data_5XF6
# 
_entry.id   5XF6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5XF6         
WWPDB D_1300003419 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5XF3 PDB . 
unspecified 5XF4 PDB . 
unspecified 5XF5 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5XF6 
_pdbx_database_status.recvd_initial_deposition_date   2017-04-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ma, Z.'         1 ? 
'Adhireksan, Z.' 2 ? 
'Murray, B.S.'   3 ? 
'Dyson, P.J.'    4 ? 
'Davey, C.A.'    5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                1575 
_citation.page_last                 1575 
_citation.title                     
'Nucleosome acidic patch-targeting binuclear ruthenium compounds induce aberrant chromatin condensation' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-017-01680-4 
_citation.pdbx_database_id_PubMed   29146919 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Davey, G.E.'    1  
primary 'Adhireksan, Z.' 2  
primary 'Ma, Z.'         3  
primary 'Riedel, T.'     4  
primary 'Sharma, D.'     5  
primary 'Padavattan, S.' 6  
primary 'Rhodes, D.'     7  
primary 'Ludwig, A.'     8  
primary 'Sandin, S.'     9  
primary 'Murray, B.S.'   10 
primary 'Dyson, P.J.'    11 
primary 'Davey, C.A.'    12 
# 
_cell.entry_id           5XF6 
_cell.length_a           106.840 
_cell.length_b           109.729 
_cell.length_c           182.527 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5XF6 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.2'                                                               15303.930 2  ? ? ? ? 
2  polymer     man 'Histone H4'                                                                 11263.231 2  ? ? ? ? 
3  polymer     man 'Histone H2A'                                                                13907.163 2  ? ? ? ? 
4  polymer     man 'Histone H2B 1.1'                                                            13848.097 2  ? ? ? ? 
5  polymer     syn 'DNA (145-MER)'                                                              44749.664 1  ? ? ? ? 
6  polymer     syn 'DNA (145-MER)'                                                              44740.648 1  ? ? ? ? 
7  non-polymer syn 'SULFATE ION'                                                                96.063    3  ? ? ? ? 
8  non-polymer syn 'MAGNESIUM ION'                                                              24.305    1  ? ? ? ? 
9  non-polymer syn '[ethane6-3-(p-tolyl)propanoic acid]Ru(1,3,5-triaza-7-phosphaadamantane)Cl2' 493.330   2  ? ? ? ? 
10 non-polymer syn ETHANE-1,2-DIAMINE                                                           60.098    1  ? ? ? ? 
11 water       nat water                                                                        18.015    22 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 LYS n 
3 127 SER n 
3 128 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 128 'African clawed frog' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 125 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 145 'Homo sapiens' ? 9606 ? 
6 1 sample 1 145 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA    P84233 ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
2 UNP H4_XENLA     P62799 ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 
4 UNP H2B11_XENLA  P02281 ? 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 
5 PDB 5XF6         5XF6   ? 5 ? 1 
6 PDB 5XF6         5XF6   ? 6 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5XF6 A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 5XF6 B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 5XF6 C 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
4  4 5XF6 D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
5  1 5XF6 E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 5XF6 F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 5XF6 G 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
8  4 5XF6 H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
9  5 5XF6 I 1 ? 145 ? 5XF6   -72 ? 72  ? -72 72  
10 6 5XF6 J 1 ? 145 ? 5XF6   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5XF6 ALA A 102 ? UNP P84233 GLY 103 variant  102 1 
3 5XF6 ?   C ?   ? UNP Q6AZJ8 ALA 127 deletion ?   2 
4 5XF6 THR D 32  ? UNP P02281 SER 33  variant  29  3 
5 5XF6 ALA E 102 ? UNP P84233 GLY 103 variant  102 4 
7 5XF6 ?   G ?   ? UNP Q6AZJ8 ALA 127 deletion ?   5 
8 5XF6 THR H 32  ? UNP P02281 SER 33  variant  29  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                      ?               
'C3 H7 N O2'             89.093  
ARG 'L-peptide linking' y ARGININE                                                                     ?               
'C6 H15 N4 O2 1'         175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                   ?               
'C4 H8 N2 O3'            132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                              ?               
'C4 H7 N O4'             133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                     ?               
'C3 H7 N O2 S'           121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                         ?               
'C10 H14 N5 O6 P'        331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                          ?               
'C9 H14 N3 O7 P'         307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                         ?               
'C10 H14 N5 O7 P'        347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                 ?               
'C10 H15 N2 O8 P'        322.208 
EDN non-polymer         . ETHANE-1,2-DIAMINE                                                           ETHYLENEDIAMINE 'C2 H8 N2' 
60.098  
GLN 'L-peptide linking' y GLUTAMINE                                                                    ?               
'C5 H10 N2 O3'           146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                              ?               
'C5 H9 N O4'             147.129 
GLY 'peptide linking'   y GLYCINE                                                                      ?               
'C2 H5 N O2'             75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                    ?               
'C6 H10 N3 O2 1'         156.162 
HOH non-polymer         . WATER                                                                        ?               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                   ?               
'C6 H13 N O2'            131.173 
LEU 'L-peptide linking' y LEUCINE                                                                      ?               
'C6 H13 N O2'            131.173 
LYS 'L-peptide linking' y LYSINE                                                                       ?               
'C6 H15 N2 O2 1'         147.195 
MET 'L-peptide linking' y METHIONINE                                                                   ?               
'C5 H11 N O2 S'          149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                              ?               'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                ?               
'C9 H11 N O2'            165.189 
PRO 'L-peptide linking' y PROLINE                                                                      ?               
'C5 H9 N O2'             115.130 
RUD non-polymer         . '[ethane6-3-(p-tolyl)propanoic acid]Ru(1,3,5-triaza-7-phosphaadamantane)Cl2' ?               
'C16 H24 Cl2 N3 O2 P Ru' 493.330 
SER 'L-peptide linking' y SERINE                                                                       ?               
'C3 H7 N O3'             105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                ?               'O4 S -2' 
96.063  
THR 'L-peptide linking' y THREONINE                                                                    ?               
'C4 H9 N O3'             119.119 
TYR 'L-peptide linking' y TYROSINE                                                                     ?               
'C9 H11 N O3'            181.189 
VAL 'L-peptide linking' y VALINE                                                                       ?               
'C5 H11 N O2'            117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5XF6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.70 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.44 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '40 mM MnCl2, 30 mM KCl, 20 mM K-Cacodylate , pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-09-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5XF6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.63 
_reflns.d_resolution_low                 48.81 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       60682 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            31.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.63 
_reflns_shell.d_res_low                   2.77 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        71.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5XF6 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     57584 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.15 
_refine.ls_d_res_high                            2.63 
_refine.ls_percent_reflns_obs                    94.24 
_refine.ls_R_factor_obs                          0.21050 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20820 
_refine.ls_R_factor_R_free                       0.25422 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3032 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.935 
_refine.B_iso_mean                               90.390 
_refine.aniso_B[1][1]                            2.39 
_refine.aniso_B[2][2]                            -4.82 
_refine.aniso_B[3][3]                            2.43 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      3MNN 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.655 
_refine.pdbx_overall_ESU_R_Free                  0.318 
_refine.overall_SU_ML                            0.271 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.307 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        6086 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             22 
_refine_hist.number_atoms_total               12111 
_refine_hist.d_res_high                       2.63 
_refine_hist.d_res_low                        47.15 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.015  ? 12910 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 9677  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.454  1.549  ? 18719 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.201  3.000  ? 22401 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.429  5.000  ? 757   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.860 21.255 ? 271   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.820 15.000 ? 1183  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.052 15.000 ? 86    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.211  0.200  ? 1834  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 10292 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2849  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  4.477  6.309  ? 3052  'X-RAY DIFFRACTION' ? 
r_mcbond_other               4.475  6.307  ? 3051  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 6.650  9.432  ? 3801  'X-RAY DIFFRACTION' ? 
r_mcangle_other              6.649  9.436  ? 3802  'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.729  10.738 ? 9858  'X-RAY DIFFRACTION' ? 
r_scbond_other               6.729  10.739 ? 9859  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              10.047 16.091 ? 14871 'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       13.517 95.915 ? 16451 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         13.517 95.921 ? 16452 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.632 
_refine_ls_shell.d_res_low                        2.700 
_refine_ls_shell.number_reflns_R_work             2829 
_refine_ls_shell.R_factor_R_work                  0.371 
_refine_ls_shell.percent_reflns_obs               63.33 
_refine_ls_shell.R_factor_R_free                  0.410 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5XF6 
_struct.title                        
'Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having an ethylenediamine linker' 
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5XF6 
_struct_keywords.text            
'Nucleosome, Histone adduct, Ruthenium compound, Binuclear metal-based agent, STRUCTURAL PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 1  ? 
F N N 2  ? 
G N N 3  ? 
H N N 4  ? 
I N N 5  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 7  ? 
N N N 9  ? 
O N N 10 ? 
P N N 7  ? 
Q N N 9  ? 
R N N 11 ? 
S N N 11 ? 
T N N 11 ? 
U N N 11 ? 
V N N 11 ? 
W N N 11 ? 
X N N 11 ? 
Y N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASP B 24  ? ILE B 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  AA6 THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 AB1 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 AB3 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER D 55  ? ASN D 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO D 103 ? SER D 123 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 AC1 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG E 63  ? LYS E 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 AC3 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 AC6 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 AD1 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 AD3 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 AD4 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO H 103 ? ALA H 124 ? PRO H 100 ALA H 121 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ?   ? E ASP 77  OD1 ? ? ? 1_555 L MG  .   MG  ? ? E ASP 77   E MG  1001 1_555 ? ? ? ? ? ? ?               1.892 ? 
metalc2   metalc ?   ? G GLU 61  OE2 ? ? ? 1_555 N RUD .   RU  ? ? G GLU 61   G RUD 202  1_555 ? ? ? ? ? ? ?               2.129 ? 
metalc3   metalc ?   ? G GLU 64  OE1 ? ? ? 1_555 N RUD .   RU  ? ? G GLU 64   G RUD 202  1_555 ? ? ? ? ? ? ?               2.129 ? 
metalc4   metalc ?   ? H GLU 105 OE1 ? ? ? 1_555 Q RUD .   RU  ? ? H GLU 102  H RUD 202  1_555 ? ? ? ? ? ? ?               2.169 ? 
metalc5   metalc ?   ? H HIS 109 NE2 ? ? ? 1_555 Q RUD .   RU  ? ? H HIS 106  H RUD 202  1_555 ? ? ? ? ? ? ?               2.154 ? 
metalc6   metalc ?   ? L MG  .   MG  ? ? ? 1_555 U HOH .   O   ? ? E MG  1001 E HOH 1105 1_555 ? ? ? ? ? ? ?               1.843 ? 
metalc7   metalc ?   ? L MG  .   MG  ? ? ? 1_555 U HOH .   O   ? ? E MG  1001 E HOH 1106 1_555 ? ? ? ? ? ? ?               2.368 ? 
covale1   covale one ? N RUD .   C26 ? ? ? 1_555 O EDN .   NAD ? ? G RUD 202  G EDN 203  1_555 ? ? ? ? ? ? ?               1.329 ? 
covale2   covale one ? O EDN .   NAA ? ? ? 1_555 Q RUD .   C26 ? ? G EDN 203  H RUD 202  1_555 ? ? ? ? ? ? ?               1.366 ? 
metalc8   metalc ?   ? D VAL 48  O   ? ? ? 1_555 L MG  .   MG  ? ? D VAL 45   E MG  1001 3_555 ? ? ? ? ? ? ?               2.160 ? 
metalc9   metalc ?   ? L MG  .   MG  ? ? ? 1_555 T HOH .   O   ? ? E MG  1001 D HOH 202  3_545 ? ? ? ? ? ? ?               1.971 ? 
metalc10  metalc ?   ? L MG  .   MG  ? ? ? 1_555 T HOH .   O   ? ? E MG  1001 D HOH 201  3_545 ? ? ? ? ? ? ?               2.154 ? 
hydrog1   hydrog ?   ? I DA  1   N1  ? ? ? 1_555 J DT  145 N3  ? ? I DA  -72  J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ?   ? I DA  1   N6  ? ? ? 1_555 J DT  145 O4  ? ? I DA  -72  J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ?   ? I DT  2   N3  ? ? ? 1_555 J DA  144 N1  ? ? I DT  -71  J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ?   ? I DT  2   O4  ? ? ? 1_555 J DA  144 N6  ? ? I DT  -71  J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ?   ? I DC  3   N3  ? ? ? 1_555 J DG  143 N1  ? ? I DC  -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ?   ? I DC  3   N4  ? ? ? 1_555 J DG  143 O6  ? ? I DC  -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ?   ? I DC  3   O2  ? ? ? 1_555 J DG  143 N2  ? ? I DC  -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ?   ? I DA  4   N1  ? ? ? 1_555 J DT  142 N3  ? ? I DA  -69  J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ?   ? I DA  4   N6  ? ? ? 1_555 J DT  142 O4  ? ? I DA  -69  J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ?   ? I DA  5   N1  ? ? ? 1_555 J DT  141 N3  ? ? I DA  -68  J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ?   ? I DA  5   N6  ? ? ? 1_555 J DT  141 O4  ? ? I DA  -68  J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ?   ? I DT  6   N3  ? ? ? 1_555 J DA  140 N1  ? ? I DT  -67  J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ?   ? I DT  6   O4  ? ? ? 1_555 J DA  140 N6  ? ? I DT  -67  J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ?   ? I DA  7   N1  ? ? ? 1_555 J DT  139 N3  ? ? I DA  -66  J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ?   ? I DA  7   N6  ? ? ? 1_555 J DT  139 O4  ? ? I DA  -66  J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ?   ? I DT  8   N3  ? ? ? 1_555 J DA  138 N1  ? ? I DT  -65  J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ?   ? I DT  8   O4  ? ? ? 1_555 J DA  138 N6  ? ? I DT  -65  J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ?   ? I DC  9   N3  ? ? ? 1_555 J DG  137 N1  ? ? I DC  -64  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ?   ? I DC  9   N4  ? ? ? 1_555 J DG  137 O6  ? ? I DC  -64  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ?   ? I DC  9   O2  ? ? ? 1_555 J DG  137 N2  ? ? I DC  -64  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ?   ? I DC  10  N3  ? ? ? 1_555 J DG  136 N1  ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ?   ? I DC  10  N4  ? ? ? 1_555 J DG  136 O6  ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ?   ? I DC  10  O2  ? ? ? 1_555 J DG  136 N2  ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ?   ? I DA  11  N1  ? ? ? 1_555 J DG  134 N1  ? ? I DA  -62  J DG  61   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog25  hydrog ?   ? I DA  11  N6  ? ? ? 1_555 J DG  134 O6  ? ? I DA  -62  J DG  61   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog26  hydrog ?   ? I DA  11  N1  ? ? ? 1_555 J DT  135 N3  ? ? I DA  -62  J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ?   ? I DA  11  N6  ? ? ? 1_555 J DT  135 O4  ? ? I DA  -62  J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ?   ? I DC  12  O2  ? ? ? 1_555 J DG  134 N2  ? ? I DC  -61  J DG  61   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog29  hydrog ?   ? I DC  13  N3  ? ? ? 1_555 J DG  133 N1  ? ? I DC  -60  J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ?   ? I DC  13  N4  ? ? ? 1_555 J DG  133 O6  ? ? I DC  -60  J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ?   ? I DC  13  O2  ? ? ? 1_555 J DG  133 N2  ? ? I DC  -60  J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ?   ? I DT  14  N3  ? ? ? 1_555 J DA  132 N1  ? ? I DT  -59  J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ?   ? I DT  14  O4  ? ? ? 1_555 J DA  132 N6  ? ? I DT  -59  J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ?   ? I DG  15  N1  ? ? ? 1_555 J DC  131 N3  ? ? I DG  -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ?   ? I DG  15  N2  ? ? ? 1_555 J DC  131 O2  ? ? I DG  -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ?   ? I DG  15  O6  ? ? ? 1_555 J DC  131 N4  ? ? I DG  -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ?   ? I DC  16  N3  ? ? ? 1_555 J DG  130 N1  ? ? I DC  -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ?   ? I DC  16  N4  ? ? ? 1_555 J DG  130 O6  ? ? I DC  -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ?   ? I DC  16  O2  ? ? ? 1_555 J DG  130 N2  ? ? I DC  -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ?   ? I DA  17  N1  ? ? ? 1_555 J DT  129 N3  ? ? I DA  -56  J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ?   ? I DA  17  N6  ? ? ? 1_555 J DT  129 O4  ? ? I DA  -56  J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ?   ? I DG  18  N1  ? ? ? 1_555 J DC  128 N3  ? ? I DG  -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ?   ? I DG  18  N2  ? ? ? 1_555 J DC  128 O2  ? ? I DG  -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ?   ? I DG  18  O6  ? ? ? 1_555 J DC  128 N4  ? ? I DG  -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ?   ? I DA  19  N1  ? ? ? 1_555 J DT  127 N3  ? ? I DA  -54  J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ?   ? I DA  19  N6  ? ? ? 1_555 J DT  127 O4  ? ? I DA  -54  J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ?   ? I DT  20  N3  ? ? ? 1_555 J DA  126 N1  ? ? I DT  -53  J DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ?   ? I DT  20  O4  ? ? ? 1_555 J DA  126 N6  ? ? I DT  -53  J DA  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ?   ? I DA  21  N1  ? ? ? 1_555 J DT  125 N3  ? ? I DA  -52  J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ?   ? I DA  21  N6  ? ? ? 1_555 J DT  125 O4  ? ? I DA  -52  J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ?   ? I DC  22  N3  ? ? ? 1_555 J DG  124 N1  ? ? I DC  -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ?   ? I DC  22  N4  ? ? ? 1_555 J DG  124 O6  ? ? I DC  -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ?   ? I DC  22  O2  ? ? ? 1_555 J DG  124 N2  ? ? I DC  -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ?   ? I DT  23  N3  ? ? ? 1_555 J DA  123 N1  ? ? I DT  -50  J DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ?   ? I DT  23  O4  ? ? ? 1_555 J DA  123 N6  ? ? I DT  -50  J DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ?   ? I DA  24  N1  ? ? ? 1_555 J DG  121 N1  ? ? I DA  -49  J DG  48   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog57  hydrog ?   ? I DA  24  N6  ? ? ? 1_555 J DG  121 O6  ? ? I DA  -49  J DG  48   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog58  hydrog ?   ? I DA  24  N1  ? ? ? 1_555 J DT  122 N3  ? ? I DA  -49  J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ?   ? I DA  24  N6  ? ? ? 1_555 J DT  122 O4  ? ? I DA  -49  J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ?   ? I DC  25  N3  ? ? ? 1_555 J DG  121 N1  ? ? I DC  -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ?   ? I DC  25  N4  ? ? ? 1_555 J DG  121 O6  ? ? I DC  -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ?   ? I DC  25  O2  ? ? ? 1_555 J DG  121 N2  ? ? I DC  -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ?   ? I DC  26  N3  ? ? ? 1_555 J DG  120 N1  ? ? I DC  -47  J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ?   ? I DC  26  N4  ? ? ? 1_555 J DG  120 O6  ? ? I DC  -47  J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ?   ? I DC  26  O2  ? ? ? 1_555 J DG  120 N2  ? ? I DC  -47  J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ?   ? I DA  27  N1  ? ? ? 1_555 J DT  119 N3  ? ? I DA  -46  J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ?   ? I DA  27  N6  ? ? ? 1_555 J DT  119 O4  ? ? I DA  -46  J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ?   ? I DA  28  N1  ? ? ? 1_555 J DT  118 N3  ? ? I DA  -45  J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ?   ? I DA  28  N6  ? ? ? 1_555 J DT  118 O4  ? ? I DA  -45  J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ?   ? I DA  29  N1  ? ? ? 1_555 J DT  117 N3  ? ? I DA  -44  J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ?   ? I DA  29  N6  ? ? ? 1_555 J DT  117 O4  ? ? I DA  -44  J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ?   ? I DA  30  N1  ? ? ? 1_555 J DT  116 N3  ? ? I DA  -43  J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ?   ? I DA  30  N6  ? ? ? 1_555 J DT  116 O4  ? ? I DA  -43  J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ?   ? I DG  31  N1  ? ? ? 1_555 J DC  115 N3  ? ? I DG  -42  J DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ?   ? I DG  31  N2  ? ? ? 1_555 J DC  115 O2  ? ? I DG  -42  J DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ?   ? I DG  31  O6  ? ? ? 1_555 J DC  115 N4  ? ? I DG  -42  J DC  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ?   ? I DT  32  N3  ? ? ? 1_555 J DA  114 N1  ? ? I DT  -41  J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ?   ? I DT  32  O4  ? ? ? 1_555 J DA  114 N6  ? ? I DT  -41  J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ?   ? I DG  33  N1  ? ? ? 1_555 J DC  113 N3  ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ?   ? I DG  33  N2  ? ? ? 1_555 J DC  113 O2  ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ?   ? I DG  33  O6  ? ? ? 1_555 J DC  113 N4  ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ?   ? I DT  34  N3  ? ? ? 1_555 J DA  112 N1  ? ? I DT  -39  J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ?   ? I DT  34  O4  ? ? ? 1_555 J DA  112 N6  ? ? I DT  -39  J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ?   ? I DA  35  N1  ? ? ? 1_555 J DT  111 N3  ? ? I DA  -38  J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ?   ? I DA  35  N6  ? ? ? 1_555 J DT  111 O4  ? ? I DA  -38  J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ?   ? I DT  36  N3  ? ? ? 1_555 J DA  110 N1  ? ? I DT  -37  J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ?   ? I DT  36  O4  ? ? ? 1_555 J DA  110 N6  ? ? I DT  -37  J DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ?   ? I DT  37  N3  ? ? ? 1_555 J DA  109 N1  ? ? I DT  -36  J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ?   ? I DT  37  O4  ? ? ? 1_555 J DA  109 N6  ? ? I DT  -36  J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ?   ? I DT  38  N3  ? ? ? 1_555 J DA  108 N1  ? ? I DT  -35  J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ?   ? I DT  38  O4  ? ? ? 1_555 J DA  108 N6  ? ? I DT  -35  J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ?   ? I DG  40  N1  ? ? ? 1_555 J DC  106 N3  ? ? I DG  -33  J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ?   ? I DG  40  N2  ? ? ? 1_555 J DC  106 O2  ? ? I DG  -33  J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ?   ? I DG  40  O6  ? ? ? 1_555 J DC  106 N4  ? ? I DG  -33  J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ?   ? I DA  41  N1  ? ? ? 1_555 J DT  105 N3  ? ? I DA  -32  J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ?   ? I DA  41  N6  ? ? ? 1_555 J DT  105 O4  ? ? I DA  -32  J DT  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ?   ? I DA  42  N1  ? ? ? 1_555 J DT  104 N3  ? ? I DA  -31  J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ?   ? I DA  42  N6  ? ? ? 1_555 J DT  104 O4  ? ? I DA  -31  J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ?   ? I DA  43  N1  ? ? ? 1_555 J DT  103 N3  ? ? I DA  -30  J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ?   ? I DA  43  N6  ? ? ? 1_555 J DT  103 O4  ? ? I DA  -30  J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ?   ? I DC  44  N3  ? ? ? 1_555 J DG  102 N2  ? ? I DC  -29  J DG  29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog102 hydrog ?   ? I DT  45  N3  ? ? ? 1_555 J DA  101 N1  ? ? I DT  -28  J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ?   ? I DT  45  O4  ? ? ? 1_555 J DA  101 N6  ? ? I DT  -28  J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ?   ? I DG  46  N1  ? ? ? 1_555 J DC  100 N3  ? ? I DG  -27  J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ?   ? I DG  46  N2  ? ? ? 1_555 J DC  100 O2  ? ? I DG  -27  J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ?   ? I DG  46  O6  ? ? ? 1_555 J DC  100 N4  ? ? I DG  -27  J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ?   ? I DC  47  N3  ? ? ? 1_555 J DG  99  N1  ? ? I DC  -26  J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ?   ? I DC  47  N4  ? ? ? 1_555 J DG  99  O6  ? ? I DC  -26  J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ?   ? I DC  47  O2  ? ? ? 1_555 J DG  99  N2  ? ? I DC  -26  J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ?   ? I DT  48  N3  ? ? ? 1_555 J DA  98  N1  ? ? I DT  -25  J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ?   ? I DT  48  O4  ? ? ? 1_555 J DA  98  N6  ? ? I DT  -25  J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ?   ? I DC  49  N3  ? ? ? 1_555 J DG  97  N1  ? ? I DC  -24  J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ?   ? I DC  49  N4  ? ? ? 1_555 J DG  97  O6  ? ? I DC  -24  J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ?   ? I DC  49  O2  ? ? ? 1_555 J DG  97  N2  ? ? I DC  -24  J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ?   ? I DC  50  N3  ? ? ? 1_555 J DG  96  N1  ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ?   ? I DC  50  N4  ? ? ? 1_555 J DG  96  O6  ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ?   ? I DC  50  O2  ? ? ? 1_555 J DG  96  N2  ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ?   ? I DA  51  N1  ? ? ? 1_555 J DT  95  N3  ? ? I DA  -22  J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ?   ? I DA  51  N6  ? ? ? 1_555 J DT  95  O4  ? ? I DA  -22  J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ?   ? I DT  52  N3  ? ? ? 1_555 J DA  94  N1  ? ? I DT  -21  J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ?   ? I DT  52  O4  ? ? ? 1_555 J DA  94  N6  ? ? I DT  -21  J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ?   ? I DC  53  N3  ? ? ? 1_555 J DG  93  N1  ? ? I DC  -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ?   ? I DC  53  N4  ? ? ? 1_555 J DG  93  O6  ? ? I DC  -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ?   ? I DC  53  O2  ? ? ? 1_555 J DG  93  N2  ? ? I DC  -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ?   ? I DA  54  N1  ? ? ? 1_555 J DT  92  N3  ? ? I DA  -19  J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ?   ? I DA  54  N6  ? ? ? 1_555 J DT  92  O4  ? ? I DA  -19  J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ?   ? I DA  55  N1  ? ? ? 1_555 J DT  91  N3  ? ? I DA  -18  J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ?   ? I DA  55  N6  ? ? ? 1_555 J DT  91  O4  ? ? I DA  -18  J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ?   ? I DA  56  N1  ? ? ? 1_555 J DT  90  N3  ? ? I DA  -17  J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ?   ? I DA  56  N6  ? ? ? 1_555 J DT  90  O4  ? ? I DA  -17  J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ?   ? I DA  57  N1  ? ? ? 1_555 J DT  89  N3  ? ? I DA  -16  J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ?   ? I DA  57  N6  ? ? ? 1_555 J DT  89  O4  ? ? I DA  -16  J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ?   ? I DG  58  N1  ? ? ? 1_555 J DC  88  N3  ? ? I DG  -15  J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ?   ? I DG  58  N2  ? ? ? 1_555 J DC  88  O2  ? ? I DG  -15  J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ?   ? I DG  58  O6  ? ? ? 1_555 J DC  88  N4  ? ? I DG  -15  J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ?   ? I DC  60  O2  ? ? ? 1_555 J DG  86  N1  ? ? I DC  -13  J DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog137 hydrog ?   ? I DA  61  N1  ? ? ? 1_555 J DT  85  N3  ? ? I DA  -12  J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ?   ? I DA  61  N6  ? ? ? 1_555 J DT  85  O4  ? ? I DA  -12  J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ?   ? I DT  62  N3  ? ? ? 1_555 J DA  84  N1  ? ? I DT  -11  J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ?   ? I DT  62  O4  ? ? ? 1_555 J DA  84  N6  ? ? I DT  -11  J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ?   ? I DG  63  N1  ? ? ? 1_555 J DC  83  N3  ? ? I DG  -10  J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ?   ? I DG  63  N2  ? ? ? 1_555 J DC  83  O2  ? ? I DG  -10  J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ?   ? I DG  63  O6  ? ? ? 1_555 J DC  83  N4  ? ? I DG  -10  J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ?   ? I DT  64  N3  ? ? ? 1_555 J DA  82  N1  ? ? I DT  -9   J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ?   ? I DT  64  O4  ? ? ? 1_555 J DA  82  N6  ? ? I DT  -9   J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ?   ? I DT  65  N3  ? ? ? 1_555 J DA  81  N1  ? ? I DT  -8   J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ?   ? I DT  65  O4  ? ? ? 1_555 J DA  81  N6  ? ? I DT  -8   J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ?   ? I DC  66  N3  ? ? ? 1_555 J DG  80  N1  ? ? I DC  -7   J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ?   ? I DC  66  N4  ? ? ? 1_555 J DG  80  O6  ? ? I DC  -7   J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ?   ? I DC  66  O2  ? ? ? 1_555 J DG  80  N2  ? ? I DC  -7   J DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ?   ? I DA  67  N1  ? ? ? 1_555 J DT  79  N3  ? ? I DA  -6   J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ?   ? I DA  67  N6  ? ? ? 1_555 J DT  79  O4  ? ? I DA  -6   J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ?   ? I DG  68  N1  ? ? ? 1_555 J DC  78  N3  ? ? I DG  -5   J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ?   ? I DG  68  N2  ? ? ? 1_555 J DC  78  O2  ? ? I DG  -5   J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ?   ? I DG  68  O6  ? ? ? 1_555 J DC  78  N4  ? ? I DG  -5   J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ?   ? I DC  69  N3  ? ? ? 1_555 J DG  77  N1  ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ?   ? I DC  69  N4  ? ? ? 1_555 J DG  77  O6  ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ?   ? I DC  69  O2  ? ? ? 1_555 J DG  77  N2  ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ?   ? I DT  70  N3  ? ? ? 1_555 J DA  76  N1  ? ? I DT  -3   J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ?   ? I DT  70  O4  ? ? ? 1_555 J DA  76  N6  ? ? I DT  -3   J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ?   ? I DG  71  N1  ? ? ? 1_555 J DC  75  N3  ? ? I DG  -2   J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ?   ? I DG  71  N2  ? ? ? 1_555 J DC  75  O2  ? ? I DG  -2   J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ?   ? I DG  71  O6  ? ? ? 1_555 J DC  75  N4  ? ? I DG  -2   J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ?   ? I DA  72  N1  ? ? ? 1_555 J DT  74  N3  ? ? I DA  -1   J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ?   ? I DA  72  N6  ? ? ? 1_555 J DT  74  O4  ? ? I DA  -1   J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ?   ? I DA  73  N1  ? ? ? 1_555 J DT  73  N3  ? ? I DA  0    J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ?   ? I DA  73  N6  ? ? ? 1_555 J DT  73  O4  ? ? I DA  0    J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ?   ? I DT  74  N3  ? ? ? 1_555 J DA  72  N1  ? ? I DT  1    J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ?   ? I DT  74  O4  ? ? ? 1_555 J DA  72  N6  ? ? I DT  1    J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ?   ? I DC  75  N3  ? ? ? 1_555 J DG  71  N1  ? ? I DC  2    J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ?   ? I DC  75  N4  ? ? ? 1_555 J DG  71  O6  ? ? I DC  2    J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ?   ? I DC  75  O2  ? ? ? 1_555 J DG  71  N2  ? ? I DC  2    J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ?   ? I DA  76  N1  ? ? ? 1_555 J DT  70  N3  ? ? I DA  3    J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ?   ? I DA  76  N6  ? ? ? 1_555 J DT  70  O4  ? ? I DA  3    J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ?   ? I DG  77  N1  ? ? ? 1_555 J DC  69  N3  ? ? I DG  4    J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ?   ? I DG  77  N2  ? ? ? 1_555 J DC  69  O2  ? ? I DG  4    J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ?   ? I DG  77  O6  ? ? ? 1_555 J DC  69  N4  ? ? I DG  4    J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ?   ? I DC  78  N3  ? ? ? 1_555 J DG  68  N1  ? ? I DC  5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ?   ? I DC  78  N4  ? ? ? 1_555 J DG  68  O6  ? ? I DC  5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ?   ? I DC  78  O2  ? ? ? 1_555 J DG  68  N2  ? ? I DC  5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ?   ? I DT  79  N3  ? ? ? 1_555 J DA  67  N1  ? ? I DT  6    J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ?   ? I DT  79  O4  ? ? ? 1_555 J DA  67  N6  ? ? I DT  6    J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ?   ? I DG  80  N1  ? ? ? 1_555 J DC  66  N3  ? ? I DG  7    J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ?   ? I DG  80  N2  ? ? ? 1_555 J DC  66  O2  ? ? I DG  7    J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ?   ? I DG  80  O6  ? ? ? 1_555 J DC  66  N4  ? ? I DG  7    J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ?   ? I DA  81  N1  ? ? ? 1_555 J DT  65  N3  ? ? I DA  8    J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ?   ? I DA  81  N6  ? ? ? 1_555 J DT  65  O4  ? ? I DA  8    J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ?   ? I DA  82  N1  ? ? ? 1_555 J DT  64  N3  ? ? I DA  9    J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ?   ? I DA  82  N6  ? ? ? 1_555 J DT  64  O4  ? ? I DA  9    J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ?   ? I DC  83  N3  ? ? ? 1_555 J DG  63  N1  ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ?   ? I DC  83  N4  ? ? ? 1_555 J DG  63  O6  ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ?   ? I DC  83  O2  ? ? ? 1_555 J DG  63  N2  ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ?   ? I DA  84  N1  ? ? ? 1_555 J DT  62  N3  ? ? I DA  11   J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ?   ? I DA  84  N6  ? ? ? 1_555 J DT  62  O4  ? ? I DA  11   J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ?   ? I DT  85  N3  ? ? ? 1_555 J DA  61  N1  ? ? I DT  12   J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ?   ? I DT  85  O4  ? ? ? 1_555 J DA  61  N6  ? ? I DT  12   J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ?   ? I DG  86  N1  ? ? ? 1_555 J DC  60  N3  ? ? I DG  13   J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ?   ? I DG  86  N2  ? ? ? 1_555 J DC  60  O2  ? ? I DG  13   J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ?   ? I DG  86  O6  ? ? ? 1_555 J DC  60  N4  ? ? I DG  13   J DC  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ?   ? I DC  87  N3  ? ? ? 1_555 J DG  59  N1  ? ? I DC  14   J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ?   ? I DC  87  N4  ? ? ? 1_555 J DG  59  O6  ? ? I DC  14   J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ?   ? I DC  87  O2  ? ? ? 1_555 J DG  59  N2  ? ? I DC  14   J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ?   ? I DC  88  N3  ? ? ? 1_555 J DG  58  N1  ? ? I DC  15   J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ?   ? I DC  88  N4  ? ? ? 1_555 J DG  58  O6  ? ? I DC  15   J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ?   ? I DC  88  O2  ? ? ? 1_555 J DG  58  N2  ? ? I DC  15   J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ?   ? I DT  89  N3  ? ? ? 1_555 J DA  57  N1  ? ? I DT  16   J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ?   ? I DT  89  O4  ? ? ? 1_555 J DA  57  N6  ? ? I DT  16   J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ?   ? I DT  90  N3  ? ? ? 1_555 J DA  56  N1  ? ? I DT  17   J DA  -17  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog209 hydrog ?   ? I DT  91  N3  ? ? ? 1_555 J DA  55  N1  ? ? I DT  18   J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ?   ? I DT  91  O4  ? ? ? 1_555 J DA  55  N6  ? ? I DT  18   J DA  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ?   ? I DT  92  N3  ? ? ? 1_555 J DA  54  N1  ? ? I DT  19   J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ?   ? I DT  92  O4  ? ? ? 1_555 J DA  54  N6  ? ? I DT  19   J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ?   ? I DG  93  N1  ? ? ? 1_555 J DA  54  N1  ? ? I DG  20   J DA  -19  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog214 hydrog ?   ? I DG  93  O6  ? ? ? 1_555 J DA  54  N6  ? ? I DG  20   J DA  -19  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog215 hydrog ?   ? I DG  96  N1  ? ? ? 1_555 J DC  50  N3  ? ? I DG  23   J DC  -23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ?   ? I DG  96  N2  ? ? ? 1_555 J DC  50  O2  ? ? I DG  23   J DC  -23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ?   ? I DG  96  O6  ? ? ? 1_555 J DC  50  N4  ? ? I DG  23   J DC  -23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ?   ? I DG  97  N1  ? ? ? 1_555 J DC  49  N3  ? ? I DG  24   J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ?   ? I DG  97  N2  ? ? ? 1_555 J DC  49  O2  ? ? I DG  24   J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ?   ? I DG  97  O6  ? ? ? 1_555 J DC  49  N4  ? ? I DG  24   J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ?   ? I DA  98  N1  ? ? ? 1_555 J DT  48  N3  ? ? I DA  25   J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ?   ? I DA  98  N6  ? ? ? 1_555 J DT  48  O4  ? ? I DA  25   J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ?   ? I DG  99  N1  ? ? ? 1_555 J DC  47  N3  ? ? I DG  26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ?   ? I DG  99  N2  ? ? ? 1_555 J DC  47  O2  ? ? I DG  26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ?   ? I DG  99  O6  ? ? ? 1_555 J DC  47  N4  ? ? I DG  26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ?   ? I DC  100 O2  ? ? ? 1_555 J DG  46  N2  ? ? I DC  27   J DG  -27  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog227 hydrog ?   ? I DA  101 N1  ? ? ? 1_555 J DT  45  N3  ? ? I DA  28   J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ?   ? I DA  101 N6  ? ? ? 1_555 J DT  45  O4  ? ? I DA  28   J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ?   ? I DG  102 N2  ? ? ? 1_555 J DC  44  O2  ? ? I DG  29   J DC  -29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog230 hydrog ?   ? I DG  102 N2  ? ? ? 1_555 J DT  45  O2  ? ? I DG  29   J DT  -28  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog231 hydrog ?   ? I DT  103 N3  ? ? ? 1_555 J DA  43  N1  ? ? I DT  30   J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ?   ? I DT  103 O4  ? ? ? 1_555 J DA  43  N6  ? ? I DT  30   J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ?   ? I DT  104 N3  ? ? ? 1_555 J DA  42  N1  ? ? I DT  31   J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ?   ? I DT  104 O4  ? ? ? 1_555 J DA  42  N6  ? ? I DT  31   J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ?   ? I DT  105 N3  ? ? ? 1_555 J DA  41  N1  ? ? I DT  32   J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ?   ? I DT  105 O4  ? ? ? 1_555 J DA  41  N6  ? ? I DT  32   J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ?   ? I DC  106 N3  ? ? ? 1_555 J DG  40  N1  ? ? I DC  33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ?   ? I DC  106 N4  ? ? ? 1_555 J DG  40  O6  ? ? I DC  33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ?   ? I DC  106 O2  ? ? ? 1_555 J DG  40  N2  ? ? I DC  33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ?   ? I DC  107 N3  ? ? ? 1_555 J DG  39  N1  ? ? I DC  34   J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ?   ? I DC  107 N4  ? ? ? 1_555 J DG  39  O6  ? ? I DC  34   J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ?   ? I DC  107 O2  ? ? ? 1_555 J DG  39  N2  ? ? I DC  34   J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ?   ? I DA  108 N1  ? ? ? 1_555 J DT  38  N3  ? ? I DA  35   J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ?   ? I DA  108 N6  ? ? ? 1_555 J DT  38  O4  ? ? I DA  35   J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ?   ? I DA  109 N1  ? ? ? 1_555 J DT  37  N3  ? ? I DA  36   J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ?   ? I DA  109 N6  ? ? ? 1_555 J DT  37  O4  ? ? I DA  36   J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ?   ? I DA  110 N1  ? ? ? 1_555 J DT  36  N3  ? ? I DA  37   J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ?   ? I DA  110 N6  ? ? ? 1_555 J DT  36  O4  ? ? I DA  37   J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ?   ? I DT  111 N3  ? ? ? 1_555 J DA  35  N1  ? ? I DT  38   J DA  -38  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog250 hydrog ?   ? I DA  112 N1  ? ? ? 1_555 J DT  34  N3  ? ? I DA  39   J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ?   ? I DA  112 N6  ? ? ? 1_555 J DT  34  O4  ? ? I DA  39   J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ?   ? I DC  113 N3  ? ? ? 1_555 J DG  33  N1  ? ? I DC  40   J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ?   ? I DC  113 N4  ? ? ? 1_555 J DG  33  O6  ? ? I DC  40   J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ?   ? I DC  113 O2  ? ? ? 1_555 J DG  33  N2  ? ? I DC  40   J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ?   ? I DA  114 N1  ? ? ? 1_555 J DT  32  N3  ? ? I DA  41   J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ?   ? I DA  114 N6  ? ? ? 1_555 J DT  32  O4  ? ? I DA  41   J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ?   ? I DC  115 N3  ? ? ? 1_555 J DG  31  N1  ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ?   ? I DC  115 N4  ? ? ? 1_555 J DG  31  O6  ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ?   ? I DC  115 O2  ? ? ? 1_555 J DG  31  N2  ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ?   ? I DT  116 N3  ? ? ? 1_555 J DA  30  N1  ? ? I DT  43   J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ?   ? I DT  116 O4  ? ? ? 1_555 J DA  30  N6  ? ? I DT  43   J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ?   ? I DT  117 N3  ? ? ? 1_555 J DA  29  N1  ? ? I DT  44   J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ?   ? I DT  117 O4  ? ? ? 1_555 J DA  29  N6  ? ? I DT  44   J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ?   ? I DT  118 N3  ? ? ? 1_555 J DA  27  N1  ? ? I DT  45   J DA  -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ?   ? I DT  118 O4  ? ? ? 1_555 J DA  27  N6  ? ? I DT  45   J DA  -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ?   ? I DT  118 N3  ? ? ? 1_555 J DA  28  N1  ? ? I DT  45   J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ?   ? I DT  118 O4  ? ? ? 1_555 J DA  28  N6  ? ? I DT  45   J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ?   ? I DT  119 O4  ? ? ? 1_555 J DC  26  N4  ? ? I DT  46   J DC  -47  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog269 hydrog ?   ? I DT  119 N3  ? ? ? 1_555 J DA  27  N1  ? ? I DT  46   J DA  -46  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog270 hydrog ?   ? I DG  120 O6  ? ? ? 1_555 J DC  25  N4  ? ? I DG  47   J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog271 hydrog ?   ? I DG  120 N2  ? ? ? 1_555 J DC  26  N3  ? ? I DG  47   J DC  -47  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog272 hydrog ?   ? I DG  121 N1  ? ? ? 1_555 J DA  24  N1  ? ? I DG  48   J DA  -49  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog273 hydrog ?   ? I DG  121 O6  ? ? ? 1_555 J DA  24  N6  ? ? I DG  48   J DA  -49  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog274 hydrog ?   ? I DT  122 N3  ? ? ? 1_555 J DA  24  N1  ? ? I DT  49   J DA  -49  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog275 hydrog ?   ? I DA  123 N6  ? ? ? 1_555 J DC  22  N3  ? ? I DA  50   J DC  -51  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog276 hydrog ?   ? I DA  123 N1  ? ? ? 1_555 J DT  23  N3  ? ? I DA  50   J DT  -50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog277 hydrog ?   ? I DG  124 N1  ? ? ? 1_555 J DA  21  N1  ? ? I DG  51   J DA  -52  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog278 hydrog ?   ? I DG  124 O6  ? ? ? 1_555 J DA  21  N6  ? ? I DG  51   J DA  -52  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog279 hydrog ?   ? I DT  127 N3  ? ? ? 1_555 J DA  19  N1  ? ? I DT  54   J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ?   ? I DT  127 O4  ? ? ? 1_555 J DA  19  N6  ? ? I DT  54   J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ?   ? I DC  128 N3  ? ? ? 1_555 J DG  18  N1  ? ? I DC  55   J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ?   ? I DC  128 N4  ? ? ? 1_555 J DG  18  O6  ? ? I DC  55   J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ?   ? I DC  128 O2  ? ? ? 1_555 J DG  18  N2  ? ? I DC  55   J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ?   ? I DT  129 N3  ? ? ? 1_555 J DA  17  N1  ? ? I DT  56   J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ?   ? I DT  129 O4  ? ? ? 1_555 J DA  17  N6  ? ? I DT  56   J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ?   ? I DG  130 N1  ? ? ? 1_555 J DC  16  N3  ? ? I DG  57   J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ?   ? I DG  130 N2  ? ? ? 1_555 J DC  16  O2  ? ? I DG  57   J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ?   ? I DG  130 O6  ? ? ? 1_555 J DC  16  N4  ? ? I DG  57   J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ?   ? I DC  131 N3  ? ? ? 1_555 J DG  15  N1  ? ? I DC  58   J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ?   ? I DC  131 N4  ? ? ? 1_555 J DG  15  O6  ? ? I DC  58   J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ?   ? I DC  131 O2  ? ? ? 1_555 J DG  15  N2  ? ? I DC  58   J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ?   ? I DA  132 N1  ? ? ? 1_555 J DT  14  N3  ? ? I DA  59   J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ?   ? I DA  132 N6  ? ? ? 1_555 J DT  14  O4  ? ? I DA  59   J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ?   ? I DG  133 N1  ? ? ? 1_555 J DC  13  N3  ? ? I DG  60   J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ?   ? I DG  133 N2  ? ? ? 1_555 J DC  13  O2  ? ? I DG  60   J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ?   ? I DG  133 O6  ? ? ? 1_555 J DC  13  N4  ? ? I DG  60   J DC  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ?   ? I DG  134 N1  ? ? ? 1_555 J DC  12  N3  ? ? I DG  61   J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ?   ? I DG  134 N2  ? ? ? 1_555 J DC  12  O2  ? ? I DG  61   J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ?   ? I DG  134 O6  ? ? ? 1_555 J DC  12  N4  ? ? I DG  61   J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ?   ? I DT  135 N3  ? ? ? 1_555 J DA  11  N1  ? ? I DT  62   J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ?   ? I DT  135 O4  ? ? ? 1_555 J DA  11  N6  ? ? I DT  62   J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ?   ? I DG  136 N1  ? ? ? 1_555 J DC  10  N3  ? ? I DG  63   J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ?   ? I DG  136 N2  ? ? ? 1_555 J DC  10  O2  ? ? I DG  63   J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ?   ? I DG  136 O6  ? ? ? 1_555 J DC  10  N4  ? ? I DG  63   J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ?   ? I DG  137 N1  ? ? ? 1_555 J DC  9   N3  ? ? I DG  64   J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ?   ? I DG  137 N2  ? ? ? 1_555 J DC  9   O2  ? ? I DG  64   J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ?   ? I DG  137 O6  ? ? ? 1_555 J DC  9   N4  ? ? I DG  64   J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ?   ? I DA  138 N1  ? ? ? 1_555 J DT  8   N3  ? ? I DA  65   J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ?   ? I DA  138 N6  ? ? ? 1_555 J DT  8   O4  ? ? I DA  65   J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ?   ? I DT  139 N3  ? ? ? 1_555 J DA  7   N1  ? ? I DT  66   J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ?   ? I DT  139 O4  ? ? ? 1_555 J DA  7   N6  ? ? I DT  66   J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ?   ? I DA  140 N1  ? ? ? 1_555 J DT  6   N3  ? ? I DA  67   J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ?   ? I DA  140 N6  ? ? ? 1_555 J DT  6   O4  ? ? I DA  67   J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ?   ? I DT  141 N3  ? ? ? 1_555 J DA  5   N1  ? ? I DT  68   J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ?   ? I DT  141 O4  ? ? ? 1_555 J DA  5   N6  ? ? I DT  68   J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ?   ? I DT  142 N3  ? ? ? 1_555 J DA  4   N1  ? ? I DT  69   J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog317 hydrog ?   ? I DT  142 O4  ? ? ? 1_555 J DA  4   N6  ? ? I DT  69   J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ?   ? I DG  143 N1  ? ? ? 1_555 J DC  3   N3  ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ?   ? I DG  143 N2  ? ? ? 1_555 J DC  3   O2  ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ?   ? I DG  143 O6  ? ? ? 1_555 J DC  3   N4  ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ?   ? I DA  144 N1  ? ? ? 1_555 J DT  2   N3  ? ? I DA  71   J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ?   ? I DA  144 N6  ? ? ? 1_555 J DT  2   O4  ? ? I DA  71   J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ?   ? I DT  145 N3  ? ? ? 1_555 J DA  1   N1  ? ? I DT  72   J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog324 hydrog ?   ? I DT  145 O4  ? ? ? 1_555 J DA  1   N6  ? ? I DT  72   J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
AA1 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
AA2 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
AA2 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
AA3 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
AA3 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
AA4 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA4 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
AA5 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
AA5 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
AA6 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
AA6 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
AA7 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
AA7 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
AA8 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
AA8 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
AA9 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA9 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
AB1 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
AB1 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
AA2 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
AA3 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
AA4 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
AA5 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
AA6 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
AA7 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
AA8 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
AA9 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
AB1 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C SO4 1101 ? 6 'binding site for residue SO4 C 1101'               
AC2 Software E MG  1001 ? 6 'binding site for residue MG E 1001'                
AC3 Software G SO4 201  ? 7 'binding site for residue SO4 G 201'                
AC4 Software H SO4 201  ? 4 'binding site for residue SO4 H 201'                
AC5 Software G RUD 202  ? 4 'binding site for residues RUD G 202 and EDN G 203' 
AC6 Software G EDN 203  ? 6 'binding site for residues EDN G 203 and RUD H 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLY C 44  ? GLY C 44   . ? 1_555 ? 
2  AC1 6 ALA C 45  ? ALA C 45   . ? 1_555 ? 
3  AC1 6 GLY C 46  ? GLY C 46   . ? 1_555 ? 
4  AC1 6 ALA C 47  ? ALA C 47   . ? 1_555 ? 
5  AC1 6 THR D 90  ? THR D 87   . ? 1_555 ? 
6  AC1 6 SER D 91  ? SER D 88   . ? 1_555 ? 
7  AC2 6 VAL D 48  ? VAL D 45   . ? 3_545 ? 
8  AC2 6 HOH T .   ? HOH D 201  . ? 3_545 ? 
9  AC2 6 HOH T .   ? HOH D 202  . ? 3_545 ? 
10 AC2 6 ASP E 77  ? ASP E 77   . ? 1_555 ? 
11 AC2 6 HOH U .   ? HOH E 1105 . ? 1_555 ? 
12 AC2 6 HOH U .   ? HOH E 1106 . ? 1_555 ? 
13 AC3 7 GLY G 44  ? GLY G 44   . ? 1_555 ? 
14 AC3 7 ALA G 45  ? ALA G 45   . ? 1_555 ? 
15 AC3 7 GLY G 46  ? GLY G 46   . ? 1_555 ? 
16 AC3 7 ALA G 47  ? ALA G 47   . ? 1_555 ? 
17 AC3 7 THR H 90  ? THR H 87   . ? 1_555 ? 
18 AC3 7 SER H 91  ? SER H 88   . ? 1_555 ? 
19 AC3 7 DA  I 110 ? DA  I 37   . ? 1_555 ? 
20 AC4 4 HIS H 49  ? HIS H 46   . ? 1_555 ? 
21 AC4 4 PRO H 50  ? PRO H 47   . ? 1_555 ? 
22 AC4 4 ASP H 51  ? ASP H 48   . ? 1_555 ? 
23 AC4 4 THR H 52  ? THR H 49   . ? 1_555 ? 
24 AC5 4 ALA G 60  ? ALA G 60   . ? 1_555 ? 
25 AC5 4 GLU G 61  ? GLU G 61   . ? 1_555 ? 
26 AC5 4 GLU G 64  ? GLU G 64   . ? 1_555 ? 
27 AC5 4 RUD Q .   ? RUD H 202  . ? 1_555 ? 
28 AC6 6 ALA G 60  ? ALA G 60   . ? 1_555 ? 
29 AC6 6 GLU G 61  ? GLU G 61   . ? 1_555 ? 
30 AC6 6 GLU G 64  ? GLU G 64   . ? 1_555 ? 
31 AC6 6 GLU H 105 ? GLU H 102  . ? 1_555 ? 
32 AC6 6 HIS H 109 ? HIS H 106  . ? 1_555 ? 
33 AC6 6 DT  I 14  ? DT  I -59  . ? 3_545 ? 
# 
_atom_sites.entry_id                    5XF6 
_atom_sites.fract_transf_matrix[1][1]   0.009360 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009113 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005479 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
RU 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1  38  ? -60.631 -29.210 80.748 1.00 143.18 ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1  38  ? -59.430 -28.619 81.362 1.00 146.45 ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1  38  ? -58.141 -29.373 80.983 1.00 149.53 ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1  38  ? -57.561 -30.068 81.825 1.00 143.40 ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1  38  ? -59.727 -28.728 82.864 1.00 140.40 ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1  38  ? -60.612 -29.932 82.981 1.00 137.96 ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1  38  ? -61.405 -30.028 81.702 1.00 135.33 ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1  39  ? -57.705 -29.224 79.726 1.00 150.97 ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1  39  ? -56.609 -30.038 79.152 1.00 142.50 ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1  39  ? -55.633 -29.231 78.287 1.00 123.96 ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1  39  ? -56.021 -28.572 77.321 1.00 99.05  ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1  39  ? -57.188 -31.192 78.323 1.00 149.71 ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1  39  ? -56.194 -31.849 77.414 1.00 146.97 ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1  39  ? -55.928 -31.385 76.141 1.00 137.65 ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1  39  ? -55.411 -32.939 77.590 1.00 140.48 ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1  39  ? -55.025 -32.162 75.574 1.00 133.98 ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1  39  ? -54.695 -33.112 76.431 1.00 139.98 ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1  40  ? -54.353 -29.346 78.617 1.00 119.24 ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1  40  ? -53.314 -28.499 78.043 1.00 109.44 ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1  40  ? -52.160 -29.362 77.535 1.00 104.53 ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1  40  ? -51.843 -30.394 78.139 1.00 107.28 ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1  40  ? -52.822 -27.547 79.126 1.00 99.68  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1  40  ? -52.126 -26.307 78.628 1.00 95.45  ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1  40  ? -51.951 -25.348 79.781 1.00 91.38  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1  40  ? -51.007 -24.287 79.467 1.00 93.38  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1  40  ? -51.279 -23.223 78.716 1.00 99.70  ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1  40  ? -52.484 -23.049 78.152 1.00 99.11  ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1  40  ? -50.324 -22.321 78.518 1.00 98.33  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1  41  ? -51.539 -28.953 76.428 1.00 94.89  ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1  41  ? -50.376 -29.681 75.911 1.00 89.75  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1  41  ? -49.051 -29.143 76.499 1.00 82.48  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1  41  ? -48.878 -27.933 76.705 1.00 80.18  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1  41  ? -50.357 -29.678 74.374 1.00 90.83  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1  41  ? -51.218 -30.762 73.730 1.00 84.59  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1  41  ? -52.243 -30.434 72.844 1.00 86.16  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1  41  ? -50.991 -32.114 73.997 1.00 81.25  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1  41  ? -53.026 -31.418 72.252 1.00 84.76  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1  41  ? -51.763 -33.104 73.411 1.00 83.55  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1  41  ? -52.784 -32.752 72.541 1.00 88.54  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1  41  ? -53.557 -33.732 71.944 1.00 90.58  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1  42  ? -48.125 -30.056 76.780 1.00 77.49  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1  42  ? -46.849 -29.694 77.401 1.00 81.30  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1  42  ? -46.014 -28.818 76.459 1.00 82.83  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1  42  ? -46.069 -29.001 75.248 1.00 87.10  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1  42  ? -46.064 -30.955 77.762 1.00 85.98  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1  42  ? -46.804 -31.933 78.680 1.00 98.43  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1  42  ? -46.640 -31.594 80.150 1.00 102.29 ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1  42  ? -45.318 -31.989 80.610 1.00 113.43 ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1  42  ? -45.035 -33.071 81.331 1.00 120.35 ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1  42  ? -45.986 -33.909 81.727 1.00 121.84 ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1  42  ? -43.771 -33.302 81.676 1.00 128.16 ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1  43  ? -45.235 -27.863 77.004 1.00 85.05  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  43  ? -44.357 -27.087 76.137 1.00 83.93  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  43  ? -43.529 -28.013 75.285 1.00 84.17  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1  43  ? -42.877 -28.914 75.828 1.00 74.46  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  43  ? -43.452 -26.338 77.114 1.00 85.64  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  43  ? -44.252 -26.234 78.363 1.00 91.17  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  43  ? -45.064 -27.497 78.420 1.00 92.98  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1  44  ? -43.608 -27.823 73.966 1.00 84.66  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1  44  ? -42.769 -28.563 73.017 1.00 90.27  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1  44  ? -43.430 -29.748 72.346 1.00 87.74  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1  44  ? -42.826 -30.384 71.487 1.00 85.07  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1  45  ? -44.667 -30.043 72.735 1.00 84.07  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1  45  ? -45.414 -31.130 72.144 1.00 76.44  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1  45  ? -46.028 -30.669 70.859 1.00 68.18  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1  45  ? -45.982 -31.373 69.863 1.00 78.13  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1  45  ? -46.515 -31.600 73.082 1.00 79.93  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  45  ? -45.914 -31.952 74.330 1.00 89.06  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  45  ? -47.240 -32.811 72.507 1.00 79.91  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  46  ? -46.592 -29.481 70.864 1.00 66.10  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  46  ? -47.124 -28.928 69.629 1.00 74.67  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  46  ? -45.964 -28.568 68.690 1.00 77.28  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1  46  ? -46.091 -28.703 67.469 1.00 76.51  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  46  ? -48.023 -27.698 69.876 1.00 76.09  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  46  ? -48.727 -27.252 68.593 1.00 70.45  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  46  ? -49.047 -28.026 70.952 1.00 79.97  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1  47  ? -44.834 -28.140 69.259 1.00 76.10  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1  47  ? -43.641 -27.821 68.468 1.00 71.46  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1  47  ? -43.201 -29.017 67.637 1.00 67.96  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1  47  ? -43.012 -28.902 66.438 1.00 74.41  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1  47  ? -42.518 -27.365 69.365 1.00 74.44  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1  48  ? -43.063 -30.170 68.270 1.00 68.32  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1  48  ? -42.826 -31.417 67.550 1.00 67.61  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1  48  ? -43.932 -31.729 66.531 1.00 73.50  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1  48  ? -43.683 -32.208 65.405 1.00 67.08  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1  48  ? -42.706 -32.559 68.550 1.00 69.37  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1  48  ? -41.304 -32.920 69.076 1.00 81.41  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1  48  ? -40.177 -32.035 68.567 1.00 84.93  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1  48  ? -41.277 -32.947 70.597 1.00 83.59  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1  49  ? -45.169 -31.472 66.918 1.00 70.85  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1  49  ? -46.251 -31.826 66.040 1.00 71.83  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1  49  ? -46.130 -31.002 64.761 1.00 67.03  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1  49  ? -46.253 -31.541 63.663 1.00 66.84  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1  49  ? -47.593 -31.635 66.743 1.00 79.89  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1  49  ? -48.768 -32.250 66.001 1.00 86.19  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1  49  ? -49.904 -32.668 66.921 1.00 88.19  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1  49  ? -50.516 -31.537 67.600 1.00 89.09  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1  49  ? -50.703 -31.439 68.915 1.00 80.96  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1  49  ? -50.353 -32.415 69.749 1.00 71.85  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1  49  ? -51.270 -30.343 69.396 1.00 87.38  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1  50  ? -45.856 -29.708 64.904 1.00 62.70  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  50  ? -45.681 -28.843 63.744 1.00 62.38  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  50  ? -44.436 -29.219 62.929 1.00 63.51  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1  50  ? -44.428 -29.087 61.706 1.00 72.07  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  50  ? -45.612 -27.378 64.148 1.00 63.46  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  50  ? -46.871 -26.821 64.791 1.00 68.09  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  50  ? -46.686 -25.447 65.442 1.00 73.83  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  50  ? -45.742 -24.700 65.102 1.00 75.32  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  50  ? -47.509 -25.094 66.310 1.00 85.69  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1  51  ? -43.385 -29.702 63.566 1.00 58.96  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1  51  ? -42.219 -30.129 62.776 1.00 62.68  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1  51  ? -42.608 -31.266 61.836 1.00 61.83  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1  51  ? -42.261 -31.262 60.662 1.00 61.37  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1  51  ? -41.017 -30.552 63.652 1.00 59.79  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1  51  ? -40.372 -29.317 64.274 1.00 62.81  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1  51  ? -39.982 -31.316 62.843 1.00 57.71  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1  51  ? -39.570 -29.625 65.536 1.00 64.96  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1  52  ? -43.335 -32.243 62.349 1.00 66.97  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1  52  ? -43.710 -33.378 61.521 1.00 64.88  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1  52  ? -44.626 -32.893 60.401 1.00 65.98  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1  52  ? -44.479 -33.296 59.250 1.00 65.92  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1  52  ? -44.347 -34.479 62.372 1.00 63.11  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1  52  ? -43.392 -34.955 63.455 1.00 73.33  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1  52  ? -43.713 -36.314 64.064 1.00 82.01  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1  52  ? -42.549 -36.827 64.821 1.00 89.29  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1  52  ? -42.370 -36.760 66.148 1.00 86.36  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1  52  ? -43.281 -36.218 66.962 1.00 76.75  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1  52  ? -41.253 -37.263 66.672 1.00 88.39  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1  53  ? -45.538 -31.988 60.733 1.00 65.80  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1  53  ? -46.507 -31.522 59.765 1.00 71.13  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1  53  ? -45.809 -30.778 58.640 1.00 71.86  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1  53  ? -45.998 -31.090 57.465 1.00 72.13  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1  53  ? -47.540 -30.612 60.441 1.00 77.53  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1  53  ? -48.600 -30.057 59.505 1.00 75.97  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1  53  ? -49.465 -29.053 60.238 1.00 88.26  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1  53  ? -50.216 -28.219 59.293 1.00 96.80  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1  53  ? -50.717 -27.011 59.562 1.00 95.20  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1  53  ? -50.561 -26.453 60.764 1.00 102.97 ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1  53  ? -51.381 -26.351 58.621 1.00 91.01  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1  54  ? -44.990 -29.799 59.004 1.00 66.26  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1  54  ? -44.369 -28.956 58.005 1.00 63.59  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1  54  ? -43.245 -29.634 57.197 1.00 59.51  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1  54  ? -42.980 -29.245 56.045 1.00 60.33  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1  54  ? -43.931 -27.664 58.656 1.00 62.54  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1  54  ? -45.119 -26.813 59.035 1.00 64.25  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1  54  ? -45.442 -26.567 60.367 1.00 69.24  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1  54  ? -45.939 -26.269 58.061 1.00 64.12  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1  54  ? -46.530 -25.785 60.719 1.00 65.02  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1  54  ? -47.035 -25.504 58.410 1.00 67.31  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1  54  ? -47.320 -25.264 59.740 1.00 66.32  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1  54  ? -48.402 -24.494 60.089 1.00 73.19  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1  55  ? -42.640 -30.676 57.762 1.00 54.19  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1  55  ? -41.613 -31.420 57.051 1.00 57.32  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1  55  ? -42.229 -32.299 55.993 1.00 61.91  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1  55  ? -41.595 -32.620 54.987 1.00 73.52  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1  55  ? -40.696 -32.192 58.014 1.00 55.46  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1  55  ? -39.664 -31.245 58.651 1.00 55.20  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1  55  ? -38.575 -31.892 59.496 1.00 57.68  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1  55  ? -38.545 -33.112 59.749 1.00 54.10  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1  55  ? -37.652 -31.051 59.940 1.00 58.72  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1  56  ? -43.492 -32.631 56.197 1.00 68.33  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1  56  ? -44.207 -33.554 55.334 1.00 68.65  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1  56  ? -44.758 -32.822 54.137 1.00 62.78  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1  56  ? -44.777 -33.384 53.057 1.00 66.66  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1  56  ? -45.352 -34.234 56.094 1.00 77.04  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1  56  ? -45.420 -35.741 55.876 1.00 92.53  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1  56  ? -45.601 -36.503 57.193 1.00 107.47 ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1  56  ? -44.601 -37.654 57.314 1.00 117.99 ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1  56  ? -44.757 -38.412 58.585 1.00 120.44 ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1  57  ? -45.221 -31.590 54.335 1.00 56.23  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1  57  ? -45.727 -30.756 53.249 1.00 58.24  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1  57  ? -44.664 -29.917 52.509 1.00 65.00  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1  57  ? -43.477 -29.845 52.905 1.00 68.36  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1  57  ? -46.784 -29.804 53.793 1.00 59.44  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1  57  ? -46.291 -29.057 54.894 1.00 62.70  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1  58  ? -45.144 -29.262 51.447 1.00 65.04  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1  58  ? -44.369 -28.322 50.646 1.00 60.09  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1  58  ? -45.027 -26.945 50.376 1.00 58.22  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1  58  ? -44.510 -26.162 49.588 1.00 53.07  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1  58  ? -44.104 -28.953 49.303 1.00 57.56  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1  58  ? -45.334 -29.056 48.612 1.00 60.20  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1  58  ? -43.541 -30.333 49.484 1.00 61.73  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1  59  ? -46.159 -26.628 51.001 1.00 60.89  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1  59  ? -46.724 -25.292 50.756 1.00 63.64  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1  59  ? -45.735 -24.253 51.239 1.00 56.56  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1  59  ? -45.056 -24.441 52.230 1.00 53.96  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1  59  ? -48.137 -24.982 51.356 1.00 64.94  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1  59  ? -48.829 -25.926 52.338 1.00 73.76  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1  59  ? -48.063 -26.193 53.611 1.00 79.37  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1  59  ? -48.526 -25.827 54.705 1.00 77.56  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1  59  ? -46.996 -26.811 53.513 1.00 96.95  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1  60  ? -45.697 -23.147 50.530 1.00 50.81  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1  60  ? -45.127 -21.961 51.067 1.00 55.97  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1  60  ? -45.806 -21.550 52.379 1.00 58.67  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1  60  ? -47.018 -21.714 52.542 1.00 69.17  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1  60  ? -45.142 -20.840 50.017 1.00 59.91  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1  60  ? -44.286 -21.157 48.773 1.00 67.79  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1  60  ? -44.381 -20.075 47.722 1.00 74.60  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1  60  ? -42.817 -21.409 49.099 1.00 67.92  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1  61  ? -44.994 -21.004 53.291 1.00 62.91  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1  61  ? -45.346 -20.755 54.682 1.00 62.72  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1  61  ? -45.322 -19.277 55.024 1.00 66.31  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1  61  ? -45.467 -18.913 56.198 1.00 71.58  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1  61  ? -44.344 -21.474 55.585 1.00 61.16  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1  61  ? -44.138 -22.955 55.265 1.00 67.98  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1  61  ? -42.999 -23.568 56.066 1.00 70.05  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1  61  ? -45.417 -23.735 55.512 1.00 66.42  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1  62  ? -45.094 -18.428 54.024 1.00 67.12  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1  62  ? -45.226 -16.966 54.183 1.00 69.44  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1  62  ? -46.429 -16.545 53.334 1.00 66.94  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1  62  ? -46.619 -17.064 52.234 1.00 70.51  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1  62  ? -43.945 -16.217 53.715 1.00 66.37  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1  62  ? -42.748 -16.628 54.541 1.00 68.87  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1  62  ? -44.081 -14.704 53.849 1.00 65.50  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1  62  ? -41.468 -15.962 54.083 1.00 73.67  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1  63  ? -47.232 -15.606 53.817 1.00 66.94  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1  63  ? -48.458 -15.240 53.093 1.00 69.08  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1  63  ? -48.042 -14.447 51.872 1.00 62.87  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1  63  ? -47.171 -13.586 51.974 1.00 67.92  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1  63  ? -49.412 -14.406 53.955 1.00 80.26  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1  63  ? -49.654 -14.893 55.382 1.00 89.30  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1  63  ? -50.478 -16.171 55.425 1.00 98.97  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1  63  ? -51.787 -16.025 54.793 1.00 118.93 ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1  63  ? -52.787 -15.273 55.264 1.00 131.81 ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1  63  ? -52.660 -14.547 56.382 1.00 131.30 ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1  63  ? -53.934 -15.238 54.600 1.00 136.56 ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1  64  ? -48.674 -14.709 50.738 1.00 60.06  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1  64  ? -48.199 -14.198 49.463 1.00 66.54  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1  64  ? -48.133 -12.687 49.415 1.00 70.98  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1  64  ? -47.121 -12.124 48.991 1.00 85.45  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1  64  ? -49.046 -14.720 48.296 1.00 75.37  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1  64  ? -49.053 -16.237 48.188 1.00 82.44  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1  64  ? -49.267 -16.729 46.768 1.00 89.21  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1  64  ? -49.212 -18.250 46.747 1.00 99.70  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1  64  ? -49.118 -18.807 45.370 1.00 106.15 ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1  65  ? -49.190 -12.024 49.853 1.00 74.91  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1  65  ? -49.280 -10.575 49.694 1.00 79.35  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1  65  ? -48.182 -9.801  50.431 1.00 75.28  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1  65  ? -47.502 -8.995  49.789 1.00 71.51  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1  65  ? -50.673 -10.067 50.097 1.00 93.64  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1  65  ? -50.915 -8.547  50.040 1.00 96.58  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1  65  ? -51.096 -8.110  48.597 1.00 89.79  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1  65  ? -52.111 -8.142  50.901 1.00 102.20 ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1  66  ? -48.008 -10.028 51.761 1.00 72.11  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1  66  ? -46.931 -9.345  52.499 1.00 76.49  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1  66  ? -45.572 -9.508  51.830 1.00 79.48  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1  66  ? -44.809 -8.547  51.753 1.00 76.53  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1  66  ? -46.893 -10.042 53.871 1.00 77.35  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1  66  ? -48.027 -10.991 53.916 1.00 76.44  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1  66  ? -48.796 -10.920 52.626 1.00 75.19  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1  67  ? -45.288 -10.727 51.363 1.00 79.31  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1  67  ? -44.059 -11.019 50.652 1.00 71.89  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1  67  ? -43.989 -10.210 49.365 1.00 71.97  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1  67  ? -42.956 -9.628  49.053 1.00 81.14  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1  67  ? -43.942 -12.515 50.351 1.00 71.54  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1  67  ? -42.625 -12.894 49.737 1.00 72.81  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1  67  ? -41.541 -13.195 50.535 1.00 68.25  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1  67  ? -42.454 -12.896 48.361 1.00 71.61  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1  67  ? -40.322 -13.499 49.975 1.00 62.76  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1  67  ? -41.236 -13.211 47.800 1.00 67.99  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1  67  ? -40.166 -13.505 48.607 1.00 64.44  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1  68  ? -45.090 -10.152 48.630 1.00 77.79  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1  68  ? -45.142 -9.388  47.369 1.00 82.44  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1  68  ? -44.757 -7.901  47.566 1.00 78.15  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1  68  ? -43.955 -7.333  46.806 1.00 73.07  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1  68  ? -46.536 -9.518  46.719 1.00 87.50  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1  68  ? -46.519 -9.306  45.212 1.00 99.17  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1  68  ? -47.836 -9.644  44.537 1.00 106.71 ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1  68  ? -48.900 -9.277  45.034 1.00 116.64 ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1  68  ? -47.773 -10.329 43.386 1.00 100.02 ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1  69  ? -45.318 -7.282  48.596 1.00 71.68  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1  69  ? -45.027 -5.883  48.878 1.00 77.44  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1  69  ? -43.570 -5.709  49.231 1.00 68.47  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1  69  ? -42.939 -4.747  48.813 1.00 62.03  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1  69  ? -45.882 -5.351  50.045 1.00 89.90  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1  69  ? -47.378 -5.210  49.765 1.00 91.78  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1  69  ? -48.058 -4.318  50.804 1.00 92.73  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1  69  ? -47.911 -4.797  52.191 1.00 87.88  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1  69  ? -48.763 -5.597  52.836 1.00 81.49  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1  69  ? -49.860 -6.060  52.245 1.00 80.52  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1  69  ? -48.504 -5.952  54.094 1.00 82.18  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1  70  ? -43.048 -6.641  50.024 1.00 69.52  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1  70  ? -41.681 -6.550  50.516 1.00 67.96  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1  70  ? -40.743 -6.642  49.359 1.00 67.82  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1  70  ? -39.750 -5.924  49.310 1.00 69.82  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1  70  ? -41.357 -7.665  51.493 1.00 69.22  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1  70  ? -39.950 -7.624  52.082 1.00 71.24  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1  70  ? -39.760 -6.384  52.923 1.00 72.76  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1  70  ? -39.723 -8.864  52.933 1.00 77.60  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1  71  ? -41.067 -7.519  48.416 1.00 63.34  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1  71  ? -40.272 -7.612  47.209 1.00 61.66  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1  71  ? -40.273 -6.278  46.484 1.00 64.62  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1  71  ? -39.211 -5.731  46.218 1.00 69.44  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1  71  ? -40.786 -8.712  46.291 1.00 62.63  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1  71  ? -40.128 -8.625  44.926 1.00 68.42  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1  71  ? -40.513 -10.066 46.911 1.00 63.76  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1  72  ? -41.461 -5.741  46.194 1.00 67.99  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1  72  ? -41.575 -4.457  45.477 1.00 64.74  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1  72  ? -40.868 -3.318  46.179 1.00 62.47  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1  72  ? -40.152 -2.562  45.535 1.00 66.34  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1  72  ? -43.021 -4.089  45.253 1.00 65.52  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1  72  ? -43.644 -4.941  44.165 1.00 73.88  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1  72  ? -45.153 -4.891  44.214 1.00 71.79  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1  72  ? -45.741 -5.964  43.430 1.00 72.15  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1  72  ? -45.809 -5.962  42.105 1.00 75.23  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1  72  ? -45.325 -4.942  41.395 1.00 77.22  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1  72  ? -46.372 -6.988  41.484 1.00 75.38  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1  73  ? -41.053 -3.217  47.491 1.00 55.65  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1  73  ? -40.452 -2.161  48.272 1.00 58.62  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1  73  ? -38.966 -2.159  47.981 1.00 68.33  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1  73  ? -38.388 -1.139  47.591 1.00 73.67  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1  73  ? -40.726 -2.412  49.758 1.00 66.62  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1  73  ? -40.003 -1.498  50.759 1.00 72.13  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1  73  ? -40.486 -1.728  52.190 1.00 78.90  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1  73  ? -41.697 -1.900  52.397 1.00 85.89  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1  73  ? -39.668 -1.748  53.125 1.00 88.85  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1  74  ? -38.361 -3.332  48.153 1.00 71.18  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1  74  ? -36.932 -3.510  47.999 1.00 65.29  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1  74  ? -36.513 -3.192  46.568 1.00 68.04  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1  74  ? -35.506 -2.508  46.356 1.00 71.83  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1  74  ? -36.526 -4.943  48.382 1.00 64.07  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1  74  ? -36.513 -5.101  49.903 1.00 63.87  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1  74  ? -35.162 -5.288  47.820 1.00 69.63  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1  74  ? -36.646 -6.534  50.387 1.00 64.40  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1  75  ? -37.275 -3.665  45.582 1.00 62.82  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1  75  ? -36.904 -3.390  44.191 1.00 65.80  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1  75  ? -36.951 -1.890  43.838 1.00 71.88  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1  75  ? -36.156 -1.427  43.017 1.00 64.08  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1  75  ? -37.763 -4.181  43.250 1.00 62.48  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1  76  ? -37.850 -1.142  44.497 1.00 79.88  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1  76  ? -37.991 0.313   44.306 1.00 85.19  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1  76  ? -36.680 1.096   44.496 1.00 79.84  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1  76  ? -36.428 2.018   43.743 1.00 85.17  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1  76  ? -39.096 0.894   45.216 1.00 94.07  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1  76  ? -39.601 2.296   44.834 1.00 103.36 ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1  76  ? -40.674 2.304   43.727 1.00 106.85 ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1  76  ? -41.381 1.315   43.521 1.00 111.13 ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1  76  ? -40.808 3.436   43.024 1.00 96.38  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1  77  ? -35.841 0.731   45.465 1.00 73.79  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1  77  ? -34.540 1.387   45.596 1.00 70.93  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1  77  ? -33.611 1.128   44.408 1.00 74.98  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1  77  ? -32.603 1.808   44.259 1.00 82.68  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1  77  ? -33.831 0.958   46.873 1.00 78.69  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1  77  ? -34.599 1.334   48.115 1.00 93.20  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1  77  ? -35.070 0.396   48.790 1.00 104.05 ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1  77  ? -34.736 2.553   48.416 1.00 97.19  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1  78  ? -33.906 0.146   43.563 1.00 76.08  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1  78  ? -33.000 -0.144  42.444 1.00 76.43  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1  78  ? -33.524 0.442   41.148 1.00 72.64  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1  78  ? -32.754 0.875   40.286 1.00 73.39  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1  78  ? -32.741 -1.659  42.311 1.00 77.87  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1  78  ? -32.220 -2.295  43.572 1.00 73.35  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1  78  ? -32.870 -3.385  44.140 1.00 67.88  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1  78  ? -31.091 -1.775  44.218 1.00 70.86  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1  78  ? -32.395 -3.956  45.318 1.00 71.08  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1  78  ? -30.611 -2.347  45.389 1.00 66.07  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1  78  ? -31.263 -3.434  45.941 1.00 67.32  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1  79  ? -34.836 0.429   40.993 1.00 76.91  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1  79  ? -35.459 1.119   39.878 1.00 81.49  