A 1 1230 ? 24.711  31.955  47.293  1.00 46.68  ? 1230 MET A HA  1 
ATOM 7157  N N   . GLN A 1 1231 ? 25.969  34.350  47.552  1.00 46.22  ? 1231 GLN A N   1 
ATOM 7158  C CA  . GLN A 1 1231 ? 27.091  35.279  47.473  1.00 46.85  ? 1231 GLN A CA  1 
ATOM 7159  C C   . GLN A 1 1231 ? 28.356  34.731  48.117  1.00 39.93  ? 1231 GLN A C   1 
ATOM 7160  O O   . GLN A 1 1231 ? 29.455  35.080  47.678  1.00 32.42  ? 1231 GLN A O   1 
ATOM 7161  C CB  . GLN A 1 1231 ? 26.734  36.608  48.146  1.00 53.44  ? 1231 GLN A CB  1 
ATOM 7162  H H   . GLN A 1 1231 ? 25.603  34.310  48.330  1.00 55.47  ? 1231 GLN A H   1 
ATOM 7163  H HA  . GLN A 1 1231 ? 27.285  35.458  46.540  1.00 56.22  ? 1231 GLN A HA  1 
ATOM 7164  N N   . GLU A 1 1232 ? 28.220  33.910  49.166  1.00 51.35  ? 1232 GLU A N   1 
ATOM 7165  C CA  . GLU A 1 1232 ? 29.331  33.482  49.995  1.00 53.46  ? 1232 GLU A CA  1 
ATOM 7166  C C   . GLU A 1 1232 ? 29.583  31.971  49.973  1.00 57.17  ? 1232 GLU A C   1 
ATOM 7167  O O   . GLU A 1 1232 ? 30.519  31.513  50.638  1.00 59.51  ? 1232 GLU A O   1 
ATOM 7168  C CB  . GLU A 1 1232 ? 29.105  33.931  51.449  1.00 50.49  ? 1232 GLU A CB  1 
ATOM 7169  H H   . GLU A 1 1232 ? 27.465  33.583  49.417  1.00 61.63  ? 1232 GLU A H   1 
ATOM 7170  H HA  . GLU A 1 1232 ? 30.138  33.916  49.676  1.00 64.16  ? 1232 GLU A HA  1 
ATOM 7171  N N   . ILE A 1 1233 ? 28.773  31.179  49.257  1.00 52.57  ? 1233 ILE A N   1 
ATOM 7172  C CA  . ILE A 1 1233 ? 29.017  29.738  49.192  1.00 53.87  ? 1233 ILE A CA  1 
ATOM 7173  C C   . ILE A 1 1233 ? 30.358  29.451  48.520  1.00 57.80  ? 1233 ILE A C   1 
ATOM 7174  O O   . ILE A 1 1233 ? 31.137  28.609  48.988  1.00 68.81  ? 1233 ILE A O   1 
ATOM 7175  C CB  . ILE A 1 1233 ? 27.859  29.034  48.460  1.00 55.76  ? 1233 ILE A CB  1 
ATOM 7176  H H   . ILE A 1 1233 ? 28.089  31.448  48.809  1.00 63.08  ? 1233 ILE A H   1 
ATOM 7177  H HA  . ILE A 1 1233 ? 29.056  29.386  50.095  1.00 64.64  ? 1233 ILE A HA  1 
ATOM 7178  N N   . MET A 1 1234 ? 30.643  30.131  47.414  1.00 49.16  ? 1234 MET A N   1 
ATOM 7179  C CA  . MET A 1 1234 ? 31.955  30.081  46.793  1.00 41.10  ? 1234 MET A CA  1 
ATOM 7180  C C   . MET A 1 1234 ? 32.716  31.391  46.924  1.00 47.46  ? 1234 MET A C   1 
ATOM 7181  O O   . MET A 1 1234 ? 33.924  31.359  47.175  1.00 43.63  ? 1234 MET A O   1 
ATOM 7182  C CB  . MET A 1 1234 ? 31.805  29.719  45.316  1.00 31.42  ? 1234 MET A CB  1 
ATOM 7183  H H   . MET A 1 1234 ? 30.082  30.634  47.000  1.00 58.99  ? 1234 MET A H   1 
ATOM 7184  H HA  . MET A 1 1234 ? 32.472  29.379  47.218  1.00 49.32  ? 1234 MET A HA  1 
ATOM 7185  N N   . ARG A 1 1235 ? 32.013  32.532  46.809  1.00 58.02  ? 1235 ARG A N   1 
ATOM 7186  C CA  . ARG A 1 1235 ? 32.649  33.851  46.721  1.00 72.53  ? 1235 ARG A CA  1 
ATOM 7187  C C   . ARG A 1 1235 ? 33.263  34.328  48.060  1.00 82.88  ? 1235 ARG A C   1 
ATOM 7188  O O   . ARG A 1 1235 ? 34.374  34.883  48.068  1.00 87.50  ? 1235 ARG A O   1 
ATOM 7189  C CB  . ARG A 1 1235 ? 31.632  34.869  46.180  1.00 62.81  ? 1235 ARG A CB  1 
ATOM 7190  H H   . ARG A 1 1235 ? 31.154  32.563  46.779  1.00 69.62  ? 1235 ARG A H   1 
ATOM 7191  H HA  . ARG A 1 1235 ? 33.373  33.797  46.077  1.00 87.04  ? 1235 ARG A HA  1 
ATOM 7192  N N   . LEU A 1 1236 ? 32.563  34.149  49.197  1.00 79.94  ? 1236 LEU A N   1 
ATOM 7193  C CA  . LEU A 1 1236 ? 33.093  34.637  50.480  1.00 63.21  ? 1236 LEU A CA  1 
ATOM 7194  C C   . LEU A 1 1236 ? 34.408  33.924  50.815  1.00 55.09  ? 1236 LEU A C   1 
ATOM 7195  O O   . LEU A 1 1236 ? 35.390  34.565  51.217  1.00 37.33  ? 1236 LEU A O   1 
ATOM 7196  C CB  . LEU A 1 1236 ? 32.071  34.441  51.610  1.00 44.81  ? 1236 LEU A CB  1 
ATOM 7197  H H   . LEU A 1 1236 ? 31.798  33.759  49.249  1.00 95.93  ? 1236 LEU A H   1 
ATOM 7198  H HA  . LEU A 1 1236 ? 33.278  35.586  50.405  1.00 75.86  ? 1236 LEU A HA  1 
ATOM 7199  N N   . ALA A 1 1237 ? 34.428  32.591  50.662  1.00 55.61  ? 1237 ALA A N   1 
ATOM 7200  C CA  . ALA A 1 1237 ? 35.688  31.875  50.591  1.00 38.62  ? 1237 ALA A CA  1 
ATOM 7201  C C   . ALA A 1 1237 ? 36.530  32.432  49.450  1.00 41.39  ? 1237 ALA A C   1 
ATOM 7202  O O   . ALA A 1 1237 ? 37.705  32.744  49.639  1.00 36.27  ? 1237 ALA A O   1 
ATOM 7203  C CB  . ALA A 1 1237 ? 35.449  30.367  50.402  1.00 29.48  ? 1237 ALA A CB  1 
ATOM 7204  H H   . ALA A 1 1237 ? 33.729  32.093  50.598  1.00 66.73  ? 1237 ALA A H   1 
ATOM 7205  H HA  . ALA A 1 1237 ? 36.175  32.003  51.420  1.00 46.35  ? 1237 ALA A HA  1 
ATOM 7206  H HB1 . ALA A 1 1237 ? 36.306  29.914  50.359  1.00 35.38  ? 1237 ALA A HB1 1 
ATOM 7207  H HB2 . ALA A 1 1237 ? 34.936  30.032  51.155  1.00 35.38  ? 1237 ALA A HB2 1 
ATOM 7208  H HB3 . ALA A 1 1237 ? 34.958  30.226  49.578  1.00 35.38  ? 1237 ALA A HB3 1 
ATOM 7209  N N   . HIS A 1 1238 ? 35.903  32.629  48.286  1.00 46.86  ? 1238 HIS A N   1 
ATOM 7210  C CA  . HIS A 1 1238 ? 36.620  33.018  47.073  1.00 54.97  ? 1238 HIS A CA  1 
ATOM 7211  C C   . HIS A 1 1238 ? 37.148  34.449  47.115  1.00 53.91  ? 1238 HIS A C   1 
ATOM 7212  O O   . HIS A 1 1238 ? 37.746  34.883  46.125  1.00 63.19  ? 1238 HIS A O   1 
ATOM 7213  C CB  . HIS A 1 1238 ? 35.727  32.848  45.837  1.00 63.47  ? 1238 HIS A CB  1 
ATOM 7214  H H   . HIS A 1 1238 ? 35.055  32.542  48.175  1.00 56.23  ? 1238 HIS A H   1 
ATOM 7215  H HA  . HIS A 1 1238 ? 37.383  32.429  46.965  1.00 65.97  ? 1238 HIS A HA  1 
ATOM 7216  N N   . GLU A 1 1239 ? 36.904  35.206  48.189  1.00 44.32  ? 1239 GLU A N   1 
ATOM 7217  C CA  . GLU A 1 1239 ? 37.692  36.415  48.382  1.00 39.48  ? 1239 GLU A CA  1 
ATOM 7218  C C   . GLU A 1 1239 ? 39.132  35.925  48.371  1.00 52.69  ? 1239 GLU A C   1 
ATOM 7219  O O   . GLU A 1 1239 ? 39.545  35.204  49.291  1.00 50.26  ? 1239 GLU A O   1 
ATOM 7220  C CB  . GLU A 1 1239 ? 37.314  37.145  49.681  1.00 33.12  ? 1239 GLU A CB  1 
ATOM 7221  H HA  . GLU A 1 1239 ? 37.560  37.017  47.633  1.00 47.38  ? 1239 GLU A HA  1 
ATOM 7222  N N   . PHE A 1 1240 ? 39.858  36.197  47.280  1.00 57.66  ? 1240 PHE A N   1 
ATOM 7223  C CA  . PHE A 1 1240 ? 41.285  35.888  47.238  1.00 44.14  ? 1240 PHE A CA  1 
ATOM 7224  C C   . PHE A 1 1240 ? 41.905  36.513  48.479  1.00 42.67  ? 1240 PHE A C   1 
ATOM 7225  O O   . PHE A 1 1240 ? 41.831  37.736  48.672  1.00 40.28  ? 1240 PHE A O   1 
ATOM 7226  C CB  . PHE A 1 1240 ? 41.924  36.385  45.939  1.00 36.77  ? 1240 PHE A CB  1 
ATOM 7227  H HA  . PHE A 1 1240 ? 41.407  34.927  47.288  1.00 52.97  ? 1240 PHE A HA  1 
ATOM 7228  N N   . LEU A 1 1241 ? 42.420  35.663  49.363  1.00 34.92  ? 1241 LEU A N   1 
ATOM 7229  C CA  . LEU A 1 1241 ? 43.211  36.054  50.529  1.00 35.02  ? 1241 LEU A CA  1 
ATOM 7230  C C   . LEU A 1 1241 ? 43.332  37.569  50.726  1.00 33.42  ? 1241 LEU A C   1 
ATOM 7231  O O   . LEU A 1 1241 ? 44.441  38.108  50.727  1.00 44.15  ? 1241 LEU A O   1 
ATOM 7232  C CB  . LEU A 1 1241 ? 44.604  35.429  50.405  1.00 48.95  ? 1241 LEU A CB  1 
ATOM 7233  H HA  . LEU A 1 1241 ? 42.793  35.687  51.323  1.00 42.02  ? 1241 LEU A HA  1 
ATOM 7234  N N   . GLN A 1 1242 ? 42.199  38.268  50.860  1.00 28.14  ? 1242 GLN A N   1 
ATOM 7235  C CA  . GLN A 1 1242 ? 42.159  39.685  51.246  1.00 22.09  ? 1242 GLN A CA  1 
ATOM 7236  C C   . GLN A 1 1242 ? 43.075  40.609  50.446  1.00 22.36  ? 1242 GLN A C   1 
ATOM 7237  O O   . GLN A 1 1242 ? 44.166  40.951  50.908  1.00 26.85  ? 1242 GLN A O   1 
ATOM 7238  C CB  . GLN A 1 1242 ? 42.509  39.837  52.730  1.00 17.58  ? 1242 GLN A CB  1 
ATOM 7239  H H   . GLN A 1 1242 ? 41.418  37.932  50.729  1.00 33.77  ? 1242 GLN A H   1 
ATOM 7240  H HA  . GLN A 1 1242 ? 41.252  40.006  51.128  1.00 26.51  ? 1242 GLN A HA  1 
ATOM 7241  N N   . ASN A 1 1243 ? 42.626  41.055  49.280  1.00 21.22  ? 1243 ASN A N   1 
ATOM 7242  C CA  . ASN A 1 1243 ? 43.374  42.006  48.453  1.00 22.85  ? 1243 ASN A CA  1 
ATOM 7243  C C   . ASN A 1 1243 ? 44.610  41.533  47.667  1.00 20.29  ? 1243 ASN A C   1 
ATOM 7244  O O   . ASN A 1 1243 ? 45.587  42.247  47.632  1.00 22.72  ? 1243 ASN A O   1 
ATOM 7245  C CB  . ASN A 1 1243 ? 43.834  43.176  49.335  1.00 23.47  ? 1243 ASN A CB  1 
ATOM 7246  H HA  . ASN A 1 1243 ? 42.756  42.372  47.801  1.00 27.43  ? 1243 ASN A HA  1 
ATOM 7247  N N   . PHE A 1 1244 ? 44.600  40.380  47.020  1.00 24.26  ? 1244 PHE A N   1 
ATOM 7248  C CA  . PHE A 1 1244 ? 43.598  39.370  47.196  1.00 28.68  ? 1244 PHE A CA  1 
ATOM 7249  C C   . PHE A 1 1244 ? 44.244  38.045  46.832  1.00 42.37  ? 1244 PHE A C   1 
ATOM 7250  O O   . PHE A 1 1244 ? 44.415  37.223  47.724  1.00 54.76  ? 1244 PHE A O   1 
ATOM 7251  C CB  . PHE A 1 1244 ? 42.342  39.652  46.364  1.00 22.79  ? 1244 PHE A CB  1 
ATOM 7252  H HA  . PHE A 1 1244 ? 43.340  39.334  48.130  1.00 34.42  ? 1244 PHE A HA  1 
ATOM 7253  N N   . CYS A 1 1245 ? 44.655  37.823  45.571  1.00 43.33  ? 1245 CYS A N   1 
ATOM 7254  C CA  . CYS A 1 1245 ? 45.135  36.498  45.189  1.00 49.63  ? 1245 CYS A CA  1 
ATOM 7255  C C   . CYS A 1 1245 ? 46.482  36.178  45.873  1.00 60.72  ? 1245 CYS A C   1 
ATOM 7256  O O   . CYS A 1 1245 ? 47.425  36.982  45.813  1.00 64.18  ? 1245 CYS A O   1 
ATOM 7257  C CB  . CYS A 1 1245 ? 45.243  36.427  43.655  1.00 41.73  ? 1245 CYS A CB  1 
ATOM 7258  H HA  . CYS A 1 1245 ? 44.489  35.834  45.475  1.00 59.55  ? 1245 CYS A HA  1 
ATOM 7259  N N   . ALA A 1 1246 ? 46.557  35.005  46.560  1.00 57.13  ? 1246 ALA A N   1 
ATOM 7260  C CA  . ALA A 1 1246 ? 47.796  34.466  47.155  1.00 34.53  ? 1246 ALA A CA  1 
ATOM 7261  C C   . ALA A 1 1246 ? 48.065  33.032  46.676  1.00 32.11  ? 1246 ALA A C   1 
ATOM 7262  O O   . ALA A 1 1246 ? 48.412  32.150  47.474  1.00 20.86  ? 1246 ALA A O   1 
ATOM 7263  C CB  . ALA A 1 1246 ? 47.742  34.493  48.693  1.00 23.59  ? 1246 ALA A CB  1 
ATOM 7264  H HA  . ALA A 1 1246 ? 48.543  35.018  46.875  1.00 41.43  ? 1246 ALA A HA  1 
ATOM 7265  H HB1 . ALA A 1 1246 ? 48.571  34.133  49.044  1.00 28.31  ? 1246 ALA A HB1 1 
ATOM 7266  H HB2 . ALA A 1 1246 ? 47.628  35.410  48.988  1.00 28.31  ? 1246 ALA A HB2 1 
ATOM 7267  H HB3 . ALA A 1 1246 ? 46.993  33.953  48.991  1.00 28.31  ? 1246 ALA A HB3 1 
ATOM 7268  N N   . GLY A 1 1247 ? 47.954  32.813  45.372  1.00 36.77  ? 1247 GLY A N   1 
ATOM 7269  C CA  . GLY A 1 1247 ? 48.017  31.517  44.685  1.00 22.97  ? 1247 GLY A CA  1 
ATOM 7270  C C   . GLY A 1 1247 ? 46.651  31.131  44.135  1.00 23.37  ? 1247 GLY A C   1 
ATOM 7271  O O   . GLY A 1 1247 ? 45.616  31.397  44.753  1.00 34.52  ? 1247 GLY A O   1 
ATOM 7272  H H   . GLY A 1 1247 ? 47.830  33.457  44.815  1.00 44.12  ? 1247 GLY A H   1 
ATOM 7273  H HA2 . GLY A 1 1247 ? 48.648  31.565  43.950  1.00 27.56  ? 1247 GLY A HA2 1 
ATOM 7274  H HA3 . GLY A 1 1247 ? 48.310  30.831  45.305  1.00 27.56  ? 1247 GLY A HA3 1 
ATOM 7275  N N   . ASN A 1 1248 ? 46.630  30.516  42.937  1.00 14.15  ? 1248 ASN A N   1 
ATOM 7276  C CA  . ASN A 1 1248 ? 45.395  30.077  42.299  1.00 12.16  ? 1248 ASN A CA  1 
ATOM 7277  C C   . ASN A 1 1248 ? 45.307  28.557  42.216  1.00 9.09   ? 1248 ASN A C   1 
ATOM 7278  O O   . ASN A 1 1248 ? 44.653  28.023  41.316  1.00 9.09   ? 1248 ASN A O   1 
ATOM 7279  C CB  . ASN A 1 1248 ? 45.259  30.684  40.901  1.00 9.81   ? 1248 ASN A CB  1 
ATOM 7280  H H   . ASN A 1 1248 ? 47.334  30.344  42.474  1.00 16.98  ? 1248 ASN A H   1 
ATOM 7281  H HA  . ASN A 1 1248 ? 44.644  30.387  42.830  1.00 14.59  ? 1248 ASN A HA  1 
ATOM 7282  N N   . GLN A 1 1249 ? 45.975  27.868  43.148  1.00 8.95   ? 1249 GLN A N   1 
ATOM 7283  C CA  . GLN A 1 1249 ? 46.063  26.412  43.220  1.00 8.95   ? 1249 GLN A CA  1 
ATOM 7284  C C   . GLN A 1 1249 ? 45.303  25.743  42.090  1.00 8.95   ? 1249 GLN A C   1 
ATOM 7285  O O   . GLN A 1 1249 ? 45.887  25.165  41.169  1.00 8.95   ? 1249 GLN A O   1 
ATOM 7286  C CB  . GLN A 1 1249 ? 45.529  25.917  44.568  1.00 8.95   ? 1249 GLN A CB  1 
ATOM 7287  H HA  . GLN A 1 1249 ? 46.994  26.148  43.152  1.00 10.74  ? 1249 GLN A HA  1 
ATOM 7288  N N   . GLN A 1 1250 ? 43.994  25.895  42.129  1.00 8.93   ? 1250 GLN A N   1 
ATOM 7289  C CA  . GLN A 1 1250 ? 43.081  25.129  41.295  1.00 13.13  ? 1250 GLN A CA  1 
ATOM 7290  C C   . GLN A 1 1250 ? 42.646  25.958  40.088  1.00 11.10  ? 1250 GLN A C   1 
ATOM 7291  O O   . GLN A 1 1250 ? 41.467  26.053  39.759  1.00 15.93  ? 1250 GLN A O   1 
ATOM 7292  C CB  . GLN A 1 1250 ? 41.893  24.689  42.142  1.00 23.67  ? 1250 GLN A CB  1 
ATOM 7293  H HA  . GLN A 1 1250 ? 43.534  24.335  40.971  1.00 15.76  ? 1250 GLN A HA  1 
ATOM 7294  N N   . ASN A 1 1251 ? 43.632  26.528  39.401  1.00 9.63   ? 1251 ASN A N   1 
ATOM 7295  C CA  . ASN A 1 1251 ? 43.372  27.555  38.404  1.00 12.31  ? 1251 ASN A CA  1 
ATOM 7296  C C   . ASN A 1 1251 ? 43.405  27.036  36.974  1.00 20.47  ? 1251 ASN A C   1 
ATOM 7297  O O   . ASN A 1 1251 ? 43.217  27.827  36.045  1.00 23.75  ? 1251 ASN A O   1 
ATOM 7298  C CB  . ASN A 1 1251 ? 44.382  28.693  38.551  1.00 8.97   ? 1251 ASN A CB  1 
ATOM 7299  H H   . ASN A 1 1251 ? 44.465  26.334  39.495  1.00 11.56  ? 1251 ASN A H   1 
ATOM 7300  H HA  . ASN A 1 1251 ? 42.489  27.923  38.562  1.00 14.77  ? 1251 ASN A HA  1 
ATOM 7301  N N   . GLN A 1 1252 ? 43.642  25.740  36.771  1.00 26.22  ? 1252 GLN A N   1 
ATOM 7302  C CA  . GLN A 1 1252 ? 43.592  25.174  35.428  1.00 36.56  ? 1252 GLN A CA  1 
ATOM 7303  C C   . GLN A 1 1252 ? 42.881  23.820  35.433  1.00 42.36  ? 1252 GLN A C   1 
ATOM 7304  O O   . GLN A 1 1252 ? 41.732  23.720  34.986  1.00 36.75  ? 1252 GLN A O   1 
ATOM 7305  C CB  . GLN A 1 1252 ? 45.006  25.041  34.854  1.00 39.22  ? 1252 GLN A CB  1 
ATOM 7306  H H   . GLN A 1 1252 ? 43.832  25.174  37.390  1.00 31.46  ? 1252 GLN A H   1 
ATOM 7307  H HA  . GLN A 1 1252 ? 43.091  25.773  34.852  1.00 43.87  ? 1252 GLN A HA  1 
ATOM 7308  N N   . ALA A 1 1253 ? 43.550  22.774  35.940  1.00 55.75  ? 1253 ALA A N   1 
ATOM 7309  C CA  . ALA A 1 1253 ? 42.920  21.457  36.014  1.00 41.20  ? 1253 ALA A CA  1 
ATOM 7310  C C   . ALA A 1 1253 ? 41.678  21.495  36.892  1.00 32.81  ? 1253 ALA A C   1 
ATOM 7311  O O   . ALA A 1 1253 ? 40.747  20.714  36.677  1.00 41.71  ? 1253 ALA A O   1 
ATOM 7312  C CB  . ALA A 1 1253 ? 43.900  20.407  36.554  1.00 27.90  ? 1253 ALA A CB  1 
ATOM 7313  H H   . ALA A 1 1253 ? 44.355  22.803  36.241  1.00 66.90  ? 1253 ALA A H   1 
ATOM 7314  H HA  . ALA A 1 1253 ? 42.649  21.185  35.124  1.00 49.44  ? 1253 ALA A HA  1 
ATOM 7315  H HB1 . ALA A 1 1253 ? 43.452  19.547  36.591  1.00 33.49  ? 1253 ALA A HB1 1 
ATOM 7316  H HB2 . ALA A 1 1253 ? 44.666  20.356  35.961  1.00 33.49  ? 1253 ALA A HB2 1 
ATOM 7317  H HB3 . ALA A 1 1253 ? 44.186  20.670  37.443  1.00 33.49  ? 1253 ALA A HB3 1 
ATOM 7318  N N   . LEU A 1 1254 ? 41.637  22.403  37.873  1.00 23.40  ? 1254 LEU A N   1 
ATOM 7319  C CA  . LEU A 1 1254 ? 40.546  22.406  38.832  1.00 19.93  ? 1254 LEU A CA  1 
ATOM 7320  C C   . LEU A 1 1254 ? 39.249  22.829  38.182  1.00 15.93  ? 1254 LEU A C   1 
ATOM 7321  O O   . LEU A 1 1254 ? 38.219  22.169  38.340  1.00 21.93  ? 1254 LEU A O   1 
ATOM 7322  C CB  . LEU A 1 1254 ? 40.862  23.345  39.975  1.00 18.78  ? 1254 LEU A CB  1 
ATOM 7323  H H   . LEU A 1 1254 ? 42.225  23.017  37.999  1.00 28.08  ? 1254 LEU A H   1 
ATOM 7324  H HA  . LEU A 1 1254 ? 40.431  21.513  39.193  1.00 23.91  ? 1254 LEU A HA  1 
ATOM 7325  N N   . LEU A 1 1255 ? 39.267  23.943  37.472  1.00 16.35  ? 1255 LEU A N   1 
ATOM 7326  C CA  . LEU A 1 1255 ? 38.083  24.360  36.747  1.00 23.14  ? 1255 LEU A CA  1 
ATOM 7327  C C   . LEU A 1 1255 ? 37.961  23.499  35.493  1.00 26.14  ? 1255 LEU A C   1 
ATOM 7328  O O   . LEU A 1 1255 ? 37.951  23.983  34.366  1.00 27.34  ? 1255 LEU A O   1 
ATOM 7329  C CB  . LEU A 1 1255 ? 38.152  25.845  36.421  1.00 25.58  ? 1255 LEU A CB  1 
ATOM 7330  H H   . LEU A 1 1255 ? 39.943  24.470  37.395  1.00 19.62  ? 1255 LEU A H   1 
ATOM 7331  H HA  . LEU A 1 1255 ? 37.300  24.207  37.298  1.00 27.77  ? 1255 LEU A HA  1 
ATOM 7332  N N   . HIS A 1 1256 ? 37.899  22.183  35.719  1.00 26.57  ? 1256 HIS A N   1 
ATOM 7333  C CA  . HIS A 1 1256 ? 37.815  21.233  34.612  1.00 35.97  ? 1256 HIS A CA  1 
ATOM 7334  C C   . HIS A 1 1256 ? 36.484  21.340  33.876  1.00 45.25  ? 1256 HIS A C   1 
ATOM 7335  O O   . HIS A 1 1256 ? 36.430  21.134  32.657  1.00 56.66  ? 1256 HIS A O   1 
ATOM 7336  C CB  . HIS A 1 1256 ? 38.015  19.807  35.124  1.00 44.77  ? 1256 HIS A CB  1 
ATOM 7337  H HA  . HIS A 1 1256 ? 38.524  21.426  33.978  1.00 43.16  ? 1256 HIS A HA  1 
ATOM 7338  N N   . LYS A 1 1257 ? 35.402  21.633  34.606  1.00 52.19  ? 1257 LYS A N   1 
ATOM 7339  C CA  . LYS A 1 1257 ? 34.051  21.817  34.065  1.00 65.21  ? 1257 LYS A CA  1 
ATOM 7340  C C   . LYS A 1 1257 ? 33.178  22.426  35.170  1.00 58.62  ? 1257 LYS A C   1 
ATOM 7341  O O   . LYS A 1 1257 ? 33.549  22.388  36.347  1.00 60.01  ? 1257 LYS A O   1 
ATOM 7342  C CB  . LYS A 1 1257 ? 33.464  20.493  33.562  1.00 72.70  ? 1257 LYS A CB  1 
ATOM 7343  H HA  . LYS A 1 1257 ? 34.083  22.440  33.322  1.00 78.25  ? 1257 LYS A HA  1 
ATOM 7344  N N   . HIS A 1 1258 ? 32.015  22.979  34.806  1.00 46.91  ? 1258 HIS A N   1 
ATOM 7345  C CA  . HIS A 1 1258 ? 31.239  23.706  35.811  1.00 42.93  ? 1258 HIS A CA  1 
ATOM 7346  C C   . HIS A 1 1258 ? 29.800  23.973  35.332  1.00 47.22  ? 1258 HIS A C   1 
ATOM 7347  O O   . HIS A 1 1258 ? 29.399  23.525  34.254  1.00 46.21  ? 1258 HIS A O   1 
ATOM 7348  C CB  . HIS A 1 1258 ? 31.958  25.008  36.173  1.00 49.14  ? 1258 HIS A CB  1 
ATOM 7349  H HA  . HIS A 1 1258 ? 31.186  23.165  36.614  1.00 51.52  ? 1258 HIS A HA  1 
ATOM 7350  N N   . ILE A 1 1259 ? 29.013  24.714  36.180  1.00 53.49  ? 1259 ILE A N   1 
ATOM 7351  C CA  . ILE A 1 1259 ? 27.602  25.053  35.912  1.00 32.87  ? 1259 ILE A CA  1 
ATOM 7352  C C   . ILE A 1 1259 ? 27.507  26.301  35.043  1.00 24.79  ? 1259 ILE A C   1 
ATOM 7353  O O   . ILE A 1 1259 ? 28.437  27.097  34.950  1.00 53.65  ? 1259 ILE A O   1 
ATOM 7354  C CB  . ILE A 1 1259 ? 26.817  25.263  37.219  1.00 25.93  ? 1259 ILE A CB  1 
ATOM 7355  H HA  . ILE A 1 1259 ? 27.189  24.320  35.429  1.00 39.44  ? 1259 ILE A HA  1 
ATOM 7356  N N   . ASN A 1 1260 ? 26.336  26.505  34.443  1.00 9.11   ? 1260 ASN A N   1 
ATOM 7357  C CA  . ASN A 1 1260 ? 26.178  27.516  33.417  1.00 9.11   ? 1260 ASN A CA  1 
ATOM 7358  C C   . ASN A 1 1260 ? 25.426  28.710  33.984  1.00 9.11   ? 1260 ASN A C   1 
ATOM 7359  O O   . ASN A 1 1260 ? 24.657  28.565  34.933  1.00 9.11   ? 1260 ASN A O   1 
ATOM 7360  C CB  . ASN A 1 1260 ? 25.424  26.942  32.217  1.00 9.11   ? 1260 ASN A CB  1 
ATOM 7361  H H   . ASN A 1 1260 ? 25.618  26.065  34.617  1.00 10.93  ? 1260 ASN A H   1 
ATOM 7362  H HA  . ASN A 1 1260 ? 27.051  27.814  33.119  1.00 10.93  ? 1260 ASN A HA  1 
ATOM 7363  N N   . LEU A 1 1261 ? 25.703  29.891  33.404  1.00 10.27  ? 1261 LEU A N   1 
ATOM 7364  C CA  . LEU A 1 1261 ? 24.969  31.135  33.648  1.00 9.09   ? 1261 LEU A CA  1 
ATOM 7365  C C   . LEU A 1 1261 ? 23.859  31.312  32.612  1.00 9.09   ? 1261 LEU A C   1 
ATOM 7366  O O   . LEU A 1 1261 ? 24.042  31.018  31.428  1.00 10.24  ? 1261 LEU A O   1 
ATOM 7367  C CB  . LEU A 1 1261 ? 25.894  32.352  33.589  1.00 9.09   ? 1261 LEU A CB  1 
ATOM 7368  H HA  . LEU A 1 1261 ? 24.564  31.102  34.528  1.00 10.91  ? 1261 LEU A HA  1 
ATOM 7369  N N   . PHE A 1 1262 ? 22.723  31.826  33.055  1.00 8.92   ? 1262 PHE A N   1 
ATOM 7370  C CA  . PHE A 1 1262 ? 21.539  31.819  32.213  1.00 8.92   ? 1262 PHE A CA  1 
ATOM 7371  C C   . PHE A 1 1262 ? 21.735  32.717  31.013  1.00 8.92   ? 1262 PHE A C   1 
ATOM 7372  O O   . PHE A 1 1262 ? 22.259  33.824  31.138  1.00 8.92   ? 1262 PHE A O   1 
ATOM 7373  C CB  . PHE A 1 1262 ? 20.329  32.287  33.009  1.00 14.11  ? 1262 PHE A CB  1 
ATOM 7374  H H   . PHE A 1 1262 ? 22.611  32.181  33.830  1.00 10.70  ? 1262 PHE A H   1 
ATOM 7375  H HA  . PHE A 1 1262 ? 21.371  30.917  31.899  1.00 10.70  ? 1262 PHE A HA  1 
ATOM 7376  N N   . LEU A 1 1263 ? 21.284  32.253  29.850  1.00 8.96   ? 1263 LEU A N   1 
ATOM 7377  C CA  . LEU A 1 1263 ? 21.477  33.045  28.639  1.00 11.24  ? 1263 LEU A CA  1 
ATOM 7378  C C   . LEU A 1 1263 ? 20.668  32.463  27.470  1.00 19.16  ? 1263 LEU A C   1 
ATOM 7379  O O   . LEU A 1 1263 ? 19.878  31.523  27.639  1.00 18.10  ? 1263 LEU A O   1 
ATOM 7380  C CB  . LEU A 1 1263 ? 22.972  33.144  28.326  1.00 11.10  ? 1263 LEU A CB  1 
ATOM 7381  H H   . LEU A 1 1263 ? 20.875  31.505  29.737  1.00 10.75  ? 1263 LEU A H   1 
ATOM 7382  H HA  . LEU A 1 1263 ? 21.151  33.944  28.802  1.00 13.49  ? 1263 LEU A HA  1 
ATOM 7383  N N   . ASN A 1 1264 ? 20.884  33.059  26.258  1.00 23.15  ? 1264 ASN A N   1 
ATOM 7384  C CA  . ASN A 1 1264 ? 20.280  32.847  24.938  1.00 21.23  ? 1264 ASN A CA  1 
ATOM 7385  C C   . ASN A 1 1264 ? 18.871  33.419  24.892  1.00 26.80  ? 1264 ASN A C   1 
ATOM 7386  O O   . ASN A 1 1264 ? 18.704  34.647  24.868  1.00 28.39  ? 1264 ASN A O   1 
ATOM 7387  C CB  . ASN A 1 1264 ? 20.252  31.363  24.568  1.00 16.10  ? 1264 ASN A CB  1 
ATOM 7388  H HA  . ASN A 1 1264 ? 20.811  33.309  24.271  1.00 25.47  ? 1264 ASN A HA  1 
ATOM 7389  N N   . PRO A 1 1265 ? 17.843  32.567  24.858  1.00 33.60  ? 1265 PRO A N   1 
ATOM 7390  C CA  . PRO A 1 1265 ? 16.464  33.064  24.967  1.00 39.60  ? 1265 PRO A CA  1 
ATOM 7391  C C   . PRO A 1 1265 ? 16.201  33.678  26.337  1.00 49.42  ? 1265 PRO A C   1 
ATOM 7392  O O   . PRO A 1 1265 ? 16.584  33.118  27.366  1.00 45.55  ? 1265 PRO A O   1 
ATOM 7393  C CB  . PRO A 1 1265 ? 15.614  31.805  24.758  1.00 39.37  ? 1265 PRO A CB  1 
ATOM 7394  H HA  . PRO A 1 1265 ? 16.273  33.712  24.271  1.00 47.52  ? 1265 PRO A HA  1 
ATOM 7395  N N   . GLY A 1 1266 ? 15.500  34.811  26.338  1.00 54.59  ? 1266 GLY A N   1 
ATOM 7396  C CA  . GLY A 1 1266 ? 15.290  35.563  27.579  1.00 50.22  ? 1266 GLY A CA  1 
ATOM 7397  C C   . GLY A 1 1266 ? 16.487  36.456  27.938  1.00 43.20  ? 1266 GLY A C   1 
ATOM 7398  O O   . GLY A 1 1266 ? 17.016  37.176  27.078  1.00 39.35  ? 1266 GLY A O   1 
ATOM 7399  H H   . GLY A 1 1266 ? 15.138  35.164  25.642  1.00 65.51  ? 1266 GLY A H   1 
ATOM 7400  H HA2 . GLY A 1 1266 ? 14.505  36.126  27.486  1.00 60.27  ? 1266 GLY A HA2 1 
ATOM 7401  H HA3 . GLY A 1 1266 ? 15.139  34.944  28.310  1.00 60.27  ? 1266 GLY A HA3 1 
ATOM 7402  N N   . ILE A 1 1267 ? 16.918  36.414  29.211  1.00 42.37  ? 1267 ILE A N   1 
ATOM 7403  C CA  . ILE A 1 1267 ? 18.040  37.227  29.702  1.00 31.24  ? 1267 ILE A CA  1 
ATOM 7404  C C   . ILE A 1 1267 ? 18.653  36.670  31.009  1.00 41.94  ? 1267 ILE A C   1 
ATOM 7405  O O   . ILE A 1 1267 ? 18.072  35.774  31.632  1.00 59.27  ? 1267 ILE A O   1 
ATOM 7406  C CB  . ILE A 1 1267 ? 17.580  38.685  29.886  1.00 36.49  ? 1267 ILE A CB  1 
ATOM 7407  H HA  . ILE A 1 1267 ? 18.739  37.225  29.029  1.00 37.48  ? 1267 ILE A HA  1 
ATOM 7408  N N   . LEU A 1 1268 ? 19.814  37.200  31.441  1.00 31.09  ? 1268 LEU A N   1 
ATOM 7409  C CA  . LEU A 1 1268 ? 20.607  36.640  32.550  1.00 14.26  ? 1268 LEU A CA  1 
ATOM 7410  C C   . LEU A 1 1268 ? 20.038  37.049  33.912  1.00 15.95  ? 1268 LEU A C   1 
ATOM 7411  O O   . LEU A 1 1268 ? 19.043  37.763  34.007  1.00 24.57  ? 1268 LEU A O   1 
ATOM 7412  C CB  . LEU A 1 1268 ? 22.064  37.079  32.448  1.00 9.13   ? 1268 LEU A CB  1 
ATOM 7413  H H   . LEU A 1 1268 ? 20.170  37.903  31.096  1.00 37.30  ? 1268 LEU A H   1 
ATOM 7414  H HA  . LEU A 1 1268 ? 20.583  35.672  32.495  1.00 17.11  ? 1268 LEU A HA  1 
ATOM 7415  N N   . GLU A 1 1269 ? 20.674  36.612  34.996  1.00 10.33  ? 1269 GLU A N   1 
ATOM 7416  C CA  . GLU A 1 1269 ? 20.043  36.674  36.316  1.00 17.14  ? 1269 GLU A CA  1 
ATOM 7417  C C   . GLU A 1 1269 ? 20.526  37.868  37.156  1.00 17.16  ? 1269 GLU A C   1 
ATOM 7418  O O   . GLU A 1 1269 ? 21.460  38.577  36.777  1.00 19.63  ? 1269 GLU A O   1 
ATOM 7419  C CB  . GLU A 1 1269 ? 20.309  35.369  37.057  1.00 19.85  ? 1269 GLU A CB  1 
ATOM 7420  H HA  . GLU A 1 1269 ? 19.084  36.761  36.201  1.00 20.57  ? 1269 GLU A HA  1 
ATOM 7421  N N   . ALA A 1 1270 ? 19.889  38.058  38.337  1.00 16.26  ? 1270 ALA A N   1 
ATOM 7422  C CA  . ALA A 1 1270 ? 20.111  39.178  39.262  1.00 12.43  ? 1270 ALA A CA  1 
ATOM 7423  C C   . ALA A 1 1270 ? 20.680  38.734  40.620  1.00 12.62  ? 1270 ALA A C   1 
ATOM 7424  O O   . ALA A 1 1270 ? 20.539  37.582  41.027  1.00 15.34  ? 1270 ALA A O   1 
ATOM 7425  C CB  . ALA A 1 1270 ? 18.815  39.936  39.512  1.00 11.64  ? 1270 ALA A CB  1 
ATOM 7426  H HA  . ALA A 1 1270 ? 20.744  39.794  38.861  1.00 14.92  ? 1270 ALA A HA  1 
ATOM 7427  H HB1 . ALA A 1 1270 ? 18.991  40.668  40.124  1.00 13.97  ? 1270 ALA A HB1 1 
ATOM 7428  H HB2 . ALA A 1 1270 ? 18.485  40.282  38.668  1.00 13.97  ? 1270 ALA A HB2 1 
ATOM 7429  H HB3 . ALA A 1 1270 ? 18.164  39.329  39.898  1.00 13.97  ? 1270 ALA A HB3 1 
ATOM 7430  N N   . VAL A 1 1271 ? 21.247  39.696  41.360  1.00 10.72  ? 1271 VAL A N   1 
ATOM 7431  C CA  . VAL A 1 1271 ? 22.242  39.450  42.420  1.00 8.97   ? 1271 VAL A CA  1 
ATOM 7432  C C   . VAL A 1 1271 ? 22.920  38.106  42.222  1.00 13.32  ? 1271 VAL A C   1 
ATOM 7433  O O   . VAL A 1 1271 ? 23.108  37.338  43.173  1.00 8.97   ? 1271 VAL A O   1 
ATOM 7434  C CB  . VAL A 1 1271 ? 21.664  39.521  43.843  1.00 10.11  ? 1271 VAL A CB  1 
ATOM 7435  H H   . VAL A 1 1271 ? 21.065  40.531  41.264  1.00 12.86  ? 1271 VAL A H   1 
ATOM 7436  H HA  . VAL A 1 1271 ? 22.929  40.132  42.354  1.00 10.76  ? 1271 VAL A HA  1 
ATOM 7437  N N   . THR A 1 1272 ? 23.267  37.829  40.972  1.00 13.74  ? 1272 THR A N   1 
ATOM 7438  C CA  . THR A 1 1272 ? 24.296  36.866  40.618  1.00 15.67  ? 1272 THR A CA  1 
ATOM 7439  C C   . THR A 1 1272 ? 25.208  37.446  39.535  1.00 20.44  ? 1272 THR A C   1 
ATOM 7440  O O   . THR A 1 1272 ? 26.206  36.806  39.194  1.00 23.57  ? 1272 THR A O   1 
ATOM 7441  C CB  . THR A 1 1272 ? 23.670  35.547  40.133  1.00 12.99  ? 1272 THR A CB  1 
ATOM 7442  H HA  . THR A 1 1272 ? 24.837  36.675  41.400  1.00 18.81  ? 1272 THR A HA  1 
ATOM 7443  N N   . MET A 1 1273 ? 24.906  38.645  39.005  1.00 20.87  ? 1273 MET A N   1 
ATOM 7444  C CA  . MET A 1 1273 ? 25.723  39.260  37.967  1.00 18.56  ? 1273 MET A CA  1 
ATOM 7445  C C   . MET A 1 1273 ? 26.984  39.906  38.538  1.00 16.83  ? 1273 MET A C   1 
ATOM 7446  O O   . MET A 1 1273 ? 28.062  39.780  37.952  1.00 20.70  ? 1273 MET A O   1 
ATOM 7447  C CB  . MET A 1 1273 ? 24.916  40.318  37.194  1.00 17.59  ? 1273 MET A CB  1 
ATOM 7448  H H   . MET A 1 1273 ? 24.226  39.118  39.237  1.00 25.04  ? 1273 MET A H   1 
ATOM 7449  H HA  . MET A 1 1273 ? 25.987  38.573  37.335  1.00 22.27  ? 1273 MET A HA  1 
ATOM 7450  N N   . GLN A 1 1274 ? 26.863  40.641  39.651  1.00 17.47  ? 1274 GLN A N   1 
ATOM 7451  C CA  . GLN A 1 1274 ? 28.027  41.159  40.377  1.00 23.27  ? 1274 GLN A CA  1 
ATOM 7452  C C   . GLN A 1 1274 ? 28.986  40.042  40.799  1.00 32.17  ? 1274 GLN A C   1 
ATOM 7453  O O   . GLN A 1 1274 ? 30.094  39.888  40.246  1.00 33.64  ? 1274 GLN A O   1 
ATOM 7454  C CB  . GLN A 1 1274 ? 27.563  41.948  41.609  1.00 21.29  ? 1274 GLN A CB  1 
ATOM 7455  H H   . GLN A 1 1274 ? 26.110  40.855  40.007  1.00 20.97  ? 1274 GLN A H   1 
ATOM 7456  H HA  . GLN A 1 1274 ? 28.513  41.767  39.798  1.00 27.92  ? 1274 GLN A HA  1 
ATOM 7457  N N   . HIS A 1 1275 ? 28.557  39.235  41.768  1.00 38.92  ? 1275 HIS A N   1 
ATOM 7458  C CA  . HIS A 1 1275 ? 29.398  38.152  42.259  1.00 41.77  ? 1275 HIS A CA  1 
ATOM 7459  C C   . HIS A 1 1275 ? 29.788  37.206  41.130  1.00 28.03  ? 1275 HIS A C   1 
ATOM 7460  O O   . HIS A 1 1275 ? 30.808  36.515  41.233  1.00 22.79  ? 1275 HIS A O   1 
ATOM 7461  C CB  . HIS A 1 1275 ? 28.665  37.395  43.371  1.00 57.27  ? 1275 HIS A CB  1 
ATOM 7462  H H   . HIS A 1 1275 ? 27.790  39.294  42.153  1.00 46.70  ? 1275 HIS A H   1 
ATOM 7463  H HA  . HIS A 1 1275 ? 30.211  38.526  42.634  1.00 50.12  ? 1275 HIS A HA  1 
ATOM 7464  N N   . ILE A 1 1276 ? 28.987  37.159  40.055  1.00 27.21  ? 1276 ILE A N   1 
ATOM 7465  C CA  . ILE A 1 1276 ? 29.285  36.289  38.932  1.00 24.82  ? 1276 ILE A CA  1 
ATOM 7466  C C   . ILE A 1 1276 ? 30.468  36.824  38.133  1.00 26.72  ? 1276 ILE A C   1 
ATOM 7467  O O   . ILE A 1 1276 ? 31.449  36.113  37.956  1.00 23.87  ? 1276 ILE A O   1 
ATOM 7468  C CB  . ILE A 1 1276 ? 28.030  36.106  38.059  1.00 25.08  ? 1276 ILE A CB  1 
ATOM 7469  H H   . ILE A 1 1276 ? 28.270  37.624  39.962  1.00 32.65  ? 1276 ILE A H   1 
ATOM 7470  H HA  . ILE A 1 1276 ? 29.534  35.416  39.274  1.00 29.79  ? 1276 ILE A HA  1 
ATOM 7471  N N   . PHE A 1 1277 ? 30.397  38.064  37.626  1.00 32.06  ? 1277 PHE A N   1 
ATOM 7472  C CA  . PHE A 1 1277 ? 31.523  38.622  36.864  1.00 26.48  ? 1277 PHE A CA  1 
ATOM 7473  C C   . PHE A 1 1277 ? 32.815  38.468  37.643  1.00 23.18  ? 1277 PHE A C   1 
ATOM 7474  O O   . PHE A 1 1277 ? 33.848  38.010  37.112  1.00 17.59  ? 1277 PHE A O   1 
ATOM 7475  C CB  . PHE A 1 1277 ? 31.276  40.099  36.555  1.00 22.96  ? 1277 PHE A CB  1 
ATOM 7476  H H   . PHE A 1 1277 ? 29.723  38.591  37.708  1.00 38.47  ? 1277 PHE A H   1 
ATOM 7477  H HA  . PHE A 1 1277 ? 31.612  38.144  36.025  1.00 31.78  ? 1277 PHE A HA  1 
ATOM 7478  N N   . MET A 1 1278 ? 32.763  38.838  38.922  1.00 24.28  ? 1278 MET A N   1 
ATOM 7479  C CA  . MET A 1 1278 ? 33.869  38.516  39.800  1.00 27.58  ? 1278 MET A CA  1 
ATOM 7480  C C   . MET A 1 1278 ? 34.205  37.041  39.676  1.00 34.11  ? 1278 MET A C   1 
ATOM 7481  O O   . MET A 1 1278 ? 35.351  36.664  39.390  1.00 47.83  ? 1278 MET A O   1 
ATOM 7482  C CB  . MET A 1 1278 ? 33.497  38.859  41.242  1.00 27.76  ? 1278 MET A CB  1 
ATOM 7483  H H   . MET A 1 1278 ? 32.115  39.265  39.291  1.00 29.14  ? 1278 MET A H   1 
ATOM 7484  H HA  . MET A 1 1278 ? 34.643  39.045  39.550  1.00 33.10  ? 1278 MET A HA  1 
ATOM 7485  N N   . ASN A 1 1279 ? 33.181  36.200  39.810  1.00 28.35  ? 1279 ASN A N   1 
ATOM 7486  C CA  . ASN A 1 1279 ? 33.358  34.760  39.886  1.00 33.02  ? 1279 ASN A CA  1 
ATOM 7487  C C   . ASN A 1 1279 ? 33.978  34.201  38.604  1.00 47.30  ? 1279 ASN A C   1 
ATOM 7488  O O   . ASN A 1 1279 ? 34.760  33.238  38.643  1.00 65.55  ? 1279 ASN A O   1 
ATOM 7489  C CB  . ASN A 1 1279 ? 31.997  34.123  40.170  1.00 26.10  ? 1279 ASN A CB  1 
ATOM 7490  H H   . ASN A 1 1279 ? 32.359  36.449  39.860  1.00 34.02  ? 1279 ASN A H   1 
ATOM 7491  H HA  . ASN A 1 1279 ? 33.950  34.551  40.625  1.00 39.63  ? 1279 ASN A HA  1 
ATOM 7492  N N   . ASN A 1 1280 ? 33.636  34.798  37.461  1.00 38.39  ? 1280 ASN A N   1 
ATOM 7493  C CA  . ASN A 1 1280 ? 34.245  34.464  36.189  1.00 38.77  ? 1280 ASN A CA  1 
ATOM 7494  C C   . ASN A 1 1280 ? 35.734  34.772  36.216  1.00 45.28  ? 1280 ASN A C   1 
ATOM 7495  O O   . ASN A 1 1280 ? 36.552  33.909  35.884  1.00 58.27  ? 1280 ASN A O   1 
ATOM 7496  C CB  . ASN A 1 1280 ? 33.559  35.243  35.070  1.00 33.78  ? 1280 ASN A CB  1 
ATOM 7497  H H   . ASN A 1 1280 ? 33.038  35.414  37.403  1.00 46.07  ? 1280 ASN A H   1 
ATOM 7498  H HA  . ASN A 1 1280 ? 34.132  33.516  36.017  1.00 46.53  ? 1280 ASN A HA  1 
ATOM 7499  N N   . PHE A 1 1281 ? 36.112  35.991  36.630  1.00 31.42  ? 1281 PHE A N   1 
ATOM 7500  C CA  . PHE A 1 1281 ? 37.540  36.290  36.717  1.00 30.70  ? 1281 PHE A CA  1 
ATOM 7501  C C   . PHE A 1 1281 ? 38.294  35.407  37.726  1.00 42.56  ? 1281 PHE A C   1 
ATOM 7502  O O   . PHE A 1 1281 ? 39.524  35.310  37.623  1.00 36.38  ? 1281 PHE A O   1 
ATOM 7503  C CB  . PHE A 1 1281 ? 37.759  37.761  37.076  1.00 24.78  ? 1281 PHE A CB  1 
ATOM 7504  H H   . PHE A 1 1281 ? 35.585  36.632  36.856  1.00 37.70  ? 1281 PHE A H   1 
ATOM 7505  H HA  . PHE A 1 1281 ? 37.938  36.140  35.845  1.00 36.85  ? 1281 PHE A HA  1 
ATOM 7506  N N   . GLN A 1 1282 ? 37.592  34.777  38.700  1.00 54.76  ? 1282 GLN A N   1 
ATOM 7507  C CA  . GLN A 1 1282 ? 38.211  33.920  39.730  1.00 44.19  ? 1282 GLN A CA  1 
ATOM 7508  C C   . GLN A 1 1282 ? 38.215  32.402  39.452  1.00 26.49  ? 1282 GLN A C   1 
ATOM 7509  O O   . GLN A 1 1282 ? 38.917  31.670  40.168  1.00 18.03  ? 1282 GLN A O   1 
ATOM 7510  C CB  . GLN A 1 1282 ? 37.504  34.121  41.075  1.00 39.65  ? 1282 GLN A CB  1 
ATOM 7511  H H   . GLN A 1 1282 ? 36.738  34.836  38.781  1.00 65.71  ? 1282 GLN A H   1 
ATOM 7512  H HA  . GLN A 1 1282 ? 39.134  34.197  39.841  1.00 53.03  ? 1282 GLN A HA  1 
ATOM 7513  N N   . LEU A 1 1283 ? 37.427  31.893  38.495  1.00 29.71  ? 1283 LEU A N   1 
ATOM 7514  C CA  . LEU A 1 1283 ? 37.477  30.466  38.195  1.00 17.89  ? 1283 LEU A CA  1 
ATOM 7515  C C   . LEU A 1 1283 ? 38.825  30.072  37.600  1.00 21.15  ? 1283 LEU A C   1 
ATOM 7516  O O   . LEU A 1 1283 ? 39.287  28.950  37.822  1.00 32.32  ? 1283 LEU A O   1 
ATOM 7517  C CB  . LEU A 1 1283 ? 36.347  30.077  37.244  1.00 16.20  ? 1283 LEU A CB  1 
ATOM 7518  H H   . LEU A 1 1283 ? 36.871  32.344  38.020  1.00 35.65  ? 1283 LEU A H   1 
ATOM 7519  H HA  . LEU A 1 1283 ? 37.358  29.968  39.019  1.00 21.47  ? 1283 LEU A HA  1 
ATOM 7520  N N   . CYS A 1 1284 ? 39.452  30.949  36.808  1.00 23.66  ? 1284 CYS A N   1 
ATOM 7521  C CA  . CYS A 1 1284 ? 40.812  30.705  36.337  1.00 22.48  ? 1284 CYS A CA  1 
ATOM 7522  C C   . CYS A 1 1284 ? 41.472  32.064  36.109  1.00 22.18  ? 1284 CYS A C   1 
ATOM 7523  O O   . CYS A 1 1284 ? 41.202  32.721  35.105  1.00 24.81  ? 1284 CYS A O   1 
ATOM 7524  C CB  . CYS A 1 1284 ? 40.795  29.857  35.068  1.00 21.35  ? 1284 CYS A CB  1 
ATOM 7525  H H   . CYS A 1 1284 ? 39.110  31.688  36.531  1.00 28.39  ? 1284 CYS A H   1 
ATOM 7526  H HA  . CYS A 1 1284 ? 41.312  30.230  37.019  1.00 26.98  ? 1284 CYS A HA  1 
ATOM 7527  N N   . SER A 1 1285 ? 42.349  32.473  37.036  1.00 19.30  ? 1285 SER A N   1 
ATOM 7528  C CA  . SER A 1 1285 ? 43.157  33.678  36.886  1.00 21.30  ? 1285 SER A CA  1 
ATOM 7529  C C   . SER A 1 1285 ? 44.526  33.426  37.513  1.00 18.91  ? 1285 SER A C   1 
ATOM 7530  O O   . SER A 1 1285 ? 44.605  32.839  38.598  1.00 11.62  ? 1285 SER A O   1 
ATOM 7531  C CB  . SER A 1 1285 ? 42.493  34.902  37.532  1.00 26.49  ? 1285 SER A CB  1 
ATOM 7532  H H   . SER A 1 1285 ? 42.492  32.057  37.775  1.00 23.16  ? 1285 SER A H   1 
ATOM 7533  H HA  . SER A 1 1285 ? 43.283  33.864  35.942  1.00 25.55  ? 1285 SER A HA  1 
ATOM 7534  N N   . GLU A 1 1286 ? 45.602  33.877  36.824  1.00 24.11  ? 1286 GLU A N   1 
ATOM 7535  C CA  . GLU A 1 1286 ? 46.974  33.606  37.274  1.00 30.74  ? 1286 GLU A CA  1 
ATOM 7536  C C   . GLU A 1 1286 ? 48.164  34.097  36.406  1.00 30.97  ? 1286 GLU A C   1 
ATOM 7537  O O   . GLU A 1 1286 ? 48.140  33.985  35.176  1.00 27.18  ? 1286 GLU A O   1 
ATOM 7538  C CB  . GLU A 1 1286 ? 47.089  32.089  37.468  1.00 32.45  ? 1286 GLU A CB  1 
ATOM 7539  H HA  . GLU A 1 1286 ? 47.082  34.012  38.148  1.00 36.89  ? 1286 GLU A HA  1 
ATOM 7540  N N   . ILE A 1 1287 ? 49.233  34.596  37.054  1.00 23.36  ? 1287 ILE A N   1 
ATOM 7541  C CA  . ILE A 1 1287 ? 50.466  34.992  36.354  1.00 17.18  ? 1287 ILE A CA  1 
ATOM 7542  C C   . ILE A 1 1287 ? 51.301  33.819  35.922  1.00 21.64  ? 1287 ILE A C   1 
ATOM 7543  O O   . ILE A 1 1287 ? 52.020  33.925  34.921  1.00 18.71  ? 1287 ILE A O   1 
ATOM 7544  C CB  . ILE A 1 1287 ? 51.303  35.935  37.241  1.00 9.29   ? 1287 ILE A CB  1 
ATOM 7545  H H   . ILE A 1 1287 ? 49.266  34.716  37.905  1.00 28.03  ? 1287 ILE A H   1 
ATOM 7546  H HA  . ILE A 1 1287 ? 50.221  35.485  35.555  1.00 20.62  ? 1287 ILE A HA  1 
ATOM 7547  N N   . ASN A 1 1288 ? 51.189  32.679  36.597  1.00 30.68  ? 1288 ASN A N   1 
ATOM 7548  C CA  . ASN A 1 1288 ? 51.934  31.504  36.176  1.00 33.75  ? 1288 ASN A CA  1 
ATOM 7549  C C   . ASN A 1 1288 ? 51.306  30.843  34.951  1.00 34.93  ? 1288 ASN A C   1 
ATOM 7550  O O   . ASN A 1 1288 ? 52.026  30.395  34.046  1.00 53.35  ? 1288 ASN A O   1 
ATOM 7551  C CB  . ASN A 1 1288 ? 52.034  30.500  37.327  1.00 29.22  ? 1288 ASN A CB  1 
ATOM 7552  H HA  . ASN A 1 1288 ? 52.835  31.774  35.938  1.00 40.50  ? 1288 ASN A HA  1 
ATOM 7553  N N   . GLU A 1 1289 ? 49.981  30.811  34.874  1.00 27.99  ? 1289 GLU A N   1 
ATOM 7554  C CA  . GLU A 1 1289 ? 49.273  30.030  33.865  1.00 21.14  ? 1289 GLU A CA  1 
ATOM 7555  C C   . GLU A 1 1289 ? 48.518  30.939  32.906  1.00 13.89  ? 1289 GLU A C   1 
ATOM 7556  O O   . GLU A 1 1289 ? 47.632  31.687  33.320  1.00 15.95  ? 1289 GLU A O   1 
ATOM 7557  C CB  . GLU A 1 1289 ? 48.314  29.046  34.530  1.00 19.43  ? 1289 GLU A CB  1 
ATOM 7558  H H   . GLU A 1 1289 ? 49.459  31.241  35.405  1.00 33.59  ? 1289 GLU A H   1 
ATOM 7559  H HA  . GLU A 1 1289 ? 49.918  29.520  33.350  1.00 25.37  ? 1289 GLU A HA  1 
ATOM 7560  N N   . ARG A 1 1290 ? 48.860  30.851  31.623  1.00 10.84  ? 1290 ARG A N   1 
ATOM 7561  C CA  . ARG A 1 1290 ? 48.132  31.594  30.611  1.00 9.22   ? 1290 ARG A CA  1 
ATOM 7562  C C   . ARG A 1 1290 ? 46.720  31.085  30.435  1.00 10.76  ? 1290 ARG A C   1 
ATOM 7563  O O   . ARG A 1 1290 ? 45.939  31.734  29.738  1.00 13.54  ? 1290 ARG A O   1 
ATOM 7564  C CB  . ARG A 1 1290 ? 48.851  31.507  29.272  1.00 15.12  ? 1290 ARG A CB  1 
ATOM 7565  H HA  . ARG A 1 1290 ? 48.087  32.527  30.872  1.00 11.06  ? 1290 ARG A HA  1 
ATOM 7566  N N   . VAL A 1 1291 ? 46.380  29.942  31.035  1.00 9.27   ? 1291 VAL A N   1 
ATOM 7567  C CA  . VAL A 1 1291 ? 45.065  29.332  30.854  1.00 20.31  ? 1291 VAL A CA  1 
ATOM 7568  C C   . VAL A 1 1291 ? 43.941  30.134  31.480  1.00 47.03  ? 1291 VAL A C   1 
ATOM 7569  O O   . VAL A 1 1291 ? 42.749  29.784  31.322  1.00 65.52  ? 1291 VAL A O   1 
ATOM 7570  C CB  . VAL A 1 1291 ? 45.046  27.915  31.468  1.00 19.33  ? 1291 VAL A CB  1 
ATOM 7571  H HA  . VAL A 1 1291 ? 44.883  29.251  29.905  1.00 24.37  ? 1291 VAL A HA  1 
ATOM 7572  N N   . VAL A 1 1292 ? 44.288  31.204  32.193  1.00 65.79  ? 1292 VAL A N   1 
ATOM 7573  C CA  . VAL A 1 1292 ? 43.332  31.893  33.057  1.00 60.67  ? 1292 VAL A CA  1 
ATOM 7574  C C   . VAL A 1 1292 ? 42.352  32.751  32.247  1.00 60.31  ? 1292 VAL A C   1 
ATOM 7575  O O   . VAL A 1 1292 ? 41.134  32.623  32.412  1.00 53.56  ? 1292 VAL A O   1 
ATOM 7576  C CB  . VAL A 1 1292 ? 44.106  32.724  34.096  1.00 49.79  ? 1292 VAL A CB  1 
ATOM 7577  H H   . VAL A 1 1292 ? 45.075  31.552  32.193  1.00 78.95  ? 1292 VAL A H   1 
ATOM 7578  H HA  . VAL A 1 1292 ? 42.813  31.229  33.538  1.00 72.80  ? 1292 VAL A HA  1 
ATOM 7579  N N   . GLN A 1 1293 ? 42.862  33.646  31.378  1.00 59.00  ? 1293 GLN A N   1 
ATOM 7580  C CA  . GLN A 1 1293 ? 41.995  34.536  30.605  1.00 41.69  ? 1293 GLN A CA  1 
ATOM 7581  C C   . GLN A 1 1293 ? 40.912  33.765  29.856  1.00 39.16  ? 1293 GLN A C   1 
ATOM 7582  O O   . GLN A 1 1293 ? 39.760  34.201  29.809  1.00 51.80  ? 1293 GLN A O   1 
ATOM 7583  C CB  . GLN A 1 1293 ? 42.838  35.356  29.625  1.00 26.26  ? 1293 GLN A CB  1 
ATOM 7584  H H   . GLN A 1 1293 ? 43.702  33.752  31.224  1.00 70.81  ? 1293 GLN A H   1 
ATOM 7585  H HA  . GLN A 1 1293 ? 41.556  35.153  31.212  1.00 50.03  ? 1293 GLN A HA  1 
ATOM 7586  N N   . HIS A 1 1294 ? 41.262  32.635  29.242  1.00 32.40  ? 1294 HIS A N   1 
ATOM 7587  C CA  . HIS A 1 1294 ? 40.244  31.817  28.606  1.00 31.29  ? 1294 HIS A CA  1 
ATOM 7588  C C   . HIS A 1 1294 ? 39.332  31.124  29.635  1.00 36.34  ? 1294 HIS A C   1 
ATOM 7589  O O   . HIS A 1 1294 ? 38.116  31.107  29.452  1.00 38.88  ? 1294 HIS A O   1 
ATOM 7590  C CB  . HIS A 1 1294 ? 40.900  30.802  27.676  1.00 31.21  ? 1294 HIS A CB  1 
ATOM 7591  H H   . HIS A 1 1294 ? 42.063  32.330  29.183  1.00 38.89  ? 1294 HIS A H   1 
ATOM 7592  H HA  . HIS A 1 1294 ? 39.683  32.391  28.061  1.00 37.55  ? 1294 HIS A HA  1 
ATOM 7593  N N   . PHE A 1 1295 ? 39.875  30.549  30.725  1.00 30.44  ? 1295 PHE A N   1 
ATOM 7594  C CA  . PHE A 1 1295 ? 39.014  29.753  31.609  1.00 26.22  ? 1295 PHE A CA  1 
ATOM 7595  C C   . PHE A 1 1295 ? 38.082  30.609  32.450  1.00 26.94  ? 1295 PHE A C   1 
ATOM 7596  O O   . PHE A 1 1295 ? 37.156  30.062  33.065  1.00 22.09  ? 1295 PHE A O   1 
ATOM 7597  C CB  . PHE A 1 1295 ? 39.847  28.864  32.529  1.00 16.12  ? 1295 PHE A CB  1 
ATOM 7598  H H   . PHE A 1 1295 ? 40.699  30.602  30.963  1.00 36.53  ? 1295 PHE A H   1 
ATOM 7599  H HA  . PHE A 1 1295 ? 38.463  29.173  31.061  1.00 31.47  ? 1295 PHE A HA  1 
ATOM 7600  N N   . VAL A 1 1296 ? 38.349  31.919  32.520  1.00 47.23  ? 1296 VAL A N   1 
ATOM 7601  C CA  . VAL A 1 1296 ? 37.397  32.916  33.009  1.00 72.95  ? 1296 VAL A CA  1 
ATOM 7602  C C   . VAL A 1 1296 ? 36.474  33.413  31.885  1.00 88.38  ? 1296 VAL A C   1 
ATOM 7603  O O   . VAL A 1 1296 ? 35.272  33.622  32.107  1.00 95.43  ? 1296 VAL A O   1 
ATOM 7604  C CB  . VAL A 1 1296 ? 38.167  34.083  33.660  1.00 69.46  ? 1296 VAL A CB  1 
ATOM 7605  H H   . VAL A 1 1296 ? 39.100  32.261  32.281  1.00 56.67  ? 1296 VAL A H   1 
ATOM 7606  H HA  . VAL A 1 1296 ? 36.841  32.509  33.692  1.00 87.54  ? 1296 VAL A HA  1 
ATOM 7607  N N   . HIS A 1 1297 ? 37.018  33.645  30.676  1.00 94.33  ? 1297 HIS A N   1 
ATOM 7608  C CA  . HIS A 1 1297 ? 36.226  34.025  29.488  1.00 88.37  ? 1297 HIS A CA  1 
ATOM 7609  C C   . HIS A 1 1297 ? 36.849  33.420  28.210  1.00 76.92  ? 1297 HIS A C   1 
ATOM 7610  O O   . HIS A 1 1297 ? 37.328  34.105  27.307  1.00 83.24  ? 1297 HIS A O   1 
ATOM 7611  C CB  . HIS A 1 1297 ? 36.095  35.550  29.401  1.00 86.89  ? 1297 HIS A CB  1 
ATOM 7612  H H   . HIS A 1 1297 ? 37.861  33.586  30.517  1.00 113.20 ? 1297 HIS A H   1 
ATOM 7613  H HA  . HIS A 1 1297 ? 35.333  33.659  29.581  1.00 106.04 ? 1297 HIS A HA  1 
ATOM 7614  N N   . CYS A 1 1298 ? 36.863  32.084  28.120  1.00 65.35  ? 1298 CYS A N   1 
ATOM 7615  C CA  . CYS A 1 1298 ? 37.213  31.436  26.857  1.00 53.14  ? 1298 CYS A CA  1 
ATOM 7616  C C   . CYS A 1 1298 ? 36.160  31.710  25.786  1.00 62.62  ? 1298 CYS A C   1 
ATOM 7617  O O   . CYS A 1 1298 ? 36.488  31.761  24.594  1.00 65.57  ? 1298 CYS A O   1 
ATOM 7618  C CB  . CYS A 1 1298 ? 37.368  29.929  27.062  1.00 59.39  ? 1298 CYS A CB  1 
ATOM 7619  H HA  . CYS A 1 1298 ? 38.061  31.787  26.544  1.00 63.77  ? 1298 CYS A HA  1 
ATOM 7620  N N   . ILE A 1 1299 ? 34.900  31.903  26.197  1.00 72.15  ? 1299 ILE A N   1 
ATOM 7621  C CA  . ILE A 1 1299 ? 33.787  31.971  25.252  1.00 86.43  ? 1299 ILE A CA  1 