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1  79  ? -36.923 1.298   40.185 1.00 86.80  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1  79  ? -37.556 0.414   40.765 1.00 94.39  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1  79  ? -35.273 0.374   38.559 1.00 82.09  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1  79  ? -36.046 1.002   37.420 1.00 90.12  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1  79  ? -35.500 0.656   36.049 1.00 101.85 ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1  79  ? -36.162 1.520   34.984 1.00 112.24 ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1  79  ? -35.649 1.245   33.614 1.00 116.72 ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1  80  ? -37.447 2.457   39.796 1.00 93.09  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1  80  ? -38.833 2.818   40.055 1.00 92.04  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1  80  ? -39.703 2.473   38.858 1.00 89.10  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1  80  ? -39.216 2.373   37.730 1.00 83.37  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1  80  ? -38.947 4.320   40.328 1.00 92.67  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1  80  ? -38.498 5.036   39.174 1.00 89.18  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1  80  ? -38.088 4.723   41.556 1.00 88.50  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1  81  ? -40.989 2.288   39.123 1.00 92.66  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1  81  ? -41.992 2.021   38.085 1.00 100.90 ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1  81  ? -41.771 0.631   37.483 1.00 98.52  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1  81  ? -41.702 0.442   36.258 1.00 100.23 ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1  81  ? -41.990 3.135   37.011 1.00 106.07 ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1  81  ? -43.322 3.257   36.281 1.00 108.53 ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1  81  ? -44.365 2.879   36.871 1.00 95.26  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1  81  ? -43.315 3.731   35.117 1.00 114.23 ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1  82  ? -41.664 -0.347  38.373 1.00 93.98  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1  82  ? -41.356 -1.706  37.966 1.00 89.15  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1  82  ? -42.591 -2.529  38.039 1.00 78.23  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1  82  ? -43.464 -2.248  38.815 1.00 79.40  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1  82  ? -40.279 -2.321  38.866 1.00 82.85  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1  82  ? -38.857 -1.979  38.423 1.00 79.43  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1  82  ? -37.860 -2.619  39.375 1.00 77.67  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1  82  ? -38.598 -2.390  36.973 1.00 73.28  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1  83  ? -42.668 -3.548  37.209 1.00 76.27  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1  83  ? -43.720 -4.528  37.351 1.00 81.84  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1  83  ? -43.025 -5.879  37.372 1.00 85.56  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1  83  ? -41.877 -6.016  36.913 1.00 77.68  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1  83  ? -44.745 -4.432  36.216 1.00 85.72  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1  83  ? -45.253 -3.011  35.971 1.00 91.68  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1  83  ? -46.121 -2.883  34.728 1.00 87.60  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1  83  ? -47.533 -2.908  35.076 1.00 96.20  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1  83  ? -48.508 -3.298  34.263 1.00 103.91 ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1  83  ? -48.237 -3.703  33.020 1.00 108.14 ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1  83  ? -49.768 -3.284  34.703 1.00 105.88 ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1  84  ? -43.736 -6.856  37.930 1.00 80.67  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1  84  ? -43.211 -8.181  38.236 1.00 74.65  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1  84  ? -44.124 -9.199  37.599 1.00 66.82  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1  84  ? -45.323 -9.143  37.813 1.00 80.73  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1  84  ? -43.227 -8.409  39.760 1.00 73.43  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1  84  ? -42.029 -7.843  40.476 1.00 76.16  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1  84  ? -41.974 -6.503  40.820 1.00 75.75  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1  84  ? -40.958 -8.654  40.798 1.00 70.04  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1  84  ? -40.868 -5.982  41.461 1.00 76.38  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1  84  ? -39.860 -8.145  41.442 1.00 70.48  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1  84  ? -39.809 -6.809  41.769 1.00 74.91  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1  85  ? -43.592 -10.133 36.825 1.00 61.41  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1  85  ? -44.409 -11.269 36.429 1.00 62.80  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1  85  ? -44.846 -11.983 37.695 1.00 65.53  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1  85  ? -44.208 -11.885 38.733 1.00 72.55  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1  85  ? -43.672 -12.247 35.514 1.00 64.31  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1  85  ? -43.502 -11.795 34.069 1.00 62.74  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1  85  ? -42.776 -12.830 33.240 1.00 65.07  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1  85  ? -42.299 -13.833 33.762 1.00 69.42  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1  85  ? -42.684 -12.595 31.945 1.00 68.03  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1  86  ? -45.964 -12.679 37.597 1.00 70.21  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1  86  ? -46.520 -13.429 38.703 1.00 68.14  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1  86  ? -45.570 -14.574 39.076 1.00 66.34  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1  86  ? -45.392 -14.867 40.254 1.00 65.62  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1  86  ? -47.887 -13.987 38.295 1.00 67.40  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1  86  ? -48.224 -15.110 39.080 1.00 77.25  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1  87  ? -45.001 -15.230 38.061 1.00 60.21  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1  87  ? -44.038 -16.313 38.251 1.00 61.18  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1  87  ? -42.703 -15.805 38.832 1.00 64.53  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1  87  ? -42.027 -16.540 39.533 1.00 59.15  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1  87  ? -43.759 -16.996 36.921 1.00 58.90  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1  87  ? -43.176 -16.062 36.015 1.00 56.56  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1  88  ? -42.334 -14.556 38.538 1.00 67.77  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1  88  ? -41.140 -13.924 39.135 1.00 70.06  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1  88  ? -41.226 -13.798 40.649 1.00 63.41  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1  88  ? -40.293 -14.147 41.367 1.00 72.67  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1  88  ? -40.887 -12.553 38.523 1.00 69.80  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1  89  ? -42.338 -13.295 41.135 1.00 59.28  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1  89  ? -42.526 -13.176 42.564 1.00 61.05  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1  89  ? -42.557 -14.567 43.178 1.00 63.42  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1  89  ? -42.074 -14.762 44.279 1.00 66.01  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1  89  ? -43.823 -12.432 42.925 1.00 61.26  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1  89  ? -43.893 -12.212 44.434 1.00 62.96  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1  89  ? -43.899 -11.095 42.200 1.00 58.55  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1  90  ? -43.130 -15.526 42.465 1.00 68.74  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1  90  ? -43.236 -16.891 42.964 1.00 78.56  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1  90  ? -41.843 -17.478 43.110 1.00 71.23  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1  90  ? -41.482 -17.991 44.160 1.00 74.00  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1  90  ? -44.105 -17.784 42.038 1.00 88.57  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1  90  ? -45.610 -17.691 42.274 1.00 90.76  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1  90  ? -46.041 -17.857 44.026 1.00 110.26 ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1  90  ? -45.637 -19.588 44.338 1.00 115.76 ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1  91  ? -41.059 -17.380 42.055 1.00 64.62  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1  91  ? -39.700 -17.874 42.077 1.00 63.09  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1  91  ? -38.909 -17.267 43.252 1.00 67.41  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1  91  ? -38.230 -17.994 43.985 1.00 67.01  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1  91  ? -39.019 -17.594 40.744 1.00 59.80  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1  92  ? -39.034 -15.959 43.465 1.00 64.98  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1  92  ? -38.386 -15.321 44.620 1.00 64.95  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1  92  ? -38.817 -15.919 45.969 1.00 66.54  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1  92  ? -38.007 -16.005 46.903 1.00 70.81  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1  92  ? -38.614 -13.798 44.632 1.00 63.16  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1  92  ? -37.707 -12.968 43.715 1.00 65.64  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1  92  ? -38.148 -11.520 43.635 1.00 67.64  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1  92  ? -36.269 -13.016 44.175 1.00 65.24  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1  93  ? -40.079 -16.326 46.083 1.00 64.98  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1  93  ? -40.573 -16.859 47.352 1.00 64.65  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1  93  ? -40.044 -18.271 47.591 1.00 60.26  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1  93  ? -39.589 -18.592 48.679 1.00 59.76  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1  93  ? -42.104 -16.825 47.434 1.00 64.22  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1  93  ? -42.591 -16.590 48.860 1.00 66.80  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1  93  ? -44.099 -16.709 49.018 1.00 66.15  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1  93  ? -44.872 -16.128 48.254 1.00 69.68  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1  93  ? -44.523 -17.461 50.018 1.00 63.65  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1  94  ? -40.081 -19.104 46.569 1.00 55.50  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1  94  ? -39.583 -20.444 46.699 1.00 59.36  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1  94  ? -38.128 -20.409 47.154 1.00 61.66  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1  94  ? -37.708 -21.170 48.041 1.00 60.43  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1  94  ? -39.661 -21.160 45.359 1.00 64.19  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1  94  ? -41.065 -21.526 44.916 1.00 67.42  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1  94  ? -41.604 -22.745 45.613 1.00 71.35  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1  94  ? -42.820 -22.769 45.906 1.00 80.70  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1  94  ? -40.816 -23.678 45.852 1.00 69.63  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1  95  ? -37.359 -19.520 46.534 1.00 56.35  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1  95  ? -35.940 -19.432 46.810 1.00 50.75  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1  95  ? -35.690 -18.973 48.239 1.00 54.66  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1  95  ? -34.914 -19.618 48.957 1.00 57.12  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1  95  ? -35.267 -18.502 45.826 1.00 49.16  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1  96  ? -36.350 -17.886 48.651 1.00 50.31  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1  96  ? -36.157 -17.343 49.992 1.00 52.50  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1  96  ? -36.523 -18.328 51.089 1.00 54.00  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1  96  ? -35.823 -18.437 52.107 1.00 55.33  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1  96  ? -36.952 -16.054 50.189 1.00 51.85  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1  96  ? -36.640 -15.123 49.170 1.00 50.60  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1  97  ? -37.616 -19.051 50.898 1.00 56.57  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1  97  ? -38.055 -20.009 51.921 1.00 55.85  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1  97  ? -37.130 -21.234 51.965 1.00 48.03  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1  97  ? -36.751 -21.703 53.022 1.00 48.11  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1  97  ? -39.513 -20.411 51.696 1.00 58.26  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1  97  ? -40.514 -19.254 51.834 1.00 63.11  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1  97  ? -41.950 -19.743 52.075 1.00 68.35  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1  97  ? -42.119 -20.974 52.167 1.00 65.37  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1  97  ? -42.905 -18.923 52.189 1.00 68.01  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1  98  ? -36.727 -21.732 50.812 1.00 47.37  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1  98  ? -35.720 -22.781 50.780 1.00 45.48  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1  98  ? -34.505 -22.317 51.566 1.00 45.47  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1  98  ? -34.039 -23.022 52.441 1.00 45.40  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1  98  ? -35.319 -23.082 49.357 1.00 48.62  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1  99  ? -34.036 -21.107 51.259 1.00 48.24  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1  99  ? -32.901 -20.508 51.917 1.00 46.37  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1  99  ? -33.091 -20.416 53.413 1.00 51.96  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1  99  ? -32.189 -20.789 54.187 1.00 58.21  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1  99  ? -32.634 -19.098 51.377 1.00 45.93  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1  99  ? -31.599 -18.316 52.171 1.00 46.48  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1  99  ? -30.225 -18.594 52.068 1.00 47.26  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1  99  ? -31.990 -17.319 53.036 1.00 50.15  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1  99  ? -29.279 -17.865 52.795 1.00 49.27  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1  99  ? -31.060 -16.595 53.772 1.00 57.26  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1  99  ? -29.704 -16.867 53.651 1.00 53.90  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1  99  ? -28.814 -16.138 54.411 1.00 57.14  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1  100 ? -34.230 -19.885 53.838 1.00 49.78  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1  100 ? -34.417 -19.656 55.260 1.00 46.87  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1  100 ? -34.569 -20.995 55.946 1.00 53.63  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1  100 ? -34.018 -21.189 57.043 1.00 55.39  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1  100 ? -35.622 -18.790 55.530 1.00 45.70  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1  100 ? -35.526 -17.304 55.226 1.00 47.58  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1  100 ? -36.851 -16.666 55.576 1.00 49.43  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1  100 ? -34.437 -16.611 56.008 1.00 49.25  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1  101 ? -35.287 -21.937 55.311 1.00 54.26  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1  101 ? -35.502 -23.220 55.955 1.00 54.40  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1  101 ? -34.156 -23.842 56.245 1.00 53.16  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1  101 ? -33.911 -24.303 57.361 1.00 52.41  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1  101 ? -36.312 -24.213 55.125 1.00 55.91  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1  101 ? -36.195 -25.601 55.743 1.00 58.48  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1  101 ? -37.763 -23.810 55.079 1.00 54.55  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1  102 ? -33.287 -23.830 55.233 1.00 51.09  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1  102 ? -31.959 -24.442 55.351 1.00 44.98  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1  102 ? -31.135 -23.710 56.370 1.00 45.47  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1  102 ? -30.541 -24.343 57.230 1.00 51.23  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1  102 ? -31.253 -24.492 54.026 1.00 38.27  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1  103 ? -31.128 -22.387 56.333 1.00 44.37  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1  103 ? -30.457 -21.646 57.410 1.00 45.66  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1  103 ? -30.960 -21.995 58.806 1.00 48.19  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1  103 ? -30.184 -21.917 59.749 1.00 53.36  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1  103 ? -30.603 -20.138 57.227 1.00 46.70  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1  103 ? -29.883 -19.198 58.193 1.00 43.38  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1  103 ? -28.403 -19.356 58.005 1.00 42.47  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1  103 ? -30.265 -17.756 57.898 1.00 46.54  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1  104 ? -32.238 -22.339 58.975 1.00 46.85  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1  104 ? -32.656 -22.813 60.285 1.00 49.69  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1  104 ? -32.074 -24.210 60.556 1.00 49.58  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1  104 ? -31.836 -24.555 61.683 1.00 52.23  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1  104 ? -34.187 -22.797 60.485 1.00 53.25  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1  104 ? -34.796 -21.398 60.654 1.00 52.01  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1  104 ? -35.633 -20.862 59.696 1.00 50.96  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1  104 ? -34.571 -20.656 61.784 1.00 50.43  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1  104 ? -36.195 -19.610 59.857 1.00 48.83  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1  104 ? -35.110 -19.396 61.937 1.00 47.40  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1  104 ? -35.936 -18.880 60.980 1.00 47.60  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1  105 ? -31.830 -25.038 59.559 1.00 48.69  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1  105 ? -31.246 -26.331 59.888 1.00 48.99  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1  105 ? -29.881 -26.049 60.514 1.00 48.94  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1  105 ? -29.601 -26.501 61.612 1.00 57.94  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1  105 ? -31.136 -27.245 58.663 1.00 53.21  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1  105 ? -32.456 -27.817 58.138 1.00 62.10  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1  105 ? -32.463 -28.157 56.625 1.00 70.49  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1  105 ? -31.372 -28.348 56.039 1.00 71.80  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1  105 ? -33.572 -28.241 56.013 1.00 65.79  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1  106 ? -29.050 -25.249 59.855 1.00 47.68  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1  106 ? -27.677 -24.998 60.335 1.00 49.18  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1  106 ? -27.684 -24.290 61.686 1.00 49.47  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1  106 ? -26.882 -24.598 62.587 1.00 49.20  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1  106 ? -26.900 -24.132 59.365 1.00 47.20  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1  106 ? -26.770 -24.737 57.999 1.00 51.79  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1  106 ? -27.138 -25.919 57.826 1.00 54.66  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1  106 ? -26.289 -24.008 57.081 1.00 55.59  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1  107 ? -28.587 -23.327 61.810 1.00 50.28  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1  107 ? -28.774 -22.595 63.055 1.00 53.11  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1  107 ? -29.089 -23.568 64.204 1.00 58.51  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1  107 ? -28.541 -23.481 65.331 1.00 54.30  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1  107 ? -29.909 -21.574 62.914 1.00 51.87  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1  107 ? -29.624 -20.705 61.807 1.00 50.10  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1  107 ? -30.018 -20.739 64.173 1.00 53.06  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1  108 ? -29.948 -24.528 63.899 1.00 55.86  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1  108 ? -30.377 -25.446 64.913 1.00 56.62  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1  108 ? -29.183 -26.296 65.278 1.00 51.45  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1  108 ? -28.889 -26.465 66.455 1.00 53.14  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1  108 ? -31.581 -26.263 64.448 1.00 58.08  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1  108 ? -32.316 -26.910 65.586 1.00 57.73  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1  108 ? -32.510 -26.313 66.637 1.00 69.38  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1  108 ? -32.723 -28.138 65.389 1.00 60.57  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1  109 ? -28.422 -26.743 64.295 1.00 51.15  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1  109 ? -27.153 -27.425 64.627 1.00 51.30  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1  109 ? -26.233 -26.559 65.515 1.00 49.18  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1  109 ? -25.638 -27.052 66.469 1.00 55.49  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1  109 ? -26.431 -27.871 63.368 1.00 50.56  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1  109 ? -27.172 -28.917 62.529 1.00 50.00  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1  109 ? -26.477 -29.112 61.200 1.00 50.79  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1  109 ? -27.217 -30.239 63.252 1.00 50.71  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1  110 ? -26.155 -25.269 65.249 1.00 45.86  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1  110 ? -25.324 -24.423 66.084 1.00 52.70  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1  110 ? -25.810 -24.326 67.558 1.00 57.37  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1  110 ? -24.996 -24.411 68.506 1.00 49.40  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1  110 ? -25.220 -23.042 65.460 1.00 55.20  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1  110 ? -24.297 -23.043 63.919 1.00 54.18  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1  111 ? -27.129 -24.178 67.748 1.00 55.21  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1  111 ? -27.706 -24.254 69.086 1.00 47.06  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1  111 ? -27.413 -25.596 69.735 1.00 46.30  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1  111 ? -26.952 -25.670 70.853 1.00 51.95  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1  111 ? -29.177 -24.022 69.019 1.00 50.28  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1  112 ? -27.629 -26.680 69.027 1.00 46.43  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1  112 ? -27.337 -27.966 69.623 1.00 48.48  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1  112 ? -25.854 -28.085 70.001 1.00 56.66  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1  112 ? -25.518 -28.696 71.016 1.00 62.75  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1  112 ? -27.813 -29.110 68.724 1.00 48.87  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1  112 ? -29.341 -29.134 68.684 1.00 49.78  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1  112 ? -27.374 -30.464 69.238 1.00 47.72  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1  112 ? -29.896 -29.863 67.463 1.00 52.51  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1  113 ? -24.963 -27.473 69.226 1.00 59.08  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1  113 ? -23.527 -27.537 69.532 1.00 52.24  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1  113 ? -23.215 -26.887 70.858 1.00 57.13  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1  113 ? -22.302 -27.318 71.575 1.00 57.74  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1  113 ? -22.753 -26.820 68.440 1.00 52.50  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1  113 ? -21.259 -26.938 68.539 1.00 48.07  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1  113 ? -20.579 -28.104 68.270 1.00 46.58  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1  113 ? -20.314 -26.004 68.795 1.00 49.42  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1  113 ? -19.282 -27.888 68.377 1.00 47.22  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1  113 ? -19.093 -26.623 68.700 1.00 45.01  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1  114 ? -23.958 -25.829 71.178 1.00 58.07  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1  114 ? -23.738 -25.118 72.436 1.00 55.53  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1  114 ? -24.621 -25.703 73.524 1.00 63.09  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1  114 ? -24.905 -25.029 74.516 1.00 64.18  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1  114 ? -24.015 -23.657 72.258 1.00 54.36  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1  115 ? -25.046 -26.957 73.322 1.00 64.81  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1  115 ? -25.752 -27.752 74.325 1.00 64.48  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1  115 ? -27.086 -27.154 74.728 1.00 63.69  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1  115 ? -27.501 -27.261 75.869 1.00 64.61  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1  115 ? -24.844 -28.011 75.515 1.00 62.67  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1  115 ? -23.699 -28.913 75.108 1.00 73.25  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1  115 ? -22.748 -29.213 76.248 1.00 83.15  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1  115 ? -21.850 -30.392 75.896 1.00 91.22  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1  115 ? -21.148 -30.952 77.087 1.00 99.38  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1  116 ? -27.743 -26.545 73.743 1.00 59.78  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1  116 ? -29.031 -25.913 73.884 1.00 56.60  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1  116 ? -30.054 -26.599 72.956 1.00 58.10  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1  116 ? -29.733 -27.542 72.242 1.00 59.74  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1  116 ? -28.909 -24.421 73.530 1.00 56.60  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1  116 ? -28.156 -23.609 74.569 1.00 55.62  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1  116 ? -28.329 -22.110 74.400 1.00 54.67  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1  116 ? -27.368 -21.520 73.456 1.00 58.99  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1  116 ? -27.584 -21.295 72.150 1.00 55.58  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1  116 ? -28.723 -21.612 71.579 1.00 56.70  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1  116 ? -26.639 -20.752 71.394 1.00 57.70  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1  117 ? -31.299 -26.133 73.021 1.00 56.98  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1  117 ? -32.355 -26.565 72.123 1.00 54.60  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1  117 ? -33.145 -25.360 71.639 1.00 57.96  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1  117 ? -34.193 -25.510 71.022 1.00 68.28  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1  117 ? -33.315 -27.568 72.801 1.00 57.19  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1  117 ? -32.557 -28.769 73.353 1.00 58.46  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1  117 ? -34.089 -26.915 73.924 1.00 61.25  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1  118 ? -32.621 -24.164 71.878 1.00 59.02  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1  118 ? -33.354 -22.937 71.650 1.00 59.78  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1  118 ? -32.547 -22.091 70.702 1.00 61.42  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1  118 ? -31.491 -21.626 71.087 1.00 63.64  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1  118 ? -33.528 -22.135 72.965 1.00 57.65  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1  118 ? -34.002 -22.997 74.016 1.00 61.82  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1  118 ? -34.498 -21.006 72.754 1.00 59.36  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1  119 ? -33.024 -21.852 69.483 1.00 62.14  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1  119 ? -32.201 -21.072 68.557 1.00 59.65  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1  119 ? -32.162 -19.590 68.963 1.00 60.10  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1  119 ? -33.162 -19.022 69.383 1.00 55.93  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1  119 ? -32.593 -21.234 67.076 1.00 52.45  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1  119 ? -33.935 -20.584 66.778 1.00 52.19  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1  119 ? -32.586 -22.703 66.689 1.00 53.72  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1  119 ? -34.264 -20.518 65.296 1.00 51.26  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1  120 ? -30.981 -18.997 68.844 1.00 56.17  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1  120 ? -30.768 -17.625 69.205 1.00 59.66  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1  120 ? -30.096 -16.925 68.053 1.00 61.89  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1  120 ? -29.553 -17.583 67.169 1.00 58.99  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1  120 ? -29.890 -17.543 70.444 1.00 60.49  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1  120 ? -30.329 -18.487 71.555 1.00 63.12  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1  120 ? -29.642 -18.022 73.157 1.00 68.36  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1  120 ? -30.758 -18.924 74.238 1.00 74.18  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1  121 ? -30.140 -15.586 68.048 1.00 59.56  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1  121 ? -29.485 -14.836 67.020 1.00 61.33  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1  121 ? -28.020 -15.220 66.855 1.00 63.29  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1  121 ? -27.509 -15.211 65.728 1.00 63.12  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1  121 ? -29.614 -13.396 67.512 1.00 61.91  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1  121 ? -30.924 -13.391 68.197 1.00 62.89  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1  121 ? -30.928 -14.709 68.925 1.00 64.65  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1  122 ? -27.335 -15.560 67.942 1.00 59.29  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1  122 ? -25.933 -15.906 67.781 1.00 54.82  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1  122 ? -25.749 -17.159 66.947 1.00 54.17  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1  122 ? -24.822 -17.235 66.146 1.00 53.85  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1  122 ? -25.167 -15.957 69.100 1.00 58.31  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1  122 ? -25.754 -16.755 70.233 1.00 66.40  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1  122 ? -24.840 -16.650 71.445 1.00 72.82  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1  122 ? -25.622 -16.814 72.734 1.00 80.43  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1  122 ? -24.707 -17.191 73.838 1.00 86.02  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1  123 ? -26.665 -18.111 67.086 1.00 53.08  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1  123 ? -26.641 -19.321 66.269 1.00 50.04  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1  123 ? -26.828 -18.992 64.788 1.00 50.27  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1  123 ? -26.158 -19.553 63.959 1.00 52.55  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1  123 ? -27.746 -20.278 66.710 1.00 52.14  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1  123 ? -27.634 -20.679 68.172 1.00 51.88  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1  123 ? -26.499 -20.863 68.655 1.00 48.78  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1  123 ? -28.688 -20.839 68.830 1.00 50.49  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1  124 ? -27.751 -18.094 64.460 1.00 52.38  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1  124 ? -27.921 -17.626 63.085 1.00 54.53  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1  124 ? -26.665 -16.896 62.612 1.00 53.70  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1  124 ? -26.336 -16.914 61.440 1.00 52.47  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1  124 ? -29.125 -16.654 62.929 1.00 52.92  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1  124 ? -30.429 -17.365 63.238 1.00 57.61  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1  124 ? -29.263 -16.149 61.499 1.00 52.50  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1  124 ? -31.673 -16.518 63.001 1.00 56.65  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1  125 ? -25.978 -16.238 63.524 1.00 57.21  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1  125 ? -24.813 -15.452 63.156 1.00 59.64  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1  125 ? -23.672 -16.390 62.853 1.00 53.38  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1  125 ? -22.972 -16.240 61.877 1.00 56.36  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1  125 ? -24.451 -14.468 64.277 1.00 58.63  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  125 ? -25.365 -13.252 64.299 1.00 61.46  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  125 ? -25.537 -12.599 65.670 1.00 67.25  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  125 ? -24.897 -12.973 66.661 1.00 70.67  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  125 ? -26.416 -11.600 65.724 1.00 66.74  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1  126 ? -23.494 -17.376 63.697 1.00 50.88  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1  126 ? -22.403 -18.317 63.509 1.00 51.03  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1  126 ? -22.557 -19.060 62.191 1.00 52.43  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1  126 ? -21.589 -19.271 61.467 1.00 52.89  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1  126 ? -22.389 -19.322 64.647 1.00 46.91  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1  126 ? -21.261 -20.309 64.551 1.00 53.56  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1  126 ? -19.916 -19.595 64.566 1.00 52.95  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1  126 ? -21.371 -21.269 65.710 1.00 57.43  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1  127 ? -23.779 -19.478 61.898 1.00 51.39  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1  127 ? -24.041 -20.206 60.682 1.00 54.13  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1  127 ? -23.735 -19.335 59.457 1.00 52.89  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1  127 ? -23.076 -19.775 58.515 1.00 52.83  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1  127 ? -25.471 -20.700 60.675 1.00 53.84  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1  128 ? -24.148 -18.080 59.499 1.00 50.51  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1  128 ? -23.885 -17.203 58.387 1.00 47.35  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1  128 ? -22.436 -16.891 58.229 1.00 46.03  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1  128 ? -21.949 -16.833 57.114 1.00 53.80  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1  128 ? -24.696 -15.961 58.500 1.00 48.16  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1  128 ? -26.156 -16.273 58.230 1.00 50.33  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1  128 ? -26.962 -15.002 58.170 1.00 53.84  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1  128 ? -26.722 -14.284 56.926 1.00 56.04  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1  128 ? -26.396 -13.004 56.849 1.00 53.84  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1  128 ? -26.274 -12.297 57.947 1.00 57.18  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1  128 ? -26.208 -12.427 55.667 1.00 54.54  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1  129 ? -21.732 -16.728 59.330 1.00 47.14  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1  129 ? -20.267 -16.486 59.295 1.00 49.91  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1  129 ? -19.555 -17.692 58.662 1.00 48.98  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1  129 ? -18.822 -17.546 57.690 1.00 48.70  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1  129 ? -19.746 -16.094 60.706 1.00 47.88  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1  129 ? -18.250 -16.093 60.946 1.00 54.09  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1  129 ? -17.413 -15.317 59.941 1.00 62.48  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1  129 ? -15.995 -15.615 60.157 1.00 67.33  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1  129 ? -15.365 -16.694 59.680 1.00 70.18  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1  129 ? -16.003 -17.571 58.912 1.00 67.99  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1  129 ? -14.080 -16.900 59.957 1.00 68.87  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1  130 ? -19.847 -18.891 59.140 1.00 52.69  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1  130 ? -19.198 -20.093 58.615 1.00 50.35  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1  130 ? -19.563 -20.377 57.164 1.00 51.18  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1  130 ? -18.705 -20.761 56.371 1.00 49.42  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1  130 ? -19.457 -21.276 59.534 1.00 51.02  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1  130 ? -18.725 -21.013 60.841 1.00 55.66  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1  130 ? -18.961 -22.573 58.936 1.00 51.54  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1  130 ? -19.254 -21.836 61.996 1.00 63.01  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1  131 ? -20.817 -20.138 56.787 1.00 60.18  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1  131 ? -21.198 -20.226 55.355 1.00 58.63  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1  131 ? -20.456 -19.208 54.484 1.00 58.83  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1  131 ? -20.572 -19.229 53.276 1.00 53.44  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1  131 ? -22.680 -19.966 55.171 1.00 53.72  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1  131 ? -23.609 -21.115 55.493 1.00 53.30  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1  131 ? -24.981 -20.521 55.771 1.00 54.43  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1  131 ? -26.053 -21.491 55.836 1.00 54.79  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1  131 ? -27.166 -21.434 55.104 1.00 58.43  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1  131 ? -27.364 -20.434 54.260 1.00 61.68  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1  131 ? -28.103 -22.373 55.222 1.00 53.83  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1  132 ? -19.745 -18.280 55.101 1.00 60.19  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1  132 ? -19.108 -17.251 54.343 1.00 66.84  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1  132 ? -20.072 -16.223 53.815 1.00 66.42  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1  132 ? -19.824 -15.636 52.783 1.00 83.59  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1  133 ? -21.151 -15.961 54.535 1.00 71.73  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1  133 ? -21.996 -14.803 54.227 1.00 72.08  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1  133 ? -21.580 -13.542 55.009 1.00 80.37  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1  133 ? -22.067 -12.458 54.694 1.00 81.00  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1  133 ? -23.478 -15.134 54.472 1.00 67.84  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1  133 ? -24.085 -16.098 53.452 1.00 63.75  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1  133 ? -25.466 -16.637 53.851 1.00 65.98  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1  133 ? -26.224 -15.901 54.526 1.00 63.84  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1  133 ? -25.799 -17.797 53.490 1.00 57.62  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A 1  134 ? -20.698 -13.681 56.015 1.00 96.03  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A 1  134 ? -20.189 -12.530 56.811 1.00 109.82 ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A 1  134 ? -18.690 -12.299 56.581 1.00 112.40 ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A 1  134 ? -17.960 -11.904 57.501 1.00 115.67 ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A 1  134 ? -20.442 -12.704 58.329 1.00 113.28 ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A 1  134 ? -21.826 -13.211 58.710 1.00 114.45 ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A 1  134 ? -22.312 -12.705 60.067 1.00 120.92 ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A 1  134 ? -22.902 -11.364 59.930 1.00 137.65 ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A 1  134 ? -24.044 -10.941 60.488 1.00 134.26 ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A 1  134 ? -24.794 -11.742 61.251 1.00 123.89 ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A 1  134 ? -24.452 -9.692  60.260 1.00 128.80 ? 134  ARG A NH2   1 
ATOM   803   N  N     . VAL B 2  21  ? -53.492 1.851   60.611 1.00 177.00 ? 21   VAL B N     1 
ATOM   804   C  CA    . VAL B 2  21  ? -52.499 1.004   61.349 1.00 176.59 ? 21   VAL B CA    1 
ATOM   805   C  C     . VAL B 2  21  ? -51.173 0.938   60.554 1.00 178.83 ? 21   VAL B C     1 
ATOM   806   O  O     . VAL B 2  21  ? -50.788 -0.115  60.027 1.00 169.96 ? 21   VAL B O     1 
ATOM   807   C  CB    . VAL B 2  21  ? -53.079 -0.405  61.659 1.00 172.67 ? 21   VAL B CB    1 
ATOM   808   C  CG1   . VAL B 2  21  ? -52.224 -1.131  62.692 1.00 167.05 ? 21   VAL B CG1   1 
ATOM   809   C  CG2   . VAL B 2  21  ? -54.522 -0.301  62.156 1.00 165.14 ? 21   VAL B CG2   1 
ATOM   810   N  N     . LEU B 2  22  ? -50.491 2.087   60.487 1.00 180.52 ? 22   LEU B N     1 
ATOM   811   C  CA    . LEU B 2  22  ? -49.255 2.273   59.694 1.00 180.60 ? 22   LEU B CA    1 
ATOM   812   C  C     . LEU B 2  22  ? -48.128 1.321   60.117 1.00 180.03 ? 22   LEU B C     1 
ATOM   813   O  O     . LEU B 2  22  ? -47.786 1.252   61.299 1.00 197.08 ? 22   LEU B O     1 
ATOM   814   C  CB    . LEU B 2  22  ? -48.783 3.745   59.768 1.00 179.50 ? 22   LEU B CB    1 
ATOM   815   C  CG    . LEU B 2  22  ? -48.445 4.390   61.132 1.00 171.71 ? 22   LEU B CG    1 
ATOM   816   C  CD1   . LEU B 2  22  ? -46.939 4.502   61.351 1.00 161.60 ? 22   LEU B CD1   1 
ATOM   817   C  CD2   . LEU B 2  22  ? -49.085 5.769   61.267 1.00 162.56 ? 22   LEU B CD2   1 
ATOM   818   N  N     . ARG B 2  23  ? -47.548 0.603   59.151 1.00 162.29 ? 23   ARG B N     1 
ATOM   819   C  CA    . ARG B 2  23  ? -46.637 -0.509  59.455 1.00 147.24 ? 23   ARG B CA    1 
ATOM   820   C  C     . ARG B 2  23  ? -45.709 -0.876  58.283 1.00 140.48 ? 23   ARG B C     1 
ATOM   821   O  O     . ARG B 2  23  ? -46.189 -1.092  57.167 1.00 136.36 ? 23   ARG B O     1 
ATOM   822   C  CB    . ARG B 2  23  ? -47.480 -1.726  59.832 1.00 143.65 ? 23   ARG B CB    1 
ATOM   823   C  CG    . ARG B 2  23  ? -46.721 -2.815  60.565 1.00 146.65 ? 23   ARG B CG    1 
ATOM   824   C  CD    . ARG B 2  23  ? -47.642 -3.965  60.935 1.00 147.21 ? 23   ARG B CD    1 
ATOM   825   N  NE    . ARG B 2  23  ? -48.601 -4.278  59.871 1.00 149.29 ? 23   ARG B NE    1 
ATOM   826   C  CZ    . ARG B 2  23  ? -48.307 -4.893  58.724 1.00 143.60 ? 23   ARG B CZ    1 
ATOM   827   N  NH1   . ARG B 2  23  ? -47.064 -5.271  58.443 1.00 146.20 ? 23   ARG B NH1   1 
ATOM   828   N  NH2   . ARG B 2  23  ? -49.268 -5.128  57.839 1.00 136.01 ? 23   ARG B NH2   1 
ATOM   829   N  N     . ASP B 2  24  ? -44.395 -0.963  58.544 1.00 130.90 ? 24   ASP B N     1 
ATOM   830   C  CA    . ASP B 2  24  ? -43.384 -1.357  57.525 1.00 124.48 ? 24   ASP B CA    1 
ATOM   831   C  C     . ASP B 2  24  ? -43.714 -2.723  56.923 1.00 109.99 ? 24   ASP B C     1 
ATOM   832   O  O     . ASP B 2  24  ? -44.264 -3.588  57.613 1.00 109.00 ? 24   ASP B O     1 
ATOM   833   C  CB    . ASP B 2  24  ? -41.975 -1.452  58.137 1.00 135.27 ? 24   ASP B CB    1 
ATOM   834   C  CG    . ASP B 2  24  ? -41.460 -0.124  58.659 1.00 144.28 ? 24   ASP B CG    1 
ATOM   835   O  OD1   . ASP B 2  24  ? -41.382 0.838   57.864 1.00 153.96 ? 24   ASP B OD1   1 
ATOM   836   O  OD2   . ASP B 2  24  ? -41.117 -0.053  59.864 1.00 140.57 ? 24   ASP B OD2   1 
ATOM   837   N  N     . ASN B 2  25  ? -43.371 -2.937  55.656 1.00 93.80  ? 25   ASN B N     1 
ATOM   838   C  CA    . ASN B 2  25  ? -43.732 -4.209  54.997 1.00 89.18  ? 25   ASN B CA    1 
ATOM   839   C  C     . ASN B 2  25  ? -42.956 -5.430  55.506 1.00 87.44  ? 25   ASN B C     1 
ATOM   840   O  O     . ASN B 2  25  ? -43.473 -6.554  55.464 1.00 87.45  ? 25   ASN B O     1 
ATOM   841   C  CB    . ASN B 2  25  ? -43.568 -4.116  53.484 1.00 87.74  ? 25   ASN B CB    1 
ATOM   842   C  CG    . ASN B 2  25  ? -44.693 -3.348  52.813 1.00 84.58  ? 25   ASN B CG    1 
ATOM   843   O  OD1   . ASN B 2  25  ? -45.874 -3.641  53.014 1.00 85.64  ? 25   ASN B OD1   1 
ATOM   844   N  ND2   . ASN B 2  25  ? -44.332 -2.390  51.977 1.00 75.79  ? 25   ASN B ND2   1 
ATOM   845   N  N     . ILE B 2  26  ? -41.726 -5.205  55.972 1.00 80.77  ? 26   ILE B N     1 
ATOM   846   C  CA    . ILE B 2  26  ? -40.918 -6.259  56.575 1.00 80.47  ? 26   ILE B CA    1 
ATOM   847   C  C     . ILE B 2  26  ? -41.654 -6.938  57.729 1.00 76.89  ? 26   ILE B C     1 
ATOM   848   O  O     . ILE B 2  26  ? -41.474 -8.128  57.982 1.00 80.24  ? 26   ILE B O     1 
ATOM   849   C  CB    . ILE B 2  26  ? -39.552 -5.713  57.063 1.00 84.70  ? 26   ILE B CB    1 
ATOM   850   C  CG1   . ILE B 2  26  ? -38.600 -6.836  57.507 1.00 80.27  ? 26   ILE B CG1   1 
ATOM   851   C  CG2   . ILE B 2  26  ? -39.737 -4.746  58.222 1.00 92.90  ? 26   ILE B CG2   1 
ATOM   852   C  CD1   . ILE B 2  26  ? -38.211 -7.788  56.407 1.00 79.43  ? 26   ILE B CD1   1 
ATOM   853   N  N     . GLN B 2  27  ? -42.501 -6.190  58.417 1.00 76.52  ? 27   GLN B N     1 
ATOM   854   C  CA    . GLN B 2  27  ? -43.209 -6.719  59.582 1.00 76.93  ? 27   GLN B CA    1 
ATOM   855   C  C     . GLN B 2  27  ? -44.395 -7.616  59.222 1.00 74.55  ? 27   GLN B C     1 
ATOM   856   O  O     . GLN B 2  27  ? -44.934 -8.324  60.100 1.00 68.90  ? 27   GLN B O     1 
ATOM   857   C  CB    . GLN B 2  27  ? -43.650 -5.566  60.469 1.00 76.79  ? 27   GLN B CB    1 
ATOM   858   C  CG    . GLN B 2  27  ? -42.475 -4.781  61.027 1.00 76.85  ? 27   GLN B CG    1 
ATOM   859   C  CD    . GLN B 2  27  ? -41.690 -5.561  62.062 1.00 81.08  ? 27   GLN B CD    1 
ATOM   860   O  OE1   . GLN B 2  27  ? -42.231 -6.437  62.746 1.00 79.66  ? 27   GLN B OE1   1 
ATOM   861   N  NE2   . GLN B 2  27  ? -40.407 -5.239  62.193 1.00 88.50  ? 27   GLN B NE2   1 
ATOM   862   N  N     . GLY B 2  28  ? -44.773 -7.601  57.939 1.00 70.67  ? 28   GLY B N     1 
ATOM   863   C  CA    . GLY B 2  28  ? -45.756 -8.537  57.381 1.00 74.01  ? 28   GLY B CA    1 
ATOM   864   C  C     . GLY B 2  28  ? -45.231 -9.958  57.324 1.00 79.66  ? 28   GLY B C     1 
ATOM   865   O  O     . GLY B 2  28  ? -45.987 -10.923 57.179 1.00 77.71  ? 28   GLY B O     1 
ATOM   866   N  N     . ILE B 2  29  ? -43.912 -10.076 57.413 1.00 76.19  ? 29   ILE B N     1 
ATOM   867   C  CA    . ILE B 2  29  ? -43.286 -11.341 57.624 1.00 68.60  ? 29   ILE B CA    1 
ATOM   868   C  C     . ILE B 2  29  ? -43.418 -11.547 59.115 1.00 67.21  ? 29   ILE B C     1 
ATOM   869   O  O     . ILE B 2  29  ? -42.645 -11.030 59.914 1.00 66.70  ? 29   ILE B O     1 
ATOM   870   C  CB    . ILE B 2  29  ? -41.817 -11.324 57.196 1.00 69.26  ? 29   ILE B CB    1 
ATOM   871   C  CG1   . ILE B 2  29  ? -41.670 -10.819 55.749 1.00 65.28  ? 29   ILE B CG1   1 
ATOM   872   C  CG2   . ILE B 2  29  ? -41.199 -12.708 57.383 1.00 70.38  ? 29   ILE B CG2   1 
ATOM   873   C  CD1   . ILE B 2  29  ? -42.477 -11.564 54.715 1.00 63.19  ? 29   ILE B CD1   1 
ATOM   874   N  N     . THR B 2  30  ? -44.427 -12.304 59.480 1.00 65.89  ? 30   THR B N     1 
ATOM   875   C  CA    . THR B 2  30  ? -44.905 -12.304 60.838 1.00 68.70  ? 30   THR B CA    1 
ATOM   876   C  C     . THR B 2  30  ? -44.275 -13.395 61.664 1.00 61.90  ? 30   THR B C     1 
ATOM   877   O  O     . THR B 2  30  ? -43.753 -14.358 61.140 1.00 65.15  ? 30   THR B O     1 
ATOM   878   C  CB    . THR B 2  30  ? -46.434 -12.513 60.833 1.00 71.53  ? 30   THR B CB    1 
ATOM   879   O  OG1   . THR B 2  30  ? -46.745 -13.794 60.260 1.00 73.58  ? 30   THR B OG1   1 
ATOM   880   C  CG2   . THR B 2  30  ? -47.109 -11.426 60.007 1.00 70.32  ? 30   THR B CG2   1 
ATOM   881   N  N     . LYS B 2  31  ? -44.391 -13.256 62.970 1.00 62.37  ? 31   LYS B N     1 
ATOM   882   C  CA    . LYS B 2  31  ? -43.945 -14.277 63.895 1.00 63.29  ? 31   LYS B CA    1 
ATOM   883   C  C     . LYS B 2  31  ? -44.402 -15.685 63.536 1.00 64.99  ? 31   LYS B C     1 
ATOM   884   O  O     . LYS B 2  31  ? -43.600 -16.605 63.555 1.00 70.78  ? 31   LYS B O     1 
ATOM   885   C  CB    . LYS B 2  31  ? -44.368 -13.928 65.326 1.00 64.64  ? 31   LYS B CB    1 
ATOM   886   C  CG    . LYS B 2  31  ? -44.204 -15.074 66.312 1.00 72.92  ? 31   LYS B CG    1 
ATOM   887   C  CD    . LYS B 2  31  ? -44.034 -14.566 67.737 1.00 76.38  ? 31   LYS B CD    1 
ATOM   888   C  CE    . LYS B 2  31  ? -44.006 -15.718 68.731 1.00 73.73  ? 31   LYS B CE    1 
ATOM   889   N  NZ    . LYS B 2  31  ? -43.668 -15.192 70.078 1.00 77.64  ? 31   LYS B NZ    1 
ATOM   890   N  N     . PRO B 2  32  ? -45.683 -15.877 63.224 1.00 68.93  ? 32   PRO B N     1 
ATOM   891   C  CA    . PRO B 2  32  ? -46.118 -17.261 62.986 1.00 70.65  ? 32   PRO B CA    1 
ATOM   892   C  C     . PRO B 2  32  ? -45.626 -17.857 61.669 1.00 71.34  ? 32   PRO B C     1 
ATOM   893   O  O     . PRO B 2  32  ? -45.487 -19.074 61.567 1.00 70.33  ? 32   PRO B O     1 
ATOM   894   C  CB    . PRO B 2  32  ? -47.637 -17.154 62.968 1.00 73.58  ? 32   PRO B CB    1 
ATOM   895   C  CG    . PRO B 2  32  ? -47.942 -15.821 63.566 1.00 74.92  ? 32   PRO B CG    1 
ATOM   896   C  CD    . PRO B 2  32  ? -46.809 -14.946 63.170 1.00 69.03  ? 32   PRO B CD    1 
ATOM   897   N  N     . ALA B 2  33  ? -45.385 -17.008 60.672 1.00 72.35  ? 33   ALA B N     1 
ATOM   898   C  CA    . ALA B 2  33  ? -44.803 -17.453 59.408 1.00 70.95  ? 33   ALA B CA    1 
ATOM   899   C  C     . ALA B 2  33  ? -43.327 -17.807 59.586 1.00 72.88  ? 33   ALA B C     1 
ATOM   900   O  O     . ALA B 2  33  ? -42.844 -18.805 59.037 1.00 73.94  ? 33   ALA B O     1 
ATOM   901   C  CB    . ALA B 2  33  ? -44.945 -16.376 58.363 1.00 69.92  ? 33   ALA B CB    1 
ATOM   902   N  N     . ILE B 2  34  ? -42.603 -16.992 60.349 1.00 65.73  ? 34   ILE B N     1 
ATOM   903   C  CA    . ILE B 2  34  ? -41.193 -17.283 60.635 1.00 62.91  ? 34   ILE B CA    1 
ATOM   904   C  C     . ILE B 2  34  ? -41.074 -18.553 61.481 1.00 61.47  ? 34   ILE B C     1 
ATOM   905   O  O     . ILE B 2  34  ? -40.180 -19.359 61.281 1.00 63.43  ? 34   ILE B O     1 
ATOM   906   C  CB    . ILE B 2  34  ? -40.494 -16.102 61.319 1.00 59.94  ? 34   ILE B CB    1 
ATOM   907   C  CG1   . ILE B 2  34  ? -40.406 -14.915 60.369 1.00 61.42  ? 34   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B 2  34  ? -39.089 -16.471 61.702 1.00 62.48  ? 34   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B 2  34  ? -40.190 -13.604 61.091 1.00 64.00  ? 34   ILE B CD1   1 
ATOM   910   N  N     . ARG B 2  35  ? -42.004 -18.735 62.403 1.00 64.17  ? 35   ARG B N     1 
ATOM   911   C  CA    . ARG B 2  35  ? -42.089 -19.953 63.203 1.00 66.11  ? 35   ARG B CA    1 
ATOM   912   C  C     . ARG B 2  35  ? -42.346 -21.186 62.333 1.00 68.79  ? 35   ARG B C     1 
ATOM   913   O  O     . ARG B 2  35  ? -41.770 -22.254 62.574 1.00 63.78  ? 35   ARG B O     1 
ATOM   914   C  CB    . ARG B 2  35  ? -43.191 -19.763 64.226 1.00 71.60  ? 35   ARG B CB    1 
ATOM   915   C  CG    . ARG B 2  35  ? -43.573 -20.953 65.085 1.00 79.83  ? 35   ARG B CG    1 
ATOM   916   C  CD    . ARG B 2  35  ? -44.476 -20.453 66.211 1.00 79.62  ? 35   ARG B CD    1 
ATOM   917   N  NE    . ARG B 2  35  ? -43.653 -19.914 67.288 1.00 75.46  ? 35   ARG B NE    1 
ATOM   918   C  CZ    . ARG B 2  35  ? -43.609 -20.395 68.529 1.00 82.13  ? 35   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B 2  35  ? -44.394 -21.405 68.932 1.00 83.08  ? 35   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B 2  35  ? -42.784 -19.834 69.395 1.00 89.94  ? 35   ARG B NH2   1 
ATOM   921   N  N     . ARG B 2  36  ? -43.185 -21.041 61.303 1.00 70.74  ? 36   ARG B N     1 
ATOM   922   C  CA    . ARG B 2  36  ? -43.498 -22.175 60.404 1.00 65.03  ? 36   ARG B CA    1 
ATOM   923   C  C     . ARG B 2  36  ? -42.251 -22.652 59.651 1.00 61.55  ? 36   ARG B C     1 
ATOM   924   O  O     . ARG B 2  36  ? -41.958 -23.861 59.603 1.00 58.18  ? 36   ARG B O     1 
ATOM   925   C  CB    . ARG B 2  36  ? -44.642 -21.839 59.432 1.00 65.16  ? 36   ARG B CB    1 
ATOM   926   C  CG    . ARG B 2  36  ? -46.043 -21.993 60.025 1.00 69.07  ? 36   ARG B CG    1 
ATOM   927   C  CD    . ARG B 2  36  ? -47.137 -22.017 58.962 1.00 66.15  ? 36   ARG B CD    1 
ATOM   928   N  NE    . ARG B 2  36  ? -47.258 -20.771 58.193 1.00 72.05  ? 36   ARG B NE    1 
ATOM   929   C  CZ    . ARG B 2  36  ? -47.857 -19.658 58.623 1.00 73.33  ? 36   ARG B CZ    1 
ATOM   930   N  NH1   . ARG B 2  36  ? -48.383 -19.593 59.837 1.00 74.07  ? 36   ARG B NH1   1 
ATOM   931   N  NH2   . ARG B 2  36  ? -47.921 -18.591 57.842 1.00 70.48  ? 36   ARG B NH2   1 
ATOM   932   N  N     . LEU B 2  37  ? -41.515 -21.692 59.093 1.00 58.53  ? 37   LEU B N     1 
ATOM   933   C  CA    . LEU B 2  37  ? -40.253 -21.972 58.420 1.00 53.44  ? 37   LEU B CA    1 
ATOM   934   C  C     . LEU B 2  37  ? -39.314 -22.714 59.353 1.00 52.42  ? 37   LEU B C     1 
ATOM   935   O  O     . LEU B 2  37  ? -38.909 -23.842 59.078 1.00 54.47  ? 37   LEU B O     1 
ATOM   936   C  CB    . LEU B 2  37  ? -39.602 -20.672 57.981 1.00 53.59  ? 37   LEU B CB    1 
ATOM   937   C  CG    . LEU B 2  37  ? -40.284 -20.002 56.801 1.00 55.40  ? 37   LEU B CG    1 
ATOM   938   C  CD1   . LEU B 2  37  ? -39.827 -18.548 56.658 1.00 56.59  ? 37   LEU B CD1   1 
ATOM   939   C  CD2   . LEU B 2  37  ? -40.013 -20.804 55.535 1.00 53.59  ? 37   LEU B CD2   1 
ATOM   940   N  N     . ALA B 2  38  ? -39.003 -22.101 60.482 1.00 48.99  ? 38   ALA B N     1 
ATOM   941   C  CA    . ALA B 2  38  ? -38.171 -22.758 61.463 1.00 52.43  ? 38   ALA B CA    1 
ATOM   942   C  C     . ALA B 2  38  ? -38.567 -24.212 61.570 1.00 54.84  ? 38   ALA B C     1 
ATOM   943   O  O     . ALA B 2  38  ? -37.718 -25.091 61.534 1.00 53.60  ? 38   ALA B O     1 
ATOM   944   C  CB    . ALA B 2  38  ? -38.313 -22.088 62.822 1.00 52.23  ? 38   ALA B CB    1 
ATOM   945   N  N     . ARG B 2  39  ? -39.873 -24.442 61.695 1.00 61.86  ? 39   ARG B N     1 
ATOM   946   C  CA    . ARG B 2  39  ? -40.419 -25.765 61.995 1.00 63.69  ? 39   ARG B CA    1 
ATOM   947   C  C     . ARG B 2  39  ? -40.055 -26.743 60.893 1.00 61.22  ? 39   ARG B C     1 
ATOM   948   O  O     . ARG B 2  39  ? -39.613 -27.877 61.154 1.00 61.15  ? 39   ARG B O     1 
ATOM   949   C  CB    . ARG B 2  39  ? -41.954 -25.684 62.191 1.00 65.01  ? 39   ARG B CB    1 
ATOM   950   C  CG    . ARG B 2  39  ? -42.401 -24.986 63.475 1.00 65.68  ? 39   ARG B CG    1 
ATOM   951   C  CD    . ARG B 2  39  ? -42.208 -25.878 64.716 1.00 73.53  ? 39   ARG B CD    1 
ATOM   952   N  NE    . ARG B 2  39  ? -42.810 -25.304 65.935 1.00 74.63  ? 39   ARG B NE    1 
ATOM   953   C  CZ    . ARG B 2  39  ? -42.182 -24.523 66.813 1.00 82.00  ? 39   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B 2  39  ? -40.905 -24.202 66.658 1.00 84.70  ? 39   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B 2  39  ? -42.838 -24.055 67.862 1.00 85.46  ? 39   ARG B NH2   1 
ATOM   956   N  N     . ARG B 2  40  ? -40.218 -26.294 59.656 1.00 54.36  ? 40   ARG B N     1 
ATOM   957   C  CA    . ARG B 2  40  ? -39.824 -27.095 58.519 1.00 55.23  ? 40   ARG B CA    1 
ATOM   958   C  C     . ARG B 2  40  ? -38.329 -27.425 58.616 1.00 58.54  ? 40   ARG B C     1 
ATOM   959   O  O     . ARG B 2  40  ? -37.893 -28.509 58.231 1.00 62.32  ? 40   ARG B O     1 
ATOM   960   C  CB    . ARG B 2  40  ? -40.152 -26.350 57.229 1.00 56.80  ? 40   ARG B CB    1 
ATOM   961   C  CG    . ARG B 2  40  ? -39.921 -27.138 55.951 1.00 61.60  ? 40   ARG B CG    1 
ATOM   962   C  CD    . ARG B 2  40  ? -40.640 -26.519 54.757 1.00 61.25  ? 40   ARG B CD    1 
ATOM   963   N  NE    . ARG B 2  40  ? -42.010 -27.007 54.627 1.00 72.66  ? 40   ARG B NE    1 
ATOM   964   C  CZ    . ARG B 2  40  ? -42.953 -26.433 53.882 1.00 76.85  ? 40   ARG B CZ    1 
ATOM   965   N  NH1   . ARG B 2  40  ? -42.706 -25.323 53.195 1.00 70.07  ? 40   ARG B NH1   1 
ATOM   966   N  NH2   . ARG B 2  40  ? -44.160 -26.976 53.826 1.00 81.35  ? 40   ARG B NH2   1 
ATOM   967   N  N     . GLY B 2  41  ? -37.549 -26.486 59.149 1.00 59.67  ? 41   GLY B N     1 
ATOM   968   C  CA    . GLY B 2  41  ? -36.115 -26.708 59.405 1.00 57.70  ? 41   GLY B CA    1 
ATOM   969   C  C     . GLY B 2  41  ? -35.733 -27.469 60.669 1.00 52.97  ? 41   GLY B C     1 
ATOM   970   O  O     . GLY B 2  41  ? -34.551 -27.595 60.963 1.00 52.38  ? 41   GLY B O     1 
ATOM   971   N  N     . GLY B 2  42  ? -36.718 -27.955 61.422 1.00 49.43  ? 42   GLY B N     1 
ATOM   972   C  CA    . GLY B 2  42  ? -36.478 -28.885 62.524 1.00 47.89  ? 42   GLY B CA    1 
ATOM   973   C  C     . GLY B 2  42  ? -36.268 -28.222 63.855 1.00 49.57  ? 42   GLY B C     1 
ATOM   974   O  O     . GLY B 2  42  ? -35.783 -28.858 64.789 1.00 50.88  ? 42   GLY B O     1 
ATOM   975   N  N     . VAL B 2  43  ? -36.656 -26.956 63.946 1.00 50.56  ? 43   VAL B N     1 
ATOM   976   C  CA    . VAL B 2  43  ? -36.478 -26.172 65.158 1.00 58.83  ? 43   VAL B CA    1 
ATOM   977   C  C     . VAL B 2  43  ? -37.646 -26.341 66.154 1.00 59.69  ? 43   VAL B C     1 
ATOM   978   O  O     . VAL B 2  43  ? -38.790 -26.119 65.801 1.00 59.51  ? 43   VAL B O     1 
ATOM   979   C  CB    . VAL B 2  43  ? -36.340 -24.682 64.804 1.00 63.77  ? 43   VAL B CB    1 
ATOM   980   C  CG1   . VAL B 2  43  ? -36.135 -23.843 66.050 1.00 64.20  ? 43   VAL B CG1   1 
ATOM   981   C  CG2   . VAL B 2  43  ? -35.180 -24.472 63.849 1.00 70.59  ? 43   VAL B CG2   1 
ATOM   982   N  N     . LYS B 2  44  ? -37.332 -26.681 67.405 1.00 64.93  ? 44   LYS B N     1 
ATOM   983   C  CA    . LYS B 2  44  ? -38.326 -26.966 68.450 1.00 63.20  ? 44   LYS B CA    1 
ATOM   984   C  C     . LYS B 2  44  ? -38.693 -25.737 69.281 1.00 64.73  ? 44   LYS B C     1 
ATOM   985   O  O     . LYS B 2  44  ? -39.865 -25.459 69.512 1.00 75.84  ? 44   LYS B O     1 
ATOM   986   C  CB    . LYS B 2  44  ? -37.766 -28.018 69.388 1.00 67.54  ? 44   LYS B CB    1 
ATOM   987   C  CG    . LYS B 2  44  ? -38.781 -28.562 70.364 1.00 78.98  ? 44   LYS B CG    1 
ATOM   988   C  CD    . LYS B 2  44  ? -38.137 -29.523 71.352 1.00 83.21  ? 44   LYS B CD    1 
ATOM   989   C  CE    . LYS B 2  44  ? -39.171 -30.186 72.250 1.00 80.61  ? 44   LYS B CE    1 
ATOM   990   N  NZ    . LYS B 2  44  ? -38.547 -31.275 73.038 1.00 84.18  ? 44   LYS B NZ    1 
ATOM   991   N  N     . ARG B 2  45  ? -37.680 -25.006 69.728 1.00 63.41  ? 45   ARG B N     1 
ATOM   992   C  CA    . ARG B 2  45  ? -37.849 -23.874 70.615 1.00 59.74  ? 45   ARG B CA    1 
ATOM   993   C  C     . ARG B 2  45  ? -37.121 -22.685 70.008 1.00 58.53  ? 45   ARG B C     1 
ATOM   994   O  O     . ARG B 2  45  ? -36.030 -22.846 69.477 1.00 54.20  ? 45   ARG B O     1 
ATOM   995   C  CB    . ARG B 2  45  ? -37.252 -24.241 71.977 1.00 65.57  ? 45   ARG B CB    1 
ATOM   996   C  CG    . ARG B 2  45  ? -37.756 -23.433 73.159 1.00 66.01  ? 45   ARG B CG    1 
ATOM   997   C  CD    . ARG B 2  45  ? -37.385 -24.110 74.486 1.00 68.29  ? 45   ARG B CD    1 
ATOM   998   N  NE    . ARG B 2  45  ? -37.961 -23.351 75.603 1.00 75.11  ? 45   ARG B NE    1 
ATOM   999   C  CZ    . ARG B 2  45  ? -37.435 -22.243 76.148 1.00 81.56  ? 45   ARG B CZ    1 
ATOM   1000  N  NH1   . ARG B 2  45  ? -36.274 -21.727 75.734 1.00 74.51  ? 45   ARG B NH1   1 
ATOM   1001  N  NH2   . ARG B 2  45  ? -38.080 -21.636 77.138 1.00 89.99  ? 45   ARG B NH2   1 
ATOM   1002  N  N     . ILE B 2  46  ? -37.704 -21.491 70.137 1.00 62.03  ? 46   ILE B N     1 
ATOM   1003  C  CA    . ILE B 2  46  ? -37.263 -20.284 69.419 1.00 56.84  ? 46   ILE B CA    1 
ATOM   1004  C  C     . ILE B 2  46  ? -37.168 -19.012 70.305 1.00 55.59  ? 46   ILE B C     1 
ATOM   1005  O  O     . ILE B 2  46  ? -38.146 -18.499 70.771 1.00 62.74  ? 46   ILE B O     1 
ATOM   1006  C  CB    . ILE B 2  46  ? -38.222 -20.003 68.243 1.00 52.70  ? 46   ILE B CB    1 
ATOM   1007  C  CG1   . ILE B 2  46  ? -38.230 -21.161 67.247 1.00 54.17  ? 46   ILE B CG1   1 
ATOM   1008  C  CG2   . ILE B 2  46  ? -37.872 -18.712 67.523 1.00 52.81  ? 46   ILE B CG2   1 
ATOM   1009  C  CD1   . ILE B 2  46  ? -39.396 -21.093 66.266 1.00 54.82  ? 46   ILE B CD1   1 
ATOM   1010  N  N     . SER B 2  47  ? -35.975 -18.485 70.496 1.00 61.15  ? 47   SER B N     1 
ATOM   1011  C  CA    . SER B 2  47  ? -35.794 -17.215 71.179 1.00 59.37  ? 47   SER B CA    1 
ATOM   1012  C  C     . SER B 2  47  ? -36.611 -16.126 70.532 1.00 57.79  ? 47   SER B C     1 
ATOM   1013  O  O     . SER B 2  47  ? -36.691 -16.026 69.317 1.00 63.67  ? 47   SER B O     1 
ATOM   1014  C  CB    . SER B 2  47  ? -34.313 -16.813 71.159 1.00 63.26  ? 47   SER B CB    1 
ATOM   1015  O  OG    . SER B 2  47  ? -34.135 -15.420 71.329 1.00 70.54  ? 47   SER B OG    1 
ATOM   1016  N  N     . GLY B 2  48  ? -37.182 -15.270 71.363 1.00 65.86  ? 48   GLY B N     1 
ATOM   1017  C  CA    . GLY B 2  48  ? -37.973 -14.122 70.909 1.00 60.71  ? 48   GLY B CA    1 
ATOM   1018  C  C     . GLY B 2  48  ? -37.236 -13.192 69.981 1.00 63.54  ? 48   GLY B C     1 
ATOM   1019  O  O     . GLY B 2  48  ? -37.850 -12.562 69.122 1.00 71.02  ? 48   GLY B O     1 
ATOM   1020  N  N     . LEU B 2  49  ? -35.917 -13.092 70.130 1.00 65.28  ? 49   LEU B N     1 
ATOM   1021  C  CA    . LEU B 2  49  ? -35.155 -12.138 69.322 1.00 66.92  ? 49   LEU B CA    1 
ATOM   1022  C  C     . LEU B 2  49  ? -34.938 -12.628 67.883 1.00 66.22  ? 49   LEU B C     1 
ATOM   1023  O  O     . LEU B 2  49  ? -34.579 -11.845 66.993 1.00 60.05  ? 49   LEU B O     1 
ATOM   1024  C  CB    . LEU B 2  49  ? -33.825 -11.828 69.991 1.00 70.73  ? 49   LEU B CB    1 
ATOM   1025  C  CG    . LEU B 2  49  ? -33.966 -11.137 71.359 1.00 67.80  ? 49   LEU B CG    1 
ATOM   1026  C  CD1   . LEU B 2  49  ? -32.754 -11.430 72.235 1.00 65.85  ? 49   LEU B CD1   1 
ATOM   1027  C  CD2   . LEU B 2  49  ? -34.173 -9.636  71.178 1.00 63.82  ? 49   LEU B CD2   1 
ATOM   1028  N  N     . ILE B 2  50  ? -35.194 -13.917 67.663 1.00 63.62  ? 50   ILE B N     1 
ATOM   1029  C  CA    . ILE B 2  50  ? -35.039 -14.532 66.345 1.00 63.87  ? 50   ILE B CA    1 
ATOM   1030  C  C     . ILE B 2  50  ? -35.851 -13.824 65.260 1.00 63.54  ? 50   ILE B C     1 
ATOM   1031  O  O     . ILE B 2  50  ? -35.410 -13.803 64.115 1.00 68.38  ? 50   ILE B O     1 
ATOM   1032  C  CB    . ILE B 2  50  ? -35.452 -16.032 66.363 1.00 63.00  ? 50   ILE B CB    1 
ATOM   1033  C  CG1   . ILE B 2  50  ? -34.487 -16.878 67.199 1.00 65.72  ? 50   ILE B CG1   1 
ATOM   1034  C  CG2   . ILE B 2  50  ? -35.524 -16.602 64.964 1.00 64.22  ? 50   ILE B CG2   1 
ATOM   1035  C  CD1   . ILE B 2  50  ? -33.094 -17.025 66.625 1.00 69.55  ? 50   ILE B CD1   1 
ATOM   1036  N  N     . TYR B 2  51  ? -37.020 -13.263 65.598 1.00 59.40  ? 51   TYR B N     1 
ATOM   1037  C  CA    . TYR B 2  51  ? -37.966 -12.829 64.555 1.00 57.87  ? 51   TYR B CA    1 
ATOM   1038  C  C     . TYR B 2  51  ? -37.359 -11.613 63.875 1.00 60.94  ? 51   TYR B C     1 
ATOM   1039  O  O     . TYR B 2  51  ? -37.327 -11.535 62.653 1.00 65.03  ? 51   TYR B O     1 
ATOM   1040  C  CB    . TYR B 2  51  ? -39.423 -12.633 65.090 1.00 57.73  ? 51   TYR B CB    1 
ATOM   1041  C  CG    . TYR B 2  51  ? -39.907 -13.867 65.845 1.00 51.88  ? 51   TYR B CG    1 
ATOM   1042  C  CD1   . TYR B 2  51  ? -40.286 -15.021 65.175 1.00 51.30  ? 51   TYR B CD1   1 
ATOM   1043  C  CD2   . TYR B 2  51  ? -39.896 -13.900 67.216 1.00 48.12  ? 51   TYR B CD2   1 
ATOM   1044  C  CE1   . TYR B 2  51  ? -40.649 -16.170 65.863 1.00 51.78  ? 51   TYR B CE1   1 
ATOM   1045  C  CE2   . TYR B 2  51  ? -40.270 -15.032 67.917 1.00 47.86  ? 51   TYR B CE2   1 
ATOM   1046  C  CZ    . TYR B 2  51  ? -40.636 -16.173 67.252 1.00 52.38  ? 51   TYR B CZ    1 
ATOM   1047  O  OH    . TYR B 2  51  ? -40.955 -17.323 67.988 1.00 51.97  ? 51   TYR B OH    1 
ATOM   1048  N  N     . GLU B 2  52  ? -36.794 -10.704 64.656 1.00 67.32  ? 52   GLU B N     1 
ATOM   1049  C  CA    . GLU B 2  52  ? -36.112 -9.558  64.057 1.00 73.43  ? 52   GLU B CA    1 
ATOM   1050  C  C     . GLU B 2  52  ? -34.825 -9.971  63.329 1.00 66.85  ? 52   GLU B C     1 
ATOM   1051  O  O     . GLU B 2  52  ? -34.517 -9.437  62.267 1.00 66.31  ? 52   GLU B O     1 
ATOM   1052  C  CB    . GLU B 2  52  ? -35.862 -8.441  65.090 1.00 75.68  ? 52   GLU B CB    1 
ATOM   1053  C  CG    . GLU B 2  52  ? -37.099 -7.600  65.407 1.00 77.72  ? 52   GLU B CG    1 
ATOM   1054  C  CD    . GLU B 2  52  ? -37.602 -6.806  64.201 1.00 84.93  ? 52   GLU B CD    1 
ATOM   1055  O  OE1   . GLU B 2  52  ? -36.889 -5.887  63.746 1.00 89.76  ? 52   GLU B OE1   1 
ATOM   1056  O  OE2   . GLU B 2  52  ? -38.707 -7.108  63.689 1.00 84.43  ? 52   GLU B OE2   1 
ATOM   1057  N  N     . GLU B 2  53  ? -34.088 -10.930 63.868 1.00 62.54  ? 53   GLU B N     1 
ATOM   1058  C  CA    . GLU B 2  53  ? -32.868 -11.370 63.188 1.00 61.75  ? 53   GLU B CA    1 
ATOM   1059  C  C     . GLU B 2  53  ? -33.257 -11.948 61.807 1.00 62.11  ? 53   GLU B C     1 
ATOM   1060  O  O     . GLU B 2  53  ? -32.707 -11.536 60.773 1.00 56.27  ? 53   GLU B O     1 
ATOM   1061  C  CB    . GLU B 2  53  ? -32.068 -12.364 64.053 1.00 59.80  ? 53   GLU B CB    1 
ATOM   1062  C  CG    . GLU B 2  53  ? -30.647 -12.678 63.563 1.00 62.84  ? 53   GLU B CG    1 
ATOM   1063  C  CD    . GLU B 2  53  ? -29.606 -11.576 63.824 1.00 70.95  ? 53   GLU B CD    1 
ATOM   1064  O  OE1   . GLU B 2  53  ? -29.775 -10.728 64.748 1.00 62.41  ? 53   GLU B OE1   1 
ATOM   1065  O  OE2   . GLU B 2  53  ? -28.584 -11.571 63.089 1.00 72.08  ? 53   GLU B OE2   1 
ATOM   1066  N  N     . THR B 2  54  ? -34.250 -12.842 61.791 1.00 53.69  ? 54   THR B N     1 
ATOM   1067  C  CA    . THR B 2  54  ? -34.651 -13.484 60.565 1.00 52.65  ? 54   THR B CA    1 
ATOM   1068  C  C     . THR B 2  54  ? -35.122 -12.478 59.505 1.00 58.38  ? 54   THR B C     1 
ATOM   1069  O  O     . THR B 2  54  ? -34.857 -12.650 58.300 1.00 55.25  ? 54   THR B O     1 
ATOM   1070  C  CB    . THR B 2  54  ? -35.748 -14.529 60.809 1.00 58.01  ? 54   THR B CB    1 
ATOM   1071  O  OG1   . THR B 2  54  ? -35.275 -15.584 61.672 1.00 54.99  ? 54   THR B OG1   1 
ATOM   1072  C  CG2   . THR B 2  54  ? -36.207 -15.141 59.493 1.00 60.52  ? 54   THR B CG2   1 
ATOM   1073  N  N     . ARG B 2  55  ? -35.808 -11.420 59.928 1.00 65.01  ? 55   ARG B N     1 
ATOM   1074  C  CA    . ARG B 2  55  ? -36.225 -10.388 58.961 1.00 65.79  ? 55   ARG B CA    1 
ATOM   1075  C  C     . ARG B 2  55  ? -35.015 -9.687  58.340 1.00 58.40  ? 55   ARG B C     1 
ATOM   1076  O  O     . ARG B 2  55  ? -34.969 -9.476  57.127 1.00 52.14  ? 55   ARG B O     1 
ATOM   1077  C  CB    . ARG B 2  55  ? -37.180 -9.387  59.599 1.00 74.28  ? 55   ARG B CB    1 
ATOM   1078  C  CG    . ARG B 2  55  ? -38.562 -9.967  59.877 1.00 80.05  ? 55   ARG B CG    1 
ATOM   1079  C  CD    . ARG B 2  55  ? -39.506 -8.948  60.524 1.00 83.06  ? 55   ARG B CD    1 
ATOM   1080  N  NE    . ARG B 2  55  ? -40.715 -9.583  61.048 1.00 73.14  ? 55   ARG B NE    1 
ATOM   1081  C  CZ    . ARG B 2  55  ? -40.900 -9.929  62.315 1.00 69.64  ? 55   ARG B CZ    1 
ATOM   1082  N  NH1   . ARG B 2  55  ? -39.971 -9.686  63.246 1.00 71.51  ? 55   ARG B NH1   1 
ATOM   1083  N  NH2   . ARG B 2  55  ? -42.037 -10.518 62.656 1.00 71.33  ? 55   ARG B NH2   1 
ATOM   1084  N  N     . GLY B 2  56  ? -34.023 -9.364  59.170 1.00 55.69  ? 56   GLY B N     1 
ATOM   1085  C  CA    . GLY B 2  56  ? -32.780 -8.769  58.679 1.00 53.60  ? 56   GLY B CA    1 
ATOM   1086  C  C     . GLY B 2  56  ? -32.145 -9.644  57.609 1.00 52.99  ? 56   GLY B C     1 
ATOM   1087  O  O     . GLY B 2  56  ? -31.871 -9.192  56.486 1.00 53.88  ? 56   GLY B O     1 
ATOM   1088  N  N     . VAL B 2  57  ? -31.949 -10.912 57.958 1.00 48.43  ? 57   VAL B N     1 
ATOM   1089  C  CA    . VAL B 2  57  ? -31.414 -11.898 57.039 1.00 49.63  ? 57   VAL B CA    1 
ATOM   1090  C  C     . VAL B 2  57  ? -32.229 -11.974 55.728 1.00 50.68  ? 57   VAL B C     1 
ATOM   1091  O  O     . VAL B 2  57  ? -31.660 -12.016 54.626 1.00 46.98  ? 57   VAL B O     1 
ATOM   1092  C  CB    . VAL B 2  57  ? -31.348 -13.275 57.720 1.00 51.81  ? 57   VAL B CB    1 
ATOM   1093  C  CG1   . VAL B 2  57  ? -31.226 -14.394 56.704 1.00 59.14  ? 57   VAL B CG1   1 
ATOM   1094  C  CG2   . VAL B 2  57  ? -30.177 -13.341 58.680 1.00 52.86  ? 57   VAL B CG2   1 
ATOM   1095  N  N     . LEU B 2  58  ? -33.557 -11.986 55.836 1.00 53.06  ? 58   LEU B N     1 
ATOM   1096  C  CA    . LEU B 2  58  ? -34.382 -12.112 54.632 1.00 51.69  ? 58   LEU B CA    1 
ATOM   1097  C  C     . LEU B 2  58  ? -34.260 -10.881 53.760 1.00 54.29  ? 58   LEU B C     1 
ATOM   1098  O  O     . LEU B 2  58  ? -34.241 -10.976 52.514 1.00 52.01  ? 58   LEU B O     1 
ATOM   1099  C  CB    . LEU B 2  58  ? -35.830 -12.350 54.985 1.00 51.89  ? 58   LEU B CB    1 
ATOM   1100  C  CG    . LEU B 2  58  ? -36.807 -12.308 53.801 1.00 54.48  ? 58   LEU B CG    1 
ATOM   1101  C  CD1   . LEU B 2  58  ? -36.480 -13.293 52.701 1.00 52.78  ? 58   LEU B CD1   1 
ATOM   1102  C  CD2   . LEU B 2  58  ? -38.211 -12.557 54.314 1.00 57.71  ? 58   LEU B CD2   1 
ATOM   1103  N  N     . LYS B 2  59  ? -34.176 -9.723  54.411 1.00 55.16  ? 59   LYS B N     1 
ATOM   1104  C  CA    . LYS B 2  59  ? -34.032 -8.485  53.684 1.00 55.71  ? 59   LYS B CA    1 
ATOM   1105  C  C     . LYS B 2  59  ? -32.741 -8.471  52.884 1.00 58.80  ? 59   LYS B C     1 
ATOM   1106  O  O     . LYS B 2  59  ? -32.764 -8.053  51.723 1.00 65.40  ? 59   LYS B O     1 
ATOM   1107  C  CB    . LYS B 2  59  ? -34.104 -7.298  54.620 1.00 61.87  ? 59   LYS B CB    1 
ATOM   1108  C  CG    . LYS B 2  59  ? -34.045 -5.949  53.918 1.00 67.06  ? 59   LYS B CG    1 
ATOM   1109  C  CD    . LYS B 2  59  ? -34.583 -4.844  54.832 1.00 72.36  ? 59   LYS B CD    1 
ATOM   1110  C  CE    . LYS B 2  59  ? -34.167 -3.449  54.363 1.00 75.02  ? 59   LYS B CE    1 
ATOM   1111  N  NZ    . LYS B 2  59  ? -32.818 -3.067  54.872 1.00 73.79  ? 59   LYS B NZ    1 
ATOM   1112  N  N     . VAL B 2  60  ? -31.629 -8.937  53.474 1.00 51.28  ? 60   VAL B N     1 
ATOM   1113  C  CA    . VAL B 2  60  ? -30.346 -8.928  52.760 1.00 47.48  ? 60   VAL B CA    1 
ATOM   1114  C  C     . VAL B 2  60  ? -30.386 -9.902  51.576 1.00 47.32  ? 60   VAL B C     1 
ATOM   1115  O  O     . VAL B 2  60  ? -29.743 -9.674  50.541 1.00 44.15  ? 60   VAL B O     1 
ATOM   1116  C  CB    . VAL B 2  60  ? -29.171 -9.355  53.664 1.00 49.50  ? 60   VAL B CB    1 
ATOM   1117  C  CG1   . VAL B 2  60  ? -28.000 -9.813  52.810 1.00 49.89  ? 60   VAL B CG1   1 
ATOM   1118  C  CG2   . VAL B 2  60  ? -28.719 -8.225  54.565 1.00 50.55  ? 60   VAL B CG2   1 
ATOM   1119  N  N     . PHE B 2  61  ? -31.081 -11.027 51.761 1.00 47.09  ? 61   PHE B N     1 
ATOM   1120  C  CA    . PHE B 2  61  ? -31.164 -12.060 50.729 1.00 48.83  ? 61   PHE B CA    1 
ATOM   1121  C  C     . PHE B 2  61  ? -31.857 -11.449 49.521 1.00 53.40  ? 61   PHE B C     1 
ATOM   1122  O  O     . PHE B 2  61  ? -31.328 -11.440 48.409 1.00 60.38  ? 61   PHE B O     1 
ATOM   1123  C  CB    . PHE B 2  61  ? -31.932 -13.293 51.250 1.00 48.05  ? 61   PHE B CB    1 
ATOM   1124  C  CG    . PHE B 2  61  ? -32.065 -14.410 50.237 1.00 54.00  ? 61   PHE B CG    1 
ATOM   1125  C  CD1   . PHE B 2  61  ? -31.087 -15.382 50.098 1.00 51.54  ? 61   PHE B CD1   1 
ATOM   1126  C  CD2   . PHE B 2  61  ? -33.180 -14.493 49.413 1.00 58.15  ? 61   PHE B CD2   1 
ATOM   1127  C  CE1   . PHE B 2  61  ? -31.213 -16.399 49.157 1.00 47.64  ? 61   PHE B CE1   1 
ATOM   1128  C  CE2   . PHE B 2  61  ? -33.306 -15.523 48.482 1.00 53.50  ? 61   PHE B CE2   1 
ATOM   1129  C  CZ    . PHE B 2  61  ? -32.319 -16.462 48.350 1.00 47.58  ? 61   PHE B CZ    1 
ATOM   1130  N  N     . LEU B 2  62  ? -33.028 -10.885 49.770 1.00 55.23  ? 62   LEU B N     1 
ATOM   1131  C  CA    . LEU B 2  62  ? -33.813 -10.297 48.711 1.00 56.06  ? 62   LEU B CA    1 
ATOM   1132  C  C     . LEU B 2  62  ? -33.096 -9.125  48.055 1.00 52.93  ? 62   LEU B C     1 
ATOM   1133  O  O     . LEU B 2  62  ? -33.129 -8.994  46.844 1.00 54.48  ? 62   LEU B O     1 
ATOM   1134  C  CB    . LEU B 2  62  ? -35.190 -9.881  49.240 1.00 54.07  ? 62   LEU B CB    1 
ATOM   1135  C  CG    . LEU B 2  62  ? -36.078 -11.070 49.605 1.00 55.30  ? 62   LEU B CG    1 
ATOM   1136  C  CD1   . LEU B 2  62  ? -37.393 -10.562 50.144 1.00 63.08  ? 62   LEU B CD1   1 
ATOM   1137  C  CD2   . LEU B 2  62  ? -36.344 -11.986 48.415 1.00 54.50  ? 62   LEU B CD2   1 
ATOM   1138  N  N     . GLU B 2  63  ? -32.454 -8.269  48.836 1.00 49.62  ? 63   GLU B N     1 
ATOM   1139  C  CA    . GLU B 2  63  ? -31.709 -7.190  48.234 1.00 51.63  ? 63   GLU B CA    1 
ATOM   1140  C  C     . GLU B 2  63  ? -30.749 -7.754  47.205 1.00 51.16  ? 63   GLU B C     1 
ATOM   1141  O  O     . GLU B 2  63  ? -30.789 -7.338  46.033 1.00 53.33  ? 63   GLU B O     1 
ATOM   1142  C  CB    . GLU B 2  63  ? -30.969 -6.363  49.278 1.00 54.95  ? 63   GLU B CB    1 
ATOM   1143  C  CG    . GLU B 2  63  ? -31.879 -5.373  49.976 1.00 60.51  ? 63   GLU B CG    1 
ATOM   1144  C  CD    . GLU B 2  63  ? -31.301 -4.804  51.264 1.00 66.61  ? 63   GLU B CD    1 
ATOM   1145  O  OE1   . GLU B 2  63  ? -30.105 -5.021  51.562 1.00 70.64  ? 63   GLU B OE1   1 
ATOM   1146  O  OE2   . GLU B 2  63  ? -32.067 -4.137  51.990 1.00 70.22  ? 63   GLU B OE2   1 
ATOM   1147  N  N     . ASN B 2  64  ? -29.925 -8.729  47.610 1.00 50.90  ? 64   ASN B N     1 
ATOM   1148  C  CA    . ASN B 2  64  ? -28.846 -9.185  46.721 1.00 53.40  ? 64   ASN B CA    1 
ATOM   1149  C  C     . ASN B 2  64  ? -29.361 -9.783  45.430 1.00 53.74  ? 64   ASN B C     1 
ATOM   1150  O  O     . ASN B 2  64  ? -28.799 -9.538  44.355 1.00 60.05  ? 64   ASN B O     1 
ATOM   1151  C  CB    . ASN B 2  64  ? -27.892 -10.141 47.408 1.00 51.96  ? 64   ASN B CB    1 
ATOM   1152  C  CG    . ASN B 2  64  ? -27.040 -9.461  48.440 1.00 56.38  ? 64   ASN B CG    1 
ATOM   1153  O  OD1   . ASN B 2  64  ? -26.506 -8.396  48.198 1.00 71.71  ? 64   ASN B OD1   1 
ATOM   1154  N  ND2   . ASN B 2  64  ? -26.920 -10.058 49.603 1.00 62.26  ? 64   ASN B ND2   1 
ATOM   1155  N  N     . VAL B 2  65  ? -30.444 -10.537 45.548 1.00 51.59  ? 65   VAL B N     1 
ATOM   1156  C  CA    . VAL B 2  65  ? -31.032 -11.229 44.422 1.00 51.86  ? 65   VAL B CA    1 
ATOM   1157  C  C     . VAL B 2  65  ? -31.813 -10.269 43.539 1.00 54.02  ? 65   VAL B C     1 
ATOM   1158  O  O     . VAL B 2  65  ? -31.667 -10.290 42.309 1.00 53.50  ? 65   VAL B O     1 
ATOM   1159  C  CB    . VAL B 2  65  ? -31.954 -12.344 44.912 1.00 52.36  ? 65   VAL B CB    1 
ATOM   1160  C  CG1   . VAL B 2  65  ? -32.549 -13.075 43.740 1.00 53.79  ? 65   VAL B CG1   1 
ATOM   1161  C  CG2   . VAL B 2  65  ? -31.155 -13.326 45.743 1.00 59.76  ? 65   VAL B CG2   1 
ATOM   1162  N  N     . ILE B 2  66  ? -32.640 -9.428  44.167 1.00 55.01  ? 66   ILE B N     1 
ATOM   1163  C  CA    . ILE B 2  66  ? -33.478 -8.491  43.439 1.00 52.50  ? 66   ILE B CA    1 
ATOM   1164  C  C     . ILE B 2  66  ? -32.587 -7.514  42.697 1.00 53.23  ? 66   ILE B C     1 
ATOM   1165  O  O     . ILE B 2  66  ? -32.779 -7.297  41.491 1.00 45.29  ? 66   ILE B O     1 
ATOM   1166  C  CB    . ILE B 2  66  ? -34.482 -7.777  44.363 1.00 58.07  ? 66   ILE B CB    1 
ATOM   1167  C  CG1   . ILE B 2  66  ? -35.569 -8.776  44.774 1.00 56.21  ? 66   ILE B CG1   1 
ATOM   1168  C  CG2   . ILE B 2  66  ? -35.139 -6.587  43.654 1.00 61.13  ? 66   ILE B CG2   1 
ATOM   1169  C  CD1   . ILE B 2  66  ? -36.460 -8.322  45.899 1.00 55.16  ? 66   ILE B CD1   1 
ATOM   1170  N  N     . ARG B 2  67  ? -31.589 -6.958  43.392 1.00 53.09  ? 67   ARG B N     1 
ATOM   1171  C  CA    . ARG B 2  67  ? -30.593 -6.116  42.704 1.00 52.93  ? 67   ARG B CA    1 
ATOM   1172  C  C     . ARG B 2  67  ? -30.139 -6.747  41.376 1.00 50.23  ? 67   ARG B C     1 
ATOM   1173  O  O     . ARG B 2  67  ? -30.191 -6.112  40.335 1.00 48.77  ? 67   ARG B O     1 
ATOM   1174  C  CB    . ARG B 2  67  ? -29.404 -5.822  43.612 1.00 57.94  ? 67   ARG B CB    1 
ATOM   1175  C  CG    . ARG B 2  67  ? -28.339 -4.882  43.028 1.00 63.16  ? 67   ARG B CG    1 
ATOM   1176  C  CD    . ARG B 2  67  ? -27.012 -4.954  43.817 1.00 66.41  ? 67   ARG B CD    1 
ATOM   1177  N  NE    . ARG B 2  67  ? -27.040 -4.246  45.110 1.00 70.94  ? 67   ARG B NE    1 
ATOM   1178  C  CZ    . ARG B 2  67  ? -26.973 -4.801  46.323 1.00 76.27  ? 67   ARG B CZ    1 
ATOM   1179  N  NH1   . ARG B 2  67  ? -26.881 -6.113  46.490 1.00 82.96  ? 67   ARG B NH1   1 
ATOM   1180  N  NH2   . ARG B 2  67  ? -26.991 -4.022  47.393 1.00 78.15  ? 67   ARG B NH2   1 
ATOM   1181  N  N     . ASP B 2  68  ? -29.759 -8.013  41.413 1.00 50.29  ? 68   ASP B N     1 
ATOM   1182  C  CA    . ASP B 2  68  ? -29.195 -8.650  40.250 1.00 54.50  ? 68   ASP B CA    1 
ATOM   1183  C  C     . ASP B 2  68  ? -30.276 -8.878  39.200 1.00 58.51  ? 68   ASP B C     1 
ATOM   1184  O  O     . ASP B 2  68  ? -30.026 -8.675  38.010 1.00 55.60  ? 68   ASP B O     1 
ATOM   1185  C  CB    . ASP B 2  68  ? -28.507 -9.982  40.615 1.00 56.33  ? 68   ASP B CB    1 
ATOM   1186  C  CG    . ASP B 2  68  ? -27.057 -9.814  41.101 1.00 53.98  ? 68   ASP B CG    1 
ATOM   1187  O  OD1   . ASP B 2  68  ? -26.615 -8.722  41.505 1.00 63.46  ? 68   ASP B OD1   1 
ATOM   1188  O  OD2   . ASP B 2  68  ? -26.340 -10.820 41.098 1.00 57.76  ? 68   ASP B OD2   1 
ATOM   1189  N  N     . ALA B 2  69  ? -31.472 -9.297  39.624 1.00 60.50  ? 69   ALA B N     1 
ATOM   1190  C  CA    . ALA B 2  69  ? -32.606 -9.522  38.677 1.00 60.79  ? 69   ALA B CA    1 
ATOM   1191  C  C     . ALA B 2  69  ? -32.977 -8.230  37.929 1.00 56.04  ? 69   ALA B C     1 
ATOM   1192  O  O     . ALA B 2  69  ? -32.953 -8.163  36.699 1.00 52.44  ? 69   ALA B O     1 
ATOM   1193  C  CB    . ALA B 2  69  ? -33.831 -10.073 39.415 1.00 59.72  ? 69   ALA B CB    1 
ATOM   1194  N  N     . VAL B 2  70  ? -33.277 -7.193  38.697 1.00 55.04  ? 70   VAL B N     1 
ATOM   1195  C  CA    . VAL B 2  70  ? -33.540 -5.878  38.151 1.00 55.69  ? 70   VAL B CA    1 
ATOM   1196  C  C     . VAL B 2  70  ? -32.436 -5.478  37.153 1.00 58.21  ? 70   VAL B C     1 
ATOM   1197  O  O     . VAL B 2  70  ? -32.735 -5.054  36.051 1.00 65.82  ? 70   VAL B O     1 
ATOM   1198  C  CB    . VAL B 2  70  ? -33.693 -4.872  39.296 1.00 56.30  ? 70   VAL B CB    1 
ATOM   1199  C  CG1   . VAL B 2  70  ? -33.725 -3.441  38.789 1.00 61.14  ? 70   VAL B CG1   1 
ATOM   1200  C  CG2   . VAL B 2  70  ? -34.967 -5.176  40.060 1.00 57.75  ? 70   VAL B CG2   1 
ATOM   1201  N  N     . THR B 2  71  ? -31.172 -5.666  37.510 1.00 54.87  ? 71   THR B N     1 
ATOM   1202  C  CA    . THR B 2  71  ? -30.085 -5.391  36.589 1.00 53.27  ? 71   THR B CA    1 
ATOM   1203  C  C     . THR B 2  71  ? -30.211 -6.136  35.281 1.00 54.61  ? 71   THR B C     1 
ATOM   1204  O  O     . THR B 2  71  ? -29.823 -5.638  34.252 1.00 54.86  ? 71   THR B O     1 
ATOM   1205  C  CB    . THR B 2  71  ? -28.761 -5.756  37.233 1.00 54.55  ? 71   THR B CB    1 
ATOM   1206  O  OG1   . THR B 2  71  ? -28.669 -5.065  38.476 1.00 63.68  ? 71   THR B OG1   1 
ATOM   1207  C  CG2   . THR B 2  71  ? -27.607 -5.357  36.363 1.00 56.57  ? 71   THR B CG2   1 
ATOM   1208  N  N     . TYR B 2  72  ? -30.722 -7.356  35.327 1.00 63.44  ? 72   TYR B N     1 
ATOM   1209  C  CA    . TYR B 2  72  ? -31.092 -8.077  34.105 1.00 65.64  ? 72   TYR B CA    1 
ATOM   1210  C  C     . TYR B 2  72  ? -32.216 -7.380  33.341 1.00 69.89  ? 72   TYR B C     1 
ATOM   1211  O  O     . TYR B 2  72  ? -32.138 -7.277  32.114 1.00 57.82  ? 72   TYR B O     1 
ATOM   1212  C  CB    . TYR B 2  72  ? -31.508 -9.518  34.422 1.00 63.76  ? 72   TYR B CB    1 
ATOM   1213  C  CG    . TYR B 2  72  ? -30.307 -10.390 34.660 1.00 62.81  ? 72   TYR B CG    1 
ATOM   1214  C  CD1   . TYR B 2  72  ? -30.092 -11.011 35.881 1.00 60.09  ? 72   TYR B CD1   1 
ATOM   1215  C  CD2   . TYR B 2  72  ? -29.357 -10.563 33.652 1.00 58.88  ? 72   TYR B CD2   1 
ATOM   1216  C  CE1   . TYR B 2  72  ? -28.969 -11.794 36.076 1.00 57.42  ? 72   TYR B CE1   1 
ATOM   1217  C  CE2   . TYR B 2  72  ? -28.263 -11.348 33.839 1.00 54.08  ? 72   TYR B CE2   1 
ATOM   1218  C  CZ    . TYR B 2  72  ? -28.069 -11.942 35.053 1.00 50.52  ? 72   TYR B CZ    1 
ATOM   1219  O  OH    . TYR B 2  72  ? -26.967 -12.688 35.204 1.00 43.98  ? 72   TYR B OH    1 
ATOM   1220  N  N     . THR B 2  73  ? -33.240 -6.925  34.080 1.00 66.89  ? 73   THR B N     1 
ATOM   1221  C  CA    . THR B 2  73  ? -34.367 -6.184  33.514 1.00 69.08  ? 73   THR B CA    1 
ATOM   1222  C  C     . THR B 2  73  ? -33.899 -4.922  32.770 1.00 73.36  ? 73   THR B C     1 
ATOM   1223  O  O     . THR B 2  73  ? -34.159 -4.766  31.562 1.00 76.04  ? 73   THR B O     1 
ATOM   1224  C  CB    . THR B 2  73  ? -35.397 -5.776  34.592 1.00 65.09  ? 73   THR B CB    1 
ATOM   1225  O  OG1   . THR B 2  73  ? -35.698 -6.891  35.427 1.00 59.14  ? 73   THR B OG1   1 
ATOM   1226  C  CG2   . THR B 2  73  ? -36.691 -5.326  33.946 1.00 67.52  ? 73   THR B CG2   1 
ATOM   1227  N  N     . GLU B 2  74  ? -33.201 -4.040  33.487 1.00 71.84  ? 74   GLU B N     1 
ATOM   1228  C  CA    . GLU B 2  74  ? -32.653 -2.817  32.905 1.00 70.81  ? 74   GLU B CA    1 
ATOM   1229  C  C     . GLU B 2  74  ? -31.860 -3.170  31.663 1.00 70.57  ? 74   GLU B C     1 
ATOM   1230  O  O     . GLU B 2  74  ? -31.933 -2.452  30.662 1.00 73.04  ? 74   GLU B O     1 
ATOM   1231  C  CB    . GLU B 2  74  ? -31.779 -2.022  33.901 1.00 77.63  ? 74   GLU B CB    1 
ATOM   1232  C  CG    . GLU B 2  74  ? -32.565 -1.168  34.908 1.00 87.70  ? 74   GLU B CG    1 
ATOM   1233  C  CD    . GLU B 2  74  ? -31.700 -0.275  35.813 1.00 100.95 ? 74   GLU B CD    1 
ATOM   1234  O  OE1   . GLU B 2  74  ? -32.148 0.012   36.958 1.00 104.03 ? 74   GLU B OE1   1 
ATOM   1235  O  OE2   . GLU B 2  74  ? -30.582 0.158   35.396 1.00 109.88 ? 74   GLU B OE2   1 
ATOM   1236  N  N     . HIS B 2  75  ? -31.147 -4.295  31.679 1.00 65.61  ? 75   HIS B N     1 
ATOM   1237  C  CA    . HIS B 2  75  ? -30.357 -4.625  30.501 1.00 68.40  ? 75   HIS B CA    1 
ATOM   1238  C  C     . HIS B 2  75  ? -31.226 -4.923  29.281 1.00 70.67  ? 75   HIS B C     1 
ATOM   1239  O  O     . HIS B 2  75  ? -30.931 -4.479  28.187 1.00 73.74  ? 75   HIS B O     1 
ATOM   1240  C  CB    . HIS B 2  75  ? -29.370 -5.759  30.738 1.00 65.86  ? 75   HIS B CB    1 
ATOM   1241  C  CG    . HIS B 2  75  ? -28.431 -5.956  29.595 1.00 59.89  ? 75   HIS B CG    1 
ATOM   1242  N  ND1   . HIS B 2  75  ? -27.309 -5.180  29.416 1.00 60.97  ? 75   HIS B ND1   1 
ATOM   1243  C  CD2   . HIS B 2  75  ? -28.483 -6.791  28.534 1.00 59.85  ? 75   HIS B CD2   1 
ATOM   1244  C  CE1   . HIS B 2  75  ? -26.686 -5.553  28.311 1.00 62.90  ? 75   HIS B CE1   1 
ATOM   1245  N  NE2   . HIS B 2  75  ? -27.390 -6.519  27.748 1.00 62.83  ? 75   HIS B NE2   1 
ATOM   1246  N  N     . ALA B 2  76  ? -32.308 -5.658  29.480 1.00 76.82  ? 76   ALA B N     1 
ATOM   1247  C  CA    . ALA B 2  76  ? -33.206 -6.022  28.396 1.00 72.86  ? 76   ALA B CA    1 
ATOM   1248  C  C     . ALA B 2  76  ? -34.148 -4.859  28.040 1.00 79.14  ? 76   ALA B C     1 
ATOM   1249  O  O     . ALA B 2  76  ? -35.080 -5.034  27.262 1.00 77.53  ? 76   ALA B O     1 
ATOM   1250  C  CB    . ALA B 2  76  ? -34.007 -7.244  28.798 1.00 68.01  ? 76   ALA B CB    1 
ATOM   1251  N  N     . LYS B 2  77  ? -33.910 -3.681  28.612 1.00 75.07  ? 77   LYS B N     1 
ATOM   1252  C  CA    . LYS B 2  77  ? -34.736 -2.508  28.348 1.00 77.64  ? 77   LYS B CA    1 
ATOM   1253  C  C     . LYS B 2  77  ? -36.209 -2.779  28.631 1.00 72.98  ? 77   LYS B C     1 
ATOM   1254  O  O     . LYS B 2  77  ? -37.057 -2.454  27.820 1.00 77.08  ? 77   LYS B O     1 
ATOM   1255  C  CB    . LYS B 2  77  ? -34.541 -2.037  26.906 1.00 78.16  ? 77   LYS B CB    1 
ATOM   1256  C  CG    . LYS B 2  77  ? -33.114 -1.634  26.581 1.00 88.13  ? 77   LYS B CG    1 
ATOM   1257  C  CD    . LYS B 2  77  ? -32.822 -1.624  25.084 1.00 94.25  ? 77   LYS B CD    1 
ATOM   1258  C  CE    . LYS B 2  77  ? -31.345 -1.322  24.840 1.00 97.85  ? 77   LYS B CE    1 
ATOM   1259  N  NZ    . LYS B 2  77  ? -31.027 -1.050  23.410 1.00 104.63 ? 77   LYS B NZ    1 
ATOM   1260  N  N     . ARG B 2  78  ? -36.509 -3.380  29.776 1.00 66.32  ? 78   ARG B N     1 
ATOM   1261  C  CA    . ARG B 2  78  ? -37.878 -3.747  30.119 1.00 67.21  ? 78   ARG B CA    1 
ATOM   1262  C  C     . ARG B 2  78  ? -38.263 -3.025  31.394 1.00 68.49  ? 78   ARG B C     1 
ATOM   1263  O  O     . ARG B 2  78  ? -37.440 -2.383  32.003 1.00 70.23  ? 78   ARG B O     1 
ATOM   1264  C  CB    . ARG B 2  78  ? -38.029 -5.268  30.315 1.00 74.34  ? 78   ARG B CB    1 
ATOM   1265  C  CG    . ARG B 2  78  ? -38.002 -6.127  29.046 1.00 72.74  ? 78   ARG B CG    1 
ATOM   1266  C  CD    . ARG B 2  78  ? -38.392 -7.600  29.314 1.00 74.28  ? 78   ARG B CD    1 
ATOM   1267  N  NE    . ARG B 2  78  ? -37.235 -8.482  29.560 1.00 76.86  ? 78   ARG B NE    1 
ATOM   1268  C  CZ    . ARG B 2  78  ? -36.750 -8.821  30.764 1.00 76.92  ? 78   ARG B CZ    1 
ATOM   1269  N  NH1   . ARG B 2  78  ? -37.310 -8.389  31.899 1.00 81.62  ? 78   ARG B NH1   1 
ATOM   1270  N  NH2   . ARG B 2  78  ? -35.690 -9.610  30.836 1.00 70.20  ? 78   ARG B NH2   1 
ATOM   1271  N  N     . LYS B 2  79  ? -39.540 -3.090  31.750 1.00 75.48  ? 79   LYS B N     1 
ATOM   1272  C  CA    . LYS B 2  79  ? -40.068 -2.509  32.972 1.00 73.91  ? 79   LYS B CA    1 
ATOM   1273  C  C     . LYS B 2  79  ? -40.731 -3.599  33.806 1.00 77.41  ? 79   LYS B C     1 
ATOM   1274  O  O     . LYS B 2  79  ? -41.316 -3.319  34.873 1.00 80.48  ? 79   LYS B O     1 
ATOM   1275  C  CB    . LYS B 2  79  ? -41.133 -1.470  32.629 1.00 85.50  ? 79   LYS B CB    1 
ATOM   1276  C  CG    . LYS B 2  79  ? -40.629 -0.182  31.990 1.00 94.17  ? 79   LYS B CG    1 
ATOM   1277  C  CD    . LYS B 2  79  ? -41.308 0.997   32.678 1.00 103.32 ? 79   LYS B CD    1 
ATOM   1278  C  CE    . LYS B 2  79  ? -41.405 2.228   31.807 1.00 107.41 ? 79   LYS B CE    1 
ATOM   1279  N  NZ    . LYS B 2  79  ? -42.413 3.150   32.400 1.00 112.60 ? 79   LYS B NZ    1 
ATOM   1280  N  N     . THR B 2  80  ? -40.679 -4.831  33.297 1.00 70.89  ? 80   THR B N     1 
ATOM   1281  C  CA    . THR B 2  80  ? -41.181 -5.997  34.015 1.00 75.27  ? 80   THR B CA    1 
ATOM   1282  C  C     . THR B 2  80  ? -40.030 -6.978  34.336 1.00 74.63  ? 80   THR B C     1 
ATOM   1283  O  O     . THR B 2  80  ? -39.293 -7.445  33.431 1.00 72.19  ? 80   THR B O     1 
ATOM   1284  C  CB    . THR B 2  80  ? -42.263 -6.744  33.206 1.00 75.66  ? 80   THR B CB    1 
ATOM   1285  O  OG1   . THR B 2  80  ? -43.129 -5.800  32.564 1.00 81.48  ? 80   THR B OG1   1 
ATOM   1286  C  CG2   . THR B 2  80  ? -43.072 -7.634  34.112 1.00 72.75  ? 80   THR B CG2   1 
ATOM   1287  N  N     . VAL B 2  81  ? -39.893 -7.286  35.625 1.00 66.37  ? 81   VAL B N     1 
ATOM   1288  C  CA    . VAL B 2  81  ? -38.971 -8.308  36.084 1.00 59.98  ? 81   VAL B CA    1 
ATOM   1289  C  C     . VAL B 2  81  ? -39.581 -9.632  35.702 1.00 62.05  ? 81   VAL B C     1 
ATOM   1290  O  O     . VAL B 2  81  ? -40.651 -9.966  36.221 1.00 63.17  ? 81   VAL B O     1 
ATOM   1291  C  CB    . VAL B 2  81  ? -38.828 -8.276  37.608 1.00 61.92  ? 81   VAL B CB    1 
ATOM   1292  C  CG1   . VAL B 2  81  ? -37.902 -9.389  38.056 1.00 66.96  ? 81   VAL B CG1   1 
ATOM   1293  C  CG2   . VAL B 2  81  ? -38.298 -6.924  38.079 1.00 61.36  ? 81   VAL B CG2   1 
ATOM   1294  N  N     . THR B 2  82  ? -38.961 -10.378 34.782 1.00 62.76  ? 82   THR B N     1 
ATOM   1295  C  CA    . THR B 2  82  ? -39.491 -11.703 34.429 1.00 62.30  ? 82   THR B CA    1 
ATOM   1296  C  C     . THR B 2  82  ? -39.020 -12.739 35.424 1.00 63.79  ? 82   THR B C     1 
ATOM   1297  O  O     . THR B 2  82  ? -38.156 -12.479 36.241 1.00 65.91  ? 82   THR B O     1 
ATOM   1298  C  CB    . THR B 2  82  ? -39.101 -12.156 33.026 1.00 64.61  ? 82   THR B CB    1 
ATOM   1299  O  OG1   . THR B 2  82  ? -37.685 -12.171 32.892 1.00 68.48  ? 82   THR B OG1   1 
ATOM   1300  C  CG2   . THR B 2  82  ? -39.642 -11.213 32.010 1.00 73.29  ? 82   THR B CG2   1 
ATOM   1301  N  N     . ALA B 2  83  ? -39.636 -13.909 35.388 1.00 68.24  ? 83   ALA B N     1 
ATOM   1302  C  CA    . ALA B 2  83  ? -39.159 -15.031 36.185 1.00 62.39  ? 83   ALA B CA    1 
ATOM   1303  C  C     . ALA B 2  83  ? -37.765 -15.424 35.738 1.00 57.45  ? 83   ALA B C     1 
ATOM   1304  O  O     . ALA B 2  83  ? -37.001 -15.865 36.558 1.00 59.44  ? 83   ALA B O     1 
ATOM   1305  C  CB    . ALA B 2  83  ? -40.092 -16.219 36.065 1.00 63.80  ? 83   ALA B CB    1 
ATOM   1306  N  N     . MET B 2  84  ? -37.441 -15.264 34.453 1.00 54.48  ? 84   MET B N     1 
ATOM   1307  C  CA    . MET B 2  84  ? -36.115 -15.580 33.967 1.00 56.13  ? 84   MET B CA    1 
ATOM   1308  C  C     . MET B 2  84  ? -35.094 -14.611 34.527 1.00 63.69  ? 84   MET B C     1 
ATOM   1309  O  O     . MET B 2  84  ? -33.967 -15.023 34.833 1.00 71.78  ? 84   MET B O     1 
ATOM   1310  C  CB    . MET B 2  84  ? -36.025 -15.553 32.448 1.00 57.86  ? 84   MET B CB    1 
ATOM   1311  C  CG    . MET B 2  84  ? -36.647 -16.743 31.735 1.00 60.56  ? 84   MET B CG    1 
ATOM   1312  S  SD    . MET B 2  84  ? -36.296 -18.332 32.497 1.00 68.75  ? 84   MET B SD    1 
ATOM   1313  C  CE    . MET B 2  84  ? -34.531 -18.500 32.138 1.00 64.55  ? 84   MET B CE    1 
ATOM   1314  N  N     . ASP B 2  85  ? -35.454 -13.340 34.677 1.00 56.75  ? 85   ASP B N     1 
ATOM   1315  C  CA    . ASP B 2  85  ? -34.547 -12.421 35.382 1.00 63.81  ? 85   ASP B CA    1 
ATOM   1316  C  C     . ASP B 2  85  ? -34.161 -12.990 36.756 1.00 63.00  ? 85   ASP B C     1 
ATOM   1317  O  O     . ASP B 2  85  ? -32.986 -13.013 37.117 1.00 64.88  ? 85   ASP B O     1 
ATOM   1318  C  CB    . ASP B 2  85  ? -35.150 -11.018 35.591 1.00 63.77  ? 85   ASP B CB    1 
ATOM   1319  C  CG    . ASP B 2  85  ? -35.255 -10.229 34.325 1.00 62.23  ? 85   ASP B CG    1 
ATOM   1320  O  OD1   . ASP B 2  85  ? -34.527 -10.536 33.361 1.00 67.14  ? 85   ASP B OD1   1 
ATOM   1321  O  OD2   . ASP B 2  85  ? -36.068 -9.288  34.303 1.00 63.76  ? 85   ASP B OD2   1 
ATOM   1322  N  N     . VAL B 2  86  ? -35.162 -13.436 37.510 1.00 55.02  ? 86   VAL B N     1 
ATOM   1323  C  CA    . VAL B 2  86  ? -34.945 -13.938 38.860 1.00 57.14  ? 86   VAL B CA    1 
ATOM   1324  C  C     . VAL B 2  86  ? -34.093 -15.225 38.855 1.00 59.83  ? 86   VAL B C     1 
ATOM   1325  O  O     . VAL B 2  86  ? -33.131 -15.366 39.610 1.00 57.41  ? 86   VAL B O     1 
ATOM   1326  C  CB    . VAL B 2  86  ? -36.297 -14.183 39.543 1.00 58.62  ? 86   VAL B CB    1 
ATOM   1327  C  CG1   . VAL B 2  86  ? -36.136 -14.952 40.830 1.00 62.95  ? 86   VAL B CG1   1 
ATOM   1328  C  CG2   . VAL B 2  86  ? -36.986 -12.852 39.826 1.00 62.05  ? 86   VAL B CG2   1 
ATOM   1329  N  N     . VAL B 2  87  ? -34.437 -16.137 37.963 1.00 54.81  ? 87   VAL B N     1 
ATOM   1330  C  CA    . VAL B 2  87  ? -33.770 -17.403 37.859 1.00 51.04  ? 87   VAL B CA    1 
ATOM   1331  C  C     . VAL B 2  87  ? -32.306 -17.224 37.496 1.00 54.21  ? 87   VAL B C     1 
ATOM   1332  O  O     . VAL B 2  87  ? -31.435 -17.908 38.030 1.00 57.73  ? 87   VAL B O     1 
ATOM   1333  C  CB    . VAL B 2  87  ? -34.475 -18.290 36.821 1.00 52.50  ? 87   VAL B CB    1 
ATOM   1334  C  CG1   . VAL B 2  87  ? -33.649 -19.517 36.470 1.00 51.30  ? 87   VAL B CG1   1 
ATOM   1335  C  CG2   . VAL B 2  87  ? -35.841 -18.729 37.340 1.00 56.50  ? 87   VAL B CG2   1 
ATOM   1336  N  N     . TYR B 2  88  ? -32.025 -16.308 36.593 1.00 56.22  ? 88   TYR B N     1 
ATOM   1337  C  CA    . TYR B 2  88  ? -30.647 -15.995 36.290 1.00 55.16  ? 88   TYR B CA    1 
ATOM   1338  C  C     . TYR B 2  88  ? -29.880 -15.395 37.491 1.00 55.26  ? 88   TYR B C     1 
ATOM   1339  O  O     . TYR B 2  88  ? -28.670 -15.668 37.671 1.00 52.35  ? 88   TYR B O     1 
ATOM   1340  C  CB    . TYR B 2  88  ? -30.576 -15.056 35.098 1.00 58.84  ? 88   TYR B CB    1 
ATOM   1341  C  CG    . TYR B 2  88  ? -31.024 -15.654 33.775 1.00 62.45  ? 88   TYR B CG    1 
ATOM   1342  C  CD1   . TYR B 2  88  ? -31.611 -14.861 32.807 1.00 64.03  ? 88   TYR B CD1   1 
ATOM   1343  C  CD2   . TYR B 2  88  ? -30.860 -17.001 33.494 1.00 68.47  ? 88   TYR B CD2   1 
ATOM   1344  C  CE1   . TYR B 2  88  ? -32.016 -15.383 31.596 1.00 69.83  ? 88   TYR B CE1   1 
ATOM   1345  C  CE2   . TYR B 2  88  ? -31.260 -17.532 32.280 1.00 74.50  ? 88   TYR B CE2   1 
ATOM   1346  C  CZ    . TYR B 2  88  ? -31.837 -16.712 31.336 1.00 74.50  ? 88   TYR B CZ    1 
ATOM   1347  O  OH    . TYR B 2  88  ? -32.229 -17.239 30.132 1.00 80.23  ? 88   TYR B OH    1 
ATOM   1348  N  N     . ALA B 2  89  ? -30.574 -14.606 38.312 1.00 53.39  ? 89   ALA B N     1 
ATOM   1349  C  CA    . ALA B 2  89  ? -29.932 -13.921 39.450 1.00 53.25  ? 89   ALA B CA    1 
ATOM   1350  C  C     . ALA B 2  89  ? -29.603 -14.952 40.474 1.00 52.06  ? 89   ALA B C     1 
ATOM   1351  O  O     . ALA B 2  89  ? -28.492 -14.994 40.994 1.00 53.60  ? 89   ALA B O     1 
ATOM   1352  C  CB    . ALA B 2  89  ? -30.849 -12.880 40.065 1.00 53.05  ? 89   ALA B CB    1 
ATOM   1353  N  N     . LEU B 2  90  ? -30.586 -15.793 40.759 1.00 52.51  ? 90   LEU B N     1 
ATOM   1354  C  CA    . LEU B 2  90  ? -30.384 -16.936 41.633 1.00 52.40  ? 90   LEU B CA    1 
ATOM   1355  C  C     . LEU B 2  90  ? -29.212 -17.843 41.191 1.00 53.18  ? 90   LEU B C     1 
ATOM   1356  O  O     . LEU B 2  90  ? -28.454 -18.318 42.030 1.00 51.20  ? 90   LEU B O     1 
ATOM   1357  C  CB    . LEU B 2  90  ? -31.673 -17.729 41.743 1.00 51.00  ? 90   LEU B CB    1 
ATOM   1358  C  CG    . LEU B 2  90  ? -32.721 -17.047 42.614 1.00 54.66  ? 90   LEU B CG    1 
ATOM   1359  C  CD1   . LEU B 2  90  ? -34.093 -17.597 42.294 1.00 56.85  ? 90   LEU B CD1   1 
ATOM   1360  C  CD2   . LEU B 2  90  ? -32.432 -17.227 44.102 1.00 55.66  ? 90   LEU B CD2   1 
ATOM   1361  N  N     . LYS B 2  91  ? -29.048 -18.064 39.890 1.00 51.74  ? 91   LYS B N     1 
ATOM   1362  C  CA    . LYS B 2  91  ? -27.964 -18.924 39.436 1.00 52.29  ? 91   LYS B CA    1 
ATOM   1363  C  C     . LYS B 2  91  ? -26.627 -18.299 39.765 1.00 55.82  ? 91   LYS B C     1 
ATOM   1364  O  O     . LYS B 2  91  ? -25.763 -18.961 40.369 1.00 54.23  ? 91   LYS B O     1 
ATOM   1365  C  CB    . LYS B 2  91  ? -28.041 -19.237 37.949 1.00 52.14  ? 91   LYS B CB    1 
ATOM   1366  C  CG    . LYS B 2  91  ? -26.977 -20.237 37.518 1.00 57.73  ? 91   LYS B CG    1 
ATOM   1367  C  CD    . LYS B 2  91  ? -27.441 -21.195 36.431 1.00 60.32  ? 91   LYS B CD    1 
ATOM   1368  C  CE    . LYS B 2  91  ? -27.842 -20.421 35.185 1.00 70.61  ? 91   LYS B CE    1 
ATOM   1369  N  NZ    . LYS B 2  91  ? -28.212 -21.326 34.057 1.00 81.50  ? 91   LYS B NZ    1 
ATOM   1370  N  N     . ARG B 2  92  ? -26.435 -17.031 39.410 1.00 53.76  ? 92   ARG B N     1 
ATOM   1371  C  CA    . ARG B 2  92  ? -25.126 -16.428 39.692 1.00 54.17  ? 92   ARG B CA    1 
ATOM   1372  C  C     . ARG B 2  92  ? -24.840 -16.167 41.184 1.00 54.20  ? 92   ARG B C     1 
ATOM   1373  O  O     . ARG B 2  92  ? -23.651 -16.048 41.546 1.00 54.22  ? 92   ARG B O     1 
ATOM   1374  C  CB    . ARG B 2  92  ? -24.871 -15.168 38.878 1.00 54.17  ? 92   ARG B CB    1 
ATOM   1375  C  CG    . ARG B 2  92  ? -25.726 -13.979 39.266 1.00 57.85  ? 92   ARG B CG    1 
ATOM   1376  C  CD    . ARG B 2  92  ? -25.356 -12.789 38.400 1.00 58.75  ? 92   ARG B CD    1 
ATOM   1377  N  NE    . ARG B 2  92  ? -23.924 -12.625 38.444 1.00 58.48  ? 92   ARG B NE    1 
ATOM   1378  C  CZ    . ARG B 2  92  ? -23.264 -12.136 39.482 1.00 56.49  ? 92   ARG B CZ    1 
ATOM   1379  N  NH1   . ARG B 2  92  ? -23.908 -11.714 40.564 1.00 56.08  ? 92   ARG B NH1   1 
ATOM   1380  N  NH2   . ARG B 2  92  ? -21.946 -12.073 39.432 1.00 56.69  ? 92   ARG B NH2   1 
ATOM   1381  N  N     . GLN B 2  93  ? -25.882 -16.104 42.036 1.00 48.06  ? 93   GLN B N     1 
ATOM   1382  C  CA    . GLN B 2  93  ? -25.678 -16.016 43.488 1.00 48.79  ? 93   GLN B CA    1 
ATOM   1383  C  C     . GLN B 2  93  ? -25.447 -17.400 44.091 1.00 48.22  ? 93   GLN B C     1 
ATOM   1384  O  O     . GLN B 2  93  ? -25.440 -17.537 45.315 1.00 45.51  ? 93   GLN B O     1 
ATOM   1385  C  CB    . GLN B 2  93  ? -26.891 -15.416 44.217 1.00 57.23  ? 93   GLN B CB    1 
ATOM   1386  C  CG    . GLN B 2  93  ? -27.283 -14.002 43.837 1.00 61.56  ? 93   GLN B CG    1 
ATOM   1387  C  CD    . GLN B 2  93  ? -26.245 -12.975 44.223 1.00 66.74  ? 93   GLN B CD    1 
ATOM   1388  O  OE1   . GLN B 2  93  ? -25.664 -13.021 45.312 1.00 63.89  ? 93   GLN B OE1   1 
ATOM   1389  N  NE2   . GLN B 2  93  ? -26.012 -12.022 43.329 1.00 72.89  ? 93   GLN B NE2   1 
ATOM   1390  N  N     . GLY B 2  94  ? -25.297 -18.426 43.253 1.00 48.25  ? 94   GLY B N     1 
ATOM   1391  C  CA    . GLY B 2  94  ? -25.167 -19.801 43.723 1.00 50.65  ? 94   GLY B CA    1 
ATOM   1392  C  C     . GLY B 2  94  ? -26.398 -20.447 44.357 1.00 51.95  ? 94   GLY B C     1 
ATOM   1393  O  O     . GLY B 2  94  ? -26.269 -21.420 45.086 1.00 55.63  ? 94   GLY B O     1 
ATOM   1394  N  N     . ARG B 2  95  ? -27.582 -19.910 44.079 1.00 54.78  ? 95   ARG B N     1 
ATOM   1395  C  CA    . ARG B 2  95  ? -28.841 -20.466 44.555 1.00 53.33  ? 95   ARG B CA    1 
ATOM   1396  C  C     . ARG B 2  95  ? -29.717 -20.995 43.408 1.00 48.52  ? 95   ARG B C     1 
ATOM   1397  O  O     . ARG B 2  95  ? -30.904 -20.751 43.412 1.00 51.36  ? 95   ARG B O     1 
ATOM   1398  C  CB    . ARG B 2  95  ? -29.663 -19.399 45.280 1.00 55.96  ? 95   ARG B CB    1 
ATOM   1399  C  CG    . ARG B 2  95  ? -28.949 -18.505 46.262 1.00 56.84  ? 95   ARG B CG    1 
ATOM   1400  C  CD    . ARG B 2  95  ? -28.520 -19.173 47.537 1.00 60.64  ? 95   ARG B CD    1 
ATOM   1401  N  NE    . ARG B 2  95  ? -29.535 -20.048 48.097 1.00 72.77  ? 95   ARG B NE    1 
ATOM   1402  C  CZ    . ARG B 2  95  ? -29.313 -20.843 49.144 1.00 75.83  ? 95   ARG B CZ    1 
ATOM   1403  N  NH1   . ARG B 2  95  ? -28.109 -20.830 49.741 1.00 75.08  ? 95   ARG B NH1   1 
ATOM   1404  N  NH2   . ARG B 2  95  ? -30.296 -21.631 49.602 1.00 65.74  ? 95   ARG B NH2   1 
ATOM   1405  N  N     . THR B 2  96  ? -29.154 -21.744 42.465 1.00 49.81  ? 96   THR B N     1 
ATOM   1406  C  CA    . THR B 2  96  ? -29.904 -22.242 41.302 1.00 44.24  ? 96   THR B CA    1 
ATOM   1407  C  C     . THR B 2  96  ? -31.225 -22.843 41.701 1.00 48.75  ? 96   THR B C     1 
ATOM   1408  O  O     . THR B 2  96  ? -31.266 -23.708 42.576 1.00 52.17  ? 96   THR B O     1 
ATOM   1409  C  CB    . THR B 2  96  ? -29.147 -23.357 40.589 1.00 40.67  ? 96   THR B CB    1 
ATOM   1410  O  OG1   . THR B 2  96  ? -28.063 -22.798 39.857 1.00 41.66  ? 96   THR B OG1   1 
ATOM   1411  C  CG2   . THR B 2  96  ? -30.026 -24.059 39.618 1.00 40.45  ? 96   THR B CG2   1 
ATOM   1412  N  N     . LEU B 2  97  ? -32.287 -22.395 41.028 1.00 49.75  ? 97   LEU B N     1 
ATOM   1413  C  CA    . LEU B 2  97  ? -33.663 -22.825 41.273 1.00 48.99  ? 97   LEU B CA    1 
ATOM   1414  C  C     . LEU B 2  97  ? -34.222 -23.549 40.052 1.00 50.70  ? 97   LEU B C     1 
ATOM   1415  O  O     . LEU B 2  97  ? -34.026 -23.118 38.950 1.00 53.62  ? 97   LEU B O     1 
ATOM   1416  C  CB    . LEU B 2  97  ? -34.483 -21.583 41.526 1.00 48.44  ? 97   LEU B CB    1 
ATOM   1417  C  CG    . LEU B 2  97  ? -35.984 -21.690 41.754 1.00 49.17  ? 97   LEU B CG    1 
ATOM   1418  C  CD1   . LEU B 2  97  ? -36.252 -22.259 43.122 1.00 52.20  ? 97   LEU B CD1   1 
ATOM   1419  C  CD2   . LEU B 2  97  ? -36.634 -20.314 41.657 1.00 48.59  ? 97   LEU B CD2   1 
ATOM   1420  N  N     . TYR B 2  98  ? -34.920 -24.650 40.240 1.00 55.94  ? 98   TYR B N     1 
ATOM   1421  C  CA    . TYR B 2  98  ? -35.527 -25.355 39.119 1.00 54.60  ? 98   TYR B CA    1 
ATOM   1422  C  C     . TYR B 2  98  ? -37.034 -25.198 39.155 1.00 61.61  ? 98   TYR B C     1 
ATOM   1423  O  O     . TYR B 2  98  ? -37.643 -25.172 40.245 1.00 62.31  ? 98   TYR B O     1 
ATOM   1424  C  CB    . TYR B 2  98  ? -35.254 -26.841 39.213 1.00 54.75  ? 98   TYR B CB    1 
ATOM   1425  C  CG    . TYR B 2  98  ? -33.867 -27.336 38.902 1.00 50.12  ? 98   TYR B CG    1 
ATOM   1426  C  CD1   . TYR B 2  98  ? -32.856 -26.505 38.389 1.00 48.71  ? 98   TYR B CD1   1 
ATOM   1427  C  CD2   . TYR B 2  98  ? -33.583 -28.661 39.091 1.00 43.71  ? 98   TYR B CD2   1 
ATOM   1428  C  CE1   . TYR B 2  98  ? -31.593 -27.005 38.082 1.00 44.46  ? 98   TYR B CE1   1 
ATOM   1429  C  CE2   . TYR B 2  98  ? -32.340 -29.158 38.788 1.00 50.47  ? 98   TYR B CE2   1 
ATOM   1430  C  CZ    . TYR B 2  98  ? -31.351 -28.331 38.287 1.00 50.46  ? 98   TYR B CZ    1 
ATOM   1431  O  OH    . TYR B 2  98  ? -30.154 -28.920 37.993 1.00 48.91  ? 98   TYR B OH    1 
ATOM   1432  N  N     . GLY B 2  99  ? -37.628 -25.125 37.960 1.00 64.72  ? 99   GLY B N     1 
ATOM   1433  C  CA    . GLY B 2  99  ? -39.074 -25.011 37.803 1.00 66.71  ? 99   GLY B CA    1 
ATOM   1434  C  C     . GLY B 2  99  ? -39.684 -23.689 37.356 1.00 59.52  ? 99   GLY B C     1 
ATOM   1435  O  O     . GLY B 2  99  ? -40.888 -23.584 37.278 1.00 72.53  ? 99   GLY B O     1 
ATOM   1436  N  N     . PHE B 2  100 ? -38.888 -22.686 37.050 1.00 55.31  ? 100  PHE B N     1 
ATOM   1437  C  CA    . PHE B 2  100 ? -39.427 -21.411 36.600 1.00 52.68  ? 100  PHE B CA    1 
ATOM   1438  C  C     . PHE B 2  100 ? -38.817 -20.970 35.261 1.00 58.80  ? 100  PHE B C     1 
ATOM   1439  O  O     . PHE B 2  100 ? -38.848 -19.791 34.902 1.00 58.80  ? 100  PHE B O     1 
ATOM   1440  C  CB    . PHE B 2  100 ? -39.213 -20.374 37.674 1.00 50.48  ? 100  PHE B CB    1 
ATOM   1441  C  CG    . PHE B 2  100 ? -40.032 -20.618 38.892 1.00 54.68  ? 100  PHE B CG    1 
ATOM   1442  C  CD1   . PHE B 2  100 ? -39.545 -21.381 39.935 1.00 53.82  ? 100  PHE B CD1   1 
ATOM   1443  C  CD2   . PHE B 2  100 ? -41.317 -20.097 38.994 1.00 54.12  ? 100  PHE B CD2   1 
ATOM   1444  C  CE1   . PHE B 2  100 ? -40.317 -21.585 41.076 1.00 57.40  ? 100  PHE B CE1   1 
ATOM   1445  C  CE2   . PHE B 2  100 ? -42.093 -20.305 40.126 1.00 52.32  ? 100  PHE B CE2   1 
ATOM   1446  C  CZ    . PHE B 2  100 ? -41.601 -21.051 41.169 1.00 53.10  ? 100  PHE B CZ    1 
ATOM   1447  N  N     . GLY B 2  101 ? -38.312 -21.943 34.505 1.00 61.60  ? 101  GLY B N     1 
ATOM   1448  C  CA    . GLY B 2  101 ? -37.720 -21.698 33.208 1.00 64.39  ? 101  GLY B CA    1 
ATOM   1449  C  C     . GLY B 2  101 ? -36.220 -21.868 33.250 1.00 71.37  ? 101  GLY B C     1 
ATOM   1450  O  O     . GLY B 2  101 ? -35.645 -22.212 34.286 1.00 76.33  ? 101  GLY B O     1 
ATOM   1451  N  N     . GLY B 2  102 ? -35.583 -21.632 32.105 1.00 81.08  ? 102  GLY B N     1 
ATOM   1452  C  CA    . GLY B 2  102 ? -34.136 -21.784 31.964 1.00 75.41  ? 102  GLY B CA    1 
ATOM   1453  C  C     . GLY B 2  102 ? -33.693 -23.228 32.030 1.00 72.03  ? 102  GLY B C     1 
ATOM   1454  O  O     . GLY B 2  102 ? -32.495 -23.468 32.044 1.00 71.83  ? 102  GLY B O     1 
ATOM   1455  O  OXT   . GLY B 2  102 ? -34.489 -24.171 32.081 1.00 75.84  ? 102  GLY B OXT   1 
ATOM   1456  N  N     . ALA C 3  14  ? -0.958  6.604   12.833 1.00 119.68 ? 14   ALA C N     1 
ATOM   1457  C  CA    . ALA C 3  14  ? -0.011  5.625   13.467 1.00 125.12 ? 14   ALA C CA    1 
ATOM   1458  C  C     . ALA C 3  14  ? -0.292  5.369   14.972 1.00 127.25 ? 14   ALA C C     1 
ATOM   1459  O  O     . ALA C 3  14  ? 0.608   4.946   15.706 1.00 121.46 ? 14   ALA C O     1 
ATOM   1460  C  CB    . ALA C 3  14  ? 1.430   6.094   13.258 1.00 117.07 ? 14   ALA C CB    1 
ATOM   1461  N  N     . LYS C 3  15  ? -1.542  5.574   15.406 1.00 120.01 ? 15   LYS C N     1 
ATOM   1462  C  CA    . LYS C 3  15  ? -1.890  5.647   16.835 1.00 111.89 ? 15   LYS C CA    1 
ATOM   1463  C  C     . LYS C 3  15  ? -2.652  4.436   17.376 1.00 102.72 ? 15   LYS C C     1 
ATOM   1464  O  O     . LYS C 3  15  ? -3.660  4.030   16.796 1.00 98.85  ? 15   LYS C O     1 
ATOM   1465  C  CB    . LYS C 3  15  ? -2.732  6.897   17.104 1.00 115.09 ? 15   LYS C CB    1 
ATOM   1466  C  CG    . LYS C 3  15  ? -1.906  8.166   17.208 1.00 127.43 ? 15   LYS C CG    1 
ATOM   1467  C  CD    . LYS C 3  15  ? -2.486  9.134   18.223 1.00 135.69 ? 15   LYS C CD    1 
ATOM   1468  C  CE    . LYS C 3  15  ? -1.617  10.374  18.336 1.00 141.90 ? 15   LYS C CE    1 
ATOM   1469  N  NZ    . LYS C 3  15  ? -2.223  11.392  19.238 1.00 146.84 ? 15   LYS C NZ    1 
ATOM   1470  N  N     . THR C 3  16  ? -2.195  3.901   18.515 1.00 89.92  ? 16   THR C N     1 
ATOM   1471  C  CA    . THR C 3  16  ? -2.884  2.792   19.182 1.00 78.86  ? 16   THR C CA    1 
ATOM   1472  C  C     . THR C 3  16  ? -4.240  3.195   19.766 1.00 74.48  ? 16   THR C C     1 
ATOM   1473  O  O     . THR C 3  16  ? -4.530  4.369   20.047 1.00 66.75  ? 16   THR C O     1 
ATOM   1474  C  CB    . THR C 3  16  ? -2.090  2.233   20.368 1.00 77.08  ? 16   THR C CB    1 
ATOM   1475  O  OG1   . THR C 3  16  ? -1.902  3.282   21.323 1.00 78.42  ? 16   THR C OG1   1 
ATOM   1476  C  CG2   . THR C 3  16  ? -0.750  1.630   19.932 1.00 73.95  ? 16   THR C CG2   1 
ATOM   1477  N  N     . ARG C 3  17  ? -5.050  2.177   19.992 1.00 71.18  ? 17   ARG C N     1 
ATOM   1478  C  CA    . ARG C 3  17  ? -6.402  2.362   20.491 1.00 73.03  ? 17   ARG C CA    1 
ATOM   1479  C  C     . ARG C 3  17  ? -6.365  2.634   21.978 1.00 72.31  ? 17   ARG C C     1 
ATOM   1480  O  O     . ARG C 3  17  ? -7.259  3.274   22.546 1.00 64.91  ? 17   ARG C O     1 
ATOM   1481  C  CB    . ARG C 3  17  ? -7.192  1.101   20.224 1.00 80.30  ? 17   ARG C CB    1 
ATOM   1482  C  CG    . ARG C 3  17  ? -7.109  0.667   18.775 1.00 81.99  ? 17   ARG C CG    1 
ATOM   1483  C  CD    . ARG C 3  17  ? -8.315  -0.150  18.421 1.00 86.58  ? 17   ARG C CD    1 
ATOM   1484  N  NE    . ARG C 3  17  ? -8.026  -1.572  18.445 1.00 87.20  ? 17   ARG C NE    1 
ATOM   1485  C  CZ    . ARG C 3  17  ? -8.924  -2.497  18.759 1.00 79.92  ? 17   ARG C CZ    1 
ATOM   1486  N  NH1   . ARG C 3  17  ? -10.166 -2.149  19.109 1.00 76.97  ? 17   ARG C NH1   1 
ATOM   1487  N  NH2   . ARG C 3  17  ? -8.555  -3.766  18.734 1.00 78.90  ? 17   ARG C NH2   1 
ATOM   1488  N  N     . SER C 3  18  ? -5.324  2.114   22.616 1.00 74.81  ? 18   SER C N     1 
ATOM   1489  C  CA    . SER C 3  18  ? -5.065  2.442   23.994 1.00 69.80  ? 18   SER C CA    1 
ATOM   1490  C  C     . SER C 3  18  ? -4.882  3.941   24.100 1.00 67.98  ? 18   SER C C     1 
ATOM   1491  O  O     . SER C 3  18  ? -5.680  4.580   24.773 1.00 68.15  ? 18   SER C O     1 
ATOM   1492  C  CB    . SER C 3  18  ? -3.861  1.671   24.510 1.00 70.45  ? 18   SER C CB    1 
ATOM   1493  O  OG    . SER C 3  18  ? -4.201  0.315   24.667 1.00 69.35  ? 18   SER C OG    1 
ATOM   1494  N  N     . SER C 3  19  ? -3.895  4.522   23.406 1.00 69.34  ? 19   SER C N     1 
ATOM   1495  C  CA    . SER C 3  19  ? -3.749  6.005   23.459 1.00 73.60  ? 19   SER C CA    1 
ATOM   1496  C  C     . SER C 3  19  ? -5.024  6.729   22.979 1.00 60.44  ? 19   SER C C     1 
ATOM   1497  O  O     . SER C 3  19  ? -5.408  7.728   23.554 1.00 61.06  ? 19   SER C O     1 
ATOM   1498  C  CB    . SER C 3  19  ? -2.462  6.553   22.785 1.00 69.11  ? 19   SER C CB    1 
ATOM   1499  O  OG    . SER C 3  19  ? -2.329  6.124   21.442 1.00 82.84  ? 19   SER C OG    1 
ATOM   1500  N  N     . ARG C 3  20  ? -5.732  6.199   22.002 1.00 60.19  ? 20   ARG C N     1 
ATOM   1501  C  CA    . ARG C 3  20  ? -6.991  6.831   21.631 1.00 67.38  ? 20   ARG C CA    1 
ATOM   1502  C  C     . ARG C 3  20  ? -7.962  6.934   22.795 1.00 65.69  ? 20   ARG C C     1 
ATOM   1503  O  O     . ARG C 3  20  ? -8.706  7.919   22.873 1.00 69.13  ? 20   ARG C O     1 
ATOM   1504  C  CB    . ARG C 3  20  ? -7.690  6.111   20.471 1.00 81.28  ? 20   ARG C CB    1 
ATOM   1505  C  CG    . ARG C 3  20  ? -7.116  6.349   19.082 1.00 90.38  ? 20   ARG C CG    1 
ATOM   1506  C  CD    . ARG C 3  20  ? -7.922  5.619   18.008 1.00 99.19  ? 20   ARG C CD    1 
ATOM   1507  N  NE    . ARG C 3  20  ? -7.072  5.274   16.869 1.00 118.60 ? 20   ARG C NE    1 
ATOM   1508  C  CZ    . ARG C 3  20  ? -6.742  6.103   15.874 1.00 135.97 ? 20   ARG C CZ    1 
ATOM   1509  N  NH1   . ARG C 3  20  ? -7.191  7.361   15.834 1.00 137.44 ? 20   ARG C NH1   1 
ATOM   1510  N  NH2   . ARG C 3  20  ? -5.953  5.667   14.898 1.00 146.04 ? 20   ARG C NH2   1 
ATOM   1511  N  N     . ALA C 3  21  ? -7.975  5.924   23.680 1.00 70.76  ? 21   ALA C N     1 
ATOM   1512  C  CA    . ALA C 3  21  ? -8.938  5.855   24.831 1.00 68.18  ? 21   ALA C CA    1 
ATOM   1513  C  C     . ALA C 3  21  ? -8.386  6.392   26.147 1.00 66.68  ? 21   ALA C C     1 
ATOM   1514  O  O     . ALA C 3  21  ? -9.111  6.513   27.143 1.00 69.33  ? 21   ALA C O     1 
ATOM   1515  C  CB    . ALA C 3  21  ? -9.401  4.427   25.037 1.00 70.95  ? 21   ALA C CB    1 
ATOM   1516  N  N     . GLY C 3  22  ? -7.091  6.676   26.152 1.00 61.07  ? 22   GLY C N     1 
ATOM   1517  C  CA    . GLY C 3  22  ? -6.450  7.293   27.275 1.00 61.38  ? 22   GLY C CA    1 
ATOM   1518  C  C     . GLY C 3  22  ? -6.106  6.282   28.321 1.00 62.33  ? 22   GLY C C     1 
ATOM   1519  O  O     . GLY C 3  22  ? -6.247  6.557   29.501 1.00 63.75  ? 22   GLY C O     1 
ATOM   1520  N  N     . LEU C 3  23  ? -5.589  5.139   27.866 1.00 64.36  ? 23   LEU C N     1 
ATOM   1521  C  CA    . LEU C 3  23  ? -5.424  3.948   28.688 1.00 55.69  ? 23   LEU C CA    1 
ATOM   1522  C  C     . LEU C 3  23  ? -4.043  3.366   28.542 1.00 59.31  ? 23   LEU C C     1 
ATOM   1523  O  O     . LEU C 3  23  ? -3.471  3.374   27.470 1.00 64.21  ? 23   LEU C O     1 
ATOM   1524  C  CB    . LEU C 3  23  ? -6.429  2.881   28.270 1.00 53.32  ? 23   LEU C CB    1 
ATOM   1525  C  CG    . LEU C 3  23  ? -7.925  3.118   28.507 1.00 51.00  ? 23   LEU C CG    1 
ATOM   1526  C  CD1   . LEU C 3  23  ? -8.675  1.902   28.021 1.00 55.18  ? 23   LEU C CD1   1 
ATOM   1527  C  CD2   . LEU C 3  23  ? -8.248  3.320   29.968 1.00 49.79  ? 23   LEU C CD2   1 
ATOM   1528  N  N     . GLN C 3  24  ? -3.520  2.854   29.646 1.00 65.98  ? 24   GLN C N     1 
ATOM   1529  C  CA    . GLN C 3  24  ? -2.233  2.186   29.679 1.00 65.62  ? 24   GLN C CA    1 
ATOM   1530  C  C     . GLN C 3  24  ? -2.409  0.749   29.269 1.00 65.54  ? 24   GLN C C     1 
ATOM   1531  O  O     . GLN C 3  24  ? -1.531  0.174   28.634 1.00 68.78  ? 24   GLN C O     1 
ATOM   1532  C  CB    . GLN C 3  24  ? -1.700  2.187   31.100 1.00 70.56  ? 24   GLN C CB    1 
ATOM   1533  C  CG    . GLN C 3  24  ? -1.597  3.566   31.721 1.00 67.00  ? 24   GLN C CG    1 
ATOM   1534  C  CD    . GLN C 3  24  ? -0.603  4.401   30.979 1.00 62.26  ? 24   GLN C CD    1 
ATOM   1535  O  OE1   . GLN C 3  24  ? 0.468   3.920   30.572 1.00 62.09  ? 24   GLN C OE1   1 
ATOM   1536  N  NE2   . GLN C 3  24  ? -0.959  5.645   30.754 1.00 63.17  ? 24   GLN C NE2   1 
ATOM   1537  N  N     . PHE C 3  25  ? -3.542  0.168   29.657 1.00 59.10  ? 25   PHE C N     1 
ATOM   1538  C  CA    . PHE C 3  25  ? -3.807  -1.232  29.387 1.00 63.44  ? 25   PHE C CA    1 
ATOM   1539  C  C     . PHE C 3  25  ? -4.084  -1.455  27.903 1.00 63.64  ? 25   PHE C C     1 
ATOM   1540  O  O     . PHE C 3  25  ? -4.557  -0.560  27.210 1.00 75.33  ? 25   PHE C O     1 
ATOM   1541  C  CB    . PHE C 3  25  ? -4.973  -1.731  30.245 1.00 67.84  ? 25   PHE C CB    1 
ATOM   1542  C  CG    . PHE C 3  25  ? -4.545  -2.433  31.504 1.00 63.38  ? 25   PHE C CG    1 
ATOM   1543  C  CD1   . PHE C 3  25  ? -3.719  -1.815  32.411 1.00 59.86  ? 25   PHE C CD1   1 
ATOM   1544  C  CD2   . PHE C 3  25  ? -4.973  -3.730  31.769 1.00 63.97  ? 25   PHE C CD2   1 
ATOM   1545  C  CE1   . PHE C 3  25  ? -3.330  -2.470  33.561 1.00 60.35  ? 25   PHE C CE1   1 
ATOM   1546  C  CE2   . PHE C 3  25  ? -4.595  -4.390  32.912 1.00 53.23  ? 25   PHE C CE2   1 
ATOM   1547  C  CZ    . PHE C 3  25  ? -3.778  -3.755  33.812 1.00 56.13  ? 25   PHE C CZ    1 
ATOM   1548  N  N     . PRO C 3  26  ? -3.796  -2.653  27.409 1.00 61.35  ? 26   PRO C N     1 
ATOM   1549  C  CA    . PRO C 3  26  ? -3.683  -2.862  25.976 1.00 60.62  ? 26   PRO C CA    1 
ATOM   1550  C  C     . PRO C 3  26  ? -4.984  -3.235  25.333 1.00 63.09  ? 26   PRO C C     1 
ATOM   1551  O  O     . PRO C 3  26  ? -5.428  -4.364  25.483 1.00 68.10  ? 26   PRO C O     1 
ATOM   1552  C  CB    . PRO C 3  26  ? -2.703  -4.019  25.883 1.00 60.05  ? 26   PRO C CB    1 
ATOM   1553  C  CG    . PRO C 3  26  ? -2.935  -4.795  27.123 1.00 65.03  ? 26   PRO C CG    1 
ATOM   1554  C  CD    . PRO C 3  26  ? -3.564  -3.893  28.153 1.00 67.16  ? 26   PRO C CD    1 
ATOM   1555  N  N     . VAL C 3  27  ? -5.598  -2.309  24.609 1.00 63.41  ? 27   VAL C N     1 
ATOM   1556  C  CA    . VAL C 3  27  ? -6.900  -2.594  23.996 1.00 65.79  ? 27   VAL C CA    1 
ATOM   1557  C  C     . VAL C 3  27  ? -6.844  -3.676  22.899 1.00 64.92  ? 27   VAL C C     1 
ATOM   1558  O  O     . VAL C 3  27  ? -7.694  -4.544  22.855 1.00 68.82  ? 27   VAL C O     1 
ATOM   1559  C  CB    . VAL C 3  27  ? -7.549  -1.333  23.429 1.00 63.43  ? 27   VAL C CB    1 
ATOM   1560  C  CG1   . VAL C 3  27  ? -8.936  -1.661  22.901 1.00 67.17  ? 27   VAL C CG1   1 
ATOM   1561  C  CG2   . VAL C 3  27  ? -7.644  -0.281  24.511 1.00 60.46  ? 27   VAL C CG2   1 
ATOM   1562  N  N     . GLY C 3  28  ? -5.856  -3.620  22.019 1.00 63.39  ? 28   GLY C N     1 
ATOM   1563  C  CA    . GLY C 3  28  ? -5.724  -4.629  21.002 1.00 63.97  ? 28   GLY C CA    1 
ATOM   1564  C  C     . GLY C 3  28  ? -5.664  -6.027  21.590 1.00 63.30  ? 28   GLY C C     1 
ATOM   1565  O  O     . GLY C 3  28  ? -6.358  -6.933  21.137 1.00 67.68  ? 28   GLY C O     1 
ATOM   1566  N  N     . ARG C 3  29  ? -4.808  -6.195  22.587 1.00 64.31  ? 29   ARG C N     1 
ATOM   1567  C  CA    . ARG C 3  29  ? -4.645  -7.469  23.310 1.00 63.45  ? 29   ARG C CA    1 
ATOM   1568  C  C     . ARG C 3  29  ? -5.977  -7.936  23.883 1.00 63.83  ? 29   ARG C C     1 
ATOM   1569  O  O     . ARG C 3  29  ? -6.382  -9.076  23.701 1.00 64.87  ? 29   ARG C O     1 
ATOM   1570  C  CB    . ARG C 3  29  ? -3.648  -7.283  24.462 1.00 62.32  ? 29   ARG C CB    1 
ATOM   1571  C  CG    . ARG C 3  29  ? -3.330  -8.536  25.265 1.00 63.06  ? 29   ARG C CG    1 
ATOM   1572  C  CD    . ARG C 3  29  ? -1.929  -8.991  24.953 1.00 66.27  ? 29   ARG C CD    1 
ATOM   1573  N  NE    . ARG C 3  29  ? -1.084  -8.917  26.118 1.00 67.72  ? 29   ARG C NE    1 
ATOM   1574  C  CZ    . ARG C 3  29  ? 0.252   -8.896  26.096 1.00 78.68  ? 29   ARG C CZ    1 
ATOM   1575  N  NH1   . ARG C 3  29  ? 0.946   -8.886  24.959 1.00 77.70  ? 29   ARG C NH1   1 
ATOM   1576  N  NH2   . ARG C 3  29  ? 0.904   -8.872  27.248 1.00 88.38  ? 29   ARG C NH2   1 
ATOM   1577  N  N     . VAL C 3  30  ? -6.653  -7.035  24.576 1.00 61.85  ? 30   VAL C N     1 
ATOM   1578  C  CA    . VAL C 3  30  ? -7.946  -7.334  25.137 1.00 63.39  ? 30   VAL C CA    1 
ATOM   1579  C  C     . VAL C 3  30  ? -8.961  -7.672  24.033 1.00 65.88  ? 30   VAL C C     1 
ATOM   1580  O  O     . VAL C 3  30  ? -9.776  -8.569  24.226 1.00 70.51  ? 30   VAL C O     1 
ATOM   1581  C  CB    . VAL C 3  30  ? -8.437  -6.193  26.066 1.00 61.72  ? 30   VAL C CB    1 
ATOM   1582  C  CG1   . VAL C 3  30  ? -9.869  -6.424  26.523 1.00 62.59  ? 30   VAL C CG1   1 
ATOM   1583  C  CG2   . VAL C 3  30  ? -7.549  -6.101  27.290 1.00 60.28  ? 30   VAL C CG2   1 
ATOM   1584  N  N     . HIS C 3  31  ? -8.914  -6.988  22.887 1.00 71.80  ? 31   HIS C N     1 
ATOM   1585  C  CA    . HIS C 3  31  ? -9.794  -7.352  21.757 1.00 72.56  ? 31   HIS C CA    1 
ATOM   1586  C  C     . HIS C 3  31  ? -9.505  -8.764  21.330 1.00 68.85  ? 31   HIS C C     1 
ATOM   1587  O  O     . HIS C 3  31  ? -10.421 -9.560  21.153 1.00 66.40  ? 31   HIS C O     1 
ATOM   1588  C  CB    . HIS C 3  31  ? -9.619  -6.464  20.523 1.00 75.45  ? 31   HIS C CB    1 
ATOM   1589  C  CG    . HIS C 3  31  ? -10.876 -6.319  19.716 1.00 82.27  ? 31   HIS C CG    1 
ATOM   1590  N  ND1   . HIS C 3  31  ? -11.769 -7.352  19.542 1.00 86.98  ? 31   HIS C ND1   1 
ATOM   1591  C  CD2   . HIS C 3  31  ? -11.411 -5.254  19.070 1.00 79.46  ? 31   HIS C CD2   1 
ATOM   1592  C  CE1   . HIS C 3  31  ? -12.800 -6.928  18.831 1.00 82.89  ? 31   HIS C CE1   1 
ATOM   1593  N  NE2   . HIS C 3  31  ? -12.607 -5.658  18.532 1.00 78.44  ? 31   HIS C NE2   1 
ATOM   1594  N  N     . ARG C 3  32  ? -8.221  -9.068  21.176 1.00 63.64  ? 32   ARG C N     1 
ATOM   1595  C  CA    . ARG C 3  32  ? -7.805  -10.361 20.675 1.00 64.83  ? 32   ARG C CA    1 
ATOM   1596  C  C     . ARG C 3  32  ? -8.273  -11.472 21.610 1.00 68.57  ? 32   ARG C C     1 
ATOM   1597  O  O     . ARG C 3  32  ? -8.757  -12.490 21.132 1.00 80.11  ? 32   ARG C O     1 
ATOM   1598  C  CB    . ARG C 3  32  ? -6.281  -10.395 20.481 1.00 62.32  ? 32   ARG C CB    1 
ATOM   1599  C  CG    . ARG C 3  32  ? -5.715  -11.737 20.035 1.00 66.34  ? 32   ARG C CG    1 
ATOM   1600  C  CD    . ARG C 3  32  ? -4.193  -11.787 20.196 1.00 67.86  ? 32   ARG C CD    1 
ATOM   1601  N  NE    . ARG C 3  32  ? -3.823  -12.176 21.549 1.00 72.12  ? 32   ARG C NE    1 
ATOM   1602  C  CZ    . ARG C 3  32  ? -2.769  -11.737 22.237 1.00 80.55  ? 32   ARG C CZ    1 
ATOM   1603  N  NH1   . ARG C 3  32  ? -1.911  -10.864 21.733 1.00 89.56  ? 32   ARG C NH1   1 
ATOM   1604  N  NH2   . ARG C 3  32  ? -2.589  -12.174 23.473 1.00 95.49  ? 32   ARG C NH2   1 
ATOM   1605  N  N     . LEU C 3  33  ? -8.147  -11.264 22.927 1.00 65.48  ? 33   LEU C N     1 
ATOM   1606  C  CA    . LEU C 3  33  ? -8.436  -12.304 23.905 1.00 58.78  ? 33   LEU C CA    1 
ATOM   1607  C  C     . LEU C 3  33  ? -9.926  -12.533 24.033 1.00 61.75  ? 33   LEU C C     1 
ATOM   1608  O  O     . LEU C 3  33  ? -10.341 -13.633 24.383 1.00 70.60  ? 33   LEU C O     1 
ATOM   1609  C  CB    . LEU C 3  33  ? -7.845  -11.974 25.262 1.00 57.87  ? 33   LEU C CB    1 
ATOM   1610  C  CG    . LEU C 3  33  ? -6.313  -11.935 25.387 1.00 61.19  ? 33   LEU C CG    1 
ATOM   1611  C  CD1   . LEU C 3  33  ? -5.896  -11.327 26.719 1.00 67.40  ? 33   LEU C CD1   1 
ATOM   1612  C  CD2   . LEU C 3  33  ? -5.676  -13.293 25.278 1.00 62.43  ? 33   LEU C CD2   1 
ATOM   1613  N  N     . LEU C 3  34  ? -10.733 -11.518 23.743 1.00 61.74  ? 34   LEU C N     1 
ATOM   1614  C  CA    . LEU C 3  34  ? -12.186 -11.698 23.704 1.00 65.62  ? 34   LEU C CA    1 
ATOM   1615  C  C     . LEU C 3  34  ? -12.640 -12.595 22.548 1.00 68.41  ? 34   LEU C C     1 
ATOM   1616  O  O     . LEU C 3  34  ? -13.558 -13.397 22.704 1.00 61.12  ? 34   LEU C O     1 
ATOM   1617  C  CB    . LEU C 3  34  ? -12.906 -10.358 23.575 1.00 66.92  ? 34   LEU C CB    1 
ATOM   1618  C  CG    . LEU C 3  34  ? -13.009 -9.408  24.769 1.00 70.06  ? 34   LEU C CG    1 
ATOM   1619  C  CD1   . LEU C 3  34  ? -13.585 -8.079  24.299 1.00 76.15  ? 34   LEU C CD1   1 
ATOM   1620  C  CD2   . LEU C 3  34  ? -13.875 -9.955  25.885 1.00 66.31  ? 34   LEU C CD2   1 
ATOM   1621  N  N     . ARG C 3  35  ? -12.016 -12.436 21.381 1.00 75.48  ? 35   ARG C N     1 
ATOM   1622  C  CA    . ARG C 3  35  ? -12.384 -13.230 20.207 1.00 77.38  ? 35   ARG C CA    1 
ATOM   1623  C  C     . ARG C 3  35  ? -12.086 -14.701 20.424 1.00 74.66  ? 35   ARG C C     1 
ATOM   1624  O  O     . ARG C 3  35  ? -12.975 -15.544 20.322 1.00 74.97  ? 35   ARG C O     1 
ATOM   1625  C  CB    . ARG C 3  35  ? -11.651 -12.741 18.968 1.00 83.23  ? 35   ARG C CB    1 
ATOM   1626  C  CG    . ARG C 3  35  ? -12.064 -11.338 18.550 1.00 84.62  ? 35   ARG C CG    1 
ATOM   1627  C  CD    . ARG C 3  35  ? -11.500 -10.961 17.183 1.00 81.73  ? 35   ARG C CD    1 
ATOM   1628  N  NE    . ARG C 3  35  ? -11.866 -9.598  16.790 1.00 82.09  ? 35   ARG C NE    1 
ATOM   1629  C  CZ    . ARG C 3  35  ? -13.106 -9.174  16.492 1.00 88.63  ? 35   ARG C CZ    1 
ATOM   1630  N  NH1   . ARG C 3  35  ? -14.186 -9.977  16.559 1.00 83.75  ? 35   ARG C NH1   1 
ATOM   1631  N  NH2   . ARG C 3  35  ? -13.276 -7.908  16.121 1.00 92.68  ? 35   ARG C NH2   1 
ATOM   1632  N  N     . LYS C 3  36  ? -10.838 -14.998 20.755 1.00 75.62  ? 36   LYS C N     1 
ATOM   1633  C  CA    . LYS C 3  36  ? -10.405 -16.385 20.942 1.00 88.77  ? 36   LYS C CA    1 
ATOM   1634  C  C     . LYS C 3  36  ? -10.952 -17.118 22.195 1.00 83.33  ? 36   LYS C C     1 
ATOM   1635  O  O     . LYS C 3  36  ? -10.723 -18.316 22.351 1.00 82.41  ? 36   LYS C O     1 
ATOM   1636  C  CB    . LYS C 3  36  ? -8.873  -16.467 20.933 1.00 97.07  ? 36   LYS C CB    1 
ATOM   1637  C  CG    . LYS C 3  36  ? -8.221  -15.784 22.120 1.00 108.45 ? 36   LYS C CG    1 
ATOM   1638  C  CD    . LYS C 3  36  ? -6.763  -16.169 22.275 1.00 114.64 ? 36   LYS C CD    1 
ATOM   1639  C  CE    . LYS C 3  36  ? -6.606  -17.374 23.181 1.00 118.72 ? 36   LYS C CE    1 
ATOM   1640  N  NZ    . LYS C 3  36  ? -5.163  -17.650 23.407 1.00 128.66 ? 36   LYS C NZ    1 
ATOM   1641  N  N     . GLY C 3  37  ? -11.646 -16.415 23.082 1.00 76.58  ? 37   GLY C N     1 
ATOM   1642  C  CA    . GLY C 3  37  ? -12.230 -17.037 24.262 1.00 70.40  ? 37   GLY C CA    1 
ATOM   1643  C  C     . GLY C 3  37  ? -13.649 -17.497 24.027 1.00 77.59  ? 37   GLY C C     1 
ATOM   1644  O  O     . GLY C 3  37  ? -14.255 -18.097 24.922 1.00 87.48  ? 37   GLY C O     1 
ATOM   1645  N  N     . ASN C 3  38  ? -14.181 -17.229 22.831 1.00 73.98  ? 38   ASN C N     1 
ATOM   1646  C  CA    . ASN C 3  38  ? -15.522 -17.679 22.447 1.00 76.44  ? 38   ASN C CA    1 
ATOM   1647  C  C     . ASN C 3  38  ? -16.596 -17.277 23.432 1.00 70.48  ? 38   ASN C C     1 
ATOM   1648  O  O     . ASN C 3  38  ? -17.304 -18.117 23.981 1.00 73.64  ? 38   ASN C O     1 
ATOM   1649  C  CB    . ASN C 3  38  ? -15.557 -19.199 22.254 1.00 88.11  ? 38   ASN C CB    1 
ATOM   1650  C  CG    . ASN C 3  38  ? -14.982 -19.625 20.926 1.00 99.40  ? 38   ASN C CG    1 
ATOM   1651  O  OD1   . ASN C 3  38  ? -14.096 -20.496 20.858 1.00 99.26  ? 38   ASN C OD1   1 
ATOM   1652  N  ND2   . ASN C 3  38  ? -15.485 -19.015 19.850 1.00 103.50 ? 38   ASN C ND2   1 
ATOM   1653  N  N     . TYR C 3  39  ? -16.726 -15.983 23.665 1.00 66.01  ? 39   TYR C N     1 
ATOM   1654  C  CA    . TYR C 3  39  ? -17.781 -15.504 24.544 1.00 62.85  ? 39   TYR C CA    1 
ATOM   1655  C  C     . TYR C 3  39  ? -19.067 -15.218 23.744 1.00 60.96  ? 39   TYR C C     1 
ATOM   1656  O  O     . TYR C 3  39  ? -20.162 -15.316 24.281 1.00 56.56  ? 39   TYR C O     1 
ATOM   1657  C  CB    . TYR C 3  39  ? -17.266 -14.303 25.344 1.00 61.37  ? 39   TYR C CB    1 
ATOM   1658  C  CG    . TYR C 3  39  ? -16.009 -14.614 26.173 1.00 56.13  ? 39   TYR C CG    1 
ATOM   1659  C  CD1   . TYR C 3  39  ? -14.747 -14.270 25.707 1.00 54.53  ? 39   TYR C CD1   1 
ATOM   1660  C  CD2   . TYR C 3  39  ? -16.088 -15.253 27.408 1.00 53.99  ? 39   TYR C CD2   1 
ATOM   1661  C  CE1   . TYR C 3  39  ? -13.591 -14.542 26.424 1.00 52.85  ? 39   TYR C CE1   1 
ATOM   1662  C  CE2   . TYR C 3  39  ? -14.934 -15.533 28.141 1.00 55.27  ? 39   TYR C CE2   1 
ATOM   1663  C  CZ    . TYR C 3  39  ? -13.685 -15.175 27.638 1.00 58.81  ? 39   TYR C CZ    1 
ATOM   1664  O  OH    . TYR C 3  39  ? -12.518 -15.440 28.343 1.00 60.86  ? 39   TYR C OH    1 
ATOM   1665  N  N     . ALA C 3  40  ? -18.920 -14.937 22.448 1.00 64.27  ? 40   ALA C N     1 
ATOM   1666  C  CA    . ALA C 3  40  ? -20.041 -14.594 21.558 1.00 66.22  ? 40   ALA C CA    1 
ATOM   1667  C  C     . ALA C 3  40  ? -19.609 -14.592 20.087 1.00 63.95  ? 40   ALA C C     1 
ATOM   1668  O  O     . ALA C 3  40  ? -18.409 -14.548 19.795 1.00 64.21  ? 40   ALA C O     1 
ATOM   1669  C  CB    . ALA C 3  40  ? -20.589 -13.230 21.944 1.00 66.98  ? 40   ALA C CB    1 
ATOM   1670  N  N     . GLU C 3  41  ? -20.557 -14.661 19.153 1.00 67.24  ? 41   GLU C N     1 
ATOM   1671  C  CA    . GLU C 3  41  ? -20.170 -14.605 17.724 1.00 75.51  ? 41   GLU C CA    1 
ATOM   1672  C  C     . GLU C 3  41  ? -19.296 -13.374 17.497 1.00 73.09  ? 41   GLU C C     1 
ATOM   1673  O  O     . GLU C 3  41  ? -18.172 -13.480 17.014 1.00 64.33  ? 41   GLU C O     1 
ATOM   1674  C  CB    . GLU C 3  41  ? -21.381 -14.507 16.759 1.00 81.91  ? 41   GLU C CB    1 
ATOM   1675  C  CG    . GLU C 3  41  ? -22.292 -15.721 16.643 1.00 86.66  ? 41   GLU C CG    1 
ATOM   1676  C  CD    . GLU C 3  41  ? -21.526 -17.027 16.620 1.00 97.16  ? 41   GLU C CD    1 
ATOM   1677  O  OE1   . GLU C 3  41  ? -20.668 -17.223 15.721 1.00 101.39 ? 41   GLU C OE1   1 
ATOM   1678  O  OE2   . GLU C 3  41  ? -21.780 -17.854 17.519 1.00 94.84  ? 41   GLU C OE2   1 
ATOM   1679  N  N     . ARG C 3  42  ? -19.829 -12.216 17.881 1.00 69.93  ? 42   ARG C N     1 
ATOM   1680  C  CA    . ARG C 3  42  ? -19.249 -10.940 17.520 1.00 76.48  ? 42   ARG C CA    1 
ATOM   1681  C  C     . ARG C 3  42  ? -18.795 -10.159 18.729 1.00 77.96  ? 42   ARG C C     1 
ATOM   1682  O  O     . ARG C 3  42  ? -19.429 -10.213 19.773 1.00 77.83  ? 42   ARG C O     1 
ATOM   1683  C  CB    . ARG C 3  42  ? -20.294 -10.093 16.807 1.00 84.12  ? 42   ARG C CB    1 
ATOM   1684  C  CG    . ARG C 3  42  ? -20.846 -10.713 15.540 1.00 84.65  ? 42   ARG C CG    1 
ATOM   1685  C  CD    . ARG C 3  42  ? -21.752 -9.747  14.795 1.00 85.65  ? 42   ARG C CD    1 
ATOM   1686  N  NE    . ARG C 3  42  ? -21.760 -10.124 13.392 1.00 89.51  ? 42   ARG C NE    1 
ATOM   1687  C  CZ    . ARG C 3  42  ? -21.960 -9.297  12.381 1.00 90.84  ? 42   ARG C CZ    1 
ATOM   1688  N  NH1   . ARG C 3  42  ? -22.190 -8.000  12.600 1.00 94.00  ? 42   ARG C NH1   1 
ATOM   1689  N  NH2   . ARG C 3  42  ? -21.930 -9.785  11.143 1.00 89.11  ? 42   ARG C NH2   1 
ATOM   1690  N  N     . VAL C 3  43  ? -17.732 -9.380  18.550 1.00 74.48  ? 43   VAL C N     1 
ATOM   1691  C  CA    . VAL C 3  43  ? -17.238 -8.497  19.585 1.00 76.68  ? 43   VAL C CA    1 
ATOM   1692  C  C     . VAL C 3  43  ? -17.177 -7.047  19.139 1.00 74.98  ? 43   VAL C C     1 
ATOM   1693  O  O     . VAL C 3  43  ? -16.303 -6.660  18.368 1.00 82.15  ? 43   VAL C O     1 
ATOM   1694  C  CB    . VAL C 3  43  ? -15.839 -8.919  20.014 1.00 75.51  ? 43   VAL C CB    1 
ATOM   1695  C  CG1   . VAL C 3  43  ? -15.289 -7.965  21.072 1.00 72.01  ? 43   VAL C CG1   1 
ATOM   1696  C  CG2   . VAL C 3  43  ? -15.903 -10.340 20.534 1.00 77.40  ? 43   VAL C CG2   1 
ATOM   1697  N  N     . GLY C 3  44  ? -18.088 -6.242  19.661 1.00 69.23  ? 44   GLY C N     1 
ATOM   1698  C  CA    . GLY C 3  44  ? -18.093 -4.816  19.387 1.00 73.33  ? 44   GLY C CA    1 
ATOM   1699  C  C     . GLY C 3  44  ? -16.799 -4.071  19.709 1.00 70.19  ? 44   GLY C C     1 
ATOM   1700  O  O     . GLY C 3  44  ? -15.946 -4.532  20.471 1.00 68.24  ? 44   GLY C O     1 
ATOM   1701  N  N     . ALA C 3  45  ? -16.692 -2.884  19.134 1.00 70.12  ? 45   ALA C N     1 
ATOM   1702  C  CA    . ALA C 3  45  ? -15.479 -2.081  19.185 1.00 69.62  ? 45   ALA C CA    1 
ATOM   1703  C  C     . ALA C 3  45  ? -15.263 -1.387  20.527 1.00 67.67  ? 45   ALA C C     1 
ATOM   1704  O  O     . ALA C 3  45  ? -14.140 -1.109  20.908 1.00 72.51  ? 45   ALA C O     1 
ATOM   1705  C  CB    . ALA C 3  45  ? -15.525 -1.043  18.073 1.00 71.38  ? 45   ALA C CB    1 
ATOM   1706  N  N     . GLY C 3  46  ? -16.338 -1.066  21.221 1.00 65.95  ? 46   GLY C N     1 
ATOM   1707  C  CA    . GLY C 3  46  ? -16.220 -0.440  22.516 1.00 70.50  ? 46   GLY C CA    1 
ATOM   1708  C  C     . GLY C 3  46  ? -15.993 -1.412  23.660 1.00 70.22  ? 46   GLY C C     1 
ATOM   1709  O  O     . GLY C 3  46  ? -15.621 -0.988  24.756 1.00 72.86  ? 46   GLY C O     1 
ATOM   1710  N  N     . ALA C 3  47  ? -16.233 -2.702  23.427 1.00 68.41  ? 47   ALA C N     1 
ATOM   1711  C  CA    . ALA C 3  47  ? -16.131 -3.699  24.494 1.00 68.47  ? 47   ALA C CA    1 
ATOM   1712  C  C     . ALA C 3  47  ? -14.707 -3.842  25.043 1.00 60.48  ? 47   ALA C C     1 
ATOM   1713  O  O     . ALA C 3  47  ? -14.510 -3.681  26.238 1.00 58.15  ? 47   ALA C O     1 
ATOM   1714  C  CB    . ALA C 3  47  ? -16.680 -5.045  24.045 1.00 69.55  ? 47   ALA C CB    1 
ATOM   1715  N  N     . PRO C 3  48  ? -13.714 -4.098  24.182 1.00 58.61  ? 48   PRO C N     1 
ATOM   1716  C  CA    . PRO C 3  48  ? -12.342 -4.200  24.715 1.00 61.26  ? 48   PRO C CA    1 
ATOM   1717  C  C     . PRO C 3  48  ? -11.849 -2.901  25.329 1.00 61.03  ? 48   PRO C C     1 
ATOM   1718  O  O     . PRO C 3  48  ? -11.004 -2.930  26.215 1.00 68.36  ? 48   PRO C O     1 
ATOM   1719  C  CB    . PRO C 3  48  ? -11.483 -4.567  23.481 1.00 62.27  ? 48   PRO C CB    1 
ATOM   1720  C  CG    . PRO C 3  48  ? -12.272 -4.078  22.319 1.00 63.24  ? 48   PRO C CG    1 
ATOM   1721  C  CD    . PRO C 3  48  ? -13.738 -4.151  22.709 1.00 63.17  ? 48   PRO C CD    1 
ATOM   1722  N  N     . VAL C 3  49  ? -12.365 -1.775  24.850 1.00 62.26  ? 49   VAL C N     1 
ATOM   1723  C  CA    . VAL C 3  49  ? -12.062 -0.472  25.430 1.00 60.30  ? 49   VAL C CA    1 
ATOM   1724  C  C     . VAL C 3  49  ? -12.598 -0.365  26.848 1.00 56.49  ? 49   VAL C C     1 
ATOM   1725  O  O     . VAL C 3  49  ? -11.859 -0.013  27.778 1.00 59.03  ? 49   VAL C O     1 
ATOM   1726  C  CB    . VAL C 3  49  ? -12.616 0.661   24.531 1.00 62.37  ? 49   VAL C CB    1 
ATOM   1727  C  CG1   . VAL C 3  49  ? -12.681 2.004   25.259 1.00 64.75  ? 49   VAL C CG1   1 
ATOM   1728  C  CG2   . VAL C 3  49  ? -11.729 0.780   23.304 1.00 63.68  ? 49   VAL C CG2   1 
ATOM   1729  N  N     . TYR C 3  50  ? -13.877 -0.672  27.018 1.00 52.95  ? 50   TYR C N     1 
ATOM   1730  C  CA    . TYR C 3  50  ? -14.517 -0.553  28.324 1.00 53.77  ? 50   TYR C CA    1 
ATOM   1731  C  C     . TYR C 3  50  ? -13.907 -1.544  29.297 1.00 58.71  ? 50   TYR C C     1 
ATOM   1732  O  O     . TYR C 3  50  ? -13.669 -1.212  30.453 1.00 65.52  ? 50   TYR C O     1 
ATOM   1733  C  CB    . TYR C 3  50  ? -15.987 -0.839  28.183 1.00 54.30  ? 50   TYR C CB    1 
ATOM   1734  C  CG    . TYR C 3  50  ? -16.890 -0.432  29.325 1.00 56.09  ? 50   TYR C CG    1 
ATOM   1735  C  CD1   . TYR C 3  50  ? -17.939 0.448   29.105 1.00 57.11  ? 50   TYR C CD1   1 
ATOM   1736  C  CD2   . TYR C 3  50  ? -16.755 -0.963  30.593 1.00 57.80  ? 50   TYR C CD2   1 
ATOM   1737  C  CE1   . TYR C 3  50  ? -18.804 0.816   30.114 1.00 55.79  ? 50   TYR C CE1   1 
ATOM   1738  C  CE2   . TYR C 3  50  ? -17.627 -0.603  31.605 1.00 58.58  ? 50   TYR C CE2   1 
ATOM   1739  C  CZ    . TYR C 3  50  ? -18.657 0.289   31.358 1.00 57.24  ? 50   TYR C CZ    1 
ATOM   1740  O  OH    . TYR C 3  50  ? -19.550 0.676   32.355 1.00 55.46  ? 50   TYR C OH    1 
ATOM   1741  N  N     . LEU C 3  51  ? -13.665 -2.763  28.829 1.00 56.01  ? 51   LEU C N     1 
ATOM   1742  C  CA    . LEU C 3  51  ? -13.106 -3.801  29.678 1.00 55.14  ? 51   LEU C CA    1 
ATOM   1743  C  C     . LEU C 3  51  ? -11.655 -3.473  30.072 1.00 57.52  ? 51   LEU C C     1 
ATOM   1744  O  O     . LEU C 3  51  ? -11.236 -3.655  31.229 1.00 55.37  ? 51   LEU C O     1 
ATOM   1745  C  CB    . LEU C 3  51  ? -13.189 -5.175  28.982 1.00 56.07  ? 51   LEU C CB    1 
ATOM   1746  C  CG    . LEU C 3  51  ? -12.576 -6.405  29.691 1.00 53.62  ? 51   LEU C CG    1 
ATOM   1747  C  CD1   . LEU C 3  51  ? -13.061 -6.586  31.117 1.00 53.27  ? 51   LEU C CD1   1 
ATOM   1748  C  CD2   . LEU C 3  51  ? -12.908 -7.628  28.879 1.00 55.47  ? 51   LEU C CD2   1 
ATOM   1749  N  N     . ALA C 3  52  ? -10.876 -3.005  29.115 1.00 53.39  ? 52   ALA C N     1 
ATOM   1750  C  CA    . ALA C 3  52  ? -9.489  -2.707  29.401 1.00 53.72  ? 52   ALA C CA    1 
ATOM   1751  C  C     . ALA C 3  52  ? -9.390  -1.620  30.464 1.00 54.78  ? 52   ALA C C     1 
ATOM   1752  O  O     . ALA C 3  52  ? -8.446  -1.605  31.270 1.00 60.76  ? 52   ALA C O     1 
ATOM   1753  C  CB    . ALA C 3  52  ? -8.781  -2.281  28.133 1.00 53.53  ? 52   ALA C CB    1 
ATOM   1754  N  N     . ALA C 3  53  ? -10.366 -0.721  30.472 1.00 50.29  ? 53   ALA C N     1 
ATOM   1755  C  CA    . ALA C 3  53  ? -10.397 0.346   31.451 1.00 53.69  ? 53   ALA C CA    1 
ATOM   1756  C  C     . ALA C 3  53  ? -10.763 -0.134  32.863 1.00 54.41  ? 53   ALA C C     1 
ATOM   1757  O  O     . ALA C 3  53  ? -10.228 0.338   33.872 1.00 55.21  ? 53   ALA C O     1 
ATOM   1758  C  CB    . ALA C 3  53  ? -11.391 1.400   31.001 1.00 55.17  ? 53   ALA C CB    1 
ATOM   1759  N  N     . VAL C 3  54  ? -11.732 -1.034  32.923 1.00 51.69  ? 54   VAL C N     1 
ATOM   1760  C  CA    . VAL C 3  54  ? -12.132 -1.635  34.177 1.00 51.32  ? 54   VAL C CA    1 
ATOM   1761  C  C     . VAL C 3  54  ? -10.946 -2.387  34.781 1.00 47.53  ? 54   VAL C C     1 
ATOM   1762  O  O     . VAL C 3  54  ? -10.600 -2.213  35.963 1.00 43.16  ? 54   VAL C O     1 
ATOM   1763  C  CB    . VAL C 3  54  ? -13.370 -2.528  33.970 1.00 50.36  ? 54   VAL C CB    1 
ATOM   1764  C  CG1   . VAL C 3  54  ? -13.613 -3.464  35.155 1.00 47.27  ? 54   VAL C CG1   1 
ATOM   1765  C  CG2   . VAL C 3  54  ? -14.574 -1.632  33.735 1.00 50.99  ? 54   VAL C CG2   1 
ATOM   1766  N  N     . LEU C 3  55  ? -10.288 -3.167  33.939 1.00 50.18  ? 55   LEU C N     1 
ATOM   1767  C  CA    . LEU C 3  55  ? -9.088  -3.890  34.348 1.00 52.57  ? 55   LEU C CA    1 
ATOM   1768  C  C     . LEU C 3  55  ? -8.075  -2.941  34.895 1.00 52.38  ? 55   LEU C C     1 
ATOM   1769  O  O     . LEU C 3  55  ? -7.565  -3.177  35.976 1.00 57.22  ? 55   LEU C O     1 
ATOM   1770  C  CB    . LEU C 3  55  ? -8.509  -4.715  33.209 1.00 53.96  ? 55   LEU C CB    1 
ATOM   1771  C  CG    . LEU C 3  55  ? -9.469  -5.873  32.829 1.00 57.82  ? 55   LEU C CG    1 
ATOM   1772  C  CD1   . LEU C 3  55  ? -8.944  -6.641  31.629 1.00 61.36  ? 55   LEU C CD1   1 
ATOM   1773  C  CD2   . LEU C 3  55  ? -9.751  -6.833  33.975 1.00 52.33  ? 55   LEU C CD2   1 
ATOM   1774  N  N     . GLU C 3  56  ? -7.854  -1.825  34.214 1.00 53.38  ? 56   GLU C N     1 
ATOM   1775  C  CA    . GLU C 3  56  ? -6.870  -0.832  34.679 1.00 52.27  ? 56   GLU C CA    1 
ATOM   1776  C  C     . GLU C 3  56  ? -7.300  -0.153  35.979 1.00 48.14  ? 56   GLU C C     1 
ATOM   1777  O  O     . GLU C 3  56  ? -6.473  0.114   36.880 1.00 45.12  ? 56   GLU C O     1 
ATOM   1778  C  CB    . GLU C 3  56  ? -6.660  0.201   33.589 1.00 55.96  ? 56   GLU C CB    1 
ATOM   1779  C  CG    . GLU C 3  56  ? -5.420  1.071   33.706 1.00 55.50  ? 56   GLU C CG    1 
ATOM   1780  C  CD    . GLU C 3  56  ? -5.371  2.046   32.538 1.00 57.68  ? 56   GLU C CD    1 
ATOM   1781  O  OE1   . GLU C 3  56  ? -5.321  1.588   31.365 1.00 57.29  ? 56   GLU C OE1   1 
ATOM   1782  O  OE2   . GLU C 3  56  ? -5.420  3.265   32.775 1.00 62.10  ? 56   GLU C OE2   1 
ATOM   1783  N  N     . TYR C 3  57  ? -8.598  0.120   36.073 1.00 46.45  ? 57   TYR C N     1 
ATOM   1784  C  CA    . TYR C 3  57  ? -9.143  0.745   37.255 1.00 49.38  ? 57   TYR C CA    1 
ATOM   1785  C  C     . TYR C 3  57  ? -8.891  -0.161  38.479 1.00 58.05  ? 57   TYR C C     1 
ATOM   1786  O  O     . TYR C 3  57  ? -8.298  0.275   39.461 1.00 58.90  ? 57   TYR C O     1 
ATOM   1787  C  CB    . TYR C 3  57  ? -10.646 1.033   37.094 1.00 49.92  ? 57   TYR C CB    1 
ATOM   1788  C  CG    . TYR C 3  57  ? -11.261 1.347   38.438 1.00 54.84  ? 57   TYR C CG    1 
ATOM   1789  C  CD1   . TYR C 3  57  ? -10.867 2.465   39.151 1.00 59.24  ? 57   TYR C CD1   1 
ATOM   1790  C  CD2   . TYR C 3  57  ? -12.150 0.473   39.036 1.00 57.78  ? 57   TYR C CD2   1 
ATOM   1791  C  CE1   . TYR C 3  57  ? -11.371 2.724   40.409 1.00 65.10  ? 57   TYR C CE1   1 
ATOM   1792  C  CE2   . TYR C 3  57  ? -12.666 0.721   40.289 1.00 59.98  ? 57   TYR C CE2   1 
ATOM   1793  C  CZ    . TYR C 3  57  ? -12.270 1.847   40.975 1.00 65.71  ? 57   TYR C CZ    1 
ATOM   1794  O  OH    . TYR C 3  57  ? -12.781 2.103   42.228 1.00 70.88  ? 57   TYR C OH    1 
ATOM   1795  N  N     . LEU C 3  58  ? -9.318  -1.427  38.397 1.00 58.51  ? 58   LEU C N     1 
ATOM   1796  C  CA    . LEU C 3  58  ? -9.097  -2.394  39.483 1.00 54.50  ? 58   LEU C CA    1 
ATOM   1797  C  C     . LEU C 3  58  ? -7.619  -2.619  39.839 1.00 52.19  ? 58   LEU C C     1 
ATOM   1798  O  O     . LEU C 3  58  ? -7.256  -2.681  41.036 1.00 50.14  ? 58   LEU C O     1 
ATOM   1799  C  CB    . LEU C 3  58  ? -9.737  -3.734  39.146 1.00 52.68  ? 58   LEU C CB    1 
ATOM   1800  C  CG    . LEU C 3  58  ? -11.261 -3.699  39.139 1.00 55.15  ? 58   LEU C CG    1 
ATOM   1801  C  CD1   . LEU C 3  58  ? -11.848 -5.003  38.601 1.00 53.97  ? 58   LEU C CD1   1 
ATOM   1802  C  CD2   . LEU C 3  58  ? -11.810 -3.393  40.519 1.00 58.99  ? 58   LEU C CD2   1 
ATOM   1803  N  N     . THR C 3  59  ? -6.749  -2.726  38.840 1.00 48.65  ? 59   THR C N     1 
ATOM   1804  C  CA    . THR C 3  59  ? -5.368  -2.990  39.201 1.00 48.05  ? 59   THR C CA    1 
ATOM   1805  C  C     . THR C 3  59  ? -4.756  -1.760  39.834 1.00 48.66  ? 59   THR C C     1 
ATOM   1806  O  O     . THR C 3  59  ? -3.851  -1.882  40.673 1.00 49.89  ? 59   THR C O     1 
ATOM   1807  C  CB    . THR C 3  59  ? -4.460  -3.573  38.101 1.00 50.42  ? 59   THR C CB    1 
ATOM   1808  O  OG1   . THR C 3  59  ? -3.389  -2.669  37.820 1.00 53.87  ? 59   THR C OG1   1 
ATOM   1809  C  CG2   . THR C 3  59  ? -5.214  -3.973  36.850 1.00 48.35  ? 59   THR C CG2   1 
ATOM   1810  N  N     . ALA C 3  60  ? -5.267  -0.579  39.501 1.00 46.62  ? 60   ALA C N     1 
ATOM   1811  C  CA    . ALA C 3  60  ? -4.713  0.633   40.108 1.00 48.57  ? 60   ALA C CA    1 
ATOM   1812  C  C     . ALA C 3  60  ? -5.098  0.744   41.592 1.00 49.83  ? 60   ALA C C     1 
ATOM   1813  O  O     . ALA C 3  60  ? -4.286  1.072   42.479 1.00 48.06  ? 60   ALA C O     1 
ATOM   1814  C  CB    . ALA C 3  60  ? -5.169  1.848   39.333 1.00 50.70  ? 60   ALA C CB    1 
ATOM   1815  N  N     . GLU C 3  61  ? -6.349  0.404   41.843 1.00 50.89  ? 61   GLU C N     1 
ATOM   1816  C  CA    . GLU C 3  61  ? -6.928  0.405   43.171 1.00 48.38  ? 61   GLU C CA    1 
ATOM   1817  C  C     . GLU C 3  61  ? -6.155  -0.561  44.068 1.00 47.77  ? 61   GLU C C     1 
ATOM   1818  O  O     . GLU C 3  61  ? -5.857  -0.259  45.226 1.00 43.86  ? 61   GLU C O     1 
ATOM   1819  C  CB    . GLU C 3  61  ? -8.405  0.008   43.032 1.00 47.19  ? 61   GLU C CB    1 
ATOM   1820  C  CG    . GLU C 3  61  ? -9.222  0.071   44.296 1.00 56.08  ? 61   GLU C CG    1 
ATOM   1821  C  CD    . GLU C 3  61  ? -9.552  1.477   44.759 1.00 67.90  ? 61   GLU C CD    1 
ATOM   1822  O  OE1   . GLU C 3  61  ? -9.748  2.410   43.909 1.00 66.85  ? 61   GLU C OE1   1 
ATOM   1823  O  OE2   . GLU C 3  61  ? -9.646  1.612   46.005 1.00 75.58  ? 61   GLU C OE2   1 
ATOM   1824  N  N     . ILE C 3  62  ? -5.825  -1.734  43.544 1.00 48.50  ? 62   ILE C N     1 
ATOM   1825  C  CA    . ILE C 3  62  ? -5.123  -2.697  44.392 1.00 53.21  ? 62   ILE C CA    1 
ATOM   1826  C  C     . ILE C 3  62  ? -3.653  -2.295  44.629 1.00 46.60  ? 62   ILE C C     1 
ATOM   1827  O  O     . ILE C 3  62  ? -3.124  -2.411  45.756 1.00 45.44  ? 62   ILE C O     1 
ATOM   1828  C  CB    . ILE C 3  62  ? -5.301  -4.150  43.915 1.00 52.63  ? 62   ILE C CB    1 
ATOM   1829  C  CG1   . ILE C 3  62  ? -4.515  -5.091  44.775 1.00 58.06  ? 62   ILE C CG1   1 
ATOM   1830  C  CG2   . ILE C 3  62  ? -4.759  -4.345  42.534 1.00 61.06  ? 62   ILE C CG2   1 
ATOM   1831  C  CD1   . ILE C 3  62  ? -5.080  -6.489  44.678 1.00 73.71  ? 62   ILE C CD1   1 
ATOM   1832  N  N     . LEU C 3  63  ? -3.003  -1.783  43.600 1.00 45.63  ? 63   LEU C N     1 
ATOM   1833  C  CA    . LEU C 3  63  ? -1.617  -1.307  43.785 1.00 50.01  ? 63   LEU C CA    1 
ATOM   1834  C  C     . LEU C 3  63  ? -1.545  -0.094  44.709 1.00 49.73  ? 63   LEU C C     1 
ATOM   1835  O  O     . LEU C 3  63  ? -0.595  0.035   45.477 1.00 48.17  ? 63   LEU C O     1 
ATOM   1836  C  CB    . LEU C 3  63  ? -0.946  -0.997  42.458 1.00 47.70  ? 63   LEU C CB    1 
ATOM   1837  C  CG    . LEU C 3  63  ? -0.813  -2.226  41.560 1.00 50.18  ? 63   LEU C CG    1 
ATOM   1838  C  CD1   . LEU C 3  63  ? -0.409  -1.800  40.178 1.00 53.31  ? 63   LEU C CD1   1 
ATOM   1839  C  CD2   . LEU C 3  63  ? 0.175   -3.216  42.128 1.00 51.86  ? 63   LEU C CD2   1 
ATOM   1840  N  N     . GLU C 3  64  ? -2.552  0.773   44.686 1.00 47.56  ? 64   GLU C N     1 
ATOM   1841  C  CA    . GLU C 3  64  ? -2.499  1.927   45.561 1.00 50.21  ? 64   GLU C CA    1 
ATOM   1842  C  C     . GLU C 3  64  ? -2.431  1.424   46.973 1.00 50.17  ? 64   GLU C C     1 
ATOM   1843  O  O     . GLU C 3  64  ? -1.535  1.787   47.732 1.00 49.79  ? 64   GLU C O     1 
ATOM   1844  C  CB    . GLU C 3  64  ? -3.712  2.832   45.364 1.00 52.32  ? 64   GLU C CB    1 
ATOM   1845  C  CG    . GLU C 3  64  ? -3.773  4.063   46.269 1.00 55.06  ? 64   GLU C CG    1 
ATOM   1846  C  CD    . GLU C 3  64  ? -2.683  5.104   46.021 1.00 55.88  ? 64   GLU C CD    1 
ATOM   1847  O  OE1   . GLU C 3  64  ? -2.386  5.902   46.931 1.00 63.58  ? 64   GLU C OE1   1 
ATOM   1848  O  OE2   . GLU C 3  64  ? -2.138  5.143   44.923 1.00 60.93  ? 64   GLU C OE2   1 
ATOM   1849  N  N     . LEU C 3  65  ? -3.374  0.551   47.313 1.00 59.80  ? 65   LEU C N     1 
ATOM   1850  C  CA    . LEU C 3  65  ? -3.498  -0.007  48.686 1.00 57.96  ? 65   LEU C CA    1 
ATOM   1851  C  C     . LEU C 3  65  ? -2.348  -0.936  49.102 1.00 56.87  ? 65   LEU C C     1 
ATOM   1852  O  O     . LEU C 3  65  ? -1.951  -0.945  50.277 1.00 56.35  ? 65   LEU C O     1 
ATOM   1853  C  CB    . LEU C 3  65  ? -4.802  -0.778  48.818 1.00 53.66  ? 65   LEU C CB    1 
ATOM   1854  C  CG    . LEU C 3  65  ? -6.090  0.029   48.723 1.00 51.89  ? 65   LEU C CG    1 
ATOM   1855  C  CD1   . LEU C 3  65  ? -7.272  -0.933  48.703 1.00 51.08  ? 65   LEU C CD1   1 
ATOM   1856  C  CD2   . LEU C 3  65  ? -6.212  0.975   49.896 1.00 48.41  ? 65   LEU C CD2   1 
ATOM   1857  N  N     . ALA C 3  66  ? -1.859  -1.729  48.149 1.00 51.90  ? 66   ALA C N     1 
ATOM   1858  C  CA    . ALA C 3  66  ? -0.693  -2.591  48.363 1.00 54.27  ? 66   ALA C CA    1 
ATOM   1859  C  C     . ALA C 3  66  ? 0.603   -1.783  48.578 1.00 54.18  ? 66   ALA C C     1 
ATOM   1860  O  O     . ALA C 3  66  ? 1.429   -2.081  49.458 1.00 47.71  ? 66   ALA C O     1 
ATOM   1861  C  CB    . ALA C 3  66  ? -0.539  -3.518  47.171 1.00 52.19  ? 66   ALA C CB    1 
ATOM   1862  N  N     . GLY C 3  67  ? 0.771   -0.745  47.767 1.00 54.94  ? 67   GLY C N     1 
ATOM   1863  C  CA    . GLY C 3  67  ? 1.859   0.186   47.975 1.00 55.87  ? 67   GLY C CA    1 
ATOM   1864  C  C     . GLY C 3  67  ? 1.828   0.735   49.393 1.00 53.42  ? 67   GLY C C     1 
ATOM   1865  O  O     . GLY C 3  67  ? 2.867   0.884   50.026 1.00 52.74  ? 67   GLY C O     1 
ATOM   1866  N  N     . ASN C 3  68  ? 0.647   1.031   49.916 1.00 50.59  ? 68   ASN C N     1 
ATOM   1867  C  CA    . ASN C 3  68  ? 0.606   1.597   51.256 1.00 53.23  ? 68   ASN C CA    1 
ATOM   1868  C  C     . ASN C 3  68  ? 1.041   0.592   52.295 1.00 53.24  ? 68   ASN C C     1 
ATOM   1869  O  O     . ASN C 3  68  ? 1.630   0.952   53.309 1.00 56.41  ? 68   ASN C O     1 
ATOM   1870  C  CB    . ASN C 3  68  ? -0.775  2.113   51.595 1.00 53.75  ? 68   ASN C CB    1 
ATOM   1871  C  CG    . ASN C 3  68  ? -1.217  3.252   50.692 1.00 57.80  ? 68   ASN C CG    1 
ATOM   1872  O  OD1   . ASN C 3  68  ? -0.403  3.931   50.053 1.00 53.17  ? 68   ASN C OD1   1 
ATOM   1873  N  ND2   . ASN C 3  68  ? -2.528  3.465   50.638 1.00 58.60  ? 68   ASN C ND2   1 
ATOM   1874  N  N     . ALA C 3  69  ? 0.770   -0.680  52.040 1.00 51.94  ? 69   ALA C N     1 
ATOM   1875  C  CA    . ALA C 3  69  ? 1.109   -1.683  53.008 1.00 52.70  ? 69   ALA C CA    1 
ATOM   1876  C  C     . ALA C 3  69  ? 2.592   -1.897  52.950 1.00 53.17  ? 69   ALA C C     1 
ATOM   1877  O  O     . ALA C 3  69  ? 3.224   -2.052  53.986 1.00 54.28  ? 69   ALA C O     1 
ATOM   1878  C  CB    . ALA C 3  69  ? 0.372   -2.967  52.750 1.00 56.39  ? 69   ALA C CB    1 
ATOM   1879  N  N     . ALA C 3  70  ? 3.154   -1.880  51.744 1.00 57.29  ? 70   ALA C N     1 
ATOM   1880  C  CA    . ALA C 3  70  ? 4.612   -1.876  51.608 1.00 59.43  ? 70   ALA C CA    1 
ATOM   1881  C  C     . ALA C 3  70  ? 5.240   -0.744  52.431 1.00 58.65  ? 70   ALA C C     1 
ATOM   1882  O  O     . ALA C 3  70  ? 6.215   -0.958  53.126 1.00 62.44  ? 70   ALA C O     1 
ATOM   1883  C  CB    . ALA C 3  70  ? 5.015   -1.747  50.159 1.00 56.43  ? 70   ALA C CB    1 
ATOM   1884  N  N     . ARG C 3  71  ? 4.662   0.450   52.384 1.00 59.09  ? 71   ARG C N     1 
ATOM   1885  C  CA    . ARG C 3  71  ? 5.275   1.591   53.052 1.00 57.17  ? 71   ARG C CA    1 
ATOM   1886  C  C     . ARG C 3  71  ? 5.069   1.502   54.534 1.00 53.77  ? 71   ARG C C     1 
ATOM   1887  O  O     . ARG C 3  71  ? 5.949   1.840   55.292 1.00 57.61  ? 71   ARG C O     1 
ATOM   1888  C  CB    . ARG C 3  71  ? 4.749   2.917   52.508 1.00 61.68  ? 71   ARG C CB    1 
ATOM   1889  C  CG    . ARG C 3  71  ? 4.936   4.068   53.470 1.00 70.16  ? 71   ARG C CG    1 
ATOM   1890  C  CD    . ARG C 3  71  ? 4.495   5.390   52.913 1.00 78.70  ? 71   ARG C CD    1 
ATOM   1891  N  NE    . ARG C 3  71  ? 5.467   5.903   51.950 1.00 97.20  ? 71   ARG C NE    1 
ATOM   1892  C  CZ    . ARG C 3  71  ? 5.529   7.168   51.530 1.00 111.07 ? 71   ARG C CZ    1 
ATOM   1893  N  NH1   . ARG C 3  71  ? 4.670   8.080   51.989 1.00 113.76 ? 71   ARG C NH1   1 
ATOM   1894  N  NH2   . ARG C 3  71  ? 6.459   7.526   50.646 1.00 113.48 ? 71   ARG C NH2   1 
ATOM   1895  N  N     . ASP C 3  72  ? 3.909   1.044   54.959 1.00 55.55  ? 72   ASP C N     1 
ATOM   1896  C  CA    . ASP C 3  72  ? 3.689   0.790   56.376 1.00 59.40  ? 72   ASP C CA    1 
ATOM   1897  C  C     . ASP C 3  72  ? 4.668   -0.261  56.996 1.00 64.49  ? 72   ASP C C     1 
ATOM   1898  O  O     . ASP C 3  72  ? 4.776   -0.326  58.214 1.00 67.88  ? 72   ASP C O     1 
ATOM   1899  C  CB    . ASP C 3  72  ? 2.253   0.305   56.603 1.00 59.01  ? 72   ASP C CB    1 
ATOM   1900  C  CG    . ASP C 3  72  ? 1.206   1.329   56.241 1.00 60.85  ? 72   ASP C CG    1 
ATOM   1901  O  OD1   . ASP C 3  72  ? 1.415   2.561   56.382 1.00 63.49  ? 72   ASP C OD1   1 
ATOM   1902  O  OD2   . ASP C 3  72  ? 0.130   0.879   55.804 1.00 71.26  ? 72   ASP C OD2   1 
ATOM   1903  N  N     . ASN C 3  73  ? 5.322   -1.096  56.176 1.00 67.74  ? 73   ASN C N     1 
ATOM   1904  C  CA    . ASN C 3  73  ? 6.320   -2.093  56.636 1.00 76.62  ? 73   ASN C CA    1 
ATOM   1905  C  C     . ASN C 3  73  ? 7.739   -1.612  56.342 1.00 79.56  ? 73   ASN C C     1 
ATOM   1906  O  O     . ASN C 3  73  ? 8.679   -2.410  56.333 1.00 78.53  ? 73   ASN C O     1 
ATOM   1907  C  CB    . ASN C 3  73  ? 6.183   -3.437  55.892 1.00 88.81  ? 73   ASN C CB    1 
ATOM   1908  C  CG    . ASN C 3  73  ? 5.044   -4.308  56.385 1.00 100.80 ? 73   ASN C CG    1 
ATOM   1909  O  OD1   . ASN C 3  73  ? 5.219   -5.520  56.500 1.00 105.49 ? 73   ASN C OD1   1 
ATOM   1910  N  ND2   . ASN C 3  73  ? 3.860   -3.720  56.603 1.00 106.00 ? 73   ASN C ND2   1 
ATOM   1911  N  N     . LYS C 3  74  ? 7.892   -0.324  56.059 1.00 78.28  ? 74   LYS C N     1 
ATOM   1912  C  CA    . LYS C 3  74  ? 9.165   0.231   55.589 1.00 75.79  ? 74   LYS C CA    1 
ATOM   1913  C  C     . LYS C 3  74  ? 9.810   -0.587  54.479 1.00 66.03  ? 74   LYS C C     1 
ATOM   1914  O  O     . LYS C 3  74  ? 10.992  -0.905  54.538 1.00 64.87  ? 74   LYS C O     1 
ATOM   1915  C  CB    . LYS C 3  74  ? 10.129  0.402   56.761 1.00 90.99  ? 74   LYS C CB    1 
ATOM   1916  C  CG    . LYS C 3  74  ? 9.655   1.414   57.800 1.00 99.37  ? 74   LYS C CG    1 
ATOM   1917  C  CD    . LYS C 3  74  ? 9.882   0.920   59.220 1.00 107.12 ? 74   LYS C CD    1 
ATOM   1918  C  CE    . LYS C 3  74  ? 8.806   1.452   60.152 1.00 113.25 ? 74   LYS C CE    1 
ATOM   1919  N  NZ    . LYS C 3  74  ? 8.999   0.923   61.527 1.00 119.11 ? 74   LYS C NZ    1 
ATOM   1920  N  N     . LYS C 3  75  ? 9.021   -0.918  53.463 1.00 61.48  ? 75   LYS C N     1 
ATOM   1921  C  CA    . LYS C 3  75  ? 9.527   -1.599  52.270 1.00 60.61  ? 75   LYS C CA    1 
ATOM   1922  C  C     . LYS C 3  75  ? 9.155   -0.800  51.061 1.00 57.72  ? 75   LYS C C     1 
ATOM   1923  O  O     . LYS C 3  75  ? 8.256   0.019   51.090 1.00 68.02  ? 75   LYS C O     1 
ATOM   1924  C  CB    . LYS C 3  75  ? 8.920   -2.991  52.093 1.00 61.58  ? 75   LYS C CB    1 
ATOM   1925  C  CG    . LYS C 3  75  ? 9.058   -3.904  53.277 1.00 60.40  ? 75   LYS C CG    1 
ATOM   1926  C  CD    . LYS C 3  75  ? 10.408  -4.570  53.296 1.00 64.90  ? 75   LYS C CD    1 
ATOM   1927  C  CE    . LYS C 3  75  ? 10.488  -5.575  54.441 1.00 70.30  ? 75   LYS C CE    1 
ATOM   1928  N  NZ    . LYS C 3  75  ? 10.158  -4.979  55.773 1.00 72.42  ? 75   LYS C NZ    1 
ATOM   1929  N  N     . THR C 3  76  ? 9.829   -1.134  49.986 1.00 56.32  ? 76   THR C N     1 
ATOM   1930  C  CA    . THR C 3  76  ? 9.842   -0.420  48.742 1.00 54.09  ? 76   THR C CA    1 
ATOM   1931  C  C     . THR C 3  76  ? 9.384   -1.357  47.625 1.00 58.76  ? 76   THR C C     1 
ATOM   1932  O  O     . THR C 3  76  ? 9.027   -0.919  46.508 1.00 57.82  ? 76   THR C O     1 
ATOM   1933  C  CB    . THR C 3  76  ? 11.318  -0.014  48.497 1.00 60.62  ? 76   THR C CB    1 
ATOM   1934  O  OG1   . THR C 3  76  ? 11.544  1.240   49.140 1.00 61.15  ? 76   THR C OG1   1 
ATOM   1935  C  CG2   . THR C 3  76  ? 11.707  0.063   46.979 1.00 66.37  ? 76   THR C CG2   1 
ATOM   1936  N  N     . ARG C 3  77  ? 9.455   -2.657  47.896 1.00 59.41  ? 77   ARG C N     1 
ATOM   1937  C  CA    . ARG C 3  77  ? 9.050   -3.637  46.945 1.00 57.01  ? 77   ARG C CA    1 
ATOM   1938  C  C     . ARG C 3  77  ? 7.796   -4.337  47.455 1.00 54.53  ? 77   ARG C C     1 
ATOM   1939  O  O     . ARG C 3  77  ? 7.819   -4.988  48.503 1.00 57.17  ? 77   ARG C O     1 
ATOM   1940  C  CB    . ARG C 3  77  ? 10.185  -4.617  46.731 1.00 60.71  ? 77   ARG C CB    1 
ATOM   1941  C  CG    . ARG C 3  77  ? 10.045  -5.329  45.399 1.00 69.83  ? 77   ARG C CG    1 
ATOM   1942  C  CD    . ARG C 3  77  ? 10.985  -6.491  45.286 1.00 71.45  ? 77   ARG C CD    1 
ATOM   1943  N  NE    . ARG C 3  77  ? 12.318  -5.983  45.032 1.00 80.72  ? 77   ARG C NE    1 
ATOM   1944  C  CZ    . ARG C 3  77  ? 13.389  -6.223  45.778 1.00 83.45  ? 77   ARG C CZ    1 
ATOM   1945  N  NH1   . ARG C 3  77  ? 13.320  -6.995  46.863 1.00 79.69  ? 77   ARG C NH1   1 
ATOM   1946  N  NH2   . ARG C 3  77  ? 14.546  -5.685  45.417 1.00 87.50  ? 77   ARG C NH2   1 
ATOM   1947  N  N     . ILE C 3  78  ? 6.700   -4.164  46.734 1.00 50.88  ? 78   ILE C N     1 
ATOM   1948  C  CA    . ILE C 3  78  ? 5.459   -4.889  47.020 1.00 52.10  ? 78   ILE C CA    1 
ATOM   1949  C  C     . ILE C 3  78  ? 5.681   -6.388  46.850 1.00 52.69  ? 78   ILE C C     1 
ATOM   1950  O  O     . ILE C 3  78  ? 6.112   -6.828  45.795 1.00 57.34  ? 78   ILE C O     1 
ATOM   1951  C  CB    . ILE C 3  78  ? 4.318   -4.484  46.064 1.00 50.18  ? 78   ILE C CB    1 
ATOM   1952  C  CG1   . ILE C 3  78  ? 3.804   -3.085  46.409 1.00 52.92  ? 78   ILE C CG1   1 
ATOM   1953  C  CG2   . ILE C 3  78  ? 3.174   -5.469  46.176 1.00 53.87  ? 78   ILE C CG2   1 
ATOM   1954  C  CD1   . ILE C 3  78  ? 2.880   -2.456  45.384 1.00 52.82  ? 78   ILE C CD1   1 
ATOM   1955  N  N     . ILE C 3  79  ? 5.348   -7.165  47.867 1.00 48.61  ? 79   ILE C N     1 
ATOM   1956  C  CA    . ILE C 3  79  ? 5.370   -8.620  47.800 1.00 49.22  ? 79   ILE C CA    1 
ATOM   1957  C  C     . ILE C 3  79  ? 3.953   -9.167  48.082 1.00 53.70  ? 79   ILE C C     1 
ATOM   1958  O  O     . ILE C 3  79  ? 3.018   -8.402  48.390 1.00 55.72  ? 79   ILE C O     1 
ATOM   1959  C  CB    . ILE C 3  79  ? 6.394   -9.166  48.813 1.00 49.28  ? 79   ILE C CB    1 
ATOM   1960  C  CG1   . ILE C 3  79  ? 5.948   -8.909  50.270 1.00 43.52  ? 79   ILE C CG1   1 
ATOM   1961  C  CG2   . ILE C 3  79  ? 7.734   -8.497  48.550 1.00 54.06  ? 79   ILE C CG2   1 
ATOM   1962  C  CD1   . ILE C 3  79  ? 6.899   -9.455  51.296 1.00 37.86  ? 79   ILE C CD1   1 
ATOM   1963  N  N     . PRO C 3  80  ? 3.770   -10.490 47.996 1.00 49.96  ? 80   PRO C N     1 
ATOM   1964  C  CA    . PRO C 3  80  ? 2.381   -10.928 48.152 1.00 46.00  ? 80   PRO C CA    1 
ATOM   1965  C  C     . PRO C 3  80  ? 1.790   -10.628 49.504 1.00 42.43  ? 80   PRO C C     1 
ATOM   1966  O  O     . PRO C 3  80  ? 0.622   -10.322 49.577 1.00 46.25  ? 80   PRO C O     1 
ATOM   1967  C  CB    . PRO C 3  80  ? 2.448   -12.428 47.868 1.00 47.17  ? 80   PRO C CB    1 
ATOM   1968  C  CG    . PRO C 3  80  ? 3.599   -12.550 46.919 1.00 48.20  ? 80   PRO C CG    1 
ATOM   1969  C  CD    . PRO C 3  80  ? 4.617   -11.566 47.473 1.00 49.29  ? 80   PRO C CD    1 
ATOM   1970  N  N     . ARG C 3  81  ? 2.553   -10.649 50.578 1.00 43.81  ? 81   ARG C N     1 
ATOM   1971  C  CA    . ARG C 3  81  ? 1.925   -10.260 51.858 1.00 42.84  ? 81   ARG C CA    1 
ATOM   1972  C  C     . ARG C 3  81  ? 1.225   -8.916  51.737 1.00 45.29  ? 81   ARG C C     1 
ATOM   1973  O  O     . ARG C 3  81  ? 0.139   -8.737  52.305 1.00 46.52  ? 81   ARG C O     1 
ATOM   1974  C  CB    . ARG C 3  81  ? 2.897   -10.271 53.051 1.00 39.53  ? 81   ARG C CB    1 
ATOM   1975  C  CG    . ARG C 3  81  ? 2.445   -9.407  54.203 1.00 46.35  ? 81   ARG C CG    1 
ATOM   1976  C  CD    . ARG C 3  81  ? 2.238   -10.071 55.567 1.00 49.08  ? 81   ARG C CD    1 
ATOM   1977  N  NE    . ARG C 3  81  ? 1.068   -10.923 55.559 1.00 50.18  ? 81   ARG C NE    1 
ATOM   1978  C  CZ    . ARG C 3  81  ? 0.285   -11.209 56.612 1.00 56.21  ? 81   ARG C CZ    1 
ATOM   1979  N  NH1   . ARG C 3  81  ? 0.464   -10.698 57.834 1.00 45.03  ? 81   ARG C NH1   1 
ATOM   1980  N  NH2   . ARG C 3  81  ? -0.722  -12.061 56.424 1.00 60.43  ? 81   ARG C NH2   1 
ATOM   1981  N  N     . HIS C 3  82  ? 1.827   -7.963  51.016 1.00 47.29  ? 82   HIS C N     1 
ATOM   1982  C  CA    . HIS C 3  82  ? 1.242   -6.605  50.942 1.00 46.32  ? 82   HIS C CA    1 
ATOM   1983  C  C     . HIS C 3  82  ? -0.031  -6.602  50.125 1.00 49.18  ? 82   HIS C C     1 
ATOM   1984  O  O     . HIS C 3  82  ? -0.943  -5.806  50.409 1.00 54.14  ? 82   HIS C O     1 
ATOM   1985  C  CB    . HIS C 3  82  ? 2.188   -5.580  50.346 1.00 43.41  ? 82   HIS C CB    1 
ATOM   1986  C  CG    . HIS C 3  82  ? 3.519   -5.520  51.015 1.00 40.76  ? 82   HIS C CG    1 
ATOM   1987  N  ND1   . HIS C 3  82  ? 4.693   -5.463  50.306 1.00 43.10  ? 82   HIS C ND1   1 
ATOM   1988  C  CD2   . HIS C 3  82  ? 3.871   -5.540  52.315 1.00 41.76  ? 82   HIS C CD2   1 
ATOM   1989  C  CE1   . HIS C 3  82  ? 5.718   -5.467  51.136 1.00 42.58  ? 82   HIS C CE1   1 
ATOM   1990  N  NE2   . HIS C 3  82  ? 5.245   -5.506  52.366 1.00 44.28  ? 82   HIS C NE2   1 
ATOM   1991  N  N     . LEU C 3  83  ? -0.087  -7.466  49.112 1.00 45.40  ? 83   LEU C N     1 
ATOM   1992  C  CA    . LEU C 3  83  ? -1.298  -7.618  48.323 1.00 48.35  ? 83   LEU C CA    1 
ATOM   1993  C  C     . LEU C 3  83  ? -2.418  -8.232  49.190 1.00 49.11  ? 83   LEU C C     1 
ATOM   1994  O  O     . LEU C 3  83  ? -3.594  -7.875  49.125 1.00 44.62  ? 83   LEU C O     1 
ATOM   1995  C  CB    . LEU C 3  83  ? -1.041  -8.486  47.106 1.00 45.51  ? 83   LEU C CB    1 
ATOM   1996  C  CG    . LEU C 3  83  ? -0.142  -7.879  46.028 1.00 48.88  ? 83   LEU C CG    1 
ATOM   1997  C  CD1   . LEU C 3  83  ? 0.214   -8.946  45.001 1.00 51.20  ? 83   LEU C CD1   1 
ATOM   1998  C  CD2   . LEU C 3  83  ? -0.789  -6.728  45.304 1.00 46.17  ? 83   LEU C CD2   1 
ATOM   1999  N  N     . GLN C 3  84  ? -2.042  -9.168  50.019 1.00 47.13  ? 84   GLN C N     1 
ATOM   2000  C  CA    . GLN C 3  84  ? -3.024  -9.768  50.858 1.00 45.25  ? 84   GLN C CA    1 
ATOM   2001  C  C     . GLN C 3  84  ? -3.524  -8.706  51.891 1.00 43.90  ? 84   GLN C C     1 
ATOM   2002  O  O     . GLN C 3  84  ? -4.728  -8.600  52.178 1.00 44.82  ? 84   GLN C O     1 
ATOM   2003  C  CB    . GLN C 3  84  ? -2.434  -11.001 51.511 1.00 41.03  ? 84   GLN C CB    1 
ATOM   2004  C  CG    . GLN C 3  84  ? -3.291  -11.499 52.642 1.00 45.56  ? 84   GLN C CG    1 
ATOM   2005  C  CD    . GLN C 3  84  ? -4.441  -12.381 52.180 1.00 43.08  ? 84   GLN C CD    1 
ATOM   2006  O  OE1   . GLN C 3  84  ? -4.980  -12.264 51.055 1.00 44.47  ? 84   GLN C OE1   1 
ATOM   2007  N  NE2   . GLN C 3  84  ? -4.801  -13.290 53.041 1.00 35.86  ? 84   GLN C NE2   1 
ATOM   2008  N  N     . LEU C 3  85  ? -2.624  -7.918  52.440 1.00 40.41  ? 85   LEU C N     1 
ATOM   2009  C  CA    . LEU C 3  85  ? -3.055  -6.915  53.390 1.00 44.78  ? 85   LEU C CA    1 
ATOM   2010  C  C     . LEU C 3  85  ? -4.014  -5.895  52.744 1.00 46.23  ? 85   LEU C C     1 
ATOM   2011  O  O     . LEU C 3  85  ? -5.022  -5.528  53.316 1.00 41.39  ? 85   LEU C O     1 
ATOM   2012  C  CB    . LEU C 3  85  ? -1.840  -6.199  53.957 1.00 49.46  ? 85   LEU C CB    1 
ATOM   2013  C  CG    . LEU C 3  85  ? -1.080  -6.979  55.023 1.00 51.51  ? 85   LEU C CG    1 
ATOM   2014  C  CD1   . LEU C 3  85  ? 0.069   -6.138  55.504 1.00 47.83  ? 85   LEU C CD1   1 
ATOM   2015  C  CD2   . LEU C 3  85  ? -1.993  -7.355  56.180 1.00 53.16  ? 85   LEU C CD2   1 
ATOM   2016  N  N     . ALA C 3  86  ? -3.684  -5.457  51.540 1.00 46.88  ? 86   ALA C N     1 
ATOM   2017  C  CA    . ALA C 3  86  ? -4.538  -4.578  50.766 1.00 45.13  ? 86   ALA C CA    1 
ATOM   2018  C  C     . ALA C 3  86  ? -5.921  -5.128  50.529 1.00 45.27  ? 86   ALA C C     1 
ATOM   2019  O  O     . ALA C 3  86  ? -6.924  -4.448  50.729 1.00 50.75  ? 86   ALA C O     1 
ATOM   2020  C  CB    . ALA C 3  86  ? -3.886  -4.304  49.428 1.00 50.96  ? 86   ALA C CB    1 
ATOM   2021  N  N     . VAL C 3  87  ? -5.978  -6.352  50.036 1.00 50.02  ? 87   VAL C N     1 
ATOM   2022  C  CA    . VAL C 3  87  ? -7.242  -6.961  49.656 1.00 45.05  ? 87   VAL C CA    1 
ATOM   2023  C  C     . VAL C 3  87  ? -8.096  -7.214  50.905 1.00 47.00  ? 87   VAL C C     1 
ATOM   2024  O  O     . VAL C 3  87  ? -9.259  -6.862  50.944 1.00 45.38  ? 87   VAL C O     1 
ATOM   2025  C  CB    . VAL C 3  87  ? -6.971  -8.251  48.874 1.00 46.34  ? 87   VAL C CB    1 
ATOM   2026  C  CG1   . VAL C 3  87  ? -8.248  -9.034  48.598 1.00 51.81  ? 87   VAL C CG1   1 
ATOM   2027  C  CG2   . VAL C 3  87  ? -6.342  -7.908  47.548 1.00 50.94  ? 87   VAL C CG2   1 
ATOM   2028  N  N     . ARG C 3  88  ? -7.498  -7.809  51.936 1.00 43.97  ? 88   ARG C N     1 
ATOM   2029  C  CA    . ARG C 3  88  ? -8.262  -8.278  53.049 1.00 40.64  ? 88   ARG C CA    1 
ATOM   2030  C  C     . ARG C 3  88  ? -8.649  -7.158  53.962 1.00 40.19  ? 88   ARG C C     1 
ATOM   2031  O  O     . ARG C 3  88  ? -9.545  -7.313  54.768 1.00 47.67  ? 88   ARG C O     1 
ATOM   2032  C  CB    . ARG C 3  88  ? -7.499  -9.364  53.826 1.00 41.82  ? 88   ARG C CB    1 
ATOM   2033  C  CG    . ARG C 3  88  ? -7.203  -10.657 53.029 1.00 41.99  ? 88   ARG C CG    1 
ATOM   2034  C  CD    . ARG C 3  88  ? -8.439  -11.226 52.307 1.00 40.29  ? 88   ARG C CD    1 
ATOM   2035  N  NE    . ARG C 3  88  ? -8.091  -12.035 51.125 1.00 34.76  ? 88   ARG C NE    1 
ATOM   2036  C  CZ    . ARG C 3  88  ? -8.967  -12.435 50.208 1.00 37.06  ? 88   ARG C CZ    1 
ATOM   2037  N  NH1   . ARG C 3  88  ? -10.277 -12.112 50.271 1.00 40.09  ? 88   ARG C NH1   1 
ATOM   2038  N  NH2   . ARG C 3  88  ? -8.548  -13.149 49.185 1.00 36.62  ? 88   ARG C NH2   1 
ATOM   2039  N  N     . ASN C 3  89  ? -7.984  -6.025  53.870 1.00 44.16  ? 89   ASN C N     1 
ATOM   2040  C  CA    . ASN C 3  89  ? -8.332  -4.877  54.718 1.00 44.35  ? 89   ASN C CA    1 
ATOM   2041  C  C     . ASN C 3  89  ? -9.366  -3.962  54.093 1.00 45.56  ? 89   ASN C C     1 
ATOM   2042  O  O     . ASN C 3  89  ? -9.890  -3.112  54.785 1.00 43.78  ? 89   ASN C O     1 
ATOM   2043  C  CB    . ASN C 3  89  ? -7.101  -4.101  55.114 1.00 46.64  ? 89   ASN C CB    1 
ATOM   2044  C  CG    . ASN C 3  89  ? -6.372  -4.755  56.276 1.00 48.11  ? 89   ASN C CG    1 
ATOM   2045  O  OD1   . ASN C 3  89  ? -6.979  -5.054  57.288 1.00 48.12  ? 89   ASN C OD1   1 
ATOM   2046  N  ND2   . ASN C 3  89  ? -5.078  -4.992  56.130 1.00 51.56  ? 89   ASN C ND2   1 
ATOM   2047  N  N     . ASP C 3  90  ? -9.701  -4.213  52.823 1.00 45.46  ? 90   ASP C N     1 
ATOM   2048  C  CA    . ASP C 3  90  ? -10.692 -3.478  52.079 1.00 44.65  ? 90   ASP C CA    1 
ATOM   2049  C  C     . ASP C 3  90  ? -11.949 -4.287  51.814 1.00 52.80  ? 90   ASP C C     1 
ATOM   2050  O  O     . ASP C 3  90  ? -11.939 -5.206  51.010 1.00 56.55  ? 90   ASP C O     1 
ATOM   2051  C  CB    . ASP C 3  90  ? -10.119 -3.118  50.735 1.00 47.78  ? 90   ASP C CB    1 
ATOM   2052  C  CG    . ASP C 3  90  ? -11.006 -2.191  49.986 1.00 51.70  ? 90   ASP C CG    1 
ATOM   2053  O  OD1   . ASP C 3  90  ? -11.034 -1.003  50.364 1.00 59.24  ? 90   ASP C OD1   1 
ATOM   2054  O  OD2   . ASP C 3  90  ? -11.679 -2.642  49.049 1.00 55.36  ? 90   ASP C OD2   1 
ATOM   2055  N  N     . GLU C 3  91  ? -13.048 -3.916  52.456 1.00 55.72  ? 91   GLU C N     1 
ATOM   2056  C  CA    . GLU C 3  91  ? -14.297 -4.642  52.348 1.00 51.76  ? 91   GLU C CA    1 
ATOM   2057  C  C     . GLU C 3  91  ? -14.627 -5.134  50.925 1.00 51.98  ? 91   GLU C C     1 
ATOM   2058  O  O     . GLU C 3  91  ? -15.001 -6.298  50.719 1.00 49.21  ? 91   GLU C O     1 
ATOM   2059  C  CB    . GLU C 3  91  ? -15.409 -3.743  52.854 1.00 64.11  ? 91   GLU C CB    1 
ATOM   2060  C  CG    . GLU C 3  91  ? -16.473 -4.457  53.664 1.00 78.27  ? 91   GLU C CG    1 
ATOM   2061  C  CD    . GLU C 3  91  ? -17.636 -3.539  53.963 1.00 84.55  ? 91   GLU C CD    1 
ATOM   2062  O  OE1   . GLU C 3  91  ? -18.316 -3.099  53.010 1.00 90.30  ? 91   GLU C OE1   1 
ATOM   2063  O  OE2   . GLU C 3  91  ? -17.856 -3.249  55.152 1.00 90.25  ? 91   GLU C OE2   1 
ATOM   2064  N  N     . GLU C 3  92  ? -14.475 -4.260  49.934 1.00 53.96  ? 92   GLU C N     1 
ATOM   2065  C  CA    . GLU C 3  92  ? -14.961 -4.551  48.569 1.00 50.27  ? 92   GLU C CA    1 
ATOM   2066  C  C     . GLU C 3  92  ? -14.050 -5.436  47.759 1.00 48.84  ? 92   GLU C C     1 
ATOM   2067  O  O     . GLU C 3  92  ? -14.526 -6.322  47.056 1.00 45.15  ? 92   GLU C O     1 
ATOM   2068  C  CB    . GLU C 3  92  ? -15.246 -3.259  47.809 1.00 50.06  ? 92   GLU C CB    1 
ATOM   2069  C  CG    . GLU C 3  92  ? -16.479 -2.583  48.382 1.00 56.75  ? 92   GLU C CG    1 
ATOM   2070  C  CD    . GLU C 3  92  ? -17.119 -1.553  47.476 1.00 61.11  ? 92   GLU C CD    1 
ATOM   2071  O  OE1   . GLU C 3  92  ? -16.427 -0.996  46.594 1.00 61.33  ? 92   GLU C OE1   1 
ATOM   2072  O  OE2   . GLU C 3  92  ? -18.327 -1.299  47.679 1.00 65.06  ? 92   GLU C OE2   1 
ATOM   2073  N  N     . LEU C 3  93  ? -12.745 -5.183  47.842 1.00 46.45  ? 93   LEU C N     1 
ATOM   2074  C  CA    . LEU C 3  93  ? -11.765 -6.100  47.301 1.00 45.92  ? 93   LEU C CA    1 
ATOM   2075  C  C     . LEU C 3  93  ? -11.785 -7.471  47.987 1.00 43.66  ? 93   LEU C C     1 
ATOM   2076  O  O     . LEU C 3  93  ? -11.730 -8.506  47.318 1.00 43.52  ? 93   LEU C O     1 
ATOM   2077  C  CB    . LEU C 3  93  ? -10.385 -5.495  47.392 1.00 49.19  ? 93   LEU C CB    1 
ATOM   2078  C  CG    . LEU C 3  93  ? -10.071 -4.431  46.341 1.00 50.12  ? 93   LEU C CG    1 
ATOM   2079  C  CD1   . LEU C 3  93  ? -8.701  -3.877  46.672 1.00 54.92  ? 93   LEU C CD1   1 
ATOM   2080  C  CD2   . LEU C 3  93  ? -10.065 -4.992  44.925 1.00 49.54  ? 93   LEU C CD2   1 
ATOM   2081  N  N     . ASN C 3  94  ? -11.894 -7.482  49.313 1.00 44.84  ? 94   ASN C N     1 
ATOM   2082  C  CA    . ASN C 3  94  ? -12.107 -8.725  50.045 1.00 45.00  ? 94   ASN C CA    1 
ATOM   2083  C  C     . ASN C 3  94  ? -13.307 -9.549  49.577 1.00 44.62  ? 94   ASN C C     1 
ATOM   2084  O  O     . ASN C 3  94  ? -13.243 -10.767 49.571 1.00 47.96  ? 94   ASN C O     1 
ATOM   2085  C  CB    . ASN C 3  94  ? -12.278 -8.505  51.537 1.00 44.28  ? 94   ASN C CB    1 
ATOM   2086  C  CG    . ASN C 3  94  ? -12.376 -9.836  52.286 1.00 41.07  ? 94   ASN C CG    1 
ATOM   2087  O  OD1   . ASN C 3  94  ? -11.569 -10.729 52.067 1.00 44.81  ? 94   ASN C OD1   1 
ATOM   2088  N  ND2   . ASN C 3  94  ? -13.345 -9.972  53.136 1.00 38.28  ? 94   ASN C ND2   1 
ATOM   2089  N  N     . LYS C 3  95  ? -14.401 -8.899  49.225 1.00 44.68  ? 95   LYS C N     1 
ATOM   2090  C  CA    . LYS C 3  95  ? -15.551 -9.634  48.716 1.00 50.32  ? 95   LYS C CA    1 
ATOM   2091  C  C     . LYS C 3  95  ? -15.313 -10.098 47.265 1.00 48.53  ? 95   LYS C C     1 
ATOM   2092  O  O     . LYS C 3  95  ? -15.668 -11.218 46.899 1.00 51.89  ? 95   LYS C O     1 
ATOM   2093  C  CB    . LYS C 3  95  ? -16.805 -8.776  48.827 1.00 52.24  ? 95   LYS C CB    1 
ATOM   2094  C  CG    . LYS C 3  95  ? -18.044 -9.357  48.200 1.00 59.25  ? 95   LYS C CG    1 
ATOM   2095  C  CD    . LYS C 3  95  ? -19.142 -8.339  48.422 1.00 79.93  ? 95   LYS C CD    1 
ATOM   2096  C  CE    . LYS C 3  95  ? -20.531 -8.852  48.090 1.00 96.08  ? 95   LYS C CE    1 
ATOM   2097  N  NZ    . LYS C 3  95  ? -21.556 -7.886  48.609 1.00 103.91 ? 95   LYS C NZ    1 
ATOM   2098  N  N     . LEU C 3  96  ? -14.733 -9.238  46.437 1.00 43.34  ? 96   LEU C N     1 
ATOM   2099  C  CA    . LEU C 3  96  ? -14.532 -9.576  45.039 1.00 42.96  ? 96   LEU C CA    1 
ATOM   2100  C  C     . LEU C 3  96  ? -13.632 -10.781 44.926 1.00 46.61  ? 96   LEU C C     1 
ATOM   2101  O  O     . LEU C 3  96  ? -13.755 -11.581 44.003 1.00 48.52  ? 96   LEU C O     1 
ATOM   2102  C  CB    . LEU C 3  96  ? -13.855 -8.433  44.322 1.00 44.21  ? 96   LEU C CB    1 
ATOM   2103  C  CG    . LEU C 3  96  ? -13.515 -8.663  42.856 1.00 45.29  ? 96   LEU C CG    1 
ATOM   2104  C  CD1   . LEU C 3  96  ? -14.806 -8.802  42.068 1.00 43.27  ? 96   LEU C CD1   1 
ATOM   2105  C  CD2   . LEU C 3  96  ? -12.675 -7.518  42.316 1.00 44.32  ? 96   LEU C CD2   1 
ATOM   2106  N  N     . LEU C 3  97  ? -12.715 -10.886 45.874 1.00 46.89  ? 97   LEU C N     1 
ATOM   2107  C  CA    . LEU C 3  97  ? -11.730 -11.940 45.892 1.00 48.46  ? 97   LEU C CA    1 
ATOM   2108  C  C     . LEU C 3  97  ? -11.968 -12.904 47.081 1.00 48.45  ? 97   LEU C C     1 
ATOM   2109  O  O     . LEU C 3  97  ? -11.027 -13.483 47.663 1.00 44.52  ? 97   LEU C O     1 
ATOM   2110  C  CB    . LEU C 3  97  ? -10.354 -11.279 45.977 1.00 48.85  ? 97   LEU C CB    1 
ATOM   2111  C  CG    . LEU C 3  97  ? -9.846  -10.424 44.800 1.00 50.16  ? 97   LEU C CG    1 
ATOM   2112  C  CD1   . LEU C 3  97  ? -8.443  -9.911  45.080 1.00 50.81  ? 97   LEU C CD1   1 
ATOM   2113  C  CD2   . LEU C 3  97  ? -9.801  -11.237 43.514 1.00 54.80  ? 97   LEU C CD2   1 
ATOM   2114  N  N     . GLY C 3  98  ? -13.233 -13.064 47.444 1.00 42.76  ? 98   GLY C N     1 
ATOM   2115  C  CA    . GLY C 3  98  ? -13.566 -13.789 48.652 1.00 43.78  ? 98   GLY C CA    1 
ATOM   2116  C  C     . GLY C 3  98  ? -13.437 -15.295 48.496 1.00 45.10  ? 98   GLY C C     1 
ATOM   2117  O  O     . GLY C 3  98  ? -13.486 -16.036 49.465 1.00 47.44  ? 98   GLY C O     1 
ATOM   2118  N  N     . ARG C 3  99  ? -13.276 -15.753 47.274 1.00 46.31  ? 99   ARG C N     1 
ATOM   2119  C  CA    . ARG C 3  99  ? -13.087 -17.153 47.023 1.00 50.14  ? 99   ARG C CA    1 
ATOM   2120  C  C     . ARG C 3  99  ? -11.782 -17.366 46.250 1.00 48.28  ? 99   ARG C C     1 
ATOM   2121  O  O     . ARG C 3  99  ? -11.690 -18.245 45.381 1.00 57.18  ? 99   ARG C O     1 
ATOM   2122  C  CB    . ARG C 3  99  ? -14.305 -17.663 46.277 1.00 51.65  ? 99   ARG C CB    1 
ATOM   2123  C  CG    . ARG C 3  99  ? -15.457 -17.934 47.213 1.00 64.15  ? 99   ARG C CG    1 
ATOM   2124  C  CD    . ARG C 3  99  ? -16.534 -18.700 46.460 1.00 89.88  ? 99   ARG C CD    1 
ATOM   2125  N  NE    . ARG C 3  99  ? -17.605 -19.186 47.340 1.00 112.33 ? 99   ARG C NE    1 
ATOM   2126  C  CZ    . ARG C 3  99  ? -18.862 -19.424 46.955 1.00 120.93 ? 99   ARG C CZ    1 
ATOM   2127  N  NH1   . ARG C 3  99  ? -19.250 -19.217 45.694 1.00 130.05 ? 99   ARG C NH1   1 
ATOM   2128  N  NH2   . ARG C 3  99  ? -19.751 -19.857 47.844 1.00 123.57 ? 99   ARG C NH2   1 
ATOM   2129  N  N     . VAL C 3  100 ? -10.781 -16.543 46.568 1.00 41.23  ? 100  VAL C N     1 
ATOM   2130  C  CA    . VAL C 3  100 ? -9.487  -16.590 45.912 1.00 38.65  ? 100  VAL C CA    1 
ATOM   2131  C  C     . VAL C 3  100 ? -8.403  -16.655 46.964 1.00 41.14  ? 100  VAL C C     1 
ATOM   2132  O  O     . VAL C 3  100 ? -8.562  -16.128 48.077 1.00 38.75  ? 100  VAL C O     1 
ATOM   2133  C  CB    . VAL C 3  100 ? -9.262  -15.318 45.104 1.00 42.90  ? 100  VAL C CB    1 
ATOM   2134  C  CG1   . VAL C 3  100 ? -7.825  -15.173 44.628 1.00 46.23  ? 100  VAL C CG1   1 
ATOM   2135  C  CG2   . VAL C 3  100 ? -10.170 -15.309 43.906 1.00 45.01  ? 100  VAL C CG2   1 
ATOM   2136  N  N     . THR C 3  101 ? -7.297  -17.310 46.618 1.00 44.10  ? 101  THR C N     1 
ATOM   2137  C  CA    . THR C 3  101 ? -6.178  -17.456 47.538 1.00 43.10  ? 101  THR C CA    1 
ATOM   2138  C  C     . THR C 3  101 ? -4.935  -16.884 46.896 1.00 44.26  ? 101  THR C C     1 
ATOM   2139  O  O     . THR C 3  101 ? -4.568  -17.253 45.770 1.00 43.96  ? 101  THR C O     1 
ATOM   2140  C  CB    . THR C 3  101 ? -5.969  -18.930 47.946 1.00 45.89  ? 101  THR C CB    1 
ATOM   2141  O  OG1   . THR C 3  101 ? -7.123  -19.397 48.672 1.00 45.09  ? 101  THR C OG1   1 
ATOM   2142  C  CG2   . THR C 3  101 ? -4.725  -19.070 48.828 1.00 43.45  ? 101  THR C CG2   1 
ATOM   2143  N  N     . ILE C 3  102 ? -4.309  -15.964 47.627 1.00 44.14  ? 102  ILE C N     1 
ATOM   2144  C  CA    . ILE C 3  102 ? -3.069  -15.305 47.212 1.00 38.41  ? 102  ILE C CA    1 
ATOM   2145  C  C     . ILE C 3  102 ? -1.960  -16.105 47.841 1.00 39.04  ? 102  ILE C C     1 
ATOM   2146  O  O     . ILE C 3  102 ? -1.764  -16.126 49.073 1.00 39.14  ? 102  ILE C O     1 
ATOM   2147  C  CB    . ILE C 3  102 ? -3.045  -13.851 47.707 1.00 40.69  ? 102  ILE C CB    1 
ATOM   2148  C  CG1   . ILE C 3  102 ? -4.109  -13.048 46.940 1.00 43.62  ? 102  ILE C CG1   1 
ATOM   2149  C  CG2   . ILE C 3  102 ? -1.663  -13.224 47.558 1.00 38.91  ? 102  ILE C CG2   1 
ATOM   2150  C  CD1   . ILE C 3  102 ? -4.424  -11.689 47.512 1.00 43.76  ? 102  ILE C CD1   1 
ATOM   2151  N  N     . ALA C 3  103 ? -1.278  -16.853 47.005 1.00 40.25  ? 103  ALA C N     1 
ATOM   2152  C  CA    . ALA C 3  103 ? -0.114  -17.580 47.456 1.00 43.40  ? 103  ALA C CA    1 
ATOM   2153  C  C     . ALA C 3  103 ? 0.762   -16.629 48.266 1.00 43.33  ? 103  ALA C C     1 
ATOM   2154  O  O     . ALA C 3  103 ? 0.813   -15.459 47.988 1.00 48.76  ? 103  ALA C O     1 
ATOM   2155  C  CB    . ALA C 3  103 ? 0.638   -18.127 46.262 1.00 45.67  ? 103  ALA C CB    1 
ATOM   2156  N  N     . GLN C 3  104 ? 1.397   -17.132 49.308 1.00 45.54  ? 104  GLN C N     1 
ATOM   2157  C  CA    . GLN C 3  104 ? 2.321   -16.361 50.138 1.00 46.64  ? 104  GLN C CA    1 
ATOM   2158  C  C     . GLN C 3  104 ? 1.789   -15.063 50.791 1.00 47.33  ? 104  GLN C C     1 
ATOM   2159  O  O     . GLN C 3  104 ? 2.562   -14.176 51.210 1.00 50.59  ? 104  GLN C O     1 
ATOM   2160  C  CB    . GLN C 3  104 ? 3.636   -16.170 49.389 1.00 49.41  ? 104  GLN C CB    1 
ATOM   2161  C  CG    . GLN C 3  104 ? 4.534   -17.402 49.501 1.00 54.75  ? 104  GLN C CG    1 
ATOM   2162  C  CD    . GLN C 3  104 ? 4.827   -17.813 50.982 1.00 64.49  ? 104  GLN C CD    1 
ATOM   2163  O  OE1   . GLN C 3  104 ? 5.366   -17.012 51.789 1.00 64.56  ? 104  GLN C OE1   1 
ATOM   2164  N  NE2   . GLN C 3  104 ? 4.447   -19.055 51.349 1.00 58.20  ? 104  GLN C NE2   1 
ATOM   2165  N  N     . GLY C 3  105 ? 0.481   -15.008 50.969 1.00 39.94  ? 105  GLY C N     1 
ATOM   2166  C  CA    . GLY C 3  105 ? -0.157  -13.850 51.566 1.00 44.27  ? 105  GLY C CA    1 
ATOM   2167  C  C     . GLY C 3  105 ? -0.422  -13.854 53.071 1.00 45.59  ? 105  GLY C C     1 
ATOM   2168  O  O     . GLY C 3  105 ? -0.594  -12.759 53.688 1.00 44.04  ? 105  GLY C O     1 
ATOM   2169  N  N     . GLY C 3  106 ? -0.432  -15.048 53.679 1.00 41.54  ? 106  GLY C N     1 
ATOM   2170  C  CA    . GLY C 3  106 ? -0.706  -15.167 55.112 1.00 37.92  ? 106  GLY C CA    1 
ATOM   2171  C  C     . GLY C 3  106 ? -2.137  -14.803 55.409 1.00 42.44  ? 106  GLY C C     1 
ATOM   2172  O  O     . GLY C 3  106 ? -3.006  -14.767 54.517 1.00 45.41  ? 106  GLY C O     1 
ATOM   2173  N  N     . VAL C 3  107 ? -2.384  -14.504 56.670 1.00 44.00  ? 107  VAL C N     1 
ATOM   2174  C  CA    . VAL C 3  107 ? -3.698  -14.051 57.123 1.00 41.77  ? 107  VAL C CA    1 
ATOM   2175  C  C     . VAL C 3  107 ? -3.577  -12.691 57.828 1.00 41.11  ? 107  VAL C C     1 
ATOM   2176  O  O     . VAL C 3  107 ? -2.482  -12.221 58.084 1.00 42.48  ? 107  VAL C O     1 
ATOM   2177  C  CB    . VAL C 3  107 ? -4.280  -15.080 58.109 1.00 41.71  ? 107  VAL C CB    1 
ATOM   2178  C  CG1   . VAL C 3  107 ? -4.358  -16.453 57.461 1.00 39.14  ? 107  VAL C CG1   1 
ATOM   2179  C  CG2   . VAL C 3  107 ? -3.469  -15.148 59.393 1.00 42.60  ? 107  VAL C CG2   1 
ATOM   2180  N  N     . LEU C 3  108 ? -4.684  -12.053 58.148 1.00 43.92  ? 108  LEU C N     1 
ATOM   2181  C  CA    . LEU C 3  108 ? -4.637  -10.835 59.004 1.00 48.74  ? 108  LEU C CA    1 
ATOM   2182  C  C     . LEU C 3  108 ? -4.399  -11.164 60.475 1.00 49.11  ? 108  LEU C C     1 
ATOM   2183  O  O     . LEU C 3  108 ? -4.984  -12.103 61.013 1.00 52.49  ? 108  LEU C O     1 
ATOM   2184  C  CB    . LEU C 3  108 ? -5.953  -10.039 58.895 1.00 47.06  ? 108  LEU C CB    1 
ATOM   2185  C  CG    . LEU C 3  108 ? -6.251  -9.394  57.531 1.00 46.40  ? 108  LEU C CG    1 
ATOM   2186  C  CD1   . LEU C 3  108 ? -7.491  -8.553  57.656 1.00 44.83  ? 108  LEU C CD1   1 
ATOM   2187  C  CD2   . LEU C 3  108 ? -5.106  -8.507  57.052 1.00 46.78  ? 108  LEU C CD2   1 
ATOM   2188  N  N     . PRO C 3  109 ? -3.560  -10.382 61.152 1.00 55.72  ? 109  PRO C N     1 
ATOM   2189  C  CA    . PRO C 3  109 ? -3.539  -10.590 62.610 1.00 56.14  ? 109  PRO C CA    1 
ATOM   2190  C  C     . PRO C 3  109 ? -4.951  -10.448 63.182 1.00 54.36  ? 109  PRO C C     1 
ATOM   2191  O  O     . PRO C 3  109 ? -5.632  -9.494  62.881 1.00 50.13  ? 109  PRO C O     1 
ATOM   2192  C  CB    . PRO C 3  109 ? -2.617  -9.467  63.108 1.00 51.78  ? 109  PRO C CB    1 
ATOM   2193  C  CG    . PRO C 3  109 ? -1.668  -9.270  61.967 1.00 51.64  ? 109  PRO C CG    1 
ATOM   2194  C  CD    . PRO C 3  109 ? -2.539  -9.410  60.728 1.00 52.33  ? 109  PRO C CD    1 
ATOM   2195  N  N     . ASN C 3  110 ? -5.401  -11.442 63.926 1.00 53.34  ? 110  ASN C N     1 
ATOM   2196  C  CA    . ASN C 3  110 ? -6.681  -11.383 64.564 1.00 54.48  ? 110  ASN C CA    1 
ATOM   2197  C  C     . ASN C 3  110 ? -6.822  -12.543 65.527 1.00 60.76  ? 110  ASN C C     1 
ATOM   2198  O  O     . ASN C 3  110 ? -6.938  -13.699 65.108 1.00 60.27  ? 110  ASN C O     1 
ATOM   2199  C  CB    . ASN C 3  110 ? -7.822  -11.429 63.555 1.00 56.04  ? 110  ASN C CB    1 
ATOM   2200  C  CG    . ASN C 3  110 ? -9.169  -11.265 64.209 1.00 59.95  ? 110  ASN C CG    1 
ATOM   2201  O  OD1   . ASN C 3  110 ? -9.268  -10.931 65.399 1.00 72.75  ? 110  ASN C OD1   1 
ATOM   2202  N  ND2   . ASN C 3  110 ? -10.220 -11.494 63.448 1.00 62.69  ? 110  ASN C ND2   1 
ATOM   2203  N  N     . ILE C 3  111 ? -6.819  -12.183 66.814 1.00 63.47  ? 111  ILE C N     1 
ATOM   2204  C  CA    . ILE C 3  111 ? -7.053  -13.057 67.959 1.00 57.72  ? 111  ILE C CA    1 
ATOM   2205  C  C     . ILE C 3  111 ? -8.430  -12.744 68.556 1.00 57.71  ? 111  ILE C C     1 
ATOM   2206  O  O     . ILE C 3  111 ? -8.766  -11.592 68.766 1.00 64.36  ? 111  ILE C O     1 
ATOM   2207  C  CB    . ILE C 3  111 ? -5.999  -12.769 69.022 1.00 54.66  ? 111  ILE C CB    1 
ATOM   2208  C  CG1   . ILE C 3  111 ? -4.621  -12.826 68.391 1.00 56.95  ? 111  ILE C CG1   1 
ATOM   2209  C  CG2   . ILE C 3  111 ? -6.120  -13.754 70.169 1.00 60.84  ? 111  ILE C CG2   1 
ATOM   2210  C  CD1   . ILE C 3  111 ? -3.496  -12.654 69.389 1.00 62.76  ? 111  ILE C CD1   1 
ATOM   2211  N  N     . GLN C 3  112 ? -9.234  -13.760 68.819 1.00 59.86  ? 112  GLN C N     1 
ATOM   2212  C  CA    . GLN C 3  112 ? -10.569 -13.544 69.345 1.00 56.39  ? 112  GLN C CA    1 
ATOM   2213  C  C     . GLN C 3  112 ? -10.405 -13.128 70.778 1.00 62.58  ? 112  GLN C C     1 
ATOM   2214  O  O     . GLN C 3  112 ? -9.549  -13.689 71.457 1.00 68.27  ? 112  GLN C O     1 
ATOM   2215  C  CB    . GLN C 3  112 ? -11.350 -14.851 69.358 1.00 59.19  ? 112  GLN C CB    1 
ATOM   2216  C  CG    . GLN C 3  112 ? -11.624 -15.436 68.009 1.00 57.53  ? 112  GLN C CG    1 
ATOM   2217  C  CD    . GLN C 3  112 ? -12.557 -14.564 67.221 1.00 60.14  ? 112  GLN C CD    1 
ATOM   2218  O  OE1   . GLN C 3  112 ? -13.716 -14.329 67.618 1.00 57.64  ? 112  GLN C OE1   1 
ATOM   2219  N  NE2   . GLN C 3  112 ? -12.070 -14.081 66.090 1.00 58.26  ? 112  GLN C NE2   1 
ATOM   2220  N  N     . SER C 3  113 ? -11.259 -12.212 71.248 1.00 65.84  ? 113  SER C N     1 
ATOM   2221  C  CA    . SER C 3  113 ? -11.193 -11.648 72.622 1.00 62.26  ? 113  SER C CA    1 
ATOM   2222  C  C     . SER C 3  113 ? -11.022 -12.635 73.756 1.00 59.35  ? 113  SER C C     1 
ATOM   2223  O  O     . SER C 3  113 ? -10.065 -12.541 74.514 1.00 71.66  ? 113  SER C O     1 
ATOM   2224  C  CB    . SER C 3  113 ? -12.438 -10.820 72.916 1.00 61.75  ? 113  SER C CB    1 
ATOM   2225  O  OG    . SER C 3  113 ? -12.389 -9.646  72.155 1.00 60.90  ? 113  SER C OG    1 
ATOM   2226  N  N     . VAL C 3  114 ? -11.938 -13.581 73.884 1.00 59.68  ? 114  VAL C N     1 
ATOM   2227  C  CA    . VAL C 3  114 ? -11.933 -14.489 75.054 1.00 61.09  ? 114  VAL C CA    1 
ATOM   2228  C  C     . VAL C 3  114 ? -10.617 -15.218 75.220 1.00 61.23  ? 114  VAL C C     1 
ATOM   2229  O  O     . VAL C 3  114 ? -10.337 -15.768 76.288 1.00 69.15  ? 114  VAL C O     1 
ATOM   2230  C  CB    . VAL C 3  114 ? -13.036 -15.573 75.004 1.00 58.00  ? 114  VAL C CB    1 
ATOM   2231  C  CG1   . VAL C 3  114 ? -14.420 -14.942 74.880 1.00 67.58  ? 114  VAL C CG1   1 
ATOM   2232  C  CG2   . VAL C 3  114 ? -12.801 -16.540 73.852 1.00 60.85  ? 114  VAL C CG2   1 
ATOM   2233  N  N     . LEU C 3  115 ? -9.836  -15.262 74.151 1.00 57.28  ? 115  LEU C N     1 
ATOM   2234  C  CA    . LEU C 3  115 ? -8.568  -15.947 74.189 1.00 63.61  ? 115  LEU C CA    1 
ATOM   2235  C  C     . LEU C 3  115 ? -7.479  -15.176 74.918 1.00 60.36  ? 115  LEU C C     1 
ATOM   2236  O  O     . LEU C 3  115 ? -6.479  -15.787 75.318 1.00 56.27  ? 115  LEU C O     1 
ATOM   2237  C  CB    . LEU C 3  115 ? -8.092  -16.272 72.768 1.00 67.47  ? 115  LEU C CB    1 
ATOM   2238  C  CG    . LEU C 3  115 ? -8.993  -17.151 71.904 1.00 61.60  ? 115  LEU C CG    1 
ATOM   2239  C  CD1   . LEU C 3  115 ? -8.245  -17.515 70.643 1.00 56.47  ? 115  LEU C CD1   1 
ATOM   2240  C  CD2   . LEU C 3  115 ? -9.431  -18.407 72.641 1.00 61.20  ? 115  LEU C CD2   1 
ATOM   2241  N  N     . LEU C 3  116 ? -7.659  -13.861 75.084 1.00 61.27  ? 116  LEU C N     1 
ATOM   2242  C  CA    . LEU C 3  116 ? -6.643  -13.021 75.764 1.00 66.59  ? 116  LEU C CA    1 
ATOM   2243  C  C     . LEU C 3  116 ? -6.610  -13.229 77.288 1.00 71.44  ? 116  LEU C C     1 
ATOM   2244  O  O     . LEU C 3  116 ? -7.581  -13.698 77.869 1.00 75.06  ? 116  LEU C O     1 
ATOM   2245  C  CB    . LEU C 3  116 ? -6.854  -11.543 75.439 1.00 64.40  ? 116  LEU C CB    1 
ATOM   2246  C  CG    . LEU C 3  116 ? -6.843  -11.095 73.964 1.00 66.34  ? 116  LEU C CG    1 
ATOM   2247  C  CD1   . LEU C 3  116 ? -7.062  -9.590  73.888 1.00 65.64  ? 116  LEU C CD1   1 
ATOM   2248  C  CD2   . LEU C 3  116 ? -5.576  -11.456 73.212 1.00 60.52  ? 116  LEU C CD2   1 
ATOM   2249  N  N     . PRO C 3  117 ? -5.494  -12.870 77.950 1.00 81.70  ? 117  PRO C N     1 
ATOM   2250  C  CA    . PRO C 3  117 ? -5.379  -13.109 79.402 1.00 84.46  ? 117  PRO C CA    1 
ATOM   2251  C  C     . PRO C 3  117 ? -6.360  -12.338 80.310 1.00 90.74  ? 117  PRO C C     1 
ATOM   2252  O  O     . PRO C 3  117 ? -6.944  -11.325 79.886 1.00 68.72  ? 117  PRO C O     1 
ATOM   2253  C  CB    . PRO C 3  117 ? -3.947  -12.657 79.717 1.00 83.68  ? 117  PRO C CB    1 
ATOM   2254  C  CG    . PRO C 3  117 ? -3.229  -12.634 78.408 1.00 84.76  ? 117  PRO C CG    1 
ATOM   2255  C  CD    . PRO C 3  117 ? -4.267  -12.264 77.402 1.00 83.38  ? 117  PRO C CD    1 
ATOM   2256  N  N     . LYS C 3  118 ? -6.485  -12.842 81.552 1.00 108.01 ? 118  LYS C N     1 
ATOM   2257  C  CA    . LYS C 3  118 ? -7.162  -12.195 82.711 1.00 115.74 ? 118  LYS C CA    1 
ATOM   2258  C  C     . LYS C 3  118 ? -8.693  -12.148 82.567 1.00 140.09 ? 118  LYS C C     1 
ATOM   2259  O  O     . LYS C 3  118 ? -9.312  -13.147 82.186 1.00 136.43 ? 118  LYS C O     1 
ATOM   2260  C  CB    . LYS C 3  118 ? -6.631  -10.779 82.994 1.00 112.69 ? 118  LYS C CB    1 
ATOM   2261  C  CG    . LYS C 3  118 ? -5.131  -10.560 82.954 1.00 114.85 ? 118  LYS C CG    1 