ATOM 7622  C C   . ILE A 1 1299 ? 33.782  33.307  24.513  1.00 81.72  ? 1299 ILE A C   1 
ATOM 7623  O O   . ILE A 1 1299 ? 33.615  33.363  23.288  1.00 88.75  ? 1299 ILE A O   1 
ATOM 7624  C CB  . ILE A 1 1299 ? 32.451  31.741  25.984  1.00 83.65  ? 1299 ILE A CB  1 
ATOM 7625  H HA  . ILE A 1 1299 ? 33.891  31.267  24.593  1.00 103.71 ? 1299 ILE A HA  1 
ATOM 7626  N N   . GLU A 1 1300 ? 33.928  34.407  25.255  1.00 80.82  ? 1300 GLU A N   1 
ATOM 7627  C CA  . GLU A 1 1300 ? 33.906  35.754  24.706  1.00 73.43  ? 1300 GLU A CA  1 
ATOM 7628  C C   . GLU A 1 1300 ? 34.867  35.930  23.527  1.00 54.38  ? 1300 GLU A C   1 
ATOM 7629  O O   . GLU A 1 1300 ? 34.436  36.070  22.375  1.00 58.76  ? 1300 GLU A O   1 
ATOM 7630  C CB  . GLU A 1 1300 ? 34.231  36.763  25.818  1.00 55.81  ? 1300 GLU A CB  1 
ATOM 7631  H H   . GLU A 1 1300 ? 34.044  34.391  26.107  1.00 96.98  ? 1300 GLU A H   1 
ATOM 7632  H HA  . GLU A 1 1300 ? 33.010  35.944  24.386  1.00 88.11  ? 1300 GLU A HA  1 
ATOM 7633  N N   . THR A 1 1301 ? 36.171  35.933  23.799  1.00 34.18  ? 1301 THR A N   1 
ATOM 7634  C CA  . THR A 1 1301 ? 37.159  36.214  22.770  1.00 20.55  ? 1301 THR A CA  1 
ATOM 7635  C C   . THR A 1 1301 ? 36.972  37.641  22.280  1.00 20.54  ? 1301 THR A C   1 
ATOM 7636  O O   . THR A 1 1301 ? 37.778  38.517  22.608  1.00 10.60  ? 1301 THR A O   1 
ATOM 7637  C CB  . THR A 1 1301 ? 37.042  35.239  21.595  1.00 19.30  ? 1301 THR A CB  1 
ATOM 7638  H HA  . THR A 1 1301 ? 38.049  36.134  23.147  1.00 24.66  ? 1301 THR A HA  1 
ATOM 7639  N N   . HIS A 1 1302 ? 35.879  37.895  21.543  1.00 35.81  ? 1302 HIS A N   1 
ATOM 7640  C CA  . HIS A 1 1302 ? 35.569  39.223  21.010  1.00 51.82  ? 1302 HIS A CA  1 
ATOM 7641  C C   . HIS A 1 1302 ? 34.127  39.718  21.226  1.00 64.95  ? 1302 HIS A C   1 
ATOM 7642  O O   . HIS A 1 1302 ? 33.916  40.939  21.151  1.00 71.65  ? 1302 HIS A O   1 
ATOM 7643  C CB  . HIS A 1 1302 ? 35.850  39.279  19.500  1.00 50.82  ? 1302 HIS A CB  1 
ATOM 7644  H H   . HIS A 1 1302 ? 35.294  37.299  21.337  1.00 42.97  ? 1302 HIS A H   1 
ATOM 7645  H HA  . HIS A 1 1302 ? 36.159  39.864  21.437  1.00 62.19  ? 1302 HIS A HA  1 
ATOM 7646  N N   . GLY A 1 1303 ? 33.128  38.828  21.426  1.00 65.43  ? 1303 GLY A N   1 
ATOM 7647  C CA  . GLY A 1 1303 ? 31.734  39.179  21.684  1.00 52.69  ? 1303 GLY A CA  1 
ATOM 7648  C C   . GLY A 1 1303 ? 31.289  39.298  23.145  1.00 50.97  ? 1303 GLY A C   1 
ATOM 7649  O O   . GLY A 1 1303 ? 30.112  39.599  23.390  1.00 44.87  ? 1303 GLY A O   1 
ATOM 7650  H H   . GLY A 1 1303 ? 33.254  37.977  21.413  1.00 78.52  ? 1303 GLY A H   1 
ATOM 7651  H HA2 . GLY A 1 1303 ? 31.550  40.030  21.256  1.00 63.23  ? 1303 GLY A HA2 1 
ATOM 7652  H HA3 . GLY A 1 1303 ? 31.169  38.512  21.264  1.00 63.23  ? 1303 GLY A HA3 1 
ATOM 7653  N N   . ARG A 1 1304 ? 32.188  39.085  24.122  1.00 42.69  ? 1304 ARG A N   1 
ATOM 7654  C CA  . ARG A 1 1304 ? 31.844  39.177  25.545  1.00 34.42  ? 1304 ARG A CA  1 
ATOM 7655  C C   . ARG A 1 1304 ? 30.985  40.385  25.824  1.00 32.16  ? 1304 ARG A C   1 
ATOM 7656  O O   . ARG A 1 1304 ? 29.959  40.288  26.506  1.00 32.03  ? 1304 ARG A O   1 
ATOM 7657  C CB  . ARG A 1 1304 ? 33.104  39.287  26.410  1.00 14.73  ? 1304 ARG A CB  1 
ATOM 7658  H HA  . ARG A 1 1304 ? 31.355  38.383  25.812  1.00 41.30  ? 1304 ARG A HA  1 
ATOM 7659  N N   . ASN A 1 1305 ? 31.418  41.531  25.306  1.00 32.89  ? 1305 ASN A N   1 
ATOM 7660  C CA  . ASN A 1 1305 ? 30.831  42.807  25.683  1.00 43.93  ? 1305 ASN A CA  1 
ATOM 7661  C C   . ASN A 1 1305 ? 29.319  42.763  25.546  1.00 45.91  ? 1305 ASN A C   1 
ATOM 7662  O O   . ASN A 1 1305 ? 28.591  43.314  26.388  1.00 41.02  ? 1305 ASN A O   1 
ATOM 7663  C CB  . ASN A 1 1305 ? 31.432  43.923  24.822  1.00 41.34  ? 1305 ASN A CB  1 
ATOM 7664  H H   . ASN A 1 1305 ? 32.054  41.595  24.731  1.00 39.47  ? 1305 ASN A H   1 
ATOM 7665  H HA  . ASN A 1 1305 ? 31.044  42.993  26.610  1.00 52.71  ? 1305 ASN A HA  1 
ATOM 7666  N N   . VAL A 1 1306 ? 28.829  42.055  24.522  1.00 52.01  ? 1306 VAL A N   1 
ATOM 7667  C CA  . VAL A 1 1306 ? 27.402  42.071  24.226  1.00 52.21  ? 1306 VAL A CA  1 
ATOM 7668  C C   . VAL A 1 1306 ? 26.595  41.751  25.483  1.00 48.05  ? 1306 VAL A C   1 
ATOM 7669  O O   . VAL A 1 1306 ? 25.725  42.527  25.889  1.00 53.13  ? 1306 VAL A O   1 
ATOM 7670  C CB  . VAL A 1 1306 ? 27.086  41.092  23.077  1.00 48.98  ? 1306 VAL A CB  1 
ATOM 7671  H H   . VAL A 1 1306 ? 29.298  41.566  23.993  1.00 62.41  ? 1306 VAL A H   1 
ATOM 7672  H HA  . VAL A 1 1306 ? 27.153  42.962  23.933  1.00 62.65  ? 1306 VAL A HA  1 
ATOM 7673  N N   . GLN A 1 1307 ? 26.914  40.630  26.145  1.00 43.20  ? 1307 GLN A N   1 
ATOM 7674  C CA  . GLN A 1 1307 ? 26.082  40.157  27.247  1.00 33.32  ? 1307 GLN A CA  1 
ATOM 7675  C C   . GLN A 1 1307 ? 25.878  41.234  28.304  1.00 36.94  ? 1307 GLN A C   1 
ATOM 7676  O O   . GLN A 1 1307 ? 24.814  41.292  28.931  1.00 35.86  ? 1307 GLN A O   1 
ATOM 7677  C CB  . GLN A 1 1307 ? 26.709  38.918  27.878  1.00 25.29  ? 1307 GLN A CB  1 
ATOM 7678  H H   . GLN A 1 1307 ? 27.597  40.136  25.975  1.00 51.84  ? 1307 GLN A H   1 
ATOM 7679  H HA  . GLN A 1 1307 ? 25.210  39.909  26.900  1.00 39.98  ? 1307 GLN A HA  1 
ATOM 7680  N N   . TYR A 1 1308 ? 26.900  42.071  28.539  1.00 44.12  ? 1308 TYR A N   1 
ATOM 7681  C CA  . TYR A 1 1308 ? 26.765  43.204  29.454  1.00 48.05  ? 1308 TYR A CA  1 
ATOM 7682  C C   . TYR A 1 1308 ? 26.101  44.404  28.789  1.00 45.93  ? 1308 TYR A C   1 
ATOM 7683  O O   . TYR A 1 1308 ? 25.271  45.079  29.409  1.00 56.09  ? 1308 TYR A O   1 
ATOM 7684  C CB  . TYR A 1 1308 ? 28.135  43.620  29.989  1.00 63.34  ? 1308 TYR A CB  1 
ATOM 7685  H H   . TYR A 1 1308 ? 27.678  42.001  28.180  1.00 52.94  ? 1308 TYR A H   1 
ATOM 7686  H HA  . TYR A 1 1308 ? 26.216  42.937  30.208  1.00 57.66  ? 1308 TYR A HA  1 
ATOM 7687  N N   . ILE A 1 1309 ? 26.502  44.727  27.556  1.00 44.91  ? 1309 ILE A N   1 
ATOM 7688  C CA  . ILE A 1 1309 ? 25.768  45.718  26.780  1.00 42.68  ? 1309 ILE A CA  1 
ATOM 7689  C C   . ILE A 1 1309 ? 24.375  45.191  26.418  1.00 45.83  ? 1309 ILE A C   1 
ATOM 7690  O O   . ILE A 1 1309 ? 23.482  45.973  26.064  1.00 40.75  ? 1309 ILE A O   1 
ATOM 7691  C CB  . ILE A 1 1309 ? 26.573  46.111  25.526  1.00 33.51  ? 1309 ILE A CB  1 
ATOM 7692  H HA  . ILE A 1 1309 ? 25.652  46.515  27.320  1.00 51.21  ? 1309 ILE A HA  1 
ATOM 7693  N N   . LYS A 1 1310 ? 24.168  43.868  26.507  1.00 53.50  ? 1310 LYS A N   1 
ATOM 7694  C CA  . LYS A 1 1310 ? 22.882  43.216  26.223  1.00 51.09  ? 1310 LYS A CA  1 
ATOM 7695  C C   . LYS A 1 1310 ? 22.043  43.127  27.500  1.00 48.30  ? 1310 LYS A C   1 
ATOM 7696  O O   . LYS A 1 1310 ? 21.654  42.052  27.965  1.00 50.32  ? 1310 LYS A O   1 
ATOM 7697  C CB  . LYS A 1 1310 ? 23.096  41.829  25.631  1.00 65.66  ? 1310 LYS A CB  1 
ATOM 7698  H HA  . LYS A 1 1310 ? 22.392  43.748  25.576  1.00 61.31  ? 1310 LYS A HA  1 
ATOM 7699  N N   . PHE A 1 1311 ? 21.813  44.298  28.087  1.00 49.83  ? 1311 PHE A N   1 
ATOM 7700  C CA  . PHE A 1 1311 ? 20.943  44.457  29.248  1.00 49.54  ? 1311 PHE A CA  1 
ATOM 7701  C C   . PHE A 1 1311 ? 21.588  43.994  30.564  1.00 31.19  ? 1311 PHE A C   1 
ATOM 7702  O O   . PHE A 1 1311 ? 21.659  42.792  30.841  1.00 35.29  ? 1311 PHE A O   1 
ATOM 7703  C CB  . PHE A 1 1311 ? 19.630  43.713  28.988  1.00 50.55  ? 1311 PHE A CB  1 
ATOM 7704  H HA  . PHE A 1 1311 ? 20.730  45.398  29.345  1.00 59.44  ? 1311 PHE A HA  1 
ATOM 7705  N N   . LEU A 1 1312 ? 22.066  44.941  31.377  1.00 20.65  ? 1312 LEU A N   1 
ATOM 7706  C CA  . LEU A 1 1312 ? 22.644  44.642  32.681  1.00 10.31  ? 1312 LEU A CA  1 
ATOM 7707  C C   . LEU A 1 1312 ? 21.699  44.995  33.816  1.00 12.19  ? 1312 LEU A C   1 
ATOM 7708  O O   . LEU A 1 1312 ? 21.397  44.149  34.658  1.00 10.88  ? 1312 LEU A O   1 
ATOM 7709  C CB  . LEU A 1 1312 ? 23.965  45.397  32.869  1.00 10.17  ? 1312 LEU A CB  1 
ATOM 7710  H H   . LEU A 1 1312 ? 22.064  45.780  31.188  1.00 24.78  ? 1312 LEU A H   1 
ATOM 7711  H HA  . LEU A 1 1312 ? 22.832  43.692  32.732  1.00 12.37  ? 1312 LEU A HA  1 
ATOM 7712  N N   . GLN A 1 1313 ? 21.228  46.233  33.861  1.00 11.66  ? 1313 GLN A N   1 
ATOM 7713  C CA  . GLN A 1 1313 ? 20.319  46.608  34.928  1.00 15.22  ? 1313 GLN A CA  1 
ATOM 7714  C C   . GLN A 1 1313 ? 19.064  45.738  34.878  1.00 18.58  ? 1313 GLN A C   1 
ATOM 7715  O O   . GLN A 1 1313 ? 18.685  45.104  35.878  1.00 19.57  ? 1313 GLN A O   1 
ATOM 7716  C CB  . GLN A 1 1313 ? 19.989  48.101  34.822  1.00 15.31  ? 1313 GLN A CB  1 
ATOM 7717  H H   . GLN A 1 1313 ? 21.414  46.859  33.301  1.00 13.99  ? 1313 GLN A H   1 
ATOM 7718  H HA  . GLN A 1 1313 ? 20.755  46.457  35.781  1.00 18.27  ? 1313 GLN A HA  1 
ATOM 7719  N N   . THR A 1 1314 ? 18.462  45.610  33.689  1.00 21.53  ? 1314 THR A N   1 
ATOM 7720  C CA  . THR A 1 1314 ? 17.153  44.973  33.595  1.00 23.82  ? 1314 THR A CA  1 
ATOM 7721  C C   . THR A 1 1314 ? 17.149  43.655  34.349  1.00 22.83  ? 1314 THR A C   1 
ATOM 7722  O O   . THR A 1 1314 ? 16.194  43.343  35.077  1.00 23.86  ? 1314 THR A O   1 
ATOM 7723  C CB  . THR A 1 1314 ? 16.780  44.757  32.126  1.00 27.08  ? 1314 THR A CB  1 
ATOM 7724  H H   . THR A 1 1314 ? 18.786  45.879  32.940  1.00 25.83  ? 1314 THR A H   1 
ATOM 7725  H HA  . THR A 1 1314 ? 16.486  45.553  33.995  1.00 28.58  ? 1314 THR A HA  1 
ATOM 7726  N N   . ILE A 1 1315 ? 18.237  42.892  34.214  1.00 25.27  ? 1315 ILE A N   1 
ATOM 7727  C CA  . ILE A 1 1315 ? 18.356  41.609  34.896  1.00 31.37  ? 1315 ILE A CA  1 
ATOM 7728  C C   . ILE A 1 1315 ? 18.201  41.802  36.392  1.00 16.99  ? 1315 ILE A C   1 
ATOM 7729  O O   . ILE A 1 1315 ? 17.414  41.111  37.046  1.00 15.92  ? 1315 ILE A O   1 
ATOM 7730  C CB  . ILE A 1 1315 ? 19.702  40.944  34.554  1.00 38.45  ? 1315 ILE A CB  1 
ATOM 7731  H H   . ILE A 1 1315 ? 18.919  43.099  33.733  1.00 30.33  ? 1315 ILE A H   1 
ATOM 7732  H HA  . ILE A 1 1315 ? 17.645  41.022  34.593  1.00 37.65  ? 1315 ILE A HA  1 
ATOM 7733  N N   . VAL A 1 1316 ? 18.936  42.760  36.947  1.00 14.80  ? 1316 VAL A N   1 
ATOM 7734  C CA  . VAL A 1 1316 ? 18.815  43.012  38.368  1.00 13.54  ? 1316 VAL A CA  1 
ATOM 7735  C C   . VAL A 1 1316 ? 17.349  43.215  38.712  1.00 16.72  ? 1316 VAL A C   1 
ATOM 7736  O O   . VAL A 1 1316 ? 16.880  42.758  39.756  1.00 18.34  ? 1316 VAL A O   1 
ATOM 7737  C CB  . VAL A 1 1316 ? 19.661  44.223  38.780  1.00 15.60  ? 1316 VAL A CB  1 
ATOM 7738  H H   . VAL A 1 1316 ? 19.497  43.263  36.532  1.00 17.76  ? 1316 VAL A H   1 
ATOM 7739  H HA  . VAL A 1 1316 ? 19.137  42.239  38.857  1.00 16.24  ? 1316 VAL A HA  1 
ATOM 7740  N N   . LYS A 1 1317 ? 16.584  43.855  37.809  1.00 18.51  ? 1317 LYS A N   1 
ATOM 7741  C CA  . LYS A 1 1317 ? 15.218  44.255  38.155  1.00 17.03  ? 1317 LYS A CA  1 
ATOM 7742  C C   . LYS A 1 1317 ? 14.302  43.079  38.439  1.00 16.94  ? 1317 LYS A C   1 
ATOM 7743  O O   . LYS A 1 1317 ? 13.555  43.118  39.418  1.00 19.57  ? 1317 LYS A O   1 
ATOM 7744  C CB  . LYS A 1 1317 ? 14.598  45.103  37.047  1.00 14.44  ? 1317 LYS A CB  1 
ATOM 7745  H H   . LYS A 1 1317 ? 16.829  44.062  37.011  1.00 22.21  ? 1317 LYS A H   1 
ATOM 7746  H HA  . LYS A 1 1317 ? 15.251  44.800  38.957  1.00 20.43  ? 1317 LYS A HA  1 
ATOM 7747  N N   . ALA A 1 1318 ? 14.305  42.045  37.592  1.00 16.57  ? 1318 ALA A N   1 
ATOM 7748  C CA  . ALA A 1 1318 ? 13.192  41.105  37.580  1.00 18.95  ? 1318 ALA A CA  1 
ATOM 7749  C C   . ALA A 1 1318 ? 13.110  40.230  38.844  1.00 24.33  ? 1318 ALA A C   1 
ATOM 7750  O O   . ALA A 1 1318 ? 11.999  39.869  39.264  1.00 34.71  ? 1318 ALA A O   1 
ATOM 7751  C CB  . ALA A 1 1318 ? 13.248  40.228  36.322  1.00 16.78  ? 1318 ALA A CB  1 
ATOM 7752  H H   . ALA A 1 1318 ? 14.929  41.872  37.026  1.00 19.89  ? 1318 ALA A H   1 
ATOM 7753  H HA  . ALA A 1 1318 ? 12.369  41.616  37.534  1.00 22.75  ? 1318 ALA A HA  1 
ATOM 7754  H HB1 . ALA A 1 1318 ? 12.500  39.611  36.334  1.00 20.13  ? 1318 ALA A HB1 1 
ATOM 7755  H HB2 . ALA A 1 1318 ? 13.196  40.797  35.538  1.00 20.13  ? 1318 ALA A HB2 1 
ATOM 7756  H HB3 . ALA A 1 1318 ? 14.084  39.736  36.318  1.00 20.13  ? 1318 ALA A HB3 1 
ATOM 7757  N N   . GLU A 1 1319 ? 14.236  39.846  39.456  1.00 17.70  ? 1319 GLU A N   1 
ATOM 7758  C CA  . GLU A 1 1319 ? 14.180  38.909  40.584  1.00 11.17  ? 1319 GLU A CA  1 
ATOM 7759  C C   . GLU A 1 1319 ? 13.955  39.571  41.943  1.00 8.96   ? 1319 GLU A C   1 
ATOM 7760  O O   . GLU A 1 1319 ? 13.266  39.012  42.808  1.00 8.96   ? 1319 GLU A O   1 
ATOM 7761  C CB  . GLU A 1 1319 ? 15.473  38.096  40.645  1.00 15.44  ? 1319 GLU A CB  1 
ATOM 7762  H H   . GLU A 1 1319 ? 15.027  40.107  39.243  1.00 21.24  ? 1319 GLU A H   1 
ATOM 7763  H HA  . GLU A 1 1319 ? 13.449  38.289  40.435  1.00 13.41  ? 1319 GLU A HA  1 
ATOM 7764  N N   . GLY A 1 1320 ? 14.594  40.699  42.175  1.00 11.10  ? 1320 GLY A N   1 
ATOM 7765  C CA  . GLY A 1 1320 ? 14.444  41.416  43.422  1.00 10.06  ? 1320 GLY A CA  1 
ATOM 7766  C C   . GLY A 1 1320 ? 13.869  42.828  43.339  1.00 17.35  ? 1320 GLY A C   1 
ATOM 7767  O O   . GLY A 1 1320 ? 13.846  43.557  44.340  1.00 18.59  ? 1320 GLY A O   1 
ATOM 7768  H H   . GLY A 1 1320 ? 15.129  41.076  41.617  1.00 13.32  ? 1320 GLY A H   1 
ATOM 7769  H HA2 . GLY A 1 1320 ? 13.868  40.899  44.007  1.00 12.08  ? 1320 GLY A HA2 1 
ATOM 7770  H HA3 . GLY A 1 1320 ? 15.314  41.479  43.848  1.00 12.08  ? 1320 GLY A HA3 1 
ATOM 7771  N N   . LYS A 1 1321 ? 13.453  43.240  42.141  1.00 21.56  ? 1321 LYS A N   1 
ATOM 7772  C CA  . LYS A 1 1321 ? 12.889  44.554  41.797  1.00 17.74  ? 1321 LYS A CA  1 
ATOM 7773  C C   . LYS A 1 1321 ? 13.975  45.565  41.460  1.00 15.12  ? 1321 LYS A C   1 
ATOM 7774  O O   . LYS A 1 1321 ? 13.622  46.671  41.066  1.00 12.46  ? 1321 LYS A O   1 
ATOM 7775  C CB  . LYS A 1 1321 ? 11.995  45.123  42.913  1.00 17.49  ? 1321 LYS A CB  1 
ATOM 7776  H HA  . LYS A 1 1321 ? 12.335  44.450  41.007  1.00 21.29  ? 1321 LYS A HA  1 
ATOM 7777  N N   . PHE A 1 1322 ? 15.262  45.190  41.515  1.00 20.24  ? 1322 PHE A N   1 
ATOM 7778  C CA  . PHE A 1 1322 ? 16.396  46.119  41.399  1.00 30.79  ? 1322 PHE A CA  1 
ATOM 7779  C C   . PHE A 1 1322 ? 16.634  46.515  39.949  1.00 37.83  ? 1322 PHE A C   1 
ATOM 7780  O O   . PHE A 1 1322 ? 15.674  46.782  39.200  1.00 37.73  ? 1322 PHE A O   1 
ATOM 7781  C CB  . PHE A 1 1322 ? 17.704  45.521  41.959  1.00 24.75  ? 1322 PHE A CB  1 
ATOM 7782  H HA  . PHE A 1 1322 ? 16.196  46.925  41.901  1.00 36.95  ? 1322 PHE A HA  1 
ATOM 7783  N N   . ILE A 1 1323 ? 17.909  46.600  39.552  1.00 37.89  ? 1323 ILE A N   1 
ATOM 7784  C CA  . ILE A 1 1323 ? 18.209  46.806  38.138  1.00 30.54  ? 1323 ILE A CA  1 
ATOM 7785  C C   . ILE A 1 1323 ? 19.615  47.373  38.084  1.00 24.65  ? 1323 ILE A C   1 
ATOM 7786  O O   . ILE A 1 1323 ? 20.609  46.638  38.151  1.00 24.92  ? 1323 ILE A O   1 
ATOM 7787  C CB  . ILE A 1 1323 ? 17.199  47.747  37.428  1.00 34.74  ? 1323 ILE A CB  1 
ATOM 7788  H HA  . ILE A 1 1323 ? 18.205  45.951  37.679  1.00 36.65  ? 1323 ILE A HA  1 
ATOM 7789  N N   . LYS A 1 1324 ? 19.692  48.699  38.037  1.00 21.03  ? 1324 LYS A N   1 
ATOM 7790  C CA  . LYS A 1 1324 ? 20.981  49.363  37.976  1.00 20.03  ? 1324 LYS A CA  1 
ATOM 7791  C C   . LYS A 1 1324 ? 21.866  49.035  39.174  1.00 19.50  ? 1324 LYS A C   1 
ATOM 7792  O O   . LYS A 1 1324 ? 23.084  49.265  39.116  1.00 17.80  ? 1324 LYS A O   1 
ATOM 7793  C CB  . LYS A 1 1324 ? 20.757  50.868  37.871  1.00 23.59  ? 1324 LYS A CB  1 
ATOM 7794  H HA  . LYS A 1 1324 ? 21.446  49.074  37.175  1.00 24.04  ? 1324 LYS A HA  1 
ATOM 7795  N N   . LYS A 1 1325 ? 21.277  48.522  40.262  1.00 16.29  ? 1325 LYS A N   1 
ATOM 7796  C CA  . LYS A 1 1325 ? 22.064  48.114  41.421  1.00 14.16  ? 1325 LYS A CA  1 
ATOM 7797  C C   . LYS A 1 1325 ? 22.880  46.863  41.118  1.00 15.39  ? 1325 LYS A C   1 
ATOM 7798  O O   . LYS A 1 1325 ? 24.075  46.813  41.423  1.00 13.94  ? 1325 LYS A O   1 
ATOM 7799  C CB  . LYS A 1 1325 ? 21.147  47.876  42.620  1.00 8.86   ? 1325 LYS A CB  1 
ATOM 7800  H HA  . LYS A 1 1325 ? 22.681  48.826  41.652  1.00 16.99  ? 1325 LYS A HA  1 
ATOM 7801  N N   . CYS A 1 1326 ? 22.259  45.844  40.514  1.00 13.96  ? 1326 CYS A N   1 
ATOM 7802  C CA  . CYS A 1 1326 ? 22.996  44.634  40.167  1.00 14.30  ? 1326 CYS A CA  1 
ATOM 7803  C C   . CYS A 1 1326 ? 23.790  44.760  38.871  1.00 15.30  ? 1326 CYS A C   1 
ATOM 7804  O O   . CYS A 1 1326 ? 24.693  43.944  38.639  1.00 9.23   ? 1326 CYS A O   1 
ATOM 7805  C CB  . CYS A 1 1326 ? 22.048  43.435  40.059  1.00 11.16  ? 1326 CYS A CB  1 
ATOM 7806  H H   . CYS A 1 1326 ? 21.426  45.831  40.299  1.00 16.75  ? 1326 CYS A H   1 
ATOM 7807  H HA  . CYS A 1 1326 ? 23.628  44.445  40.879  1.00 17.16  ? 1326 CYS A HA  1 
ATOM 7808  N N   . GLN A 1 1327 ? 23.450  45.725  38.007  1.00 20.85  ? 1327 GLN A N   1 
ATOM 7809  C CA  . GLN A 1 1327 ? 24.293  46.014  36.853  1.00 16.75  ? 1327 GLN A CA  1 
ATOM 7810  C C   . GLN A 1 1327 ? 25.540  46.764  37.290  1.00 14.91  ? 1327 GLN A C   1 
ATOM 7811  O O   . GLN A 1 1327 ? 26.655  46.411  36.894  1.00 13.21  ? 1327 GLN A O   1 
ATOM 7812  C CB  . GLN A 1 1327 ? 23.511  46.823  35.808  1.00 15.94  ? 1327 GLN A CB  1 
ATOM 7813  H H   . GLN A 1 1327 ? 22.747  46.216  38.069  1.00 25.02  ? 1327 GLN A H   1 
ATOM 7814  H HA  . GLN A 1 1327 ? 24.570  45.180  36.444  1.00 20.10  ? 1327 GLN A HA  1 
ATOM 7815  N N   . ASP A 1 1328 ? 25.364  47.809  38.105  1.00 13.39  ? 1328 ASP A N   1 
ATOM 7816  C CA  . ASP A 1 1328 ? 26.489  48.563  38.640  1.00 13.52  ? 1328 ASP A CA  1 
ATOM 7817  C C   . ASP A 1 1328 ? 27.378  47.680  39.527  1.00 16.73  ? 1328 ASP A C   1 
ATOM 7818  O O   . ASP A 1 1328 ? 28.614  47.673  39.383  1.00 25.53  ? 1328 ASP A O   1 
ATOM 7819  C CB  . ASP A 1 1328 ? 25.937  49.775  39.393  1.00 11.25  ? 1328 ASP A CB  1 
ATOM 7820  H H   . ASP A 1 1328 ? 24.596  48.098  38.361  1.00 16.07  ? 1328 ASP A H   1 
ATOM 7821  H HA  . ASP A 1 1328 ? 27.029  48.889  37.903  1.00 16.22  ? 1328 ASP A HA  1 
ATOM 7822  N N   . MET A 1 1329 ? 26.773  46.910  40.435  1.00 15.11  ? 1329 MET A N   1 
ATOM 7823  C CA  . MET A 1 1329 ? 27.536  45.898  41.160  1.00 17.49  ? 1329 MET A CA  1 
ATOM 7824  C C   . MET A 1 1329 ? 28.202  44.942  40.167  1.00 19.43  ? 1329 MET A C   1 
ATOM 7825  O O   . MET A 1 1329 ? 29.401  44.615  40.279  1.00 23.43  ? 1329 MET A O   1 
ATOM 7826  C CB  . MET A 1 1329 ? 26.606  45.137  42.107  1.00 14.45  ? 1329 MET A CB  1 
ATOM 7827  H H   . MET A 1 1329 ? 25.940  46.954  40.644  1.00 18.13  ? 1329 MET A H   1 
ATOM 7828  H HA  . MET A 1 1329 ? 28.220  46.334  41.691  1.00 20.99  ? 1329 MET A HA  1 
ATOM 7829  N N   . VAL A 1 1330 ? 27.419  44.509  39.174  1.00 14.51  ? 1330 VAL A N   1 
ATOM 7830  C CA  . VAL A 1 1330 ? 27.897  43.706  38.058  1.00 14.81  ? 1330 VAL A CA  1 
ATOM 7831  C C   . VAL A 1 1330 ? 29.152  44.300  37.434  1.00 15.70  ? 1330 VAL A C   1 
ATOM 7832  O O   . VAL A 1 1330 ? 29.980  43.562  36.896  1.00 19.98  ? 1330 VAL A O   1 
ATOM 7833  C CB  . VAL A 1 1330 ? 26.760  43.561  37.026  1.00 10.10  ? 1330 VAL A CB  1 
ATOM 7834  H H   . VAL A 1 1330 ? 26.577  44.677  39.129  1.00 17.41  ? 1330 VAL A H   1 
ATOM 7835  H HA  . VAL A 1 1330 ? 28.118  42.819  38.382  1.00 17.78  ? 1330 VAL A HA  1 
ATOM 7836  N N   . MET A 1 1331 ? 29.353  45.613  37.524  1.00 16.51  ? 1331 MET A N   1 
ATOM 7837  C CA  . MET A 1 1331 ? 30.519  46.217  36.887  1.00 14.44  ? 1331 MET A CA  1 
ATOM 7838  C C   . MET A 1 1331 ? 31.678  46.420  37.849  1.00 8.79   ? 1331 MET A C   1 
ATOM 7839  O O   . MET A 1 1331 ? 32.821  46.549  37.409  1.00 9.27   ? 1331 MET A O   1 
ATOM 7840  C CB  . MET A 1 1331 ? 30.135  47.548  36.229  1.00 20.87  ? 1331 MET A CB  1 
ATOM 7841  H HA  . MET A 1 1331 ? 30.815  45.624  36.179  1.00 17.33  ? 1331 MET A HA  1 
ATOM 7842  N N   . ALA A 1 1332 ? 31.431  46.484  39.152  1.00 8.69   ? 1332 ALA A N   1 
ATOM 7843  C CA  . ALA A 1 1332 ? 32.553  46.303  40.048  1.00 8.69   ? 1332 ALA A CA  1 
ATOM 7844  C C   . ALA A 1 1332 ? 33.197  44.973  39.777  1.00 8.69   ? 1332 ALA A C   1 
ATOM 7845  O O   . ALA A 1 1332 ? 34.373  44.892  39.416  1.00 8.69   ? 1332 ALA A O   1 
ATOM 7846  C CB  . ALA A 1 1332 ? 32.096  46.347  41.489  1.00 8.69   ? 1332 ALA A CB  1 
ATOM 7847  H H   . ALA A 1 1332 ? 30.667  46.623  39.522  1.00 10.43  ? 1332 ALA A H   1 
ATOM 7848  H HA  . ALA A 1 1332 ? 33.208  47.004  39.905  1.00 10.43  ? 1332 ALA A HA  1 
ATOM 7849  H HB1 . ALA A 1 1332 ? 32.864  46.223  42.068  1.00 10.43  ? 1332 ALA A HB1 1 
ATOM 7850  H HB2 . ALA A 1 1332 ? 31.685  47.208  41.663  1.00 10.43  ? 1332 ALA A HB2 1 
ATOM 7851  H HB3 . ALA A 1 1332 ? 31.452  45.637  41.638  1.00 10.43  ? 1332 ALA A HB3 1 
ATOM 7852  N N   . GLU A 1 1333 ? 32.429  43.908  39.956  1.00 8.74   ? 1333 GLU A N   1 
ATOM 7853  C CA  . GLU A 1 1333 ? 33.033  42.602  39.801  1.00 8.74   ? 1333 GLU A CA  1 
ATOM 7854  C C   . GLU A 1 1333 ? 33.449  42.392  38.369  1.00 8.74   ? 1333 GLU A C   1 
ATOM 7855  O O   . GLU A 1 1333 ? 34.503  41.815  38.100  1.00 8.74   ? 1333 GLU A O   1 
ATOM 7856  C CB  . GLU A 1 1333 ? 32.061  41.525  40.233  1.00 10.53  ? 1333 GLU A CB  1 
ATOM 7857  H H   . GLU A 1 1333 ? 31.593  43.913  40.159  1.00 10.49  ? 1333 GLU A H   1 
ATOM 7858  H HA  . GLU A 1 1333 ? 33.823  42.544  40.361  1.00 10.49  ? 1333 GLU A HA  1 
ATOM 7859  N N   . LEU A 1 1334 ? 32.645  42.869  37.437  1.00 8.75   ? 1334 LEU A N   1 
ATOM 7860  C CA  . LEU A 1 1334 ? 33.024  42.786  36.050  1.00 8.75   ? 1334 LEU A CA  1 
ATOM 7861  C C   . LEU A 1 1334 ? 34.376  43.409  35.885  1.00 9.70   ? 1334 LEU A C   1 
ATOM 7862  O O   . LEU A 1 1334 ? 35.233  42.863  35.189  1.00 29.12  ? 1334 LEU A O   1 
ATOM 7863  C CB  . LEU A 1 1334 ? 31.998  43.513  35.195  1.00 8.75   ? 1334 LEU A CB  1 
ATOM 7864  H H   . LEU A 1 1334 ? 31.883  43.242  37.582  1.00 10.50  ? 1334 LEU A H   1 
ATOM 7865  H HA  . LEU A 1 1334 ? 33.066  41.858  35.772  1.00 10.50  ? 1334 LEU A HA  1 
ATOM 7866  N N   . VAL A 1 1335 ? 34.608  44.497  36.610  1.00 12.31  ? 1335 VAL A N   1 
ATOM 7867  C CA  . VAL A 1 1335 ? 35.763  45.370  36.492  1.00 18.99  ? 1335 VAL A CA  1 
ATOM 7868  C C   . VAL A 1 1335 ? 37.018  44.726  37.070  1.00 16.05  ? 1335 VAL A C   1 
ATOM 7869  O O   . VAL A 1 1335 ? 36.935  43.767  37.846  1.00 11.76  ? 1335 VAL A O   1 
ATOM 7870  C CB  . VAL A 1 1335 ? 35.441  46.697  37.199  1.00 18.25  ? 1335 VAL A CB  1 
ATOM 7871  H H   . VAL A 1 1335 ? 34.065  44.764  37.221  1.00 14.77  ? 1335 VAL A H   1 
ATOM 7872  H HA  . VAL A 1 1335 ? 35.925  45.559  35.555  1.00 22.79  ? 1335 VAL A HA  1 
ATOM 7873  N N   . ASN A 1 1336 ? 38.192  45.248  36.703  1.00 11.03  ? 1336 ASN A N   1 
ATOM 7874  C CA  . ASN A 1 1336 ? 39.470  44.755  37.194  1.00 9.71   ? 1336 ASN A CA  1 
ATOM 7875  C C   . ASN A 1 1336 ? 39.887  43.435  36.556  1.00 13.24  ? 1336 ASN A C   1 
ATOM 7876  O O   . ASN A 1 1336 ? 40.515  42.607  37.224  1.00 15.58  ? 1336 ASN A O   1 
ATOM 7877  C CB  . ASN A 1 1336 ? 39.449  44.583  38.716  1.00 9.00   ? 1336 ASN A CB  1 
ATOM 7878  H H   . ASN A 1 1336 ? 38.269  45.906  36.155  1.00 13.24  ? 1336 ASN A H   1 
ATOM 7879  H HA  . ASN A 1 1336 ? 40.154  45.410  36.984  1.00 11.65  ? 1336 ASN A HA  1 
ATOM 7880  N N   . SER A 1 1337 ? 39.547  43.192  35.284  1.00 14.19  ? 1337 SER A N   1 
ATOM 7881  C CA  . SER A 1 1337 ? 40.058  42.010  34.590  1.00 16.54  ? 1337 SER A CA  1 
ATOM 7882  C C   . SER A 1 1337 ? 41.431  42.254  33.972  1.00 21.42  ? 1337 SER A C   1 
ATOM 7883  O O   . SER A 1 1337 ? 42.208  41.304  33.833  1.00 23.87  ? 1337 SER A O   1 
ATOM 7884  C CB  . SER A 1 1337 ? 39.093  41.556  33.494  1.00 23.74  ? 1337 SER A CB  1 
ATOM 7885  H HA  . SER A 1 1337 ? 40.144  41.285  35.229  1.00 19.85  ? 1337 SER A HA  1 
ATOM 7886  N N   . GLY A 1 1338 ? 41.721  43.502  33.556  1.00 31.71  ? 1338 GLY A N   1 
ATOM 7887  C CA  . GLY A 1 1338 ? 42.972  43.894  32.893  1.00 41.37  ? 1338 GLY A CA  1 
ATOM 7888  C C   . GLY A 1 1338 ? 44.200  44.371  33.682  1.00 29.73  ? 1338 GLY A C   1 
ATOM 7889  O O   . GLY A 1 1338 ? 45.355  44.068  33.342  1.00 15.86  ? 1338 GLY A O   1 
ATOM 7890  H H   . GLY A 1 1338 ? 41.180  44.163  33.655  1.00 38.05  ? 1338 GLY A H   1 
ATOM 7891  H HA2 . GLY A 1 1338 ? 43.266  43.137  32.363  1.00 49.65  ? 1338 GLY A HA2 1 
ATOM 7892  H HA3 . GLY A 1 1338 ? 42.756  44.606  32.270  1.00 49.65  ? 1338 GLY A HA3 1 
ATOM 7893  N N   . GLU A 1 1339 ? 43.978  45.167  34.723  1.00 36.81  ? 1339 GLU A N   1 
ATOM 7894  C CA  . GLU A 1 1339 ? 45.071  45.673  35.540  1.00 33.32  ? 1339 GLU A CA  1 
ATOM 7895  C C   . GLU A 1 1339 ? 45.276  44.859  36.818  1.00 50.67  ? 1339 GLU A C   1 
ATOM 7896  O O   . GLU A 1 1339 ? 46.276  45.071  37.512  1.00 39.52  ? 1339 GLU A O   1 
ATOM 7897  C CB  . GLU A 1 1339 ? 44.827  47.150  35.900  1.00 35.38  ? 1339 GLU A CB  1 
ATOM 7898  H H   . GLU A 1 1339 ? 43.200  45.429  34.977  1.00 44.18  ? 1339 GLU A H   1 
ATOM 7899  H HA  . GLU A 1 1339 ? 45.891  45.626  35.025  1.00 39.99  ? 1339 GLU A HA  1 
ATOM 7900  N N   . ASP A 1 1340 ? 44.353  43.943  37.142  1.00 67.80  ? 1340 ASP A N   1 
ATOM 7901  C CA  . ASP A 1 1340 ? 44.422  43.064  38.310  1.00 70.86  ? 1340 ASP A CA  1 
ATOM 7902  C C   . ASP A 1 1340 ? 44.377  41.603  37.849  1.00 79.86  ? 1340 ASP A C   1 
ATOM 7903  O O   . ASP A 1 1340 ? 43.495  41.221  37.070  1.00 80.63  ? 1340 ASP A O   1 
ATOM 7904  C CB  . ASP A 1 1340 ? 43.272  43.364  39.292  1.00 66.46  ? 1340 ASP A CB  1 
ATOM 7905  H HA  . ASP A 1 1340 ? 45.262  43.211  38.772  1.00 85.03  ? 1340 ASP A HA  1 
ATOM 7906  N N   . VAL A 1 1341 ? 45.312  40.781  38.347  1.00 72.57  ? 1341 VAL A N   1 
ATOM 7907  C CA  . VAL A 1 1341 ? 45.575  39.473  37.747  1.00 51.08  ? 1341 VAL A CA  1 
ATOM 7908  C C   . VAL A 1 1341 ? 45.843  39.710  36.264  1.00 43.35  ? 1341 VAL A C   1 
ATOM 7909  O O   . VAL A 1 1341 ? 45.484  38.877  35.423  1.00 39.69  ? 1341 VAL A O   1 
ATOM 7910  C CB  . VAL A 1 1341 ? 44.412  38.481  37.941  1.00 54.10  ? 1341 VAL A CB  1 
ATOM 7911  H HA  . VAL A 1 1341 ? 46.373  39.091  38.144  1.00 61.30  ? 1341 VAL A HA  1 
ATOM 7912  N N   . LEU A 1 1342 ? 46.503  40.840  35.945  1.00 46.39  ? 1342 LEU A N   1 
ATOM 7913  C CA  . LEU A 1 1342 ? 46.834  41.183  34.564  1.00 34.90  ? 1342 LEU A CA  1 
ATOM 7914  C C   . LEU A 1 1342 ? 47.540  40.017  33.918  1.00 31.38  ? 1342 LEU A C   1 
ATOM 7915  O O   . LEU A 1 1342 ? 47.714  39.966  32.691  1.00 32.54  ? 1342 LEU A O   1 
ATOM 7916  C CB  . LEU A 1 1342 ? 47.711  42.440  34.543  1.00 28.49  ? 1342 LEU A CB  1 
ATOM 7917  H H   . LEU A 1 1342 ? 46.768  41.422  36.520  1.00 55.67  ? 1342 LEU A H   1 
ATOM 7918  H HA  . LEU A 1 1342 ? 46.020  41.365  34.069  1.00 41.88  ? 1342 LEU A HA  1 
ATOM 7919  N N   . VAL A 1 1343 ? 47.936  39.081  34.757  1.00 31.66  ? 1343 VAL A N   1 
ATOM 7920  C CA  . VAL A 1 1343 ? 48.599  37.879  34.336  1.00 26.06  ? 1343 VAL A CA  1 
ATOM 7921  C C   . VAL A 1 1343 ? 47.588  36.891  33.775  1.00 28.59  ? 1343 VAL A C   1 
ATOM 7922  O O   . VAL A 1 1343 ? 47.857  36.232  32.769  1.00 34.08  ? 1343 VAL A O   1 
ATOM 7923  C CB  . VAL A 1 1343 ? 49.359  37.345  35.555  1.00 22.39  ? 1343 VAL A CB  1 
ATOM 7924  H HA  . VAL A 1 1343 ? 49.242  38.090  33.641  1.00 31.27  ? 1343 VAL A HA  1 
ATOM 7925  N N   . PHE A 1 1344 ? 46.391  36.815  34.364  1.00 27.66  ? 1344 PHE A N   1 
ATOM 7926  C CA  . PHE A 1 1344 ? 45.260  36.082  33.790  1.00 30.14  ? 1344 PHE A CA  1 
ATOM 7927  C C   . PHE A 1 1344 ? 44.696  36.770  32.556  1.00 31.01  ? 1344 PHE A C   1 
ATOM 7928  O O   . PHE A 1 1344 ? 43.472  36.922  32.423  1.00 23.22  ? 1344 PHE A O   1 
ATOM 7929  C CB  . PHE A 1 1344 ? 44.162  35.930  34.846  1.00 27.29  ? 1344 PHE A CB  1 
ATOM 7930  H H   . PHE A 1 1344 ? 46.207  37.190  35.116  1.00 33.19  ? 1344 PHE A H   1 
ATOM 7931  H HA  . PHE A 1 1344 ? 45.555  35.195  33.532  1.00 36.16  ? 1344 PHE A HA  1 
ATOM 7932  N N   . TYR A 1 1345 ? 45.583  37.173  31.637  1.00 31.00  ? 1345 TYR A N   1 
ATOM 7933  C CA  . TYR A 1 1345 ? 45.187  38.047  30.538  1.00 40.84  ? 1345 TYR A CA  1 
ATOM 7934  C C   . TYR A 1 1345 ? 46.209  38.072  29.396  1.00 31.68  ? 1345 TYR A C   1 
ATOM 7935  O O   . TYR A 1 1345 ? 45.968  37.497  28.330  1.00 30.72  ? 1345 TYR A O   1 
ATOM 7936  C CB  . TYR A 1 1345 ? 44.970  39.453  31.093  1.00 54.26  ? 1345 TYR A CB  1 
ATOM 7937  H H   . TYR A 1 1345 ? 46.414  36.952  31.631  1.00 37.20  ? 1345 TYR A H   1 
ATOM 7938  H HA  . TYR A 1 1345 ? 44.343  37.735  30.176  1.00 49.01  ? 1345 TYR A HA  1 
ATOM 7939  N N   . ASN A 1 1346 ? 47.339  38.757  29.597  1.00 27.95  ? 1346 ASN A N   1 
ATOM 7940  C CA  . ASN A 1 1346 ? 48.339  38.963  28.551  1.00 25.14  ? 1346 ASN A CA  1 
ATOM 7941  C C   . ASN A 1 1346 ? 49.576  38.141  28.894  1.00 27.30  ? 1346 ASN A C   1 
ATOM 7942  O O   . ASN A 1 1346 ? 50.240  38.386  29.909  1.00 24.36  ? 1346 ASN A O   1 
ATOM 7943  C CB  . ASN A 1 1346 ? 48.691  40.439  28.395  1.00 29.03  ? 1346 ASN A CB  1 
ATOM 7944  H HA  . ASN A 1 1346 ? 47.987  38.644  27.705  1.00 30.17  ? 1346 ASN A HA  1 
ATOM 7945  N N   . ASP A 1 1347 ? 49.869  37.171  28.032  1.00 33.12  ? 1347 ASP A N   1 
ATOM 7946  C CA  . ASP A 1 1347 ? 50.981  36.235  28.158  1.00 42.57  ? 1347 ASP A CA  1 
ATOM 7947  C C   . ASP A 1 1347 ? 50.834  35.217  27.032  1.00 41.25  ? 1347 ASP A C   1 
ATOM 7948  O O   . ASP A 1 1347 ? 51.825  34.775  26.439  1.00 32.05  ? 1347 ASP A O   1 
ATOM 7949  C CB  . ASP A 1 1347 ? 50.985  35.561  29.531  1.00 44.15  ? 1347 ASP A CB  1 
ATOM 7950  H HA  . ASP A 1 1347 ? 51.820  36.707  28.042  1.00 51.08  ? 1347 ASP A HA  1 
ATOM 7951  N N   . ARG A 1 1348 ? 49.586  34.849  26.749  1.00 55.57  ? 1348 ARG A N   1 
ATOM 7952  C CA  . ARG A 1 1348 ? 49.179  34.168  25.529  1.00 58.28  ? 1348 ARG A CA  1 
ATOM 7953  C C   . ARG A 1 1348 ? 48.392  35.168  24.684  1.00 57.13  ? 1348 ARG A C   1 
ATOM 7954  O O   . ARG A 1 1348 ? 47.709  36.043  25.229  1.00 57.22  ? 1348 ARG A O   1 
ATOM 7955  C CB  . ARG A 1 1348 ? 48.325  32.930  25.831  1.00 67.79  ? 1348 ARG A CB  1 
ATOM 7956  H HA  . ARG A 1 1348 ? 49.964  33.890  25.032  1.00 69.94  ? 1348 ARG A HA  1 
ATOM 7957  N N   . ALA A 1 1349 ? 48.501  35.046  23.368  1.00 50.76  ? 1349 ALA A N   1 
ATOM 7958  C CA  . ALA A 1 1349 ? 47.935  36.024  22.450  1.00 63.70  ? 1349 ALA A CA  1 
ATOM 7959  C C   . ALA A 1 1349 ? 46.589  35.540  21.893  1.00 59.94  ? 1349 ALA A C   1 
ATOM 7960  O O   . ALA A 1 1349 ? 46.526  34.501  21.222  1.00 62.74  ? 1349 ALA A O   1 
ATOM 7961  C CB  . ALA A 1 1349 ? 48.947  36.298  21.330  1.00 64.71  ? 1349 ALA A CB  1 
ATOM 7962  H H   . ALA A 1 1349 ? 48.904  34.396  22.976  1.00 60.91  ? 1349 ALA A H   1 
ATOM 7963  H HA  . ALA A 1 1349 ? 47.782  36.854  22.927  1.00 76.44  ? 1349 ALA A HA  1 
ATOM 7964  H HB1 . ALA A 1 1349 ? 48.571  36.950  20.718  1.00 77.66  ? 1349 ALA A HB1 1 
ATOM 7965  H HB2 . ALA A 1 1349 ? 49.764  36.645  21.721  1.00 77.66  ? 1349 ALA A HB2 1 
ATOM 7966  H HB3 . ALA A 1 1349 ? 49.131  35.470  20.860  1.00 77.66  ? 1349 ALA A HB3 1 
ATOM 7967  N N   . SER A 1 1350 ? 45.516  36.280  22.181  1.00 37.84  ? 1350 SER A N   1 
ATOM 7968  C CA  . SER A 1 1350 ? 44.174  35.989  21.653  1.00 16.13  ? 1350 SER A CA  1 
ATOM 7969  C C   . SER A 1 1350 ? 43.497  37.286  21.233  1.00 9.16   ? 1350 SER A C   1 
ATOM 7970  O O   . SER A 1 1350 ? 42.331  37.541  21.543  1.00 9.16   ? 1350 SER A O   1 
ATOM 7971  C CB  . SER A 1 1350 ? 43.334  35.249  22.686  1.00 25.99  ? 1350 SER A CB  1 
ATOM 7972  H H   . SER A 1 1350 ? 45.538  36.971  22.691  1.00 45.41  ? 1350 SER A H   1 
ATOM 7973  H HA  . SER A 1 1350 ? 44.256  35.423  20.869  1.00 19.35  ? 1350 SER A HA  1 
ATOM 7974  N N   . PHE A 1 1351 ? 44.232  38.127  20.524  1.00 9.04   ? 1351 PHE A N   1 
ATOM 7975  C CA  . PHE A 1 1351 ? 43.814  39.486  20.257  1.00 9.04   ? 1351 PHE A CA  1 
ATOM 7976  C C   . PHE A 1 1351 ? 43.407  39.670  18.810  1.00 9.04   ? 1351 PHE A C   1 
ATOM 7977  O O   . PHE A 1 1351 ? 43.675  40.711  18.215  1.00 10.34  ? 1351 PHE A O   1 
ATOM 7978  C CB  . PHE A 1 1351 ? 44.935  40.454  20.612  1.00 10.54  ? 1351 PHE A CB  1 
ATOM 7979  H H   . PHE A 1 1351 ? 44.994  37.926  20.181  1.00 10.85  ? 1351 PHE A H   1 
ATOM 7980  H HA  . PHE A 1 1351 ? 43.048  39.696  20.813  1.00 10.85  ? 1351 PHE A HA  1 
ATOM 7981  N N   . GLN A 1 1352 ? 42.791  38.660  18.221  1.00 8.99   ? 1352 GLN A N   1 
ATOM 7982  C CA  . GLN A 1 1352 ? 42.353  38.804  16.845  1.00 13.10  ? 1352 GLN A CA  1 
ATOM 7983  C C   . GLN A 1 1352 ? 41.259  39.876  16.687  1.00 27.81  ? 1352 GLN A C   1 
ATOM 7984  O O   . GLN A 1 1352 ? 41.346  40.704  15.775  1.00 30.37  ? 1352 GLN A O   1 
ATOM 7985  C CB  . GLN A 1 1352 ? 41.897  37.446  16.317  1.00 12.81  ? 1352 GLN A CB  1 
ATOM 7986  H H   . GLN A 1 1352 ? 42.616  37.900  18.584  1.00 10.79  ? 1352 GLN A H   1 
ATOM 7987  H HA  . GLN A 1 1352 ? 43.112  39.085  16.309  1.00 15.72  ? 1352 GLN A HA  1 
ATOM 7988  N N   . THR A 1 1353 ? 40.233  39.903  17.564  1.00 33.76  ? 1353 THR A N   1 
ATOM 7989  C CA  . THR A 1 1353 ? 39.014  40.698  17.326  1.00 30.40  ? 1353 THR A CA  1 
ATOM 7990  C C   . THR A 1 1353 ? 38.634  41.678  18.442  1.00 24.03  ? 1353 THR A C   1 
ATOM 7991  O O   . THR A 1 1353 ? 37.487  42.154  18.463  1.00 25.57  ? 1353 THR A O   1 
ATOM 7992  C CB  . THR A 1 1353 ? 37.825  39.764  17.083  1.00 38.41  ? 1353 THR A CB  1 
ATOM 7993  H H   . THR A 1 1353 ? 40.222  39.468  18.306  1.00 40.51  ? 1353 THR A H   1 
ATOM 7994  H HA  . THR A 1 1353 ? 39.144  41.219  16.517  1.00 36.48  ? 1353 THR A HA  1 
ATOM 7995  N N   . LEU A 1 1354 ? 39.543  41.994  19.367  1.00 23.41  ? 1354 LEU A N   1 
ATOM 7996  C CA  . LEU A 1 1354 ? 39.274  42.981  20.400  1.00 25.56  ? 1354 LEU A CA  1 
ATOM 7997  C C   . LEU A 1 1354 ? 40.255  44.158  20.446  1.00 40.90  ? 1354 LEU A C   1 
ATOM 7998  O O   . LEU A 1 1354 ? 40.085  45.032  21.301  1.00 45.17  ? 1354 LEU A O   1 
ATOM 7999  C CB  . LEU A 1 1354 ? 39.270  42.302  21.776  1.00 20.85  ? 1354 LEU A CB  1 
ATOM 8000  H H   . LEU A 1 1354 ? 40.328  41.645  19.414  1.00 28.10  ? 1354 LEU A H   1 
ATOM 8001  H HA  . LEU A 1 1354 ? 38.388  43.347  20.252  1.00 30.67  ? 1354 LEU A HA  1 
ATOM 8002  N N   . ILE A 1 1355 ? 41.274  44.211  19.578  1.00 43.50  ? 1355 ILE A N   1 
ATOM 8003  C CA  . ILE A 1 1355 ? 42.290  45.263  19.681  1.00 40.02  ? 1355 ILE A CA  1 
ATOM 8004  C C   . ILE A 1 1355 ? 41.775  46.586  19.115  1.00 44.34  ? 1355 ILE A C   1 
ATOM 8005  O O   . ILE A 1 1355 ? 42.116  47.665  19.621  1.00 41.36  ? 1355 ILE A O   1 
ATOM 8006  C CB  . ILE A 1 1355 ? 43.583  44.833  18.967  1.00 42.42  ? 1355 ILE A CB  1 
ATOM 8007  H HA  . ILE A 1 1355 ? 42.501  45.403  20.617  1.00 48.03  ? 1355 ILE A HA  1 
ATOM 8008  N N   . GLN A 1 1356 ? 40.971  46.529  18.053  1.00 48.79  ? 1356 GLN A N   1 
ATOM 8009  C CA  . GLN A 1 1356 ? 40.420  47.713  17.405  1.00 47.82  ? 1356 GLN A CA  1 
ATOM 8010  C C   . GLN A 1 1356 ? 38.903  47.837  17.560  1.00 52.04  ? 1356 GLN A C   1 
ATOM 8011  O O   . GLN A 1 1356 ? 38.413  48.924  17.897  1.00 41.77  ? 1356 GLN A O   1 
ATOM 8012  C CB  . GLN A 1 1356 ? 40.793  47.699  15.914  1.00 45.06  ? 1356 GLN A CB  1 
ATOM 8013  H HA  . GLN A 1 1356 ? 40.822  48.501  17.803  1.00 57.39  ? 1356 GLN A HA  1 
ATOM 8014  N N   . MET A 1 1357 ? 38.151  46.748  17.319  1.00 59.82  ? 1357 MET A N   1 
ATOM 8015  C CA  . MET A 1 1357 ? 36.685  46.795  17.358  1.00 50.66  ? 1357 MET A CA  1 
ATOM 8016  C C   . MET A 1 1357 ? 36.148  46.786  18.782  1.00 46.33  ? 1357 MET A C   1 
ATOM 8017  O O   . MET A 1 1357 ? 35.005  47.187  19.005  1.00 48.09  ? 1357 MET A O   1 
ATOM 8018  C CB  . MET A 1 1357 ? 36.084  45.612  16.588  1.00 43.80  ? 1357 MET A CB  1 
ATOM 8019  H HA  . MET A 1 1357 ? 36.390  47.609  16.921  1.00 60.79  ? 1357 MET A HA  1 
ATOM 8020  N N   . MET A 1 1358 ? 36.936  46.330  19.756  1.00 49.06  ? 1358 MET A N   1 
ATOM 8021  C CA  . MET A 1 1358 ? 36.436  46.240  21.124  1.00 45.82  ? 1358 MET A CA  1 
ATOM 8022  C C   . MET A 1 1358 ? 36.629  47.538  21.930  1.00 64.47  ? 1358 MET A C   1 
ATOM 8023  O O   . MET A 1 1358 ? 35.884  47.749  22.894  1.00 67.81  ? 1358 MET A O   1 
ATOM 8024  C CB  . MET A 1 1358 ? 37.106  45.065  21.846  1.00 37.69  ? 1358 MET A CB  1 
ATOM 8025  H HA  . MET A 1 1358 ? 35.486  46.048  21.085  1.00 54.98  ? 1358 MET A HA  1 
ATOM 8026  N N   . ARG A 1 1359 ? 37.618  48.401  21.583  1.00 69.15  ? 1359 ARG A N   1 
ATOM 8027  C CA  . ARG A 1 1359 ? 37.907  49.617  22.364  1.00 67.46  ? 1359 ARG A CA  1 
ATOM 8028  C C   . ARG A 1 1359 ? 36.850  50.702  22.174  1.00 69.10  ? 1359 ARG A C   1 
ATOM 8029  O O   . ARG A 1 1359 ? 36.536  51.443  23.116  1.00 65.50  ? 1359 ARG A O   1 
ATOM 8030  C CB  . ARG A 1 1359 ? 39.279  50.190  21.983  1.00 37.48  ? 1359 ARG A CB  1 
ATOM 8031  H H   . ARG A 1 1359 ? 38.130  48.298  20.900  1.00 82.98  ? 1359 ARG A H   1 
ATOM 8032  H HA  . ARG A 1 1359 ? 37.931  49.386  23.306  1.00 80.96  ? 1359 ARG A HA  1 
ATOM 8033  N N   . SER A 1 1360 ? 36.365  50.870  20.942  1.00 78.65  ? 1360 SER A N   1 
ATOM 8034  C CA  . SER A 1 1360 ? 35.263  51.795  20.679  1.00 89.23  ? 1360 SER A CA  1 
ATOM 8035  C C   . SER A 1 1360 ? 33.903  51.195  21.061  1.00 83.89  ? 1360 SER A C   1 
ATOM 8036  O O   . SER A 1 1360 ? 32.973  51.932  21.424  1.00 65.04  ? 1360 SER A O   1 
ATOM 8037  C CB  . SER A 1 1360 ? 35.274  52.196  19.202  1.00 96.52  ? 1360 SER A CB  1 
ATOM 8038  H H   . SER A 1 1360 ? 36.656  50.460  20.243  1.00 94.38  ? 1360 SER A H   1 
ATOM 8039  H HA  . SER A 1 1360 ? 35.394  52.598  21.208  1.00 107.07 ? 1360 SER A HA  1 
ATOM 8040  N N   . GLU A 1 1361 ? 33.762  49.864  20.965  1.00 94.71  ? 1361 GLU A N   1 
ATOM 8041  C CA  . GLU A 1 1361 ? 32.498  49.201  21.284  1.00 98.02  ? 1361 GLU A CA  1 
ATOM 8042  C C   . GLU A 1 1361 ? 32.238  49.164  22.788  1.00 78.85  ? 1361 GLU A C   1 
ATOM 8043  O O   . GLU A 1 1361 ? 31.129  49.497  23.242  1.00 59.11  ? 1361 GLU A O   1 
ATOM 8044  C CB  . GLU A 1 1361 ? 32.502  47.775  20.716  1.00 108.91 ? 1361 GLU A CB  1 
ATOM 8045  H H   . GLU A 1 1361 ? 34.386  49.326  20.716  1.00 113.65 ? 1361 GLU A H   1 
ATOM 8046  H HA  . GLU A 1 1361 ? 31.771  49.689  20.866  1.00 117.62 ? 1361 GLU A HA  1 
ATOM 8047  N N   . ARG A 1 1362 ? 33.250  48.760  23.574  1.00 74.42  ? 1362 ARG A N   1 
ATOM 8048  C CA  . ARG A 1 1362 ? 33.073  48.620  25.012  1.00 52.97  ? 1362 ARG A CA  1 
ATOM 8049  C C   . ARG A 1 1362 ? 32.412  49.870  25.572  1.00 45.81  ? 1362 ARG A C   1 
ATOM 8050  O O   . ARG A 1 1362 ? 31.559  49.784  26.462  1.00 37.39  ? 1362 ARG A O   1 
ATOM 8051  C CB  . ARG A 1 1362 ? 34.427  48.359  25.678  1.00 41.19  ? 1362 ARG A CB  1 
ATOM 8052  H H   . ARG A 1 1362 ? 34.040  48.566  23.293  1.00 89.30  ? 1362 ARG A H   1 
ATOM 8053  H HA  . ARG A 1 1362 ? 32.494  47.863  25.192  1.00 63.57  ? 1362 ARG A HA  1 
ATOM 8054  N N   . ASP A 1 1363 ? 32.760  51.039  25.017  1.00 47.78  ? 1363 ASP A N   1 
ATOM 8055  C CA  . ASP A 1 1363 ? 32.178  52.298  25.463  1.00 38.95  ? 1363 ASP A CA  1 
ATOM 8056  C C   . ASP A 1 1363 ? 30.662  52.233  25.522  1.00 28.48  ? 1363 ASP A C   1 
ATOM 8057  O O   . ASP A 1 1363 ? 30.051  52.886  26.372  1.00 30.12  ? 1363 ASP A O   1 
ATOM 8058  C CB  . ASP A 1 1363 ? 32.606  53.434  24.533  1.00 47.94  ? 1363 ASP A CB  1 
ATOM 8059  H H   . ASP A 1 1363 ? 33.332  51.123  24.380  1.00 57.33  ? 1363 ASP A H   1 
ATOM 8060  H HA  . ASP A 1 1363 ? 32.504  52.499  26.353  1.00 46.74  ? 1363 ASP A HA  1 
ATOM 8061  N N   . ARG A 1 1364 ? 30.047  51.477  24.622  1.00 19.57  ? 1364 ARG A N   1 
ATOM 8062  C CA  . ARG A 1 1364 ? 28.613  51.290  24.693  1.00 14.30  ? 1364 ARG A CA  1 
ATOM 8063  C C   . ARG A 1 1364 ? 28.182  51.128  26.142  1.00 19.84  ? 1364 ARG A C   1 
ATOM 8064  O O   . ARG A 1 1364 ? 28.653  50.228  26.841  1.00 21.16  ? 1364 ARG A O   1 
ATOM 8065  C CB  . ARG A 1 1364 ? 28.210  50.069  23.877  1.00 12.35  ? 1364 ARG A CB  1 
ATOM 8066  H HA  . ARG A 1 1364 ? 28.166  52.068  24.324  1.00 17.16  ? 1364 ARG A HA  1 
ATOM 8067  N N   . MET A 1 1365 ? 27.338  52.056  26.597  1.00 24.16  ? 1365 MET A N   1 
ATOM 8068  C CA  . MET A 1 1365 ? 26.706  52.022  27.919  1.00 33.37  ? 1365 MET A CA  1 
ATOM 8069  C C   . MET A 1 1365 ? 27.415  52.778  29.065  1.00 49.76  ? 1365 MET A C   1 
ATOM 8070  O O   . MET A 1 1365 ? 27.129  52.509  30.236  1.00 54.66  ? 1365 MET A O   1 
ATOM 8071  C CB  . MET A 1 1365 ? 26.506  50.556  28.319  1.00 26.34  ? 1365 MET A CB  1 
ATOM 8072  H H   . MET A 1 1365 ? 27.107  52.745  26.136  1.00 29.00  ? 1365 MET A H   1 
ATOM 8073  H HA  . MET A 1 1365 ? 25.821  52.407  27.826  1.00 40.05  ? 1365 MET A HA  1 
ATOM 8074  N N   . ASP A 1 1366 ? 28.269  53.773  28.779  1.00 51.47  ? 1366 ASP A N   1 
ATOM 8075  C CA  . ASP A 1 1366 ? 29.016  54.498  29.824  1.00 53.17  ? 1366 ASP A CA  1 
ATOM 8076  C C   . ASP A 1 1366 ? 28.355  55.839  30.191  1.00 60.03  ? 1366 ASP A C   1 
ATOM 8077  O O   . ASP A 1 1366 ? 28.966  56.905  30.077  1.00 71.53  ? 1366 ASP A O   1 
ATOM 8078  C CB  . ASP A 1 1366 ? 30.459  54.718  29.377  1.00 45.35  ? 1366 ASP A CB  1 
ATOM 8079  H HA  . ASP A 1 1366 ? 29.037  53.952  30.625  1.00 63.80  ? 1366 ASP A HA  1 
ATOM 8080  N N   . GLU A 1 1367 ? 27.106  55.777  30.681  1.00 53.46  ? 1367 GLU A N   1 
ATOM 8081  C CA  . GLU A 1 1367 ? 26.313  56.967  31.010  1.00 36.64  ? 1367 GLU A CA  1 
ATOM 8082  C C   . GLU A 1 1367 ? 25.950  57.030  32.487  1.00 30.08  ? 1367 GLU A C   1 
ATOM 8083  O O   . GLU A 1 1367 ? 24.997  57.720  32.864  1.00 28.46  ? 1367 GLU A O   1 
ATOM 8084  C CB  . GLU A 1 1367 ? 25.036  57.014  30.170  1.00 23.84  ? 1367 GLU A CB  1 
ATOM 8085  H H   . GLU A 1 1367 ? 26.692  55.040  30.835  1.00 64.16  ? 1367 GLU A H   1 
ATOM 8086  H HA  . GLU A 1 1367 ? 26.835  57.757  30.800  1.00 43.97  ? 1367 GLU A HA  1 
ATOM 8087  N N   . ASN A 1 1368 ? 26.686  56.316  33.329  1.00 35.78  ? 1368 ASN A N   1 
ATOM 8088  C CA  . ASN A 1 1368 ? 26.384  56.260  34.744  1.00 42.45  ? 1368 ASN A CA  1 