ATOM   2262  C  CD    . LYS C 3  118 ? -4.825  -9.061  82.935 1.00 116.65 ? 118  LYS C CD    1 
ATOM   2263  C  CE    . LYS C 3  118 ? -5.406  -8.369  81.705 1.00 113.44 ? 118  LYS C CE    1 
ATOM   2264  N  NZ    . LYS C 3  118 ? -5.045  -6.931  81.635 1.00 114.90 ? 118  LYS C NZ    1 
ATOM   2265  N  N     . LYS C 3  119 ? -9.297  -11.000 82.907 1.00 163.74 ? 119  LYS C N     1 
ATOM   2266  C  CA    . LYS C 3  119 ? -10.727 -10.749 82.694 1.00 171.08 ? 119  LYS C CA    1 
ATOM   2267  C  C     . LYS C 3  119 ? -10.961 -9.468  81.884 1.00 157.55 ? 119  LYS C C     1 
ATOM   2268  O  O     . LYS C 3  119 ? -10.235 -8.483  82.025 1.00 139.80 ? 119  LYS C O     1 
ATOM   2269  C  CB    . LYS C 3  119 ? -11.482 -10.670 84.032 1.00 177.05 ? 119  LYS C CB    1 
ATOM   2270  C  CG    . LYS C 3  119 ? -10.960 -9.643  85.037 1.00 176.20 ? 119  LYS C CG    1 
ATOM   2271  C  CD    . LYS C 3  119 ? -10.156 -10.279 86.166 1.00 170.98 ? 119  LYS C CD    1 
ATOM   2272  C  CE    . LYS C 3  119 ? -10.122 -9.383  87.397 1.00 164.02 ? 119  LYS C CE    1 
ATOM   2273  N  NZ    . LYS C 3  119 ? -9.828  -10.155 88.633 1.00 159.50 ? 119  LYS C NZ    1 
ATOM   2274  N  N     . LYS D 4  31  ? 10.989  -21.866 22.051 1.00 143.09 ? 28   LYS D N     1 
ATOM   2275  C  CA    . LYS D 4  31  ? 11.171  -20.771 23.064 1.00 136.29 ? 28   LYS D CA    1 
ATOM   2276  C  C     . LYS D 4  31  ? 9.891   -19.932 23.097 1.00 131.37 ? 28   LYS D C     1 
ATOM   2277  O  O     . LYS D 4  31  ? 9.931   -18.707 22.931 1.00 113.75 ? 28   LYS D O     1 
ATOM   2278  C  CB    . LYS D 4  31  ? 12.395  -19.879 22.742 1.00 135.80 ? 28   LYS D CB    1 
ATOM   2279  C  CG    . LYS D 4  31  ? 13.505  -20.497 21.886 1.00 133.52 ? 28   LYS D CG    1 
ATOM   2280  C  CD    . LYS D 4  31  ? 13.402  -20.112 20.404 1.00 128.92 ? 28   LYS D CD    1 
ATOM   2281  C  CE    . LYS D 4  31  ? 13.712  -21.272 19.460 1.00 121.99 ? 28   LYS D CE    1 
ATOM   2282  N  NZ    . LYS D 4  31  ? 14.898  -22.082 19.856 1.00 117.48 ? 28   LYS D NZ    1 
ATOM   2283  N  N     . THR D 4  32  ? 8.758   -20.600 23.316 1.00 129.50 ? 29   THR D N     1 
ATOM   2284  C  CA    . THR D 4  32  ? 7.462   -20.021 22.963 1.00 128.13 ? 29   THR D CA    1 
ATOM   2285  C  C     . THR D 4  32  ? 7.093   -18.824 23.839 1.00 130.37 ? 29   THR D C     1 
ATOM   2286  O  O     . THR D 4  32  ? 7.220   -18.865 25.075 1.00 124.21 ? 29   THR D O     1 
ATOM   2287  C  CB    . THR D 4  32  ? 6.322   -21.065 22.962 1.00 127.64 ? 29   THR D CB    1 
ATOM   2288  O  OG1   . THR D 4  32  ? 5.275   -20.619 22.086 1.00 117.05 ? 29   THR D OG1   1 
ATOM   2289  C  CG2   . THR D 4  32  ? 5.765   -21.324 24.390 1.00 125.96 ? 29   THR D CG2   1 
ATOM   2290  N  N     . ARG D 4  33  ? 6.630   -17.768 23.168 1.00 123.52 ? 30   ARG D N     1 
ATOM   2291  C  CA    . ARG D 4  33  ? 6.371   -16.486 23.806 1.00 117.57 ? 30   ARG D CA    1 
ATOM   2292  C  C     . ARG D 4  33  ? 5.167   -16.562 24.748 1.00 112.05 ? 30   ARG D C     1 
ATOM   2293  O  O     . ARG D 4  33  ? 4.040   -16.859 24.336 1.00 103.11 ? 30   ARG D O     1 
ATOM   2294  C  CB    . ARG D 4  33  ? 6.179   -15.377 22.763 1.00 115.61 ? 30   ARG D CB    1 
ATOM   2295  C  CG    . ARG D 4  33  ? 4.951   -15.522 21.868 1.00 121.02 ? 30   ARG D CG    1 
ATOM   2296  C  CD    . ARG D 4  33  ? 4.504   -14.210 21.229 1.00 125.29 ? 30   ARG D CD    1 
ATOM   2297  N  NE    . ARG D 4  33  ? 5.222   -13.018 21.701 1.00 123.08 ? 30   ARG D NE    1 
ATOM   2298  C  CZ    . ARG D 4  33  ? 4.744   -11.772 21.658 1.00 123.94 ? 30   ARG D CZ    1 
ATOM   2299  N  NH1   . ARG D 4  33  ? 3.534   -11.507 21.171 1.00 122.41 ? 30   ARG D NH1   1 
ATOM   2300  N  NH2   . ARG D 4  33  ? 5.492   -10.770 22.108 1.00 124.44 ? 30   ARG D NH2   1 
ATOM   2301  N  N     . LYS D 4  34  ? 5.422   -16.290 26.020 1.00 97.05  ? 31   LYS D N     1 
ATOM   2302  C  CA    . LYS D 4  34  ? 4.377   -16.338 27.017 1.00 93.70  ? 31   LYS D CA    1 
ATOM   2303  C  C     . LYS D 4  34  ? 4.074   -14.902 27.416 1.00 89.74  ? 31   LYS D C     1 
ATOM   2304  O  O     . LYS D 4  34  ? 4.925   -14.197 27.958 1.00 87.40  ? 31   LYS D O     1 
ATOM   2305  C  CB    . LYS D 4  34  ? 4.771   -17.218 28.208 1.00 99.16  ? 31   LYS D CB    1 
ATOM   2306  C  CG    . LYS D 4  34  ? 6.267   -17.457 28.361 1.00 114.72 ? 31   LYS D CG    1 
ATOM   2307  C  CD    . LYS D 4  34  ? 6.608   -18.227 29.632 1.00 119.96 ? 31   LYS D CD    1 
ATOM   2308  C  CE    . LYS D 4  34  ? 8.079   -18.086 30.007 1.00 114.57 ? 31   LYS D CE    1 
ATOM   2309  N  NZ    . LYS D 4  34  ? 8.239   -18.230 31.476 1.00 112.39 ? 31   LYS D NZ    1 
ATOM   2310  N  N     . GLU D 4  35  ? 2.858   -14.468 27.095 1.00 83.85  ? 32   GLU D N     1 
ATOM   2311  C  CA    . GLU D 4  35  ? 2.394   -13.108 27.365 1.00 77.34  ? 32   GLU D CA    1 
ATOM   2312  C  C     . GLU D 4  35  ? 1.861   -12.925 28.762 1.00 74.20  ? 32   GLU D C     1 
ATOM   2313  O  O     . GLU D 4  35  ? 1.349   -13.863 29.365 1.00 77.14  ? 32   GLU D O     1 
ATOM   2314  C  CB    . GLU D 4  35  ? 1.236   -12.766 26.463 1.00 82.20  ? 32   GLU D CB    1 
ATOM   2315  C  CG    . GLU D 4  35  ? 1.604   -12.617 25.009 1.00 96.58  ? 32   GLU D CG    1 
ATOM   2316  C  CD    . GLU D 4  35  ? 0.375   -12.333 24.184 1.00 97.67  ? 32   GLU D CD    1 
ATOM   2317  O  OE1   . GLU D 4  35  ? -0.727  -12.630 24.702 1.00 93.91  ? 32   GLU D OE1   1 
ATOM   2318  O  OE2   . GLU D 4  35  ? 0.505   -11.811 23.051 1.00 96.28  ? 32   GLU D OE2   1 
ATOM   2319  N  N     . SER D 4  36  ? 1.936   -11.687 29.246 1.00 70.63  ? 33   SER D N     1 
ATOM   2320  C  CA    . SER D 4  36  ? 1.351   -11.297 30.528 1.00 64.06  ? 33   SER D CA    1 
ATOM   2321  C  C     . SER D 4  36  ? 1.006   -9.826  30.539 1.00 59.55  ? 33   SER D C     1 
ATOM   2322  O  O     . SER D 4  36  ? 1.374   -9.085  29.655 1.00 64.51  ? 33   SER D O     1 
ATOM   2323  C  CB    . SER D 4  36  ? 2.271   -11.652 31.712 1.00 63.15  ? 33   SER D CB    1 
ATOM   2324  O  OG    . SER D 4  36  ? 3.335   -10.743 31.920 1.00 61.84  ? 33   SER D OG    1 
ATOM   2325  N  N     . TYR D 4  37  ? 0.295   -9.407  31.565 1.00 57.34  ? 34   TYR D N     1 
ATOM   2326  C  CA    . TYR D 4  37  ? -0.025  -8.013  31.742 1.00 52.59  ? 34   TYR D CA    1 
ATOM   2327  C  C     . TYR D 4  37  ? 1.051   -7.260  32.543 1.00 52.78  ? 34   TYR D C     1 
ATOM   2328  O  O     . TYR D 4  37  ? 0.860   -6.100  32.924 1.00 50.58  ? 34   TYR D O     1 
ATOM   2329  C  CB    . TYR D 4  37  ? -1.345  -7.890  32.443 1.00 54.13  ? 34   TYR D CB    1 
ATOM   2330  C  CG    . TYR D 4  37  ? -2.531  -8.324  31.643 1.00 56.59  ? 34   TYR D CG    1 
ATOM   2331  C  CD1   . TYR D 4  37  ? -3.022  -9.603  31.734 1.00 59.65  ? 34   TYR D CD1   1 
ATOM   2332  C  CD2   . TYR D 4  37  ? -3.211  -7.432  30.853 1.00 60.58  ? 34   TYR D CD2   1 
ATOM   2333  C  CE1   . TYR D 4  37  ? -4.151  -9.988  31.030 1.00 64.85  ? 34   TYR D CE1   1 
ATOM   2334  C  CE2   . TYR D 4  37  ? -4.342  -7.815  30.136 1.00 62.00  ? 34   TYR D CE2   1 
ATOM   2335  C  CZ    . TYR D 4  37  ? -4.806  -9.092  30.233 1.00 58.52  ? 34   TYR D CZ    1 
ATOM   2336  O  OH    . TYR D 4  37  ? -5.929  -9.478  29.531 1.00 70.36  ? 34   TYR D OH    1 
ATOM   2337  N  N     . ALA D 4  38  ? 2.205   -7.885  32.747 1.00 55.05  ? 35   ALA D N     1 
ATOM   2338  C  CA    . ALA D 4  38  ? 3.233   -7.315  33.603 1.00 58.25  ? 35   ALA D CA    1 
ATOM   2339  C  C     . ALA D 4  38  ? 3.630   -5.872  33.261 1.00 59.08  ? 35   ALA D C     1 
ATOM   2340  O  O     . ALA D 4  38  ? 3.794   -5.042  34.154 1.00 62.31  ? 35   ALA D O     1 
ATOM   2341  C  CB    . ALA D 4  38  ? 4.464   -8.228  33.645 1.00 59.53  ? 35   ALA D CB    1 
ATOM   2342  N  N     . ILE D 4  39  ? 3.787   -5.539  31.994 1.00 61.43  ? 36   ILE D N     1 
ATOM   2343  C  CA    . ILE D 4  39  ? 4.357   -4.232  31.720 1.00 64.65  ? 36   ILE D CA    1 
ATOM   2344  C  C     . ILE D 4  39  ? 3.324   -3.184  32.022 1.00 61.91  ? 36   ILE D C     1 
ATOM   2345  O  O     . ILE D 4  39  ? 3.642   -2.108  32.498 1.00 65.94  ? 36   ILE D O     1 
ATOM   2346  C  CB    . ILE D 4  39  ? 4.950   -4.079  30.302 1.00 71.53  ? 36   ILE D CB    1 
ATOM   2347  C  CG1   . ILE D 4  39  ? 3.964   -4.484  29.224 1.00 76.18  ? 36   ILE D CG1   1 
ATOM   2348  C  CG2   . ILE D 4  39  ? 6.245   -4.892  30.163 1.00 73.10  ? 36   ILE D CG2   1 
ATOM   2349  C  CD1   . ILE D 4  39  ? 4.580   -4.371  27.855 1.00 81.72  ? 36   ILE D CD1   1 
ATOM   2350  N  N     . TYR D 4  40  ? 2.071   -3.527  31.802 1.00 62.61  ? 37   TYR D N     1 
ATOM   2351  C  CA    . TYR D 4  40  ? 0.999   -2.578  32.038 1.00 59.56  ? 37   TYR D CA    1 
ATOM   2352  C  C     . TYR D 4  40  ? 0.784   -2.415  33.528 1.00 58.43  ? 37   TYR D C     1 
ATOM   2353  O  O     . TYR D 4  40  ? 0.618   -1.306  34.015 1.00 64.70  ? 37   TYR D O     1 
ATOM   2354  C  CB    . TYR D 4  40  ? -0.258  -3.059  31.350 1.00 60.16  ? 37   TYR D CB    1 
ATOM   2355  C  CG    . TYR D 4  40  ? 0.024   -3.514  29.943 1.00 63.41  ? 37   TYR D CG    1 
ATOM   2356  C  CD1   . TYR D 4  40  ? 0.106   -4.866  29.637 1.00 66.03  ? 37   TYR D CD1   1 
ATOM   2357  C  CD2   . TYR D 4  40  ? 0.267   -2.584  28.930 1.00 64.80  ? 37   TYR D CD2   1 
ATOM   2358  C  CE1   . TYR D 4  40  ? 0.378   -5.291  28.351 1.00 71.30  ? 37   TYR D CE1   1 
ATOM   2359  C  CE2   . TYR D 4  40  ? 0.539   -2.985  27.645 1.00 70.39  ? 37   TYR D CE2   1 
ATOM   2360  C  CZ    . TYR D 4  40  ? 0.590   -4.338  27.359 1.00 79.13  ? 37   TYR D CZ    1 
ATOM   2361  O  OH    . TYR D 4  40  ? 0.864   -4.722  26.075 1.00 92.40  ? 37   TYR D OH    1 
ATOM   2362  N  N     . VAL D 4  41  ? 0.808   -3.521  34.263 1.00 54.88  ? 38   VAL D N     1 
ATOM   2363  C  CA    . VAL D 4  41  ? 0.693   -3.451  35.713 1.00 51.71  ? 38   VAL D CA    1 
ATOM   2364  C  C     . VAL D 4  41  ? 1.773   -2.527  36.262 1.00 50.64  ? 38   VAL D C     1 
ATOM   2365  O  O     . VAL D 4  41  ? 1.495   -1.731  37.145 1.00 47.10  ? 38   VAL D O     1 
ATOM   2366  C  CB    . VAL D 4  41  ? 0.803   -4.835  36.382 1.00 51.48  ? 38   VAL D CB    1 
ATOM   2367  C  CG1   . VAL D 4  41  ? 0.829   -4.674  37.889 1.00 52.77  ? 38   VAL D CG1   1 
ATOM   2368  C  CG2   . VAL D 4  41  ? -0.362  -5.725  35.979 1.00 52.22  ? 38   VAL D CG2   1 
ATOM   2369  N  N     . TYR D 4  42  ? 2.988   -2.633  35.716 1.00 51.96  ? 39   TYR D N     1 
ATOM   2370  C  CA    . TYR D 4  42  ? 4.132   -1.805  36.134 1.00 55.94  ? 39   TYR D CA    1 
ATOM   2371  C  C     . TYR D 4  42  ? 3.921   -0.305  35.792 1.00 54.53  ? 39   TYR D C     1 
ATOM   2372  O  O     . TYR D 4  42  ? 4.188   0.580   36.608 1.00 53.42  ? 39   TYR D O     1 
ATOM   2373  C  CB    . TYR D 4  42  ? 5.420   -2.346  35.491 1.00 58.95  ? 39   TYR D CB    1 
ATOM   2374  C  CG    . TYR D 4  42  ? 6.695   -1.860  36.118 1.00 67.97  ? 39   TYR D CG    1 
ATOM   2375  C  CD1   . TYR D 4  42  ? 7.061   -2.260  37.401 1.00 77.96  ? 39   TYR D CD1   1 
ATOM   2376  C  CD2   . TYR D 4  42  ? 7.550   -1.008  35.426 1.00 84.37  ? 39   TYR D CD2   1 
ATOM   2377  C  CE1   . TYR D 4  42  ? 8.235   -1.807  37.998 1.00 85.80  ? 39   TYR D CE1   1 
ATOM   2378  C  CE2   . TYR D 4  42  ? 8.735   -0.547  35.999 1.00 94.10  ? 39   TYR D CE2   1 
ATOM   2379  C  CZ    . TYR D 4  42  ? 9.079   -0.940  37.290 1.00 96.85  ? 39   TYR D CZ    1 
ATOM   2380  O  OH    . TYR D 4  42  ? 10.256  -0.465  37.864 1.00 89.67  ? 39   TYR D OH    1 
ATOM   2381  N  N     . LYS D 4  43  ? 3.426   -0.015  34.592 1.00 58.05  ? 40   LYS D N     1 
ATOM   2382  C  CA    . LYS D 4  43  ? 3.109   1.376   34.210 1.00 59.68  ? 40   LYS D CA    1 
ATOM   2383  C  C     . LYS D 4  43  ? 2.171   1.962   35.246 1.00 58.58  ? 40   LYS D C     1 
ATOM   2384  O  O     . LYS D 4  43  ? 2.452   2.995   35.848 1.00 61.63  ? 40   LYS D O     1 
ATOM   2385  C  CB    . LYS D 4  43  ? 2.451   1.452   32.834 1.00 61.41  ? 40   LYS D CB    1 
ATOM   2386  C  CG    . LYS D 4  43  ? 3.407   1.323   31.674 1.00 69.63  ? 40   LYS D CG    1 
ATOM   2387  C  CD    . LYS D 4  43  ? 2.654   1.243   30.347 1.00 79.60  ? 40   LYS D CD    1 
ATOM   2388  C  CE    . LYS D 4  43  ? 3.618   1.142   29.172 1.00 88.96  ? 40   LYS D CE    1 
ATOM   2389  N  NZ    . LYS D 4  43  ? 2.930   0.668   27.937 1.00 95.25  ? 40   LYS D NZ    1 
ATOM   2390  N  N     . VAL D 4  44  ? 1.087   1.238   35.489 1.00 56.00  ? 41   VAL D N     1 
ATOM   2391  C  CA    . VAL D 4  44  ? 0.075   1.667   36.424 1.00 55.70  ? 41   VAL D CA    1 
ATOM   2392  C  C     . VAL D 4  44  ? 0.665   1.769   37.828 1.00 56.21  ? 41   VAL D C     1 
ATOM   2393  O  O     . VAL D 4  44  ? 0.298   2.651   38.622 1.00 60.89  ? 41   VAL D O     1 
ATOM   2394  C  CB    . VAL D 4  44  ? -1.138  0.717   36.392 1.00 55.23  ? 41   VAL D CB    1 
ATOM   2395  C  CG1   . VAL D 4  44  ? -2.174  1.148   37.415 1.00 52.19  ? 41   VAL D CG1   1 
ATOM   2396  C  CG2   . VAL D 4  44  ? -1.775  0.679   34.994 1.00 53.49  ? 41   VAL D CG2   1 
ATOM   2397  N  N     . LEU D 4  45  ? 1.597   0.881   38.137 1.00 57.33  ? 42   LEU D N     1 
ATOM   2398  C  CA    . LEU D 4  45  ? 2.296   0.964   39.415 1.00 56.73  ? 42   LEU D CA    1 
ATOM   2399  C  C     . LEU D 4  45  ? 3.077   2.275   39.528 1.00 55.68  ? 42   LEU D C     1 
ATOM   2400  O  O     . LEU D 4  45  ? 3.113   2.885   40.608 1.00 55.59  ? 42   LEU D O     1 
ATOM   2401  C  CB    . LEU D 4  45  ? 3.231   -0.231  39.606 1.00 52.42  ? 42   LEU D CB    1 
ATOM   2402  C  CG    . LEU D 4  45  ? 4.078   -0.205  40.882 1.00 52.96  ? 42   LEU D CG    1 
ATOM   2403  C  CD1   . LEU D 4  45  ? 3.173   -0.115  42.101 1.00 49.12  ? 42   LEU D CD1   1 
ATOM   2404  C  CD2   . LEU D 4  45  ? 5.033   -1.410  40.979 1.00 52.59  ? 42   LEU D CD2   1 
ATOM   2405  N  N     . LYS D 4  46  ? 3.692   2.708   38.429 1.00 49.82  ? 43   LYS D N     1 
ATOM   2406  C  CA    . LYS D 4  46  ? 4.563   3.884   38.499 1.00 53.45  ? 43   LYS D CA    1 
ATOM   2407  C  C     . LYS D 4  46  ? 3.733   5.127   38.593 1.00 51.10  ? 43   LYS D C     1 
ATOM   2408  O  O     . LYS D 4  46  ? 4.061   6.048   39.337 1.00 51.74  ? 43   LYS D O     1 
ATOM   2409  C  CB    . LYS D 4  46  ? 5.545   3.929   37.316 1.00 57.20  ? 43   LYS D CB    1 
ATOM   2410  C  CG    . LYS D 4  46  ? 6.693   2.902   37.391 1.00 55.30  ? 43   LYS D CG    1 
ATOM   2411  C  CD    . LYS D 4  46  ? 7.072   2.697   38.848 1.00 57.52  ? 43   LYS D CD    1 
ATOM   2412  C  CE    . LYS D 4  46  ? 8.317   1.889   39.074 1.00 64.63  ? 43   LYS D CE    1 
ATOM   2413  N  NZ    . LYS D 4  46  ? 8.793   2.216   40.453 1.00 69.82  ? 43   LYS D NZ    1 
ATOM   2414  N  N     . GLN D 4  47  ? 2.598   5.098   37.908 1.00 48.19  ? 44   GLN D N     1 
ATOM   2415  C  CA    . GLN D 4  47  ? 1.606   6.125   38.059 1.00 46.89  ? 44   GLN D CA    1 
ATOM   2416  C  C     . GLN D 4  47  ? 1.223   6.386   39.524 1.00 48.48  ? 44   GLN D C     1 
ATOM   2417  O  O     . GLN D 4  47  ? 1.107   7.554   39.922 1.00 48.14  ? 44   GLN D O     1 
ATOM   2418  C  CB    . GLN D 4  47  ? 0.369   5.790   37.238 1.00 51.39  ? 44   GLN D CB    1 
ATOM   2419  C  CG    . GLN D 4  47  ? 0.577   5.722   35.716 1.00 53.03  ? 44   GLN D CG    1 
ATOM   2420  C  CD    . GLN D 4  47  ? -0.753  5.749   34.957 1.00 58.46  ? 44   GLN D CD    1 
ATOM   2421  O  OE1   . GLN D 4  47  ? -1.736  5.096   35.371 1.00 66.87  ? 44   GLN D OE1   1 
ATOM   2422  N  NE2   . GLN D 4  47  ? -0.810  6.520   33.865 1.00 57.75  ? 44   GLN D NE2   1 
ATOM   2423  N  N     . VAL D 4  48  ? 1.033   5.338   40.333 1.00 47.81  ? 45   VAL D N     1 
ATOM   2424  C  CA    . VAL D 4  48  ? 0.430   5.542   41.673 1.00 48.56  ? 45   VAL D CA    1 
ATOM   2425  C  C     . VAL D 4  48  ? 1.418   5.560   42.808 1.00 49.99  ? 45   VAL D C     1 
ATOM   2426  O  O     . VAL D 4  48  ? 1.214   6.264   43.810 1.00 51.66  ? 45   VAL D O     1 
ATOM   2427  C  CB    . VAL D 4  48  ? -0.695  4.543   42.023 1.00 50.39  ? 45   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D 4  48  ? -1.740  4.523   40.926 1.00 56.16  ? 45   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D 4  48  ? -0.156  3.145   42.273 1.00 53.86  ? 45   VAL D CG2   1 
ATOM   2430  N  N     . HIS D 4  49  ? 2.472   4.773   42.684 1.00 53.94  ? 46   HIS D N     1 
ATOM   2431  C  CA    . HIS D 4  49  ? 3.537   4.787   43.683 1.00 54.38  ? 46   HIS D CA    1 
ATOM   2432  C  C     . HIS D 4  49  ? 4.885   4.829   42.989 1.00 56.27  ? 46   HIS D C     1 
ATOM   2433  O  O     . HIS D 4  49  ? 5.524   3.789   42.805 1.00 56.42  ? 46   HIS D O     1 
ATOM   2434  C  CB    . HIS D 4  49  ? 3.436   3.579   44.558 1.00 51.00  ? 46   HIS D CB    1 
ATOM   2435  C  CG    . HIS D 4  49  ? 2.343   3.669   45.555 1.00 51.76  ? 46   HIS D CG    1 
ATOM   2436  N  ND1   . HIS D 4  49  ? 2.358   4.585   46.577 1.00 55.06  ? 46   HIS D ND1   1 
ATOM   2437  C  CD2   . HIS D 4  49  ? 1.205   2.955   45.702 1.00 55.76  ? 46   HIS D CD2   1 
ATOM   2438  C  CE1   . HIS D 4  49  ? 1.281   4.425   47.322 1.00 56.84  ? 46   HIS D CE1   1 
ATOM   2439  N  NE2   . HIS D 4  49  ? 0.561   3.448   46.809 1.00 59.36  ? 46   HIS D NE2   1 
ATOM   2440  N  N     . PRO D 4  50  ? 5.309   6.041   42.599 1.00 59.91  ? 47   PRO D N     1 
ATOM   2441  C  CA    . PRO D 4  50  ? 6.445   6.195   41.681 1.00 59.30  ? 47   PRO D CA    1 
ATOM   2442  C  C     . PRO D 4  50  ? 7.760   5.665   42.225 1.00 56.06  ? 47   PRO D C     1 
ATOM   2443  O  O     . PRO D 4  50  ? 8.626   5.409   41.448 1.00 57.58  ? 47   PRO D O     1 
ATOM   2444  C  CB    . PRO D 4  50  ? 6.534   7.712   41.445 1.00 60.67  ? 47   PRO D CB    1 
ATOM   2445  C  CG    . PRO D 4  50  ? 5.285   8.309   42.008 1.00 60.43  ? 47   PRO D CG    1 
ATOM   2446  C  CD    . PRO D 4  50  ? 4.740   7.341   43.024 1.00 60.65  ? 47   PRO D CD    1 
ATOM   2447  N  N     . ASP D 4  51  ? 7.894   5.455   43.529 1.00 59.52  ? 48   ASP D N     1 
ATOM   2448  C  CA    . ASP D 4  51  ? 9.148   4.910   44.064 1.00 66.41  ? 48   ASP D CA    1 
ATOM   2449  C  C     . ASP D 4  51  ? 8.997   3.521   44.647 1.00 61.86  ? 48   ASP D C     1 
ATOM   2450  O  O     . ASP D 4  51  ? 9.812   3.091   45.451 1.00 68.89  ? 48   ASP D O     1 
ATOM   2451  C  CB    . ASP D 4  51  ? 9.742   5.846   45.132 1.00 72.59  ? 48   ASP D CB    1 
ATOM   2452  C  CG    . ASP D 4  51  ? 9.994   7.263   44.606 1.00 72.37  ? 48   ASP D CG    1 
ATOM   2453  O  OD1   . ASP D 4  51  ? 10.225  7.426   43.372 1.00 61.81  ? 48   ASP D OD1   1 
ATOM   2454  O  OD2   . ASP D 4  51  ? 9.932   8.199   45.444 1.00 69.77  ? 48   ASP D OD2   1 
ATOM   2455  N  N     . THR D 4  52  ? 7.987   2.799   44.200 1.00 58.50  ? 49   THR D N     1 
ATOM   2456  C  CA    . THR D 4  52  ? 7.716   1.483   44.713 1.00 55.60  ? 49   THR D CA    1 
ATOM   2457  C  C     . THR D 4  52  ? 7.958   0.423   43.639 1.00 53.06  ? 49   THR D C     1 
ATOM   2458  O  O     . THR D 4  52  ? 7.570   0.591   42.489 1.00 52.74  ? 49   THR D O     1 
ATOM   2459  C  CB    . THR D 4  52  ? 6.269   1.450   45.178 1.00 58.37  ? 49   THR D CB    1 
ATOM   2460  O  OG1   . THR D 4  52  ? 6.094   2.468   46.155 1.00 54.53  ? 49   THR D OG1   1 
ATOM   2461  C  CG2   . THR D 4  52  ? 5.907   0.118   45.785 1.00 60.76  ? 49   THR D CG2   1 
ATOM   2462  N  N     . GLY D 4  53  ? 8.611   -0.664  44.026 1.00 51.41  ? 50   GLY D N     1 
ATOM   2463  C  CA    . GLY D 4  53  ? 8.782   -1.810  43.141 1.00 55.82  ? 50   GLY D CA    1 
ATOM   2464  C  C     . GLY D 4  53  ? 7.823   -2.967  43.453 1.00 59.38  ? 50   GLY D C     1 
ATOM   2465  O  O     . GLY D 4  53  ? 7.096   -2.980  44.447 1.00 60.08  ? 50   GLY D O     1 
ATOM   2466  N  N     . ILE D 4  54  ? 7.838   -3.972  42.601 1.00 59.27  ? 51   ILE D N     1 
ATOM   2467  C  CA    . ILE D 4  54  ? 7.016   -5.119  42.823 1.00 57.06  ? 51   ILE D CA    1 
ATOM   2468  C  C     . ILE D 4  54  ? 7.838   -6.343  42.515 1.00 56.48  ? 51   ILE D C     1 
ATOM   2469  O  O     . ILE D 4  54  ? 8.520   -6.369  41.499 1.00 60.95  ? 51   ILE D O     1 
ATOM   2470  C  CB    . ILE D 4  54  ? 5.774   -5.059  41.940 1.00 55.41  ? 51   ILE D CB    1 
ATOM   2471  C  CG1   . ILE D 4  54  ? 4.812   -6.193  42.310 1.00 54.94  ? 51   ILE D CG1   1 
ATOM   2472  C  CG2   . ILE D 4  54  ? 6.166   -5.081  40.471 1.00 50.76  ? 51   ILE D CG2   1 
ATOM   2473  C  CD1   . ILE D 4  54  ? 3.459   -6.051  41.642 1.00 58.66  ? 51   ILE D CD1   1 
ATOM   2474  N  N     . SER D 4  55  ? 7.756   -7.338  43.399 1.00 54.96  ? 52   SER D N     1 
ATOM   2475  C  CA    . SER D 4  55  ? 8.480   -8.607  43.268 1.00 57.16  ? 52   SER D CA    1 
ATOM   2476  C  C     . SER D 4  55  ? 7.809   -9.478  42.216 1.00 54.16  ? 52   SER D C     1 
ATOM   2477  O  O     . SER D 4  55  ? 6.633   -9.318  41.966 1.00 53.77  ? 52   SER D O     1 
ATOM   2478  C  CB    . SER D 4  55  ? 8.473   -9.363  44.586 1.00 58.31  ? 52   SER D CB    1 
ATOM   2479  O  OG    . SER D 4  55  ? 7.233   -10.049 44.716 1.00 63.66  ? 52   SER D OG    1 
ATOM   2480  N  N     . SER D 4  56  ? 8.544   -10.411 41.617 1.00 52.83  ? 53   SER D N     1 
ATOM   2481  C  CA    . SER D 4  56  ? 7.978   -11.181 40.522 1.00 54.43  ? 53   SER D CA    1 
ATOM   2482  C  C     . SER D 4  56  ? 6.810   -12.069 40.974 1.00 55.87  ? 53   SER D C     1 
ATOM   2483  O  O     . SER D 4  56  ? 5.916   -12.373 40.154 1.00 56.69  ? 53   SER D O     1 
ATOM   2484  C  CB    . SER D 4  56  ? 9.030   -12.064 39.887 1.00 54.33  ? 53   SER D CB    1 
ATOM   2485  O  OG    . SER D 4  56  ? 9.354   -13.058 40.820 1.00 59.23  ? 53   SER D OG    1 
ATOM   2486  N  N     . LYS D 4  57  ? 6.833   -12.516 42.238 1.00 51.13  ? 54   LYS D N     1 
ATOM   2487  C  CA    . LYS D 4  57  ? 5.741   -13.319 42.762 1.00 51.93  ? 54   LYS D CA    1 
ATOM   2488  C  C     . LYS D 4  57  ? 4.532   -12.419 42.939 1.00 54.57  ? 54   LYS D C     1 
ATOM   2489  O  O     . LYS D 4  57  ? 3.408   -12.810 42.598 1.00 53.30  ? 54   LYS D O     1 
ATOM   2490  C  CB    . LYS D 4  57  ? 6.082   -13.971 44.095 1.00 62.13  ? 54   LYS D CB    1 
ATOM   2491  C  CG    . LYS D 4  57  ? 6.878   -15.268 44.026 1.00 74.62  ? 54   LYS D CG    1 
ATOM   2492  C  CD    . LYS D 4  57  ? 7.063   -15.843 45.441 1.00 89.76  ? 54   LYS D CD    1 
ATOM   2493  C  CE    . LYS D 4  57  ? 8.157   -16.916 45.546 1.00 93.46  ? 54   LYS D CE    1 
ATOM   2494  N  NZ    . LYS D 4  57  ? 9.413   -16.421 46.203 1.00 92.99  ? 54   LYS D NZ    1 
ATOM   2495  N  N     . ALA D 4  58  ? 4.761   -11.204 43.446 1.00 48.64  ? 55   ALA D N     1 
ATOM   2496  C  CA    . ALA D 4  58  ? 3.681   -10.245 43.548 1.00 45.38  ? 55   ALA D CA    1 
ATOM   2497  C  C     . ALA D 4  58  ? 3.170   -9.915  42.188 1.00 43.31  ? 55   ALA D C     1 
ATOM   2498  O  O     . ALA D 4  58  ? 1.980   -9.798  42.013 1.00 49.12  ? 55   ALA D O     1 
ATOM   2499  C  CB    . ALA D 4  58  ? 4.095   -8.993  44.281 1.00 48.89  ? 55   ALA D CB    1 
ATOM   2500  N  N     . MET D 4  59  ? 4.037   -9.799  41.193 1.00 48.46  ? 56   MET D N     1 
ATOM   2501  C  CA    . MET D 4  59  ? 3.541   -9.547  39.826 1.00 52.53  ? 56   MET D CA    1 
ATOM   2502  C  C     . MET D 4  59  ? 2.786   -10.771 39.300 1.00 49.11  ? 56   MET D C     1 
ATOM   2503  O  O     . MET D 4  59  ? 1.820   -10.648 38.538 1.00 48.36  ? 56   MET D O     1 
ATOM   2504  C  CB    . MET D 4  59  ? 4.665   -9.160  38.867 1.00 52.81  ? 56   MET D CB    1 
ATOM   2505  C  CG    . MET D 4  59  ? 4.218   -8.918  37.413 1.00 55.30  ? 56   MET D CG    1 
ATOM   2506  S  SD    . MET D 4  59  ? 3.185   -7.439  37.272 1.00 59.63  ? 56   MET D SD    1 
ATOM   2507  C  CE    . MET D 4  59  ? 4.458   -6.174  37.276 1.00 55.91  ? 56   MET D CE    1 
ATOM   2508  N  N     . SER D 4  60  ? 3.191   -11.952 39.721 1.00 44.43  ? 57   SER D N     1 
ATOM   2509  C  CA    . SER D 4  60  ? 2.542   -13.128 39.173 1.00 49.66  ? 57   SER D CA    1 
ATOM   2510  C  C     . SER D 4  60  ? 1.043   -13.167 39.535 1.00 49.27  ? 57   SER D C     1 
ATOM   2511  O  O     . SER D 4  60  ? 0.182   -13.434 38.699 1.00 48.21  ? 57   SER D O     1 
ATOM   2512  C  CB    . SER D 4  60  ? 3.230   -14.362 39.661 1.00 47.36  ? 57   SER D CB    1 
ATOM   2513  O  OG    . SER D 4  60  ? 2.702   -15.424 38.929 1.00 60.26  ? 57   SER D OG    1 
ATOM   2514  N  N     . ILE D 4  61  ? 0.793   -12.865 40.801 1.00 44.93  ? 58   ILE D N     1 
ATOM   2515  C  CA    . ILE D 4  61  ? -0.524  -12.670 41.386 1.00 47.65  ? 58   ILE D CA    1 
ATOM   2516  C  C     . ILE D 4  61  ? -1.276  -11.504 40.750 1.00 50.13  ? 58   ILE D C     1 
ATOM   2517  O  O     . ILE D 4  61  ? -2.473  -11.608 40.484 1.00 44.40  ? 58   ILE D O     1 
ATOM   2518  C  CB    . ILE D 4  61  ? -0.368  -12.358 42.897 1.00 46.02  ? 58   ILE D CB    1 
ATOM   2519  C  CG1   . ILE D 4  61  ? 0.042   -13.627 43.646 1.00 46.14  ? 58   ILE D CG1   1 
ATOM   2520  C  CG2   . ILE D 4  61  ? -1.636  -11.754 43.460 1.00 43.75  ? 58   ILE D CG2   1 
ATOM   2521  C  CD1   . ILE D 4  61  ? 0.797   -13.306 44.900 1.00 49.09  ? 58   ILE D CD1   1 
ATOM   2522  N  N     . MET D 4  62  ? -0.598  -10.378 40.538 1.00 48.30  ? 59   MET D N     1 
ATOM   2523  C  CA    . MET D 4  62  ? -1.261  -9.320  39.800 1.00 54.62  ? 59   MET D CA    1 
ATOM   2524  C  C     . MET D 4  62  ? -1.677  -9.852  38.428 1.00 51.62  ? 59   MET D C     1 
ATOM   2525  O  O     . MET D 4  62  ? -2.818  -9.624  37.987 1.00 45.00  ? 59   MET D O     1 
ATOM   2526  C  CB    . MET D 4  62  ? -0.397  -8.073  39.667 1.00 52.94  ? 59   MET D CB    1 
ATOM   2527  C  CG    . MET D 4  62  ? -0.205  -7.296  40.964 1.00 50.22  ? 59   MET D CG    1 
ATOM   2528  S  SD    . MET D 4  62  ? -1.713  -6.861  41.798 1.00 48.92  ? 59   MET D SD    1 
ATOM   2529  C  CE    . MET D 4  62  ? -2.663  -6.144  40.489 1.00 44.74  ? 59   MET D CE    1 
ATOM   2530  N  N     . ASN D 4  63  ? -0.793  -10.606 37.779 1.00 51.02  ? 60   ASN D N     1 
ATOM   2531  C  CA    . ASN D 4  63  ? -1.173  -11.154 36.487 1.00 56.92  ? 60   ASN D CA    1 
ATOM   2532  C  C     . ASN D 4  63  ? -2.390  -12.084 36.541 1.00 56.76  ? 60   ASN D C     1 
ATOM   2533  O  O     . ASN D 4  63  ? -3.253  -12.022 35.651 1.00 47.98  ? 60   ASN D O     1 
ATOM   2534  C  CB    . ASN D 4  63  ? -0.029  -11.859 35.783 1.00 58.03  ? 60   ASN D CB    1 
ATOM   2535  C  CG    . ASN D 4  63  ? -0.298  -12.003 34.295 1.00 58.07  ? 60   ASN D CG    1 
ATOM   2536  O  OD1   . ASN D 4  63  ? -0.600  -11.037 33.639 1.00 60.63  ? 60   ASN D OD1   1 
ATOM   2537  N  ND2   . ASN D 4  63  ? -0.216  -13.204 33.773 1.00 62.99  ? 60   ASN D ND2   1 
ATOM   2538  N  N     . SER D 4  64  ? -2.434  -12.932 37.580 1.00 52.01  ? 61   SER D N     1 
ATOM   2539  C  CA    . SER D 4  64  ? -3.538  -13.854 37.789 1.00 51.78  ? 61   SER D CA    1 
ATOM   2540  C  C     . SER D 4  64  ? -4.838  -13.093 37.990 1.00 55.73  ? 61   SER D C     1 
ATOM   2541  O  O     . SER D 4  64  ? -5.877  -13.435 37.410 1.00 59.91  ? 61   SER D O     1 
ATOM   2542  C  CB    . SER D 4  64  ? -3.313  -14.716 39.031 1.00 55.61  ? 61   SER D CB    1 
ATOM   2543  O  OG    . SER D 4  64  ? -2.289  -15.680 38.849 1.00 59.33  ? 61   SER D OG    1 
ATOM   2544  N  N     . PHE D 4  65  ? -4.761  -12.069 38.832 1.00 55.30  ? 62   PHE D N     1 
ATOM   2545  C  CA    . PHE D 4  65  ? -5.901  -11.208 39.151 1.00 53.95  ? 62   PHE D CA    1 
ATOM   2546  C  C     . PHE D 4  65  ? -6.512  -10.585 37.927 1.00 54.54  ? 62   PHE D C     1 
ATOM   2547  O  O     . PHE D 4  65  ? -7.740  -10.612 37.783 1.00 56.75  ? 62   PHE D O     1 
ATOM   2548  C  CB    . PHE D 4  65  ? -5.474  -10.109 40.112 1.00 52.83  ? 62   PHE D CB    1 
ATOM   2549  C  CG    . PHE D 4  65  ? -6.470  -9.024  40.279 1.00 49.92  ? 62   PHE D CG    1 
ATOM   2550  C  CD1   . PHE D 4  65  ? -7.675  -9.266  40.892 1.00 53.39  ? 62   PHE D CD1   1 
ATOM   2551  C  CD2   . PHE D 4  65  ? -6.184  -7.738  39.853 1.00 54.96  ? 62   PHE D CD2   1 
ATOM   2552  C  CE1   . PHE D 4  65  ? -8.609  -8.252  41.067 1.00 53.01  ? 62   PHE D CE1   1 
ATOM   2553  C  CE2   . PHE D 4  65  ? -7.095  -6.718  40.015 1.00 50.72  ? 62   PHE D CE2   1 
ATOM   2554  C  CZ    . PHE D 4  65  ? -8.315  -6.980  40.617 1.00 54.21  ? 62   PHE D CZ    1 
ATOM   2555  N  N     . VAL D 4  66  ? -5.678  -10.051 37.031 1.00 53.19  ? 63   VAL D N     1 
ATOM   2556  C  CA    . VAL D 4  66  ? -6.221  -9.475  35.786 1.00 52.56  ? 63   VAL D CA    1 
ATOM   2557  C  C     . VAL D 4  66  ? -6.874  -10.549 34.918 1.00 50.98  ? 63   VAL D C     1 
ATOM   2558  O  O     . VAL D 4  66  ? -7.997  -10.357 34.460 1.00 50.72  ? 63   VAL D O     1 
ATOM   2559  C  CB    . VAL D 4  66  ? -5.176  -8.741  34.936 1.00 53.18  ? 63   VAL D CB    1 
ATOM   2560  C  CG1   . VAL D 4  66  ? -5.839  -8.148  33.716 1.00 54.34  ? 63   VAL D CG1   1 
ATOM   2561  C  CG2   . VAL D 4  66  ? -4.500  -7.636  35.724 1.00 53.35  ? 63   VAL D CG2   1 
ATOM   2562  N  N     . ASN D 4  67  ? -6.186  -11.674 34.699 1.00 47.95  ? 64   ASN D N     1 
ATOM   2563  C  CA    . ASN D 4  67  ? -6.780  -12.769 33.948 1.00 45.57  ? 64   ASN D CA    1 
ATOM   2564  C  C     . ASN D 4  67  ? -8.081  -13.229 34.560 1.00 46.68  ? 64   ASN D C     1 
ATOM   2565  O  O     . ASN D 4  67  ? -9.036  -13.494 33.843 1.00 50.63  ? 64   ASN D O     1 
ATOM   2566  C  CB    . ASN D 4  67  ? -5.839  -13.931 33.871 1.00 47.63  ? 64   ASN D CB    1 
ATOM   2567  C  CG    . ASN D 4  67  ? -4.629  -13.633 33.008 1.00 55.10  ? 64   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D 4  67  ? -4.760  -13.288 31.833 1.00 61.39  ? 64   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D 4  67  ? -3.439  -13.748 33.588 1.00 57.63  ? 64   ASN D ND2   1 
ATOM   2570  N  N     . ASP D 4  68  ? -8.128  -13.300 35.883 1.00 45.21  ? 65   ASP D N     1 
ATOM   2571  C  CA    . ASP D 4  68  ? -9.305  -13.760 36.581 1.00 46.89  ? 65   ASP D CA    1 
ATOM   2572  C  C     . ASP D 4  68  ? -10.521 -12.837 36.379 1.00 49.58  ? 65   ASP D C     1 
ATOM   2573  O  O     . ASP D 4  68  ? -11.575 -13.263 35.906 1.00 52.90  ? 65   ASP D O     1 
ATOM   2574  C  CB    . ASP D 4  68  ? -8.982  -13.937 38.074 1.00 50.98  ? 65   ASP D CB    1 
ATOM   2575  C  CG    . ASP D 4  68  ? -10.112 -14.626 38.851 1.00 53.64  ? 65   ASP D CG    1 
ATOM   2576  O  OD1   . ASP D 4  68  ? -10.848 -15.464 38.261 1.00 61.29  ? 65   ASP D OD1   1 
ATOM   2577  O  OD2   . ASP D 4  68  ? -10.271 -14.312 40.051 1.00 51.47  ? 65   ASP D OD2   1 
ATOM   2578  N  N     . VAL D 4  69  ? -10.368 -11.572 36.721 1.00 49.50  ? 66   VAL D N     1 
ATOM   2579  C  CA    . VAL D 4  69  ? -11.418 -10.594 36.475 1.00 49.19  ? 66   VAL D CA    1 
ATOM   2580  C  C     . VAL D 4  69  ? -11.827 -10.487 34.981 1.00 48.43  ? 66   VAL D C     1 
ATOM   2581  O  O     . VAL D 4  69  ? -13.006 -10.307 34.664 1.00 49.54  ? 66   VAL D O     1 
ATOM   2582  C  CB    . VAL D 4  69  ? -10.989 -9.218  37.009 1.00 50.83  ? 66   VAL D CB    1 
ATOM   2583  C  CG1   . VAL D 4  69  ? -12.045 -8.163  36.694 1.00 53.76  ? 66   VAL D CG1   1 
ATOM   2584  C  CG2   . VAL D 4  69  ? -10.776 -9.297  38.515 1.00 52.22  ? 66   VAL D CG2   1 
ATOM   2585  N  N     . PHE D 4  70  ? -10.872 -10.588 34.066 1.00 47.80  ? 67   PHE D N     1 
ATOM   2586  C  CA    . PHE D 4  70  ? -11.196 -10.619 32.643 1.00 49.37  ? 67   PHE D CA    1 
ATOM   2587  C  C     . PHE D 4  70  ? -12.132 -11.785 32.387 1.00 49.69  ? 67   PHE D C     1 
ATOM   2588  O  O     . PHE D 4  70  ? -13.151 -11.621 31.753 1.00 50.50  ? 67   PHE D O     1 
ATOM   2589  C  CB    . PHE D 4  70  ? -9.927  -10.768 31.796 1.00 54.53  ? 67   PHE D CB    1 
ATOM   2590  C  CG    . PHE D 4  70  ? -10.180 -10.950 30.312 1.00 61.03  ? 67   PHE D CG    1 
ATOM   2591  C  CD1   . PHE D 4  70  ? -9.865  -9.938  29.412 1.00 60.09  ? 67   PHE D CD1   1 
ATOM   2592  C  CD2   . PHE D 4  70  ? -10.690 -12.148 29.802 1.00 66.13  ? 67   PHE D CD2   1 
ATOM   2593  C  CE1   . PHE D 4  70  ? -10.088 -10.098 28.058 1.00 60.16  ? 67   PHE D CE1   1 
ATOM   2594  C  CE2   . PHE D 4  70  ? -10.902 -12.315 28.432 1.00 64.61  ? 67   PHE D CE2   1 
ATOM   2595  C  CZ    . PHE D 4  70  ? -10.606 -11.287 27.565 1.00 63.46  ? 67   PHE D CZ    1 
ATOM   2596  N  N     . GLU D 4  71  ? -11.773 -12.970 32.870 1.00 51.96  ? 68   GLU D N     1 
ATOM   2597  C  CA    . GLU D 4  71  ? -12.559 -14.154 32.572 1.00 55.22  ? 68   GLU D CA    1 
ATOM   2598  C  C     . GLU D 4  71  ? -13.936 -14.032 33.184 1.00 52.24  ? 68   GLU D C     1 
ATOM   2599  O  O     . GLU D 4  71  ? -14.928 -14.339 32.542 1.00 49.42  ? 68   GLU D O     1 
ATOM   2600  C  CB    . GLU D 4  71  ? -11.848 -15.440 33.002 1.00 65.34  ? 68   GLU D CB    1 
ATOM   2601  C  CG    . GLU D 4  71  ? -10.903 -15.980 31.918 1.00 79.77  ? 68   GLU D CG    1 
ATOM   2602  C  CD    . GLU D 4  71  ? -9.508  -16.409 32.428 1.00 92.10  ? 68   GLU D CD    1 
ATOM   2603  O  OE1   . GLU D 4  71  ? -9.421  -17.246 33.369 1.00 75.44  ? 68   GLU D OE1   1 
ATOM   2604  O  OE2   . GLU D 4  71  ? -8.482  -15.916 31.866 1.00 94.86  ? 68   GLU D OE2   1 
ATOM   2605  N  N     . ARG D 4  72  ? -14.012 -13.530 34.405 1.00 50.80  ? 69   ARG D N     1 
ATOM   2606  C  CA    . ARG D 4  72  ? -15.303 -13.384 35.054 1.00 47.70  ? 69   ARG D CA    1 
ATOM   2607  C  C     . ARG D 4  72  ? -16.204 -12.327 34.427 1.00 52.27  ? 69   ARG D C     1 
ATOM   2608  O  O     . ARG D 4  72  ? -17.419 -12.504 34.397 1.00 56.60  ? 69   ARG D O     1 
ATOM   2609  C  CB    . ARG D 4  72  ? -15.109 -13.021 36.492 1.00 48.89  ? 69   ARG D CB    1 
ATOM   2610  C  CG    . ARG D 4  72  ? -14.382 -14.063 37.324 1.00 52.68  ? 69   ARG D CG    1 
ATOM   2611  C  CD    . ARG D 4  72  ? -14.793 -13.890 38.788 1.00 52.36  ? 69   ARG D CD    1 
ATOM   2612  N  NE    . ARG D 4  72  ? -13.643 -13.697 39.631 1.00 48.00  ? 69   ARG D NE    1 
ATOM   2613  C  CZ    . ARG D 4  72  ? -13.689 -13.218 40.856 1.00 49.48  ? 69   ARG D CZ    1 
ATOM   2614  N  NH1   . ARG D 4  72  ? -14.827 -12.853 41.405 1.00 44.24  ? 69   ARG D NH1   1 
ATOM   2615  N  NH2   . ARG D 4  72  ? -12.552 -13.093 41.526 1.00 59.97  ? 69   ARG D NH2   1 
ATOM   2616  N  N     . ILE D 4  73  ? -15.647 -11.212 33.950 1.00 55.29  ? 70   ILE D N     1 
ATOM   2617  C  CA    . ILE D 4  73  ? -16.502 -10.207 33.282 1.00 53.47  ? 70   ILE D CA    1 
ATOM   2618  C  C     . ILE D 4  73  ? -16.961 -10.734 31.945 1.00 53.66  ? 70   ILE D C     1 
ATOM   2619  O  O     . ILE D 4  73  ? -18.145 -10.601 31.597 1.00 56.18  ? 70   ILE D O     1 
ATOM   2620  C  CB    . ILE D 4  73  ? -15.816 -8.853  33.079 1.00 50.54  ? 70   ILE D CB    1 
ATOM   2621  C  CG1   . ILE D 4  73  ? -15.659 -8.138  34.424 1.00 51.88  ? 70   ILE D CG1   1 
ATOM   2622  C  CG2   . ILE D 4  73  ? -16.645 -7.984  32.154 1.00 49.93  ? 70   ILE D CG2   1 
ATOM   2623  C  CD1   . ILE D 4  73  ? -14.551 -7.118  34.446 1.00 53.61  ? 70   ILE D CD1   1 
ATOM   2624  N  N     . ALA D 4  74  ? -16.023 -11.341 31.216 1.00 50.55  ? 71   ALA D N     1 
ATOM   2625  C  CA    . ALA D 4  74  ? -16.286 -11.854 29.870 1.00 54.84  ? 71   ALA D CA    1 
ATOM   2626  C  C     . ALA D 4  74  ? -17.337 -12.954 29.890 1.00 53.78  ? 71   ALA D C     1 
ATOM   2627  O  O     . ALA D 4  74  ? -18.142 -13.053 28.985 1.00 60.84  ? 71   ALA D O     1 
ATOM   2628  C  CB    . ALA D 4  74  ? -15.000 -12.367 29.232 1.00 54.80  ? 71   ALA D CB    1 
ATOM   2629  N  N     . GLY D 4  75  ? -17.314 -13.776 30.926 1.00 52.36  ? 72   GLY D N     1 
ATOM   2630  C  CA    . GLY D 4  75  ? -18.296 -14.824 31.096 1.00 53.52  ? 72   GLY D CA    1 
ATOM   2631  C  C     . GLY D 4  75  ? -19.694 -14.288 31.352 1.00 57.26  ? 72   GLY D C     1 
ATOM   2632  O  O     . GLY D 4  75  ? -20.640 -14.701 30.687 1.00 56.18  ? 72   GLY D O     1 
ATOM   2633  N  N     . GLU D 4  76  ? -19.833 -13.376 32.316 1.00 58.14  ? 73   GLU D N     1 
ATOM   2634  C  CA    . GLU D 4  76  ? -21.136 -12.765 32.591 1.00 61.92  ? 73   GLU D CA    1 
ATOM   2635  C  C     . GLU D 4  76  ? -21.672 -12.145 31.321 1.00 63.15  ? 73   GLU D C     1 
ATOM   2636  O  O     . GLU D 4  76  ? -22.865 -12.203 31.067 1.00 70.52  ? 73   GLU D O     1 
ATOM   2637  C  CB    . GLU D 4  76  ? -21.031 -11.650 33.633 1.00 64.66  ? 73   GLU D CB    1 
ATOM   2638  C  CG    . GLU D 4  76  ? -20.674 -12.112 35.025 1.00 71.05  ? 73   GLU D CG    1 
ATOM   2639  C  CD    . GLU D 4  76  ? -21.828 -12.768 35.757 1.00 73.14  ? 73   GLU D CD    1 
ATOM   2640  O  OE1   . GLU D 4  76  ? -23.007 -12.678 35.287 1.00 73.61  ? 73   GLU D OE1   1 
ATOM   2641  O  OE2   . GLU D 4  76  ? -21.527 -13.369 36.819 1.00 67.74  ? 73   GLU D OE2   1 
ATOM   2642  N  N     . ALA D 4  77  ? -20.790 -11.517 30.542 1.00 58.60  ? 74   ALA D N     1 
ATOM   2643  C  CA    . ALA D 4  77  ? -21.207 -10.836 29.330 1.00 58.75  ? 74   ALA D CA    1 
ATOM   2644  C  C     . ALA D 4  77  ? -21.690 -11.862 28.332 1.00 57.26  ? 74   ALA D C     1 
ATOM   2645  O  O     . ALA D 4  77  ? -22.696 -11.670 27.675 1.00 55.76  ? 74   ALA D O     1 
ATOM   2646  C  CB    . ALA D 4  77  ? -20.060 -10.027 28.756 1.00 59.77  ? 74   ALA D CB    1 
ATOM   2647  N  N     . SER D 4  78  ? -20.969 -12.972 28.257 1.00 56.19  ? 75   SER D N     1 
ATOM   2648  C  CA    . SER D 4  78  ? -21.339 -14.070 27.400 1.00 54.62  ? 75   SER D CA    1 
ATOM   2649  C  C     . SER D 4  78  ? -22.755 -14.564 27.675 1.00 54.91  ? 75   SER D C     1 
ATOM   2650  O  O     . SER D 4  78  ? -23.573 -14.668 26.759 1.00 62.29  ? 75   SER D O     1 
ATOM   2651  C  CB    . SER D 4  78  ? -20.355 -15.215 27.573 1.00 52.38  ? 75   SER D CB    1 
ATOM   2652  O  OG    . SER D 4  78  ? -20.612 -16.230 26.613 1.00 56.24  ? 75   SER D OG    1 
ATOM   2653  N  N     . ARG D 4  79  ? -23.014 -14.883 28.934 1.00 55.72  ? 76   ARG D N     1 
ATOM   2654  C  CA    . ARG D 4  79  ? -24.309 -15.363 29.384 1.00 58.96  ? 76   ARG D CA    1 
ATOM   2655  C  C     . ARG D 4  79  ? -25.389 -14.331 29.079 1.00 61.24  ? 76   ARG D C     1 
ATOM   2656  O  O     . ARG D 4  79  ? -26.427 -14.643 28.494 1.00 70.08  ? 76   ARG D O     1 
ATOM   2657  C  CB    . ARG D 4  79  ? -24.278 -15.634 30.896 1.00 57.81  ? 76   ARG D CB    1 
ATOM   2658  C  CG    . ARG D 4  79  ? -23.999 -17.070 31.292 1.00 57.98  ? 76   ARG D CG    1 
ATOM   2659  C  CD    . ARG D 4  79  ? -23.512 -17.194 32.741 1.00 56.37  ? 76   ARG D CD    1 
ATOM   2660  N  NE    . ARG D 4  79  ? -22.067 -17.423 32.723 1.00 62.14  ? 76   ARG D NE    1 
ATOM   2661  C  CZ    . ARG D 4  79  ? -21.179 -16.899 33.565 1.00 59.46  ? 76   ARG D CZ    1 
ATOM   2662  N  NH1   . ARG D 4  79  ? -21.544 -16.107 34.564 1.00 61.05  ? 76   ARG D NH1   1 
ATOM   2663  N  NH2   . ARG D 4  79  ? -19.898 -17.172 33.392 1.00 61.68  ? 76   ARG D NH2   1 
ATOM   2664  N  N     . LEU D 4  80  ? -25.125 -13.101 29.482 1.00 59.06  ? 77   LEU D N     1 
ATOM   2665  C  CA    . LEU D 4  80  ? -26.054 -11.997 29.290 1.00 65.38  ? 77   LEU D CA    1 
ATOM   2666  C  C     . LEU D 4  80  ? -26.513 -11.855 27.830 1.00 61.33  ? 77   LEU D C     1 
ATOM   2667  O  O     . LEU D 4  80  ? -27.700 -11.721 27.540 1.00 63.73  ? 77   LEU D O     1 
ATOM   2668  C  CB    . LEU D 4  80  ? -25.372 -10.713 29.744 1.00 66.73  ? 77   LEU D CB    1 
ATOM   2669  C  CG    . LEU D 4  80  ? -26.261 -9.504  29.968 1.00 70.12  ? 77   LEU D CG    1 
ATOM   2670  C  CD1   . LEU D 4  80  ? -27.184 -9.696  31.161 1.00 65.89  ? 77   LEU D CD1   1 
ATOM   2671  C  CD2   . LEU D 4  80  ? -25.347 -8.307  30.177 1.00 77.72  ? 77   LEU D CD2   1 
ATOM   2672  N  N     . ALA D 4  81  ? -25.553 -11.879 26.924 1.00 58.24  ? 78   ALA D N     1 
ATOM   2673  C  CA    . ALA D 4  81  ? -25.836 -11.849 25.510 1.00 64.47  ? 78   ALA D CA    1 
ATOM   2674  C  C     . ALA D 4  81  ? -26.773 -12.988 25.137 1.00 68.44  ? 78   ALA D C     1 
ATOM   2675  O  O     . ALA D 4  81  ? -27.813 -12.763 24.499 1.00 67.62  ? 78   ALA D O     1 
ATOM   2676  C  CB    . ALA D 4  81  ? -24.541 -11.960 24.722 1.00 66.12  ? 78   ALA D CB    1 
ATOM   2677  N  N     . HIS D 4  82  ? -26.411 -14.205 25.546 1.00 66.95  ? 79   HIS D N     1 
ATOM   2678  C  CA    . HIS D 4  82  ? -27.217 -15.362 25.206 1.00 67.80  ? 79   HIS D CA    1 
ATOM   2679  C  C     . HIS D 4  82  ? -28.611 -15.150 25.742 1.00 65.11  ? 79   HIS D C     1 
ATOM   2680  O  O     . HIS D 4  82  ? -29.550 -15.167 24.995 1.00 68.00  ? 79   HIS D O     1 
ATOM   2681  C  CB    . HIS D 4  82  ? -26.603 -16.670 25.706 1.00 75.97  ? 79   HIS D CB    1 
ATOM   2682  C  CG    . HIS D 4  82  ? -25.506 -17.195 24.820 1.00 97.26  ? 79   HIS D CG    1 
ATOM   2683  N  ND1   . HIS D 4  82  ? -25.725 -17.586 23.513 1.00 106.79 ? 79   HIS D ND1   1 
ATOM   2684  C  CD2   . HIS D 4  82  ? -24.181 -17.383 25.049 1.00 99.87  ? 79   HIS D CD2   1 
ATOM   2685  C  CE1   . HIS D 4  82  ? -24.585 -17.987 22.977 1.00 106.25 ? 79   HIS D CE1   1 
ATOM   2686  N  NE2   . HIS D 4  82  ? -23.634 -17.878 23.889 1.00 100.92 ? 79   HIS D NE2   1 
ATOM   2687  N  N     . TYR D 4  83  ? -28.737 -14.859 27.022 1.00 67.70  ? 80   TYR D N     1 
ATOM   2688  C  CA    . TYR D 4  83  ? -30.041 -14.678 27.620 1.00 70.60  ? 80   TYR D CA    1 
ATOM   2689  C  C     . TYR D 4  83  ? -30.908 -13.741 26.777 1.00 70.18  ? 80   TYR D C     1 
ATOM   2690  O  O     . TYR D 4  83  ? -32.113 -13.940 26.667 1.00 61.46  ? 80   TYR D O     1 
ATOM   2691  C  CB    . TYR D 4  83  ? -29.910 -14.114 29.040 1.00 75.30  ? 80   TYR D CB    1 
ATOM   2692  C  CG    . TYR D 4  83  ? -29.150 -14.974 30.042 1.00 78.81  ? 80   TYR D CG    1 
ATOM   2693  C  CD1   . TYR D 4  83  ? -28.667 -14.414 31.223 1.00 81.41  ? 80   TYR D CD1   1 
ATOM   2694  C  CD2   . TYR D 4  83  ? -28.901 -16.335 29.820 1.00 80.94  ? 80   TYR D CD2   1 
ATOM   2695  C  CE1   . TYR D 4  83  ? -27.977 -15.172 32.161 1.00 74.80  ? 80   TYR D CE1   1 
ATOM   2696  C  CE2   . TYR D 4  83  ? -28.206 -17.095 30.755 1.00 77.55  ? 80   TYR D CE2   1 
ATOM   2697  C  CZ    . TYR D 4  83  ? -27.747 -16.505 31.930 1.00 74.92  ? 80   TYR D CZ    1 
ATOM   2698  O  OH    . TYR D 4  83  ? -27.060 -17.241 32.888 1.00 75.74  ? 80   TYR D OH    1 
ATOM   2699  N  N     . ASN D 4  84  ? -30.286 -12.727 26.185 1.00 71.22  ? 81   ASN D N     1 
ATOM   2700  C  CA    . ASN D 4  84  ? -31.001 -11.757 25.366 1.00 72.98  ? 81   ASN D CA    1 
ATOM   2701  C  C     . ASN D 4  84  ? -30.948 -12.030 23.863 1.00 75.04  ? 81   ASN D C     1 
ATOM   2702  O  O     . ASN D 4  84  ? -31.212 -11.134 23.075 1.00 83.06  ? 81   ASN D O     1 
ATOM   2703  C  CB    . ASN D 4  84  ? -30.444 -10.362 25.643 1.00 75.15  ? 81   ASN D CB    1 
ATOM   2704  C  CG    . ASN D 4  84  ? -30.880 -9.824  26.980 1.00 73.03  ? 81   ASN D CG    1 
ATOM   2705  O  OD1   . ASN D 4  84  ? -31.942 -9.207  27.092 1.00 72.92  ? 81   ASN D OD1   1 
ATOM   2706  N  ND2   . ASN D 4  84  ? -30.066 -10.052 28.008 1.00 72.32  ? 81   ASN D ND2   1 
ATOM   2707  N  N     . LYS D 4  85  ? -30.613 -13.256 23.466 1.00 78.44  ? 82   LYS D N     1 
ATOM   2708  C  CA    . LYS D 4  85  ? -30.533 -13.655 22.043 1.00 78.73  ? 82   LYS D CA    1 
ATOM   2709  C  C     . LYS D 4  85  ? -29.824 -12.598 21.189 1.00 73.28  ? 82   LYS D C     1 
ATOM   2710  O  O     . LYS D 4  85  ? -30.317 -12.171 20.154 1.00 79.90  ? 82   LYS D O     1 
ATOM   2711  C  CB    . LYS D 4  85  ? -31.927 -13.978 21.477 1.00 85.92  ? 82   LYS D CB    1 
ATOM   2712  C  CG    . LYS D 4  85  ? -32.718 -15.047 22.234 1.00 91.90  ? 82   LYS D CG    1 
ATOM   2713  C  CD    . LYS D 4  85  ? -34.133 -14.554 22.556 1.00 108.54 ? 82   LYS D CD    1 
ATOM   2714  C  CE    . LYS D 4  85  ? -34.906 -15.495 23.478 1.00 114.61 ? 82   LYS D CE    1 
ATOM   2715  N  NZ    . LYS D 4  85  ? -35.359 -16.721 22.763 1.00 119.33 ? 82   LYS D NZ    1 
ATOM   2716  N  N     . ARG D 4  86  ? -28.665 -12.178 21.665 1.00 73.03  ? 83   ARG D N     1 
ATOM   2717  C  CA    . ARG D 4  86  ? -27.781 -11.303 20.940 1.00 75.15  ? 83   ARG D CA    1 
ATOM   2718  C  C     . ARG D 4  86  ? -26.584 -12.138 20.551 1.00 72.06  ? 83   ARG D C     1 
ATOM   2719  O  O     . ARG D 4  86  ? -26.187 -13.041 21.283 1.00 76.96  ? 83   ARG D O     1 
ATOM   2720  C  CB    . ARG D 4  86  ? -27.303 -10.166 21.840 1.00 82.41  ? 83   ARG D CB    1 
ATOM   2721  C  CG    . ARG D 4  86  ? -28.397 -9.228  22.319 1.00 91.33  ? 83   ARG D CG    1 
ATOM   2722  C  CD    . ARG D 4  86  ? -28.640 -8.077  21.350 1.00 103.02 ? 83   ARG D CD    1 
ATOM   2723  N  NE    . ARG D 4  86  ? -29.999 -7.537  21.484 1.00 105.08 ? 83   ARG D NE    1 
ATOM   2724  C  CZ    . ARG D 4  86  ? -31.088 -8.015  20.873 1.00 88.70  ? 83   ARG D CZ    1 
ATOM   2725  N  NH1   . ARG D 4  86  ? -31.041 -9.063  20.050 1.00 95.89  ? 83   ARG D NH1   1 
ATOM   2726  N  NH2   . ARG D 4  86  ? -32.248 -7.434  21.096 1.00 87.05  ? 83   ARG D NH2   1 
ATOM   2727  N  N     . SER D 4  87  ? -26.002 -11.824 19.405 1.00 67.32  ? 84   SER D N     1 
ATOM   2728  C  CA    . SER D 4  87  ? -24.797 -12.470 18.967 1.00 66.11  ? 84   SER D CA    1 
ATOM   2729  C  C     . SER D 4  87  ? -23.582 -11.599 19.258 1.00 62.10  ? 84   SER D C     1 
ATOM   2730  O  O     . SER D 4  87  ? -22.450 -12.019 19.035 1.00 63.72  ? 84   SER D O     1 
ATOM   2731  C  CB    . SER D 4  87  ? -24.897 -12.749 17.465 1.00 75.20  ? 84   SER D CB    1 
ATOM   2732  O  OG    . SER D 4  87  ? -24.909 -11.540 16.699 1.00 77.38  ? 84   SER D OG    1 
ATOM   2733  N  N     . THR D 4  88  ? -23.791 -10.379 19.731 1.00 63.66  ? 85   THR D N     1 
ATOM   2734  C  CA    . THR D 4  88  ? -22.669 -9.436  19.851 1.00 73.22  ? 85   THR D CA    1 
ATOM   2735  C  C     . THR D 4  88  ? -22.426 -8.962  21.294 1.00 69.65  ? 85   THR D C     1 
ATOM   2736  O  O     . THR D 4  88  ? -23.366 -8.598  22.013 1.00 67.63  ? 85   THR D O     1 
ATOM   2737  C  CB    . THR D 4  88  ? -22.863 -8.184  18.959 1.00 72.77  ? 85   THR D CB    1 
ATOM   2738  O  OG1   . THR D 4  88  ? -23.326 -8.558  17.664 1.00 82.43  ? 85   THR D OG1   1 
ATOM   2739  C  CG2   . THR D 4  88  ? -21.563 -7.453  18.789 1.00 75.97  ? 85   THR D CG2   1 
ATOM   2740  N  N     . ILE D 4  89  ? -21.157 -8.961  21.704 1.00 65.29  ? 86   ILE D N     1 
ATOM   2741  C  CA    . ILE D 4  89  ? -20.764 -8.381  22.999 1.00 70.40  ? 86   ILE D CA    1 
ATOM   2742  C  C     . ILE D 4  89  ? -20.223 -6.977  22.791 1.00 66.89  ? 86   ILE D C     1 
ATOM   2743  O  O     . ILE D 4  89  ? -19.103 -6.786  22.256 1.00 62.96  ? 86   ILE D O     1 
ATOM   2744  C  CB    . ILE D 4  89  ? -19.678 -9.189  23.740 1.00 68.07  ? 86   ILE D CB    1 
ATOM   2745  C  CG1   . ILE D 4  89  ? -20.243 -10.490 24.285 1.00 70.70  ? 86   ILE D CG1   1 
ATOM   2746  C  CG2   . ILE D 4  89  ? -19.175 -8.392  24.924 1.00 71.51  ? 86   ILE D CG2   1 
ATOM   2747  C  CD1   . ILE D 4  89  ? -19.159 -11.455 24.705 1.00 73.39  ? 86   ILE D CD1   1 
ATOM   2748  N  N     . THR D 4  90  ? -21.015 -6.015  23.242 1.00 60.76  ? 87   THR D N     1 
ATOM   2749  C  CA    . THR D 4  90  ? -20.696 -4.603  23.139 1.00 61.50  ? 87   THR D CA    1 
ATOM   2750  C  C     . THR D 4  90  ? -20.279 -4.042  24.495 1.00 64.56  ? 87   THR D C     1 
ATOM   2751  O  O     . THR D 4  90  ? -20.284 -4.756  25.493 1.00 71.65  ? 87   THR D O     1 
ATOM   2752  C  CB    . THR D 4  90  ? -21.923 -3.824  22.655 1.00 61.20  ? 87   THR D CB    1 
ATOM   2753  O  OG1   . THR D 4  90  ? -22.925 -3.796  23.685 1.00 63.70  ? 87   THR D OG1   1 
ATOM   2754  C  CG2   . THR D 4  90  ? -22.487 -4.471  21.408 1.00 64.49  ? 87   THR D CG2   1 
ATOM   2755  N  N     . SER D 4  91  ? -19.935 -2.760  24.537 1.00 62.19  ? 88   SER D N     1 
ATOM   2756  C  CA    . SER D 4  91  ? -19.556 -2.131  25.781 1.00 60.18  ? 88   SER D CA    1 
ATOM   2757  C  C     . SER D 4  91  ? -20.750 -2.101  26.717 1.00 58.27  ? 88   SER D C     1 
ATOM   2758  O  O     . SER D 4  91  ? -20.587 -2.102  27.918 1.00 61.38  ? 88   SER D O     1 
ATOM   2759  C  CB    . SER D 4  91  ? -19.033 -0.715  25.552 1.00 61.83  ? 88   SER D CB    1 
ATOM   2760  O  OG    . SER D 4  91  ? -20.113 0.195   25.567 1.00 64.35  ? 88   SER D OG    1 
ATOM   2761  N  N     . ARG D 4  92  ? -21.958 -2.079  26.180 1.00 60.92  ? 89   ARG D N     1 
ATOM   2762  C  CA    . ARG D 4  92  ? -23.147 -2.214  27.034 1.00 62.33  ? 89   ARG D CA    1 
ATOM   2763  C  C     . ARG D 4  92  ? -23.216 -3.571  27.798 1.00 62.04  ? 89   ARG D C     1 
ATOM   2764  O  O     . ARG D 4  92  ? -23.501 -3.600  28.982 1.00 56.39  ? 89   ARG D O     1 
ATOM   2765  C  CB    . ARG D 4  92  ? -24.401 -2.007  26.207 1.00 60.51  ? 89   ARG D CB    1 
ATOM   2766  C  CG    . ARG D 4  92  ? -25.623 -1.800  27.064 1.00 64.12  ? 89   ARG D CG    1 
ATOM   2767  C  CD    . ARG D 4  92  ? -26.805 -1.346  26.237 1.00 68.92  ? 89   ARG D CD    1 
ATOM   2768  N  NE    . ARG D 4  92  ? -27.955 -1.171  27.107 1.00 76.28  ? 89   ARG D NE    1 
ATOM   2769  C  CZ    . ARG D 4  92  ? -28.866 -2.107  27.359 1.00 80.32  ? 89   ARG D CZ    1 
ATOM   2770  N  NH1   . ARG D 4  92  ? -28.777 -3.308  26.793 1.00 75.91  ? 89   ARG D NH1   1 
ATOM   2771  N  NH2   . ARG D 4  92  ? -29.880 -1.831  28.184 1.00 83.05  ? 89   ARG D NH2   1 
ATOM   2772  N  N     . GLU D 4  93  ? -22.926 -4.688  27.133 1.00 67.06  ? 90   GLU D N     1 
ATOM   2773  C  CA    . GLU D 4  93  ? -22.858 -5.994  27.827 1.00 63.63  ? 90   GLU D CA    1 
ATOM   2774  C  C     . GLU D 4  93  ? -21.776 -5.999  28.919 1.00 62.05  ? 90   GLU D C     1 
ATOM   2775  O  O     . GLU D 4  93  ? -22.041 -6.400  30.059 1.00 61.15  ? 90   GLU D O     1 
ATOM   2776  C  CB    . GLU D 4  93  ? -22.633 -7.155  26.856 1.00 61.61  ? 90   GLU D CB    1 
ATOM   2777  C  CG    . GLU D 4  93  ? -23.902 -7.644  26.156 1.00 68.06  ? 90   GLU D CG    1 
ATOM   2778  C  CD    . GLU D 4  93  ? -24.575 -6.572  25.312 1.00 70.08  ? 90   GLU D CD    1 
ATOM   2779  O  OE1   . GLU D 4  93  ? -25.819 -6.440  25.374 1.00 71.78  ? 90   GLU D OE1   1 
ATOM   2780  O  OE2   . GLU D 4  93  ? -23.852 -5.843  24.610 1.00 62.84  ? 90   GLU D OE2   1 
ATOM   2781  N  N     . ILE D 4  94  ? -20.580 -5.523  28.584 1.00 52.97  ? 91   ILE D N     1 
ATOM   2782  C  CA    . ILE D 4  94  ? -19.522 -5.432  29.559 1.00 50.26  ? 91   ILE D CA    1 
ATOM   2783  C  C     . ILE D 4  94  ? -19.991 -4.609  30.768 1.00 52.43  ? 91   ILE D C     1 
ATOM   2784  O  O     . ILE D 4  94  ? -19.729 -4.954  31.928 1.00 52.30  ? 91   ILE D O     1 
ATOM   2785  C  CB    . ILE D 4  94  ? -18.284 -4.763  28.958 1.00 52.87  ? 91   ILE D CB    1 
ATOM   2786  C  CG1   . ILE D 4  94  ? -17.739 -5.583  27.784 1.00 55.22  ? 91   ILE D CG1   1 
ATOM   2787  C  CG2   . ILE D 4  94  ? -17.194 -4.557  30.013 1.00 55.32  ? 91   ILE D CG2   1 
ATOM   2788  C  CD1   . ILE D 4  94  ? -16.915 -6.784  28.162 1.00 57.32  ? 91   ILE D CD1   1 
ATOM   2789  N  N     . GLN D 4  95  ? -20.690 -3.517  30.497 1.00 58.58  ? 92   GLN D N     1 
ATOM   2790  C  CA    . GLN D 4  95  ? -21.148 -2.636  31.566 1.00 61.60  ? 92   GLN D CA    1 
ATOM   2791  C  C     . GLN D 4  95  ? -22.027 -3.397  32.535 1.00 57.68  ? 92   GLN D C     1 
ATOM   2792  O  O     . GLN D 4  95  ? -21.716 -3.453  33.715 1.00 60.65  ? 92   GLN D O     1 
ATOM   2793  C  CB    . GLN D 4  95  ? -21.893 -1.416  31.025 1.00 67.68  ? 92   GLN D CB    1 
ATOM   2794  C  CG    . GLN D 4  95  ? -22.599 -0.626  32.114 1.00 70.47  ? 92   GLN D CG    1 
ATOM   2795  C  CD    . GLN D 4  95  ? -22.746 0.835   31.798 1.00 66.87  ? 92   GLN D CD    1 
ATOM   2796  O  OE1   . GLN D 4  95  ? -23.839 1.341   31.831 1.00 79.81  ? 92   GLN D OE1   1 
ATOM   2797  N  NE2   . GLN D 4  95  ? -21.647 1.521   31.521 1.00 63.97  ? 92   GLN D NE2   1 
ATOM   2798  N  N     . THR D 4  96  ? -23.091 -4.018  32.049 1.00 53.13  ? 93   THR D N     1 
ATOM   2799  C  CA    . THR D 4  96  ? -23.896 -4.840  32.938 1.00 57.38  ? 93   THR D CA    1 
ATOM   2800  C  C     . THR D 4  96  ? -23.088 -5.910  33.711 1.00 53.01  ? 93   THR D C     1 
ATOM   2801  O  O     . THR D 4  96  ? -23.292 -6.112  34.896 1.00 52.10  ? 93   THR D O     1 
ATOM   2802  C  CB    . THR D 4  96  ? -25.008 -5.517  32.170 1.00 59.05  ? 93   THR D CB    1 
ATOM   2803  O  OG1   . THR D 4  96  ? -25.687 -4.523  31.410 1.00 65.03  ? 93   THR D OG1   1 
ATOM   2804  C  CG2   . THR D 4  96  ? -26.001 -6.160  33.125 1.00 60.85  ? 93   THR D CG2   1 
ATOM   2805  N  N     . ALA D 4  97  ? -22.152 -6.559  33.045 1.00 50.67  ? 94   ALA D N     1 
ATOM   2806  C  CA    . ALA D 4  97  ? -21.365 -7.617  33.656 1.00 49.43  ? 94   ALA D CA    1 
ATOM   2807  C  C     . ALA D 4  97  ? -20.573 -7.040  34.780 1.00 52.68  ? 94   ALA D C     1 
ATOM   2808  O  O     . ALA D 4  97  ? -20.294 -7.723  35.767 1.00 51.27  ? 94   ALA D O     1 
ATOM   2809  C  CB    . ALA D 4  97  ? -20.417 -8.235  32.635 1.00 51.82  ? 94   ALA D CB    1 
ATOM   2810  N  N     . VAL D 4  98  ? -20.184 -5.780  34.631 1.00 51.78  ? 95   VAL D N     1 
ATOM   2811  C  CA    . VAL D 4  98  ? -19.464 -5.130  35.703 1.00 54.99  ? 95   VAL D CA    1 
ATOM   2812  C  C     . VAL D 4  98  ? -20.335 -4.860  36.940 1.00 54.93  ? 95   VAL D C     1 
ATOM   2813  O  O     . VAL D 4  98  ? -19.885 -5.055  38.069 1.00 51.28  ? 95   VAL D O     1 
ATOM   2814  C  CB    . VAL D 4  98  ? -18.792 -3.863  35.205 1.00 55.78  ? 95   VAL D CB    1 
ATOM   2815  C  CG1   . VAL D 4  98  ? -18.421 -2.981  36.378 1.00 57.59  ? 95   VAL D CG1   1 
ATOM   2816  C  CG2   . VAL D 4  98  ? -17.569 -4.235  34.363 1.00 53.74  ? 95   VAL D CG2   1 
ATOM   2817  N  N     . ARG D 4  99  ? -21.571 -4.435  36.711 1.00 56.09  ? 96   ARG D N     1 
ATOM   2818  C  CA    . ARG D 4  99  ? -22.533 -4.176  37.781 1.00 58.15  ? 96   ARG D CA    1 
ATOM   2819  C  C     . ARG D 4  99  ? -22.991 -5.444  38.436 1.00 55.63  ? 96   ARG D C     1 
ATOM   2820  O  O     . ARG D 4  99  ? -23.351 -5.423  39.612 1.00 64.16  ? 96   ARG D O     1 
ATOM   2821  C  CB    . ARG D 4  99  ? -23.759 -3.414  37.259 1.00 62.65  ? 96   ARG D CB    1 
ATOM   2822  C  CG    . ARG D 4  99  ? -23.408 -2.001  36.826 1.00 73.22  ? 96   ARG D CG    1 
ATOM   2823  C  CD    . ARG D 4  99  ? -24.645 -1.153  36.661 1.00 88.34  ? 96   ARG D CD    1 
ATOM   2824  N  NE    . ARG D 4  99  ? -24.320 0.259   36.411 1.00 102.77 ? 96   ARG D NE    1 
ATOM   2825  C  CZ    . ARG D 4  99  ? -24.765 0.990   35.378 1.00 105.70 ? 96   ARG D CZ    1 
ATOM   2826  N  NH1   . ARG D 4  99  ? -25.576 0.482   34.445 1.00 101.15 ? 96   ARG D NH1   1 
ATOM   2827  N  NH2   . ARG D 4  99  ? -24.401 2.264   35.282 1.00 109.05 ? 96   ARG D NH2   1 
ATOM   2828  N  N     . LEU D 4  100 ? -23.004 -6.544  37.691 1.00 53.11  ? 97   LEU D N     1 
ATOM   2829  C  CA    . LEU D 4  100 ? -23.362 -7.838  38.275 1.00 52.05  ? 97   LEU D CA    1 
ATOM   2830  C  C     . LEU D 4  100 ? -22.215 -8.402  39.090 1.00 53.92  ? 97   LEU D C     1 
ATOM   2831  O  O     . LEU D 4  100 ? -22.409 -8.805  40.225 1.00 61.50  ? 97   LEU D O     1 
ATOM   2832  C  CB    . LEU D 4  100 ? -23.757 -8.841  37.214 1.00 47.81  ? 97   LEU D CB    1 
ATOM   2833  C  CG    . LEU D 4  100 ? -25.096 -8.543  36.548 1.00 49.74  ? 97   LEU D CG    1 
ATOM   2834  C  CD1   . LEU D 4  100 ? -25.192 -9.415  35.315 1.00 51.40  ? 97   LEU D CD1   1 
ATOM   2835  C  CD2   . LEU D 4  100 ? -26.294 -8.791  37.459 1.00 52.87  ? 97   LEU D CD2   1 
ATOM   2836  N  N     . LEU D 4  101 ? -21.019 -8.370  38.527 1.00 53.77  ? 98   LEU D N     1 
ATOM   2837  C  CA    . LEU D 4  101 ? -19.850 -8.935  39.165 1.00 52.81  ? 98   LEU D CA    1 
ATOM   2838  C  C     . LEU D 4  101 ? -19.249 -8.140  40.328 1.00 49.71  ? 98   LEU D C     1 
ATOM   2839  O  O     . LEU D 4  101 ? -18.925 -8.720  41.368 1.00 54.77  ? 98   LEU D O     1 
ATOM   2840  C  CB    . LEU D 4  101 ? -18.783 -9.153  38.123 1.00 56.40  ? 98   LEU D CB    1 
ATOM   2841  C  CG    . LEU D 4  101 ? -17.504 -9.741  38.688 1.00 65.67  ? 98   LEU D CG    1 
ATOM   2842  C  CD1   . LEU D 4  101 ? -17.754 -11.217 38.955 1.00 66.40  ? 98   LEU D CD1   1 
ATOM   2843  C  CD2   . LEU D 4  101 ? -16.309 -9.525  37.749 1.00 69.29  ? 98   LEU D CD2   1 
ATOM   2844  N  N     . LEU D 4  102 ? -19.064 -6.837  40.181 1.00 47.82  ? 99   LEU D N     1 
ATOM   2845  C  CA    . LEU D 4  102 ? -18.373 -6.073  41.239 1.00 46.30  ? 99   LEU D CA    1 
ATOM   2846  C  C     . LEU D 4  102 ? -19.325 -5.555  42.302 1.00 48.72  ? 99   LEU D C     1 
ATOM   2847  O  O     . LEU D 4  102 ? -20.524 -5.450  42.053 1.00 56.58  ? 99   LEU D O     1 
ATOM   2848  C  CB    . LEU D 4  102 ? -17.625 -4.884  40.648 1.00 48.17  ? 99   LEU D CB    1 
ATOM   2849  C  CG    . LEU D 4  102 ? -16.666 -5.144  39.497 1.00 45.44  ? 99   LEU D CG    1 
ATOM   2850  C  CD1   . LEU D 4  102 ? -15.719 -3.978  39.318 1.00 48.25  ? 99   LEU D CD1   1 
ATOM   2851  C  CD2   . LEU D 4  102 ? -15.887 -6.381  39.807 1.00 48.11  ? 99   LEU D CD2   1 
ATOM   2852  N  N     . PRO D 4  103 ? -18.797 -5.238  43.495 1.00 46.90  ? 100  PRO D N     1 
ATOM   2853  C  CA    . PRO D 4  103 ? -19.594 -4.692  44.564 1.00 48.82  ? 100  PRO D CA    1 
ATOM   2854  C  C     . PRO D 4  103 ? -19.657 -3.177  44.550 1.00 59.60  ? 100  PRO D C     1 
ATOM   2855  O  O     . PRO D 4  103 ? -18.733 -2.520  44.066 1.00 62.72  ? 100  PRO D O     1 
ATOM   2856  C  CB    . PRO D 4  103 ? -18.872 -5.165  45.826 1.00 48.56  ? 100  PRO D CB    1 
ATOM   2857  C  CG    . PRO D 4  103 ? -17.469 -5.407  45.434 1.00 46.64  ? 100  PRO D CG    1 
ATOM   2858  C  CD    . PRO D 4  103 ? -17.452 -5.628  43.957 1.00 49.72  ? 100  PRO D CD    1 
ATOM   2859  N  N     . GLY D 4  104 ? -20.738 -2.664  45.149 1.00 64.03  ? 101  GLY D N     1 
ATOM   2860  C  CA    . GLY D 4  104 ? -21.160 -1.271  45.089 1.00 59.50  ? 101  GLY D CA    1 
ATOM   2861  C  C     . GLY D 4  104 ? -20.209 -0.243  44.546 1.00 58.70  ? 101  GLY D C     1 
ATOM   2862  O  O     . GLY D 4  104 ? -20.277 0.151   43.384 1.00 62.86  ? 101  GLY D O     1 
ATOM   2863  N  N     . GLU D 4  105 ? -19.317 0.206   45.395 1.00 58.21  ? 102  GLU D N     1 
ATOM   2864  C  CA    . GLU D 4  105 ? -18.502 1.326   45.045 1.00 61.47  ? 102  GLU D CA    1 
ATOM   2865  C  C     . GLU D 4  105 ? -17.506 0.981   43.940 1.00 61.62  ? 102  GLU D C     1 
ATOM   2866  O  O     . GLU D 4  105 ? -17.292 1.793   43.058 1.00 73.10  ? 102  GLU D O     1 
ATOM   2867  C  CB    . GLU D 4  105 ? -17.806 1.896   46.287 1.00 69.01  ? 102  GLU D CB    1 
ATOM   2868  C  CG    . GLU D 4  105 ? -17.745 3.424   46.314 1.00 81.00  ? 102  GLU D CG    1 
ATOM   2869  C  CD    . GLU D 4  105 ? -19.129 4.059   46.244 1.00 84.62  ? 102  GLU D CD    1 
ATOM   2870  O  OE1   . GLU D 4  105 ? -20.042 3.560   46.926 1.00 88.70  ? 102  GLU D OE1   1 
ATOM   2871  O  OE2   . GLU D 4  105 ? -19.313 5.047   45.499 1.00 94.56  ? 102  GLU D OE2   1 
ATOM   2872  N  N     . LEU D 4  106 ? -16.895 -0.202  43.959 1.00 59.04  ? 103  LEU D N     1 
ATOM   2873  C  CA    . LEU D 4  106 ? -15.956 -0.558  42.885 1.00 56.36  ? 103  LEU D CA    1 
ATOM   2874  C  C     . LEU D 4  106 ? -16.671 -0.533  41.549 1.00 56.90  ? 103  LEU D C     1 
ATOM   2875  O  O     . LEU D 4  106 ? -16.120 -0.087  40.553 1.00 61.08  ? 103  LEU D O     1 
ATOM   2876  C  CB    . LEU D 4  106 ? -15.335 -1.950  43.088 1.00 57.25  ? 103  LEU D CB    1 
ATOM   2877  C  CG    . LEU D 4  106 ? -14.170 -2.102  44.070 1.00 53.96  ? 103  LEU D CG    1 
ATOM   2878  C  CD1   . LEU D 4  106 ? -13.796 -3.565  44.202 1.00 58.42  ? 103  LEU D CD1   1 
ATOM   2879  C  CD2   . LEU D 4  106 ? -12.964 -1.304  43.639 1.00 49.86  ? 103  LEU D CD2   1 
ATOM   2880  N  N     . ALA D 4  107 ? -17.903 -1.026  41.540 1.00 59.59  ? 104  ALA D N     1 
ATOM   2881  C  CA    . ALA D 4  107 ? -18.750 -1.006  40.361 1.00 57.48  ? 104  ALA D CA    1 
ATOM   2882  C  C     . ALA D 4  107 ? -19.022 0.428   39.864 1.00 61.68  ? 104  ALA D C     1 
ATOM   2883  O  O     . ALA D 4  107 ? -18.848 0.733   38.676 1.00 64.66  ? 104  ALA D O     1 
ATOM   2884  C  CB    . ALA D 4  107 ? -20.039 -1.717  40.675 1.00 56.43  ? 104  ALA D CB    1 
ATOM   2885  N  N     . LYS D 4  108 ? -19.416 1.311   40.775 1.00 66.86  ? 105  LYS D N     1 
ATOM   2886  C  CA    . LYS D 4  108 ? -19.698 2.713   40.421 1.00 71.00  ? 105  LYS D CA    1 
ATOM   2887  C  C     . LYS D 4  108 ? -18.515 3.314   39.688 1.00 64.32  ? 105  LYS D C     1 
ATOM   2888  O  O     . LYS D 4  108 ? -18.660 3.822   38.584 1.00 72.58  ? 105  LYS D O     1 
ATOM   2889  C  CB    . LYS D 4  108 ? -20.021 3.548   41.664 1.00 80.79  ? 105  LYS D CB    1 
ATOM   2890  C  CG    . LYS D 4  108 ? -21.107 4.598   41.465 1.00 98.18  ? 105  LYS D CG    1 
ATOM   2891  C  CD    . LYS D 4  108 ? -21.411 5.368   42.754 1.00 112.46 ? 105  LYS D CD    1 
ATOM   2892  C  CE    . LYS D 4  108 ? -22.280 4.568   43.730 1.00 120.54 ? 105  LYS D CE    1 
ATOM   2893  N  NZ    . LYS D 4  108 ? -22.387 5.207   45.076 1.00 120.95 ? 105  LYS D NZ    1 
ATOM   2894  N  N     . HIS D 4  109 ? -17.340 3.198   40.278 1.00 59.04  ? 106  HIS D N     1 
ATOM   2895  C  CA    . HIS D 4  109 ? -16.140 3.812   39.723 1.00 63.27  ? 106  HIS D CA    1 
ATOM   2896  C  C     . HIS D 4  109 ? -15.612 3.125   38.461 1.00 62.34  ? 106  HIS D C     1 
ATOM   2897  O  O     . HIS D 4  109 ? -15.099 3.797   37.555 1.00 60.84  ? 106  HIS D O     1 
ATOM   2898  C  CB    . HIS D 4  109 ? -15.027 3.824   40.760 1.00 67.03  ? 106  HIS D CB    1 
ATOM   2899  C  CG    . HIS D 4  109 ? -15.241 4.804   41.870 1.00 77.24  ? 106  HIS D CG    1 
ATOM   2900  N  ND1   . HIS D 4  109 ? -16.347 4.776   42.693 1.00 79.43  ? 106  HIS D ND1   1 
ATOM   2901  C  CD2   . HIS D 4  109 ? -14.465 5.818   42.317 1.00 82.44  ? 106  HIS D CD2   1 
ATOM   2902  C  CE1   . HIS D 4  109 ? -16.251 5.740   43.590 1.00 85.82  ? 106  HIS D CE1   1 
ATOM   2903  N  NE2   . HIS D 4  109 ? -15.116 6.385   43.385 1.00 89.40  ? 106  HIS D NE2   1 
ATOM   2904  N  N     . ALA D 4  110 ? -15.702 1.795   38.404 1.00 57.50  ? 107  ALA D N     1 
ATOM   2905  C  CA    . ALA D 4  110 ? -15.252 1.053   37.218 1.00 53.43  ? 107  ALA D CA    1 
ATOM   2906  C  C     . ALA D 4  110 ? -16.085 1.502   36.038 1.00 55.98  ? 107  ALA D C     1 
ATOM   2907  O  O     . ALA D 4  110 ? -15.566 1.794   34.967 1.00 53.46  ? 107  ALA D O     1 
ATOM   2908  C  CB    . ALA D 4  110 ? -15.412 -0.442  37.427 1.00 51.49  ? 107  ALA D CB    1 
ATOM   2909  N  N     . VAL D 4  111 ? -17.391 1.590   36.274 1.00 58.28  ? 108  VAL D N     1 
ATOM   2910  C  CA    . VAL D 4  111 ? -18.336 2.067   35.284 1.00 60.50  ? 108  VAL D CA    1 
ATOM   2911  C  C     . VAL D 4  111 ? -18.032 3.502   34.821 1.00 63.18  ? 108  VAL D C     1 
ATOM   2912  O  O     . VAL D 4  111 ? -18.164 3.801   33.642 1.00 65.83  ? 108  VAL D O     1 
ATOM   2913  C  CB    . VAL D 4  111 ? -19.776 1.973   35.820 1.00 63.00  ? 108  VAL D CB    1 
ATOM   2914  C  CG1   . VAL D 4  111 ? -20.750 2.671   34.882 1.00 61.21  ? 108  VAL D CG1   1 
ATOM   2915  C  CG2   . VAL D 4  111 ? -20.178 0.517   36.014 1.00 62.80  ? 108  VAL D CG2   1 
ATOM   2916  N  N     . SER D 4  112 ? -17.624 4.397   35.713 1.00 63.83  ? 109  SER D N     1 
ATOM   2917  C  CA    . SER D 4  112 ? -17.144 5.708   35.235 1.00 68.40  ? 109  SER D CA    1 
ATOM   2918  C  C     . SER D 4  112 ? -16.016 5.566   34.226 1.00 66.53  ? 109  SER D C     1 
ATOM   2919  O  O     . SER D 4  112 ? -16.094 6.073   33.100 1.00 73.61  ? 109  SER D O     1 
ATOM   2920  C  CB    . SER D 4  112 ? -16.669 6.597   36.367 1.00 63.12  ? 109  SER D CB    1 
ATOM   2921  O  OG    . SER D 4  112 ? -17.756 6.903   37.185 1.00 70.51  ? 109  SER D OG    1 
ATOM   2922  N  N     . GLU D 4  113 ? -14.985 4.849   34.631 1.00 62.48  ? 110  GLU D N     1 
ATOM   2923  C  CA    . GLU D 4  113 ? -13.753 4.815   33.868 1.00 64.64  ? 110  GLU D CA    1 
ATOM   2924  C  C     . GLU D 4  113 ? -13.916 4.089   32.524 1.00 62.08  ? 110  GLU D C     1 
ATOM   2925  O  O     . GLU D 4  113 ? -13.219 4.379   31.559 1.00 63.20  ? 110  GLU D O     1 
ATOM   2926  C  CB    . GLU D 4  113 ? -12.661 4.200   34.729 1.00 62.18  ? 110  GLU D CB    1 
ATOM   2927  C  CG    . GLU D 4  113 ? -12.347 5.047   35.942 1.00 65.45  ? 110  GLU D CG    1 
ATOM   2928  C  CD    . GLU D 4  113 ? -10.989 5.676   35.818 1.00 78.23  ? 110  GLU D CD    1 
ATOM   2929  O  OE1   . GLU D 4  113 ? -10.866 6.717   35.122 1.00 87.43  ? 110  GLU D OE1   1 
ATOM   2930  O  OE2   . GLU D 4  113 ? -10.034 5.098   36.395 1.00 81.77  ? 110  GLU D OE2   1 
ATOM   2931  N  N     . GLY D 4  114 ? -14.848 3.158   32.463 1.00 59.19  ? 111  GLY D N     1 
ATOM   2932  C  CA    . GLY D 4  114 ? -15.114 2.473   31.220 1.00 65.02  ? 111  GLY D CA    1 
ATOM   2933  C  C     . GLY D 4  114 ? -15.974 3.335   30.308 1.00 66.13  ? 111  GLY D C     1 
ATOM   2934  O  O     . GLY D 4  114 ? -15.747 3.361   29.108 1.00 61.86  ? 111  GLY D O     1 
ATOM   2935  N  N     . THR D 4  115 ? -16.974 4.016   30.869 1.00 60.10  ? 112  THR D N     1 
ATOM   2936  C  CA    . THR D 4  115 ? -17.766 4.963   30.098 1.00 68.49  ? 112  THR D CA    1 
ATOM   2937  C  C     . THR D 4  115 ? -16.846 6.076   29.551 1.00 71.20  ? 112  THR D C     1 
ATOM   2938  O  O     . THR D 4  115 ? -16.781 6.337   28.347 1.00 68.03  ? 112  THR D O     1 
ATOM   2939  C  CB    . THR D 4  115 ? -18.899 5.585   30.949 1.00 70.58  ? 112  THR D CB    1 
ATOM   2940  O  OG1   . THR D 4  115 ? -19.669 4.550   31.576 1.00 81.32  ? 112  THR D OG1   1 
ATOM   2941  C  CG2   . THR D 4  115 ? -19.836 6.404   30.090 1.00 68.06  ? 112  THR D CG2   1 
ATOM   2942  N  N     . LYS D 4  116 ? -16.110 6.700   30.455 1.00 72.96  ? 113  LYS D N     1 
ATOM   2943  C  CA    . LYS D 4  116 ? -15.127 7.701   30.091 1.00 74.89  ? 113  LYS D CA    1 
ATOM   2944  C  C     . LYS D 4  116 ? -14.219 7.264   28.944 1.00 70.06  ? 113  LYS D C     1 
ATOM   2945  O  O     . LYS D 4  116 ? -13.934 8.047   28.066 1.00 72.78  ? 113  LYS D O     1 
ATOM   2946  C  CB    . LYS D 4  116 ? -14.282 8.024   31.325 1.00 81.81  ? 113  LYS D CB    1 
ATOM   2947  C  CG    . LYS D 4  116 ? -13.196 9.068   31.155 1.00 77.73  ? 113  LYS D CG    1 
ATOM   2948  C  CD    . LYS D 4  116 ? -12.935 9.724   32.498 1.00 84.68  ? 113  LYS D CD    1 
ATOM   2949  C  CE    . LYS D 4  116 ? -11.568 10.380  32.548 1.00 94.07  ? 113  LYS D CE    1 
ATOM   2950  N  NZ    . LYS D 4  116 ? -10.474 9.388   32.691 1.00 93.76  ? 113  LYS D NZ    1 
ATOM   2951  N  N     . ALA D 4  117 ? -13.751 6.024   28.959 1.00 69.83  ? 114  ALA D N     1 
ATOM   2952  C  CA    . ALA D 4  117 ? -12.800 5.571   27.954 1.00 68.42  ? 114  ALA D CA    1 
ATOM   2953  C  C     . ALA D 4  117 ? -13.468 5.304   26.611 1.00 71.22  ? 114  ALA D C     1 
ATOM   2954  O  O     . ALA D 4  117 ? -12.848 5.465   25.554 1.00 72.88  ? 114  ALA D O     1 
ATOM   2955  C  CB    . ALA D 4  117 ? -12.093 4.325   28.428 1.00 69.23  ? 114  ALA D CB    1 
ATOM   2956  N  N     . VAL D 4  118 ? -14.722 4.880   26.642 1.00 68.89  ? 115  VAL D N     1 
ATOM   2957  C  CA    . VAL D 4  118 ? -15.426 4.601   25.403 1.00 74.06  ? 115  VAL D CA    1 
ATOM   2958  C  C     . VAL D 4  118 ? -15.836 5.903   24.723 1.00 74.15  ? 115  VAL D C     1 
ATOM   2959  O  O     . VAL D 4  118 ? -15.580 6.091   23.544 1.00 80.98  ? 115  VAL D O     1 
ATOM   2960  C  CB    . VAL D 4  118 ? -16.631 3.691   25.638 1.00 71.40  ? 115  VAL D CB    1 
ATOM   2961  C  CG1   . VAL D 4  118 ? -17.522 3.606   24.397 1.00 68.99  ? 115  VAL D CG1   1 
ATOM   2962  C  CG2   . VAL D 4  118 ? -16.127 2.316   26.025 1.00 74.57  ? 115  VAL D CG2   1 
ATOM   2963  N  N     . THR D 4  119 ? -16.470 6.793   25.465 1.00 72.16  ? 116  THR D N     1 
ATOM   2964  C  CA    . THR D 4  119 ? -16.685 8.149   24.996 1.00 73.25  ? 116  THR D CA    1 
ATOM   2965  C  C     . THR D 4  119 ? -15.430 8.767   24.363 1.00 72.91  ? 116  THR D C     1 
ATOM   2966  O  O     . THR D 4  119 ? -15.454 9.196   23.213 1.00 83.62  ? 116  THR D O     1 
ATOM   2967  C  CB    . THR D 4  119 ? -17.131 9.037   26.148 1.00 69.96  ? 116  THR D CB    1 
ATOM   2968  O  OG1   . THR D 4  119 ? -18.280 8.447   26.774 1.00 67.93  ? 116  THR D OG1   1 
ATOM   2969  C  CG2   . THR D 4  119 ? -17.488 10.400  25.620 1.00 77.16  ? 116  THR D CG2   1 
ATOM   2970  N  N     . LYS D 4  120 ? -14.332 8.789   25.101 1.00 70.29  ? 117  LYS D N     1 
ATOM   2971  C  CA    . LYS D 4  120 ? -13.088 9.347   24.586 1.00 68.14  ? 117  LYS D CA    1 
ATOM   2972  C  C     . LYS D 4  120 ? -12.538 8.539   23.406 1.00 71.01  ? 117  LYS D C     1 
ATOM   2973  O  O     . LYS D 4  120 ? -11.744 9.043   22.620 1.00 78.69  ? 117  LYS D O     1 
ATOM   2974  C  CB    . LYS D 4  120 ? -12.018 9.508   25.698 1.00 65.46  ? 117  LYS D CB    1 
ATOM   2975  C  CG    . LYS D 4  120 ? -10.595 9.549   25.152 1.00 68.13  ? 117  LYS D CG    1 
ATOM   2976  C  CD    . LYS D 4  120 ? -9.567  10.308  25.973 1.00 73.31  ? 117  LYS D CD    1 
ATOM   2977  C  CE    . LYS D 4  120 ? -8.200  10.280  25.249 1.00 79.18  ? 117  LYS D CE    1 
ATOM   2978  N  NZ    . LYS D 4  120 ? -7.357  11.515  25.406 1.00 77.84  ? 117  LYS D NZ    1 
ATOM   2979  N  N     . TYR D 4  121 ? -12.927 7.282   23.282 1.00 80.10  ? 118  TYR D N     1 
ATOM   2980  C  CA    . TYR D 4  121 ? -12.464 6.468   22.153 1.00 80.64  ? 118  TYR D CA    1 
ATOM   2981  C  C     . TYR D 4  121 ? -13.204 6.797   20.860 1.00 81.68  ? 118  TYR D C     1 
ATOM   2982  O  O     . TYR D 4  121 ? -12.590 6.861   19.792 1.00 70.96  ? 118  TYR D O     1 
ATOM   2983  C  CB    . TYR D 4  121 ? -12.686 5.005   22.455 1.00 76.51  ? 118  TYR D CB    1 
ATOM   2984  C  CG    . TYR D 4  121 ? -12.192 4.099   21.371 1.00 74.03  ? 118  TYR D CG    1 
ATOM   2985  C  CD1   . TYR D 4  121 ? -10.831 3.851   21.248 1.00 72.34  ? 118  TYR D CD1   1 
ATOM   2986  C  CD2   . TYR D 4  121 ? -13.081 3.464   20.479 1.00 66.95  ? 118  TYR D CD2   1 
ATOM   2987  C  CE1   . TYR D 4  121 ? -10.345 2.997   20.276 1.00 70.74  ? 118  TYR D CE1   1 
ATOM   2988  C  CE2   . TYR D 4  121 ? -12.605 2.614   19.498 1.00 66.57  ? 118  TYR D CE2   1 
ATOM   2989  C  CZ    . TYR D 4  121 ? -11.227 2.391   19.409 1.00 73.44  ? 118  TYR D CZ    1 
ATOM   2990  O  OH    . TYR D 4  121 ? -10.678 1.557   18.476 1.00 83.42  ? 118  TYR D OH    1 
ATOM   2991  N  N     . THR D 4  122 ? -14.525 6.944   20.983 1.00 87.49  ? 119  THR D N     1 
ATOM   2992  C  CA    . THR D 4  122 ? -15.422 7.303   19.891 1.00 91.85  ? 119  THR D CA    1 
ATOM   2993  C  C     . THR D 4  122 ? -15.059 8.685   19.342 1.00 92.76  ? 119  THR D C     1 
ATOM   2994  O  O     . THR D 4  122 ? -14.873 8.843   18.136 1.00 91.35  ? 119  THR D O     1 
ATOM   2995  C  CB    . THR D 4  122 ? -16.898 7.309   20.371 1.00 97.04  ? 119  THR D CB    1 
ATOM   2996  O  OG1   . THR D 4  122 ? -17.184 6.095   21.078 1.00 89.39  ? 119  THR D OG1   1 
ATOM   2997  C  CG2   . THR D 4  122 ? -17.868 7.429   19.204 1.00 100.97 ? 119  THR D CG2   1 
ATOM   2998  N  N     . SER D 4  123 ? -14.927 9.673   20.228 1.00 98.34  ? 120  SER D N     1 
ATOM   2999  C  CA    . SER D 4  123 ? -14.588 11.047  19.805 1.00 102.35 ? 120  SER D CA    1 
ATOM   3000  C  C     . SER D 4  123 ? -13.136 11.198  19.282 1.00 102.81 ? 120  SER D C     1 
ATOM   3001  O  O     . SER D 4  123 ? -12.794 12.229  18.688 1.00 102.40 ? 120  SER D O     1 
ATOM   3002  C  CB    . SER D 4  123 ? -14.843 12.061  20.933 1.00 95.79  ? 120  SER D CB    1 
ATOM   3003  O  OG    . SER D 4  123 ? -13.614 12.561  21.443 1.00 96.57  ? 120  SER D OG    1 
ATOM   3004  N  N     . ALA D 4  124 ? -12.293 10.188  19.499 1.00 97.75  ? 121  ALA D N     1 
ATOM   3005  C  CA    . ALA D 4  124 ? -10.923 10.202  18.993 1.00 106.19 ? 121  ALA D CA    1 
ATOM   3006  C  C     . ALA D 4  124 ? -10.756 9.466   17.643 1.00 115.66 ? 121  ALA D C     1 
ATOM   3007  O  O     . ALA D 4  124 ? -10.032 8.467   17.544 1.00 108.07 ? 121  ALA D O     1 
ATOM   3008  C  CB    . ALA D 4  124 ? -9.969  9.651   20.047 1.00 104.80 ? 121  ALA D CB    1 
ATOM   3009  N  N     . LYS D 4  125 ? -11.453 9.969   16.620 1.00 131.21 ? 122  LYS D N     1 
ATOM   3010  C  CA    . LYS D 4  125 ? -11.129 9.708   15.203 1.00 140.60 ? 122  LYS D CA    1 
ATOM   3011  C  C     . LYS D 4  125 ? -11.945 10.639  14.297 1.00 145.52 ? 122  LYS D C     1 
ATOM   3012  O  O     . LYS D 4  125 ? -11.570 10.943  13.158 1.00 141.69 ? 122  LYS D O     1 
ATOM   3013  C  CB    . LYS D 4  125 ? -11.348 8.240   14.790 1.00 137.59 ? 122  LYS D CB    1 
ATOM   3014  C  CG    . LYS D 4  125 ? -10.707 7.898   13.442 1.00 133.10 ? 122  LYS D CG    1 
ATOM   3015  C  CD    . LYS D 4  125 ? -10.574 6.399   13.212 1.00 129.57 ? 122  LYS D CD    1 
ATOM   3016  C  CE    . LYS D 4  125 ? -9.632  6.096   12.056 1.00 127.32 ? 122  LYS D CE    1 
ATOM   3017  N  NZ    . LYS D 4  125 ? -9.246  4.655   12.030 1.00 127.16 ? 122  LYS D NZ    1 
ATOM   3018  O  OXT   . LYS D 4  125 ? -13.010 11.113  14.696 1.00 151.53 ? 122  LYS D OXT   1 
ATOM   3019  N  N     . PRO E 1  38  ? 15.228  -22.121 87.706 1.00 150.00 ? 38   PRO E N     1 
ATOM   3020  C  CA    . PRO E 1  38  ? 14.060  -22.806 87.156 1.00 138.02 ? 38   PRO E CA    1 
ATOM   3021  C  C     . PRO E 1  38  ? 12.954  -21.815 86.829 1.00 130.52 ? 38   PRO E C     1 
ATOM   3022  O  O     . PRO E 1  38  ? 12.533  -21.074 87.716 1.00 141.94 ? 38   PRO E O     1 
ATOM   3023  C  CB    . PRO E 1  38  ? 13.628  -23.709 88.316 1.00 134.66 ? 38   PRO E CB    1 
ATOM   3024  C  CG    . PRO E 1  38  ? 14.092  -22.997 89.563 1.00 139.62 ? 38   PRO E CG    1 
ATOM   3025  C  CD    . PRO E 1  38  ? 15.131  -21.971 89.171 1.00 144.24 ? 38   PRO E CD    1 
ATOM   3026  N  N     . HIS E 1  39  ? 12.485  -21.778 85.586 1.00 118.40 ? 39   HIS E N     1 
ATOM   3027  C  CA    . HIS E 1  39  ? 11.433  -20.809 85.215 1.00 123.54 ? 39   HIS E CA    1 
ATOM   3028  C  C     . HIS E 1  39  ? 10.410  -21.337 84.186 1.00 119.75 ? 39   HIS E C     1 
ATOM   3029  O  O     . HIS E 1  39  ? 10.742  -22.216 83.372 1.00 112.62 ? 39   HIS E O     1 
ATOM   3030  C  CB    . HIS E 1  39  ? 12.063  -19.508 84.709 1.00 128.24 ? 39   HIS E CB    1 
ATOM   3031  C  CG    . HIS E 1  39  ? 11.073  -18.560 84.109 1.00 131.12 ? 39   HIS E CG    1 
ATOM   3032  N  ND1   . HIS E 1  39  ? 10.732  -18.590 82.773 1.00 127.51 ? 39   HIS E ND1   1 
ATOM   3033  C  CD2   . HIS E 1  39  ? 10.321  -17.583 84.670 1.00 131.92 ? 39   HIS E CD2   1 
ATOM   3034  C  CE1   . HIS E 1  39  ? 9.828   -17.657 82.533 1.00 130.35 ? 39   HIS E CE1   1 
ATOM   3035  N  NE2   . HIS E 1  39  ? 9.560   -17.033 83.667 1.00 133.09 ? 39   HIS E NE2   1 
ATOM   3036  N  N     . ARG E 1  40  ? 9.183   -20.778 84.234 1.00 105.07 ? 40   ARG E N     1 
ATOM   3037  C  CA    . ARG E 1  40  ? 8.033   -21.215 83.396 1.00 92.15  ? 40   ARG E CA    1 
ATOM   3038  C  C     . ARG E 1  40  ? 7.042   -20.127 82.941 1.00 84.40  ? 40   ARG E C     1 
ATOM   3039  O  O     . ARG E 1  40  ? 6.691   -19.217 83.704 1.00 77.96  ? 40   ARG E O     1 
ATOM   3040  C  CB    . ARG E 1  40  ? 7.204   -22.275 84.143 1.00 84.15  ? 40   ARG E CB    1 
ATOM   3041  C  CG    . ARG E 1  40  ? 7.812   -23.655 84.073 1.00 79.81  ? 40   ARG E CG    1 
ATOM   3042  C  CD    . ARG E 1  40  ? 6.811   -24.793 84.156 1.00 73.92  ? 40   ARG E CD    1 
ATOM   3043  N  NE    . ARG E 1  40  ? 7.543   -25.969 83.703 1.00 77.11  ? 40   ARG E NE    1 
ATOM   3044  C  CZ    . ARG E 1  40  ? 7.154   -26.824 82.771 1.00 77.30  ? 40   ARG E CZ    1 
ATOM   3045  N  NH1   . ARG E 1  40  ? 5.967   -26.711 82.207 1.00 73.43  ? 40   ARG E NH1   1 
ATOM   3046  N  NH2   . ARG E 1  40  ? 7.953   -27.843 82.445 1.00 85.28  ? 40   ARG E NH2   1 
ATOM   3047  N  N     . TYR E 1  41  ? 6.555   -20.261 81.706 1.00 73.80  ? 41   TYR E N     1 
ATOM   3048  C  CA    . TYR E 1  41  ? 5.365   -19.517 81.295 1.00 68.15  ? 41   TYR E CA    1 
ATOM   3049  C  C     . TYR E 1  41  ? 4.115   -20.304 81.687 1.00 60.75  ? 41   TYR E C     1 
ATOM   3050  O  O     . TYR E 1  41  ? 4.126   -21.534 81.712 1.00 60.74  ? 41   TYR E O     1 
ATOM   3051  C  CB    . TYR E 1  41  ? 5.413   -19.177 79.794 1.00 67.61  ? 41   TYR E CB    1 
ATOM   3052  C  CG    . TYR E 1  41  ? 6.483   -18.150 79.495 1.00 63.66  ? 41   TYR E CG    1 
ATOM   3053  C  CD1   . TYR E 1  41  ? 7.651   -18.492 78.844 1.00 66.38  ? 41   TYR E CD1   1 
ATOM   3054  C  CD2   . TYR E 1  41  ? 6.345   -16.844 79.935 1.00 67.44  ? 41   TYR E CD2   1 
ATOM   3055  C  CE1   . TYR E 1  41  ? 8.646   -17.547 78.621 1.00 68.01  ? 41   TYR E CE1   1 
ATOM   3056  C  CE2   . TYR E 1  41  ? 7.321   -15.896 79.709 1.00 66.86  ? 41   TYR E CE2   1 
ATOM   3057  C  CZ    . TYR E 1  41  ? 8.470   -16.248 79.055 1.00 67.57  ? 41   TYR E CZ    1 
ATOM   3058  O  OH    . TYR E 1  41  ? 9.435   -15.280 78.849 1.00 81.74  ? 41   TYR E OH    1 
ATOM   3059  N  N     . ARG E 1  42  ? 3.048   -19.593 82.028 1.00 61.43  ? 42   ARG E N     1 
ATOM   3060  C  CA    . ARG E 1  42  ? 1.748   -20.232 82.278 1.00 63.75  ? 42   ARG E CA    1 
ATOM   3061  C  C     . ARG E 1  42  ? 1.124   -20.765 80.966 1.00 63.01  ? 42   ARG E C     1 
ATOM   3062  O  O     . ARG E 1  42  ? 1.250   -20.132 79.914 1.00 60.76  ? 42   ARG E O     1 
ATOM   3063  C  CB    . ARG E 1  42  ? 0.791   -19.244 82.929 1.00 68.48  ? 42   ARG E CB    1 
ATOM   3064  C  CG    . ARG E 1  42  ? 1.249   -18.719 84.286 1.00 80.54  ? 42   ARG E CG    1 
ATOM   3065  C  CD    . ARG E 1  42  ? 0.607   -17.376 84.625 1.00 92.60  ? 42   ARG E CD    1 
ATOM   3066  N  NE    . ARG E 1  42  ? -0.300  -17.438 85.769 1.00 97.87  ? 42   ARG E NE    1 
ATOM   3067  C  CZ    . ARG E 1  42  ? 0.081   -17.415 87.050 1.00 106.65 ? 42   ARG E CZ    1 
ATOM   3068  N  NH1   . ARG E 1  42  ? 1.364   -17.350 87.388 1.00 101.29 ? 42   ARG E NH1   1 
ATOM   3069  N  NH2   . ARG E 1  42  ? -0.833  -17.464 88.013 1.00 111.76 ? 42   ARG E NH2   1 
ATOM   3070  N  N     . PRO E 1  43  ? 0.459   -21.932 81.012 1.00 62.35  ? 43   PRO E N     1 
ATOM   3071  C  CA    . PRO E 1  43  ? -0.207  -22.394 79.819 1.00 62.20  ? 43   PRO E CA    1 
ATOM   3072  C  C     . PRO E 1  43  ? -1.041  -21.320 79.157 1.00 59.39  ? 43   PRO E C     1 
ATOM   3073  O  O     . PRO E 1  43  ? -1.884  -20.691 79.815 1.00 53.00  ? 43   PRO E O     1 
ATOM   3074  C  CB    . PRO E 1  43  ? -1.114  -23.522 80.328 1.00 64.72  ? 43   PRO E CB    1 
ATOM   3075  C  CG    . PRO E 1  43  ? -0.953  -23.560 81.800 1.00 64.37  ? 43   PRO E CG    1 
ATOM   3076  C  CD    . PRO E 1  43  ? 0.377   -22.954 82.061 1.00 67.53  ? 43   PRO E CD    1 
ATOM   3077  N  N     . GLY E 1  44  ? -0.792  -21.133 77.857 1.00 59.26  ? 44   GLY E N     1 
ATOM   3078  C  CA    . GLY E 1  44  ? -1.519  -20.152 77.051 1.00 59.49  ? 44   GLY E CA    1 
ATOM   3079  C  C     . GLY E 1  44  ? -0.689  -18.953 76.667 1.00 58.94  ? 44   GLY E C     1 
ATOM   3080  O  O     . GLY E 1  44  ? -1.032  -18.224 75.758 1.00 58.87  ? 44   GLY E O     1 
ATOM   3081  N  N     . THR E 1  45  ? 0.405   -18.733 77.376 1.00 63.50  ? 45   THR E N     1 
ATOM   3082  C  CA    . THR E 1  45  ? 1.218   -17.578 77.130 1.00 59.46  ? 45   THR E CA    1 
ATOM   3083  C  C     . THR E 1  45  ? 2.071   -17.853 75.904 1.00 55.32  ? 45   THR E C     1 
ATOM   3084  O  O     . THR E 1  45  ? 2.232   -16.971 75.060 1.00 59.07  ? 45   THR E O     1 
ATOM   3085  C  CB    . THR E 1  45  ? 2.055   -17.224 78.380 1.00 64.27  ? 45   THR E CB    1 
ATOM   3086  O  OG1   . THR E 1  45  ? 1.173   -16.921 79.457 1.00 64.74  ? 45   THR E OG1   1 
ATOM   3087  C  CG2   . THR E 1  45  ? 2.929   -16.009 78.144 1.00 66.56  ? 45   THR E CG2   1 
ATOM   3088  N  N     . VAL E 1  46  ? 2.615   -19.059 75.786 1.00 52.81  ? 46   VAL E N     1 
ATOM   3089  C  CA    . VAL E 1  46  ? 3.435   -19.368 74.610 1.00 55.66  ? 46   VAL E CA    1 
ATOM   3090  C  C     . VAL E 1  46  ? 2.476   -19.539 73.444 1.00 59.57  ? 46   VAL E C     1 
ATOM   3091  O  O     . VAL E 1  46  ? 2.814   -19.184 72.297 1.00 57.60  ? 46   VAL E O     1 
ATOM   3092  C  CB    . VAL E 1  46  ? 4.298   -20.639 74.769 1.00 52.97  ? 46   VAL E CB    1 
ATOM   3093  C  CG1   . VAL E 1  46  ? 5.298   -20.787 73.624 1.00 48.81  ? 46   VAL E CG1   1 
ATOM   3094  C  CG2   . VAL E 1  46  ? 5.063   -20.578 76.071 1.00 57.46  ? 46   VAL E CG2   1 
ATOM   3095  N  N     . ALA E 1  47  ? 1.271   -20.048 73.737 1.00 54.81  ? 47   ALA E N     1 
ATOM   3096  C  CA    . ALA E 1  47  ? 0.300   -20.285 72.678 1.00 54.53  ? 47   ALA E CA    1 
ATOM   3097  C  C     . ALA E 1  47  ? -0.055  -18.950 71.983 1.00 53.48  ? 47   ALA E C     1 
ATOM   3098  O  O     . ALA E 1  47  ? 0.043   -18.843 70.756 1.00 56.21  ? 47   ALA E O     1 
ATOM   3099  C  CB    . ALA E 1  47  ? -0.932  -21.017 73.197 1.00 51.49  ? 47   ALA E CB    1 
ATOM   3100  N  N     . LEU E 1  48  ? -0.400  -17.927 72.758 1.00 48.77  ? 48   LEU E N     1 
ATOM   3101  C  CA    . LEU E 1  48  ? -0.615  -16.596 72.190 1.00 50.92  ? 48   LEU E CA    1 
ATOM   3102  C  C     . LEU E 1  48  ? 0.648   -16.051 71.503 1.00 53.28  ? 48   LEU E C     1 
ATOM   3103  O  O     . LEU E 1  48  ? 0.565   -15.366 70.482 1.00 56.95  ? 48   LEU E O     1 
ATOM   3104  C  CB    . LEU E 1  48  ? -1.065  -15.631 73.257 1.00 48.68  ? 48   LEU E CB    1 
ATOM   3105  C  CG    . LEU E 1  48  ? -2.422  -15.987 73.828 1.00 57.05  ? 48   LEU E CG    1 
ATOM   3106  C  CD1   . LEU E 1  48  ? -2.630  -15.272 75.142 1.00 58.47  ? 48   LEU E CD1   1 
ATOM   3107  C  CD2   . LEU E 1  48  ? -3.555  -15.624 72.883 1.00 60.56  ? 48   LEU E CD2   1 
ATOM   3108  N  N     . ARG E 1  49  ? 1.820   -16.353 72.047 1.00 48.28  ? 49   ARG E N     1 
ATOM   3109  C  CA    . ARG E 1  49  ? 3.044   -15.884 71.436 1.00 51.83  ? 49   ARG E CA    1 
ATOM   3110  C  C     . ARG E 1  49  ? 3.113   -16.437 69.994 1.00 54.34  ? 49   ARG E C     1 
ATOM   3111  O  O     . ARG E 1  49  ? 3.444   -15.727 69.018 1.00 52.04  ? 49   ARG E O     1 
ATOM   3112  C  CB    . ARG E 1  49  ? 4.254   -16.342 72.277 1.00 59.13  ? 49   ARG E CB    1 
ATOM   3113  C  CG    . ARG E 1  49  ? 5.521   -15.507 72.100 1.00 62.59  ? 49   ARG E CG    1 
ATOM   3114  C  CD    . ARG E 1  49  ? 6.839   -16.290 72.240 1.00 69.95  ? 49   ARG E CD    1 
ATOM   3115  N  NE    . ARG E 1  49  ? 7.294   -16.812 73.547 1.00 70.11  ? 49   ARG E NE    1 
ATOM   3116  C  CZ    . ARG E 1  49  ? 6.901   -16.423 74.761 1.00 75.71  ? 49   ARG E CZ    1 
ATOM   3117  N  NH1   . ARG E 1  49  ? 5.988   -15.464 74.976 1.00 80.51  ? 49   ARG E NH1   1 
ATOM   3118  N  NH2   . ARG E 1  49  ? 7.450   -17.017 75.805 1.00 70.98  ? 49   ARG E NH2   1 
ATOM   3119  N  N     . GLU E 1  50  ? 2.765   -17.711 69.856 1.00 54.98  ? 50   GLU E N     1 
ATOM   3120  C  CA    . GLU E 1  50  ? 2.820   -18.362 68.551 1.00 58.27  ? 50   GLU E CA    1 
ATOM   3121  C  C     . GLU E 1  50  ? 1.777   -17.813 67.571 1.00 57.86  ? 50   GLU E C     1 
ATOM   3122  O  O     . GLU E 1  50  ? 2.101   -17.536 66.396 1.00 52.97  ? 50   GLU E O     1 
ATOM   3123  C  CB    . GLU E 1  50  ? 2.702   -19.870 68.714 1.00 62.05  ? 50   GLU E CB    1 
ATOM   3124  C  CG    . GLU E 1  50  ? 3.962   -20.483 69.286 1.00 61.29  ? 50   GLU E CG    1 
ATOM   3125  C  CD    . GLU E 1  50  ? 3.757   -21.873 69.808 1.00 69.22  ? 50   GLU E CD    1 
ATOM   3126  O  OE1   . GLU E 1  50  ? 4.629   -22.295 70.583 1.00 87.12  ? 50   GLU E OE1   1 
ATOM   3127  O  OE2   . GLU E 1  50  ? 2.755   -22.546 69.452 1.00 74.78  ? 50   GLU E OE2   1 
ATOM   3128  N  N     . ILE E 1  51  ? 0.549   -17.617 68.059 1.00 51.91  ? 51   ILE E N     1 
ATOM   3129  C  CA    . ILE E 1  51  ? -0.486  -17.005 67.243 1.00 50.21  ? 51   ILE E CA    1 
ATOM   3130  C  C     . ILE E 1  51  ? 0.035   -15.675 66.666 1.00 51.33  ? 51   ILE E C     1 
ATOM   3131  O  O     . ILE E 1  51  ? -0.091  -15.429 65.462 1.00 55.46  ? 51   ILE E O     1 
ATOM   3132  C  CB    . ILE E 1  51  ? -1.798  -16.765 68.020 1.00 49.51  ? 51   ILE E CB    1 
ATOM   3133  C  CG1   . ILE E 1  51  ? -2.404  -18.088 68.500 1.00 47.12  ? 51   ILE E CG1   1 
ATOM   3134  C  CG2   . ILE E 1  51  ? -2.822  -16.060 67.137 1.00 48.44  ? 51   ILE E CG2   1 
ATOM   3135  C  CD1   . ILE E 1  51  ? -3.721  -17.936 69.228 1.00 45.19  ? 51   ILE E CD1   1 
ATOM   3136  N  N     . ARG E 1  52  ? 0.648   -14.834 67.495 1.00 48.20  ? 52   ARG E N     1 
ATOM   3137  C  CA    . ARG E 1  52  ? 1.118   -13.528 67.009 1.00 48.29  ? 52   ARG E CA    1 
ATOM   3138  C  C     . ARG E 1  52  ? 2.191   -13.735 65.964 1.00 47.00  ? 52   ARG E C     1 
ATOM   3139  O  O     . ARG E 1  52  ? 2.254   -13.012 65.003 1.00 50.82  ? 52   ARG E O     1 
ATOM   3140  C  CB    . ARG E 1  52  ? 1.606   -12.621 68.161 1.00 47.42  ? 52   ARG E CB    1 
ATOM   3141  C  CG    . ARG E 1  52  ? 0.485   -12.158 69.105 1.00 52.32  ? 52   ARG E CG    1 
ATOM   3142  C  CD    . ARG E 1  52  ? 0.930   -11.238 70.235 1.00 58.57  ? 52   ARG E CD    1 
ATOM   3143  N  NE    . ARG E 1  52  ? 0.560   -11.784 71.553 1.00 62.21  ? 52   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E 1  52  ? -0.608  -11.589 72.173 1.00 65.84  ? 52   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E 1  52  ? -1.588  -10.854 71.645 1.00 64.45  ? 52   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E 1  52  ? -0.802  -12.144 73.353 1.00 72.68  ? 52   ARG E NH2   1 
ATOM   3147  N  N     . ARG E 1  53  ? 3.007   -14.758 66.155 1.00 53.67  ? 53   ARG E N     1 
ATOM   3148  C  CA    . ARG E 1  53  ? 4.154   -15.006 65.320 1.00 51.98  ? 53   ARG E CA    1 
ATOM   3149  C  C     . ARG E 1  53  ? 3.700   -15.523 63.975 1.00 53.99  ? 53   ARG E C     1 
ATOM   3150  O  O     . ARG E 1  53  ? 4.064   -14.973 62.928 1.00 53.09  ? 53   ARG E O     1 
ATOM   3151  C  CB    . ARG E 1  53  ? 5.062   -16.045 65.997 1.00 55.31  ? 53   ARG E CB    1 
ATOM   3152  C  CG    . ARG E 1  53  ? 6.234   -16.468 65.121 1.00 61.03  ? 53   ARG E CG    1 
ATOM   3153  C  CD    . ARG E 1  53  ? 7.011   -17.674 65.631 1.00 68.54  ? 53   ARG E CD    1 
ATOM   3154  N  NE    . ARG E 1  53  ? 7.994   -18.066 64.607 1.00 79.49  ? 53   ARG E NE    1 
ATOM   3155  C  CZ    . ARG E 1  53  ? 8.847   -19.088 64.695 1.00 76.47  ? 53   ARG E CZ    1 
ATOM   3156  N  NH1   . ARG E 1  53  ? 8.876   -19.865 65.771 1.00 70.41  ? 53   ARG E NH1   1 
ATOM   3157  N  NH2   . ARG E 1  53  ? 9.686   -19.318 63.692 1.00 78.99  ? 53   ARG E NH2   1 
ATOM   3158  N  N     . TYR E 1  54  ? 2.904   -16.589 63.995 1.00 49.54  ? 54   TYR E N     1 
ATOM   3159  C  CA    . TYR E 1  54  ? 2.494   -17.203 62.742 1.00 50.45  ? 54   TYR E CA    1 
ATOM   3160  C  C     . TYR E 1  54  ? 1.511   -16.333 61.946 1.00 49.70  ? 54   TYR E C     1 
ATOM   3161  O  O     . TYR E 1  54  ? 1.478   -16.427 60.701 1.00 50.51  ? 54   TYR E O     1 
ATOM   3162  C  CB    . TYR E 1  54  ? 1.988   -18.645 62.971 1.00 50.52  ? 54   TYR E CB    1 
ATOM   3163  C  CG    . TYR E 1  54  ? 3.132   -19.510 63.402 1.00 49.68  ? 54   TYR E CG    1 
ATOM   3164  C  CD1   . TYR E 1  54  ? 3.171   -20.117 64.663 1.00 50.74  ? 54   TYR E CD1   1 
ATOM   3165  C  CD2   . TYR E 1  54  ? 4.220   -19.658 62.579 1.00 46.85  ? 54   TYR E CD2   1 
ATOM   3166  C  CE1   . TYR E 1  54  ? 4.266   -20.874 65.052 1.00 47.68  ? 54   TYR E CE1   1 
ATOM   3167  C  CE2   . TYR E 1  54  ? 5.305   -20.404 62.963 1.00 49.97  ? 54   TYR E CE2   1 
ATOM   3168  C  CZ    . TYR E 1  54  ? 5.329   -21.007 64.196 1.00 45.87  ? 54   TYR E CZ    1 
ATOM   3169  O  OH    . TYR E 1  54  ? 6.452   -21.716 64.535 1.00 48.44  ? 54   TYR E OH    1 
ATOM   3170  N  N     . GLN E 1  55  ? 0.740   -15.484 62.640 1.00 44.35  ? 55   GLN E N     1 
ATOM   3171  C  CA    . GLN E 1  55  ? -0.147  -14.526 61.945 1.00 46.63  ? 55   GLN E CA    1 
ATOM   3172  C  C     . GLN E 1  55  ? 0.583   -13.354 61.282 1.00 51.22  ? 55   GLN E C     1 
ATOM   3173  O  O     . GLN E 1  55  ? 0.033   -12.685 60.407 1.00 54.58  ? 55   GLN E O     1 
ATOM   3174  C  CB    . GLN E 1  55  ? -1.210  -13.998 62.876 1.00 42.95  ? 55   GLN E CB    1 
ATOM   3175  C  CG    . GLN E 1  55  ? -2.392  -14.925 62.963 1.00 45.63  ? 55   GLN E CG    1 
ATOM   3176  C  CD    . GLN E 1  55  ? -3.424  -14.436 63.915 1.00 47.09  ? 55   GLN E CD    1 
ATOM   3177  O  OE1   . GLN E 1  55  ? -3.271  -13.384 64.547 1.00 53.35  ? 55   GLN E OE1   1 
ATOM   3178  N  NE2   . GLN E 1  55  ? -4.488  -15.193 64.042 1.00 50.86  ? 55   GLN E NE2   1 
ATOM   3179  N  N     . LYS E 1  56  ? 1.828   -13.132 61.693 1.00 53.70  ? 56   LYS E N     1 
ATOM   3180  C  CA    . LYS E 1  56  ? 2.666   -12.079 61.160 1.00 55.04  ? 56   LYS E CA    1 
ATOM   3181  C  C     . LYS E 1  56  ? 3.413   -12.534 59.912 1.00 55.01  ? 56   LYS E C     1 
ATOM   3182  O  O     . LYS E 1  56  ? 3.847   -11.704 59.116 1.00 56.83  ? 56   LYS E O     1 
ATOM   3183  C  CB    . LYS E 1  56  ? 3.672   -11.718 62.233 1.00 64.59  ? 56   LYS E CB    1 
ATOM   3184  C  CG    . LYS E 1  56  ? 4.464   -10.437 62.049 1.00 73.04  ? 56   LYS E CG    1 
ATOM   3185  C  CD    . LYS E 1  56  ? 4.877   -9.948  63.433 1.00 81.37  ? 56   LYS E CD    1 
ATOM   3186  C  CE    . LYS E 1  56  ? 6.202   -9.206  63.467 1.00 91.50  ? 56   LYS E CE    1 
ATOM   3187  N  NZ    . LYS E 1  56  ? 6.426   -8.782  64.883 1.00 97.83  ? 56   LYS E NZ    1 
ATOM   3188  N  N     . SER E 1  57  ? 3.596   -13.838 59.743 1.00 50.28  ? 57   SER E N     1 
ATOM   3189  C  CA    . SER E 1  57  ? 4.413   -14.326 58.643 1.00 51.30  ? 57   SER E CA    1 
ATOM   3190  C  C     . SER E 1  57  ? 3.582   -15.077 57.606 1.00 55.27  ? 57   SER E C     1 
ATOM   3191  O  O     . SER E 1  57  ? 2.371   -15.366 57.807 1.00 49.48  ? 57   SER E O     1 
ATOM   3192  C  CB    . SER E 1  57  ? 5.484   -15.252 59.182 1.00 52.10  ? 57   SER E CB    1 
ATOM   3193  O  OG    . SER E 1  57  ? 4.857   -16.234 59.979 1.00 57.62  ? 57   SER E OG    1 
ATOM   3194  N  N     . THR E 1  58  ? 4.260   -15.409 56.511 1.00 49.18  ? 58   THR E N     1 
ATOM   3195  C  CA    . THR E 1  58  ? 3.648   -16.138 55.434 1.00 48.39  ? 58   THR E CA    1 
ATOM   3196  C  C     . THR E 1  58  ? 4.340   -17.441 54.987 1.00 49.23  ? 58   THR E C     1 
ATOM   3197  O  O     . THR E 1  58  ? 3.912   -18.015 53.983 1.00 47.35  ? 58   THR E O     1 
ATOM   3198  C  CB    . THR E 1  58  ? 3.615   -15.238 54.208 1.00 50.70  ? 58   THR E CB    1 
ATOM   3199  O  OG1   . THR E 1  58  ? 4.940   -15.082 53.740 1.00 45.69  ? 58   THR E OG1   1 
ATOM   3200  C  CG2   . THR E 1  58  ? 3.053   -13.876 54.559 1.00 52.12  ? 58   THR E CG2   1 
ATOM   3201  N  N     . GLU E 1  59  ? 5.379   -17.920 55.689 1.00 48.80  ? 59   GLU E N     1 
ATOM   3202  C  CA    . GLU E 1  59  ? 6.045   -19.159 55.255 1.00 48.40  ? 59   GLU E CA    1 
ATOM   3203  C  C     . GLU E 1  59  ? 5.103   -20.343 55.349 1.00 49.25  ? 59   GLU E C     1 
ATOM   3204  O  O     . GLU E 1  59  ? 4.294   -20.399 56.273 1.00 48.26  ? 59   GLU E O     1 
ATOM   3205  C  CB    . GLU E 1  59  ? 7.296   -19.537 56.030 1.00 51.26  ? 59   GLU E CB    1 
ATOM   3206  C  CG    . GLU E 1  59  ? 7.726   -18.679 57.183 1.00 65.10  ? 59   GLU E CG    1 
ATOM   3207  C  CD    . GLU E 1  59  ? 7.037   -18.991 58.484 1.00 68.43  ? 59   GLU E CD    1 
ATOM   3208  O  OE1   . GLU E 1  59  ? 7.549   -19.865 59.212 1.00 67.29  ? 59   GLU E OE1   1 
ATOM   3209  O  OE2   . GLU E 1  59  ? 6.036   -18.303 58.794 1.00 68.44  ? 59   GLU E OE2   1 
ATOM   3210  N  N     . LEU E 1  60  ? 5.243   -21.313 54.435 1.00 45.44  ? 60   LEU E N     1 
ATOM   3211  C  CA    . LEU E 1  60  ? 4.552   -22.594 54.633 1.00 48.39  ? 60   LEU E CA    1 
ATOM   3212  C  C     . LEU E 1  60  ? 4.976   -23.245 55.943 1.00 47.57  ? 60   LEU E C     1 
ATOM   3213  O  O     . LEU E 1  60  ? 6.123   -23.142 56.344 1.00 55.67  ? 60   LEU E O     1 