ATOM 8089  C C   . ASN A 1 1368 ? 26.758  57.581  35.415  1.00 36.97  ? 1368 ASN A C   1 
ATOM 8090  O O   . ASN A 1 1368 ? 27.453  58.431  34.848  1.00 31.12  ? 1368 ASN A O   1 
ATOM 8091  C CB  . ASN A 1 1368 ? 27.118  55.084  35.393  1.00 42.54  ? 1368 ASN A CB  1 
ATOM 8092  H HA  . ASN A 1 1368 ? 25.431  56.122  34.860  1.00 50.94  ? 1368 ASN A HA  1 
ATOM 8093  N N   . SER A 1 1369 ? 26.258  57.762  36.636  1.00 30.21  ? 1369 SER A N   1 
ATOM 8094  C CA  . SER A 1 1369 ? 26.690  58.900  37.420  1.00 22.17  ? 1369 SER A CA  1 
ATOM 8095  C C   . SER A 1 1369 ? 26.464  58.573  38.877  1.00 17.11  ? 1369 SER A C   1 
ATOM 8096  O O   . SER A 1 1369 ? 25.459  57.929  39.200  1.00 17.70  ? 1369 SER A O   1 
ATOM 8097  C CB  . SER A 1 1369 ? 25.920  60.168  37.062  1.00 18.56  ? 1369 SER A CB  1 
ATOM 8098  H HA  . SER A 1 1369 ? 27.636  59.058  37.278  1.00 26.61  ? 1369 SER A HA  1 
ATOM 8099  N N   . PRO A 1 1370 ? 27.359  58.977  39.760  1.00 16.45  ? 1370 PRO A N   1 
ATOM 8100  C CA  . PRO A 1 1370 ? 27.097  58.843  41.193  1.00 17.24  ? 1370 PRO A CA  1 
ATOM 8101  C C   . PRO A 1 1370 ? 26.483  57.520  41.633  1.00 19.58  ? 1370 PRO A C   1 
ATOM 8102  O O   . PRO A 1 1370 ? 25.587  57.540  42.478  1.00 25.87  ? 1370 PRO A O   1 
ATOM 8103  C CB  . PRO A 1 1370 ? 26.128  60.002  41.464  1.00 12.79  ? 1370 PRO A CB  1 
ATOM 8104  H HA  . PRO A 1 1370 ? 27.914  58.992  41.694  1.00 20.69  ? 1370 PRO A HA  1 
ATOM 8105  N N   . LEU A 1 1371 ? 26.919  56.372  41.108  1.00 18.56  ? 1371 LEU A N   1 
ATOM 8106  C CA  . LEU A 1 1371 ? 26.320  55.091  41.469  1.00 15.94  ? 1371 LEU A CA  1 
ATOM 8107  C C   . LEU A 1 1371 ? 27.292  54.331  42.366  1.00 13.34  ? 1371 LEU A C   1 
ATOM 8108  O O   . LEU A 1 1371 ? 28.400  54.000  41.944  1.00 13.06  ? 1371 LEU A O   1 
ATOM 8109  C CB  . LEU A 1 1371 ? 25.958  54.301  40.211  1.00 15.04  ? 1371 LEU A CB  1 
ATOM 8110  H HA  . LEU A 1 1371 ? 25.506  55.250  41.971  1.00 19.12  ? 1371 LEU A HA  1 
ATOM 8111  N N   . MET A 1 1372 ? 26.915  54.176  43.641  1.00 13.44  ? 1372 MET A N   1 
ATOM 8112  C CA  . MET A 1 1372 ? 27.701  53.384  44.584  1.00 16.60  ? 1372 MET A CA  1 
ATOM 8113  C C   . MET A 1 1372 ? 27.836  51.947  44.097  1.00 16.27  ? 1372 MET A C   1 
ATOM 8114  O O   . MET A 1 1372 ? 28.942  51.395  44.019  1.00 18.70  ? 1372 MET A O   1 
ATOM 8115  C CB  . MET A 1 1372 ? 27.056  53.419  45.965  1.00 22.74  ? 1372 MET A CB  1 
ATOM 8116  H H   . MET A 1 1372 ? 26.205  54.522  43.981  1.00 16.13  ? 1372 MET A H   1 
ATOM 8117  H HA  . MET A 1 1372 ? 28.586  53.773  44.659  1.00 19.92  ? 1372 MET A HA  1 
ATOM 8118  N N   . TYR A 1 1373 ? 26.709  51.314  43.781  1.00 14.54  ? 1373 TYR A N   1 
ATOM 8119  C CA  . TYR A 1 1373 ? 26.770  50.040  43.089  1.00 11.49  ? 1373 TYR A CA  1 
ATOM 8120  C C   . TYR A 1 1373 ? 27.644  50.187  41.861  1.00 12.53  ? 1373 TYR A C   1 
ATOM 8121  O O   . TYR A 1 1373 ? 28.530  49.363  41.623  1.00 14.48  ? 1373 TYR A O   1 
ATOM 8122  C CB  . TYR A 1 1373 ? 25.364  49.567  42.724  1.00 13.67  ? 1373 TYR A CB  1 
ATOM 8123  H H   . TYR A 1 1373 ? 25.916  51.597  43.953  1.00 17.45  ? 1373 TYR A H   1 
ATOM 8124  H HA  . TYR A 1 1373 ? 27.172  49.378  43.673  1.00 13.79  ? 1373 TYR A HA  1 
ATOM 8125  N N   . HIS A 1 1374 ? 27.443  51.256  41.088  1.00 11.90  ? 1374 HIS A N   1 
ATOM 8126  C CA  . HIS A 1 1374 ? 28.426  51.582  40.074  1.00 14.61  ? 1374 HIS A CA  1 
ATOM 8127  C C   . HIS A 1 1374 ? 29.677  52.181  40.700  1.00 16.13  ? 1374 HIS A C   1 
ATOM 8128  O O   . HIS A 1 1374 ? 30.639  52.441  39.980  1.00 17.37  ? 1374 HIS A O   1 
ATOM 8129  C CB  . HIS A 1 1374 ? 27.832  52.529  39.022  1.00 14.47  ? 1374 HIS A CB  1 
ATOM 8130  H H   . HIS A 1 1374 ? 26.769  51.788  41.132  1.00 14.28  ? 1374 HIS A H   1 
ATOM 8131  H HA  . HIS A 1 1374 ? 28.686  50.765  39.620  1.00 17.53  ? 1374 HIS A HA  1 
ATOM 8132  N N   . ILE A 1 1375 ? 29.698  52.426  42.014  1.00 16.75  ? 1375 ILE A N   1 
ATOM 8133  C CA  . ILE A 1 1375 ? 30.920  52.972  42.585  1.00 17.81  ? 1375 ILE A CA  1 
ATOM 8134  C C   . ILE A 1 1375 ? 31.970  51.875  42.699  1.00 24.07  ? 1375 ILE A C   1 
ATOM 8135  O O   . ILE A 1 1375 ? 33.170  52.144  42.615  1.00 27.32  ? 1375 ILE A O   1 
ATOM 8136  C CB  . ILE A 1 1375 ? 30.697  53.645  43.952  1.00 21.43  ? 1375 ILE A CB  1 
ATOM 8137  H HA  . ILE A 1 1375 ? 31.267  53.647  41.981  1.00 21.37  ? 1375 ILE A HA  1 
ATOM 8138  N N   . HIS A 1 1376 ? 31.559  50.625  42.897  1.00 22.73  ? 1376 HIS A N   1 
ATOM 8139  C CA  . HIS A 1 1376 ? 32.540  49.552  42.841  1.00 13.72  ? 1376 HIS A CA  1 
ATOM 8140  C C   . HIS A 1 1376 ? 32.851  49.205  41.385  1.00 10.33  ? 1376 HIS A C   1 
ATOM 8141  O O   . HIS A 1 1376 ? 33.893  48.607  41.096  1.00 8.78   ? 1376 HIS A O   1 
ATOM 8142  C CB  . HIS A 1 1376 ? 32.029  48.360  43.641  1.00 8.78   ? 1376 HIS A CB  1 
ATOM 8143  H H   . HIS A 1 1376 ? 30.750  50.380  43.059  1.00 27.28  ? 1376 HIS A H   1 
ATOM 8144  H HA  . HIS A 1 1376 ? 33.363  49.858  43.255  1.00 16.47  ? 1376 HIS A HA  1 
ATOM 8145  N N   . LEU A 1 1377 ? 31.977  49.611  40.471  1.00 11.01  ? 1377 LEU A N   1 
ATOM 8146  C CA  . LEU A 1 1377 ? 32.263  49.633  39.037  1.00 10.61  ? 1377 LEU A CA  1 
ATOM 8147  C C   . LEU A 1 1377 ? 32.797  50.985  38.571  1.00 13.73  ? 1377 LEU A C   1 
ATOM 8148  O O   . LEU A 1 1377 ? 33.960  51.093  38.178  1.00 13.97  ? 1377 LEU A O   1 
ATOM 8149  C CB  . LEU A 1 1377 ? 30.986  49.301  38.280  1.00 15.95  ? 1377 LEU A CB  1 
ATOM 8150  H H   . LEU A 1 1377 ? 31.186  49.888  40.662  1.00 13.21  ? 1377 LEU A H   1 
ATOM 8151  H HA  . LEU A 1 1377 ? 32.925  48.955  38.830  1.00 12.73  ? 1377 LEU A HA  1 
ATOM 8152  N N   . VAL A 1 1378 ? 31.926  52.004  38.577  1.00 14.71  ? 1378 VAL A N   1 
ATOM 8153  C CA  . VAL A 1 1378 ? 32.233  53.347  38.078  1.00 16.52  ? 1378 VAL A CA  1 
ATOM 8154  C C   . VAL A 1 1378 ? 33.140  54.133  39.033  1.00 20.13  ? 1378 VAL A C   1 
ATOM 8155  O O   . VAL A 1 1378 ? 34.190  54.641  38.625  1.00 24.94  ? 1378 VAL A O   1 
ATOM 8156  C CB  . VAL A 1 1378 ? 30.918  54.096  37.806  1.00 13.81  ? 1378 VAL A CB  1 
ATOM 8157  H H   . VAL A 1 1378 ? 31.123  51.935  38.877  1.00 17.66  ? 1378 VAL A H   1 
ATOM 8158  H HA  . VAL A 1 1378 ? 32.702  53.262  37.233  1.00 19.82  ? 1378 VAL A HA  1 
ATOM 8159  N N   . GLU A 1 1379 ? 32.709  54.345  40.281  1.00 18.11  ? 1379 GLU A N   1 
ATOM 8160  C CA  . GLU A 1 1379 ? 33.599  55.012  41.250  1.00 17.96  ? 1379 GLU A CA  1 
ATOM 8161  C C   . GLU A 1 1379 ? 34.802  54.135  41.628  1.00 16.29  ? 1379 GLU A C   1 
ATOM 8162  O O   . GLU A 1 1379 ? 35.850  54.656  42.033  1.00 13.12  ? 1379 GLU A O   1 
ATOM 8163  C CB  . GLU A 1 1379 ? 32.838  55.433  42.512  1.00 12.50  ? 1379 GLU A CB  1 
ATOM 8164  H H   . GLU A 1 1379 ? 31.937  54.123  40.586  1.00 21.73  ? 1379 GLU A H   1 
ATOM 8165  H HA  . GLU A 1 1379 ? 33.947  55.819  40.839  1.00 21.56  ? 1379 GLU A HA  1 
ATOM 8166  N N   . LEU A 1 1380 ? 34.677  52.810  41.520  1.00 16.04  ? 1380 LEU A N   1 
ATOM 8167  C CA  . LEU A 1 1380 ? 35.822  51.927  41.668  1.00 13.64  ? 1380 LEU A CA  1 
ATOM 8168  C C   . LEU A 1 1380 ? 36.535  51.722  40.345  1.00 14.01  ? 1380 LEU A C   1 
ATOM 8169  O O   . LEU A 1 1380 ? 37.693  51.316  40.342  1.00 12.64  ? 1380 LEU A O   1 
ATOM 8170  C CB  . LEU A 1 1380 ? 35.394  50.574  42.238  1.00 16.07  ? 1380 LEU A CB  1 
ATOM 8171  H H   . LEU A 1 1380 ? 33.936  52.403  41.361  1.00 19.24  ? 1380 LEU A H   1 
ATOM 8172  H HA  . LEU A 1 1380 ? 36.452  52.328  42.288  1.00 16.36  ? 1380 LEU A HA  1 
ATOM 8173  N N   . LEU A 1 1381 ? 35.876  51.978  39.219  1.00 15.29  ? 1381 LEU A N   1 
ATOM 8174  C CA  . LEU A 1 1381 ? 36.625  52.014  37.975  1.00 15.28  ? 1381 LEU A CA  1 
ATOM 8175  C C   . LEU A 1 1381 ? 37.898  52.813  38.157  1.00 11.61  ? 1381 LEU A C   1 
ATOM 8176  O O   . LEU A 1 1381 ? 39.003  52.310  37.937  1.00 8.68   ? 1381 LEU A O   1 
ATOM 8177  C CB  . LEU A 1 1381 ? 35.774  52.608  36.854  1.00 22.95  ? 1381 LEU A CB  1 
ATOM 8178  H H   . LEU A 1 1381 ? 35.032  52.128  39.150  1.00 18.35  ? 1381 LEU A H   1 
ATOM 8179  H HA  . LEU A 1 1381 ? 36.869  51.110  37.724  1.00 18.33  ? 1381 LEU A HA  1 
ATOM 8180  N N   . ALA A 1 1382 ? 37.777  54.042  38.638  1.00 12.65  ? 1382 ALA A N   1 
ATOM 8181  C CA  . ALA A 1 1382 ? 38.964  54.846  38.833  1.00 10.29  ? 1382 ALA A CA  1 
ATOM 8182  C C   . ALA A 1 1382 ? 40.016  54.025  39.534  1.00 12.42  ? 1382 ALA A C   1 
ATOM 8183  O O   . ALA A 1 1382 ? 41.175  53.961  39.105  1.00 15.06  ? 1382 ALA A O   1 
ATOM 8184  C CB  . ALA A 1 1382 ? 38.619  56.081  39.650  1.00 13.79  ? 1382 ALA A CB  1 
ATOM 8185  H H   . ALA A 1 1382 ? 37.037  54.423  38.854  1.00 15.18  ? 1382 ALA A H   1 
ATOM 8186  H HA  . ALA A 1 1382 ? 39.312  55.130  37.973  1.00 12.35  ? 1382 ALA A HA  1 
ATOM 8187  H HB1 . ALA A 1 1382 ? 39.422  56.611  39.774  1.00 16.55  ? 1382 ALA A HB1 1 
ATOM 8188  H HB2 . ALA A 1 1382 ? 37.951  56.598  39.174  1.00 16.55  ? 1382 ALA A HB2 1 
ATOM 8189  H HB3 . ALA A 1 1382 ? 38.271  55.801  40.511  1.00 16.55  ? 1382 ALA A HB3 1 
ATOM 8190  N N   . VAL A 1 1383 ? 39.615  53.344  40.600  1.00 9.38   ? 1383 VAL A N   1 
ATOM 8191  C CA  . VAL A 1 1383 ? 40.505  52.465  41.337  1.00 15.80  ? 1383 VAL A CA  1 
ATOM 8192  C C   . VAL A 1 1383 ? 40.290  51.007  40.918  1.00 19.31  ? 1383 VAL A C   1 
ATOM 8193  O O   . VAL A 1 1383 ? 41.190  50.379  40.350  1.00 22.99  ? 1383 VAL A O   1 
ATOM 8194  C CB  . VAL A 1 1383 ? 40.291  52.667  42.847  1.00 14.37  ? 1383 VAL A CB  1 
ATOM 8195  H H   . VAL A 1 1383 ? 38.818  53.377  40.920  1.00 11.25  ? 1383 VAL A H   1 
ATOM 8196  H HA  . VAL A 1 1383 ? 41.423  52.702  41.131  1.00 18.96  ? 1383 VAL A HA  1 
ATOM 8197  N N   . CYS A 1 1384 ? 39.097  50.462  41.209  1.00 19.23  ? 1384 CYS A N   1 
ATOM 8198  C CA  . CYS A 1 1384 ? 38.835  49.019  41.104  1.00 23.70  ? 1384 CYS A CA  1 
ATOM 8199  C C   . CYS A 1 1384 ? 38.795  48.489  39.666  1.00 16.19  ? 1384 CYS A C   1 
ATOM 8200  O O   . CYS A 1 1384 ? 39.135  47.323  39.436  1.00 15.47  ? 1384 CYS A O   1 
ATOM 8201  C CB  . CYS A 1 1384 ? 37.518  48.670  41.805  1.00 22.66  ? 1384 CYS A CB  1 
ATOM 8202  H H   . CYS A 1 1384 ? 38.415  50.916  41.473  1.00 23.07  ? 1384 CYS A H   1 
ATOM 8203  H HA  . CYS A 1 1384 ? 39.544  48.546  41.567  1.00 28.43  ? 1384 CYS A HA  1 
ATOM 8204  N N   . THR A 1 1385 ? 38.363  49.288  38.697  1.00 10.72  ? 1385 THR A N   1 
ATOM 8205  C CA  . THR A 1 1385 ? 38.250  48.826  37.316  1.00 8.88   ? 1385 THR A CA  1 
ATOM 8206  C C   . THR A 1 1385 ? 39.229  49.609  36.475  1.00 8.88   ? 1385 THR A C   1 
ATOM 8207  O O   . THR A 1 1385 ? 39.085  50.823  36.342  1.00 8.88   ? 1385 THR A O   1 
ATOM 8208  C CB  . THR A 1 1385 ? 36.849  49.027  36.757  1.00 8.88   ? 1385 THR A CB  1 
ATOM 8209  H H   . THR A 1 1385 ? 38.127  50.107  38.813  1.00 12.87  ? 1385 THR A H   1 
ATOM 8210  H HA  . THR A 1 1385 ? 38.476  47.884  37.265  1.00 10.66  ? 1385 THR A HA  1 
ATOM 8211  N N   . GLU A 1 1386 ? 40.180  48.930  35.860  1.00 9.07   ? 1386 GLU A N   1 
ATOM 8212  C CA  . GLU A 1 1386 ? 41.256  49.685  35.242  1.00 9.07   ? 1386 GLU A CA  1 
ATOM 8213  C C   . GLU A 1 1386 ? 41.904  48.856  34.139  1.00 9.78   ? 1386 GLU A C   1 
ATOM 8214  O O   . GLU A 1 1386 ? 41.407  47.789  33.772  1.00 9.07   ? 1386 GLU A O   1 
ATOM 8215  C CB  . GLU A 1 1386 ? 42.267  50.122  36.308  1.00 17.13  ? 1386 GLU A CB  1 
ATOM 8216  H H   . GLU A 1 1386 ? 40.229  48.074  35.788  1.00 10.88  ? 1386 GLU A H   1 
ATOM 8217  H HA  . GLU A 1 1386 ? 40.886  50.484  34.836  1.00 10.88  ? 1386 GLU A HA  1 
ATOM 8218  N N   . GLY A 1 1387 ? 42.980  49.397  33.561  1.00 19.32  ? 1387 GLY A N   1 
ATOM 8219  C CA  . GLY A 1 1387 ? 43.953  48.640  32.797  1.00 25.21  ? 1387 GLY A CA  1 
ATOM 8220  C C   . GLY A 1 1387 ? 44.088  48.955  31.320  1.00 40.42  ? 1387 GLY A C   1 
ATOM 8221  O O   . GLY A 1 1387 ? 44.959  48.364  30.675  1.00 50.88  ? 1387 GLY A O   1 
ATOM 8222  H H   . GLY A 1 1387 ? 43.167  50.236  33.605  1.00 23.19  ? 1387 GLY A H   1 
ATOM 8223  H HA2 . GLY A 1 1387 ? 44.825  48.771  33.201  1.00 30.25  ? 1387 GLY A HA2 1 
ATOM 8224  H HA3 . GLY A 1 1387 ? 43.734  47.698  32.873  1.00 30.25  ? 1387 GLY A HA3 1 
ATOM 8225  N N   . LYS A 1 1388 ? 43.290  49.873  30.756  1.00 38.43  ? 1388 LYS A N   1 
ATOM 8226  C CA  . LYS A 1 1388 ? 43.218  50.009  29.300  1.00 47.46  ? 1388 LYS A CA  1 
ATOM 8227  C C   . LYS A 1 1388 ? 44.501  50.586  28.690  1.00 54.80  ? 1388 LYS A C   1 
ATOM 8228  O O   . LYS A 1 1388 ? 45.092  49.980  27.786  1.00 60.75  ? 1388 LYS A O   1 
ATOM 8229  C CB  . LYS A 1 1388 ? 42.018  50.877  28.923  1.00 56.70  ? 1388 LYS A CB  1 
ATOM 8230  H H   . LYS A 1 1388 ? 42.789  50.420  31.190  1.00 46.12  ? 1388 LYS A H   1 
ATOM 8231  H HA  . LYS A 1 1388 ? 43.079  49.130  28.913  1.00 56.96  ? 1388 LYS A HA  1 
ATOM 8232  N N   . ASN A 1 1389 ? 44.921  51.780  29.129  1.00 45.20  ? 1389 ASN A N   1 
ATOM 8233  C CA  . ASN A 1 1389 ? 45.987  52.507  28.433  1.00 53.28  ? 1389 ASN A CA  1 
ATOM 8234  C C   . ASN A 1 1389 ? 47.367  51.867  28.616  1.00 46.45  ? 1389 ASN A C   1 
ATOM 8235  O O   . ASN A 1 1389 ? 48.199  51.881  27.693  1.00 30.92  ? 1389 ASN A O   1 
ATOM 8236  C CB  . ASN A 1 1389 ? 46.013  53.951  28.922  1.00 44.45  ? 1389 ASN A CB  1 
ATOM 8237  H H   . ASN A 1 1389 ? 44.607  52.185  29.819  1.00 54.24  ? 1389 ASN A H   1 
ATOM 8238  H HA  . ASN A 1 1389 ? 45.790  52.518  27.483  1.00 63.94  ? 1389 ASN A HA  1 
ATOM 8239  N N   . VAL A 1 1390 ? 47.653  51.378  29.822  1.00 50.68  ? 1390 VAL A N   1 
ATOM 8240  C CA  . VAL A 1 1390 ? 48.917  50.701  30.080  1.00 53.65  ? 1390 VAL A CA  1 
ATOM 8241  C C   . VAL A 1 1390 ? 48.950  49.319  29.411  1.00 50.36  ? 1390 VAL A C   1 
ATOM 8242  O O   . VAL A 1 1390 ? 49.994  48.898  28.906  1.00 57.43  ? 1390 VAL A O   1 
ATOM 8243  C CB  . VAL A 1 1390 ? 49.161  50.619  31.600  1.00 48.68  ? 1390 VAL A CB  1 
ATOM 8244  H H   . VAL A 1 1390 ? 47.132  51.426  30.505  1.00 60.81  ? 1390 VAL A H   1 
ATOM 8245  H HA  . VAL A 1 1390 ? 49.635  51.229  29.696  1.00 64.38  ? 1390 VAL A HA  1 
ATOM 8246  N N   . TYR A 1 1391 ? 47.815  48.598  29.375  1.00 42.61  ? 1391 TYR A N   1 
ATOM 8247  C CA  . TYR A 1 1391 ? 47.825  47.202  28.919  1.00 27.43  ? 1391 TYR A CA  1 
ATOM 8248  C C   . TYR A 1 1391 ? 47.944  47.077  27.406  1.00 20.12  ? 1391 TYR A C   1 
ATOM 8249  O O   . TYR A 1 1391 ? 48.481  46.078  26.918  1.00 9.21   ? 1391 TYR A O   1 
ATOM 8250  C CB  . TYR A 1 1391 ? 46.563  46.482  29.385  1.00 21.04  ? 1391 TYR A CB  1 
ATOM 8251  H HA  . TYR A 1 1391 ? 48.587  46.750  29.314  1.00 32.92  ? 1391 TYR A HA  1 
ATOM 8252  N N   . THR A 1 1392 ? 47.434  48.052  26.657  1.00 27.40  ? 1392 THR A N   1 
ATOM 8253  C CA  . THR A 1 1392 ? 47.528  48.073  25.204  1.00 35.04  ? 1392 THR A CA  1 
ATOM 8254  C C   . THR A 1 1392 ? 48.362  49.284  24.771  1.00 49.01  ? 1392 THR A C   1 
ATOM 8255  O O   . THR A 1 1392 ? 47.981  50.437  25.008  1.00 54.31  ? 1392 THR A O   1 
ATOM 8256  C CB  . THR A 1 1392 ? 46.139  48.110  24.566  1.00 32.46  ? 1392 THR A CB  1 
ATOM 8257  H H   . THR A 1 1392 ? 47.017  48.731  26.980  1.00 32.88  ? 1392 THR A H   1 
ATOM 8258  H HA  . THR A 1 1392 ? 47.980  47.270  24.901  1.00 42.05  ? 1392 THR A HA  1 
ATOM 8259  N N   . GLU A 1 1393 ? 49.518  49.013  24.159  1.00 71.60  ? 1393 GLU A N   1 
ATOM 8260  C CA  . GLU A 1 1393 ? 50.310  50.024  23.465  1.00 80.84  ? 1393 GLU A CA  1 
ATOM 8261  C C   . GLU A 1 1393 ? 50.896  49.485  22.153  1.00 85.33  ? 1393 GLU A C   1 
ATOM 8262  O O   . GLU A 1 1393 ? 51.680  50.192  21.505  1.00 95.17  ? 1393 GLU A O   1 
ATOM 8263  C CB  . GLU A 1 1393 ? 51.439  50.555  24.371  1.00 65.46  ? 1393 GLU A CB  1 
ATOM 8264  H HA  . GLU A 1 1393 ? 49.733  50.772  23.244  1.00 97.01  ? 1393 GLU A HA  1 
ATOM 8265  N N   . ILE A 1 1394 ? 50.525  48.265  21.742  1.00 74.77  ? 1394 ILE A N   1 
ATOM 8266  C CA  . ILE A 1 1394 ? 51.094  47.643  20.546  1.00 55.34  ? 1394 ILE A CA  1 
ATOM 8267  C C   . ILE A 1 1394 ? 50.306  47.980  19.276  1.00 66.89  ? 1394 ILE A C   1 
ATOM 8268  O O   . ILE A 1 1394 ? 50.876  47.931  18.177  1.00 71.26  ? 1394 ILE A O   1 
ATOM 8269  C CB  . ILE A 1 1394 ? 51.181  46.116  20.740  1.00 46.57  ? 1394 ILE A CB  1 
ATOM 8270  H HA  . ILE A 1 1394 ? 51.998  47.975  20.426  1.00 66.41  ? 1394 ILE A HA  1 
ATOM 8271  N N   . LYS A 1 1395 ? 49.001  48.285  19.386  1.00 73.68  ? 1395 LYS A N   1 
ATOM 8272  C CA  . LYS A 1 1395 ? 48.177  48.731  18.260  1.00 66.01  ? 1395 LYS A CA  1 
ATOM 8273  C C   . LYS A 1 1395 ? 47.452  50.045  18.580  1.00 47.35  ? 1395 LYS A C   1 
ATOM 8274  O O   . LYS A 1 1395 ? 46.919  50.220  19.682  1.00 40.92  ? 1395 LYS A O   1 
ATOM 8275  C CB  . LYS A 1 1395 ? 47.149  47.649  17.862  1.00 58.60  ? 1395 LYS A CB  1 
ATOM 8276  H H   . LYS A 1 1395 ? 48.564  48.237  20.126  1.00 88.41  ? 1395 LYS A H   1 
ATOM 8277  H HA  . LYS A 1 1395 ? 48.752  48.889  17.495  1.00 79.21  ? 1395 LYS A HA  1 
ATOM 8278  N N   . CYS A 1 1396 ? 47.423  50.968  17.593  1.00 30.32  ? 1396 CYS A N   1 
ATOM 8279  C CA  . CYS A 1 1396 ? 46.799  52.292  17.739  1.00 21.73  ? 1396 CYS A CA  1 
ATOM 8280  C C   . CYS A 1 1396 ? 45.899  52.581  16.517  1.00 20.45  ? 1396 CYS A C   1 
ATOM 8281  O O   . CYS A 1 1396 ? 46.285  53.335  15.621  1.00 9.30   ? 1396 CYS A O   1 
ATOM 8282  C CB  . CYS A 1 1396 ? 47.864  53.374  17.911  1.00 9.30   ? 1396 CYS A CB  1 
ATOM 8283  H H   . CYS A 1 1396 ? 47.768  50.841  16.815  1.00 36.38  ? 1396 CYS A H   1 
ATOM 8284  H HA  . CYS A 1 1396 ? 46.239  52.293  18.531  1.00 26.08  ? 1396 CYS A HA  1 
ATOM 8285  N N   . ASN A 1 1397 ? 44.681  51.990  16.507  1.00 35.80  ? 1397 ASN A N   1 
ATOM 8286  C CA  . ASN A 1 1397 ? 43.730  52.061  15.389  1.00 21.76  ? 1397 ASN A CA  1 
ATOM 8287  C C   . ASN A 1 1397 ? 42.313  52.555  15.745  1.00 19.88  ? 1397 ASN A C   1 
ATOM 8288  O O   . ASN A 1 1397 ? 41.437  52.529  14.874  1.00 18.59  ? 1397 ASN A O   1 
ATOM 8289  C CB  . ASN A 1 1397 ? 43.607  50.680  14.724  1.00 22.13  ? 1397 ASN A CB  1 
ATOM 8290  H HA  . ASN A 1 1397 ? 44.089  52.670  14.725  1.00 26.12  ? 1397 ASN A HA  1 
ATOM 8291  N N   . SER A 1 1398 ? 42.058  52.973  16.986  1.00 25.43  ? 1398 SER A N   1 
ATOM 8292  C CA  . SER A 1 1398 ? 40.835  53.668  17.398  1.00 18.78  ? 1398 SER A CA  1 
ATOM 8293  C C   . SER A 1 1398 ? 41.241  55.007  18.026  1.00 27.23  ? 1398 SER A C   1 
ATOM 8294  O O   . SER A 1 1398 ? 42.414  55.232  18.316  1.00 45.32  ? 1398 SER A O   1 
ATOM 8295  C CB  . SER A 1 1398 ? 40.023  52.806  18.376  1.00 17.24  ? 1398 SER A CB  1 
ATOM 8296  H H   . SER A 1 1398 ? 42.607  52.859  17.638  1.00 30.52  ? 1398 SER A H   1 
ATOM 8297  H HA  . SER A 1 1398 ? 40.286  53.847  16.618  1.00 22.54  ? 1398 SER A HA  1 
ATOM 8298  N N   . LEU A 1 1399 ? 40.302  55.931  18.232  1.00 29.07  ? 1399 LEU A N   1 
ATOM 8299  C CA  . LEU A 1 1399 ? 40.702  57.242  18.768  1.00 32.71  ? 1399 LEU A CA  1 
ATOM 8300  C C   . LEU A 1 1399 ? 39.529  57.948  19.442  1.00 38.91  ? 1399 LEU A C   1 
ATOM 8301  O O   . LEU A 1 1399 ? 38.371  57.547  19.305  1.00 46.33  ? 1399 LEU A O   1 
ATOM 8302  C CB  . LEU A 1 1399 ? 41.283  58.133  17.668  1.00 36.92  ? 1399 LEU A CB  1 
ATOM 8303  H H   . LEU A 1 1399 ? 39.461  55.835  18.078  1.00 34.89  ? 1399 LEU A H   1 
ATOM 8304  H HA  . LEU A 1 1399 ? 41.392  57.108  19.436  1.00 39.25  ? 1399 LEU A HA  1 
ATOM 8305  N N   . LEU A 1 1400 ? 39.862  59.014  20.205  1.00 28.68  ? 1400 LEU A N   1 
ATOM 8306  C CA  . LEU A 1 1400 ? 38.912  59.955  20.802  1.00 28.32  ? 1400 LEU A CA  1 
ATOM 8307  C C   . LEU A 1 1400 ? 38.263  59.428  22.071  1.00 31.28  ? 1400 LEU A C   1 
ATOM 8308  O O   . LEU A 1 1400 ? 37.280  60.017  22.538  1.00 26.99  ? 1400 LEU A O   1 
ATOM 8309  C CB  . LEU A 1 1400 ? 37.808  60.314  19.808  1.00 31.40  ? 1400 LEU A CB  1 
ATOM 8310  H HA  . LEU A 1 1400 ? 39.384  60.772  21.028  1.00 33.98  ? 1400 LEU A HA  1 
ATOM 8311  N N   . PRO A 1 1401 ? 38.765  58.342  22.664  1.00 57.60  ? 1401 PRO A N   1 
ATOM 8312  C CA  . PRO A 1 1401 ? 38.138  57.839  23.908  1.00 80.47  ? 1401 PRO A CA  1 
ATOM 8313  C C   . PRO A 1 1401 ? 38.577  58.610  25.163  1.00 88.55  ? 1401 PRO A C   1 
ATOM 8314  O O   . PRO A 1 1401 ? 37.788  58.804  26.119  1.00 98.35  ? 1401 PRO A O   1 
ATOM 8315  C CB  . PRO A 1 1401 ? 38.577  56.364  23.942  1.00 100.89 ? 1401 PRO A CB  1 
ATOM 8316  H HA  . PRO A 1 1401 ? 37.172  57.880  23.834  1.00 96.56  ? 1401 PRO A HA  1 
ATOM 8317  N N   . LEU A 1 1402 ? 39.840  59.072  25.172  1.00 79.47  ? 1402 LEU A N   1 
ATOM 8318  C CA  . LEU A 1 1402 ? 40.397  59.704  26.367  1.00 52.26  ? 1402 LEU A CA  1 
ATOM 8319  C C   . LEU A 1 1402 ? 39.581  60.913  26.791  1.00 57.56  ? 1402 LEU A C   1 
ATOM 8320  O O   . LEU A 1 1402 ? 39.528  61.236  27.986  1.00 49.30  ? 1402 LEU A O   1 
ATOM 8321  C CB  . LEU A 1 1402 ? 41.849  60.121  26.119  1.00 39.60  ? 1402 LEU A CB  1 
ATOM 8322  H HA  . LEU A 1 1402 ? 40.388  59.065  27.096  1.00 62.71  ? 1402 LEU A HA  1 
ATOM 8323  N N   . ASP A 1 1403 ? 38.944  61.590  25.825  1.00 75.50  ? 1403 ASP A N   1 
ATOM 8324  C CA  . ASP A 1 1403 ? 38.182  62.806  26.107  1.00 86.79  ? 1403 ASP A CA  1 
ATOM 8325  C C   . ASP A 1 1403 ? 36.917  62.518  26.929  1.00 84.53  ? 1403 ASP A C   1 
ATOM 8326  O O   . ASP A 1 1403 ? 36.734  63.079  28.020  1.00 65.18  ? 1403 ASP A O   1 
ATOM 8327  C CB  . ASP A 1 1403 ? 37.834  63.508  24.784  1.00 84.13  ? 1403 ASP A CB  1 
ATOM 8328  H H   . ASP A 1 1403 ? 38.940  61.361  24.997  1.00 90.60  ? 1403 ASP A H   1 
ATOM 8329  H HA  . ASP A 1 1403 ? 38.739  63.409  26.625  1.00 104.15 ? 1403 ASP A HA  1 
ATOM 8330  N N   . ASP A 1 1404 ? 36.021  61.660  26.418  1.00 80.23  ? 1404 ASP A N   1 
ATOM 8331  C CA  . ASP A 1 1404 ? 34.808  61.331  27.169  1.00 69.62  ? 1404 ASP A CA  1 
ATOM 8332  C C   . ASP A 1 1404 ? 35.171  60.858  28.572  1.00 54.78  ? 1404 ASP A C   1 
ATOM 8333  O O   . ASP A 1 1404 ? 34.574  61.303  29.566  1.00 51.19  ? 1404 ASP A O   1 
ATOM 8334  C CB  . ASP A 1 1404 ? 33.984  60.269  26.425  1.00 65.78  ? 1404 ASP A CB  1 
ATOM 8335  H H   . ASP A 1 1404 ? 36.092  61.265  25.658  1.00 96.27  ? 1404 ASP A H   1 
ATOM 8336  H HA  . ASP A 1 1404 ? 34.263  62.129  27.254  1.00 83.54  ? 1404 ASP A HA  1 
ATOM 8337  N N   . ILE A 1 1405 ? 36.181  59.980  28.679  1.00 66.92  ? 1405 ILE A N   1 
ATOM 8338  C CA  . ILE A 1 1405 ? 36.619  59.545  30.005  1.00 59.74  ? 1405 ILE A CA  1 
ATOM 8339  C C   . ILE A 1 1405 ? 36.962  60.756  30.877  1.00 53.71  ? 1405 ILE A C   1 
ATOM 8340  O O   . ILE A 1 1405 ? 36.344  60.995  31.933  1.00 47.87  ? 1405 ILE A O   1 
ATOM 8341  C CB  . ILE A 1 1405 ? 37.816  58.581  29.877  1.00 69.38  ? 1405 ILE A CB  1 
ATOM 8342  H H   . ILE A 1 1405 ? 36.613  59.634  28.020  1.00 80.31  ? 1405 ILE A H   1 
ATOM 8343  H HA  . ILE A 1 1405 ? 35.894  59.065  30.433  1.00 71.69  ? 1405 ILE A HA  1 
ATOM 8344  N N   . VAL A 1 1406 ? 37.938  61.549  30.423  1.00 43.82  ? 1406 VAL A N   1 
ATOM 8345  C CA  . VAL A 1 1406 ? 38.453  62.645  31.237  1.00 39.80  ? 1406 VAL A CA  1 
ATOM 8346  C C   . VAL A 1 1406 ? 37.301  63.511  31.728  1.00 40.40  ? 1406 VAL A C   1 
ATOM 8347  O O   . VAL A 1 1406 ? 37.318  64.004  32.860  1.00 41.34  ? 1406 VAL A O   1 
ATOM 8348  C CB  . VAL A 1 1406 ? 39.486  63.464  30.441  1.00 46.03  ? 1406 VAL A CB  1 
ATOM 8349  H H   . VAL A 1 1406 ? 38.314  61.472  29.654  1.00 52.58  ? 1406 VAL A H   1 
ATOM 8350  H HA  . VAL A 1 1406 ? 38.900  62.276  32.015  1.00 47.77  ? 1406 VAL A HA  1 
ATOM 8351  N N   . ARG A 1 1407 ? 36.269  63.684  30.894  1.00 37.59  ? 1407 ARG A N   1 
ATOM 8352  C CA  . ARG A 1 1407 ? 35.101  64.434  31.329  1.00 39.36  ? 1407 ARG A CA  1 
ATOM 8353  C C   . ARG A 1 1407 ? 34.363  63.704  32.439  1.00 39.36  ? 1407 ARG A C   1 
ATOM 8354  O O   . ARG A 1 1407 ? 33.870  64.338  33.381  1.00 35.65  ? 1407 ARG A O   1 
ATOM 8355  C CB  . ARG A 1 1407 ? 34.162  64.672  30.149  1.00 36.19  ? 1407 ARG A CB  1 
ATOM 8356  H H   . ARG A 1 1407 ? 36.226  63.382  30.090  1.00 45.10  ? 1407 ARG A H   1 
ATOM 8357  H HA  . ARG A 1 1407 ? 35.385  65.296  31.669  1.00 47.23  ? 1407 ARG A HA  1 
ATOM 8358  N N   . VAL A 1 1408 ? 34.287  62.373  32.347  1.00 45.40  ? 1408 VAL A N   1 
ATOM 8359  C CA  . VAL A 1 1408 ? 33.469  61.600  33.275  1.00 53.01  ? 1408 VAL A CA  1 
ATOM 8360  C C   . VAL A 1 1408 ? 34.066  61.583  34.681  1.00 50.72  ? 1408 VAL A C   1 
ATOM 8361  O O   . VAL A 1 1408 ? 33.328  61.490  35.670  1.00 61.01  ? 1408 VAL A O   1 
ATOM 8362  C CB  . VAL A 1 1408 ? 33.276  60.167  32.744  1.00 45.99  ? 1408 VAL A CB  1 
ATOM 8363  H H   . VAL A 1 1408 ? 34.699  61.900  31.758  1.00 54.48  ? 1408 VAL A H   1 
ATOM 8364  H HA  . VAL A 1 1408 ? 32.593  62.013  33.333  1.00 63.61  ? 1408 VAL A HA  1 
ATOM 8365  N N   . VAL A 1 1409 ? 35.395  61.624  34.807  1.00 43.51  ? 1409 VAL A N   1 
ATOM 8366  C CA  . VAL A 1 1409 ? 35.989  61.532  36.146  1.00 41.25  ? 1409 VAL A CA  1 
ATOM 8367  C C   . VAL A 1 1409 ? 35.667  62.763  37.001  1.00 43.94  ? 1409 VAL A C   1 
ATOM 8368  O O   . VAL A 1 1409 ? 35.512  62.646  38.224  1.00 46.20  ? 1409 VAL A O   1 
ATOM 8369  C CB  . VAL A 1 1409 ? 37.509  61.320  36.053  1.00 48.19  ? 1409 VAL A CB  1 
ATOM 8370  H H   . VAL A 1 1409 ? 35.957  61.702  34.161  1.00 52.21  ? 1409 VAL A H   1 
ATOM 8371  H HA  . VAL A 1 1409 ? 35.613  60.759  36.596  1.00 49.50  ? 1409 VAL A HA  1 
ATOM 8372  N N   . THR A 1 1410 ? 35.626  63.964  36.396  1.00 38.61  ? 1410 THR A N   1 
ATOM 8373  C CA  . THR A 1 1410 ? 35.343  65.197  37.133  1.00 26.95  ? 1410 THR A CA  1 
ATOM 8374  C C   . THR A 1 1410 ? 33.849  65.445  37.398  1.00 34.85  ? 1410 THR A C   1 
ATOM 8375  O O   . THR A 1 1410 ? 33.525  66.344  38.183  1.00 27.21  ? 1410 THR A O   1 
ATOM 8376  C CB  . THR A 1 1410 ? 35.926  66.397  36.380  1.00 13.97  ? 1410 THR A CB  1 
ATOM 8377  H H   . THR A 1 1410 ? 35.759  64.085  35.555  1.00 46.33  ? 1410 THR A H   1 
ATOM 8378  H HA  . THR A 1 1410 ? 35.787  65.149  37.994  1.00 32.34  ? 1410 THR A HA  1 
ATOM 8379  N N   . HIS A 1 1411 ? 32.935  64.671  36.785  1.00 46.87  ? 1411 HIS A N   1 
ATOM 8380  C CA  . HIS A 1 1411 ? 31.487  64.872  36.934  1.00 40.67  ? 1411 HIS A CA  1 
ATOM 8381  C C   . HIS A 1 1411 ? 30.922  64.170  38.175  1.00 47.63  ? 1411 HIS A C   1 
ATOM 8382  O O   . HIS A 1 1411 ? 30.117  64.757  38.910  1.00 32.82  ? 1411 HIS A O   1 
ATOM 8383  C CB  . HIS A 1 1411 ? 30.754  64.381  35.676  1.00 30.50  ? 1411 HIS A CB  1 
ATOM 8384  H HA  . HIS A 1 1411 ? 31.313  65.822  37.026  1.00 48.81  ? 1411 HIS A HA  1 
ATOM 8385  N N   . GLU A 1 1412 ? 31.336  62.913  38.417  1.00 67.47  ? 1412 GLU A N   1 
ATOM 8386  C CA  . GLU A 1 1412 ? 30.834  62.020  39.470  1.00 68.31  ? 1412 GLU A CA  1 
ATOM 8387  C C   . GLU A 1 1412 ? 31.537  62.202  40.818  1.00 70.38  ? 1412 GLU A C   1 
ATOM 8388  O O   . GLU A 1 1412 ? 30.897  62.048  41.866  1.00 82.70  ? 1412 GLU A O   1 
ATOM 8389  C CB  . GLU A 1 1412 ? 30.974  60.550  39.037  1.00 58.48  ? 1412 GLU A CB  1 
ATOM 8390  H HA  . GLU A 1 1412 ? 29.890  62.199  39.604  1.00 81.97  ? 1412 GLU A HA  1 
ATOM 8391  N N   . ASP A 1 1413 ? 32.845  62.474  40.819  1.00 62.46  ? 1413 ASP A N   1 
ATOM 8392  C CA  . ASP A 1 1413 ? 33.587  62.813  42.030  1.00 46.76  ? 1413 ASP A CA  1 
ATOM 8393  C C   . ASP A 1 1413 ? 34.047  61.588  42.819  1.00 27.88  ? 1413 ASP A C   1 
ATOM 8394  O O   . ASP A 1 1413 ? 33.959  60.441  42.356  1.00 15.88  ? 1413 ASP A O   1 
ATOM 8395  C CB  . ASP A 1 1413 ? 32.743  63.726  42.928  1.00 56.06  ? 1413 ASP A CB  1 
ATOM 8396  H H   . ASP A 1 1413 ? 33.334  62.467  40.111  1.00 74.95  ? 1413 ASP A H   1 
ATOM 8397  H HA  . ASP A 1 1413 ? 34.381  63.309  41.775  1.00 56.11  ? 1413 ASP A HA  1 
ATOM 8398  N N   . CYS A 1 1414 ? 34.522  61.862  44.037  1.00 34.75  ? 1414 CYS A N   1 
ATOM 8399  C CA  . CYS A 1 1414 ? 35.182  60.913  44.924  1.00 37.54  ? 1414 CYS A CA  1 
ATOM 8400  C C   . CYS A 1 1414 ? 35.382  61.531  46.313  1.00 40.18  ? 1414 CYS A C   1 
ATOM 8401  O O   . CYS A 1 1414 ? 34.762  62.548  46.626  1.00 54.66  ? 1414 CYS A O   1 
ATOM 8402  C CB  . CYS A 1 1414 ? 36.521  60.497  44.321  1.00 49.68  ? 1414 CYS A CB  1 
ATOM 8403  H HA  . CYS A 1 1414 ? 34.630  60.121  45.018  1.00 45.04  ? 1414 CYS A HA  1 
ATOM 8404  N N   . ILE A 1 1415 ? 36.236  60.957  47.157  1.00 27.38  ? 1415 ILE A N   1 
ATOM 8405  C CA  . ILE A 1 1415 ? 36.477  61.543  48.475  1.00 21.10  ? 1415 ILE A CA  1 
ATOM 8406  C C   . ILE A 1 1415 ? 37.299  62.825  48.316  1.00 26.98  ? 1415 ILE A C   1 
ATOM 8407  O O   . ILE A 1 1415 ? 37.834  63.106  47.232  1.00 28.63  ? 1415 ILE A O   1 
ATOM 8408  C CB  . ILE A 1 1415 ? 37.156  60.535  49.413  1.00 16.42  ? 1415 ILE A CB  1 
ATOM 8409  H HA  . ILE A 1 1415 ? 35.624  61.785  48.870  1.00 25.32  ? 1415 ILE A HA  1 
ATOM 8410  N N   . PRO A 1 1416 ? 37.442  63.611  49.384  1.00 25.71  ? 1416 PRO A N   1 
ATOM 8411  C CA  . PRO A 1 1416 ? 37.911  65.007  49.276  1.00 26.81  ? 1416 PRO A CA  1 
ATOM 8412  C C   . PRO A 1 1416 ? 39.404  65.125  48.959  1.00 29.29  ? 1416 PRO A C   1 
ATOM 8413  O O   . PRO A 1 1416 ? 40.250  64.749  49.772  1.00 32.45  ? 1416 PRO A O   1 
ATOM 8414  C CB  . PRO A 1 1416 ? 37.582  65.566  50.665  1.00 23.84  ? 1416 PRO A CB  1 
ATOM 8415  H HA  . PRO A 1 1416 ? 37.399  65.485  48.605  1.00 32.17  ? 1416 PRO A HA  1 
ATOM 8416  N N   . GLU A 1 1417 ? 39.729  65.695  47.786  1.00 26.22  ? 1417 GLU A N   1 
ATOM 8417  C CA  . GLU A 1 1417 ? 41.122  65.861  47.360  1.00 22.72  ? 1417 GLU A CA  1 
ATOM 8418  C C   . GLU A 1 1417 ? 41.793  64.539  47.032  1.00 27.01  ? 1417 GLU A C   1 
ATOM 8419  O O   . GLU A 1 1417 ? 42.040  64.236  45.863  1.00 26.98  ? 1417 GLU A O   1 
ATOM 8420  C CB  . GLU A 1 1417 ? 41.961  66.539  48.436  1.00 19.21  ? 1417 GLU A CB  1 
ATOM 8421  H HA  . GLU A 1 1417 ? 41.146  66.416  46.565  1.00 27.26  ? 1417 GLU A HA  1 
ATOM 8422  N N   . VAL A 1 1418 ? 42.128  63.783  48.086  1.00 34.53  ? 1418 VAL A N   1 
ATOM 8423  C CA  . VAL A 1 1418 ? 42.981  62.599  47.964  1.00 49.47  ? 1418 VAL A CA  1 
ATOM 8424  C C   . VAL A 1 1418 ? 42.324  61.530  47.092  1.00 35.49  ? 1418 VAL A C   1 
ATOM 8425  O O   . VAL A 1 1418 ? 42.984  60.896  46.264  1.00 35.45  ? 1418 VAL A O   1 
ATOM 8426  C CB  . VAL A 1 1418 ? 43.332  62.045  49.360  1.00 55.11  ? 1418 VAL A CB  1 
ATOM 8427  H H   . VAL A 1 1418 ? 41.868  63.939  48.891  1.00 41.44  ? 1418 VAL A H   1 
ATOM 8428  H HA  . VAL A 1 1418 ? 43.811  62.859  47.534  1.00 59.37  ? 1418 VAL A HA  1 
ATOM 8429  N N   . LYS A 1 1419 ? 41.037  61.272  47.293  1.00 28.62  ? 1419 LYS A N   1 
ATOM 8430  C CA  . LYS A 1 1419 ? 40.373  60.340  46.399  1.00 22.94  ? 1419 LYS A CA  1 
ATOM 8431  C C   . LYS A 1 1419 ? 40.176  60.980  45.035  1.00 26.51  ? 1419 LYS A C   1 
ATOM 8432  O O   . LYS A 1 1419 ? 40.404  60.338  44.003  1.00 25.08  ? 1419 LYS A O   1 
ATOM 8433  C CB  . LYS A 1 1419 ? 39.039  59.901  46.996  1.00 26.24  ? 1419 LYS A CB  1 
ATOM 8434  H H   . LYS A 1 1419 ? 40.546  61.608  47.913  1.00 34.34  ? 1419 LYS A H   1 
ATOM 8435  H HA  . LYS A 1 1419 ? 40.929  59.553  46.287  1.00 27.53  ? 1419 LYS A HA  1 
ATOM 8436  N N   . ILE A 1 1420 ? 39.772  62.258  45.019  1.00 29.12  ? 1420 ILE A N   1 
ATOM 8437  C CA  . ILE A 1 1420 ? 39.493  62.957  43.768  1.00 30.94  ? 1420 ILE A CA  1 
ATOM 8438  C C   . ILE A 1 1420 ? 40.701  62.879  42.847  1.00 36.23  ? 1420 ILE A C   1 
ATOM 8439  O O   . ILE A 1 1420 ? 40.598  62.445  41.692  1.00 42.78  ? 1420 ILE A O   1 
ATOM 8440  C CB  . ILE A 1 1420 ? 39.090  64.418  44.056  1.00 24.58  ? 1420 ILE A CB  1 
ATOM 8441  H H   . ILE A 1 1420 ? 39.653  62.738  45.722  1.00 34.95  ? 1420 ILE A H   1 
ATOM 8442  H HA  . ILE A 1 1420 ? 38.749  62.523  43.323  1.00 37.13  ? 1420 ILE A HA  1 
ATOM 8443  N N   . ALA A 1 1421 ? 41.865  63.291  43.349  1.00 35.95  ? 1421 ALA A N   1 
ATOM 8444  C CA  . ALA A 1 1421 ? 43.108  63.035  42.633  1.00 34.09  ? 1421 ALA A CA  1 
ATOM 8445  C C   . ALA A 1 1421 ? 43.308  61.550  42.408  1.00 40.12  ? 1421 ALA A C   1 
ATOM 8446  O O   . ALA A 1 1421 ? 43.755  61.127  41.337  1.00 43.50  ? 1421 ALA A O   1 
ATOM 8447  C CB  . ALA A 1 1421 ? 44.272  63.594  43.422  1.00 25.11  ? 1421 ALA A CB  1 
ATOM 8448  H H   . ALA A 1 1421 ? 41.960  63.714  44.091  1.00 43.14  ? 1421 ALA A H   1 
ATOM 8449  H HA  . ALA A 1 1421 ? 43.081  63.477  41.770  1.00 40.91  ? 1421 ALA A HA  1 
ATOM 8450  H HB1 . ALA A 1 1421 ? 45.094  63.419  42.938  1.00 30.13  ? 1421 ALA A HB1 1 
ATOM 8451  H HB2 . ALA A 1 1421 ? 44.148  64.550  43.531  1.00 30.13  ? 1421 ALA A HB2 1 
ATOM 8452  H HB3 . ALA A 1 1421 ? 44.300  63.162  44.290  1.00 30.13  ? 1421 ALA A HB3 1 
ATOM 8453  N N   . TYR A 1 1422 ? 43.041  60.750  43.445  1.00 41.54  ? 1422 TYR A N   1 
ATOM 8454  C CA  . TYR A 1 1422 ? 43.294  59.321  43.375  1.00 35.82  ? 1422 TYR A CA  1 
ATOM 8455  C C   . TYR A 1 1422 ? 42.420  58.659  42.319  1.00 40.13  ? 1422 TYR A C   1 
ATOM 8456  O O   . TYR A 1 1422 ? 42.890  57.807  41.559  1.00 52.76  ? 1422 TYR A O   1 
ATOM 8457  C CB  . TYR A 1 1422 ? 43.055  58.679  44.748  1.00 29.27  ? 1422 TYR A CB  1 
ATOM 8458  H H   . TYR A 1 1422 ? 42.715  61.015  44.195  1.00 49.85  ? 1422 TYR A H   1 
ATOM 8459  H HA  . TYR A 1 1422 ? 44.221  59.175  43.132  1.00 42.98  ? 1422 TYR A HA  1 
ATOM 8460  N N   . ILE A 1 1423 ? 41.144  59.038  42.255  1.00 25.19  ? 1423 ILE A N   1 
ATOM 8461  C CA  . ILE A 1 1423 ? 40.253  58.462  41.258  1.00 24.46  ? 1423 ILE A CA  1 
ATOM 8462  C C   . ILE A 1 1423 ? 40.664  58.879  39.848  1.00 26.34  ? 1423 ILE A C   1 
ATOM 8463  O O   . ILE A 1 1423 ? 40.606  58.074  38.911  1.00 23.89  ? 1423 ILE A O   1 
ATOM 8464  C CB  . ILE A 1 1423 ? 38.799  58.861  41.549  1.00 26.85  ? 1423 ILE A CB  1 
ATOM 8465  H H   . ILE A 1 1423 ? 40.776  59.618  42.772  1.00 30.23  ? 1423 ILE A H   1 
ATOM 8466  H HA  . ILE A 1 1423 ? 40.311  57.495  41.309  1.00 29.36  ? 1423 ILE A HA  1 
ATOM 8467  N N   . ASN A 1 1424 ? 41.068  60.140  39.671  1.00 33.44  ? 1424 ASN A N   1 
ATOM 8468  C CA  . ASN A 1 1424 ? 41.497  60.656  38.365  1.00 39.29  ? 1424 ASN A CA  1 
ATOM 8469  C C   . ASN A 1 1424 ? 42.974  61.062  38.263  1.00 40.91  ? 1424 ASN A C   1 
ATOM 8470  O O   . ASN A 1 1424 ? 43.597  60.840  37.215  1.00 38.95  ? 1424 ASN A O   1 
ATOM 8471  C CB  . ASN A 1 1424 ? 40.619  61.854  37.984  1.00 37.83  ? 1424 ASN A CB  1 
ATOM 8472  H H   . ASN A 1 1424 ? 41.103  60.725  40.300  1.00 40.13  ? 1424 ASN A H   1 
ATOM 8473  H HA  . ASN A 1 1424 ? 41.345  59.964  37.702  1.00 47.15  ? 1424 ASN A HA  1 
ATOM 8474  N N   . PHE A 1 1425 ? 43.563  61.712  39.284  1.00 36.92  ? 1425 PHE A N   1 
ATOM 8475  C CA  . PHE A 1 1425 ? 44.967  62.115  39.205  1.00 32.28  ? 1425 PHE A CA  1 
ATOM 8476  C C   . PHE A 1 1425 ? 45.934  60.934  39.392  1.00 32.94  ? 1425 PHE A C   1 
ATOM 8477  O O   . PHE A 1 1425 ? 46.986  60.891  38.744  1.00 31.96  ? 1425 PHE A O   1 
ATOM 8478  C CB  . PHE A 1 1425 ? 45.262  63.206  40.242  1.00 25.32  ? 1425 PHE A CB  1 
ATOM 8479  H H   . PHE A 1 1425 ? 43.173  61.925  40.019  1.00 44.31  ? 1425 PHE A H   1 
ATOM 8480  H HA  . PHE A 1 1425 ? 45.131  62.492  38.326  1.00 38.74  ? 1425 PHE A HA  1 
ATOM 8481  N N   . LEU A 1 1426 ? 45.617  59.985  40.295  1.00 42.89  ? 1426 LEU A N   1 
ATOM 8482  C CA  . LEU A 1 1426 ? 46.541  58.877  40.610  1.00 42.98  ? 1426 LEU A CA  1 
ATOM 8483  C C   . LEU A 1 1426 ? 46.646  57.855  39.473  1.00 30.25  ? 1426 LEU A C   1 
ATOM 8484  O O   . LEU A 1 1426 ? 47.723  57.294  39.227  1.00 25.95  ? 1426 LEU A O   1 
ATOM 8485  C CB  . LEU A 1 1426 ? 46.115  58.147  41.888  1.00 44.01  ? 1426 LEU A CB  1 
ATOM 8486  H H   . LEU A 1 1426 ? 44.879  59.962  40.736  1.00 51.46  ? 1426 LEU A H   1 
ATOM 8487  H HA  . LEU A 1 1426 ? 47.427  59.244  40.760  1.00 51.57  ? 1426 LEU A HA  1 
ATOM 8488  N N   . ASN A 1 1427 ? 45.531  57.537  38.817  1.00 33.96  ? 1427 ASN A N   1 
ATOM 8489  C CA  . ASN A 1 1427 ? 45.641  56.740  37.613  1.00 26.36  ? 1427 ASN A CA  1 
ATOM 8490  C C   . ASN A 1 1427 ? 46.532  57.447  36.600  1.00 30.23  ? 1427 ASN A C   1 
ATOM 8491  O O   . ASN A 1 1427 ? 47.182  56.778  35.796  1.00 25.43  ? 1427 ASN A O   1 
ATOM 8492  C CB  . ASN A 1 1427 ? 44.254  56.475  37.028  1.00 46.76  ? 1427 ASN A CB  1 
ATOM 8493  H H   . ASN A 1 1427 ? 44.732  57.763  39.041  1.00 40.75  ? 1427 ASN A H   1 
ATOM 8494  H HA  . ASN A 1 1427 ? 46.047  55.886  37.831  1.00 31.63  ? 1427 ASN A HA  1 
ATOM 8495  N N   . HIS A 1 1428 ? 46.555  58.798  36.615  1.00 34.64  ? 1428 HIS A N   1 
ATOM 8496  C CA  . HIS A 1 1428 ? 47.452  59.571  35.757  1.00 28.58  ? 1428 HIS A CA  1 
ATOM 8497  C C   . HIS A 1 1428 ? 48.914  59.410  36.162  1.00 20.08  ? 1428 HIS A C   1 
ATOM 8498  O O   . HIS A 1 1428 ? 49.785  59.283  35.300  1.00 16.15  ? 1428 HIS A O   1 
ATOM 8499  C CB  . HIS A 1 1428 ? 47.052  61.052  35.783  1.00 25.40  ? 1428 HIS A CB  1 
ATOM 8500  H H   . HIS A 1 1428 ? 46.055  59.282  37.120  1.00 41.57  ? 1428 HIS A H   1 
ATOM 8501  H HA  . HIS A 1 1428 ? 47.360  59.255  34.845  1.00 34.30  ? 1428 HIS A HA  1 
ATOM 8502  N N   . CYS A 1 1429 ? 49.217  59.462  37.458  1.00 22.59  ? 1429 CYS A N   1 
ATOM 8503  C CA  . CYS A 1 1429 ? 50.602  59.280  37.876  1.00 20.17  ? 1429 CYS A CA  1 
ATOM 8504  C C   . CYS A 1 1429 ? 51.082  57.881  37.542  1.00 17.40  ? 1429 CYS A C   1 
ATOM 8505  O O   . CYS A 1 1429 ? 52.123  57.706  36.903  1.00 13.15  ? 1429 CYS A O   1 
ATOM 8506  C CB  . CYS A 1 1429 ? 50.756  59.551  39.374  1.00 25.27  ? 1429 CYS A CB  1 
ATOM 8507  H H   . CYS A 1 1429 ? 48.657  59.597  38.097  1.00 27.11  ? 1429 CYS A H   1 
ATOM 8508  H HA  . CYS A 1 1429 ? 51.162  59.911  37.398  1.00 24.20  ? 1429 CYS A HA  1 
ATOM 8509  N N   . TYR A 1 1430 ? 50.321  56.866  37.942  1.00 20.04  ? 1430 TYR A N   1 
ATOM 8510  C CA  . TYR A 1 1430 ? 50.683  55.514  37.569  1.00 18.56  ? 1430 TYR A CA  1 
ATOM 8511  C C   . TYR A 1 1430 ? 50.809  55.418  36.062  1.00 18.36  ? 1430 TYR A C   1 
ATOM 8512  O O   . TYR A 1 1430 ? 51.871  55.075  35.534  1.00 22.51  ? 1430 TYR A O   1 
ATOM 8513  C CB  . TYR A 1 1430 ? 49.631  54.542  38.105  1.00 17.86  ? 1430 TYR A CB  1 
ATOM 8514  H H   . TYR A 1 1430 ? 49.609  56.936  38.418  1.00 24.04  ? 1430 TYR A H   1 
ATOM 8515  H HA  . TYR A 1 1430 ? 51.539  55.288  37.964  1.00 22.28  ? 1430 TYR A HA  1 
ATOM 8516  N N   . VAL A 1 1431 ? 49.758  55.824  35.351  1.00 17.59  ? 1431 VAL A N   1 
ATOM 8517  C CA  . VAL A 1 1431 ? 49.655  55.612  33.919  1.00 16.54  ? 1431 VAL A CA  1 
ATOM 8518  C C   . VAL A 1 1431 ? 50.677  56.429  33.156  1.00 15.23  ? 1431 VAL A C   1 
ATOM 8519  O O   . VAL A 1 1431 ? 51.023  56.093  32.022  1.00 19.42  ? 1431 VAL A O   1 
ATOM 8520  C CB  . VAL A 1 1431 ? 48.226  55.955  33.475  1.00 17.17  ? 1431 VAL A CB  1 
ATOM 8521  H H   . VAL A 1 1431 ? 49.080  56.233  35.688  1.00 21.11  ? 1431 VAL A H   1 
ATOM 8522  H HA  . VAL A 1 1431 ? 49.814  54.675  33.725  1.00 19.85  ? 1431 VAL A HA  1 
ATOM 8523  N N   . ASP A 1 1432 ? 51.209  57.469  33.761  1.00 13.42  ? 1432 ASP A N   1 
ATOM 8524  C CA  . ASP A 1 1432 ? 51.834  58.504  32.964  1.00 17.76  ? 1432 ASP A CA  1 
ATOM 8525  C C   . ASP A 1 1432 ? 53.163  58.077  32.355  1.00 17.45  ? 1432 ASP A C   1 
ATOM 8526  O O   . ASP A 1 1432 ? 53.713  58.835  31.540  1.00 20.19  ? 1432 ASP A O   1 
ATOM 8527  C CB  . ASP A 1 1432 ? 52.017  59.742  33.835  1.00 36.08  ? 1432 ASP A CB  1 
ATOM 8528  H H   . ASP A 1 1432 ? 51.223  57.600  34.611  1.00 16.11  ? 1432 ASP A H   1 
ATOM 8529  H HA  . ASP A 1 1432 ? 51.238  58.740  32.236  1.00 21.31  ? 1432 ASP A HA  1 
ATOM 8530  N N   . THR A 1 1433 ? 53.655  56.875  32.680  1.00 12.18  ? 1433 THR A N   1 
ATOM 8531  C CA  . THR A 1 1433 ? 55.043  56.533  32.402  1.00 12.37  ? 1433 THR A CA  1 
ATOM 8532  C C   . THR A 1 1433 ? 55.406  56.744  30.945  1.00 15.22  ? 1433 THR A C   1 
ATOM 8533  O O   . THR A 1 1433 ? 56.510  57.201  30.644  1.00 20.04  ? 1433 THR A O   1 
ATOM 8534  C CB  . THR A 1 1433 ? 55.309  55.083  32.805  1.00 8.97   ? 1433 THR A CB  1 
ATOM 8535  H H   . THR A 1 1433 ? 53.204  56.249  33.060  1.00 14.62  ? 1433 THR A H   1 
ATOM 8536  H HA  . THR A 1 1433 ? 55.619  57.101  32.938  1.00 14.84  ? 1433 THR A HA  1 
ATOM 8537  N N   . GLU A 1 1434 ? 54.483  56.468  30.033  1.00 18.78  ? 1434 GLU A N   1 
ATOM 8538  C CA  . GLU A 1 1434 ? 54.845  56.373  28.625  1.00 23.58  ? 1434 GLU A CA  1 
ATOM 8539  C C   . GLU A 1 1434 ? 55.307  57.716  28.056  1.00 22.33  ? 1434 GLU A C   1 
ATOM 8540  O O   . GLU A 1 1434 ? 56.414  57.822  27.515  1.00 20.50  ? 1434 GLU A O   1 
ATOM 8541  C CB  . GLU A 1 1434 ? 53.656  55.814  27.844  1.00 50.46  ? 1434 GLU A CB  1 
ATOM 8542  H H   . GLU A 1 1434 ? 53.651  56.332  30.200  1.00 22.54  ? 1434 GLU A H   1 
ATOM 8543  H HA  . GLU A 1 1434 ? 55.579  55.746  28.534  1.00 28.29  ? 1434 GLU A HA  1 
ATOM 8544  N N   . VAL A 1 1435 ? 54.459  58.742  28.132  1.00 21.88  ? 1435 VAL A N   1 
ATOM 8545  C CA  . VAL A 1 1435 ? 54.788  60.076  27.630  1.00 22.50  ? 1435 VAL A CA  1 
ATOM 8546  C C   . VAL A 1 1435 ? 54.476  60.225  26.141  1.00 32.79  ? 1435 VAL A C   1 
ATOM 8547  O O   . VAL A 1 1435 ? 53.585  60.998  25.777  1.00 51.27  ? 1435 VAL A O   1 
ATOM 8548  C CB  . VAL A 1 1435 ? 56.265  60.418  27.896  1.00 18.90  ? 1435 VAL A CB  1 
ATOM 8549  H HA  . VAL A 1 1435 ? 54.248  60.725  28.107  1.00 27.00  ? 1435 VAL A HA  1 
ATOM 8550  N N   . GLU A 1 1436 ? 55.208  59.523  25.266  1.00 29.22  ? 1436 GLU A N   1 
ATOM 8551  C CA  . GLU A 1 1436 ? 55.010  59.674  23.820  1.00 31.94  ? 1436 GLU A CA  1 
ATOM 8552  C C   . GLU A 1 1436 ? 53.681  59.068  23.344  1.00 39.95  ? 1436 GLU A C   1 
ATOM 8553  O O   . GLU A 1 1436 ? 52.956  59.682  22.537  1.00 41.08  ? 1436 GLU A O   1 
ATOM 8554  C CB  . GLU A 1 1436 ? 56.179  59.029  23.083  1.00 30.85  ? 1436 GLU A CB  1 