ATOM   3214  C  CB    . LEU E 1  60  ? 4.754   -23.543 53.482 1.00 48.20  ? 60   LEU E CB    1 
ATOM   3215  C  CG    . LEU E 1  60  ? 4.217   -22.900 52.220 1.00 53.73  ? 60   LEU E CG    1 
ATOM   3216  C  CD1   . LEU E 1  60  ? 4.481   -23.854 51.085 1.00 54.70  ? 60   LEU E CD1   1 
ATOM   3217  C  CD2   . LEU E 1  60  ? 2.731   -22.526 52.327 1.00 53.20  ? 60   LEU E CD2   1 
ATOM   3218  N  N     . LEU E 1  61  ? 4.011   -23.853 56.619 1.00 47.47  ? 61   LEU E N     1 
ATOM   3219  C  CA    . LEU E 1  61  ? 4.179   -24.390 57.947 1.00 48.99  ? 61   LEU E CA    1 
ATOM   3220  C  C     . LEU E 1  61  ? 4.272   -25.937 57.979 1.00 50.08  ? 61   LEU E C     1 
ATOM   3221  O  O     . LEU E 1  61  ? 4.571   -26.528 59.025 1.00 52.31  ? 61   LEU E O     1 
ATOM   3222  C  CB    . LEU E 1  61  ? 3.028   -23.891 58.816 1.00 50.36  ? 61   LEU E CB    1 
ATOM   3223  C  CG    . LEU E 1  61  ? 2.911   -22.360 58.932 1.00 51.32  ? 61   LEU E CG    1 
ATOM   3224  C  CD1   . LEU E 1  61  ? 1.562   -21.955 59.490 1.00 48.80  ? 61   LEU E CD1   1 
ATOM   3225  C  CD2   . LEU E 1  61  ? 4.021   -21.787 59.805 1.00 52.77  ? 61   LEU E CD2   1 
ATOM   3226  N  N     . ILE E 1  62  ? 4.021   -26.589 56.845 1.00 47.20  ? 62   ILE E N     1 
ATOM   3227  C  CA    . ILE E 1  62  ? 4.232   -28.017 56.722 1.00 47.98  ? 62   ILE E CA    1 
ATOM   3228  C  C     . ILE E 1  62  ? 5.583   -28.215 56.020 1.00 46.97  ? 62   ILE E C     1 
ATOM   3229  O  O     . ILE E 1  62  ? 5.902   -27.472 55.125 1.00 48.56  ? 62   ILE E O     1 
ATOM   3230  C  CB    . ILE E 1  62  ? 3.107   -28.683 55.915 1.00 50.07  ? 62   ILE E CB    1 
ATOM   3231  C  CG1   . ILE E 1  62  ? 1.765   -28.557 56.643 1.00 49.27  ? 62   ILE E CG1   1 
ATOM   3232  C  CG2   . ILE E 1  62  ? 3.411   -30.159 55.665 1.00 53.20  ? 62   ILE E CG2   1 
ATOM   3233  C  CD1   . ILE E 1  62  ? 0.591   -29.147 55.886 1.00 46.53  ? 62   ILE E CD1   1 
ATOM   3234  N  N     . ARG E 1  63  ? 6.365   -29.213 56.442 1.00 47.87  ? 63   ARG E N     1 
ATOM   3235  C  CA    . ARG E 1  63  ? 7.697   -29.453 55.904 1.00 46.52  ? 63   ARG E CA    1 
ATOM   3236  C  C     . ARG E 1  63  ? 7.569   -29.899 54.439 1.00 46.19  ? 63   ARG E C     1 
ATOM   3237  O  O     . ARG E 1  63  ? 6.657   -30.628 54.079 1.00 48.69  ? 63   ARG E O     1 
ATOM   3238  C  CB    . ARG E 1  63  ? 8.387   -30.554 56.712 1.00 54.42  ? 63   ARG E CB    1 
ATOM   3239  C  CG    . ARG E 1  63  ? 8.752   -30.282 58.172 1.00 57.19  ? 63   ARG E CG    1 
ATOM   3240  C  CD    . ARG E 1  63  ? 10.003  -29.425 58.354 1.00 67.78  ? 63   ARG E CD    1 
ATOM   3241  N  NE    . ARG E 1  63  ? 9.631   -28.070 58.819 1.00 81.25  ? 63   ARG E NE    1 
ATOM   3242  C  CZ    . ARG E 1  63  ? 9.786   -26.930 58.136 1.00 75.89  ? 63   ARG E CZ    1 
ATOM   3243  N  NH1   . ARG E 1  63  ? 10.348  -26.934 56.932 1.00 84.23  ? 63   ARG E NH1   1 
ATOM   3244  N  NH2   . ARG E 1  63  ? 9.380   -25.772 58.663 1.00 68.63  ? 63   ARG E NH2   1 
ATOM   3245  N  N     . LYS E 1  64  ? 8.477   -29.478 53.587 1.00 44.91  ? 64   LYS E N     1 
ATOM   3246  C  CA    . LYS E 1  64  ? 8.268   -29.633 52.146 1.00 54.47  ? 64   LYS E CA    1 
ATOM   3247  C  C     . LYS E 1  64  ? 8.223   -31.075 51.684 1.00 48.90  ? 64   LYS E C     1 
ATOM   3248  O  O     . LYS E 1  64  ? 7.318   -31.468 50.980 1.00 54.88  ? 64   LYS E O     1 
ATOM   3249  C  CB    . LYS E 1  64  ? 9.349   -28.905 51.335 1.00 60.19  ? 64   LYS E CB    1 
ATOM   3250  C  CG    . LYS E 1  64  ? 9.055   -27.447 51.059 1.00 66.38  ? 64   LYS E CG    1 
ATOM   3251  C  CD    . LYS E 1  64  ? 10.065  -26.913 50.044 1.00 82.53  ? 64   LYS E CD    1 
ATOM   3252  C  CE    . LYS E 1  64  ? 10.215  -25.387 50.099 1.00 91.57  ? 64   LYS E CE    1 
ATOM   3253  N  NZ    . LYS E 1  64  ? 8.929   -24.666 50.359 1.00 90.91  ? 64   LYS E NZ    1 
ATOM   3254  N  N     . LEU E 1  65  ? 9.222   -31.840 52.074 1.00 50.17  ? 65   LEU E N     1 
ATOM   3255  C  CA    . LEU E 1  65  ? 9.388   -33.199 51.598 1.00 50.00  ? 65   LEU E CA    1 
ATOM   3256  C  C     . LEU E 1  65  ? 8.266   -34.120 52.049 1.00 47.46  ? 65   LEU E C     1 
ATOM   3257  O  O     . LEU E 1  65  ? 7.702   -34.816 51.210 1.00 46.82  ? 65   LEU E O     1 
ATOM   3258  C  CB    . LEU E 1  65  ? 10.750  -33.781 52.017 1.00 51.27  ? 65   LEU E CB    1 
ATOM   3259  C  CG    . LEU E 1  65  ? 11.012  -35.227 51.543 1.00 51.61  ? 65   LEU E CG    1 
ATOM   3260  C  CD1   . LEU E 1  65  ? 11.025  -35.361 50.021 1.00 51.67  ? 65   LEU E CD1   1 
ATOM   3261  C  CD2   . LEU E 1  65  ? 12.335  -35.644 52.120 1.00 54.94  ? 65   LEU E CD2   1 
ATOM   3262  N  N     . PRO E 1  66  ? 7.957   -34.152 53.362 1.00 44.54  ? 66   PRO E N     1 
ATOM   3263  C  CA    . PRO E 1  66  ? 6.811   -34.919 53.793 1.00 45.01  ? 66   PRO E CA    1 
ATOM   3264  C  C     . PRO E 1  66  ? 5.581   -34.612 52.956 1.00 44.40  ? 66   PRO E C     1 
ATOM   3265  O  O     . PRO E 1  66  ? 4.946   -35.507 52.420 1.00 49.12  ? 66   PRO E O     1 
ATOM   3266  C  CB    . PRO E 1  66  ? 6.585   -34.445 55.228 1.00 50.06  ? 66   PRO E CB    1 
ATOM   3267  C  CG    . PRO E 1  66  ? 7.908   -33.998 55.688 1.00 48.13  ? 66   PRO E CG    1 
ATOM   3268  C  CD    . PRO E 1  66  ? 8.534   -33.382 54.472 1.00 47.07  ? 66   PRO E CD    1 
ATOM   3269  N  N     . PHE E 1  67  ? 5.256   -33.342 52.807 1.00 49.64  ? 67   PHE E N     1 
ATOM   3270  C  CA    . PHE E 1  67  ? 4.063   -32.987 52.051 1.00 48.62  ? 67   PHE E CA    1 
ATOM   3271  C  C     . PHE E 1  67  ? 4.183   -33.541 50.612 1.00 46.61  ? 67   PHE E C     1 
ATOM   3272  O  O     . PHE E 1  67  ? 3.203   -33.988 50.030 1.00 48.17  ? 67   PHE E O     1 
ATOM   3273  C  CB    . PHE E 1  67  ? 3.791   -31.472 52.099 1.00 42.22  ? 67   PHE E CB    1 
ATOM   3274  C  CG    . PHE E 1  67  ? 2.582   -31.066 51.322 1.00 41.09  ? 67   PHE E CG    1 
ATOM   3275  C  CD1   . PHE E 1  67  ? 1.363   -30.928 51.941 1.00 43.63  ? 67   PHE E CD1   1 
ATOM   3276  C  CD2   . PHE E 1  67  ? 2.657   -30.847 49.960 1.00 39.88  ? 67   PHE E CD2   1 
ATOM   3277  C  CE1   . PHE E 1  67  ? 0.221   -30.598 51.212 1.00 38.94  ? 67   PHE E CE1   1 
ATOM   3278  C  CE2   . PHE E 1  67  ? 1.541   -30.510 49.244 1.00 38.97  ? 67   PHE E CE2   1 
ATOM   3279  C  CZ    . PHE E 1  67  ? 0.313   -30.378 49.878 1.00 37.39  ? 67   PHE E CZ    1 
ATOM   3280  N  N     . GLN E 1  68  ? 5.378   -33.515 50.053 1.00 47.53  ? 68   GLN E N     1 
ATOM   3281  C  CA    . GLN E 1  68  ? 5.593   -33.961 48.669 1.00 53.31  ? 68   GLN E CA    1 
ATOM   3282  C  C     . GLN E 1  68  ? 5.296   -35.451 48.550 1.00 53.72  ? 68   GLN E C     1 
ATOM   3283  O  O     . GLN E 1  68  ? 4.672   -35.906 47.577 1.00 58.26  ? 68   GLN E O     1 
ATOM   3284  C  CB    . GLN E 1  68  ? 7.030   -33.682 48.220 1.00 56.65  ? 68   GLN E CB    1 
ATOM   3285  C  CG    . GLN E 1  68  ? 7.145   -33.418 46.738 1.00 70.03  ? 68   GLN E CG    1 
ATOM   3286  C  CD    . GLN E 1  68  ? 8.578   -33.241 46.259 1.00 80.78  ? 68   GLN E CD    1 
ATOM   3287  O  OE1   . GLN E 1  68  ? 9.540   -33.675 46.912 1.00 86.48  ? 68   GLN E OE1   1 
ATOM   3288  N  NE2   . GLN E 1  68  ? 8.728   -32.607 45.099 1.00 84.34  ? 68   GLN E NE2   1 
ATOM   3289  N  N     . ARG E 1  69  ? 5.727   -36.216 49.542 1.00 46.93  ? 69   ARG E N     1 
ATOM   3290  C  CA    . ARG E 1  69  ? 5.555   -37.639 49.469 1.00 50.49  ? 69   ARG E CA    1 
ATOM   3291  C  C     . ARG E 1  69  ? 4.097   -37.948 49.494 1.00 50.36  ? 69   ARG E C     1 
ATOM   3292  O  O     . ARG E 1  69  ? 3.617   -38.777 48.717 1.00 58.04  ? 69   ARG E O     1 
ATOM   3293  C  CB    . ARG E 1  69  ? 6.145   -38.311 50.671 1.00 57.43  ? 69   ARG E CB    1 
ATOM   3294  C  CG    . ARG E 1  69  ? 7.625   -38.570 50.641 1.00 54.99  ? 69   ARG E CG    1 
ATOM   3295  C  CD    . ARG E 1  69  ? 7.937   -39.300 51.946 1.00 56.41  ? 69   ARG E CD    1 
ATOM   3296  N  NE    . ARG E 1  69  ? 9.151   -38.772 52.526 1.00 60.31  ? 69   ARG E NE    1 
ATOM   3297  C  CZ    . ARG E 1  69  ? 9.309   -38.368 53.775 1.00 55.81  ? 69   ARG E CZ    1 
ATOM   3298  N  NH1   . ARG E 1  69  ? 8.337   -38.423 54.675 1.00 47.48  ? 69   ARG E NH1   1 
ATOM   3299  N  NH2   . ARG E 1  69  ? 10.498  -37.901 54.106 1.00 65.85  ? 69   ARG E NH2   1 
ATOM   3300  N  N     . LEU E 1  70  ? 3.412   -37.290 50.428 1.00 48.20  ? 70   LEU E N     1 
ATOM   3301  C  CA    . LEU E 1  70  ? 1.974   -37.419 50.591 1.00 43.56  ? 70   LEU E CA    1 
ATOM   3302  C  C     . LEU E 1  70  ? 1.235   -37.139 49.294 1.00 46.93  ? 70   LEU E C     1 
ATOM   3303  O  O     . LEU E 1  70  ? 0.289   -37.859 48.975 1.00 42.86  ? 70   LEU E O     1 
ATOM   3304  C  CB    . LEU E 1  70  ? 1.464   -36.500 51.699 1.00 42.44  ? 70   LEU E CB    1 
ATOM   3305  C  CG    . LEU E 1  70  ? -0.063  -36.622 51.925 1.00 44.66  ? 70   LEU E CG    1 
ATOM   3306  C  CD1   . LEU E 1  70  ? -0.503  -38.061 52.203 1.00 43.17  ? 70   LEU E CD1   1 
ATOM   3307  C  CD2   . LEU E 1  70  ? -0.502  -35.690 53.041 1.00 43.25  ? 70   LEU E CD2   1 
ATOM   3308  N  N     . VAL E 1  71  ? 1.666   -36.112 48.545 1.00 47.09  ? 71   VAL E N     1 
ATOM   3309  C  CA    . VAL E 1  71  ? 1.057   -35.811 47.250 1.00 47.43  ? 71   VAL E CA    1 
ATOM   3310  C  C     . VAL E 1  71  ? 1.281   -37.015 46.347 1.00 47.23  ? 71   VAL E C     1 
ATOM   3311  O  O     . VAL E 1  71  ? 0.338   -37.592 45.803 1.00 45.58  ? 71   VAL E O     1 
ATOM   3312  C  CB    . VAL E 1  71  ? 1.633   -34.527 46.608 1.00 47.89  ? 71   VAL E CB    1 
ATOM   3313  C  CG1   . VAL E 1  71  ? 1.141   -34.336 45.188 1.00 48.67  ? 71   VAL E CG1   1 
ATOM   3314  C  CG2   . VAL E 1  71  ? 1.241   -33.294 47.407 1.00 51.56  ? 71   VAL E CG2   1 
ATOM   3315  N  N     . ARG E 1  72  ? 2.532   -37.424 46.224 1.00 49.45  ? 72   ARG E N     1 
ATOM   3316  C  CA    . ARG E 1  72  ? 2.886   -38.505 45.278 1.00 51.03  ? 72   ARG E CA    1 
ATOM   3317  C  C     . ARG E 1  72  ? 2.213   -39.835 45.593 1.00 47.86  ? 72   ARG E C     1 
ATOM   3318  O  O     . ARG E 1  72  ? 1.868   -40.590 44.687 1.00 46.15  ? 72   ARG E O     1 
ATOM   3319  C  CB    . ARG E 1  72  ? 4.399   -38.685 45.193 1.00 49.27  ? 72   ARG E CB    1 
ATOM   3320  C  CG    . ARG E 1  72  ? 5.102   -37.486 44.568 1.00 53.13  ? 72   ARG E CG    1 
ATOM   3321  C  CD    . ARG E 1  72  ? 6.583   -37.674 44.679 1.00 55.80  ? 72   ARG E CD    1 
ATOM   3322  N  NE    . ARG E 1  72  ? 7.340   -36.503 44.299 1.00 61.30  ? 72   ARG E NE    1 
ATOM   3323  C  CZ    . ARG E 1  72  ? 7.528   -36.113 43.048 1.00 64.35  ? 72   ARG E CZ    1 
ATOM   3324  N  NH1   . ARG E 1  72  ? 6.974   -36.767 42.037 1.00 67.98  ? 72   ARG E NH1   1 
ATOM   3325  N  NH2   . ARG E 1  72  ? 8.268   -35.049 42.807 1.00 69.94  ? 72   ARG E NH2   1 
ATOM   3326  N  N     . GLU E 1  73  ? 2.020   -40.100 46.876 1.00 45.00  ? 73   GLU E N     1 
ATOM   3327  C  CA    . GLU E 1  73  ? 1.311   -41.272 47.311 1.00 43.75  ? 73   GLU E CA    1 
ATOM   3328  C  C     . GLU E 1  73  ? -0.125  -41.210 46.843 1.00 45.46  ? 73   GLU E C     1 
ATOM   3329  O  O     . GLU E 1  73  ? -0.650  -42.135 46.227 1.00 49.58  ? 73   GLU E O     1 
ATOM   3330  C  CB    . GLU E 1  73  ? 1.356   -41.362 48.845 1.00 44.62  ? 73   GLU E CB    1 
ATOM   3331  C  CG    . GLU E 1  73  ? 0.507   -42.489 49.430 1.00 42.54  ? 73   GLU E CG    1 
ATOM   3332  C  CD    . GLU E 1  73  ? 0.637   -42.674 50.953 1.00 43.63  ? 73   GLU E CD    1 
ATOM   3333  O  OE1   . GLU E 1  73  ? 1.749   -42.549 51.534 1.00 46.42  ? 73   GLU E OE1   1 
ATOM   3334  O  OE2   . GLU E 1  73  ? -0.397  -43.001 51.578 1.00 41.71  ? 73   GLU E OE2   1 
ATOM   3335  N  N     . ILE E 1  74  ? -0.794  -40.120 47.162 1.00 52.74  ? 74   ILE E N     1 
ATOM   3336  C  CA    . ILE E 1  74  ? -2.207  -40.003 46.821 1.00 48.14  ? 74   ILE E CA    1 
ATOM   3337  C  C     . ILE E 1  74  ? -2.342  -40.071 45.323 1.00 48.91  ? 74   ILE E C     1 
ATOM   3338  O  O     . ILE E 1  74  ? -3.139  -40.862 44.820 1.00 49.90  ? 74   ILE E O     1 
ATOM   3339  C  CB    . ILE E 1  74  ? -2.844  -38.757 47.418 1.00 45.59  ? 74   ILE E CB    1 
ATOM   3340  C  CG1   . ILE E 1  74  ? -2.979  -38.956 48.932 1.00 45.32  ? 74   ILE E CG1   1 
ATOM   3341  C  CG2   . ILE E 1  74  ? -4.212  -38.511 46.819 1.00 47.95  ? 74   ILE E CG2   1 
ATOM   3342  C  CD1   . ILE E 1  74  ? -3.078  -37.663 49.740 1.00 47.38  ? 74   ILE E CD1   1 
ATOM   3343  N  N     . ALA E 1  75  ? -1.532  -39.311 44.598 1.00 49.63  ? 75   ALA E N     1 
ATOM   3344  C  CA    . ALA E 1  75  ? -1.626  -39.364 43.120 1.00 56.86  ? 75   ALA E CA    1 
ATOM   3345  C  C     . ALA E 1  75  ? -1.421  -40.770 42.580 1.00 54.56  ? 75   ALA E C     1 
ATOM   3346  O  O     . ALA E 1  75  ? -2.177  -41.248 41.739 1.00 44.75  ? 75   ALA E O     1 
ATOM   3347  C  CB    . ALA E 1  75  ? -0.620  -38.437 42.481 1.00 58.53  ? 75   ALA E CB    1 
ATOM   3348  N  N     . GLN E 1  76  ? -0.381  -41.425 43.080 1.00 60.29  ? 76   GLN E N     1 
ATOM   3349  C  CA    . GLN E 1  76  ? -0.059  -42.786 42.649 1.00 59.36  ? 76   GLN E CA    1 
ATOM   3350  C  C     . GLN E 1  76  ? -1.266  -43.679 42.758 1.00 56.38  ? 76   GLN E C     1 
ATOM   3351  O  O     . GLN E 1  76  ? -1.572  -44.385 41.805 1.00 54.85  ? 76   GLN E O     1 
ATOM   3352  C  CB    . GLN E 1  76  ? 1.052   -43.382 43.474 1.00 61.62  ? 76   GLN E CB    1 
ATOM   3353  C  CG    . GLN E 1  76  ? 1.833   -44.437 42.738 1.00 65.98  ? 76   GLN E CG    1 
ATOM   3354  C  CD    . GLN E 1  76  ? 3.024   -44.860 43.548 1.00 64.98  ? 76   GLN E CD    1 
ATOM   3355  O  OE1   . GLN E 1  76  ? 2.907   -45.100 44.750 1.00 63.40  ? 76   GLN E OE1   1 
ATOM   3356  N  NE2   . GLN E 1  76  ? 4.183   -44.927 42.907 1.00 70.05  ? 76   GLN E NE2   1 
ATOM   3357  N  N     . ASP E 1  77  ? -1.965  -43.631 43.892 1.00 50.72  ? 77   ASP E N     1 
ATOM   3358  C  CA    . ASP E 1  77  ? -3.203  -44.411 44.047 1.00 48.89  ? 77   ASP E CA    1 
ATOM   3359  C  C     . ASP E 1  77  ? -4.265  -44.135 42.949 1.00 49.68  ? 77   ASP E C     1 
ATOM   3360  O  O     . ASP E 1  77  ? -5.001  -45.024 42.578 1.00 57.61  ? 77   ASP E O     1 
ATOM   3361  C  CB    . ASP E 1  77  ? -3.786  -44.262 45.465 1.00 47.00  ? 77   ASP E CB    1 
ATOM   3362  C  CG    . ASP E 1  77  ? -2.863  -44.869 46.557 1.00 51.71  ? 77   ASP E CG    1 
ATOM   3363  O  OD1   . ASP E 1  77  ? -1.930  -45.607 46.205 1.00 53.44  ? 77   ASP E OD1   1 
ATOM   3364  O  OD2   . ASP E 1  77  ? -3.062  -44.636 47.770 1.00 50.40  ? 77   ASP E OD2   1 
ATOM   3365  N  N     . PHE E 1  78  ? -4.324  -42.923 42.420 1.00 53.53  ? 78   PHE E N     1 
ATOM   3366  C  CA    . PHE E 1  78  ? -5.164  -42.625 41.281 1.00 51.15  ? 78   PHE E CA    1 
ATOM   3367  C  C     . PHE E 1  78  ? -4.529  -43.064 39.976 1.00 53.65  ? 78   PHE E C     1 
ATOM   3368  O  O     . PHE E 1  78  ? -5.239  -43.428 39.059 1.00 55.02  ? 78   PHE E O     1 
ATOM   3369  C  CB    . PHE E 1  78  ? -5.400  -41.116 41.151 1.00 55.95  ? 78   PHE E CB    1 
ATOM   3370  C  CG    . PHE E 1  78  ? -6.342  -40.559 42.164 1.00 64.41  ? 78   PHE E CG    1 
ATOM   3371  C  CD1   . PHE E 1  78  ? -5.924  -39.598 43.076 1.00 67.40  ? 78   PHE E CD1   1 
ATOM   3372  C  CD2   . PHE E 1  78  ? -7.659  -40.993 42.218 1.00 72.58  ? 78   PHE E CD2   1 
ATOM   3373  C  CE1   . PHE E 1  78  ? -6.803  -39.091 44.028 1.00 64.96  ? 78   PHE E CE1   1 
ATOM   3374  C  CE2   . PHE E 1  78  ? -8.540  -40.483 43.177 1.00 70.93  ? 78   PHE E CE2   1 
ATOM   3375  C  CZ    . PHE E 1  78  ? -8.108  -39.525 44.074 1.00 64.18  ? 78   PHE E CZ    1 
ATOM   3376  N  N     . LYS E 1  79  ? -3.213  -42.937 39.849 1.00 56.56  ? 79   LYS E N     1 
ATOM   3377  C  CA    . LYS E 1  79  ? -2.552  -43.187 38.575 1.00 61.24  ? 79   LYS E CA    1 
ATOM   3378  C  C     . LYS E 1  79  ? -1.015  -43.312 38.709 1.00 66.88  ? 79   LYS E C     1 
ATOM   3379  O  O     . LYS E 1  79  ? -0.324  -42.404 39.216 1.00 73.68  ? 79   LYS E O     1 
ATOM   3380  C  CB    . LYS E 1  79  ? -2.893  -42.049 37.617 1.00 63.00  ? 79   LYS E CB    1 
ATOM   3381  C  CG    . LYS E 1  79  ? -3.192  -42.479 36.203 1.00 71.13  ? 79   LYS E CG    1 
ATOM   3382  C  CD    . LYS E 1  79  ? -1.957  -42.411 35.335 1.00 76.62  ? 79   LYS E CD    1 
ATOM   3383  C  CE    . LYS E 1  79  ? -2.224  -42.993 33.957 1.00 78.48  ? 79   LYS E CE    1 
ATOM   3384  N  NZ    . LYS E 1  79  ? -1.068  -43.866 33.598 1.00 81.72  ? 79   LYS E NZ    1 
ATOM   3385  N  N     . THR E 1  80  ? -0.485  -44.423 38.216 1.00 64.70  ? 80   THR E N     1 
ATOM   3386  C  CA    . THR E 1  80  ? 0.939   -44.713 38.330 1.00 69.95  ? 80   THR E CA    1 
ATOM   3387  C  C     . THR E 1  80  ? 1.775   -44.033 37.275 1.00 69.01  ? 80   THR E C     1 
ATOM   3388  O  O     . THR E 1  80  ? 1.257   -43.568 36.255 1.00 72.72  ? 80   THR E O     1 
ATOM   3389  C  CB    . THR E 1  80  ? 1.202   -46.196 38.141 1.00 72.96  ? 80   THR E CB    1 
ATOM   3390  O  OG1   . THR E 1  80  ? 0.742   -46.582 36.829 1.00 74.71  ? 80   THR E OG1   1 
ATOM   3391  C  CG2   . THR E 1  80  ? 0.492   -46.987 39.233 1.00 70.08  ? 80   THR E CG2   1 
ATOM   3392  N  N     . ASP E 1  81  ? 3.083   -44.016 37.530 1.00 70.52  ? 81   ASP E N     1 
ATOM   3393  C  CA    . ASP E 1  81  ? 4.079   -43.460 36.602 1.00 78.39  ? 81   ASP E CA    1 
ATOM   3394  C  C     . ASP E 1  81  ? 3.794   -41.992 36.280 1.00 71.65  ? 81   ASP E C     1 
ATOM   3395  O  O     . ASP E 1  81  ? 3.895   -41.573 35.141 1.00 77.10  ? 81   ASP E O     1 
ATOM   3396  C  CB    . ASP E 1  81  ? 4.139   -44.299 35.310 1.00 87.73  ? 81   ASP E CB    1 
ATOM   3397  C  CG    . ASP E 1  81  ? 4.116   -45.800 35.581 1.00 98.48  ? 81   ASP E CG    1 
ATOM   3398  O  OD1   . ASP E 1  81  ? 3.267   -46.489 34.963 1.00 102.35 ? 81   ASP E OD1   1 
ATOM   3399  O  OD2   . ASP E 1  81  ? 4.922   -46.282 36.423 1.00 94.60  ? 81   ASP E OD2   1 
ATOM   3400  N  N     . LEU E 1  82  ? 3.424   -41.234 37.308 1.00 73.18  ? 82   LEU E N     1 
ATOM   3401  C  CA    . LEU E 1  82  ? 3.145   -39.809 37.202 1.00 69.71  ? 82   LEU E CA    1 
ATOM   3402  C  C     . LEU E 1  82  ? 4.345   -39.007 37.705 1.00 63.31  ? 82   LEU E C     1 
ATOM   3403  O  O     . LEU E 1  82  ? 4.992   -39.390 38.656 1.00 60.98  ? 82   LEU E O     1 
ATOM   3404  C  CB    . LEU E 1  82  ? 1.897   -39.429 38.033 1.00 70.99  ? 82   LEU E CB    1 
ATOM   3405  C  CG    . LEU E 1  82  ? 0.495   -39.698 37.457 1.00 70.64  ? 82   LEU E CG    1 
ATOM   3406  C  CD1   . LEU E 1  82  ? -0.585  -39.317 38.461 1.00 63.53  ? 82   LEU E CD1   1 
ATOM   3407  C  CD2   . LEU E 1  82  ? 0.292   -38.948 36.146 1.00 68.32  ? 82   LEU E CD2   1 
ATOM   3408  N  N     . ARG E 1  83  ? 4.608   -37.875 37.083 1.00 61.21  ? 83   ARG E N     1 
ATOM   3409  C  CA    . ARG E 1  83  ? 5.591   -36.941 37.597 1.00 70.09  ? 83   ARG E CA    1 
ATOM   3410  C  C     . ARG E 1  83  ? 4.875   -35.643 37.986 1.00 65.85  ? 83   ARG E C     1 
ATOM   3411  O  O     . ARG E 1  83  ? 3.728   -35.446 37.630 1.00 66.44  ? 83   ARG E O     1 
ATOM   3412  C  CB    . ARG E 1  83  ? 6.627   -36.650 36.506 1.00 79.62  ? 83   ARG E CB    1 
ATOM   3413  C  CG    . ARG E 1  83  ? 7.285   -37.881 35.894 1.00 80.98  ? 83   ARG E CG    1 
ATOM   3414  C  CD    . ARG E 1  83  ? 7.968   -37.540 34.576 1.00 86.57  ? 83   ARG E CD    1 
ATOM   3415  N  NE    . ARG E 1  83  ? 9.222   -38.285 34.399 1.00 96.87  ? 83   ARG E NE    1 
ATOM   3416  C  CZ    . ARG E 1  83  ? 10.457  -37.778 34.504 1.00 101.89 ? 83   ARG E CZ    1 
ATOM   3417  N  NH1   . ARG E 1  83  ? 10.668  -36.495 34.774 1.00 100.07 ? 83   ARG E NH1   1 
ATOM   3418  N  NH2   . ARG E 1  83  ? 11.506  -38.569 34.324 1.00 109.96 ? 83   ARG E NH2   1 
ATOM   3419  N  N     . PHE E 1  84  ? 5.565   -34.749 38.681 1.00 62.55  ? 84   PHE E N     1 
ATOM   3420  C  CA    . PHE E 1  84  ? 5.004   -33.456 39.059 1.00 58.00  ? 84   PHE E CA    1 
ATOM   3421  C  C     . PHE E 1  84  ? 5.992   -32.360 38.845 1.00 53.64  ? 84   PHE E C     1 
ATOM   3422  O  O     . PHE E 1  84  ? 7.091   -32.439 39.373 1.00 61.18  ? 84   PHE E O     1 
ATOM   3423  C  CB    . PHE E 1  84  ? 4.726   -33.422 40.548 1.00 60.55  ? 84   PHE E CB    1 
ATOM   3424  C  CG    . PHE E 1  84  ? 3.504   -34.166 40.956 1.00 64.83  ? 84   PHE E CG    1 
ATOM   3425  C  CD1   . PHE E 1  84  ? 3.519   -35.535 41.069 1.00 64.93  ? 84   PHE E CD1   1 
ATOM   3426  C  CD2   . PHE E 1  84  ? 2.340   -33.484 41.268 1.00 63.03  ? 84   PHE E CD2   1 
ATOM   3427  C  CE1   . PHE E 1  84  ? 2.376   -36.213 41.472 1.00 66.84  ? 84   PHE E CE1   1 
ATOM   3428  C  CE2   . PHE E 1  84  ? 1.217   -34.154 41.676 1.00 55.56  ? 84   PHE E CE2   1 
ATOM   3429  C  CZ    . PHE E 1  84  ? 1.228   -35.516 41.766 1.00 56.95  ? 84   PHE E CZ    1 
ATOM   3430  N  N     . GLN E 1  85  ? 5.599   -31.301 38.146 1.00 52.39  ? 85   GLN E N     1 
ATOM   3431  C  CA    . GLN E 1  85  ? 6.374   -30.056 38.177 1.00 49.53  ? 85   GLN E CA    1 
ATOM   3432  C  C     . GLN E 1  85  ? 6.492   -29.638 39.617 1.00 48.61  ? 85   GLN E C     1 
ATOM   3433  O  O     . GLN E 1  85  ? 5.588   -29.838 40.391 1.00 55.27  ? 85   GLN E O     1 
ATOM   3434  C  CB    . GLN E 1  85  ? 5.701   -28.963 37.365 1.00 51.07  ? 85   GLN E CB    1 
ATOM   3435  C  CG    . GLN E 1  85  ? 5.695   -29.244 35.865 1.00 54.89  ? 85   GLN E CG    1 
ATOM   3436  C  CD    . GLN E 1  85  ? 5.039   -28.132 35.058 1.00 59.83  ? 85   GLN E CD    1 
ATOM   3437  O  OE1   . GLN E 1  85  ? 4.364   -27.255 35.610 1.00 59.74  ? 85   GLN E OE1   1 
ATOM   3438  N  NE2   . GLN E 1  85  ? 5.202   -28.187 33.732 1.00 62.95  ? 85   GLN E NE2   1 
ATOM   3439  N  N     . SER E 1  86  ? 7.610   -29.093 40.025 1.00 52.82  ? 86   SER E N     1 
ATOM   3440  C  CA    . SER E 1  86  ? 7.735   -28.830 41.436 1.00 54.99  ? 86   SER E CA    1 
ATOM   3441  C  C     . SER E 1  86  ? 6.783   -27.711 41.824 1.00 53.56  ? 86   SER E C     1 
ATOM   3442  O  O     . SER E 1  86  ? 6.338   -27.692 42.945 1.00 58.84  ? 86   SER E O     1 
ATOM   3443  C  CB    . SER E 1  86  ? 9.174   -28.528 41.846 1.00 53.66  ? 86   SER E CB    1 
ATOM   3444  O  OG    . SER E 1  86  ? 9.565   -27.276 41.362 1.00 67.90  ? 86   SER E OG    1 
ATOM   3445  N  N     . SER E 1  87  ? 6.457   -26.798 40.911 1.00 52.20  ? 87   SER E N     1 
ATOM   3446  C  CA    . SER E 1  87  ? 5.527   -25.706 41.241 1.00 51.63  ? 87   SER E CA    1 
ATOM   3447  C  C     . SER E 1  87  ? 4.096   -26.241 41.428 1.00 53.26  ? 87   SER E C     1 
ATOM   3448  O  O     . SER E 1  87  ? 3.280   -25.631 42.136 1.00 54.89  ? 87   SER E O     1 
ATOM   3449  C  CB    . SER E 1  87  ? 5.542   -24.616 40.182 1.00 47.73  ? 87   SER E CB    1 
ATOM   3450  O  OG    . SER E 1  87  ? 5.155   -25.139 38.913 1.00 52.85  ? 87   SER E OG    1 
ATOM   3451  N  N     . ALA E 1  88  ? 3.807   -27.391 40.835 1.00 50.22  ? 88   ALA E N     1 
ATOM   3452  C  CA    . ALA E 1  88  ? 2.536   -28.044 41.053 1.00 50.80  ? 88   ALA E CA    1 
ATOM   3453  C  C     . ALA E 1  88  ? 2.389   -28.472 42.489 1.00 48.85  ? 88   ALA E C     1 
ATOM   3454  O  O     . ALA E 1  88  ? 1.339   -28.306 43.122 1.00 55.78  ? 88   ALA E O     1 
ATOM   3455  C  CB    . ALA E 1  88  ? 2.392   -29.241 40.160 1.00 51.73  ? 88   ALA E CB    1 
ATOM   3456  N  N     . VAL E 1  89  ? 3.440   -29.023 43.024 1.00 45.62  ? 89   VAL E N     1 
ATOM   3457  C  CA    . VAL E 1  89  ? 3.390   -29.459 44.412 1.00 45.17  ? 89   VAL E CA    1 
ATOM   3458  C  C     . VAL E 1  89  ? 3.258   -28.244 45.310 1.00 45.93  ? 89   VAL E C     1 
ATOM   3459  O  O     . VAL E 1  89  ? 2.535   -28.264 46.298 1.00 49.47  ? 89   VAL E O     1 
ATOM   3460  C  CB    . VAL E 1  89  ? 4.644   -30.260 44.794 1.00 43.00  ? 89   VAL E CB    1 
ATOM   3461  C  CG1   . VAL E 1  89  ? 4.607   -30.672 46.243 1.00 44.56  ? 89   VAL E CG1   1 
ATOM   3462  C  CG2   . VAL E 1  89  ? 4.727   -31.513 43.959 1.00 46.77  ? 89   VAL E CG2   1 
ATOM   3463  N  N     . MET E 1  90  ? 3.981   -27.190 44.954 1.00 51.49  ? 90   MET E N     1 
ATOM   3464  C  CA    . MET E 1  90  ? 3.965   -25.962 45.693 1.00 50.72  ? 90   MET E CA    1 
ATOM   3465  C  C     . MET E 1  90  ? 2.564   -25.349 45.617 1.00 51.74  ? 90   MET E C     1 
ATOM   3466  O  O     . MET E 1  90  ? 2.059   -24.812 46.620 1.00 45.94  ? 90   MET E O     1 
ATOM   3467  C  CB    . MET E 1  90  ? 5.023   -25.009 45.144 1.00 54.99  ? 90   MET E CB    1 
ATOM   3468  C  CG    . MET E 1  90  ? 6.438   -25.362 45.535 1.00 59.76  ? 90   MET E CG    1 
ATOM   3469  S  SD    . MET E 1  90  ? 6.568   -25.890 47.274 1.00 77.16  ? 90   MET E SD    1 
ATOM   3470  C  CE    . MET E 1  90  ? 6.268   -24.345 48.134 1.00 72.62  ? 90   MET E CE    1 
ATOM   3471  N  N     . ALA E 1  91  ? 1.917   -25.453 44.457 1.00 47.64  ? 91   ALA E N     1 
ATOM   3472  C  CA    . ALA E 1  91  ? 0.563   -24.900 44.335 1.00 49.42  ? 91   ALA E CA    1 
ATOM   3473  C  C     . ALA E 1  91  ? -0.376  -25.621 45.280 1.00 48.37  ? 91   ALA E C     1 
ATOM   3474  O  O     . ALA E 1  91  ? -1.169  -24.987 45.952 1.00 53.13  ? 91   ALA E O     1 
ATOM   3475  C  CB    . ALA E 1  91  ? 0.060   -24.976 42.912 1.00 47.38  ? 91   ALA E CB    1 
ATOM   3476  N  N     . LEU E 1  92  ? -0.245  -26.942 45.356 1.00 48.32  ? 92   LEU E N     1 
ATOM   3477  C  CA    . LEU E 1  92  ? -1.049  -27.765 46.264 1.00 46.27  ? 92   LEU E CA    1 
ATOM   3478  C  C     . LEU E 1  92  ? -0.768  -27.404 47.696 1.00 49.35  ? 92   LEU E C     1 
ATOM   3479  O  O     . LEU E 1  92  ? -1.677  -27.342 48.525 1.00 54.70  ? 92   LEU E O     1 
ATOM   3480  C  CB    . LEU E 1  92  ? -0.774  -29.267 46.041 1.00 48.68  ? 92   LEU E CB    1 
ATOM   3481  C  CG    . LEU E 1  92  ? -1.473  -29.854 44.787 1.00 51.55  ? 92   LEU E CG    1 
ATOM   3482  C  CD1   . LEU E 1  92  ? -0.905  -31.164 44.255 1.00 50.88  ? 92   LEU E CD1   1 
ATOM   3483  C  CD2   . LEU E 1  92  ? -2.936  -30.054 45.101 1.00 55.00  ? 92   LEU E CD2   1 
ATOM   3484  N  N     . GLN E 1  93  ? 0.490   -27.154 48.013 1.00 48.62  ? 93   GLN E N     1 
ATOM   3485  C  CA    . GLN E 1  93  ? 0.804   -26.882 49.388 1.00 47.68  ? 93   GLN E CA    1 
ATOM   3486  C  C     . GLN E 1  93  ? 0.203   -25.550 49.815 1.00 47.39  ? 93   GLN E C     1 
ATOM   3487  O  O     . GLN E 1  93  ? -0.461  -25.478 50.844 1.00 50.20  ? 93   GLN E O     1 
ATOM   3488  C  CB    . GLN E 1  93  ? 2.311   -26.957 49.660 1.00 48.33  ? 93   GLN E CB    1 
ATOM   3489  C  CG    . GLN E 1  93  ? 2.562   -27.331 51.122 1.00 48.16  ? 93   GLN E CG    1 
ATOM   3490  C  CD    . GLN E 1  93  ? 4.010   -27.384 51.514 1.00 47.69  ? 93   GLN E CD    1 
ATOM   3491  O  OE1   . GLN E 1  93  ? 4.889   -27.538 50.675 1.00 48.83  ? 93   GLN E OE1   1 
ATOM   3492  N  NE2   . GLN E 1  93  ? 4.272   -27.253 52.806 1.00 50.47  ? 93   GLN E NE2   1 
ATOM   3493  N  N     . GLU E 1  94  ? 0.404   -24.509 49.014 1.00 46.14  ? 94   GLU E N     1 
ATOM   3494  C  CA    . GLU E 1  94  ? -0.206  -23.208 49.274 1.00 43.41  ? 94   GLU E CA    1 
ATOM   3495  C  C     . GLU E 1  94  ? -1.728  -23.342 49.374 1.00 44.75  ? 94   GLU E C     1 
ATOM   3496  O  O     . GLU E 1  94  ? -2.359  -22.727 50.236 1.00 45.53  ? 94   GLU E O     1 
ATOM   3497  C  CB    . GLU E 1  94  ? 0.117   -22.221 48.170 1.00 46.43  ? 94   GLU E CB    1 
ATOM   3498  C  CG    . GLU E 1  94  ? 1.561   -21.772 48.081 1.00 48.48  ? 94   GLU E CG    1 
ATOM   3499  C  CD    . GLU E 1  94  ? 1.898   -20.738 49.125 1.00 55.63  ? 94   GLU E CD    1 
ATOM   3500  O  OE1   . GLU E 1  94  ? 0.964   -20.191 49.773 1.00 51.94  ? 94   GLU E OE1   1 
ATOM   3501  O  OE2   . GLU E 1  94  ? 3.114   -20.489 49.298 1.00 59.10  ? 94   GLU E OE2   1 
ATOM   3502  N  N     . ALA E 1  95  ? -2.343  -24.131 48.507 1.00 40.18  ? 95   ALA E N     1 
ATOM   3503  C  CA    . ALA E 1  95  ? -3.799  -24.235 48.588 1.00 39.75  ? 95   ALA E CA    1 
ATOM   3504  C  C     . ALA E 1  95  ? -4.185  -25.013 49.829 1.00 43.78  ? 95   ALA E C     1 
ATOM   3505  O  O     . ALA E 1  95  ? -5.112  -24.620 50.508 1.00 50.51  ? 95   ALA E O     1 
ATOM   3506  C  CB    . ALA E 1  95  ? -4.382  -24.874 47.342 1.00 39.43  ? 95   ALA E CB    1 
ATOM   3507  N  N     . SER E 1  96  ? -3.464  -26.097 50.138 1.00 43.63  ? 96   SER E N     1 
ATOM   3508  C  CA    . SER E 1  96  ? -3.759  -26.947 51.312 1.00 41.93  ? 96   SER E CA    1 
ATOM   3509  C  C     . SER E 1  96  ? -3.644  -26.224 52.632 1.00 39.73  ? 96   SER E C     1 
ATOM   3510  O  O     . SER E 1  96  ? -4.542  -26.290 53.462 1.00 40.01  ? 96   SER E O     1 
ATOM   3511  C  CB    . SER E 1  96  ? -2.829  -28.177 51.372 1.00 45.73  ? 96   SER E CB    1 
ATOM   3512  O  OG    . SER E 1  96  ? -3.070  -29.120 50.317 1.00 44.96  ? 96   SER E OG    1 
ATOM   3513  N  N     . GLU E 1  97  ? -2.535  -25.530 52.838 1.00 44.95  ? 97   GLU E N     1 
ATOM   3514  C  CA    . GLU E 1  97  ? -2.367  -24.721 54.060 1.00 42.60  ? 97   GLU E CA    1 
ATOM   3515  C  C     . GLU E 1  97  ? -3.384  -23.570 54.132 1.00 36.81  ? 97   GLU E C     1 
ATOM   3516  O  O     . GLU E 1  97  ? -3.927  -23.259 55.170 1.00 39.59  ? 97   GLU E O     1 
ATOM   3517  C  CB    . GLU E 1  97  ? -0.939  -24.210 54.194 1.00 44.48  ? 97   GLU E CB    1 
ATOM   3518  C  CG    . GLU E 1  97  ? 0.115   -25.327 54.167 1.00 50.51  ? 97   GLU E CG    1 
ATOM   3519  C  CD    . GLU E 1  97  ? 1.473   -24.968 54.809 1.00 54.40  ? 97   GLU E CD    1 
ATOM   3520  O  OE1   . GLU E 1  97  ? 1.643   -23.840 55.326 1.00 54.77  ? 97   GLU E OE1   1 
ATOM   3521  O  OE2   . GLU E 1  97  ? 2.394   -25.828 54.796 1.00 53.85  ? 97   GLU E OE2   1 
ATOM   3522  N  N     . ALA E 1  98  ? -3.707  -22.943 53.033 1.00 36.82  ? 98   ALA E N     1 
ATOM   3523  C  CA    . ALA E 1  98  ? -4.681  -21.843 53.132 1.00 35.52  ? 98   ALA E CA    1 
ATOM   3524  C  C     . ALA E 1  98  ? -6.019  -22.415 53.497 1.00 38.85  ? 98   ALA E C     1 
ATOM   3525  O  O     . ALA E 1  98  ? -6.776  -21.810 54.265 1.00 46.00  ? 98   ALA E O     1 
ATOM   3526  C  CB    . ALA E 1  98  ? -4.786  -21.076 51.845 1.00 32.42  ? 98   ALA E CB    1 
ATOM   3527  N  N     . TYR E 1  99  ? -6.317  -23.587 52.962 1.00 40.65  ? 99   TYR E N     1 
ATOM   3528  C  CA    . TYR E 1  99  ? -7.574  -24.241 53.306 1.00 43.76  ? 99   TYR E CA    1 
ATOM   3529  C  C     . TYR E 1  99  ? -7.601  -24.559 54.798 1.00 43.57  ? 99   TYR E C     1 
ATOM   3530  O  O     . TYR E 1  99  ? -8.587  -24.237 55.497 1.00 41.36  ? 99   TYR E O     1 
ATOM   3531  C  CB    . TYR E 1  99  ? -7.814  -25.487 52.456 1.00 43.44  ? 99   TYR E CB    1 
ATOM   3532  C  CG    . TYR E 1  99  ? -8.910  -26.383 52.946 1.00 42.93  ? 99   TYR E CG    1 
ATOM   3533  C  CD1   . TYR E 1  99  ? -10.241 -26.097 52.696 1.00 46.16  ? 99   TYR E CD1   1 
ATOM   3534  C  CD2   . TYR E 1  99  ? -8.616  -27.516 53.655 1.00 43.60  ? 99   TYR E CD2   1 
ATOM   3535  C  CE1   . TYR E 1  99  ? -11.247 -26.941 53.143 1.00 43.70  ? 99   TYR E CE1   1 
ATOM   3536  C  CE2   . TYR E 1  99  ? -9.604  -28.366 54.098 1.00 42.48  ? 99   TYR E CE2   1 
ATOM   3537  C  CZ    . TYR E 1  99  ? -10.911 -28.085 53.833 1.00 41.17  ? 99   TYR E CZ    1 
ATOM   3538  O  OH    . TYR E 1  99  ? -11.868 -28.935 54.325 1.00 39.99  ? 99   TYR E OH    1 
ATOM   3539  N  N     . LEU E 1  100 ? -6.523  -25.157 55.291 1.00 41.83  ? 100  LEU E N     1 
ATOM   3540  C  CA    . LEU E 1  100 ? -6.546  -25.642 56.659 1.00 43.00  ? 100  LEU E CA    1 
ATOM   3541  C  C     . LEU E 1  100 ? -6.557  -24.494 57.653 1.00 43.17  ? 100  LEU E C     1 
ATOM   3542  O  O     . LEU E 1  100 ? -7.255  -24.543 58.642 1.00 41.53  ? 100  LEU E O     1 
ATOM   3543  C  CB    . LEU E 1  100 ? -5.391  -26.603 56.927 1.00 44.08  ? 100  LEU E CB    1 
ATOM   3544  C  CG    . LEU E 1  100 ? -5.465  -28.008 56.300 1.00 44.22  ? 100  LEU E CG    1 
ATOM   3545  C  CD1   . LEU E 1  100 ? -4.149  -28.719 56.595 1.00 42.05  ? 100  LEU E CD1   1 
ATOM   3546  C  CD2   . LEU E 1  100 ? -6.619  -28.856 56.821 1.00 41.60  ? 100  LEU E CD2   1 
ATOM   3547  N  N     . VAL E 1  101 ? -5.800  -23.439 57.379 1.00 46.32  ? 101  VAL E N     1 
ATOM   3548  C  CA    . VAL E 1  101 ? -5.795  -22.282 58.261 1.00 45.63  ? 101  VAL E CA    1 
ATOM   3549  C  C     . VAL E 1  101 ? -7.193  -21.688 58.385 1.00 40.88  ? 101  VAL E C     1 
ATOM   3550  O  O     . VAL E 1  101 ? -7.651  -21.371 59.459 1.00 43.98  ? 101  VAL E O     1 
ATOM   3551  C  CB    . VAL E 1  101 ? -4.791  -21.219 57.769 1.00 48.39  ? 101  VAL E CB    1 
ATOM   3552  C  CG1   . VAL E 1  101 ? -5.000  -19.898 58.499 1.00 47.03  ? 101  VAL E CG1   1 
ATOM   3553  C  CG2   . VAL E 1  101 ? -3.356  -21.717 57.968 1.00 47.44  ? 101  VAL E CG2   1 
ATOM   3554  N  N     . ALA E 1  102 ? -7.881  -21.538 57.275 1.00 41.52  ? 102  ALA E N     1 
ATOM   3555  C  CA    . ALA E 1  102 ? -9.245  -20.974 57.299 1.00 38.30  ? 102  ALA E CA    1 
ATOM   3556  C  C     . ALA E 1  102 ? -10.221 -21.907 58.065 1.00 43.30  ? 102  ALA E C     1 
ATOM   3557  O  O     . ALA E 1  102 ? -11.104 -21.440 58.819 1.00 53.31  ? 102  ALA E O     1 
ATOM   3558  C  CB    . ALA E 1  102 ? -9.709  -20.747 55.888 1.00 30.73  ? 102  ALA E CB    1 
ATOM   3559  N  N     . LEU E 1  103 ? -10.058 -23.214 57.876 1.00 39.75  ? 103  LEU E N     1 
ATOM   3560  C  CA    . LEU E 1  103 ? -10.875 -24.207 58.561 1.00 40.37  ? 103  LEU E CA    1 
ATOM   3561  C  C     . LEU E 1  103 ? -10.711 -24.092 60.069 1.00 43.84  ? 103  LEU E C     1 
ATOM   3562  O  O     . LEU E 1  103 ? -11.702 -24.150 60.827 1.00 48.17  ? 103  LEU E O     1 
ATOM   3563  C  CB    . LEU E 1  103 ? -10.522 -25.638 58.087 1.00 40.30  ? 103  LEU E CB    1 
ATOM   3564  C  CG    . LEU E 1  103 ? -11.258 -26.751 58.812 1.00 43.25  ? 103  LEU E CG    1 
ATOM   3565  C  CD1   . LEU E 1  103 ? -12.754 -26.540 58.748 1.00 46.00  ? 103  LEU E CD1   1 
ATOM   3566  C  CD2   . LEU E 1  103 ? -10.922 -28.110 58.245 1.00 46.43  ? 103  LEU E CD2   1 
ATOM   3567  N  N     . PHE E 1  104 ? -9.466  -23.931 60.522 1.00 45.48  ? 104  PHE E N     1 
ATOM   3568  C  CA    . PHE E 1  104 ? -9.210  -23.676 61.943 1.00 43.10  ? 104  PHE E CA    1 
ATOM   3569  C  C     . PHE E 1  104 ? -9.800  -22.372 62.465 1.00 42.32  ? 104  PHE E C     1 
ATOM   3570  O  O     . PHE E 1  104 ? -10.142 -22.321 63.612 1.00 46.23  ? 104  PHE E O     1 
ATOM   3571  C  CB    . PHE E 1  104 ? -7.736  -23.696 62.251 1.00 46.20  ? 104  PHE E CB    1 
ATOM   3572  C  CG    . PHE E 1  104 ? -7.130  -25.069 62.268 1.00 48.75  ? 104  PHE E CG    1 
ATOM   3573  C  CD1   . PHE E 1  104 ? -6.042  -25.368 61.483 1.00 50.12  ? 104  PHE E CD1   1 
ATOM   3574  C  CD2   . PHE E 1  104 ? -7.606  -26.042 63.118 1.00 51.54  ? 104  PHE E CD2   1 
ATOM   3575  C  CE1   . PHE E 1  104 ? -5.474  -26.624 61.513 1.00 50.22  ? 104  PHE E CE1   1 
ATOM   3576  C  CE2   . PHE E 1  104 ? -7.033  -27.300 63.156 1.00 48.69  ? 104  PHE E CE2   1 
ATOM   3577  C  CZ    . PHE E 1  104 ? -5.973  -27.594 62.340 1.00 47.93  ? 104  PHE E CZ    1 
ATOM   3578  N  N     . GLU E 1  105 ? -9.923  -21.308 61.674 1.00 44.19  ? 105  GLU E N     1 
ATOM   3579  C  CA    . GLU E 1  105 ? -10.664 -20.126 62.193 1.00 46.12  ? 105  GLU E CA    1 
ATOM   3580  C  C     . GLU E 1  105 ? -12.095 -20.540 62.416 1.00 47.00  ? 105  GLU E C     1 
ATOM   3581  O  O     . GLU E 1  105 ? -12.663 -20.278 63.469 1.00 51.76  ? 105  GLU E O     1 
ATOM   3582  C  CB    . GLU E 1  105 ? -10.654 -18.894 61.275 1.00 45.67  ? 105  GLU E CB    1 
ATOM   3583  C  CG    . GLU E 1  105 ? -9.267  -18.380 60.926 1.00 55.25  ? 105  GLU E CG    1 
ATOM   3584  C  CD    . GLU E 1  105 ? -9.157  -17.763 59.532 1.00 59.40  ? 105  GLU E CD    1 
ATOM   3585  O  OE1   . GLU E 1  105 ? -10.224 -17.521 58.890 1.00 62.02  ? 105  GLU E OE1   1 
ATOM   3586  O  OE2   . GLU E 1  105 ? -7.987  -17.529 59.100 1.00 53.92  ? 105  GLU E OE2   1 
ATOM   3587  N  N     . ASP E 1  106 ? -12.703 -21.191 61.429 1.00 49.66  ? 106  ASP E N     1 
ATOM   3588  C  CA    . ASP E 1  106 ? -14.120 -21.546 61.579 1.00 47.61  ? 106  ASP E CA    1 
ATOM   3589  C  C     . ASP E 1  106 ? -14.286 -22.493 62.752 1.00 47.22  ? 106  ASP E C     1 
ATOM   3590  O  O     . ASP E 1  106 ? -15.231 -22.357 63.515 1.00 45.29  ? 106  ASP E O     1 
ATOM   3591  C  CB    . ASP E 1  106 ? -14.669 -22.172 60.313 1.00 46.19  ? 106  ASP E CB    1 
ATOM   3592  C  CG    . ASP E 1  106 ? -14.739 -21.208 59.171 1.00 46.89  ? 106  ASP E CG    1 
ATOM   3593  O  OD1   . ASP E 1  106 ? -14.499 -20.009 59.424 1.00 49.40  ? 106  ASP E OD1   1 
ATOM   3594  O  OD2   . ASP E 1  106 ? -15.054 -21.654 58.021 1.00 50.93  ? 106  ASP E OD2   1 
ATOM   3595  N  N     . THR E 1  107 ? -13.323 -23.409 62.914 1.00 46.60  ? 107  THR E N     1 
ATOM   3596  C  CA    . THR E 1  107 ? -13.354 -24.387 63.993 1.00 45.10  ? 107  THR E CA    1 
ATOM   3597  C  C     . THR E 1  107 ? -13.253 -23.694 65.330 1.00 46.27  ? 107  THR E C     1 
ATOM   3598  O  O     . THR E 1  107 ? -14.002 -23.970 66.245 1.00 48.44  ? 107  THR E O     1 
ATOM   3599  C  CB    . THR E 1  107 ? -12.193 -25.351 63.844 1.00 43.84  ? 107  THR E CB    1 
ATOM   3600  O  OG1   . THR E 1  107 ? -12.304 -26.028 62.584 1.00 43.00  ? 107  THR E OG1   1 
ATOM   3601  C  CG2   . THR E 1  107 ? -12.211 -26.361 64.920 1.00 44.25  ? 107  THR E CG2   1 
ATOM   3602  N  N     . ASN E 1  108 ? -12.337 -22.744 65.408 1.00 51.86  ? 108  ASN E N     1 
ATOM   3603  C  CA    . ASN E 1  108 ? -12.099 -21.984 66.613 1.00 49.04  ? 108  ASN E CA    1 
ATOM   3604  C  C     . ASN E 1  108 ? -13.313 -21.178 67.016 1.00 48.22  ? 108  ASN E C     1 
ATOM   3605  O  O     . ASN E 1  108 ? -13.595 -21.036 68.204 1.00 49.75  ? 108  ASN E O     1 
ATOM   3606  C  CB    . ASN E 1  108 ? -10.928 -21.051 66.398 1.00 49.03  ? 108  ASN E CB    1 
ATOM   3607  C  CG    . ASN E 1  108 ? -10.350 -20.544 67.690 1.00 49.24  ? 108  ASN E CG    1 
ATOM   3608  O  OD1   . ASN E 1  108 ? -10.320 -21.244 68.695 1.00 54.16  ? 108  ASN E OD1   1 
ATOM   3609  N  ND2   . ASN E 1  108 ? -9.835  -19.355 67.652 1.00 47.23  ? 108  ASN E ND2   1 
ATOM   3610  N  N     . LEU E 1  109 ? -14.034 -20.659 66.024 1.00 48.77  ? 109  LEU E N     1 
ATOM   3611  C  CA    . LEU E 1  109 ? -15.326 -19.977 66.270 1.00 46.48  ? 109  LEU E CA    1 
ATOM   3612  C  C     . LEU E 1  109 ? -16.389 -20.950 66.759 1.00 46.69  ? 109  LEU E C     1 
ATOM   3613  O  O     . LEU E 1  109 ? -17.260 -20.566 67.507 1.00 51.55  ? 109  LEU E O     1 
ATOM   3614  C  CB    . LEU E 1  109 ? -15.842 -19.337 65.004 1.00 41.23  ? 109  LEU E CB    1 
ATOM   3615  C  CG    . LEU E 1  109 ? -15.146 -18.108 64.500 1.00 39.75  ? 109  LEU E CG    1 
ATOM   3616  C  CD1   . LEU E 1  109 ? -15.917 -17.628 63.272 1.00 39.59  ? 109  LEU E CD1   1 
ATOM   3617  C  CD2   . LEU E 1  109 ? -15.098 -17.040 65.562 1.00 35.93  ? 109  LEU E CD2   1 
ATOM   3618  N  N     . CYS E 1  110 ? -16.315 -22.199 66.317 1.00 46.41  ? 110  CYS E N     1 
ATOM   3619  C  CA    . CYS E 1  110 ? -17.234 -23.230 66.789 1.00 50.51  ? 110  CYS E CA    1 
ATOM   3620  C  C     . CYS E 1  110 ? -17.015 -23.656 68.262 1.00 51.67  ? 110  CYS E C     1 
ATOM   3621  O  O     . CYS E 1  110 ? -17.973 -23.725 69.030 1.00 49.35  ? 110  CYS E O     1 
ATOM   3622  C  CB    . CYS E 1  110 ? -17.216 -24.414 65.827 1.00 49.69  ? 110  CYS E CB    1 
ATOM   3623  S  SG    . CYS E 1  110 ? -18.063 -24.019 64.266 1.00 50.09  ? 110  CYS E SG    1 
ATOM   3624  N  N     . ALA E 1  111 ? -15.770 -23.904 68.666 1.00 50.49  ? 111  ALA E N     1 
ATOM   3625  C  CA    . ALA E 1  111 ? -15.468 -24.047 70.089 1.00 49.23  ? 111  ALA E CA    1 
ATOM   3626  C  C     . ALA E 1  111 ? -15.925 -22.846 70.906 1.00 50.86  ? 111  ALA E C     1 
ATOM   3627  O  O     . ALA E 1  111 ? -16.534 -22.993 71.953 1.00 57.79  ? 111  ALA E O     1 
ATOM   3628  C  CB    . ALA E 1  111 ? -13.997 -24.279 70.300 1.00 49.25  ? 111  ALA E CB    1 
ATOM   3629  N  N     . ILE E 1  112 ? -15.649 -21.639 70.439 1.00 55.93  ? 112  ILE E N     1 
ATOM   3630  C  CA    . ILE E 1  112 ? -15.941 -20.449 71.251 1.00 48.69  ? 112  ILE E CA    1 
ATOM   3631  C  C     . ILE E 1  112 ? -17.425 -20.313 71.398 1.00 48.39  ? 112  ILE E C     1 
ATOM   3632  O  O     . ILE E 1  112 ? -17.901 -19.863 72.412 1.00 52.49  ? 112  ILE E O     1 
ATOM   3633  C  CB    . ILE E 1  112 ? -15.332 -19.179 70.635 1.00 46.54  ? 112  ILE E CB    1 
ATOM   3634  C  CG1   . ILE E 1  112 ? -13.828 -19.184 70.850 1.00 47.55  ? 112  ILE E CG1   1 
ATOM   3635  C  CG2   . ILE E 1  112 ? -15.928 -17.913 71.231 1.00 44.63  ? 112  ILE E CG2   1 
ATOM   3636  C  CD1   . ILE E 1  112 ? -13.116 -18.201 69.953 1.00 51.92  ? 112  ILE E CD1   1 
ATOM   3637  N  N     . HIS E 1  113 ? -18.171 -20.717 70.382 1.00 51.78  ? 113  HIS E N     1 
ATOM   3638  C  CA    . HIS E 1  113 ? -19.641 -20.717 70.469 1.00 49.73  ? 113  HIS E CA    1 
ATOM   3639  C  C     . HIS E 1  113 ? -20.133 -21.602 71.618 1.00 54.19  ? 113  HIS E C     1 
ATOM   3640  O  O     . HIS E 1  113 ? -21.163 -21.310 72.242 1.00 54.35  ? 113  HIS E O     1 
ATOM   3641  C  CB    . HIS E 1  113 ? -20.197 -21.240 69.162 1.00 49.68  ? 113  HIS E CB    1 
ATOM   3642  C  CG    . HIS E 1  113 ? -21.679 -21.196 69.069 1.00 49.24  ? 113  HIS E CG    1 
ATOM   3643  N  ND1   . HIS E 1  113 ? -22.372 -20.015 68.967 1.00 47.80  ? 113  HIS E ND1   1 
ATOM   3644  C  CD2   . HIS E 1  113 ? -22.599 -22.186 69.002 1.00 53.50  ? 113  HIS E CD2   1 
ATOM   3645  C  CE1   . HIS E 1  113 ? -23.663 -20.269 68.867 1.00 49.80  ? 113  HIS E CE1   1 
ATOM   3646  N  NE2   . HIS E 1  113 ? -23.830 -21.581 68.883 1.00 56.95  ? 113  HIS E NE2   1 
ATOM   3647  N  N     . ALA E 1  114 ? -19.381 -22.687 71.870 1.00 53.69  ? 114  ALA E N     1 
ATOM   3648  C  CA    . ALA E 1  114 ? -19.683 -23.700 72.886 1.00 49.61  ? 114  ALA E CA    1 
ATOM   3649  C  C     . ALA E 1  114 ? -19.074 -23.357 74.226 1.00 54.72  ? 114  ALA E C     1 
ATOM   3650  O  O     . ALA E 1  114 ? -18.825 -24.231 75.075 1.00 48.84  ? 114  ALA E O     1 
ATOM   3651  C  CB    . ALA E 1  114 ? -19.144 -25.034 72.425 1.00 50.95  ? 114  ALA E CB    1 
ATOM   3652  N  N     . LYS E 1  115 ? -18.780 -22.076 74.396 1.00 60.27  ? 115  LYS E N     1 
ATOM   3653  C  CA    . LYS E 1  115 ? -18.165 -21.583 75.611 1.00 62.08  ? 115  LYS E CA    1 
ATOM   3654  C  C     . LYS E 1  115 ? -16.878 -22.322 75.974 1.00 56.04  ? 115  LYS E C     1 
ATOM   3655  O  O     . LYS E 1  115 ? -16.546 -22.420 77.119 1.00 61.60  ? 115  LYS E O     1 
ATOM   3656  C  CB    . LYS E 1  115 ? -19.204 -21.604 76.725 1.00 65.97  ? 115  LYS E CB    1 
ATOM   3657  C  CG    . LYS E 1  115 ? -20.410 -20.780 76.308 1.00 73.23  ? 115  LYS E CG    1 
ATOM   3658  C  CD    . LYS E 1  115 ? -21.460 -20.601 77.381 1.00 80.05  ? 115  LYS E CD    1 
ATOM   3659  C  CE    . LYS E 1  115 ? -22.462 -19.558 76.911 1.00 84.92  ? 115  LYS E CE    1 
ATOM   3660  N  NZ    . LYS E 1  115 ? -23.431 -19.256 77.992 1.00 99.87  ? 115  LYS E NZ    1 
ATOM   3661  N  N     . ARG E 1  116 ? -16.129 -22.786 74.976 1.00 50.71  ? 116  ARG E N     1 
ATOM   3662  C  CA    . ARG E 1  116 ? -14.798 -23.343 75.191 1.00 48.20  ? 116  ARG E CA    1 
ATOM   3663  C  C     . ARG E 1  116 ? -13.705 -22.507 74.503 1.00 47.42  ? 116  ARG E C     1 
ATOM   3664  O  O     . ARG E 1  116 ? -13.970 -21.616 73.695 1.00 49.63  ? 116  ARG E O     1 
ATOM   3665  C  CB    . ARG E 1  116 ? -14.738 -24.768 74.641 1.00 49.61  ? 116  ARG E CB    1 
ATOM   3666  C  CG    . ARG E 1  116 ? -15.663 -25.747 75.304 1.00 46.52  ? 116  ARG E CG    1 
ATOM   3667  C  CD    . ARG E 1  116 ? -15.533 -27.128 74.691 1.00 51.06  ? 116  ARG E CD    1 
ATOM   3668  N  NE    . ARG E 1  116 ? -16.441 -27.354 73.547 1.00 55.54  ? 116  ARG E NE    1 
ATOM   3669  C  CZ    . ARG E 1  116 ? -16.111 -27.373 72.251 1.00 51.43  ? 116  ARG E CZ    1 
ATOM   3670  N  NH1   . ARG E 1  116 ? -14.873 -27.170 71.826 1.00 52.96  ? 116  ARG E NH1   1 
ATOM   3671  N  NH2   . ARG E 1  116 ? -17.054 -27.605 71.364 1.00 53.48  ? 116  ARG E NH2   1 
ATOM   3672  N  N     . VAL E 1  117 ? -12.465 -22.820 74.831 1.00 48.33  ? 117  VAL E N     1 
ATOM   3673  C  CA    . VAL E 1  117 ? -11.308 -22.251 74.140 1.00 50.78  ? 117  VAL E CA    1 
ATOM   3674  C  C     . VAL E 1  117 ? -10.441 -23.355 73.519 1.00 51.37  ? 117  VAL E C     1 
ATOM   3675  O  O     . VAL E 1  117 ? -9.396  -23.083 72.922 1.00 60.83  ? 117  VAL E O     1 
ATOM   3676  C  CB    . VAL E 1  117 ? -10.455 -21.378 75.113 1.00 51.67  ? 117  VAL E CB    1 
ATOM   3677  C  CG1   . VAL E 1  117 ? -11.312 -20.312 75.765 1.00 50.12  ? 117  VAL E CG1   1 
ATOM   3678  C  CG2   . VAL E 1  117 ? -9.820  -22.222 76.204 1.00 54.74  ? 117  VAL E CG2   1 
ATOM   3679  N  N     . THR E 1  118 ? -10.883 -24.594 73.662 1.00 51.03  ? 118  THR E N     1 
ATOM   3680  C  CA    . THR E 1  118 ? -10.177 -25.745 73.140 1.00 54.12  ? 118  THR E CA    1 
ATOM   3681  C  C     . THR E 1  118 ? -10.903 -26.358 71.939 1.00 52.01  ? 118  THR E C     1 
ATOM   3682  O  O     . THR E 1  118 ? -11.966 -26.966 72.096 1.00 53.19  ? 118  THR E O     1 
ATOM   3683  C  CB    . THR E 1  118 ? -10.101 -26.835 74.229 1.00 56.20  ? 118  THR E CB    1 
ATOM   3684  O  OG1   . THR E 1  118 ? -9.637  -26.254 75.449 1.00 58.31  ? 118  THR E OG1   1 
ATOM   3685  C  CG2   . THR E 1  118 ? -9.172  -27.973 73.804 1.00 57.93  ? 118  THR E CG2   1 
ATOM   3686  N  N     . ILE E 1  119 ? -10.326 -26.244 70.755 1.00 44.42  ? 119  ILE E N     1 
ATOM   3687  C  CA    . ILE E 1  119 ? -10.941 -26.876 69.581 1.00 44.95  ? 119  ILE E CA    1 
ATOM   3688  C  C     . ILE E 1  119 ? -10.963 -28.426 69.684 1.00 43.47  ? 119  ILE E C     1 
ATOM   3689  O  O     . ILE E 1  119 ? -10.018 -29.048 70.122 1.00 41.53  ? 119  ILE E O     1 
ATOM   3690  C  CB    . ILE E 1  119 ? -10.294 -26.411 68.255 1.00 43.66  ? 119  ILE E CB    1 
ATOM   3691  C  CG1   . ILE E 1  119 ? -8.825  -26.796 68.132 1.00 44.58  ? 119  ILE E CG1   1 
ATOM   3692  C  CG2   . ILE E 1  119 ? -10.339 -24.910 68.164 1.00 48.27  ? 119  ILE E CG2   1 
ATOM   3693  C  CD1   . ILE E 1  119 ? -8.375  -26.869 66.704 1.00 44.86  ? 119  ILE E CD1   1 
ATOM   3694  N  N     . MET E 1  120 ? -12.069 -29.043 69.290 1.00 46.38  ? 120  MET E N     1 
ATOM   3695  C  CA    . MET E 1  120 ? -12.196 -30.502 69.325 1.00 47.08  ? 120  MET E CA    1 
ATOM   3696  C  C     . MET E 1  120 ? -12.728 -30.991 67.989 1.00 42.76  ? 120  MET E C     1 
ATOM   3697  O  O     . MET E 1  120 ? -13.214 -30.205 67.177 1.00 46.18  ? 120  MET E O     1 
ATOM   3698  C  CB    . MET E 1  120 ? -13.131 -30.919 70.460 1.00 51.90  ? 120  MET E CB    1 
ATOM   3699  C  CG    . MET E 1  120 ? -12.993 -30.081 71.716 1.00 56.59  ? 120  MET E CG    1 
ATOM   3700  S  SD    . MET E 1  120 ? -13.744 -30.799 73.184 1.00 66.62  ? 120  MET E SD    1 
ATOM   3701  C  CE    . MET E 1  120 ? -15.450 -30.864 72.718 1.00 80.49  ? 120  MET E CE    1 
ATOM   3702  N  N     . PRO E 1  121 ? -12.649 -32.291 67.743 1.00 43.91  ? 121  PRO E N     1 
ATOM   3703  C  CA    . PRO E 1  121 ? -13.175 -32.798 66.498 1.00 45.54  ? 121  PRO E CA    1 
ATOM   3704  C  C     . PRO E 1  121 ? -14.621 -32.376 66.211 1.00 48.46  ? 121  PRO E C     1 
ATOM   3705  O  O     . PRO E 1  121 ? -14.967 -32.078 65.056 1.00 53.45  ? 121  PRO E O     1 
ATOM   3706  C  CB    . PRO E 1  121 ? -13.042 -34.303 66.679 1.00 45.85  ? 121  PRO E CB    1 
ATOM   3707  C  CG    . PRO E 1  121 ? -11.774 -34.441 67.450 1.00 44.64  ? 121  PRO E CG    1 
ATOM   3708  C  CD    . PRO E 1  121 ? -11.980 -33.366 68.498 1.00 47.66  ? 121  PRO E CD    1 
ATOM   3709  N  N     . LYS E 1  122 ? -15.453 -32.294 67.234 1.00 50.93  ? 122  LYS E N     1 
ATOM   3710  C  CA    . LYS E 1  122 ? -16.835 -31.902 66.989 1.00 50.69  ? 122  LYS E CA    1 
ATOM   3711  C  C     . LYS E 1  122 ? -16.886 -30.506 66.391 1.00 46.33  ? 122  LYS E C     1 
ATOM   3712  O  O     . LYS E 1  122 ? -17.730 -30.235 65.560 1.00 45.60  ? 122  LYS E O     1 
ATOM   3713  C  CB    . LYS E 1  122 ? -17.729 -32.056 68.244 1.00 52.25  ? 122  LYS E CB    1 
ATOM   3714  C  CG    . LYS E 1  122 ? -17.562 -31.011 69.334 1.00 56.81  ? 122  LYS E CG    1 
ATOM   3715  C  CD    . LYS E 1  122 ? -17.848 -31.545 70.740 1.00 59.71  ? 122  LYS E CD    1 
ATOM   3716  C  CE    . LYS E 1  122 ? -19.322 -31.567 71.082 1.00 72.30  ? 122  LYS E CE    1 
ATOM   3717  N  NZ    . LYS E 1  122 ? -19.612 -32.538 72.175 1.00 77.82  ? 122  LYS E NZ    1 
ATOM   3718  N  N     . ASP E 1  123 ? -15.955 -29.641 66.751 1.00 46.84  ? 123  ASP E N     1 
ATOM   3719  C  CA    . ASP E 1  123 ? -15.927 -28.303 66.153 1.00 45.78  ? 123  ASP E CA    1 
ATOM   3720  C  C     . ASP E 1  123 ? -15.536 -28.356 64.690 1.00 47.27  ? 123  ASP E C     1 
ATOM   3721  O  O     . ASP E 1  123 ? -16.094 -27.654 63.873 1.00 48.98  ? 123  ASP E O     1 
ATOM   3722  C  CB    . ASP E 1  123 ? -14.968 -27.399 66.878 1.00 45.07  ? 123  ASP E CB    1 
ATOM   3723  C  CG    . ASP E 1  123 ? -15.252 -27.319 68.361 1.00 47.39  ? 123  ASP E CG    1 
ATOM   3724  O  OD1   . ASP E 1  123 ? -16.394 -27.047 68.752 1.00 48.49  ? 123  ASP E OD1   1 
ATOM   3725  O  OD2   . ASP E 1  123 ? -14.316 -27.528 69.149 1.00 48.83  ? 123  ASP E OD2   1 
ATOM   3726  N  N     . ILE E 1  124 ? -14.576 -29.193 64.334 1.00 51.47  ? 124  ILE E N     1 
ATOM   3727  C  CA    . ILE E 1  124 ? -14.191 -29.280 62.919 1.00 49.14  ? 124  ILE E CA    1 
ATOM   3728  C  C     . ILE E 1  124 ? -15.394 -29.770 62.135 1.00 49.39  ? 124  ILE E C     1 
ATOM   3729  O  O     . ILE E 1  124 ? -15.729 -29.219 61.105 1.00 47.35  ? 124  ILE E O     1 
ATOM   3730  C  CB    . ILE E 1  124 ? -13.003 -30.226 62.685 1.00 47.92  ? 124  ILE E CB    1 
ATOM   3731  C  CG1   . ILE E 1  124 ? -11.726 -29.634 63.259 1.00 53.45  ? 124  ILE E CG1   1 
ATOM   3732  C  CG2   . ILE E 1  124 ? -12.731 -30.389 61.211 1.00 51.48  ? 124  ILE E CG2   1 
ATOM   3733  C  CD1   . ILE E 1  124 ? -10.517 -30.545 63.112 1.00 52.37  ? 124  ILE E CD1   1 
ATOM   3734  N  N     . GLN E 1  125 ? -16.047 -30.804 62.645 1.00 50.96  ? 125  GLN E N     1 
ATOM   3735  C  CA    . GLN E 1  125 ? -17.208 -31.371 61.973 1.00 51.24  ? 125  GLN E CA    1 
ATOM   3736  C  C     . GLN E 1  125 ? -18.363 -30.389 61.824 1.00 49.08  ? 125  GLN E C     1 
ATOM   3737  O  O     . GLN E 1  125 ? -19.040 -30.349 60.818 1.00 49.68  ? 125  GLN E O     1 
ATOM   3738  C  CB    . GLN E 1  125 ? -17.661 -32.620 62.709 1.00 52.28  ? 125  GLN E CB    1 
ATOM   3739  C  CG    . GLN E 1  125 ? -16.683 -33.767 62.498 1.00 53.98  ? 125  GLN E CG    1 
ATOM   3740  C  CD    . GLN E 1  125 ? -16.679 -34.785 63.619 1.00 59.68  ? 125  GLN E CD    1 
ATOM   3741  O  OE1   . GLN E 1  125 ? -17.632 -34.897 64.396 1.00 60.87  ? 125  GLN E OE1   1 
ATOM   3742  N  NE2   . GLN E 1  125 ? -15.581 -35.536 63.718 1.00 67.01  ? 125  GLN E NE2   1 
ATOM   3743  N  N     . LEU E 1  126 ? -18.595 -29.560 62.813 1.00 49.40  ? 126  LEU E N     1 
ATOM   3744  C  CA    . LEU E 1  126 ? -19.713 -28.652 62.688 1.00 43.93  ? 126  LEU E CA    1 
ATOM   3745  C  C     . LEU E 1  126 ? -19.352 -27.659 61.599 1.00 44.00  ? 126  LEU E C     1 
ATOM   3746  O  O     . LEU E 1  126 ? -20.198 -27.324 60.789 1.00 43.93  ? 126  LEU E O     1 
ATOM   3747  C  CB    . LEU E 1  126 ? -20.027 -27.997 64.026 1.00 42.02  ? 126  LEU E CB    1 
ATOM   3748  C  CG    . LEU E 1  126 ? -21.053 -26.908 63.955 1.00 45.99  ? 126  LEU E CG    1 
ATOM   3749  C  CD1   . LEU E 1  126 ? -22.292 -27.437 63.303 1.00 46.21  ? 126  LEU E CD1   1 
ATOM   3750  C  CD2   . LEU E 1  126 ? -21.365 -26.432 65.356 1.00 49.25  ? 126  LEU E CD2   1 
ATOM   3751  N  N     . ALA E 1  127 ? -18.093 -27.213 61.570 1.00 42.98  ? 127  ALA E N     1 
ATOM   3752  C  CA    . ALA E 1  127 ? -17.624 -26.257 60.552 1.00 45.53  ? 127  ALA E CA    1 
ATOM   3753  C  C     . ALA E 1  127 ? -17.814 -26.782 59.145 1.00 47.49  ? 127  ALA E C     1 
ATOM   3754  O  O     . ALA E 1  127 ? -18.244 -26.068 58.227 1.00 45.51  ? 127  ALA E O     1 
ATOM   3755  C  CB    . ALA E 1  127 ? -16.165 -25.932 60.752 1.00 46.52  ? 127  ALA E CB    1 
ATOM   3756  N  N     . ARG E 1  128 ? -17.494 -28.050 58.969 1.00 47.17  ? 128  ARG E N     1 
ATOM   3757  C  CA    . ARG E 1  128 ? -17.529 -28.605 57.645 1.00 42.62  ? 128  ARG E CA    1 
ATOM   3758  C  C     . ARG E 1  128 ? -18.950 -28.905 57.228 1.00 44.62  ? 128  ARG E C     1 
ATOM   3759  O  O     . ARG E 1  128 ? -19.227 -28.876 56.048 1.00 47.00  ? 128  ARG E O     1 
ATOM   3760  C  CB    . ARG E 1  128 ? -16.665 -29.827 57.570 1.00 40.76  ? 128  ARG E CB    1 
ATOM   3761  C  CG    . ARG E 1  128 ? -15.208 -29.586 57.922 1.00 41.38  ? 128  ARG E CG    1 
ATOM   3762  C  CD    . ARG E 1  128 ? -14.315 -30.401 56.999 1.00 46.58  ? 128  ARG E CD    1 
ATOM   3763  N  NE    . ARG E 1  128 ? -14.735 -31.795 56.985 1.00 53.16  ? 128  ARG E NE    1 
ATOM   3764  C  CZ    . ARG E 1  128 ? -14.778 -32.569 55.915 1.00 59.54  ? 128  ARG E CZ    1 
ATOM   3765  N  NH1   . ARG E 1  128 ? -14.400 -32.120 54.722 1.00 63.69  ? 128  ARG E NH1   1 
ATOM   3766  N  NH2   . ARG E 1  128 ? -15.200 -33.815 56.052 1.00 70.12  ? 128  ARG E NH2   1 
ATOM   3767  N  N     . ARG E 1  129 ? -19.858 -29.192 58.164 1.00 47.64  ? 129  ARG E N     1 
ATOM   3768  C  CA    . ARG E 1  129 ? -21.251 -29.413 57.785 1.00 50.50  ? 129  ARG E CA    1 
ATOM   3769  C  C     . ARG E 1  129 ? -21.850 -28.079 57.350 1.00 49.15  ? 129  ARG E C     1 
ATOM   3770  O  O     . ARG E 1  129 ? -22.372 -27.962 56.267 1.00 49.57  ? 129  ARG E O     1 
ATOM   3771  C  CB    . ARG E 1  129 ? -22.083 -30.023 58.913 1.00 56.43  ? 129  ARG E CB    1 
ATOM   3772  C  CG    . ARG E 1  129 ? -23.569 -30.172 58.549 1.00 64.91  ? 129  ARG E CG    1 
ATOM   3773  C  CD    . ARG E 1  129 ? -24.171 -31.277 59.385 1.00 75.83  ? 129  ARG E CD    1 
ATOM   3774  N  NE    . ARG E 1  129 ? -25.559 -31.623 59.065 1.00 88.61  ? 129  ARG E NE    1 
ATOM   3775  C  CZ    . ARG E 1  129 ? -26.295 -32.488 59.784 1.00 92.68  ? 129  ARG E CZ    1 
ATOM   3776  N  NH1   . ARG E 1  129 ? -25.784 -33.092 60.858 1.00 84.51  ? 129  ARG E NH1   1 
ATOM   3777  N  NH2   . ARG E 1  129 ? -27.558 -32.741 59.443 1.00 101.35 ? 129  ARG E NH2   1 
ATOM   3778  N  N     . ILE E 1  130 ? -21.718 -27.057 58.168 1.00 47.90  ? 130  ILE E N     1 
ATOM   3779  C  CA    . ILE E 1  130 ? -22.229 -25.757 57.793 1.00 50.06  ? 130  ILE E CA    1 
ATOM   3780  C  C     . ILE E 1  130 ? -21.584 -25.253 56.514 1.00 52.98  ? 130  ILE E C     1 
ATOM   3781  O  O     . ILE E 1  130 ? -22.270 -24.651 55.688 1.00 59.18  ? 130  ILE E O     1 
ATOM   3782  C  CB    . ILE E 1  130 ? -22.050 -24.736 58.902 1.00 52.16  ? 130  ILE E CB    1 
ATOM   3783  C  CG1   . ILE E 1  130 ? -22.860 -25.181 60.118 1.00 60.98  ? 130  ILE E CG1   1 
ATOM   3784  C  CG2   . ILE E 1  130 ? -22.524 -23.367 58.460 1.00 49.09  ? 130  ILE E CG2   1 
ATOM   3785  C  CD1   . ILE E 1  130 ? -22.382 -24.536 61.398 1.00 65.39  ? 130  ILE E CD1   1 
ATOM   3786  N  N     . ARG E 1  131 ? -20.292 -25.500 56.317 1.00 53.87  ? 131  ARG E N     1 
ATOM   3787  C  CA    . ARG E 1  131 ? -19.639 -25.103 55.029 1.00 54.45  ? 131  ARG E CA    1 
ATOM   3788  C  C     . ARG E 1  131 ? -20.163 -25.838 53.769 1.00 56.22  ? 131  ARG E C     1 
ATOM   3789  O  O     . ARG E 1  131 ? -19.827 -25.462 52.657 1.00 59.66  ? 131  ARG E O     1 
ATOM   3790  C  CB    . ARG E 1  131 ? -18.141 -25.333 55.075 1.00 48.26  ? 131  ARG E CB    1 
ATOM   3791  C  CG    . ARG E 1  131 ? -17.328 -24.264 55.750 1.00 47.04  ? 131  ARG E CG    1 
ATOM   3792  C  CD    . ARG E 1  131 ? -15.914 -24.840 55.850 1.00 43.84  ? 131  ARG E CD    1 
ATOM   3793  N  NE    . ARG E 1  131 ? -14.895 -23.848 56.169 1.00 41.16  ? 131  ARG E NE    1 
ATOM   3794  C  CZ    . ARG E 1  131 ? -13.656 -23.899 55.695 1.00 43.90  ? 131  ARG E CZ    1 
ATOM   3795  N  NH1   . ARG E 1  131 ? -13.281 -24.879 54.891 1.00 43.49  ? 131  ARG E NH1   1 
ATOM   3796  N  NH2   . ARG E 1  131 ? -12.765 -22.963 56.007 1.00 46.02  ? 131  ARG E NH2   1 
ATOM   3797  N  N     . GLY E 1  132 ? -20.942 -26.900 53.934 1.00 56.68  ? 132  GLY E N     1 
ATOM   3798  C  CA    . GLY E 1  132 ? -21.422 -27.644 52.785 1.00 57.78  ? 132  GLY E CA    1 
ATOM   3799  C  C     . GLY E 1  132 ? -20.405 -28.623 52.293 1.00 60.34  ? 132  GLY E C     1 
ATOM   3800  O  O     . GLY E 1  132 ? -20.482 -29.073 51.177 1.00 78.14  ? 132  GLY E O     1 
ATOM   3801  N  N     . GLU E 1  133 ? -19.449 -28.976 53.136 1.00 70.86  ? 133  GLU E N     1 
ATOM   3802  C  CA    . GLU E 1  133 ? -18.484 -30.036 52.829 1.00 72.34  ? 133  GLU E CA    1 
ATOM   3803  C  C     . GLU E 1  133 ? -19.084 -31.393 53.228 1.00 82.48  ? 133  GLU E C     1 
ATOM   3804  O  O     . GLU E 1  133 ? -18.457 -32.441 53.075 1.00 91.21  ? 133  GLU E O     1 
ATOM   3805  C  CB    . GLU E 1  133 ? -17.118 -29.736 53.506 1.00 66.07  ? 133  GLU E CB    1 
ATOM   3806  C  CG    . GLU E 1  133 ? -16.400 -28.554 52.850 1.00 62.51  ? 133  GLU E CG    1 
ATOM   3807  C  CD    . GLU E 1  133 ? -15.106 -28.054 53.518 1.00 61.87  ? 133  GLU E CD    1 
ATOM   3808  O  OE1   . GLU E 1  133 ? -14.286 -28.841 54.062 1.00 52.37  ? 133  GLU E OE1   1 
ATOM   3809  O  OE2   . GLU E 1  133 ? -14.890 -26.825 53.446 1.00 56.79  ? 133  GLU E OE2   1 
ATOM   3810  N  N     . ARG E 1  134 ? -20.304 -31.356 53.760 1.00 102.07 ? 134  ARG E N     1 
ATOM   3811  C  CA    . ARG E 1  134 ? -21.194 -32.519 53.787 1.00 110.00 ? 134  ARG E CA    1 
ATOM   3812  C  C     . ARG E 1  134 ? -22.671 -32.101 53.652 1.00 103.22 ? 134  ARG E C     1 
ATOM   3813  O  O     . ARG E 1  134 ? -23.099 -31.057 54.162 1.00 80.67  ? 134  ARG E O     1 
ATOM   3814  C  CB    . ARG E 1  134 ? -20.998 -33.312 55.071 1.00 120.19 ? 134  ARG E CB    1 
ATOM   3815  C  CG    . ARG E 1  134 ? -19.759 -34.198 55.079 1.00 126.33 ? 134  ARG E CG    1 
ATOM   3816  C  CD    . ARG E 1  134 ? -19.476 -34.653 56.493 1.00 129.84 ? 134  ARG E CD    1 
ATOM   3817  N  NE    . ARG E 1  134 ? -19.397 -33.489 57.374 1.00 132.17 ? 134  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E 1  134 ? -19.425 -33.533 58.703 1.00 126.80 ? 134  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E 1  134 ? -19.523 -34.689 59.361 1.00 121.21 ? 134  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E 1  134 ? -19.344 -32.400 59.385 1.00 120.86 ? 134  ARG E NH2   1 
ATOM   3821  N  N     . LYS F 2  16  ? 14.347  -47.251 34.044 1.00 157.76 ? 16   LYS F N     1 
ATOM   3822  C  CA    . LYS F 2  16  ? 14.467  -47.144 35.529 1.00 160.92 ? 16   LYS F CA    1 
ATOM   3823  C  C     . LYS F 2  16  ? 14.514  -48.529 36.172 1.00 164.61 ? 16   LYS F C     1 
ATOM   3824  O  O     . LYS F 2  16  ? 13.821  -49.455 35.731 1.00 166.54 ? 16   LYS F O     1 
ATOM   3825  C  CB    . LYS F 2  16  ? 13.308  -46.327 36.126 1.00 159.13 ? 16   LYS F CB    1 
ATOM   3826  C  CG    . LYS F 2  16  ? 11.927  -46.951 35.956 1.00 157.56 ? 16   LYS F CG    1 
ATOM   3827  C  CD    . LYS F 2  16  ? 10.877  -46.189 36.740 1.00 154.70 ? 16   LYS F CD    1 
ATOM   3828  C  CE    . LYS F 2  16  ? 9.520   -46.868 36.649 1.00 153.68 ? 16   LYS F CE    1 
ATOM   3829  N  NZ    . LYS F 2  16  ? 8.466   -46.084 37.353 1.00 150.99 ? 16   LYS F NZ    1 
ATOM   3830  N  N     . ARG F 2  17  ? 15.345  -48.663 37.202 1.00 161.83 ? 17   ARG F N     1 
ATOM   3831  C  CA    . ARG F 2  17  ? 15.381  -49.875 38.008 1.00 154.34 ? 17   ARG F CA    1 
ATOM   3832  C  C     . ARG F 2  17  ? 14.836  -49.607 39.413 1.00 155.57 ? 17   ARG F C     1 
ATOM   3833  O  O     . ARG F 2  17  ? 15.349  -48.745 40.136 1.00 153.08 ? 17   ARG F O     1 
ATOM   3834  C  CB    . ARG F 2  17  ? 16.795  -50.460 38.071 1.00 145.03 ? 17   ARG F CB    1 
ATOM   3835  C  CG    . ARG F 2  17  ? 16.956  -51.759 37.291 1.00 149.96 ? 17   ARG F CG    1 
ATOM   3836  C  CD    . ARG F 2  17  ? 17.851  -52.740 38.035 1.00 154.87 ? 17   ARG F CD    1 
ATOM   3837  N  NE    . ARG F 2  17  ? 18.407  -53.761 37.150 1.00 153.88 ? 17   ARG F NE    1 
ATOM   3838  C  CZ    . ARG F 2  17  ? 19.413  -54.576 37.466 1.00 144.85 ? 17   ARG F CZ    1 
ATOM   3839  N  NH1   . ARG F 2  17  ? 19.991  -54.514 38.660 1.00 140.73 ? 17   ARG F NH1   1 
ATOM   3840  N  NH2   . ARG F 2  17  ? 19.847  -55.462 36.576 1.00 143.00 ? 17   ARG F NH2   1 
ATOM   3841  N  N     . HIS F 2  18  ? 13.780  -50.348 39.763 1.00 151.15 ? 18   HIS F N     1 
ATOM   3842  C  CA    . HIS F 2  18  ? 13.148  -50.326 41.086 1.00 151.44 ? 18   HIS F CA    1 
ATOM   3843  C  C     . HIS F 2  18  ? 12.412  -49.012 41.276 1.00 137.54 ? 18   HIS F C     1 
ATOM   3844  O  O     . HIS F 2  18  ? 12.571  -48.093 40.475 1.00 137.30 ? 18   HIS F O     1 
ATOM   3845  C  CB    . HIS F 2  18  ? 14.169  -50.605 42.207 1.00 169.27 ? 18   HIS F CB    1 
ATOM   3846  C  CG    . HIS F 2  18  ? 15.076  -51.771 41.920 1.00 186.34 ? 18   HIS F CG    1 
ATOM   3847  N  ND1   . HIS F 2  18  ? 14.650  -53.083 41.982 1.00 190.76 ? 18   HIS F ND1   1 
ATOM   3848  C  CD2   . HIS F 2  18  ? 16.380  -51.819 41.550 1.00 189.23 ? 18   HIS F CD2   1 
ATOM   3849  C  CE1   . HIS F 2  18  ? 15.652  -53.887 41.669 1.00 185.28 ? 18   HIS F CE1   1 
ATOM   3850  N  NE2   . HIS F 2  18  ? 16.713  -53.146 41.402 1.00 185.40 ? 18   HIS F NE2   1 
ATOM   3851  N  N     . ARG F 2  19  ? 11.577  -48.935 42.306 1.00 133.37 ? 19   ARG F N     1 
ATOM   3852  C  CA    . ARG F 2  19  ? 10.721  -47.767 42.499 1.00 126.97 ? 19   ARG F CA    1 
ATOM   3853  C  C     . ARG F 2  19  ? 10.141  -47.775 43.909 1.00 119.04 ? 19   ARG F C     1 
ATOM   3854  O  O     . ARG F 2  19  ? 9.145   -48.453 44.164 1.00 121.30 ? 19   ARG F O     1 
ATOM   3855  C  CB    . ARG F 2  19  ? 9.599   -47.754 41.440 1.00 130.92 ? 19   ARG F CB    1 
ATOM   3856  C  CG    . ARG F 2  19  ? 9.136   -46.365 41.013 1.00 139.20 ? 19   ARG F CG    1 
ATOM   3857  C  CD    . ARG F 2  19  ? 8.187   -45.734 42.024 1.00 146.85 ? 19   ARG F CD    1 
ATOM   3858  N  NE    . ARG F 2  19  ? 8.412   -44.292 42.192 1.00 153.26 ? 19   ARG F NE    1 
ATOM   3859  C  CZ    . ARG F 2  19  ? 7.936   -43.555 43.201 1.00 153.73 ? 19   ARG F CZ    1 
ATOM   3860  N  NH1   . ARG F 2  19  ? 7.193   -44.109 44.156 1.00 152.39 ? 19   ARG F NH1   1 
ATOM   3861  N  NH2   . ARG F 2  19  ? 8.202   -42.251 43.261 1.00 147.17 ? 19   ARG F NH2   1 
ATOM   3862  N  N     . LYS F 2  20  ? 10.760  -47.008 44.809 1.00 104.82 ? 20   LYS F N     1 
ATOM   3863  C  CA    . LYS F 2  20  ? 10.401  -46.994 46.238 1.00 98.95  ? 20   LYS F CA    1 
ATOM   3864  C  C     . LYS F 2  20  ? 8.881   -47.009 46.546 1.00 85.28  ? 20   LYS F C     1 
ATOM   3865  O  O     . LYS F 2  20  ? 8.104   -46.303 45.922 1.00 96.74  ? 20   LYS F O     1 
ATOM   3866  C  CB    . LYS F 2  20  ? 11.052  -45.778 46.923 1.00 102.35 ? 20   LYS F CB    1 
ATOM   3867  C  CG    . LYS F 2  20  ? 10.867  -45.724 48.439 1.00 116.79 ? 20   LYS F CG    1 
ATOM   3868  C  CD    . LYS F 2  20  ? 11.343  -46.994 49.157 1.00 120.91 ? 20   LYS F CD    1 
ATOM   3869  C  CE    . LYS F 2  20  ? 11.110  -46.914 50.660 1.00 126.07 ? 20   LYS F CE    1 
ATOM   3870  N  NZ    . LYS F 2  20  ? 12.081  -47.750 51.421 1.00 131.46 ? 20   LYS F NZ    1 
ATOM   3871  N  N     . VAL F 2  21  ? 8.475   -47.812 47.519 1.00 68.43  ? 21   VAL F N     1 
ATOM   3872  C  CA    . VAL F 2  21  ? 7.080   -47.913 47.902 1.00 62.68  ? 21   VAL F CA    1 
ATOM   3873  C  C     . VAL F 2  21  ? 6.746   -46.788 48.861 1.00 61.49  ? 21   VAL F C     1 
ATOM   3874  O  O     . VAL F 2  21  ? 7.463   -46.586 49.833 1.00 64.62  ? 21   VAL F O     1 
ATOM   3875  C  CB    . VAL F 2  21  ? 6.771   -49.268 48.600 1.00 56.36  ? 21   VAL F CB    1 
ATOM   3876  C  CG1   . VAL F 2  21  ? 5.403   -49.279 49.227 1.00 58.66  ? 21   VAL F CG1   1 
ATOM   3877  C  CG2   . VAL F 2  21  ? 6.838   -50.385 47.607 1.00 61.01  ? 21   VAL F CG2   1 
ATOM   3878  N  N     . LEU F 2  22  ? 5.615   -46.126 48.598 1.00 58.04  ? 22   LEU F N     1 
ATOM   3879  C  CA    . LEU F 2  22  ? 5.094   -45.029 49.380 1.00 51.76  ? 22   LEU F CA    1 
ATOM   3880  C  C     . LEU F 2  22  ? 4.021   -45.550 50.282 1.00 54.41  ? 22   LEU F C     1 
ATOM   3881  O  O     . LEU F 2  22  ? 3.058   -46.106 49.788 1.00 55.91  ? 22   LEU F O     1 
ATOM   3882  C  CB    . LEU F 2  22  ? 4.473   -43.989 48.459 1.00 51.77  ? 22   LEU F CB    1 
ATOM   3883  C  CG    . LEU F 2  22  ? 5.501   -43.243 47.587 1.00 57.82  ? 22   LEU F CG    1 
ATOM   3884  C  CD1   . LEU F 2  22  ? 4.865   -42.468 46.455 1.00 58.04  ? 22   LEU F CD1   1 
ATOM   3885  C  CD2   . LEU F 2  22  ? 6.347   -42.304 48.419 1.00 61.97  ? 22   LEU F CD2   1 
ATOM   3886  N  N     . ARG F 2  23  ? 4.150   -45.346 51.597 1.00 54.50  ? 23   ARG F N     1 
ATOM   3887  C  CA    . ARG F 2  23  ? 3.062   -45.688 52.508 1.00 53.52  ? 23   ARG F CA    1 
ATOM   3888  C  C     . ARG F 2  23  ? 3.095   -44.911 53.807 1.00 53.81  ? 23   ARG F C     1 
ATOM   3889  O  O     . ARG F 2  23  ? 4.147   -44.576 54.297 1.00 59.28  ? 23   ARG F O     1 
ATOM   3890  C  CB    . ARG F 2  23  ? 3.044   -47.198 52.809 1.00 55.34  ? 23   ARG F CB    1 
ATOM   3891  C  CG    . ARG F 2  23  ? 4.393   -47.798 53.097 1.00 59.12  ? 23   ARG F CG    1 
ATOM   3892  C  CD    . ARG F 2  23  ? 4.360   -49.305 52.953 1.00 60.17  ? 23   ARG F CD    1 
ATOM   3893  N  NE    . ARG F 2  23  ? 4.092   -49.886 54.259 1.00 65.52  ? 23   ARG F NE    1 
ATOM   3894  C  CZ    . ARG F 2  23  ? 5.035   -50.230 55.138 1.00 56.62  ? 23   ARG F CZ    1 
ATOM   3895  N  NH1   . ARG F 2  23  ? 6.335   -50.071 54.871 1.00 47.98  ? 23   ARG F NH1   1 
ATOM   3896  N  NH2   . ARG F 2  23  ? 4.662   -50.730 56.295 1.00 55.31  ? 23   ARG F NH2   1 
ATOM   3897  N  N     . ASP F 2  24  ? 1.920   -44.635 54.367 1.00 55.30  ? 24   ASP F N     1 
ATOM   3898  C  CA    . ASP F 2  24  ? 1.795   -43.899 55.632 1.00 53.60  ? 24   ASP F CA    1 
ATOM   3899  C  C     . ASP F 2  24  ? 2.318   -42.446 55.643 1.00 53.30  ? 24   ASP F C     1 
ATOM   3900  O  O     . ASP F 2  24  ? 2.458   -41.820 56.704 1.00 41.16  ? 24   ASP F O     1 
ATOM   3901  C  CB    . ASP F 2  24  ? 2.482   -44.655 56.742 1.00 52.18  ? 24   ASP F CB    1 
ATOM   3902  C  CG    . ASP F 2  24  ? 1.780   -44.489 58.036 1.00 58.31  ? 24   ASP F CG    1 
ATOM   3903  O  OD1   . ASP F 2  24  ? 0.549   -44.295 57.991 1.00 63.92  ? 24   ASP F OD1   1 
ATOM   3904  O  OD2   . ASP F 2  24  ? 2.433   -44.568 59.091 1.00 64.18  ? 24   ASP F OD2   1 
ATOM   3905  N  N     . ASN F 2  25  ? 2.577   -41.894 54.468 1.00 51.95  ? 25   ASN F N     1 
ATOM   3906  C  CA    . ASN F 2  25  ? 3.081   -40.568 54.404 1.00 50.65  ? 25   ASN F CA    1 
ATOM   3907  C  C     . ASN F 2  25  ? 2.192   -39.510 55.047 1.00 52.50  ? 25   ASN F C     1 
ATOM   3908  O  O     . ASN F 2  25  ? 2.686   -38.460 55.405 1.00 61.37  ? 25   ASN F O     1 
ATOM   3909  C  CB    . ASN F 2  25  ? 3.350   -40.217 52.986 1.00 53.15  ? 25   ASN F CB    1 
ATOM   3910  C  CG    . ASN F 2  25  ? 4.598   -40.859 52.487 1.00 54.83  ? 25   ASN F CG    1 
ATOM   3911  O  OD1   . ASN F 2  25  ? 5.678   -40.508 52.934 1.00 59.38  ? 25   ASN F OD1   1 
ATOM   3912  N  ND2   . ASN F 2  25  ? 4.472   -41.803 51.566 1.00 59.11  ? 25   ASN F ND2   1 
ATOM   3913  N  N     . ILE F 2  26  ? 0.911   -39.795 55.233 1.00 53.59  ? 26   ILE F N     1 
ATOM   3914  C  CA    . ILE F 2  26  ? 0.019   -38.897 55.935 1.00 51.63  ? 26   ILE F CA    1 
ATOM   3915  C  C     . ILE F 2  26  ? 0.640   -38.525 57.270 1.00 52.75  ? 26   ILE F C     1 
ATOM   3916  O  O     . ILE F 2  26  ? 0.290   -37.501 57.835 1.00 53.22  ? 26   ILE F O     1 
ATOM   3917  C  CB    . ILE F 2  26  ? -1.360  -39.547 56.214 1.00 52.49  ? 26   ILE F CB    1 
ATOM   3918  C  CG1   . ILE F 2  26  ? -2.405  -38.547 56.710 1.00 57.12  ? 26   ILE F CG1   1 
ATOM   3919  C  CG2   . ILE F 2  26  ? -1.237  -40.591 57.297 1.00 53.53  ? 26   ILE F CG2   1 
ATOM   3920  C  CD1   . ILE F 2  26  ? -2.455  -37.238 55.951 1.00 63.89  ? 26   ILE F CD1   1 
ATOM   3921  N  N     . GLN F 2  27  ? 1.542   -39.355 57.781 1.00 52.26  ? 27   GLN F N     1 
ATOM   3922  C  CA    . GLN F 2  27  ? 2.116   -39.133 59.131 1.00 56.83  ? 27   GLN F CA    1 
ATOM   3923  C  C     . GLN F 2  27  ? 3.274   -38.154 59.129 1.00 52.09  ? 27   GLN F C     1 
ATOM   3924  O  O     . GLN F 2  27  ? 3.809   -37.825 60.190 1.00 56.04  ? 27   GLN F O     1 
ATOM   3925  C  CB    . GLN F 2  27  ? 2.568   -40.459 59.790 1.00 52.77  ? 27   GLN F CB    1 
ATOM   3926  C  CG    . GLN F 2  27  ? 1.411   -41.328 60.234 1.00 50.34  ? 27   GLN F CG    1 
ATOM   3927  C  CD    . GLN F 2  27  ? 0.621   -40.710 61.382 1.00 53.81  ? 27   GLN F CD    1 
ATOM   3928  O  OE1   . GLN F 2  27  ? 1.180   -39.967 62.200 1.00 62.68  ? 27   GLN F OE1   1 
ATOM   3929  N  NE2   . GLN F 2  27  ? -0.691  -41.012 61.456 1.00 50.93  ? 27   GLN F NE2   1 
ATOM   3930  N  N     . GLY F 2  28  ? 3.659   -37.693 57.949 1.00 50.05  ? 28   GLY F N     1 
ATOM   3931  C  CA    . GLY F 2  28  ? 4.619   -36.593 57.847 1.00 56.99  ? 28   GLY F CA    1 
ATOM   3932  C  C     . GLY F 2  28  ? 4.021   -35.230 58.169 1.00 57.52  ? 28   GLY F C     1 
ATOM   3933  O  O     . GLY F 2  28  ? 4.744   -34.241 58.290 1.00 61.77  ? 28   GLY F O     1 
ATOM   3934  N  N     . ILE F 2  29  ? 2.690   -35.181 58.239 1.00 53.90  ? 29   ILE F N     1 
ATOM   3935  C  CA    . ILE F 2  29  ? 1.947   -34.013 58.663 1.00 48.06  ? 29   ILE F CA    1 
ATOM   3936  C  C     . ILE F 2  29  ? 1.959   -34.126 60.181 1.00 49.85  ? 29   ILE F C     1 
ATOM   3937  O  O     . ILE F 2  29  ? 1.038   -34.688 60.808 1.00 48.57  ? 29   ILE F O     1 
ATOM   3938  C  CB    . ILE F 2  29  ? 0.503   -34.066 58.144 1.00 48.06  ? 29   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F 2  29  ? 0.444   -34.302 56.637 1.00 50.27  ? 29   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F 2  29  ? -0.236  -32.810 58.478 1.00 52.01  ? 29   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F 2  29  ? 1.387   -33.456 55.850 1.00 52.55  ? 29   ILE F CD1   1 
ATOM   3942  N  N     . THR F 2  30  ? 3.014   -33.592 60.780 1.00 50.00  ? 30   THR F N     1 
ATOM   3943  C  CA    . THR F 2  30  ? 3.296   -33.848 62.191 1.00 50.58  ? 30   THR F CA    1 
ATOM   3944  C  C     . THR F 2  30  ? 2.429   -33.066 63.137 1.00 47.95  ? 30   THR F C     1 
ATOM   3945  O  O     . THR F 2  30  ? 1.886   -32.047 62.772 1.00 48.65  ? 30   THR F O     1 
ATOM   3946  C  CB    . THR F 2  30  ? 4.767   -33.561 62.501 1.00 51.18  ? 30   THR F CB    1 
ATOM   3947  O  OG1   . THR F 2  30  ? 5.078   -32.204 62.149 1.00 58.29  ? 30   THR F OG1   1 
ATOM   3948  C  CG2   . THR F 2  30  ? 5.669   -34.490 61.678 1.00 51.39  ? 30   THR F CG2   1 
ATOM   3949  N  N     . LYS F 2  31  ? 2.330   -33.539 64.374 1.00 50.02  ? 31   LYS F N     1 
ATOM   3950  C  CA    . LYS F 2  31  ? 1.686   -32.772 65.450 1.00 49.64  ? 31   LYS F CA    1 
ATOM   3951  C  C     . LYS F 2  31  ? 2.115   -31.290 65.492 1.00 52.68  ? 31   LYS F C     1 
ATOM   3952  O  O     . LYS F 2  31  ? 1.273   -30.420 65.545 1.00 57.48  ? 31   LYS F O     1 
ATOM   3953  C  CB    . LYS F 2  31  ? 1.957   -33.409 66.790 1.00 52.72  ? 31   LYS F CB    1 
ATOM   3954  C  CG    . LYS F 2  31  ? 1.147   -32.824 67.926 1.00 61.74  ? 31   LYS F CG    1 
ATOM   3955  C  CD    . LYS F 2  31  ? 1.573   -33.403 69.270 1.00 67.91  ? 31   LYS F CD    1 
ATOM   3956  C  CE    . LYS F 2  31  ? 1.139   -32.513 70.430 1.00 74.62  ? 31   LYS F CE    1 
ATOM   3957  N  NZ    . LYS F 2  31  ? 1.623   -33.034 71.747 1.00 81.03  ? 31   LYS F NZ    1 
ATOM   3958  N  N     . PRO F 2  32  ? 3.419   -30.998 65.462 1.00 49.65  ? 32   PRO F N     1 
ATOM   3959  C  CA    . PRO F 2  32  ? 3.804   -29.597 65.481 1.00 50.18  ? 32   PRO F CA    1 
ATOM   3960  C  C     . PRO F 2  32  ? 3.445   -28.814 64.218 1.00 52.88  ? 32   PRO F C     1 
ATOM   3961  O  O     . PRO F 2  32  ? 3.246   -27.601 64.297 1.00 53.74  ? 32   PRO F O     1 
ATOM   3962  C  CB    . PRO F 2  32  ? 5.339   -29.653 65.596 1.00 52.95  ? 32   PRO F CB    1 
ATOM   3963  C  CG    . PRO F 2  32  ? 5.631   -31.036 66.071 1.00 53.07  ? 32   PRO F CG    1 
ATOM   3964  C  CD    . PRO F 2  32  ? 4.594   -31.881 65.431 1.00 47.81  ? 32   PRO F CD    1 
ATOM   3965  N  N     . ALA F 2  33  ? 3.430   -29.450 63.048 1.00 49.16  ? 33   ALA F N     1 
ATOM   3966  C  CA    . ALA F 2  33  ? 3.119   -28.673 61.858 1.00 48.61  ? 33   ALA F CA    1 
ATOM   3967  C  C     . ALA F 2  33  ? 1.612   -28.294 61.883 1.00 52.83  ? 33   ALA F C     1 
ATOM   3968  O  O     . ALA F 2  33  ? 1.225   -27.236 61.401 1.00 58.97  ? 33   ALA F O     1 
ATOM   3969  C  CB    . ALA F 2  33  ? 3.486   -29.426 60.606 1.00 42.24  ? 33   ALA F CB    1 
ATOM   3970  N  N     . ILE F 2  34  ? 0.793   -29.162 62.477 1.00 49.88  ? 34   ILE F N     1 
ATOM   3971  C  CA    . ILE F 2  34  ? -0.640  -28.980 62.562 1.00 49.35  ? 34   ILE F CA    1 
ATOM   3972  C  C     . ILE F 2  34  ? -0.931  -27.930 63.609 1.00 51.09  ? 34   ILE F C     1 
ATOM   3973  O  O     . ILE F 2  34  ? -1.865  -27.166 63.487 1.00 56.71  ? 34   ILE F O     1 
ATOM   3974  C  CB    . ILE F 2  34  ? -1.352  -30.304 62.946 1.00 47.77  ? 34   ILE F CB    1 
ATOM   3975  C  CG1   . ILE F 2  34  ? -1.233  -31.307 61.809 1.00 49.76  ? 34   ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F 2  34  ? -2.832  -30.070 63.223 1.00 49.00  ? 34   ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F 2  34  ? -1.719  -32.691 62.151 1.00 51.65  ? 34   ILE F CD1   1 
ATOM   3978  N  N     . ARG F 2  35  ? -0.130  -27.904 64.652 1.00 52.16  ? 35   ARG F N     1 
ATOM   3979  C  CA    . ARG F 2  35  ? -0.248  -26.882 65.675 1.00 53.48  ? 35   ARG F CA    1 
ATOM   3980  C  C     . ARG F 2  35  ? 0.102   -25.509 65.083 1.00 49.39  ? 35   ARG F C     1 
ATOM   3981  O  O     . ARG F 2  35  ? -0.603  -24.536 65.280 1.00 49.68  ? 35   ARG F O     1 
ATOM   3982  C  CB    . ARG F 2  35  ? 0.651   -27.269 66.815 1.00 54.86  ? 35   ARG F CB    1 
ATOM   3983  C  CG    . ARG F 2  35  ? 0.784   -26.256 67.913 1.00 73.46  ? 35   ARG F CG    1 
ATOM   3984  C  CD    . ARG F 2  35  ? 1.688   -26.845 68.968 1.00 73.38  ? 35   ARG F CD    1 
ATOM   3985  N  NE    . ARG F 2  35  ? 1.075   -28.095 69.358 1.00 65.58  ? 35   ARG F NE    1 
ATOM   3986  C  CZ    . ARG F 2  35  ? 0.466   -28.287 70.515 1.00 83.29  ? 35   ARG F CZ    1 
ATOM   3987  N  NH1   . ARG F 2  35  ? 0.419   -27.345 71.458 1.00 78.04  ? 35   ARG F NH1   1 
ATOM   3988  N  NH2   . ARG F 2  35  ? -0.063  -29.471 70.753 1.00 109.84 ? 35   ARG F NH2   1 
ATOM   3989  N  N     . ARG F 2  36  ? 1.132   -25.433 64.272 1.00 45.36  ? 36   ARG F N     1 
ATOM   3990  C  CA    . ARG F 2  36  ? 1.435   -24.159 63.660 1.00 47.28  ? 36   ARG F CA    1 
ATOM   3991  C  C     . ARG F 2  36  ? 0.237   -23.671 62.828 1.00 46.74  ? 36   ARG F C     1 
ATOM   3992  O  O     . ARG F 2  36  ? -0.119  -22.502 62.905 1.00 49.34  ? 36   ARG F O     1 
ATOM   3993  C  CB    . ARG F 2  36  ? 2.733   -24.204 62.817 1.00 49.85  ? 36   ARG F CB    1 
ATOM   3994  C  CG    . ARG F 2  36  ? 4.015   -24.362 63.629 1.00 48.89  ? 36   ARG F CG    1 
ATOM   3995  C  CD    . ARG F 2  36  ? 5.293   -24.204 62.784 1.00 51.55  ? 36   ARG F CD    1 
ATOM   3996  N  NE    . ARG F 2  36  ? 5.603   -25.278 61.818 1.00 52.08  ? 36   ARG F NE    1 
ATOM   3997  C  CZ    . ARG F 2  36  ? 6.241   -26.434 62.095 1.00 54.92  ? 36   ARG F CZ    1 
ATOM   3998  N  NH1   . ARG F 2  36  ? 6.650   -26.724 63.327 1.00 53.03  ? 36   ARG F NH1   1 
ATOM   3999  N  NH2   . ARG F 2  36  ? 6.466   -27.328 61.122 1.00 52.14  ? 36   ARG F NH2   1 
ATOM   4000  N  N     . LEU F 2  37  ? -0.379  -24.541 62.028 1.00 46.76  ? 37   LEU F N     1 
ATOM   4001  C  CA    . LEU F 2  37  ? -1.520  -24.114 61.162 1.00 46.09  ? 37   LEU F CA    1 
ATOM   4002  C  C     . LEU F 2  37  ? -2.704  -23.622 62.016 1.00 42.86  ? 37   LEU F C     1 
ATOM   4003  O  O     . LEU F 2  37  ? -3.267  -22.583 61.760 1.00 45.32  ? 37   LEU F O     1 
ATOM   4004  C  CB    . LEU F 2  37  ? -1.978  -25.249 60.263 1.00 43.27  ? 37   LEU F CB    1 
ATOM   4005  C  CG    . LEU F 2  37  ? -1.016  -25.712 59.198 1.00 43.09  ? 37   LEU F CG    1 
ATOM   4006  C  CD1   . LEU F 2  37  ? -1.301  -27.146 58.820 1.00 46.27  ? 37   LEU F CD1   1 
ATOM   4007  C  CD2   . LEU F 2  37  ? -1.132  -24.864 57.960 1.00 44.92  ? 37   LEU F CD2   1 
ATOM   4008  N  N     . ALA F 2  38  ? -3.034  -24.361 63.057 1.00 42.30  ? 38   ALA F N     1 
ATOM   4009  C  CA    . ALA F 2  38  ? -3.960  -23.885 64.094 1.00 47.25  ? 38   ALA F CA    1 
ATOM   4010  C  C     . ALA F 2  38  ? -3.656  -22.478 64.582 1.00 43.52  ? 38   ALA F C     1 
ATOM   4011  O  O     . ALA F 2  38  ? -4.554  -21.657 64.762 1.00 40.89  ? 38   ALA F O     1 
ATOM   4012  C  CB    . ALA F 2  38  ? -3.943  -24.836 65.294 1.00 47.95  ? 38   ALA F CB    1 
ATOM   4013  N  N     . ARG F 2  39  ? -2.381  -22.233 64.833 1.00 45.77  ? 39   ARG F N     1 
ATOM   4014  C  CA    . ARG F 2  39  ? -1.923  -20.958 65.366 1.00 46.94  ? 39   ARG F CA    1 
ATOM   4015  C  C     . ARG F 2  39  ? -2.128  -19.838 64.364 1.00 45.53  ? 39   ARG F C     1 
ATOM   4016  O  O     . ARG F 2  39  ? -2.672  -18.772 64.680 1.00 48.44  ? 39   ARG F O     1 
ATOM   4017  C  CB    . ARG F 2  39  ? -0.438  -21.051 65.727 1.00 46.37  ? 39   ARG F CB    1 
ATOM   4018  C  CG    . ARG F 2  39  ? -0.201  -21.951 66.893 1.00 45.01  ? 39   ARG F CG    1 
ATOM   4019  C  CD    . ARG F 2  39  ? -0.680  -21.376 68.214 1.00 47.73  ? 39   ARG F CD    1 
ATOM   4020  N  NE    . ARG F 2  39  ? -0.136  -22.234 69.252 1.00 51.82  ? 39   ARG F NE    1 
ATOM   4021  C  CZ    . ARG F 2  39  ? -0.834  -23.002 70.071 1.00 53.80  ? 39   ARG F CZ    1 
ATOM   4022  N  NH1   . ARG F 2  39  ? -2.154  -22.986 70.090 1.00 57.40  ? 39   ARG F NH1   1 
ATOM   4023  N  NH2   . ARG F 2  39  ? -0.189  -23.769 70.912 1.00 54.90  ? 39   ARG F NH2   1 
ATOM   4024  N  N     . ARG F 2  40  ? -1.703  -20.079 63.141 1.00 42.44  ? 40   ARG F N     1 
ATOM   4025  C  CA    . ARG F 2  40  ? -1.968  -19.108 62.118 1.00 45.21  ? 40   ARG F CA    1 
ATOM   4026  C  C     . ARG F 2  40  ? -3.458  -18.850 62.087 1.00 42.12  ? 40   ARG F C     1 
ATOM   4027  O  O     . ARG F 2  40  ? -3.890  -17.758 61.779 1.00 47.16  ? 40   ARG F O     1 
ATOM   4028  C  CB    . ARG F 2  40  ? -1.478  -19.598 60.766 1.00 44.08  ? 40   ARG F CB    1 
ATOM   4029  C  CG    . ARG F 2  40  ? -1.669  -18.579 59.664 1.00 45.77  ? 40   ARG F CG    1 
ATOM   4030  C  CD    . ARG F 2  40  ? -0.631  -18.784 58.567 1.00 44.65  ? 40   ARG F CD    1 
ATOM   4031  N  NE    . ARG F 2  40  ? 0.698   -18.349 58.951 1.00 42.85  ? 40   ARG F NE    1 
ATOM   4032  C  CZ    . ARG F 2  40  ? 1.787   -18.611 58.243 1.00 48.62  ? 40   ARG F CZ    1 
ATOM   4033  N  NH1   . ARG F 2  40  ? 1.694   -19.332 57.135 1.00 45.97  ? 40   ARG F NH1   1 
ATOM   4034  N  NH2   . ARG F 2  40  ? 2.989   -18.153 58.637 1.00 51.32  ? 40   ARG F NH2   1 
ATOM   4035  N  N     . GLY F 2  41  ? -4.241  -19.869 62.398 1.00 40.72  ? 41   GLY F N     1 
ATOM   4036  C  CA    . GLY F 2  41  ? -5.698  -19.747 62.375 1.00 43.65  ? 41   GLY F CA    1 
ATOM   4037  C  C     . GLY F 2  41  ? -6.291  -19.225 63.663 1.00 44.67  ? 41   GLY F C     1 
ATOM   4038  O  O     . GLY F 2  41  ? -7.518  -19.149 63.799 1.00 44.77  ? 41   GLY F O     1 
ATOM   4039  N  N     . GLY F 2  42  ? -5.424  -18.898 64.619 1.00 43.98  ? 42   GLY F N     1 
ATOM   4040  C  CA    . GLY F 2  42  ? -5.825  -18.184 65.830 1.00 45.82  ? 42   GLY F CA    1 
ATOM   4041  C  C     . GLY F 2  42  ? -6.265  -19.083 66.961 1.00 48.94  ? 42   GLY F C     1 
ATOM   4042  O  O     . GLY F 2  42  ? -7.000  -18.665 67.849 1.00 53.87  ? 42   GLY F O     1 
ATOM   4043  N  N     . VAL F 2  43  ? -5.804  -20.323 66.940 1.00 48.33  ? 43   VAL F N     1 
ATOM   4044  C  CA    . VAL F 2  43  ? -6.245  -21.299 67.897 1.00 45.31  ? 43   VAL F CA    1 
ATOM   4045  C  C     . VAL F 2  43  ? -5.281  -21.291 69.054 1.00 44.65  ? 43   VAL F C     1 
ATOM   4046  O  O     . VAL F 2  43  ? -4.092  -21.310 68.846 1.00 46.58  ? 43   VAL F O     1 
ATOM   4047  C  CB    . VAL F 2  43  ? -6.268  -22.668 67.250 1.00 44.74  ? 43   VAL F CB    1 
ATOM   4048  C  CG1   . VAL F 2  43  ? -6.517  -23.746 68.270 1.00 46.15  ? 43   VAL F CG1   1 
ATOM   4049  C  CG2   . VAL F 2  43  ? -7.345  -22.680 66.198 1.00 48.35  ? 43   VAL F CG2   1 
ATOM   4050  N  N     . LYS F 2  44  ? -5.814  -21.278 70.272 1.00 50.72  ? 44   LYS F N     1 
ATOM   4051  C  CA    . LYS F 2  44  ? -5.017  -21.233 71.498 1.00 51.82  ? 44   LYS F CA    1 
ATOM   4052  C  C     . LYS F 2  44  ? -4.798  -22.587 72.107 1.00 50.89  ? 44   LYS F C     1 
ATOM   4053  O  O     . LYS F 2  44  ? -3.679  -22.883 72.523 1.00 60.07  ? 44   LYS F O     1 
ATOM   4054  C  CB    . LYS F 2  44  ? -5.709  -20.374 72.539 1.00 55.47  ? 44   LYS F CB    1 
ATOM   4055  C  CG    . LYS F 2  44  ? -4.806  -19.953 73.682 1.00 61.17  ? 44   LYS F CG    1 
ATOM   4056  C  CD    . LYS F 2  44  ? -5.470  -18.844 74.485 1.00 61.75  ? 44   LYS F CD    1 
ATOM   4057  C  CE    . LYS F 2  44  ? -4.745  -18.572 75.777 1.00 58.73  ? 44   LYS F CE    1 
ATOM   4058  N  NZ    . LYS F 2  44  ? -5.800  -18.386 76.810 1.00 66.07  ? 44   LYS F NZ    1 
ATOM   4059  N  N     . ARG F 2  45  ? -5.856  -23.400 72.173 1.00 46.76  ? 45   ARG F N     1 
ATOM   4060  C  CA    . ARG F 2  45  ? -5.790  -24.678 72.859 1.00 47.90  ? 45   ARG F CA    1 
ATOM   4061  C  C     . ARG F 2  45  ? -6.302  -25.781 71.938 1.00 46.63  ? 45   ARG F C     1 
ATOM   4062  O  O     . ARG F 2  45  ? -7.298  -25.606 71.282 1.00 47.40  ? 45   ARG F O     1 
ATOM   4063  C  CB    . ARG F 2  45  ? -6.599  -24.590 74.156 1.00 49.21  ? 45   ARG F CB    1 
ATOM   4064  C  CG    . ARG F 2  45  ? -6.180  -25.522 75.270 1.00 49.43  ? 45   ARG F CG    1 
ATOM   4065  C  CD    . ARG F 2  45  ? -6.839  -25.167 76.613 1.00 54.12  ? 45   ARG F CD    1 
ATOM   4066  N  NE    . ARG F 2  45  ? -6.443  -26.139 77.642 1.00 58.88  ? 45   ARG F NE    1 
ATOM   4067  C  CZ    . ARG F 2  45  ? -7.005  -27.341 77.823 1.00 63.57  ? 45   ARG F CZ    1 
ATOM   4068  N  NH1   . ARG F 2  45  ? -8.031  -27.725 77.088 1.00 64.26  ? 45   ARG F NH1   1 
ATOM   4069  N  NH2   . ARG F 2  45  ? -6.554  -28.169 78.767 1.00 72.29  ? 45   ARG F NH2   1 
ATOM   4070  N  N     . ILE F 2  46  ? -5.619  -26.923 71.909 1.00 49.55  ? 46   ILE F N     1 
ATOM   4071  C  CA    . ILE F 2  46  ? -5.885  -27.985 70.934 1.00 49.12  ? 46   ILE F CA    1 
ATOM   4072  C  C     . ILE F 2  46  ? -6.005  -29.370 71.578 1.00 54.61  ? 46   ILE F C     1 
ATOM   4073  O  O     . ILE F 2  46  ? -5.022  -29.932 72.091 1.00 61.19  ? 46   ILE F O     1 
ATOM   4074  C  CB    . ILE F 2  46  ? -4.739  -28.062 69.926 1.00 48.50  ? 46   ILE F CB    1 
ATOM   4075  C  CG1   . ILE F 2  46  ? -4.651  -26.776 69.130 1.00 47.55  ? 46   ILE F CG1   1 
ATOM   4076  C  CG2   . ILE F 2  46  ? -4.911  -29.244 68.988 1.00 47.94  ? 46   ILE F CG2   1 
ATOM   4077  C  CD1   . ILE F 2  46  ? -3.310  -26.605 68.488 1.00 47.08  ? 46   ILE F CD1   1 
ATOM   4078  N  N     . SER F 2  47  ? -7.213  -29.917 71.530 1.00 54.97  ? 47   SER F N     1 
ATOM   4079  C  CA    . SER F 2  47  ? -7.485  -31.264 71.995 1.00 51.65  ? 47   SER F CA    1 
ATOM   4080  C  C     . SER F 2  47  ? -6.605  -32.256 71.273 1.00 51.81  ? 47   SER F C     1 
ATOM   4081  O  O     . SER F 2  47  ? -6.274  -32.071 70.111 1.00 54.92  ? 47   SER F O     1 
ATOM   4082  C  CB    . SER F 2  47  ? -8.950  -31.616 71.733 1.00 52.70  ? 47   SER F CB    1 
ATOM   4083  O  OG    . SER F 2  47  ? -9.029  -32.969 71.334 1.00 58.60  ? 47   SER F OG    1 
ATOM   4084  N  N     . GLY F 2  48  ? -6.239  -33.338 71.941 1.00 55.05  ? 48   GLY F N     1 
ATOM   4085  C  CA    . GLY F 2  48  ? -5.288  -34.311 71.345 1.00 54.96  ? 48   GLY F CA    1 
ATOM   4086  C  C     . GLY F 2  48  ? -5.829  -35.100 70.164 1.00 57.01  ? 48   GLY F C     1 
ATOM   4087  O  O     . GLY F 2  48  ? -5.063  -35.693 69.372 1.00 53.20  ? 48   GLY F O     1 
ATOM   4088  N  N     . LEU F 2  49  ? -7.154  -35.109 70.041 1.00 53.03  ? 49   LEU F N     1 
ATOM   4089  C  CA    . LEU F 2  49  ? -7.797  -35.803 68.944 1.00 53.57  ? 49   LEU F CA    1 
ATOM   4090  C  C     . LEU F 2  49  ? -7.798  -34.987 67.639 1.00 53.49  ? 49   LEU F C     1 
ATOM   4091  O  O     . LEU F 2  49  ? -8.144  -35.516 66.578 1.00 46.35  ? 49   LEU F O     1 
ATOM   4092  C  CB    . LEU F 2  49  ? -9.223  -36.135 69.346 1.00 54.52  ? 49   LEU F CB    1 
ATOM   4093  C  CG    . LEU F 2  49  ? -9.278  -37.245 70.386 1.00 58.14  ? 49   LEU F CG    1 
ATOM   4094  C  CD1   . LEU F 2  49  ? -10.701 -37.311 70.920 1.00 64.09  ? 49   LEU F CD1   1 
ATOM   4095  C  CD2   . LEU F 2  49  ? -8.804  -38.589 69.827 1.00 54.34  ? 49   LEU F CD2   1 
ATOM   4096  N  N     . ILE F 2  50  ? -7.428  -33.704 67.729 1.00 49.43  ? 50   ILE F N     1 
ATOM   4097  C  CA    . ILE F 2  50  ? -7.503  -32.815 66.599 1.00 46.57  ? 50   ILE F CA    1 
ATOM   4098  C  C     . ILE F 2  50  ? -6.572  -33.320 65.515 1.00 46.90  ? 50   ILE F C     1 
ATOM   4099  O  O     . ILE F 2  50  ? -6.932  -33.304 64.329 1.00 49.59  ? 50   ILE F O     1 
ATOM   4100  C  CB    . ILE F 2  50  ? -7.175  -31.359 66.999 1.00 47.37  ? 50   ILE F CB    1 
ATOM   4101  C  CG1   . ILE F 2  50  ? -8.382  -30.675 67.625 1.00 51.40  ? 50   ILE F CG1   1 
ATOM   4102  C  CG2   . ILE F 2  50  ? -6.765  -30.527 65.814 1.00 46.19  ? 50   ILE F CG2   1 
ATOM   4103  C  CD1   . ILE F 2  50  ? -9.472  -30.305 66.633 1.00 53.22  ? 50   ILE F CD1   1 
ATOM   4104  N  N     . TYR F 2  51  ? -5.399  -33.814 65.913 1.00 47.33  ? 51   TYR F N     1 
ATOM   4105  C  CA    . TYR F 2  51  ? -4.363  -34.179 64.924 1.00 45.13  ? 51   TYR F CA    1 
ATOM   4106  C  C     . TYR F 2  51  ? -4.800  -35.281 63.972 1.00 46.66  ? 51   TYR F C     1 
ATOM   4107  O  O     . TYR F 2  51  ? -4.642  -35.098 62.772 1.00 49.60  ? 51   TYR F O     1 
ATOM   4108  C  CB    . TYR F 2  51  ? -3.025  -34.491 65.576 1.00 44.49  ? 51   TYR F CB    1 
ATOM   4109  C  CG    . TYR F 2  51  ? -2.656  -33.449 66.589 1.00 44.29  ? 51   TYR F CG    1 
ATOM   4110  C  CD1   . TYR F 2  51  ? -2.713  -33.719 67.955 1.00 49.22  ? 51   TYR F CD1   1 
ATOM   4111  C  CD2   . TYR F 2  51  ? -2.320  -32.183 66.192 1.00 46.30  ? 51   TYR F CD2   1 
ATOM   4112  C  CE1   . TYR F 2  51  ? -2.415  -32.750 68.898 1.00 50.57  ? 51   TYR F CE1   1 
ATOM   4113  C  CE2   . TYR F 2  51  ? -2.005  -31.204 67.118 1.00 51.79  ? 51   TYR F CE2   1 
ATOM   4114  C  CZ    . TYR F 2  51  ? -2.063  -31.498 68.465 1.00 53.37  ? 51   TYR F CZ    1 
ATOM   4115  O  OH    . TYR F 2  51  ? -1.778  -30.530 69.367 1.00 59.00  ? 51   TYR F OH    1 
ATOM   4116  N  N     . GLU F 2  52  ? -5.376  -36.392 64.451 1.00 47.31  ? 52   GLU F N     1 
ATOM   4117  C  CA    . GLU F 2  52  ? -5.855  -37.403 63.497 1.00 54.32  ? 52   GLU F CA    1 
ATOM   4118  C  C     . GLU F 2  52  ? -7.004  -36.838 62.610 1.00 50.76  ? 52   GLU F C     1 
ATOM   4119  O  O     . GLU F 2  52  ? -7.057  -37.073 61.396 1.00 45.73  ? 52   GLU F O     1 
ATOM   4120  C  CB    . GLU F 2  52  ? -6.275  -38.715 64.182 1.00 57.58  ? 52   GLU F CB    1 
ATOM   4121  C  CG    . GLU F 2  52  ? -5.134  -39.708 64.395 1.00 66.19  ? 52   GLU F CG    1 
ATOM   4122  C  CD    . GLU F 2  52  ? -4.275  -39.961 63.146 1.00 74.72  ? 52   GLU F CD    1 
ATOM   4123  O  OE1   . GLU F 2  52  ? -4.837  -40.255 62.051 1.00 83.12  ? 52   GLU F OE1   1 
ATOM   4124  O  OE2   . GLU F 2  52  ? -3.022  -39.879 63.258 1.00 64.53  ? 52   GLU F OE2   1 
ATOM   4125  N  N     . GLU F 2  53  ? -7.885  -36.058 63.211 1.00 43.01  ? 53   GLU F N     1 
ATOM   4126  C  CA    . GLU F 2  53  ? -8.994  -35.503 62.470 1.00 46.13  ? 53   GLU F CA    1 
ATOM   4127  C  C     . GLU F 2  53  ? -8.480  -34.600 61.375 1.00 45.05  ? 53   GLU F C     1 
ATOM   4128  O  O     . GLU F 2  53  ? -8.933  -34.694 60.236 1.00 43.05  ? 53   GLU F O     1 
ATOM   4129  C  CB    . GLU F 2  53  ? -9.921  -34.706 63.375 1.00 48.66  ? 53   GLU F CB    1 
ATOM   4130  C  CG    . GLU F 2  53  ? -11.251 -34.412 62.719 1.00 52.95  ? 53   GLU F CG    1 
ATOM   4131  C  CD    . GLU F 2  53  ? -12.315 -35.472 62.924 1.00 56.24  ? 53   GLU F CD    1 
ATOM   4132  O  OE1   . GLU F 2  53  ? -12.032 -36.531 63.519 1.00 57.09  ? 53   GLU F OE1   1 
ATOM   4133  O  OE2   . GLU F 2  53  ? -13.460 -35.228 62.464 1.00 63.03  ? 53   GLU F OE2   1 
ATOM   4134  N  N     . THR F 2  54  ? -7.532  -33.730 61.713 1.00 42.22  ? 54   THR F N     1 
ATOM   4135  C  CA    . THR F 2  54  ? -6.941  -32.872 60.708 1.00 42.22  ? 54   THR F CA    1 
ATOM   4136  C  C     . THR F 2  54  ? -6.254  -33.656 59.573 1.00 43.02  ? 54   THR F C     1 
ATOM   4137  O  O     . THR F 2  54  ? -6.379  -33.304 58.388 1.00 42.71  ? 54   THR F O     1 
ATOM   4138  C  CB    . THR F 2  54  ? -5.950  -31.861 61.293 1.00 44.03  ? 54   THR F CB    1 
ATOM   4139  O  OG1   . THR F 2  54  ? -6.581  -31.068 62.332 1.00 37.30  ? 54   THR F OG1   1 
ATOM   4140  C  CG2   . THR F 2  54  ? -5.469  -30.951 60.140 1.00 43.07  ? 54   THR F CG2   1 
ATOM   4141  N  N     . ARG F 2  55  ? -5.562  -34.732 59.904 1.00 43.84  ? 55   ARG F N     1 
ATOM   4142  C  CA    . ARG F 2  55  ? -4.932  -35.532 58.854 1.00 45.04  ? 55   ARG F CA    1 
ATOM   4143  C  C     . ARG F 2  55  ? -5.991  -36.055 57.893 1.00 44.73  ? 55   ARG F C     1 
ATOM   4144  O  O     . ARG F 2  55  ? -5.815  -36.021 56.680 1.00 43.36  ? 55   ARG F O     1 
ATOM   4145  C  CB    . ARG F 2  55  ? -4.124  -36.667 59.475 1.00 49.18  ? 55   ARG F CB    1 
ATOM   4146  C  CG    . ARG F 2  55  ? -2.866  -36.164 60.149 1.00 50.77  ? 55   ARG F CG    1 
ATOM   4147  C  CD    . ARG F 2  55  ? -1.836  -37.240 60.490 1.00 53.76  ? 55   ARG F CD    1 
ATOM   4148  N  NE    . ARG F 2  55  ? -0.814  -36.679 61.390 1.00 48.02  ? 55   ARG F NE    1 
ATOM   4149  C  CZ    . ARG F 2  55  ? -0.873  -36.727 62.709 1.00 46.95  ? 55   ARG F CZ    1 
ATOM   4150  N  NH1   . ARG F 2  55  ? -1.860  -37.344 63.327 1.00 51.09  ? 55   ARG F NH1   1 
ATOM   4151  N  NH2   . ARG F 2  55  ? 0.057   -36.140 63.423 1.00 53.08  ? 55   ARG F NH2   1 
ATOM   4152  N  N     . GLY F 2  56  ? -7.116  -36.499 58.445 1.00 43.75  ? 56   GLY F N     1 
ATOM   4153  C  CA    . GLY F 2  56  ? -8.189  -37.057 57.644 1.00 43.22  ? 56   GLY F CA    1 
ATOM   4154  C  C     . GLY F 2  56  ? -8.737  -36.024 56.693 1.00 45.71  ? 56   GLY F C     1 
ATOM   4155  O  O     . GLY F 2  56  ? -8.789  -36.264 55.475 1.00 49.37  ? 56   GLY F O     1 
ATOM   4156  N  N     . VAL F 2  57  ? -9.111  -34.870 57.254 1.00 40.89  ? 57   VAL F N     1 
ATOM   4157  C  CA    . VAL F 2  57  ? -9.619  -33.750 56.477 1.00 40.32  ? 57   VAL F CA    1 
ATOM   4158  C  C     . VAL F 2  57  ? -8.635  -33.343 55.400 1.00 40.96  ? 57   VAL F C     1 
ATOM   4159  O  O     . VAL F 2  57  ? -9.052  -33.063 54.288 1.00 40.11  ? 57   VAL F O     1 
ATOM   4160  C  CB    . VAL F 2  57  ? -9.915  -32.539 57.364 1.00 44.39  ? 57   VAL F CB    1 
ATOM   4161  C  CG1   . VAL F 2  57  ? -10.148 -31.313 56.525 1.00 49.37  ? 57   VAL F CG1   1 
ATOM   4162  C  CG2   . VAL F 2  57  ? -11.153 -32.786 58.225 1.00 47.14  ? 57   VAL F CG2   1 
ATOM   4163  N  N     . LEU F 2  58  ? -7.332  -33.303 55.708 1.00 40.71  ? 58   LEU F N     1 
ATOM   4164  C  CA    . LEU F 2  58  ? -6.348  -32.968 54.675 1.00 40.76  ? 58   LEU F CA    1 
ATOM   4165  C  C     . LEU F 2  58  ? -6.315  -34.019 53.568 1.00 43.14  ? 58   LEU F C     1 
ATOM   4166  O  O     . LEU F 2  58  ? -6.215  -33.682 52.382 1.00 43.09  ? 58   LEU F O     1 