ATOM 8555  H H   . GLU A 1 1436 ? 55.820  58.959  25.483  1.00 35.06  ? 1436 GLU A H   1 
ATOM 8556  H HA  . GLU A 1 1436 ? 55.003  60.619  23.600  1.00 38.33  ? 1436 GLU A HA  1 
ATOM 8557  N N   . MET A 1 1437 ? 53.362  57.852  23.808  1.00 41.44  ? 1437 MET A N   1 
ATOM 8558  C CA  . MET A 1 1437 ? 52.131  57.173  23.403  1.00 45.66  ? 1437 MET A CA  1 
ATOM 8559  C C   . MET A 1 1437 ? 50.879  57.982  23.773  1.00 51.69  ? 1437 MET A C   1 
ATOM 8560  O O   . MET A 1 1437 ? 49.884  57.950  23.041  1.00 57.29  ? 1437 MET A O   1 
ATOM 8561  C CB  . MET A 1 1437 ? 52.077  55.775  24.032  1.00 42.17  ? 1437 MET A CB  1 
ATOM 8562  H H   . MET A 1 1437 ? 53.844  57.402  24.359  1.00 49.72  ? 1437 MET A H   1 
ATOM 8563  H HA  . MET A 1 1437 ? 52.148  57.058  22.440  1.00 54.80  ? 1437 MET A HA  1 
ATOM 8564  N N   . LYS A 1 1438 ? 50.898  58.694  24.912  1.00 55.32  ? 1438 LYS A N   1 
ATOM 8565  C CA  . LYS A 1 1438 ? 49.759  59.529  25.298  1.00 45.01  ? 1438 LYS A CA  1 
ATOM 8566  C C   . LYS A 1 1438 ? 49.607  60.748  24.383  1.00 39.89  ? 1438 LYS A C   1 
ATOM 8567  O O   . LYS A 1 1438 ? 48.487  61.134  24.038  1.00 41.81  ? 1438 LYS A O   1 
ATOM 8568  C CB  . LYS A 1 1438 ? 49.899  59.975  26.758  1.00 32.54  ? 1438 LYS A CB  1 
ATOM 8569  H H   . LYS A 1 1438 ? 51.553  58.709  25.469  1.00 66.39  ? 1438 LYS A H   1 
ATOM 8570  H HA  . LYS A 1 1438 ? 48.948  59.002  25.225  1.00 54.01  ? 1438 LYS A HA  1 
ATOM 8571  N N   . GLU A 1 1439 ? 50.715  61.378  23.993  1.00 32.76  ? 1439 GLU A N   1 
ATOM 8572  C CA  . GLU A 1 1439 ? 50.614  62.565  23.158  1.00 24.57  ? 1439 GLU A CA  1 
ATOM 8573  C C   . GLU A 1 1439 ? 50.184  62.223  21.739  1.00 27.07  ? 1439 GLU A C   1 
ATOM 8574  O O   . GLU A 1 1439 ? 49.543  63.051  21.090  1.00 27.06  ? 1439 GLU A O   1 
ATOM 8575  C CB  . GLU A 1 1439 ? 51.947  63.312  23.136  1.00 21.87  ? 1439 GLU A CB  1 
ATOM 8576  H H   . GLU A 1 1439 ? 51.518  61.144  24.196  1.00 39.31  ? 1439 GLU A H   1 
ATOM 8577  H HA  . GLU A 1 1439 ? 49.947  63.158  23.536  1.00 29.48  ? 1439 GLU A HA  1 
ATOM 8578  N N   . ILE A 1 1440 ? 50.535  61.030  21.232  1.00 30.80  ? 1440 ILE A N   1 
ATOM 8579  C CA  . ILE A 1 1440 ? 50.188  60.670  19.848  1.00 45.70  ? 1440 ILE A CA  1 
ATOM 8580  C C   . ILE A 1 1440 ? 48.674  60.521  19.660  1.00 46.34  ? 1440 ILE A C   1 
ATOM 8581  O O   . ILE A 1 1440 ? 48.141  60.773  18.566  1.00 38.80  ? 1440 ILE A O   1 
ATOM 8582  C CB  . ILE A 1 1440 ? 50.925  59.387  19.420  1.00 47.42  ? 1440 ILE A CB  1 
ATOM 8583  H H   . ILE A 1 1440 ? 50.966  60.422  21.661  1.00 36.96  ? 1440 ILE A H   1 
ATOM 8584  H HA  . ILE A 1 1440 ? 50.484  61.385  19.263  1.00 54.84  ? 1440 ILE A HA  1 
ATOM 8585  N N   . TYR A 1 1441 ? 47.969  60.068  20.688  1.00 52.51  ? 1441 TYR A N   1 
ATOM 8586  C CA  . TYR A 1 1441 ? 46.516  59.898  20.672  1.00 64.52  ? 1441 TYR A CA  1 
ATOM 8587  C C   . TYR A 1 1441 ? 45.871  60.885  21.646  1.00 75.57  ? 1441 TYR A C   1 
ATOM 8588  O O   . TYR A 1 1441 ? 46.560  61.671  22.312  1.00 78.22  ? 1441 TYR A O   1 
ATOM 8589  C CB  . TYR A 1 1441 ? 46.142  58.454  21.018  1.00 67.48  ? 1441 TYR A CB  1 
ATOM 8590  H HA  . TYR A 1 1441 ? 46.184  60.091  19.781  1.00 77.42  ? 1441 TYR A HA  1 
ATOM 8591  N N   . THR A 1 1442 ? 44.536  60.841  21.711  1.00 74.57  ? 1442 THR A N   1 
ATOM 8592  C CA  . THR A 1 1442 ? 43.725  61.678  22.607  1.00 62.14  ? 1442 THR A CA  1 
ATOM 8593  C C   . THR A 1 1442 ? 44.183  63.142  22.566  1.00 56.48  ? 1442 THR A C   1 
ATOM 8594  O O   . THR A 1 1442 ? 44.636  63.721  23.554  1.00 48.46  ? 1442 THR A O   1 
ATOM 8595  C CB  . THR A 1 1442 ? 43.758  61.130  24.028  1.00 52.04  ? 1442 THR A CB  1 
ATOM 8596  H HA  . THR A 1 1442 ? 42.804  61.651  22.304  1.00 74.57  ? 1442 THR A HA  1 
ATOM 8597  N N   . SER A 1 1443 ? 44.040  63.733  21.379  1.00 57.12  ? 1443 SER A N   1 
ATOM 8598  C CA  . SER A 1 1443 ? 44.450  65.110  21.156  1.00 45.26  ? 1443 SER A CA  1 
ATOM 8599  C C   . SER A 1 1443 ? 43.915  65.992  22.263  1.00 37.34  ? 1443 SER A C   1 
ATOM 8600  O O   . SER A 1 1443 ? 42.710  66.015  22.527  1.00 36.61  ? 1443 SER A O   1 
ATOM 8601  C CB  . SER A 1 1443 ? 43.938  65.587  19.795  1.00 47.51  ? 1443 SER A CB  1 
ATOM 8602  H H   . SER A 1 1443 ? 43.705  63.351  20.685  1.00 68.54  ? 1443 SER A H   1 
ATOM 8603  H HA  . SER A 1 1443 ? 45.419  65.165  21.158  1.00 54.31  ? 1443 SER A HA  1 
ATOM 8604  N N   . ASN A 1 1444 ? 44.811  66.702  22.935  1.00 32.52  ? 1444 ASN A N   1 
ATOM 8605  C CA  . ASN A 1 1444 ? 44.403  67.488  24.083  1.00 39.56  ? 1444 ASN A CA  1 
ATOM 8606  C C   . ASN A 1 1444 ? 43.811  66.587  25.164  1.00 34.25  ? 1444 ASN A C   1 
ATOM 8607  O O   . ASN A 1 1444 ? 42.859  66.963  25.852  1.00 34.84  ? 1444 ASN A O   1 
ATOM 8608  C CB  . ASN A 1 1444 ? 43.391  68.563  23.679  1.00 39.45  ? 1444 ASN A CB  1 
ATOM 8609  H H   . ASN A 1 1444 ? 45.650  66.744  22.749  1.00 39.03  ? 1444 ASN A H   1 
ATOM 8610  H HA  . ASN A 1 1444 ? 45.181  67.932  24.455  1.00 47.47  ? 1444 ASN A HA  1 
ATOM 8611  N N   . HIS A 1 1445 ? 44.336  65.370  25.292  1.00 33.26  ? 1445 HIS A N   1 
ATOM 8612  C CA  . HIS A 1 1445 ? 43.844  64.483  26.336  1.00 34.96  ? 1445 HIS A CA  1 
ATOM 8613  C C   . HIS A 1 1445 ? 44.292  64.885  27.727  1.00 60.65  ? 1445 HIS A C   1 
ATOM 8614  O O   . HIS A 1 1445 ? 43.787  64.313  28.698  1.00 70.10  ? 1445 HIS A O   1 
ATOM 8615  C CB  . HIS A 1 1445 ? 44.305  63.051  26.094  1.00 32.45  ? 1445 HIS A CB  1 
ATOM 8616  H HA  . HIS A 1 1445 ? 42.874  64.491  26.322  1.00 41.96  ? 1445 HIS A HA  1 
ATOM 8617  N N   . MET A 1 1446 ? 45.211  65.851  27.849  1.00 82.06  ? 1446 MET A N   1 
ATOM 8618  C CA  . MET A 1 1446 ? 45.896  66.156  29.114  1.00 100.50 ? 1446 MET A CA  1 
ATOM 8619  C C   . MET A 1 1446 ? 45.043  67.089  29.985  1.00 117.14 ? 1446 MET A C   1 
ATOM 8620  O O   . MET A 1 1446 ? 45.425  68.207  30.327  1.00 135.72 ? 1446 MET A O   1 
ATOM 8621  C CB  . MET A 1 1446 ? 47.276  66.735  28.819  1.00 86.60  ? 1446 MET A CB  1 
ATOM 8622  H HA  . MET A 1 1446 ? 46.028  65.325  29.597  1.00 120.61 ? 1446 MET A HA  1 
ATOM 8623  N N   . TRP A 1 1447 ? 43.837  66.617  30.342  1.00 98.32  ? 1447 TRP A N   1 
ATOM 8624  C CA  . TRP A 1 1447 ? 43.015  67.326  31.327  1.00 79.90  ? 1447 TRP A CA  1 
ATOM 8625  C C   . TRP A 1 1447 ? 43.599  67.204  32.756  1.00 94.43  ? 1447 TRP A C   1 
ATOM 8626  O O   . TRP A 1 1447 ? 43.614  68.185  33.525  1.00 103.91 ? 1447 TRP A O   1 
ATOM 8627  C CB  . TRP A 1 1447 ? 41.578  66.794  31.262  1.00 46.99  ? 1447 TRP A CB  1 
ATOM 8628  H H   . TRP A 1 1447 ? 43.480  65.899  30.032  1.00 117.99 ? 1447 TRP A H   1 
ATOM 8629  H HA  . TRP A 1 1447 ? 42.993  68.268  31.095  1.00 95.88  ? 1447 TRP A HA  1 
ATOM 8630  N N   . LYS A 1 1448 ? 44.137  66.024  33.101  1.00 86.23  ? 1448 LYS A N   1 
ATOM 8631  C CA  . LYS A 1 1448 ? 44.527  65.684  34.471  1.00 73.14  ? 1448 LYS A CA  1 
ATOM 8632  C C   . LYS A 1 1448 ? 45.654  66.544  35.059  1.00 71.04  ? 1448 LYS A C   1 
ATOM 8633  O O   . LYS A 1 1448 ? 45.851  66.503  36.280  1.00 73.85  ? 1448 LYS A O   1 
ATOM 8634  C CB  . LYS A 1 1448 ? 44.938  64.205  34.534  1.00 52.25  ? 1448 LYS A CB  1 
ATOM 8635  H H   . LYS A 1 1448 ? 44.288  65.390  32.540  1.00 103.47 ? 1448 LYS A H   1 
ATOM 8636  H HA  . LYS A 1 1448 ? 43.752  65.794  35.044  1.00 87.77  ? 1448 LYS A HA  1 
ATOM 8637  N N   . LEU A 1 1449 ? 46.396  67.311  34.250  1.00 74.39  ? 1449 LEU A N   1 
ATOM 8638  C CA  . LEU A 1 1449 ? 47.397  68.229  34.800  1.00 70.82  ? 1449 LEU A CA  1 
ATOM 8639  C C   . LEU A 1 1449 ? 46.776  69.259  35.745  1.00 73.26  ? 1449 LEU A C   1 
ATOM 8640  O O   . LEU A 1 1449 ? 47.461  69.743  36.661  1.00 67.82  ? 1449 LEU A O   1 
ATOM 8641  C CB  . LEU A 1 1449 ? 48.133  68.953  33.674  1.00 70.08  ? 1449 LEU A CB  1 
ATOM 8642  H H   . LEU A 1 1449 ? 46.340  67.317  33.392  1.00 89.27  ? 1449 LEU A H   1 
ATOM 8643  H HA  . LEU A 1 1449 ? 48.050  67.717  35.303  1.00 84.98  ? 1449 LEU A HA  1 
ATOM 8644  N N   . PHE A 1 1450 ? 45.503  69.644  35.523  1.00 80.39  ? 1450 PHE A N   1 
ATOM 8645  C CA  . PHE A 1 1450 ? 44.872  70.590  36.444  1.00 76.94  ? 1450 PHE A CA  1 
ATOM 8646  C C   . PHE A 1 1450 ? 44.575  69.940  37.788  1.00 64.52  ? 1450 PHE A C   1 
ATOM 8647  O O   . PHE A 1 1450 ? 44.528  70.634  38.820  1.00 57.81  ? 1450 PHE A O   1 
ATOM 8648  C CB  . PHE A 1 1450 ? 43.583  71.160  35.840  1.00 72.62  ? 1450 PHE A CB  1 
ATOM 8649  H H   . PHE A 1 1450 ? 45.007  69.379  34.872  1.00 96.46  ? 1450 PHE A H   1 
ATOM 8650  H HA  . PHE A 1 1450 ? 45.481  71.330  36.599  1.00 92.33  ? 1450 PHE A HA  1 
ATOM 8651  N N   . GLU A 1 1451 ? 44.373  68.616  37.799  1.00 63.49  ? 1451 GLU A N   1 
ATOM 8652  C CA  . GLU A 1 1451 ? 44.113  67.930  39.051  1.00 56.80  ? 1451 GLU A CA  1 
ATOM 8653  C C   . GLU A 1 1451 ? 45.214  68.246  40.074  1.00 72.90  ? 1451 GLU A C   1 
ATOM 8654  O O   . GLU A 1 1451 ? 44.910  68.538  41.233  1.00 74.62  ? 1451 GLU A O   1 
ATOM 8655  C CB  . GLU A 1 1451 ? 43.983  66.420  38.809  1.00 50.47  ? 1451 GLU A CB  1 
ATOM 8656  H H   . GLU A 1 1451 ? 44.383  68.109  37.105  1.00 76.19  ? 1451 GLU A H   1 
ATOM 8657  H HA  . GLU A 1 1451 ? 43.271  68.246  39.414  1.00 68.16  ? 1451 GLU A HA  1 
ATOM 8658  N N   . ASN A 1 1452 ? 46.500  68.218  39.645  1.00 85.70  ? 1452 ASN A N   1 
ATOM 8659  C CA  . ASN A 1 1452 ? 47.639  68.475  40.539  1.00 63.09  ? 1452 ASN A CA  1 
ATOM 8660  C C   . ASN A 1 1452 ? 47.583  69.871  41.177  1.00 52.21  ? 1452 ASN A C   1 
ATOM 8661  O O   . ASN A 1 1452 ? 48.122  70.075  42.274  1.00 51.89  ? 1452 ASN A O   1 
ATOM 8662  C CB  . ASN A 1 1452 ? 48.961  68.309  39.781  1.00 37.63  ? 1452 ASN A CB  1 
ATOM 8663  H H   . ASN A 1 1452 ? 46.731  68.050  38.833  1.00 102.84 ? 1452 ASN A H   1 
ATOM 8664  H HA  . ASN A 1 1452 ? 47.624  67.822  41.256  1.00 75.71  ? 1452 ASN A HA  1 
ATOM 8665  N N   . PHE A 1 1453 ? 46.981  70.854  40.490  1.00 48.11  ? 1453 PHE A N   1 
ATOM 8666  C CA  . PHE A 1 1453 ? 46.736  72.144  41.121  1.00 33.95  ? 1453 PHE A CA  1 
ATOM 8667  C C   . PHE A 1 1453 ? 45.399  72.202  41.881  1.00 36.22  ? 1453 PHE A C   1 
ATOM 8668  O O   . PHE A 1 1453 ? 45.264  73.021  42.801  1.00 31.13  ? 1453 PHE A O   1 
ATOM 8669  C CB  . PHE A 1 1453 ? 46.800  73.252  40.068  1.00 24.90  ? 1453 PHE A CB  1 
ATOM 8670  H H   . PHE A 1 1453 ? 46.712  70.795  39.676  1.00 57.73  ? 1453 PHE A H   1 
ATOM 8671  H HA  . PHE A 1 1453 ? 47.443  72.311  41.764  1.00 40.74  ? 1453 PHE A HA  1 
ATOM 8672  N N   . LEU A 1 1454 ? 44.403  71.365  41.531  1.00 41.22  ? 1454 LEU A N   1 
ATOM 8673  C CA  . LEU A 1 1454 ? 43.116  71.329  42.234  1.00 29.19  ? 1454 LEU A CA  1 
ATOM 8674  C C   . LEU A 1 1454 ? 42.744  69.967  42.820  1.00 30.43  ? 1454 LEU A C   1 
ATOM 8675  O O   . LEU A 1 1454 ? 42.416  69.888  44.010  1.00 27.99  ? 1454 LEU A O   1 
ATOM 8676  C CB  . LEU A 1 1454 ? 42.023  71.797  41.270  1.00 26.93  ? 1454 LEU A CB  1 
ATOM 8677  H H   . LEU A 1 1454 ? 44.455  70.804  40.881  1.00 49.47  ? 1454 LEU A H   1 
ATOM 8678  H HA  . LEU A 1 1454 ? 43.150  71.962  42.969  1.00 35.02  ? 1454 LEU A HA  1 
ATOM 8679  N N   . VAL A 1 1455 ? 42.721  68.899  42.014  1.00 32.43  ? 1455 VAL A N   1 
ATOM 8680  C CA  . VAL A 1 1455 ? 42.288  67.578  42.484  1.00 32.10  ? 1455 VAL A CA  1 
ATOM 8681  C C   . VAL A 1 1455 ? 43.309  66.949  43.462  1.00 34.19  ? 1455 VAL A C   1 
ATOM 8682  O O   . VAL A 1 1455 ? 42.922  66.416  44.507  1.00 25.40  ? 1455 VAL A O   1 
ATOM 8683  C CB  . VAL A 1 1455 ? 42.018  66.662  41.274  1.00 29.59  ? 1455 VAL A CB  1 
ATOM 8684  H H   . VAL A 1 1455 ? 42.954  68.914  41.186  1.00 38.92  ? 1455 VAL A H   1 
ATOM 8685  H HA  . VAL A 1 1455 ? 41.451  67.681  42.964  1.00 38.52  ? 1455 VAL A HA  1 
ATOM 8686  N N   . ASP A 1 1456 ? 44.621  66.971  43.124  1.00 46.04  ? 1456 ASP A N   1 
ATOM 8687  C CA  . ASP A 1 1456 ? 45.693  66.287  43.892  1.00 35.74  ? 1456 ASP A CA  1 
ATOM 8688  C C   . ASP A 1 1456 ? 46.086  66.984  45.184  1.00 35.75  ? 1456 ASP A C   1 
ATOM 8689  O O   . ASP A 1 1456 ? 46.672  66.324  46.050  1.00 31.87  ? 1456 ASP A O   1 
ATOM 8690  C CB  . ASP A 1 1456 ? 46.964  66.134  43.041  1.00 36.04  ? 1456 ASP A CB  1 
ATOM 8691  H H   . ASP A 1 1456 ? 44.920  67.387  42.434  1.00 55.25  ? 1456 ASP A H   1 
ATOM 8692  H HA  . ASP A 1 1456 ? 45.385  65.397  44.122  1.00 42.89  ? 1456 ASP A HA  1 
ATOM 8693  N N   . ILE A 1 1457 ? 45.797  68.271  45.356  1.00 37.11  ? 1457 ILE A N   1 
ATOM 8694  C CA  . ILE A 1 1457 ? 46.053  68.960  46.608  1.00 26.36  ? 1457 ILE A CA  1 
ATOM 8695  C C   . ILE A 1 1457 ? 44.742  69.571  47.086  1.00 26.03  ? 1457 ILE A C   1 
ATOM 8696  O O   . ILE A 1 1457 ? 43.816  69.828  46.313  1.00 25.13  ? 1457 ILE A O   1 
ATOM 8697  C CB  . ILE A 1 1457 ? 47.152  70.034  46.483  1.00 23.46  ? 1457 ILE A CB  1 
ATOM 8698  H H   . ILE A 1 1457 ? 45.446  68.771  44.751  1.00 44.53  ? 1457 ILE A H   1 
ATOM 8699  H HA  . ILE A 1 1457 ? 46.341  68.313  47.271  1.00 31.63  ? 1457 ILE A HA  1 
ATOM 8700  N N   . CYS A 1 1458 ? 44.672  69.786  48.383  1.00 25.91  ? 1458 CYS A N   1 
ATOM 8701  C CA  . CYS A 1 1458 ? 43.489  70.344  49.035  1.00 27.38  ? 1458 CYS A CA  1 
ATOM 8702  C C   . CYS A 1 1458 ? 43.881  70.660  50.483  1.00 28.84  ? 1458 CYS A C   1 
ATOM 8703  O O   . CYS A 1 1458 ? 45.055  70.520  50.850  1.00 31.77  ? 1458 CYS A O   1 
ATOM 8704  C CB  . CYS A 1 1458 ? 42.310  69.374  48.921  1.00 25.26  ? 1458 CYS A CB  1 
ATOM 8705  H H   . CYS A 1 1458 ? 45.313  69.613  48.930  1.00 31.10  ? 1458 CYS A H   1 
ATOM 8706  H HA  . CYS A 1 1458 ? 43.243  71.174  48.598  1.00 32.86  ? 1458 CYS A HA  1 
ATOM 8707  N N   . ARG A 1 1459 ? 42.917  71.097  51.314  1.00 22.82  ? 1459 ARG A N   1 
ATOM 8708  C CA  . ARG A 1 1459 ? 43.249  71.287  52.722  1.00 10.06  ? 1459 ARG A CA  1 
ATOM 8709  C C   . ARG A 1 1459 ? 43.346  69.908  53.312  1.00 8.74   ? 1459 ARG A C   1 
ATOM 8710  O O   . ARG A 1 1459 ? 43.818  68.973  52.672  1.00 8.74   ? 1459 ARG A O   1 
ATOM 8711  C CB  . ARG A 1 1459 ? 42.220  72.101  53.507  1.00 8.74   ? 1459 ARG A CB  1 
ATOM 8712  H HA  . ARG A 1 1459 ? 44.113  71.720  52.799  1.00 12.07  ? 1459 ARG A HA  1 
ATOM 8713  N N   . ALA A 1 1460 ? 42.886  69.744  54.521  1.00 8.72   ? 1460 ALA A N   1 
ATOM 8714  C CA  . ALA A 1 1460 ? 43.099  68.440  55.079  1.00 8.72   ? 1460 ALA A CA  1 
ATOM 8715  C C   . ALA A 1 1460 ? 42.419  67.356  54.253  1.00 8.72   ? 1460 ALA A C   1 
ATOM 8716  O O   . ALA A 1 1460 ? 42.945  66.247  54.165  1.00 8.72   ? 1460 ALA A O   1 
ATOM 8717  C CB  . ALA A 1 1460 ? 42.625  68.446  56.495  1.00 8.72   ? 1460 ALA A CB  1 
ATOM 8718  H HA  . ALA A 1 1460 ? 44.051  68.254  55.086  1.00 10.46  ? 1460 ALA A HA  1 
ATOM 8719  H HB1 . ALA A 1 1460 ? 42.766  67.566  56.879  1.00 10.46  ? 1460 ALA A HB1 1 
ATOM 8720  H HB2 . ALA A 1 1460 ? 43.127  69.109  56.994  1.00 10.46  ? 1460 ALA A HB2 1 
ATOM 8721  H HB3 . ALA A 1 1460 ? 41.680  68.666  56.510  1.00 10.46  ? 1460 ALA A HB3 1 
ATOM 8722  N N   . CYS A 1 1461 ? 41.287  67.652  53.618  1.00 8.74   ? 1461 CYS A N   1 
ATOM 8723  C CA  . CYS A 1 1461 ? 40.670  66.697  52.698  1.00 11.52  ? 1461 CYS A CA  1 
ATOM 8724  C C   . CYS A 1 1461 ? 40.144  67.446  51.480  1.00 14.34  ? 1461 CYS A C   1 
ATOM 8725  O O   . CYS A 1 1461 ? 40.892  67.654  50.523  1.00 16.01  ? 1461 CYS A O   1 
ATOM 8726  C CB  . CYS A 1 1461 ? 39.544  65.895  53.369  1.00 20.46  ? 1461 CYS A CB  1 
ATOM 8727  N N   . ASN A 1 1462 ? 38.867  67.851  51.504  1.00 22.79  ? 1462 ASN A N   1 
ATOM 8728  C CA  . ASN A 1 1462 ? 38.292  68.798  50.550  1.00 18.95  ? 1462 ASN A CA  1 
ATOM 8729  C C   . ASN A 1 1462 ? 37.848  70.022  51.332  1.00 14.15  ? 1462 ASN A C   1 
ATOM 8730  O O   . ASN A 1 1462 ? 37.167  69.892  52.353  1.00 14.53  ? 1462 ASN A O   1 
ATOM 8731  C CB  . ASN A 1 1462 ? 37.093  68.235  49.769  1.00 17.93  ? 1462 ASN A CB  1 
ATOM 8732  H HA  . ASN A 1 1462 ? 38.972  69.069  49.914  1.00 22.74  ? 1462 ASN A HA  1 
ATOM 8733  N N   . ASN A 1 1463 ? 38.213  71.200  50.845  1.00 14.11  ? 1463 ASN A N   1 
ATOM 8734  C CA  . ASN A 1 1463 ? 38.108  72.405  51.665  1.00 14.95  ? 1463 ASN A CA  1 
ATOM 8735  C C   . ASN A 1 1463 ? 38.764  72.029  52.998  1.00 13.36  ? 1463 ASN A C   1 
ATOM 8736  O O   . ASN A 1 1463 ? 39.860  71.455  52.996  1.00 10.62  ? 1463 ASN A O   1 
ATOM 8737  C CB  . ASN A 1 1463 ? 36.659  72.877  51.743  1.00 15.06  ? 1463 ASN A CB  1 
ATOM 8738  H H   . ASN A 1 1463 ? 38.521  71.332  50.053  1.00 16.93  ? 1463 ASN A H   1 
ATOM 8739  H HA  . ASN A 1 1463 ? 38.634  73.113  51.260  1.00 17.94  ? 1463 ASN A HA  1 
ATOM 8740  N N   . THR A 1 1464 ? 38.121  72.248  54.140  1.00 16.03  ? 1464 THR A N   1 
ATOM 8741  C CA  . THR A 1 1464 ? 38.796  72.009  55.412  1.00 16.27  ? 1464 THR A CA  1 
ATOM 8742  C C   . THR A 1 1464 ? 38.065  70.989  56.300  1.00 17.93  ? 1464 THR A C   1 
ATOM 8743  O O   . THR A 1 1464 ? 37.745  71.289  57.453  1.00 19.93  ? 1464 THR A O   1 
ATOM 8744  C CB  . THR A 1 1464 ? 38.966  73.338  56.157  1.00 17.66  ? 1464 THR A CB  1 
ATOM 8745  H H   . THR A 1 1464 ? 37.311  72.529  54.207  1.00 19.24  ? 1464 THR A H   1 
ATOM 8746  H HA  . THR A 1 1464 ? 39.682  71.659  55.231  1.00 19.53  ? 1464 THR A HA  1 
ATOM 8747  N N   . SER A 1 1465 ? 37.820  69.771  55.804  1.00 15.05  ? 1465 SER A N   1 
ATOM 8748  C CA  . SER A 1 1465 ? 37.083  68.785  56.605  1.00 13.16  ? 1465 SER A CA  1 
ATOM 8749  C C   . SER A 1 1465 ? 37.955  68.175  57.707  1.00 13.21  ? 1465 SER A C   1 
ATOM 8750  O O   . SER A 1 1465 ? 37.515  68.097  58.860  1.00 10.07  ? 1465 SER A O   1 
ATOM 8751  C CB  . SER A 1 1465 ? 36.502  67.695  55.696  1.00 11.39  ? 1465 SER A CB  1 
ATOM 8752  H H   . SER A 1 1465 ? 38.062  69.495  55.026  1.00 18.07  ? 1465 SER A H   1 
ATOM 8753  H HA  . SER A 1 1465 ? 36.339  69.233  57.036  1.00 15.79  ? 1465 SER A HA  1 
ATOM 8754  N N   . ASP A 1 1466 ? 39.168  67.705  57.350  1.00 19.71  ? 1466 ASP A N   1 
ATOM 8755  C CA  . ASP A 1 1466 ? 40.252  67.309  58.278  1.00 18.26  ? 1466 ASP A CA  1 
ATOM 8756  C C   . ASP A 1 1466 ? 40.251  65.854  58.768  1.00 19.25  ? 1466 ASP A C   1 
ATOM 8757  O O   . ASP A 1 1466 ? 40.439  65.624  59.970  1.00 16.87  ? 1466 ASP A O   1 
ATOM 8758  C CB  . ASP A 1 1466 ? 40.240  68.223  59.493  1.00 17.68  ? 1466 ASP A CB  1 
ATOM 8759  H H   . ASP A 1 1466 ? 39.397  67.602  56.528  1.00 23.65  ? 1466 ASP A H   1 
ATOM 8760  H HA  . ASP A 1 1466 ? 41.097  67.452  57.824  1.00 21.91  ? 1466 ASP A HA  1 
ATOM 8761  N N   . ARG A 1 1467 ? 40.258  64.873  57.845  1.00 26.20  ? 1467 ARG A N   1 
ATOM 8762  C CA  . ARG A 1 1467 ? 39.985  63.480  58.192  1.00 30.33  ? 1467 ARG A CA  1 
ATOM 8763  C C   . ARG A 1 1467 ? 41.224  62.624  58.494  1.00 32.44  ? 1467 ARG A C   1 
ATOM 8764  O O   . ARG A 1 1467 ? 41.169  61.796  59.404  1.00 32.26  ? 1467 ARG A O   1 
ATOM 8765  C CB  . ARG A 1 1467 ? 39.175  62.801  57.082  1.00 22.76  ? 1467 ARG A CB  1 
ATOM 8766  H HA  . ARG A 1 1467 ? 39.435  63.474  58.991  1.00 36.39  ? 1467 ARG A HA  1 
ATOM 8767  N N   . LYS A 1 1468 ? 42.328  62.775  57.758  1.00 28.00  ? 1468 LYS A N   1 
ATOM 8768  C CA  . LYS A 1 1468 ? 43.479  61.880  57.895  1.00 20.80  ? 1468 LYS A CA  1 
ATOM 8769  C C   . LYS A 1 1468 ? 44.579  62.616  58.646  1.00 19.79  ? 1468 LYS A C   1 
ATOM 8770  O O   . LYS A 1 1468 ? 45.248  63.493  58.089  1.00 17.69  ? 1468 LYS A O   1 
ATOM 8771  C CB  . LYS A 1 1468 ? 43.984  61.383  56.536  1.00 20.10  ? 1468 LYS A CB  1 
ATOM 8772  H H   . LYS A 1 1468 ? 42.435  63.392  57.169  1.00 33.60  ? 1468 LYS A H   1 
ATOM 8773  H HA  . LYS A 1 1468 ? 43.220  61.107  58.421  1.00 24.96  ? 1468 LYS A HA  1 
ATOM 8774  N N   . HIS A 1 1469 ? 44.780  62.220  59.907  1.00 20.58  ? 1469 HIS A N   1 
ATOM 8775  C CA  . HIS A 1 1469 ? 45.664  62.955  60.796  1.00 18.40  ? 1469 HIS A CA  1 
ATOM 8776  C C   . HIS A 1 1469 ? 47.098  62.879  60.324  1.00 18.04  ? 1469 HIS A C   1 
ATOM 8777  O O   . HIS A 1 1469 ? 47.778  63.903  60.219  1.00 34.44  ? 1469 HIS A O   1 
ATOM 8778  C CB  . HIS A 1 1469 ? 45.548  62.406  62.217  1.00 16.06  ? 1469 HIS A CB  1 
ATOM 8779  H H   . HIS A 1 1469 ? 44.413  61.529  60.265  1.00 24.70  ? 1469 HIS A H   1 
ATOM 8780  H HA  . HIS A 1 1469 ? 45.398  63.888  60.809  1.00 22.08  ? 1469 HIS A HA  1 
ATOM 8781  N N   . ALA A 1 1470 ? 47.575  61.692  60.030  1.00 19.32  ? 1470 ALA A N   1 
ATOM 8782  C CA  . ALA A 1 1470 ? 48.979  61.514  59.692  1.00 21.90  ? 1470 ALA A CA  1 
ATOM 8783  C C   . ALA A 1 1470 ? 49.069  61.311  58.187  1.00 23.88  ? 1470 ALA A C   1 
ATOM 8784  O O   . ALA A 1 1470 ? 48.509  60.353  57.643  1.00 21.64  ? 1470 ALA A O   1 
ATOM 8785  C CB  . ALA A 1 1470 ? 49.600  60.376  60.484  1.00 22.08  ? 1470 ALA A CB  1 
ATOM 8786  H H   . ALA A 1 1470 ? 47.112  60.968  60.016  1.00 23.18  ? 1470 ALA A H   1 
ATOM 8787  H HA  . ALA A 1 1470 ? 49.460  62.327  59.912  1.00 26.28  ? 1470 ALA A HA  1 
ATOM 8788  H HB1 . ALA A 1 1470 ? 50.533  60.289  60.232  1.00 26.49  ? 1470 ALA A HB1 1 
ATOM 8789  H HB2 . ALA A 1 1470 ? 49.530  60.576  61.431  1.00 26.49  ? 1470 ALA A HB2 1 
ATOM 8790  H HB3 . ALA A 1 1470 ? 49.124  59.555  60.283  1.00 26.49  ? 1470 ALA A HB3 1 
ATOM 8791  N N   . ASP A 1 1471 ? 49.752  62.249  57.532  1.00 30.19  ? 1471 ASP A N   1 
ATOM 8792  C CA  . ASP A 1 1471 ? 49.850  62.325  56.088  1.00 39.96  ? 1471 ASP A CA  1 
ATOM 8793  C C   . ASP A 1 1471 ? 51.257  62.070  55.556  1.00 50.21  ? 1471 ASP A C   1 
ATOM 8794  O O   . ASP A 1 1471 ? 51.422  62.016  54.338  1.00 68.96  ? 1471 ASP A O   1 
ATOM 8795  C CB  . ASP A 1 1471 ? 49.389  63.712  55.600  1.00 30.65  ? 1471 ASP A CB  1 
ATOM 8796  H HA  . ASP A 1 1471 ? 49.260  61.661  55.699  1.00 47.96  ? 1471 ASP A HA  1 
ATOM 8797  N N   . SER A 1 1472 ? 52.277  61.932  56.407  1.00 40.39  ? 1472 SER A N   1 
ATOM 8798  C CA  . SER A 1 1472 ? 53.627  61.767  55.871  1.00 38.47  ? 1472 SER A CA  1 
ATOM 8799  C C   . SER A 1 1472 ? 53.785  60.425  55.157  1.00 38.34  ? 1472 SER A C   1 
ATOM 8800  O O   . SER A 1 1472 ? 54.677  60.278  54.312  1.00 31.49  ? 1472 SER A O   1 
ATOM 8801  C CB  . SER A 1 1472 ? 54.663  61.919  56.985  1.00 45.21  ? 1472 SER A CB  1 
ATOM 8802  H H   . SER A 1 1472 ? 52.217  61.931  57.265  1.00 48.47  ? 1472 SER A H   1 
ATOM 8803  H HA  . SER A 1 1472 ? 53.790  62.467  55.221  1.00 46.16  ? 1472 SER A HA  1 
ATOM 8804  N N   . ILE A 1 1473 ? 52.939  59.438  55.490  1.00 39.15  ? 1473 ILE A N   1 
ATOM 8805  C CA  . ILE A 1 1473 ? 52.978  58.151  54.811  1.00 42.02  ? 1473 ILE A CA  1 
ATOM 8806  C C   . ILE A 1 1473 ? 52.374  58.263  53.418  1.00 51.82  ? 1473 ILE A C   1 
ATOM 8807  O O   . ILE A 1 1473 ? 52.993  57.860  52.431  1.00 53.71  ? 1473 ILE A O   1 
ATOM 8808  C CB  . ILE A 1 1473 ? 52.253  57.087  55.659  1.00 43.30  ? 1473 ILE A CB  1 
ATOM 8809  H H   . ILE A 1 1473 ? 52.339  59.496  56.103  1.00 46.97  ? 1473 ILE A H   1 
ATOM 8810  H HA  . ILE A 1 1473 ? 53.903  57.875  54.714  1.00 50.43  ? 1473 ILE A HA  1 
ATOM 8811  N N   . LEU A 1 1474 ? 51.144  58.777  53.319  1.00 66.55  ? 1474 LEU A N   1 
ATOM 8812  C CA  . LEU A 1 1474 ? 50.489  58.921  52.016  1.00 77.25  ? 1474 LEU A CA  1 
ATOM 8813  C C   . LEU A 1 1474 ? 51.247  59.897  51.107  1.00 68.98  ? 1474 LEU A C   1 
ATOM 8814  O O   . LEU A 1 1474 ? 51.437  59.630  49.912  1.00 66.36  ? 1474 LEU A O   1 
ATOM 8815  C CB  . LEU A 1 1474 ? 49.038  59.377  52.216  1.00 76.57  ? 1474 LEU A CB  1 
ATOM 8816  H H   . LEU A 1 1474 ? 50.671  59.047  53.984  1.00 79.85  ? 1474 LEU A H   1 
ATOM 8817  H HA  . LEU A 1 1474 ? 50.472  58.056  51.576  1.00 92.70  ? 1474 LEU A HA  1 
ATOM 8818  N N   . GLU A 1 1475 ? 51.668  61.042  51.649  1.00 65.76  ? 1475 GLU A N   1 
ATOM 8819  C CA  . GLU A 1 1475 ? 52.393  62.030  50.856  1.00 61.56  ? 1475 GLU A CA  1 
ATOM 8820  C C   . GLU A 1 1475 ? 53.829  61.589  50.611  1.00 43.74  ? 1475 GLU A C   1 
ATOM 8821  O O   . GLU A 1 1475 ? 54.430  61.948  49.591  1.00 39.35  ? 1475 GLU A O   1 
ATOM 8822  C CB  . GLU A 1 1475 ? 52.367  63.384  51.567  1.00 85.28  ? 1475 GLU A CB  1 
ATOM 8823  H H   . GLU A 1 1475 ? 51.547  61.268  52.470  1.00 78.92  ? 1475 GLU A H   1 
ATOM 8824  H HA  . GLU A 1 1475 ? 51.956  62.131  49.996  1.00 73.88  ? 1475 GLU A HA  1 
ATOM 8825  N N   . LYS A 1 1476 ? 54.408  60.851  51.560  1.00 32.79  ? 1476 LYS A N   1 
ATOM 8826  C CA  . LYS A 1 1476 ? 55.746  60.312  51.391  1.00 34.25  ? 1476 LYS A CA  1 
ATOM 8827  C C   . LYS A 1 1476 ? 55.770  59.205  50.336  1.00 53.21  ? 1476 LYS A C   1 
ATOM 8828  O O   . LYS A 1 1476 ? 56.696  59.137  49.517  1.00 74.27  ? 1476 LYS A O   1 
ATOM 8829  C CB  . LYS A 1 1476 ? 56.253  59.798  52.740  1.00 31.80  ? 1476 LYS A CB  1 
ATOM 8830  H H   . LYS A 1 1476 ? 54.041  60.650  52.312  1.00 39.35  ? 1476 LYS A H   1 
ATOM 8831  H HA  . LYS A 1 1476 ? 56.339  61.021  51.097  1.00 41.10  ? 1476 LYS A HA  1 
ATOM 8832  N N   . TYR A 1 1477 ? 54.771  58.318  50.351  1.00 48.18  ? 1477 TYR A N   1 
ATOM 8833  C CA  . TYR A 1 1477 ? 54.646  57.304  49.312  1.00 49.55  ? 1477 TYR A CA  1 
ATOM 8834  C C   . TYR A 1 1477 ? 54.262  57.920  47.961  1.00 60.82  ? 1477 TYR A C   1 
ATOM 8835  O O   . TYR A 1 1477 ? 54.676  57.403  46.909  1.00 70.01  ? 1477 TYR A O   1 
ATOM 8836  C CB  . TYR A 1 1477 ? 53.624  56.238  49.734  1.00 45.83  ? 1477 TYR A CB  1 
ATOM 8837  H H   . TYR A 1 1477 ? 54.156  58.286  50.952  1.00 57.82  ? 1477 TYR A H   1 
ATOM 8838  H HA  . TYR A 1 1477 ? 55.504  56.864  49.202  1.00 59.46  ? 1477 TYR A HA  1 
ATOM 8839  N N   . VAL A 1 1478 ? 53.496  59.028  47.967  1.00 60.65  ? 1478 VAL A N   1 
ATOM 8840  C CA  . VAL A 1 1478 ? 53.105  59.714  46.729  1.00 62.79  ? 1478 VAL A CA  1 
ATOM 8841  C C   . VAL A 1 1478 ? 54.256  60.572  46.156  1.00 72.02  ? 1478 VAL A C   1 
ATOM 8842  O O   . VAL A 1 1478 ? 54.275  60.861  44.945  1.00 69.67  ? 1478 VAL A O   1 
ATOM 8843  C CB  . VAL A 1 1478 ? 51.840  60.569  46.965  1.00 44.96  ? 1478 VAL A CB  1 
ATOM 8844  H H   . VAL A 1 1478 ? 53.192  59.400  48.680  1.00 72.78  ? 1478 VAL A H   1 
ATOM 8845  H HA  . VAL A 1 1478 ? 52.883  59.044  46.064  1.00 75.35  ? 1478 VAL A HA  1 
ATOM 8846  N N   . THR A 1 1479 ? 55.224  60.990  46.999  1.00 76.48  ? 1479 THR A N   1 
ATOM 8847  C CA  . THR A 1 1479 ? 56.438  61.665  46.531  1.00 77.55  ? 1479 THR A CA  1 
ATOM 8848  C C   . THR A 1 1479 ? 57.557  60.681  46.096  1.00 89.31  ? 1479 THR A C   1 
ATOM 8849  O O   . THR A 1 1479 ? 58.331  61.021  45.189  1.00 100.16 ? 1479 THR A O   1 
ATOM 8850  C CB  . THR A 1 1479 ? 56.947  62.629  47.615  1.00 54.51  ? 1479 THR A CB  1 
ATOM 8851  H H   . THR A 1 1479 ? 55.194  60.889  47.852  1.00 91.78  ? 1479 THR A H   1 
ATOM 8852  H HA  . THR A 1 1479 ? 56.208  62.199  45.755  1.00 93.05  ? 1479 THR A HA  1 
ATOM 8853  N N   . GLU A 1 1480 ? 57.694  59.476  46.708  1.00 74.71  ? 1480 GLU A N   1 
ATOM 8854  C CA  . GLU A 1 1480 ? 58.578  58.450  46.136  1.00 38.99  ? 1480 GLU A CA  1 
ATOM 8855  C C   . GLU A 1 1480 ? 57.983  57.838  44.863  1.00 49.32  ? 1480 GLU A C   1 
ATOM 8856  O O   . GLU A 1 1480 ? 58.733  57.240  44.074  1.00 33.81  ? 1480 GLU A O   1 
ATOM 8857  C CB  . GLU A 1 1480 ? 58.886  57.348  47.159  1.00 24.93  ? 1480 GLU A CB  1 
ATOM 8858  H H   . GLU A 1 1480 ? 57.294  59.243  47.433  1.00 89.65  ? 1480 GLU A H   1 
ATOM 8859  H HA  . GLU A 1 1480 ? 59.419  58.868  45.893  1.00 46.79  ? 1480 GLU A HA  1 
ATOM 8860  N N   . ILE A 1 1481 ? 56.650  57.952  44.669  1.00 66.62  ? 1481 ILE A N   1 
ATOM 8861  C CA  . ILE A 1 1481 ? 56.012  57.673  43.375  1.00 63.30  ? 1481 ILE A CA  1 
ATOM 8862  C C   . ILE A 1 1481 ? 56.048  58.865  42.396  1.00 58.98  ? 1481 ILE A C   1 
ATOM 8863  O O   . ILE A 1 1481 ? 55.773  58.669  41.200  1.00 43.85  ? 1481 ILE A O   1 
ATOM 8864  C CB  . ILE A 1 1481 ? 54.535  57.238  43.543  1.00 72.86  ? 1481 ILE A CB  1 
ATOM 8865  H H   . ILE A 1 1481 ? 56.095  58.191  45.281  1.00 79.95  ? 1481 ILE A H   1 
ATOM 8866  H HA  . ILE A 1 1481 ? 56.486  56.939  42.954  1.00 75.96  ? 1481 ILE A HA  1 
ATOM 8867  N N   . VAL A 1 1482 ? 56.322  60.096  42.863  1.00 71.70  ? 1482 VAL A N   1 
ATOM 8868  C CA  . VAL A 1 1482 ? 56.635  61.210  41.958  1.00 65.91  ? 1482 VAL A CA  1 
ATOM 8869  C C   . VAL A 1 1482 ? 58.115  61.235  41.566  1.00 61.63  ? 1482 VAL A C   1 
ATOM 8870  O O   . VAL A 1 1482 ? 58.487  61.970  40.638  1.00 43.43  ? 1482 VAL A O   1 
ATOM 8871  C CB  . VAL A 1 1482 ? 56.268  62.585  42.575  1.00 64.98  ? 1482 VAL A CB  1 
ATOM 8872  H H   . VAL A 1 1482 ? 56.332  60.308  43.697  1.00 86.04  ? 1482 VAL A H   1 
ATOM 8873  H HA  . VAL A 1 1482 ? 56.117  61.104  41.146  1.00 79.09  ? 1482 VAL A HA  1 
ATOM 8874  N N   . MET A 1 1483 ? 58.979  60.531  42.326  1.00 71.59  ? 1483 MET A N   1 
ATOM 8875  C CA  . MET A 1 1483 ? 60.355  60.234  41.919  1.00 78.68  ? 1483 MET A CA  1 
ATOM 8876  C C   . MET A 1 1483 ? 60.428  59.001  41.013  1.00 63.11  ? 1483 MET A C   1 
ATOM 8877  O O   . MET A 1 1483 ? 61.105  59.028  39.981  1.00 59.68  ? 1483 MET A O   1 
ATOM 8878  C CB  . MET A 1 1483 ? 61.230  60.021  43.164  1.00 99.13  ? 1483 MET A CB  1 
ATOM 8879  H H   . MET A 1 1483 ? 58.779  60.212  43.099  1.00 85.91  ? 1483 MET A H   1 
ATOM 8880  H HA  . MET A 1 1483 ? 60.708  60.997  41.436  1.00 94.41  ? 1483 MET A HA  1 
ATOM 8881  N N   . SER A 1 1484 ? 59.802  57.888  41.410  1.00 56.92  ? 1484 SER A N   1 
ATOM 8882  C CA  . SER A 1 1484 ? 59.741  56.745  40.508  1.00 48.16  ? 1484 SER A CA  1 
ATOM 8883  C C   . SER A 1 1484 ? 58.937  57.102  39.261  1.00 47.99  ? 1484 SER A C   1 
ATOM 8884  O O   . SER A 1 1484 ? 59.240  56.621  38.161  1.00 43.84  ? 1484 SER A O   1 
ATOM 8885  C CB  . SER A 1 1484 ? 59.142  55.539  41.233  1.00 50.17  ? 1484 SER A CB  1 
ATOM 8886  H H   . SER A 1 1484 ? 59.418  57.775  42.171  1.00 68.30  ? 1484 SER A H   1 
ATOM 8887  H HA  . SER A 1 1484 ? 60.641  56.513  40.229  1.00 57.79  ? 1484 SER A HA  1 
ATOM 8888  N N   . ILE A 1 1485 ? 57.919  57.960  39.416  1.00 46.34  ? 1485 ILE A N   1 
ATOM 8889  C CA  . ILE A 1 1485 ? 57.184  58.505  38.277  1.00 44.60  ? 1485 ILE A CA  1 
ATOM 8890  C C   . ILE A 1 1485 ? 58.025  59.547  37.534  1.00 57.10  ? 1485 ILE A C   1 
ATOM 8891  O O   . ILE A 1 1485 ? 58.039  59.576  36.299  1.00 56.36  ? 1485 ILE A O   1 
ATOM 8892  C CB  . ILE A 1 1485 ? 55.840  59.091  38.756  1.00 43.68  ? 1485 ILE A CB  1 
ATOM 8893  H H   . ILE A 1 1485 ? 57.635  58.240  40.178  1.00 55.61  ? 1485 ILE A H   1 
ATOM 8894  H HA  . ILE A 1 1485 ? 56.990  57.785  37.657  1.00 53.52  ? 1485 ILE A HA  1 
ATOM 8895  N N   . VAL A 1 1486 ? 58.741  60.410  38.261  1.00 45.15  ? 1486 VAL A N   1 
ATOM 8896  C CA  . VAL A 1 1486 ? 59.537  61.437  37.599  1.00 50.19  ? 1486 VAL A CA  1 
ATOM 8897  C C   . VAL A 1 1486 ? 60.696  60.816  36.815  1.00 63.46  ? 1486 VAL A C   1 
ATOM 8898  O O   . VAL A 1 1486 ? 61.146  61.392  35.816  1.00 71.29  ? 1486 VAL A O   1 
ATOM 8899  C CB  . VAL A 1 1486 ? 60.038  62.461  38.638  1.00 34.97  ? 1486 VAL A CB  1 
ATOM 8900  H H   . VAL A 1 1486 ? 58.781  60.420  39.120  1.00 54.18  ? 1486 VAL A H   1 
ATOM 8901  H HA  . VAL A 1 1486 ? 58.973  61.909  36.967  1.00 60.23  ? 1486 VAL A HA  1 
ATOM 8902  N N   . THR A 1 1487 ? 61.153  59.615  37.216  1.00 71.30  ? 1487 THR A N   1 
ATOM 8903  C CA  . THR A 1 1487 ? 62.406  59.042  36.724  1.00 72.28  ? 1487 THR A CA  1 
ATOM 8904  C C   . THR A 1 1487 ? 62.341  58.671  35.243  1.00 79.07  ? 1487 THR A C   1 
ATOM 8905  O O   . THR A 1 1487 ? 63.343  58.810  34.532  1.00 92.75  ? 1487 THR A O   1 
ATOM 8906  C CB  . THR A 1 1487 ? 62.782  57.810  37.557  1.00 54.65  ? 1487 THR A CB  1 
ATOM 8907  H H   . THR A 1 1487 ? 60.744  59.111  37.780  1.00 85.56  ? 1487 THR A H   1 
ATOM 8908  H HA  . THR A 1 1487 ? 63.111  59.699  36.833  1.00 86.74  ? 1487 THR A HA  1 
ATOM 8909  N N   . THR A 1 1488 ? 61.186  58.209  34.749  1.00 65.77  ? 1488 THR A N   1 
ATOM 8910  C CA  . THR A 1 1488 ? 61.101  57.609  33.424  1.00 48.10  ? 1488 THR A CA  1 
ATOM 8911  C C   . THR A 1 1488 ? 60.287  58.401  32.402  1.00 32.01  ? 1488 THR A C   1 
ATOM 8912  O O   . THR A 1 1488 ? 60.228  57.990  31.241  1.00 36.75  ? 1488 THR A O   1 
ATOM 8913  C CB  . THR A 1 1488 ? 60.518  56.201  33.559  1.00 53.83  ? 1488 THR A CB  1 
ATOM 8914  H H   . THR A 1 1488 ? 60.436  58.235  35.169  1.00 78.93  ? 1488 THR A H   1 
ATOM 8915  H HA  . THR A 1 1488 ? 62.000  57.520  33.071  1.00 57.73  ? 1488 THR A HA  1 
ATOM 8916  N N   . PHE A 1 1489 ? 59.680  59.530  32.775  1.00 25.41  ? 1489 PHE A N   1 
ATOM 8917  C CA  . PHE A 1 1489 ? 58.770  60.206  31.862  1.00 21.91  ? 1489 PHE A CA  1 
ATOM 8918  C C   . PHE A 1 1489 ? 59.415  60.436  30.501  1.00 24.61  ? 1489 PHE A C   1 
ATOM 8919  O O   . PHE A 1 1489 ? 58.858  60.044  29.469  1.00 24.00  ? 1489 PHE A O   1 
ATOM 8920  C CB  . PHE A 1 1489 ? 58.318  61.525  32.478  1.00 16.82  ? 1489 PHE A CB  1 
ATOM 8921  H H   . PHE A 1 1489 ? 59.778  59.916  33.538  1.00 30.49  ? 1489 PHE A H   1 
ATOM 8922  H HA  . PHE A 1 1489 ? 57.985  59.651  31.731  1.00 26.29  ? 1489 PHE A HA  1 
ATOM 8923  N N   . PHE A 1 1490 ? 60.594  61.061  30.480  1.00 27.47  ? 1490 PHE A N   1 
ATOM 8924  C CA  . PHE A 1 1490 ? 61.229  61.411  29.212  1.00 33.11  ? 1490 PHE A CA  1 
ATOM 8925  C C   . PHE A 1 1490 ? 61.648  60.174  28.412  1.00 39.45  ? 1490 PHE A C   1 
ATOM 8926  O O   . PHE A 1 1490 ? 61.536  60.171  27.181  1.00 39.12  ? 1490 PHE A O   1 
ATOM 8927  C CB  . PHE A 1 1490 ? 62.432  62.321  29.469  1.00 32.03  ? 1490 PHE A CB  1 
ATOM 8928  H H   . PHE A 1 1490 ? 61.041  61.290  31.178  1.00 32.96  ? 1490 PHE A H   1 
ATOM 8929  H HA  . PHE A 1 1490 ? 60.593  61.907  28.674  1.00 39.73  ? 1490 PHE A HA  1 
ATOM 8930  N N   . SER A 1 1491 ? 62.139  59.127  29.074  1.00 39.10  ? 1491 SER A N   1 
ATOM 8931  C CA  . SER A 1 1491 ? 62.603  57.913  28.395  1.00 36.81  ? 1491 SER A CA  1 
ATOM 8932  C C   . SER A 1 1491 ? 61.974  56.676  29.017  1.00 42.15  ? 1491 SER A C   1 
ATOM 8933  O O   . SER A 1 1491 ? 62.644  55.664  29.239  1.00 49.35  ? 1491 SER A O   1 
ATOM 8934  C CB  . SER A 1 1491 ? 64.127  57.816  28.421  1.00 31.74  ? 1491 SER A CB  1 
ATOM 8935  H H   . SER A 1 1491 ? 62.216  59.094  29.930  1.00 46.92  ? 1491 SER A H   1 
ATOM 8936  H HA  . SER A 1 1491 ? 62.325  57.951  27.467  1.00 44.17  ? 1491 SER A HA  1 
ATOM 8937  N N   . SER A 1 1492 ? 60.656  56.736  29.288  1.00 50.41  ? 1492 SER A N   1 
ATOM 8938  C CA  . SER A 1 1492 ? 59.812  55.652  29.816  1.00 76.99  ? 1492 SER A CA  1 
ATOM 8939  C C   . SER A 1 1492 ? 60.561  54.561  30.611  1.00 99.81  ? 1492 SER A C   1 
ATOM 8940  O O   . SER A 1 1492 ? 61.568  54.852  31.277  1.00 80.42  ? 1492 SER A O   1 
ATOM 8941  C CB  . SER A 1 1492 ? 59.034  55.033  28.646  1.00 80.27  ? 1492 SER A CB  1 
ATOM 8942  H H   . SER A 1 1492 ? 60.201  57.455  29.160  1.00 60.49  ? 1492 SER A H   1 
ATOM 8943  H HA  . SER A 1 1492 ? 59.161  56.044  30.418  1.00 92.39  ? 1492 SER A HA  1 
ATOM 8944  N N   . PRO A 1 1493 ? 60.074  53.286  30.605  1.00 125.77 ? 1493 PRO A N   1 
ATOM 8945  C CA  . PRO A 1 1493 ? 60.636  52.031  31.164  1.00 94.09  ? 1493 PRO A CA  1 
ATOM 8946  C C   . PRO A 1 1493 ? 59.979  50.732  30.659  1.00 80.83  ? 1493 PRO A C   1 
ATOM 8947  O O   . PRO A 1 1493 ? 58.843  50.721  30.175  1.00 87.68  ? 1493 PRO A O   1 
ATOM 8948  C CB  . PRO A 1 1493 ? 60.409  52.177  32.679  1.00 81.60  ? 1493 PRO A CB  1 
ATOM 8949  H HA  . PRO A 1 1493 ? 61.589  51.989  30.991  1.00 112.91 ? 1493 PRO A HA  1 
ATOM 8950  N N   . SER B 1 7    ? 87.901  1.264   -4.571  1.00 22.90  ? 7    SER B N   1 
ATOM 8951  C CA  . SER B 1 7    ? 88.789  2.313   -5.067  1.00 26.73  ? 7    SER B CA  1 
ATOM 8952  C C   . SER B 1 7    ? 89.870  1.763   -5.999  1.00 26.29  ? 7    SER B C   1 
ATOM 8953  O O   . SER B 1 7    ? 90.961  2.342   -6.114  1.00 24.34  ? 7    SER B O   1 
ATOM 8954  C CB  . SER B 1 7    ? 89.424  3.059   -3.892  1.00 30.98  ? 7    SER B CB  1 
ATOM 8955  O OG  . SER B 1 7    ? 90.671  3.625   -4.246  1.00 25.91  ? 7    SER B OG  1 
ATOM 8956  N N   . PHE B 1 8    ? 89.557  0.646   -6.660  1.00 30.22  ? 8    PHE B N   1 
ATOM 8957  C CA  . PHE B 1 8    ? 90.438  0.117   -7.691  1.00 34.26  ? 8    PHE B CA  1 
ATOM 8958  C C   . PHE B 1 8    ? 90.391  1.034   -8.905  1.00 30.91  ? 8    PHE B C   1 
ATOM 8959  O O   . PHE B 1 8    ? 89.324  1.497   -9.324  1.00 23.64  ? 8    PHE B O   1 
ATOM 8960  C CB  . PHE B 1 8    ? 90.057  -1.327  -8.082  1.00 28.08  ? 8    PHE B CB  1 
ATOM 8961  C CG  . PHE B 1 8    ? 91.159  -2.377  -7.822  1.00 24.80  ? 8    PHE B CG  1 
ATOM 8962  C CD1 . PHE B 1 8    ? 91.542  -2.719  -6.521  1.00 16.75  ? 8    PHE B CD1 1 
ATOM 8963  C CD2 . PHE B 1 8    ? 91.779  -3.037  -8.879  1.00 15.76  ? 8    PHE B CD2 1 
ATOM 8964  C CE1 . PHE B 1 8    ? 92.531  -3.676  -6.287  1.00 9.04   ? 8    PHE B CE1 1 
ATOM 8965  C CE2 . PHE B 1 8    ? 92.765  -3.990  -8.649  1.00 9.04   ? 8    PHE B CE2 1 
ATOM 8966  C CZ  . PHE B 1 8    ? 93.140  -4.308  -7.354  1.00 9.04   ? 8    PHE B CZ  1 
ATOM 8967  N N   . LEU B 1 9    ? 91.579  1.314   -9.442  1.00 48.42  ? 9    LEU B N   1 
ATOM 8968  C CA  . LEU B 1 9    ? 91.764  2.152   -10.619 1.00 60.74  ? 9    LEU B CA  1 
ATOM 8969  C C   . LEU B 1 9    ? 91.659  1.304   -11.883 1.00 60.91  ? 9    LEU B C   1 
ATOM 8970  O O   . LEU B 1 9    ? 92.136  0.160   -11.927 1.00 56.89  ? 9    LEU B O   1 
ATOM 8971  C CB  . LEU B 1 9    ? 93.125  2.873   -10.562 1.00 70.25  ? 9    LEU B CB  1 
ATOM 8972  C CG  . LEU B 1 9    ? 94.212  2.717   -11.649 1.00 58.20  ? 9    LEU B CG  1 
ATOM 8973  C CD1 . LEU B 1 9    ? 94.145  3.776   -12.733 1.00 47.11  ? 9    LEU B CD1 1 
ATOM 8974  C CD2 . LEU B 1 9    ? 95.596  2.757   -11.004 1.00 37.19  ? 9    LEU B CD2 1 
ATOM 8975  N N   . HIS B 1 10   ? 90.994  1.871   -12.895 1.00 63.54  ? 10   HIS B N   1 
ATOM 8976  C CA  . HIS B 1 10   ? 90.752  1.255   -14.202 1.00 59.95  ? 10   HIS B CA  1 
ATOM 8977  C C   . HIS B 1 10   ? 90.362  2.359   -15.189 1.00 54.70  ? 10   HIS B C   1 
ATOM 8978  O O   . HIS B 1 10   ? 89.904  3.434   -14.794 1.00 52.39  ? 10   HIS B O   1 
ATOM 8979  C CB  . HIS B 1 10   ? 89.666  0.152   -14.123 1.00 52.19  ? 10   HIS B CB  1 
ATOM 8980  C CG  . HIS B 1 10   ? 89.952  -0.931  -13.114 1.00 45.23  ? 10   HIS B CG  1 
ATOM 8981  N ND1 . HIS B 1 10   ? 90.989  -1.826  -13.263 1.00 42.94  ? 10   HIS B ND1 1 
ATOM 8982  C CD2 . HIS B 1 10   ? 89.349  -1.251  -11.941 1.00 33.72  ? 10   HIS B CD2 1 
ATOM 8983  C CE1 . HIS B 1 10   ? 91.012  -2.651  -12.232 1.00 34.75  ? 10   HIS B CE1 1 
ATOM 8984  N NE2 . HIS B 1 10   ? 90.027  -2.325  -11.414 1.00 32.24  ? 10   HIS B NE2 1 
ATOM 8985  N N   . ILE B 1 11   ? 90.574  2.089   -16.471 1.00 44.22  ? 11   ILE B N   1 
ATOM 8986  C CA  . ILE B 1 11   ? 90.301  3.051   -17.539 1.00 39.58  ? 11   ILE B CA  1 
ATOM 8987  C C   . ILE B 1 11   ? 88.823  3.387   -17.560 1.00 39.37  ? 11   ILE B C   1 
ATOM 8988  O O   . ILE B 1 11   ? 87.972  2.569   -17.176 1.00 30.13  ? 11   ILE B O   1 
ATOM 8989  C CB  . ILE B 1 11   ? 90.755  2.499   -18.889 1.00 37.90  ? 11   ILE B CB  1 
ATOM 8990  C CG1 . ILE B 1 11   ? 92.159  1.942   -18.740 1.00 36.80  ? 11   ILE B CG1 1 
ATOM 8991  C CG2 . ILE B 1 11   ? 90.714  3.558   -19.916 1.00 29.15  ? 11   ILE B CG2 1 
ATOM 8992  C CD1 . ILE B 1 11   ? 93.022  2.225   -19.879 1.00 34.13  ? 11   ILE B CD1 1 
ATOM 8993  N N   . GLY B 1 12   ? 88.503  4.581   -18.004 1.00 42.47  ? 12   GLY B N   1 
ATOM 8994  C CA  . GLY B 1 12   ? 87.121  4.997   -17.901 1.00 52.30  ? 12   GLY B CA  1 
ATOM 8995  C C   . GLY B 1 12   ? 86.782  5.920   -16.758 1.00 52.02  ? 12   GLY B C   1 
ATOM 8996  O O   . GLY B 1 12   ? 86.063  6.929   -16.959 1.00 46.16  ? 12   GLY B O   1 
ATOM 8997  N N   . ASP B 1 13   ? 87.300  5.618   -15.574 1.00 57.95  ? 13   ASP B N   1 
ATOM 8998  C CA  . ASP B 1 13   ? 86.893  6.288   -14.349 1.00 52.75  ? 13   ASP B CA  1 
ATOM 8999  C C   . ASP B 1 13   ? 87.179  7.773   -14.542 1.00 45.76  ? 13   ASP B C   1 
ATOM 9000  O O   . ASP B 1 13   ? 87.881  8.143   -15.489 1.00 38.97  ? 13   ASP B O   1 
ATOM 9001  C CB  . ASP B 1 13   ? 87.628  5.665   -13.158 1.00 53.27  ? 13   ASP B CB  1 
ATOM 9002  C CG  . ASP B 1 13   ? 89.134  5.843   -13.233 1.00 63.67  ? 13   ASP B CG  1 
ATOM 9003  O OD1 . ASP B 1 13   ? 89.517  6.744   -13.978 1.00 61.18  ? 13   ASP B OD1 1 
ATOM 9004  O OD2 . ASP B 1 13   ? 89.934  5.092   -12.607 1.00 57.52  ? 13   ASP B OD2 1 
ATOM 9005  N N   . ILE B 1 14   ? 86.664  8.608   -13.672 1.00 36.08  ? 14   ILE B N   1 
ATOM 9006  C CA  . ILE B 1 14   ? 86.899  10.075  -13.683 1.00 32.86  ? 14   ILE B CA  1 
ATOM 9007  C C   . ILE B 1 14   ? 87.595  10.436  -12.345 1.00 29.62  ? 14   ILE B C   1 
ATOM 9008  O O   . ILE B 1 14   ? 87.520  9.669   -11.398 1.00 24.31  ? 14   ILE B O   1 
ATOM 9009  C CB  . ILE B 1 14   ? 85.551  10.746  -13.937 1.00 32.61  ? 14   ILE B CB  1 
ATOM 9010  C CG1 . ILE B 1 14   ? 84.620  9.580   -14.369 1.00 27.24  ? 14   ILE B CG1 1 
ATOM 9011  C CG2 . ILE B 1 14   ? 85.626  11.507  -15.228 1.00 22.19  ? 14   ILE B CG2 1 
ATOM 9012  C CD1 . ILE B 1 14   ? 83.949  8.781   -13.169 1.00 28.70  ? 14   ILE B CD1 1 
ATOM 9013  N N   . CYS B 1 15   ? 88.363  11.564  -12.293 1.00 31.96  ? 15   CYS B N   1 
ATOM 9014  C CA  . CYS B 1 15   ? 89.116  11.971  -11.068 1.00 23.49  ? 15   CYS B CA  1 
ATOM 9015  C C   . CYS B 1 15   ? 90.103  13.161  -11.319 1.00 25.56  ? 15   CYS B C   1 
ATOM 9016  O O   . CYS B 1 15   ? 90.382  13.491  -12.476 1.00 32.37  ? 15   CYS B O   1 
ATOM 9017  C CB  . CYS B 1 15   ? 89.889  10.773  -10.454 1.00 18.85  ? 15   CYS B CB  1 
ATOM 9018  S SG  . CYS B 1 15   ? 89.252  9.975   -8.939  1.00 8.88   ? 15   CYS B SG  1 
ATOM 9019  N N   . SER B 1 16   ? 90.621  13.839  -10.260 1.00 22.52  ? 16   SER B N   1 
ATOM 9020  C CA  . SER B 1 16   ? 91.423  15.074  -10.370 1.00 24.86  ? 16   SER B CA  1 
ATOM 9021  C C   . SER B 1 16   ? 92.832  14.960  -9.780  1.00 25.45  ? 16   SER B C   1 
ATOM 9022  O O   . SER B 1 16   ? 93.056  14.259  -8.785  1.00 23.38  ? 16   SER B O   1 
ATOM 9023  C CB  . SER B 1 16   ? 90.765  16.240  -9.640  1.00 21.57  ? 16   SER B CB  1 
ATOM 9024  O OG  . SER B 1 16   ? 89.355  16.161  -9.653  1.00 24.12  ? 16   SER B OG  1 
ATOM 9025  N N   . LEU B 1 17   ? 93.755  15.765  -10.334 1.00 32.14  ? 17   LEU B N   1 
ATOM 9026  C CA  . LEU B 1 17   ? 95.187  15.740  -10.001 1.00 33.93  ? 17   LEU B CA  1 
ATOM 9027  C C   . LEU B 1 17   ? 95.712  17.161  -9.692  1.00 22.00  ? 17   LEU B C   1 
ATOM 9028  O O   . LEU B 1 17   ? 95.186  18.133  -10.232 1.00 24.72  ? 17   LEU B O   1 
ATOM 9029  C CB  . LEU B 1 17   ? 95.990  15.111  -11.165 1.00 51.74  ? 17   LEU B CB  1 
ATOM 9030  C CG  . LEU B 1 17   ? 95.517  13.782  -11.815 1.00 62.97  ? 17   LEU B CG  1 
ATOM 9031  C CD1 . LEU B 1 17   ? 94.319  13.942  -12.789 1.00 74.38  ? 17   LEU B CD1 1 
ATOM 9032  C CD2 . LEU B 1 17   ? 96.650  13.005  -12.506 1.00 87.63  ? 17   LEU B CD2 1 
ATOM 9033  N N   . TYR B 1 18   ? 96.749  17.293  -8.842  1.00 16.92  ? 18   TYR B N   1 
ATOM 9034  C CA  . TYR B 1 18   ? 97.097  18.596  -8.286  1.00 12.96  ? 18   TYR B CA  1 
ATOM 9035  C C   . TYR B 1 18   ? 98.577  18.863  -8.011  1.00 14.99  ? 18   TYR B C   1 
ATOM 9036  O O   . TYR B 1 18   ? 99.184  18.092  -7.300  1.00 8.76   ? 18   TYR B O   1 
ATOM 9037  C CB  . TYR B 1 18   ? 96.490  18.800  -6.943  1.00 12.55  ? 18   TYR B CB  1 
ATOM 9038  C CG  . TYR B 1 18   ? 97.098  19.954  -6.339  1.00 8.76   ? 18   TYR B CG  1 
ATOM 9039  C CD1 . TYR B 1 18   ? 96.870  21.190  -6.887  1.00 13.43  ? 18   TYR B CD1 1 
ATOM 9040  C CD2 . TYR B 1 18   ? 97.975  19.825  -5.299  1.00 10.76  ? 18   TYR B CD2 1 
ATOM 9041  C CE1 . TYR B 1 18   ? 97.401  22.260  -6.392  1.00 11.08  ? 18   TYR B CE1 1 
ATOM 9042  C CE2 . TYR B 1 18   ? 98.522  20.898  -4.775  1.00 12.90  ? 18   TYR B CE2 1 
ATOM 9043  C CZ  . TYR B 1 18   ? 98.238  22.124  -5.331  1.00 12.11  ? 18   TYR B CZ  1 
ATOM 9044  O OH  . TYR B 1 18   ? 98.787  23.226  -4.775  1.00 12.89  ? 18   TYR B OH  1 
ATOM 9045  N N   . ALA B 1 19   ? 99.120  20.032  -8.364  1.00 9.07   ? 19   ALA B N   1 
ATOM 9046  C CA  . ALA B 1 19   ? 100.530 20.052  -8.481  1.00 8.71   ? 19   ALA B CA  1 
ATOM 9047  C C   . ALA B 1 19   ? 101.278 20.019  -7.163  1.00 10.72  ? 19   ALA B C   1 
ATOM 9048  O O   . ALA B 1 19   ? 100.731 20.219  -6.090  1.00 11.36  ? 19   ALA B O   1 
ATOM 9049  C CB  . ALA B 1 19   ? 101.036 21.230  -9.269  1.00 13.10  ? 19   ALA B CB  1 
ATOM 9050  N N   . GLU B 1 20   ? 102.542 19.637  -7.268  1.00 15.64  ? 20   GLU B N   1 
ATOM 9051  C CA  . GLU B 1 20   ? 103.338 19.600  -6.095  1.00 20.99  ? 20   GLU B CA  1 
ATOM 9052  C C   . GLU B 1 20   ? 104.728 19.153  -6.540  1.00 33.85  ? 20   GLU B C   1 
ATOM 9053  O O   . GLU B 1 20   ? 104.886 18.503  -7.585  1.00 30.27  ? 20   GLU B O   1 
ATOM 9054  C CB  . GLU B 1 20   ? 102.738 18.688  -4.966  1.00 20.27  ? 20   GLU B CB  1 
ATOM 9055  C CG  . GLU B 1 20   ? 102.380 17.306  -5.346  1.00 15.51  ? 20   GLU B CG  1 
ATOM 9056  C CD  . GLU B 1 20   ? 102.881 17.028  -6.740  1.00 18.36  ? 20   GLU B CD  1 
ATOM 9057  O OE1 . GLU B 1 20   ? 102.298 17.644  -7.668  1.00 8.78   ? 20   GLU B OE1 1 
ATOM 9058  O OE2 . GLU B 1 20   ? 103.887 16.300  -6.891  1.00 15.06  ? 20   GLU B OE2 1 
ATOM 9059  N N   . GLY B 1 21   ? 105.715 19.480  -5.697  1.00 34.43  ? 21   GLY B N   1 
ATOM 9060  C CA  . GLY B 1 21   ? 107.094 19.116  -5.896  1.00 30.77  ? 21   GLY B CA  1 
ATOM 9061  C C   . GLY B 1 21   ? 107.875 20.346  -6.267  1.00 15.97  ? 21   GLY B C   1 
ATOM 9062  O O   . GLY B 1 21   ? 108.990 20.536  -5.780  1.00 8.85   ? 21   GLY B O   1 
ATOM 9063  N N   . SER B 1 22   ? 107.276 21.189  -7.108  1.00 11.83  ? 22   SER B N   1 
ATOM 9064  C CA  . SER B 1 22   ? 107.914 22.369  -7.657  1.00 8.82   ? 22   SER B CA  1 
ATOM 9065  C C   . SER B 1 22   ? 106.948 23.535  -7.569  1.00 8.82   ? 22   SER B C   1 
ATOM 9066  O O   . SER B 1 22   ? 107.278 24.593  -7.040  1.00 8.82   ? 22   SER B O   1 
ATOM 9067  C CB  . SER B 1 22   ? 108.305 22.125  -9.109  1.00 12.15  ? 22   SER B CB  1 
ATOM 9068  O OG  . SER B 1 22   ? 108.927 20.860  -9.267  1.00 25.73  ? 22   SER B OG  1 
ATOM 9069  N N   . THR B 1 23   ? 105.772 23.374  -8.133  1.00 8.72   ? 23   THR B N   1 
ATOM 9070  C CA  . THR B 1 23   ? 104.750 24.390  -8.015  1.00 8.72   ? 23   THR B CA  1 
ATOM 9071  C C   . THR B 1 23   ? 103.435 23.667  -7.858  1.00 10.50  ? 23   THR B C   1 
ATOM 9072  O O   . THR B 1 23   ? 103.174 22.678  -8.541  1.00 17.38  ? 23   THR B O   1 
ATOM 9073  C CB  . THR B 1 23   ? 104.741 25.310  -9.223  1.00 8.72   ? 23   THR B CB  1 
ATOM 9074  O OG1 . THR B 1 23   ? 106.079 25.763  -9.433  1.00 8.72   ? 23   THR B OG1 1 
ATOM 9075  C CG2 . THR B 1 23   ? 103.836 26.500  -8.974  1.00 8.72   ? 23   THR B CG2 1 
ATOM 9076  N N   . ASN B 1 24   ? 102.648 24.118  -6.910  1.00 8.69   ? 24   ASN B N   1 
ATOM 9077  C CA  . ASN B 1 24   ? 101.330 23.559  -6.719  1.00 10.39  ? 24   ASN B CA  1 
ATOM 9078  C C   . ASN B 1 24   ? 100.431 23.975  -7.880  1.00 14.47  ? 24   ASN B C   1 
ATOM 9079  O O   . ASN B 1 24   ? 100.586 25.069  -8.420  1.00 12.57  ? 24   ASN B O   1 
ATOM 9080  C CB  . ASN B 1 24   ? 100.834 24.079  -5.400  1.00 8.68   ? 24   ASN B CB  1 
ATOM 9081  C CG  . ASN B 1 24   ? 101.343 25.451  -5.122  1.00 9.26   ? 24   ASN B CG  1 
ATOM 9082  O OD1 . ASN B 1 24   ? 102.461 25.620  -4.632  1.00 8.68   ? 24   ASN B OD1 1 
ATOM 9083  N ND2 . ASN B 1 24   ? 100.539 26.455  -5.446  1.00 8.72   ? 24   ASN B ND2 1 
ATOM 9084  N N   . GLY B 1 25   ? 99.532  23.088  -8.305  1.00 11.95  ? 25   GLY B N   1 
ATOM 9085  C CA  . GLY B 1 25   ? 98.692  23.365  -9.461  1.00 16.88  ? 25   GLY B CA  1 
ATOM 9086  C C   . GLY B 1 25   ? 98.338  22.110  -10.245 1.00 16.53  ? 25   GLY B C   1 
ATOM 9087  O O   . GLY B 1 25   ? 98.387  21.002  -9.734  1.00 11.68  ? 25   GLY B O   1 
ATOM 9088  N N   . PHE B 1 26   ? 97.927  22.315  -11.500 1.00 25.36  ? 26   PHE B N   1 
ATOM 9089  C CA  . PHE B 1 26   ? 97.651  21.237  -12.459 1.00 47.59  ? 26   PHE B CA  1 
ATOM 9090  C C   . PHE B 1 26   ? 97.476  21.857  -13.866 1.00 57.13  ? 26   PHE B C   1 
ATOM 9091  O O   . PHE B 1 26   ? 97.479  23.084  -14.008 1.00 51.00  ? 26   PHE B O   1 
ATOM 9092  C CB  . PHE B 1 26   ? 96.439  20.348  -12.035 1.00 48.89  ? 26   PHE B CB  1 
ATOM 9093  C CG  . PHE B 1 26   ? 95.467  20.982  -11.030 1.00 32.38  ? 26   PHE B CG  1 
ATOM 9094  C CD1 . PHE B 1 26   ? 95.640  20.832  -9.675  1.00 16.59  ? 26   PHE B CD1 1 
ATOM 9095  C CD2 . PHE B 1 26   ? 94.328  21.644  -11.465 1.00 41.50  ? 26   PHE B CD2 1 
ATOM 9096  C CE1 . PHE B 1 26   ? 94.748  21.370  -8.807  1.00 11.03  ? 26   PHE B CE1 1 
ATOM 9097  C CE2 . PHE B 1 26   ? 93.434  22.198  -10.568 1.00 19.08  ? 26   PHE B CE2 1 
ATOM 9098  C CZ  . PHE B 1 26   ? 93.654  22.064  -9.257  1.00 11.90  ? 26   PHE B CZ  1 
ATOM 9099  N N   . ILE B 1 27   ? 97.336  20.951  -14.969 1.00 63.75  ? 27   ILE B N   1 
ATOM 9100  C CA  . ILE B 1 27   ? 97.306  21.344  -16.399 1.00 60.59  ? 27   ILE B CA  1 
ATOM 9101  C C   . ILE B 1 27   ? 95.869  21.632  -16.866 1.00 57.97  ? 27   ILE B C   1 
ATOM 9102  O O   . ILE B 1 27   ? 94.929  20.919  -16.493 1.00 65.79  ? 27   ILE B O   1 
ATOM 9103  C CB  . ILE B 1 27   ? 97.978  20.264  -17.295 1.00 40.99  ? 27   ILE B CB  1 
ATOM 9104  C CG1 . ILE B 1 27   ? 98.486  20.866  -18.613 1.00 33.90  ? 27   ILE B CG1 1 
ATOM 9105  C CG2 . ILE B 1 27   ? 97.034  19.074  -17.593 1.00 34.32  ? 27   ILE B CG2 1 
ATOM 9106  C CD1 . ILE B 1 27   ? 99.800  20.306  -19.039 1.00 20.12  ? 27   ILE B CD1 1 
ATOM 9107  N N   . SER B 1 28   ? 95.693  22.684  -17.688 1.00 46.61  ? 28   SER B N   1 
ATOM 9108  C CA  . SER B 1 28   ? 94.384  23.203  -18.106 1.00 24.40  ? 28   SER B CA  1 
ATOM 9109  C C   . SER B 1 28   ? 94.443  23.733  -19.535 1.00 23.42  ? 28   SER B C   1 
ATOM 9110  O O   . SER B 1 28   ? 95.471  24.273  -19.967 1.00 32.22  ? 28   SER B O   1 
ATOM 9111  C CB  . SER B 1 28   ? 93.902  24.356  -17.230 1.00 28.48  ? 28   SER B CB  1 
ATOM 9112  O OG  . SER B 1 28   ? 94.599  25.530  -17.613 1.00 32.98  ? 28   SER B OG  1 
ATOM 9113  N N   . THR B 1 29   ? 93.296  23.650  -20.226 1.00 16.04  ? 29   THR B N   1 
ATOM 9114  C CA  . THR B 1 29   ? 93.182  23.849  -21.670 1.00 14.45  ? 29   THR B CA  1 
ATOM 9115  C C   . THR B 1 29   ? 92.441  25.149  -21.983 1.00 10.13  ? 29   THR B C   1 
ATOM 9116  O O   . THR B 1 29   ? 91.489  25.503  -21.290 1.00 13.57  ? 29   THR B O   1 
ATOM 9117  C CB  . THR B 1 29   ? 92.449  22.656  -22.301 1.00 12.35  ? 29   THR B CB  1 
ATOM 9118  O OG1 . THR B 1 29   ? 92.366  22.805  -23.725 1.00 13.81  ? 29   THR B OG1 1 
ATOM 9119  C CG2 . THR B 1 29   ? 91.064  22.561  -21.737 1.00 11.76  ? 29   THR B CG2 1 
ATOM 9120  N N   . LEU B 1 30   ? 92.870  25.850  -23.041 1.00 12.55  ? 30   LEU B N   1 
ATOM 9121  C CA  . LEU B 1 30   ? 92.339  27.178  -23.332 1.00 8.88   ? 30   LEU B CA  1 
ATOM 9122  C C   . LEU B 1 30   ? 91.058  27.115  -24.139 1.00 8.88   ? 30   LEU B C   1 
ATOM 9123  O O   . LEU B 1 30   ? 90.124  27.876  -23.887 1.00 8.88   ? 30   LEU B O   1 
ATOM 9124  C CB  . LEU B 1 30   ? 93.366  27.998  -24.090 1.00 8.88   ? 30   LEU B CB  1 
ATOM 9125  C CG  . LEU B 1 30   ? 94.158  28.914  -23.184 1.00 11.73  ? 30   LEU B CG  1 
ATOM 9126  C CD1 . LEU B 1 30   ? 95.630  28.752  -23.486 1.00 19.28  ? 30   LEU B CD1 1 
ATOM 9127  C CD2 . LEU B 1 30   ? 93.708  30.342  -23.394 1.00 14.05  ? 30   LEU B CD2 1 
ATOM 9128  N N   . GLY B 1 31   ? 91.022  26.256  -25.141 1.00 8.79   ? 31   GLY B N   1 
ATOM 9129  C CA  . GLY B 1 31   ? 89.854  26.131  -25.990 1.00 11.49  ? 31   GLY B CA  1 
ATOM 9130  C C   . GLY B 1 31   ? 90.194  25.412  -27.281 1.00 16.62  ? 31   GLY B C   1 
ATOM 9131  O O   . GLY B 1 31   ? 91.323  24.985  -27.506 1.00 33.90  ? 31   GLY B O   1 
ATOM 9132  N N   . LEU B 1 32   ? 89.192  25.335  -28.149 1.00 13.91  ? 32   LEU B N   1 
ATOM 9133  C CA  . LEU B 1 32   ? 89.282  24.549  -29.373 1.00 15.43  ? 32   LEU B CA  1 
ATOM 9134  C C   . LEU B 1 32   ? 89.701  25.377  -30.587 1.00 15.77  ? 32   LEU B C   1 
ATOM 9135  O O   . LEU B 1 32   ? 90.358  24.861  -31.501 1.00 14.31  ? 32   LEU B O   1 
ATOM 9136  C CB  . LEU B 1 32   ? 87.942  23.865  -29.617 1.00 17.68  ? 32   LEU B CB  1 
ATOM 9137  C CG  . LEU B 1 32   ? 86.706  24.536  -29.021 1.00 15.82  ? 32   LEU B CG  1 
ATOM 9138  C CD1 . LEU B 1 32   ? 85.597  23.661  -29.473 1.00 23.37  ? 32   LEU B CD1 1 
ATOM 9139  C CD2 . LEU B 1 32   ? 86.650  24.561  -27.529 1.00 12.73  ? 32   LEU B CD2 1 
ATOM 9140  N N   . VAL B 1 33   ? 89.334  26.658  -30.610 1.00 15.96  ? 33   VAL B N   1 
ATOM 9141  C CA  . VAL B 1 33   ? 89.786  27.555  -31.669 1.00 16.71  ? 33   VAL B CA  1 
ATOM 9142  C C   . VAL B 1 33   ? 91.122  28.224  -31.340 1.00 18.09  ? 33   VAL B C   1 
ATOM 9143  O O   . VAL B 1 33   ? 91.880  28.594  -32.249 1.00 15.84  ? 33   VAL B O   1 
ATOM 9144  C CB  . VAL B 1 33   ? 88.731  28.624  -31.939 1.00 14.79  ? 33   VAL B CB  1 
ATOM 9145  C CG1 . VAL B 1 33   ? 89.396  29.740  -32.635 1.00 12.58  ? 33   VAL B CG1 1 
ATOM 9146  C CG2 . VAL B 1 33   ? 87.579  28.068  -32.761 1.00 14.63  ? 33   VAL B CG2 1 
ATOM 9147  N N   . ASP B 1 34   ? 91.394  28.478  -30.059 1.00 22.31  ? 34   ASP B N   1 
ATOM 9148  C CA  . ASP B 1 34   ? 92.719  28.892  -29.592 1.00 22.78  ? 34   ASP B CA  1 
ATOM 9149  C C   . ASP B 1 34   ? 93.260  27.825  -28.630 1.00 21.43  ? 34   ASP B C   1 
ATOM 9150  O O   . ASP B 1 34   ? 92.832  27.751  -27.470 1.00 20.45  ? 34   ASP B O   1 
ATOM 9151  C CB  . ASP B 1 34   ? 92.695  30.300  -28.952 1.00 21.24  ? 34   ASP B CB  1 
ATOM 9152  C CG  . ASP B 1 34   ? 91.447  30.591  -28.081 1.00 14.61  ? 34   ASP B CG  1 
ATOM 9153  O OD1 . ASP B 1 34   ? 91.262  29.952  -27.026 1.00 13.42  ? 34   ASP B OD1 1 
ATOM 9154  O OD2 . ASP B 1 34   ? 90.667  31.507  -28.423 1.00 10.33  ? 34   ASP B OD2 1 
ATOM 9155  N N   . ASP B 1 35   ? 94.215  27.006  -29.099 1.00 14.56  ? 35   ASP B N   1 
ATOM 9156  C CA  . ASP B 1 35   ? 94.634  25.810  -28.372 1.00 14.73  ? 35   ASP B CA  1 
ATOM 9157  C C   . ASP B 1 35   ? 96.039  25.991  -27.826 1.00 8.68   ? 35   ASP B C   1 
ATOM 9158  O O   . ASP B 1 35   ? 96.966  26.286  -28.580 1.00 8.68   ? 35   ASP B O   1 
ATOM 9159  C CB  . ASP B 1 35   ? 94.559  24.560  -29.252 1.00 16.23  ? 35   ASP B CB  1 
ATOM 9160  C CG  . ASP B 1 35   ? 95.808  24.331  -30.042 1.00 8.68   ? 35   ASP B CG  1 
ATOM 9161  O OD1 . ASP B 1 35   ? 96.189  25.239  -30.804 1.00 8.68   ? 35   ASP B OD1 1 
ATOM 9162  O OD2 . ASP B 1 35   ? 96.404  23.246  -29.886 1.00 8.68   ? 35   ASP B OD2 1 
ATOM 9163  N N   . ARG B 1 36   ? 96.175  25.822  -26.512 1.00 8.85   ? 36   ARG B N   1 
ATOM 9164  C CA  . ARG B 1 36   ? 97.426  25.960  -25.769 1.00 15.85  ? 36   ARG B CA  1 
ATOM 9165  C C   . ARG B 1 36   ? 97.215  25.381  -24.373 1.00 24.34  ? 36   ARG B C   1 
ATOM 9166  O O   . ARG B 1 36   ? 96.079  25.111  -23.972 1.00 40.47  ? 36   ARG B O   1 
ATOM 9167  C CB  . ARG B 1 36   ? 97.878  27.419  -25.670 1.00 17.31  ? 36   ARG B CB  1 
ATOM 9168  C CG  . ARG B 1 36   ? 99.244  27.588  -24.996 1.00 21.47  ? 36   ARG B CG  1 
ATOM 9169  C CD  . ARG B 1 36   ? 99.273  28.758  -24.029 1.00 10.67  ? 36   ARG B CD  1 
ATOM 9170  N NE  . ARG B 1 36   ? 99.661  30.011  -24.669 1.00 8.85   ? 36   ARG B NE  1 
ATOM 9171  C CZ  . ARG B 1 36   ? 100.917 30.414  -24.777 1.00 8.85   ? 36   ARG B CZ  1 
ATOM 9172  N NH1 . ARG B 1 36   ? 101.877 29.648  -24.294 1.00 8.85   ? 36   ARG B NH1 1 
ATOM 9173  N NH2 . ARG B 1 36   ? 101.208 31.568  -25.356 1.00 8.85   ? 36   ARG B NH2 1 
ATOM 9174  N N   . CYS B 1 37   ? 98.319  25.260  -23.605 1.00 31.00  ? 37   CYS B N   1 
ATOM 9175  C CA  . CYS B 1 37   ? 98.360  24.522  -22.336 1.00 26.95  ? 37   CYS B CA  1 
ATOM 9176  C C   . CYS B 1 37   ? 98.949  25.367  -21.202 1.00 22.20  ? 37   CYS B C   1 
ATOM 9177  O O   . CYS B 1 37   ? 99.948  26.073  -21.401 1.00 17.96  ? 37   CYS B O   1 
ATOM 9178  C CB  . CYS B 1 37   ? 99.141  23.204  -22.559 1.00 18.97  ? 37   CYS B CB  1 
ATOM 9179  S SG  . CYS B 1 37   ? 100.437 22.729  -21.433 1.00 9.99   ? 37   CYS B SG  1 
ATOM 9180  N N   . VAL B 1 38   ? 98.314  25.319  -20.019 1.00 25.22  ? 38   VAL B N   1 
ATOM 9181  C CA  . VAL B 1 38   ? 98.625  26.274  -18.945 1.00 30.33  ? 38   VAL B CA  1 
ATOM 9182  C C   . VAL B 1 38   ? 98.176  25.743  -17.573 1.00 40.17  ? 38   VAL B C   1 
ATOM 9183  O O   . VAL B 1 38   ? 97.146  25.075  -17.463 1.00 35.96  ? 38   VAL B O   1 
ATOM 9184  C CB  . VAL B 1 38   ? 97.985  27.642  -19.279 1.00 34.44  ? 38   VAL B CB  1 
ATOM 9185  C CG1 . VAL B 1 38   ? 98.533  28.153  -20.607 1.00 23.04  ? 38   VAL B CG1 1 
ATOM 9186  C CG2 . VAL B 1 38   ? 96.458  27.506  -19.348 1.00 34.65  ? 38   VAL B CG2 1 
ATOM 9187  N N   . VAL B 1 39   ? 98.947  26.079  -16.510 1.00 50.71  ? 39   VAL B N   1 
ATOM 9188  C CA  . VAL B 1 39   ? 98.756  25.581  -15.135 1.00 54.64  ? 39   VAL B CA  1 
ATOM 9189  C C   . VAL B 1 39   ? 98.882  26.717  -14.110 1.00 71.84  ? 39   VAL B C   1 
ATOM 9190  O O   . VAL B 1 39   ? 99.573  27.713  -14.355 1.00 85.78  ? 39   VAL B O   1 
ATOM 9191  C CB  . VAL B 1 39   ? 99.780  24.478  -14.763 1.00 47.16  ? 39   VAL B CB  1 
ATOM 9192  C CG1 . VAL B 1 39   ? 99.914  23.476  -15.885 1.00 42.63  ? 39   VAL B CG1 1 
ATOM 9193  C CG2 . VAL B 1 39   ? 101.140 25.107  -14.432 1.00 53.68  ? 39   VAL B CG2 1 
ATOM 9194  N N   . GLN B 1 40   ? 98.253  26.545  -12.932 1.00 68.67  ? 40   GLN B N   1 
ATOM 9195  C CA  . GLN B 1 40   ? 98.176  27.616  -11.922 1.00 73.36  ? 40   GLN B CA  1 
ATOM 9196  C C   . GLN B 1 40   ? 98.604  27.131  -10.527 1.00 44.50  ? 40   GLN B C   1 
ATOM 9197  O O   . GLN B 1 40   ? 98.146  26.071  -10.073 1.00 40.37  ? 40   GLN B O   1 
ATOM 9198  C CB  . GLN B 1 40   ? 96.702  28.254  -11.863 1.00 82.26  ? 40   GLN B CB  1 
ATOM 9199  C CG  . GLN B 1 40   ? 95.677  28.093  -13.092 1.00 63.43  ? 40   GLN B CG  1 
ATOM 9200  C CD  . GLN B 1 40   ? 96.058  28.785  -14.428 1.00 41.11  ? 40   GLN B CD  1 
ATOM 9201  O OE1 . GLN B 1 40   ? 96.376  28.112  -15.409 1.00 46.00  ? 40   GLN B OE1 1 
ATOM 9202  N NE2 . GLN B 1 40   ? 95.988  30.115  -14.470 1.00 28.76  ? 40   GLN B NE2 1 
ATOM 9203  N N   . PRO B 1 41   ? 99.514  27.842  -9.844  1.00 31.04  ? 41   PRO B N   1 
ATOM 9204  C CA  . PRO B 1 41   ? 99.831  27.469  -8.449  1.00 19.95  ? 41   PRO B CA  1 
ATOM 9205  C C   . PRO B 1 41   ? 98.699  27.730  -7.448  1.00 16.41  ? 41   PRO B C   1 
ATOM 9206  O O   . PRO B 1 41   ? 98.478  26.914  -6.541  1.00 12.53  ? 41   PRO B O   1 
ATOM 9207  C CB  . PRO B 1 41   ? 101.083 28.307  -8.150  1.00 18.90  ? 41   PRO B CB  1 
ATOM 9208  C CG  . PRO B 1 41   ? 101.694 28.612  -9.512  1.00 14.46  ? 41   PRO B CG  1 
ATOM 9209  C CD  . PRO B 1 41   ? 100.513 28.774  -10.413 1.00 27.67  ? 41   PRO B CD  1 
ATOM 9210  N N   . GLU B 1 42   ? 97.978  28.844  -7.579  1.00 10.95  ? 42   GLU B N   1 
ATOM 9211  C CA  . GLU B 1 42   ? 97.018  29.267  -6.565  1.00 11.93  ? 42   GLU B CA  1 
ATOM 9212  C C   . GLU B 1 42   ? 95.603  28.966  -7.002  1.00 8.74   ? 42   GLU B C   1 
ATOM 9213  O O   . GLU B 1 42   ? 95.196  27.804  -7.028  1.00 8.74   ? 42   GLU B O   1 
ATOM 9214  C CB  . GLU B 1 42   ? 97.158  30.760  -6.292  1.00 8.74   ? 42   GLU B CB  1 
ATOM 9215  C CG  . GLU B 1 42   ? 98.576  31.151  -5.899  1.00 18.04  ? 42   GLU B CG  1 
ATOM 9216  C CD  . GLU B 1 42   ? 99.035  32.479  -6.489  1.00 13.21  ? 42   GLU B CD  1 
ATOM 9217  O OE1 . GLU B 1 42   ? 100.254 32.655  -6.711  1.00 10.99  ? 42   GLU B OE1 1 
ATOM 9218  O OE2 . GLU B 1 42   ? 98.180  33.352  -6.727  1.00 10.57  ? 42   GLU B OE2 1 
ATOM 9219  N N   . ALA B 1 43   ? 94.872  30.018  -7.365  1.00 8.69   ? 43   ALA B N   1 
ATOM 9220  C CA  . ALA B 1 43   ? 93.496  29.904  -7.808  1.00 8.69   ? 43   ALA B CA  1 
ATOM 9221  C C   . ALA B 1 43   ? 92.924  28.549  -7.441  1.00 8.69   ? 43   ALA B C   1 
ATOM 9222  O O   . ALA B 1 43   ? 92.330  28.415  -6.377  1.00 8.69   ? 43   ALA B O   1 
ATOM 9223  C CB  . ALA B 1 43   ? 93.395  30.138  -9.305  1.00 8.69   ? 43   ALA B CB  1 
ATOM 9224  N N   . GLY B 1 44   ? 93.168  27.523  -8.253  1.00 8.76   ? 44   GLY B N   1 
ATOM 9225  C CA  . GLY B 1 44   ? 92.522  26.220  -8.092  1.00 8.76   ? 44   GLY B CA  1 
ATOM 9226  C C   . GLY B 1 44   ? 93.492  25.097  -7.766  1.00 8.76   ? 44   GLY B C   1 
ATOM 9227  O O   . GLY B 1 44   ? 94.637  25.105  -8.213  1.00 8.76   ? 44   GLY B O   1 
ATOM 9228  N N   . ASP B 1 45   ? 93.024  24.134  -6.971  1.00 8.78   ? 45   ASP B N   1 
ATOM 9229  C CA  . ASP B 1 45   ? 93.848  23.022  -6.485  1.00 9.14   ? 45   ASP B CA  1 
ATOM 9230  C C   . ASP B 1 45   ? 93.000  21.752  -6.503  1.00 8.78   ? 45   ASP B C   1 
ATOM 9231  O O   . ASP B 1 45   ? 91.898  21.739  -7.048  1.00 8.94   ? 45   ASP B O   1 
ATOM 9232  C CB  . ASP B 1 45   ? 94.427  23.304  -5.095  1.00 8.78   ? 45   ASP B CB  1 
ATOM 9233  C CG  . ASP B 1 45   ? 93.620  24.312  -4.309  1.00 8.78   ? 45   ASP B CG  1 
ATOM 9234  O OD1 . ASP B 1 45   ? 93.893  25.518  -4.483  1.00 8.78   ? 45   ASP B OD1 1 
ATOM 9235  O OD2 . ASP B 1 45   ? 92.741  23.908  -3.511  1.00 8.78   ? 45   ASP B OD2 1 
ATOM 9236  N N   . LEU B 1 46   ? 93.539  20.638  -5.999  1.00 8.75   ? 46   LEU B N   1 
ATOM 9237  C CA  . LEU B 1 46   ? 92.745  19.407  -5.987  1.00 8.75   ? 46   LEU B CA  1 
ATOM 9238  C C   . LEU B 1 46   ? 91.676  19.415  -4.913  1.00 10.03  ? 46   LEU B C   1 
ATOM 9239  O O   . LEU B 1 46   ? 90.666  18.719  -5.040  1.00 13.51  ? 46   LEU B O   1 
ATOM 9240  C CB  . LEU B 1 46   ? 93.614  18.184  -5.779  1.00 10.31  ? 46   LEU B CB  1 
ATOM 9241  C CG  . LEU B 1 46   ? 94.110  17.744  -7.130  1.00 8.75   ? 46   LEU B CG  1 
ATOM 9242  C CD1 . LEU B 1 46   ? 93.821  16.329  -7.299  1.00 14.57  ? 46   LEU B CD1 1 
ATOM 9243  C CD2 . LEU B 1 46   ? 93.395  18.560  -8.139  1.00 10.97  ? 46   LEU B CD2 1 
ATOM 9244  N N   . ASN B 1 47   ? 91.906  20.126  -3.816  1.00 11.29  ? 47   ASN B N   1 
ATOM 9245  C CA  . ASN B 1 47   ? 90.808  20.391  -2.901  1.00 12.74  ? 47   ASN B CA  1 
ATOM 9246  C C   . ASN B 1 47   ? 89.830  21.399  -3.483  1.00 12.75  ? 47   ASN B C   1 
ATOM 9247  O O   . ASN B 1 47   ? 88.690  21.482  -3.019  1.00 13.08  ? 47   ASN B O   1 
ATOM 9248  C CB  . ASN B 1 47   ? 91.328  20.924  -1.572  1.00 12.45  ? 47   ASN B CB  1 
ATOM 9249  C CG  . ASN B 1 47   ? 92.496  20.156  -1.062  1.00 12.61  ? 47   ASN B CG  1 
ATOM 9250  O OD1 . ASN B 1 47   ? 93.113  19.385  -1.797  1.00 19.85  ? 47   ASN B OD1 1 
ATOM 9251  N ND2 . ASN B 1 47   ? 92.824  20.362  0.208   1.00 12.66  ? 47   ASN B ND2 1 
ATOM 9252  N N   . ASN B 1 48   ? 90.268  22.211  -4.432  1.00 12.97  ? 48   ASN B N   1 
ATOM 9253  C CA  . ASN B 1 48   ? 89.384  23.129  -5.139  1.00 11.32  ? 48   ASN B CA  1 
ATOM 9254  C C   . ASN B 1 48   ? 90.129  23.616  -6.366  1.00 10.05  ? 48   ASN B C   1 
ATOM 9255  O O   . ASN B 1 48   ? 91.200  24.226  -6.261  1.00 9.33   ? 48   ASN B O   1 
ATOM 9256  C CB  . ASN B 1 48   ? 88.935  24.324  -4.300  1.00 13.43  ? 48   ASN B CB  1 
ATOM 9257  C CG  . ASN B 1 48   ? 87.723  24.027  -3.470  1.00 10.56  ? 48   ASN B CG  1 
ATOM 9258  O OD1 . ASN B 1 48   ? 86.737  23.495  -3.956  1.00 8.81   ? 48   ASN B OD1 1 
ATOM 9259  N ND2 . ASN B 1 48   ? 87.798  24.353  -2.196  1.00 21.69  ? 48   ASN B ND2 1 
ATOM 9260  N N   . PRO B 1 49   ? 89.650  23.264  -7.536  1.00 11.41  ? 49   PRO B N   1 
ATOM 9261  C CA  . PRO B 1 49   ? 90.249  23.768  -8.754  1.00 10.65  ? 49   PRO B CA  1 
ATOM 9262  C C   . PRO B 1 49   ? 89.664  25.123  -9.104  1.00 10.81  ? 49   PRO B C   1 
ATOM 9263  O O   . PRO B 1 49   ? 88.587  25.485  -8.603  1.00 23.20  ? 49   PRO B O   1 
ATOM 9264  C CB  . PRO B 1 49   ? 89.874  22.703  -9.794  1.00 17.27  ? 49   PRO B CB  1 
ATOM 9265  C CG  . PRO B 1 49   ? 89.460  21.496  -8.971  1.00 17.51  ? 49   PRO B CG  1 
ATOM 9266  C CD  . PRO B 1 49   ? 88.831  22.065  -7.762  1.00 16.04  ? 49   PRO B CD  1 
ATOM 9267  N N   . PRO B 1 50   ? 90.335  25.882  -9.968  1.00 8.86   ? 50   PRO B N   1 
ATOM 9268  C CA  . PRO B 1 50   ? 89.905  27.250  -10.310 1.00 8.86   ? 50   PRO B CA  1 
ATOM 9269  C C   . PRO B 1 50   ? 88.420  27.604  -10.157 1.00 18.57  ? 50   PRO B C   1 
ATOM 9270  O O   . PRO B 1 50   ? 88.043  28.168  -9.121  1.00 20.40  ? 50   PRO B O   1 
ATOM 9271  C CB  . PRO B 1 50   ? 90.341  27.360  -11.771 1.00 8.86   ? 50   PRO B CB  1 
ATOM 9272  C CG  . PRO B 1 50   ? 91.586  26.528  -11.824 1.00 8.86   ? 50   PRO B CG  1 
ATOM 9273  C CD  . PRO B 1 50   ? 91.472  25.443  -10.792 1.00 8.86   ? 50   PRO B CD  1 
ATOM 9274  N N   . LYS B 1 51   ? 87.578  27.336  -11.176 1.00 31.17  ? 51   LYS B N   1 
ATOM 9275  C CA  . LYS B 1 51   ? 86.151  27.712  -11.143 1.00 35.78  ? 51   LYS B CA  1 
ATOM 9276  C C   . LYS B 1 51   ? 85.162  26.785  -11.894 1.00 42.68  ? 51   LYS B C   1 
ATOM 9277  O O   . LYS B 1 51   ? 84.132  26.385  -11.325 1.00 29.95  ? 51   LYS B O   1 
ATOM 9278  C CB  . LYS B 1 51   ? 86.002  29.153  -11.649 1.00 19.86  ? 51   LYS B CB  1 
ATOM 9279  C CG  . LYS B 1 51   ? 85.771  30.143  -10.536 1.00 13.44  ? 51   LYS B CG  1 
ATOM 9280  C CD  . LYS B 1 51   ? 85.925  31.552  -10.998 1.00 9.05   ? 51   LYS B CD  1 
ATOM 9281  C CE  . LYS B 1 51   ? 86.189  32.404  -9.792  1.00 9.05   ? 51   LYS B CE  1 
ATOM 9282  N NZ  . LYS B 1 51   ? 85.361  31.966  -8.624  1.00 9.05   ? 51   LYS B NZ  1 
ATOM 9283  N N   . LYS B 1 52   ? 85.432  26.444  -13.170 1.00 47.30  ? 52   LYS B N   1 
ATOM 9284  C CA  . LYS B 1 52   ? 84.609  25.496  -13.942 1.00 35.11  ? 52   LYS B CA  1 
ATOM 9285  C C   . LYS B 1 52   ? 85.422  24.226  -14.197 1.00 45.22  ? 52   LYS B C   1 
ATOM 9286  O O   . LYS B 1 52   ? 86.459  24.268  -14.872 1.00 49.31  ? 52   LYS B O   1 
ATOM 9287  C CB  . LYS B 1 52   ? 84.149  26.116  -15.259 1.00 32.43  ? 52   LYS B CB  1 
ATOM 9288  N N   . PHE B 1 53   ? 84.937  23.090  -13.672 1.00 42.47  ? 53   PHE B N   1 
ATOM 9289  C CA  . PHE B 1 53   ? 85.763  21.877  -13.626 1.00 42.07  ? 53   PHE B CA  1 
ATOM 9290  C C   . PHE B 1 53   ? 85.612  21.067  -14.915 1.00 50.73  ? 53   PHE B C   1 
ATOM 9291  O O   . PHE B 1 53   ? 86.603  20.538  -15.448 1.00 56.55  ? 53   PHE B O   1 
ATOM 9292  C CB  . PHE B 1 53   ? 85.387  21.053  -12.370 1.00 28.44  ? 53   PHE B CB  1 
ATOM 9293  C CG  . PHE B 1 53   ? 86.561  20.319  -11.677 1.00 14.79  ? 53   PHE B CG  1 
ATOM 9294  C CD1 . PHE B 1 53   ? 87.841  20.323  -12.210 1.00 16.50  ? 53   PHE B CD1 1 
ATOM 9295  C CD2 . PHE B 1 53   ? 86.350  19.609  -10.488 1.00 12.79  ? 53   PHE B CD2 1 
ATOM 9296  C CE1 . PHE B 1 53   ? 88.879  19.646  -11.583 1.00 12.09  ? 53   PHE B CE1 1 
ATOM 9297  C CE2 . PHE B 1 53   ? 87.389  18.932  -9.861  1.00 10.51  ? 53   PHE B CE2 1 
ATOM 9298  C CZ  . PHE B 1 53   ? 88.651  18.951  -10.416 1.00 12.38  ? 53   PHE B CZ  1 
ATOM 9299  N N   . ARG B 1 54   ? 84.390  21.047  -15.472 1.00 48.40  ? 54   ARG B N   1 
ATOM 9300  C CA  . ARG B 1 54   ? 84.035  20.167  -16.584 1.00 39.51  ? 54   ARG B CA  1 
ATOM 9301  C C   . ARG B 1 54   ? 84.941  20.311  -17.785 1.00 34.10  ? 54   ARG B C   1 
ATOM 9302  O O   . ARG B 1 54   ? 84.880  19.469  -18.690 1.00 22.96  ? 54   ARG B O   1 
ATOM 9303  C CB  . ARG B 1 54   ? 82.626  20.438  -17.071 1.00 28.90  ? 54   ARG B CB  1 
ATOM 9304  C CG  . ARG B 1 54   ? 81.694  20.743  -15.996 1.00 28.30  ? 54   ARG B CG  1 
ATOM 9305  C CD  . ARG B 1 54   ? 81.806  22.171  -15.522 1.00 32.56  ? 54   ARG B CD  1 
ATOM 9306  N NE  . ARG B 1 54   ? 81.839  23.122  -16.630 1.00 41.35  ? 54   ARG B NE  1 
ATOM 9307  C CZ  . ARG B 1 54   ? 82.948  23.656  -17.133 1.00 42.10  ? 54   ARG B CZ  1 
ATOM 9308  N NH1 . ARG B 1 54   ? 84.118  23.346  -16.627 1.00 42.87  ? 54   ARG B NH1 1 
ATOM 9309  N NH2 . ARG B 1 54   ? 82.896  24.513  -18.141 1.00 42.98  ? 54   ARG B NH2 1 
ATOM 9310  N N   . ASP B 1 55   ? 85.712  21.394  -17.866 1.00 38.98  ? 55   ASP B N   1 
ATOM 9311  C CA  . ASP B 1 55   ? 86.635  21.451  -18.981 1.00 31.72  ? 55   ASP B CA  1 
ATOM 9312  C C   . ASP B 1 55   ? 87.753  20.444  -18.776 1.00 37.22  ? 55   ASP B C   1 
ATOM 9313  O O   . ASP B 1 55   ? 87.857  19.458  -19.511 1.00 37.09  ? 55   ASP B O   1 
ATOM 9314  C CB  . ASP B 1 55   ? 87.225  22.848  -19.216 1.00 31.72  ? 55   ASP B CB  1 
ATOM 9315  C CG  . ASP B 1 55   ? 87.044  23.782  -18.075 1.00 29.27  ? 55   ASP B CG  1 
ATOM 9316  O OD1 . ASP B 1 55   ? 85.881  24.148  -17.836 1.00 28.64  ? 55   ASP B OD1 1 
ATOM 9317  O OD2 . ASP B 1 55   ? 88.072  24.216  -17.491 1.00 27.87  ? 55   ASP B OD2 1 
ATOM 9318  N N   . CYS B 1 56   ? 88.547  20.657  -17.737 1.00 47.47  ? 56   CYS B N   1 
ATOM 9319  C CA  . CYS B 1 56   ? 89.791  19.955  -17.538 1.00 45.80  ? 56   CYS B CA  1 
ATOM 9320  C C   . CYS B 1 56   ? 89.582  18.582  -16.872 1.00 40.10  ? 56   CYS B C   1 
ATOM 9321  O O   . CYS B 1 56   ? 90.494  18.057  -16.220 1.00 27.42  ? 56   CYS B O   1 
ATOM 9322  C CB  . CYS B 1 56   ? 90.753  20.889  -16.781 1.00 33.06  ? 56   CYS B CB  1 
ATOM 9323  S SG  . CYS B 1 56   ? 91.002  22.562  -17.645 1.00 8.96   ? 56   CYS B SG  1 
ATOM 9324  N N   . LEU B 1 57   ? 88.416  17.967  -17.075 1.00 41.89  ? 57   LEU B N   1 
ATOM 9325  C CA  . LEU B 1 57   ? 88.179  16.628  -16.548 1.00 41.15  ? 57   LEU B CA  1 
ATOM 9326  C C   . LEU B 1 57   ? 88.865  15.609  -17.447 1.00 37.06  ? 57   LEU B C   1 
ATOM 9327  O O   . LEU B 1 57   ? 88.815  15.707  -18.675 1.00 31.80  ? 57   LEU B O   1 
ATOM 9328  C CB  . LEU B 1 57   ? 86.676  16.340  -16.429 1.00 61.51  ? 57   LEU B CB  1 
ATOM 9329  C CG  . LEU B 1 57   ? 86.209  15.038  -15.741 1.00 61.23  ? 57   LEU B CG  1 
ATOM 9330  C CD1 . LEU B 1 57   ? 84.710  15.054  -15.293 1.00 52.51  ? 57   LEU B CD1 1 
ATOM 9331  C CD2 . LEU B 1 57   ? 86.488  13.856  -16.662 1.00 51.98  ? 57   LEU B CD2 1 
ATOM 9332  N N   . PHE B 1 58   ? 89.547  14.654  -16.824 1.00 33.77  ? 58   PHE B N   1 
ATOM 9333  C CA  . PHE B 1 58   ? 90.230  13.583  -17.522 1.00 32.55  ? 58   PHE B CA  1 
ATOM 9334  C C   . PHE B 1 58   ? 89.773  12.256  -16.954 1.00 36.93  ? 58   PHE B C   1 
ATOM 9335  O O   . PHE B 1 58   ? 89.296  12.171  -15.822 1.00 47.86  ? 58   PHE B O   1 
ATOM 9336  C CB  . PHE B 1 58   ? 91.742  13.652  -17.359 1.00 39.33  ? 58   PHE B CB  1 
ATOM 9337  C CG  . PHE B 1 58   ? 92.423  14.607  -18.283 1.00 47.56  ? 58   PHE B CG  1 
ATOM 9338  C CD1 . PHE B 1 58   ? 91.729  15.638  -18.876 1.00 42.98  ? 58   PHE B CD1 1 
ATOM 9339  C CD2 . PHE B 1 58   ? 93.783  14.475  -18.550 1.00 55.16  ? 58   PHE B CD2 1 
ATOM 9340  C CE1 . PHE B 1 58   ? 92.379  16.516  -19.721 1.00 43.92  ? 58   PHE B CE1 1 
ATOM 9341  C CE2 . PHE B 1 58   ? 94.436  15.367  -19.393 1.00 43.67  ? 58   PHE B CE2 1 
ATOM 9342  C CZ  . PHE B 1 58   ? 93.725  16.386  -19.981 1.00 38.01  ? 58   PHE B CZ  1 
ATOM 9343  N N   . LYS B 1 59   ? 89.959  11.212  -17.741 1.00 29.16  ? 59   LYS B N   1 
ATOM 9344  C CA  . LYS B 1 59   ? 89.833  9.868   -17.228 1.00 28.18  ? 59   LYS B CA  1 
ATOM 9345  C C   . LYS B 1 59   ? 91.074  9.102   -17.645 1.00 26.38  ? 59   LYS B C   1 
ATOM 9346  O O   . LYS B 1 59   ? 91.882  9.601   -18.423 1.00 27.45  ? 59   LYS B O   1 
ATOM 9347  C CB  . LYS B 1 59   ? 88.508  9.229   -17.698 1.00 28.97  ? 59   LYS B CB  1 
ATOM 9348  C CG  . LYS B 1 59   ? 88.348  8.735   -19.114 1.00 27.26  ? 59   LYS B CG  1 
ATOM 9349  C CD  . LYS B 1 59   ? 87.004  8.282   -19.298 1.00 27.05  ? 59   LYS B CD  1 
ATOM 9350  C CE  . LYS B 1 59   ? 87.018  7.099   -20.303 1.00 35.55  ? 59   LYS B CE  1 
ATOM 9351  N NZ  . LYS B 1 59   ? 86.549  7.573   -21.606 1.00 23.84  ? 59   LYS B NZ  1 
ATOM 9352  N N   . LEU B 1 60   ? 91.274  7.923   -17.069 1.00 25.88  ? 60   LEU B N   1 
ATOM 9353  C CA  . LEU B 1 60   ? 92.222  7.010   -17.687 1.00 29.82  ? 60   LEU B CA  1 
ATOM 9354  C C   . LEU B 1 60   ? 91.589  6.343   -18.892 1.00 35.51  ? 60   LEU B C   1 
ATOM 9355  O O   . LEU B 1 60   ? 90.377  6.124   -18.953 1.00 34.39  ? 60   LEU B O   1 
ATOM 9356  C CB  . LEU B 1 60   ? 92.739  5.929   -16.745 1.00 27.87  ? 60   LEU B CB  1 
ATOM 9357  C CG  . LEU B 1 60   ? 91.836  5.313   -15.736 1.00 27.46  ? 60   LEU B CG  1 
ATOM 9358  C CD1 . LEU B 1 60   ? 92.254  5.895   -14.426 1.00 32.06  ? 60   LEU B CD1 1 
ATOM 9359  C CD2 . LEU B 1 60   ? 90.486  5.673   -16.172 1.00 24.15  ? 60   LEU B CD2 1 
ATOM 9360  N N   . CYS B 1 61   ? 92.462  5.956   -19.818 1.00 40.56  ? 61   CYS B N   1 
ATOM 9361  C CA  . CYS B 1 61   ? 92.197  5.746   -21.231 1.00 46.47  ? 61   CYS B CA  1 
ATOM 9362  C C   . CYS B 1 61   ? 93.271  4.855   -21.822 1.00 34.16  ? 61   CYS B C   1 
ATOM 9363  O O   . CYS B 1 61   ? 94.444  5.039   -21.508 1.00 31.07  ? 61   CYS B O   1 
ATOM 9364  C CB  . CYS B 1 61   ? 92.209  7.078   -21.983 1.00 45.89  ? 61   CYS B CB  1 
ATOM 9365  S SG  . CYS B 1 61   ? 91.938  8.550   -20.979 1.00 84.54  ? 61   CYS B SG  1 
ATOM 9366  N N   . PRO B 1 62   ? 92.922  3.938   -22.724 1.00 40.24  ? 62   PRO B N   1 
ATOM 9367  C CA  . PRO B 1 62   ? 93.925  3.100   -23.395 1.00 51.43  ? 62   PRO B CA  1 
ATOM 9368  C C   . PRO B 1 62   ? 94.661  3.831   -24.528 1.00 53.39  ? 62   PRO B C   1 
ATOM 9369  O O   . PRO B 1 62   ? 94.567  5.043   -24.703 1.00 53.34  ? 62   PRO B O   1 
ATOM 9370  C CB  . PRO B 1 62   ? 93.089  1.907   -23.907 1.00 40.43  ? 62   PRO B CB  1 
ATOM 9371  C CG  . PRO B 1 62   ? 91.863  1.916   -23.058 1.00 34.80  ? 62   PRO B CG  1 
ATOM 9372  C CD  . PRO B 1 62   ? 91.580  3.347   -22.786 1.00 39.73  ? 62   PRO B CD  1 
ATOM 9373  N N   . MET B 1 63   ? 95.447  3.060   -25.276 1.00 47.48  ? 63   MET B N   1 
ATOM 9374  C CA  . MET B 1 63   ? 96.437  3.580   -26.218 1.00 40.62  ? 63   MET B CA  1 
ATOM 9375  C C   . MET B 1 63   ? 96.045  3.337   -27.671 1.00 23.67  ? 63   MET B C   1 
ATOM 9376  O O   . MET B 1 63   ? 95.511  2.285   -28.017 1.00 25.48  ? 63   MET B O   1 
ATOM 9377  C CB  . MET B 1 63   ? 97.794  2.935   -26.000 1.00 31.92  ? 63   MET B CB  1 
ATOM 9378  C CG  . MET B 1 63   ? 98.810  3.611   -27.076 1.00 22.58  ? 63   MET B CG  1 
ATOM 9379  S SD  . MET B 1 63   ? 98.597  3.338   -28.893 1.00 12.91  ? 63   MET B SD  1 
ATOM 9380  C CE  . MET B 1 63   ? 99.284  4.768   -29.638 1.00 18.40  ? 63   MET B CE  1 
ATOM 9381  N N   . ASN B 1 64   ? 96.400  4.270   -28.549 1.00 15.46  ? 64   ASN B N   1 
ATOM 9382  C CA  . ASN B 1 64   ? 95.805  4.283   -29.888 1.00 17.40  ? 64   ASN B CA  1 
ATOM 9383  C C   . ASN B 1 64   ? 96.878  4.483   -30.952 1.00 19.23  ? 64   ASN B C   1 
ATOM 9384  O O   . ASN B 1 64   ? 97.322  5.631   -31.165 1.00 19.42  ? 64   ASN B O   1 
ATOM 9385  C CB  . ASN B 1 64   ? 94.760  5.365   -29.949 1.00 13.94  ? 64   ASN B CB  1 
ATOM 9386  C CG  . ASN B 1 64   ? 93.812  5.166   -31.086 1.00 15.94  ? 64   ASN B CG  1 
ATOM 9387  O OD1 . ASN B 1 64   ? 94.127  4.466   -32.043 1.00 24.00  ? 64   ASN B OD1 1 
ATOM 9388  N ND2 . ASN B 1 64   ? 92.653  5.797   -31.014 1.00 13.25  ? 64   ASN B ND2 1 
ATOM 9389  N N   . ARG B 1 65   ? 97.318  3.376   -31.578 1.00 24.15  ? 65   ARG B N   1 
ATOM 9390  C CA  . ARG B 1 65   ? 98.419  3.388   -32.546 1.00 31.62  ? 65   ARG B CA  1 
ATOM 9391  C C   . ARG B 1 65   ? 97.899  3.315   -33.978 1.00 37.96  ? 65   ARG B C   1 
ATOM 9392  O O   . ARG B 1 65   ? 97.349  2.289   -34.386 1.00 32.12  ? 65   ARG B O   1 
ATOM 9393  C CB  . ARG B 1 65   ? 99.360  2.217   -32.255 1.00 25.22  ? 65   ARG B CB  1 
ATOM 9394  C CG  . ARG B 1 65   ? 98.963  0.811   -32.807 1.00 16.35  ? 65   ARG B CG  1 
ATOM 9395  C CD  . ARG B 1 65   ? 97.679  0.258   -32.253 1.00 8.79   ? 65   ARG B CD  1 
ATOM 9396  N NE  . ARG B 1 65   ? 96.539  0.652   -33.063 1.00 10.67  ? 65   ARG B NE  1 
ATOM 9397  C CZ  . ARG B 1 65   ? 95.307  0.383   -32.697 1.00 10.23  ? 65   ARG B CZ  1 
ATOM 9398  N NH1 . ARG B 1 65   ? 95.148  -0.259  -31.561 1.00 13.47  ? 65   ARG B NH1 1 
ATOM 9399  N NH2 . ARG B 1 65   ? 94.260  0.753   -33.423 1.00 15.34  ? 65   ARG B NH2 1 
ATOM 9400  N N   . TYR B 1 66   ? 98.143  4.376   -34.770 1.00 43.99  ? 66   TYR B N   1 
ATOM 9401  C CA  . TYR B 1 66   ? 97.604  4.529   -36.135 1.00 34.57  ? 66   TYR B CA  1 
ATOM 9402  C C   . TYR B 1 66   ? 98.741  4.741   -37.137 1.00 27.68  ? 66   TYR B C   1 
ATOM 9403  O O   . TYR B 1 66   ? 98.886  5.852   -37.657 1.00 22.27  ? 66   TYR B O   1 
ATOM 9404  C CB  . TYR B 1 66   ? 96.651  5.733   -36.252 1.00 28.14  ? 66   TYR B CB  1 
ATOM 9405  C CG  . TYR B 1 66   ? 95.382  5.818   -35.417 1.00 29.35  ? 66   TYR B CG  1 
ATOM 9406  C CD1 . TYR B 1 66   ? 94.280  5.052   -35.734 1.00 30.01  ? 66   TYR B CD1 1 
ATOM 9407  C CD2 . TYR B 1 66   ? 95.251  6.768   -34.391 1.00 27.57  ? 66   TYR B CD2 1 
ATOM 9408  C CE1 . TYR B 1 66   ? 93.151  5.148   -35.031 1.00 26.90  ? 66   TYR B CE1 1 
ATOM 9409  C CE2 . TYR B 1 66   ? 94.091  6.868   -33.671 1.00 22.28  ? 66   TYR B CE2 1 
ATOM 9410  C CZ  . TYR B 1 66   ? 93.035  6.043   -34.015 1.00 24.17  ? 66   TYR B CZ  1 
ATOM 9411  O OH  . TYR B 1 66   ? 91.823  6.035   -33.371 1.00 24.54  ? 66   TYR B OH  1 
ATOM 9412  N N   . SER B 1 67   ? 99.530  3.699   -37.410 1.00 30.79  ? 67   SER B N   1 
ATOM 9413  C CA  . SER B 1 67   ? 100.441 3.751   -38.553 1.00 22.97  ? 67   SER B CA  1 
ATOM 9414  C C   . SER B 1 67   ? 99.680  4.155   -39.810 1.00 31.19  ? 67   SER B C   1 
ATOM 9415  O O   . SER B 1 67   ? 100.147 4.994   -40.597 1.00 34.70  ? 67   SER B O   1 
ATOM 9416  C CB  . SER B 1 67   ? 101.127 2.388   -38.742 1.00 20.79  ? 67   SER B CB  1 
ATOM 9417  O OG  . SER B 1 67   ? 101.942 2.347   -39.904 1.00 15.70  ? 67   SER B OG  1 
ATOM 9418  N N   . ALA B 1 68   ? 98.470  3.600   -39.973 1.00 39.39  ? 68   ALA B N   1 
ATOM 9419  C CA  . ALA B 1 68   ? 97.652  3.807   -41.166 1.00 42.40  ? 68   ALA B CA  1 
ATOM 9420  C C   . ALA B 1 68   ? 97.187  5.252   -41.332 1.00 32.30  ? 68   ALA B C   1 
ATOM 9421  O O   . ALA B 1 68   ? 96.828  5.652   -42.443 1.00 29.94  ? 68   ALA B O   1 
ATOM 9422  C CB  . ALA B 1 68   ? 96.435  2.878   -41.137 1.00 43.82  ? 68   ALA B CB  1 
ATOM 9423  N N   . GLN B 1 69   ? 97.134  6.046   -40.265 1.00 26.59  ? 69   GLN B N   1 
ATOM 9424  C CA  . GLN B 1 69   ? 96.811  7.449   -40.500 1.00 25.03  ? 69   GLN B CA  1 
ATOM 9425  C C   . GLN B 1 69   ? 98.026  8.282   -40.904 1.00 28.66  ? 69   GLN B C   1 
ATOM 9426  O O   . GLN B 1 69   ? 97.867  9.268   -41.625 1.00 32.53  ? 69   GLN B O   1 
ATOM 9427  C CB  . GLN B 1 69   ? 96.191  8.083   -39.278 1.00 21.28  ? 69   GLN B CB  1 
ATOM 9428  C CG  . GLN B 1 69   ? 97.078  7.966   -38.109 1.00 23.26  ? 69   GLN B CG  1 
ATOM 9429  C CD  . GLN B 1 69   ? 96.490  8.645   -36.905 1.00 24.09  ? 69   GLN B CD  1 
ATOM 9430  O OE1 . GLN B 1 69   ? 95.289  8.558   -36.646 1.00 21.52  ? 69   GLN B OE1 1 
ATOM 9431  N NE2 . GLN B 1 69   ? 97.325  9.358   -36.176 1.00 27.32  ? 69   GLN B NE2 1 
ATOM 9432  N N   . LYS B 1 70   ? 99.227  7.969   -40.411 1.00 26.68  ? 70   LYS B N   1 
ATOM 9433  C CA  . LYS B 1 70   ? 100.413 8.550   -41.034 1.00 22.85  ? 70   LYS B CA  1 
ATOM 9434  C C   . LYS B 1 70   ? 100.401 8.253   -42.521 1.00 23.36  ? 70   LYS B C   1 
ATOM 9435  O O   . LYS B 1 70   ? 100.540 9.154   -43.351 1.00 18.13  ? 70   LYS B O   1 
ATOM 9436  C CB  . LYS B 1 70   ? 101.695 8.017   -40.391 1.00 19.73  ? 70   LYS B CB  1 
ATOM 9437  N N   . GLN B 1 71   ? 100.196 6.987   -42.868 1.00 32.88  ? 71   GLN B N   1 
ATOM 9438  C CA  . GLN B 1 71   ? 100.145 6.626   -44.275 1.00 36.08  ? 71   GLN B CA  1 
ATOM 9439  C C   . GLN B 1 71   ? 99.012  7.394   -44.980 1.00 35.04  ? 71   GLN B C   1 
ATOM 9440  O O   . GLN B 1 71   ? 99.283  8.270   -45.802 1.00 33.47  ? 71   GLN B O   1 
ATOM 9441  C CB  . GLN B 1 71   ? 99.973  5.115   -44.429 1.00 49.36  ? 71   GLN B CB  1 
ATOM 9442  C CG  . GLN B 1 71   ? 100.501 4.233   -43.253 1.00 42.26  ? 71   GLN B CG  1 
ATOM 9443  C CD  . GLN B 1 71   ? 101.986 4.386   -42.890 1.00 35.36  ? 71   GLN B CD  1 
ATOM 9444  O OE1 . GLN B 1 71   ? 102.476 3.711   -41.970 1.00 22.94  ? 71   GLN B OE1 1 
ATOM 9445  N NE2 . GLN B 1 71   ? 102.701 5.254   -43.604 1.00 29.16  ? 71   GLN B NE2 1 
ATOM 9446  N N   . PHE B 1 72   ? 97.749  7.099   -44.642 1.00 32.17  ? 72   PHE B N   1 
ATOM 9447  C CA  . PHE B 1 72   ? 96.643  7.714   -45.331 1.00 29.60  ? 72   PHE B CA  1 
ATOM 9448  C C   . PHE B 1 72   ? 96.812  9.223   -45.377 1.00 30.34  ? 72   PHE B C   1 
ATOM 9449  O O   . PHE B 1 72   ? 96.408  9.887   -46.349 1.00 28.87  ? 72   PHE B O   1 
ATOM 9450  C CB  . PHE B 1 72   ? 95.293  7.421   -44.686 1.00 23.72  ? 72   PHE B CB  1 
ATOM 9451  C CG  . PHE B 1 72   ? 94.187  8.210   -45.286 1.00 25.50  ? 72   PHE B CG  1 
ATOM 9452  C CD1 . PHE B 1 72   ? 94.133  8.338   -46.660 1.00 25.00  ? 72   PHE B CD1 1 
ATOM 9453  C CD2 . PHE B 1 72   ? 93.242  8.850   -44.527 1.00 28.32  ? 72   PHE B CD2 1 
ATOM 9454  C CE1 . PHE B 1 72   ? 93.145  9.069   -47.283 1.00 23.37  ? 72   PHE B CE1 1 
ATOM 9455  C CE2 . PHE B 1 72   ? 92.237  9.592   -45.135 1.00 36.69  ? 72   PHE B CE2 1 
ATOM 9456  C CZ  . PHE B 1 72   ? 92.188  9.699   -46.530 1.00 31.02  ? 72   PHE B CZ  1 
ATOM 9457  N N   . TRP B 1 73   ? 97.363  9.770   -44.305 1.00 35.96  ? 73   TRP B N   1 
ATOM 9458  C CA  . TRP B 1 73   ? 97.744  11.168  -44.187 1.00 50.57  ? 73   TRP B CA  1 
ATOM 9459  C C   . TRP B 1 73   ? 98.847  11.527  -45.157 1.00 51.70  ? 73   TRP B C   1 
ATOM 9460  O O   . TRP B 1 73   ? 99.083  12.718  -45.391 1.00 69.89  ? 73   TRP B O   1 
ATOM 9461  C CB  . TRP B 1 73   ? 98.193  11.468  -42.748 1.00 37.60  ? 73   TRP B CB  1 
ATOM 9462  N N   . LYS B 1 74   ? 99.532  10.527  -45.721 1.00 37.31  ? 74   LYS B N   1 
ATOM 9463  C CA  . LYS B 1 74   ? 100.604 10.803  -46.673 1.00 30.15  ? 74   LYS B CA  1 
ATOM 9464  C C   . LYS B 1 74   ? 100.077 10.986  -48.108 1.00 25.42  ? 74   LYS B C   1 
ATOM 9465  O O   . LYS B 1 74   ? 100.461 11.936  -48.799 1.00 38.00  ? 74   LYS B O   1 
ATOM 9466  C CB  . LYS B 1 74   ? 101.658 9.697   -46.570 1.00 20.00  ? 74   LYS B CB  1 
ATOM 9467  C CG  . LYS B 1 74   ? 102.246 9.594   -45.150 1.00 14.77  ? 74   LYS B CG  1 
ATOM 9468  C CD  . LYS B 1 74   ? 103.052 8.346   -44.998 1.00 8.99   ? 74   LYS B CD  1 
ATOM 9469  C CE  . LYS B 1 74   ? 104.040 8.300   -46.132 1.00 8.67   ? 74   LYS B CE  1 
ATOM 9470  N NZ  . LYS B 1 74   ? 104.687 6.982   -46.228 1.00 8.67   ? 74   LYS B NZ  1 
ATOM 9471  N N   . ALA B 1 75   ? 99.181  10.123  -48.574 1.00 15.20  ? 75   ALA B N   1 
ATOM 9472  C CA  . ALA B 1 75   ? 98.702  10.249  -49.948 1.00 8.74   ? 75   ALA B CA  1 
ATOM 9473  C C   . ALA B 1 75   ? 97.824  11.485  -50.110 1.00 9.46   ? 75   ALA B C   1 
ATOM 9474  O O   . ALA B 1 75   ? 96.929  11.723  -49.304 1.00 9.52   ? 75   ALA B O   1 
ATOM 9475  C CB  . ALA B 1 75   ? 97.926  9.004   -50.342 1.00 11.54  ? 75   ALA B CB  1 
ATOM 9476  N N   . ALA B 1 76   ? 98.083  12.275  -51.151 1.00 10.82  ? 76   ALA B N   1 
ATOM 9477  C CA  . ALA B 1 76   ? 97.265  13.460  -51.485 1.00 15.99  ? 76   ALA B CA  1 
ATOM 9478  C C   . ALA B 1 76   ? 97.475  14.663  -50.541 1.00 27.67  ? 76   ALA B C   1 
ATOM 9479  O O   . ALA B 1 76   ? 97.469  15.837  -50.958 1.00 25.49  ? 76   ALA B O   1 
ATOM 9480  C CB  . ALA B 1 76   ? 95.785  13.080  -51.518 1.00 8.85   ? 76   ALA B CB  1 
ATOM 9481  N N   . ASP B 1 85   ? 98.594  6.182   -56.384 1.00 43.00  ? 85   ASP B N   1 
ATOM 9482  C CA  . ASP B 1 85   ? 98.612  7.640   -56.311 1.00 37.90  ? 85   ASP B CA  1 
ATOM 9483  C C   . ASP B 1 85   ? 97.205  8.176   -56.058 1.00 33.73  ? 85   ASP B C   1 
ATOM 9484  O O   . ASP B 1 85   ? 96.848  8.477   -54.923 1.00 33.18  ? 85   ASP B O   1 
ATOM 9485  C CB  . ASP B 1 85   ? 99.194  8.239   -57.597 1.00 40.72  ? 85   ASP B CB  1 
ATOM 9486  N N   . ALA B 1 86   ? 96.414  8.290   -57.128 1.00 47.53  ? 86   ALA B N   1 