ATOM   4167  C  CB    . LEU F 2  58  ? -4.949  -32.756 55.265 1.00 43.25  ? 58   LEU F CB    1 
ATOM   4168  C  CG    . LEU F 2  58  ? -3.760  -32.556 54.294 1.00 44.01  ? 58   LEU F CG    1 
ATOM   4169  C  CD1   . LEU F 2  58  ? -3.999  -31.402 53.346 1.00 47.33  ? 58   LEU F CD1   1 
ATOM   4170  C  CD2   . LEU F 2  58  ? -2.469  -32.311 55.044 1.00 43.78  ? 58   LEU F CD2   1 
ATOM   4171  N  N     . LYS F 2  59  ? -6.428  -35.293 53.948 1.00 46.66  ? 59   LYS F N     1 
ATOM   4172  C  CA    . LYS F 2  59  ? -6.369  -36.371 52.977 1.00 47.61  ? 59   LYS F CA    1 
ATOM   4173  C  C     . LYS F 2  59  ? -7.507  -36.262 51.978 1.00 48.81  ? 59   LYS F C     1 
ATOM   4174  O  O     . LYS F 2  59  ? -7.296  -36.419 50.781 1.00 48.44  ? 59   LYS F O     1 
ATOM   4175  C  CB    . LYS F 2  59  ? -6.384  -37.707 53.695 1.00 55.24  ? 59   LYS F CB    1 
ATOM   4176  C  CG    . LYS F 2  59  ? -6.219  -38.896 52.767 1.00 64.91  ? 59   LYS F CG    1 
ATOM   4177  C  CD    . LYS F 2  59  ? -5.822  -40.167 53.518 1.00 71.47  ? 59   LYS F CD    1 
ATOM   4178  C  CE    . LYS F 2  59  ? -6.324  -41.446 52.819 1.00 78.21  ? 59   LYS F CE    1 
ATOM   4179  N  NZ    . LYS F 2  59  ? -7.797  -41.696 52.969 1.00 71.18  ? 59   LYS F NZ    1 
ATOM   4180  N  N     . VAL F 2  60  ? -8.703  -35.949 52.475 1.00 44.60  ? 60   VAL F N     1 
ATOM   4181  C  CA    . VAL F 2  60  ? -9.862  -35.732 51.631 1.00 43.09  ? 60   VAL F CA    1 
ATOM   4182  C  C     . VAL F 2  60  ? -9.665  -34.526 50.722 1.00 44.19  ? 60   VAL F C     1 
ATOM   4183  O  O     . VAL F 2  60  ? -10.044 -34.552 49.560 1.00 51.07  ? 60   VAL F O     1 
ATOM   4184  C  CB    . VAL F 2  60  ? -11.130 -35.504 52.499 1.00 46.56  ? 60   VAL F CB    1 
ATOM   4185  C  CG1   . VAL F 2  60  ? -12.249 -34.892 51.698 1.00 46.34  ? 60   VAL F CG1   1 
ATOM   4186  C  CG2   . VAL F 2  60  ? -11.622 -36.809 53.096 1.00 52.09  ? 60   VAL F CG2   1 
ATOM   4187  N  N     . PHE F 2  61  ? -9.120  -33.441 51.249 1.00 41.00  ? 61   PHE F N     1 
ATOM   4188  C  CA    . PHE F 2  61  ? -8.976  -32.266 50.444 1.00 38.84  ? 61   PHE F CA    1 
ATOM   4189  C  C     . PHE F 2  61  ? -8.063  -32.584 49.273 1.00 43.56  ? 61   PHE F C     1 
ATOM   4190  O  O     . PHE F 2  61  ? -8.443  -32.355 48.106 1.00 48.88  ? 61   PHE F O     1 
ATOM   4191  C  CB    . PHE F 2  61  ? -8.410  -31.148 51.270 1.00 41.03  ? 61   PHE F CB    1 
ATOM   4192  C  CG    . PHE F 2  61  ? -8.066  -29.912 50.481 1.00 44.62  ? 61   PHE F CG    1 
ATOM   4193  C  CD1   . PHE F 2  61  ? -8.985  -28.897 50.310 1.00 41.51  ? 61   PHE F CD1   1 
ATOM   4194  C  CD2   . PHE F 2  61  ? -6.781  -29.742 49.959 1.00 41.89  ? 61   PHE F CD2   1 
ATOM   4195  C  CE1   . PHE F 2  61  ? -8.636  -27.753 49.596 1.00 44.45  ? 61   PHE F CE1   1 
ATOM   4196  C  CE2   . PHE F 2  61  ? -6.438  -28.604 49.264 1.00 40.99  ? 61   PHE F CE2   1 
ATOM   4197  C  CZ    . PHE F 2  61  ? -7.369  -27.612 49.066 1.00 43.13  ? 61   PHE F CZ    1 
ATOM   4198  N  N     . LEU F 2  62  ? -6.886  -33.149 49.564 1.00 41.84  ? 62   LEU F N     1 
ATOM   4199  C  CA    . LEU F 2  62  ? -5.942  -33.552 48.502 1.00 43.00  ? 62   LEU F CA    1 
ATOM   4200  C  C     . LEU F 2  62  ? -6.451  -34.561 47.466 1.00 46.39  ? 62   LEU F C     1 
ATOM   4201  O  O     . LEU F 2  62  ? -6.204  -34.396 46.260 1.00 43.21  ? 62   LEU F O     1 
ATOM   4202  C  CB    . LEU F 2  62  ? -4.657  -34.098 49.104 1.00 45.74  ? 62   LEU F CB    1 
ATOM   4203  C  CG    . LEU F 2  62  ? -3.713  -33.020 49.633 1.00 45.68  ? 62   LEU F CG    1 
ATOM   4204  C  CD1   . LEU F 2  62  ? -2.522  -33.667 50.331 1.00 46.83  ? 62   LEU F CD1   1 
ATOM   4205  C  CD2   . LEU F 2  62  ? -3.250  -32.103 48.502 1.00 44.45  ? 62   LEU F CD2   1 
ATOM   4206  N  N     . GLU F 2  63  ? -7.131  -35.618 47.922 1.00 49.03  ? 63   GLU F N     1 
ATOM   4207  C  CA    . GLU F 2  63  ? -7.734  -36.564 46.992 1.00 48.45  ? 63   GLU F CA    1 
ATOM   4208  C  C     . GLU F 2  63  ? -8.588  -35.815 45.972 1.00 48.08  ? 63   GLU F C     1 
ATOM   4209  O  O     . GLU F 2  63  ? -8.531  -36.095 44.770 1.00 46.58  ? 63   GLU F O     1 
ATOM   4210  C  CB    . GLU F 2  63  ? -8.600  -37.577 47.726 1.00 54.11  ? 63   GLU F CB    1 
ATOM   4211  C  CG    . GLU F 2  63  ? -7.845  -38.776 48.291 1.00 61.98  ? 63   GLU F CG    1 
ATOM   4212  C  CD    . GLU F 2  63  ? -8.550  -39.447 49.484 1.00 66.77  ? 63   GLU F CD    1 
ATOM   4213  O  OE1   . GLU F 2  63  ? -9.731  -39.094 49.765 1.00 61.93  ? 63   GLU F OE1   1 
ATOM   4214  O  OE2   . GLU F 2  63  ? -7.900  -40.316 50.147 1.00 64.04  ? 63   GLU F OE2   1 
ATOM   4215  N  N     . ASN F 2  64  ? -9.393  -34.867 46.449 1.00 46.28  ? 64   ASN F N     1 
ATOM   4216  C  CA    . ASN F 2  64  ? -10.340 -34.223 45.563 1.00 48.42  ? 64   ASN F CA    1 
ATOM   4217  C  C     . ASN F 2  64  ? -9.626  -33.394 44.543 1.00 48.32  ? 64   ASN F C     1 
ATOM   4218  O  O     . ASN F 2  64  ? -10.003 -33.390 43.369 1.00 46.73  ? 64   ASN F O     1 
ATOM   4219  C  CB    . ASN F 2  64  ? -11.407 -33.416 46.317 1.00 51.08  ? 64   ASN F CB    1 
ATOM   4220  C  CG    . ASN F 2  64  ? -12.438 -34.316 47.018 1.00 54.61  ? 64   ASN F CG    1 
ATOM   4221  O  OD1   . ASN F 2  64  ? -12.535 -35.492 46.729 1.00 61.32  ? 64   ASN F OD1   1 
ATOM   4222  N  ND2   . ASN F 2  64  ? -13.191 -33.760 47.951 1.00 62.68  ? 64   ASN F ND2   1 
ATOM   4223  N  N     . VAL F 2  65  ? -8.580  -32.705 44.975 1.00 48.57  ? 65   VAL F N     1 
ATOM   4224  C  CA    . VAL F 2  65  ? -7.957  -31.753 44.098 1.00 46.83  ? 65   VAL F CA    1 
ATOM   4225  C  C     . VAL F 2  65  ? -7.018  -32.491 43.186 1.00 44.76  ? 65   VAL F C     1 
ATOM   4226  O  O     . VAL F 2  65  ? -6.891  -32.135 42.040 1.00 47.83  ? 65   VAL F O     1 
ATOM   4227  C  CB    . VAL F 2  65  ? -7.197  -30.658 44.865 1.00 51.21  ? 65   VAL F CB    1 
ATOM   4228  C  CG1   . VAL F 2  65  ? -6.469  -29.745 43.891 1.00 54.64  ? 65   VAL F CG1   1 
ATOM   4229  C  CG2   . VAL F 2  65  ? -8.144  -29.817 45.689 1.00 48.78  ? 65   VAL F CG2   1 
ATOM   4230  N  N     . ILE F 2  66  ? -6.347  -33.513 43.688 1.00 47.62  ? 66   ILE F N     1 
ATOM   4231  C  CA    . ILE F 2  66  ? -5.437  -34.278 42.848 1.00 46.27  ? 66   ILE F CA    1 
ATOM   4232  C  C     . ILE F 2  66  ? -6.201  -35.066 41.786 1.00 45.89  ? 66   ILE F C     1 
ATOM   4233  O  O     . ILE F 2  66  ? -5.772  -35.109 40.647 1.00 47.47  ? 66   ILE F O     1 
ATOM   4234  C  CB    . ILE F 2  66  ? -4.553  -35.207 43.678 1.00 47.29  ? 66   ILE F CB    1 
ATOM   4235  C  CG1   . ILE F 2  66  ? -3.472  -34.380 44.356 1.00 46.44  ? 66   ILE F CG1   1 
ATOM   4236  C  CG2   . ILE F 2  66  ? -3.917  -36.270 42.790 1.00 49.78  ? 66   ILE F CG2   1 
ATOM   4237  C  CD1   . ILE F 2  66  ? -2.918  -34.977 45.615 1.00 48.69  ? 66   ILE F CD1   1 
ATOM   4238  N  N     . ARG F 2  67  ? -7.333  -35.662 42.141 1.00 44.47  ? 67   ARG F N     1 
ATOM   4239  C  CA    . ARG F 2  67  ? -8.135  -36.394 41.170 1.00 47.91  ? 67   ARG F CA    1 
ATOM   4240  C  C     . ARG F 2  67  ? -8.397  -35.494 39.967 1.00 48.10  ? 67   ARG F C     1 
ATOM   4241  O  O     . ARG F 2  67  ? -8.114  -35.846 38.826 1.00 45.36  ? 67   ARG F O     1 
ATOM   4242  C  CB    . ARG F 2  67  ? -9.459  -36.855 41.804 1.00 55.04  ? 67   ARG F CB    1 
ATOM   4243  C  CG    . ARG F 2  67  ? -10.362 -37.710 40.908 1.00 59.14  ? 67   ARG F CG    1 
ATOM   4244  C  CD    . ARG F 2  67  ? -11.741 -37.973 41.542 1.00 70.26  ? 67   ARG F CD    1 
ATOM   4245  N  NE    . ARG F 2  67  ? -11.626 -38.742 42.796 1.00 82.75  ? 67   ARG F NE    1 
ATOM   4246  C  CZ    . ARG F 2  67  ? -11.942 -38.313 44.031 1.00 85.99  ? 67   ARG F CZ    1 
ATOM   4247  N  NH1   . ARG F 2  67  ? -12.461 -37.093 44.252 1.00 80.88  ? 67   ARG F NH1   1 
ATOM   4248  N  NH2   . ARG F 2  67  ? -11.747 -39.139 45.063 1.00 79.85  ? 67   ARG F NH2   1 
ATOM   4249  N  N     . ASP F 2  68  ? -8.905  -34.297 40.230 1.00 51.17  ? 68   ASP F N     1 
ATOM   4250  C  CA    . ASP F 2  68  ? -9.239  -33.379 39.147 1.00 49.68  ? 68   ASP F CA    1 
ATOM   4251  C  C     . ASP F 2  68  ? -7.977  -32.978 38.414 1.00 48.34  ? 68   ASP F C     1 
ATOM   4252  O  O     . ASP F 2  68  ? -7.956  -32.880 37.178 1.00 46.94  ? 68   ASP F O     1 
ATOM   4253  C  CB    . ASP F 2  68  ? -9.944  -32.137 39.678 1.00 51.73  ? 68   ASP F CB    1 
ATOM   4254  C  CG    . ASP F 2  68  ? -11.406 -32.386 40.051 1.00 52.69  ? 68   ASP F CG    1 
ATOM   4255  O  OD1   . ASP F 2  68  ? -11.928 -33.530 39.938 1.00 54.46  ? 68   ASP F OD1   1 
ATOM   4256  O  OD2   . ASP F 2  68  ? -12.023 -31.393 40.473 1.00 53.92  ? 68   ASP F OD2   1 
ATOM   4257  N  N     . ALA F 2  69  ? -6.908  -32.763 39.166 1.00 44.24  ? 69   ALA F N     1 
ATOM   4258  C  CA    . ALA F 2  69  ? -5.695  -32.291 38.539 1.00 44.34  ? 69   ALA F CA    1 
ATOM   4259  C  C     . ALA F 2  69  ? -5.182  -33.350 37.613 1.00 45.46  ? 69   ALA F C     1 
ATOM   4260  O  O     . ALA F 2  69  ? -4.883  -33.060 36.474 1.00 43.43  ? 69   ALA F O     1 
ATOM   4261  C  CB    . ALA F 2  69  ? -4.652  -31.917 39.570 1.00 49.30  ? 69   ALA F CB    1 
ATOM   4262  N  N     . VAL F 2  70  ? -5.125  -34.592 38.098 1.00 47.63  ? 70   VAL F N     1 
ATOM   4263  C  CA    . VAL F 2  70  ? -4.675  -35.727 37.284 1.00 43.03  ? 70   VAL F CA    1 
ATOM   4264  C  C     . VAL F 2  70  ? -5.614  -36.014 36.109 1.00 44.18  ? 70   VAL F C     1 
ATOM   4265  O  O     . VAL F 2  70  ? -5.167  -36.372 35.024 1.00 45.33  ? 70   VAL F O     1 
ATOM   4266  C  CB    . VAL F 2  70  ? -4.565  -36.989 38.106 1.00 40.40  ? 70   VAL F CB    1 
ATOM   4267  C  CG1   . VAL F 2  70  ? -4.334  -38.157 37.179 1.00 41.88  ? 70   VAL F CG1   1 
ATOM   4268  C  CG2   . VAL F 2  70  ? -3.421  -36.860 39.104 1.00 42.76  ? 70   VAL F CG2   1 
ATOM   4269  N  N     . THR F 2  71  ? -6.907  -35.825 36.297 1.00 39.54  ? 71   THR F N     1 
ATOM   4270  C  CA    . THR F 2  71  ? -7.803  -35.945 35.171 1.00 42.13  ? 71   THR F CA    1 
ATOM   4271  C  C     . THR F 2  71  ? -7.408  -34.998 34.037 1.00 48.82  ? 71   THR F C     1 
ATOM   4272  O  O     . THR F 2  71  ? -7.426  -35.397 32.880 1.00 53.00  ? 71   THR F O     1 
ATOM   4273  C  CB    . THR F 2  71  ? -9.240  -35.669 35.597 1.00 40.69  ? 71   THR F CB    1 
ATOM   4274  O  OG1   . THR F 2  71  ? -9.588  -36.563 36.656 1.00 41.00  ? 71   THR F OG1   1 
ATOM   4275  C  CG2   . THR F 2  71  ? -10.177 -35.835 34.456 1.00 38.12  ? 71   THR F CG2   1 
ATOM   4276  N  N     . TYR F 2  72  ? -7.088  -33.742 34.366 1.00 54.22  ? 72   TYR F N     1 
ATOM   4277  C  CA    . TYR F 2  72  ? -6.612  -32.775 33.360 1.00 55.42  ? 72   TYR F CA    1 
ATOM   4278  C  C     . TYR F 2  72  ? -5.289  -33.270 32.722 1.00 56.96  ? 72   TYR F C     1 
ATOM   4279  O  O     . TYR F 2  72  ? -5.107  -33.266 31.513 1.00 52.67  ? 72   TYR F O     1 
ATOM   4280  C  CB    . TYR F 2  72  ? -6.402  -31.375 33.977 1.00 53.73  ? 72   TYR F CB    1 
ATOM   4281  C  CG    . TYR F 2  72  ? -7.670  -30.572 34.232 1.00 52.30  ? 72   TYR F CG    1 
ATOM   4282  C  CD1   . TYR F 2  72  ? -8.022  -30.133 35.522 1.00 55.61  ? 72   TYR F CD1   1 
ATOM   4283  C  CD2   . TYR F 2  72  ? -8.495  -30.234 33.196 1.00 49.71  ? 72   TYR F CD2   1 
ATOM   4284  C  CE1   . TYR F 2  72  ? -9.175  -29.391 35.738 1.00 55.35  ? 72   TYR F CE1   1 
ATOM   4285  C  CE2   . TYR F 2  72  ? -9.642  -29.500 33.405 1.00 54.84  ? 72   TYR F CE2   1 
ATOM   4286  C  CZ    . TYR F 2  72  ? -9.988  -29.086 34.664 1.00 54.25  ? 72   TYR F CZ    1 
ATOM   4287  O  OH    . TYR F 2  72  ? -11.144 -28.355 34.790 1.00 52.00  ? 72   TYR F OH    1 
ATOM   4288  N  N     . THR F 2  73  ? -4.359  -33.707 33.549 1.00 59.95  ? 73   THR F N     1 
ATOM   4289  C  CA    . THR F 2  73  ? -3.137  -34.273 33.035 1.00 60.63  ? 73   THR F CA    1 
ATOM   4290  C  C     . THR F 2  73  ? -3.414  -35.360 31.987 1.00 63.69  ? 73   THR F C     1 
ATOM   4291  O  O     . THR F 2  73  ? -2.831  -35.340 30.908 1.00 59.45  ? 73   THR F O     1 
ATOM   4292  C  CB    . THR F 2  73  ? -2.346  -34.885 34.172 1.00 57.75  ? 73   THR F CB    1 
ATOM   4293  O  OG1   . THR F 2  73  ? -2.145  -33.888 35.173 1.00 56.86  ? 73   THR F OG1   1 
ATOM   4294  C  CG2   . THR F 2  73  ? -1.022  -35.359 33.669 1.00 63.21  ? 73   THR F CG2   1 
ATOM   4295  N  N     . GLU F 2  74  ? -4.302  -36.303 32.310 1.00 61.17  ? 74   GLU F N     1 
ATOM   4296  C  CA    . GLU F 2  74  ? -4.566  -37.417 31.415 1.00 60.99  ? 74   GLU F CA    1 
ATOM   4297  C  C     . GLU F 2  74  ? -5.277  -36.929 30.177 1.00 64.14  ? 74   GLU F C     1 
ATOM   4298  O  O     . GLU F 2  74  ? -5.007  -37.406 29.077 1.00 64.50  ? 74   GLU F O     1 
ATOM   4299  C  CB    . GLU F 2  74  ? -5.416  -38.495 32.065 1.00 67.52  ? 74   GLU F CB    1 
ATOM   4300  C  CG    . GLU F 2  74  ? -4.773  -39.223 33.242 1.00 78.41  ? 74   GLU F CG    1 
ATOM   4301  C  CD    . GLU F 2  74  ? -5.592  -40.441 33.685 1.00 86.11  ? 74   GLU F CD    1 
ATOM   4302  O  OE1   . GLU F 2  74  ? -5.887  -41.285 32.808 1.00 99.82  ? 74   GLU F OE1   1 
ATOM   4303  O  OE2   . GLU F 2  74  ? -5.938  -40.573 34.887 1.00 76.31  ? 74   GLU F OE2   1 
ATOM   4304  N  N     . HIS F 2  75  ? -6.182  -35.963 30.326 1.00 67.51  ? 75   HIS F N     1 
ATOM   4305  C  CA    . HIS F 2  75  ? -6.909  -35.487 29.158 1.00 60.21  ? 75   HIS F CA    1 
ATOM   4306  C  C     . HIS F 2  75  ? -5.978  -34.852 28.151 1.00 62.18  ? 75   HIS F C     1 
ATOM   4307  O  O     . HIS F 2  75  ? -6.226  -34.911 26.950 1.00 61.75  ? 75   HIS F O     1 
ATOM   4308  C  CB    . HIS F 2  75  ? -7.957  -34.483 29.506 1.00 59.71  ? 75   HIS F CB    1 
ATOM   4309  C  CG    . HIS F 2  75  ? -8.718  -34.028 28.314 1.00 61.43  ? 75   HIS F CG    1 
ATOM   4310  N  ND1   . HIS F 2  75  ? -9.920  -34.594 27.947 1.00 59.59  ? 75   HIS F ND1   1 
ATOM   4311  C  CD2   . HIS F 2  75  ? -8.422  -33.108 27.369 1.00 62.90  ? 75   HIS F CD2   1 
ATOM   4312  C  CE1   . HIS F 2  75  ? -10.348 -34.018 26.838 1.00 69.39  ? 75   HIS F CE1   1 
ATOM   4313  N  NE2   . HIS F 2  75  ? -9.457  -33.115 26.463 1.00 71.05  ? 75   HIS F NE2   1 
ATOM   4314  N  N     . ALA F 2  76  ? -4.910  -34.241 28.656 1.00 60.45  ? 76   ALA F N     1 
ATOM   4315  C  CA    . ALA F 2  76  ? -3.875  -33.679 27.821 1.00 57.67  ? 76   ALA F CA    1 
ATOM   4316  C  C     . ALA F 2  76  ? -2.925  -34.733 27.257 1.00 62.81  ? 76   ALA F C     1 
ATOM   4317  O  O     . ALA F 2  76  ? -2.057  -34.368 26.494 1.00 66.09  ? 76   ALA F O     1 
ATOM   4318  C  CB    . ALA F 2  76  ? -3.081  -32.665 28.607 1.00 57.06  ? 76   ALA F CB    1 
ATOM   4319  N  N     . LYS F 2  77  ? -3.078  -36.009 27.634 1.00 63.08  ? 77   LYS F N     1 
ATOM   4320  C  CA    . LYS F 2  77  ? -2.130  -37.096 27.272 1.00 68.92  ? 77   LYS F CA    1 
ATOM   4321  C  C     . LYS F 2  77  ? -0.697  -36.870 27.780 1.00 66.71  ? 77   LYS F C     1 
ATOM   4322  O  O     . LYS F 2  77  ? 0.268   -37.184 27.084 1.00 71.18  ? 77   LYS F O     1 
ATOM   4323  C  CB    . LYS F 2  77  ? -2.118  -37.374 25.749 1.00 72.53  ? 77   LYS F CB    1 
ATOM   4324  C  CG    . LYS F 2  77  ? -3.437  -37.885 25.170 1.00 78.27  ? 77   LYS F CG    1 
ATOM   4325  C  CD    . LYS F 2  77  ? -3.600  -37.479 23.710 1.00 88.13  ? 77   LYS F CD    1 
ATOM   4326  C  CE    . LYS F 2  77  ? -4.868  -38.070 23.093 1.00 96.92  ? 77   LYS F CE    1 
ATOM   4327  N  NZ    . LYS F 2  77  ? -4.901  -37.925 21.603 1.00 99.00  ? 77   LYS F NZ    1 
ATOM   4328  N  N     . ARG F 2  78  ? -0.565  -36.352 28.998 1.00 62.30  ? 78   ARG F N     1 
ATOM   4329  C  CA    . ARG F 2  78  ? 0.744   -36.172 29.627 1.00 59.67  ? 78   ARG F CA    1 
ATOM   4330  C  C     . ARG F 2  78  ? 0.955   -37.124 30.793 1.00 60.30  ? 78   ARG F C     1 
ATOM   4331  O  O     . ARG F 2  78  ? 0.006   -37.710 31.309 1.00 57.51  ? 78   ARG F O     1 
ATOM   4332  C  CB    . ARG F 2  78  ? 0.896   -34.745 30.127 1.00 59.74  ? 78   ARG F CB    1 
ATOM   4333  C  CG    . ARG F 2  78  ? 1.200   -33.760 29.038 1.00 61.94  ? 78   ARG F CG    1 
ATOM   4334  C  CD    . ARG F 2  78  ? 1.394   -32.363 29.603 1.00 65.37  ? 78   ARG F CD    1 
ATOM   4335  N  NE    . ARG F 2  78  ? 0.115   -31.650 29.797 1.00 67.14  ? 78   ARG F NE    1 
ATOM   4336  C  CZ    . ARG F 2  78  ? -0.497  -31.437 30.971 1.00 61.30  ? 78   ARG F CZ    1 
ATOM   4337  N  NH1   . ARG F 2  78  ? 0.002   -31.876 32.128 1.00 61.97  ? 78   ARG F NH1   1 
ATOM   4338  N  NH2   . ARG F 2  78  ? -1.620  -30.755 30.984 1.00 53.25  ? 78   ARG F NH2   1 
ATOM   4339  N  N     . LYS F 2  79  ? 2.214   -37.266 31.200 1.00 63.31  ? 79   LYS F N     1 
ATOM   4340  C  CA    . LYS F 2  79  ? 2.588   -38.070 32.365 1.00 66.75  ? 79   LYS F CA    1 
ATOM   4341  C  C     . LYS F 2  79  ? 3.000   -37.194 33.525 1.00 64.46  ? 79   LYS F C     1 
ATOM   4342  O  O     . LYS F 2  79  ? 3.305   -37.686 34.617 1.00 61.53  ? 79   LYS F O     1 
ATOM   4343  C  CB    . LYS F 2  79  ? 3.745   -39.002 32.020 1.00 73.26  ? 79   LYS F CB    1 
ATOM   4344  C  CG    . LYS F 2  79  ? 3.485   -39.868 30.789 1.00 89.67  ? 79   LYS F CG    1 
ATOM   4345  C  CD    . LYS F 2  79  ? 4.094   -41.253 30.957 1.00 105.44 ? 79   LYS F CD    1 
ATOM   4346  C  CE    . LYS F 2  79  ? 4.451   -41.899 29.630 1.00 112.24 ? 79   LYS F CE    1 
ATOM   4347  N  NZ    . LYS F 2  79  ? 5.534   -42.898 29.850 1.00 120.29 ? 79   LYS F NZ    1 
ATOM   4348  N  N     . THR F 2  80  ? 3.015   -35.890 33.280 1.00 63.46  ? 80   THR F N     1 
ATOM   4349  C  CA    . THR F 2  80  ? 3.468   -34.938 34.257 1.00 62.20  ? 80   THR F CA    1 
ATOM   4350  C  C     . THR F 2  80  ? 2.317   -34.037 34.649 1.00 60.20  ? 80   THR F C     1 
ATOM   4351  O  O     . THR F 2  80  ? 1.634   -33.462 33.800 1.00 58.75  ? 80   THR F O     1 
ATOM   4352  C  CB    . THR F 2  80  ? 4.582   -34.084 33.675 1.00 64.51  ? 80   THR F CB    1 
ATOM   4353  O  OG1   . THR F 2  80  ? 5.537   -34.938 33.047 1.00 68.76  ? 80   THR F OG1   1 
ATOM   4354  C  CG2   . THR F 2  80  ? 5.256   -33.277 34.774 1.00 69.87  ? 80   THR F CG2   1 
ATOM   4355  N  N     . VAL F 2  81  ? 2.137   -33.891 35.951 1.00 59.41  ? 81   VAL F N     1 
ATOM   4356  C  CA    . VAL F 2  81  ? 1.124   -33.000 36.501 1.00 57.07  ? 81   VAL F CA    1 
ATOM   4357  C  C     . VAL F 2  81  ? 1.698   -31.594 36.540 1.00 51.72  ? 81   VAL F C     1 
ATOM   4358  O  O     . VAL F 2  81  ? 2.676   -31.355 37.223 1.00 48.52  ? 81   VAL F O     1 
ATOM   4359  C  CB    . VAL F 2  81  ? 0.739   -33.427 37.919 1.00 55.67  ? 81   VAL F CB    1 
ATOM   4360  C  CG1   . VAL F 2  81  ? -0.347  -32.502 38.441 1.00 58.99  ? 81   VAL F CG1   1 
ATOM   4361  C  CG2   . VAL F 2  81  ? 0.281   -34.896 37.935 1.00 50.59  ? 81   VAL F CG2   1 
ATOM   4362  N  N     . THR F 2  82  ? 1.118   -30.665 35.793 1.00 52.76  ? 82   THR F N     1 
ATOM   4363  C  CA    . THR F 2  82  ? 1.628   -29.294 35.785 1.00 52.97  ? 82   THR F CA    1 
ATOM   4364  C  C     . THR F 2  82  ? 0.975   -28.513 36.894 1.00 50.60  ? 82   THR F C     1 
ATOM   4365  O  O     . THR F 2  82  ? -0.110  -28.837 37.326 1.00 52.24  ? 82   THR F O     1 
ATOM   4366  C  CB    . THR F 2  82  ? 1.267   -28.538 34.497 1.00 53.04  ? 82   THR F CB    1 
ATOM   4367  O  OG1   . THR F 2  82  ? -0.150  -28.657 34.281 1.00 52.11  ? 82   THR F OG1   1 
ATOM   4368  C  CG2   . THR F 2  82  ? 2.027   -29.076 33.283 1.00 51.84  ? 82   THR F CG2   1 
ATOM   4369  N  N     . ALA F 2  83  ? 1.648   -27.453 37.314 1.00 51.81  ? 83   ALA F N     1 
ATOM   4370  C  CA    . ALA F 2  83  ? 1.037   -26.364 38.055 1.00 47.80  ? 83   ALA F CA    1 
ATOM   4371  C  C     . ALA F 2  83  ? -0.323  -25.938 37.489 1.00 48.05  ? 83   ALA F C     1 
ATOM   4372  O  O     . ALA F 2  83  ? -1.222  -25.624 38.254 1.00 55.31  ? 83   ALA F O     1 
ATOM   4373  C  CB    . ALA F 2  83  ? 1.962   -25.185 38.054 1.00 43.95  ? 83   ALA F CB    1 
ATOM   4374  N  N     . MET F 2  84  ? -0.468  -25.903 36.170 1.00 46.16  ? 84   MET F N     1 
ATOM   4375  C  CA    . MET F 2  84  ? -1.722  -25.511 35.559 1.00 46.48  ? 84   MET F CA    1 
ATOM   4376  C  C     . MET F 2  84  ? -2.816  -26.555 35.744 1.00 49.49  ? 84   MET F C     1 
ATOM   4377  O  O     . MET F 2  84  ? -3.969  -26.214 35.887 1.00 51.51  ? 84   MET F O     1 
ATOM   4378  C  CB    . MET F 2  84  ? -1.543  -25.196 34.067 1.00 49.81  ? 84   MET F CB    1 
ATOM   4379  C  CG    . MET F 2  84  ? -0.801  -23.889 33.788 1.00 56.80  ? 84   MET F CG    1 
ATOM   4380  S  SD    . MET F 2  84  ? -1.253  -22.482 34.862 1.00 63.91  ? 84   MET F SD    1 
ATOM   4381  C  CE    . MET F 2  84  ? -2.947  -22.226 34.305 1.00 58.53  ? 84   MET F CE    1 
ATOM   4382  N  N     . ASP F 2  85  ? -2.475  -27.828 35.755 1.00 50.86  ? 85   ASP F N     1 
ATOM   4383  C  CA    . ASP F 2  85  ? -3.477  -28.842 36.054 1.00 48.74  ? 85   ASP F CA    1 
ATOM   4384  C  C     . ASP F 2  85  ? -4.057  -28.557 37.438 1.00 49.40  ? 85   ASP F C     1 
ATOM   4385  O  O     . ASP F 2  85  ? -5.276  -28.575 37.641 1.00 47.87  ? 85   ASP F O     1 
ATOM   4386  C  CB    . ASP F 2  85  ? -2.850  -30.248 36.008 1.00 49.83  ? 85   ASP F CB    1 
ATOM   4387  C  CG    . ASP F 2  85  ? -2.408  -30.673 34.581 1.00 50.73  ? 85   ASP F CG    1 
ATOM   4388  O  OD1   . ASP F 2  85  ? -3.050  -30.260 33.590 1.00 47.00  ? 85   ASP F OD1   1 
ATOM   4389  O  OD2   . ASP F 2  85  ? -1.432  -31.443 34.459 1.00 47.36  ? 85   ASP F OD2   1 
ATOM   4390  N  N     . VAL F 2  86  ? -3.179  -28.274 38.400 1.00 47.98  ? 86   VAL F N     1 
ATOM   4391  C  CA    . VAL F 2  86  ? -3.611  -28.002 39.788 1.00 44.46  ? 86   VAL F CA    1 
ATOM   4392  C  C     . VAL F 2  86  ? -4.388  -26.687 39.931 1.00 46.00  ? 86   VAL F C     1 
ATOM   4393  O  O     . VAL F 2  86  ? -5.336  -26.583 40.698 1.00 42.67  ? 86   VAL F O     1 
ATOM   4394  C  CB    . VAL F 2  86  ? -2.404  -27.877 40.679 1.00 43.55  ? 86   VAL F CB    1 
ATOM   4395  C  CG1   . VAL F 2  86  ? -2.835  -27.507 42.076 1.00 46.35  ? 86   VAL F CG1   1 
ATOM   4396  C  CG2   . VAL F 2  86  ? -1.633  -29.183 40.686 1.00 47.58  ? 86   VAL F CG2   1 
ATOM   4397  N  N     . VAL F 2  87  ? -3.964  -25.667 39.192 1.00 44.05  ? 87   VAL F N     1 
ATOM   4398  C  CA    . VAL F 2  87  ? -4.648  -24.417 39.224 1.00 43.83  ? 87   VAL F CA    1 
ATOM   4399  C  C     . VAL F 2  87  ? -6.063  -24.550 38.665 1.00 46.82  ? 87   VAL F C     1 
ATOM   4400  O  O     . VAL F 2  87  ? -6.990  -24.065 39.270 1.00 53.46  ? 87   VAL F O     1 
ATOM   4401  C  CB    . VAL F 2  87  ? -3.848  -23.354 38.514 1.00 44.15  ? 87   VAL F CB    1 
ATOM   4402  C  CG1   . VAL F 2  87  ? -4.675  -22.100 38.379 1.00 43.59  ? 87   VAL F CG1   1 
ATOM   4403  C  CG2   . VAL F 2  87  ? -2.576  -23.072 39.305 1.00 47.01  ? 87   VAL F CG2   1 
ATOM   4404  N  N     . TYR F 2  88  ? -6.226  -25.248 37.551 1.00 49.84  ? 88   TYR F N     1 
ATOM   4405  C  CA    . TYR F 2  88  ? -7.548  -25.518 36.997 1.00 49.42  ? 88   TYR F CA    1 
ATOM   4406  C  C     . TYR F 2  88  ? -8.394  -26.399 37.867 1.00 45.84  ? 88   TYR F C     1 
ATOM   4407  O  O     . TYR F 2  88  ? -9.609  -26.293 37.824 1.00 51.08  ? 88   TYR F O     1 
ATOM   4408  C  CB    . TYR F 2  88  ? -7.499  -26.149 35.590 1.00 52.36  ? 88   TYR F CB    1 
ATOM   4409  C  CG    . TYR F 2  88  ? -6.798  -25.297 34.571 1.00 57.22  ? 88   TYR F CG    1 
ATOM   4410  C  CD1   . TYR F 2  88  ? -5.850  -25.839 33.727 1.00 56.24  ? 88   TYR F CD1   1 
ATOM   4411  C  CD2   . TYR F 2  88  ? -7.035  -23.934 34.489 1.00 67.43  ? 88   TYR F CD2   1 
ATOM   4412  C  CE1   . TYR F 2  88  ? -5.190  -25.072 32.797 1.00 60.50  ? 88   TYR F CE1   1 
ATOM   4413  C  CE2   . TYR F 2  88  ? -6.372  -23.153 33.559 1.00 73.40  ? 88   TYR F CE2   1 
ATOM   4414  C  CZ    . TYR F 2  88  ? -5.455  -23.741 32.714 1.00 70.83  ? 88   TYR F CZ    1 
ATOM   4415  O  OH    . TYR F 2  88  ? -4.791  -22.988 31.793 1.00 82.93  ? 88   TYR F OH    1 
ATOM   4416  N  N     . ALA F 2  89  ? -7.787  -27.291 38.625 1.00 47.02  ? 89   ALA F N     1 
ATOM   4417  C  CA    . ALA F 2  89  ? -8.584  -28.156 39.497 1.00 48.62  ? 89   ALA F CA    1 
ATOM   4418  C  C     . ALA F 2  89  ? -9.058  -27.329 40.644 1.00 47.17  ? 89   ALA F C     1 
ATOM   4419  O  O     . ALA F 2  89  ? -10.194 -27.451 41.059 1.00 56.80  ? 89   ALA F O     1 
ATOM   4420  C  CB    . ALA F 2  89  ? -7.779  -29.321 40.016 1.00 51.39  ? 89   ALA F CB    1 
ATOM   4421  N  N     . LEU F 2  90  ? -8.177  -26.471 41.146 1.00 46.46  ? 90   LEU F N     1 
ATOM   4422  C  CA    . LEU F 2  90  ? -8.502  -25.624 42.255 1.00 42.27  ? 90   LEU F CA    1 
ATOM   4423  C  C     . LEU F 2  90  ? -9.615  -24.662 41.854 1.00 46.85  ? 90   LEU F C     1 
ATOM   4424  O  O     . LEU F 2  90  ? -10.503 -24.372 42.653 1.00 50.69  ? 90   LEU F O     1 
ATOM   4425  C  CB    . LEU F 2  90  ? -7.262  -24.898 42.706 1.00 42.26  ? 90   LEU F CB    1 
ATOM   4426  C  CG    . LEU F 2  90  ? -6.241  -25.650 43.578 1.00 41.83  ? 90   LEU F CG    1 
ATOM   4427  C  CD1   . LEU F 2  90  ? -5.008  -24.768 43.759 1.00 40.05  ? 90   LEU F CD1   1 
ATOM   4428  C  CD2   . LEU F 2  90  ? -6.828  -26.061 44.924 1.00 37.46  ? 90   LEU F CD2   1 
ATOM   4429  N  N     . LYS F 2  91  ? -9.615  -24.195 40.614 1.00 47.08  ? 91   LYS F N     1 
ATOM   4430  C  CA    . LYS F 2  91  ? -10.652 -23.286 40.207 1.00 49.93  ? 91   LYS F CA    1 
ATOM   4431  C  C     . LYS F 2  91  ? -12.010 -23.997 40.183 1.00 52.58  ? 91   LYS F C     1 
ATOM   4432  O  O     . LYS F 2  91  ? -12.993 -23.466 40.700 1.00 54.70  ? 91   LYS F O     1 
ATOM   4433  C  CB    . LYS F 2  91  ? -10.304 -22.638 38.877 1.00 55.96  ? 91   LYS F CB    1 
ATOM   4434  C  CG    . LYS F 2  91  ? -11.326 -21.619 38.345 1.00 61.55  ? 91   LYS F CG    1 
ATOM   4435  C  CD    . LYS F 2  91  ? -10.754 -20.807 37.176 1.00 63.23  ? 91   LYS F CD    1 
ATOM   4436  C  CE    . LYS F 2  91  ? -10.514 -19.352 37.555 1.00 79.58  ? 91   LYS F CE    1 
ATOM   4437  N  NZ    . LYS F 2  91  ? -9.153  -18.799 37.269 1.00 85.75  ? 91   LYS F NZ    1 
ATOM   4438  N  N     . ARG F 2  92  ? -12.075 -25.202 39.625 1.00 53.15  ? 92   ARG F N     1 
ATOM   4439  C  CA    . ARG F 2  92  ? -13.354 -25.964 39.559 1.00 51.66  ? 92   ARG F CA    1 
ATOM   4440  C  C     . ARG F 2  92  ? -13.958 -26.171 40.909 1.00 51.34  ? 92   ARG F C     1 
ATOM   4441  O  O     . ARG F 2  92  ? -15.154 -26.243 41.068 1.00 52.90  ? 92   ARG F O     1 
ATOM   4442  C  CB    . ARG F 2  92  ? -13.137 -27.378 39.079 1.00 54.29  ? 92   ARG F CB    1 
ATOM   4443  C  CG    . ARG F 2  92  ? -13.294 -27.579 37.611 1.00 59.03  ? 92   ARG F CG    1 
ATOM   4444  C  CD    . ARG F 2  92  ? -13.356 -29.066 37.320 1.00 59.82  ? 92   ARG F CD    1 
ATOM   4445  N  NE    . ARG F 2  92  ? -14.716 -29.500 37.568 1.00 58.13  ? 92   ARG F NE    1 
ATOM   4446  C  CZ    . ARG F 2  92  ? -15.124 -30.046 38.691 1.00 58.05  ? 92   ARG F CZ    1 
ATOM   4447  N  NH1   . ARG F 2  92  ? -14.266 -30.289 39.656 1.00 63.02  ? 92   ARG F NH1   1 
ATOM   4448  N  NH2   . ARG F 2  92  ? -16.390 -30.390 38.836 1.00 68.65  ? 92   ARG F NH2   1 
ATOM   4449  N  N     . GLN F 2  93  ? -13.097 -26.370 41.877 1.00 53.12  ? 93   GLN F N     1 
ATOM   4450  C  CA    . GLN F 2  93  ? -13.540 -26.658 43.191 1.00 52.15  ? 93   GLN F CA    1 
ATOM   4451  C  C     . GLN F 2  93  ? -13.794 -25.444 44.032 1.00 46.59  ? 93   GLN F C     1 
ATOM   4452  O  O     . GLN F 2  93  ? -13.933 -25.589 45.205 1.00 40.93  ? 93   GLN F O     1 
ATOM   4453  C  CB    . GLN F 2  93  ? -12.503 -27.564 43.838 1.00 63.36  ? 93   GLN F CB    1 
ATOM   4454  C  CG    . GLN F 2  93  ? -12.976 -29.008 43.752 1.00 75.90  ? 93   GLN F CG    1 
ATOM   4455  C  CD    . GLN F 2  93  ? -11.849 -29.947 43.841 1.00 77.84  ? 93   GLN F CD    1 
ATOM   4456  O  OE1   . GLN F 2  93  ? -10.954 -29.749 44.670 1.00 83.85  ? 93   GLN F OE1   1 
ATOM   4457  N  NE2   . GLN F 2  93  ? -11.848 -30.967 42.978 1.00 77.02  ? 93   GLN F NE2   1 
ATOM   4458  N  N     . GLY F 2  94  ? -13.846 -24.250 43.433 1.00 43.98  ? 94   GLY F N     1 
ATOM   4459  C  CA    . GLY F 2  94  ? -14.100 -23.034 44.163 1.00 43.41  ? 94   GLY F CA    1 
ATOM   4460  C  C     . GLY F 2  94  ? -13.005 -22.597 45.127 1.00 50.82  ? 94   GLY F C     1 
ATOM   4461  O  O     . GLY F 2  94  ? -13.294 -21.927 46.110 1.00 60.39  ? 94   GLY F O     1 
ATOM   4462  N  N     . ARG F 2  95  ? -11.758 -22.951 44.836 1.00 51.89  ? 95   ARG F N     1 
ATOM   4463  C  CA    . ARG F 2  95  ? -10.622 -22.587 45.656 1.00 47.96  ? 95   ARG F CA    1 
ATOM   4464  C  C     . ARG F 2  95  ? -9.527  -21.998 44.742 1.00 46.61  ? 95   ARG F C     1 
ATOM   4465  O  O     . ARG F 2  95  ? -8.330  -22.340 44.867 1.00 48.74  ? 95   ARG F O     1 
ATOM   4466  C  CB    . ARG F 2  95  ? -10.041 -23.805 46.413 1.00 50.81  ? 95   ARG F CB    1 
ATOM   4467  C  CG    . ARG F 2  95  ? -10.998 -24.777 47.094 1.00 53.83  ? 95   ARG F CG    1 
ATOM   4468  C  CD    . ARG F 2  95  ? -11.257 -24.583 48.587 1.00 59.80  ? 95   ARG F CD    1 
ATOM   4469  N  NE    . ARG F 2  95  ? -10.233 -23.779 49.263 1.00 62.92  ? 95   ARG F NE    1 
ATOM   4470  C  CZ    . ARG F 2  95  ? -10.425 -23.031 50.360 1.00 59.99  ? 95   ARG F CZ    1 
ATOM   4471  N  NH1   . ARG F 2  95  ? -11.595 -22.986 50.985 1.00 59.96  ? 95   ARG F NH1   1 
ATOM   4472  N  NH2   . ARG F 2  95  ? -9.411  -22.341 50.868 1.00 59.90  ? 95   ARG F NH2   1 
ATOM   4473  N  N     . THR F 2  96  ? -9.927  -21.117 43.831 1.00 45.03  ? 96   THR F N     1 
ATOM   4474  C  CA    . THR F 2  96  ? -8.989  -20.354 42.965 1.00 44.90  ? 96   THR F CA    1 
ATOM   4475  C  C     . THR F 2  96  ? -7.701  -19.870 43.592 1.00 41.15  ? 96   THR F C     1 
ATOM   4476  O  O     . THR F 2  96  ? -7.703  -19.228 44.621 1.00 44.18  ? 96   THR F O     1 
ATOM   4477  C  CB    . THR F 2  96  ? -9.663  -19.079 42.471 1.00 43.66  ? 96   THR F CB    1 
ATOM   4478  O  OG1   . THR F 2  96  ? -10.866 -19.434 41.799 1.00 48.84  ? 96   THR F OG1   1 
ATOM   4479  C  CG2   . THR F 2  96  ? -8.791  -18.384 41.512 1.00 44.22  ? 96   THR F CG2   1 
ATOM   4480  N  N     . LEU F 2  97  ? -6.597  -20.125 42.928 1.00 43.61  ? 97   LEU F N     1 
ATOM   4481  C  CA    . LEU F 2  97  ? -5.273  -19.801 43.497 1.00 44.14  ? 97   LEU F CA    1 
ATOM   4482  C  C     . LEU F 2  97  ? -4.573  -18.873 42.559 1.00 42.97  ? 97   LEU F C     1 
ATOM   4483  O  O     . LEU F 2  97  ? -4.483  -19.161 41.383 1.00 43.47  ? 97   LEU F O     1 
ATOM   4484  C  CB    . LEU F 2  97  ? -4.414  -21.043 43.641 1.00 41.37  ? 97   LEU F CB    1 
ATOM   4485  C  CG    . LEU F 2  97  ? -2.968  -20.895 44.054 1.00 40.07  ? 97   LEU F CG    1 
ATOM   4486  C  CD1   . LEU F 2  97  ? -2.866  -20.427 45.473 1.00 43.77  ? 97   LEU F CD1   1 
ATOM   4487  C  CD2   . LEU F 2  97  ? -2.276  -22.243 43.972 1.00 45.75  ? 97   LEU F CD2   1 
ATOM   4488  N  N     . TYR F 2  98  ? -4.088  -17.756 43.083 1.00 43.65  ? 98   TYR F N     1 
ATOM   4489  C  CA    . TYR F 2  98  ? -3.249  -16.879 42.331 1.00 42.93  ? 98   TYR F CA    1 
ATOM   4490  C  C     . TYR F 2  98  ? -1.784  -17.116 42.709 1.00 44.53  ? 98   TYR F C     1 
ATOM   4491  O  O     . TYR F 2  98  ? -1.454  -17.395 43.867 1.00 42.47  ? 98   TYR F O     1 
ATOM   4492  C  CB    . TYR F 2  98  ? -3.604  -15.468 42.679 1.00 44.86  ? 98   TYR F CB    1 
ATOM   4493  C  CG    . TYR F 2  98  ? -4.941  -14.948 42.233 1.00 46.88  ? 98   TYR F CG    1 
ATOM   4494  C  CD1   . TYR F 2  98  ? -5.797  -15.645 41.377 1.00 48.14  ? 98   TYR F CD1   1 
ATOM   4495  C  CD2   . TYR F 2  98  ? -5.293  -13.669 42.599 1.00 48.08  ? 98   TYR F CD2   1 
ATOM   4496  C  CE1   . TYR F 2  98  ? -7.005  -15.057 40.967 1.00 49.40  ? 98   TYR F CE1   1 
ATOM   4497  C  CE2   . TYR F 2  98  ? -6.462  -13.089 42.203 1.00 46.24  ? 98   TYR F CE2   1 
ATOM   4498  C  CZ    . TYR F 2  98  ? -7.313  -13.763 41.400 1.00 49.56  ? 98   TYR F CZ    1 
ATOM   4499  O  OH    . TYR F 2  98  ? -8.450  -13.060 41.108 1.00 50.87  ? 98   TYR F OH    1 
ATOM   4500  N  N     . GLY F 2  99  ? -0.897  -16.992 41.736 1.00 46.04  ? 99   GLY F N     1 
ATOM   4501  C  CA    . GLY F 2  99  ? 0.549   -17.020 42.025 1.00 47.65  ? 99   GLY F CA    1 
ATOM   4502  C  C     . GLY F 2  99  ? 1.329   -18.071 41.262 1.00 48.37  ? 99   GLY F C     1 
ATOM   4503  O  O     . GLY F 2  99  ? 2.553   -18.101 41.362 1.00 56.63  ? 99   GLY F O     1 
ATOM   4504  N  N     . PHE F 2  100 ? 0.618   -18.936 40.518 1.00 50.77  ? 100  PHE F N     1 
ATOM   4505  C  CA    . PHE F 2  100 ? 1.204   -20.090 39.816 1.00 44.31  ? 100  PHE F CA    1 
ATOM   4506  C  C     . PHE F 2  100 ? 0.836   -20.197 38.350 1.00 44.32  ? 100  PHE F C     1 
ATOM   4507  O  O     . PHE F 2  100 ? 1.080   -21.214 37.769 1.00 50.42  ? 100  PHE F O     1 
ATOM   4508  C  CB    . PHE F 2  100 ? 0.837   -21.394 40.532 1.00 42.04  ? 100  PHE F CB    1 
ATOM   4509  C  CG    . PHE F 2  100 ? 1.501   -21.545 41.865 1.00 41.05  ? 100  PHE F CG    1 
ATOM   4510  C  CD1   . PHE F 2  100 ? 0.905   -21.059 43.013 1.00 42.74  ? 100  PHE F CD1   1 
ATOM   4511  C  CD2   . PHE F 2  100 ? 2.732   -22.161 41.969 1.00 39.85  ? 100  PHE F CD2   1 
ATOM   4512  C  CE1   . PHE F 2  100 ? 1.524   -21.178 44.264 1.00 46.53  ? 100  PHE F CE1   1 
ATOM   4513  C  CE2   . PHE F 2  100 ? 3.367   -22.284 43.210 1.00 42.92  ? 100  PHE F CE2   1 
ATOM   4514  C  CZ    . PHE F 2  100 ? 2.768   -21.786 44.364 1.00 45.41  ? 100  PHE F CZ    1 
ATOM   4515  N  N     . GLY F 2  101 ? 0.267   -19.156 37.747 1.00 48.27  ? 101  GLY F N     1 
ATOM   4516  C  CA    . GLY F 2  101 ? -0.040  -19.149 36.321 1.00 47.39  ? 101  GLY F CA    1 
ATOM   4517  C  C     . GLY F 2  101 ? -1.495  -19.015 35.920 1.00 51.89  ? 101  GLY F C     1 
ATOM   4518  O  O     . GLY F 2  101 ? -1.844  -19.131 34.734 1.00 57.81  ? 101  GLY F O     1 
ATOM   4519  N  N     . GLY F 2  102 ? -2.372  -18.735 36.860 1.00 59.94  ? 102  GLY F N     1 
ATOM   4520  C  CA    . GLY F 2  102 ? -3.757  -18.425 36.444 1.00 83.93  ? 102  GLY F CA    1 
ATOM   4521  C  C     . GLY F 2  102 ? -4.574  -17.543 37.396 1.00 96.98  ? 102  GLY F C     1 
ATOM   4522  O  O     . GLY F 2  102 ? -5.265  -16.608 36.903 1.00 95.02  ? 102  GLY F O     1 
ATOM   4523  O  OXT   . GLY F 2  102 ? -4.583  -17.764 38.642 1.00 76.10  ? 102  GLY F OXT   1 
ATOM   4524  N  N     . ALA G 3  14  ? -35.104 -40.752 5.158  1.00 125.82 ? 14   ALA G N     1 
ATOM   4525  C  CA    . ALA G 3  14  ? -34.378 -40.083 6.292  1.00 128.05 ? 14   ALA G CA    1 
ATOM   4526  C  C     . ALA G 3  14  ? -34.604 -40.809 7.634  1.00 128.34 ? 14   ALA G C     1 
ATOM   4527  O  O     . ALA G 3  14  ? -35.699 -41.316 7.894  1.00 129.14 ? 14   ALA G O     1 
ATOM   4528  C  CB    . ALA G 3  14  ? -34.804 -38.623 6.396  1.00 123.26 ? 14   ALA G CB    1 
ATOM   4529  N  N     . LYS G 3  15  ? -33.567 -40.862 8.475  1.00 130.85 ? 15   LYS G N     1 
ATOM   4530  C  CA    . LYS G 3  15  ? -33.648 -41.516 9.799  1.00 128.33 ? 15   LYS G CA    1 
ATOM   4531  C  C     . LYS G 3  15  ? -32.864 -40.746 10.881 1.00 124.56 ? 15   LYS G C     1 
ATOM   4532  O  O     . LYS G 3  15  ? -31.662 -40.481 10.720 1.00 123.21 ? 15   LYS G O     1 
ATOM   4533  C  CB    . LYS G 3  15  ? -33.149 -42.967 9.717  1.00 122.61 ? 15   LYS G CB    1 
ATOM   4534  C  CG    . LYS G 3  15  ? -33.809 -43.889 10.728 1.00 122.31 ? 15   LYS G CG    1 
ATOM   4535  C  CD    . LYS G 3  15  ? -35.257 -44.190 10.343 1.00 124.35 ? 15   LYS G CD    1 
ATOM   4536  C  CE    . LYS G 3  15  ? -36.179 -44.316 11.552 1.00 118.81 ? 15   LYS G CE    1 
ATOM   4537  N  NZ    . LYS G 3  15  ? -35.840 -45.483 12.411 1.00 116.19 ? 15   LYS G NZ    1 
ATOM   4538  N  N     . THR G 3  16  ? -33.540 -40.416 11.988 1.00 113.25 ? 16   THR G N     1 
ATOM   4539  C  CA    . THR G 3  16  ? -32.967 -39.522 13.017 1.00 102.82 ? 16   THR G CA    1 
ATOM   4540  C  C     . THR G 3  16  ? -31.708 -40.078 13.666 1.00 105.08 ? 16   THR G C     1 
ATOM   4541  O  O     . THR G 3  16  ? -31.574 -41.294 13.885 1.00 103.33 ? 16   THR G O     1 
ATOM   4542  C  CB    . THR G 3  16  ? -33.949 -39.175 14.156 1.00 93.97  ? 16   THR G CB    1 
ATOM   4543  O  OG1   . THR G 3  16  ? -34.290 -40.355 14.906 1.00 85.75  ? 16   THR G OG1   1 
ATOM   4544  C  CG2   . THR G 3  16  ? -35.200 -38.504 13.605 1.00 96.79  ? 16   THR G CG2   1 
ATOM   4545  N  N     . ARG G 3  17  ? -30.796 -39.165 13.984 1.00 98.03  ? 17   ARG G N     1 
ATOM   4546  C  CA    . ARG G 3  17  ? -29.523 -39.537 14.579 1.00 93.55  ? 17   ARG G CA    1 
ATOM   4547  C  C     . ARG G 3  17  ? -29.693 -40.171 15.958 1.00 92.81  ? 17   ARG G C     1 
ATOM   4548  O  O     . ARG G 3  17  ? -28.876 -41.006 16.385 1.00 85.01  ? 17   ARG G O     1 
ATOM   4549  C  CB    . ARG G 3  17  ? -28.624 -38.323 14.659 1.00 91.34  ? 17   ARG G CB    1 
ATOM   4550  C  CG    . ARG G 3  17  ? -28.177 -37.861 13.291 1.00 90.65  ? 17   ARG G CG    1 
ATOM   4551  C  CD    . ARG G 3  17  ? -26.890 -37.073 13.372 1.00 87.41  ? 17   ARG G CD    1 
ATOM   4552  N  NE    . ARG G 3  17  ? -27.156 -35.649 13.509 1.00 89.27  ? 17   ARG G NE    1 
ATOM   4553  C  CZ    . ARG G 3  17  ? -26.251 -34.753 13.888 1.00 89.85  ? 17   ARG G CZ    1 
ATOM   4554  N  NH1   . ARG G 3  17  ? -25.013 -35.147 14.191 1.00 83.58  ? 17   ARG G NH1   1 
ATOM   4555  N  NH2   . ARG G 3  17  ? -26.602 -33.465 13.971 1.00 89.72  ? 17   ARG G NH2   1 
ATOM   4556  N  N     . SER G 3  18  ? -30.761 -39.777 16.644 1.00 84.40  ? 18   SER G N     1 
ATOM   4557  C  CA    . SER G 3  18  ? -31.127 -40.417 17.883 1.00 78.48  ? 18   SER G CA    1 
ATOM   4558  C  C     . SER G 3  18  ? -31.445 -41.892 17.647 1.00 81.96  ? 18   SER G C     1 
ATOM   4559  O  O     . SER G 3  18  ? -30.872 -42.755 18.310 1.00 90.16  ? 18   SER G O     1 
ATOM   4560  C  CB    . SER G 3  18  ? -32.296 -39.685 18.508 1.00 75.39  ? 18   SER G CB    1 
ATOM   4561  O  OG    . SER G 3  18  ? -32.039 -38.298 18.485 1.00 72.67  ? 18   SER G OG    1 
ATOM   4562  N  N     . SER G 3  19  ? -32.317 -42.193 16.685 1.00 84.76  ? 19   SER G N     1 
ATOM   4563  C  CA    . SER G 3  19  ? -32.682 -43.590 16.399 1.00 80.53  ? 19   SER G CA    1 
ATOM   4564  C  C     . SER G 3  19  ? -31.463 -44.397 15.980 1.00 75.03  ? 19   SER G C     1 
ATOM   4565  O  O     . SER G 3  19  ? -31.341 -45.547 16.357 1.00 71.73  ? 19   SER G O     1 
ATOM   4566  C  CB    . SER G 3  19  ? -33.732 -43.661 15.311 1.00 80.53  ? 19   SER G CB    1 
ATOM   4567  O  OG    . SER G 3  19  ? -33.276 -42.968 14.163 1.00 88.51  ? 19   SER G OG    1 
ATOM   4568  N  N     . ARG G 3  20  ? -30.558 -43.789 15.219 1.00 74.27  ? 20   ARG G N     1 
ATOM   4569  C  CA    . ARG G 3  20  ? -29.277 -44.437 14.882 1.00 85.02  ? 20   ARG G CA    1 
ATOM   4570  C  C     . ARG G 3  20  ? -28.475 -44.783 16.133 1.00 83.58  ? 20   ARG G C     1 
ATOM   4571  O  O     . ARG G 3  20  ? -27.866 -45.853 16.221 1.00 81.64  ? 20   ARG G O     1 
ATOM   4572  C  CB    . ARG G 3  20  ? -28.385 -43.539 13.996 1.00 90.15  ? 20   ARG G CB    1 
ATOM   4573  C  CG    . ARG G 3  20  ? -28.887 -43.249 12.591 1.00 90.43  ? 20   ARG G CG    1 
ATOM   4574  C  CD    . ARG G 3  20  ? -27.759 -42.714 11.719 1.00 96.57  ? 20   ARG G CD    1 
ATOM   4575  N  NE    . ARG G 3  20  ? -28.270 -41.971 10.564 1.00 109.94 ? 20   ARG G NE    1 
ATOM   4576  C  CZ    . ARG G 3  20  ? -28.704 -42.517 9.424  1.00 117.28 ? 20   ARG G CZ    1 
ATOM   4577  N  NH1   . ARG G 3  20  ? -28.701 -43.839 9.243  1.00 125.44 ? 20   ARG G NH1   1 
ATOM   4578  N  NH2   . ARG G 3  20  ? -29.146 -41.732 8.450  1.00 111.74 ? 20   ARG G NH2   1 
ATOM   4579  N  N     . ALA G 3  21  ? -28.451 -43.845 17.079 1.00 86.87  ? 21   ALA G N     1 
ATOM   4580  C  CA    . ALA G 3  21  ? -27.704 -44.011 18.329 1.00 86.46  ? 21   ALA G CA    1 
ATOM   4581  C  C     . ALA G 3  21  ? -28.517 -44.720 19.416 1.00 80.21  ? 21   ALA G C     1 
ATOM   4582  O  O     . ALA G 3  21  ? -27.982 -45.072 20.462 1.00 74.00  ? 21   ALA G O     1 
ATOM   4583  C  CB    . ALA G 3  21  ? -27.222 -42.659 18.825 1.00 95.01  ? 21   ALA G CB    1 
ATOM   4584  N  N     . GLY G 3  22  ? -29.805 -44.931 19.163 1.00 81.23  ? 22   GLY G N     1 
ATOM   4585  C  CA    . GLY G 3  22  ? -30.632 -45.789 20.009 1.00 83.17  ? 22   GLY G CA    1 
ATOM   4586  C  C     . GLY G 3  22  ? -31.164 -45.000 21.169 1.00 82.83  ? 22   GLY G C     1 
ATOM   4587  O  O     . GLY G 3  22  ? -31.420 -45.541 22.244 1.00 84.59  ? 22   GLY G O     1 
ATOM   4588  N  N     . LEU G 3  23  ? -31.362 -43.711 20.928 1.00 78.89  ? 23   LEU G N     1 
ATOM   4589  C  CA    . LEU G 3  23  ? -31.640 -42.779 21.983 1.00 75.97  ? 23   LEU G CA    1 
ATOM   4590  C  C     . LEU G 3  23  ? -32.978 -42.109 21.770 1.00 75.87  ? 23   LEU G C     1 
ATOM   4591  O  O     . LEU G 3  23  ? -33.371 -41.826 20.633 1.00 79.90  ? 23   LEU G O     1 
ATOM   4592  C  CB    . LEU G 3  23  ? -30.531 -41.730 22.042 1.00 76.42  ? 23   LEU G CB    1 
ATOM   4593  C  CG    . LEU G 3  23  ? -29.147 -42.184 22.521 1.00 73.08  ? 23   LEU G CG    1 
ATOM   4594  C  CD1   . LEU G 3  23  ? -28.106 -41.108 22.219 1.00 71.01  ? 23   LEU G CD1   1 
ATOM   4595  C  CD2   . LEU G 3  23  ? -29.179 -42.502 24.011 1.00 73.18  ? 23   LEU G CD2   1 
ATOM   4596  N  N     . GLN G 3  24  ? -33.659 -41.870 22.890 1.00 77.29  ? 24   GLN G N     1 
ATOM   4597  C  CA    . GLN G 3  24  ? -34.875 -41.082 22.950 1.00 73.95  ? 24   GLN G CA    1 
ATOM   4598  C  C     . GLN G 3  24  ? -34.623 -39.582 23.022 1.00 72.70  ? 24   GLN G C     1 
ATOM   4599  O  O     . GLN G 3  24  ? -35.562 -38.826 23.110 1.00 73.25  ? 24   GLN G O     1 
ATOM   4600  C  CB    . GLN G 3  24  ? -35.649 -41.469 24.196 1.00 84.61  ? 24   GLN G CB    1 
ATOM   4601  C  CG    . GLN G 3  24  ? -36.083 -42.922 24.246 1.00 90.11  ? 24   GLN G CG    1 
ATOM   4602  C  CD    . GLN G 3  24  ? -37.094 -43.244 23.172 1.00 89.91  ? 24   GLN G CD    1 
ATOM   4603  O  OE1   . GLN G 3  24  ? -38.113 -42.562 23.030 1.00 89.04  ? 24   GLN G OE1   1 
ATOM   4604  N  NE2   . GLN G 3  24  ? -36.814 -44.277 22.397 1.00 97.00  ? 24   GLN G NE2   1 
ATOM   4605  N  N     . PHE G 3  25  ? -33.373 -39.140 23.004 1.00 71.76  ? 25   PHE G N     1 
ATOM   4606  C  CA    . PHE G 3  25  ? -33.062 -37.737 23.290 1.00 74.42  ? 25   PHE G CA    1 
ATOM   4607  C  C     . PHE G 3  25  ? -32.448 -37.130 22.045 1.00 71.92  ? 25   PHE G C     1 
ATOM   4608  O  O     . PHE G 3  25  ? -31.612 -37.757 21.402 1.00 74.23  ? 25   PHE G O     1 
ATOM   4609  C  CB    . PHE G 3  25  ? -32.080 -37.611 24.480 1.00 77.78  ? 25   PHE G CB    1 
ATOM   4610  C  CG    . PHE G 3  25  ? -32.721 -37.200 25.789 1.00 67.54  ? 25   PHE G CG    1 
ATOM   4611  C  CD1   . PHE G 3  25  ? -33.732 -37.955 26.358 1.00 69.98  ? 25   PHE G CD1   1 
ATOM   4612  C  CD2   . PHE G 3  25  ? -32.276 -36.073 26.462 1.00 63.50  ? 25   PHE G CD2   1 
ATOM   4613  C  CE1   . PHE G 3  25  ? -34.301 -37.587 27.563 1.00 69.05  ? 25   PHE G CE1   1 
ATOM   4614  C  CE2   . PHE G 3  25  ? -32.845 -35.691 27.655 1.00 66.48  ? 25   PHE G CE2   1 
ATOM   4615  C  CZ    . PHE G 3  25  ? -33.856 -36.454 28.215 1.00 70.58  ? 25   PHE G CZ    1 
ATOM   4616  N  N     . PRO G 3  26  ? -32.833 -35.891 21.725 1.00 69.39  ? 26   PRO G N     1 
ATOM   4617  C  CA    . PRO G 3  26  ? -32.583 -35.340 20.402 1.00 68.17  ? 26   PRO G CA    1 
ATOM   4618  C  C     . PRO G 3  26  ? -31.128 -34.986 20.166 1.00 63.62  ? 26   PRO G C     1 
ATOM   4619  O  O     . PRO G 3  26  ? -30.655 -33.895 20.537 1.00 67.36  ? 26   PRO G O     1 
ATOM   4620  C  CB    . PRO G 3  26  ? -33.478 -34.099 20.365 1.00 68.03  ? 26   PRO G CB    1 
ATOM   4621  C  CG    . PRO G 3  26  ? -33.521 -33.649 21.778 1.00 69.49  ? 26   PRO G CG    1 
ATOM   4622  C  CD    . PRO G 3  26  ? -33.439 -34.893 22.624 1.00 71.12  ? 26   PRO G CD    1 
ATOM   4623  N  N     . VAL G 3  27  ? -30.441 -35.914 19.523 1.00 57.18  ? 27   VAL G N     1 
ATOM   4624  C  CA    . VAL G 3  27  ? -29.062 -35.717 19.129 1.00 57.36  ? 27   VAL G CA    1 
ATOM   4625  C  C     . VAL G 3  27  ? -28.936 -34.470 18.283 1.00 60.09  ? 27   VAL G C     1 
ATOM   4626  O  O     . VAL G 3  27  ? -28.036 -33.686 18.482 1.00 72.49  ? 27   VAL G O     1 
ATOM   4627  C  CB    . VAL G 3  27  ? -28.561 -36.915 18.342 1.00 56.18  ? 27   VAL G CB    1 
ATOM   4628  C  CG1   . VAL G 3  27  ? -27.129 -36.711 17.891 1.00 55.64  ? 27   VAL G CG1   1 
ATOM   4629  C  CG2   . VAL G 3  27  ? -28.693 -38.161 19.201 1.00 59.12  ? 27   VAL G CG2   1 
ATOM   4630  N  N     . GLY G 3  28  ? -29.858 -34.273 17.353 1.00 66.58  ? 28   GLY G N     1 
ATOM   4631  C  CA    . GLY G 3  28  ? -29.812 -33.110 16.497 1.00 64.76  ? 28   GLY G CA    1 
ATOM   4632  C  C     . GLY G 3  28  ? -29.837 -31.836 17.307 1.00 64.22  ? 28   GLY G C     1 
ATOM   4633  O  O     . GLY G 3  28  ? -28.923 -31.025 17.215 1.00 67.92  ? 28   GLY G O     1 
ATOM   4634  N  N     . ARG G 3  29  ? -30.873 -31.674 18.121 1.00 60.44  ? 29   ARG G N     1 
ATOM   4635  C  CA    . ARG G 3  29  ? -31.027 -30.475 18.936 1.00 58.25  ? 29   ARG G CA    1 
ATOM   4636  C  C     . ARG G 3  29  ? -29.810 -30.244 19.784 1.00 61.43  ? 29   ARG G C     1 
ATOM   4637  O  O     . ARG G 3  29  ? -29.301 -29.122 19.860 1.00 63.41  ? 29   ARG G O     1 
ATOM   4638  C  CB    . ARG G 3  29  ? -32.234 -30.593 19.849 1.00 61.18  ? 29   ARG G CB    1 
ATOM   4639  C  CG    . ARG G 3  29  ? -32.633 -29.289 20.517 1.00 63.19  ? 29   ARG G CG    1 
ATOM   4640  C  CD    . ARG G 3  29  ? -33.925 -29.469 21.313 1.00 66.67  ? 29   ARG G CD    1 
ATOM   4641  N  NE    . ARG G 3  29  ? -35.124 -29.431 20.488 1.00 68.40  ? 29   ARG G NE    1 
ATOM   4642  C  CZ    . ARG G 3  29  ? -36.365 -29.514 20.957 1.00 72.75  ? 29   ARG G CZ    1 
ATOM   4643  N  NH1   . ARG G 3  29  ? -36.593 -29.662 22.254 1.00 77.71  ? 29   ARG G NH1   1 
ATOM   4644  N  NH2   . ARG G 3  29  ? -37.392 -29.448 20.122 1.00 80.27  ? 29   ARG G NH2   1 
ATOM   4645  N  N     . VAL G 3  30  ? -29.341 -31.308 20.428 1.00 60.70  ? 30   VAL G N     1 
ATOM   4646  C  CA    . VAL G 3  30  ? -28.161 -31.204 21.255 1.00 58.71  ? 30   VAL G CA    1 
ATOM   4647  C  C     . VAL G 3  30  ? -27.028 -30.644 20.404 1.00 60.22  ? 30   VAL G C     1 
ATOM   4648  O  O     . VAL G 3  30  ? -26.321 -29.719 20.831 1.00 67.07  ? 30   VAL G O     1 
ATOM   4649  C  CB    . VAL G 3  30  ? -27.791 -32.560 21.905 1.00 63.25  ? 30   VAL G CB    1 
ATOM   4650  C  CG1   . VAL G 3  30  ? -26.363 -32.557 22.452 1.00 65.57  ? 30   VAL G CG1   1 
ATOM   4651  C  CG2   . VAL G 3  30  ? -28.767 -32.895 23.020 1.00 63.96  ? 30   VAL G CG2   1 
ATOM   4652  N  N     . HIS G 3  31  ? -26.869 -31.173 19.195 1.00 61.94  ? 31   HIS G N     1 
ATOM   4653  C  CA    . HIS G 3  31  ? -25.801 -30.700 18.311 1.00 66.50  ? 31   HIS G CA    1 
ATOM   4654  C  C     . HIS G 3  31  ? -25.919 -29.198 18.086 1.00 62.68  ? 31   HIS G C     1 
ATOM   4655  O  O     . HIS G 3  31  ? -24.939 -28.461 18.178 1.00 63.10  ? 31   HIS G O     1 
ATOM   4656  C  CB    . HIS G 3  31  ? -25.819 -31.411 16.957 1.00 68.11  ? 31   HIS G CB    1 
ATOM   4657  C  CG    . HIS G 3  31  ? -24.515 -31.327 16.218 1.00 78.12  ? 31   HIS G CG    1 
ATOM   4658  N  ND1   . HIS G 3  31  ? -23.598 -30.315 16.420 1.00 82.59  ? 31   HIS G ND1   1 
ATOM   4659  C  CD2   . HIS G 3  31  ? -23.976 -32.133 15.274 1.00 79.37  ? 31   HIS G CD2   1 
ATOM   4660  C  CE1   . HIS G 3  31  ? -22.548 -30.513 15.643 1.00 86.36  ? 31   HIS G CE1   1 
ATOM   4661  N  NE2   . HIS G 3  31  ? -22.753 -31.608 14.936 1.00 83.37  ? 31   HIS G NE2   1 
ATOM   4662  N  N     . ARG G 3  32  ? -27.130 -28.760 17.783 1.00 59.84  ? 32   ARG G N     1 
ATOM   4663  C  CA    . ARG G 3  32  ? -27.372 -27.383 17.434 1.00 63.20  ? 32   ARG G CA    1 
ATOM   4664  C  C     . ARG G 3  32  ? -27.058 -26.532 18.642 1.00 65.47  ? 32   ARG G C     1 
ATOM   4665  O  O     . ARG G 3  32  ? -26.176 -25.649 18.573 1.00 63.60  ? 32   ARG G O     1 
ATOM   4666  C  CB    . ARG G 3  32  ? -28.820 -27.219 16.984 1.00 62.07  ? 32   ARG G CB    1 
ATOM   4667  C  CG    . ARG G 3  32  ? -29.249 -25.816 16.619 1.00 59.62  ? 32   ARG G CG    1 
ATOM   4668  C  CD    . ARG G 3  32  ? -30.763 -25.774 16.723 1.00 66.30  ? 32   ARG G CD    1 
ATOM   4669  N  NE    . ARG G 3  32  ? -31.218 -25.443 18.073 1.00 70.49  ? 32   ARG G NE    1 
ATOM   4670  C  CZ    . ARG G 3  32  ? -32.331 -25.888 18.668 1.00 72.85  ? 32   ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G 3  32  ? -33.159 -26.737 18.076 1.00 69.79  ? 32   ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G 3  32  ? -32.610 -25.482 19.903 1.00 79.02  ? 32   ARG G NH2   1 
ATOM   4673  N  N     . LEU G 3  33  ? -27.742 -26.841 19.752 1.00 61.99  ? 33   LEU G N     1 
ATOM   4674  C  CA    . LEU G 3  33  ? -27.538 -26.133 21.018 1.00 62.90  ? 33   LEU G CA    1 
ATOM   4675  C  C     . LEU G 3  33  ? -26.046 -25.998 21.387 1.00 61.32  ? 33   LEU G C     1 
ATOM   4676  O  O     . LEU G 3  33  ? -25.635 -24.947 21.847 1.00 69.51  ? 33   LEU G O     1 
ATOM   4677  C  CB    . LEU G 3  33  ? -28.331 -26.793 22.142 1.00 61.99  ? 33   LEU G CB    1 
ATOM   4678  C  CG    . LEU G 3  33  ? -29.859 -26.562 22.156 1.00 59.65  ? 33   LEU G CG    1 
ATOM   4679  C  CD1   . LEU G 3  33  ? -30.518 -27.338 23.284 1.00 56.00  ? 33   LEU G CD1   1 
ATOM   4680  C  CD2   . LEU G 3  33  ? -30.229 -25.094 22.293 1.00 58.54  ? 33   LEU G CD2   1 
ATOM   4681  N  N     . LEU G 3  34  ? -25.242 -27.024 21.135 1.00 58.69  ? 34   LEU G N     1 
ATOM   4682  C  CA    . LEU G 3  34  ? -23.779 -26.894 21.247 1.00 67.37  ? 34   LEU G CA    1 
ATOM   4683  C  C     . LEU G 3  34  ? -23.142 -25.853 20.325 1.00 71.32  ? 34   LEU G C     1 
ATOM   4684  O  O     . LEU G 3  34  ? -22.227 -25.174 20.766 1.00 78.87  ? 34   LEU G O     1 
ATOM   4685  C  CB    . LEU G 3  34  ? -23.042 -28.243 21.038 1.00 66.64  ? 34   LEU G CB    1 
ATOM   4686  C  CG    . LEU G 3  34  ? -23.085 -29.287 22.169 1.00 66.10  ? 34   LEU G CG    1 
ATOM   4687  C  CD1   . LEU G 3  34  ? -22.426 -30.578 21.712 1.00 64.29  ? 34   LEU G CD1   1 
ATOM   4688  C  CD2   . LEU G 3  34  ? -22.424 -28.792 23.454 1.00 66.21  ? 34   LEU G CD2   1 
ATOM   4689  N  N     . ARG G 3  35  ? -23.566 -25.744 19.061 1.00 81.02  ? 35   ARG G N     1 
ATOM   4690  C  CA    . ARG G 3  35  ? -22.953 -24.757 18.135 1.00 81.01  ? 35   ARG G CA    1 
ATOM   4691  C  C     . ARG G 3  35  ? -23.287 -23.346 18.586 1.00 78.47  ? 35   ARG G C     1 
ATOM   4692  O  O     . ARG G 3  35  ? -22.419 -22.485 18.709 1.00 79.31  ? 35   ARG G O     1 
ATOM   4693  C  CB    . ARG G 3  35  ? -23.455 -24.875 16.701 1.00 86.93  ? 35   ARG G CB    1 
ATOM   4694  C  CG    . ARG G 3  35  ? -23.603 -26.267 16.151 1.00 101.31 ? 35   ARG G CG    1 
ATOM   4695  C  CD    . ARG G 3  35  ? -23.820 -26.226 14.642 1.00 112.47 ? 35   ARG G CD    1 
ATOM   4696  N  NE    . ARG G 3  35  ? -23.253 -27.413 14.018 1.00 123.16 ? 35   ARG G NE    1 
ATOM   4697  C  CZ    . ARG G 3  35  ? -21.946 -27.670 13.940 1.00 131.09 ? 35   ARG G CZ    1 
ATOM   4698  N  NH1   . ARG G 3  35  ? -21.043 -26.821 14.448 1.00 131.12 ? 35   ARG G NH1   1 
ATOM   4699  N  NH2   . ARG G 3  35  ? -21.535 -28.788 13.350 1.00 136.76 ? 35   ARG G NH2   1 
ATOM   4700  N  N     . LYS G 3  36  ? -24.560 -23.110 18.860 1.00 79.84  ? 36   LYS G N     1 
ATOM   4701  C  CA    . LYS G 3  36  ? -25.007 -21.754 19.102 1.00 88.31  ? 36   LYS G CA    1 
ATOM   4702  C  C     . LYS G 3  36  ? -24.814 -21.409 20.570 1.00 84.65  ? 36   LYS G C     1 
ATOM   4703  O  O     . LYS G 3  36  ? -25.490 -20.536 21.102 1.00 95.58  ? 36   LYS G O     1 
ATOM   4704  C  CB    . LYS G 3  36  ? -26.456 -21.579 18.595 1.00 101.57 ? 36   LYS G CB    1 
ATOM   4705  C  CG    . LYS G 3  36  ? -26.656 -22.217 17.210 1.00 104.97 ? 36   LYS G CG    1 
ATOM   4706  C  CD    . LYS G 3  36  ? -27.335 -21.349 16.151 1.00 111.63 ? 36   LYS G CD    1 
ATOM   4707  C  CE    . LYS G 3  36  ? -26.896 -21.781 14.742 1.00 117.33 ? 36   LYS G CE    1 
ATOM   4708  N  NZ    . LYS G 3  36  ? -27.892 -21.547 13.652 1.00 116.58 ? 36   LYS G NZ    1 
ATOM   4709  N  N     . GLY G 3  37  ? -23.865 -22.102 21.206 1.00 81.09  ? 37   GLY G N     1 
ATOM   4710  C  CA    . GLY G 3  37  ? -23.530 -21.927 22.616 1.00 70.33  ? 37   GLY G CA    1 
ATOM   4711  C  C     . GLY G 3  37  ? -22.140 -21.354 22.816 1.00 66.04  ? 37   GLY G C     1 
ATOM   4712  O  O     . GLY G 3  37  ? -21.736 -21.109 23.933 1.00 65.36  ? 37   GLY G O     1 
ATOM   4713  N  N     . ASN G 3  38  ? -21.404 -21.121 21.738 1.00 66.13  ? 38   ASN G N     1 
ATOM   4714  C  CA    . ASN G 3  38  ? -20.068 -20.546 21.852 1.00 72.83  ? 38   ASN G CA    1 
ATOM   4715  C  C     . ASN G 3  38  ? -19.233 -21.325 22.841 1.00 62.12  ? 38   ASN G C     1 
ATOM   4716  O  O     . ASN G 3  38  ? -18.505 -20.767 23.641 1.00 69.92  ? 38   ASN G O     1 
ATOM   4717  C  CB    . ASN G 3  38  ? -20.131 -19.065 22.269 1.00 80.90  ? 38   ASN G CB    1 
ATOM   4718  C  CG    . ASN G 3  38  ? -20.825 -18.195 21.237 1.00 80.57  ? 38   ASN G CG    1 
ATOM   4719  O  OD1   . ASN G 3  38  ? -21.953 -17.746 21.442 1.00 79.27  ? 38   ASN G OD1   1 
ATOM   4720  N  ND2   . ASN G 3  38  ? -20.161 -17.971 20.115 1.00 81.31  ? 38   ASN G ND2   1 
ATOM   4721  N  N     . TYR G 3  39  ? -19.347 -22.634 22.782 1.00 62.00  ? 39   TYR G N     1 
ATOM   4722  C  CA    . TYR G 3  39  ? -18.546 -23.507 23.624 1.00 59.20  ? 39   TYR G CA    1 
ATOM   4723  C  C     . TYR G 3  39  ? -17.185 -23.768 22.942 1.00 62.93  ? 39   TYR G C     1 
ATOM   4724  O  O     . TYR G 3  39  ? -16.144 -23.747 23.608 1.00 62.76  ? 39   TYR G O     1 
ATOM   4725  C  CB    . TYR G 3  39  ? -19.334 -24.779 23.898 1.00 54.03  ? 39   TYR G CB    1 
ATOM   4726  C  CG    . TYR G 3  39  ? -20.604 -24.549 24.713 1.00 51.87  ? 39   TYR G CG    1 
ATOM   4727  C  CD1   . TYR G 3  39  ? -21.849 -24.813 24.211 1.00 51.36  ? 39   TYR G CD1   1 
ATOM   4728  C  CD2   . TYR G 3  39  ? -20.530 -24.111 26.006 1.00 59.53  ? 39   TYR G CD2   1 
ATOM   4729  C  CE1   . TYR G 3  39  ? -22.989 -24.641 24.982 1.00 54.95  ? 39   TYR G CE1   1 
ATOM   4730  C  CE2   . TYR G 3  39  ? -21.652 -23.931 26.786 1.00 59.29  ? 39   TYR G CE2   1 
ATOM   4731  C  CZ    . TYR G 3  39  ? -22.885 -24.195 26.282 1.00 59.92  ? 39   TYR G CZ    1 
ATOM   4732  O  OH    . TYR G 3  39  ? -23.994 -23.992 27.109 1.00 63.65  ? 39   TYR G OH    1 
ATOM   4733  N  N     . ALA G 3  40  ? -17.197 -23.956 21.616 1.00 64.80  ? 40   ALA G N     1 
ATOM   4734  C  CA    . ALA G 3  40  ? -15.957 -23.960 20.814 1.00 72.65  ? 40   ALA G CA    1 
ATOM   4735  C  C     . ALA G 3  40  ? -16.195 -23.598 19.349 1.00 73.74  ? 40   ALA G C     1 
ATOM   4736  O  O     . ALA G 3  40  ? -17.325 -23.680 18.885 1.00 79.91  ? 40   ALA G O     1 
ATOM   4737  C  CB    . ALA G 3  40  ? -15.292 -25.317 20.900 1.00 74.23  ? 40   ALA G CB    1 
ATOM   4738  N  N     . GLU G 3  41  ? -15.130 -23.223 18.626 1.00 78.59  ? 41   GLU G N     1 
ATOM   4739  C  CA    . GLU G 3  41  ? -15.208 -22.964 17.155 1.00 86.34  ? 41   GLU G CA    1 
ATOM   4740  C  C     . GLU G 3  41  ? -15.977 -24.082 16.439 1.00 79.29  ? 41   GLU G C     1 
ATOM   4741  O  O     . GLU G 3  41  ? -16.772 -23.821 15.557 1.00 73.40  ? 41   GLU G O     1 
ATOM   4742  C  CB    . GLU G 3  41  ? -13.811 -22.889 16.484 1.00 94.09  ? 41   GLU G CB    1 
ATOM   4743  C  CG    . GLU G 3  41  ? -12.810 -21.864 17.027 1.00 107.51 ? 41   GLU G CG    1 
ATOM   4744  C  CD    . GLU G 3  41  ? -12.826 -20.515 16.315 1.00 110.48 ? 41   GLU G CD    1 
ATOM   4745  O  OE1   . GLU G 3  41  ? -13.745 -20.254 15.501 1.00 123.59 ? 41   GLU G OE1   1 
ATOM   4746  O  OE2   . GLU G 3  41  ? -11.900 -19.702 16.577 1.00 116.00 ? 41   GLU G OE2   1 
ATOM   4747  N  N     . ARG G 3  42  ? -15.718 -25.322 16.850 1.00 79.83  ? 42   ARG G N     1 
ATOM   4748  C  CA    . ARG G 3  42  ? -16.110 -26.518 16.130 1.00 81.44  ? 42   ARG G CA    1 
ATOM   4749  C  C     . ARG G 3  42  ? -16.654 -27.579 17.077 1.00 77.72  ? 42   ARG G C     1 
ATOM   4750  O  O     . ARG G 3  42  ? -16.460 -27.503 18.268 1.00 83.87  ? 42   ARG G O     1 
ATOM   4751  C  CB    . ARG G 3  42  ? -14.894 -27.114 15.436 1.00 86.15  ? 42   ARG G CB    1 
ATOM   4752  C  CG    . ARG G 3  42  ? -14.204 -26.227 14.403 1.00 88.99  ? 42   ARG G CG    1 
ATOM   4753  C  CD    . ARG G 3  42  ? -13.244 -27.070 13.569 1.00 94.85  ? 42   ARG G CD    1 
ATOM   4754  N  NE    . ARG G 3  42  ? -13.254 -26.676 12.164 1.00 108.63 ? 42   ARG G NE    1 
ATOM   4755  C  CZ    . ARG G 3  42  ? -13.204 -27.515 11.129 1.00 115.96 ? 42   ARG G CZ    1 
ATOM   4756  N  NH1   . ARG G 3  42  ? -13.150 -28.830 11.318 1.00 113.32 ? 42   ARG G NH1   1 
ATOM   4757  N  NH2   . ARG G 3  42  ? -13.226 -27.033 9.886  1.00 125.27 ? 42   ARG G NH2   1 
ATOM   4758  N  N     . VAL G 3  43  ? -17.316 -28.584 16.528 1.00 73.54  ? 43   VAL G N     1 
ATOM   4759  C  CA    . VAL G 3  43  ? -18.022 -29.572 17.316 1.00 75.45  ? 43   VAL G CA    1 
ATOM   4760  C  C     . VAL G 3  43  ? -18.020 -30.889 16.573 1.00 77.86  ? 43   VAL G C     1 
ATOM   4761  O  O     . VAL G 3  43  ? -18.666 -31.010 15.532 1.00 89.47  ? 43   VAL G O     1 
ATOM   4762  C  CB    . VAL G 3  43  ? -19.500 -29.173 17.513 1.00 78.97  ? 43   VAL G CB    1 
ATOM   4763  C  CG1   . VAL G 3  43  ? -20.300 -30.322 18.128 1.00 80.92  ? 43   VAL G CG1   1 
ATOM   4764  C  CG2   . VAL G 3  43  ? -19.624 -27.912 18.360 1.00 78.65  ? 43   VAL G CG2   1 
ATOM   4765  N  N     . GLY G 3  44  ? -17.322 -31.874 17.120 1.00 80.37  ? 44   GLY G N     1 
ATOM   4766  C  CA    . GLY G 3  44  ? -17.255 -33.217 16.531 1.00 84.64  ? 44   GLY G CA    1 
ATOM   4767  C  C     . GLY G 3  44  ? -18.592 -33.945 16.464 1.00 79.02  ? 44   GLY G C     1 
ATOM   4768  O  O     . GLY G 3  44  ? -19.534 -33.602 17.171 1.00 75.53  ? 44   GLY G O     1 
ATOM   4769  N  N     . ALA G 3  45  ? -18.650 -34.966 15.615 1.00 76.72  ? 45   ALA G N     1 
ATOM   4770  C  CA    . ALA G 3  45  ? -19.897 -35.643 15.288 1.00 73.18  ? 45   ALA G CA    1 
ATOM   4771  C  C     . ALA G 3  45  ? -20.462 -36.478 16.427 1.00 68.62  ? 45   ALA G C     1 
ATOM   4772  O  O     . ALA G 3  45  ? -21.669 -36.620 16.510 1.00 81.69  ? 45   ALA G O     1 
ATOM   4773  C  CB    . ALA G 3  45  ? -19.724 -36.500 14.047 1.00 71.33  ? 45   ALA G CB    1 
ATOM   4774  N  N     . GLY G 3  46  ? -19.614 -37.024 17.292 1.00 66.15  ? 46   GLY G N     1 
ATOM   4775  C  CA    . GLY G 3  46  ? -20.074 -37.862 18.431 1.00 72.20  ? 46   GLY G CA    1 
ATOM   4776  C  C     . GLY G 3  46  ? -20.374 -37.144 19.756 1.00 72.42  ? 46   GLY G C     1 
ATOM   4777  O  O     . GLY G 3  46  ? -21.157 -37.627 20.603 1.00 67.94  ? 46   GLY G O     1 
ATOM   4778  N  N     . ALA G 3  47  ? -19.755 -35.983 19.939 1.00 69.21  ? 47   ALA G N     1 
ATOM   4779  C  CA    . ALA G 3  47  ? -20.014 -35.152 21.094 1.00 61.51  ? 47   ALA G CA    1 
ATOM   4780  C  C     . ALA G 3  47  ? -21.512 -35.000 21.396 1.00 66.44  ? 47   ALA G C     1 
ATOM   4781  O  O     . ALA G 3  47  ? -21.917 -35.181 22.538 1.00 68.53  ? 47   ALA G O     1 
ATOM   4782  C  CB    . ALA G 3  47  ? -19.360 -33.800 20.914 1.00 60.81  ? 47   ALA G CB    1 
ATOM   4783  N  N     . PRO G 3  48  ? -22.347 -34.668 20.388 1.00 71.11  ? 48   PRO G N     1 
ATOM   4784  C  CA    . PRO G 3  48  ? -23.764 -34.543 20.762 1.00 69.33  ? 48   PRO G CA    1 
ATOM   4785  C  C     . PRO G 3  48  ? -24.379 -35.885 21.076 1.00 66.23  ? 48   PRO G C     1 
ATOM   4786  O  O     . PRO G 3  48  ? -25.320 -35.967 21.868 1.00 65.05  ? 48   PRO G O     1 
ATOM   4787  C  CB    . PRO G 3  48  ? -24.420 -33.918 19.526 1.00 72.65  ? 48   PRO G CB    1 
ATOM   4788  C  CG    . PRO G 3  48  ? -23.462 -34.153 18.410 1.00 74.01  ? 48   PRO G CG    1 
ATOM   4789  C  CD    . PRO G 3  48  ? -22.095 -34.208 19.008 1.00 70.11  ? 48   PRO G CD    1 
ATOM   4790  N  N     . VAL G 3  49  ? -23.846 -36.936 20.471 1.00 68.90  ? 49   VAL G N     1 
ATOM   4791  C  CA    . VAL G 3  49  ? -24.351 -38.280 20.737 1.00 72.71  ? 49   VAL G CA    1 
ATOM   4792  C  C     . VAL G 3  49  ? -24.081 -38.642 22.203 1.00 72.18  ? 49   VAL G C     1 
ATOM   4793  O  O     . VAL G 3  49  ? -24.990 -39.022 22.969 1.00 68.70  ? 49   VAL G O     1 
ATOM   4794  C  CB    . VAL G 3  49  ? -23.712 -39.315 19.783 1.00 72.23  ? 49   VAL G CB    1 
ATOM   4795  C  CG1   . VAL G 3  49  ? -24.117 -40.736 20.168 1.00 78.02  ? 49   VAL G CG1   1 
ATOM   4796  C  CG2   . VAL G 3  49  ? -24.125 -39.016 18.349 1.00 73.99  ? 49   VAL G CG2   1 
ATOM   4797  N  N     . TYR G 3  50  ? -22.818 -38.511 22.580 1.00 68.11  ? 50   TYR G N     1 
ATOM   4798  C  CA    . TYR G 3  50  ? -22.395 -38.779 23.946 1.00 66.59  ? 50   TYR G CA    1 
ATOM   4799  C  C     . TYR G 3  50  ? -23.206 -37.905 24.953 1.00 69.27  ? 50   TYR G C     1 
ATOM   4800  O  O     . TYR G 3  50  ? -23.824 -38.397 25.924 1.00 64.01  ? 50   TYR G O     1 
ATOM   4801  C  CB    . TYR G 3  50  ? -20.904 -38.482 24.020 1.00 63.18  ? 50   TYR G CB    1 
ATOM   4802  C  CG    . TYR G 3  50  ? -20.171 -39.118 25.170 1.00 65.82  ? 50   TYR G CG    1 
ATOM   4803  C  CD1   . TYR G 3  50  ? -19.065 -39.915 24.941 1.00 63.25  ? 50   TYR G CD1   1 
ATOM   4804  C  CD2   . TYR G 3  50  ? -20.555 -38.880 26.491 1.00 66.60  ? 50   TYR G CD2   1 
ATOM   4805  C  CE1   . TYR G 3  50  ? -18.381 -40.490 25.988 1.00 67.53  ? 50   TYR G CE1   1 
ATOM   4806  C  CE2   . TYR G 3  50  ? -19.870 -39.440 27.552 1.00 66.54  ? 50   TYR G CE2   1 
ATOM   4807  C  CZ    . TYR G 3  50  ? -18.782 -40.247 27.298 1.00 72.28  ? 50   TYR G CZ    1 
ATOM   4808  O  OH    . TYR G 3  50  ? -18.081 -40.818 28.352 1.00 75.43  ? 50   TYR G OH    1 
ATOM   4809  N  N     . LEU G 3  51  ? -23.226 -36.603 24.694 1.00 64.68  ? 51   LEU G N     1 
ATOM   4810  C  CA    . LEU G 3  51  ? -23.869 -35.683 25.588 1.00 62.04  ? 51   LEU G CA    1 
ATOM   4811  C  C     . LEU G 3  51  ? -25.313 -36.082 25.763 1.00 60.19  ? 51   LEU G C     1 
ATOM   4812  O  O     . LEU G 3  51  ? -25.800 -36.179 26.895 1.00 72.29  ? 51   LEU G O     1 
ATOM   4813  C  CB    . LEU G 3  51  ? -23.754 -34.250 25.075 1.00 66.30  ? 51   LEU G CB    1 
ATOM   4814  C  CG    . LEU G 3  51  ? -24.447 -33.186 25.943 1.00 67.69  ? 51   LEU G CG    1 
ATOM   4815  C  CD1   . LEU G 3  51  ? -24.109 -33.369 27.409 1.00 64.76  ? 51   LEU G CD1   1 
ATOM   4816  C  CD2   . LEU G 3  51  ? -24.070 -31.789 25.480 1.00 70.09  ? 51   LEU G CD2   1 
ATOM   4817  N  N     . ALA G 3  52  ? -25.988 -36.355 24.655 1.00 55.65  ? 52   ALA G N     1 
ATOM   4818  C  CA    . ALA G 3  52  ? -27.408 -36.709 24.701 1.00 55.34  ? 52   ALA G CA    1 
ATOM   4819  C  C     . ALA G 3  52  ? -27.699 -38.008 25.462 1.00 56.17  ? 52   ALA G C     1 
ATOM   4820  O  O     . ALA G 3  52  ? -28.733 -38.131 26.117 1.00 57.10  ? 52   ALA G O     1 
ATOM   4821  C  CB    . ALA G 3  52  ? -27.948 -36.803 23.300 1.00 60.87  ? 52   ALA G CB    1 
ATOM   4822  N  N     . ALA G 3  53  ? -26.799 -38.978 25.361 1.00 54.41  ? 53   ALA G N     1 
ATOM   4823  C  CA    . ALA G 3  53  ? -26.926 -40.221 26.108 1.00 58.10  ? 53   ALA G CA    1 
ATOM   4824  C  C     . ALA G 3  53  ? -26.784 -39.962 27.601 1.00 61.54  ? 53   ALA G C     1 
ATOM   4825  O  O     . ALA G 3  53  ? -27.516 -40.517 28.432 1.00 61.43  ? 53   ALA G O     1 
ATOM   4826  C  CB    . ALA G 3  53  ? -25.837 -41.197 25.666 1.00 64.33  ? 53   ALA G CB    1 
ATOM   4827  N  N     . VAL G 3  54  ? -25.807 -39.133 27.943 1.00 62.19  ? 54   VAL G N     1 
ATOM   4828  C  CA    . VAL G 3  54  ? -25.589 -38.800 29.339 1.00 61.18  ? 54   VAL G CA    1 
ATOM   4829  C  C     . VAL G 3  54  ? -26.845 -38.133 29.913 1.00 58.40  ? 54   VAL G C     1 
ATOM   4830  O  O     . VAL G 3  54  ? -27.310 -38.494 30.992 1.00 55.97  ? 54   VAL G O     1 
ATOM   4831  C  CB    . VAL G 3  54  ? -24.362 -37.904 29.502 1.00 60.06  ? 54   VAL G CB    1 
ATOM   4832  C  CG1   . VAL G 3  54  ? -24.211 -37.445 30.950 1.00 60.17  ? 54   VAL G CG1   1 
ATOM   4833  C  CG2   . VAL G 3  54  ? -23.125 -38.661 29.048 1.00 61.28  ? 54   VAL G CG2   1 
ATOM   4834  N  N     . LEU G 3  55  ? -27.420 -37.190 29.182 1.00 50.25  ? 55   LEU G N     1 
ATOM   4835  C  CA    . LEU G 3  55  ? -28.611 -36.547 29.681 1.00 53.24  ? 55   LEU G CA    1 
ATOM   4836  C  C     . LEU G 3  55  ? -29.789 -37.543 29.842 1.00 56.38  ? 55   LEU G C     1 
ATOM   4837  O  O     . LEU G 3  55  ? -30.587 -37.432 30.790 1.00 52.81  ? 55   LEU G O     1 
ATOM   4838  C  CB    . LEU G 3  55  ? -28.986 -35.378 28.768 1.00 53.12  ? 55   LEU G CB    1 
ATOM   4839  C  CG    . LEU G 3  55  ? -27.975 -34.238 28.660 1.00 51.82  ? 55   LEU G CG    1 
ATOM   4840  C  CD1   . LEU G 3  55  ? -28.295 -33.266 27.540 1.00 49.85  ? 55   LEU G CD1   1 
ATOM   4841  C  CD2   . LEU G 3  55  ? -27.912 -33.486 29.971 1.00 54.76  ? 55   LEU G CD2   1 
ATOM   4842  N  N     . GLU G 3  56  ? -29.893 -38.510 28.920 1.00 62.73  ? 56   GLU G N     1 
ATOM   4843  C  CA    . GLU G 3  56  ? -31.006 -39.472 28.919 1.00 61.72  ? 56   GLU G CA    1 
ATOM   4844  C  C     . GLU G 3  56  ? -30.823 -40.332 30.129 1.00 56.16  ? 56   GLU G C     1 
ATOM   4845  O  O     . GLU G 3  56  ? -31.722 -40.499 30.964 1.00 56.11  ? 56   GLU G O     1 
ATOM   4846  C  CB    . GLU G 3  56  ? -31.003 -40.338 27.661 1.00 68.12  ? 56   GLU G CB    1 
ATOM   4847  C  CG    . GLU G 3  56  ? -32.255 -41.191 27.470 1.00 72.28  ? 56   GLU G CG    1 
ATOM   4848  C  CD    . GLU G 3  56  ? -32.293 -41.959 26.140 1.00 81.05  ? 56   GLU G CD    1 
ATOM   4849  O  OE1   . GLU G 3  56  ? -31.808 -41.443 25.091 1.00 70.85  ? 56   GLU G OE1   1 
ATOM   4850  O  OE2   . GLU G 3  56  ? -32.837 -43.091 26.136 1.00 90.55  ? 56   GLU G OE2   1 
ATOM   4851  N  N     . TYR G 3  57  ? -29.621 -40.850 30.236 1.00 54.83  ? 57   TYR G N     1 
ATOM   4852  C  CA    . TYR G 3  57  ? -29.257 -41.647 31.382 1.00 60.69  ? 57   TYR G CA    1 
ATOM   4853  C  C     . TYR G 3  57  ? -29.639 -40.980 32.726 1.00 63.40  ? 57   TYR G C     1 
ATOM   4854  O  O     . TYR G 3  57  ? -30.342 -41.574 33.552 1.00 64.37  ? 57   TYR G O     1 
ATOM   4855  C  CB    . TYR G 3  57  ? -27.763 -41.919 31.346 1.00 62.94  ? 57   TYR G CB    1 
ATOM   4856  C  CG    . TYR G 3  57  ? -27.323 -42.530 32.631 1.00 71.00  ? 57   TYR G CG    1 
ATOM   4857  C  CD1   . TYR G 3  57  ? -27.790 -43.785 33.010 1.00 71.81  ? 57   TYR G CD1   1 
ATOM   4858  C  CD2   . TYR G 3  57  ? -26.496 -41.842 33.494 1.00 65.79  ? 57   TYR G CD2   1 
ATOM   4859  C  CE1   . TYR G 3  57  ? -27.411 -44.346 34.197 1.00 74.01  ? 57   TYR G CE1   1 
ATOM   4860  C  CE2   . TYR G 3  57  ? -26.115 -42.400 34.683 1.00 68.79  ? 57   TYR G CE2   1 
ATOM   4861  C  CZ    . TYR G 3  57  ? -26.576 -43.646 35.028 1.00 72.83  ? 57   TYR G CZ    1 
ATOM   4862  O  OH    . TYR G 3  57  ? -26.203 -44.188 36.227 1.00 80.96  ? 57   TYR G OH    1 
ATOM   4863  N  N     . LEU G 3  58  ? -29.184 -39.744 32.925 1.00 58.99  ? 58   LEU G N     1 
ATOM   4864  C  CA    . LEU G 3  58  ? -29.395 -39.068 34.187 1.00 55.90  ? 58   LEU G CA    1 
ATOM   4865  C  C     . LEU G 3  58  ? -30.859 -38.835 34.388 1.00 56.57  ? 58   LEU G C     1 
ATOM   4866  O  O     . LEU G 3  58  ? -31.334 -38.876 35.520 1.00 54.25  ? 58   LEU G O     1 
ATOM   4867  C  CB    . LEU G 3  58  ? -28.642 -37.733 34.261 1.00 52.23  ? 58   LEU G CB    1 
ATOM   4868  C  CG    . LEU G 3  58  ? -27.125 -37.890 34.386 1.00 54.21  ? 58   LEU G CG    1 
ATOM   4869  C  CD1   . LEU G 3  58  ? -26.423 -36.569 34.154 1.00 56.98  ? 58   LEU G CD1   1 
ATOM   4870  C  CD2   . LEU G 3  58  ? -26.718 -38.466 35.728 1.00 54.49  ? 58   LEU G CD2   1 
ATOM   4871  N  N     . THR G 3  59  ? -31.573 -38.575 33.300 1.00 58.65  ? 59   THR G N     1 
ATOM   4872  C  CA    . THR G 3  59  ? -33.011 -38.336 33.388 1.00 62.70  ? 59   THR G CA    1 
ATOM   4873  C  C     . THR G 3  59  ? -33.726 -39.595 33.858 1.00 62.41  ? 59   THR G C     1 
ATOM   4874  O  O     . THR G 3  59  ? -34.635 -39.540 34.683 1.00 62.51  ? 59   THR G O     1 
ATOM   4875  C  CB    . THR G 3  59  ? -33.566 -37.873 32.034 1.00 61.93  ? 59   THR G CB    1 
ATOM   4876  O  OG1   . THR G 3  59  ? -33.093 -36.554 31.789 1.00 56.41  ? 59   THR G OG1   1 
ATOM   4877  C  CG2   . THR G 3  59  ? -35.083 -37.853 32.032 1.00 62.33  ? 59   THR G CG2   1 
ATOM   4878  N  N     . ALA G 3  60  ? -33.280 -40.730 33.348 1.00 64.98  ? 60   ALA G N     1 
ATOM   4879  C  CA    . ALA G 3  60  ? -33.923 -41.994 33.655 1.00 67.22  ? 60   ALA G CA    1 
ATOM   4880  C  C     . ALA G 3  60  ? -33.733 -42.323 35.131 1.00 67.83  ? 60   ALA G C     1 
ATOM   4881  O  O     . ALA G 3  60  ? -34.687 -42.590 35.880 1.00 62.96  ? 60   ALA G O     1 
ATOM   4882  C  CB    . ALA G 3  60  ? -33.349 -43.092 32.774 1.00 62.03  ? 60   ALA G CB    1 
ATOM   4883  N  N     . GLU G 3  61  ? -32.482 -42.277 35.551 1.00 72.44  ? 61   GLU G N     1 
ATOM   4884  C  CA    . GLU G 3  61  ? -32.144 -42.568 36.938 1.00 71.80  ? 61   GLU G CA    1 
ATOM   4885  C  C     . GLU G 3  61  ? -33.097 -41.809 37.883 1.00 62.68  ? 61   GLU G C     1 
ATOM   4886  O  O     . GLU G 3  61  ? -33.613 -42.369 38.840 1.00 70.23  ? 61   GLU G O     1 
ATOM   4887  C  CB    . GLU G 3  61  ? -30.674 -42.220 37.194 1.00 75.76  ? 61   GLU G CB    1 
ATOM   4888  C  CG    . GLU G 3  61  ? -29.948 -43.154 38.144 1.00 83.97  ? 61   GLU G CG    1 
ATOM   4889  C  CD    . GLU G 3  61  ? -29.566 -44.493 37.522 1.00 95.18  ? 61   GLU G CD    1 
ATOM   4890  O  OE1   . GLU G 3  61  ? -28.407 -44.598 37.084 1.00 100.09 ? 61   GLU G OE1   1 
ATOM   4891  O  OE2   . GLU G 3  61  ? -30.392 -45.456 37.493 1.00 124.70 ? 61   GLU G OE2   1 
ATOM   4892  N  N     . ILE G 3  62  ? -33.371 -40.552 37.582 1.00 53.33  ? 62   ILE G N     1 
ATOM   4893  C  CA    . ILE G 3  62  ? -34.151 -39.719 38.467 1.00 54.47  ? 62   ILE G CA    1 
ATOM   4894  C  C     . ILE G 3  62  ? -35.616 -40.067 38.386 1.00 62.27  ? 62   ILE G C     1 
ATOM   4895  O  O     . ILE G 3  62  ? -36.309 -40.158 39.426 1.00 65.31  ? 62   ILE G O     1 
ATOM   4896  C  CB    . ILE G 3  62  ? -33.972 -38.231 38.128 1.00 58.41  ? 62   ILE G CB    1 
ATOM   4897  C  CG1   . ILE G 3  62  ? -32.591 -37.776 38.565 1.00 64.47  ? 62   ILE G CG1   1 
ATOM   4898  C  CG2   . ILE G 3  62  ? -34.986 -37.359 38.852 1.00 55.04  ? 62   ILE G CG2   1 
ATOM   4899  C  CD1   . ILE G 3  62  ? -32.201 -36.444 37.972 1.00 68.49  ? 62   ILE G CD1   1 
ATOM   4900  N  N     . LEU G 3  63  ? -36.099 -40.245 37.157 1.00 61.19  ? 63   LEU G N     1 
ATOM   4901  C  CA    . LEU G 3  63  ? -37.467 -40.683 36.960 1.00 57.90  ? 63   LEU G CA    1 
ATOM   4902  C  C     . LEU G 3  63  ? -37.653 -42.057 37.583 1.00 57.15  ? 63   LEU G C     1 
ATOM   4903  O  O     . LEU G 3  63  ? -38.667 -42.288 38.247 1.00 60.04  ? 63   LEU G O     1 
ATOM   4904  C  CB    . LEU G 3  63  ? -37.831 -40.703 35.493 1.00 61.32  ? 63   LEU G CB    1 
ATOM   4905  C  CG    . LEU G 3  63  ? -37.878 -39.323 34.837 1.00 63.01  ? 63   LEU G CG    1 
ATOM   4906  C  CD1   . LEU G 3  63  ? -38.014 -39.513 33.342 1.00 62.74  ? 63   LEU G CD1   1 
ATOM   4907  C  CD2   . LEU G 3  63  ? -38.976 -38.428 35.390 1.00 61.96  ? 63   LEU G CD2   1 
ATOM   4908  N  N     . GLU G 3  64  ? -36.675 -42.950 37.433 1.00 56.35  ? 64   GLU G N     1 
ATOM   4909  C  CA    . GLU G 3  64  ? -36.761 -44.231 38.124 1.00 68.95  ? 64   GLU G CA    1 
ATOM   4910  C  C     . GLU G 3  64  ? -37.052 -43.983 39.595 1.00 73.00  ? 64   GLU G C     1 
ATOM   4911  O  O     . GLU G 3  64  ? -38.066 -44.439 40.108 1.00 82.39  ? 64   GLU G O     1 
ATOM   4912  C  CB    . GLU G 3  64  ? -35.501 -45.092 37.957 1.00 81.43  ? 64   GLU G CB    1 
ATOM   4913  C  CG    . GLU G 3  64  ? -35.658 -46.478 38.586 1.00 96.40  ? 64   GLU G CG    1 
ATOM   4914  C  CD    . GLU G 3  64  ? -34.480 -47.448 38.379 1.00 117.05 ? 64   GLU G CD    1 
ATOM   4915  O  OE1   . GLU G 3  64  ? -33.358 -47.082 37.893 1.00 125.25 ? 64   GLU G OE1   1 
ATOM   4916  O  OE2   . GLU G 3  64  ? -34.689 -48.627 38.755 1.00 128.90 ? 64   GLU G OE2   1 
ATOM   4917  N  N     . LEU G 3  65  ? -36.201 -43.211 40.262 1.00 70.25  ? 65   LEU G N     1 
ATOM   4918  C  CA    . LEU G 3  65  ? -36.328 -43.048 41.713 1.00 66.45  ? 65   LEU G CA    1 
ATOM   4919  C  C     . LEU G 3  65  ? -37.509 -42.188 42.120 1.00 68.39  ? 65   LEU G C     1 
ATOM   4920  O  O     . LEU G 3  65  ? -38.055 -42.355 43.211 1.00 72.10  ? 65   LEU G O     1 
ATOM   4921  C  CB    . LEU G 3  65  ? -35.047 -42.472 42.302 1.00 63.12  ? 65   LEU G CB    1 
ATOM   4922  C  CG    . LEU G 3  65  ? -33.791 -43.325 42.078 1.00 63.65  ? 65   LEU G CG    1 
ATOM   4923  C  CD1   . LEU G 3  65  ? -32.539 -42.502 42.326 1.00 65.99  ? 65   LEU G CD1   1 
ATOM   4924  C  CD2   . LEU G 3  65  ? -33.757 -44.574 42.933 1.00 60.50  ? 65   LEU G CD2   1 
ATOM   4925  N  N     . ALA G 3  66  ? -37.894 -41.251 41.265 1.00 66.60  ? 66   ALA G N     1 
ATOM   4926  C  CA    . ALA G 3  66  ? -38.980 -40.355 41.616 1.00 72.00  ? 66   ALA G CA    1 
ATOM   4927  C  C     . ALA G 3  66  ? -40.285 -41.116 41.457 1.00 78.23  ? 66   ALA G C     1 
ATOM   4928  O  O     . ALA G 3  66  ? -41.238 -40.903 42.214 1.00 81.32  ? 66   ALA G O     1 
ATOM   4929  C  CB    . ALA G 3  66  ? -38.951 -39.087 40.769 1.00 66.44  ? 66   ALA G CB    1 
ATOM   4930  N  N     . GLY G 3  67  ? -40.317 -42.021 40.482 1.00 80.72  ? 67   GLY G N     1 
ATOM   4931  C  CA    . GLY G 3  67  ? -41.458 -42.909 40.308 1.00 79.88  ? 67   GLY G CA    1 
ATOM   4932  C  C     . GLY G 3  67  ? -41.573 -43.794 41.527 1.00 75.13  ? 67   GLY G C     1 
ATOM   4933  O  O     . GLY G 3  67  ? -42.641 -43.936 42.110 1.00 83.25  ? 67   GLY G O     1 
ATOM   4934  N  N     . ASN G 3  68  ? -40.457 -44.376 41.931 1.00 71.17  ? 68   ASN G N     1 
ATOM   4935  C  CA    . ASN G 3  68  ? -40.440 -45.178 43.132 1.00 70.21  ? 68   ASN G CA    1 
ATOM   4936  C  C     . ASN G 3  68  ? -40.997 -44.416 44.307 1.00 68.76  ? 68   ASN G C     1 
ATOM   4937  O  O     . ASN G 3  68  ? -41.645 -45.004 45.154 1.00 69.00  ? 68   ASN G O     1 
ATOM   4938  C  CB    . ASN G 3  68  ? -39.025 -45.642 43.452 1.00 75.72  ? 68   ASN G CB    1 
ATOM   4939  C  CG    . ASN G 3  68  ? -38.509 -46.680 42.462 1.00 80.98  ? 68   ASN G CG    1 
ATOM   4940  O  OD1   . ASN G 3  68  ? -39.285 -47.250 41.661 1.00 80.61  ? 68   ASN G OD1   1 
ATOM   4941  N  ND2   . ASN G 3  68  ? -37.187 -46.943 42.511 1.00 66.16  ? 68   ASN G ND2   1 
ATOM   4942  N  N     . ALA G 3  69  ? -40.752 -43.113 44.369 1.00 68.41  ? 69   ALA G N     1 
ATOM   4943  C  CA    . ALA G 3  69  ? -41.273 -42.334 45.483 1.00 72.82  ? 69   ALA G CA    1 
ATOM   4944  C  C     . ALA G 3  69  ? -42.756 -42.192 45.366 1.00 70.05  ? 69   ALA G C     1 
ATOM   4945  O  O     . ALA G 3  69  ? -43.448 -42.346 46.358 1.00 78.21  ? 69   ALA G O     1 
ATOM   4946  C  CB    . ALA G 3  69  ? -40.622 -40.971 45.577 1.00 73.56  ? 69   ALA G CB    1 
ATOM   4947  N  N     . ALA G 3  70  ? -43.241 -41.892 44.161 1.00 77.69  ? 70   ALA G N     1 
ATOM   4948  C  CA    . ALA G 3  70  ? -44.695 -41.841 43.889 1.00 77.56  ? 70   ALA G CA    1 
ATOM   4949  C  C     . ALA G 3  70  ? -45.369 -43.102 44.402 1.00 78.35  ? 70   ALA G C     1 
ATOM   4950  O  O     . ALA G 3  70  ? -46.299 -43.038 45.212 1.00 85.65  ? 70   ALA G O     1 
ATOM   4951  C  CB    . ALA G 3  70  ? -44.974 -41.672 42.406 1.00 74.43  ? 70   ALA G CB    1 
ATOM   4952  N  N     . ARG G 3  71  ? -44.863 -44.249 43.962 1.00 79.09  ? 71   ARG G N     1 
ATOM   4953  C  CA    . ARG G 3  71  ? -45.360 -45.538 44.431 1.00 84.48  ? 71   ARG G CA    1 
ATOM   4954  C  C     . ARG G 3  71  ? -45.528 -45.580 45.974 1.00 83.41  ? 71   ARG G C     1 
ATOM   4955  O  O     . ARG G 3  71  ? -46.615 -45.834 46.490 1.00 84.40  ? 71   ARG G O     1 
ATOM   4956  C  CB    . ARG G 3  71  ? -44.434 -46.645 43.943 1.00 90.86  ? 71   ARG G CB    1 
ATOM   4957  C  CG    . ARG G 3  71  ? -45.078 -48.009 43.947 1.00 101.84 ? 71   ARG G CG    1 
ATOM   4958  C  CD    . ARG G 3  71  ? -44.056 -49.123 44.083 1.00 108.10 ? 71   ARG G CD    1 
ATOM   4959  N  NE    . ARG G 3  71  ? -44.716 -50.380 44.446 1.00 115.61 ? 71   ARG G NE    1 
ATOM   4960  C  CZ    . ARG G 3  71  ? -44.097 -51.546 44.613 1.00 118.85 ? 71   ARG G CZ    1 
ATOM   4961  N  NH1   . ARG G 3  71  ? -42.777 -51.644 44.446 1.00 122.35 ? 71   ARG G NH1   1 
ATOM   4962  N  NH2   . ARG G 3  71  ? -44.804 -52.624 44.946 1.00 110.98 ? 71   ARG G NH2   1 
ATOM   4963  N  N     . ASP G 3  72  ? -44.468 -45.277 46.705 1.00 84.89  ? 72   ASP G N     1 
ATOM   4964  C  CA    . ASP G 3  72  ? -44.517 -45.320 48.162 1.00 86.01  ? 72   ASP G CA    1 
ATOM   4965  C  C     . ASP G 3  72  ? -45.676 -44.521 48.702 1.00 85.42  ? 72   ASP G C     1 
ATOM   4966  O  O     . ASP G 3  72  ? -46.379 -44.997 49.569 1.00 85.93  ? 72   ASP G O     1 
ATOM   4967  C  CB    . ASP G 3  72  ? -43.245 -44.753 48.787 1.00 94.60  ? 72   ASP G CB    1 
ATOM   4968  C  CG    . ASP G 3  72  ? -42.002 -45.439 48.303 1.00 96.08  ? 72   ASP G CG    1 
ATOM   4969  O  OD1   . ASP G 3  72  ? -42.066 -46.661 48.047 1.00 91.70  ? 72   ASP G OD1   1 
ATOM   4970  O  OD2   . ASP G 3  72  ? -40.967 -44.742 48.175 1.00 104.02 ? 72   ASP G OD2   1 
ATOM   4971  N  N     . ASN G 3  73  ? -45.869 -43.304 48.200 1.00 89.86  ? 73   ASN G N     1 
ATOM   4972  C  CA    . ASN G 3  73  ? -46.927 -42.432 48.722 1.00 100.99 ? 73   ASN G CA    1 
ATOM   4973  C  C     . ASN G 3  73  ? -48.295 -42.726 48.093 1.00 97.25  ? 73   ASN G C     1 
ATOM   4974  O  O     . ASN G 3  73  ? -49.232 -41.962 48.282 1.00 90.38  ? 73   ASN G O     1 
ATOM   4975  C  CB    . ASN G 3  73  ? -46.535 -40.954 48.573 1.00 105.16 ? 73   ASN G CB    1 
ATOM   4976  C  CG    . ASN G 3  73  ? -45.251 -40.618 49.329 1.00 119.65 ? 73   ASN G CG    1 
ATOM   4977  O  OD1   . ASN G 3  73  ? -45.277 -40.418 50.544 1.00 136.26 ? 73   ASN G OD1   1 
ATOM   4978  N  ND2   . ASN G 3  73  ? -44.118 -40.574 48.619 1.00 111.48 ? 73   ASN G ND2   1 
ATOM   4979  N  N     . LYS G 3  74  ? -48.401 -43.851 47.379 1.00 92.80  ? 74   LYS G N     1 
ATOM   4980  C  CA    . LYS G 3  74  ? -49.655 -44.318 46.782 1.00 99.58  ? 74   LYS G CA    1 
ATOM   4981  C  C     . LYS G 3  74  ? -50.108 -43.381 45.678 1.00 92.18  ? 74   LYS G C     1 
ATOM   4982  O  O     . LYS G 3  74  ? -51.280 -43.018 45.620 1.00 93.53  ? 74   LYS G O     1 
ATOM   4983  C  CB    . LYS G 3  74  ? -50.780 -44.450 47.836 1.00 112.54 ? 74   LYS G CB    1 
ATOM   4984  C  CG    . LYS G 3  74  ? -50.586 -45.522 48.912 1.00 115.49 ? 74   LYS G CG    1 
ATOM   4985  C  CD    . LYS G 3  74  ? -51.258 -46.848 48.551 1.00 112.93 ? 74   LYS G CD    1 
ATOM   4986  C  CE    . LYS G 3  74  ? -51.330 -47.797 49.743 1.00 110.47 ? 74   LYS G CE    1 
ATOM   4987  N  NZ    . LYS G 3  74  ? -49.982 -48.267 50.176 1.00 107.04 ? 74   LYS G NZ    1 
ATOM   4988  N  N     . LYS G 3  75  ? -49.182 -42.987 44.808 1.00 87.71  ? 75   LYS G N     1 
ATOM   4989  C  CA    . LYS G 3  75  ? -49.483 -42.057 43.708 1.00 81.08  ? 75   LYS G CA    1 
ATOM   4990  C  C     . LYS G 3  75  ? -48.978 -42.567 42.366 1.00 83.95  ? 75   LYS G C     1 
ATOM   4991  O  O     . LYS G 3  75  ? -48.056 -43.394 42.297 1.00 81.68  ? 75   LYS G O     1 
ATOM   4992  C  CB    . LYS G 3  75  ? -48.877 -40.695 44.001 1.00 80.97  ? 75   LYS G CB    1 
ATOM   4993  C  CG    . LYS G 3  75  ? -49.858 -39.713 44.630 1.00 90.38  ? 75   LYS G CG    1 
ATOM   4994  C  CD    . LYS G 3  75  ? -49.708 -39.568 46.131 1.00 89.16  ? 75   LYS G CD    1 
ATOM   4995  C  CE    . LYS G 3  75  ? -51.048 -39.323 46.826 1.00 93.66  ? 75   LYS G CE    1 
ATOM   4996  N  NZ    . LYS G 3  75  ? -51.672 -37.995 46.571 1.00 92.58  ? 75   LYS G NZ    1 
ATOM   4997  N  N     . THR G 3  76  ? -49.600 -42.099 41.292 1.00 87.29  ? 76   THR G N     1 
ATOM   4998  C  CA    . THR G 3  76  ? -49.161 -42.475 39.927 1.00 91.06  ? 76   THR G CA    1 
ATOM   4999  C  C     . THR G 3  76  ? -48.661 -41.286 39.104 1.00 89.02  ? 76   THR G C     1 
ATOM   5000  O  O     . THR G 3  76  ? -47.959 -41.466 38.113 1.00 88.54  ? 76   THR G O     1 
ATOM   5001  C  CB    . THR G 3  76  ? -50.284 -43.188 39.145 1.00 98.30  ? 76   THR G CB    1 
ATOM   5002  O  OG1   . THR G 3  76  ? -51.533 -42.493 39.332 1.00 93.33  ? 76   THR G OG1   1 
ATOM   5003  C  CG2   . THR G 3  76  ? -50.399 -44.657 39.610 1.00 99.49  ? 76   THR G CG2   1 
ATOM   5004  N  N     . ARG G 3  77  ? -49.031 -40.080 39.525 1.00 87.32  ? 77   ARG G N     1 
ATOM   5005  C  CA    . ARG G 3  77  ? -48.564 -38.838 38.925 1.00 82.32  ? 77   ARG G CA    1 
ATOM   5006  C  C     . ARG G 3  77  ? -47.410 -38.342 39.780 1.00 74.87  ? 77   ARG G C     1 
ATOM   5007  O  O     . ARG G 3  77  ? -47.606 -38.098 40.974 1.00 70.47  ? 77   ARG G O     1 
ATOM   5008  C  CB    . ARG G 3  77  ? -49.720 -37.830 38.937 1.00 85.76  ? 77   ARG G CB    1 
ATOM   5009  C  CG    . ARG G 3  77  ? -49.370 -36.353 38.823 1.00 89.31  ? 77   ARG G CG    1 
ATOM   5010  C  CD    . ARG G 3  77  ? -50.594 -35.541 38.414 1.00 88.01  ? 77   ARG G CD    1 
ATOM   5011  N  NE    . ARG G 3  77  ? -51.152 -36.145 37.209 1.00 90.23  ? 77   ARG G NE    1 
ATOM   5012  C  CZ    . ARG G 3  77  ? -52.426 -36.464 37.002 1.00 90.01  ? 77   ARG G CZ    1 
ATOM   5013  N  NH1   . ARG G 3  77  ? -53.383 -36.178 37.887 1.00 91.29  ? 77   ARG G NH1   1 
ATOM   5014  N  NH2   . ARG G 3  77  ? -52.744 -37.060 35.859 1.00 89.81  ? 77   ARG G NH2   1 
ATOM   5015  N  N     . ILE G 3  78  ? -46.218 -38.247 39.177 1.00 69.69  ? 78   ILE G N     1 
ATOM   5016  C  CA    . ILE G 3  78  ? -45.021 -37.669 39.817 1.00 66.67  ? 78   ILE G CA    1 
ATOM   5017  C  C     . ILE G 3  78  ? -45.174 -36.144 40.027 1.00 67.46  ? 78   ILE G C     1 
ATOM   5018  O  O     . ILE G 3  78  ? -45.408 -35.415 39.063 1.00 66.19  ? 78   ILE G O     1 
ATOM   5019  C  CB    . ILE G 3  78  ? -43.740 -37.923 38.975 1.00 61.33  ? 78   ILE G CB    1 
ATOM   5020  C  CG1   . ILE G 3  78  ? -43.263 -39.366 39.156 1.00 61.41  ? 78   ILE G CG1   1 
ATOM   5021  C  CG2   . ILE G 3  78  ? -42.634 -36.939 39.358 1.00 62.75  ? 78   ILE G CG2   1 
ATOM   5022  C  CD1   . ILE G 3  78  ? -42.139 -39.821 38.230 1.00 59.77  ? 78   ILE G CD1   1 
ATOM   5023  N  N     . ILE G 3  79  ? -45.033 -35.677 41.269 1.00 62.06  ? 79   ILE G N     1 
ATOM   5024  C  CA    . ILE G 3  79  ? -44.953 -34.243 41.561 1.00 67.60  ? 79   ILE G CA    1 
ATOM   5025  C  C     . ILE G 3  79  ? -43.556 -33.805 42.081 1.00 66.81  ? 79   ILE G C     1 
ATOM   5026  O  O     . ILE G 3  79  ? -42.672 -34.635 42.303 1.00 70.65  ? 79   ILE G O     1 
ATOM   5027  C  CB    . ILE G 3  79  ? -46.061 -33.810 42.531 1.00 65.63  ? 79   ILE G CB    1 
ATOM   5028  C  CG1   . ILE G 3  79  ? -46.112 -34.718 43.762 1.00 67.23  ? 79   ILE G CG1   1 
ATOM   5029  C  CG2   . ILE G 3  79  ? -47.391 -33.813 41.810 1.00 72.08  ? 79   ILE G CG2   1 
ATOM   5030  C  CD1   . ILE G 3  79  ? -46.777 -34.059 44.964 1.00 62.83  ? 79   ILE G CD1   1 
ATOM   5031  N  N     . PRO G 3  80  ? -43.342 -32.493 42.246 1.00 63.27  ? 80   PRO G N     1 
ATOM   5032  C  CA    . PRO G 3  80  ? -42.040 -32.051 42.682 1.00 65.12  ? 80   PRO G CA    1 
ATOM   5033  C  C     . PRO G 3  80  ? -41.555 -32.722 43.958 1.00 63.00  ? 80   PRO G C     1 
ATOM   5034  O  O     . PRO G 3  80  ? -40.388 -33.112 44.044 1.00 58.51  ? 80   PRO G O     1 
ATOM   5035  C  CB    . PRO G 3  80  ? -42.268 -30.558 42.888 1.00 69.03  ? 80   PRO G CB    1 
ATOM   5036  C  CG    . PRO G 3  80  ? -43.154 -30.213 41.754 1.00 65.62  ? 80   PRO G CG    1 
ATOM   5037  C  CD    . PRO G 3  80  ? -44.136 -31.354 41.756 1.00 66.85  ? 80   PRO G CD    1 
ATOM   5038  N  N     . ARG G 3  81  ? -42.444 -32.880 44.928 1.00 60.32  ? 81   ARG G N     1 
ATOM   5039  C  CA    . ARG G 3  81  ? -42.095 -33.610 46.134 1.00 58.65  ? 81   ARG G CA    1 
ATOM   5040  C  C     . ARG G 3  81  ? -41.482 -34.938 45.829 1.00 56.97  ? 81   ARG G C     1 
ATOM   5041  O  O     . ARG G 3  81  ? -40.646 -35.381 46.575 1.00 56.68  ? 81   ARG G O     1 
ATOM   5042  C  CB    . ARG G 3  81  ? -43.314 -33.861 47.003 1.00 62.08  ? 81   ARG G CB    1 
ATOM   5043  C  CG    . ARG G 3  81  ? -43.045 -34.646 48.272 1.00 61.50  ? 81   ARG G CG    1 
ATOM   5044  C  CD    . ARG G 3  81  ? -41.974 -33.991 49.091 1.00 61.27  ? 81   ARG G CD    1 
ATOM   5045  N  NE    . ARG G 3  81  ? -42.032 -34.447 50.463 1.00 63.46  ? 81   ARG G NE    1 
ATOM   5046  C  CZ    . ARG G 3  81  ? -41.297 -33.947 51.451 1.00 66.04  ? 81   ARG G CZ    1 
ATOM   5047  N  NH1   . ARG G 3  81  ? -40.415 -32.970 51.224 1.00 67.25  ? 81   ARG G NH1   1 
ATOM   5048  N  NH2   . ARG G 3  81  ? -41.450 -34.424 52.679 1.00 65.36  ? 81   ARG G NH2   1 
ATOM   5049  N  N     . HIS G 3  82  ? -41.896 -35.609 44.763 1.00 58.77  ? 82   HIS G N     1 
ATOM   5050  C  CA    . HIS G 3  82  ? -41.292 -36.918 44.493 1.00 63.35  ? 82   HIS G CA    1 
ATOM   5051  C  C     . HIS G 3  82  ? -39.875 -36.783 43.919 1.00 68.08  ? 82   HIS G C     1 
ATOM   5052  O  O     . HIS G 3  82  ? -39.019 -37.649 44.169 1.00 62.71  ? 82   HIS G O     1 
ATOM   5053  C  CB    . HIS G 3  82  ? -42.190 -37.827 43.635 1.00 61.32  ? 82   HIS G CB    1 
ATOM   5054  C  CG    . HIS G 3  82  ? -43.579 -37.958 44.175 1.00 64.99  ? 82   HIS G CG    1 
ATOM   5055  N  ND1   . HIS G 3  82  ? -44.694 -37.962 43.368 1.00 63.81  ? 82   HIS G ND1   1 
ATOM   5056  C  CD2   . HIS G 3  82  ? -44.036 -38.004 45.447 1.00 62.71  ? 82   HIS G CD2   1 
ATOM   5057  C  CE1   . HIS G 3  82  ? -45.776 -38.028 44.113 1.00 62.57  ? 82   HIS G CE1   1 
ATOM   5058  N  NE2   . HIS G 3  82  ? -45.405 -38.053 45.381 1.00 67.64  ? 82   HIS G NE2   1 
ATOM   5059  N  N     . LEU G 3  83  ? -39.618 -35.701 43.177 1.00 66.58  ? 83   LEU G N     1 
ATOM   5060  C  CA    . LEU G 3  83  ? -38.254 -35.433 42.668 1.00 64.32  ? 83   LEU G CA    1 
ATOM   5061  C  C     . LEU G 3  83  ? -37.324 -35.087 43.813 1.00 58.88  ? 83   LEU G C     1 
ATOM   5062  O  O     . LEU G 3  83  ? -36.212 -35.584 43.856 1.00 51.77  ? 83   LEU G O     1 
ATOM   5063  C  CB    . LEU G 3  83  ? -38.244 -34.298 41.669 1.00 61.83  ? 83   LEU G CB    1 
ATOM   5064  C  CG    . LEU G 3  83  ? -39.063 -34.594 40.421 1.00 62.50  ? 83   LEU G CG    1 
ATOM   5065  C  CD1   . LEU G 3  83  ? -39.380 -33.289 39.710 1.00 65.79  ? 83   LEU G CD1   1 
ATOM   5066  C  CD2   . LEU G 3  83  ? -38.302 -35.549 39.522 1.00 63.10  ? 83   LEU G CD2   1 
ATOM   5067  N  N     . GLN G 3  84  ? -37.809 -34.261 44.743 1.00 54.81  ? 84   GLN G N     1 
ATOM   5068  C  CA    . GLN G 3  84  ? -37.065 -33.925 45.945 1.00 53.02  ? 84   GLN G CA    1 
ATOM   5069  C  C     . GLN G 3  84  ? -36.728 -35.145 46.781 1.00 58.05  ? 84   GLN G C     1 
ATOM   5070  O  O     . GLN G 3  84  ? -35.592 -35.275 47.214 1.00 67.81  ? 84   GLN G O     1 
ATOM   5071  C  CB    . GLN G 3  84  ? -37.830 -32.947 46.806 1.00 49.21  ? 84   GLN G CB    1 
ATOM   5072  C  CG    . GLN G 3  84  ? -37.169 -32.634 48.129 1.00 52.11  ? 84   GLN G CG    1 
ATOM   5073  C  CD    . GLN G 3  84  ? -35.936 -31.740 48.015 1.00 51.90  ? 84   GLN G CD    1 
ATOM   5074  O  OE1   . GLN G 3  84  ? -35.230 -31.718 46.982 1.00 49.08  ? 84   GLN G OE1   1 
ATOM   5075  N  NE2   . GLN G 3  84  ? -35.642 -31.029 49.099 1.00 43.45  ? 84   GLN G NE2   1 
ATOM   5076  N  N     . LEU G 3  85  ? -37.683 -36.040 47.019 1.00 58.71  ? 85   LEU G N     1 
ATOM   5077  C  CA    . LEU G 3  85  ? -37.397 -37.207 47.859 1.00 57.67  ? 85   LEU G CA    1 
ATOM   5078  C  C     . LEU G 3  85  ? -36.421 -38.132 47.142 1.00 57.47  ? 85   LEU G C     1 
ATOM   5079  O  O     . LEU G 3  85  ? -35.551 -38.743 47.748 1.00 60.06  ? 85   LEU G O     1 
ATOM   5080  C  CB    . LEU G 3  85  ? -38.665 -37.966 48.211 1.00 61.70  ? 85   LEU G CB    1 
ATOM   5081  C  CG    . LEU G 3  85  ? -39.710 -37.273 49.106 1.00 67.05  ? 85   LEU G CG    1 
ATOM   5082  C  CD1   . LEU G 3  85  ? -40.802 -38.269 49.438 1.00 70.13  ? 85   LEU G CD1   1 
ATOM   5083  C  CD2   . LEU G 3  85  ? -39.148 -36.698 50.389 1.00 65.38  ? 85   LEU G CD2   1 
ATOM   5084  N  N     . ALA G 3  86  ? -36.544 -38.215 45.836 1.00 58.77  ? 86   ALA G N     1 
ATOM   5085  C  CA    . ALA G 3  86  ? -35.655 -39.064 45.070 1.00 61.10  ? 86   ALA G CA    1 
ATOM   5086  C  C     . ALA G 3  86  ? -34.242 -38.553 45.160 1.00 60.34  ? 86   ALA G C     1 
ATOM   5087  O  O     . ALA G 3  86  ? -33.326 -39.312 45.350 1.00 57.79  ? 86   ALA G O     1 
ATOM   5088  C  CB    . ALA G 3  86  ? -36.086 -39.102 43.613 1.00 65.53  ? 86   ALA G CB    1 
ATOM   5089  N  N     . VAL G 3  87  ? -34.086 -37.246 44.994 1.00 65.37  ? 87   VAL G N     1 
ATOM   5090  C  CA    . VAL G 3  87  ? -32.775 -36.634 44.855 1.00 58.50  ? 87   VAL G CA    1 
ATOM   5091  C  C     . VAL G 3  87  ? -32.041 -36.596 46.198 1.00 55.65  ? 87   VAL G C     1 
ATOM   5092  O  O     . VAL G 3  87  ? -30.861 -36.940 46.269 1.00 51.35  ? 87   VAL G O     1 
ATOM   5093  C  CB    . VAL G 3  87  ? -32.895 -35.243 44.197 1.00 59.82  ? 87   VAL G CB    1 
ATOM   5094  C  CG1   . VAL G 3  87  ? -31.729 -34.327 44.550 1.00 67.67  ? 87   VAL G CG1   1 
ATOM   5095  C  CG2   . VAL G 3  87  ? -32.986 -35.391 42.689 1.00 57.60  ? 87   VAL G CG2   1 
ATOM   5096  N  N     . ARG G 3  88  ? -32.738 -36.248 47.267 1.00 50.35  ? 88   ARG G N     1 
ATOM   5097  C  CA    . ARG G 3  88  ? -32.052 -36.067 48.537 1.00 55.66  ? 88   ARG G CA    1 
ATOM   5098  C  C     . ARG G 3  88  ? -31.896 -37.397 49.329 1.00 51.65  ? 88   ARG G C     1 
ATOM   5099  O  O     . ARG G 3  88  ? -31.162 -37.479 50.294 1.00 54.47  ? 88   ARG G O     1 
ATOM   5100  C  CB    . ARG G 3  88  ? -32.734 -34.967 49.379 1.00 56.39  ? 88   ARG G CB    1 
ATOM   5101  C  CG    . ARG G 3  88  ? -33.468 -33.917 48.555 1.00 57.89  ? 88   ARG G CG    1 
ATOM   5102  C  CD    . ARG G 3  88  ? -32.799 -32.557 48.318 1.00 54.90  ? 88   ARG G CD    1 
ATOM   5103  N  NE    . ARG G 3  88  ? -31.477 -32.528 47.703 1.00 48.66  ? 88   ARG G NE    1 
ATOM   5104  C  CZ    . ARG G 3  88  ? -31.049 -31.619 46.812 1.00 45.17  ? 88   ARG G CZ    1 
ATOM   5105  N  NH1   . ARG G 3  88  ? -31.828 -30.674 46.319 1.00 40.30  ? 88   ARG G NH1   1 
ATOM   5106  N  NH2   . ARG G 3  88  ? -29.798 -31.677 46.361 1.00 52.35  ? 88   ARG G NH2   1 
ATOM   5107  N  N     . ASN G 3  89  ? -32.581 -38.441 48.925 1.00 51.46  ? 89   ASN G N     1 
ATOM   5108  C  CA    . ASN G 3  89  ? -32.322 -39.749 49.498 1.00 51.72  ? 89   ASN G CA    1 
ATOM   5109  C  C     . ASN G 3  89  ? -31.267 -40.535 48.733 1.00 52.15  ? 89   ASN G C     1 
ATOM   5110  O  O     . ASN G 3  89  ? -31.003 -41.656 49.110 1.00 61.12  ? 89   ASN G O     1 
ATOM   5111  C  CB    . ASN G 3  89  ? -33.621 -40.565 49.605 1.00 51.92  ? 89   ASN G CB    1 
ATOM   5112  C  CG    . ASN G 3  89  ? -34.514 -40.077 50.736 1.00 59.09  ? 89   ASN G CG    1 
ATOM   5113  O  OD1   . ASN G 3  89  ? -34.096 -40.024 51.904 1.00 59.16  ? 89   ASN G OD1   1 
ATOM   5114  N  ND2   . ASN G 3  89  ? -35.738 -39.685 50.399 1.00 58.92  ? 89   ASN G ND2   1 
ATOM   5115  N  N     . ASP G 3  90  ? -30.701 -39.986 47.650 1.00 51.11  ? 90   ASP G N     1 
ATOM   5116  C  CA    . ASP G 3  90  ? -29.563 -40.603 46.966 1.00 49.51  ? 90   ASP G CA    1 
ATOM   5117  C  C     . ASP G 3  90  ? -28.299 -39.735 47.079 1.00 51.60  ? 90   ASP G C     1 
ATOM   5118  O  O     . ASP G 3  90  ? -28.213 -38.596 46.603 1.00 49.58  ? 90   ASP G O     1 
ATOM   5119  C  CB    . ASP G 3  90  ? -29.865 -40.908 45.510 1.00 54.51  ? 90   ASP G CB    1 