ATOM 9487  C CA  . ALA B 1 86   ? 95.023  8.720   -57.001 1.00 49.32  ? 86   ALA B CA  1 
ATOM 9488  C C   . ALA B 1 86   ? 94.196  7.698   -56.223 1.00 30.96  ? 86   ALA B C   1 
ATOM 9489  O O   . ALA B 1 86   ? 93.478  8.039   -55.274 1.00 27.25  ? 86   ALA B O   1 
ATOM 9490  C CB  . ALA B 1 86   ? 94.427  8.948   -58.393 1.00 61.38  ? 86   ALA B CB  1 
ATOM 9491  N N   . VAL B 1 87   ? 94.264  6.438   -56.637 1.00 30.18  ? 87   VAL B N   1 
ATOM 9492  C CA  . VAL B 1 87   ? 93.629  5.369   -55.890 1.00 27.71  ? 87   VAL B CA  1 
ATOM 9493  C C   . VAL B 1 87   ? 94.303  5.194   -54.533 1.00 24.61  ? 87   VAL B C   1 
ATOM 9494  O O   . VAL B 1 87   ? 93.661  4.811   -53.537 1.00 24.24  ? 87   VAL B O   1 
ATOM 9495  C CB  . VAL B 1 87   ? 93.699  4.096   -56.747 1.00 40.26  ? 87   VAL B CB  1 
ATOM 9496  C CG1 . VAL B 1 87   ? 93.120  2.923   -56.004 1.00 67.26  ? 87   VAL B CG1 1 
ATOM 9497  C CG2 . VAL B 1 87   ? 93.016  4.322   -58.114 1.00 35.09  ? 87   VAL B CG2 1 
ATOM 9498  N N   . LEU B 1 88   ? 95.605  5.481   -54.475 1.00 21.76  ? 88   LEU B N   1 
ATOM 9499  C CA  . LEU B 1 88   ? 96.357  5.262   -53.253 1.00 23.21  ? 88   LEU B CA  1 
ATOM 9500  C C   . LEU B 1 88   ? 95.701  5.969   -52.082 1.00 31.87  ? 88   LEU B C   1 
ATOM 9501  O O   . LEU B 1 88   ? 95.631  5.411   -50.986 1.00 44.49  ? 88   LEU B O   1 
ATOM 9502  C CB  . LEU B 1 88   ? 97.801  5.730   -53.425 1.00 24.85  ? 88   LEU B CB  1 
ATOM 9503  C CG  . LEU B 1 88   ? 98.666  5.767   -52.161 1.00 24.76  ? 88   LEU B CG  1 
ATOM 9504  C CD1 . LEU B 1 88   ? 98.914  4.370   -51.595 1.00 21.83  ? 88   LEU B CD1 1 
ATOM 9505  C CD2 . LEU B 1 88   ? 99.981  6.491   -52.424 1.00 26.27  ? 88   LEU B CD2 1 
ATOM 9506  N N   . LEU B 1 89   ? 95.187  7.189   -52.300 1.00 31.44  ? 89   LEU B N   1 
ATOM 9507  C CA  . LEU B 1 89   ? 94.589  7.949   -51.201 1.00 33.47  ? 89   LEU B CA  1 
ATOM 9508  C C   . LEU B 1 89   ? 93.361  7.249   -50.631 1.00 39.71  ? 89   LEU B C   1 
ATOM 9509  O O   . LEU B 1 89   ? 93.060  7.386   -49.435 1.00 44.02  ? 89   LEU B O   1 
ATOM 9510  C CB  . LEU B 1 89   ? 94.210  9.361   -51.655 1.00 22.10  ? 89   LEU B CB  1 
ATOM 9511  C CG  . LEU B 1 89   ? 93.680  10.201  -50.498 1.00 12.10  ? 89   LEU B CG  1 
ATOM 9512  C CD1 . LEU B 1 89   ? 94.799  10.362  -49.521 1.00 9.97   ? 89   LEU B CD1 1 
ATOM 9513  C CD2 . LEU B 1 89   ? 93.205  11.537  -50.988 1.00 8.78   ? 89   LEU B CD2 1 
ATOM 9514  N N   . ASN B 1 90   ? 92.646  6.491   -51.462 1.00 37.25  ? 90   ASN B N   1 
ATOM 9515  C CA  . ASN B 1 90   ? 91.439  5.823   -50.991 1.00 41.59  ? 90   ASN B CA  1 
ATOM 9516  C C   . ASN B 1 90   ? 91.748  4.482   -50.309 1.00 39.67  ? 90   ASN B C   1 
ATOM 9517  O O   . ASN B 1 90   ? 91.261  4.212   -49.196 1.00 38.25  ? 90   ASN B O   1 
ATOM 9518  C CB  . ASN B 1 90   ? 90.466  5.665   -52.163 1.00 45.31  ? 90   ASN B CB  1 
ATOM 9519  C CG  . ASN B 1 90   ? 89.997  7.021   -52.721 1.00 28.80  ? 90   ASN B CG  1 
ATOM 9520  O OD1 . ASN B 1 90   ? 89.133  7.681   -52.137 1.00 23.54  ? 90   ASN B OD1 1 
ATOM 9521  N ND2 . ASN B 1 90   ? 90.576  7.437   -53.847 1.00 18.53  ? 90   ASN B ND2 1 
ATOM 9522  N N   . LYS B 1 91   ? 92.561  3.626   -50.938 1.00 33.21  ? 91   LYS B N   1 
ATOM 9523  C CA  . LYS B 1 91   ? 93.015  2.438   -50.211 1.00 32.39  ? 91   LYS B CA  1 
ATOM 9524  C C   . LYS B 1 91   ? 93.595  2.842   -48.849 1.00 52.30  ? 91   LYS B C   1 
ATOM 9525  O O   . LYS B 1 91   ? 93.289  2.232   -47.803 1.00 57.80  ? 91   LYS B O   1 
ATOM 9526  C CB  . LYS B 1 91   ? 94.048  1.676   -51.052 1.00 32.85  ? 91   LYS B CB  1 
ATOM 9527  C CG  . LYS B 1 91   ? 93.808  0.179   -51.204 1.00 26.15  ? 91   LYS B CG  1 
ATOM 9528  C CD  . LYS B 1 91   ? 95.052  -0.607  -50.764 1.00 30.33  ? 91   LYS B CD  1 
ATOM 9529  C CE  . LYS B 1 91   ? 94.856  -2.119  -50.878 1.00 31.82  ? 91   LYS B CE  1 
ATOM 9530  N NZ  . LYS B 1 91   ? 96.140  -2.893  -50.968 1.00 18.24  ? 91   LYS B NZ  1 
ATOM 9531  N N   . LEU B 1 92   ? 94.390  3.920   -48.840 1.00 59.71  ? 92   LEU B N   1 
ATOM 9532  C CA  . LEU B 1 92   ? 95.029  4.393   -47.612 1.00 59.00  ? 92   LEU B CA  1 
ATOM 9533  C C   . LEU B 1 92   ? 94.005  4.879   -46.597 1.00 53.18  ? 92   LEU B C   1 
ATOM 9534  O O   . LEU B 1 92   ? 94.199  4.726   -45.381 1.00 49.31  ? 92   LEU B O   1 
ATOM 9535  C CB  . LEU B 1 92   ? 95.994  5.514   -47.933 1.00 59.13  ? 92   LEU B CB  1 
ATOM 9536  C CG  . LEU B 1 92   ? 97.438  5.208   -47.746 1.00 54.98  ? 92   LEU B CG  1 
ATOM 9537  C CD1 . LEU B 1 92   ? 98.092  6.628   -48.004 1.00 47.15  ? 92   LEU B CD1 1 
ATOM 9538  C CD2 . LEU B 1 92   ? 97.740  4.614   -46.350 1.00 43.42  ? 92   LEU B CD2 1 
ATOM 9539  N N   . HIS B 1 93   ? 92.906  5.488   -47.078 1.00 59.20  ? 93   HIS B N   1 
ATOM 9540  C CA  . HIS B 1 93   ? 91.812  5.848   -46.184 1.00 57.03  ? 93   HIS B CA  1 
ATOM 9541  C C   . HIS B 1 93   ? 91.253  4.625   -45.472 1.00 60.21  ? 93   HIS B C   1 
ATOM 9542  O O   . HIS B 1 93   ? 90.959  4.682   -44.269 1.00 65.17  ? 93   HIS B O   1 
ATOM 9543  C CB  . HIS B 1 93   ? 90.677  6.534   -46.944 1.00 65.94  ? 93   HIS B CB  1 
ATOM 9544  C CG  . HIS B 1 93   ? 89.331  6.421   -46.274 1.00 78.95  ? 93   HIS B CG  1 
ATOM 9545  N ND1 . HIS B 1 93   ? 89.127  6.700   -44.937 1.00 69.28  ? 93   HIS B ND1 1 
ATOM 9546  C CD2 . HIS B 1 93   ? 88.118  6.073   -46.770 1.00 87.17  ? 93   HIS B CD2 1 
ATOM 9547  C CE1 . HIS B 1 93   ? 87.851  6.526   -44.637 1.00 59.07  ? 93   HIS B CE1 1 
ATOM 9548  N NE2 . HIS B 1 93   ? 87.217  6.147   -45.732 1.00 80.37  ? 93   HIS B NE2 1 
ATOM 9549  N N   . HIS B 1 94   ? 91.064  3.523   -46.204 1.00 60.03  ? 94   HIS B N   1 
ATOM 9550  C CA  . HIS B 1 94   ? 90.545  2.322   -45.566 1.00 55.52  ? 94   HIS B CA  1 
ATOM 9551  C C   . HIS B 1 94   ? 91.512  1.772   -44.504 1.00 60.34  ? 94   HIS B C   1 
ATOM 9552  O O   . HIS B 1 94   ? 91.069  1.318   -43.435 1.00 60.92  ? 94   HIS B O   1 
ATOM 9553  C CB  . HIS B 1 94   ? 90.205  1.264   -46.621 1.00 46.75  ? 94   HIS B CB  1 
ATOM 9554  C CG  . HIS B 1 94   ? 88.942  0.507   -46.332 1.00 50.74  ? 94   HIS B CG  1 
ATOM 9555  N ND1 . HIS B 1 94   ? 87.946  1.011   -45.523 1.00 48.46  ? 94   HIS B ND1 1 
ATOM 9556  C CD2 . HIS B 1 94   ? 88.518  -0.719  -46.728 1.00 47.91  ? 94   HIS B CD2 1 
ATOM 9557  C CE1 . HIS B 1 94   ? 86.959  0.135   -45.441 1.00 44.12  ? 94   HIS B CE1 1 
ATOM 9558  N NE2 . HIS B 1 94   ? 87.284  -0.927  -46.157 1.00 40.95  ? 94   HIS B NE2 1 
ATOM 9559  N N   . ALA B 1 95   ? 92.834  1.813   -44.750 1.00 61.68  ? 95   ALA B N   1 
ATOM 9560  C CA  . ALA B 1 95   ? 93.758  1.364   -43.697 1.00 48.83  ? 95   ALA B CA  1 
ATOM 9561  C C   . ALA B 1 95   ? 93.718  2.279   -42.468 1.00 41.46  ? 95   ALA B C   1 
ATOM 9562  O O   . ALA B 1 95   ? 93.665  1.792   -41.330 1.00 36.76  ? 95   ALA B O   1 
ATOM 9563  C CB  . ALA B 1 95   ? 95.191  1.249   -44.222 1.00 42.96  ? 95   ALA B CB  1 
ATOM 9564  N N   . ALA B 1 96   ? 93.777  3.602   -42.664 1.00 43.22  ? 96   ALA B N   1 
ATOM 9565  C CA  . ALA B 1 96   ? 93.677  4.512   -41.525 1.00 37.22  ? 96   ALA B CA  1 
ATOM 9566  C C   . ALA B 1 96   ? 92.330  4.353   -40.814 1.00 41.95  ? 96   ALA B C   1 
ATOM 9567  O O   . ALA B 1 96   ? 92.259  3.734   -39.735 1.00 35.02  ? 96   ALA B O   1 
ATOM 9568  C CB  . ALA B 1 96   ? 93.895  5.965   -41.966 1.00 30.92  ? 96   ALA B CB  1 
ATOM 9569  N N   . ASP B 1 97   ? 91.255  4.902   -41.409 1.00 55.26  ? 97   ASP B N   1 
ATOM 9570  C CA  . ASP B 1 97   ? 89.919  4.855   -40.805 1.00 55.29  ? 97   ASP B CA  1 
ATOM 9571  C C   . ASP B 1 97   ? 89.706  3.476   -40.164 1.00 56.20  ? 97   ASP B C   1 
ATOM 9572  O O   . ASP B 1 97   ? 89.348  3.399   -38.976 1.00 50.96  ? 97   ASP B O   1 
ATOM 9573  C CB  . ASP B 1 97   ? 88.818  5.213   -41.830 1.00 40.09  ? 97   ASP B CB  1 
ATOM 9574  N N   . LEU B 1 98   ? 90.015  2.381   -40.892 1.00 51.86  ? 98   LEU B N   1 
ATOM 9575  C CA  . LEU B 1 98   ? 89.936  1.052   -40.279 1.00 44.52  ? 98   LEU B CA  1 
ATOM 9576  C C   . LEU B 1 98   ? 90.800  0.971   -39.027 1.00 36.74  ? 98   LEU B C   1 
ATOM 9577  O O   . LEU B 1 98   ? 90.448  0.276   -38.067 1.00 42.85  ? 98   LEU B O   1 
ATOM 9578  C CB  . LEU B 1 98   ? 90.336  -0.052  -41.274 1.00 40.81  ? 98   LEU B CB  1 
ATOM 9579  C CG  . LEU B 1 98   ? 89.238  -1.060  -41.693 1.00 47.99  ? 98   LEU B CG  1 
ATOM 9580  C CD1 . LEU B 1 98   ? 88.456  -0.621  -42.925 1.00 45.50  ? 98   LEU B CD1 1 
ATOM 9581  C CD2 . LEU B 1 98   ? 89.777  -2.459  -41.920 1.00 54.24  ? 98   LEU B CD2 1 
ATOM 9582  N N   . GLU B 1 99   ? 91.924  1.677   -39.003 1.00 31.75  ? 99   GLU B N   1 
ATOM 9583  C CA  . GLU B 1 99   ? 92.740  1.640   -37.802 1.00 30.31  ? 99   GLU B CA  1 
ATOM 9584  C C   . GLU B 1 99   ? 92.007  2.269   -36.626 1.00 28.53  ? 99   GLU B C   1 
ATOM 9585  O O   . GLU B 1 99   ? 91.933  1.672   -35.542 1.00 25.47  ? 99   GLU B O   1 
ATOM 9586  C CB  . GLU B 1 99   ? 94.075  2.322   -38.057 1.00 38.79  ? 99   GLU B CB  1 
ATOM 9587  C CG  . GLU B 1 99   ? 95.208  1.559   -37.411 1.00 38.92  ? 99   GLU B CG  1 
ATOM 9588  C CD  . GLU B 1 99   ? 94.999  1.434   -35.914 1.00 28.47  ? 99   GLU B CD  1 
ATOM 9589  O OE1 . GLU B 1 99   ? 94.591  0.346   -35.426 1.00 17.42  ? 99   GLU B OE1 1 
ATOM 9590  O OE2 . GLU B 1 99   ? 95.197  2.456   -35.222 1.00 41.55  ? 99   GLU B OE2 1 
ATOM 9591  N N   . LYS B 1 100  ? 91.432  3.460   -36.828 1.00 25.99  ? 100  LYS B N   1 
ATOM 9592  C CA  . LYS B 1 100  ? 90.587  4.035   -35.782 1.00 25.45  ? 100  LYS B CA  1 
ATOM 9593  C C   . LYS B 1 100  ? 89.534  3.046   -35.302 1.00 27.31  ? 100  LYS B C   1 
ATOM 9594  O O   . LYS B 1 100  ? 89.230  2.989   -34.107 1.00 25.05  ? 100  LYS B O   1 
ATOM 9595  C CB  . LYS B 1 100  ? 89.903  5.307   -36.262 1.00 30.82  ? 100  LYS B CB  1 
ATOM 9596  C CG  . LYS B 1 100  ? 90.484  5.889   -37.506 1.00 41.29  ? 100  LYS B CG  1 
ATOM 9597  C CD  . LYS B 1 100  ? 91.841  6.535   -37.293 1.00 37.27  ? 100  LYS B CD  1 
ATOM 9598  C CE  . LYS B 1 100  ? 92.824  5.866   -38.247 1.00 32.01  ? 100  LYS B CE  1 
ATOM 9599  N NZ  . LYS B 1 100  ? 94.207  6.394   -38.380 1.00 23.99  ? 100  LYS B NZ  1 
ATOM 9600  N N   . LYS B 1 101  ? 88.929  2.291   -36.214 1.00 38.46  ? 101  LYS B N   1 
ATOM 9601  C CA  . LYS B 1 101  ? 87.957  1.304   -35.756 1.00 47.50  ? 101  LYS B CA  1 
ATOM 9602  C C   . LYS B 1 101  ? 88.617  0.299   -34.830 1.00 42.50  ? 101  LYS B C   1 
ATOM 9603  O O   . LYS B 1 101  ? 88.094  0.010   -33.740 1.00 30.49  ? 101  LYS B O   1 
ATOM 9604  C CB  . LYS B 1 101  ? 87.321  0.582   -36.944 1.00 81.46  ? 101  LYS B CB  1 
ATOM 9605  N N   . GLN B 1 102  ? 89.772  -0.262  -35.266 1.00 44.43  ? 102  GLN B N   1 
ATOM 9606  C CA  . GLN B 1 102  ? 90.490  -1.210  -34.412 1.00 26.25  ? 102  GLN B CA  1 
ATOM 9607  C C   . GLN B 1 102  ? 90.438  -0.518  -33.072 1.00 18.36  ? 102  GLN B C   1 
ATOM 9608  O O   . GLN B 1 102  ? 89.654  -0.911  -32.201 1.00 19.59  ? 102  GLN B O   1 
ATOM 9609  C CB  . GLN B 1 102  ? 91.928  -1.627  -34.897 1.00 17.53  ? 102  GLN B CB  1 
ATOM 9610  C CG  . GLN B 1 102  ? 92.109  -3.267  -35.071 1.00 8.68   ? 102  GLN B CG  1 
ATOM 9611  C CD  . GLN B 1 102  ? 92.130  -4.084  -33.844 1.00 9.22   ? 102  GLN B CD  1 
ATOM 9612  O OE1 . GLN B 1 102  ? 91.168  -4.813  -33.560 1.00 8.68   ? 102  GLN B OE1 1 
ATOM 9613  N NE2 . GLN B 1 102  ? 93.277  -4.102  -33.167 1.00 12.34  ? 102  GLN B NE2 1 
ATOM 9614  N N   . ASN B 1 103  ? 91.193  0.553   -32.892 1.00 17.53  ? 103  ASN B N   1 
ATOM 9615  C CA  . ASN B 1 103  ? 91.180  1.116   -31.545 1.00 18.78  ? 103  ASN B CA  1 
ATOM 9616  C C   . ASN B 1 103  ? 89.798  1.055   -30.922 1.00 17.24  ? 103  ASN B C   1 
ATOM 9617  O O   . ASN B 1 103  ? 89.664  0.589   -29.801 1.00 15.99  ? 103  ASN B O   1 
ATOM 9618  C CB  . ASN B 1 103  ? 91.685  2.538   -31.535 1.00 21.91  ? 103  ASN B CB  1 
ATOM 9619  C CG  . ASN B 1 103  ? 91.387  3.229   -32.758 1.00 22.84  ? 103  ASN B CG  1 
ATOM 9620  O OD1 . ASN B 1 103  ? 92.015  2.967   -33.759 1.00 23.55  ? 103  ASN B OD1 1 
ATOM 9621  N ND2 . ASN B 1 103  ? 90.370  4.072   -32.741 1.00 22.86  ? 103  ASN B ND2 1 
ATOM 9622  N N   . GLU B 1 104  ? 88.745  1.510   -31.605 1.00 19.34  ? 104  GLU B N   1 
ATOM 9623  C CA  . GLU B 1 104  ? 87.438  1.457   -30.945 1.00 19.67  ? 104  GLU B CA  1 
ATOM 9624  C C   . GLU B 1 104  ? 87.141  0.062   -30.407 1.00 14.09  ? 104  GLU B C   1 
ATOM 9625  O O   . GLU B 1 104  ? 86.716  -0.093  -29.262 1.00 17.91  ? 104  GLU B O   1 
ATOM 9626  C CB  . GLU B 1 104  ? 86.328  1.914   -31.895 1.00 30.22  ? 104  GLU B CB  1 
ATOM 9627  N N   . THR B 1 105  ? 87.396  -0.971  -31.189 1.00 14.41  ? 105  THR B N   1 
ATOM 9628  C CA  . THR B 1 105  ? 86.943  -2.279  -30.744 1.00 16.51  ? 105  THR B CA  1 
ATOM 9629  C C   . THR B 1 105  ? 88.038  -3.061  -30.000 1.00 32.55  ? 105  THR B C   1 
ATOM 9630  O O   . THR B 1 105  ? 87.704  -3.816  -29.088 1.00 48.95  ? 105  THR B O   1 
ATOM 9631  C CB  . THR B 1 105  ? 86.387  -3.054  -31.949 1.00 14.76  ? 105  THR B CB  1 
ATOM 9632  O OG1 . THR B 1 105  ? 85.530  -2.191  -32.708 1.00 8.73   ? 105  THR B OG1 1 
ATOM 9633  C CG2 . THR B 1 105  ? 85.588  -4.282  -31.526 1.00 14.03  ? 105  THR B CG2 1 
ATOM 9634  N N   . GLU B 1 106  ? 89.339  -2.849  -30.324 1.00 23.59  ? 106  GLU B N   1 
ATOM 9635  C CA  . GLU B 1 106  ? 90.532  -3.503  -29.748 1.00 19.50  ? 106  GLU B CA  1 
ATOM 9636  C C   . GLU B 1 106  ? 90.983  -2.838  -28.460 1.00 21.11  ? 106  GLU B C   1 
ATOM 9637  O O   . GLU B 1 106  ? 91.471  -3.500  -27.534 1.00 20.41  ? 106  GLU B O   1 
ATOM 9638  C CB  . GLU B 1 106  ? 91.699  -3.408  -30.725 1.00 14.37  ? 106  GLU B CB  1 
ATOM 9639  C CG  . GLU B 1 106  ? 91.972  -1.922  -31.017 1.00 14.11  ? 106  GLU B CG  1 
ATOM 9640  C CD  . GLU B 1 106  ? 93.103  -1.617  -31.966 1.00 12.87  ? 106  GLU B CD  1 
ATOM 9641  O OE1 . GLU B 1 106  ? 94.081  -2.370  -32.051 1.00 12.50  ? 106  GLU B OE1 1 
ATOM 9642  O OE2 . GLU B 1 106  ? 93.025  -0.572  -32.629 1.00 9.49   ? 106  GLU B OE2 1 
ATOM 9643  N N   . ASN B 1 107  ? 90.821  -1.530  -28.389 1.00 19.41  ? 107  ASN B N   1 
ATOM 9644  C CA  . ASN B 1 107  ? 90.966  -0.865  -27.116 1.00 21.83  ? 107  ASN B CA  1 
ATOM 9645  C C   . ASN B 1 107  ? 89.647  -0.847  -26.357 1.00 29.40  ? 107  ASN B C   1 
ATOM 9646  O O   . ASN B 1 107  ? 89.650  -0.725  -25.128 1.00 33.38  ? 107  ASN B O   1 
ATOM 9647  C CB  . ASN B 1 107  ? 91.468  0.541   -27.348 1.00 19.93  ? 107  ASN B CB  1 
ATOM 9648  C CG  . ASN B 1 107  ? 92.352  0.652   -28.576 1.00 21.97  ? 107  ASN B CG  1 
ATOM 9649  O OD1 . ASN B 1 107  ? 92.302  -0.171  -29.456 1.00 20.08  ? 107  ASN B OD1 1 
ATOM 9650  N ND2 . ASN B 1 107  ? 93.143  1.714   -28.641 1.00 32.75  ? 107  ASN B ND2 1 
ATOM 9651  N N   . ARG B 1 108  ? 88.513  -0.996  -27.069 1.00 32.99  ? 108  ARG B N   1 
ATOM 9652  C CA  . ARG B 1 108  ? 87.182  -0.975  -26.443 1.00 34.17  ? 108  ARG B CA  1 
ATOM 9653  C C   . ARG B 1 108  ? 86.872  -2.212  -25.603 1.00 29.87  ? 108  ARG B C   1 
ATOM 9654  O O   . ARG B 1 108  ? 85.821  -2.258  -24.947 1.00 25.60  ? 108  ARG B O   1 
ATOM 9655  C CB  . ARG B 1 108  ? 86.076  -0.829  -27.504 1.00 31.11  ? 108  ARG B CB  1 
ATOM 9656  C CG  . ARG B 1 108  ? 85.018  0.226   -27.187 1.00 35.21  ? 108  ARG B CG  1 
ATOM 9657  C CD  . ARG B 1 108  ? 83.737  -0.336  -26.604 1.00 30.03  ? 108  ARG B CD  1 
ATOM 9658  N NE  . ARG B 1 108  ? 82.764  0.741   -26.435 1.00 42.88  ? 108  ARG B NE  1 
ATOM 9659  C CZ  . ARG B 1 108  ? 81.683  0.658   -25.669 1.00 44.21  ? 108  ARG B CZ  1 
ATOM 9660  N NH1 . ARG B 1 108  ? 81.438  -0.458  -24.997 1.00 44.14  ? 108  ARG B NH1 1 
ATOM 9661  N NH2 . ARG B 1 108  ? 80.850  1.688   -25.569 1.00 60.95  ? 108  ARG B NH2 1 
ATOM 9662  N N   . LYS B 1 109  ? 87.729  -3.228  -25.623 1.00 29.22  ? 109  LYS B N   1 
ATOM 9663  C CA  . LYS B 1 109  ? 87.388  -4.435  -24.890 1.00 24.93  ? 109  LYS B CA  1 
ATOM 9664  C C   . LYS B 1 109  ? 87.379  -4.178  -23.402 1.00 25.00  ? 109  LYS B C   1 
ATOM 9665  O O   . LYS B 1 109  ? 86.576  -4.780  -22.684 1.00 22.24  ? 109  LYS B O   1 
ATOM 9666  C CB  . LYS B 1 109  ? 88.346  -5.568  -25.236 1.00 20.11  ? 109  LYS B CB  1 
ATOM 9667  C CG  . LYS B 1 109  ? 88.026  -6.234  -26.575 1.00 37.29  ? 109  LYS B CG  1 
ATOM 9668  C CD  . LYS B 1 109  ? 86.494  -6.401  -26.851 1.00 43.31  ? 109  LYS B CD  1 
ATOM 9669  C CE  . LYS B 1 109  ? 85.852  -5.203  -27.605 1.00 39.13  ? 109  LYS B CE  1 
ATOM 9670  N NZ  . LYS B 1 109  ? 84.594  -5.499  -28.398 1.00 17.63  ? 109  LYS B NZ  1 
ATOM 9671  N N   . LEU B 1 110  ? 88.232  -3.264  -22.929 1.00 30.39  ? 110  LEU B N   1 
ATOM 9672  C CA  . LEU B 1 110  ? 88.408  -2.981  -21.502 1.00 60.39  ? 110  LEU B CA  1 
ATOM 9673  C C   . LEU B 1 110  ? 87.936  -1.558  -21.174 1.00 50.15  ? 110  LEU B C   1 
ATOM 9674  O O   . LEU B 1 110  ? 88.628  -0.568  -21.445 1.00 59.11  ? 110  LEU B O   1 
ATOM 9675  C CB  . LEU B 1 110  ? 89.863  -3.227  -21.060 1.00 76.55  ? 110  LEU B CB  1 
ATOM 9676  C CG  . LEU B 1 110  ? 91.140  -2.862  -21.841 1.00 89.32  ? 110  LEU B CG  1 
ATOM 9677  C CD1 . LEU B 1 110  ? 92.388  -3.291  -21.046 1.00 78.91  ? 110  LEU B CD1 1 
ATOM 9678  C CD2 . LEU B 1 110  ? 91.173  -3.481  -23.234 1.00 71.84  ? 110  LEU B CD2 1 
ATOM 9679  N N   . LEU B 1 111  ? 86.730  -1.469  -20.610 1.00 42.00  ? 111  LEU B N   1 
ATOM 9680  C CA  . LEU B 1 111  ? 86.249  -0.222  -20.033 1.00 24.26  ? 111  LEU B CA  1 
ATOM 9681  C C   . LEU B 1 111  ? 87.284  0.377   -19.091 1.00 23.18  ? 111  LEU B C   1 
ATOM 9682  O O   . LEU B 1 111  ? 87.512  1.584   -19.119 1.00 21.66  ? 111  LEU B O   1 
ATOM 9683  C CB  . LEU B 1 111  ? 84.914  -0.461  -19.333 1.00 23.28  ? 111  LEU B CB  1 
ATOM 9684  C CG  . LEU B 1 111  ? 84.640  -1.797  -18.634 1.00 37.86  ? 111  LEU B CG  1 
ATOM 9685  C CD1 . LEU B 1 111  ? 85.922  -2.554  -18.223 1.00 46.52  ? 111  LEU B CD1 1 
ATOM 9686  C CD2 . LEU B 1 111  ? 83.657  -1.649  -17.435 1.00 44.22  ? 111  LEU B CD2 1 
ATOM 9687  N N   . GLY B 1 112  ? 87.925  -0.450  -18.265 1.00 25.25  ? 112  GLY B N   1 
ATOM 9688  C CA  . GLY B 1 112  ? 89.015  0.004   -17.421 1.00 31.65  ? 112  GLY B CA  1 
ATOM 9689  C C   . GLY B 1 112  ? 90.161  -0.985  -17.312 1.00 33.06  ? 112  GLY B C   1 
ATOM 9690  O O   . GLY B 1 112  ? 89.966  -2.200  -17.313 1.00 26.88  ? 112  GLY B O   1 
ATOM 9691  N N   . THR B 1 113  ? 91.380  -0.441  -17.210 1.00 37.48  ? 113  THR B N   1 
ATOM 9692  C CA  . THR B 1 113  ? 92.600  -1.222  -16.991 1.00 37.28  ? 113  THR B CA  1 
ATOM 9693  C C   . THR B 1 113  ? 93.149  -0.930  -15.606 1.00 49.03  ? 113  THR B C   1 
ATOM 9694  O O   . THR B 1 113  ? 93.440  0.230   -15.289 1.00 53.62  ? 113  THR B O   1 
ATOM 9695  C CB  . THR B 1 113  ? 93.689  -0.894  -18.005 1.00 34.06  ? 113  THR B CB  1 
ATOM 9696  O OG1 . THR B 1 113  ? 94.247  0.398   -17.708 1.00 32.69  ? 113  THR B OG1 1 
ATOM 9697  C CG2 . THR B 1 113  ? 93.131  -0.895  -19.384 1.00 38.35  ? 113  THR B CG2 1 
ATOM 9698  N N   . VAL B 1 114  ? 93.335  -1.986  -14.809 1.00 57.74  ? 114  VAL B N   1 
ATOM 9699  C CA  . VAL B 1 114  ? 94.150  -1.889  -13.603 1.00 58.99  ? 114  VAL B CA  1 
ATOM 9700  C C   . VAL B 1 114  ? 95.575  -1.477  -14.007 1.00 66.74  ? 114  VAL B C   1 
ATOM 9701  O O   . VAL B 1 114  ? 96.096  -1.903  -15.048 1.00 75.11  ? 114  VAL B O   1 
ATOM 9702  C CB  . VAL B 1 114  ? 94.076  -3.227  -12.833 1.00 33.71  ? 114  VAL B CB  1 
ATOM 9703  C CG1 . VAL B 1 114  ? 95.242  -4.146  -13.144 1.00 45.24  ? 114  VAL B CG1 1 
ATOM 9704  C CG2 . VAL B 1 114  ? 93.923  -3.008  -11.337 1.00 20.81  ? 114  VAL B CG2 1 
ATOM 9705  N N   . ILE B 1 115  ? 96.208  -0.609  -13.212 1.00 51.12  ? 115  ILE B N   1 
ATOM 9706  C CA  . ILE B 1 115  ? 97.450  0.050   -13.618 1.00 40.12  ? 115  ILE B CA  1 
ATOM 9707  C C   . ILE B 1 115  ? 98.618  -0.528  -12.832 1.00 27.40  ? 115  ILE B C   1 
ATOM 9708  O O   . ILE B 1 115  ? 98.638  -0.476  -11.595 1.00 24.19  ? 115  ILE B O   1 
ATOM 9709  C CB  . ILE B 1 115  ? 97.370  1.574   -13.428 1.00 36.84  ? 115  ILE B CB  1 
ATOM 9710  C CG1 . ILE B 1 115  ? 96.565  2.212   -14.559 1.00 26.09  ? 115  ILE B CG1 1 
ATOM 9711  C CG2 . ILE B 1 115  ? 98.751  2.161   -13.398 1.00 44.65  ? 115  ILE B CG2 1 
ATOM 9712  C CD1 . ILE B 1 115  ? 96.726  1.522   -15.870 1.00 18.29  ? 115  ILE B CD1 1 
ATOM 9713  N N   . GLN B 1 116  ? 99.601  -1.065  -13.553 1.00 20.98  ? 116  GLN B N   1 
ATOM 9714  C CA  . GLN B 1 116  ? 100.786 -1.625  -12.917 1.00 18.02  ? 116  GLN B CA  1 
ATOM 9715  C C   . GLN B 1 116  ? 101.974 -0.666  -12.880 1.00 23.06  ? 116  GLN B C   1 
ATOM 9716  O O   . GLN B 1 116  ? 102.773 -0.731  -11.939 1.00 24.41  ? 116  GLN B O   1 
ATOM 9717  C CB  . GLN B 1 116  ? 101.186 -2.924  -13.621 1.00 15.43  ? 116  GLN B CB  1 
ATOM 9718  C CG  . GLN B 1 116  ? 100.584 -4.163  -12.989 1.00 12.48  ? 116  GLN B CG  1 
ATOM 9719  C CD  . GLN B 1 116  ? 101.534 -4.868  -12.024 1.00 8.95   ? 116  GLN B CD  1 
ATOM 9720  O OE1 . GLN B 1 116  ? 102.007 -4.285  -11.043 1.00 13.69  ? 116  GLN B OE1 1 
ATOM 9721  N NE2 . GLN B 1 116  ? 101.806 -6.140  -12.294 1.00 8.95   ? 116  GLN B NE2 1 
ATOM 9722  N N   . TYR B 1 117  ? 102.111 0.218   -13.871 1.00 25.29  ? 117  TYR B N   1 
ATOM 9723  C CA  . TYR B 1 117  ? 103.147 1.248   -14.025 1.00 32.54  ? 117  TYR B CA  1 
ATOM 9724  C C   . TYR B 1 117  ? 104.264 0.802   -14.981 1.00 31.80  ? 117  TYR B C   1 
ATOM 9725  O O   . TYR B 1 117  ? 105.096 1.627   -15.359 1.00 40.27  ? 117  TYR B O   1 
ATOM 9726  C CB  . TYR B 1 117  ? 103.754 1.718   -12.682 1.00 27.32  ? 117  TYR B CB  1 
ATOM 9727  C CG  . TYR B 1 117  ? 103.072 2.953   -12.089 1.00 27.78  ? 117  TYR B CG  1 
ATOM 9728  C CD1 . TYR B 1 117  ? 101.726 3.192   -12.302 1.00 36.31  ? 117  TYR B CD1 1 
ATOM 9729  C CD2 . TYR B 1 117  ? 103.775 3.881   -11.337 1.00 25.00  ? 117  TYR B CD2 1 
ATOM 9730  C CE1 . TYR B 1 117  ? 101.105 4.315   -11.787 1.00 28.64  ? 117  TYR B CE1 1 
ATOM 9731  C CE2 . TYR B 1 117  ? 103.161 5.002   -10.815 1.00 24.63  ? 117  TYR B CE2 1 
ATOM 9732  C CZ  . TYR B 1 117  ? 101.822 5.211   -11.045 1.00 22.89  ? 117  TYR B CZ  1 
ATOM 9733  O OH  . TYR B 1 117  ? 101.169 6.310   -10.550 1.00 19.47  ? 117  TYR B OH  1 
ATOM 9734  N N   . GLY B 1 118  ? 104.293 -0.460  -15.405 1.00 30.89  ? 118  GLY B N   1 
ATOM 9735  C CA  . GLY B 1 118  ? 105.226 -0.956  -16.403 1.00 29.35  ? 118  GLY B CA  1 
ATOM 9736  C C   . GLY B 1 118  ? 104.666 -1.126  -17.805 1.00 29.69  ? 118  GLY B C   1 
ATOM 9737  O O   . GLY B 1 118  ? 105.337 -1.697  -18.672 1.00 18.09  ? 118  GLY B O   1 
ATOM 9738  N N   . ASN B 1 119  ? 103.452 -0.648  -18.047 1.00 39.62  ? 119  ASN B N   1 
ATOM 9739  C CA  . ASN B 1 119  ? 102.821 -0.688  -19.357 1.00 52.52  ? 119  ASN B CA  1 
ATOM 9740  C C   . ASN B 1 119  ? 102.189 0.685   -19.659 1.00 47.96  ? 119  ASN B C   1 
ATOM 9741  O O   . ASN B 1 119  ? 101.736 1.400   -18.753 1.00 41.99  ? 119  ASN B O   1 
ATOM 9742  C CB  . ASN B 1 119  ? 101.755 -1.860  -19.437 1.00 81.22  ? 119  ASN B CB  1 
ATOM 9743  C CG  . ASN B 1 119  ? 102.380 -3.302  -19.352 1.00 58.35  ? 119  ASN B CG  1 
ATOM 9744  O OD1 . ASN B 1 119  ? 103.566 -3.513  -19.639 1.00 38.87  ? 119  ASN B OD1 1 
ATOM 9745  N ND2 . ASN B 1 119  ? 101.549 -4.289  -18.969 1.00 58.28  ? 119  ASN B ND2 1 
ATOM 9746  N N   . VAL B 1 120  ? 102.173 1.056   -20.947 1.00 29.53  ? 120  VAL B N   1 
ATOM 9747  C CA  . VAL B 1 120  ? 101.663 2.362   -21.372 1.00 17.52  ? 120  VAL B CA  1 
ATOM 9748  C C   . VAL B 1 120  ? 100.210 2.562   -20.922 1.00 17.02  ? 120  VAL B C   1 
ATOM 9749  O O   . VAL B 1 120  ? 99.397  1.640   -20.983 1.00 26.59  ? 120  VAL B O   1 
ATOM 9750  C CB  . VAL B 1 120  ? 101.791 2.484   -22.901 1.00 10.47  ? 120  VAL B CB  1 
ATOM 9751  C CG1 . VAL B 1 120  ? 101.868 3.911   -23.293 1.00 13.97  ? 120  VAL B CG1 1 
ATOM 9752  C CG2 . VAL B 1 120  ? 103.028 1.772   -23.411 1.00 13.92  ? 120  VAL B CG2 1 
ATOM 9753  N N   . ILE B 1 121  ? 99.868  3.776   -20.476 1.00 12.13  ? 121  ILE B N   1 
ATOM 9754  C CA  . ILE B 1 121  ? 98.489  4.157   -20.158 1.00 13.38  ? 121  ILE B CA  1 
ATOM 9755  C C   . ILE B 1 121  ? 98.257  5.588   -20.671 1.00 35.86  ? 121  ILE B C   1 
ATOM 9756  O O   . ILE B 1 121  ? 99.212  6.300   -20.971 1.00 66.17  ? 121  ILE B O   1 
ATOM 9757  C CB  . ILE B 1 121  ? 98.227  4.017   -18.645 1.00 8.87   ? 121  ILE B CB  1 
ATOM 9758  C CG1 . ILE B 1 121  ? 99.518  4.219   -17.883 1.00 8.87   ? 121  ILE B CG1 1 
ATOM 9759  C CG2 . ILE B 1 121  ? 97.778  2.631   -18.306 1.00 8.87   ? 121  ILE B CG2 1 
ATOM 9760  C CD1 . ILE B 1 121  ? 99.582  3.362   -16.691 1.00 9.97   ? 121  ILE B CD1 1 
ATOM 9761  N N   . GLN B 1 122  ? 96.984  6.018   -20.821 1.00 33.82  ? 122  GLN B N   1 
ATOM 9762  C CA  . GLN B 1 122  ? 96.636  7.342   -21.397 1.00 38.77  ? 122  GLN B CA  1 
ATOM 9763  C C   . GLN B 1 122  ? 95.561  8.058   -20.556 1.00 39.27  ? 122  GLN B C   1 
ATOM 9764  O O   . GLN B 1 122  ? 94.852  7.428   -19.778 1.00 57.34  ? 122  GLN B O   1 
ATOM 9765  C CB  . GLN B 1 122  ? 96.168  7.221   -22.872 1.00 32.37  ? 122  GLN B CB  1 
ATOM 9766  C CG  . GLN B 1 122  ? 97.282  6.869   -23.895 1.00 39.89  ? 122  GLN B CG  1 
ATOM 9767  C CD  . GLN B 1 122  ? 97.755  8.077   -24.719 1.00 37.77  ? 122  GLN B CD  1 
ATOM 9768  O OE1 . GLN B 1 122  ? 98.880  8.130   -25.238 1.00 25.85  ? 122  GLN B OE1 1 
ATOM 9769  N NE2 . GLN B 1 122  ? 96.889  9.052   -24.829 1.00 39.60  ? 122  GLN B NE2 1 
ATOM 9770  N N   . LEU B 1 123  ? 95.446  9.392   -20.688 1.00 35.69  ? 123  LEU B N   1 
ATOM 9771  C CA  . LEU B 1 123  ? 94.516  10.207  -19.885 1.00 33.01  ? 123  LEU B CA  1 
ATOM 9772  C C   . LEU B 1 123  ? 93.756  11.155  -20.813 1.00 47.42  ? 123  LEU B C   1 
ATOM 9773  O O   . LEU B 1 123  ? 94.382  11.844  -21.625 1.00 65.48  ? 123  LEU B O   1 
ATOM 9774  C CB  . LEU B 1 123  ? 95.275  11.001  -18.799 1.00 23.55  ? 123  LEU B CB  1 
ATOM 9775  C CG  . LEU B 1 123  ? 94.835  10.978  -17.332 1.00 11.70  ? 123  LEU B CG  1 
ATOM 9776  C CD1 . LEU B 1 123  ? 93.463  11.451  -17.252 1.00 18.68  ? 123  LEU B CD1 1 
ATOM 9777  C CD2 . LEU B 1 123  ? 94.838  9.611   -16.786 1.00 11.57  ? 123  LEU B CD2 1 
ATOM 9778  N N   . LEU B 1 124  ? 92.412  11.191  -20.717 1.00 44.95  ? 124  LEU B N   1 
ATOM 9779  C CA  . LEU B 1 124  ? 91.582  11.861  -21.724 1.00 43.69  ? 124  LEU B CA  1 
ATOM 9780  C C   . LEU B 1 124  ? 90.733  12.991  -21.146 1.00 40.20  ? 124  LEU B C   1 
ATOM 9781  O O   . LEU B 1 124  ? 90.260  12.928  -20.006 1.00 29.63  ? 124  LEU B O   1 
ATOM 9782  C CB  . LEU B 1 124  ? 90.649  10.880  -22.464 1.00 28.97  ? 124  LEU B CB  1 
ATOM 9783  C CG  . LEU B 1 124  ? 89.160  11.211  -22.575 1.00 23.81  ? 124  LEU B CG  1 
ATOM 9784  C CD1 . LEU B 1 124  ? 88.661  10.895  -23.965 1.00 16.32  ? 124  LEU B CD1 1 
ATOM 9785  C CD2 . LEU B 1 124  ? 88.344  10.450  -21.543 1.00 27.04  ? 124  LEU B CD2 1 
ATOM 9786  N N   . HIS B 1 125  ? 90.513  13.994  -22.010 1.00 45.73  ? 125  HIS B N   1 
ATOM 9787  C CA  . HIS B 1 125  ? 89.867  15.277  -21.738 1.00 50.22  ? 125  HIS B CA  1 
ATOM 9788  C C   . HIS B 1 125  ? 88.486  15.358  -22.383 1.00 61.31  ? 125  HIS B C   1 
ATOM 9789  O O   . HIS B 1 125  ? 88.322  14.975  -23.546 1.00 71.72  ? 125  HIS B O   1 
ATOM 9790  C CB  . HIS B 1 125  ? 90.691  16.439  -22.308 1.00 49.18  ? 125  HIS B CB  1 
ATOM 9791  C CG  . HIS B 1 125  ? 90.520  17.708  -21.555 1.00 37.21  ? 125  HIS B CG  1 
ATOM 9792  N ND1 . HIS B 1 125  ? 91.239  18.856  -21.818 1.00 25.40  ? 125  HIS B ND1 1 
ATOM 9793  C CD2 . HIS B 1 125  ? 89.744  17.982  -20.484 1.00 37.58  ? 125  HIS B CD2 1 
ATOM 9794  C CE1 . HIS B 1 125  ? 90.885  19.793  -20.956 1.00 24.85  ? 125  HIS B CE1 1 
ATOM 9795  N NE2 . HIS B 1 125  ? 89.986  19.288  -20.134 1.00 34.04  ? 125  HIS B NE2 1 
ATOM 9796  N N   . LEU B 1 126  ? 87.515  15.961  -21.671 1.00 56.69  ? 126  LEU B N   1 
ATOM 9797  C CA  . LEU B 1 126  ? 86.129  15.943  -22.149 1.00 63.14  ? 126  LEU B CA  1 
ATOM 9798  C C   . LEU B 1 126  ? 85.840  17.062  -23.148 1.00 55.48  ? 126  LEU B C   1 
ATOM 9799  O O   . LEU B 1 126  ? 85.093  16.866  -24.120 1.00 54.44  ? 126  LEU B O   1 
ATOM 9800  C CB  . LEU B 1 126  ? 85.155  16.043  -20.968 1.00 62.74  ? 126  LEU B CB  1 
ATOM 9801  C CG  . LEU B 1 126  ? 85.542  15.499  -19.587 1.00 59.61  ? 126  LEU B CG  1 
ATOM 9802  C CD1 . LEU B 1 126  ? 84.288  15.324  -18.731 1.00 72.78  ? 126  LEU B CD1 1 
ATOM 9803  C CD2 . LEU B 1 126  ? 86.333  14.190  -19.656 1.00 73.02  ? 126  LEU B CD2 1 
ATOM 9804  N N   . LYS B 1 127  ? 86.424  18.236  -22.918 1.00 55.70  ? 127  LYS B N   1 
ATOM 9805  C CA  . LYS B 1 127  ? 86.068  19.441  -23.658 1.00 60.90  ? 127  LYS B CA  1 
ATOM 9806  C C   . LYS B 1 127  ? 86.815  19.527  -24.995 1.00 46.54  ? 127  LYS B C   1 
ATOM 9807  O O   . LYS B 1 127  ? 86.200  19.641  -26.068 1.00 35.70  ? 127  LYS B O   1 
ATOM 9808  C CB  . LYS B 1 127  ? 86.335  20.653  -22.751 1.00 59.15  ? 127  LYS B CB  1 
ATOM 9809  C CG  . LYS B 1 127  ? 85.467  20.662  -21.490 1.00 34.17  ? 127  LYS B CG  1 
ATOM 9810  C CD  . LYS B 1 127  ? 84.413  21.708  -21.526 1.00 32.28  ? 127  LYS B CD  1 
ATOM 9811  C CE  . LYS B 1 127  ? 83.441  21.501  -20.392 1.00 32.01  ? 127  LYS B CE  1 
ATOM 9812  N NZ  . LYS B 1 127  ? 83.973  22.396  -19.478 1.00 22.09  ? 127  LYS B NZ  1 
ATOM 9813  N N   . SER B 1 128  ? 88.146  19.439  -24.947 1.00 44.67  ? 128  SER B N   1 
ATOM 9814  C CA  . SER B 1 128  ? 88.929  19.530  -26.167 1.00 34.90  ? 128  SER B CA  1 
ATOM 9815  C C   . SER B 1 128  ? 88.652  18.339  -27.074 1.00 49.91  ? 128  SER B C   1 
ATOM 9816  O O   . SER B 1 128  ? 88.716  18.468  -28.300 1.00 61.48  ? 128  SER B O   1 
ATOM 9817  C CB  . SER B 1 128  ? 90.414  19.636  -25.815 1.00 22.80  ? 128  SER B CB  1 
ATOM 9818  O OG  . SER B 1 128  ? 90.961  20.799  -26.388 1.00 13.14  ? 128  SER B OG  1 
ATOM 9819  N N   . ASN B 1 129  ? 88.273  17.196  -26.482 1.00 55.54  ? 129  ASN B N   1 
ATOM 9820  C CA  . ASN B 1 129  ? 88.258  15.878  -27.124 1.00 55.08  ? 129  ASN B CA  1 
ATOM 9821  C C   . ASN B 1 129  ? 89.528  15.704  -27.954 1.00 56.33  ? 129  ASN B C   1 
ATOM 9822  O O   . ASN B 1 129  ? 89.539  14.954  -28.939 1.00 52.40  ? 129  ASN B O   1 
ATOM 9823  C CB  . ASN B 1 129  ? 86.999  15.670  -27.994 1.00 48.90  ? 129  ASN B CB  1 
ATOM 9824  C CG  . ASN B 1 129  ? 85.992  14.680  -27.387 1.00 39.57  ? 129  ASN B CG  1 
ATOM 9825  O OD1 . ASN B 1 129  ? 86.185  13.464  -27.449 1.00 35.33  ? 129  ASN B OD1 1 
ATOM 9826  N ND2 . ASN B 1 129  ? 84.893  15.205  -26.848 1.00 37.27  ? 129  ASN B ND2 1 
ATOM 9827  N N   . LYS B 1 130  ? 90.605  16.381  -27.523 1.00 51.83  ? 130  LYS B N   1 
ATOM 9828  C CA  . LYS B 1 130  ? 91.863  16.545  -28.250 1.00 37.73  ? 130  LYS B CA  1 
ATOM 9829  C C   . LYS B 1 130  ? 93.027  15.915  -27.483 1.00 37.77  ? 130  LYS B C   1 
ATOM 9830  O O   . LYS B 1 130  ? 93.264  16.258  -26.319 1.00 36.94  ? 130  LYS B O   1 
ATOM 9831  C CB  . LYS B 1 130  ? 92.129  18.048  -28.500 1.00 19.69  ? 130  LYS B CB  1 
ATOM 9832  C CG  . LYS B 1 130  ? 93.471  18.393  -29.150 1.00 14.92  ? 130  LYS B CG  1 
ATOM 9833  C CD  . LYS B 1 130  ? 93.352  19.537  -30.030 1.00 11.29  ? 130  LYS B CD  1 
ATOM 9834  C CE  . LYS B 1 130  ? 92.591  20.649  -29.397 1.00 8.81   ? 130  LYS B CE  1 
ATOM 9835  N NZ  . LYS B 1 130  ? 91.753  21.205  -30.465 1.00 8.81   ? 130  LYS B NZ  1 
ATOM 9836  N N   . TYR B 1 131  ? 93.779  15.033  -28.174 1.00 32.50  ? 131  TYR B N   1 
ATOM 9837  C CA  . TYR B 1 131  ? 94.855  14.194  -27.634 1.00 24.28  ? 131  TYR B CA  1 
ATOM 9838  C C   . TYR B 1 131  ? 96.233  14.610  -28.131 1.00 24.78  ? 131  TYR B C   1 
ATOM 9839  O O   . TYR B 1 131  ? 96.699  14.136  -29.174 1.00 25.49  ? 131  TYR B O   1 
ATOM 9840  C CB  . TYR B 1 131  ? 94.636  12.751  -27.995 1.00 23.19  ? 131  TYR B CB  1 
ATOM 9841  C CG  . TYR B 1 131  ? 94.635  12.003  -26.771 1.00 25.69  ? 131  TYR B CG  1 
ATOM 9842  C CD1 . TYR B 1 131  ? 95.083  12.599  -25.616 1.00 32.89  ? 131  TYR B CD1 1 
ATOM 9843  C CD2 . TYR B 1 131  ? 94.171  10.723  -26.732 1.00 33.83  ? 131  TYR B CD2 1 
ATOM 9844  C CE1 . TYR B 1 131  ? 95.080  11.927  -24.456 1.00 46.00  ? 131  TYR B CE1 1 
ATOM 9845  C CE2 . TYR B 1 131  ? 94.161  10.029  -25.575 1.00 34.86  ? 131  TYR B CE2 1 
ATOM 9846  C CZ  . TYR B 1 131  ? 94.606  10.639  -24.427 1.00 47.18  ? 131  TYR B CZ  1 
ATOM 9847  O OH  . TYR B 1 131  ? 94.630  9.952   -23.235 1.00 53.53  ? 131  TYR B OH  1 
ATOM 9848  N N   . LEU B 1 132  ? 96.916  15.388  -27.315 1.00 21.92  ? 132  LEU B N   1 
ATOM 9849  C CA  . LEU B 1 132  ? 98.106  16.088  -27.745 1.00 20.58  ? 132  LEU B CA  1 
ATOM 9850  C C   . LEU B 1 132  ? 99.164  15.108  -28.238 1.00 18.12  ? 132  LEU B C   1 
ATOM 9851  O O   . LEU B 1 132  ? 99.323  14.012  -27.692 1.00 14.60  ? 132  LEU B O   1 
ATOM 9852  C CB  . LEU B 1 132  ? 98.625  16.934  -26.598 1.00 23.85  ? 132  LEU B CB  1 
ATOM 9853  C CG  . LEU B 1 132  ? 97.714  17.540  -25.527 1.00 43.43  ? 132  LEU B CG  1 
ATOM 9854  C CD1 . LEU B 1 132  ? 96.802  16.549  -24.807 1.00 29.75  ? 132  LEU B CD1 1 
ATOM 9855  C CD2 . LEU B 1 132  ? 98.619  18.196  -24.510 1.00 68.45  ? 132  LEU B CD2 1 
ATOM 9856  N N   . THR B 1 133  ? 99.856  15.513  -29.305 1.00 12.77  ? 133  THR B N   1 
ATOM 9857  C CA  . THR B 1 133  ? 100.683 14.638  -30.108 1.00 18.60  ? 133  THR B CA  1 
ATOM 9858  C C   . THR B 1 133  ? 102.094 15.159  -30.128 1.00 19.81  ? 133  THR B C   1 
ATOM 9859  O O   . THR B 1 133  ? 102.315 16.323  -30.457 1.00 16.67  ? 133  THR B O   1 
ATOM 9860  C CB  . THR B 1 133  ? 100.212 14.490  -31.572 1.00 18.52  ? 133  THR B CB  1 
ATOM 9861  O OG1 . THR B 1 133  ? 100.980 13.441  -32.146 1.00 22.64  ? 133  THR B OG1 1 
ATOM 9862  C CG2 . THR B 1 133  ? 100.480 15.740  -32.488 1.00 15.06  ? 133  THR B CG2 1 
ATOM 9863  N N   . VAL B 1 134  ? 103.047 14.275  -29.800 1.00 28.87  ? 134  VAL B N   1 
ATOM 9864  C CA  . VAL B 1 134  ? 104.445 14.643  -29.859 1.00 28.03  ? 134  VAL B CA  1 
ATOM 9865  C C   . VAL B 1 134  ? 104.806 15.100  -31.263 1.00 22.85  ? 134  VAL B C   1 
ATOM 9866  O O   . VAL B 1 134  ? 104.341 14.557  -32.268 1.00 20.43  ? 134  VAL B O   1 
ATOM 9867  C CB  . VAL B 1 134  ? 105.354 13.491  -29.423 1.00 34.16  ? 134  VAL B CB  1 
ATOM 9868  C CG1 . VAL B 1 134  ? 106.733 14.045  -29.146 1.00 41.62  ? 134  VAL B CG1 1 
ATOM 9869  C CG2 . VAL B 1 134  ? 104.783 12.793  -28.187 1.00 35.81  ? 134  VAL B CG2 1 
ATOM 9870  N N   . ASN B 1 135  ? 105.660 16.103  -31.313 1.00 19.74  ? 135  ASN B N   1 
ATOM 9871  C CA  . ASN B 1 135  ? 106.122 16.732  -32.534 1.00 15.22  ? 135  ASN B CA  1 
ATOM 9872  C C   . ASN B 1 135  ? 107.628 16.584  -32.438 1.00 11.49  ? 135  ASN B C   1 
ATOM 9873  O O   . ASN B 1 135  ? 108.329 17.513  -32.035 1.00 13.79  ? 135  ASN B O   1 
ATOM 9874  C CB  . ASN B 1 135  ? 105.661 18.195  -32.630 1.00 18.23  ? 135  ASN B CB  1 
ATOM 9875  C CG  . ASN B 1 135  ? 104.171 18.362  -32.350 1.00 22.94  ? 135  ASN B CG  1 
ATOM 9876  O OD1 . ASN B 1 135  ? 103.621 17.662  -31.518 1.00 21.05  ? 135  ASN B OD1 1 
ATOM 9877  N ND2 . ASN B 1 135  ? 103.511 19.279  -33.062 1.00 31.87  ? 135  ASN B ND2 1 
ATOM 9878  N N   . LYS B 1 136  ? 108.107 15.372  -32.689 1.00 8.78   ? 136  LYS B N   1 
ATOM 9879  C CA  . LYS B 1 136  ? 109.541 15.142  -32.775 1.00 8.78   ? 136  LYS B CA  1 
ATOM 9880  C C   . LYS B 1 136  ? 110.297 15.886  -31.690 1.00 9.73   ? 136  LYS B C   1 
ATOM 9881  O O   . LYS B 1 136  ? 111.419 16.344  -31.912 1.00 9.18   ? 136  LYS B O   1 
ATOM 9882  C CB  . LYS B 1 136  ? 110.056 15.573  -34.142 1.00 11.40  ? 136  LYS B CB  1 
ATOM 9883  N N   . ARG B 1 137  ? 109.686 16.071  -30.538 1.00 8.97   ? 137  ARG B N   1 
ATOM 9884  C CA  . ARG B 1 137  ? 110.445 16.530  -29.391 1.00 15.01  ? 137  ARG B CA  1 
ATOM 9885  C C   . ARG B 1 137  ? 110.815 18.005  -29.507 1.00 18.48  ? 137  ARG B C   1 
ATOM 9886  O O   . ARG B 1 137  ? 111.933 18.404  -29.188 1.00 23.61  ? 137  ARG B O   1 
ATOM 9887  C CB  . ARG B 1 137  ? 111.702 15.671  -29.211 1.00 14.04  ? 137  ARG B CB  1 
ATOM 9888  N N   . LEU B 1 138  ? 109.895 18.831  -29.971 1.00 19.90  ? 138  LEU B N   1 
ATOM 9889  C CA  . LEU B 1 138  ? 110.130 20.257  -29.840 1.00 27.61  ? 138  LEU B CA  1 
ATOM 9890  C C   . LEU B 1 138  ? 109.420 20.725  -28.591 1.00 34.72  ? 138  LEU B C   1 
ATOM 9891  O O   . LEU B 1 138  ? 108.230 20.446  -28.437 1.00 35.86  ? 138  LEU B O   1 
ATOM 9892  C CB  . LEU B 1 138  ? 109.623 21.013  -31.054 1.00 36.31  ? 138  LEU B CB  1 
ATOM 9893  C CG  . LEU B 1 138  ? 108.140 20.935  -31.381 1.00 37.56  ? 138  LEU B CG  1 
ATOM 9894  C CD1 . LEU B 1 138  ? 107.708 22.347  -31.605 1.00 50.37  ? 138  LEU B CD1 1 
ATOM 9895  C CD2 . LEU B 1 138  ? 107.949 20.136  -32.643 1.00 31.24  ? 138  LEU B CD2 1 
ATOM 9896  N N   . PRO B 1 139  ? 110.078 21.409  -27.681 1.00 40.15  ? 139  PRO B N   1 
ATOM 9897  C CA  . PRO B 1 139  ? 109.531 21.495  -26.315 1.00 46.50  ? 139  PRO B CA  1 
ATOM 9898  C C   . PRO B 1 139  ? 108.438 22.541  -26.102 1.00 60.51  ? 139  PRO B C   1 
ATOM 9899  O O   . PRO B 1 139  ? 107.350 22.248  -25.579 1.00 57.98  ? 139  PRO B O   1 
ATOM 9900  C CB  . PRO B 1 139  ? 110.771 21.811  -25.466 1.00 45.91  ? 139  PRO B CB  1 
ATOM 9901  C CG  . PRO B 1 139  ? 111.763 22.435  -26.411 1.00 37.39  ? 139  PRO B CG  1 
ATOM 9902  C CD  . PRO B 1 139  ? 111.452 21.936  -27.797 1.00 31.65  ? 139  PRO B CD  1 
ATOM 9903  N N   . ALA B 1 140  ? 108.722 23.779  -26.486 1.00 59.22  ? 140  ALA B N   1 
ATOM 9904  C CA  . ALA B 1 140  ? 107.837 24.846  -26.066 1.00 39.87  ? 140  ALA B CA  1 
ATOM 9905  C C   . ALA B 1 140  ? 108.371 26.179  -26.549 1.00 26.38  ? 140  ALA B C   1 
ATOM 9906  O O   . ALA B 1 140  ? 109.582 26.435  -26.524 1.00 25.50  ? 140  ALA B O   1 
ATOM 9907  C CB  . ALA B 1 140  ? 107.678 24.821  -24.548 1.00 31.43  ? 140  ALA B CB  1 
ATOM 9908  N N   . LEU B 1 141  ? 107.458 27.009  -27.031 1.00 22.06  ? 141  LEU B N   1 
ATOM 9909  C CA  . LEU B 1 141  ? 107.765 28.376  -27.396 1.00 17.76  ? 141  LEU B CA  1 
ATOM 9910  C C   . LEU B 1 141  ? 108.649 28.945  -26.312 1.00 15.88  ? 141  LEU B C   1 
ATOM 9911  O O   . LEU B 1 141  ? 109.593 29.693  -26.588 1.00 15.30  ? 141  LEU B O   1 
ATOM 9912  C CB  . LEU B 1 141  ? 106.485 29.199  -27.540 1.00 19.84  ? 141  LEU B CB  1 
ATOM 9913  C CG  . LEU B 1 141  ? 105.357 29.064  -26.507 1.00 19.41  ? 141  LEU B CG  1 
ATOM 9914  C CD1 . LEU B 1 141  ? 104.250 30.098  -26.753 1.00 18.57  ? 141  LEU B CD1 1 
ATOM 9915  C CD2 . LEU B 1 141  ? 104.766 27.674  -26.539 1.00 17.75  ? 141  LEU B CD2 1 
ATOM 9916  N N   . LEU B 1 142  ? 108.354 28.547  -25.075 1.00 17.12  ? 142  LEU B N   1 
ATOM 9917  C CA  . LEU B 1 142  ? 109.039 29.030  -23.889 1.00 18.05  ? 142  LEU B CA  1 
ATOM 9918  C C   . LEU B 1 142  ? 109.700 27.909  -23.106 1.00 18.79  ? 142  LEU B C   1 
ATOM 9919  O O   . LEU B 1 142  ? 109.836 28.011  -21.888 1.00 16.05  ? 142  LEU B O   1 
ATOM 9920  C CB  . LEU B 1 142  ? 108.076 29.760  -22.961 1.00 18.31  ? 142  LEU B CB  1 
ATOM 9921  C CG  . LEU B 1 142  ? 107.059 30.760  -23.483 1.00 24.59  ? 142  LEU B CG  1 
ATOM 9922  C CD1 . LEU B 1 142  ? 106.723 31.750  -22.368 1.00 29.17  ? 142  LEU B CD1 1 
ATOM 9923  C CD2 . LEU B 1 142  ? 107.557 31.481  -24.733 1.00 31.18  ? 142  LEU B CD2 1 
ATOM 9924  N N   . GLU B 1 143  ? 110.094 26.824  -23.741 1.00 21.93  ? 143  GLU B N   1 
ATOM 9925  C CA  . GLU B 1 143  ? 110.839 25.812  -23.010 1.00 28.16  ? 143  GLU B CA  1 
ATOM 9926  C C   . GLU B 1 143  ? 112.130 25.502  -23.732 1.00 34.55  ? 143  GLU B C   1 
ATOM 9927  O O   . GLU B 1 143  ? 112.164 25.447  -24.966 1.00 41.78  ? 143  GLU B O   1 
ATOM 9928  C CB  . GLU B 1 143  ? 110.026 24.543  -22.817 1.00 35.27  ? 143  GLU B CB  1 
ATOM 9929  C CG  . GLU B 1 143  ? 109.108 24.619  -21.645 1.00 31.83  ? 143  GLU B CG  1 
ATOM 9930  C CD  . GLU B 1 143  ? 109.813 25.161  -20.433 1.00 30.99  ? 143  GLU B CD  1 
ATOM 9931  O OE1 . GLU B 1 143  ? 109.247 26.071  -19.803 1.00 36.42  ? 143  GLU B OE1 1 
ATOM 9932  O OE2 . GLU B 1 143  ? 110.932 24.695  -20.123 1.00 28.62  ? 143  GLU B OE2 1 
ATOM 9933  N N   . LYS B 1 144  ? 113.186 25.272  -22.954 1.00 33.97  ? 144  LYS B N   1 
ATOM 9934  C CA  . LYS B 1 144  ? 114.476 24.976  -23.557 1.00 43.58  ? 144  LYS B CA  1 
ATOM 9935  C C   . LYS B 1 144  ? 114.538 23.545  -24.100 1.00 43.70  ? 144  LYS B C   1 
ATOM 9936  O O   . LYS B 1 144  ? 115.008 23.330  -25.222 1.00 50.23  ? 144  LYS B O   1 
ATOM 9937  C CB  . LYS B 1 144  ? 115.590 25.228  -22.543 1.00 48.68  ? 144  LYS B CB  1 
ATOM 9938  N N   . ASN B 1 145  ? 114.067 22.553  -23.338 1.00 33.37  ? 145  ASN B N   1 
ATOM 9939  C CA  . ASN B 1 145  ? 114.170 21.150  -23.729 1.00 24.54  ? 145  ASN B CA  1 
ATOM 9940  C C   . ASN B 1 145  ? 112.816 20.468  -23.603 1.00 25.89  ? 145  ASN B C   1 
ATOM 9941  O O   . ASN B 1 145  ? 112.044 20.781  -22.690 1.00 30.55  ? 145  ASN B O   1 
ATOM 9942  C CB  . ASN B 1 145  ? 115.199 20.409  -22.868 1.00 14.49  ? 145  ASN B CB  1 
ATOM 9943  N N   . ALA B 1 146  ? 112.529 19.550  -24.551 1.00 30.28  ? 146  ALA B N   1 
ATOM 9944  C CA  . ALA B 1 146  ? 111.370 18.634  -24.551 1.00 44.99  ? 146  ALA B CA  1 
ATOM 9945  C C   . ALA B 1 146  ? 110.615 18.478  -25.891 1.00 44.64  ? 146  ALA B C   1 
ATOM 9946  O O   . ALA B 1 146  ? 110.974 19.105  -26.895 1.00 38.10  ? 146  ALA B O   1 
ATOM 9947  C CB  . ALA B 1 146  ? 110.352 19.042  -23.481 1.00 41.82  ? 146  ALA B CB  1 
ATOM 9948  N N   . MET B 1 147  ? 109.566 17.625  -25.900 1.00 37.90  ? 147  MET B N   1 
ATOM 9949  C CA  . MET B 1 147  ? 108.675 17.362  -27.034 1.00 33.02  ? 147  MET B CA  1 
ATOM 9950  C C   . MET B 1 147  ? 107.522 18.351  -27.028 1.00 28.10  ? 147  MET B C   1 
ATOM 9951  O O   . MET B 1 147  ? 107.069 18.792  -25.969 1.00 28.27  ? 147  MET B O   1 
ATOM 9952  C CB  . MET B 1 147  ? 108.052 15.950  -26.982 1.00 41.47  ? 147  MET B CB  1 
ATOM 9953  C CG  . MET B 1 147  ? 108.992 14.725  -26.834 1.00 35.49  ? 147  MET B CG  1 
ATOM 9954  S SD  . MET B 1 147  ? 108.232 13.094  -26.507 1.00 8.93   ? 147  MET B SD  1 
ATOM 9955  C CE  . MET B 1 147  ? 107.369 13.696  -25.096 1.00 18.02  ? 147  MET B CE  1 
ATOM 9956  N N   . ARG B 1 148  ? 106.988 18.652  -28.204 1.00 23.64  ? 148  ARG B N   1 
ATOM 9957  C CA  . ARG B 1 148  ? 105.779 19.462  -28.237 1.00 22.91  ? 148  ARG B CA  1 
ATOM 9958  C C   . ARG B 1 148  ? 104.545 18.624  -28.470 1.00 22.21  ? 148  ARG B C   1 
ATOM 9959  O O   . ARG B 1 148  ? 104.512 17.742  -29.329 1.00 23.15  ? 148  ARG B O   1 
ATOM 9960  C CB  . ARG B 1 148  ? 105.809 20.529  -29.311 1.00 23.60  ? 148  ARG B CB  1 
ATOM 9961  C CG  . ARG B 1 148  ? 104.603 20.430  -30.188 1.00 20.51  ? 148  ARG B CG  1 
ATOM 9962  C CD  . ARG B 1 148  ? 104.824 21.260  -31.397 1.00 22.05  ? 148  ARG B CD  1 
ATOM 9963  N NE  . ARG B 1 148  ? 103.630 21.999  -31.783 1.00 18.76  ? 148  ARG B NE  1 
ATOM 9964  C CZ  . ARG B 1 148  ? 102.814 22.626  -30.942 1.00 10.94  ? 148  ARG B CZ  1 
ATOM 9965  N NH1 . ARG B 1 148  ? 103.015 22.599  -29.629 1.00 8.86   ? 148  ARG B NH1 1 
ATOM 9966  N NH2 . ARG B 1 148  ? 101.774 23.277  -31.426 1.00 10.77  ? 148  ARG B NH2 1 
ATOM 9967  N N   . VAL B 1 149  ? 103.492 18.985  -27.772 1.00 23.06  ? 149  VAL B N   1 
ATOM 9968  C CA  . VAL B 1 149  ? 102.285 18.177  -27.736 1.00 24.86  ? 149  VAL B CA  1 
ATOM 9969  C C   . VAL B 1 149  ? 101.244 19.223  -27.355 1.00 36.22  ? 149  VAL B C   1 
ATOM 9970  O O   . VAL B 1 149  ? 101.308 19.785  -26.266 1.00 62.22  ? 149  VAL B O   1 
ATOM 9971  C CB  . VAL B 1 149  ? 102.488 17.015  -26.737 1.00 22.45  ? 149  VAL B CB  1 
ATOM 9972  C CG1 . VAL B 1 149  ? 101.253 16.496  -26.184 1.00 19.46  ? 149  VAL B CG1 1 
ATOM 9973  C CG2 . VAL B 1 149  ? 103.208 15.858  -27.388 1.00 25.38  ? 149  VAL B CG2 1 
ATOM 9974  N N   . THR B 1 150  ? 100.398 19.629  -28.300 1.00 25.61  ? 150  THR B N   1 
ATOM 9975  C CA  . THR B 1 150  ? 99.672  20.896  -28.137 1.00 19.71  ? 150  THR B CA  1 
ATOM 9976  C C   . THR B 1 150  ? 98.207  20.751  -28.515 1.00 18.79  ? 150  THR B C   1 
ATOM 9977  O O   . THR B 1 150  ? 97.762  21.311  -29.513 1.00 13.74  ? 150  THR B O   1 
ATOM 9978  C CB  . THR B 1 150  ? 100.274 21.938  -28.996 1.00 13.31  ? 150  THR B CB  1 
ATOM 9979  O OG1 . THR B 1 150  ? 99.404  23.072  -28.972 1.00 9.94   ? 150  THR B OG1 1 
ATOM 9980  C CG2 . THR B 1 150  ? 100.266 21.365  -30.365 1.00 14.47  ? 150  THR B CG2 1 
ATOM 9981  N N   . LEU B 1 151  ? 97.462  19.996  -27.723 1.00 24.95  ? 151  LEU B N   1 
ATOM 9982  C CA  . LEU B 1 151  ? 96.120  19.665  -28.152 1.00 21.00  ? 151  LEU B CA  1 
ATOM 9983  C C   . LEU B 1 151  ? 96.198  19.135  -29.567 1.00 21.37  ? 151  LEU B C   1 
ATOM 9984  O O   . LEU B 1 151  ? 96.006  19.877  -30.538 1.00 17.49  ? 151  LEU B O   1 
ATOM 9985  C CB  . LEU B 1 151  ? 95.213  20.878  -28.080 1.00 12.94  ? 151  LEU B CB  1 
ATOM 9986  C CG  . LEU B 1 151  ? 94.408  21.044  -26.801 1.00 11.15  ? 151  LEU B CG  1 
ATOM 9987  C CD1 . LEU B 1 151  ? 93.625  22.327  -26.871 1.00 16.31  ? 151  LEU B CD1 1 
ATOM 9988  C CD2 . LEU B 1 151  ? 93.456  19.889  -26.572 1.00 10.56  ? 151  LEU B CD2 1 
ATOM 9989  N N   . ASP B 1 152  ? 96.547  17.865  -29.692 1.00 28.56  ? 152  ASP B N   1 
ATOM 9990  C CA  . ASP B 1 152  ? 96.691  17.262  -30.997 1.00 30.51  ? 152  ASP B CA  1 
ATOM 9991  C C   . ASP B 1 152  ? 95.727  16.067  -31.205 1.00 51.58  ? 152  ASP B C   1 
ATOM 9992  O O   . ASP B 1 152  ? 96.136  15.069  -31.800 1.00 74.82  ? 152  ASP B O   1 
ATOM 9993  C CB  . ASP B 1 152  ? 98.151  16.848  -31.226 1.00 21.01  ? 152  ASP B CB  1 
ATOM 9994  C CG  . ASP B 1 152  ? 99.184  17.848  -30.651 1.00 17.20  ? 152  ASP B CG  1 
ATOM 9995  O OD1 . ASP B 1 152  ? 98.810  18.855  -30.028 1.00 28.19  ? 152  ASP B OD1 1 
ATOM 9996  O OD2 . ASP B 1 152  ? 100.395 17.602  -30.847 1.00 11.04  ? 152  ASP B OD2 1 
ATOM 9997  N N   . GLU B 1 153  ? 94.469  16.153  -30.686 1.00 49.22  ? 153  GLU B N   1 
ATOM 9998  C CA  . GLU B 1 153  ? 93.258  15.382  -31.068 1.00 36.27  ? 153  GLU B CA  1 
ATOM 9999  C C   . GLU B 1 153  ? 93.135  13.907  -30.608 1.00 32.71  ? 153  GLU B C   1 
ATOM 10000 O O   . GLU B 1 153  ? 92.730  13.682  -29.459 1.00 29.12  ? 153  GLU B O   1 
ATOM 10001 C CB  . GLU B 1 153  ? 93.093  15.496  -32.581 1.00 31.45  ? 153  GLU B CB  1 
ATOM 10002 C CG  . GLU B 1 153  ? 92.522  16.826  -33.176 1.00 16.21  ? 153  GLU B CG  1 
ATOM 10003 C CD  . GLU B 1 153  ? 92.314  17.985  -32.212 1.00 8.76   ? 153  GLU B CD  1 
ATOM 10004 O OE1 . GLU B 1 153  ? 92.740  19.107  -32.530 1.00 8.76   ? 153  GLU B OE1 1 
ATOM 10005 O OE2 . GLU B 1 153  ? 91.749  17.787  -31.135 1.00 10.57  ? 153  GLU B OE2 1 
ATOM 10006 N N   . ALA B 1 154  ? 93.384  12.895  -31.468 1.00 23.91  ? 154  ALA B N   1 
ATOM 10007 C CA  . ALA B 1 154  ? 93.327  11.499  -31.018 1.00 19.20  ? 154  ALA B CA  1 
ATOM 10008 C C   . ALA B 1 154  ? 94.669  11.015  -30.486 1.00 14.82  ? 154  ALA B C   1 
ATOM 10009 O O   . ALA B 1 154  ? 94.715  10.145  -29.613 1.00 13.89  ? 154  ALA B O   1 
ATOM 10010 C CB  . ALA B 1 154  ? 92.869  10.578  -32.150 1.00 11.35  ? 154  ALA B CB  1 
ATOM 10011 N N   . GLY B 1 155  ? 95.764  11.573  -30.982 1.00 18.98  ? 155  GLY B N   1 
ATOM 10012 C CA  . GLY B 1 155  ? 97.080  11.089  -30.637 1.00 16.31  ? 155  GLY B CA  1 
ATOM 10013 C C   . GLY B 1 155  ? 97.486  10.165  -31.757 1.00 16.48  ? 155  GLY B C   1 
ATOM 10014 O O   . GLY B 1 155  ? 96.662  9.373   -32.226 1.00 16.44  ? 155  GLY B O   1 
ATOM 10015 N N   . ASN B 1 156  ? 98.709  10.326  -32.263 1.00 17.45  ? 156  ASN B N   1 
ATOM 10016 C CA  . ASN B 1 156  ? 99.252  9.422   -33.267 1.00 17.72  ? 156  ASN B CA  1 
ATOM 10017 C C   . ASN B 1 156  ? 99.776  8.186   -32.555 1.00 17.19  ? 156  ASN B C   1 
ATOM 10018 O O   . ASN B 1 156  ? 99.413  7.933   -31.401 1.00 16.86  ? 156  ASN B O   1 
ATOM 10019 C CB  . ASN B 1 156  ? 100.382 10.072  -34.078 1.00 24.49  ? 156  ASN B CB  1 
ATOM 10020 C CG  . ASN B 1 156  ? 100.262 11.576  -34.161 1.00 31.08  ? 156  ASN B CG  1 
ATOM 10021 O OD1 . ASN B 1 156  ? 100.413 12.266  -33.162 1.00 31.64  ? 156  ASN B OD1 1 
ATOM 10022 N ND2 . ASN B 1 156  ? 100.003 12.096  -35.359 1.00 41.80  ? 156  ASN B ND2 1 
ATOM 10023 N N   . GLU B 1 157  ? 100.662 7.439   -33.223 1.00 17.31  ? 157  GLU B N   1 
ATOM 10024 C CA  . GLU B 1 157  ? 101.303 6.273   -32.620 1.00 18.53  ? 157  GLU B CA  1 
ATOM 10025 C C   . GLU B 1 157  ? 102.296 6.645   -31.533 1.00 16.43  ? 157  GLU B C   1 
ATOM 10026 O O   . GLU B 1 157  ? 102.706 5.766   -30.769 1.00 13.11  ? 157  GLU B O   1 
ATOM 10027 C CB  . GLU B 1 157  ? 102.035 5.449   -33.678 1.00 24.55  ? 157  GLU B CB  1 
ATOM 10028 N N   . GLY B 1 158  ? 102.731 7.906   -31.490 1.00 17.94  ? 158  GLY B N   1 
ATOM 10029 C CA  . GLY B 1 158  ? 103.567 8.463   -30.447 1.00 22.43  ? 158  GLY B CA  1 
ATOM 10030 C C   . GLY B 1 158  ? 102.790 8.956   -29.244 1.00 23.13  ? 158  GLY B C   1 
ATOM 10031 O O   . GLY B 1 158  ? 103.317 9.692   -28.401 1.00 27.91  ? 158  GLY B O   1 
ATOM 10032 N N   . SER B 1 159  ? 101.524 8.566   -29.135 1.00 19.08  ? 159  SER B N   1 
ATOM 10033 C CA  . SER B 1 159  ? 100.753 8.967   -27.965 1.00 15.83  ? 159  SER B CA  1 
ATOM 10034 C C   . SER B 1 159  ? 101.254 8.281   -26.701 1.00 13.86  ? 159  SER B C   1 
ATOM 10035 O O   . SER B 1 159  ? 101.161 8.860   -25.614 1.00 8.88   ? 159  SER B O   1 
ATOM 10036 C CB  . SER B 1 159  ? 99.271  8.676   -28.188 1.00 17.71  ? 159  SER B CB  1 
ATOM 10037 O OG  . SER B 1 159  ? 98.751  9.451   -29.258 1.00 16.83  ? 159  SER B OG  1 
ATOM 10038 N N   . TRP B 1 160  ? 101.775 7.046   -26.829 1.00 16.69  ? 160  TRP B N   1 
ATOM 10039 C CA  . TRP B 1 160  ? 102.387 6.304   -25.722 1.00 18.06  ? 160  TRP B CA  1 
ATOM 10040 C C   . TRP B 1 160  ? 103.161 7.264   -24.858 1.00 20.61  ? 160  TRP B C   1 
ATOM 10041 O O   . TRP B 1 160  ? 103.908 8.103   -25.362 1.00 20.64  ? 160  TRP B O   1 
ATOM 10042 C CB  . TRP B 1 160  ? 103.356 5.195   -26.195 1.00 15.42  ? 160  TRP B CB  1 
ATOM 10043 C CG  . TRP B 1 160  ? 102.820 4.201   -27.114 1.00 12.10  ? 160  TRP B CG  1 
ATOM 10044 C CD1 . TRP B 1 160  ? 101.545 4.052   -27.313 1.00 14.69  ? 160  TRP B CD1 1 
ATOM 10045 C CD2 . TRP B 1 160  ? 103.476 3.254   -27.964 1.00 10.87  ? 160  TRP B CD2 1 
ATOM 10046 N NE1 . TRP B 1 160  ? 101.311 3.035   -28.181 1.00 14.16  ? 160  TRP B NE1 1 
ATOM 10047 C CE2 . TRP B 1 160  ? 102.476 2.574   -28.687 1.00 10.69  ? 160  TRP B CE2 1 
ATOM 10048 C CE3 . TRP B 1 160  ? 104.808 2.888   -28.185 1.00 14.40  ? 160  TRP B CE3 1 
ATOM 10049 C CZ2 . TRP B 1 160  ? 102.746 1.524   -29.604 1.00 10.28  ? 160  TRP B CZ2 1 
ATOM 10050 C CZ3 . TRP B 1 160  ? 105.057 1.850   -29.118 1.00 15.45  ? 160  TRP B CZ3 1 
ATOM 10051 C CH2 . TRP B 1 160  ? 104.037 1.190   -29.809 1.00 11.92  ? 160  TRP B CH2 1 
ATOM 10052 N N   . PHE B 1 161  ? 102.943 7.172   -23.561 1.00 27.56  ? 161  PHE B N   1 
ATOM 10053 C CA  . PHE B 1 161  ? 103.624 8.051   -22.633 1.00 33.49  ? 161  PHE B CA  1 
ATOM 10054 C C   . PHE B 1 161  ? 103.865 7.314   -21.321 1.00 43.82  ? 161  PHE B C   1 
ATOM 10055 O O   . PHE B 1 161  ? 102.922 6.852   -20.676 1.00 71.56  ? 161  PHE B O   1 
ATOM 10056 C CB  . PHE B 1 161  ? 102.816 9.342   -22.439 1.00 36.91  ? 161  PHE B CB  1 
ATOM 10057 C CG  . PHE B 1 161  ? 103.358 10.502  -23.227 1.00 56.23  ? 161  PHE B CG  1 
ATOM 10058 C CD1 . PHE B 1 161  ? 103.192 10.553  -24.597 1.00 36.39  ? 161  PHE B CD1 1 
ATOM 10059 C CD2 . PHE B 1 161  ? 104.067 11.532  -22.604 1.00 86.85  ? 161  PHE B CD2 1 
ATOM 10060 C CE1 . PHE B 1 161  ? 103.709 11.597  -25.343 1.00 41.15  ? 161  PHE B CE1 1 
ATOM 10061 C CE2 . PHE B 1 161  ? 104.595 12.606  -23.356 1.00 87.18  ? 161  PHE B CE2 1 
ATOM 10062 C CZ  . PHE B 1 161  ? 104.411 12.628  -24.729 1.00 64.38  ? 161  PHE B CZ  1 
ATOM 10063 N N   . TYR B 1 162  ? 105.126 7.220   -20.919 1.00 41.29  ? 162  TYR B N   1 
ATOM 10064 C CA  . TYR B 1 162  ? 105.525 6.438   -19.754 1.00 37.86  ? 162  TYR B CA  1 
ATOM 10065 C C   . TYR B 1 162  ? 104.995 7.018   -18.442 1.00 32.41  ? 162  TYR B C   1 
ATOM 10066 O O   . TYR B 1 162  ? 104.954 8.239   -18.249 1.00 37.64  ? 162  TYR B O   1 
ATOM 10067 C CB  . TYR B 1 162  ? 107.044 6.375   -19.682 1.00 31.84  ? 162  TYR B CB  1 
ATOM 10068 C CG  . TYR B 1 162  ? 107.670 5.230   -20.422 1.00 37.48  ? 162  TYR B CG  1 
ATOM 10069 C CD1 . TYR B 1 162  ? 107.781 5.243   -21.810 1.00 32.65  ? 162  TYR B CD1 1 
ATOM 10070 C CD2 . TYR B 1 162  ? 108.190 4.150   -19.726 1.00 31.04  ? 162  TYR B CD2 1 
ATOM 10071 C CE1 . TYR B 1 162  ? 108.377 4.200   -22.476 1.00 33.88  ? 162  TYR B CE1 1 
ATOM 10072 C CE2 . TYR B 1 162  ? 108.782 3.111   -20.376 1.00 31.27  ? 162  TYR B CE2 1 
ATOM 10073 C CZ  . TYR B 1 162  ? 108.875 3.135   -21.746 1.00 38.62  ? 162  TYR B CZ  1 
ATOM 10074 O OH  . TYR B 1 162  ? 109.475 2.075   -22.371 1.00 37.80  ? 162  TYR B OH  1 
ATOM 10075 N N   . ILE B 1 163  ? 104.637 6.110   -17.519 1.00 45.92  ? 163  ILE B N   1 
ATOM 10076 C CA  . ILE B 1 163  ? 104.196 6.418   -16.152 1.00 54.80  ? 163  ILE B CA  1 
ATOM 10077 C C   . ILE B 1 163  ? 104.900 5.451   -15.188 1.00 59.39  ? 163  ILE B C   1 
ATOM 10078 O O   . ILE B 1 163  ? 105.065 4.267   -15.511 1.00 51.72  ? 163  ILE B O   1 
ATOM 10079 C CB  . ILE B 1 163  ? 102.659 6.318   -16.008 1.00 40.99  ? 163  ILE B CB  1 
ATOM 10080 C CG1 . ILE B 1 163  ? 102.160 7.191   -14.848 1.00 30.85  ? 163  ILE B CG1 1 
ATOM 10081 C CG2 . ILE B 1 163  ? 102.241 4.873   -15.812 1.00 39.29  ? 163  ILE B CG2 1 
ATOM 10082 C CD1 . ILE B 1 163  ? 100.793 6.813   -14.331 1.00 20.22  ? 163  ILE B CD1 1 
ATOM 10083 N N   . GLN B 1 164  ? 105.302 5.947   -14.005 1.00 56.52  ? 164  GLN B N   1 
ATOM 10084 C CA  . GLN B 1 164  ? 106.264 5.250   -13.147 1.00 49.26  ? 164  GLN B CA  1 
ATOM 10085 C C   . GLN B 1 164  ? 106.216 5.807   -11.712 1.00 40.46  ? 164  GLN B C   1 
ATOM 10086 O O   . GLN B 1 164  ? 105.992 7.009   -11.523 1.00 38.67  ? 164  GLN B O   1 
ATOM 10087 C CB  . GLN B 1 164  ? 107.687 5.372   -13.740 1.00 64.99  ? 164  GLN B CB  1 
ATOM 10088 C CG  . GLN B 1 164  ? 108.167 4.198   -14.685 1.00 67.72  ? 164  GLN B CG  1 
ATOM 10089 C CD  . GLN B 1 164  ? 107.805 4.324   -16.190 1.00 42.05  ? 164  GLN B CD  1 
ATOM 10090 O OE1 . GLN B 1 164  ? 108.172 5.294   -16.859 1.00 35.51  ? 164  GLN B OE1 1 
ATOM 10091 N NE2 . GLN B 1 164  ? 107.113 3.312   -16.721 1.00 30.87  ? 164  GLN B NE2 1 
ATOM 10092 N N   . PRO B 1 165  ? 106.428 4.965   -10.691 1.00 37.52  ? 165  PRO B N   1 
ATOM 10093 C CA  . PRO B 1 165  ? 106.373 5.456   -9.303  1.00 39.80  ? 165  PRO B CA  1 
ATOM 10094 C C   . PRO B 1 165  ? 107.550 6.366   -8.950  1.00 39.63  ? 165  PRO B C   1 
ATOM 10095 O O   . PRO B 1 165  ? 108.708 6.084   -9.279  1.00 33.93  ? 165  PRO B O   1 
ATOM 10096 C CB  . PRO B 1 165  ? 106.384 4.169   -8.469  1.00 40.34  ? 165  PRO B CB  1 
ATOM 10097 C CG  . PRO B 1 165  ? 107.050 3.164   -9.335  1.00 46.27  ? 165  PRO B CG  1 
ATOM 10098 C CD  . PRO B 1 165  ? 106.654 3.508   -10.744 1.00 49.80  ? 165  PRO B CD  1 
ATOM 10099 N N   . PHE B 1 166  ? 107.223 7.463   -8.243  1.00 45.95  ? 166  PHE B N   1 
ATOM 10100 C CA  . PHE B 1 166  ? 108.203 8.498   -7.907  1.00 57.72  ? 166  PHE B CA  1 
ATOM 10101 C C   . PHE B 1 166  ? 109.410 7.895   -7.195  1.00 55.72  ? 166  PHE B C   1 
ATOM 10102 O O   . PHE B 1 166  ? 110.562 8.264   -7.461  1.00 66.36  ? 166  PHE B O   1 
ATOM 10103 C CB  . PHE B 1 166  ? 107.542 9.595   -7.034  1.00 49.11  ? 166  PHE B CB  1 
ATOM 10104 C CG  . PHE B 1 166  ? 107.907 11.033  -7.442  1.00 57.09  ? 166  PHE B CG  1 
ATOM 10105 C CD1 . PHE B 1 166  ? 107.368 11.583  -8.588  1.00 39.25  ? 166  PHE B CD1 1 
ATOM 10106 C CD2 . PHE B 1 166  ? 108.794 11.822  -6.688  1.00 53.59  ? 166  PHE B CD2 1 
ATOM 10107 C CE1 . PHE B 1 166  ? 107.709 12.852  -8.982  1.00 27.41  ? 166  PHE B CE1 1 
ATOM 10108 C CE2 . PHE B 1 166  ? 109.129 13.129  -7.096  1.00 29.13  ? 166  PHE B CE2 1 
ATOM 10109 C CZ  . PHE B 1 166  ? 108.573 13.637  -8.237  1.00 23.47  ? 166  PHE B CZ  1 
ATOM 10110 N N   . TYR B 1 167  ? 109.163 6.923   -6.331  1.00 42.70  ? 167  TYR B N   1 
ATOM 10111 C CA  . TYR B 1 167  ? 110.135 6.459   -5.364  1.00 32.19  ? 167  TYR B CA  1 
ATOM 10112 C C   . TYR B 1 167  ? 109.992 4.956   -5.259  1.00 22.62  ? 167  TYR B C   1 
ATOM 10113 O O   . TYR B 1 167  ? 109.163 4.341   -5.934  1.00 25.19  ? 167  TYR B O   1 
ATOM 10114 C CB  . TYR B 1 167  ? 109.958 7.148   -3.996  1.00 31.21  ? 167  TYR B CB  1 
ATOM 10115 C CG  . TYR B 1 167  ? 108.594 7.780   -3.706  1.00 30.69  ? 167  TYR B CG  1 
ATOM 10116 C CD1 . TYR B 1 167  ? 107.451 7.439   -4.440  1.00 24.12  ? 167  TYR B CD1 1 
ATOM 10117 C CD2 . TYR B 1 167  ? 108.452 8.710   -2.684  1.00 27.51  ? 167  TYR B CD2 1 
ATOM 10118 C CE1 . TYR B 1 167  ? 106.231 8.007   -4.182  1.00 19.39  ? 167  TYR B CE1 1 
ATOM 10119 C CE2 . TYR B 1 167  ? 107.228 9.276   -2.416  1.00 24.29  ? 167  TYR B CE2 1 
ATOM 10120 C CZ  . TYR B 1 167  ? 106.126 8.915   -3.178  1.00 20.25  ? 167  TYR B CZ  1 
ATOM 10121 O OH  . TYR B 1 167  ? 104.886 9.435   -2.961  1.00 15.73  ? 167  TYR B OH  1 
ATOM 10122 N N   . LYS B 1 168  ? 110.811 4.351   -4.420  1.00 14.38  ? 168  LYS B N   1 
ATOM 10123 C CA  . LYS B 1 168  ? 110.640 2.935   -4.171  1.00 9.20   ? 168  LYS B CA  1 
ATOM 10124 C C   . LYS B 1 168  ? 109.616 2.742   -3.058  1.00 14.64  ? 168  LYS B C   1 
ATOM 10125 O O   . LYS B 1 168  ? 109.934 2.425   -1.910  1.00 12.86  ? 168  LYS B O   1 
ATOM 10126 C CB  . LYS B 1 168  ? 111.976 2.291   -3.864  1.00 8.79   ? 168  LYS B CB  1 
ATOM 10127 C CG  . LYS B 1 168  ? 112.465 1.484   -5.042  1.00 8.79   ? 168  LYS B CG  1 
ATOM 10128 C CD  . LYS B 1 168  ? 113.546 0.553   -4.608  1.00 9.61   ? 168  LYS B CD  1 
ATOM 10129 C CE  . LYS B 1 168  ? 114.828 1.312   -4.359  1.00 8.79   ? 168  LYS B CE  1 
ATOM 10130 N NZ  . LYS B 1 168  ? 114.724 2.262   -3.217  1.00 8.79   ? 168  LYS B NZ  1 
ATOM 10131 N N   . LEU B 1 169  ? 108.357 3.011   -3.418  1.00 18.40  ? 169  LEU B N   1 
ATOM 10132 C CA  . LEU B 1 169  ? 107.184 2.559   -2.675  1.00 21.20  ? 169  LEU B CA  1 
ATOM 10133 C C   . LEU B 1 169  ? 106.614 1.253   -3.220  1.00 32.88  ? 169  LEU B C   1 
ATOM 10134 O O   . LEU B 1 169  ? 106.190 0.398   -2.436  1.00 49.85  ? 169  LEU B O   1 
ATOM 10135 C CB  . LEU B 1 169  ? 106.079 3.611   -2.699  1.00 17.14  ? 169  LEU B CB  1 
ATOM 10136 C CG  . LEU B 1 169  ? 106.091 4.563   -1.527  1.00 16.87  ? 169  LEU B CG  1 
ATOM 10137 C CD1 . LEU B 1 169  ? 106.802 5.735   -2.054  1.00 17.91  ? 169  LEU B CD1 1 
ATOM 10138 C CD2 . LEU B 1 169  ? 104.723 4.949   -1.157  1.00 21.59  ? 169  LEU B CD2 1 
ATOM 10139 N N   . ARG B 1 170  ? 106.547 1.103   -4.547  1.00 27.10  ? 170  ARG B N   1 
ATOM 10140 C CA  . ARG B 1 170  ? 106.016 -0.101  -5.178  1.00 19.72  ? 170  ARG B CA  1 
ATOM 10141 C C   . ARG B 1 170  ? 106.643 -0.257  -6.550  1.00 16.92  ? 170  ARG B C   1 
ATOM 10142 O O   . ARG B 1 170  ? 106.791 0.723   -7.285  1.00 15.94  ? 170  ARG B O   1 
ATOM 10143 C CB  . ARG B 1 170  ? 104.502 -0.052  -5.304  1.00 18.76  ? 170  ARG B CB  1 
ATOM 10144 C CG  . ARG B 1 170  ? 103.854 0.318   -4.014  1.00 13.50  ? 170  ARG B CG  1 
ATOM 10145 C CD  . ARG B 1 170  ? 102.407 0.003   -4.069  1.00 8.91   ? 170  ARG B CD  1 
ATOM 10146 N NE  . ARG B 1 170  ? 101.840 -0.143  -2.743  1.00 8.91   ? 170  ARG B NE  1 
ATOM 10147 C CZ  . ARG B 1 170  ? 101.191 0.826   -2.124  1.00 8.91   ? 170  ARG B CZ  1 
ATOM 10148 N NH1 . ARG B 1 170  ? 101.042 1.992   -2.720  1.00 8.91   ? 170  ARG B NH1 1 
ATOM 10149 N NH2 . ARG B 1 170  ? 100.687 0.629   -0.920  1.00 8.91   ? 170  ARG B NH2 1 
ATOM 10150 N N   . SER B 1 171  ? 106.993 -1.488  -6.887  1.00 15.13  ? 171  SER B N   1 
ATOM 10151 C CA  . SER B 1 171  ? 107.822 -1.787  -8.042  1.00 17.20  ? 171  SER B CA  1 
ATOM 10152 C C   . SER B 1 171  ? 107.095 -2.819  -8.886  1.00 20.63  ? 171  SER B C   1 
ATOM 10153 O O   . SER B 1 171  ? 107.455 -3.998  -8.892  1.00 33.83  ? 171  SER B O   1 
ATOM 10154 C CB  . SER B 1 171  ? 109.196 -2.285  -7.615  1.00 21.01  ? 171  SER B CB  1 
ATOM 10155 O OG  . SER B 1 171  ? 109.940 -1.264  -6.988  1.00 28.00  ? 171  SER B OG  1 
ATOM 10156 N N   . ILE B 1 172  ? 106.043 -2.382  -9.564  1.00 20.47  ? 172  ILE B N   1 
ATOM 10157 C CA  . ILE B 1 172  ? 105.403 -3.207  -10.584 1.00 23.45  ? 172  ILE B CA  1 
ATOM 10158 C C   . ILE B 1 172  ? 104.868 -4.483  -9.921  1.00 14.07  ? 172  ILE B C   1 
ATOM 10159 O O   . ILE B 1 172  ? 104.968 -4.647  -8.698  1.00 11.46  ? 172  ILE B O   1 
ATOM 10160 C CB  . ILE B 1 172  ? 106.400 -3.488  -11.737 1.00 25.18  ? 172  ILE B CB  1 
ATOM 10161 C CG1 . ILE B 1 172  ? 107.402 -2.331  -11.898 1.00 16.78  ? 172  ILE B CG1 1 
ATOM 10162 C CG2 . ILE B 1 172  ? 105.693 -3.629  -13.060 1.00 27.40  ? 172  ILE B CG2 1 
ATOM 10163 C CD1 . ILE B 1 172  ? 108.335 -2.489  -13.102 1.00 8.94   ? 172  ILE B CD1 1 
ATOM 10164 N N   . GLY B 1 173  ? 104.259 -5.376  -10.699 1.00 8.88   ? 173  GLY B N   1 
ATOM 10165 C CA  . GLY B 1 173  ? 103.741 -6.606  -10.146 1.00 8.88   ? 173  GLY B CA  1 
ATOM 10166 C C   . GLY B 1 173  ? 102.409 -6.484  -9.453  1.00 8.88   ? 173  GLY B C   1 
ATOM 10167 O O   . GLY B 1 173  ? 101.852 -7.508  -9.046  1.00 8.88   ? 173  GLY B O   1 
ATOM 10168 N N   . ASP B 1 174  ? 101.862 -5.278  -9.331  1.00 8.95   ? 174  ASP B N   1 
ATOM 10169 C CA  . ASP B 1 174  ? 100.639 -5.075  -8.571  1.00 8.95   ? 174  ASP B CA  1 
ATOM 10170 C C   . ASP B 1 174  ? 99.830  -3.897  -9.106  1.00 12.59  ? 174  ASP B C   1 
ATOM 10171 O O   . ASP B 1 174  ? 100.344 -3.056  -9.848  1.00 13.83  ? 174  ASP B O   1 
ATOM 10172 C CB  . ASP B 1 174  ? 100.964 -4.841  -7.107  1.00 8.95   ? 174  ASP B CB  1 
ATOM 10173 C CG  . ASP B 1 174  ? 100.764 -6.061  -6.287  1.00 9.73   ? 174  ASP B CG  1 
ATOM 10174 O OD1 . ASP B 1 174  ? 99.590  -6.346  -5.973  1.00 9.93   ? 174  ASP B OD1 1 
ATOM 10175 O OD2 . ASP B 1 174  ? 101.773 -6.726  -5.961  1.00 11.60  ? 174  ASP B OD2 1 
ATOM 10176 N N   . SER B 1 175  ? 98.553  -3.834  -8.684  1.00 16.72  ? 175  SER B N   1 
ATOM 10177 C CA  . SER B 1 175  ? 97.601  -2.801  -9.111  1.00 20.06  ? 175  SER B CA  1 
ATOM 10178 C C   . SER B 1 175  ? 97.748  -1.530  -8.278  1.00 22.28  ? 175  SER B C   1 
ATOM 10179 O O   . SER B 1 175  ? 97.801  -1.590  -7.047  1.00 23.46  ? 175  SER B O   1 
ATOM 10180 C CB  . SER B 1 175  ? 96.156  -3.308  -8.991  1.00 13.81  ? 175  SER B CB  1 
ATOM 10181 O OG  . SER B 1 175  ? 95.850  -4.347  -9.906  1.00 10.23  ? 175  SER B OG  1 
ATOM 10182 N N   . VAL B 1 176  ? 97.787  -0.371  -8.950  1.00 20.22  ? 176  VAL B N   1 
ATOM 10183 C CA  . VAL B 1 176  ? 97.896  0.889   -8.223  1.00 23.17  ? 176  VAL B CA  1 
ATOM 10184 C C   . VAL B 1 176  ? 96.757  1.020   -7.209  1.00 27.60  ? 176  VAL B C   1 
ATOM 10185 O O   . VAL B 1 176  ? 95.635  0.550   -7.432  1.00 36.24  ? 176  VAL B O   1 
ATOM 10186 C CB  . VAL B 1 176  ? 97.905  2.075   -9.201  1.00 18.32  ? 176  VAL B CB  1 
ATOM 10187 C CG1 . VAL B 1 176  ? 98.185  3.371   -8.475  1.00 22.73  ? 176  VAL B CG1 1 
ATOM 10188 C CG2 . VAL B 1 176  ? 98.973  1.858   -10.204 1.00 19.02  ? 176  VAL B CG2 1 
ATOM 10189 N N   . VAL B 1 177  ? 97.062  1.661   -6.062  1.00 35.44  ? 177  VAL B N   1 
ATOM 10190 C CA  . VAL B 1 177  ? 96.085  2.069   -5.053  1.00 30.03  ? 177  VAL B CA  1 
ATOM 10191 C C   . VAL B 1 177  ? 95.649  3.500   -5.349  1.00 25.20  ? 177  VAL B C   1 
ATOM 10192 O O   . VAL B 1 177  ? 96.406  4.291   -5.920  1.00 26.52  ? 177  VAL B O   1 
ATOM 10193 C CB  . VAL B 1 177  ? 96.676  1.942   -3.632  1.00 31.47  ? 177  VAL B CB  1 
ATOM 10194 C CG1 . VAL B 1 177  ? 95.683  2.450   -2.599  1.00 23.54  ? 177  VAL B CG1 1 
ATOM 10195 C CG2 . VAL B 1 177  ? 97.118  0.488   -3.344  1.00 28.85  ? 177  VAL B CG2 1 
ATOM 10196 N N   . ILE B 1 178  ? 94.428  3.865   -4.973  1.00 16.86  ? 178  ILE B N   1 
ATOM 10197 C CA  . ILE B 1 178  ? 93.920  5.134   -5.472  1.00 15.66  ? 178  ILE B CA  1 
ATOM 10198 C C   . ILE B 1 178  ? 94.556  6.295   -4.725  1.00 16.16  ? 178  ILE B C   1 
ATOM 10199 O O   . ILE B 1 178  ? 94.735  6.256   -3.501  1.00 13.92  ? 178  ILE B O   1 
ATOM 10200 C CB  . ILE B 1 178  ? 92.391  5.200   -5.391  1.00 16.53  ? 178  ILE B CB  1 
ATOM 10201 C CG1 . ILE B 1 178  ? 91.809  5.136   -6.810  1.00 17.74  ? 178  ILE B CG1 1 
ATOM 10202 C CG2 . ILE B 1 178  ? 91.986  6.465   -4.654  1.00 17.78  ? 178  ILE B CG2 1 
ATOM 10203 C CD1 . ILE B 1 178  ? 90.288  5.148   -6.901  1.00 23.78  ? 178  ILE B CD1 1 
ATOM 10204 N N   . GLY B 1 179  ? 94.895  7.343   -5.476  1.00 16.65  ? 179  GLY B N   1 
ATOM 10205 C CA  . GLY B 1 179  ? 95.444  8.572   -4.934  1.00 18.17  ? 179  GLY B CA  1 
ATOM 10206 C C   . GLY B 1 179  ? 96.958  8.627   -4.899  1.00 17.12  ? 179  GLY B C   1 
ATOM 10207 O O   . GLY B 1 179  ? 97.561  8.284   -3.875  1.00 15.03  ? 179  GLY B O   1 
ATOM 10208 N N   . ASP B 1 180  ? 97.597  9.054   -5.986  1.00 16.74  ? 180  ASP B N   1 
ATOM 10209 C CA  . ASP B 1 180  ? 99.050  9.115   -5.974  1.00 18.45  ? 180  ASP B CA  1 
ATOM 10210 C C   . ASP B 1 180  ? 99.550  9.999   -7.106  1.00 18.16  ? 180  ASP B C   1 
ATOM 10211 O O   . ASP B 1 180  ? 98.792  10.451  -7.972  1.00 13.78  ? 180  ASP B O   1 
ATOM 10212 C CB  . ASP B 1 180  ? 99.687  7.721   -6.065  1.00 18.72  ? 180  ASP B CB  1 
ATOM 10213 C CG  . ASP B 1 180  ? 101.098 7.670   -5.448  1.00 19.91  ? 180  ASP B CG  1 
ATOM 10214 O OD1 . ASP B 1 180  ? 101.246 8.062   -4.273  1.00 16.05  ? 180  ASP B OD1 1 
ATOM 10215 O OD2 . ASP B 1 180  ? 102.062 7.241   -6.124  1.00 18.05  ? 180  ASP B OD2 1 
ATOM 10216 N N   . LYS B 1 181  ? 100.878 10.127  -7.123  1.00 27.02  ? 181  LYS B N   1 
ATOM 10217 C CA  . LYS B 1 181  ? 101.640 11.190  -7.769  1.00 25.26  ? 181  LYS B CA  1 
ATOM 10218 C C   . LYS B 1 181  ? 102.904 10.609  -8.396  1.00 25.67  ? 181  LYS B C   1 
ATOM 10219 O O   . LYS B 1 181  ? 103.739 10.037  -7.688  1.00 28.02  ? 181  LYS B O   1 
ATOM 10220 C CB  . LYS B 1 181  ? 102.040 12.257  -6.739  1.00 24.79  ? 181  LYS B CB  1 
ATOM 10221 C CG  . LYS B 1 181  ? 100.971 13.230  -6.256  1.00 27.56  ? 181  LYS B CG  1 
ATOM 10222 C CD  . LYS B 1 181  ? 101.308 14.687  -6.497  1.00 18.39  ? 181  LYS B CD  1 
ATOM 10223 C CE  . LYS B 1 181  ? 100.087 15.626  -6.799  1.00 16.18  ? 181  LYS B CE  1 
ATOM 10224 N NZ  . LYS B 1 181  ? 100.278 16.942  -7.413  1.00 13.05  ? 181  LYS B NZ  1 
ATOM 10225 N N   . VAL B 1 182  ? 103.085 10.798  -9.702  1.00 23.67  ? 182  VAL B N   1 
ATOM 10226 C CA  . VAL B 1 182  ? 104.153 10.101  -10.408 1.00 26.66  ? 182  VAL B CA  1 
ATOM 10227 C C   . VAL B 1 182  ? 104.669 10.957  -11.561 1.00 27.59  ? 182  VAL B C   1 
ATOM 10228 O O   . VAL B 1 182  ? 103.906 11.706  -12.175 1.00 25.50  ? 182  VAL B O   1 
ATOM 10229 C CB  . VAL B 1 182  ? 103.643 8.729   -10.889 1.00 30.73  ? 182  VAL B CB  1 
ATOM 10230 C CG1 . VAL B 1 182  ? 103.550 7.806   -9.706  1.00 29.51  ? 182  VAL B CG1 1 
ATOM 10231 C CG2 . VAL B 1 182  ? 102.258 8.875   -11.515 1.00 23.46  ? 182  VAL B CG2 1 
ATOM 10232 N N   . VAL B 1 183  ? 105.972 10.821  -11.865 1.00 28.19  ? 183  VAL B N   1 
ATOM 10233 C CA  . VAL B 1 183  ? 106.611 11.554  -12.977 1.00 31.85  ? 183  VAL B CA  1 
ATOM 10234 C C   . VAL B 1 183  ? 106.108 11.031  -14.319 1.00 32.12  ? 183  VAL B C   1 
ATOM 10235 O O   . VAL B 1 183  ? 105.629 9.902   -14.418 1.00 50.13  ? 183  VAL B O   1 
ATOM 10236 C CB  . VAL B 1 183  ? 108.140 11.426  -12.897 1.00 29.16  ? 183  VAL B CB  1 
ATOM 10237 C CG1 . VAL B 1 183  ? 108.775 12.752  -13.134 1.00 29.57  ? 183  VAL B CG1 1 
ATOM 10238 C CG2 . VAL B 1 183  ? 108.537 10.880  -11.552 1.00 31.04  ? 183  VAL B CG2 1 
ATOM 10239 N N   . LEU B 1 184  ? 106.289 11.823  -15.378 1.00 28.64  ? 184  LEU B N   1 
ATOM 10240 C CA  . LEU B 1 184  ? 105.699 11.516  -16.681 1.00 22.60  ? 184  LEU B CA  1 
ATOM 10241 C C   . LEU B 1 184  ? 106.774 11.487  -17.761 1.00 18.80  ? 184  LEU B C   1 
ATOM 10242 O O   . LEU B 1 184  ? 107.302 12.526  -18.133 1.00 18.29  ? 184  LEU B O   1 
ATOM 10243 C CB  . LEU B 1 184  ? 104.616 12.542  -17.019 1.00 17.68  ? 184  LEU B CB  1 
ATOM 10244 C CG  . LEU B 1 184  ? 103.279 12.121  -17.621 1.00 16.75  ? 184  LEU B CG  1 
ATOM 10245 C CD1 . LEU B 1 184  ? 102.204 12.982  -17.030 1.00 14.27  ? 184  LEU B CD1 1 
ATOM 10246 C CD2 . LEU B 1 184  ? 103.301 12.307  -19.112 1.00 30.92  ? 184  LEU B CD2 1 
ATOM 10247 N N   . ASN B 1 185  ? 107.021 10.326  -18.341 1.00 22.82  ? 185  ASN B N   1 
ATOM 10248 C CA  . ASN B 1 185  ? 108.244 10.125  -19.106 1.00 21.20  ? 185  ASN B CA  1 
ATOM 10249 C C   . ASN B 1 185  ? 107.972 9.929   -20.603 1.00 30.15  ? 185  ASN B C   1 
ATOM 10250 O O   . ASN B 1 185  ? 107.403 8.888   -20.953 1.00 35.85  ? 185  ASN B O   1 
ATOM 10251 C CB  . ASN B 1 185  ? 108.894 8.873   -18.498 1.00 21.85  ? 185  ASN B CB  1 
ATOM 10252 C CG  . ASN B 1 185  ? 110.333 9.047   -18.134 1.00 18.49  ? 185  ASN B CG  1 
ATOM 10253 O OD1 . ASN B 1 185  ? 111.148 8.176   -18.443 1.00 20.94  ? 185  ASN B OD1 1 
ATOM 10254 N ND2 . ASN B 1 185  ? 110.662 10.143  -17.458 1.00 15.25  ? 185  ASN B ND2 1 
ATOM 10255 N N   . PRO B 1 186  ? 108.350 10.816  -21.563 1.00 30.14  ? 186  PRO B N   1 
ATOM 10256 C CA  . PRO B 1 186  ? 108.199 10.433  -22.977 1.00 34.98  ? 186  PRO B CA  1 
ATOM 10257 C C   . PRO B 1 186  ? 108.736 9.047   -23.303 1.00 42.35  ? 186  PRO B C   1 
ATOM 10258 O O   . PRO B 1 186  ? 109.817 8.658   -22.860 1.00 42.04  ? 186  PRO B O   1 
ATOM 10259 C CB  . PRO B 1 186  ? 109.001 11.501  -23.726 1.00 25.18  ? 186  PRO B CB  1 
ATOM 10260 C CG  . PRO B 1 186  ? 109.041 12.650  -22.852 1.00 21.34  ? 186  PRO B CG  1 
ATOM 10261 C CD  . PRO B 1 186  ? 108.428 12.287  -21.515 1.00 23.55  ? 186  PRO B CD  1 
ATOM 10262 N N   . VAL B 1 187  ? 108.004 8.319   -24.149 1.00 34.54  ? 187  VAL B N   1 
ATOM 10263 C CA  . VAL B 1 187  ? 108.454 6.976   -24.502 1.00 36.84  ? 187  VAL B CA  1 
ATOM 10264 C C   . VAL B 1 187  ? 109.720 7.031   -25.355 1.00 37.32  ? 187  VAL B C   1 
ATOM 10265 O O   . VAL B 1 187  ? 110.551 6.116   -25.301 1.00 40.92  ? 187  VAL B O   1 
ATOM 10266 C CB  . VAL B 1 187  ? 107.308 6.208   -25.188 1.00 32.47  ? 187  VAL B CB  1 
ATOM 10267 C CG1 . VAL B 1 187  ? 106.579 7.135   -26.113 1.00 37.40  ? 187  VAL B CG1 1 
ATOM 10268 C CG2 . VAL B 1 187  ? 107.835 5.005   -25.940 1.00 29.69  ? 187  VAL B CG2 1 
ATOM 10269 N N   . ASN B 1 188  ? 109.907 8.120   -26.121 1.00 39.70  ? 188  ASN B N   1 
ATOM 10270 C CA  . ASN B 1 188  ? 111.102 8.277   -26.952 1.00 42.02  ? 188  ASN B CA  1 
ATOM 10271 C C   . ASN B 1 188  ? 112.342 8.544   -26.099 1.00 50.90  ? 188  ASN B C   1 
ATOM 10272 O O   . ASN B 1 188  ? 113.270 7.725   -26.056 1.00 66.04  ? 188  ASN B O   1 
ATOM 10273 C CB  . ASN B 1 188  ? 110.891 9.411   -27.961 1.00 26.03  ? 188  ASN B CB  1 
ATOM 10274 C CG  . ASN B 1 188  ? 109.457 9.505   -28.428 1.00 19.27  ? 188  ASN B CG  1 
ATOM 10275 O OD1 . ASN B 1 188  ? 108.730 8.525   -28.399 1.00 16.95  ? 188  ASN B OD1 1 
ATOM 10276 N ND2 . ASN B 1 188  ? 109.039 10.687  -28.843 1.00 16.84  ? 188  ASN B ND2 1 
ATOM 10277 N N   . ALA B 1 189  ? 112.377 9.687   -25.404 1.00 45.25  ? 189  ALA B N   1 
ATOM 10278 C CA  . ALA B 1 189  ? 113.546 10.053  -24.606 1.00 33.16  ? 189  ALA B CA  1 
ATOM 10279 C C   . ALA B 1 189  ? 113.422 9.732   -23.115 1.00 40.82  ? 189  ALA B C   1 
ATOM 10280 O O   . ALA B 1 189  ? 114.411 9.886   -22.392 1.00 33.39  ? 189  ALA B O   1 
ATOM 10281 C CB  . ALA B 1 189  ? 113.858 11.545  -24.770 1.00 19.65  ? 189  ALA B CB  1 
ATOM 10282 N N   . GLY B 1 190  ? 112.251 9.305   -22.631 1.00 46.56  ? 190  GLY B N   1 
ATOM 10283 C CA  . GLY B 1 190  ? 112.050 8.990   -21.219 1.00 46.69  ? 190  GLY B CA  1 
ATOM 10284 C C   . GLY B 1 190  ? 112.155 10.161  -20.246 1.00 40.10  ? 190  GLY B C   1 
ATOM 10285 O O   . GLY B 1 190  ? 113.016 10.159  -19.359 1.00 46.21  ? 190  GLY B O   1 
ATOM 10286 N N   . GLN B 1 191  ? 111.259 11.178  -20.342 1.00 36.01  ? 191  GLN B N   1 
ATOM 10287 C CA  . GLN B 1 191  ? 111.488 12.381  -19.543 1.00 30.51  ? 191  GLN B CA  1 
ATOM 10288 C C   . GLN B 1 191  ? 110.225 12.780  -18.797 1.00 21.20  ? 191  GLN B C   1 
ATOM 10289 O O   . GLN B 1 191  ? 109.132 12.695  -19.345 1.00 16.04  ? 191  GLN B O   1 
ATOM 10290 C CB  . GLN B 1 191  ? 111.988 13.570  -20.406 1.00 35.87  ? 191  GLN B CB  1 
ATOM 10291 C CG  . GLN B 1 191  ? 113.304 13.347  -21.218 1.00 30.71  ? 191  GLN B CG  1 
ATOM 10292 C CD  . GLN B 1 191  ? 114.466 14.229  -20.767 1.00 16.63  ? 191  GLN B CD  1 
ATOM 10293 O OE1 . GLN B 1 191  ? 114.487 14.721  -19.634 1.00 13.11  ? 191  GLN B OE1 1 
ATOM 10294 N NE2 . GLN B 1 191  ? 115.439 14.431  -21.660 1.00 8.87   ? 191  GLN B NE2 1 
ATOM 10295 N N   . PRO B 1 192  ? 110.315 13.200  -17.543 1.00 19.47  ? 192  PRO B N   1 
ATOM 10296 C CA  . PRO B 1 192  ? 109.128 13.727  -16.865 1.00 20.84  ? 192  PRO B CA  1 
ATOM 10297 C C   . PRO B 1 192  ? 108.294 14.692  -17.724 1.00 20.83  ? 192  PRO B C   1 
ATOM 10298 O O   . PRO B 1 192  ? 108.830 15.455  -18.525 1.00 19.15  ? 192  PRO B O   1 
ATOM 10299 C CB  . PRO B 1 192  ? 109.743 14.415  -15.639 1.00 24.42  ? 192  PRO B CB  1 
ATOM 10300 C CG  . PRO B 1 192  ? 110.912 13.430  -15.280 1.00 20.95  ? 192  PRO B CG  1 
ATOM 10301 C CD  . PRO B 1 192  ? 111.416 12.885  -16.609 1.00 20.12  ? 192  PRO B CD  1 
ATOM 10302 N N   . LEU B 1 193  ? 106.951 14.567  -17.617 1.00 21.09  ? 193  LEU B N   1 
ATOM 10303 C CA  . LEU B 1 193  ? 106.013 15.591  -18.105 1.00 20.73  ? 193  LEU B CA  1 
ATOM 10304 C C   . LEU B 1 193  ? 105.782 16.616  -17.020 1.00 24.08  ? 193  LEU B C   1 
ATOM 10305 O O   . LEU B 1 193  ? 105.417 16.270  -15.890 1.00 24.85  ? 193  LEU B O   1 
ATOM 10306 C CB  . LEU B 1 193  ? 104.650 15.040  -18.498 1.00 19.39  ? 193  LEU B CB  1 
ATOM 10307 C CG  . LEU B 1 193  ? 103.552 16.105  -18.280 1.00 18.60  ? 193  LEU B CG  1 
ATOM 10308 C CD1 . LEU B 1 193  ? 102.426 15.746  -19.182 1.00 32.98  ? 193  LEU B CD1 1 
ATOM 10309 C CD2 . LEU B 1 193  ? 103.004 16.240  -16.838 1.00 22.37  ? 193  LEU B CD2 1 
ATOM 10310 N N   . HIS B 1 194  ? 105.908 17.874  -17.382 1.00 27.30  ? 194  HIS B N   1 
ATOM 10311 C CA  . HIS B 1 194  ? 105.883 18.954  -16.420 1.00 29.10  ? 194  HIS B CA  1 
ATOM 10312 C C   . HIS B 1 194  ? 104.816 19.940  -16.846 1.00 26.00  ? 194  HIS B C   1 
ATOM 10313 O O   . HIS B 1 194  ? 104.506 20.071  -18.037 1.00 25.06  ? 194  HIS B O   1 
ATOM 10314 C CB  . HIS B 1 194  ? 107.273 19.652  -16.322 1.00 42.03  ? 194  HIS B CB  1 
ATOM 10315 C CG  . HIS B 1 194  ? 108.450 18.713  -16.342 1.00 35.67  ? 194  HIS B CG  1 
ATOM 10316 N ND1 . HIS B 1 194  ? 109.224 18.504  -17.466 1.00 27.00  ? 194  HIS B ND1 1 
ATOM 10317 C CD2 . HIS B 1 194  ? 108.980 17.929  -15.373 1.00 35.33  ? 194  HIS B CD2 1 
ATOM 10318 C CE1 . HIS B 1 194  ? 110.179 17.631  -17.183 1.00 22.67  ? 194  HIS B CE1 1 
ATOM 10319 N NE2 . HIS B 1 194  ? 110.046 17.257  -15.923 1.00 24.33  ? 194  HIS B NE2 1 
ATOM 10320 N N   . ALA B 1 195  ? 104.257 20.630  -15.870 1.00 25.14  ? 195  ALA B N   1 
ATOM 10321 C CA  . ALA B 1 195  ? 103.344 21.694  -16.211 1.00 27.49  ? 195  ALA B CA  1 
ATOM 10322 C C   . ALA B 1 195  ? 104.072 23.002  -16.535 1.00 33.76  ? 195  ALA B C   1 
ATOM 10323 O O   . ALA B 1 195  ? 103.405 23.979  -16.875 1.00 34.49  ? 195  ALA B O   1 
ATOM 10324 C CB  . ALA B 1 195  ? 102.345 21.881  -15.076 1.00 28.37  ? 195  ALA B CB  1 
ATOM 10325 N N   . SER B 1 196  ? 105.418 23.041  -16.441 1.00 33.09  ? 196  SER B N   1 
ATOM 10326 C CA  . SER B 1 196  ? 106.289 24.165  -16.832 1.00 35.95  ? 196  SER B CA  1 
ATOM 10327 C C   . SER B 1 196  ? 105.885 25.505  -16.208 1.00 33.94  ? 196  SER B C   1 
ATOM 10328 O O   . SER B 1 196  ? 104.759 25.659  -15.724 1.00 32.86  ? 196  SER B O   1 
ATOM 10329 C CB  . SER B 1 196  ? 106.344 24.285  -18.364 1.00 37.01  ? 196  SER B CB  1 
ATOM 10330 O OG  . SER B 1 196  ? 107.621 24.696  -18.834 1.00 44.58  ? 196  SER B OG  1 
ATOM 10331 N N   . SER B 1 197  ? 106.788 26.496  -16.217 1.00 43.08  ? 197  SER B N   1 
ATOM 10332 C CA  . SER B 1 197  ? 106.493 27.788  -15.588 1.00 43.98  ? 197  SER B CA  1 
ATOM 10333 C C   . SER B 1 197  ? 107.342 28.896  -16.218 1.00 45.46  ? 197  SER B C   1 
ATOM 10334 O O   . SER B 1 197  ? 108.314 29.427  -15.669 1.00 45.11  ? 197  SER B O   1 
ATOM 10335 C CB  . SER B 1 197  ? 106.714 27.715  -14.069 1.00 54.29  ? 197  SER B CB  1 
ATOM 10336 O OG  . SER B 1 197  ? 108.091 27.558  -13.771 1.00 74.34  ? 197  SER B OG  1 
ATOM 10337 N N   . HIS B 1 198  ? 106.967 29.302  -17.427 1.00 37.12  ? 198  HIS B N   1 
ATOM 10338 C CA  . HIS B 1 198  ? 107.731 30.342  -18.089 1.00 26.92  ? 198  HIS B CA  1 
ATOM 10339 C C   . HIS B 1 198  ? 107.014 31.679  -18.099 1.00 32.72  ? 198  HIS B C   1 
ATOM 10340 O O   . HIS B 1 198  ? 107.345 32.536  -18.923 1.00 33.34  ? 198  HIS B O   1 
ATOM 10341 C CB  . HIS B 1 198  ? 108.088 29.923  -19.502 1.00 18.16  ? 198  HIS B CB  1 
ATOM 10342 C CG  . HIS B 1 198  ? 109.500 30.219  -19.837 1.00 15.83  ? 198  HIS B CG  1 
ATOM 10343 N ND1 . HIS B 1 198  ? 110.099 29.785  -20.991 1.00 13.78  ? 198  HIS B ND1 1 
ATOM 10344 C CD2 . HIS B 1 198  ? 110.439 30.911  -19.155 1.00 12.07  ? 198  HIS B CD2 1 
ATOM 10345 C CE1 . HIS B 1 198  ? 111.354 30.190  -21.008 1.00 17.34  ? 198  HIS B CE1 1 
ATOM 10346 N NE2 . HIS B 1 198  ? 111.581 30.892  -19.912 1.00 14.81  ? 198  HIS B NE2 1 
ATOM 10347 N N   . GLN B 1 199  ? 106.027 31.864  -17.211 1.00 37.26  ? 199  GLN B N   1 
ATOM 10348 C CA  . GLN B 1 199  ? 105.314 33.127  -16.998 1.00 33.94  ? 199  GLN B CA  1 
ATOM 10349 C C   . GLN B 1 199  ? 104.965 33.759  -18.338 1.00 30.63  ? 199  GLN B C   1 
ATOM 10350 O O   . GLN B 1 199  ? 104.681 34.958  -18.443 1.00 25.84  ? 199  GLN B O   1 
ATOM 10351 C CB  . GLN B 1 199  ? 106.132 34.079  -16.119 1.00 37.53  ? 199  GLN B CB  1 
ATOM 10352 C CG  . GLN B 1 199  ? 106.671 33.441  -14.804 1.00 41.49  ? 199  GLN B CG  1 
ATOM 10353 C CD  . GLN B 1 199  ? 105.627 32.663  -13.982 1.00 42.87  ? 199  GLN B CD  1 
ATOM 10354 O OE1 . GLN B 1 199  ? 105.040 31.686  -14.453 1.00 42.28  ? 199  GLN B OE1 1 
ATOM 10355 N NE2 . GLN B 1 199  ? 105.423 33.084  -12.737 1.00 40.30  ? 199  GLN B NE2 1 
ATOM 10356 N N   . LEU B 1 200  ? 105.065 32.926  -19.366 1.00 28.81  ? 200  LEU B N   1 
ATOM 10357 C CA  . LEU B 1 200  ? 104.438 33.070  -20.665 1.00 30.25  ? 200  LEU B CA  1 
ATOM 10358 C C   . LEU B 1 200  ? 104.295 34.506  -21.181 1.00 33.56  ? 200  LEU B C   1 
ATOM 10359 O O   . LEU B 1 200  ? 105.064 35.391  -20.788 1.00 31.14  ? 200  LEU B O   1 
ATOM 10360 C CB  . LEU B 1 200  ? 103.106 32.331  -20.582 1.00 30.39  ? 200  LEU B CB  1 
ATOM 10361 C CG  . LEU B 1 200  ? 103.221 31.100  -21.459 1.00 22.83  ? 200  LEU B CG  1 
ATOM 10362 C CD1 . LEU B 1 200  ? 102.203 30.031  -21.110 1.00 19.62  ? 200  LEU B CD1 1 
ATOM 10363 C CD2 . LEU B 1 200  ? 102.963 31.712  -22.810 1.00 28.01  ? 200  LEU B CD2 1 
ATOM 10364 N N   . VAL B 1 201  ? 103.360 34.718  -22.119 1.00 40.07  ? 201  VAL B N   1 
ATOM 10365 C CA  . VAL B 1 201  ? 103.223 35.965  -22.877 1.00 43.81  ? 201  VAL B CA  1 
ATOM 10366 C C   . VAL B 1 201  ? 101.741 36.266  -23.130 1.00 48.27  ? 201  VAL B C   1 
ATOM 10367 O O   . VAL B 1 201  ? 101.155 37.134  -22.467 1.00 53.05  ? 201  VAL B O   1 
ATOM 10368 C CB  . VAL B 1 201  ? 104.008 35.920  -24.214 1.00 29.96  ? 201  VAL B CB  1 
ATOM 10369 C CG1 . VAL B 1 201  ? 105.475 36.381  -24.041 1.00 20.68  ? 201  VAL B CG1 1 
ATOM 10370 C CG2 . VAL B 1 201  ? 103.939 34.531  -24.846 1.00 24.37  ? 201  VAL B CG2 1 
ATOM 10371 N N   . ASP B 1 202  ? 101.122 35.535  -24.078 1.00 41.49  ? 202  ASP B N   1 
ATOM 10372 C CA  . ASP B 1 202  ? 99.765  35.866  -24.528 1.00 35.46  ? 202  ASP B CA  1 
ATOM 10373 C C   . ASP B 1 202  ? 98.736  35.730  -23.404 1.00 33.21  ? 202  ASP B C   1 
ATOM 10374 O O   . ASP B 1 202  ? 97.803  36.538  -23.306 1.00 35.27  ? 202  ASP B O   1 
ATOM 10375 C CB  . ASP B 1 202  ? 99.358  34.985  -25.717 1.00 21.55  ? 202  ASP B CB  1 
ATOM 10376 C CG  . ASP B 1 202  ? 100.538 34.526  -26.538 1.00 13.72  ? 202  ASP B CG  1 
ATOM 10377 O OD1 . ASP B 1 202  ? 101.192 35.382  -27.157 1.00 18.50  ? 202  ASP B OD1 1 
ATOM 10378 O OD2 . ASP B 1 202  ? 100.809 33.311  -26.571 1.00 9.02   ? 202  ASP B OD2 1 
ATOM 10379 N N   . ASN B 1 203  ? 98.872  34.711  -22.562 1.00 25.49  ? 203  ASN B N   1 
ATOM 10380 C CA  . ASN B 1 203  ? 97.893  34.521  -21.499 1.00 17.93  ? 203  ASN B CA  1 
ATOM 10381 C C   . ASN B 1 203  ? 98.589  34.631  -20.156 1.00 18.26  ? 203  ASN B C   1 
ATOM 10382 O O   . ASN B 1 203  ? 99.271  33.688  -19.731 1.00 19.83  ? 203  ASN B O   1 
ATOM 10383 C CB  . ASN B 1 203  ? 97.201  33.168  -21.646 1.00 13.59  ? 203  ASN B CB  1 
ATOM 10384 C CG  . ASN B 1 203  ? 95.712  33.273  -21.494 1.00 8.95   ? 203  ASN B CG  1 
ATOM 10385 O OD1 . ASN B 1 203  ? 94.961  33.130  -22.452 1.00 8.95   ? 203  ASN B OD1 1 
ATOM 10386 N ND2 . ASN B 1 203  ? 95.271  33.516  -20.279 1.00 8.95   ? 203  ASN B ND2 1 
ATOM 10387 N N   . PRO B 1 204  ? 98.463  35.746  -19.459 1.00 16.48  ? 204  PRO B N   1 
ATOM 10388 C CA  . PRO B 1 204  ? 99.248  35.929  -18.228 1.00 14.79  ? 204  PRO B CA  1 
ATOM 10389 C C   . PRO B 1 204  ? 98.929  34.911  -17.153 1.00 12.37  ? 204  PRO B C   1 
ATOM 10390 O O   . PRO B 1 204  ? 99.840  34.367  -16.521 1.00 8.91   ? 204  PRO B O   1 
ATOM 10391 C CB  . PRO B 1 204  ? 98.880  37.354  -17.798 1.00 21.80  ? 204  PRO B CB  1 
ATOM 10392 C CG  . PRO B 1 204  ? 98.307  38.014  -19.064 1.00 24.29  ? 204  PRO B CG  1 
ATOM 10393 C CD  . PRO B 1 204  ? 97.628  36.911  -19.793 1.00 19.66  ? 204  PRO B CD  1 
ATOM 10394 N N   . GLY B 1 205  ? 97.653  34.648  -16.899 1.00 10.91  ? 205  GLY B N   1 
ATOM 10395 C CA  . GLY B 1 205  ? 97.314  33.680  -15.883 1.00 9.75   ? 205  GLY B CA  1 
ATOM 10396 C C   . GLY B 1 205  ? 97.757  32.300  -16.268 1.00 11.77  ? 205  GLY B C   1 
ATOM 10397 O O   . GLY B 1 205  ? 97.770  31.402  -15.428 1.00 12.87  ? 205  GLY B O   1 
ATOM 10398 N N   . CYS B 1 206  ? 98.174  32.132  -17.511 1.00 15.17  ? 206  CYS B N   1 
ATOM 10399 C CA  . CYS B 1 206  ? 98.464  30.843  -18.116 1.00 27.51  ? 206  CYS B CA  1 
ATOM 10400 C C   . CYS B 1 206  ? 99.970  30.602  -18.228 1.00 31.61  ? 206  CYS B C   1 
ATOM 10401 O O   . CYS B 1 206  ? 100.785 31.530  -18.280 1.00 29.24  ? 206  CYS B O   1 
ATOM 10402 C CB  . CYS B 1 206  ? 97.769  30.777  -19.478 1.00 32.36  ? 206  CYS B CB  1 
ATOM 10403 S SG  . CYS B 1 206  ? 95.952  31.098  -19.283 1.00 30.84  ? 206  CYS B SG  1 
ATOM 10404 N N   . ASN B 1 207  ? 100.344 29.329  -18.268 1.00 30.86  ? 207  ASN B N   1 
ATOM 10405 C CA  . ASN B 1 207  ? 101.731 28.957  -18.045 1.00 21.72  ? 207  ASN B CA  1 
ATOM 10406 C C   . ASN B 1 207  ? 102.037 27.739  -18.892 1.00 21.99  ? 207  ASN B C   1 
ATOM 10407 O O   . ASN B 1 207  ? 101.299 26.755  -18.856 1.00 27.90  ? 207  ASN B O   1 
ATOM 10408 C CB  . ASN B 1 207  ? 101.937 28.688  -16.563 1.00 25.85  ? 207  ASN B CB  1 
ATOM 10409 C CG  . ASN B 1 207  ? 103.248 28.086  -16.268 1.00 21.69  ? 207  ASN B CG  1 
ATOM 10410 O OD1 . ASN B 1 207  ? 104.078 28.709  -15.635 1.00 21.70  ? 207  ASN B OD1 1 
ATOM 10411 N ND2 . ASN B 1 207  ? 103.443 26.854  -16.690 1.00 24.99  ? 207  ASN B ND2 1 
ATOM 10412 N N   . GLU B 1 208  ? 103.115 27.785  -19.645 1.00 19.86  ? 208  GLU B N   1 
ATOM 10413 C CA  . GLU B 1 208  ? 103.399 26.679  -20.535 1.00 31.05  ? 208  GLU B CA  1 
ATOM 10414 C C   . GLU B 1 208  ? 103.760 25.402  -19.726 1.00 41.52  ? 208  GLU B C   1 
ATOM 10415 O O   . GLU B 1 208  ? 103.945 25.475  -18.509 1.00 38.57  ? 208  GLU B O   1 
ATOM 10416 C CB  . GLU B 1 208  ? 104.489 27.115  -21.490 1.00 34.84  ? 208  GLU B CB  1 
ATOM 10417 C CG  . GLU B 1 208  ? 105.122 26.059  -22.303 1.00 35.08  ? 208  GLU B CG  1 
ATOM 10418 C CD  . GLU B 1 208  ? 106.266 26.643  -23.053 1.00 24.63  ? 208  GLU B CD  1 
ATOM 10419 O OE1 . GLU B 1 208  ? 107.342 26.819  -22.450 1.00 24.20  ? 208  GLU B OE1 1 