ATOM   5120  C  CG    . ASP G 3  90  ? -28.630 -41.466 44.758 1.00 63.16  ? 90   ASP G CG    1 
ATOM   5121  O  OD1   . ASP G 3  90  ? -28.474 -42.707 44.650 1.00 69.95  ? 90   ASP G OD1   1 
ATOM   5122  O  OD2   . ASP G 3  90  ? -27.797 -40.662 44.294 1.00 60.79  ? 90   ASP G OD2   1 
ATOM   5123  N  N     . GLU G 3  91  ? -27.307 -40.326 47.709 1.00 59.62  ? 91   GLU G N     1 
ATOM   5124  C  CA    . GLU G 3  91  ? -26.087 -39.662 48.069 1.00 65.41  ? 91   GLU G CA    1 
ATOM   5125  C  C     . GLU G 3  91  ? -25.470 -38.955 46.863 1.00 62.77  ? 91   GLU G C     1 
ATOM   5126  O  O     . GLU G 3  91  ? -25.065 -37.787 46.972 1.00 61.54  ? 91   GLU G O     1 
ATOM   5127  C  CB    . GLU G 3  91  ? -25.121 -40.688 48.677 1.00 73.13  ? 91   GLU G CB    1 
ATOM   5128  C  CG    . GLU G 3  91  ? -23.881 -40.070 49.298 1.00 83.78  ? 91   GLU G CG    1 
ATOM   5129  C  CD    . GLU G 3  91  ? -22.819 -41.102 49.587 1.00 90.64  ? 91   GLU G CD    1 
ATOM   5130  O  OE1   . GLU G 3  91  ? -21.678 -40.919 49.119 1.00 100.68 ? 91   GLU G OE1   1 
ATOM   5131  O  OE2   . GLU G 3  91  ? -23.129 -42.104 50.267 1.00 96.73  ? 91   GLU G OE2   1 
ATOM   5132  N  N     . GLU G 3  92  ? -25.449 -39.643 45.717 1.00 61.10  ? 92   GLU G N     1 
ATOM   5133  C  CA    . GLU G 3  92  ? -24.830 -39.107 44.489 1.00 59.22  ? 92   GLU G CA    1 
ATOM   5134  C  C     . GLU G 3  92  ? -25.648 -38.024 43.759 1.00 58.18  ? 92   GLU G C     1 
ATOM   5135  O  O     . GLU G 3  92  ? -25.122 -36.947 43.434 1.00 55.63  ? 92   GLU G O     1 
ATOM   5136  C  CB    . GLU G 3  92  ? -24.490 -40.237 43.543 1.00 60.12  ? 92   GLU G CB    1 
ATOM   5137  C  CG    . GLU G 3  92  ? -23.487 -41.220 44.115 1.00 66.52  ? 92   GLU G CG    1 
ATOM   5138  C  CD    . GLU G 3  92  ? -22.539 -41.773 43.071 1.00 75.41  ? 92   GLU G CD    1 
ATOM   5139  O  OE1   . GLU G 3  92  ? -22.964 -41.964 41.900 1.00 77.60  ? 92   GLU G OE1   1 
ATOM   5140  O  OE2   . GLU G 3  92  ? -21.368 -42.028 43.428 1.00 81.80  ? 92   GLU G OE2   1 
ATOM   5141  N  N     . LEU G 3  93  ? -26.928 -38.291 43.518 1.00 54.16  ? 93   LEU G N     1 
ATOM   5142  C  CA    . LEU G 3  93  ? -27.824 -37.251 43.001 1.00 55.95  ? 93   LEU G CA    1 
ATOM   5143  C  C     . LEU G 3  93  ? -27.837 -36.018 43.898 1.00 55.75  ? 93   LEU G C     1 
ATOM   5144  O  O     . LEU G 3  93  ? -27.907 -34.891 43.379 1.00 51.45  ? 93   LEU G O     1 
ATOM   5145  C  CB    . LEU G 3  93  ? -29.268 -37.761 42.844 1.00 55.25  ? 93   LEU G CB    1 
ATOM   5146  C  CG    . LEU G 3  93  ? -29.485 -38.631 41.616 1.00 54.11  ? 93   LEU G CG    1 
ATOM   5147  C  CD1   . LEU G 3  93  ? -30.874 -39.214 41.609 1.00 54.02  ? 93   LEU G CD1   1 
ATOM   5148  C  CD2   . LEU G 3  93  ? -29.252 -37.843 40.346 1.00 57.90  ? 93   LEU G CD2   1 
ATOM   5149  N  N     . ASN G 3  94  ? -27.805 -36.229 45.225 1.00 51.64  ? 94   ASN G N     1 
ATOM   5150  C  CA    . ASN G 3  94  ? -27.832 -35.109 46.171 1.00 49.54  ? 94   ASN G CA    1 
ATOM   5151  C  C     . ASN G 3  94  ? -26.610 -34.261 46.044 1.00 50.76  ? 94   ASN G C     1 
ATOM   5152  O  O     . ASN G 3  94  ? -26.684 -33.054 46.229 1.00 53.18  ? 94   ASN G O     1 
ATOM   5153  C  CB    . ASN G 3  94  ? -27.913 -35.593 47.608 1.00 49.76  ? 94   ASN G CB    1 
ATOM   5154  C  CG    . ASN G 3  94  ? -28.030 -34.458 48.600 1.00 47.11  ? 94   ASN G CG    1 
ATOM   5155  O  OD1   . ASN G 3  94  ? -28.805 -33.527 48.436 1.00 55.25  ? 94   ASN G OD1   1 
ATOM   5156  N  ND2   . ASN G 3  94  ? -27.295 -34.549 49.644 1.00 45.95  ? 94   ASN G ND2   1 
ATOM   5157  N  N     . LYS G 3  95  ? -25.478 -34.892 45.725 1.00 53.20  ? 95   LYS G N     1 
ATOM   5158  C  CA    . LYS G 3  95  ? -24.224 -34.151 45.636 1.00 55.49  ? 95   LYS G CA    1 
ATOM   5159  C  C     . LYS G 3  95  ? -24.201 -33.314 44.384 1.00 52.70  ? 95   LYS G C     1 
ATOM   5160  O  O     . LYS G 3  95  ? -23.757 -32.170 44.415 1.00 47.03  ? 95   LYS G O     1 
ATOM   5161  C  CB    . LYS G 3  95  ? -23.012 -35.065 45.698 1.00 57.93  ? 95   LYS G CB    1 
ATOM   5162  C  CG    . LYS G 3  95  ? -21.689 -34.310 45.775 1.00 70.26  ? 95   LYS G CG    1 
ATOM   5163  C  CD    . LYS G 3  95  ? -20.513 -35.233 46.112 1.00 87.21  ? 95   LYS G CD    1 
ATOM   5164  C  CE    . LYS G 3  95  ? -19.314 -35.031 45.179 1.00 90.46  ? 95   LYS G CE    1 
ATOM   5165  N  NZ    . LYS G 3  95  ? -18.291 -36.098 45.388 1.00 92.02  ? 95   LYS G NZ    1 
ATOM   5166  N  N     . LEU G 3  96  ? -24.678 -33.905 43.296 1.00 54.35  ? 96   LEU G N     1 
ATOM   5167  C  CA    . LEU G 3  96  ? -24.785 -33.232 42.001 1.00 52.01  ? 96   LEU G CA    1 
ATOM   5168  C  C     . LEU G 3  96  ? -25.748 -32.083 42.079 1.00 53.70  ? 96   LEU G C     1 
ATOM   5169  O  O     . LEU G 3  96  ? -25.552 -31.071 41.429 1.00 61.02  ? 96   LEU G O     1 
ATOM   5170  C  CB    . LEU G 3  96  ? -25.285 -34.205 40.930 1.00 50.44  ? 96   LEU G CB    1 
ATOM   5171  C  CG    . LEU G 3  96  ? -25.281 -33.751 39.469 1.00 52.16  ? 96   LEU G CG    1 
ATOM   5172  C  CD1   . LEU G 3  96  ? -23.880 -33.608 38.897 1.00 53.00  ? 96   LEU G CD1   1 
ATOM   5173  C  CD2   . LEU G 3  96  ? -26.051 -34.761 38.645 1.00 51.13  ? 96   LEU G CD2   1 
ATOM   5174  N  N     . LEU G 3  97  ? -26.801 -32.229 42.867 1.00 52.07  ? 97   LEU G N     1 
ATOM   5175  C  CA    . LEU G 3  97  ? -27.798 -31.178 42.939 1.00 53.02  ? 97   LEU G CA    1 
ATOM   5176  C  C     . LEU G 3  97  ? -27.673 -30.417 44.236 1.00 54.46  ? 97   LEU G C     1 
ATOM   5177  O  O     . LEU G 3  97  ? -28.668 -29.831 44.728 1.00 52.70  ? 97   LEU G O     1 
ATOM   5178  C  CB    . LEU G 3  97  ? -29.207 -31.766 42.765 1.00 49.42  ? 97   LEU G CB    1 
ATOM   5179  C  CG    . LEU G 3  97  ? -29.470 -32.357 41.378 1.00 48.72  ? 97   LEU G CG    1 
ATOM   5180  C  CD1   . LEU G 3  97  ? -30.962 -32.454 41.106 1.00 50.35  ? 97   LEU G CD1   1 
ATOM   5181  C  CD2   . LEU G 3  97  ? -28.826 -31.543 40.269 1.00 47.32  ? 97   LEU G CD2   1 
ATOM   5182  N  N     . GLY G 3  98  ? -26.454 -30.414 44.779 1.00 48.20  ? 98   GLY G N     1 
ATOM   5183  C  CA    . GLY G 3  98  ? -26.222 -29.884 46.117 1.00 50.70  ? 98   GLY G CA    1 
ATOM   5184  C  C     . GLY G 3  98  ? -26.357 -28.377 46.282 1.00 50.54  ? 98   GLY G C     1 
ATOM   5185  O  O     . GLY G 3  98  ? -26.518 -27.896 47.380 1.00 48.31  ? 98   GLY G O     1 
ATOM   5186  N  N     . ARG G 3  99  ? -26.280 -27.632 45.193 1.00 53.89  ? 99   ARG G N     1 
ATOM   5187  C  CA    . ARG G 3  99  ? -26.521 -26.208 45.254 1.00 59.31  ? 99   ARG G CA    1 
ATOM   5188  C  C     . ARG G 3  99  ? -27.748 -25.834 44.406 1.00 55.64  ? 99   ARG G C     1 
ATOM   5189  O  O     . ARG G 3  99  ? -27.816 -24.748 43.837 1.00 61.35  ? 99   ARG G O     1 
ATOM   5190  C  CB    . ARG G 3  99  ? -25.257 -25.449 44.841 1.00 63.57  ? 99   ARG G CB    1 
ATOM   5191  C  CG    . ARG G 3  99  ? -24.142 -25.499 45.880 1.00 67.42  ? 99   ARG G CG    1 
ATOM   5192  C  CD    . ARG G 3  99  ? -22.862 -24.901 45.288 1.00 92.38  ? 99   ARG G CD    1 
ATOM   5193  N  NE    . ARG G 3  99  ? -21.620 -25.465 45.850 1.00 114.68 ? 99   ARG G NE    1 
ATOM   5194  C  CZ    . ARG G 3  99  ? -20.437 -25.552 45.223 1.00 115.83 ? 99   ARG G CZ    1 
ATOM   5195  N  NH1   . ARG G 3  99  ? -20.261 -25.124 43.973 1.00 112.53 ? 99   ARG G NH1   1 
ATOM   5196  N  NH2   . ARG G 3  99  ? -19.403 -26.086 45.862 1.00 120.02 ? 99   ARG G NH2   1 
ATOM   5197  N  N     . VAL G 3  100 ? -28.727 -26.736 44.371 1.00 51.06  ? 100  VAL G N     1 
ATOM   5198  C  CA    . VAL G 3  100 ? -29.939 -26.561 43.591 1.00 46.54  ? 100  VAL G CA    1 
ATOM   5199  C  C     . VAL G 3  100 ? -31.161 -26.720 44.445 1.00 46.22  ? 100  VAL G C     1 
ATOM   5200  O  O     . VAL G 3  100 ? -31.213 -27.582 45.324 1.00 51.70  ? 100  VAL G O     1 
ATOM   5201  C  CB    . VAL G 3  100 ? -30.043 -27.625 42.510 1.00 46.59  ? 100  VAL G CB    1 
ATOM   5202  C  CG1   . VAL G 3  100 ? -31.458 -27.715 41.963 1.00 47.09  ? 100  VAL G CG1   1 
ATOM   5203  C  CG2   . VAL G 3  100 ? -29.085 -27.316 41.393 1.00 45.54  ? 100  VAL G CG2   1 
ATOM   5204  N  N     . THR G 3  101 ? -32.152 -25.894 44.167 1.00 47.99  ? 101  THR G N     1 
ATOM   5205  C  CA    . THR G 3  101 ? -33.407 -25.912 44.887 1.00 49.53  ? 101  THR G CA    1 
ATOM   5206  C  C     . THR G 3  101 ? -34.463 -26.300 43.906 1.00 53.52  ? 101  THR G C     1 
ATOM   5207  O  O     . THR G 3  101 ? -34.626 -25.627 42.883 1.00 54.71  ? 101  THR G O     1 
ATOM   5208  C  CB    . THR G 3  101 ? -33.728 -24.526 45.435 1.00 51.12  ? 101  THR G CB    1 
ATOM   5209  O  OG1   . THR G 3  101 ? -32.703 -24.162 46.346 1.00 46.54  ? 101  THR G OG1   1 
ATOM   5210  C  CG2   . THR G 3  101 ? -35.067 -24.500 46.160 1.00 49.63  ? 101  THR G CG2   1 
ATOM   5211  N  N     . ILE G 3  102 ? -35.143 -27.402 44.213 1.00 56.09  ? 102  ILE G N     1 
ATOM   5212  C  CA    . ILE G 3  102 ? -36.317 -27.860 43.479 1.00 54.18  ? 102  ILE G CA    1 
ATOM   5213  C  C     . ILE G 3  102 ? -37.544 -27.157 44.021 1.00 53.60  ? 102  ILE G C     1 
ATOM   5214  O  O     . ILE G 3  102 ? -37.939 -27.381 45.154 1.00 56.51  ? 102  ILE G O     1 
ATOM   5215  C  CB    . ILE G 3  102 ? -36.521 -29.371 43.677 1.00 56.43  ? 102  ILE G CB    1 
ATOM   5216  C  CG1   . ILE G 3  102 ? -35.358 -30.126 43.047 1.00 57.69  ? 102  ILE G CG1   1 
ATOM   5217  C  CG2   . ILE G 3  102 ? -37.811 -29.842 43.038 1.00 54.72  ? 102  ILE G CG2   1 
ATOM   5218  C  CD1   . ILE G 3  102 ? -35.200 -31.516 43.598 1.00 58.80  ? 102  ILE G CD1   1 
ATOM   5219  N  N     . ALA G 3  103 ? -38.155 -26.303 43.213 1.00 57.94  ? 103  ALA G N     1 
ATOM   5220  C  CA    . ALA G 3  103 ? -39.358 -25.601 43.644 1.00 58.92  ? 103  ALA G CA    1 
ATOM   5221  C  C     . ALA G 3  103 ? -40.395 -26.602 44.102 1.00 57.46  ? 103  ALA G C     1 
ATOM   5222  O  O     . ALA G 3  103 ? -40.597 -27.619 43.457 1.00 63.91  ? 103  ALA G O     1 
ATOM   5223  C  CB    . ALA G 3  103 ? -39.910 -24.771 42.514 1.00 59.07  ? 103  ALA G CB    1 
ATOM   5224  N  N     . GLN G 3  104 ? -41.045 -26.316 45.220 1.00 56.04  ? 104  GLN G N     1 
ATOM   5225  C  CA    . GLN G 3  104 ? -42.149 -27.146 45.721 1.00 58.86  ? 104  GLN G CA    1 
ATOM   5226  C  C     . GLN G 3  104 ? -41.701 -28.550 46.158 1.00 57.75  ? 104  GLN G C     1 
ATOM   5227  O  O     . GLN G 3  104 ? -42.462 -29.507 46.085 1.00 68.37  ? 104  GLN G O     1 
ATOM   5228  C  CB    . GLN G 3  104 ? -43.318 -27.197 44.705 1.00 60.38  ? 104  GLN G CB    1 
ATOM   5229  C  CG    . GLN G 3  104 ? -44.291 -26.033 44.813 1.00 63.16  ? 104  GLN G CG    1 
ATOM   5230  C  CD    . GLN G 3  104 ? -44.852 -25.852 46.237 1.00 74.70  ? 104  GLN G CD    1 
ATOM   5231  O  OE1   . GLN G 3  104 ? -45.674 -26.664 46.721 1.00 74.75  ? 104  GLN G OE1   1 
ATOM   5232  N  NE2   . GLN G 3  104 ? -44.401 -24.783 46.923 1.00 69.62  ? 104  GLN G NE2   1 
ATOM   5233  N  N     . GLY G 3  105 ? -40.482 -28.660 46.666 1.00 53.77  ? 105  GLY G N     1 
ATOM   5234  C  CA    . GLY G 3  105 ? -39.953 -29.949 47.092 1.00 52.73  ? 105  GLY G CA    1 
ATOM   5235  C  C     . GLY G 3  105 ? -40.032 -30.248 48.584 1.00 50.23  ? 105  GLY G C     1 
ATOM   5236  O  O     . GLY G 3  105 ? -39.921 -31.402 49.002 1.00 46.86  ? 105  GLY G O     1 
ATOM   5237  N  N     . GLY G 3  106 ? -40.214 -29.227 49.410 1.00 45.32  ? 106  GLY G N     1 
ATOM   5238  C  CA    . GLY G 3  106 ? -40.042 -29.432 50.837 1.00 46.02  ? 106  GLY G CA    1 
ATOM   5239  C  C     . GLY G 3  106 ? -38.664 -30.009 51.216 1.00 52.46  ? 106  GLY G C     1 
ATOM   5240  O  O     . GLY G 3  106 ? -37.657 -29.897 50.479 1.00 47.51  ? 106  GLY G O     1 
ATOM   5241  N  N     . VAL G 3  107 ? -38.632 -30.615 52.394 1.00 51.23  ? 107  VAL G N     1 
ATOM   5242  C  CA    . VAL G 3  107 ? -37.433 -31.218 52.919 1.00 50.80  ? 107  VAL G CA    1 
ATOM   5243  C  C     . VAL G 3  107 ? -37.688 -32.631 53.420 1.00 54.27  ? 107  VAL G C     1 
ATOM   5244  O  O     . VAL G 3  107 ? -38.841 -33.009 53.630 1.00 62.59  ? 107  VAL G O     1 
ATOM   5245  C  CB    . VAL G 3  107 ? -36.918 -30.399 54.078 1.00 49.72  ? 107  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G 3  107 ? -36.773 -28.967 53.637 1.00 49.08  ? 107  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G 3  107 ? -37.848 -30.495 55.282 1.00 56.08  ? 107  VAL G CG2   1 
ATOM   5248  N  N     . LEU G 3  108 ? -36.623 -33.400 53.622 1.00 53.75  ? 108  LEU G N     1 
ATOM   5249  C  CA    . LEU G 3  108 ? -36.750 -34.734 54.232 1.00 57.17  ? 108  LEU G CA    1 
ATOM   5250  C  C     . LEU G 3  108 ? -37.180 -34.677 55.673 1.00 55.90  ? 108  LEU G C     1 
ATOM   5251  O  O     . LEU G 3  108 ? -36.585 -33.975 56.434 1.00 63.48  ? 108  LEU G O     1 
ATOM   5252  C  CB    . LEU G 3  108 ? -35.412 -35.442 54.232 1.00 53.72  ? 108  LEU G CB    1 
ATOM   5253  C  CG    . LEU G 3  108 ? -34.855 -35.705 52.855 1.00 51.59  ? 108  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G 3  108 ? -33.778 -36.769 52.998 1.00 47.46  ? 108  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G 3  108 ? -35.969 -36.140 51.904 1.00 52.21  ? 108  LEU G CD2   1 
ATOM   5256  N  N     . PRO G 3  109 ? -38.211 -35.432 56.059 1.00 70.02  ? 109  PRO G N     1 
ATOM   5257  C  CA    . PRO G 3  109 ? -38.481 -35.588 57.480 1.00 68.78  ? 109  PRO G CA    1 
ATOM   5258  C  C     . PRO G 3  109 ? -37.200 -35.874 58.235 1.00 65.34  ? 109  PRO G C     1 
ATOM   5259  O  O     . PRO G 3  109 ? -36.534 -36.833 57.906 1.00 65.29  ? 109  PRO G O     1 
ATOM   5260  C  CB    . PRO G 3  109 ? -39.386 -36.821 57.506 1.00 67.70  ? 109  PRO G CB    1 
ATOM   5261  C  CG    . PRO G 3  109 ? -40.197 -36.652 56.269 1.00 71.84  ? 109  PRO G CG    1 
ATOM   5262  C  CD    . PRO G 3  109 ? -39.202 -36.160 55.246 1.00 73.31  ? 109  PRO G CD    1 
ATOM   5263  N  N     . ASN G 3  110 ? -36.854 -35.032 59.204 1.00 63.83  ? 110  ASN G N     1 
ATOM   5264  C  CA    . ASN G 3  110 ? -35.644 -35.215 59.992 1.00 64.04  ? 110  ASN G CA    1 
ATOM   5265  C  C     . ASN G 3  110 ? -35.653 -34.329 61.238 1.00 68.04  ? 110  ASN G C     1 
ATOM   5266  O  O     . ASN G 3  110 ? -35.739 -33.104 61.148 1.00 64.67  ? 110  ASN G O     1 
ATOM   5267  C  CB    . ASN G 3  110 ? -34.398 -34.908 59.155 1.00 67.41  ? 110  ASN G CB    1 
ATOM   5268  C  CG    . ASN G 3  110 ? -33.098 -35.222 59.883 1.00 72.62  ? 110  ASN G CG    1 
ATOM   5269  O  OD1   . ASN G 3  110 ? -33.090 -35.803 60.976 1.00 87.71  ? 110  ASN G OD1   1 
ATOM   5270  N  ND2   . ASN G 3  110 ? -31.988 -34.843 59.274 1.00 73.10  ? 110  ASN G ND2   1 
ATOM   5271  N  N     . ILE G 3  111 ? -35.541 -34.975 62.394 1.00 68.32  ? 111  ILE G N     1 
ATOM   5272  C  CA    . ILE G 3  111 ? -35.576 -34.305 63.678 1.00 65.24  ? 111  ILE G CA    1 
ATOM   5273  C  C     . ILE G 3  111 ? -34.386 -34.765 64.464 1.00 66.25  ? 111  ILE G C     1 
ATOM   5274  O  O     . ILE G 3  111 ? -34.184 -35.960 64.608 1.00 66.48  ? 111  ILE G O     1 
ATOM   5275  C  CB    . ILE G 3  111 ? -36.835 -34.687 64.474 1.00 67.28  ? 111  ILE G CB    1 
ATOM   5276  C  CG1   . ILE G 3  111 ? -38.099 -34.422 63.632 1.00 70.28  ? 111  ILE G CG1   1 
ATOM   5277  C  CG2   . ILE G 3  111 ? -36.869 -33.906 65.775 1.00 71.18  ? 111  ILE G CG2   1 
ATOM   5278  C  CD1   . ILE G 3  111 ? -39.413 -34.808 64.280 1.00 69.76  ? 111  ILE G CD1   1 
ATOM   5279  N  N     . GLN G 3  112 ? -33.611 -33.810 64.976 1.00 75.37  ? 112  GLN G N     1 
ATOM   5280  C  CA    . GLN G 3  112 ? -32.394 -34.105 65.745 1.00 74.35  ? 112  GLN G CA    1 
ATOM   5281  C  C     . GLN G 3  112 ? -32.770 -34.817 67.018 1.00 72.43  ? 112  GLN G C     1 
ATOM   5282  O  O     . GLN G 3  112 ? -33.673 -34.360 67.726 1.00 77.53  ? 112  GLN G O     1 
ATOM   5283  C  CB    . GLN G 3  112 ? -31.670 -32.817 66.130 1.00 77.64  ? 112  GLN G CB    1 
ATOM   5284  C  CG    . GLN G 3  112 ? -31.190 -32.016 64.958 1.00 73.93  ? 112  GLN G CG    1 
ATOM   5285  C  CD    . GLN G 3  112 ? -30.238 -32.816 64.125 1.00 72.66  ? 112  GLN G CD    1 
ATOM   5286  O  OE1   . GLN G 3  112 ? -29.138 -33.172 64.570 1.00 76.20  ? 112  GLN G OE1   1 
ATOM   5287  N  NE2   . GLN G 3  112 ? -30.657 -33.132 62.920 1.00 71.65  ? 112  GLN G NE2   1 
ATOM   5288  N  N     . SER G 3  113 ? -32.057 -35.896 67.335 1.00 71.24  ? 113  SER G N     1 
ATOM   5289  C  CA    . SER G 3  113 ? -32.509 -36.828 68.376 1.00 75.27  ? 113  SER G CA    1 
ATOM   5290  C  C     . SER G 3  113 ? -32.654 -36.185 69.742 1.00 71.04  ? 113  SER G C     1 
ATOM   5291  O  O     . SER G 3  113 ? -33.595 -36.492 70.453 1.00 72.92  ? 113  SER G O     1 
ATOM   5292  C  CB    . SER G 3  113 ? -31.594 -38.043 68.466 1.00 76.57  ? 113  SER G CB    1 
ATOM   5293  O  OG    . SER G 3  113 ? -30.248 -37.629 68.492 1.00 85.65  ? 113  SER G OG    1 
ATOM   5294  N  N     . VAL G 3  114 ? -31.765 -35.254 70.080 1.00 71.30  ? 114  VAL G N     1 
ATOM   5295  C  CA    . VAL G 3  114 ? -31.872 -34.528 71.356 1.00 70.49  ? 114  VAL G CA    1 
ATOM   5296  C  C     . VAL G 3  114 ? -33.170 -33.730 71.533 1.00 68.49  ? 114  VAL G C     1 
ATOM   5297  O  O     . VAL G 3  114 ? -33.495 -33.339 72.646 1.00 63.46  ? 114  VAL G O     1 
ATOM   5298  C  CB    . VAL G 3  114 ? -30.708 -33.543 71.535 1.00 69.53  ? 114  VAL G CB    1 
ATOM   5299  C  CG1   . VAL G 3  114 ? -30.921 -32.316 70.657 1.00 71.12  ? 114  VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G 3  114 ? -30.559 -33.150 72.997 1.00 65.62  ? 114  VAL G CG2   1 
ATOM   5301  N  N     . LEU G 3  115 ? -33.880 -33.455 70.437 1.00 69.64  ? 115  LEU G N     1 
ATOM   5302  C  CA    . LEU G 3  115 ? -35.161 -32.756 70.501 1.00 70.14  ? 115  LEU G CA    1 
ATOM   5303  C  C     . LEU G 3  115 ? -36.355 -33.681 70.709 1.00 73.45  ? 115  LEU G C     1 
ATOM   5304  O  O     . LEU G 3  115 ? -37.462 -33.190 70.895 1.00 74.01  ? 115  LEU G O     1 
ATOM   5305  C  CB    . LEU G 3  115 ? -35.380 -31.909 69.240 1.00 70.69  ? 115  LEU G CB    1 
ATOM   5306  C  CG    . LEU G 3  115 ? -34.313 -30.830 68.974 1.00 70.23  ? 115  LEU G CG    1 
ATOM   5307  C  CD1   . LEU G 3  115 ? -34.619 -30.084 67.692 1.00 69.04  ? 115  LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G 3  115 ? -34.187 -29.827 70.114 1.00 69.90  ? 115  LEU G CD2   1 
ATOM   5309  N  N     . LEU G 3  116 ? -36.145 -35.002 70.680 1.00 81.64  ? 116  LEU G N     1 
ATOM   5310  C  CA    . LEU G 3  116 ? -37.197 -35.961 71.059 1.00 83.24  ? 116  LEU G CA    1 
ATOM   5311  C  C     . LEU G 3  116 ? -37.444 -35.964 72.585 1.00 94.01  ? 116  LEU G C     1 
ATOM   5312  O  O     . LEU G 3  116 ? -36.495 -35.830 73.379 1.00 83.43  ? 116  LEU G O     1 
ATOM   5313  C  CB    . LEU G 3  116 ? -36.834 -37.372 70.606 1.00 78.00  ? 116  LEU G CB    1 
ATOM   5314  C  CG    . LEU G 3  116 ? -36.654 -37.577 69.101 1.00 85.19  ? 116  LEU G CG    1 
ATOM   5315  C  CD1   . LEU G 3  116 ? -36.078 -38.965 68.800 1.00 84.38  ? 116  LEU G CD1   1 
ATOM   5316  C  CD2   . LEU G 3  116 ? -37.955 -37.345 68.340 1.00 82.72  ? 116  LEU G CD2   1 
ATOM   5317  N  N     . PRO G 3  117 ? -38.719 -36.137 73.000 1.00 101.23 ? 117  PRO G N     1 
ATOM   5318  C  CA    . PRO G 3  117 ? -39.094 -36.228 74.419 1.00 107.66 ? 117  PRO G CA    1 
ATOM   5319  C  C     . PRO G 3  117 ? -38.565 -37.505 75.064 1.00 110.91 ? 117  PRO G C     1 
ATOM   5320  O  O     . PRO G 3  117 ? -38.318 -38.480 74.348 1.00 123.93 ? 117  PRO G O     1 
ATOM   5321  C  CB    . PRO G 3  117 ? -40.621 -36.270 74.371 1.00 110.87 ? 117  PRO G CB    1 
ATOM   5322  C  CG    . PRO G 3  117 ? -40.937 -36.890 73.054 1.00 108.90 ? 117  PRO G CG    1 
ATOM   5323  C  CD    . PRO G 3  117 ? -39.866 -36.412 72.115 1.00 106.14 ? 117  PRO G CD    1 
ATOM   5324  N  N     . LYS G 3  118 ? -38.412 -37.510 76.392 1.00 114.37 ? 118  LYS G N     1 
ATOM   5325  C  CA    . LYS G 3  118 ? -37.810 -38.666 77.100 1.00 126.50 ? 118  LYS G CA    1 
ATOM   5326  C  C     . LYS G 3  118 ? -38.770 -39.860 77.327 1.00 126.14 ? 118  LYS G C     1 
ATOM   5327  O  O     . LYS G 3  118 ? -39.968 -39.675 77.530 1.00 122.62 ? 118  LYS G O     1 
ATOM   5328  C  CB    . LYS G 3  118 ? -37.159 -38.207 78.417 1.00 131.27 ? 118  LYS G CB    1 
ATOM   5329  C  CG    . LYS G 3  118 ? -35.734 -37.698 78.227 1.00 142.10 ? 118  LYS G CG    1 
ATOM   5330  C  CD    . LYS G 3  118 ? -35.513 -36.292 78.768 1.00 155.35 ? 118  LYS G CD    1 
ATOM   5331  C  CE    . LYS G 3  118 ? -34.275 -35.656 78.137 1.00 161.64 ? 118  LYS G CE    1 
ATOM   5332  N  NZ    . LYS G 3  118 ? -33.946 -34.303 78.680 1.00 161.35 ? 118  LYS G NZ    1 
ATOM   5333  N  N     . LYS G 3  119 ? -38.223 -41.078 77.294 1.00 134.62 ? 119  LYS G N     1 
ATOM   5334  C  CA    . LYS G 3  119 ? -39.021 -42.319 77.401 1.00 133.82 ? 119  LYS G CA    1 
ATOM   5335  C  C     . LYS G 3  119 ? -39.298 -42.645 78.874 1.00 125.35 ? 119  LYS G C     1 
ATOM   5336  O  O     . LYS G 3  119 ? -40.399 -42.448 79.375 1.00 112.30 ? 119  LYS G O     1 
ATOM   5337  C  CB    . LYS G 3  119 ? -38.320 -43.536 76.748 1.00 134.45 ? 119  LYS G CB    1 
ATOM   5338  C  CG    . LYS G 3  119 ? -37.344 -43.249 75.606 1.00 132.79 ? 119  LYS G CG    1 
ATOM   5339  C  CD    . LYS G 3  119 ? -37.661 -44.045 74.348 1.00 128.02 ? 119  LYS G CD    1 
ATOM   5340  C  CE    . LYS G 3  119 ? -38.767 -43.351 73.564 1.00 128.12 ? 119  LYS G CE    1 
ATOM   5341  N  NZ    . LYS G 3  119 ? -39.100 -44.031 72.285 1.00 122.86 ? 119  LYS G NZ    1 
ATOM   5342  N  N     . LYS H 4  31  ? -46.816 -16.717 20.192 1.00 110.46 ? 28   LYS H N     1 
ATOM   5343  C  CA    . LYS H 4  31  ? -46.670 -17.245 18.803 1.00 116.62 ? 28   LYS H CA    1 
ATOM   5344  C  C     . LYS H 4  31  ? -45.355 -17.982 18.620 1.00 109.34 ? 28   LYS H C     1 
ATOM   5345  O  O     . LYS H 4  31  ? -45.344 -19.086 18.075 1.00 111.34 ? 28   LYS H O     1 
ATOM   5346  C  CB    . LYS H 4  31  ? -46.763 -16.114 17.764 1.00 121.36 ? 28   LYS H CB    1 
ATOM   5347  C  CG    . LYS H 4  31  ? -46.773 -16.586 16.309 1.00 125.63 ? 28   LYS H CG    1 
ATOM   5348  C  CD    . LYS H 4  31  ? -47.142 -15.464 15.340 1.00 126.24 ? 28   LYS H CD    1 
ATOM   5349  C  CE    . LYS H 4  31  ? -48.645 -15.189 15.299 1.00 118.41 ? 28   LYS H CE    1 
ATOM   5350  N  NZ    . LYS H 4  31  ? -48.966 -13.868 14.694 1.00 109.25 ? 28   LYS H NZ    1 
ATOM   5351  N  N     . THR H 4  32  ? -44.253 -17.368 19.057 1.00 101.09 ? 29   THR H N     1 
ATOM   5352  C  CA    . THR H 4  32  ? -42.935 -17.954 18.827 1.00 106.25 ? 29   THR H CA    1 
ATOM   5353  C  C     . THR H 4  32  ? -42.856 -19.314 19.523 1.00 108.70 ? 29   THR H C     1 
ATOM   5354  O  O     . THR H 4  32  ? -43.286 -19.474 20.671 1.00 97.41  ? 29   THR H O     1 
ATOM   5355  C  CB    . THR H 4  32  ? -41.761 -17.019 19.225 1.00 104.32 ? 29   THR H CB    1 
ATOM   5356  O  OG1   . THR H 4  32  ? -40.605 -17.349 18.443 1.00 93.00  ? 29   THR H OG1   1 
ATOM   5357  C  CG2   . THR H 4  32  ? -41.406 -17.126 20.717 1.00 109.51 ? 29   THR H CG2   1 
ATOM   5358  N  N     . ARG H 4  33  ? -42.347 -20.297 18.787 1.00 115.50 ? 30   ARG H N     1 
ATOM   5359  C  CA    . ARG H 4  33  ? -42.283 -21.671 19.264 1.00 121.33 ? 30   ARG H CA    1 
ATOM   5360  C  C     . ARG H 4  33  ? -41.350 -21.769 20.476 1.00 117.64 ? 30   ARG H C     1 
ATOM   5361  O  O     . ARG H 4  33  ? -40.182 -21.368 20.396 1.00 114.59 ? 30   ARG H O     1 
ATOM   5362  C  CB    . ARG H 4  33  ? -41.803 -22.586 18.136 1.00 121.55 ? 30   ARG H CB    1 
ATOM   5363  C  CG    . ARG H 4  33  ? -42.886 -22.946 17.132 1.00 127.28 ? 30   ARG H CG    1 
ATOM   5364  C  CD    . ARG H 4  33  ? -42.318 -23.528 15.843 1.00 137.05 ? 30   ARG H CD    1 
ATOM   5365  N  NE    . ARG H 4  33  ? -41.044 -24.236 16.035 1.00 149.33 ? 30   ARG H NE    1 
ATOM   5366  C  CZ    . ARG H 4  33  ? -40.904 -25.510 16.421 1.00 150.43 ? 30   ARG H CZ    1 
ATOM   5367  N  NH1   . ARG H 4  33  ? -41.957 -26.280 16.691 1.00 149.08 ? 30   ARG H NH1   1 
ATOM   5368  N  NH2   . ARG H 4  33  ? -39.683 -26.022 16.549 1.00 146.03 ? 30   ARG H NH2   1 
ATOM   5369  N  N     . LYS H 4  34  ? -41.866 -22.286 21.591 1.00 102.44 ? 31   LYS H N     1 
ATOM   5370  C  CA    . LYS H 4  34  ? -41.069 -22.415 22.807 1.00 104.88 ? 31   LYS H CA    1 
ATOM   5371  C  C     . LYS H 4  34  ? -40.623 -23.881 23.045 1.00 96.23  ? 31   LYS H C     1 
ATOM   5372  O  O     . LYS H 4  34  ? -41.366 -24.694 23.600 1.00 91.00  ? 31   LYS H O     1 
ATOM   5373  C  CB    . LYS H 4  34  ? -41.834 -21.836 24.011 1.00 111.28 ? 31   LYS H CB    1 
ATOM   5374  C  CG    . LYS H 4  34  ? -40.955 -21.047 24.982 1.00 126.08 ? 31   LYS H CG    1 
ATOM   5375  C  CD    . LYS H 4  34  ? -39.947 -21.929 25.724 1.00 137.00 ? 31   LYS H CD    1 
ATOM   5376  C  CE    . LYS H 4  34  ? -38.956 -21.127 26.564 1.00 141.34 ? 31   LYS H CE    1 
ATOM   5377  N  NZ    . LYS H 4  34  ? -37.765 -20.666 25.790 1.00 141.74 ? 31   LYS H NZ    1 
ATOM   5378  N  N     . GLU H 4  35  ? -39.400 -24.192 22.614 1.00 82.81  ? 32   GLU H N     1 
ATOM   5379  C  CA    . GLU H 4  35  ? -38.784 -25.506 22.805 1.00 80.89  ? 32   GLU H CA    1 
ATOM   5380  C  C     . GLU H 4  35  ? -38.582 -25.943 24.261 1.00 79.20  ? 32   GLU H C     1 
ATOM   5381  O  O     . GLU H 4  35  ? -38.533 -25.128 25.185 1.00 82.30  ? 32   GLU H O     1 
ATOM   5382  C  CB    . GLU H 4  35  ? -37.408 -25.525 22.176 1.00 83.51  ? 32   GLU H CB    1 
ATOM   5383  C  CG    . GLU H 4  35  ? -37.345 -25.783 20.695 1.00 84.22  ? 32   GLU H CG    1 
ATOM   5384  C  CD    . GLU H 4  35  ? -35.892 -25.905 20.285 1.00 95.94  ? 32   GLU H CD    1 
ATOM   5385  O  OE1   . GLU H 4  35  ? -35.583 -26.485 19.219 1.00 87.00  ? 32   GLU H OE1   1 
ATOM   5386  O  OE2   . GLU H 4  35  ? -35.033 -25.430 21.072 1.00 98.65  ? 32   GLU H OE2   1 
ATOM   5387  N  N     . SER H 4  36  ? -38.375 -27.249 24.414 1.00 75.32  ? 33   SER H N     1 
ATOM   5388  C  CA    . SER H 4  36  ? -38.380 -27.929 25.695 1.00 71.09  ? 33   SER H CA    1 
ATOM   5389  C  C     . SER H 4  36  ? -37.898 -29.350 25.486 1.00 69.72  ? 33   SER H C     1 
ATOM   5390  O  O     . SER H 4  36  ? -38.123 -29.919 24.423 1.00 69.99  ? 33   SER H O     1 
ATOM   5391  C  CB    . SER H 4  36  ? -39.810 -27.979 26.228 1.00 73.24  ? 33   SER H CB    1 
ATOM   5392  O  OG    . SER H 4  36  ? -39.905 -28.790 27.381 1.00 72.56  ? 33   SER H OG    1 
ATOM   5393  N  N     . TYR H 4  37  ? -37.249 -29.929 26.493 1.00 70.52  ? 34   TYR H N     1 
ATOM   5394  C  CA    . TYR H 4  37  ? -36.927 -31.373 26.481 1.00 66.17  ? 34   TYR H CA    1 
ATOM   5395  C  C     . TYR H 4  37  ? -38.120 -32.234 26.935 1.00 61.69  ? 34   TYR H C     1 
ATOM   5396  O  O     . TYR H 4  37  ? -38.013 -33.454 26.943 1.00 58.45  ? 34   TYR H O     1 
ATOM   5397  C  CB    . TYR H 4  37  ? -35.714 -31.705 27.376 1.00 64.55  ? 34   TYR H CB    1 
ATOM   5398  C  CG    . TYR H 4  37  ? -34.377 -31.180 26.904 1.00 67.26  ? 34   TYR H CG    1 
ATOM   5399  C  CD1   . TYR H 4  37  ? -33.829 -30.014 27.431 1.00 66.87  ? 34   TYR H CD1   1 
ATOM   5400  C  CD2   . TYR H 4  37  ? -33.631 -31.876 25.958 1.00 69.79  ? 34   TYR H CD2   1 
ATOM   5401  C  CE1   . TYR H 4  37  ? -32.586 -29.552 27.005 1.00 67.92  ? 34   TYR H CE1   1 
ATOM   5402  C  CE2   . TYR H 4  37  ? -32.403 -31.408 25.510 1.00 64.25  ? 34   TYR H CE2   1 
ATOM   5403  C  CZ    . TYR H 4  37  ? -31.883 -30.251 26.030 1.00 65.16  ? 34   TYR H CZ    1 
ATOM   5404  O  OH    . TYR H 4  37  ? -30.648 -29.803 25.592 1.00 67.32  ? 34   TYR H OH    1 
ATOM   5405  N  N     . ALA H 4  38  ? -39.250 -31.607 27.284 1.00 66.89  ? 35   ALA H N     1 
ATOM   5406  C  CA    . ALA H 4  38  ? -40.423 -32.302 27.881 1.00 69.77  ? 35   ALA H CA    1 
ATOM   5407  C  C     . ALA H 4  38  ? -40.830 -33.635 27.247 1.00 71.68  ? 35   ALA H C     1 
ATOM   5408  O  O     . ALA H 4  38  ? -41.053 -34.612 27.961 1.00 74.77  ? 35   ALA H O     1 
ATOM   5409  C  CB    . ALA H 4  38  ? -41.636 -31.374 27.924 1.00 66.87  ? 35   ALA H CB    1 
ATOM   5410  N  N     . ILE H 4  39  ? -40.951 -33.680 25.928 1.00 73.08  ? 36   ILE H N     1 
ATOM   5411  C  CA    . ILE H 4  39  ? -41.403 -34.923 25.271 1.00 86.97  ? 36   ILE H CA    1 
ATOM   5412  C  C     . ILE H 4  39  ? -40.378 -36.049 25.415 1.00 80.24  ? 36   ILE H C     1 
ATOM   5413  O  O     . ILE H 4  39  ? -40.750 -37.222 25.598 1.00 76.95  ? 36   ILE H O     1 
ATOM   5414  C  CB    . ILE H 4  39  ? -41.821 -34.755 23.769 1.00 93.29  ? 36   ILE H CB    1 
ATOM   5415  C  CG1   . ILE H 4  39  ? -40.952 -33.733 23.042 1.00 87.22  ? 36   ILE H CG1   1 
ATOM   5416  C  CG2   . ILE H 4  39  ? -43.295 -34.348 23.656 1.00 97.01  ? 36   ILE H CG2   1 
ATOM   5417  C  CD1   . ILE H 4  39  ? -40.935 -33.955 21.560 1.00 89.37  ? 36   ILE H CD1   1 
ATOM   5418  N  N     . TYR H 4  40  ? -39.100 -35.689 25.364 1.00 68.61  ? 37   TYR H N     1 
ATOM   5419  C  CA    . TYR H 4  40  ? -38.052 -36.685 25.493 1.00 69.22  ? 37   TYR H CA    1 
ATOM   5420  C  C     . TYR H 4  40  ? -38.020 -37.178 26.939 1.00 68.94  ? 37   TYR H C     1 
ATOM   5421  O  O     . TYR H 4  40  ? -37.846 -38.373 27.204 1.00 68.11  ? 37   TYR H O     1 
ATOM   5422  C  CB    . TYR H 4  40  ? -36.715 -36.117 25.105 1.00 67.76  ? 37   TYR H CB    1 
ATOM   5423  C  CG    . TYR H 4  40  ? -36.775 -35.350 23.834 1.00 74.07  ? 37   TYR H CG    1 
ATOM   5424  C  CD1   . TYR H 4  40  ? -36.829 -33.973 23.844 1.00 82.78  ? 37   TYR H CD1   1 
ATOM   5425  C  CD2   . TYR H 4  40  ? -36.769 -35.996 22.608 1.00 81.59  ? 37   TYR H CD2   1 
ATOM   5426  C  CE1   . TYR H 4  40  ? -36.886 -33.248 22.663 1.00 88.20  ? 37   TYR H CE1   1 
ATOM   5427  C  CE2   . TYR H 4  40  ? -36.808 -35.286 21.419 1.00 85.09  ? 37   TYR H CE2   1 
ATOM   5428  C  CZ    . TYR H 4  40  ? -36.877 -33.910 21.452 1.00 84.45  ? 37   TYR H CZ    1 
ATOM   5429  O  OH    . TYR H 4  40  ? -36.929 -33.191 20.279 1.00 93.12  ? 37   TYR H OH    1 
ATOM   5430  N  N     . VAL H 4  41  ? -38.217 -36.264 27.878 1.00 60.06  ? 38   VAL H N     1 
ATOM   5431  C  CA    . VAL H 4  41  ? -38.374 -36.670 29.267 1.00 64.15  ? 38   VAL H CA    1 
ATOM   5432  C  C     . VAL H 4  41  ? -39.545 -37.655 29.390 1.00 67.05  ? 38   VAL H C     1 
ATOM   5433  O  O     . VAL H 4  41  ? -39.412 -38.693 30.032 1.00 58.94  ? 38   VAL H O     1 
ATOM   5434  C  CB    . VAL H 4  41  ? -38.615 -35.455 30.181 1.00 67.21  ? 38   VAL H CB    1 
ATOM   5435  C  CG1   . VAL H 4  41  ? -39.027 -35.893 31.569 1.00 64.36  ? 38   VAL H CG1   1 
ATOM   5436  C  CG2   . VAL H 4  41  ? -37.369 -34.588 30.245 1.00 69.87  ? 38   VAL H CG2   1 
ATOM   5437  N  N     . TYR H 4  42  ? -40.679 -37.317 28.762 1.00 74.21  ? 39   TYR H N     1 
ATOM   5438  C  CA    . TYR H 4  42  ? -41.904 -38.125 28.835 1.00 73.43  ? 39   TYR H CA    1 
ATOM   5439  C  C     . TYR H 4  42  ? -41.716 -39.492 28.170 1.00 73.44  ? 39   TYR H C     1 
ATOM   5440  O  O     . TYR H 4  42  ? -42.168 -40.507 28.699 1.00 65.42  ? 39   TYR H O     1 
ATOM   5441  C  CB    . TYR H 4  42  ? -43.102 -37.380 28.215 1.00 80.39  ? 39   TYR H CB    1 
ATOM   5442  C  CG    . TYR H 4  42  ? -44.453 -37.896 28.681 1.00 90.38  ? 39   TYR H CG    1 
ATOM   5443  C  CD1   . TYR H 4  42  ? -45.014 -37.461 29.892 1.00 96.42  ? 39   TYR H CD1   1 
ATOM   5444  C  CD2   . TYR H 4  42  ? -45.169 -38.824 27.922 1.00 104.26 ? 39   TYR H CD2   1 
ATOM   5445  C  CE1   . TYR H 4  42  ? -46.238 -37.936 30.339 1.00 102.16 ? 39   TYR H CE1   1 
ATOM   5446  C  CE2   . TYR H 4  42  ? -46.401 -39.305 28.356 1.00 111.97 ? 39   TYR H CE2   1 
ATOM   5447  C  CZ    . TYR H 4  42  ? -46.929 -38.859 29.566 1.00 116.33 ? 39   TYR H CZ    1 
ATOM   5448  O  OH    . TYR H 4  42  ? -48.145 -39.326 30.009 1.00 127.85 ? 39   TYR H OH    1 
ATOM   5449  N  N     . LYS H 4  43  ? -41.025 -39.535 27.034 1.00 71.63  ? 40   LYS H N     1 
ATOM   5450  C  CA    . LYS H 4  43  ? -40.728 -40.821 26.414 1.00 74.15  ? 40   LYS H CA    1 
ATOM   5451  C  C     . LYS H 4  43  ? -39.943 -41.728 27.352 1.00 72.91  ? 40   LYS H C     1 
ATOM   5452  O  O     . LYS H 4  43  ? -40.178 -42.934 27.405 1.00 82.46  ? 40   LYS H O     1 
ATOM   5453  C  CB    . LYS H 4  43  ? -39.973 -40.647 25.098 1.00 83.45  ? 40   LYS H CB    1 
ATOM   5454  C  CG    . LYS H 4  43  ? -40.836 -40.160 23.938 1.00 89.47  ? 40   LYS H CG    1 
ATOM   5455  C  CD    . LYS H 4  43  ? -40.027 -40.138 22.647 1.00 95.83  ? 40   LYS H CD    1 
ATOM   5456  C  CE    . LYS H 4  43  ? -40.696 -39.346 21.533 1.00 96.43  ? 40   LYS H CE    1 
ATOM   5457  N  NZ    . LYS H 4  43  ? -39.643 -38.701 20.692 1.00 96.18  ? 40   LYS H NZ    1 
ATOM   5458  N  N     . VAL H 4  44  ? -39.027 -41.141 28.113 1.00 81.13  ? 41   VAL H N     1 
ATOM   5459  C  CA    . VAL H 4  44  ? -38.137 -41.913 28.993 1.00 73.49  ? 41   VAL H CA    1 
ATOM   5460  C  C     . VAL H 4  44  ? -38.871 -42.339 30.267 1.00 69.43  ? 41   VAL H C     1 
ATOM   5461  O  O     . VAL H 4  44  ? -38.626 -43.429 30.823 1.00 59.91  ? 41   VAL H O     1 
ATOM   5462  C  CB    . VAL H 4  44  ? -36.872 -41.106 29.336 1.00 69.78  ? 41   VAL H CB    1 
ATOM   5463  C  CG1   . VAL H 4  44  ? -35.907 -41.940 30.153 1.00 73.23  ? 41   VAL H CG1   1 
ATOM   5464  C  CG2   . VAL H 4  44  ? -36.170 -40.665 28.068 1.00 71.58  ? 41   VAL H CG2   1 
ATOM   5465  N  N     . LEU H 4  45  ? -39.766 -41.473 30.735 1.00 64.00  ? 42   LEU H N     1 
ATOM   5466  C  CA    . LEU H 4  45  ? -40.664 -41.825 31.825 1.00 66.98  ? 42   LEU H CA    1 
ATOM   5467  C  C     . LEU H 4  45  ? -41.358 -43.157 31.524 1.00 78.51  ? 42   LEU H C     1 
ATOM   5468  O  O     . LEU H 4  45  ? -41.388 -44.070 32.356 1.00 81.84  ? 42   LEU H O     1 
ATOM   5469  C  CB    . LEU H 4  45  ? -41.703 -40.725 32.016 1.00 64.74  ? 42   LEU H CB    1 
ATOM   5470  C  CG    . LEU H 4  45  ? -42.770 -40.943 33.081 1.00 67.85  ? 42   LEU H CG    1 
ATOM   5471  C  CD1   . LEU H 4  45  ? -42.236 -41.557 34.372 1.00 66.97  ? 42   LEU H CD1   1 
ATOM   5472  C  CD2   . LEU H 4  45  ? -43.478 -39.625 33.381 1.00 71.25  ? 42   LEU H CD2   1 
ATOM   5473  N  N     . LYS H 4  46  ? -41.887 -43.276 30.313 1.00 82.43  ? 43   LYS H N     1 
ATOM   5474  C  CA    . LYS H 4  46  ? -42.674 -44.440 29.954 1.00 80.71  ? 43   LYS H CA    1 
ATOM   5475  C  C     . LYS H 4  46  ? -41.852 -45.738 29.894 1.00 80.95  ? 43   LYS H C     1 
ATOM   5476  O  O     . LYS H 4  46  ? -42.333 -46.771 30.343 1.00 79.00  ? 43   LYS H O     1 
ATOM   5477  C  CB    . LYS H 4  46  ? -43.436 -44.164 28.661 1.00 79.86  ? 43   LYS H CB    1 
ATOM   5478  C  CG    . LYS H 4  46  ? -44.496 -43.071 28.818 1.00 75.84  ? 43   LYS H CG    1 
ATOM   5479  C  CD    . LYS H 4  46  ? -45.689 -43.590 29.596 1.00 78.12  ? 43   LYS H CD    1 
ATOM   5480  C  CE    . LYS H 4  46  ? -46.239 -42.569 30.569 1.00 88.91  ? 43   LYS H CE    1 
ATOM   5481  N  NZ    . LYS H 4  46  ? -47.092 -43.188 31.626 1.00 89.62  ? 43   LYS H NZ    1 
ATOM   5482  N  N     . GLN H 4  47  ? -40.620 -45.692 29.382 1.00 82.56  ? 44   GLN H N     1 
ATOM   5483  C  CA    . GLN H 4  47  ? -39.711 -46.857 29.466 1.00 83.90  ? 44   GLN H CA    1 
ATOM   5484  C  C     . GLN H 4  47  ? -39.462 -47.260 30.921 1.00 83.68  ? 44   GLN H C     1 
ATOM   5485  O  O     . GLN H 4  47  ? -39.518 -48.424 31.314 1.00 85.74  ? 44   GLN H O     1 
ATOM   5486  C  CB    . GLN H 4  47  ? -38.344 -46.549 28.864 1.00 88.73  ? 44   GLN H CB    1 
ATOM   5487  C  CG    . GLN H 4  47  ? -38.290 -46.292 27.368 1.00 96.00  ? 44   GLN H CG    1 
ATOM   5488  C  CD    . GLN H 4  47  ? -36.842 -46.295 26.844 1.00 111.54 ? 44   GLN H CD    1 
ATOM   5489  O  OE1   . GLN H 4  47  ? -35.934 -46.883 27.457 1.00 105.51 ? 44   GLN H OE1   1 
ATOM   5490  N  NE2   . GLN H 4  47  ? -36.623 -45.638 25.708 1.00 113.84 ? 44   GLN H NE2   1 
ATOM   5491  N  N     . VAL H 4  48  ? -39.171 -46.258 31.721 1.00 83.96  ? 45   VAL H N     1 
ATOM   5492  C  CA    . VAL H 4  48  ? -38.798 -46.452 33.105 1.00 80.09  ? 45   VAL H CA    1 
ATOM   5493  C  C     . VAL H 4  48  ? -39.999 -46.788 33.998 1.00 76.64  ? 45   VAL H C     1 
ATOM   5494  O  O     . VAL H 4  48  ? -39.877 -47.610 34.889 1.00 75.93  ? 45   VAL H O     1 
ATOM   5495  C  CB    . VAL H 4  48  ? -38.075 -45.172 33.584 1.00 82.93  ? 45   VAL H CB    1 
ATOM   5496  C  CG1   . VAL H 4  48  ? -37.947 -45.122 35.080 1.00 80.94  ? 45   VAL H CG1   1 
ATOM   5497  C  CG2   . VAL H 4  48  ? -36.704 -45.087 32.933 1.00 88.17  ? 45   VAL H CG2   1 
ATOM   5498  N  N     . HIS H 4  49  ? -41.141 -46.145 33.757 1.00 74.57  ? 46   HIS H N     1 
ATOM   5499  C  CA    . HIS H 4  49  ? -42.352 -46.344 34.551 1.00 85.21  ? 46   HIS H CA    1 
ATOM   5500  C  C     . HIS H 4  49  ? -43.609 -46.167 33.665 1.00 91.63  ? 46   HIS H C     1 
ATOM   5501  O  O     . HIS H 4  49  ? -44.238 -45.088 33.685 1.00 96.39  ? 46   HIS H O     1 
ATOM   5502  C  CB    . HIS H 4  49  ? -42.398 -45.318 35.688 1.00 89.60  ? 46   HIS H CB    1 
ATOM   5503  C  CG    . HIS H 4  49  ? -41.661 -45.720 36.929 1.00 86.86  ? 46   HIS H CG    1 
ATOM   5504  N  ND1   . HIS H 4  49  ? -42.285 -46.318 38.001 1.00 87.99  ? 46   HIS H ND1   1 
ATOM   5505  C  CD2   . HIS H 4  49  ? -40.372 -45.544 37.299 1.00 82.10  ? 46   HIS H CD2   1 
ATOM   5506  C  CE1   . HIS H 4  49  ? -41.404 -46.529 38.961 1.00 87.93  ? 46   HIS H CE1   1 
ATOM   5507  N  NE2   . HIS H 4  49  ? -40.235 -46.066 38.558 1.00 86.24  ? 46   HIS H NE2   1 
ATOM   5508  N  N     . PRO H 4  50  ? -43.998 -47.219 32.900 1.00 89.78  ? 47   PRO H N     1 
ATOM   5509  C  CA    . PRO H 4  50  ? -45.051 -47.043 31.877 1.00 85.07  ? 47   PRO H CA    1 
ATOM   5510  C  C     . PRO H 4  50  ? -46.417 -46.632 32.435 1.00 82.40  ? 47   PRO H C     1 
ATOM   5511  O  O     . PRO H 4  50  ? -47.200 -46.020 31.721 1.00 77.43  ? 47   PRO H O     1 
ATOM   5512  C  CB    . PRO H 4  50  ? -45.129 -48.410 31.187 1.00 83.44  ? 47   PRO H CB    1 
ATOM   5513  C  CG    . PRO H 4  50  ? -43.955 -49.202 31.682 1.00 84.03  ? 47   PRO H CG    1 
ATOM   5514  C  CD    . PRO H 4  50  ? -43.553 -48.622 32.997 1.00 85.77  ? 47   PRO H CD    1 
ATOM   5515  N  N     . ASP H 4  51  ? -46.682 -46.933 33.702 1.00 83.29  ? 48   ASP H N     1 
ATOM   5516  C  CA    . ASP H 4  51  ? -47.957 -46.583 34.329 1.00 94.30  ? 48   ASP H CA    1 
ATOM   5517  C  C     . ASP H 4  51  ? -47.913 -45.285 35.157 1.00 91.14  ? 48   ASP H C     1 
ATOM   5518  O  O     . ASP H 4  51  ? -48.883 -44.960 35.845 1.00 85.39  ? 48   ASP H O     1 
ATOM   5519  C  CB    . ASP H 4  51  ? -48.446 -47.751 35.216 1.00 103.88 ? 48   ASP H CB    1 
ATOM   5520  C  CG    . ASP H 4  51  ? -48.717 -49.037 34.418 1.00 112.14 ? 48   ASP H CG    1 
ATOM   5521  O  OD1   . ASP H 4  51  ? -49.415 -48.971 33.376 1.00 110.79 ? 48   ASP H OD1   1 
ATOM   5522  O  OD2   . ASP H 4  51  ? -48.244 -50.120 34.845 1.00 116.97 ? 48   ASP H OD2   1 
ATOM   5523  N  N     . THR H 4  52  ? -46.804 -44.544 35.096 1.00 92.56  ? 49   THR H N     1 
ATOM   5524  C  CA    . THR H 4  52  ? -46.619 -43.345 35.933 1.00 79.82  ? 49   THR H CA    1 
ATOM   5525  C  C     . THR H 4  52  ? -46.670 -42.086 35.071 1.00 76.57  ? 49   THR H C     1 
ATOM   5526  O  O     . THR H 4  52  ? -46.196 -42.100 33.930 1.00 73.71  ? 49   THR H O     1 
ATOM   5527  C  CB    . THR H 4  52  ? -45.266 -43.381 36.653 1.00 81.88  ? 49   THR H CB    1 
ATOM   5528  O  OG1   . THR H 4  52  ? -45.058 -44.675 37.234 1.00 78.83  ? 49   THR H OG1   1 
ATOM   5529  C  CG2   . THR H 4  52  ? -45.206 -42.335 37.747 1.00 82.78  ? 49   THR H CG2   1 
ATOM   5530  N  N     . GLY H 4  53  ? -47.254 -41.018 35.618 1.00 71.41  ? 50   GLY H N     1 
ATOM   5531  C  CA    . GLY H 4  53  ? -47.394 -39.726 34.930 1.00 74.17  ? 50   GLY H CA    1 
ATOM   5532  C  C     . GLY H 4  53  ? -46.576 -38.663 35.640 1.00 73.66  ? 50   GLY H C     1 
ATOM   5533  O  O     . GLY H 4  53  ? -45.777 -38.976 36.511 1.00 76.26  ? 50   GLY H O     1 
ATOM   5534  N  N     . ILE H 4  54  ? -46.786 -37.404 35.294 1.00 67.86  ? 51   ILE H N     1 
ATOM   5535  C  CA    . ILE H 4  54  ? -45.956 -36.344 35.813 1.00 70.96  ? 51   ILE H CA    1 
ATOM   5536  C  C     . ILE H 4  54  ? -46.638 -35.019 35.724 1.00 65.08  ? 51   ILE H C     1 
ATOM   5537  O  O     . ILE H 4  54  ? -47.186 -34.681 34.692 1.00 69.66  ? 51   ILE H O     1 
ATOM   5538  C  CB    . ILE H 4  54  ? -44.625 -36.247 35.024 1.00 81.04  ? 51   ILE H CB    1 
ATOM   5539  C  CG1   . ILE H 4  54  ? -43.667 -35.227 35.674 1.00 76.12  ? 51   ILE H CG1   1 
ATOM   5540  C  CG2   . ILE H 4  54  ? -44.863 -35.924 33.550 1.00 79.17  ? 51   ILE H CG2   1 
ATOM   5541  C  CD1   . ILE H 4  54  ? -42.216 -35.506 35.333 1.00 73.50  ? 51   ILE H CD1   1 
ATOM   5542  N  N     . SER H 4  55  ? -46.536 -34.245 36.790 1.00 64.44  ? 52   SER H N     1 
ATOM   5543  C  CA    . SER H 4  55  ? -47.213 -32.970 36.863 1.00 64.87  ? 52   SER H CA    1 
ATOM   5544  C  C     . SER H 4  55  ? -46.535 -31.961 35.962 1.00 62.06  ? 52   SER H C     1 
ATOM   5545  O  O     . SER H 4  55  ? -45.441 -32.198 35.437 1.00 59.37  ? 52   SER H O     1 
ATOM   5546  C  CB    . SER H 4  55  ? -47.268 -32.450 38.303 1.00 67.82  ? 52   SER H CB    1 
ATOM   5547  O  OG    . SER H 4  55  ? -46.258 -31.509 38.564 1.00 68.93  ? 52   SER H OG    1 
ATOM   5548  N  N     . SER H 4  56  ? -47.211 -30.839 35.777 1.00 62.04  ? 53   SER H N     1 
ATOM   5549  C  CA    . SER H 4  56  ? -46.692 -29.773 34.962 1.00 67.61  ? 53   SER H CA    1 
ATOM   5550  C  C     . SER H 4  56  ? -45.433 -29.242 35.624 1.00 66.46  ? 53   SER H C     1 
ATOM   5551  O  O     . SER H 4  56  ? -44.383 -29.177 34.987 1.00 69.75  ? 53   SER H O     1 
ATOM   5552  C  CB    . SER H 4  56  ? -47.714 -28.650 34.818 1.00 65.92  ? 53   SER H CB    1 
ATOM   5553  O  OG    . SER H 4  56  ? -47.294 -27.789 33.788 1.00 75.58  ? 53   SER H OG    1 
ATOM   5554  N  N     . LYS H 4  57  ? -45.555 -28.892 36.904 1.00 60.57  ? 54   LYS H N     1 
ATOM   5555  C  CA    . LYS H 4  57  ? -44.455 -28.366 37.673 1.00 65.94  ? 54   LYS H CA    1 
ATOM   5556  C  C     . LYS H 4  57  ? -43.287 -29.362 37.713 1.00 70.97  ? 54   LYS H C     1 
ATOM   5557  O  O     . LYS H 4  57  ? -42.114 -28.991 37.482 1.00 72.83  ? 54   LYS H O     1 
ATOM   5558  C  CB    . LYS H 4  57  ? -44.916 -27.962 39.076 1.00 78.82  ? 54   LYS H CB    1 
ATOM   5559  C  CG    . LYS H 4  57  ? -45.519 -26.551 39.133 1.00 96.37  ? 54   LYS H CG    1 
ATOM   5560  C  CD    . LYS H 4  57  ? -46.806 -26.451 39.977 1.00 105.37 ? 54   LYS H CD    1 
ATOM   5561  C  CE    . LYS H 4  57  ? -47.510 -25.104 39.775 1.00 104.15 ? 54   LYS H CE    1 
ATOM   5562  N  NZ    . LYS H 4  57  ? -48.979 -25.162 39.992 1.00 102.40 ? 54   LYS H NZ    1 
ATOM   5563  N  N     . ALA H 4  58  ? -43.590 -30.631 37.950 1.00 62.27  ? 55   ALA H N     1 
ATOM   5564  C  CA    . ALA H 4  58  ? -42.538 -31.620 37.937 1.00 62.03  ? 55   ALA H CA    1 
ATOM   5565  C  C     . ALA H 4  58  ? -41.802 -31.665 36.591 1.00 62.15  ? 55   ALA H C     1 
ATOM   5566  O  O     . ALA H 4  58  ? -40.600 -31.854 36.538 1.00 65.44  ? 55   ALA H O     1 
ATOM   5567  C  CB    . ALA H 4  58  ? -43.089 -32.973 38.299 1.00 62.93  ? 55   ALA H CB    1 
ATOM   5568  N  N     . MET H 4  59  ? -42.505 -31.487 35.492 1.00 63.18  ? 56   MET H N     1 
ATOM   5569  C  CA    . MET H 4  59  ? -41.828 -31.590 34.198 1.00 64.72  ? 56   MET H CA    1 
ATOM   5570  C  C     . MET H 4  59  ? -40.918 -30.374 33.994 1.00 59.18  ? 56   MET H C     1 
ATOM   5571  O  O     . MET H 4  59  ? -39.845 -30.463 33.382 1.00 49.37  ? 56   MET H O     1 
ATOM   5572  C  CB    . MET H 4  59  ? -42.850 -31.706 33.063 1.00 62.14  ? 56   MET H CB    1 
ATOM   5573  C  CG    . MET H 4  59  ? -42.239 -31.655 31.676 1.00 63.23  ? 56   MET H CG    1 
ATOM   5574  S  SD    . MET H 4  59  ? -41.178 -33.047 31.287 1.00 65.09  ? 56   MET H SD    1 
ATOM   5575  C  CE    . MET H 4  59  ? -42.411 -34.307 31.023 1.00 72.55  ? 56   MET H CE    1 
ATOM   5576  N  N     . SER H 4  60  ? -41.356 -29.238 34.525 1.00 57.60  ? 57   SER H N     1 
ATOM   5577  C  CA    . SER H 4  60  ? -40.600 -28.012 34.364 1.00 58.41  ? 57   SER H CA    1 
ATOM   5578  C  C     . SER H 4  60  ? -39.243 -28.173 35.072 1.00 60.91  ? 57   SER H C     1 
ATOM   5579  O  O     . SER H 4  60  ? -38.211 -27.777 34.539 1.00 56.52  ? 57   SER H O     1 
ATOM   5580  C  CB    . SER H 4  60  ? -41.386 -26.809 34.885 1.00 51.79  ? 57   SER H CB    1 
ATOM   5581  O  OG    . SER H 4  60  ? -41.126 -25.691 34.057 1.00 57.95  ? 57   SER H OG    1 
ATOM   5582  N  N     . ILE H 4  61  ? -39.272 -28.819 36.240 1.00 59.57  ? 58   ILE H N     1 
ATOM   5583  C  CA    . ILE H 4  61  ? -38.079 -29.128 37.009 1.00 57.03  ? 58   ILE H CA    1 
ATOM   5584  C  C     . ILE H 4  61  ? -37.165 -30.090 36.287 1.00 57.98  ? 58   ILE H C     1 
ATOM   5585  O  O     . ILE H 4  61  ? -35.952 -29.929 36.285 1.00 63.76  ? 58   ILE H O     1 
ATOM   5586  C  CB    . ILE H 4  61  ? -38.458 -29.735 38.356 1.00 59.40  ? 58   ILE H CB    1 
ATOM   5587  C  CG1   . ILE H 4  61  ? -39.003 -28.636 39.270 1.00 62.17  ? 58   ILE H CG1   1 
ATOM   5588  C  CG2   . ILE H 4  61  ? -37.247 -30.358 39.015 1.00 60.41  ? 58   ILE H CG2   1 
ATOM   5589  C  CD1   . ILE H 4  61  ? -39.936 -29.173 40.323 1.00 67.18  ? 58   ILE H CD1   1 
ATOM   5590  N  N     . MET H 4  62  ? -37.741 -31.103 35.663 1.00 63.70  ? 59   MET H N     1 
ATOM   5591  C  CA    . MET H 4  62  ? -36.938 -32.029 34.866 1.00 60.82  ? 59   MET H CA    1 
ATOM   5592  C  C     . MET H 4  62  ? -36.307 -31.309 33.681 1.00 59.53  ? 59   MET H C     1 
ATOM   5593  O  O     . MET H 4  62  ? -35.211 -31.649 33.231 1.00 54.72  ? 59   MET H O     1 
ATOM   5594  C  CB    . MET H 4  62  ? -37.791 -33.196 34.397 1.00 58.34  ? 59   MET H CB    1 
ATOM   5595  C  CG    . MET H 4  62  ? -38.221 -34.097 35.548 1.00 60.17  ? 59   MET H CG    1 
ATOM   5596  S  SD    . MET H 4  62  ? -36.849 -34.900 36.384 1.00 60.15  ? 59   MET H SD    1 
ATOM   5597  C  CE    . MET H 4  62  ? -36.108 -35.680 34.977 1.00 54.79  ? 59   MET H CE    1 
ATOM   5598  N  N     . ASN H 4  63  ? -36.992 -30.296 33.183 1.00 57.84  ? 60   ASN H N     1 
ATOM   5599  C  CA    . ASN H 4  63  ? -36.454 -29.549 32.089 1.00 56.73  ? 60   ASN H CA    1 
ATOM   5600  C  C     . ASN H 4  63  ? -35.267 -28.690 32.544 1.00 58.67  ? 60   ASN H C     1 
ATOM   5601  O  O     . ASN H 4  63  ? -34.195 -28.718 31.920 1.00 58.79  ? 60   ASN H O     1 
ATOM   5602  C  CB    . ASN H 4  63  ? -37.546 -28.699 31.472 1.00 58.49  ? 60   ASN H CB    1 
ATOM   5603  C  CG    . ASN H 4  63  ? -37.225 -28.320 30.065 1.00 57.53  ? 60   ASN H CG    1 
ATOM   5604  O  OD1   . ASN H 4  63  ? -36.646 -29.114 29.331 1.00 59.06  ? 60   ASN H OD1   1 
ATOM   5605  N  ND2   . ASN H 4  63  ? -37.572 -27.100 29.681 1.00 56.86  ? 60   ASN H ND2   1 
ATOM   5606  N  N     . SER H 4  64  ? -35.457 -27.944 33.635 1.00 54.62  ? 61   SER H N     1 
ATOM   5607  C  CA    . SER H 4  64  ? -34.372 -27.180 34.242 1.00 56.88  ? 61   SER H CA    1 
ATOM   5608  C  C     . SER H 4  64  ? -33.181 -28.118 34.386 1.00 55.81  ? 61   SER H C     1 
ATOM   5609  O  O     . SER H 4  64  ? -32.066 -27.831 33.921 1.00 52.26  ? 61   SER H O     1 
ATOM   5610  C  CB    . SER H 4  64  ? -34.757 -26.666 35.636 1.00 60.14  ? 61   SER H CB    1 
ATOM   5611  O  OG    . SER H 4  64  ? -35.806 -25.728 35.593 1.00 57.45  ? 61   SER H OG    1 
ATOM   5612  N  N     . PHE H 4  65  ? -33.447 -29.270 34.993 1.00 52.92  ? 62   PHE H N     1 
ATOM   5613  C  CA    . PHE H 4  65  ? -32.406 -30.230 35.231 1.00 53.36  ? 62   PHE H CA    1 
ATOM   5614  C  C     . PHE H 4  65  ? -31.578 -30.545 33.993 1.00 57.24  ? 62   PHE H C     1 
ATOM   5615  O  O     . PHE H 4  65  ? -30.344 -30.463 34.033 1.00 60.78  ? 62   PHE H O     1 
ATOM   5616  C  CB    . PHE H 4  65  ? -32.987 -31.489 35.756 1.00 54.51  ? 62   PHE H CB    1 
ATOM   5617  C  CG    . PHE H 4  65  ? -31.974 -32.565 35.927 1.00 59.35  ? 62   PHE H CG    1 
ATOM   5618  C  CD1   . PHE H 4  65  ? -31.015 -32.458 36.916 1.00 60.53  ? 62   PHE H CD1   1 
ATOM   5619  C  CD2   . PHE H 4  65  ? -31.979 -33.669 35.106 1.00 57.71  ? 62   PHE H CD2   1 
ATOM   5620  C  CE1   . PHE H 4  65  ? -30.086 -33.442 37.099 1.00 61.33  ? 62   PHE H CE1   1 
ATOM   5621  C  CE2   . PHE H 4  65  ? -31.055 -34.659 35.282 1.00 60.22  ? 62   PHE H CE2   1 
ATOM   5622  C  CZ    . PHE H 4  65  ? -30.105 -34.545 36.278 1.00 65.13  ? 62   PHE H CZ    1 
ATOM   5623  N  N     . VAL H 4  66  ? -32.244 -30.861 32.884 1.00 58.04  ? 63   VAL H N     1 
ATOM   5624  C  CA    . VAL H 4  66  ? -31.519 -31.192 31.658 1.00 54.64  ? 63   VAL H CA    1 
ATOM   5625  C  C     . VAL H 4  66  ? -30.727 -29.995 31.145 1.00 58.83  ? 63   VAL H C     1 
ATOM   5626  O  O     . VAL H 4  66  ? -29.529 -30.134 30.822 1.00 55.11  ? 63   VAL H O     1 
ATOM   5627  C  CB    . VAL H 4  66  ? -32.440 -31.735 30.565 1.00 52.89  ? 63   VAL H CB    1 
ATOM   5628  C  CG1   . VAL H 4  66  ? -31.666 -31.963 29.292 1.00 52.25  ? 63   VAL H CG1   1 
ATOM   5629  C  CG2   . VAL H 4  66  ? -33.042 -33.063 30.992 1.00 56.72  ? 63   VAL H CG2   1 
ATOM   5630  N  N     . ASN H 4  67  ? -31.368 -28.819 31.109 1.00 57.06  ? 64   ASN H N     1 
ATOM   5631  C  CA    . ASN H 4  67  ? -30.653 -27.590 30.716 1.00 59.13  ? 64   ASN H CA    1 
ATOM   5632  C  C     . ASN H 4  67  ? -29.445 -27.252 31.594 1.00 59.72  ? 64   ASN H C     1 
ATOM   5633  O  O     . ASN H 4  67  ? -28.417 -26.789 31.084 1.00 58.18  ? 64   ASN H O     1 
ATOM   5634  C  CB    . ASN H 4  67  ? -31.586 -26.395 30.693 1.00 58.48  ? 64   ASN H CB    1 
ATOM   5635  C  CG    . ASN H 4  67  ? -32.449 -26.371 29.466 1.00 61.57  ? 64   ASN H CG    1 
ATOM   5636  O  OD1   . ASN H 4  67  ? -31.967 -26.584 28.343 1.00 64.71  ? 64   ASN H OD1   1 
ATOM   5637  N  ND2   . ASN H 4  67  ? -33.742 -26.145 29.665 1.00 67.38  ? 64   ASN H ND2   1 
ATOM   5638  N  N     . ASP H 4  68  ? -29.593 -27.470 32.899 1.00 52.00  ? 65   ASP H N     1 
ATOM   5639  C  CA    . ASP H 4  68  ? -28.540 -27.210 33.836 1.00 52.14  ? 65   ASP H CA    1 
ATOM   5640  C  C     . ASP H 4  68  ? -27.398 -28.179 33.555 1.00 54.00  ? 65   ASP H C     1 
ATOM   5641  O  O     . ASP H 4  68  ? -26.261 -27.750 33.301 1.00 50.21  ? 65   ASP H O     1 
ATOM   5642  C  CB    . ASP H 4  68  ? -29.082 -27.354 35.263 1.00 59.46  ? 65   ASP H CB    1 
ATOM   5643  C  CG    . ASP H 4  68  ? -28.037 -27.098 36.327 1.00 59.24  ? 65   ASP H CG    1 
ATOM   5644  O  OD1   . ASP H 4  68  ? -27.031 -26.447 36.022 1.00 62.44  ? 65   ASP H OD1   1 
ATOM   5645  O  OD2   . ASP H 4  68  ? -28.218 -27.558 37.477 1.00 59.48  ? 65   ASP H OD2   1 
ATOM   5646  N  N     . VAL H 4  69  ? -27.673 -29.485 33.551 1.00 53.13  ? 66   VAL H N     1 
ATOM   5647  C  CA    . VAL H 4  69  ? -26.565 -30.427 33.352 1.00 50.90  ? 66   VAL H CA    1 
ATOM   5648  C  C     . VAL H 4  69  ? -25.950 -30.194 32.001 1.00 53.60  ? 66   VAL H C     1 
ATOM   5649  O  O     . VAL H 4  69  ? -24.736 -30.189 31.890 1.00 58.34  ? 66   VAL H O     1 
ATOM   5650  C  CB    . VAL H 4  69  ? -26.935 -31.904 33.492 1.00 51.85  ? 66   VAL H CB    1 
ATOM   5651  C  CG1   . VAL H 4  69  ? -25.775 -32.771 33.052 1.00 52.54  ? 66   VAL H CG1   1 
ATOM   5652  C  CG2   . VAL H 4  69  ? -27.272 -32.236 34.937 1.00 53.66  ? 66   VAL H CG2   1 
ATOM   5653  N  N     . PHE H 4  70  ? -26.770 -29.961 30.978 1.00 56.33  ? 67   PHE H N     1 
ATOM   5654  C  CA    . PHE H 4  70  ? -26.221 -29.583 29.668 1.00 55.95  ? 67   PHE H CA    1 
ATOM   5655  C  C     . PHE H 4  70  ? -25.150 -28.486 29.809 1.00 58.89  ? 67   PHE H C     1 
ATOM   5656  O  O     . PHE H 4  70  ? -24.007 -28.671 29.361 1.00 54.22  ? 67   PHE H O     1 
ATOM   5657  C  CB    . PHE H 4  70  ? -27.319 -29.097 28.721 1.00 52.78  ? 67   PHE H CB    1 
ATOM   5658  C  CG    . PHE H 4  70  ? -26.821 -28.772 27.333 1.00 50.80  ? 67   PHE H CG    1 
ATOM   5659  C  CD1   . PHE H 4  70  ? -26.968 -29.685 26.298 1.00 53.84  ? 67   PHE H CD1   1 
ATOM   5660  C  CD2   . PHE H 4  70  ? -26.219 -27.554 27.057 1.00 53.34  ? 67   PHE H CD2   1 
ATOM   5661  C  CE1   . PHE H 4  70  ? -26.502 -29.409 25.019 1.00 54.37  ? 67   PHE H CE1   1 
ATOM   5662  C  CE2   . PHE H 4  70  ? -25.759 -27.262 25.780 1.00 57.30  ? 67   PHE H CE2   1 
ATOM   5663  C  CZ    . PHE H 4  70  ? -25.893 -28.202 24.759 1.00 58.64  ? 67   PHE H CZ    1 
ATOM   5664  N  N     . GLU H 4  71  ? -25.530 -27.359 30.431 1.00 56.18  ? 68   GLU H N     1 
ATOM   5665  C  CA    . GLU H 4  71  ? -24.649 -26.191 30.524 1.00 61.74  ? 68   GLU H CA    1 
ATOM   5666  C  C     . GLU H 4  71  ? -23.380 -26.543 31.299 1.00 58.38  ? 68   GLU H C     1 
ATOM   5667  O  O     . GLU H 4  71  ? -22.256 -26.201 30.881 1.00 53.64  ? 68   GLU H O     1 
ATOM   5668  C  CB    . GLU H 4  71  ? -25.368 -24.946 31.105 1.00 65.38  ? 68   GLU H CB    1 
ATOM   5669  C  CG    . GLU H 4  71  ? -26.039 -24.087 30.007 1.00 77.26  ? 68   GLU H CG    1 
ATOM   5670  C  CD    . GLU H 4  71  ? -27.313 -23.315 30.429 1.00 83.28  ? 68   GLU H CD    1 
ATOM   5671  O  OE1   . GLU H 4  71  ? -27.761 -23.417 31.594 1.00 83.88  ? 68   GLU H OE1   1 
ATOM   5672  O  OE2   . GLU H 4  71  ? -27.877 -22.577 29.581 1.00 78.52  ? 68   GLU H OE2   1 
ATOM   5673  N  N     . ARG H 4  72  ? -23.554 -27.276 32.388 1.00 50.41  ? 69   ARG H N     1 
ATOM   5674  C  CA    . ARG H 4  72  ? -22.422 -27.655 33.183 1.00 48.59  ? 69   ARG H CA    1 
ATOM   5675  C  C     . ARG H 4  72  ? -21.415 -28.502 32.393 1.00 46.70  ? 69   ARG H C     1 
ATOM   5676  O  O     . ARG H 4  72  ? -20.220 -28.262 32.386 1.00 51.16  ? 69   ARG H O     1 
ATOM   5677  C  CB    . ARG H 4  72  ? -22.904 -28.402 34.409 1.00 51.49  ? 69   ARG H CB    1 
ATOM   5678  C  CG    . ARG H 4  72  ? -23.610 -27.553 35.451 1.00 51.27  ? 69   ARG H CG    1 
ATOM   5679  C  CD    . ARG H 4  72  ? -23.501 -28.270 36.772 1.00 52.28  ? 69   ARG H CD    1 
ATOM   5680  N  NE    . ARG H 4  72  ? -24.737 -28.283 37.504 1.00 52.61  ? 69   ARG H NE    1 
ATOM   5681  C  CZ    . ARG H 4  72  ? -24.916 -28.969 38.617 1.00 55.80  ? 69   ARG H CZ    1 
ATOM   5682  N  NH1   . ARG H 4  72  ? -23.938 -29.706 39.134 1.00 53.65  ? 69   ARG H NH1   1 
ATOM   5683  N  NH2   . ARG H 4  72  ? -26.087 -28.898 39.223 1.00 64.24  ? 69   ARG H NH2   1 
ATOM   5684  N  N     . ILE H 4  73  ? -21.902 -29.514 31.727 1.00 50.66  ? 70   ILE H N     1 
ATOM   5685  C  CA    . ILE H 4  73  ? -21.009 -30.348 30.967 1.00 53.52  ? 70   ILE H CA    1 
ATOM   5686  C  C     . ILE H 4  73  ? -20.381 -29.569 29.820 1.00 49.37  ? 70   ILE H C     1 
ATOM   5687  O  O     . ILE H 4  73  ? -19.194 -29.528 29.764 1.00 58.63  ? 70   ILE H O     1 
ATOM   5688  C  CB    . ILE H 4  73  ? -21.702 -31.612 30.455 1.00 52.68  ? 70   ILE H CB    1 
ATOM   5689  C  CG1   . ILE H 4  73  ? -22.041 -32.505 31.630 1.00 50.39  ? 70   ILE H CG1   1 
ATOM   5690  C  CG2   . ILE H 4  73  ? -20.781 -32.332 29.493 1.00 54.69  ? 70   ILE H CG2   1 
ATOM   5691  C  CD1   . ILE H 4  73  ? -22.723 -33.791 31.224 1.00 52.00  ? 70   ILE H CD1   1 
ATOM   5692  N  N     . ALA H 4  74  ? -21.164 -28.990 28.913 1.00 48.68  ? 71   ALA H N     1 
ATOM   5693  C  CA    . ALA H 4  74  ? -20.618 -28.141 27.839 1.00 54.75  ? 71   ALA H CA    1 
ATOM   5694  C  C     . ALA H 4  74  ? -19.594 -27.161 28.372 1.00 54.96  ? 71   ALA H C     1 
ATOM   5695  O  O     . ALA H 4  74  ? -18.525 -26.982 27.786 1.00 56.36  ? 71   ALA H O     1 
ATOM   5696  C  CB    . ALA H 4  74  ? -21.720 -27.353 27.141 1.00 56.95  ? 71   ALA H CB    1 
ATOM   5697  N  N     . GLY H 4  75  ? -19.922 -26.522 29.486 1.00 53.37  ? 72   GLY H N     1 
ATOM   5698  C  CA    . GLY H 4  75  ? -19.050 -25.495 30.027 1.00 56.79  ? 72   GLY H CA    1 
ATOM   5699  C  C     . GLY H 4  75  ? -17.674 -26.024 30.407 1.00 57.31  ? 72   GLY H C     1 
ATOM   5700  O  O     . GLY H 4  75  ? -16.616 -25.442 30.062 1.00 52.52  ? 72   GLY H O     1 
ATOM   5701  N  N     . GLU H 4  76  ? -17.687 -27.115 31.155 1.00 56.44  ? 73   GLU H N     1 
ATOM   5702  C  CA    . GLU H 4  76  ? -16.451 -27.787 31.473 1.00 60.10  ? 73   GLU H CA    1 
ATOM   5703  C  C     . GLU H 4  76  ? -15.710 -28.215 30.201 1.00 60.13  ? 73   GLU H C     1 
ATOM   5704  O  O     . GLU H 4  76  ? -14.484 -28.140 30.150 1.00 67.91  ? 73   GLU H O     1 
ATOM   5705  C  CB    . GLU H 4  76  ? -16.722 -28.998 32.344 1.00 62.56  ? 73   GLU H CB    1 
ATOM   5706  C  CG    . GLU H 4  76  ? -15.441 -29.583 32.905 1.00 70.99  ? 73   GLU H CG    1 
ATOM   5707  C  CD    . GLU H 4  76  ? -14.793 -28.665 33.919 1.00 79.30  ? 73   GLU H CD    1 
ATOM   5708  O  OE1   . GLU H 4  76  ? -13.626 -28.233 33.621 1.00 75.61  ? 73   GLU H OE1   1 
ATOM   5709  O  OE2   . GLU H 4  76  ? -15.481 -28.384 34.970 1.00 67.91  ? 73   GLU H OE2   1 
ATOM   5710  N  N     . ALA H 4  77  ? -16.450 -28.659 29.184 1.00 53.32  ? 74   ALA H N     1 
ATOM   5711  C  CA    . ALA H 4  77  ? -15.856 -29.174 27.958 1.00 52.68  ? 74   ALA H CA    1 
ATOM   5712  C  C     . ALA H 4  77  ? -15.186 -28.065 27.210 1.00 51.38  ? 74   ALA H C     1 
ATOM   5713  O  O     . ALA H 4  77  ? -14.077 -28.243 26.731 1.00 51.67  ? 74   ALA H O     1 
ATOM   5714  C  CB    . ALA H 4  77  ? -16.907 -29.825 27.082 1.00 56.41  ? 74   ALA H CB    1 
ATOM   5715  N  N     . SER H 4  78  ? -15.862 -26.920 27.121 1.00 48.55  ? 75   SER H N     1 
ATOM   5716  C  CA    . SER H 4  78  ? -15.294 -25.730 26.499 1.00 49.72  ? 75   SER H CA    1 
ATOM   5717  C  C     . SER H 4  78  ? -13.958 -25.404 27.155 1.00 55.96  ? 75   SER H C     1 
ATOM   5718  O  O     . SER H 4  78  ? -12.936 -25.216 26.494 1.00 65.89  ? 75   SER H O     1 
ATOM   5719  C  CB    . SER H 4  78  ? -16.254 -24.529 26.644 1.00 51.52  ? 75   SER H CB    1 
ATOM   5720  O  OG    . SER H 4  78  ? -15.611 -23.287 26.302 1.00 51.89  ? 75   SER H OG    1 
ATOM   5721  N  N     . ARG H 4  79  ? -13.972 -25.339 28.476 1.00 56.28  ? 76   ARG H N     1 
ATOM   5722  C  CA    . ARG H 4  79  ? -12.780 -25.026 29.211 1.00 53.19  ? 76   ARG H CA    1 
ATOM   5723  C  C     . ARG H 4  79  ? -11.654 -26.020 28.861 1.00 50.74  ? 76   ARG H C     1 
ATOM   5724  O  O     . ARG H 4  79  ? -10.535 -25.607 28.565 1.00 50.18  ? 76   ARG H O     1 
ATOM   5725  C  CB    . ARG H 4  79  ? -13.102 -24.989 30.702 1.00 58.30  ? 76   ARG H CB    1 
ATOM   5726  C  CG    . ARG H 4  79  ? -13.392 -23.598 31.266 1.00 60.52  ? 76   ARG H CG    1 
ATOM   5727  C  CD    . ARG H 4  79  ? -14.044 -23.658 32.664 1.00 60.74  ? 76   ARG H CD    1 
ATOM   5728  N  NE    . ARG H 4  79  ? -15.446 -23.220 32.591 1.00 63.33  ? 76   ARG H NE    1 
ATOM   5729  C  CZ    . ARG H 4  79  ? -16.521 -23.907 32.996 1.00 70.40  ? 76   ARG H CZ    1 
ATOM   5730  N  NH1   . ARG H 4  79  ? -16.408 -25.109 33.569 1.00 72.32  ? 76   ARG H NH1   1 
ATOM   5731  N  NH2   . ARG H 4  79  ? -17.740 -23.364 32.844 1.00 70.68  ? 76   ARG H NH2   1 
ATOM   5732  N  N     . LEU H 4  80  ? -11.954 -27.314 28.867 1.00 49.97  ? 77   LEU H N     1 
ATOM   5733  C  CA    . LEU H 4  80  ? -10.970 -28.307 28.503 1.00 55.91  ? 77   LEU H CA    1 
ATOM   5734  C  C     . LEU H 4  80  ? -10.332 -28.024 27.145 1.00 58.56  ? 77   LEU H C     1 
ATOM   5735  O  O     . LEU H 4  80  ? -9.098  -28.002 27.001 1.00 59.37  ? 77   LEU H O     1 
ATOM   5736  C  CB    . LEU H 4  80  ? -11.610 -29.677 28.440 1.00 60.16  ? 77   LEU H CB    1 
ATOM   5737  C  CG    . LEU H 4  80  ? -11.721 -30.375 29.775 1.00 65.76  ? 77   LEU H CG    1 
ATOM   5738  C  CD1   . LEU H 4  80  ? -12.598 -31.610 29.633 1.00 69.48  ? 77   LEU H CD1   1 
ATOM   5739  C  CD2   . LEU H 4  80  ? -10.340 -30.751 30.272 1.00 69.02  ? 77   LEU H CD2   1 
ATOM   5740  N  N     . ALA H 4  81  ? -11.161 -27.825 26.134 1.00 55.01  ? 78   ALA H N     1 
ATOM   5741  C  CA    . ALA H 4  81  ? -10.615 -27.539 24.826 1.00 56.85  ? 78   ALA H CA    1 
ATOM   5742  C  C     . ALA H 4  81  ? -9.658  -26.341 24.908 1.00 60.58  ? 78   ALA H C     1 
ATOM   5743  O  O     . ALA H 4  81  ? -8.467  -26.471 24.593 1.00 63.58  ? 78   ALA H O     1 
ATOM   5744  C  CB    . ALA H 4  81  ? -11.721 -27.293 23.839 1.00 57.35  ? 78   ALA H CB    1 
ATOM   5745  N  N     . HIS H 4  82  ? -10.155 -25.200 25.381 1.00 60.12  ? 79   HIS H N     1 
ATOM   5746  C  CA    . HIS H 4  82  ? -9.302  -24.009 25.568 1.00 63.49  ? 79   HIS H CA    1 
ATOM   5747  C  C     . HIS H 4  82  ? -7.971  -24.317 26.305 1.00 65.53  ? 79   HIS H C     1 
ATOM   5748  O  O     . HIS H 4  82  ? -6.906  -23.950 25.824 1.00 63.76  ? 79   HIS H O     1 
ATOM   5749  C  CB    . HIS H 4  82  ? -10.067 -22.866 26.261 1.00 62.20  ? 79   HIS H CB    1 
ATOM   5750  C  CG    . HIS H 4  82  ? -11.195 -22.303 25.438 1.00 79.05  ? 79   HIS H CG    1 
ATOM   5751  N  ND1   . HIS H 4  82  ? -11.019 -21.816 24.156 1.00 82.83  ? 79   HIS H ND1   1 
ATOM   5752  C  CD2   . HIS H 4  82  ? -12.517 -22.146 25.717 1.00 83.22  ? 79   HIS H CD2   1 
ATOM   5753  C  CE1   . HIS H 4  82  ? -12.179 -21.390 23.682 1.00 80.26  ? 79   HIS H CE1   1 
ATOM   5754  N  NE2   . HIS H 4  82  ? -13.103 -21.575 24.608 1.00 82.34  ? 79   HIS H NE2   1 
ATOM   5755  N  N     . TYR H 4  83  ? -8.011  -25.013 27.438 1.00 63.68  ? 80   TYR H N     1 
ATOM   5756  C  CA    . TYR H 4  83  ? -6.770  -25.307 28.158 1.00 67.04  ? 80   TYR H CA    1 
ATOM   5757  C  C     . TYR H 4  83  ? -5.805  -26.003 27.259 1.00 69.00  ? 80   TYR H C     1 
ATOM   5758  O  O     . TYR H 4  83  ? -4.603  -25.773 27.342 1.00 69.19  ? 80   TYR H O     1 
ATOM   5759  C  CB    . TYR H 4  83  ? -6.988  -26.200 29.394 1.00 70.12  ? 80   TYR H CB    1 
ATOM   5760  C  CG    . TYR H 4  83  ? -7.888  -25.615 30.451 1.00 73.10  ? 80   TYR H CG    1 
ATOM   5761  C  CD1   . TYR H 4  83  ? -8.023  -24.240 30.602 1.00 69.01  ? 80   TYR H CD1   1 
ATOM   5762  C  CD2   . TYR H 4  83  ? -8.595  -26.440 31.312 1.00 76.16  ? 80   TYR H CD2   1 
ATOM   5763  C  CE1   . TYR H 4  83  ? -8.846  -23.714 31.553 1.00 67.19  ? 80   TYR H CE1   1 
ATOM   5764  C  CE2   . TYR H 4  83  ? -9.408  -25.905 32.281 1.00 74.77  ? 80   TYR H CE2   1 
ATOM   5765  C  CZ    . TYR H 4  83  ? -9.525  -24.538 32.382 1.00 68.47  ? 80   TYR H CZ    1 
ATOM   5766  O  OH    . TYR H 4  83  ? -10.333 -23.979 33.329 1.00 82.31  ? 80   TYR H OH    1 
ATOM   5767  N  N     . ASN H 4  84  ? -6.342  -26.868 26.407 1.00 75.88  ? 81   ASN H N     1 
ATOM   5768  C  CA    . ASN H 4  84  ? -5.530  -27.634 25.480 1.00 79.15  ? 81   ASN H CA    1 
ATOM   5769  C  C     . ASN H 4  84  ? -5.429  -27.076 24.047 1.00 78.24  ? 81   ASN H C     1 
ATOM   5770  O  O     . ASN H 4  84  ? -5.141  -27.829 23.115 1.00 78.06  ? 81   ASN H O     1 
ATOM   5771  C  CB    . ASN H 4  84  ? -6.030  -29.076 25.484 1.00 78.47  ? 81   ASN H CB    1 
ATOM   5772  C  CG    . ASN H 4  84  ? -5.740  -29.770 26.798 1.00 76.54  ? 81   ASN H CG    1 
ATOM   5773  O  OD1   . ASN H 4  84  ? -4.589  -30.138 27.078 1.00 73.99  ? 81   ASN H OD1   1 
ATOM   5774  N  ND2   . ASN H 4  84  ? -6.774  -29.946 27.618 1.00 74.70  ? 81   ASN H ND2   1 
ATOM   5775  N  N     . LYS H 4  85  ? -5.636  -25.767 23.880 1.00 79.66  ? 82   LYS H N     1 
ATOM   5776  C  CA    . LYS H 4  85  ? -5.491  -25.107 22.580 1.00 78.09  ? 82   LYS H CA    1 
ATOM   5777  C  C     . LYS H 4  85  ? -6.056  -25.989 21.456 1.00 76.92  ? 82   LYS H C     1 
ATOM   5778  O  O     . LYS H 4  85  ? -5.332  -26.401 20.551 1.00 74.98  ? 82   LYS H O     1 
ATOM   5779  C  CB    . LYS H 4  85  ? -4.020  -24.797 22.326 1.00 80.28  ? 82   LYS H CB    1 
ATOM   5780  C  CG    . LYS H 4  85  ? -3.408  -23.857 23.346 1.00 88.32  ? 82   LYS H CG    1 
ATOM   5781  C  CD    . LYS H 4  85  ? -1.919  -23.620 23.095 1.00 98.76  ? 82   LYS H CD    1 
ATOM   5782  C  CE    . LYS H 4  85  ? -1.023  -24.249 24.159 1.00 103.61 ? 82   LYS H CE    1 
ATOM   5783  N  NZ    . LYS H 4  85  ? 0.428   -24.051 23.861 1.00 100.65 ? 82   LYS H NZ    1 
ATOM   5784  N  N     . ARG H 4  86  ? -7.342  -26.308 21.560 1.00 70.67  ? 83   ARG H N     1 
ATOM   5785  C  CA    . ARG H 4  86  ? -8.042  -27.092 20.566 1.00 71.85  ? 83   ARG H CA    1 
ATOM   5786  C  C     . ARG H 4  86  ? -9.271  -26.334 20.123 1.00 70.83  ? 83   ARG H C     1 
ATOM   5787  O  O     . ARG H 4  86  ? -9.952  -25.697 20.923 1.00 74.58  ? 83   ARG H O     1 
ATOM   5788  C  CB    . ARG H 4  86  ? -8.489  -28.438 21.138 1.00 77.12  ? 83   ARG H CB    1 
ATOM   5789  C  CG    . ARG H 4  86  ? -7.372  -29.370 21.561 1.00 88.13  ? 83   ARG H CG    1 
ATOM   5790  C  CD    . ARG H 4  86  ? -6.543  -29.875 20.392 1.00 93.75  ? 83   ARG H CD    1 
ATOM   5791  N  NE    . ARG H 4  86  ? -5.561  -30.877 20.826 1.00 104.07 ? 83   ARG H NE    1 
ATOM   5792  C  CZ    . ARG H 4  86  ? -4.242  -30.694 20.920 1.00 106.02 ? 83   ARG H CZ    1 
ATOM   5793  N  NH1   . ARG H 4  86  ? -3.668  -29.535 20.593 1.00 120.09 ? 83   ARG H NH1   1 
ATOM   5794  N  NH2   . ARG H 4  86  ? -3.480  -31.696 21.332 1.00 103.26 ? 83   ARG H NH2   1 
ATOM   5795  N  N     . SER H 4  87  ? -9.586  -26.432 18.848 1.00 69.76  ? 84   SER H N     1 
ATOM   5796  C  CA    . SER H 4  87  ? -10.710 -25.710 18.323 1.00 74.02  ? 84   SER H CA    1 
ATOM   5797  C  C     . SER H 4  87  ? -11.993 -26.513 18.405 1.00 75.52  ? 84   SER H C     1 
ATOM   5798  O  O     . SER H 4  87  ? -13.055 -25.992 18.070 1.00 75.33  ? 84   SER H O     1 
ATOM   5799  C  CB    . SER H 4  87  ? -10.406 -25.321 16.890 1.00 82.49  ? 84   SER H CB    1 
ATOM   5800  O  OG    . SER H 4  87  ? -9.132  -24.695 16.826 1.00 90.15  ? 84   SER H OG    1 
ATOM   5801  N  N     . THR H 4  88  ? -11.917 -27.755 18.885 1.00 72.60  ? 85   THR H N     1 
ATOM   5802  C  CA    . THR H 4  88  ? -13.048 -28.674 18.776 1.00 77.79  ? 85   THR H CA    1 
ATOM   5803  C  C     . THR H 4  88  ? -13.472 -29.359 20.109 1.00 75.55  ? 85   THR H C     1 
ATOM   5804  O  O     . THR H 4  88  ? -12.638 -29.724 20.927 1.00 79.47  ? 85   THR H O     1 
ATOM   5805  C  CB    . THR H 4  88  ? -12.725 -29.741 17.701 1.00 78.53  ? 85   THR H CB    1 
ATOM   5806  O  OG1   . THR H 4  88  ? -11.997 -29.127 16.632 1.00 82.98  ? 85   THR H OG1   1 
ATOM   5807  C  CG2   . THR H 4  88  ? -13.994 -30.380 17.132 1.00 76.06  ? 85   THR H CG2   1 
ATOM   5808  N  N     . ILE H 4  89  ? -14.787 -29.521 20.287 1.00 73.53  ? 86   ILE H N     1 
ATOM   5809  C  CA    . ILE H 4  89  ? -15.390 -30.297 21.370 1.00 69.66  ? 86   ILE H CA    1 
ATOM   5810  C  C     . ILE H 4  89  ? -15.853 -31.653 20.814 1.00 76.34  ? 86   ILE H C     1 
ATOM   5811  O  O     . ILE H 4  89  ? -16.910 -31.765 20.161 1.00 66.88  ? 86   ILE H O     1 
ATOM   5812  C  CB    . ILE H 4  89  ? -16.565 -29.532 22.026 1.00 70.20  ? 86   ILE H CB    1 
ATOM   5813  C  CG1   . ILE H 4  89  ? -16.004 -28.394 22.872 1.00 75.56  ? 86   ILE H CG1   1 
ATOM   5814  C  CG2   . ILE H 4  89  ? -17.410 -30.432 22.920 1.00 65.92  ? 86   ILE H CG2   1 
ATOM   5815  C  CD1   . ILE H 4  89  ? -17.031 -27.369 23.299 1.00 77.16  ? 86   ILE H CD1   1 
ATOM   5816  N  N     . THR H 4  90  ? -15.027 -32.667 21.074 1.00 75.76  ? 87   THR H N     1 
ATOM   5817  C  CA    . THR H 4  90  ? -15.291 -34.036 20.688 1.00 67.93  ? 87   THR H CA    1 
ATOM   5818  C  C     . THR H 4  90  ? -15.815 -34.727 21.915 1.00 70.30  ? 87   THR H C     1 
ATOM   5819  O  O     . THR H 4  90  ? -15.854 -34.153 23.000 1.00 78.15  ? 87   THR H O     1 
ATOM   5820  C  CB    . THR H 4  90  ? -13.988 -34.782 20.308 1.00 67.30  ? 87   THR H CB    1 
ATOM   5821  O  OG1   . THR H 4  90  ? -13.219 -35.036 21.486 1.00 68.22  ? 87   THR H OG1   1 
ATOM   5822  C  CG2   . THR H 4  90  ? -13.141 -33.977 19.366 1.00 67.73  ? 87   THR H CG2   1 
ATOM   5823  N  N     . SER H 4  91  ? -16.146 -35.994 21.748 1.00 66.26  ? 88   SER H N     1 
ATOM   5824  C  CA    . SER H 4  91  ? -16.659 -36.824 22.808 1.00 67.15  ? 88   SER H CA    1 
ATOM   5825  C  C     . SER H 4  91  ? -15.653 -37.007 23.965 1.00 67.41  ? 88   SER H C     1 
ATOM   5826  O  O     . SER H 4  91  ? -16.024 -37.220 25.108 1.00 78.50  ? 88   SER H O     1 
ATOM   5827  C  CB    . SER H 4  91  ? -16.991 -38.168 22.182 1.00 69.63  ? 88   SER H CB    1 
ATOM   5828  O  OG    . SER H 4  91  ? -15.890 -38.556 21.357 1.00 65.09  ? 88   SER H OG    1 
ATOM   5829  N  N     . ARG H 4  92  ? -14.376 -36.940 23.663 1.00 64.25  ? 89   ARG H N     1 
ATOM   5830  C  CA    . ARG H 4  92  ? -13.353 -37.045 24.675 1.00 66.49  ? 89   ARG H CA    1 
ATOM   5831  C  C     . ARG H 4  92  ? -13.478 -35.896 25.688 1.00 68.82  ? 89   ARG H C     1 
ATOM   5832  O  O     . ARG H 4  92  ? -13.388 -36.101 26.899 1.00 69.92  ? 89   ARG H O     1 
ATOM   5833  C  CB    . ARG H 4  92  ? -11.992 -36.987 23.992 1.00 74.11  ? 89   ARG H CB    1 
ATOM   5834  C  CG    . ARG H 4  92  ? -10.934 -37.794 24.680 1.00 79.31  ? 89   ARG H CG    1 
ATOM   5835  C  CD    . ARG H 4  92  ? -9.662  -37.756 23.883 1.00 82.88  ? 89   ARG H CD    1 
ATOM   5836  N  NE    . ARG H 4  92  ? -8.590  -38.169 24.761 1.00 85.78  ? 89   ARG H NE    1 
ATOM   5837  C  CZ    . ARG H 4  92  ? -7.883  -37.342 25.512 1.00 92.35  ? 89   ARG H CZ    1 
ATOM   5838  N  NH1   . ARG H 4  92  ? -8.119  -36.035 25.474 1.00 97.30  ? 89   ARG H NH1   1 
ATOM   5839  N  NH2   . ARG H 4  92  ? -6.926  -37.827 26.297 1.00 102.89 ? 89   ARG H NH2   1 
ATOM   5840  N  N     . GLU H 4  93  ? -13.701 -34.688 25.181 1.00 68.77  ? 90   GLU H N     1 
ATOM   5841  C  CA    . GLU H 4  93  ? -13.973 -33.542 26.044 1.00 68.27  ? 90   GLU H CA    1 
ATOM   5842  C  C     . GLU H 4  93  ? -15.273 -33.735 26.828 1.00 64.93  ? 90   GLU H C     1 
ATOM   5843  O  O     . GLU H 4  93  ? -15.300 -33.476 28.031 1.00 69.28  ? 90   GLU H O     1 
ATOM   5844  C  CB    . GLU H 4  93  ? -14.005 -32.221 25.254 1.00 70.19  ? 90   GLU H CB    1 
ATOM   5845  C  CG    . GLU H 4  93  ? -12.630 -31.701 24.824 1.00 71.38  ? 90   GLU H CG    1 
ATOM   5846  C  CD    . GLU H 4  93  ? -12.005 -32.499 23.684 1.00 76.63  ? 90   GLU H CD    1 
ATOM   5847  O  OE1   . GLU H 4  93  ? -12.732 -32.779 22.680 1.00 68.03  ? 90   GLU H OE1   1 
ATOM   5848  O  OE2   . GLU H 4  93  ? -10.796 -32.851 23.813 1.00 69.56  ? 90   GLU H OE2   1 
ATOM   5849  N  N     . ILE H 4  94  ? -16.342 -34.198 26.178 1.00 60.05  ? 91   ILE H N     1 
ATOM   5850  C  CA    . ILE H 4  94  ? -17.596 -34.476 26.922 1.00 63.46  ? 91   ILE H CA    1 
ATOM   5851  C  C     . ILE H 4  94  ? -17.390 -35.522 28.004 1.00 65.30  ? 91   ILE H C     1 
ATOM   5852  O  O     . ILE H 4  94  ? -17.978 -35.419 29.074 1.00 70.45  ? 91   ILE H O     1 
ATOM   5853  C  CB    . ILE H 4  94  ? -18.755 -34.993 26.034 1.00 60.50  ? 91   ILE H CB    1 
ATOM   5854  C  CG1   . ILE H 4  94  ? -19.155 -33.967 24.973 1.00 60.17  ? 91   ILE H CG1   1 
ATOM   5855  C  CG2   . ILE H 4  94  ? -19.959 -35.374 26.878 1.00 55.15  ? 91   ILE H CG2   1 
ATOM   5856  C  CD1   . ILE H 4  94  ? -19.547 -32.609 25.499 1.00 64.31  ? 91   ILE H CD1   1 
ATOM   5857  N  N     . GLN H 4  95  ? -16.574 -36.531 27.708 1.00 62.91  ? 92   GLN H N     1 
ATOM   5858  C  CA    . GLN H 4  95  ? -16.272 -37.609 28.660 1.00 60.64  ? 92   GLN H CA    1 
ATOM   5859  C  C     . GLN H 4  95  ? -15.468 -37.121 29.864 1.00 57.10  ? 92   GLN H C     1 
ATOM   5860  O  O     . GLN H 4  95  ? -15.881 -37.309 31.000 1.00 53.12  ? 92   GLN H O     1 
ATOM   5861  C  CB    . GLN H 4  95  ? -15.508 -38.728 27.958 1.00 59.58  ? 92   GLN H CB    1 
ATOM   5862  C  CG    . GLN H 4  95  ? -15.022 -39.797 28.899 1.00 63.63  ? 92   GLN H CG    1 
ATOM   5863  C  CD    . GLN H 4  95  ? -14.785 -41.116 28.215 1.00 61.19  ? 92   GLN H CD    1 
ATOM   5864  O  OE1   . GLN H 4  95  ? -13.640 -41.546 28.053 1.00 59.63  ? 92   GLN H OE1   1 
ATOM   5865  N  NE2   . GLN H 4  95  ? -15.866 -41.772 27.822 1.00 56.06  ? 92   GLN H NE2   1 
ATOM   5866  N  N     . THR H 4  96  ? -14.319 -36.507 29.608 1.00 56.34  ? 93   THR H N     1 
ATOM   5867  C  CA    . THR H 4  96  ? -13.540 -35.900 30.663 1.00 56.39  ? 93   THR H CA    1 
ATOM   5868  C  C     . THR H 4  96  ? -14.397 -34.938 31.506 1.00 60.13  ? 93   THR H C     1 
ATOM   5869  O  O     . THR H 4  96  ? -14.328 -34.972 32.746 1.00 59.75  ? 93   THR H O     1 
ATOM   5870  C  CB    . THR H 4  96  ? -12.355 -35.157 30.086 1.00 55.55  ? 93   THR H CB    1 
ATOM   5871  O  OG1   . THR H 4  96  ? -11.571 -36.070 29.324 1.00 67.03  ? 93   THR H OG1   1 
ATOM   5872  C  CG2   . THR H 4  96  ? -11.514 -34.622 31.168 1.00 59.20  ? 93   THR H CG2   1 
ATOM   5873  N  N     . ALA H 4  97  ? -15.202 -34.108 30.835 1.00 56.56  ? 94   ALA H N     1 
ATOM   5874  C  CA    . ALA H 4  97  ? -16.159 -33.221 31.509 1.00 57.20  ? 94   ALA H CA    1 
ATOM   5875  C  C     . ALA H 4  97  ? -17.075 -33.978 32.478 1.00 61.36  ? 94   ALA H C     1 
ATOM   5876  O  O     . ALA H 4  97  ? -17.340 -33.518 33.602 1.00 59.39  ? 94   ALA H O     1 
ATOM   5877  C  CB    . ALA H 4  97  ? -17.016 -32.486 30.488 1.00 56.66  ? 94   ALA H CB    1 
ATOM   5878  N  N     . VAL H 4  98  ? -17.588 -35.120 32.021 1.00 59.51  ? 95   VAL H N     1 
ATOM   5879  C  CA    . VAL H 4  98  ? -18.505 -35.917 32.813 1.00 51.71  ? 95   VAL H CA    1 
ATOM   5880  C  C     . VAL H 4  98  ? -17.743 -36.457 34.013 1.00 53.92  ? 95   VAL H C     1 
ATOM   5881  O  O     . VAL H 4  98  ? -18.259 -36.490 35.141 1.00 50.18  ? 95   VAL H O     1 
ATOM   5882  C  CB    . VAL H 4  98  ? -19.129 -37.050 31.969 1.00 53.65  ? 95   VAL H CB    1 
ATOM   5883  C  CG1   . VAL H 4  98  ? -19.644 -38.195 32.836 1.00 54.76  ? 95   VAL H CG1   1 
ATOM   5884  C  CG2   . VAL H 4  98  ? -20.271 -36.513 31.104 1.00 54.60  ? 95   VAL H CG2   1 
ATOM   5885  N  N     . ARG H 4  99  ? -16.501 -36.861 33.796 1.00 51.14  ? 96   ARG H N     1 
ATOM   5886  C  CA    . ARG H 4  99  ? -15.771 -37.410 34.905 1.00 55.64  ? 96   ARG H CA    1 
ATOM   5887  C  C     . ARG H 4  99  ? -15.612 -36.350 35.978 1.00 54.56  ? 96   ARG H C     1 
ATOM   5888  O  O     . ARG H 4  99  ? -15.858 -36.626 37.143 1.00 60.44  ? 96   ARG H O     1 
ATOM   5889  C  CB    . ARG H 4  99  ? -14.432 -38.011 34.479 1.00 55.43  ? 96   ARG H CB    1 
ATOM   5890  C  CG    . ARG H 4  99  ? -14.571 -39.377 33.832 1.00 58.21  ? 96   ARG H CG    1 
ATOM   5891  C  CD    . ARG H 4  99  ? -13.267 -40.146 33.781 1.00 67.51  ? 96   ARG H CD    1 
ATOM   5892  N  NE    . ARG H 4  99  ? -13.437 -41.410 33.050 1.00 81.35  ? 96   ARG H NE    1 
ATOM   5893  C  CZ    . ARG H 4  99  ? -12.978 -41.671 31.814 1.00 84.80  ? 96   ARG H CZ    1 
ATOM   5894  N  NH1   . ARG H 4  99  ? -12.281 -40.774 31.111 1.00 85.51  ? 96   ARG H NH1   1 
ATOM   5895  N  NH2   . ARG H 4  99  ? -13.213 -42.859 31.270 1.00 82.51  ? 96   ARG H NH2   1 
ATOM   5896  N  N     . LEU H 4  100 ? -15.263 -35.139 35.556 1.00 52.63  ? 97   LEU H N     1 
ATOM   5897  C  CA    . LEU H 4  100 ? -15.007 -34.009 36.454 1.00 49.51  ? 97   LEU H CA    1 
ATOM   5898  C  C     . LEU H 4  100 ? -16.250 -33.495 37.180 1.00 48.10  ? 97   LEU H C     1 
ATOM   5899  O  O     . LEU H 4  100 ? -16.155 -33.040 38.285 1.00 46.39  ? 97   LEU H O     1 
ATOM   5900  C  CB    . LEU H 4  100 ? -14.382 -32.849 35.657 1.00 49.35  ? 97   LEU H CB    1 
ATOM   5901  C  CG    . LEU H 4  100 ? -12.961 -33.011 35.115 1.00 48.29  ? 97   LEU H CG    1 
ATOM   5902  C  CD1   . LEU H 4  100 ? -12.642 -31.811 34.262 1.00 51.09  ? 97   LEU H CD1   1 
ATOM   5903  C  CD2   . LEU H 4  100 ? -11.947 -33.133 36.235 1.00 48.92  ? 97   LEU H CD2   1 
ATOM   5904  N  N     . LEU H 4  101 ? -17.405 -33.577 36.544 1.00 56.79  ? 98   LEU H N     1 
ATOM   5905  C  CA    . LEU H 4  101 ? -18.640 -33.060 37.100 1.00 61.38  ? 98   LEU H CA    1 
ATOM   5906  C  C     . LEU H 4  101 ? -19.415 -34.037 37.902 1.00 56.56  ? 98   LEU H C     1 
ATOM   5907  O  O     . LEU H 4  101 ? -20.046 -33.650 38.870 1.00 61.82  ? 98   LEU H O     1 
ATOM   5908  C  CB    . LEU H 4  101 ? -19.578 -32.595 35.998 1.00 68.46  ? 98   LEU H CB    1 
ATOM   5909  C  CG    . LEU H 4  101 ? -19.229 -31.196 35.552 1.00 75.80  ? 98   LEU H CG    1 
ATOM   5910  C  CD1   . LEU H 4  101 ? -19.903 -30.926 34.227 1.00 81.62  ? 98   LEU H CD1   1 
ATOM   5911  C  CD2   . LEU H 4  101 ? -19.677 -30.189 36.603 1.00 79.90  ? 98   LEU H CD2   1 
ATOM   5912  N  N     . LEU H 4  102 ? -19.445 -35.288 37.468 1.00 59.01  ? 99   LEU H N     1 
ATOM   5913  C  CA    . LEU H 4  102 ? -20.316 -36.280 38.117 1.00 54.91  ? 99   LEU H CA    1 
ATOM   5914  C  C     . LEU H 4  102 ? -19.606 -36.990 39.292 1.00 55.31  ? 99   LEU H C     1 
ATOM   5915  O  O     . LEU H 4  102 ? -18.383 -37.204 39.284 1.00 60.40  ? 99   LEU H O     1 
ATOM   5916  C  CB    . LEU H 4  102 ? -20.883 -37.286 37.107 1.00 51.18  ? 99   LEU H CB    1 
ATOM   5917  C  CG    . LEU H 4  102 ? -21.789 -36.805 35.946 1.00 52.16  ? 99   LEU H CG    1 
ATOM   5918  C  CD1   . LEU H 4  102 ? -22.859 -37.828 35.638 1.00 57.40  ? 99   LEU H CD1   1 
ATOM   5919  C  CD2   . LEU H 4  102 ? -22.508 -35.516 36.221 1.00 51.73  ? 99   LEU H CD2   1 
ATOM   5920  N  N     . PRO H 4  103 ? -20.369 -37.295 40.333 1.00 51.25  ? 100  PRO H N     1 
ATOM   5921  C  CA    . PRO H 4  103 ? -19.858 -38.116 41.372 1.00 54.25  ? 100  PRO H CA    1 
ATOM   5922  C  C     . PRO H 4  103 ? -19.646 -39.572 40.900 1.00 62.15  ? 100  PRO H C     1 
ATOM   5923  O  O     . PRO H 4  103 ? -20.481 -40.109 40.162 1.00 55.91  ? 100  PRO H O     1 
ATOM   5924  C  CB    . PRO H 4  103 ? -20.943 -38.051 42.449 1.00 57.72  ? 100  PRO H CB    1 
ATOM   5925  C  CG    . PRO H 4  103 ? -22.006 -37.142 41.983 1.00 54.54  ? 100  PRO H CG    1 
ATOM   5926  C  CD    . PRO H 4  103 ? -21.757 -36.863 40.554 1.00 55.80  ? 100  PRO H CD    1 
ATOM   5927  N  N     . GLY H 4  104 ? -18.519 -40.163 41.329 1.00 66.93  ? 101  GLY H N     1 
ATOM   5928  C  CA    . GLY H 4  104 ? -18.196 -41.595 41.196 1.00 64.64  ? 101  GLY H CA    1 
ATOM   5929  C  C     . GLY H 4  104 ? -19.065 -42.519 40.351 1.00 66.64  ? 101  GLY H C     1 
ATOM   5930  O  O     . GLY H 4  104 ? -18.802 -42.680 39.165 1.00 66.48  ? 101  GLY H O     1 
ATOM   5931  N  N     . GLU H 4  105 ? -20.069 -43.159 40.954 1.00 63.03  ? 102  GLU H N     1 
ATOM   5932  C  CA    . GLU H 4  105 ? -20.865 -44.164 40.237 1.00 69.21  ? 102  GLU H CA    1 
ATOM   5933  C  C     . GLU H 4  105 ? -21.699 -43.555 39.103 1.00 70.74  ? 102  GLU H C     1 
ATOM   5934  O  O     . GLU H 4  105 ? -21.834 -44.143 38.028 1.00 74.73  ? 102  GLU H O     1 
ATOM   5935  C  CB    . GLU H 4  105 ? -21.790 -44.961 41.177 1.00 77.46  ? 102  GLU H CB    1 
ATOM   5936  C  CG    . GLU H 4  105 ? -21.134 -46.054 42.025 1.00 90.08  ? 102  GLU H CG    1 
ATOM   5937  C  CD    . GLU H 4  105 ? -20.620 -47.268 41.241 1.00 99.54  ? 102  GLU H CD    1 
ATOM   5938  O  OE1   . GLU H 4  105 ? -21.440 -48.104 40.671 1.00 132.05 ? 102  GLU H OE1   1 
ATOM   5939  O  OE2   . GLU H 4  105 ? -19.360 -47.384 41.232 1.00 90.37  ? 102  GLU H OE2   1 
ATOM   5940  N  N     . LEU H 4  106 ? -22.274 -42.386 39.343 1.00 66.50  ? 103  LEU H N     1 
ATOM   5941  C  CA    . LEU H 4  106 ? -23.037 -41.713 38.309 1.00 61.96  ? 103  LEU H CA    1 
ATOM   5942  C  C     . LEU H 4  106 ? -22.104 -41.482 37.126 1.00 61.05  ? 103  LEU H C     1 
ATOM   5943  O  O     . LEU H 4  106 ? -22.452 -41.795 35.989 1.00 60.58  ? 103  LEU H O     1 
ATOM   5944  C  CB    . LEU H 4  106 ? -23.584 -40.387 38.827 1.00 64.53  ? 103  LEU H CB    1 
ATOM   5945  C  CG    . LEU H 4  106 ? -25.067 -40.046 38.705 1.00 67.57  ? 103  LEU H CG    1 
ATOM   5946  C  CD1   . LEU H 4  106 ? -26.003 -41.232 38.834 1.00 65.52  ? 103  LEU H CD1   1 
ATOM   5947  C  CD2   . LEU H 4  106 ? -25.401 -39.024 39.786 1.00 68.44  ? 103  LEU H CD2   1 
ATOM   5948  N  N     . ALA H 4  107 ? -20.902 -40.970 37.385 1.00 55.98  ? 104  ALA H N     1 
ATOM   5949  C  CA    . ALA H 4  107 ? -19.949 -40.773 36.296 1.00 56.57  ? 104  ALA H CA    1 
ATOM   5950  C  C     . ALA H 4  107 ? -19.763 -42.066 35.550 1.00 61.91  ? 104  ALA H C     1 
ATOM   5951  O  O     . ALA H 4  107 ? -19.890 -42.097 34.326 1.00 67.56  ? 104  ALA H O     1 
ATOM   5952  C  CB    . ALA H 4  107 ? -18.601 -40.286 36.793 1.00 56.57  ? 104  ALA H CB    1 
ATOM   5953  N  N     . LYS H 4  108 ? -19.467 -43.140 36.275 1.00 61.96  ? 105  LYS H N     1 
ATOM   5954  C  CA    . LYS H 4  108 ? -19.057 -44.350 35.602 1.00 66.74  ? 105  LYS H CA    1 
ATOM   5955  C  C     . LYS H 4  108 ? -20.174 -44.866 34.692 1.00 66.01  ? 105  LYS H C     1 
ATOM   5956  O  O     . LYS H 4  108 ? -19.945 -45.090 33.498 1.00 57.22  ? 105  LYS H O     1 
ATOM   5957  C  CB    . LYS H 4  108 ? -18.478 -45.372 36.582 1.00 73.37  ? 105  LYS H CB    1 
ATOM   5958  C  CG    . LYS H 4  108 ? -16.998 -45.047 36.891 1.00 83.77  ? 105  LYS H CG    1 
ATOM   5959  C  CD    . LYS H 4  108 ? -16.512 -45.501 38.267 1.00 90.21  ? 105  LYS H CD    1 
ATOM   5960  C  CE    . LYS H 4  108 ? -15.069 -45.085 38.527 1.00 99.10  ? 105  LYS H CE    1 
ATOM   5961  N  NZ    . LYS H 4  108 ? -14.471 -45.781 39.712 1.00 109.48 ? 105  LYS H NZ    1 
ATOM   5962  N  N     . HIS H 4  109 ? -21.390 -44.958 35.214 1.00 72.22  ? 106  HIS H N     1 
ATOM   5963  C  CA    . HIS H 4  109 ? -22.520 -45.409 34.400 1.00 73.48  ? 106  HIS H CA    1 
ATOM   5964  C  C     . HIS H 4  109 ? -22.819 -44.420 33.259 1.00 79.33  ? 106  HIS H C     1 
ATOM   5965  O  O     . HIS H 4  109 ? -23.042 -44.839 32.118 1.00 83.82  ? 106  HIS H O     1 
ATOM   5966  C  CB    . HIS H 4  109 ? -23.737 -45.661 35.273 1.00 73.88  ? 106  HIS H CB    1 
ATOM   5967  C  CG    . HIS H 4  109 ? -23.577 -46.835 36.195 1.00 78.89  ? 106  HIS H CG    1 
ATOM   5968  N  ND1   . HIS H 4  109 ? -24.007 -48.096 35.864 1.00 80.71  ? 106  HIS H ND1   1 
ATOM   5969  C  CD2   . HIS H 4  109 ? -23.032 -46.941 37.430 1.00 89.63  ? 106  HIS H CD2   1 
ATOM   5970  C  CE1   . HIS H 4  109 ? -23.738 -48.932 36.852 1.00 98.13  ? 106  HIS H CE1   1 
ATOM   5971  N  NE2   . HIS H 4  109 ? -23.144 -48.260 37.821 1.00 113.28 ? 106  HIS H NE2   1 
ATOM   5972  N  N     . ALA H 4  110 ? -22.775 -43.116 33.555 1.00 76.64  ? 107  ALA H N     1 
ATOM   5973  C  CA    . ALA H 4  110 ? -22.953 -42.065 32.533 1.00 64.03  ? 107  ALA H CA    1 
ATOM   5974  C  C     . ALA H 4  110 ? -21.964 -42.225 31.403 1.00 62.17  ? 107  ALA H C     1 
ATOM   5975  O  O     . ALA H 4  110 ? -22.338 -42.093 30.238 1.00 63.27  ? 107  ALA H O     1 
ATOM   5976  C  CB    . ALA H 4  110 ? -22.794 -40.685 33.141 1.00 60.06  ? 107  ALA H CB    1 
ATOM   5977  N  N     . VAL H 4  111 ? -20.706 -42.498 31.752 1.00 59.72  ? 108  VAL H N     1 
ATOM   5978  C  CA    . VAL H 4  111 ? -19.638 -42.694 30.759 1.00 62.33  ? 108  VAL H CA    1 
ATOM   5979  C  C     . VAL H 4  111 ? -19.871 -43.908 29.888 1.00 67.27  ? 108  VAL H C     1 
ATOM   5980  O  O     . VAL H 4  111 ? -19.613 -43.882 28.680 1.00 69.21  ? 108  VAL H O     1 
ATOM   5981  C  CB    . VAL H 4  111 ? -18.266 -42.857 31.425 1.00 57.46  ? 108  VAL H CB    1 
ATOM   5982  C  CG1   . VAL H 4  111 ? -17.266 -43.473 30.478 1.00 54.34  ? 108  VAL H CG1   1 
ATOM   5983  C  CG2   . VAL H 4  111 ? -17.776 -41.507 31.892 1.00 56.38  ? 108  VAL H CG2   1 
ATOM   5984  N  N     . SER H 4  112 ? -20.339 -44.985 30.499 1.00 68.21  ? 109  SER H N     1 
ATOM   5985  C  CA    . SER H 4  112 ? -20.528 -46.195 29.745 1.00 69.27  ? 109  SER H CA    1 
ATOM   5986  C  C     . SER H 4  112 ? -21.735 -45.995 28.831 1.00 70.24  ? 109  SER H C     1 
ATOM   5987  O  O     . SER H 4  112 ? -21.683 -46.362 27.672 1.00 78.90  ? 109  SER H O     1 
ATOM   5988  C  CB    . SER H 4  112 ? -20.648 -47.408 30.673 1.00 72.63  ? 109  SER H CB    1 
ATOM   5989  O  OG    . SER H 4  112 ? -21.932 -47.501 31.262 1.00 76.13  ? 109  SER H OG    1 
ATOM   5990  N  N     . GLU H 4  113 ? -22.793 -45.357 29.312 1.00 68.82  ? 110  GLU H N     1 
ATOM   5991  C  CA    . GLU H 4  113 ? -23.922 -45.049 28.429 1.00 72.56  ? 110  GLU H CA    1 
ATOM   5992  C  C     . GLU H 4  113 ? -23.531 -44.144 27.274 1.00 71.06  ? 110  GLU H C     1 
ATOM   5993  O  O     . GLU H 4  113 ? -24.092 -44.236 26.186 1.00 75.76  ? 110  GLU H O     1 
ATOM   5994  C  CB    . GLU H 4  113 ? -25.070 -44.410 29.194 1.00 78.40  ? 110  GLU H CB    1 
ATOM   5995  C  CG    . GLU H 4  113 ? -25.773 -45.361 30.156 1.00 85.23  ? 110  GLU H CG    1 
ATOM   5996  C  CD    . GLU H 4  113 ? -26.672 -46.380 29.479 1.00 85.16  ? 110  GLU H CD    1 
ATOM   5997  O  OE1   . GLU H 4  113 ? -27.107 -46.140 28.332 1.00 95.80  ? 110  GLU H OE1   1 
ATOM   5998  O  OE2   . GLU H 4  113 ? -26.963 -47.419 30.110 1.00 90.24  ? 110  GLU H OE2   1 
ATOM   5999  N  N     . GLY H 4  114 ? -22.580 -43.259 27.520 1.00 71.17  ? 111  GLY H N     1 
ATOM   6000  C  CA    . GLY H 4  114 ? -22.115 -42.340 26.498 1.00 69.71  ? 111  GLY H CA    1 
ATOM   6001  C  C     . GLY H 4  114 ? -21.248 -43.018 25.457 1.00 67.02  ? 111  GLY H C     1 
ATOM   6002  O  O     . GLY H 4  114 ? -21.429 -42.792 24.278 1.00 59.97  ? 111  GLY H O     1 
ATOM   6003  N  N     . THR H 4  115 ? -20.298 -43.840 25.889 1.00 71.76  ? 112  THR H N     1 
ATOM   6004  C  CA    . THR H 4  115 ? -19.441 -44.578 24.955 1.00 79.22  ? 112  THR H CA    1 
ATOM   6005  C  C     . THR H 4  115 ? -20.270 -45.577 24.125 1.00 83.54  ? 112  THR H C     1 
ATOM   6006  O  O     . THR H 4  115 ? -19.995 -45.821 22.934 1.00 70.20  ? 112  THR H O     1 
ATOM   6007  C  CB    . THR H 4  115 ? -18.324 -45.309 25.710 1.00 79.28  ? 112  THR H CB    1 
ATOM   6008  O  OG1   . THR H 4  115 ? -17.454 -44.339 26.309 1.00 81.94  ? 112  THR H OG1   1 
ATOM   6009  C  CG2   . THR H 4  115 ? -17.517 -46.186 24.778 1.00 80.49  ? 112  THR H CG2   1 
ATOM   6010  N  N     . LYS H 4  116 ? -21.301 -46.117 24.774 1.00 88.28  ? 113  LYS H N     1 
ATOM   6011  C  CA    . LYS H 4  116 ? -22.242 -47.044 24.150 1.00 91.67  ? 113  LYS H CA    1 
ATOM   6012  C  C     . LYS H 4  116 ? -22.934 -46.408 22.974 1.00 91.17  ? 113  LYS H C     1 
ATOM   6013  O  O     . LYS H 4  116 ? -22.878 -46.919 21.865 1.00 108.38 ? 113  LYS H O     1 
ATOM   6014  C  CB    . LYS H 4  116 ? -23.316 -47.468 25.142 1.00 90.41  ? 113  LYS H CB    1 
ATOM   6015  C  CG    . LYS H 4  116 ? -23.688 -48.919 25.045 1.00 94.01  ? 113  LYS H CG    1 
ATOM   6016  C  CD    . LYS H 4  116 ? -24.833 -49.229 25.989 1.00 96.86  ? 113  LYS H CD    1 
ATOM   6017  C  CE    . LYS H 4  116 ? -26.160 -48.970 25.310 1.00 99.22  ? 113  LYS H CE    1 
ATOM   6018  N  NZ    . LYS H 4  116 ? -27.291 -49.213 26.247 1.00 109.94 ? 113  LYS H NZ    1 
ATOM   6019  N  N     . ALA H 4  117 ? -23.589 -45.284 23.225 1.00 84.38  ? 114  ALA H N     1 
ATOM   6020  C  CA    . ALA H 4  117 ? -24.365 -44.623 22.203 1.00 76.70  ? 114  ALA H CA    1 
ATOM   6021  C  C     . ALA H 4  117 ? -23.506 -44.235 21.000 1.00 78.38  ? 114  ALA H C     1 
ATOM   6022  O  O     . ALA H 4  117 ? -24.015 -44.216 19.874 1.00 76.37  ? 114  ALA H O     1 
ATOM   6023  C  CB    . ALA H 4  117 ? -25.064 -43.406 22.781 1.00 75.38  ? 114  ALA H CB    1 
ATOM   6024  N  N     . VAL H 4  118 ? -22.218 -43.943 21.235 1.00 75.47  ? 115  VAL H N     1 
ATOM   6025  C  CA    . VAL H 4  118 ? -21.297 -43.517 20.169 1.00 75.58  ? 115  VAL H CA    1 
ATOM   6026  C  C     . VAL H 4  118 ? -20.866 -44.701 19.326 1.00 82.82  ? 115  VAL H C     1 
ATOM   6027  O  O     . VAL H 4  118 ? -20.819 -44.609 18.098 1.00 93.64  ? 115  VAL H O     1 
ATOM   6028  C  CB    . VAL H 4  118 ? -20.060 -42.789 20.733 1.00 79.18  ? 115  VAL H CB    1 
ATOM   6029  C  CG1   . VAL H 4  118 ? -18.899 -42.792 19.748 1.00 82.79  ? 115  VAL H CG1   1 
ATOM   6030  C  CG2   . VAL H 4  118 ? -20.423 -41.356 21.094 1.00 77.10  ? 115  VAL H CG2   1 
ATOM   6031  N  N     . THR H 4  119 ? -20.543 -45.806 19.989 1.00 88.58  ? 116  THR H N     1 
ATOM   6032  C  CA    . THR H 4  119 ? -20.332 -47.082 19.311 1.00 86.74  ? 116  THR H CA    1 
ATOM   6033  C  C     . THR H 4  119 ? -21.516 -47.399 18.379 1.00 85.56  ? 116  THR H C     1 
ATOM   6034  O  O     . THR H 4  119 ? -21.379 -47.358 17.157 1.00 94.64  ? 116  THR H O     1 
ATOM   6035  C  CB    . THR H 4  119 ? -20.090 -48.194 20.351 1.00 91.15  ? 116  THR H CB    1 
ATOM   6036  O  OG1   . THR H 4  119 ? -18.748 -48.076 20.834 1.00 93.93  ? 116  THR H OG1   1 
ATOM   6037  C  CG2   . THR H 4  119 ? -20.283 -49.594 19.764 1.00 101.42 ? 116  THR H CG2   1 
ATOM   6038  N  N     . LYS H 4  120 ? -22.679 -47.667 18.960 1.00 83.05  ? 117  LYS H N     1 
ATOM   6039  C  CA    . LYS H 4  120 ? -23.893 -47.953 18.199 1.00 80.70  ? 117  LYS H CA    1 
ATOM   6040  C  C     . LYS H 4  120 ? -24.077 -46.986 17.029 1.00 82.24  ? 117  LYS H C     1 
ATOM   6041  O  O     . LYS H 4  120 ? -24.417 -47.401 15.937 1.00 95.36  ? 117  LYS H O     1 
ATOM   6042  C  CB    . LYS H 4  120 ? -25.109 -47.902 19.127 1.00 84.37  ? 117  LYS H CB    1 
ATOM   6043  C  CG    . LYS H 4  120 ? -26.412 -48.422 18.536 1.00 90.01  ? 117  LYS H CG    1 
ATOM   6044  C  CD    . LYS H 4  120 ? -27.318 -49.044 19.602 1.00 95.50  ? 117  LYS H CD    1 
ATOM   6045  C  CE    . LYS H 4  120 ? -28.234 -50.131 19.039 1.00 100.84 ? 117  LYS H CE    1 
ATOM   6046  N  NZ    . LYS H 4  120 ? -29.088 -49.669 17.905 1.00 104.30 ? 117  LYS H NZ    1 
ATOM   6047  N  N     . TYR H 4  121 ? -23.824 -45.706 17.256 1.00 85.12  ? 118  TYR H N     1 
ATOM   6048  C  CA    . TYR H 4  121 ? -24.020 -44.685 16.235 1.00 84.22  ? 118  TYR H CA    1 
ATOM   6049  C  C     . TYR H 4  121 ? -23.043 -44.842 15.067 1.00 91.13  ? 118  TYR H C     1 
ATOM   6050  O  O     . TYR H 4  121 ? -23.440 -44.681 13.908 1.00 100.79 ? 118  TYR H O     1 
ATOM   6051  C  CB    . TYR H 4  121 ? -23.904 -43.269 16.852 1.00 80.18  ? 118  TYR H CB    1 
ATOM   6052  C  CG    . TYR H 4  121 ? -24.055 -42.115 15.856 1.00 76.95  ? 118  TYR H CG    1 
ATOM   6053  C  CD1   . TYR H 4  121 ? -25.329 -41.634 15.488 1.00 74.21  ? 118  TYR H CD1   1 
ATOM   6054  C  CD2   . TYR H 4  121 ? -22.926 -41.511 15.270 1.00 71.99  ? 118  TYR H CD2   1 
ATOM   6055  C  CE1   . TYR H 4  121 ? -25.467 -40.597 14.572 1.00 71.89  ? 118  TYR H CE1   1 
ATOM   6056  C  CE2   . TYR H 4  121 ? -23.057 -40.466 14.356 1.00 70.17  ? 118  TYR H CE2   1 
ATOM   6057  C  CZ    . TYR H 4  121 ? -24.325 -40.016 14.007 1.00 74.39  ? 118  TYR H CZ    1 
ATOM   6058  O  OH    . TYR H 4  121 ? -24.472 -38.977 13.104 1.00 81.75  ? 118  TYR H OH    1 
ATOM   6059  N  N     . THR H 4  122 ? -21.778 -45.143 15.359 1.00 92.73  ? 119  THR H N     1 
ATOM   6060  C  CA    . THR H 4  122 ? -20.763 -45.314 14.307 1.00 100.32 ? 119  THR H CA    1 
ATOM   6061  C  C     . THR H 4  122 ? -21.081 -46.503 13.389 1.00 111.58 ? 119  THR H C     1 
ATOM   6062  O  O     . THR H 4  122 ? -21.094 -46.367 12.163 1.00 114.51 ? 119  THR H O     1 
ATOM   6063  C  CB    . THR H 4  122 ? -19.373 -45.523 14.926 1.00 103.30 ? 119  THR H CB    1 
ATOM   6064  O  OG1   . THR H 4  122 ? -19.092 -44.428 15.797 1.00 106.76 ? 119  THR H OG1   1 
ATOM   6065  C  CG2   . THR H 4  122 ? -18.279 -45.609 13.859 1.00 103.71 ? 119  THR H CG2   1 
ATOM   6066  N  N     . SER H 4  123 ? -21.332 -47.659 14.004 1.00 115.15 ? 120  SER H N     1 
ATOM   6067  C  CA    . SER H 4  123 ? -21.699 -48.888 13.298 1.00 116.87 ? 120  SER H CA    1 
ATOM   6068  C  C     . SER H 4  123 ? -22.947 -48.730 12.419 1.00 124.94 ? 120  SER H C     1 
ATOM   6069  O  O     . SER H 4  123 ? -22.952 -49.121 11.243 1.00 123.58 ? 120  SER H O     1 
ATOM   6070  C  CB    . SER H 4  123 ? -21.931 -50.013 14.308 1.00 114.56 ? 120  SER H CB    1 
ATOM   6071  O  OG    . SER H 4  123 ? -20.785 -50.199 15.116 1.00 116.64 ? 120  SER H OG    1 
ATOM   6072  N  N     . ALA H 4  124 ? -24.007 -48.174 12.992 1.00 128.74 ? 121  ALA H N     1 