ATOM 10420 O OE2 . GLU B 1 208  ? 106.091 26.938  -24.250 1.00 20.30  ? 208  GLU B OE2 1 
ATOM 10421 N N   . VAL B 1 209  ? 103.812 24.233  -20.420 1.00 47.34  ? 209  VAL B N   1 
ATOM 10422 C CA  . VAL B 1 209  ? 104.013 22.881  -19.861 1.00 41.29  ? 209  VAL B CA  1 
ATOM 10423 C C   . VAL B 1 209  ? 105.051 22.121  -20.709 1.00 43.69  ? 209  VAL B C   1 
ATOM 10424 O O   . VAL B 1 209  ? 104.860 21.970  -21.923 1.00 45.86  ? 209  VAL B O   1 
ATOM 10425 C CB  . VAL B 1 209  ? 102.668 22.080  -19.802 1.00 23.89  ? 209  VAL B CB  1 
ATOM 10426 C CG1 . VAL B 1 209  ? 102.805 20.550  -19.788 1.00 22.96  ? 209  VAL B CG1 1 
ATOM 10427 C CG2 . VAL B 1 209  ? 101.832 22.488  -18.635 1.00 22.52  ? 209  VAL B CG2 1 
ATOM 10428 N N   . ASN B 1 210  ? 106.148 21.618  -20.062 1.00 36.56  ? 210  ASN B N   1 
ATOM 10429 C CA  . ASN B 1 210  ? 107.292 20.962  -20.732 1.00 38.77  ? 210  ASN B CA  1 
ATOM 10430 C C   . ASN B 1 210  ? 107.668 19.637  -20.063 1.00 35.51  ? 210  ASN B C   1 
ATOM 10431 O O   . ASN B 1 210  ? 107.744 19.576  -18.834 1.00 39.56  ? 210  ASN B O   1 
ATOM 10432 C CB  . ASN B 1 210  ? 108.568 21.865  -20.754 1.00 36.63  ? 210  ASN B CB  1 
ATOM 10433 C CG  . ASN B 1 210  ? 109.280 21.946  -19.387 1.00 27.97  ? 210  ASN B CG  1 
ATOM 10434 O OD1 . ASN B 1 210  ? 109.167 22.940  -18.670 1.00 26.55  ? 210  ASN B OD1 1 
ATOM 10435 N ND2 . ASN B 1 210  ? 110.023 20.902  -19.039 1.00 25.33  ? 210  ASN B ND2 1 
ATOM 10436 N N   . SER B 1 211  ? 107.937 18.584  -20.879 1.00 28.15  ? 211  SER B N   1 
ATOM 10437 C CA  . SER B 1 211  ? 108.300 17.230  -20.418 1.00 21.41  ? 211  SER B CA  1 
ATOM 10438 C C   . SER B 1 211  ? 109.759 16.909  -20.727 1.00 22.64  ? 211  SER B C   1 
ATOM 10439 O O   . SER B 1 211  ? 110.131 16.786  -21.899 1.00 31.58  ? 211  SER B O   1 
ATOM 10440 C CB  . SER B 1 211  ? 107.418 16.148  -21.056 1.00 16.64  ? 211  SER B CB  1 
ATOM 10441 O OG  . SER B 1 211  ? 107.746 14.864  -20.536 1.00 16.90  ? 211  SER B OG  1 
ATOM 10442 N N   . VAL B 1 212  ? 110.545 16.677  -19.664 1.00 20.17  ? 212  VAL B N   1 
ATOM 10443 C CA  . VAL B 1 212  ? 112.005 16.484  -19.653 1.00 19.92  ? 212  VAL B CA  1 
ATOM 10444 C C   . VAL B 1 212  ? 112.411 15.974  -18.272 1.00 16.81  ? 212  VAL B C   1 
ATOM 10445 O O   . VAL B 1 212  ? 111.605 15.377  -17.558 1.00 15.73  ? 212  VAL B O   1 
ATOM 10446 C CB  . VAL B 1 212  ? 112.767 17.773  -20.016 1.00 21.07  ? 212  VAL B CB  1 
ATOM 10447 C CG1 . VAL B 1 212  ? 112.692 18.828  -18.882 1.00 24.22  ? 212  VAL B CG1 1 
ATOM 10448 C CG2 . VAL B 1 212  ? 114.216 17.440  -20.414 1.00 16.50  ? 212  VAL B CG2 1 
ATOM 10449 N N   . ASN B 1 213  ? 113.643 16.224  -17.861 1.00 15.06  ? 213  ASN B N   1 
ATOM 10450 C CA  . ASN B 1 213  ? 114.132 15.648  -16.612 1.00 15.97  ? 213  ASN B CA  1 
ATOM 10451 C C   . ASN B 1 213  ? 113.894 16.641  -15.465 1.00 26.47  ? 213  ASN B C   1 
ATOM 10452 O O   . ASN B 1 213  ? 114.772 17.412  -15.083 1.00 51.00  ? 213  ASN B O   1 
ATOM 10453 C CB  . ASN B 1 213  ? 115.602 15.272  -16.772 1.00 10.96  ? 213  ASN B CB  1 
ATOM 10454 N N   . CYS B 1 214  ? 112.668 16.635  -14.908 1.00 21.54  ? 214  CYS B N   1 
ATOM 10455 C CA  . CYS B 1 214  ? 112.356 17.456  -13.727 1.00 22.83  ? 214  CYS B CA  1 
ATOM 10456 C C   . CYS B 1 214  ? 111.474 16.679  -12.745 1.00 20.54  ? 214  CYS B C   1 
ATOM 10457 O O   . CYS B 1 214  ? 110.552 15.980  -13.164 1.00 21.10  ? 214  CYS B O   1 
ATOM 10458 C CB  . CYS B 1 214  ? 111.659 18.783  -14.108 1.00 22.50  ? 214  CYS B CB  1 
ATOM 10459 S SG  . CYS B 1 214  ? 112.049 19.511  -15.729 1.00 24.01  ? 214  CYS B SG  1 
ATOM 10460 N N   . ASN B 1 215  ? 111.713 16.850  -11.435 1.00 20.06  ? 215  ASN B N   1 
ATOM 10461 C CA  . ASN B 1 215  ? 111.096 16.014  -10.397 1.00 21.07  ? 215  ASN B CA  1 
ATOM 10462 C C   . ASN B 1 215  ? 109.844 16.672  -9.818  1.00 21.63  ? 215  ASN B C   1 
ATOM 10463 O O   . ASN B 1 215  ? 109.944 17.685  -9.122  1.00 22.63  ? 215  ASN B O   1 
ATOM 10464 C CB  . ASN B 1 215  ? 112.094 15.735  -9.271  1.00 19.77  ? 215  ASN B CB  1 
ATOM 10465 C CG  . ASN B 1 215  ? 112.390 14.251  -9.097  1.00 22.84  ? 215  ASN B CG  1 
ATOM 10466 O OD1 . ASN B 1 215  ? 112.298 13.710  -7.994  1.00 19.25  ? 215  ASN B OD1 1 
ATOM 10467 N ND2 . ASN B 1 215  ? 112.748 13.586  -10.191 1.00 30.61  ? 215  ASN B ND2 1 
ATOM 10468 N N   . THR B 1 216  ? 108.685 16.045  -10.050 1.00 21.57  ? 216  THR B N   1 
ATOM 10469 C CA  . THR B 1 216  ? 107.359 16.537  -9.687  1.00 23.38  ? 216  THR B CA  1 
ATOM 10470 C C   . THR B 1 216  ? 106.392 15.367  -9.668  1.00 21.52  ? 216  THR B C   1 
ATOM 10471 O O   . THR B 1 216  ? 106.488 14.484  -10.518 1.00 29.36  ? 216  THR B O   1 
ATOM 10472 C CB  . THR B 1 216  ? 106.831 17.557  -10.700 1.00 27.74  ? 216  THR B CB  1 
ATOM 10473 O OG1 . THR B 1 216  ? 107.075 17.074  -12.024 1.00 30.79  ? 216  THR B OG1 1 
ATOM 10474 C CG2 . THR B 1 216  ? 107.516 18.868  -10.550 1.00 28.05  ? 216  THR B CG2 1 
ATOM 10475 N N   . SER B 1 217  ? 105.447 15.355  -8.722  1.00 17.96  ? 217  SER B N   1 
ATOM 10476 C CA  . SER B 1 217  ? 104.511 14.246  -8.613  1.00 18.16  ? 217  SER B CA  1 
ATOM 10477 C C   . SER B 1 217  ? 103.100 14.725  -9.012  1.00 18.82  ? 217  SER B C   1 
ATOM 10478 O O   . SER B 1 217  ? 102.916 15.872  -9.451  1.00 17.19  ? 217  SER B O   1 
ATOM 10479 C CB  . SER B 1 217  ? 104.600 13.602  -7.213  1.00 17.14  ? 217  SER B CB  1 
ATOM 10480 O OG  . SER B 1 217  ? 104.419 14.556  -6.190  1.00 17.48  ? 217  SER B OG  1 
ATOM 10481 N N   . TRP B 1 218  ? 102.089 13.825  -8.936  1.00 19.56  ? 218  TRP B N   1 
ATOM 10482 C CA  . TRP B 1 218  ? 100.783 14.078  -9.585  1.00 20.24  ? 218  TRP B CA  1 
ATOM 10483 C C   . TRP B 1 218  ? 99.757  13.091  -9.028  1.00 17.02  ? 218  TRP B C   1 
ATOM 10484 O O   . TRP B 1 218  ? 99.690  11.955  -9.507  1.00 12.42  ? 218  TRP B O   1 
ATOM 10485 C CB  . TRP B 1 218  ? 100.865 13.916  -11.107 1.00 29.92  ? 218  TRP B CB  1 
ATOM 10486 C CG  . TRP B 1 218  ? 100.852 15.111  -11.985 1.00 39.62  ? 218  TRP B CG  1 
ATOM 10487 C CD1 . TRP B 1 218  ? 101.095 15.202  -13.391 1.00 44.91  ? 218  TRP B CD1 1 
ATOM 10488 C CD2 . TRP B 1 218  ? 100.602 16.401  -11.547 1.00 31.65  ? 218  TRP B CD2 1 
ATOM 10489 N NE1 . TRP B 1 218  ? 101.025 16.535  -13.769 1.00 40.18  ? 218  TRP B NE1 1 
ATOM 10490 C CE2 . TRP B 1 218  ? 100.715 17.280  -12.658 1.00 29.26  ? 218  TRP B CE2 1 
ATOM 10491 C CE3 . TRP B 1 218  ? 100.307 16.923  -10.283 1.00 19.08  ? 218  TRP B CE3 1 
ATOM 10492 C CZ2 . TRP B 1 218  ? 100.528 18.622  -12.517 1.00 20.68  ? 218  TRP B CZ2 1 
ATOM 10493 C CZ3 . TRP B 1 218  ? 100.144 18.165  -10.167 1.00 14.40  ? 218  TRP B CZ3 1 
ATOM 10494 C CH2 . TRP B 1 218  ? 100.268 19.061  -11.252 1.00 15.32  ? 218  TRP B CH2 1 
ATOM 10495 N N   . LYS B 1 219  ? 98.889  13.576  -8.141  1.00 16.34  ? 219  LYS B N   1 
ATOM 10496 C CA  . LYS B 1 219  ? 97.988  12.761  -7.340  1.00 8.81   ? 219  LYS B CA  1 
ATOM 10497 C C   . LYS B 1 219  ? 96.530  12.933  -7.712  1.00 15.65  ? 219  LYS B C   1 
ATOM 10498 O O   . LYS B 1 219  ? 96.105  13.985  -8.183  1.00 17.07  ? 219  LYS B O   1 
ATOM 10499 C CB  . LYS B 1 219  ? 98.088  13.077  -5.850  1.00 14.46  ? 219  LYS B CB  1 
ATOM 10500 C CG  . LYS B 1 219  ? 98.007  14.559  -5.469  1.00 13.08  ? 219  LYS B CG  1 
ATOM 10501 C CD  . LYS B 1 219  ? 96.837  14.946  -4.595  1.00 11.37  ? 219  LYS B CD  1 
ATOM 10502 C CE  . LYS B 1 219  ? 95.556  14.552  -5.256  1.00 14.38  ? 219  LYS B CE  1 
ATOM 10503 N NZ  . LYS B 1 219  ? 95.256  13.142  -4.922  1.00 17.60  ? 219  LYS B NZ  1 
ATOM 10504 N N   . ILE B 1 220  ? 95.756  11.922  -7.355  1.00 16.19  ? 220  ILE B N   1 
ATOM 10505 C CA  . ILE B 1 220  ? 94.368  11.798  -7.783  1.00 23.01  ? 220  ILE B CA  1 
ATOM 10506 C C   . ILE B 1 220  ? 93.462  11.742  -6.550  1.00 23.76  ? 220  ILE B C   1 
ATOM 10507 O O   . ILE B 1 220  ? 93.520  10.785  -5.766  1.00 25.96  ? 220  ILE B O   1 
ATOM 10508 C CB  . ILE B 1 220  ? 94.189  10.560  -8.687  1.00 27.06  ? 220  ILE B CB  1 
ATOM 10509 C CG1 . ILE B 1 220  ? 92.859  10.590  -9.418  1.00 27.33  ? 220  ILE B CG1 1 
ATOM 10510 C CG2 . ILE B 1 220  ? 94.165  9.322   -7.880  1.00 27.83  ? 220  ILE B CG2 1 
ATOM 10511 C CD1 . ILE B 1 220  ? 92.246  11.865  -9.310  1.00 23.58  ? 220  ILE B CD1 1 
ATOM 10512 N N   . VAL B 1 221  ? 92.647  12.766  -6.364  1.00 23.05  ? 221  VAL B N   1 
ATOM 10513 C CA  . VAL B 1 221  ? 91.583  12.709  -5.360  1.00 17.84  ? 221  VAL B CA  1 
ATOM 10514 C C   . VAL B 1 221  ? 90.476  11.805  -5.899  1.00 14.24  ? 221  VAL B C   1 
ATOM 10515 O O   . VAL B 1 221  ? 90.244  11.778  -7.112  1.00 16.08  ? 221  VAL B O   1 
ATOM 10516 C CB  . VAL B 1 221  ? 91.068  14.129  -5.058  1.00 19.38  ? 221  VAL B CB  1 
ATOM 10517 C CG1 . VAL B 1 221  ? 92.207  15.168  -5.120  1.00 17.82  ? 221  VAL B CG1 1 
ATOM 10518 C CG2 . VAL B 1 221  ? 89.998  14.492  -6.043  1.00 20.19  ? 221  VAL B CG2 1 
ATOM 10519 N N   . LEU B 1 222  ? 89.804  11.045  -5.022  1.00 11.47  ? 222  LEU B N   1 
ATOM 10520 C CA  . LEU B 1 222  ? 88.781  10.073  -5.445  1.00 11.69  ? 222  LEU B CA  1 
ATOM 10521 C C   . LEU B 1 222  ? 87.874  10.670  -6.503  1.00 12.30  ? 222  LEU B C   1 
ATOM 10522 O O   . LEU B 1 222  ? 87.839  11.889  -6.663  1.00 13.72  ? 222  LEU B O   1 
ATOM 10523 C CB  . LEU B 1 222  ? 87.903  9.641   -4.267  1.00 8.68   ? 222  LEU B CB  1 
ATOM 10524 C CG  . LEU B 1 222  ? 87.238  8.258   -4.307  1.00 8.68   ? 222  LEU B CG  1 
ATOM 10525 C CD1 . LEU B 1 222  ? 85.755  8.234   -3.945  1.00 8.68   ? 222  LEU B CD1 1 
ATOM 10526 C CD2 . LEU B 1 222  ? 87.436  7.640   -5.663  1.00 8.68   ? 222  LEU B CD2 1 
ATOM 10527 N N   . PHE B 1 223  ? 87.149  9.871   -7.256  1.00 10.34  ? 223  PHE B N   1 
ATOM 10528 C CA  . PHE B 1 223  ? 85.953  10.429  -7.848  1.00 14.64  ? 223  PHE B CA  1 
ATOM 10529 C C   . PHE B 1 223  ? 84.837  9.491   -7.476  1.00 14.57  ? 223  PHE B C   1 
ATOM 10530 O O   . PHE B 1 223  ? 84.836  8.859   -6.419  1.00 8.74   ? 223  PHE B O   1 
ATOM 10531 C CB  . PHE B 1 223  ? 86.084  10.572  -9.354  1.00 21.87  ? 223  PHE B CB  1 
ATOM 10532 C CG  . PHE B 1 223  ? 85.600  11.857  -9.930  1.00 25.19  ? 223  PHE B CG  1 
ATOM 10533 C CD1 . PHE B 1 223  ? 85.449  13.067  -9.247  1.00 22.52  ? 223  PHE B CD1 1 
ATOM 10534 C CD2 . PHE B 1 223  ? 85.352  11.827  -11.248 1.00 29.66  ? 223  PHE B CD2 1 
ATOM 10535 C CE1 . PHE B 1 223  ? 84.967  14.174  -9.885  1.00 23.92  ? 223  PHE B CE1 1 
ATOM 10536 C CE2 . PHE B 1 223  ? 84.911  12.905  -11.899 1.00 32.59  ? 223  PHE B CE2 1 
ATOM 10537 C CZ  . PHE B 1 223  ? 84.686  14.102  -11.226 1.00 31.16  ? 223  PHE B CZ  1 
ATOM 10538 N N   . MET B 1 224  ? 83.857  9.405   -8.326  1.00 17.73  ? 224  MET B N   1 
ATOM 10539 C CA  . MET B 1 224  ? 82.792  8.468   -8.048  1.00 15.70  ? 224  MET B CA  1 
ATOM 10540 C C   . MET B 1 224  ? 82.555  7.642   -9.302  1.00 12.38  ? 224  MET B C   1 
ATOM 10541 O O   . MET B 1 224  ? 81.810  8.048   -10.195 1.00 12.88  ? 224  MET B O   1 
ATOM 10542 C CB  . MET B 1 224  ? 81.537  9.227   -7.533  1.00 19.91  ? 224  MET B CB  1 
ATOM 10543 C CG  . MET B 1 224  ? 81.922  10.642  -6.873  1.00 23.76  ? 224  MET B CG  1 
ATOM 10544 S SD  . MET B 1 224  ? 80.506  11.554  -6.178  1.00 19.94  ? 224  MET B SD  1 
ATOM 10545 C CE  . MET B 1 224  ? 79.752  12.794  -7.256  1.00 15.26  ? 224  MET B CE  1 
ATOM 10546 N N   . LYS B 1 225  ? 83.299  6.535   -9.393  1.00 11.18  ? 225  LYS B N   1 
ATOM 10547 C CA  . LYS B 1 225  ? 82.953  5.342   -10.149 1.00 15.63  ? 225  LYS B CA  1 
ATOM 10548 C C   . LYS B 1 225  ? 82.578  5.681   -11.588 1.00 20.07  ? 225  LYS B C   1 
ATOM 10549 O O   . LYS B 1 225  ? 81.825  6.616   -11.860 1.00 18.82  ? 225  LYS B O   1 
ATOM 10550 C CB  . LYS B 1 225  ? 81.841  4.559   -9.413  1.00 18.18  ? 225  LYS B CB  1 
ATOM 10551 C CG  . LYS B 1 225  ? 82.085  4.387   -7.879  1.00 8.81   ? 225  LYS B CG  1 
ATOM 10552 C CD  . LYS B 1 225  ? 81.813  5.655   -7.084  1.00 8.81   ? 225  LYS B CD  1 
ATOM 10553 C CE  . LYS B 1 225  ? 82.210  5.502   -5.642  1.00 8.81   ? 225  LYS B CE  1 
ATOM 10554 N NZ  . LYS B 1 225  ? 81.029  5.140   -4.832  1.00 8.81   ? 225  LYS B NZ  1 
ATOM 10555 N N   . TRP B 1 226  ? 83.200  4.984   -12.522 1.00 26.45  ? 226  TRP B N   1 
ATOM 10556 C CA  . TRP B 1 226  ? 82.872  5.033   -13.937 1.00 32.60  ? 226  TRP B CA  1 
ATOM 10557 C C   . TRP B 1 226  ? 81.791  4.045   -14.328 1.00 42.07  ? 226  TRP B C   1 
ATOM 10558 O O   . TRP B 1 226  ? 81.178  4.198   -15.391 1.00 44.11  ? 226  TRP B O   1 
ATOM 10559 C CB  . TRP B 1 226  ? 84.106  4.688   -14.740 1.00 35.90  ? 226  TRP B CB  1 
ATOM 10560 C CG  . TRP B 1 226  ? 84.641  3.361   -14.321 1.00 41.62  ? 226  TRP B CG  1 
ATOM 10561 C CD1 . TRP B 1 226  ? 84.900  2.935   -13.038 1.00 46.89  ? 226  TRP B CD1 1 
ATOM 10562 C CD2 . TRP B 1 226  ? 84.994  2.281   -15.173 1.00 31.46  ? 226  TRP B CD2 1 
ATOM 10563 N NE1 . TRP B 1 226  ? 85.392  1.655   -13.049 1.00 54.58  ? 226  TRP B NE1 1 
ATOM 10564 C CE2 . TRP B 1 226  ? 85.474  1.232   -14.348 1.00 34.95  ? 226  TRP B CE2 1 
ATOM 10565 C CE3 . TRP B 1 226  ? 84.970  2.103   -16.549 1.00 23.05  ? 226  TRP B CE3 1 
ATOM 10566 C CZ2 . TRP B 1 226  ? 85.913  0.032   -14.862 1.00 21.83  ? 226  TRP B CZ2 1 
ATOM 10567 C CZ3 . TRP B 1 226  ? 85.393  0.955   -17.039 1.00 14.68  ? 226  TRP B CZ3 1 
ATOM 10568 C CH2 . TRP B 1 226  ? 85.884  -0.085  -16.211 1.00 17.41  ? 226  TRP B CH2 1 
ATOM 10569 N N   . SER B 1 227  ? 81.631  2.967   -13.551 1.00 51.99  ? 227  SER B N   1 
ATOM 10570 C CA  . SER B 1 227  ? 80.591  1.978   -13.840 1.00 55.09  ? 227  SER B CA  1 
ATOM 10571 C C   . SER B 1 227  ? 79.211  2.616   -13.832 1.00 69.07  ? 227  SER B C   1 
ATOM 10572 O O   . SER B 1 227  ? 78.361  2.296   -14.676 1.00 62.18  ? 227  SER B O   1 
ATOM 10573 C CB  . SER B 1 227  ? 80.635  0.833   -12.821 1.00 52.51  ? 227  SER B CB  1 
ATOM 10574 O OG  . SER B 1 227  ? 79.324  0.446   -12.421 1.00 42.75  ? 227  SER B OG  1 
ATOM 10575 N N   . ASP B 1 228  ? 78.969  3.516   -12.871 1.00 83.13  ? 228  ASP B N   1 
ATOM 10576 C CA  . ASP B 1 228  ? 77.656  4.146   -12.751 1.00 84.32  ? 228  ASP B CA  1 
ATOM 10577 C C   . ASP B 1 228  ? 77.349  5.040   -13.968 1.00 72.15  ? 228  ASP B C   1 
ATOM 10578 O O   . ASP B 1 228  ? 76.181  5.173   -14.361 1.00 56.68  ? 228  ASP B O   1 
ATOM 10579 C CB  . ASP B 1 228  ? 77.547  4.918   -11.409 1.00 81.44  ? 228  ASP B CB  1 
ATOM 10580 C CG  . ASP B 1 228  ? 77.329  3.981   -10.158 1.00 40.42  ? 228  ASP B CG  1 
ATOM 10581 O OD1 . ASP B 1 228  ? 76.290  3.287   -10.072 1.00 21.95  ? 228  ASP B OD1 1 
ATOM 10582 O OD2 . ASP B 1 228  ? 78.176  3.973   -9.230  1.00 41.86  ? 228  ASP B OD2 1 
ATOM 10583 N N   . ASN B 1 229  ? 78.378  5.623   -14.610 1.00 73.41  ? 229  ASN B N   1 
ATOM 10584 C CA  . ASN B 1 229  ? 78.135  6.374   -15.844 1.00 61.82  ? 229  ASN B CA  1 
ATOM 10585 C C   . ASN B 1 229  ? 77.859  5.432   -17.013 1.00 49.75  ? 229  ASN B C   1 
ATOM 10586 O O   . ASN B 1 229  ? 78.659  4.542   -17.322 1.00 42.55  ? 229  ASN B O   1 
ATOM 10587 C CB  . ASN B 1 229  ? 79.294  7.323   -16.205 1.00 60.23  ? 229  ASN B CB  1 
ATOM 10588 C CG  . ASN B 1 229  ? 80.673  6.791   -15.846 1.00 40.25  ? 229  ASN B CG  1 
ATOM 10589 O OD1 . ASN B 1 229  ? 81.108  6.897   -14.698 1.00 35.97  ? 229  ASN B OD1 1 
ATOM 10590 N ND2 . ASN B 1 229  ? 81.393  6.278   -16.843 1.00 29.54  ? 229  ASN B ND2 1 
ATOM 10591 N N   . LYS B 1 230  ? 76.729  5.657   -17.681 1.00 52.71  ? 230  LYS B N   1 
ATOM 10592 C CA  . LYS B 1 230  ? 76.337  4.831   -18.810 1.00 47.65  ? 230  LYS B CA  1 
ATOM 10593 C C   . LYS B 1 230  ? 75.582  5.675   -19.832 1.00 47.15  ? 230  LYS B C   1 
ATOM 10594 O O   . LYS B 1 230  ? 75.122  6.782   -19.548 1.00 36.32  ? 230  LYS B O   1 
ATOM 10595 C CB  . LYS B 1 230  ? 75.490  3.631   -18.349 1.00 50.95  ? 230  LYS B CB  1 
ATOM 10596 C CG  . LYS B 1 230  ? 76.292  2.328   -18.155 1.00 42.16  ? 230  LYS B CG  1 
ATOM 10597 C CD  . LYS B 1 230  ? 77.331  2.151   -19.273 1.00 40.60  ? 230  LYS B CD  1 
ATOM 10598 C CE  . LYS B 1 230  ? 78.009  0.779   -19.248 1.00 30.94  ? 230  LYS B CE  1 
ATOM 10599 N NZ  . LYS B 1 230  ? 78.946  0.570   -20.401 1.00 8.86   ? 230  LYS B NZ  1 
ATOM 10600 N N   . ASP B 1 231  ? 75.489  5.146   -21.052 1.00 51.17  ? 231  ASP B N   1 
ATOM 10601 C CA  . ASP B 1 231  ? 74.557  5.700   -22.026 1.00 45.25  ? 231  ASP B CA  1 
ATOM 10602 C C   . ASP B 1 231  ? 73.187  5.924   -21.389 1.00 46.07  ? 231  ASP B C   1 
ATOM 10603 O O   . ASP B 1 231  ? 72.677  7.054   -21.359 1.00 45.90  ? 231  ASP B O   1 
ATOM 10604 C CB  . ASP B 1 231  ? 74.451  4.755   -23.229 1.00 39.77  ? 231  ASP B CB  1 
ATOM 10605 N N   . ASP B 1 232  ? 72.614  4.851   -20.819 1.00 47.11  ? 232  ASP B N   1 
ATOM 10606 C CA  . ASP B 1 232  ? 71.246  4.867   -20.302 1.00 38.69  ? 232  ASP B CA  1 
ATOM 10607 C C   . ASP B 1 232  ? 71.048  5.931   -19.233 1.00 33.43  ? 232  ASP B C   1 
ATOM 10608 O O   . ASP B 1 232  ? 69.921  6.405   -19.027 1.00 30.04  ? 232  ASP B O   1 
ATOM 10609 C CB  . ASP B 1 232  ? 70.891  3.484   -19.744 1.00 19.82  ? 232  ASP B CB  1 
ATOM 10610 C CG  . ASP B 1 232  ? 69.554  3.457   -19.044 1.00 9.89   ? 232  ASP B CG  1 
ATOM 10611 O OD1 . ASP B 1 232  ? 68.658  4.252   -19.403 1.00 8.76   ? 232  ASP B OD1 1 
ATOM 10612 O OD2 . ASP B 1 232  ? 69.407  2.630   -18.125 1.00 8.55   ? 232  ASP B OD2 1 
ATOM 10613 N N   . ILE B 1 233  ? 72.122  6.326   -18.555 1.00 29.54  ? 233  ILE B N   1 
ATOM 10614 C CA  . ILE B 1 233  ? 72.031  7.202   -17.400 1.00 21.11  ? 233  ILE B CA  1 
ATOM 10615 C C   . ILE B 1 233  ? 73.137  8.234   -17.493 1.00 15.20  ? 233  ILE B C   1 
ATOM 10616 O O   . ILE B 1 233  ? 74.185  8.007   -18.091 1.00 18.11  ? 233  ILE B O   1 
ATOM 10617 C CB  . ILE B 1 233  ? 72.105  6.407   -16.075 1.00 17.88  ? 233  ILE B CB  1 
ATOM 10618 C CG1 . ILE B 1 233  ? 73.494  5.841   -15.839 1.00 16.75  ? 233  ILE B CG1 1 
ATOM 10619 C CG2 . ILE B 1 233  ? 71.099  5.268   -16.075 1.00 16.69  ? 233  ILE B CG2 1 
ATOM 10620 C CD1 . ILE B 1 233  ? 74.410  6.828   -15.274 1.00 16.22  ? 233  ILE B CD1 1 
ATOM 10621 N N   . LEU B 1 234  ? 72.911  9.372   -16.898 1.00 9.86   ? 234  LEU B N   1 
ATOM 10622 C CA  . LEU B 1 234  ? 73.976  10.348  -16.968 1.00 14.30  ? 234  LEU B CA  1 
ATOM 10623 C C   . LEU B 1 234  ? 74.943  10.173  -15.805 1.00 20.17  ? 234  LEU B C   1 
ATOM 10624 O O   . LEU B 1 234  ? 74.723  9.368   -14.894 1.00 16.62  ? 234  LEU B O   1 
ATOM 10625 C CB  . LEU B 1 234  ? 73.396  11.746  -16.991 1.00 14.48  ? 234  LEU B CB  1 
ATOM 10626 C CG  . LEU B 1 234  ? 73.024  12.022  -18.434 1.00 12.65  ? 234  LEU B CG  1 
ATOM 10627 C CD1 . LEU B 1 234  ? 73.833  13.183  -18.939 1.00 13.93  ? 234  LEU B CD1 1 
ATOM 10628 C CD2 . LEU B 1 234  ? 73.341  10.787  -19.249 1.00 8.49   ? 234  LEU B CD2 1 
ATOM 10629 N N   . LYS B 1 235  ? 76.000  10.987  -15.814 1.00 26.35  ? 235  LYS B N   1 
ATOM 10630 C CA  . LYS B 1 235  ? 77.113  10.810  -14.885 1.00 33.93  ? 235  LYS B CA  1 
ATOM 10631 C C   . LYS B 1 235  ? 77.673  12.144  -14.393 1.00 40.36  ? 235  LYS B C   1 
ATOM 10632 O O   . LYS B 1 235  ? 77.270  13.225  -14.839 1.00 39.17  ? 235  LYS B O   1 
ATOM 10633 C CB  . LYS B 1 235  ? 78.237  9.992   -15.529 1.00 46.45  ? 235  LYS B CB  1 
ATOM 10634 C CG  . LYS B 1 235  ? 79.387  10.807  -16.274 1.00 40.64  ? 235  LYS B CG  1 
ATOM 10635 C CD  . LYS B 1 235  ? 79.042  11.344  -17.680 1.00 19.94  ? 235  LYS B CD  1 
ATOM 10636 C CE  . LYS B 1 235  ? 77.994  10.508  -18.403 1.00 20.97  ? 235  LYS B CE  1 
ATOM 10637 N NZ  . LYS B 1 235  ? 77.136  11.318  -19.282 1.00 15.31  ? 235  LYS B NZ  1 
ATOM 10638 N N   . GLY B 1 236  ? 78.619  12.047  -13.457 1.00 46.99  ? 236  GLY B N   1 
ATOM 10639 C CA  . GLY B 1 236  ? 79.085  13.232  -12.751 1.00 52.38  ? 236  GLY B CA  1 
ATOM 10640 C C   . GLY B 1 236  ? 79.772  14.205  -13.695 1.00 48.42  ? 236  GLY B C   1 
ATOM 10641 O O   . GLY B 1 236  ? 80.489  13.811  -14.614 1.00 45.68  ? 236  GLY B O   1 
ATOM 10642 N N   . GLY B 1 237  ? 79.531  15.492  -13.492 1.00 42.36  ? 237  GLY B N   1 
ATOM 10643 C CA  . GLY B 1 237  ? 79.960  16.388  -14.538 1.00 29.43  ? 237  GLY B CA  1 
ATOM 10644 C C   . GLY B 1 237  ? 79.161  16.231  -15.826 1.00 31.66  ? 237  GLY B C   1 
ATOM 10645 O O   . GLY B 1 237  ? 79.737  16.200  -16.916 1.00 41.73  ? 237  GLY B O   1 
ATOM 10646 N N   . ASP B 1 238  ? 77.836  16.109  -15.739 1.00 28.99  ? 238  ASP B N   1 
ATOM 10647 C CA  . ASP B 1 238  ? 77.036  15.994  -16.944 1.00 17.43  ? 238  ASP B CA  1 
ATOM 10648 C C   . ASP B 1 238  ? 76.089  17.148  -17.116 1.00 14.84  ? 238  ASP B C   1 
ATOM 10649 O O   . ASP B 1 238  ? 75.865  17.960  -16.224 1.00 22.31  ? 238  ASP B O   1 
ATOM 10650 C CB  . ASP B 1 238  ? 76.244  14.712  -16.961 1.00 16.10  ? 238  ASP B CB  1 
ATOM 10651 C CG  . ASP B 1 238  ? 77.033  13.651  -17.505 1.00 15.93  ? 238  ASP B CG  1 
ATOM 10652 O OD1 . ASP B 1 238  ? 78.240  13.923  -17.593 1.00 11.57  ? 238  ASP B OD1 1 
ATOM 10653 O OD2 . ASP B 1 238  ? 76.491  12.596  -17.857 1.00 18.13  ? 238  ASP B OD2 1 
ATOM 10654 N N   . VAL B 1 239  ? 75.470  17.167  -18.276 1.00 13.38  ? 239  VAL B N   1 
ATOM 10655 C CA  . VAL B 1 239  ? 74.888  18.398  -18.729 1.00 13.13  ? 239  VAL B CA  1 
ATOM 10656 C C   . VAL B 1 239  ? 73.565  18.086  -19.429 1.00 9.13   ? 239  VAL B C   1 
ATOM 10657 O O   . VAL B 1 239  ? 73.535  17.417  -20.466 1.00 9.97   ? 239  VAL B O   1 
ATOM 10658 C CB  . VAL B 1 239  ? 75.892  19.150  -19.617 1.00 13.53  ? 239  VAL B CB  1 
ATOM 10659 C CG1 . VAL B 1 239  ? 75.641  18.895  -21.065 1.00 15.18  ? 239  VAL B CG1 1 
ATOM 10660 C CG2 . VAL B 1 239  ? 75.959  20.628  -19.273 1.00 24.63  ? 239  VAL B CG2 1 
ATOM 10661 N N   . VAL B 1 240  ? 72.469  18.521  -18.822 1.00 11.89  ? 240  VAL B N   1 
ATOM 10662 C CA  . VAL B 1 240  ? 71.124  18.147  -19.232 1.00 8.58   ? 240  VAL B CA  1 
ATOM 10663 C C   . VAL B 1 240  ? 70.198  19.299  -18.943 1.00 12.70  ? 240  VAL B C   1 
ATOM 10664 O O   . VAL B 1 240  ? 70.030  19.714  -17.793 1.00 10.65  ? 240  VAL B O   1 
ATOM 10665 C CB  . VAL B 1 240  ? 70.624  16.932  -18.462 1.00 9.60   ? 240  VAL B CB  1 
ATOM 10666 C CG1 . VAL B 1 240  ? 71.460  15.800  -18.797 1.00 8.58   ? 240  VAL B CG1 1 
ATOM 10667 C CG2 . VAL B 1 240  ? 70.771  17.235  -16.994 1.00 8.83   ? 240  VAL B CG2 1 
ATOM 10668 N N   . ARG B 1 241  ? 69.553  19.782  -19.977 1.00 13.74  ? 241  ARG B N   1 
ATOM 10669 C CA  . ARG B 1 241  ? 68.603  20.846  -19.762 1.00 18.65  ? 241  ARG B CA  1 
ATOM 10670 C C   . ARG B 1 241  ? 67.254  20.254  -19.376 1.00 16.87  ? 241  ARG B C   1 
ATOM 10671 O O   . ARG B 1 241  ? 67.011  19.047  -19.499 1.00 13.55  ? 241  ARG B O   1 
ATOM 10672 C CB  . ARG B 1 241  ? 68.500  21.756  -20.995 1.00 21.83  ? 241  ARG B CB  1 
ATOM 10673 C CG  . ARG B 1 241  ? 68.307  21.142  -22.433 1.00 25.99  ? 241  ARG B CG  1 
ATOM 10674 C CD  . ARG B 1 241  ? 68.738  19.708  -22.600 1.00 19.73  ? 241  ARG B CD  1 
ATOM 10675 N NE  . ARG B 1 241  ? 67.852  19.109  -21.651 1.00 13.05  ? 241  ARG B NE  1 
ATOM 10676 C CZ  . ARG B 1 241  ? 66.678  18.577  -21.911 1.00 12.22  ? 241  ARG B CZ  1 
ATOM 10677 N NH1 . ARG B 1 241  ? 66.259  18.437  -23.148 1.00 9.99   ? 241  ARG B NH1 1 
ATOM 10678 N NH2 . ARG B 1 241  ? 65.918  18.208  -20.893 1.00 10.71  ? 241  ARG B NH2 1 
ATOM 10679 N N   . LEU B 1 242  ? 66.385  21.113  -18.884 1.00 23.29  ? 242  LEU B N   1 
ATOM 10680 C CA  . LEU B 1 242  ? 65.158  20.654  -18.264 1.00 24.87  ? 242  LEU B CA  1 
ATOM 10681 C C   . LEU B 1 242  ? 63.960  21.291  -18.961 1.00 27.23  ? 242  LEU B C   1 
ATOM 10682 O O   . LEU B 1 242  ? 64.120  22.206  -19.770 1.00 34.99  ? 242  LEU B O   1 
ATOM 10683 C CB  . LEU B 1 242  ? 65.200  20.958  -16.769 1.00 25.08  ? 242  LEU B CB  1 
ATOM 10684 C CG  . LEU B 1 242  ? 65.999  22.117  -16.201 1.00 25.46  ? 242  LEU B CG  1 
ATOM 10685 C CD1 . LEU B 1 242  ? 65.585  22.215  -14.755 1.00 37.37  ? 242  LEU B CD1 1 
ATOM 10686 C CD2 . LEU B 1 242  ? 67.447  21.737  -16.272 1.00 21.51  ? 242  LEU B CD2 1 
ATOM 10687 N N   . PHE B 1 243  ? 62.746  20.803  -18.648 1.00 20.77  ? 243  PHE B N   1 
ATOM 10688 C CA  . PHE B 1 243  ? 61.501  21.129  -19.372 1.00 17.40  ? 243  PHE B CA  1 
ATOM 10689 C C   . PHE B 1 243  ? 60.351  21.370  -18.410 1.00 17.21  ? 243  PHE B C   1 
ATOM 10690 O O   . PHE B 1 243  ? 60.100  20.528  -17.550 1.00 19.56  ? 243  PHE B O   1 
ATOM 10691 C CB  . PHE B 1 243  ? 61.172  19.939  -20.280 1.00 13.73  ? 243  PHE B CB  1 
ATOM 10692 C CG  . PHE B 1 243  ? 59.999  20.118  -21.157 1.00 11.99  ? 243  PHE B CG  1 
ATOM 10693 C CD1 . PHE B 1 243  ? 59.482  21.345  -21.396 1.00 11.06  ? 243  PHE B CD1 1 
ATOM 10694 C CD2 . PHE B 1 243  ? 59.411  19.027  -21.737 1.00 10.19  ? 243  PHE B CD2 1 
ATOM 10695 C CE1 . PHE B 1 243  ? 58.424  21.515  -22.237 1.00 10.70  ? 243  PHE B CE1 1 
ATOM 10696 C CE2 . PHE B 1 243  ? 58.344  19.169  -22.557 1.00 11.71  ? 243  PHE B CE2 1 
ATOM 10697 C CZ  . PHE B 1 243  ? 57.842  20.427  -22.816 1.00 13.18  ? 243  PHE B CZ  1 
ATOM 10698 N N   . HIS B 1 244  ? 59.572  22.436  -18.514 1.00 19.19  ? 244  HIS B N   1 
ATOM 10699 C CA  . HIS B 1 244  ? 58.627  22.263  -17.427 1.00 21.34  ? 244  HIS B CA  1 
ATOM 10700 C C   . HIS B 1 244  ? 57.366  21.589  -17.927 1.00 25.02  ? 244  HIS B C   1 
ATOM 10701 O O   . HIS B 1 244  ? 57.108  21.486  -19.131 1.00 22.82  ? 244  HIS B O   1 
ATOM 10702 C CB  . HIS B 1 244  ? 58.304  23.517  -16.619 1.00 21.50  ? 244  HIS B CB  1 
ATOM 10703 C CG  . HIS B 1 244  ? 57.477  24.508  -17.329 1.00 20.11  ? 244  HIS B CG  1 
ATOM 10704 N ND1 . HIS B 1 244  ? 56.558  25.298  -16.685 1.00 19.77  ? 244  HIS B ND1 1 
ATOM 10705 C CD2 . HIS B 1 244  ? 57.454  24.864  -18.627 1.00 20.49  ? 244  HIS B CD2 1 
ATOM 10706 C CE1 . HIS B 1 244  ? 55.971  26.069  -17.568 1.00 20.05  ? 244  HIS B CE1 1 
ATOM 10707 N NE2 . HIS B 1 244  ? 56.539  25.870  -18.737 1.00 20.29  ? 244  HIS B NE2 1 
ATOM 10708 N N   . ALA B 1 245  ? 56.629  21.066  -16.960 1.00 35.15  ? 245  ALA B N   1 
ATOM 10709 C CA  . ALA B 1 245  ? 55.562  20.106  -17.152 1.00 39.75  ? 245  ALA B CA  1 
ATOM 10710 C C   . ALA B 1 245  ? 54.230  20.804  -17.024 1.00 31.45  ? 245  ALA B C   1 
ATOM 10711 O O   . ALA B 1 245  ? 53.298  20.547  -17.793 1.00 33.14  ? 245  ALA B O   1 
ATOM 10712 C CB  . ALA B 1 245  ? 55.715  18.968  -16.135 1.00 42.26  ? 245  ALA B CB  1 
ATOM 10713 N N   . GLU B 1 246  ? 54.152  21.760  -16.110 1.00 24.04  ? 246  GLU B N   1 
ATOM 10714 C CA  . GLU B 1 246  ? 52.953  22.571  -16.064 1.00 21.82  ? 246  GLU B CA  1 
ATOM 10715 C C   . GLU B 1 246  ? 52.700  23.218  -17.432 1.00 25.31  ? 246  GLU B C   1 
ATOM 10716 O O   . GLU B 1 246  ? 51.601  23.094  -17.985 1.00 33.43  ? 246  GLU B O   1 
ATOM 10717 C CB  . GLU B 1 246  ? 53.093  23.572  -14.922 1.00 17.31  ? 246  GLU B CB  1 
ATOM 10718 N N   . GLN B 1 247  ? 53.749  23.774  -18.048 1.00 21.08  ? 247  GLN B N   1 
ATOM 10719 C CA  . GLN B 1 247  ? 53.687  24.578  -19.285 1.00 18.88  ? 247  GLN B CA  1 
ATOM 10720 C C   . GLN B 1 247  ? 54.936  24.211  -20.113 1.00 16.22  ? 247  GLN B C   1 
ATOM 10721 O O   . GLN B 1 247  ? 55.538  23.157  -19.915 1.00 19.14  ? 247  GLN B O   1 
ATOM 10722 C CB  . GLN B 1 247  ? 53.558  26.060  -18.886 1.00 18.45  ? 247  GLN B CB  1 
ATOM 10723 C CG  . GLN B 1 247  ? 52.370  26.871  -19.441 1.00 20.63  ? 247  GLN B CG  1 
ATOM 10724 C CD  . GLN B 1 247  ? 51.547  27.475  -18.325 1.00 15.75  ? 247  GLN B CD  1 
ATOM 10725 O OE1 . GLN B 1 247  ? 51.324  28.684  -18.271 1.00 8.70   ? 247  GLN B OE1 1 
ATOM 10726 N NE2 . GLN B 1 247  ? 51.131  26.629  -17.392 1.00 19.39  ? 247  GLN B NE2 1 
ATOM 10727 N N   . GLU B 1 248  ? 55.393  25.104  -21.000 1.00 15.03  ? 248  GLU B N   1 
ATOM 10728 C CA  . GLU B 1 248  ? 56.594  24.849  -21.803 1.00 18.02  ? 248  GLU B CA  1 
ATOM 10729 C C   . GLU B 1 248  ? 57.636  25.943  -21.678 1.00 24.66  ? 248  GLU B C   1 
ATOM 10730 O O   . GLU B 1 248  ? 58.670  25.935  -22.390 1.00 24.01  ? 248  GLU B O   1 
ATOM 10731 C CB  . GLU B 1 248  ? 56.182  24.619  -23.271 1.00 15.08  ? 248  GLU B CB  1 
ATOM 10732 C CG  . GLU B 1 248  ? 54.828  25.188  -23.715 1.00 9.19   ? 248  GLU B CG  1 
ATOM 10733 C CD  . GLU B 1 248  ? 53.675  24.454  -23.089 1.00 8.67   ? 248  GLU B CD  1 
ATOM 10734 O OE1 . GLU B 1 248  ? 52.572  25.013  -23.069 1.00 8.67   ? 248  GLU B OE1 1 
ATOM 10735 O OE2 . GLU B 1 248  ? 53.877  23.312  -22.629 1.00 8.67   ? 248  GLU B OE2 1 
ATOM 10736 N N   . LYS B 1 249  ? 57.313  26.940  -20.854 1.00 28.22  ? 249  LYS B N   1 
ATOM 10737 C CA  . LYS B 1 249  ? 58.201  27.914  -20.162 1.00 27.33  ? 249  LYS B CA  1 
ATOM 10738 C C   . LYS B 1 249  ? 59.651  27.452  -19.983 1.00 30.51  ? 249  LYS B C   1 
ATOM 10739 O O   . LYS B 1 249  ? 60.541  28.000  -20.616 1.00 32.69  ? 249  LYS B O   1 
ATOM 10740 C CB  . LYS B 1 249  ? 57.467  28.255  -18.855 1.00 23.79  ? 249  LYS B CB  1 
ATOM 10741 C CG  . LYS B 1 249  ? 58.065  29.280  -17.854 1.00 24.08  ? 249  LYS B CG  1 
ATOM 10742 C CD  . LYS B 1 249  ? 57.108  30.332  -17.569 1.00 28.20  ? 249  LYS B CD  1 
ATOM 10743 C CE  . LYS B 1 249  ? 55.808  29.658  -17.800 1.00 24.14  ? 249  LYS B CE  1 
ATOM 10744 N NZ  . LYS B 1 249  ? 54.719  30.735  -17.788 1.00 23.85  ? 249  LYS B NZ  1 
ATOM 10745 N N   . PHE B 1 250  ? 59.921  26.482  -19.107 1.00 33.01  ? 250  PHE B N   1 
ATOM 10746 C CA  . PHE B 1 250  ? 61.327  26.137  -18.787 1.00 31.09  ? 250  PHE B CA  1 
ATOM 10747 C C   . PHE B 1 250  ? 61.979  27.065  -17.775 1.00 25.82  ? 250  PHE B C   1 
ATOM 10748 O O   . PHE B 1 250  ? 61.704  28.263  -17.722 1.00 24.58  ? 250  PHE B O   1 
ATOM 10749 C CB  . PHE B 1 250  ? 62.270  26.144  -20.003 1.00 28.87  ? 250  PHE B CB  1 
ATOM 10750 C CG  . PHE B 1 250  ? 61.712  25.507  -21.228 1.00 29.88  ? 250  PHE B CG  1 
ATOM 10751 C CD1 . PHE B 1 250  ? 60.752  24.528  -21.118 1.00 29.16  ? 250  PHE B CD1 1 
ATOM 10752 C CD2 . PHE B 1 250  ? 62.074  25.952  -22.479 1.00 29.17  ? 250  PHE B CD2 1 
ATOM 10753 C CE1 . PHE B 1 250  ? 60.208  23.953  -22.223 1.00 24.32  ? 250  PHE B CE1 1 
ATOM 10754 C CE2 . PHE B 1 250  ? 61.512  25.383  -23.618 1.00 30.81  ? 250  PHE B CE2 1 
ATOM 10755 C CZ  . PHE B 1 250  ? 60.576  24.376  -23.470 1.00 25.40  ? 250  PHE B CZ  1 
ATOM 10756 N N   . LEU B 1 251  ? 62.920  26.510  -17.033 1.00 22.70  ? 251  LEU B N   1 
ATOM 10757 C CA  . LEU B 1 251  ? 63.749  27.320  -16.190 1.00 22.89  ? 251  LEU B CA  1 
ATOM 10758 C C   . LEU B 1 251  ? 64.913  27.790  -17.036 1.00 27.59  ? 251  LEU B C   1 
ATOM 10759 O O   . LEU B 1 251  ? 65.497  27.021  -17.814 1.00 24.65  ? 251  LEU B O   1 
ATOM 10760 C CB  . LEU B 1 251  ? 64.218  26.547  -14.975 1.00 17.99  ? 251  LEU B CB  1 
ATOM 10761 C CG  . LEU B 1 251  ? 65.680  26.370  -15.195 1.00 16.07  ? 251  LEU B CG  1 
ATOM 10762 C CD1 . LEU B 1 251  ? 66.414  26.427  -13.884 1.00 18.55  ? 251  LEU B CD1 1 
ATOM 10763 C CD2 . LEU B 1 251  ? 65.508  25.034  -15.808 1.00 13.75  ? 251  LEU B CD2 1 
ATOM 10764 N N   . THR B 1 252  ? 65.208  29.067  -16.885 1.00 42.54  ? 252  THR B N   1 
ATOM 10765 C CA  . THR B 1 252  ? 66.242  29.788  -17.599 1.00 58.71  ? 252  THR B CA  1 
ATOM 10766 C C   . THR B 1 252  ? 66.836  30.826  -16.641 1.00 54.37  ? 252  THR B C   1 
ATOM 10767 O O   . THR B 1 252  ? 66.123  31.389  -15.794 1.00 57.38  ? 252  THR B O   1 
ATOM 10768 C CB  . THR B 1 252  ? 65.660  30.436  -18.885 1.00 51.59  ? 252  THR B CB  1 
ATOM 10769 O OG1 . THR B 1 252  ? 64.451  31.153  -18.590 1.00 38.82  ? 252  THR B OG1 1 
ATOM 10770 C CG2 . THR B 1 252  ? 65.335  29.385  -19.941 1.00 44.39  ? 252  THR B CG2 1 
ATOM 10771 N N   . CYS B 1 253  ? 68.149  31.045  -16.756 1.00 41.16  ? 253  CYS B N   1 
ATOM 10772 C CA  . CYS B 1 253  ? 68.888  31.987  -15.920 1.00 33.47  ? 253  CYS B CA  1 
ATOM 10773 C C   . CYS B 1 253  ? 69.376  33.135  -16.795 1.00 39.47  ? 253  CYS B C   1 
ATOM 10774 O O   . CYS B 1 253  ? 70.031  32.898  -17.819 1.00 33.57  ? 253  CYS B O   1 
ATOM 10775 C CB  . CYS B 1 253  ? 70.069  31.301  -15.238 1.00 23.51  ? 253  CYS B CB  1 
ATOM 10776 S SG  . CYS B 1 253  ? 70.441  31.769  -13.541 1.00 9.08   ? 253  CYS B SG  1 
ATOM 10777 N N   . ASP B 1 254  ? 69.078  34.375  -16.376 1.00 58.35  ? 254  ASP B N   1 
ATOM 10778 C CA  . ASP B 1 254  ? 69.335  35.558  -17.201 1.00 56.20  ? 254  ASP B CA  1 
ATOM 10779 C C   . ASP B 1 254  ? 69.428  36.818  -16.334 1.00 47.26  ? 254  ASP B C   1 
ATOM 10780 O O   . ASP B 1 254  ? 68.833  36.902  -15.255 1.00 45.28  ? 254  ASP B O   1 
ATOM 10781 C CB  . ASP B 1 254  ? 68.241  35.750  -18.269 1.00 38.47  ? 254  ASP B CB  1 
ATOM 10782 C CG  . ASP B 1 254  ? 68.737  36.499  -19.474 1.00 37.75  ? 254  ASP B CG  1 
ATOM 10783 O OD1 . ASP B 1 254  ? 69.842  36.154  -19.936 1.00 38.33  ? 254  ASP B OD1 1 
ATOM 10784 O OD2 . ASP B 1 254  ? 68.027  37.405  -19.965 1.00 30.15  ? 254  ASP B OD2 1 
ATOM 10785 N N   . GLU B 1 255  ? 70.188  37.797  -16.820 1.00 48.80  ? 255  GLU B N   1 
ATOM 10786 C CA  . GLU B 1 255  ? 70.296  39.094  -16.154 1.00 42.00  ? 255  GLU B CA  1 
ATOM 10787 C C   . GLU B 1 255  ? 68.994  39.875  -16.363 1.00 39.95  ? 255  GLU B C   1 
ATOM 10788 O O   . GLU B 1 255  ? 68.546  40.067  -17.499 1.00 47.62  ? 255  GLU B O   1 
ATOM 10789 C CB  . GLU B 1 255  ? 71.525  39.844  -16.709 1.00 52.82  ? 255  GLU B CB  1 
ATOM 10790 C CG  . GLU B 1 255  ? 72.017  41.149  -15.975 1.00 55.62  ? 255  GLU B CG  1 
ATOM 10791 C CD  . GLU B 1 255  ? 73.341  41.802  -16.525 1.00 36.43  ? 255  GLU B CD  1 
ATOM 10792 O OE1 . GLU B 1 255  ? 74.226  41.123  -17.094 1.00 29.94  ? 255  GLU B OE1 1 
ATOM 10793 O OE2 . GLU B 1 255  ? 73.500  43.030  -16.358 1.00 23.56  ? 255  GLU B OE2 1 
ATOM 10794 N N   . HIS B 1 256  ? 68.359  40.280  -15.274 1.00 34.62  ? 256  HIS B N   1 
ATOM 10795 C CA  . HIS B 1 256  ? 67.265  41.216  -15.451 1.00 33.66  ? 256  HIS B CA  1 
ATOM 10796 C C   . HIS B 1 256  ? 67.749  42.594  -15.052 1.00 34.39  ? 256  HIS B C   1 
ATOM 10797 O O   . HIS B 1 256  ? 68.956  42.817  -14.992 1.00 44.64  ? 256  HIS B O   1 
ATOM 10798 C CB  . HIS B 1 256  ? 66.052  40.732  -14.695 1.00 29.07  ? 256  HIS B CB  1 
ATOM 10799 C CG  . HIS B 1 256  ? 65.028  40.179  -15.612 1.00 37.11  ? 256  HIS B CG  1 
ATOM 10800 N ND1 . HIS B 1 256  ? 63.774  40.727  -15.719 1.00 38.18  ? 256  HIS B ND1 1 
ATOM 10801 C CD2 . HIS B 1 256  ? 65.116  39.233  -16.575 1.00 41.94  ? 256  HIS B CD2 1 
ATOM 10802 C CE1 . HIS B 1 256  ? 63.104  40.085  -16.655 1.00 39.05  ? 256  HIS B CE1 1 
ATOM 10803 N NE2 . HIS B 1 256  ? 63.895  39.176  -17.195 1.00 44.38  ? 256  HIS B NE2 1 
ATOM 10804 N N   . ARG B 1 257  ? 66.822  43.539  -14.875 1.00 28.05  ? 257  ARG B N   1 
ATOM 10805 C CA  . ARG B 1 257  ? 67.086  44.874  -14.318 1.00 25.18  ? 257  ARG B CA  1 
ATOM 10806 C C   . ARG B 1 257  ? 68.508  45.070  -13.769 1.00 31.05  ? 257  ARG B C   1 
ATOM 10807 O O   . ARG B 1 257  ? 68.715  45.722  -12.743 1.00 30.89  ? 257  ARG B O   1 
ATOM 10808 C CB  . ARG B 1 257  ? 66.021  45.142  -13.246 1.00 19.84  ? 257  ARG B CB  1 
ATOM 10809 C CG  . ARG B 1 257  ? 66.325  46.158  -12.190 1.00 19.55  ? 257  ARG B CG  1 
ATOM 10810 C CD  . ARG B 1 257  ? 65.476  47.330  -12.369 1.00 14.07  ? 257  ARG B CD  1 
ATOM 10811 N NE  . ARG B 1 257  ? 64.243  47.083  -11.666 1.00 9.45   ? 257  ARG B NE  1 
ATOM 10812 C CZ  . ARG B 1 257  ? 63.209  46.545  -12.265 1.00 9.45   ? 257  ARG B CZ  1 
ATOM 10813 N NH1 . ARG B 1 257  ? 63.319  46.253  -13.547 1.00 9.45   ? 257  ARG B NH1 1 
ATOM 10814 N NH2 . ARG B 1 257  ? 62.092  46.322  -11.603 1.00 14.63  ? 257  ARG B NH2 1 
ATOM 10815 N N   . LYS B 1 258  ? 69.502  44.523  -14.468 1.00 34.27  ? 258  LYS B N   1 
ATOM 10816 C CA  . LYS B 1 258  ? 70.933  44.553  -14.115 1.00 45.17  ? 258  LYS B CA  1 
ATOM 10817 C C   . LYS B 1 258  ? 71.398  43.620  -12.990 1.00 55.96  ? 258  LYS B C   1 
ATOM 10818 O O   . LYS B 1 258  ? 72.464  43.910  -12.409 1.00 46.45  ? 258  LYS B O   1 
ATOM 10819 C CB  . LYS B 1 258  ? 71.407  45.959  -13.737 1.00 37.86  ? 258  LYS B CB  1 
ATOM 10820 C CG  . LYS B 1 258  ? 72.555  46.470  -14.613 1.00 30.74  ? 258  LYS B CG  1 
ATOM 10821 C CD  . LYS B 1 258  ? 73.595  45.388  -14.925 1.00 20.44  ? 258  LYS B CD  1 
ATOM 10822 C CE  . LYS B 1 258  ? 74.963  45.978  -15.239 1.00 10.48  ? 258  LYS B CE  1 
ATOM 10823 N NZ  . LYS B 1 258  ? 74.904  47.220  -16.073 1.00 9.50   ? 258  LYS B NZ  1 
ATOM 10824 N N   . LYS B 1 259  ? 70.680  42.525  -12.641 1.00 66.92  ? 259  LYS B N   1 
ATOM 10825 C CA  . LYS B 1 259  ? 71.156  41.485  -11.706 1.00 70.24  ? 259  LYS B CA  1 
ATOM 10826 C C   . LYS B 1 259  ? 70.688  40.091  -12.135 1.00 42.67  ? 259  LYS B C   1 
ATOM 10827 O O   . LYS B 1 259  ? 69.520  39.896  -12.507 1.00 33.29  ? 259  LYS B O   1 
ATOM 10828 C CB  . LYS B 1 259  ? 70.698  41.722  -10.245 1.00 60.64  ? 259  LYS B CB  1 
ATOM 10829 C CG  . LYS B 1 259  ? 69.199  41.471  -9.979  1.00 37.06  ? 259  LYS B CG  1 
ATOM 10830 C CD  . LYS B 1 259  ? 68.303  42.698  -10.320 1.00 44.92  ? 259  LYS B CD  1 
ATOM 10831 C CE  . LYS B 1 259  ? 67.824  42.678  -11.878 1.00 43.31  ? 259  LYS B CE  1 
ATOM 10832 N NZ  . LYS B 1 259  ? 66.375  42.713  -12.107 1.00 35.16  ? 259  LYS B NZ  1 
ATOM 10833 N N   . GLN B 1 260  ? 71.618  39.125  -12.070 1.00 33.61  ? 260  GLN B N   1 
ATOM 10834 C CA  . GLN B 1 260  ? 71.315  37.762  -12.472 1.00 20.55  ? 260  GLN B CA  1 
ATOM 10835 C C   . GLN B 1 260  ? 70.072  37.304  -11.749 1.00 26.84  ? 260  GLN B C   1 
ATOM 10836 O O   . GLN B 1 260  ? 69.784  37.738  -10.628 1.00 29.27  ? 260  GLN B O   1 
ATOM 10837 C CB  . GLN B 1 260  ? 72.462  36.805  -12.155 1.00 10.08  ? 260  GLN B CB  1 
ATOM 10838 C CG  . GLN B 1 260  ? 73.786  37.190  -12.736 1.00 9.18   ? 260  GLN B CG  1 
ATOM 10839 C CD  . GLN B 1 260  ? 73.808  37.116  -14.241 1.00 9.18   ? 260  GLN B CD  1 
ATOM 10840 O OE1 . GLN B 1 260  ? 72.798  36.834  -14.873 1.00 9.18   ? 260  GLN B OE1 1 
ATOM 10841 N NE2 . GLN B 1 260  ? 74.969  37.371  -14.825 1.00 9.18   ? 260  GLN B NE2 1 
ATOM 10842 N N   . HIS B 1 261  ? 69.335  36.419  -12.403 1.00 40.57  ? 261  HIS B N   1 
ATOM 10843 C CA  . HIS B 1 261  ? 68.114  35.893  -11.824 1.00 59.90  ? 261  HIS B CA  1 
ATOM 10844 C C   . HIS B 1 261  ? 67.849  34.485  -12.337 1.00 51.92  ? 261  HIS B C   1 
ATOM 10845 O O   . HIS B 1 261  ? 68.334  34.078  -13.408 1.00 61.33  ? 261  HIS B O   1 
ATOM 10846 C CB  . HIS B 1 261  ? 66.916  36.799  -12.135 1.00 57.49  ? 261  HIS B CB  1 
ATOM 10847 C CG  . HIS B 1 261  ? 66.870  38.031  -11.299 1.00 40.29  ? 261  HIS B CG  1 
ATOM 10848 N ND1 . HIS B 1 261  ? 66.499  39.262  -11.794 1.00 26.13  ? 261  HIS B ND1 1 
ATOM 10849 C CD2 . HIS B 1 261  ? 67.113  38.205  -9.982  1.00 41.49  ? 261  HIS B CD2 1 
ATOM 10850 C CE1 . HIS B 1 261  ? 66.582  40.155  -10.822 1.00 25.80  ? 261  HIS B CE1 1 
ATOM 10851 N NE2 . HIS B 1 261  ? 66.907  39.530  -9.702  1.00 28.52  ? 261  HIS B NE2 1 
ATOM 10852 N N   . VAL B 1 262  ? 67.030  33.767  -11.576 1.00 32.80  ? 262  VAL B N   1 
ATOM 10853 C CA  . VAL B 1 262  ? 66.632  32.417  -11.921 1.00 20.57  ? 262  VAL B CA  1 
ATOM 10854 C C   . VAL B 1 262  ? 65.121  32.366  -12.068 1.00 20.38  ? 262  VAL B C   1 
ATOM 10855 O O   . VAL B 1 262  ? 64.392  32.694  -11.122 1.00 16.80  ? 262  VAL B O   1 
ATOM 10856 C CB  . VAL B 1 262  ? 67.119  31.419  -10.861 1.00 18.06  ? 262  VAL B CB  1 
ATOM 10857 C CG1 . VAL B 1 262  ? 67.575  30.151  -11.552 1.00 31.88  ? 262  VAL B CG1 1 
ATOM 10858 C CG2 . VAL B 1 262  ? 68.251  32.019  -10.125 1.00 16.90  ? 262  VAL B CG2 1 
ATOM 10859 N N   . PHE B 1 263  ? 64.659  31.910  -13.244 1.00 25.53  ? 263  PHE B N   1 
ATOM 10860 C CA  . PHE B 1 263  ? 63.243  31.994  -13.590 1.00 27.00  ? 263  PHE B CA  1 
ATOM 10861 C C   . PHE B 1 263  ? 62.735  31.010  -14.678 1.00 30.59  ? 263  PHE B C   1 
ATOM 10862 O O   . PHE B 1 263  ? 63.320  30.904  -15.761 1.00 31.54  ? 263  PHE B O   1 
ATOM 10863 C CB  . PHE B 1 263  ? 62.992  33.425  -14.025 1.00 26.16  ? 263  PHE B CB  1 
ATOM 10864 C CG  . PHE B 1 263  ? 63.232  33.630  -15.443 1.00 26.65  ? 263  PHE B CG  1 
ATOM 10865 C CD1 . PHE B 1 263  ? 64.475  33.920  -15.956 1.00 37.93  ? 263  PHE B CD1 1 
ATOM 10866 C CD2 . PHE B 1 263  ? 62.207  33.420  -16.278 1.00 24.95  ? 263  PHE B CD2 1 
ATOM 10867 C CE1 . PHE B 1 263  ? 64.629  34.048  -17.286 1.00 33.17  ? 263  PHE B CE1 1 
ATOM 10868 C CE2 . PHE B 1 263  ? 62.336  33.561  -17.582 1.00 24.56  ? 263  PHE B CE2 1 
ATOM 10869 C CZ  . PHE B 1 263  ? 63.550  33.905  -18.095 1.00 26.91  ? 263  PHE B CZ  1 
ATOM 10870 N N   . LEU B 1 264  ? 61.591  30.356  -14.444 1.00 30.12  ? 264  LEU B N   1 
ATOM 10871 C CA  . LEU B 1 264  ? 60.882  29.616  -15.498 1.00 27.19  ? 264  LEU B CA  1 
ATOM 10872 C C   . LEU B 1 264  ? 60.483  30.560  -16.631 1.00 29.35  ? 264  LEU B C   1 
ATOM 10873 O O   . LEU B 1 264  ? 60.076  31.687  -16.382 1.00 27.03  ? 264  LEU B O   1 
ATOM 10874 C CB  . LEU B 1 264  ? 59.608  28.964  -14.948 1.00 29.67  ? 264  LEU B CB  1 
ATOM 10875 C CG  . LEU B 1 264  ? 59.207  27.490  -14.995 1.00 26.52  ? 264  LEU B CG  1 
ATOM 10876 C CD1 . LEU B 1 264  ? 58.466  27.175  -16.195 1.00 25.86  ? 264  LEU B CD1 1 
ATOM 10877 C CD2 . LEU B 1 264  ? 60.392  26.648  -14.965 1.00 32.69  ? 264  LEU B CD2 1 
ATOM 10878 N N   . ARG B 1 265  ? 60.530  30.064  -17.888 1.00 27.69  ? 265  ARG B N   1 
ATOM 10879 C CA  . ARG B 1 265  ? 60.551  30.906  -19.100 1.00 32.48  ? 265  ARG B CA  1 
ATOM 10880 C C   . ARG B 1 265  ? 59.459  30.644  -20.178 1.00 41.69  ? 265  ARG B C   1 
ATOM 10881 O O   . ARG B 1 265  ? 59.760  30.084  -21.245 1.00 44.28  ? 265  ARG B O   1 
ATOM 10882 C CB  . ARG B 1 265  ? 61.930  30.768  -19.693 1.00 30.88  ? 265  ARG B CB  1 
ATOM 10883 C CG  . ARG B 1 265  ? 62.444  32.122  -20.185 1.00 39.72  ? 265  ARG B CG  1 
ATOM 10884 C CD  . ARG B 1 265  ? 62.469  32.139  -21.636 1.00 45.59  ? 265  ARG B CD  1 
ATOM 10885 N NE  . ARG B 1 265  ? 63.837  32.255  -22.050 1.00 41.20