ATOM   6073  C  CA    . ALA H 4  124 ? -25.214 -47.901 12.224 1.00 135.11 ? 121  ALA H CA    1 
ATOM   6074  C  C     . ALA H 4  124 ? -24.844 -47.040 11.018 1.00 138.95 ? 121  ALA H C     1 
ATOM   6075  O  O     . ALA H 4  124 ? -24.100 -46.064 11.147 1.00 124.21 ? 121  ALA H O     1 
ATOM   6076  C  CB    . ALA H 4  124 ? -26.259 -47.207 13.083 1.00 136.09 ? 121  ALA H CB    1 
ATOM   6077  N  N     . LYS H 4  125 ? -25.349 -47.437 9.850  1.00 151.56 ? 122  LYS H N     1 
ATOM   6078  C  CA    . LYS H 4  125 ? -25.034 -46.778 8.574  1.00 154.46 ? 122  LYS H CA    1 
ATOM   6079  C  C     . LYS H 4  125 ? -25.662 -45.373 8.454  1.00 154.09 ? 122  LYS H C     1 
ATOM   6080  O  O     . LYS H 4  125 ? -26.055 -44.743 9.444  1.00 145.58 ? 122  LYS H O     1 
ATOM   6081  C  CB    . LYS H 4  125 ? -25.428 -47.686 7.384  1.00 150.74 ? 122  LYS H CB    1 
ATOM   6082  C  CG    . LYS H 4  125 ? -26.908 -48.067 7.294  1.00 147.38 ? 122  LYS H CG    1 
ATOM   6083  C  CD    . LYS H 4  125 ? -27.110 -49.443 6.661  1.00 148.79 ? 122  LYS H CD    1 
ATOM   6084  C  CE    . LYS H 4  125 ? -28.545 -49.941 6.815  1.00 141.99 ? 122  LYS H CE    1 
ATOM   6085  N  NZ    . LYS H 4  125 ? -28.746 -51.321 6.284  1.00 131.74 ? 122  LYS H NZ    1 
ATOM   6086  O  OXT   . LYS H 4  125 ? -25.772 -44.807 7.365  1.00 146.24 ? 122  LYS H OXT   1 
ATOM   6087  O  "O5'" . DA  I 5  1   ? 3.623   0.145   91.131 1.00 145.47 ? -72  DA  I "O5'" 1 
ATOM   6088  C  "C5'" . DA  I 5  1   ? 4.560   -0.893  91.485 1.00 147.20 ? -72  DA  I "C5'" 1 
ATOM   6089  C  "C4'" . DA  I 5  1   ? 4.849   -0.870  92.969 1.00 151.96 ? -72  DA  I "C4'" 1 
ATOM   6090  O  "O4'" . DA  I 5  1   ? 3.785   -1.530  93.701 1.00 163.13 ? -72  DA  I "O4'" 1 
ATOM   6091  C  "C3'" . DA  I 5  1   ? 6.144   -1.585  93.352 1.00 154.61 ? -72  DA  I "C3'" 1 
ATOM   6092  O  "O3'" . DA  I 5  1   ? 7.184   -0.610  93.496 1.00 150.77 ? -72  DA  I "O3'" 1 
ATOM   6093  C  "C2'" . DA  I 5  1   ? 5.789   -2.333  94.627 1.00 157.88 ? -72  DA  I "C2'" 1 
ATOM   6094  C  "C1'" . DA  I 5  1   ? 4.293   -2.600  94.490 1.00 162.75 ? -72  DA  I "C1'" 1 
ATOM   6095  N  N9    . DA  I 5  1   ? 3.883   -3.863  93.856 1.00 168.24 ? -72  DA  I N9    1 
ATOM   6096  C  C8    . DA  I 5  1   ? 2.845   -4.017  92.969 1.00 167.94 ? -72  DA  I C8    1 
ATOM   6097  N  N7    . DA  I 5  1   ? 2.680   -5.249  92.555 1.00 160.80 ? -72  DA  I N7    1 
ATOM   6098  C  C5    . DA  I 5  1   ? 3.666   -5.960  93.223 1.00 156.89 ? -72  DA  I C5    1 
ATOM   6099  C  C6    . DA  I 5  1   ? 4.014   -7.320  93.217 1.00 150.69 ? -72  DA  I C6    1 
ATOM   6100  N  N6    . DA  I 5  1   ? 3.380   -8.238  92.485 1.00 147.56 ? -72  DA  I N6    1 
ATOM   6101  N  N1    . DA  I 5  1   ? 5.048   -7.708  93.995 1.00 149.63 ? -72  DA  I N1    1 
ATOM   6102  C  C2    . DA  I 5  1   ? 5.679   -6.782  94.731 1.00 155.65 ? -72  DA  I C2    1 
ATOM   6103  N  N3    . DA  I 5  1   ? 5.438   -5.475  94.827 1.00 161.28 ? -72  DA  I N3    1 
ATOM   6104  C  C4    . DA  I 5  1   ? 4.410   -5.122  94.035 1.00 161.40 ? -72  DA  I C4    1 
ATOM   6105  P  P     . DT  I 5  2   ? 8.722   -1.059  93.476 1.00 165.21 ? -71  DT  I P     1 
ATOM   6106  O  OP1   . DT  I 5  2   ? 9.539   0.090   93.936 1.00 177.85 ? -71  DT  I OP1   1 
ATOM   6107  O  OP2   . DT  I 5  2   ? 9.014   -1.662  92.151 1.00 152.70 ? -71  DT  I OP2   1 
ATOM   6108  O  "O5'" . DT  I 5  2   ? 8.763   -2.182  94.605 1.00 158.00 ? -71  DT  I "O5'" 1 
ATOM   6109  C  "C5'" . DT  I 5  2   ? 9.882   -2.325  95.494 1.00 159.75 ? -71  DT  I "C5'" 1 
ATOM   6110  C  "C4'" . DT  I 5  2   ? 10.521  -3.678  95.287 1.00 165.68 ? -71  DT  I "C4'" 1 
ATOM   6111  O  "O4'" . DT  I 5  2   ? 9.527   -4.618  94.801 1.00 168.97 ? -71  DT  I "O4'" 1 
ATOM   6112  C  "C3'" . DT  I 5  2   ? 11.666  -3.698  94.267 1.00 164.68 ? -71  DT  I "C3'" 1 
ATOM   6113  O  "O3'" . DT  I 5  2   ? 12.796  -4.408  94.796 1.00 158.12 ? -71  DT  I "O3'" 1 
ATOM   6114  C  "C2'" . DT  I 5  2   ? 11.071  -4.425  93.075 1.00 167.34 ? -71  DT  I "C2'" 1 
ATOM   6115  C  "C1'" . DT  I 5  2   ? 10.106  -5.376  93.754 1.00 173.63 ? -71  DT  I "C1'" 1 
ATOM   6116  N  N1    . DT  I 5  2   ? 9.017   -5.905  92.894 1.00 176.97 ? -71  DT  I N1    1 
ATOM   6117  C  C2    . DT  I 5  2   ? 8.985   -7.263  92.663 1.00 173.03 ? -71  DT  I C2    1 
ATOM   6118  O  O2    . DT  I 5  2   ? 9.790   -8.043  93.147 1.00 172.49 ? -71  DT  I O2    1 
ATOM   6119  N  N3    . DT  I 5  2   ? 7.964   -7.680  91.844 1.00 160.94 ? -71  DT  I N3    1 
ATOM   6120  C  C4    . DT  I 5  2   ? 7.000   -6.893  91.244 1.00 151.16 ? -71  DT  I C4    1 
ATOM   6121  O  O4    . DT  I 5  2   ? 6.148   -7.410  90.530 1.00 143.90 ? -71  DT  I O4    1 
ATOM   6122  C  C5    . DT  I 5  2   ? 7.097   -5.479  91.523 1.00 154.63 ? -71  DT  I C5    1 
ATOM   6123  C  C7    . DT  I 5  2   ? 6.096   -4.549  90.911 1.00 141.01 ? -71  DT  I C7    1 
ATOM   6124  C  C6    . DT  I 5  2   ? 8.091   -5.060  92.319 1.00 172.53 ? -71  DT  I C6    1 
ATOM   6125  P  P     . DC  I 5  3   ? 14.208  -4.383  94.030 1.00 157.15 ? -70  DC  I P     1 
ATOM   6126  O  OP1   . DC  I 5  3   ? 15.292  -4.324  95.045 1.00 147.94 ? -70  DC  I OP1   1 
ATOM   6127  O  OP2   . DC  I 5  3   ? 14.134  -3.358  92.955 1.00 156.15 ? -70  DC  I OP2   1 
ATOM   6128  O  "O5'" . DC  I 5  3   ? 14.275  -5.818  93.341 1.00 167.20 ? -70  DC  I "O5'" 1 
ATOM   6129  C  "C5'" . DC  I 5  3   ? 14.521  -7.013  94.107 1.00 164.46 ? -70  DC  I "C5'" 1 
ATOM   6130  C  "C4'" . DC  I 5  3   ? 14.521  -8.219  93.195 1.00 164.98 ? -70  DC  I "C4'" 1 
ATOM   6131  O  "O4'" . DC  I 5  3   ? 13.215  -8.377  92.581 1.00 171.22 ? -70  DC  I "O4'" 1 
ATOM   6132  C  "C3'" . DC  I 5  3   ? 15.520  -8.142  92.037 1.00 158.42 ? -70  DC  I "C3'" 1 
ATOM   6133  O  "O3'" . DC  I 5  3   ? 16.139  -9.416  91.848 1.00 143.43 ? -70  DC  I "O3'" 1 
ATOM   6134  C  "C2'" . DC  I 5  3   ? 14.655  -7.758  90.849 1.00 158.28 ? -70  DC  I "C2'" 1 
ATOM   6135  C  "C1'" . DC  I 5  3   ? 13.368  -8.492  91.171 1.00 162.09 ? -70  DC  I "C1'" 1 
ATOM   6136  N  N1    . DC  I 5  3   ? 12.147  -7.966  90.530 1.00 151.01 ? -70  DC  I N1    1 
ATOM   6137  C  C2    . DC  I 5  3   ? 11.236  -8.870  89.973 1.00 138.31 ? -70  DC  I C2    1 
ATOM   6138  O  O2    . DC  I 5  3   ? 11.484  -10.084 90.030 1.00 126.83 ? -70  DC  I O2    1 
ATOM   6139  N  N3    . DC  I 5  3   ? 10.107  -8.398  89.391 1.00 133.00 ? -70  DC  I N3    1 
ATOM   6140  C  C4    . DC  I 5  3   ? 9.879   -7.082  89.348 1.00 129.47 ? -70  DC  I C4    1 
ATOM   6141  N  N4    . DC  I 5  3   ? 8.757   -6.659  88.762 1.00 117.89 ? -70  DC  I N4    1 
ATOM   6142  C  C5    . DC  I 5  3   ? 10.790  -6.141  89.908 1.00 135.04 ? -70  DC  I C5    1 
ATOM   6143  C  C6    . DC  I 5  3   ? 11.901  -6.621  90.483 1.00 143.05 ? -70  DC  I C6    1 
ATOM   6144  P  P     . DA  I 5  4   ? 17.351  -9.567  90.818 1.00 142.65 ? -69  DA  I P     1 
ATOM   6145  O  OP1   . DA  I 5  4   ? 18.617  -9.471  91.587 1.00 155.61 ? -69  DA  I OP1   1 
ATOM   6146  O  OP2   . DA  I 5  4   ? 17.117  -8.645  89.673 1.00 127.52 ? -69  DA  I OP2   1 
ATOM   6147  O  "O5'" . DA  I 5  4   ? 17.240  -11.082 90.329 1.00 143.74 ? -69  DA  I "O5'" 1 
ATOM   6148  C  "C5'" . DA  I 5  4   ? 16.003  -11.827 90.364 1.00 131.95 ? -69  DA  I "C5'" 1 
ATOM   6149  C  "C4'" . DA  I 5  4   ? 15.623  -12.293 88.976 1.00 123.15 ? -69  DA  I "C4'" 1 
ATOM   6150  O  "O4'" . DA  I 5  4   ? 14.467  -11.548 88.520 1.00 125.48 ? -69  DA  I "O4'" 1 
ATOM   6151  C  "C3'" . DA  I 5  4   ? 16.689  -12.107 87.890 1.00 116.95 ? -69  DA  I "C3'" 1 
ATOM   6152  O  "O3'" . DA  I 5  4   ? 16.593  -13.169 86.943 1.00 111.60 ? -69  DA  I "O3'" 1 
ATOM   6153  C  "C2'" . DA  I 5  4   ? 16.250  -10.837 87.185 1.00 114.86 ? -69  DA  I "C2'" 1 
ATOM   6154  C  "C1'" . DA  I 5  4   ? 14.745  -11.019 87.231 1.00 116.16 ? -69  DA  I "C1'" 1 
ATOM   6155  N  N9    . DA  I 5  4   ? 13.918  -9.829  87.040 1.00 107.49 ? -69  DA  I N9    1 
ATOM   6156  C  C8    . DA  I 5  4   ? 14.195  -8.506  87.283 1.00 109.05 ? -69  DA  I C8    1 
ATOM   6157  N  N7    . DA  I 5  4   ? 13.205  -7.698  86.990 1.00 111.72 ? -69  DA  I N7    1 
ATOM   6158  C  C5    . DA  I 5  4   ? 12.211  -8.546  86.521 1.00 108.53 ? -69  DA  I C5    1 
ATOM   6159  C  C6    . DA  I 5  4   ? 10.906  -8.309  86.047 1.00 102.94 ? -69  DA  I C6    1 
ATOM   6160  N  N6    . DA  I 5  4   ? 10.353  -7.096  85.966 1.00 95.83  ? -69  DA  I N6    1 
ATOM   6161  N  N1    . DA  I 5  4   ? 10.177  -9.378  85.659 1.00 101.34 ? -69  DA  I N1    1 
ATOM   6162  C  C2    . DA  I 5  4   ? 10.727  -10.597 85.746 1.00 102.06 ? -69  DA  I C2    1 
ATOM   6163  N  N3    . DA  I 5  4   ? 11.941  -10.945 86.167 1.00 93.71  ? -69  DA  I N3    1 
ATOM   6164  C  C4    . DA  I 5  4   ? 12.639  -9.861  86.546 1.00 101.80 ? -69  DA  I C4    1 
ATOM   6165  P  P     . DA  I 5  5   ? 17.568  -14.421 87.030 1.00 117.79 ? -68  DA  I P     1 
ATOM   6166  O  OP1   . DA  I 5  5   ? 17.430  -15.035 88.380 1.00 103.81 ? -68  DA  I OP1   1 
ATOM   6167  O  OP2   . DA  I 5  5   ? 18.894  -14.000 86.512 1.00 112.34 ? -68  DA  I OP2   1 
ATOM   6168  O  "O5'" . DA  I 5  5   ? 16.934  -15.440 85.983 1.00 130.17 ? -68  DA  I "O5'" 1 
ATOM   6169  C  "C5'" . DA  I 5  5   ? 15.656  -16.067 86.235 1.00 124.16 ? -68  DA  I "C5'" 1 
ATOM   6170  C  "C4'" . DA  I 5  5   ? 14.803  -16.074 84.986 1.00 110.31 ? -68  DA  I "C4'" 1 
ATOM   6171  O  "O4'" . DA  I 5  5   ? 14.159  -14.788 84.815 1.00 101.23 ? -68  DA  I "O4'" 1 
ATOM   6172  C  "C3'" . DA  I 5  5   ? 15.556  -16.351 83.681 1.00 102.91 ? -68  DA  I "C3'" 1 
ATOM   6173  O  "O3'" . DA  I 5  5   ? 14.762  -17.230 82.891 1.00 107.94 ? -68  DA  I "O3'" 1 
ATOM   6174  C  "C2'" . DA  I 5  5   ? 15.658  -14.986 83.027 1.00 99.10  ? -68  DA  I "C2'" 1 
ATOM   6175  C  "C1'" . DA  I 5  5   ? 14.370  -14.330 83.490 1.00 105.58 ? -68  DA  I "C1'" 1 
ATOM   6176  N  N9    . DA  I 5  5   ? 14.372  -12.867 83.511 1.00 115.48 ? -68  DA  I N9    1 
ATOM   6177  C  C8    . DA  I 5  5   ? 15.394  -12.014 83.849 1.00 123.06 ? -68  DA  I C8    1 
ATOM   6178  N  N7    . DA  I 5  5   ? 15.075  -10.745 83.759 1.00 131.78 ? -68  DA  I N7    1 
ATOM   6179  C  C5    . DA  I 5  5   ? 13.755  -10.763 83.331 1.00 122.72 ? -68  DA  I C5    1 
ATOM   6180  C  C6    . DA  I 5  5   ? 12.839  -9.735  83.044 1.00 119.09 ? -68  DA  I C6    1 
ATOM   6181  N  N6    . DA  I 5  5   ? 13.125  -8.436  83.149 1.00 114.49 ? -68  DA  I N6    1 
ATOM   6182  N  N1    . DA  I 5  5   ? 11.602  -10.093 82.635 1.00 123.47 ? -68  DA  I N1    1 
ATOM   6183  C  C2    . DA  I 5  5   ? 11.315  -11.397 82.525 1.00 118.14 ? -68  DA  I C2    1 
ATOM   6184  N  N3    . DA  I 5  5   ? 12.090  -12.453 82.764 1.00 113.59 ? -68  DA  I N3    1 
ATOM   6185  C  C4    . DA  I 5  5   ? 13.310  -12.063 83.173 1.00 120.01 ? -68  DA  I C4    1 
ATOM   6186  P  P     . DT  I 5  6   ? 15.415  -18.104 81.720 1.00 112.37 ? -67  DT  I P     1 
ATOM   6187  O  OP1   . DT  I 5  6   ? 15.296  -19.533 82.117 1.00 85.64  ? -67  DT  I OP1   1 
ATOM   6188  O  OP2   . DT  I 5  6   ? 16.745  -17.510 81.372 1.00 100.93 ? -67  DT  I OP2   1 
ATOM   6189  O  "O5'" . DT  I 5  6   ? 14.448  -17.853 80.474 1.00 99.72  ? -67  DT  I "O5'" 1 
ATOM   6190  C  "C5'" . DT  I 5  6   ? 13.098  -17.356 80.626 1.00 93.39  ? -67  DT  I "C5'" 1 
ATOM   6191  C  "C4'" . DT  I 5  6   ? 12.787  -16.269 79.620 1.00 92.86  ? -67  DT  I "C4'" 1 
ATOM   6192  O  "O4'" . DT  I 5  6   ? 13.108  -14.951 80.125 1.00 87.48  ? -67  DT  I "O4'" 1 
ATOM   6193  C  "C3'" . DT  I 5  6   ? 13.499  -16.380 78.267 1.00 90.99  ? -67  DT  I "C3'" 1 
ATOM   6194  O  "O3'" . DT  I 5  6   ? 12.609  -17.022 77.337 1.00 96.23  ? -67  DT  I "O3'" 1 
ATOM   6195  C  "C2'" . DT  I 5  6   ? 13.866  -14.940 77.919 1.00 84.46  ? -67  DT  I "C2'" 1 
ATOM   6196  C  "C1'" . DT  I 5  6   ? 13.199  -14.102 79.002 1.00 87.28  ? -67  DT  I "C1'" 1 
ATOM   6197  N  N1    . DT  I 5  6   ? 13.913  -12.864 79.402 1.00 93.16  ? -67  DT  I N1    1 
ATOM   6198  C  C2    . DT  I 5  6   ? 13.246  -11.666 79.259 1.00 99.56  ? -67  DT  I C2    1 
ATOM   6199  O  O2    . DT  I 5  6   ? 12.105  -11.586 78.838 1.00 103.74 ? -67  DT  I O2    1 
ATOM   6200  N  N3    . DT  I 5  6   ? 13.965  -10.559 79.638 1.00 104.30 ? -67  DT  I N3    1 
ATOM   6201  C  C4    . DT  I 5  6   ? 15.253  -10.532 80.137 1.00 102.51 ? -67  DT  I C4    1 
ATOM   6202  O  O4    . DT  I 5  6   ? 15.769  -9.461  80.435 1.00 103.50 ? -67  DT  I O4    1 
ATOM   6203  C  C5    . DT  I 5  6   ? 15.898  -11.822 80.252 1.00 100.39 ? -67  DT  I C5    1 
ATOM   6204  C  C7    . DT  I 5  6   ? 17.302  -11.889 80.766 1.00 99.00  ? -67  DT  I C7    1 
ATOM   6205  C  C6    . DT  I 5  6   ? 15.206  -12.908 79.881 1.00 101.52 ? -67  DT  I C6    1 
ATOM   6206  P  P     . DA  I 5  7   ? 12.887  -16.972 75.756 1.00 98.71  ? -66  DA  I P     1 
ATOM   6207  O  OP1   . DA  I 5  7   ? 12.308  -18.197 75.163 1.00 91.38  ? -66  DA  I OP1   1 
ATOM   6208  O  OP2   . DA  I 5  7   ? 14.321  -16.648 75.539 1.00 100.18 ? -66  DA  I OP2   1 
ATOM   6209  O  "O5'" . DA  I 5  7   ? 12.019  -15.728 75.277 1.00 92.67  ? -66  DA  I "O5'" 1 
ATOM   6210  C  "C5'" . DA  I 5  7   ? 10.633  -15.639 75.653 1.00 91.92  ? -66  DA  I "C5'" 1 
ATOM   6211  C  "C4'" . DA  I 5  7   ? 10.061  -14.301 75.248 1.00 89.60  ? -66  DA  I "C4'" 1 
ATOM   6212  O  "O4'" . DA  I 5  7   ? 10.805  -13.250 75.904 1.00 86.82  ? -66  DA  I "O4'" 1 
ATOM   6213  C  "C3'" . DA  I 5  7   ? 10.143  -14.005 73.750 1.00 92.35  ? -66  DA  I "C3'" 1 
ATOM   6214  O  "O3'" . DA  I 5  7   ? 8.994   -13.278 73.313 1.00 87.21  ? -66  DA  I "O3'" 1 
ATOM   6215  C  "C2'" . DA  I 5  7   ? 11.373  -13.131 73.636 1.00 97.11  ? -66  DA  I "C2'" 1 
ATOM   6216  C  "C1'" . DA  I 5  7   ? 11.309  -12.348 74.935 1.00 94.71  ? -66  DA  I "C1'" 1 
ATOM   6217  N  N9    . DA  I 5  7   ? 12.611  -11.865 75.391 1.00 92.71  ? -66  DA  I N9    1 
ATOM   6218  C  C8    . DA  I 5  7   ? 13.774  -12.582 75.531 1.00 91.98  ? -66  DA  I C8    1 
ATOM   6219  N  N7    . DA  I 5  7   ? 14.796  -11.859 75.921 1.00 96.39  ? -66  DA  I N7    1 
ATOM   6220  C  C5    . DA  I 5  7   ? 14.278  -10.576 76.019 1.00 91.52  ? -66  DA  I C5    1 
ATOM   6221  C  C6    . DA  I 5  7   ? 14.857  -9.348  76.379 1.00 87.10  ? -66  DA  I C6    1 
ATOM   6222  N  N6    . DA  I 5  7   ? 16.136  -9.208  76.729 1.00 86.27  ? -66  DA  I N6    1 
ATOM   6223  N  N1    . DA  I 5  7   ? 14.066  -8.252  76.370 1.00 92.28  ? -66  DA  I N1    1 
ATOM   6224  C  C2    . DA  I 5  7   ? 12.781  -8.392  76.018 1.00 90.29  ? -66  DA  I C2    1 
ATOM   6225  N  N3    . DA  I 5  7   ? 12.120  -9.494  75.665 1.00 90.25  ? -66  DA  I N3    1 
ATOM   6226  C  C4    . DA  I 5  7   ? 12.935  -10.563 75.687 1.00 93.34  ? -66  DA  I C4    1 
ATOM   6227  P  P     . DT  I 5  8   ? 8.710   -13.089 71.759 1.00 88.99  ? -65  DT  I P     1 
ATOM   6228  O  OP1   . DT  I 5  8   ? 7.247   -13.173 71.561 1.00 98.87  ? -65  DT  I OP1   1 
ATOM   6229  O  OP2   . DT  I 5  8   ? 9.634   -13.990 71.003 1.00 82.89  ? -65  DT  I OP2   1 
ATOM   6230  O  "O5'" . DT  I 5  8   ? 8.997   -11.546 71.528 1.00 81.60  ? -65  DT  I "O5'" 1 
ATOM   6231  C  "C5'" . DT  I 5  8   ? 8.350   -10.583 72.375 1.00 90.40  ? -65  DT  I "C5'" 1 
ATOM   6232  C  "C4'" . DT  I 5  8   ? 8.919   -9.212  72.108 1.00 97.67  ? -65  DT  I "C4'" 1 
ATOM   6233  O  "O4'" . DT  I 5  8   ? 10.237  -9.120  72.696 1.00 98.95  ? -65  DT  I "O4'" 1 
ATOM   6234  C  "C3'" . DT  I 5  8   ? 9.092   -8.894  70.619 1.00 105.14 ? -65  DT  I "C3'" 1 
ATOM   6235  O  "O3'" . DT  I 5  8   ? 8.380   -7.687  70.316 1.00 105.88 ? -65  DT  I "O3'" 1 
ATOM   6236  C  "C2'" . DT  I 5  8   ? 10.602  -8.847  70.426 1.00 101.45 ? -65  DT  I "C2'" 1 
ATOM   6237  C  "C1'" . DT  I 5  8   ? 11.075  -8.425  71.799 1.00 98.47  ? -65  DT  I "C1'" 1 
ATOM   6238  N  N1    . DT  I 5  8   ? 12.466  -8.741  72.155 1.00 95.30  ? -65  DT  I N1    1 
ATOM   6239  C  C2    . DT  I 5  8   ? 13.211  -7.754  72.761 1.00 94.66  ? -65  DT  I C2    1 
ATOM   6240  O  O2    . DT  I 5  8   ? 12.785  -6.626  72.969 1.00 87.31  ? -65  DT  I O2    1 
ATOM   6241  N  N3    . DT  I 5  8   ? 14.487  -8.131  73.104 1.00 91.97  ? -65  DT  I N3    1 
ATOM   6242  C  C4    . DT  I 5  8   ? 15.072  -9.373  72.916 1.00 92.57  ? -65  DT  I C4    1 
ATOM   6243  O  O4    . DT  I 5  8   ? 16.232  -9.567  73.279 1.00 86.21  ? -65  DT  I O4    1 
ATOM   6244  C  C5    . DT  I 5  8   ? 14.226  -10.364 72.285 1.00 93.76  ? -65  DT  I C5    1 
ATOM   6245  C  C7    . DT  I 5  8   ? 14.767  -11.739 72.048 1.00 89.51  ? -65  DT  I C7    1 
ATOM   6246  C  C6    . DT  I 5  8   ? 12.977  -10.005 71.954 1.00 90.43  ? -65  DT  I C6    1 
ATOM   6247  P  P     . DC  I 5  9   ? 8.242   -7.181  68.798 1.00 107.28 ? -64  DC  I P     1 
ATOM   6248  O  OP1   . DC  I 5  9   ? 6.865   -6.661  68.610 1.00 101.69 ? -64  DC  I OP1   1 
ATOM   6249  O  OP2   . DC  I 5  9   ? 8.774   -8.240  67.898 1.00 95.79  ? -64  DC  I OP2   1 
ATOM   6250  O  "O5'" . DC  I 5  9   ? 9.212   -5.920  68.760 1.00 113.09 ? -64  DC  I "O5'" 1 
ATOM   6251  C  "C5'" . DC  I 5  9   ? 9.043   -4.843  69.700 1.00 117.99 ? -64  DC  I "C5'" 1 
ATOM   6252  C  "C4'" . DC  I 5  9   ? 10.312  -4.028  69.775 1.00 123.70 ? -64  DC  I "C4'" 1 
ATOM   6253  O  "O4'" . DC  I 5  9   ? 11.393  -4.856  70.270 1.00 122.18 ? -64  DC  I "O4'" 1 
ATOM   6254  C  "C3'" . DC  I 5  9   ? 10.774  -3.473  68.422 1.00 129.18 ? -64  DC  I "C3'" 1 
ATOM   6255  O  "O3'" . DC  I 5  9   ? 10.801  -2.036  68.414 1.00 137.63 ? -64  DC  I "O3'" 1 
ATOM   6256  C  "C2'" . DC  I 5  9   ? 12.161  -4.064  68.230 1.00 125.66 ? -64  DC  I "C2'" 1 
ATOM   6257  C  "C1'" . DC  I 5  9   ? 12.581  -4.453  69.632 1.00 119.67 ? -64  DC  I "C1'" 1 
ATOM   6258  N  N1    . DC  I 5  9   ? 13.529  -5.574  69.683 1.00 119.07 ? -64  DC  I N1    1 
ATOM   6259  C  C2    . DC  I 5  9   ? 14.774  -5.378  70.290 1.00 127.16 ? -64  DC  I C2    1 
ATOM   6260  O  O2    . DC  I 5  9   ? 15.030  -4.273  70.793 1.00 131.20 ? -64  DC  I O2    1 
ATOM   6261  N  N3    . DC  I 5  9   ? 15.665  -6.398  70.316 1.00 125.27 ? -64  DC  I N3    1 
ATOM   6262  C  C4    . DC  I 5  9   ? 15.351  -7.571  69.759 1.00 111.67 ? -64  DC  I C4    1 
ATOM   6263  N  N4    . DC  I 5  9   ? 16.257  -8.551  69.815 1.00 102.76 ? -64  DC  I N4    1 
ATOM   6264  C  C5    . DC  I 5  9   ? 14.093  -7.793  69.126 1.00 107.86 ? -64  DC  I C5    1 
ATOM   6265  C  C6    . DC  I 5  9   ? 13.223  -6.776  69.108 1.00 109.09 ? -64  DC  I C6    1 
ATOM   6266  P  P     . DC  I 5  10  ? 10.016  -1.199  67.274 1.00 141.21 ? -63  DC  I P     1 
ATOM   6267  O  OP1   . DC  I 5  10  ? 9.171   -0.174  67.953 1.00 122.48 ? -63  DC  I OP1   1 
ATOM   6268  O  OP2   . DC  I 5  10  ? 9.385   -2.165  66.324 1.00 121.67 ? -63  DC  I OP2   1 
ATOM   6269  O  "O5'" . DC  I 5  10  ? 11.186  -0.410  66.528 1.00 127.95 ? -63  DC  I "O5'" 1 
ATOM   6270  C  "C5'" . DC  I 5  10  ? 12.357  -1.070  66.009 1.00 119.48 ? -63  DC  I "C5'" 1 
ATOM   6271  C  "C4'" . DC  I 5  10  ? 13.593  -0.538  66.697 1.00 123.21 ? -63  DC  I "C4'" 1 
ATOM   6272  O  "O4'" . DC  I 5  10  ? 14.084  -1.521  67.632 1.00 119.51 ? -63  DC  I "O4'" 1 
ATOM   6273  C  "C3'" . DC  I 5  10  ? 14.762  -0.213  65.770 1.00 137.24 ? -63  DC  I "C3'" 1 
ATOM   6274  O  "O3'" . DC  I 5  10  ? 14.772  1.199   65.497 1.00 151.03 ? -63  DC  I "O3'" 1 
ATOM   6275  C  "C2'" . DC  I 5  10  ? 15.986  -0.592  66.585 1.00 135.81 ? -63  DC  I "C2'" 1 
ATOM   6276  C  "C1'" . DC  I 5  10  ? 15.501  -1.589  67.613 1.00 124.09 ? -63  DC  I "C1'" 1 
ATOM   6277  N  N1    . DC  I 5  10  ? 15.889  -2.982  67.337 1.00 129.66 ? -63  DC  I N1    1 
ATOM   6278  C  C2    . DC  I 5  10  ? 17.101  -3.462  67.852 1.00 130.31 ? -63  DC  I C2    1 
ATOM   6279  O  O2    . DC  I 5  10  ? 17.824  -2.693  68.506 1.00 121.61 ? -63  DC  I O2    1 
ATOM   6280  N  N3    . DC  I 5  10  ? 17.453  -4.749  67.622 1.00 124.36 ? -63  DC  I N3    1 
ATOM   6281  C  C4    . DC  I 5  10  ? 16.648  -5.543  66.910 1.00 120.14 ? -63  DC  I C4    1 
ATOM   6282  N  N4    . DC  I 5  10  ? 17.037  -6.804  66.703 1.00 111.99 ? -63  DC  I N4    1 
ATOM   6283  C  C5    . DC  I 5  10  ? 15.411  -5.079  66.374 1.00 116.98 ? -63  DC  I C5    1 
ATOM   6284  C  C6    . DC  I 5  10  ? 15.076  -3.803  66.604 1.00 119.96 ? -63  DC  I C6    1 
ATOM   6285  P  P     . DA  I 5  11  ? 15.510  1.802   64.194 1.00 137.83 ? -62  DA  I P     1 
ATOM   6286  O  OP1   . DA  I 5  11  ? 14.521  2.654   63.484 1.00 128.64 ? -62  DA  I OP1   1 
ATOM   6287  O  OP2   . DA  I 5  11  ? 16.176  0.693   63.463 1.00 114.82 ? -62  DA  I OP2   1 
ATOM   6288  O  "O5'" . DA  I 5  11  ? 16.657  2.734   64.800 1.00 137.14 ? -62  DA  I "O5'" 1 
ATOM   6289  C  "C5'" . DA  I 5  11  ? 17.389  2.414   66.011 1.00 144.88 ? -62  DA  I "C5'" 1 
ATOM   6290  C  "C4'" . DA  I 5  11  ? 18.727  1.767   65.715 1.00 150.65 ? -62  DA  I "C4'" 1 
ATOM   6291  O  "O4'" . DA  I 5  11  ? 18.656  0.322   65.819 1.00 149.91 ? -62  DA  I "O4'" 1 
ATOM   6292  C  "C3'" . DA  I 5  11  ? 19.330  2.070   64.337 1.00 154.54 ? -62  DA  I "C3'" 1 
ATOM   6293  O  "O3'" . DA  I 5  11  ? 20.616  2.689   64.474 1.00 160.98 ? -62  DA  I "O3'" 1 
ATOM   6294  C  "C2'" . DA  I 5  11  ? 19.453  0.708   63.672 1.00 151.55 ? -62  DA  I "C2'" 1 
ATOM   6295  C  "C1'" . DA  I 5  11  ? 19.525  -0.240  64.851 1.00 144.81 ? -62  DA  I "C1'" 1 
ATOM   6296  N  N9    . DA  I 5  11  ? 19.080  -1.609  64.568 1.00 131.29 ? -62  DA  I N9    1 
ATOM   6297  C  C8    . DA  I 5  11  ? 17.854  -2.012  64.098 1.00 115.93 ? -62  DA  I C8    1 
ATOM   6298  N  N7    . DA  I 5  11  ? 17.750  -3.308  63.938 1.00 113.89 ? -62  DA  I N7    1 
ATOM   6299  C  C5    . DA  I 5  11  ? 18.996  -3.792  64.312 1.00 130.87 ? -62  DA  I C5    1 
ATOM   6300  C  C6    . DA  I 5  11  ? 19.531  -5.094  64.358 1.00 137.39 ? -62  DA  I C6    1 
ATOM   6301  N  N6    . DA  I 5  11  ? 18.846  -6.188  64.015 1.00 132.79 ? -62  DA  I N6    1 
ATOM   6302  N  N1    . DA  I 5  11  ? 20.810  -5.233  64.774 1.00 135.97 ? -62  DA  I N1    1 
ATOM   6303  C  C2    . DA  I 5  11  ? 21.496  -4.134  65.119 1.00 133.95 ? -62  DA  I C2    1 
ATOM   6304  N  N3    . DA  I 5  11  ? 21.101  -2.861  65.119 1.00 139.10 ? -62  DA  I N3    1 
ATOM   6305  C  C4    . DA  I 5  11  ? 19.828  -2.756  64.696 1.00 135.33 ? -62  DA  I C4    1 
ATOM   6306  P  P     . DC  I 5  12  ? 21.356  3.311   63.194 1.00 160.48 ? -61  DC  I P     1 
ATOM   6307  O  OP1   . DC  I 5  12  ? 22.085  4.528   63.636 1.00 157.69 ? -61  DC  I OP1   1 
ATOM   6308  O  OP2   . DC  I 5  12  ? 20.364  3.404   62.083 1.00 154.34 ? -61  DC  I OP2   1 
ATOM   6309  O  "O5'" . DC  I 5  12  ? 22.438  2.200   62.834 1.00 151.59 ? -61  DC  I "O5'" 1 
ATOM   6310  C  "C5'" . DC  I 5  12  ? 23.417  1.765   63.799 1.00 154.18 ? -61  DC  I "C5'" 1 
ATOM   6311  C  "C4'" . DC  I 5  12  ? 24.263  0.659   63.212 1.00 159.25 ? -61  DC  I "C4'" 1 
ATOM   6312  O  "O4'" . DC  I 5  12  ? 23.510  -0.581  63.221 1.00 154.75 ? -61  DC  I "O4'" 1 
ATOM   6313  C  "C3'" . DC  I 5  12  ? 24.690  0.888   61.757 1.00 162.26 ? -61  DC  I "C3'" 1 
ATOM   6314  O  "O3'" . DC  I 5  12  ? 26.048  0.498   61.532 1.00 162.33 ? -61  DC  I "O3'" 1 
ATOM   6315  C  "C2'" . DC  I 5  12  ? 23.731  0.017   60.968 1.00 155.37 ? -61  DC  I "C2'" 1 
ATOM   6316  C  "C1'" . DC  I 5  12  ? 23.512  -1.146  61.919 1.00 148.17 ? -61  DC  I "C1'" 1 
ATOM   6317  N  N1    . DC  I 5  12  ? 22.242  -1.870  61.724 1.00 133.82 ? -61  DC  I N1    1 
ATOM   6318  C  C2    . DC  I 5  12  ? 22.199  -3.244  61.985 1.00 121.15 ? -61  DC  I C2    1 
ATOM   6319  O  O2    . DC  I 5  12  ? 23.220  -3.807  62.406 1.00 126.99 ? -61  DC  I O2    1 
ATOM   6320  N  N3    . DC  I 5  12  ? 21.046  -3.920  61.779 1.00 121.61 ? -61  DC  I N3    1 
ATOM   6321  C  C4    . DC  I 5  12  ? 19.967  -3.277  61.323 1.00 121.15 ? -61  DC  I C4    1 
ATOM   6322  N  N4    . DC  I 5  12  ? 18.849  -3.982  61.137 1.00 114.70 ? -61  DC  I N4    1 
ATOM   6323  C  C5    . DC  I 5  12  ? 19.986  -1.881  61.042 1.00 126.85 ? -61  DC  I C5    1 
ATOM   6324  C  C6    . DC  I 5  12  ? 21.135  -1.225  61.244 1.00 133.67 ? -61  DC  I C6    1 
ATOM   6325  P  P     . DC  I 5  13  ? 26.678  0.595   60.062 1.00 153.79 ? -60  DC  I P     1 
ATOM   6326  O  OP1   . DC  I 5  13  ? 28.082  1.054   60.197 1.00 168.49 ? -60  DC  I OP1   1 
ATOM   6327  O  OP2   . DC  I 5  13  ? 25.736  1.361   59.204 1.00 135.22 ? -60  DC  I OP2   1 
ATOM   6328  O  "O5'" . DC  I 5  13  ? 26.756  -0.932  59.621 1.00 156.16 ? -60  DC  I "O5'" 1 
ATOM   6329  C  "C5'" . DC  I 5  13  ? 27.359  -1.906  60.498 1.00 158.98 ? -60  DC  I "C5'" 1 
ATOM   6330  C  "C4'" . DC  I 5  13  ? 27.537  -3.226  59.784 1.00 159.91 ? -60  DC  I "C4'" 1 
ATOM   6331  O  "O4'" . DC  I 5  13  ? 26.272  -3.934  59.759 1.00 157.00 ? -60  DC  I "O4'" 1 
ATOM   6332  C  "C3'" . DC  I 5  13  ? 27.996  -3.117  58.328 1.00 156.39 ? -60  DC  I "C3'" 1 
ATOM   6333  O  "O3'" . DC  I 5  13  ? 28.971  -4.127  58.044 1.00 147.97 ? -60  DC  I "O3'" 1 
ATOM   6334  C  "C2'" . DC  I 5  13  ? 26.705  -3.273  57.541 1.00 155.62 ? -60  DC  I "C2'" 1 
ATOM   6335  C  "C1'" . DC  I 5  13  ? 25.875  -4.199  58.420 1.00 145.93 ? -60  DC  I "C1'" 1 
ATOM   6336  N  N1    . DC  I 5  13  ? 24.410  -4.025  58.337 1.00 130.46 ? -60  DC  I N1    1 
ATOM   6337  C  C2    . DC  I 5  13  ? 23.594  -5.162  58.359 1.00 118.27 ? -60  DC  I C2    1 
ATOM   6338  O  O2    . DC  I 5  13  ? 24.127  -6.279  58.430 1.00 96.51  ? -60  DC  I O2    1 
ATOM   6339  N  N3    . DC  I 5  13  ? 22.250  -5.015  58.293 1.00 118.79 ? -60  DC  I N3    1 
ATOM   6340  C  C4    . DC  I 5  13  ? 21.716  -3.793  58.209 1.00 116.53 ? -60  DC  I C4    1 
ATOM   6341  N  N4    . DC  I 5  13  ? 20.386  -3.693  58.142 1.00 107.10 ? -60  DC  I N4    1 
ATOM   6342  C  C5    . DC  I 5  13  ? 22.523  -2.618  58.186 1.00 123.54 ? -60  DC  I C5    1 
ATOM   6343  C  C6    . DC  I 5  13  ? 23.852  -2.779  58.256 1.00 129.24 ? -60  DC  I C6    1 
ATOM   6344  P  P     . DT  I 5  14  ? 29.856  -4.063  56.700 1.00 148.40 ? -59  DT  I P     1 
ATOM   6345  O  OP1   . DT  I 5  14  ? 31.145  -3.404  57.027 1.00 158.19 ? -59  DT  I OP1   1 
ATOM   6346  O  OP2   . DT  I 5  14  ? 29.020  -3.513  55.606 1.00 134.73 ? -59  DT  I OP2   1 
ATOM   6347  O  "O5'" . DT  I 5  14  ? 30.145  -5.600  56.389 1.00 160.54 ? -59  DT  I "O5'" 1 
ATOM   6348  C  "C5'" . DT  I 5  14  ? 29.334  -6.662  56.947 1.00 168.14 ? -59  DT  I "C5'" 1 
ATOM   6349  C  "C4'" . DT  I 5  14  ? 28.730  -7.511  55.852 1.00 169.82 ? -59  DT  I "C4'" 1 
ATOM   6350  O  "O4'" . DT  I 5  14  ? 27.296  -7.299  55.784 1.00 167.61 ? -59  DT  I "O4'" 1 
ATOM   6351  C  "C3'" . DT  I 5  14  ? 29.263  -7.232  54.446 1.00 174.70 ? -59  DT  I "C3'" 1 
ATOM   6352  O  "O3'" . DT  I 5  14  ? 29.411  -8.467  53.746 1.00 174.21 ? -59  DT  I "O3'" 1 
ATOM   6353  C  "C2'" . DT  I 5  14  ? 28.185  -6.359  53.831 1.00 176.24 ? -59  DT  I "C2'" 1 
ATOM   6354  C  "C1'" . DT  I 5  14  ? 26.927  -6.941  54.456 1.00 169.84 ? -59  DT  I "C1'" 1 
ATOM   6355  N  N1    . DT  I 5  14  ? 25.735  -6.055  54.529 1.00 161.49 ? -59  DT  I N1    1 
ATOM   6356  C  C2    . DT  I 5  14  ? 24.547  -6.634  54.916 1.00 154.79 ? -59  DT  I C2    1 
ATOM   6357  O  O2    . DT  I 5  14  ? 24.444  -7.816  55.201 1.00 155.08 ? -59  DT  I O2    1 
ATOM   6358  N  N3    . DT  I 5  14  ? 23.477  -5.772  54.960 1.00 148.25 ? -59  DT  I N3    1 
ATOM   6359  C  C4    . DT  I 5  14  ? 23.478  -4.423  54.658 1.00 147.13 ? -59  DT  I C4    1 
ATOM   6360  O  O4    . DT  I 5  14  ? 22.437  -3.776  54.747 1.00 132.15 ? -59  DT  I O4    1 
ATOM   6361  C  C5    . DT  I 5  14  ? 24.757  -3.882  54.253 1.00 150.37 ? -59  DT  I C5    1 
ATOM   6362  C  C7    . DT  I 5  14  ? 24.857  -2.429  53.908 1.00 144.63 ? -59  DT  I C7    1 
ATOM   6363  C  C6    . DT  I 5  14  ? 25.806  -4.715  54.206 1.00 155.39 ? -59  DT  I C6    1 
ATOM   6364  P  P     . DG  I 5  15  ? 30.481  -8.596  52.572 1.00 171.32 ? -58  DG  I P     1 
ATOM   6365  O  OP1   . DG  I 5  15  ? 31.802  -8.886  53.185 1.00 164.11 ? -58  DG  I OP1   1 
ATOM   6366  O  OP2   . DG  I 5  15  ? 30.331  -7.416  51.676 1.00 162.86 ? -58  DG  I OP2   1 
ATOM   6367  O  "O5'" . DG  I 5  15  ? 30.005  -9.919  51.822 1.00 158.23 ? -58  DG  I "O5'" 1 
ATOM   6368  C  "C5'" . DG  I 5  15  ? 29.676  -11.111 52.563 1.00 144.75 ? -58  DG  I "C5'" 1 
ATOM   6369  C  "C4'" . DG  I 5  15  ? 28.442  -11.761 51.983 1.00 141.66 ? -58  DG  I "C4'" 1 
ATOM   6370  O  "O4'" . DG  I 5  15  ? 27.298  -10.886 52.132 1.00 143.10 ? -58  DG  I "O4'" 1 
ATOM   6371  C  "C3'" . DG  I 5  15  ? 28.536  -12.075 50.492 1.00 140.93 ? -58  DG  I "C3'" 1 
ATOM   6372  O  "O3'" . DG  I 5  15  ? 27.918  -13.336 50.240 1.00 139.96 ? -58  DG  I "O3'" 1 
ATOM   6373  C  "C2'" . DG  I 5  15  ? 27.802  -10.918 49.839 1.00 141.02 ? -58  DG  I "C2'" 1 
ATOM   6374  C  "C1'" . DG  I 5  15  ? 26.725  -10.598 50.862 1.00 147.61 ? -58  DG  I "C1'" 1 
ATOM   6375  N  N9    . DG  I 5  15  ? 26.275  -9.208  50.878 1.00 150.13 ? -58  DG  I N9    1 
ATOM   6376  C  C8    . DG  I 5  15  ? 27.059  -8.085  50.771 1.00 155.00 ? -58  DG  I C8    1 
ATOM   6377  N  N7    . DG  I 5  15  ? 26.374  -6.975  50.835 1.00 146.45 ? -58  DG  I N7    1 
ATOM   6378  C  C5    . DG  I 5  15  ? 25.060  -7.389  50.998 1.00 134.21 ? -58  DG  I C5    1 
ATOM   6379  C  C6    . DG  I 5  15  ? 23.865  -6.632  51.128 1.00 123.85 ? -58  DG  I C6    1 
ATOM   6380  O  O6    . DG  I 5  15  ? 23.725  -5.402  51.132 1.00 103.50 ? -58  DG  I O6    1 
ATOM   6381  N  N1    . DG  I 5  15  ? 22.753  -7.454  51.271 1.00 126.67 ? -58  DG  I N1    1 
ATOM   6382  C  C2    . DG  I 5  15  ? 22.783  -8.827  51.287 1.00 127.91 ? -58  DG  I C2    1 
ATOM   6383  N  N2    . DG  I 5  15  ? 21.602  -9.443  51.438 1.00 125.54 ? -58  DG  I N2    1 
ATOM   6384  N  N3    . DG  I 5  15  ? 23.888  -9.544  51.169 1.00 140.82 ? -58  DG  I N3    1 
ATOM   6385  C  C4    . DG  I 5  15  ? 24.982  -8.766  51.028 1.00 142.36 ? -58  DG  I C4    1 
ATOM   6386  P  P     . DC  I 5  16  ? 28.098  -14.026 48.820 1.00 148.94 ? -57  DC  I P     1 
ATOM   6387  O  OP1   . DC  I 5  16  ? 29.002  -15.191 48.995 1.00 149.02 ? -57  DC  I OP1   1 
ATOM   6388  O  OP2   . DC  I 5  16  ? 28.456  -12.959 47.838 1.00 110.64 ? -57  DC  I OP2   1 
ATOM   6389  O  "O5'" . DC  I 5  16  ? 26.648  -14.620 48.513 1.00 150.33 ? -57  DC  I "O5'" 1 
ATOM   6390  C  "C5'" . DC  I 5  16  ? 25.449  -14.139 49.168 1.00 142.08 ? -57  DC  I "C5'" 1 
ATOM   6391  C  "C4'" . DC  I 5  16  ? 24.411  -13.708 48.155 1.00 132.89 ? -57  DC  I "C4'" 1 
ATOM   6392  O  "O4'" . DC  I 5  16  ? 24.123  -12.297 48.322 1.00 133.14 ? -57  DC  I "O4'" 1 
ATOM   6393  C  "C3'" . DC  I 5  16  ? 24.799  -13.881 46.680 1.00 128.42 ? -57  DC  I "C3'" 1 
ATOM   6394  O  "O3'" . DC  I 5  16  ? 23.672  -14.247 45.884 1.00 123.22 ? -57  DC  I "O3'" 1 
ATOM   6395  C  "C2'" . DC  I 5  16  ? 25.207  -12.480 46.263 1.00 132.30 ? -57  DC  I "C2'" 1 
ATOM   6396  C  "C1'" . DC  I 5  16  ? 24.204  -11.660 47.055 1.00 133.91 ? -57  DC  I "C1'" 1 
ATOM   6397  N  N1    . DC  I 5  16  ? 24.501  -10.231 47.278 1.00 130.64 ? -57  DC  I N1    1 
ATOM   6398  C  C2    . DC  I 5  16  ? 23.436  -9.382  47.586 1.00 121.81 ? -57  DC  I C2    1 
ATOM   6399  O  O2    . DC  I 5  16  ? 22.294  -9.856  47.650 1.00 110.84 ? -57  DC  I O2    1 
ATOM   6400  N  N3    . DC  I 5  16  ? 23.677  -8.069  47.807 1.00 121.57 ? -57  DC  I N3    1 
ATOM   6401  C  C4    . DC  I 5  16  ? 24.922  -7.597  47.726 1.00 125.25 ? -57  DC  I C4    1 
ATOM   6402  N  N4    . DC  I 5  16  ? 25.112  -6.295  47.946 1.00 125.89 ? -57  DC  I N4    1 
ATOM   6403  C  C5    . DC  I 5  16  ? 26.029  -8.442  47.419 1.00 125.86 ? -57  DC  I C5    1 
ATOM   6404  C  C6    . DC  I 5  16  ? 25.776  -9.740  47.203 1.00 128.93 ? -57  DC  I C6    1 
ATOM   6405  P  P     . DA  I 5  17  ? 23.109  -15.739 45.910 1.00 132.58 ? -56  DA  I P     1 
ATOM   6406  O  OP1   . DA  I 5  17  ? 23.391  -16.326 47.245 1.00 120.78 ? -56  DA  I OP1   1 
ATOM   6407  O  OP2   . DA  I 5  17  ? 23.555  -16.421 44.667 1.00 131.73 ? -56  DA  I OP2   1 
ATOM   6408  O  "O5'" . DA  I 5  17  ? 21.536  -15.543 45.789 1.00 132.78 ? -56  DA  I "O5'" 1 
ATOM   6409  C  "C5'" . DA  I 5  17  ? 20.693  -15.471 46.953 1.00 134.58 ? -56  DA  I "C5'" 1 
ATOM   6410  C  "C4'" . DA  I 5  17  ? 19.493  -14.604 46.654 1.00 134.19 ? -56  DA  I "C4'" 1 
ATOM   6411  O  "O4'" . DA  I 5  17  ? 19.939  -13.257 46.368 1.00 131.69 ? -56  DA  I "O4'" 1 
ATOM   6412  C  "C3'" . DA  I 5  17  ? 18.683  -15.028 45.432 1.00 129.68 ? -56  DA  I "C3'" 1 
ATOM   6413  O  "O3'" . DA  I 5  17  ? 17.315  -14.655 45.631 1.00 124.17 ? -56  DA  I "O3'" 1 
ATOM   6414  C  "C2'" . DA  I 5  17  ? 19.341  -14.250 44.306 1.00 132.42 ? -56  DA  I "C2'" 1 
ATOM   6415  C  "C1'" . DA  I 5  17  ? 19.720  -12.945 44.994 1.00 132.19 ? -56  DA  I "C1'" 1 
ATOM   6416  N  N9    . DA  I 5  17  ? 20.919  -12.272 44.497 1.00 130.46 ? -56  DA  I N9    1 
ATOM   6417  C  C8    . DA  I 5  17  ? 22.017  -12.802 43.864 1.00 137.69 ? -56  DA  I C8    1 
ATOM   6418  N  N7    . DA  I 5  17  ? 22.941  -11.915 43.581 1.00 140.06 ? -56  DA  I N7    1 
ATOM   6419  C  C5    . DA  I 5  17  ? 22.418  -10.724 44.064 1.00 124.60 ? -56  DA  I C5    1 
ATOM   6420  C  C6    . DA  I 5  17  ? 22.911  -9.409  44.071 1.00 125.42 ? -56  DA  I C6    1 
ATOM   6421  N  N6    . DA  I 5  17  ? 24.088  -9.058  43.553 1.00 134.30 ? -56  DA  I N6    1 
ATOM   6422  N  N1    . DA  I 5  17  ? 22.137  -8.451  44.626 1.00 115.73 ? -56  DA  I N1    1 
ATOM   6423  C  C2    . DA  I 5  17  ? 20.951  -8.801  45.136 1.00 105.09 ? -56  DA  I C2    1 
ATOM   6424  N  N3    . DA  I 5  17  ? 20.383  -10.002 45.194 1.00 112.56 ? -56  DA  I N3    1 
ATOM   6425  C  C4    . DA  I 5  17  ? 21.177  -10.930 44.634 1.00 121.27 ? -56  DA  I C4    1 
ATOM   6426  P  P     . DG  I 5  18  ? 16.175  -15.241 44.679 1.00 127.26 ? -55  DG  I P     1 
ATOM   6427  O  OP1   . DG  I 5  18  ? 15.511  -16.355 45.403 1.00 122.29 ? -55  DG  I OP1   1 
ATOM   6428  O  OP2   . DG  I 5  18  ? 16.774  -15.483 43.338 1.00 118.81 ? -55  DG  I OP2   1 
ATOM   6429  O  "O5'" . DG  I 5  18  ? 15.121  -14.046 44.548 1.00 115.03 ? -55  DG  I "O5'" 1 
ATOM   6430  C  "C5'" . DG  I 5  18  ? 15.364  -12.710 45.053 1.00 111.66 ? -55  DG  I "C5'" 1 
ATOM   6431  C  "C4'" . DG  I 5  18  ? 15.386  -11.694 43.932 1.00 112.01 ? -55  DG  I "C4'" 1 
ATOM   6432  O  "O4'" . DG  I 5  18  ? 16.762  -11.336 43.618 1.00 120.79 ? -55  DG  I "O4'" 1 
ATOM   6433  C  "C3'" . DG  I 5  18  ? 14.753  -12.145 42.603 1.00 113.52 ? -55  DG  I "C3'" 1 
ATOM   6434  O  "O3'" . DG  I 5  18  ? 14.023  -11.119 41.902 1.00 107.06 ? -55  DG  I "O3'" 1 
ATOM   6435  C  "C2'" . DG  I 5  18  ? 15.965  -12.370 41.711 1.00 121.37 ? -55  DG  I "C2'" 1 
ATOM   6436  C  "C1'" . DG  I 5  18  ? 16.853  -11.247 42.207 1.00 124.77 ? -55  DG  I "C1'" 1 
ATOM   6437  N  N9    . DG  I 5  18  ? 18.263  -11.244 41.814 1.00 119.10 ? -55  DG  I N9    1 
ATOM   6438  C  C8    . DG  I 5  18  ? 19.001  -12.283 41.298 1.00 123.10 ? -55  DG  I C8    1 
ATOM   6439  N  N7    . DG  I 5  18  ? 20.225  -11.940 40.996 1.00 127.13 ? -55  DG  I N7    1 
ATOM   6440  C  C5    . DG  I 5  18  ? 20.289  -10.587 41.302 1.00 131.71 ? -55  DG  I C5    1 
ATOM   6441  C  C6    . DG  I 5  18  ? 21.363  -9.664  41.181 1.00 132.36 ? -55  DG  I C6    1 
ATOM   6442  O  O6    . DG  I 5  18  ? 22.512  -9.867  40.768 1.00 128.40 ? -55  DG  I O6    1 
ATOM   6443  N  N1    . DG  I 5  18  ? 20.995  -8.391  41.609 1.00 126.82 ? -55  DG  I N1    1 
ATOM   6444  C  C2    . DG  I 5  18  ? 19.754  -8.048  42.089 1.00 115.54 ? -55  DG  I C2    1 
ATOM   6445  N  N2    . DG  I 5  18  ? 19.591  -6.768  42.450 1.00 113.19 ? -55  DG  I N2    1 
ATOM   6446  N  N3    . DG  I 5  18  ? 18.746  -8.897  42.203 1.00 120.93 ? -55  DG  I N3    1 
ATOM   6447  C  C4    . DG  I 5  18  ? 19.083  -10.140 41.798 1.00 124.08 ? -55  DG  I C4    1 
ATOM   6448  P  P     . DA  I 5  19  ? 12.533  -10.624 42.330 1.00 93.64  ? -54  DA  I P     1 
ATOM   6449  O  OP1   . DA  I 5  19  ? 12.378  -10.725 43.809 1.00 74.14  ? -54  DA  I OP1   1 
ATOM   6450  O  OP2   . DA  I 5  19  ? 11.556  -11.311 41.455 1.00 83.69  ? -54  DA  I OP2   1 
ATOM   6451  O  "O5'" . DA  I 5  19  ? 12.586  -9.086  41.908 1.00 77.68  ? -54  DA  I "O5'" 1 
ATOM   6452  C  "C5'" . DA  I 5  19  ? 13.354  -8.146  42.695 1.00 92.10  ? -54  DA  I "C5'" 1 
ATOM   6453  C  "C4'" . DA  I 5  19  ? 14.037  -7.077  41.866 1.00 94.56  ? -54  DA  I "C4'" 1 
ATOM   6454  O  "O4'" . DA  I 5  19  ? 15.383  -7.484  41.512 1.00 99.53  ? -54  DA  I "O4'" 1 
ATOM   6455  C  "C3'" . DA  I 5  19  ? 13.352  -6.662  40.559 1.00 95.43  ? -54  DA  I "C3'" 1 
ATOM   6456  O  "O3'" . DA  I 5  19  ? 13.255  -5.236  40.504 1.00 92.68  ? -54  DA  I "O3'" 1 
ATOM   6457  C  "C2'" . DA  I 5  19  ? 14.294  -7.162  39.478 1.00 102.52 ? -54  DA  I "C2'" 1 
ATOM   6458  C  "C1'" . DA  I 5  19  ? 15.643  -7.097  40.174 1.00 106.37 ? -54  DA  I "C1'" 1 
ATOM   6459  N  N9    . DA  I 5  19  ? 16.671  -7.990  39.634 1.00 111.95 ? -54  DA  I N9    1 
ATOM   6460  C  C8    . DA  I 5  19  ? 16.572  -9.339  39.396 1.00 119.69 ? -54  DA  I C8    1 
ATOM   6461  N  N7    . DA  I 5  19  ? 17.668  -9.872  38.913 1.00 124.28 ? -54  DA  I N7    1 
ATOM   6462  C  C5    . DA  I 5  19  ? 18.547  -8.803  38.823 1.00 126.59 ? -54  DA  I C5    1 
ATOM   6463  C  C6    . DA  I 5  19  ? 19.875  -8.707  38.380 1.00 130.68 ? -54  DA  I C6    1 
ATOM   6464  N  N6    . DA  I 5  19  ? 20.580  -9.747  37.927 1.00 135.04 ? -54  DA  I N6    1 
ATOM   6465  N  N1    . DA  I 5  19  ? 20.465  -7.492  38.420 1.00 139.45 ? -54  DA  I N1    1 
ATOM   6466  C  C2    . DA  I 5  19  ? 19.758  -6.451  38.880 1.00 131.27 ? -54  DA  I C2    1 
ATOM   6467  N  N3    . DA  I 5  19  ? 18.503  -6.415  39.322 1.00 120.01 ? -54  DA  I N3    1 
ATOM   6468  C  C4    . DA  I 5  19  ? 17.947  -7.638  39.267 1.00 121.02 ? -54  DA  I C4    1 
ATOM   6469  P  P     . DT  I 5  20  ? 12.076  -4.536  39.676 1.00 107.61 ? -53  DT  I P     1 
ATOM   6470  O  OP1   . DT  I 5  20  ? 11.080  -4.010  40.651 1.00 109.40 ? -53  DT  I OP1   1 
ATOM   6471  O  OP2   . DT  I 5  20  ? 11.640  -5.466  38.600 1.00 92.31  ? -53  DT  I OP2   1 
ATOM   6472  O  "O5'" . DT  I 5  20  ? 12.800  -3.301  38.972 1.00 112.63 ? -53  DT  I "O5'" 1 
ATOM   6473  C  "C5'" . DT  I 5  20  ? 13.854  -2.563  39.619 1.00 113.03 ? -53  DT  I "C5'" 1 
ATOM   6474  C  "C4'" . DT  I 5  20  ? 15.008  -2.323  38.670 1.00 123.86 ? -53  DT  I "C4'" 1 
ATOM   6475  O  "O4'" . DT  I 5  20  ? 15.760  -3.540  38.426 1.00 124.52 ? -53  DT  I "O4'" 1 
ATOM   6476  C  "C3'" . DT  I 5  20  ? 14.649  -1.763  37.281 1.00 128.15 ? -53  DT  I "C3'" 1 
ATOM   6477  O  "O3'" . DT  I 5  20  ? 15.437  -0.584  37.042 1.00 137.46 ? -53  DT  I "O3'" 1 
ATOM   6478  C  "C2'" . DT  I 5  20  ? 15.044  -2.885  36.333 1.00 124.28 ? -53  DT  I "C2'" 1 
ATOM   6479  C  "C1'" . DT  I 5  20  ? 16.223  -3.449  37.092 1.00 129.94 ? -53  DT  I "C1'" 1 
ATOM   6480  N  N1    . DT  I 5  20  ? 16.738  -4.769  36.671 1.00 135.87 ? -53  DT  I N1    1 
ATOM   6481  C  C2    . DT  I 5  20  ? 18.088  -4.859  36.410 1.00 140.28 ? -53  DT  I C2    1 
ATOM   6482  O  O2    . DT  I 5  20  ? 18.855  -3.916  36.524 1.00 135.70 ? -53  DT  I O2    1 
ATOM   6483  N  N3    . DT  I 5  20  ? 18.512  -6.103  36.014 1.00 137.11 ? -53  DT  I N3    1 
ATOM   6484  C  C4    . DT  I 5  20  ? 17.737  -7.236  35.846 1.00 130.48 ? -53  DT  I C4    1 
ATOM   6485  O  O4    . DT  I 5  20  ? 18.258  -8.284  35.480 1.00 123.42 ? -53  DT  I O4    1 
ATOM   6486  C  C5    . DT  I 5  20  ? 16.329  -7.068  36.132 1.00 132.99 ? -53  DT  I C5    1 
ATOM   6487  C  C7    . DT  I 5  20  ? 15.414  -8.243  35.986 1.00 127.83 ? -53  DT  I C7    1 
ATOM   6488  C  C6    . DT  I 5  20  ? 15.905  -5.857  36.520 1.00 134.61 ? -53  DT  I C6    1 
ATOM   6489  P  P     . DA  I 5  21  ? 15.402  0.174   35.622 1.00 136.17 ? -52  DA  I P     1 
ATOM   6490  O  OP1   . DA  I 5  21  ? 15.824  1.580   35.845 1.00 124.37 ? -52  DA  I OP1   1 
ATOM   6491  O  OP2   . DA  I 5  21  ? 14.096  -0.118  34.971 1.00 135.68 ? -52  DA  I OP2   1 
ATOM   6492  O  "O5'" . DA  I 5  21  ? 16.563  -0.533  34.792 1.00 140.13 ? -52  DA  I "O5'" 1 
ATOM   6493  C  "C5'" . DA  I 5  21  ? 17.946  -0.372  35.161 1.00 145.23 ? -52  DA  I "C5'" 1 
ATOM   6494  C  "C4'" . DA  I 5  21  ? 18.850  -0.758  34.014 1.00 150.82 ? -52  DA  I "C4'" 1 
ATOM   6495  O  "O4'" . DA  I 5  21  ? 19.010  -2.198  33.969 1.00 151.41 ? -52  DA  I "O4'" 1 
ATOM   6496  C  "C3'" . DA  I 5  21  ? 18.369  -0.337  32.616 1.00 156.19 ? -52  DA  I "C3'" 1 
ATOM   6497  O  "O3'" . DA  I 5  21  ? 19.440  0.333   31.930 1.00 157.67 ? -52  DA  I "O3'" 1 
ATOM   6498  C  "C2'" . DA  I 5  21  ? 18.006  -1.658  31.954 1.00 152.94 ? -52  DA  I "C2'" 1 
ATOM   6499  C  "C1'" . DA  I 5  21  ? 19.006  -2.585  32.608 1.00 153.72 ? -52  DA  I "C1'" 1 
ATOM   6500  N  N9    . DA  I 5  21  ? 18.714  -4.017  32.535 1.00 151.83 ? -52  DA  I N9    1 
ATOM   6501  C  C8    . DA  I 5  21  ? 17.595  -4.696  32.952 1.00 142.11 ? -52  DA  I C8    1 
ATOM   6502  N  N7    . DA  I 5  21  ? 17.649  -5.988  32.732 1.00 140.28 ? -52  DA  I N7    1 
ATOM   6503  C  C5    . DA  I 5  21  ? 18.886  -6.174  32.129 1.00 150.25 ? -52  DA  I C5    1 
ATOM   6504  C  C6    . DA  I 5  21  ? 19.544  -7.322  31.647 1.00 146.59 ? -52  DA  I C6    1 
ATOM   6505  N  N6    . DA  I 5  21  ? 19.031  -8.552  31.707 1.00 136.65 ? -52  DA  I N6    1 
ATOM   6506  N  N1    . DA  I 5  21  ? 20.767  -7.159  31.094 1.00 153.90 ? -52  DA  I N1    1 
ATOM   6507  C  C2    . DA  I 5  21  ? 21.285  -5.924  31.033 1.00 157.11 ? -52  DA  I C2    1 
ATOM   6508  N  N3    . DA  I 5  21  ? 20.766  -4.772  31.455 1.00 158.57 ? -52  DA  I N3    1 
ATOM   6509  C  C4    . DA  I 5  21  ? 19.551  -4.968  31.999 1.00 155.54 ? -52  DA  I C4    1 
ATOM   6510  P  P     . DC  I 5  22  ? 19.166  1.220   30.610 1.00 144.92 ? -51  DC  I P     1 
ATOM   6511  O  OP1   . DC  I 5  22  ? 18.964  2.632   31.032 1.00 121.85 ? -51  DC  I OP1   1 
ATOM   6512  O  OP2   . DC  I 5  22  ? 18.120  0.543   29.800 1.00 140.13 ? -51  DC  I OP2   1 
ATOM   6513  O  "O5'" . DC  I 5  22  ? 20.557  1.149   29.830 1.00 146.81 ? -51  DC  I "O5'" 1 
ATOM   6514  C  "C5'" . DC  I 5  22  ? 21.418  -0.014  29.876 1.00 146.13 ? -51  DC  I "C5'" 1 
ATOM   6515  C  "C4'" . DC  I 5  22  ? 21.447  -0.732  28.544 1.00 150.58 ? -51  DC  I "C4'" 1 
ATOM   6516  O  "O4'" . DC  I 5  22  ? 21.008  -2.092  28.746 1.00 150.11 ? -51  DC  I "O4'" 1 
ATOM   6517  C  "C3'" . DC  I 5  22  ? 20.554  -0.140  27.444 1.00 158.60 ? -51  DC  I "C3'" 1 
ATOM   6518  O  "O3'" . DC  I 5  22  ? 21.353  0.631   26.521 1.00 170.14 ? -51  DC  I "O3'" 1 
ATOM   6519  C  "C2'" . DC  I 5  22  ? 19.741  -1.319  26.920 1.00 160.72 ? -51  DC  I "C2'" 1 
ATOM   6520  C  "C1'" . DC  I 5  22  ? 20.317  -2.554  27.604 1.00 159.39 ? -51  DC  I "C1'" 1 
ATOM   6521  N  N1    . DC  I 5  22  ? 19.331  -3.558  28.053 1.00 161.86 ? -51  DC  I N1    1 
ATOM   6522  C  C2    . DC  I 5  22  ? 19.745  -4.890  28.195 1.00 162.58 ? -51  DC  I C2    1 
ATOM   6523  O  O2    . DC  I 5  22  ? 20.921  -5.185  27.930 1.00 147.69 ? -51  DC  I O2    1 
ATOM   6524  N  N3    . DC  I 5  22  ? 18.853  -5.818  28.613 1.00 162.25 ? -51  DC  I N3    1 
ATOM   6525  C  C4    . DC  I 5  22  ? 17.598  -5.458  28.895 1.00 158.75 ? -51  DC  I C4    1 
ATOM   6526  N  N4    . DC  I 5  22  ? 16.754  -6.405  29.310 1.00 159.04 ? -51  DC  I N4    1 
ATOM   6527  C  C5    . DC  I 5  22  ? 17.152  -4.110  28.761 1.00 151.74 ? -51  DC  I C5    1 
ATOM   6528  C  C6    . DC  I 5  22  ? 18.043  -3.201  28.348 1.00 151.32 ? -51  DC  I C6    1 
ATOM   6529  P  P     . DT  I 5  23  ? 21.555  0.211   24.970 1.00 175.22 ? -50  DT  I P     1 
ATOM   6530  O  OP1   . DT  I 5  23  ? 22.618  1.084   24.410 1.00 161.81 ? -50  DT  I OP1   1 
ATOM   6531  O  OP2   . DT  I 5  23  ? 20.217  0.186   24.312 1.00 162.92 ? -50  DT  I OP2   1 
ATOM   6532  O  "O5'" . DT  I 5  23  ? 22.152  -1.268  25.054 1.00 180.31 ? -50  DT  I "O5'" 1 
ATOM   6533  C  "C5'" . DT  I 5  23  ? 23.471  -1.599  24.556 1.00 174.33 ? -50  DT  I "C5'" 1 
ATOM   6534  C  "C4'" . DT  I 5  23  ? 23.375  -2.643  23.467 1.00 173.77 ? -50  DT  I "C4'" 1 
ATOM   6535  O  "O4'" . DT  I 5  23  ? 22.431  -3.667  23.866 1.00 173.28 ? -50  DT  I "O4'" 1 
ATOM   6536  C  "C3'" . DT  I 5  23  ? 22.878  -2.118  22.117 1.00 180.22 ? -50  DT  I "C3'" 1 
ATOM   6537  O  "O3'" . DT  I 5  23  ? 23.563  -2.767  21.039 1.00 192.09 ? -50  DT  I "O3'" 1 
ATOM   6538  C  "C2'" . DT  I 5  23  ? 21.400  -2.450  22.150 1.00 178.52 ? -50  DT  I "C2'" 1 
ATOM   6539  C  "C1'" . DT  I 5  23  ? 21.400  -3.774  22.893 1.00 180.93 ? -50  DT  I "C1'" 1 
ATOM   6540  N  N1    . DT  I 5  23  ? 20.136  -4.108  23.589 1.00 185.16 ? -50  DT  I N1    1 
ATOM   6541  C  C2    . DT  I 5  23  ? 19.988  -5.379  24.102 1.00 179.74 ? -50  DT  I C2    1 
ATOM   6542  O  O2    . DT  I 5  23  ? 20.855  -6.235  24.028 1.00 175.39 ? -50  DT  I O2    1 
ATOM   6543  N  N3    . DT  I 5  23  ? 18.783  -5.609  24.719 1.00 176.70 ? -50  DT  I N3    1 
ATOM   6544  C  C4    . DT  I 5  23  ? 17.736  -4.718  24.867 1.00 171.55 ? -50  DT  I C4    1 
ATOM   6545  O  O4    . DT  I 5  23  ? 16.711  -5.070  25.447 1.00 150.17 ? -50  DT  I O4    1 
ATOM   6546  C  C5    . DT  I 5  23  ? 17.955  -3.408  24.294 1.00 178.83 ? -50  DT  I C5    1 
ATOM   6547  C  C7    . DT  I 5  23  ? 16.877  -2.376  24.402 1.00 174.74 ? -50  DT  I C7    1 
ATOM   6548  C  C6    . DT  I 5  23  ? 19.126  -3.174  23.689 1.00 184.24 ? -50  DT  I C6    1 
ATOM   6549  P  P     . DA  I 5  24  ? 23.086  -2.567  19.514 1.00 197.03 ? -49  DA  I P     1 
ATOM   6550  O  OP1   . DA  I 5  24  ? 24.296  -2.300  18.694 1.00 203.39 ? -49  DA  I OP1   1 
ATOM   6551  O  OP2   . DA  I 5  24  ? 21.968  -1.587  19.492 1.00 186.27 ? -49  DA  I OP2   1 
ATOM   6552  O  "O5'" . DA  I 5  24  ? 22.535  -4.014  19.124 1.00 192.14 ? -49  DA  I "O5'" 1 
ATOM   6553  C  "C5'" . DA  I 5  24  ? 23.356  -5.190  19.314 1.00 189.29 ? -49  DA  I "C5'" 1 
ATOM   6554  C  "C4'" . DA  I 5  24  ? 22.608  -6.453  18.949 1.00 188.88 ? -49  DA  I "C4'" 1 
ATOM   6555  O  "O4'" . DA  I 5  24  ? 21.614  -6.753  19.959 1.00 184.56 ? -49  DA  I "O4'" 1 
ATOM   6556  C  "C3'" . DA  I 5  24  ? 21.860  -6.412  17.613 1.00 196.87 ? -49  DA  I "C3'" 1 
ATOM   6557  O  "O3'" . DA  I 5  24  ? 22.081  -7.626  16.881 1.00 197.54 ? -49  DA  I "O3'" 1 
ATOM   6558  C  "C2'" . DA  I 5  24  ? 20.408  -6.250  18.024 1.00 192.88 ? -49  DA  I "C2'" 1 
ATOM   6559  C  "C1'" . DA  I 5  24  ? 20.364  -7.005  19.338 1.00 188.03 ? -49  DA  I "C1'" 1 
ATOM   6560  N  N9    . DA  I 5  24  ? 19.309  -6.561  20.248 1.00 189.75 ? -49  DA  I N9    1 
ATOM   6561  C  C8    . DA  I 5  24  ? 19.032  -5.275  20.639 1.00 189.33 ? -49  DA  I C8    1 
ATOM   6562  N  N7    . DA  I 5  24  ? 18.013  -5.179  21.458 1.00 189.54 ? -49  DA  I N7    1 
ATOM   6563  C  C5    . DA  I 5  24  ? 17.588  -6.491  21.615 1.00 186.55 ? -49  DA  I C5    1 
ATOM   6564  C  C6    . DA  I 5  24  ? 16.543  -7.063  22.362 1.00 179.87 ? -49  DA  I C6    1 
ATOM   6565  N  N6    . DA  I 5  24  ? 15.703  -6.356  23.122 1.00 171.04 ? -49  DA  I N6    1 
ATOM   6566  N  N1    . DA  I 5  24  ? 16.385  -8.404  22.297 1.00 185.43 ? -49  DA  I N1    1 
ATOM   6567  C  C2    . DA  I 5  24  ? 17.227  -9.112  21.532 1.00 186.54 ? -49  DA  I C2    1 
ATOM   6568  N  N3    . DA  I 5  24  ? 18.247  -8.689  20.786 1.00 190.51 ? -49  DA  I N3    1 
ATOM   6569  C  C4    . DA  I 5  24  ? 18.374  -7.353  20.872 1.00 190.70 ? -49  DA  I C4    1 
ATOM   6570  P  P     . DC  I 5  25  ? 21.646  -7.739  15.337 1.00 187.99 ? -48  DC  I P     1 
ATOM   6571  O  OP1   . DC  I 5  25  ? 22.473  -8.799  14.704 1.00 165.23 ? -48  DC  I OP1   1 
ATOM   6572  O  OP2   . DC  I 5  25  ? 21.616  -6.372  14.757 1.00 186.36 ? -48  DC  I OP2   1 
ATOM   6573  O  "O5'" . DC  I 5  25  ? 20.152  -8.281  15.424 1.00 180.34 ? -48  DC  I "O5'" 1 
ATOM   6574  C  "C5'" . DC  I 5  25  ? 19.904  -9.582  15.975 1.00 172.59 ? -48  DC  I "C5'" 1 
ATOM   6575  C  "C4'" . DC  I 5  25  ? 18.427  -9.783  16.219 1.00 166.94 ? -48  DC  I "C4'" 1 
ATOM   6576  O  "O4'" . DC  I 5  25  ? 17.941  -8.896  17.254 1.00 169.55 ? -48  DC  I "O4'" 1 
ATOM   6577  C  "C3'" . DC  I 5  25  ? 17.519  -9.552  15.004 1.00 164.41 ? -48  DC  I "C3'" 1 
ATOM   6578  O  "O3'" . DC  I 5  25  ? 16.863  -10.790 14.713 1.00 170.44 ? -48  DC  I "O3'" 1 
ATOM   6579  C  "C2'" . DC  I 5  25  ? 16.531  -8.494  15.477 1.00 165.89 ? -48  DC  I "C2'" 1 
ATOM   6580  C  "C1'" . DC  I 5  25  ? 16.570  -8.712  16.976 1.00 170.45 ? -48  DC  I "C1'" 1 
ATOM   6581  N  N1    . DC  I 5  25  ? 16.044  -7.639  17.848 1.00 161.89 ? -48  DC  I N1    1 
ATOM   6582  C  C2    . DC  I 5  25  ? 15.190  -7.994  18.903 1.00 144.00 ? -48  DC  I C2    1 
ATOM   6583  O  O2    . DC  I 5  25  ? 14.924  -9.191  19.085 1.00 121.11 ? -48  DC  I O2    1 
ATOM   6584  N  N3    . DC  I 5  25  ? 14.685  -7.024  19.699 1.00 144.77 ? -48  DC  I N3    1 
ATOM   6585  C  C4    . DC  I 5  25  ? 15.000  -5.746  19.477 1.00 150.29 ? -48  DC  I C4    1 
ATOM   6586  N  N4    . DC  I 5  25  ? 14.480  -4.823  20.291 1.00 138.80 ? -48  DC  I N4    1 
ATOM   6587  C  C5    . DC  I 5  25  ? 15.859  -5.356  18.407 1.00 161.02 ? -48  DC  I C5    1 
ATOM   6588  C  C6    . DC  I 5  25  ? 16.352  -6.326  17.623 1.00 162.65 ? -48  DC  I C6    1 
ATOM   6589  P  P     . DC  I 5  26  ? 16.270  -11.071 13.256 1.00 170.83 ? -47  DC  I P     1 
ATOM   6590  O  OP1   . DC  I 5  26  ? 17.378  -11.566 12.406 1.00 161.37 ? -47  DC  I OP1   1 
ATOM   6591  O  OP2   . DC  I 5  26  ? 15.512  -9.864  12.829 1.00 163.10 ? -47  DC  I OP2   1 
ATOM   6592  O  "O5'" . DC  I 5  26  ? 15.262  -12.292 13.482 1.00 161.00 ? -47  DC  I "O5'" 1 
ATOM   6593  C  "C5'" . DC  I 5  26  ? 14.803  -12.714 14.790 1.00 151.72 ? -47  DC  I "C5'" 1 
ATOM   6594  C  "C4'" . DC  I 5  26  ? 13.303  -12.561 14.924 1.00 148.94 ? -47  DC  I "C4'" 1 
ATOM   6595  O  "O4'" . DC  I 5  26  ? 12.998  -11.459 15.816 1.00 149.58 ? -47  DC  I "O4'" 1 
ATOM   6596  C  "C3'" . DC  I 5  26  ? 12.537  -12.279 13.626 1.00 145.79 ? -47  DC  I "C3'" 1 
ATOM   6597  O  "O3'" . DC  I 5  26  ? 11.366  -13.088 13.519 1.00 140.35 ? -47  DC  I "O3'" 1 
ATOM   6598  C  "C2'" . DC  I 5  26  ? 12.145  -10.819 13.743 1.00 145.51 ? -47  DC  I "C2'" 1 
ATOM   6599  C  "C1'" . DC  I 5  26  ? 11.979  -10.652 15.241 1.00 146.12 ? -47  DC  I "C1'" 1 
ATOM   6600  N  N1    . DC  I 5  26  ? 12.147  -9.276  15.746 1.00 142.57 ? -47  DC  I N1    1 
ATOM   6601  C  C2    . DC  I 5  26  ? 12.097  -9.057  17.128 1.00 135.26 ? -47  DC  I C2    1 
ATOM   6602  O  O2    . DC  I 5  26  ? 11.913  -10.024 17.882 1.00 130.97 ? -47  DC  I O2    1 
ATOM   6603  N  N3    . DC  I 5  26  ? 12.254  -7.801  17.605 1.00 128.65 ? -47  DC  I N3    1 
ATOM   6604  C  C4    . DC  I 5  26  ? 12.457  -6.787  16.760 1.00 125.19 ? -47  DC  I C4    1 
ATOM   6605  N  N4    . DC  I 5  26  ? 12.607  -5.565  17.275 1.00 115.11 ? -47  DC  I N4    1 
ATOM   6606  C  C5    . DC  I 5  26  ? 12.509  -6.981  15.348 1.00 132.59 ? -47  DC  I C5    1 
ATOM   6607  C  C6    . DC  I 5  26  ? 12.347  -8.229  14.889 1.00 135.97 ? -47  DC  I C6    1 
ATOM   6608  P  P     . DA  I 5  27  ? 11.434  -14.453 12.701 1.00 144.92 ? -46  DA  I P     1 
ATOM   6609  O  OP1   . DA  I 5  27  ? 12.727  -15.109 13.027 1.00 133.28 ? -46  DA  I OP1   1 
ATOM   6610  O  OP2   . DA  I 5  27  ? 11.066  -14.163 11.289 1.00 127.85 ? -46  DA  I OP2   1 
ATOM   6611  O  "O5'" . DA  I 5  27  ? 10.272  -15.327 13.347 1.00 148.18 ? -46  DA  I "O5'" 1 
ATOM   6612  C  "C5'" . DA  I 5  27  ? 10.204  -15.542 14.769 1.00 138.50 ? -46  DA  I "C5'" 1 
ATOM   6613  C  "C4'" . DA  I 5  27  ? 8.893   -15.027 15.314 1.00 123.35 ? -46  DA  I "C4'" 1 
ATOM   6614  O  "O4'" . DA  I 5  27  ? 8.949   -13.588 15.469 1.00 115.92 ? -46  DA  I "O4'" 1 
ATOM   6615  C  "C3'" . DA  I 5  27  ? 7.669   -15.304 14.440 1.00 120.75 ? -46  DA  I "C3'" 1 
ATOM   6616  O  "O3'" . DA  I 5  27  ? 6.615   -15.607 15.347 1.00 127.75 ? -46  DA  I "O3'" 1 
ATOM   6617  C  "C2'" . DA  I 5  27  ? 7.438   -13.982 13.731 1.00 121.88 ? -46  DA  I "C2'" 1 
ATOM   6618  C  "C1'" . DA  I 5  27  ? 7.837   -12.997 14.814 1.00 120.36 ? -46  DA  I "C1'" 1 
ATOM   6619  N  N9    . DA  I 5  27  ? 8.228   -11.655 14.379 1.00 128.14 ? -46  DA  I N9    1 
ATOM   6620  C  C8    . DA  I 5  27  ? 8.583   -11.212 13.128 1.00 135.76 ? -46  DA  I C8    1 
ATOM   6621  N  N7    . DA  I 5  27  ? 8.884   -9.936  13.086 1.00 134.49 ? -46  DA  I N7    1 
ATOM   6622  C  C5    . DA  I 5  27  ? 8.717   -9.510  14.396 1.00 124.03 ? -46  DA  I C5    1 
ATOM   6623  C  C6    . DA  I 5  27  ? 8.879   -8.259  15.010 1.00 120.75 ? -46  DA  I C6    1 
ATOM   6624  N  N6    . DA  I 5  27  ? 9.260   -7.159  14.358 1.00 123.85 ? -46  DA  I N6    1 
ATOM   6625  N  N1    . DA  I 5  27  ? 8.622   -8.170  16.333 1.00 125.67 ? -46  DA  I N1    1 
ATOM   6626  C  C2    . DA  I 5  27  ? 8.235   -9.273  16.986 1.00 126.59 ? -46  DA  I C2    1 
ATOM   6627  N  N3    . DA  I 5  27  ? 8.050   -10.505 16.519 1.00 123.80 ? -46  DA  I N3    1 
ATOM   6628  C  C4    . DA  I 5  27  ? 8.308   -10.557 15.201 1.00 127.63 ? -46  DA  I C4    1 
ATOM   6629  P  P     . DA  I 5  28  ? 5.349   -16.460 14.895 1.00 136.81 ? -45  DA  I P     1 
ATOM   6630  O  OP1   . DA  I 5  28  ? 5.681   -17.898 15.066 1.00 127.45 ? -45  DA  I OP1   1 
ATOM   6631  O  OP2   . DA  I 5  28  ? 4.876   -15.938 13.583 1.00 121.35 ? -45  DA  I OP2   1 
ATOM   6632  O  "O5'" . DA  I 5  28  ? 4.288   -16.107 16.027 1.00 130.71 ? -45  DA  I "O5'" 1 
ATOM   6633  C  "C5'" . DA  I 5  28  ? 4.705   -15.407 17.219 1.00 127.55 ? -45  DA  I "C5'" 1 
ATOM   6634  C  "C4'" . DA  I 5  28  ? 4.122   -14.012 17.251 1.00 122.62 ? -45  DA  I "C4'" 1 
ATOM   6635  O  "O4'" . DA  I 5  28  ? 4.807   -13.091 16.361 1.00 123.04 ? -45  DA  I "O4'" 1 
ATOM   6636  C  "C3'" . DA  I 5  28  ? 2.640   -13.939 16.870 1.00 118.64 ? -45  DA  I "C3'" 1 
ATOM   6637  O  "O3'" . DA  I 5  28  ? 1.913   -13.278 17.896 1.00 117.26 ? -45  DA  I "O3'" 1 
ATOM   6638  C  "C2'" . DA  I 5  28  ? 2.613   -13.027 15.661 1.00 123.29 ? -45  DA  I "C2'" 1 
ATOM   6639  C  "C1'" . DA  I 5  28  ? 3.824   -12.166 15.938 1.00 121.56 ? -45  DA  I "C1'" 1 
ATOM   6640  N  N9    . DA  I 5  28  ? 4.328   -11.410 14.789 1.00 115.93 ? -45  DA  I N9    1 
ATOM   6641  C  C8    . DA  I 5  28  ? 4.286   -11.753 13.460 1.00 119.83 ? -45  DA  I C8    1 
ATOM   6642  N  N7    . DA  I 5  28  ? 4.742   -10.821 12.659 1.00 127.35 ? -45  DA  I N7    1 
ATOM   6643  C  C5    . DA  I 5  28  ? 5.078   -9.782  13.515 1.00 121.50 ? -45  DA  I C5    1 
ATOM   6644  C  C6    . DA  I 5  28  ? 5.618   -8.504  13.285 1.00 120.49 ? -45  DA  I C6    1 
ATOM   6645  N  N6    . DA  I 5  28  ? 5.931   -8.039  12.074 1.00 117.52 ? -45  DA  I N6    1 
ATOM   6646  N  N1    . DA  I 5  28  ? 5.835   -7.712  14.357 1.00 119.63 ? -45  DA  I N1    1 
ATOM   6647  C  C2    . DA  I 5  28  ? 5.520   -8.178  15.573 1.00 121.90 ? -45  DA  I C2    1 
ATOM   6648  N  N3    . DA  I 5  28  ? 5.008   -9.359  15.915 1.00 125.25 ? -45  DA  I N3    1 
ATOM   6649  C  C4    . DA  I 5  28  ? 4.809   -10.123 14.827 1.00 119.62 ? -45  DA  I C4    1 
ATOM   6650  P  P     . DA  I 5  29  ? 0.489   -13.802 18.286 1.00 115.32 ? -44  DA  I P     1 
ATOM   6651  O  OP1   . DA  I 5  29  ? 0.671   -14.887 19.283 1.00 122.05 ? -44  DA  I OP1   1 
ATOM   6652  O  OP2   . DA  I 5  29  ? -0.270  -14.041 17.032 1.00 108.84 ? -44  DA  I OP2   1 
ATOM   6653  O  "O5'" . DA  I 5  29  ? -0.153  -12.550 19.015 1.00 107.85 ? -44  DA  I "O5'" 1 
ATOM   6654  C  "C5'" . DA  I 5  29  ? -0.724  -11.501 18.238 1.00 115.26 ? -44  DA  I "C5'" 1 
ATOM   6655  C  "C4'" . DA  I 5  29  ? 0.202   -10.313 18.254 1.00 114.84 ? -44  DA  I "C4'" 1 
ATOM   6656  O  "O4'" . DA  I 5  29  ? 1.157   -10.436 17.186 1.00 127.44 ? -44  DA  I "O4'" 1 
ATOM   6657  C  "C3'" . DA  I 5  29  ? -0.508  -8.996  17.996 1.00 120.21 ? -44  DA  I "C3'" 1 
ATOM   6658  O  "O3'" . DA  I 5  29  ? -0.955  -8.480  19.249 1.00 121.17 ? -44  DA  I "O3'" 1 
ATOM   6659  C  "C2'" . DA  I 5  29  ? 0.572   -8.138  17.365 1.00 125.56 ? -44  DA  I "C2'" 1 
ATOM   6660  C  "C1'" . DA  I 5  29  ? 1.541   -9.139  16.747 1.00 127.22 ? -44  DA  I "C1'" 1 
ATOM   6661  N  N9    . DA  I 5  29  ? 1.570   -9.140  15.284 1.00 128.23 ? -44  DA  I N9    1 
ATOM   6662  C  C8    . DA  I 5  29  ? 1.190   -10.125 14.404 1.00 122.02 ? -44  DA  I C8    1 
ATOM   6663  N  N7    . DA  I 5  29  ? 1.382   -9.810  13.146 1.00 116.40 ? -44  DA  I N7    1 
ATOM   6664  C  C5    . DA  I 5  29  ? 1.925   -8.535  13.202 1.00 118.86 ? -44  DA  I C5    1 
ATOM   6665  C  C6    . DA  I 5  29  ? 2.350   -7.647  12.204 1.00 121.00 ? -44  DA  I C6    1 
ATOM   6666  N  N6    . DA  I 5  29  ? 2.284   -7.916  10.901 1.00 129.85 ? -44  DA  I N6    1 
ATOM   6667  N  N1    . DA  I 5  29  ? 2.839   -6.450  12.595 1.00 122.55 ? -44  DA  I N1    1 
ATOM   6668  C  C2    . DA  I 5  29  ? 2.901   -6.178  13.905 1.00 120.94 ? -44  DA  I C2    1 
ATOM   6669  N  N3    . DA  I 5  29  ? 2.538   -6.934  14.937 1.00 113.87 ? -44  DA  I N3    1 
ATOM   6670  C  C4    . DA  I 5  29  ? 2.048   -8.111  14.512 1.00 122.88 ? -44  DA  I C4    1 
ATOM   6671  P  P     . DA  I 5  30  ? -2.500  -8.198  19.494 1.00 116.36 ? -43  DA  I P     1 
ATOM   6672  O  OP1   . DA  I 5  30  ? -2.771  -8.436  20.930 1.00 121.27 ? -43  DA  I OP1   1 
ATOM   6673  O  OP2   . DA  I 5  30  ? -3.276  -8.936  18.463 1.00 101.27 ? -43  DA  I OP2   1 
ATOM   6674  O  "O5'" . DA  I 5  30  ? -2.622  -6.629  19.235 1.00 107.18 ? -43  DA  I "O5'" 1 
ATOM   6675  C  "C5'" . DA  I 5  30  ? -1.549  -5.723  19.571 1.00 98.34  ? -43  DA  I "C5'" 1 
ATOM   6676  C  "C4'" . DA  I 5  30  ? -1.450  -4.610  18.551 1.00 100.84 ? -43  DA  I "C4'" 1 
ATOM   6677  O  "O4'" . DA  I 5  30  ? -0.871  -5.109  17.318 1.00 99.53  ? -43  DA  I "O4'" 1 
ATOM   6678  C  "C3'" . DA  I 5  30  ? -2.785  -3.956  18.167 1.00 94.93  ? -43  DA  I "C3'" 1 
ATOM   6679  O  "O3'" . DA  I 5  30  ? -2.735  -2.529  18.273 1.00 84.22  ? -43  DA  I "O3'" 1 
ATOM   6680  C  "C2'" . DA  I 5  30  ? -3.012  -4.409  16.737 1.00 96.54  ? -43  DA  I "C2'" 1 
ATOM   6681  C  "C1'" . DA  I 5  30  ? -1.595  -4.569  16.228 1.00 103.80 ? -43  DA  I "C1'" 1 
ATOM   6682  N  N9    . DA  I 5  30  ? -1.461  -5.473  15.081 1.00 112.51 ? -43  DA  I N9    1 
ATOM   6683  C  C8    . DA  I 5  30  ? -1.976  -6.738  14.926 1.00 108.92 ? -43  DA  I C8    1 
ATOM   6684  N  N7    . DA  I 5  30  ? -1.708  -7.277  13.761 1.00 110.30 ? -43  DA  I N7    1 
ATOM   6685  C  C5    . DA  I 5  30  ? -0.992  -6.293  13.095 1.00 111.60 ? -43  DA  I C5    1 
ATOM   6686  C  C6    . DA  I 5  30  ? -0.424  -6.244  11.813 1.00 104.86 ? -43  DA  I C6    1 
ATOM   6687  N  N6    . DA  I 5  30  ? -0.490  -7.248  10.938 1.00 111.93 ? -43  DA  I N6    1 
ATOM   6688  N  N1    . DA  I 5  30  ? 0.229   -5.116  11.457 1.00 104.92 ? -43  DA  I N1    1 
ATOM   6689  C  C2    . DA  I 5  30  ? 0.299   -4.109  12.338 1.00 109.74 ? -43  DA  I C2    1 
ATOM   6690  N  N3    . DA  I 5  30  ? -0.196  -4.036  13.571 1.00 113.15 ? -43  DA  I N3    1 
ATOM   6691  C  C4    . DA  I 5  30  ? -0.837  -5.174  13.893 1.00 117.66 ? -43  DA  I C4    1 
ATOM   6692  P  P     . DG  I 5  31  ? -4.009  -1.645  17.838 1.00 106.00 ? -42  DG  I P     1 
ATOM   6693  O  OP1   . DG  I 5  31  ? -4.135  -0.495  18.768 1.00 98.05  ? -42  DG  I OP1   1 
ATOM   6694  O  OP2   . DG  I 5  31  ? -5.180  -2.552  17.619 1.00 97.78  ? -42  DG  I OP2   1 
ATOM   6695  O  "O5'" . DG  I 5  31  ? -3.532  -1.027  16.454 1.00 117.12 ? -42  DG  I "O5'" 1 
ATOM   6696  C  "C5'" . DG  I 5  31  ? -2.177  -0.563  16.285 1.00 123.26 ? -42  DG  I "C5'" 1 
ATOM   6697  C  "C4'" . DG  I 5  31  ? -1.997  0.009   14.898 1.00 120.44 ? -42  DG  I "C4'" 1 
ATOM   6698  O  "O4'" . DG  I 5  31  ? -1.726  -1.063  13.960 1.00 111.19 ? -42  DG  I "O4'" 1 
ATOM   6699  C  "C3'" . DG  I 5  31  ? -3.219  0.758   14.363 1.00 118.44 ? -42  DG  I "C3'" 1 
ATOM   6700  O  "O3'" . DG  I 5  31  ? -2.824  2.005   13.782 1.00 122.35 ? -42  DG  I "O3'" 1 
ATOM   6701  C  "C2'" . DG  I 5  31  ? -3.838  -0.217  13.377 1.00 116.51 ? -42  DG  I "C2'" 1 
ATOM   6702  C  "C1'" . DG  I 5  31  ? -2.656  -1.039  12.892 1.00 111.21 ? -42  DG  I "C1'" 1 
ATOM   6703  N  N9    . DG  I 5  31  ? -2.997  -2.418  12.566 1.00 114.53 ? -42  DG  I N9    1 
ATOM   6704  C  C8    . DG  I 5  31  ? -3.650  -3.317  13.375 1.00 123.48 ? -42  DG  I C8    1 
ATOM   6705  N  N7    . DG  I 5  31  ? -3.825  -4.481  12.811 1.00 124.74 ? -42  DG  I N7    1 
ATOM   6706  C  C5    . DG  I 5  31  ? -3.264  -4.339  11.550 1.00 126.72 ? -42  DG  I C5    1 
ATOM   6707  C  C6    . DG  I 5  31  ? -3.159  -5.267  10.483 1.00 128.06 ? -42  DG  I C6    1 
ATOM   6708  O  O6    . DG  I 5  31  ? -3.551  -6.439  10.440 1.00 124.62 ? -42  DG  I O6    1 
ATOM   6709  N  N1    . DG  I 5  31  ? -2.515  -4.710  9.383  1.00 139.83 ? -42  DG  I N1    1 
ATOM   6710  C  C2    . DG  I 5  31  ? -2.034  -3.424  9.316  1.00 136.33 ? -42  DG  I C2    1 
ATOM   6711  N  N2    . DG  I 5  31  ? -1.440  -3.072  8.166  1.00 136.88 ? -42  DG  I N2    1 
ATOM   6712  N  N3    . DG  I 5  31  ? -2.128  -2.549  10.304 1.00 132.43 ? -42  DG  I N3    1 
ATOM   6713  C  C4    . DG  I 5  31  ? -2.750  -3.071  11.382 1.00 125.98 ? -42  DG  I C4    1 
ATOM   6714  P  P     . DT  I 5  32  ? -3.922  3.024   13.207 1.00 115.84 ? -41  DT  I P     1 
ATOM   6715  O  OP1   . DT  I 5  32  ? -3.440  4.403   13.484 1.00 111.69 ? -41  DT  I OP1   1 
ATOM   6716  O  OP2   . DT  I 5  32  ? -5.263  2.603   13.680 1.00 99.86  ? -41  DT  I OP2   1 
ATOM   6717  O  "O5'" . DT  I 5  32  ? -3.889  2.729   11.641 1.00 125.24 ? -41  DT  I "O5'" 1 
ATOM   6718  C  "C5'" . DT  I 5  32  ? -2.651  2.474   10.940 1.00 130.92 ? -41  DT  I "C5'" 1 
ATOM   6719  C  "C4'" . DT  I 5  32  ? -2.908  2.333   9.456  1.00 139.57 ? -41  DT  I "C4'" 1 
ATOM   6720  O  "O4'" . DT  I 5  32  ? -3.127  0.940   9.123  1.00 139.59 ? -41  DT  I "O4'" 1 
ATOM   6721  C  "C3'" . DT  I 5  32  ? -4.136  3.092   8.944  1.00 143.66 ? -41  DT  I "C3'" 1 
ATOM   6722  O  "O3'" . DT  I 5  32  ? -3.848  3.742   7.704  1.00 144.75 ? -41  DT  I "O3'" 1 
ATOM   6723  C  "C2'" . DT  I 5  32  ? -5.189  2.009   8.786  1.00 138.92 ? -41  DT  I "C2'" 1 
ATOM   6724  C  "C1'" . DT  I 5  32  ? -4.353  0.795   8.419  1.00 135.67 ? -41  DT  I "C1'" 1 
ATOM   6725  N  N1    . DT  I 5  32  ? -4.932  -0.516  8.783  1.00 125.49 ? -41  DT  I N1    1 
ATOM   6726  C  C2    . DT  I 5  32  ? -4.839  -1.542  7.870  1.00 128.96 ? -41  DT  I C2    1 
ATOM   6727  O  O2    . DT  I 5  32  ? -4.331  -1.413  6.770  1.00 142.31 ? -41  DT  I O2    1 
ATOM   6728  N  N3    . DT  I 5  32  ? -5.384  -2.731  8.288  1.00 136.54 ? -41  DT  I N3    1 
ATOM   6729  C  C4    . DT  I 5  32  ? -5.986  -2.990  9.504  1.00 131.67 ? -41  DT  I C4    1 
ATOM   6730  O  O4    . DT  I 5  32  ? -6.427  -4.111  9.741  1.00 135.26 ? -41  DT  I O4    1 
ATOM   6731  C  C5    . DT  I 5  32  ? -6.045  -1.870  10.414 1.00 121.67 ? -41  DT  I C5    1 
ATOM   6732  C  C7    . DT  I 5  32  ? -6.683  -2.058  11.754 1.00 116.85 ? -41  DT  I C7    1 
ATOM   6733  C  C6    . DT  I 5  32  ? -5.517  -0.706  10.016 1.00 123.80 ? -41  DT  I C6    1 
ATOM   6734  P  P     . DG  I 5  33  ? -4.882  4.793   7.091  1.00 149.15 ? -40  DG  I P     1 
ATOM   6735  O  OP1   . DG  I 5  33  ? -4.094  5.928   6.545  1.00 143.65 ? -40  DG  I OP1   1 
ATOM   6736  O  OP2   . DG  I 5  33  ? -5.949  5.053   8.096  1.00 138.18 ? -40  DG  I OP2   1 
ATOM   6737  O  "O5'" . DG  I 5  33  ? -5.563  3.963   5.914  1.00 154.53 ? -40  DG  I "O5'" 1 
ATOM   6738  C  "C5'" . DG  I 5  33  ? -4.763  3.328   4.899  1.00 152.99 ? -40  DG  I "C5'" 1 
ATOM   6739  C  "C4'" . DG  I 5  33  ? -5.630  2.468   4.009  1.00 153.78 ? -40  DG  I "C4'" 1 
ATOM   6740  O  "O4'" . DG  I 5  33  ? -5.810  1.165   4.619  1.00 152.87 ? -40  DG  I "O4'" 1 
ATOM   6741  C  "C3'" . DG  I 5  33  ? -7.043  3.004   3.738  1.00 154.67 ? -40  DG  I "C3'" 1 
ATOM   6742  O  "O3'" . DG  I 5  33  ? -7.336  2.847   2.340  1.00 159.48 ? -40  DG  I "O3'" 1 
ATOM   6743  C  "C2'" . DG  I 5  33  ? -7.918  2.119   4.609  1.00 152.69 ? -40  DG  I "C2'" 1 
ATOM   6744  C  "C1'" . DG  I 5  33  ? -7.171  0.813   4.464  1.00 159.68 ? -40  DG  I "C1'" 1 
ATOM   6745  N  N9    . DG  I 5  33  ? -7.493  -0.247  5.416  1.00 164.87 ? -40  DG  I N9    1 
ATOM   6746  C  C8    . DG  I 5  33  ? -7.573  -0.162  6.785  1.00 159.42 ? -40  DG  I C8    1 
ATOM   6747  N  N7    . DG  I 5  33  ? -7.903  -1.293  7.349  1.00 152.20 ? -40  DG  I N7    1 
ATOM   6748  C  C5    . DG  I 5  33  ? -8.054  -2.176  6.288  1.00 160.63 ? -40  DG  I C5    1 
ATOM   6749  C  C6    . DG  I 5  33  ? -8.409  -3.551  6.277  1.00 158.82 ? -40  DG  I C6    1 
ATOM   6750  O  O6    . DG  I 5  33  ? -8.664  -4.289  7.234  1.00 153.25 ? -40  DG  I O6    1 
ATOM   6751  N  N1    . DG  I 5  33  ? -8.449  -4.059  4.982  1.00 164.34 ? -40  DG  I N1    1 
ATOM   6752  C  C2    . DG  I 5  33  ? -8.184  -3.338  3.843  1.00 167.60 ? -40  DG  I C2    1 
ATOM   6753  N  N2    . DG  I 5  33  ? -8.279  -4.005  2.682  1.00 167.03 ? -40  DG  I N2    1 
ATOM   6754  N  N3    . DG  I 5  33  ? -7.856  -2.057  3.840  1.00 169.99 ? -40  DG  I N3    1 
ATOM   6755  C  C4    . DG  I 5  33  ? -7.809  -1.544  5.088  1.00 168.19 ? -40  DG  I C4    1 
ATOM   6756  P  P     . DT  I 5  34  ? -8.644  3.520   1.681  1.00 161.37 ? -39  DT  I P     1 
ATOM   6757  O  OP1   . DT  I 5  34  ? -8.272  4.875   1.196  1.00 147.35 ? -39  DT  I OP1   1 
ATOM   6758  O  OP2   . DT  I 5  34  ? -9.780  3.373   2.628  1.00 161.07 ? -39  DT  I OP2   1 
ATOM   6759  O  "O5'" . DT  I 5  34  ? -8.940  2.594   0.414  1.00 165.10 ? -39  DT  I "O5'" 1 
ATOM   6760  C  "C5'" . DT  I 5  34  ? -8.238  1.353   0.170  1.00 161.14 ? -39  DT  I "C5'" 1 
ATOM   6761  C  "C4'" . DT  I 5  34  ? -9.201  0.223   -0.126 1.00 164.83 ? -39  DT  I "C4'" 1 
ATOM   6762  O  "O4'" . DT  I 5  34  ? -9.353  -0.610  1.050  1.00 173.41 ? -39  DT  I "O4'" 1 
ATOM   6763  C  "C3'" . DT  I 5  34  ? -10.623 0.617   -0.550 1.00 166.61 ? -39  DT  I "C3'" 1 
ATOM   6764  O  "O3'" . DT  I 5  34  ? -11.017 -0.209  -1.656 1.00 169.36 ? -39  DT  I "O3'" 1 
ATOM   6765  C  "C2'" . DT  I 5  34  ? -11.447 0.341   0.695  1.00 164.18 ? -39  DT  I "C2'" 1 
ATOM   6766  C  "C1'" . DT  I 5  34  ? -10.731 -0.874  1.250  1.00 173.91 ? -39  DT  I "C1'" 1 
ATOM   6767  N  N1    . DT  I 5  34  ? -10.944 -1.153  2.687  1.00 175.53 ? -39  DT  I N1    1 
ATOM   6768  C  C2    . DT  I 5  34  ? -11.167 -2.458  3.073  1.00 173.61 ? -39  DT  I C2    1 
ATOM   6769  O  O2    . DT  I 5  34  ? -11.194 -3.392  2.289  1.00 177.80 ? -39  DT  I O2    1 
ATOM   6770  N  N3    . DT  I 5  34  ? -11.351 -2.630  4.423  1.00 166.84 ? -39  DT  I N3    1 
ATOM   6771  C  C4    . DT  I 5  34  ? -11.337 -1.652  5.399  1.00 169.81 ? -39  DT  I C4    1 
ATOM   6772  O  O4    . DT  I 5  34  ? -11.517 -1.960  6.574  1.00 165.55 ? -39  DT  I O4    1 
ATOM   6773  C  C5    . DT  I 5  34  ? -11.101 -0.307  4.923  1.00 173.39 ? -39  DT  I C5    1 
ATOM   6774  C  C7    . DT  I 5  34  ? -11.067 0.818   5.908  1.00 171.20 ? -39  DT  I C7    1 
ATOM   6775  C  C6    . DT  I 5  34  ? -10.917 -0.128  3.608  1.00 172.78 ? -39  DT  I C6    1 
ATOM   6776  P  P     . DA  I 5  35  ? -12.525 -0.188  -2.222 1.00 165.49 ? -38  DA  I P     1 
ATOM   6777  O  OP1   . DA  I 5  35  ? -12.453 -0.210  -3.705 1.00 150.83 ? -38  DA  I OP1   1 
ATOM   6778  O  OP2   . DA  I 5  35  ? -13.274 0.905   -1.538 1.00 147.38 ? -38  DA  I OP2   1 
ATOM   6779  O  "O5'" . DA  I 5  35  ? -13.092 -1.607  -1.769 1.00 165.69 ? -38  DA  I "O5'" 1 
ATOM   6780  C  "C5'" . DA  I 5  35  ? -12.360 -2.827  -2.035 1.00 161.09 ? -38  DA  I "C5'" 1 
ATOM   6781  C  "C4'" . DA  I 5  35  ? -13.207 -4.038  -1.714 1.00 161.16 ? -38  DA  I "C4'" 1 
ATOM   6782  O  "O4'" . DA  I 5  35  ? -13.234 -4.253  -0.276 1.00 158.69 ? -38  DA  I "O4'" 1 
ATOM   6783  C  "C3'" . DA  I 5  35  ? -14.673 -3.927  -2.151 1.00 163.39 ? -38  DA  I "C3'" 1 
ATOM   6784  O  "O3'" . DA  I 5  35  ? -15.172 -5.164  -2.682 1.00 161.07 ? -38  DA  I "O3'" 1 
ATOM   6785  C  "C2'" . DA  I 5  35  ? -15.382 -3.569  -0.860 1.00 163.47 ? -38  DA  I "C2'" 1 
ATOM   6786  C  "C1'" . DA  I 5  35  ? -14.587 -4.386  0.136  1.00 158.82 ? -38  DA  I "C1'" 1 
ATOM   6787  N  N9    . DA  I 5  35  ? -14.713 -3.900  1.510  1.00 149.69 ? -38  DA  I N9    1 
ATOM   6788  C  C8    . DA  I 5  35  ? -14.500 -2.625  1.974  1.00 152.16 ? -38  DA  I C8    1 
ATOM   6789  N  N7    . DA  I 5  35  ? -14.757 -2.479  3.251  1.00 141.98 ? -38  DA  I N7    1 
ATOM   6790  C  C5    . DA  I 5  35  ? -15.194 -3.734  3.649  1.00 140.19 ? -38  DA  I C5    1 
ATOM   6791  C  C6    . DA  I 5  35  ? -15.622 -4.235  4.888  1.00 138.13 ? -38  DA  I C6    1 
ATOM   6792  N  N6    . DA  I 5  35  ? -15.678 -3.500  6.000  1.00 136.87 ? -38  DA  I N6    1 
ATOM   6793  N  N1    . DA  I 5  35  ? -15.990 -5.534  4.948  1.00 151.73 ? -38  DA  I N1    1 
ATOM   6794  C  C2    . DA  I 5  35  ? -15.932 -6.270  3.829  1.00 150.62 ? -38  DA  I C2    1 
ATOM   6795  N  N3    . DA  I 5  35  ? -15.549 -5.910  2.605  1.00 147.57 ? -38  DA  I N3    1 
ATOM   6796  C  C4    . DA  I 5  35  ? -15.187 -4.615  2.583  1.00 144.98 ? -38  DA  I C4    1 
ATOM   6797  P  P     . DT  I 5  36  ? -16.749 -5.346  -2.999 1.00 158.08 ? -37  DT  I P     1 
ATOM   6798  O  OP1   . DT  I 5  36  ? -16.887 -6.321  -4.111 1.00 150.36 ? -37  DT  I OP1   1 
ATOM   6799  O  OP2   . DT  I 5  36  ? -17.375 -3.997  -3.104 1.00 142.67 ? -37  DT  I OP2   1 
ATOM   6800  O  "O5'" . DT  I 5  36  ? -17.312 -6.059  -1.691 1.00 156.96 ? -37  DT  I "O5'" 1 
ATOM   6801  C  "C5'" . DT  I 5  36  ? -16.990 -7.432  -1.402 1.00 158.36 ? -37  DT  I "C5'" 1 
ATOM   6802  C  "C4'" . DT  I 5  36  ? -17.798 -7.923  -0.224 1.00 156.33 ? -37  DT  I "C4'" 1 
ATOM   6803  O  "O4'" . DT  I 5  36  ? -17.564 -7.068  0.923  1.00 161.11 ? -37  DT  I "O4'" 1 
ATOM   6804  C  "C3'" . DT  I 5  36  ? -19.316 -7.946  -0.443 1.00 153.21 ? -37  DT  I "C3'" 1 
ATOM   6805  O  "O3'" . DT  I 5  36  ? -19.817 -9.234  -0.054 1.00 142.33 ? -37  DT  I "O3'" 1 
ATOM   6806  C  "C2'" . DT  I 5  36  ? -19.815 -6.780  0.396  1.00 156.33 ? -37  DT  I "C2'" 1 
ATOM   6807  C  "C1'" . DT  I 5  36  ? -18.809 -6.759  1.529  1.00 163.02 ? -37  DT  I "C1'" 1 
ATOM   6808  N  N1    . DT  I 5  36  ? -18.674 -5.463  2.234  1.00 160.24 ? -37  DT  I N1    1 
ATOM   6809  C  C2    . DT  I 5  36  ? -18.894 -5.439  3.594  1.00 152.00 ? -37  DT  I C2    1 
ATOM   6810  O  O2    . DT  I 5  36  ? -19.176 -6.434  4.242  1.00 143.58 ? -37  DT  I O2    1 
ATOM   6811  N  N3    . DT  I 5  36  ? -18.755 -4.201  4.174  1.00 150.42 ? -37  DT  I N3    1 
ATOM   6812  C  C4    . DT  I 5  36  ? -18.435 -3.013  3.541  1.00 150.24 ? -37  DT  I C4    1 
ATOM   6813  O  O4    . DT  I 5  36  ? -18.342 -1.977  4.194  1.00 136.71 ? -37  DT  I O4    1 
ATOM   6814  C  C5    . DT  I 5  36  ? -18.227 -3.111  2.114  1.00 152.51 ? -37  DT  I C5    1 
ATOM   6815  C  C7    . DT  I 5  36  ? -17.881 -1.875  1.344  1.00 150.54 ? -37  DT  I C7    1 
ATOM   6816  C  C6    . DT  I 5  36  ? -18.359 -4.314  1.540  1.00 159.32 ? -37  DT  I C6    1 
ATOM   6817  P  P     . DT  I 5  37  ? -21.389 -9.479  0.204  1.00 144.91 ? -36  DT  I P     1 
ATOM   6818  O  OP1   . DT  I 5  37  ? -21.728 -10.842 -0.274 1.00 128.45 ? -36  DT  I OP1   1 
ATOM   6819  O  OP2   . DT  I 5  37  ? -22.150 -8.300  -0.297 1.00 123.87 ? -36  DT  I OP2   1 
ATOM   6820  O  "O5'" . DT  I 5  37  ? -21.490 -9.523  1.793  1.00 151.42 ? -36  DT  I "O5'" 1 
ATOM   6821  C  "C5'" . DT  I 5  37  ? -20.701 -10.448 2.571  1.00 139.48 ? -36  DT  I "C5'" 1 
ATOM   6822  C  "C4'" . DT  I 5  37  ? -21.231 -10.517 3.984  1.00 128.73 ? -36  DT  I "C4'" 1 
ATOM   6823  O  "O4'" . DT  I 5  37  ? -21.006 -9.249  4.646  1.00 128.13 ? -36  DT  I "O4'" 1 
ATOM   6824  C  "C3'" . DT  I 5  37  ? -22.735 -10.777 4.079  1.00 117.20 ? -36  DT  I "C3'" 1 
ATOM   6825  O  "O3'" . DT  I 5  37  ? -23.034 -11.591 5.212  1.00 108.08 ? -36  DT  I "O3'" 1 
ATOM   6826  C  "C2'" . DT  I 5  37  ? -23.319 -9.389  4.254  1.00 118.43 ? -36  DT  I "C2'" 1 
ATOM   6827  C  "C1'" . DT  I 5  37  ? -22.246 -8.707  5.086  1.00 129.34 ? -36  DT  I "C1'" 1 
ATOM   6828  N  N1    . DT  I 5  37  ? -22.175 -7.238  4.950  1.00 132.40 ? -36  DT  I N1    1 
ATOM   6829  C  C2    . DT  I 5  37  ? -22.017 -6.484  6.092  1.00 135.00 ? -36  DT  I C2    1 
ATOM   6830  O  O2    . DT  I 5  37  ? -21.941 -6.971  7.209  1.00 145.31 ? -36  DT  I O2    1 
ATOM   6831  N  N3    . DT  I 5  37  ? -21.951 -5.130  5.878  1.00 129.63 ? -36  DT  I N3    1 
ATOM   6832  C  C4    . DT  I 5  37  ? -22.027 -4.471  4.666  1.00 120.96 ? -36  DT  I C4    1 
ATOM   6833  O  O4    . DT  I 5  37  ? -21.956 -3.247  4.631  1.00 112.76 ? -36  DT  I O4    1 
ATOM   6834  C  C5    . DT  I 5  37  ? -22.196 -5.322  3.512  1.00 122.89 ? -36  DT  I C5    1 
ATOM   6835  C  C7    . DT  I 5  37  ? -22.292 -4.696  2.156  1.00 122.18 ? -36  DT  I C7    1 
ATOM   6836  C  C6    . DT  I 5  37  ? -22.254 -6.645  3.708  1.00 126.77 ? -36  DT  I C6    1 
ATOM   6837  P  P     . DT  I 5  38  ? -24.540 -12.034 5.496  1.00 111.47 ? -35  DT  I P     1 
ATOM   6838  O  OP1   . DT  I 5  38  ? -24.532 -13.474 5.847  1.00 112.87 ? -35  DT  I OP1   1 
ATOM   6839  O  OP2   . DT  I 5  38  ? -25.380 -11.574 4.363  1.00 120.70 ? -35  DT  I OP2   1 
ATOM   6840  O  "O5'" . DT  I 5  38  ? -24.958 -11.144 6.754  1.00 123.77 ? -35  DT  I "O5'" 1 
ATOM   6841  C  "C5'" . DT  I 5  38  ? -24.117 -10.991 7.927  1.00 112.54 ? -35  DT  I "C5'" 1 
ATOM   6842  C  "C4'" . DT  I 5  38  ? -24.760 -10.050 8.924  1.00 107.02 ? -35  DT  I "C4'" 1 
ATOM   6843  O  "O4'" . DT  I 5  38  ? -24.591 -8.668  8.509  1.00 97.10  ? -35  DT  I "O4'" 1 
ATOM   6844  C  "C3'" . DT  I 5  38  ? -26.265 -10.246 9.134  1.00 101.79 ? -35  DT  I "C3'" 1 
ATOM   6845  O  "O3'" . DT  I 5  38  ? -26.612 -10.150 10.520 1.00 101.68 ? -35  DT  I "O3'" 1 
ATOM   6846  C  "C2'" . DT  I 5  38  ? -26.886 -9.078  8.390  1.00 102.81 ? -35  DT  I "C2'" 1 
ATOM   6847  C  "C1'" . DT  I 5  38  ? -25.842 -7.997  8.588  1.00 100.47 ? -35  DT  I "C1'" 1 
ATOM   6848  N  N1    . DT  I 5  38  ? -25.850 -6.922  7.574  1.00 105.35 ? -35  DT  I N1    1 
ATOM   6849  C  C2    . DT  I 5  38  ? -25.923 -5.619  8.008  1.00 109.19 ? -35  DT  I C2    1 
ATOM   6850  O  O2    . DT  I 5  38  ? -25.987 -5.313  9.187  1.00 108.72 ? -35  DT  I O2    1 
ATOM   6851  N  N3    . DT  I 5  38  ? -25.922 -4.680  7.006  1.00 110.21 ? -35  DT  I N3    1 
ATOM   6852  C  C4    . DT  I 5  38  ? -25.856 -4.912  5.646  1.00 112.47 ? -35  DT  I C4    1 
ATOM   6853  O  O4    . DT  I 5  38  ? -25.858 -3.966  4.863  1.00 116.04 ? -35  DT  I O4    1 
ATOM   6854  C  C5    . DT  I 5  38  ? -25.783 -6.303  5.260  1.00 112.40 ? -35  DT  I C5    1 
ATOM   6855  C  C7    . DT  I 5  38  ? -25.715 -6.654  3.807  1.00 113.56 ? -35  DT  I C7    1 
ATOM   6856  C  C6    . DT  I 5  38  ? -25.783 -7.225  6.231  1.00 110.90 ? -35  DT  I C6    1 
ATOM   6857  P  P     . DG  I 5  39  ? -26.669 -11.464 11.433 1.00 90.98  ? -34  DG  I P     1 
ATOM   6858  O  OP1   . DG  I 5  39  ? -25.518 -12.330 11.065 1.00 83.21  ? -34  DG  I OP1   1 
ATOM   6859  O  OP2   . DG  I 5  39  ? -28.058 -11.995 11.392 1.00 78.67  ? -34  DG  I OP2   1 
ATOM   6860  O  "O5'" . DG  I 5  39  ? -26.411 -10.881 12.889 1.00 84.07  ? -34  DG  I "O5'" 1 
ATOM   6861  C  "C5'" . DG  I 5  39  ? -25.216 -10.139 13.162 1.00 88.87  ? -34  DG  I "C5'" 1 
ATOM   6862  C  "C4'" . DG  I 5  39  ? -25.536 -8.915  13.988 1.00 88.46  ? -34  DG  I "C4'" 1 
ATOM   6863  O  "O4'" . DG  I 5  39  ? -26.009 -7.860  13.118 1.00 95.24  ? -34  DG  I "O4'" 1 
ATOM   6864  C  "C3'" . DG  I 5  39  ? -26.612 -9.112  15.056 1.00 84.68  ? -34  DG  I "C3'" 1 
ATOM   6865  O  "O3'" . DG  I 5  39  ? -26.192 -8.453  16.255 1.00 81.78  ? -34  DG  I "O3'" 1 
ATOM   6866  C  "C2'" . DG  I 5  39  ? -27.858 -8.511  14.430 1.00 91.74  ? -34  DG  I "C2'" 1 
ATOM   6867  C  "C1'" . DG  I 5  39  ? -27.312 -7.441  13.494 1.00 101.51 ? -34  DG  I "C1'" 1 
ATOM   6868  N  N9    . DG  I 5  39  ? -28.087 -7.228  12.272 1.00 115.95 ? -34  DG  I N9    1 
ATOM   6869  C  C8    . DG  I 5  39  ? -28.857 -8.150  11.603 1.00 114.84 ? -34  DG  I C8    1 
ATOM   6870  N  N7    . DG  I 5  39  ? -29.436 -7.661  10.541 1.00 121.81 ? -34  DG  I N7    1 
ATOM   6871  C  C5    . DG  I 5  39  ? -29.016 -6.338  10.498 1.00 126.63 ? -34  DG  I C5    1 
ATOM   6872  C  C6    . DG  I 5  39  ? -29.316 -5.309  9.570  1.00 128.79 ? -34  DG  I C6    1 
ATOM   6873  O  O6    . DG  I 5  39  ? -30.037 -5.361  8.567  1.00 136.61 ? -34  DG  I O6    1 
ATOM   6874  N  N1    . DG  I 5  39  ? -28.682 -4.117  9.906  1.00 134.75 ? -34  DG  I N1    1 
ATOM   6875  C  C2    . DG  I 5  39  ? -27.866 -3.936  10.996 1.00 129.34 ? -34  DG  I C2    1 
ATOM   6876  N  N2    . DG  I 5  39  ? -27.346 -2.709  11.150 1.00 136.32 ? -34  DG  I N2    1 
ATOM   6877  N  N3    . DG  I 5  39  ? -27.577 -4.888  11.867 1.00 124.97 ? -34  DG  I N3    1 
ATOM   6878  C  C4    . DG  I 5  39  ? -28.184 -6.054  11.561 1.00 126.54 ? -34  DG  I C4    1 
ATOM   6879  P  P     . DG  I 5  40  ? -26.942 -8.698  17.670 1.00 88.46  ? -33  DG  I P     1 
ATOM   6880  O  OP1   . DG  I 5  40  ? -25.897 -8.749  18.723 1.00 92.97  ? -33  DG  I OP1   1 
ATOM   6881  O  OP2   . DG  I 5  40  ? -27.924 -9.811  17.549 1.00 79.95  ? -33  DG  I OP2   1 
ATOM   6882  O  "O5'" . DG  I 5  40  ? -27.789 -7.365  17.848 1.00 83.30  ? -33  DG  I "O5'" 1 
ATOM   6883  C  "C5'" . DG  I 5  40  ? -27.168 -6.087  17.664 1.00 80.54  ? -33  DG  I "C5'" 1 
ATOM   6884  C  "C4'" . DG  I 5  40  ? -28.227 -5.063  17.344 1.00 86.82  ? -33  DG  I "C4'" 1 
ATOM   6885  O  "O4'" . DG  I 5  40  ? -28.776 -5.322  16.032 1.00 94.69  ? -33  DG  I "O4'" 1 
ATOM   6886  C  "C3'" . DG  I 5  40  ? -29.420 -5.058  18.306 1.00 92.34  ? -33  DG  I "C3'" 1 
ATOM   6887  O  "O3'" . DG  I 5  40  ? -29.690 -3.703  18.662 1.00 92.04  ? -33  DG  I "O3'" 1 
ATOM   6888  C  "C2'" . DG  I 5  40  ? -30.555 -5.635  17.476 1.00 92.81  ? -33  DG  I "C2'" 1 
ATOM   6889  C  "C1'" . DG  I 5  40  ? -30.175 -5.125  16.103 1.00 99.27  ? -33  DG  I "C1'" 1 
ATOM   6890  N  N9    . DG  I 5  40  ? -30.791 -5.782  14.952 1.00 105.26 ? -33  DG  I N9    1 
ATOM   6891  C  C8    . DG  I 5  40  ? -31.230 -7.082  14.856 1.00 104.89 ? -33  DG  I C8    1 
ATOM   6892  N  N7    . DG  I 5  40  ? -31.739 -7.365  13.688 1.00 98.95  ? -33  DG  I N7    1 
ATOM   6893  C  C5    . DG  I 5  40  ? -31.637 -6.179  12.972 1.00 111.73 ? -33  DG  I C5    1 
ATOM   6894  C  C6    . DG  I 5  40  ? -32.026 -5.870  11.642 1.00 115.69 ? -33  DG  I C6    1 
ATOM   6895  O  O6    . DG  I 5  40  ? -32.553 -6.609  10.801 1.00 119.06 ? -33  DG  I O6    1 
ATOM   6896  N  N1    . DG  I 5  40  ? -31.738 -4.547  11.320 1.00 111.50 ? -33  DG  I N1    1 
ATOM   6897  C  C2    . DG  I 5  40  ? -31.153 -3.637  12.167 1.00 102.62 ? -33  DG  I C2    1 
ATOM   6898  N  N2    . DG  I 5  40  ? -30.958 -2.408  11.676 1.00 108.79 ? -33  DG  I N2    1 
ATOM   6899  N  N3    . DG  I 5  40  ? -30.788 -3.912  13.407 1.00 104.37 ? -33  DG  I N3    1 
ATOM   6900  C  C4    . DG  I 5  40  ? -31.057 -5.192  13.741 1.00 107.77 ? -33  DG  I C4    1 
ATOM   6901  P  P     . DA  I 5  41  ? -30.210 -3.329  20.120 1.00 97.24  ? -32  DA  I P     1 
ATOM   6902  O  OP1   . DA  I 5  41  ? -29.107 -3.591  21.074 1.00 106.86 ? -32  DA  I OP1   1 
ATOM   6903  O  OP2   . DA  I 5  41  ? -31.526 -3.981  20.323 1.00 90.89  ? -32  DA  I OP2   1 
ATOM   6904  O  "O5'" . DA  I 5  41  ? -30.421 -1.752  20.007 1.00 106.04 ? -32  DA  I "O5'" 1 
ATOM   6905  C  "C5'" . DA  I 5  41  ? -29.552 -0.930  19.177 1.00 107.90 ? -32  DA  I "C5'" 1 
ATOM   6906  C  "C4'" . DA  I 5  41  ? -30.344 0.032   18.317 1.00 103.23 ? -32  DA  I "C4'" 1 
ATOM   6907  O  "O4'" . DA  I 5  41  ? -30.872 -0.646  17.149 1.00 100.42 ? -32  DA  I "O4'" 1 
ATOM   6908  C  "C3'" . DA  I 5  41  ? -31.535 0.704   19.012 1.00 110.69 ? -32  DA  I "C3'" 1 
ATOM   6909  O  "O3'" . DA  I 5  41  ? -31.391 2.136   18.924 1.00 107.13 ? -32  DA  I "O3'" 1 
ATOM   6910  C  "C2'" . DA  I 5  41  ? -32.754 0.042   18.379 1.00 108.80 ? -32  DA  I "C2'" 1 
ATOM   6911  C  "C1'" . DA  I 5  41  ? -32.268 -0.410  17.007 1.00 106.98 ? -32  DA  I "C1'" 1 
ATOM   6912  N  N9    . DA  I 5  41  ? -32.884 -1.648  16.516 1.00 109.31 ? -32  DA  I N9    1 
ATOM   6913  C  C8    . DA  I 5  41  ? -33.137 -2.782  17.249 1.00 107.39 ? -32  DA  I C8    1 
ATOM   6914  N  N7    . DA  I 5  41  ? -33.681 -3.750  16.554 1.00 111.37 ? -32  DA  I N7    1 
ATOM   6915  C  C5    . DA  I 5  41  ? -33.792 -3.222  15.275 1.00 112.15 ? -32  DA  I C5    1 
ATOM   6916  C  C6    . DA  I 5  41  ? -34.287 -3.756  14.075 1.00 106.80 ? -32  DA  I C6    1 
ATOM   6917  N  N6    . DA  I 5  41  ? -34.785 -4.990  13.970 1.00 109.24 ? -32  DA  I N6    1 
ATOM   6918  N  N1    . DA  I 5  41  ? -34.254 -2.971  12.977 1.00 101.74 ? -32  DA  I N1    1 
ATOM   6919  C  C2    . DA  I 5  41  ? -33.751 -1.733  13.088 1.00 102.64 ? -32  DA  I C2    1 
ATOM   6920  N  N3    . DA  I 5  41  ? -33.253 -1.120  14.161 1.00 107.79 ? -32  DA  I N3    1 
ATOM   6921  C  C4    . DA  I 5  41  ? -33.305 -1.928  15.236 1.00 113.60 ? -32  DA  I C4    1 
ATOM   6922  P  P     . DA  I 5  42  ? -32.671 3.088   18.760 1.00 109.62 ? -31  DA  I P     1 
ATOM   6923  O  OP1   . DA  I 5  42  ? -32.191 4.485   18.697 1.00 105.60 ? -31  DA  I OP1   1 
ATOM   6924  O  OP2   . DA  I 5  42  ? -33.673 2.702   19.789 1.00 107.15 ? -31  DA  I OP2   1 
ATOM   6925  O  "O5'" . DA  I 5  42  ? -33.247 2.645   17.340 1.00 125.78 ? -31  DA  I "O5'" 1 
ATOM   6926  C  "C5'" . DA  I 5  42  ? -33.361 3.545   16.224 1.00 124.72 ? -31  DA  I "C5'" 1 
ATOM   6927  C  "C4'" . DA  I 5  42  ? -34.704 3.352   15.558 1.00 120.17 ? -31  DA  I "C4'" 1 
ATOM   6928  O  "O4'" . DA  I 5  42  ? -34.954 1.943   15.311 1.00 111.05 ? -31  DA  I "O4'" 1 
ATOM   6929  C  "C3'" . DA  I 5  42  ? -35.900 3.857   16.374 1.00 117.77 ? -31  DA  I "C3'" 1 
ATOM   6930  O  "O3'" . DA  I 5  42  ? -36.776 4.564   15.489 1.00 125.60 ? -31  DA  I "O3'" 1 
ATOM   6931  C  "C2'" . DA  I 5  42  ? -36.546 2.578   16.873 1.00 118.19 ? -31  DA  I "C2'" 1 
ATOM   6932  C  "C1'" . DA  I 5  42  ? -36.290 1.666   15.691 1.00 116.42 ? -31  DA  I "C1'" 1 
ATOM   6933  N  N9    . DA  I 5  42  ? -36.414 0.230   15.940 1.00 116.34 ? -31  DA  I N9    1 
ATOM   6934  C  C8    . DA  I 5  42  ? -36.155 -0.471  17.092 1.00 119.12 ? -31  DA  I C8    1 
ATOM   6935  N  N7    . DA  I 5  42  ? -36.382 -1.758  16.989 1.00 120.44 ? -31  DA  I N7    1 
ATOM   6936  C  C5    . DA  I 5  42  ? -36.828 -1.914  15.685 1.00 118.24 ? -31  DA  I C5    1 
ATOM   6937  C  C6    . DA  I 5  42  ? -37.239 -3.043  14.956 1.00 119.08 ? -31  DA  I C6    1 
ATOM   6938  N  N6    . DA  I 5  42  ? -37.266 -4.279  15.459 1.00 118.43 ? -31  DA  I N6    1 
ATOM   6939  N  N1    . DA  I 5  42  ? -37.624 -2.858  13.674 1.00 122.09 ? -31  DA  I N1    1 
ATOM   6940  C  C2    . DA  I 5  42  ? -37.602 -1.616  13.173 1.00 129.55 ? -31  DA  I C2    1 
ATOM   6941  N  N3    . DA  I 5  42  ? -37.238 -0.477  13.760 1.00 128.10 ? -31  DA  I N3    1 
ATOM   6942  C  C4    . DA  I 5  42  ? -36.857 -0.698  15.029 1.00 118.29 ? -31  DA  I C4    1 
ATOM   6943  P  P     . DA  I 5  43  ? -37.863 5.614   16.035 1.00 121.96 ? -30  DA  I P     1 
ATOM   6944  O  OP1   . DA  I 5  43  ? -37.334 6.980   15.809 1.00 113.41 ? -30  DA  I OP1   1 
ATOM   6945  O  OP2   . DA  I 5  43  ? -38.303 5.190   17.393 1.00 115.20 ? -30  DA  I OP2   1 
ATOM   6946  O  "O5'" . DA  I 5  43  ? -39.077 5.429   15.020 1.00 125.99 ? -30  DA  I "O5'" 1 
ATOM   6947  C  "C5'" . DA  I 5  43  ? -38.972 4.565   13.869 1.00 128.86 ? -30  DA  I "C5'" 1 
ATOM   6948  C  "C4'" . DA  I 5  43  ? -40.265 3.811   13.662 1.00 130.36 ? -30  DA  I "C4'" 1 
ATOM   6949  O  "O4'" . DA  I 5  43  ? -40.051 2.410   13.953 1.00 129.70 ? -30  DA  I "O4'" 1 
ATOM   6950  C  "C3'" . DA  I 5  43  ? -41.433 4.253   14.551 1.00 132.53 ? -30  DA  I "C3'" 1 
ATOM   6951  O  "O3'" . DA  I 5  43  ? -42.656 4.250   13.807 1.00 139.65 ? -30  DA  I "O3'" 1 
ATOM   6952  C  "C2'" . DA  I 5  43  ? -41.478 3.183   15.624 1.00 128.67 ? -30  DA  I "C2'" 1 
ATOM   6953  C  "C1'" . DA  I 5  43  ? -41.080 1.965   14.820 1.00 132.43 ? -30  DA  I "C1'" 1 
ATOM   6954  N  N9    . DA  I 5  43  ? -40.564 0.842   15.600 1.00 140.62 ? -30  DA  I N9    1 
ATOM   6955  C  C8    . DA  I 5  43  ? -39.744 0.874   16.701 1.00 144.01 ? -30  DA  I C8    1 
ATOM   6956  N  N7    . DA  I 5  43  ? -39.463 -0.311  17.185 1.00 144.88 ? -30  DA  I N7    1 
ATOM   6957  C  C5    . DA  I 5  43  ? -40.147 -1.183  16.349 1.00 146.08 ? -30  DA  I C5    1 
ATOM   6958  C  C6    . DA  I 5  43  ? -40.257 -2.584  16.330 1.00 150.27 ? -30  DA  I C6    1 
ATOM   6959  N  N6    . DA  I 5  43  ? -39.654 -3.385  17.210 1.00 154.80 ? -30  DA  I N6    1 
ATOM   6960  N  N1    . DA  I 5  43  ? -41.017 -3.142  15.362 1.00 145.67 ? -30  DA  I N1    1 
ATOM   6961  C  C2    . DA  I 5  43  ? -41.622 -2.337  14.478 1.00 139.54 ? -30  DA  I C2    1 
ATOM   6962  N  N3    . DA  I 5  43  ? -41.595 -1.008  14.394 1.00 140.60 ? -30  DA  I N3    1 
ATOM   6963  C  C4    . DA  I 5  43  ? -40.831 -0.486  15.370 1.00 143.09 ? -30  DA  I C4    1 
ATOM   6964  P  P     . DC  I 5  44  ? -43.929 5.069   14.333 1.00 138.33 ? -29  DC  I P     1 
ATOM   6965  O  OP1   . DC  I 5  44  ? -44.144 6.217   13.414 1.00 135.72 ? -29  DC  I OP1   1 
ATOM   6966  O  OP2   . DC  I 5  44  ? -43.762 5.306   15.793 1.00 141.43 ? -29  DC  I OP2   1 
ATOM   6967  O  "O5'" . DC  I 5  44  ? -45.125 4.038   14.136 1.00 120.78 ? -29  DC  I "O5'" 1 
ATOM   6968  C  "C5'" . DC  I 5  44  ? -45.369 3.453   12.850 1.00 129.42 ? -29  DC  I "C5'" 1 
ATOM   6969  C  "C4'" . DC  I 5  44  ? -45.935 2.061   13.005 1.00 138.50 ? -29  DC  I "C4'" 1 
ATOM   6970  O  "O4'" . DC  I 5  44  ? -45.017 1.208   13.737 1.00 142.12 ? -29  DC  I "O4'" 1 
ATOM   6971  C  "C3'" . DC  I 5  44  ? -47.274 1.982   13.754 1.00 144.04 ? -29  DC  I "C3'" 1 
ATOM   6972  O  "O3'" . DC  I 5  44  ? -48.196 1.219   12.961 1.00 142.45 ? -29  DC  I "O3'" 1 
ATOM   6973  C  "C2'" . DC  I 5  44  ? -46.902 1.299   15.059 1.00 148.01 ? -29  DC  I "C2'" 1 
ATOM   6974  C  "C1'" . DC  I 5  44  ? -45.808 0.382   14.570 1.00 146.10 ? -29  DC  I "C1'" 1 
ATOM   6975  N  N1    . DC  I 5  44  ? -44.948 -0.200  15.613 1.00 144.90 ? -29  DC  I N1    1 
ATOM   6976  C  C2    . DC  I 5  44  ? -44.882 -1.593  15.725 1.00 143.71 ? -29  DC  I C2    1 
ATOM   6977  O  O2    . DC  I 5  44  ? -45.525 -2.289  14.925 1.00 149.07 ? -29  DC  I O2    1 
ATOM   6978  N  N3    . DC  I 5  44  ? -44.112 -2.144  16.692 1.00 135.65 ? -29  DC  I N3    1 
ATOM   6979  C  C4    . DC  I 5  44  ? -43.439 -1.358  17.536 1.00 140.66 ? -29  DC  I C4    1 
ATOM   6980  N  N4    . DC  I 5  44  ? -42.691 -1.940  18.475 1.00 146.68 ? -29  DC  I N4    1 
ATOM   6981  C  C5    . DC  I 5  44  ? -43.500 0.064   17.453 1.00 140.69 ? -29  DC  I C5    1 
ATOM   6982  C  C6    . DC  I 5  44  ? -44.265 0.595   16.490 1.00 142.61 ? -29  DC  I C6    1 
ATOM   6983  P  P     . DT  I 5  45  ? -49.494 0.541   13.620 1.00 144.48 ? -28  DT  I P     1 
ATOM   6984  O  OP1   . DT  I 5  45  ? -50.463 0.279   12.526 1.00 135.58 ? -28  DT  I OP1   1 
ATOM   6985  O  OP2   . DT  I 5  45  ? -49.909 1.373   14.783 1.00 133.65 ? -28  DT  I OP2   1 
ATOM   6986  O  "O5'" . DT  I 5  45  ? -48.933 -0.847  14.175 1.00 156.10 ? -28  DT  I "O5'" 1 
ATOM   6987  C  "C5'" . DT  I 5  45  ? -49.411 -2.128  13.702 1.00 153.61 ? -28  DT  I "C5'" 1 
ATOM   6988  C  "C4'" . DT  I 5  45  ? -49.836 -2.995  14.865 1.00 152.98 ? -28  DT  I "C4'" 1 
ATOM   6989  O  "O4'" . DT  I 5  45  ? -48.782 -3.078  15.863 1.00 152.94 ? -28  DT  I "O4'" 1 
ATOM   6990  C  "C3'" . DT  I 5  45  ? -51.069 -2.495  15.623 1.00 152.01 ? -28  DT  I "C3'" 1 
ATOM   6991  O  "O3'" . DT  I 5  45  ? -51.744 -3.624  16.167 1.00 149.82 ? -28  DT  I "O3'" 1 
ATOM   6992  C  "C2'" . DT  I 5  45  ? -50.466 -1.813  16.833 1.00 154.05 ? -28  DT  I "C2'" 1 
ATOM   6993  C  "C1'" . DT  I 5  45  ? -49.379 -2.826  17.128 1.00 150.03 ? -28  DT  I "C1'" 1 
ATOM   6994  N  N1    . DT  I 5  45  ? -48.322 -2.456  18.091 1.00 141.22 ? -28  DT  I N1    1 
ATOM   6995  C  C2    . DT  I 5  45  ? -47.558 -3.477  18.611 1.00 132.54 ? -28  DT  I C2    1 
ATOM   6996  O  O2    . DT  I 5  45  ? -47.690 -4.645  18.281 1.00 112.88 ? -28  DT  I O2    1 
ATOM   6997  N  N3    . DT  I 5  45  ? -46.614 -3.076  19.523 1.00 133.40 ? -28  DT  I N3    1 
ATOM   6998  C  C4    . DT  I 5  45  ? -46.375 -1.790  19.969 1.00 134.72 ? -28  DT  I C4    1 
ATOM   6999  O  O4    . DT  I 5  45  ? -45.487 -1.582  20.791 1.00 131.97 ? -28  DT  I O4    1 
ATOM   7000  C  C5    . DT  I 5  45  ? -47.229 -0.772  19.401 1.00 139.34 ? -28  DT  I C5    1 
ATOM   7001  C  C7    . DT  I 5  45  ? -47.044 0.652   19.824 1.00 136.47 ? -28  DT  I C7    1 
ATOM   7002  C  C6    . DT  I 5  45  ? -48.154 -1.152  18.509 1.00 142.58 ? -28  DT  I C6    1 
ATOM   7003  P  P     . DG  I 5  46  ? -53.153 -4.068  15.630 1.00 142.27 ? -27  DG  I P     1 
ATOM   7004  O  OP1   . DG  I 5  46  ? -53.319 -3.512  14.265 1.00 142.17 ? -27  DG  I OP1   1 
ATOM   7005  O  OP2   . DG  I 5  46  ? -54.145 -3.760  16.695 1.00 120.69 ? -27  DG  I OP2   1 
ATOM   7006  O  "O5'" . DG  I 5  46  ? -52.997 -5.649  15.484 1.00 137.63 ? -27  DG  I "O5'" 1 
ATOM   7007  C  "C5'" . DG  I 5  46  ? -51.720 -6.311  15.615 1.00 137.09 ? -27  DG  I "C5'" 1 
ATOM   7008  C  "C4'" . DG  I 5  46  ? -51.777 -7.431  16.632 1.00 139.02 ? -27  DG  I "C4'" 1 
ATOM   7009  O  "O4'" . DG  I 5  46  ? -50.982 -7.088  17.791 1.00 140.65 ? -27  DG  I "O4'" 1 
ATOM   7010  C  "C3'" . DG  I 5  46  ? -53.151 -7.787  17.197 1.00 137.81 ? -27  DG  I "C3'" 1 
ATOM   7011  O  "O3'" . DG  I 5  46  ? -53.085 -9.174  17.560 1.00 131.80 ? -27  DG  I "O3'" 1 
ATOM   7012  C  "C2'" . DG  I 5  46  ? -53.258 -6.863  18.398 1.00 134.48 ? -27  DG  I "C2'" 1 
ATOM   7013  C  "C1'" . DG  I 5  46  ? -51.828 -6.884  18.922 1.00 136.56 ? -27  DG  I "C1'" 1 
ATOM   7014  N  N9    . DG  I 5  46  ? -51.351 -5.693  19.620 1.00 138.92 ? -27  DG  I N9    1 
ATOM   7015  C  C8    . DG  I 5  46  ? -51.729 -4.384  19.442 1.00 144.56 ? -27  DG  I C8    1 
ATOM   7016  N  N7    . DG  I 5  46  ? -51.070 -3.553  20.204 1.00 134.51 ? -27  DG  I N7    1 
ATOM   7017  C  C5    . DG  I 5  46  ? -50.198 -4.362  20.919 1.00 127.65 ? -27  DG  I C5    1 
ATOM   7018  C  C6    . DG  I 5  46  ? -49.234 -4.031  21.905 1.00 120.59 ? -27  DG  I C6    1 
ATOM   7019  O  O6    . DG  I 5  46  ? -48.948 -2.918  22.362 1.00 120.16 ? -27  DG  I O6    1 
ATOM   7020  N  N1    . DG  I 5  46  ? -48.572 -5.163  22.371 1.00 126.22 ? -27  DG  I N1    1 
ATOM   7021  C  C2    . DG  I 5  46  ? -48.804 -6.447  21.942 1.00 125.78 ? -27  DG  I C2    1 
ATOM   7022  N  N2    . DG  I 5  46  ? -48.066 -7.410  22.510 1.00 128.22 ? -27  DG  I N2    1 
ATOM   7023  N  N3    . DG  I 5  46  ? -49.695 -6.767  21.023 1.00 127.24 ? -27  DG  I N3    1 
ATOM   7024  C  C4    . DG  I 5  46  ? -50.352 -5.684  20.560 1.00 133.30 ? -27  DG  I C4    1 
ATOM   7025  P  P     . DC  I 5  47  ? -54.385 -9.967  18.065 1.00 137.72 ? -26  DC  I P     1 
ATOM   7026  O  OP1   . DC  I 5  47  ? -54.516 -11.206 17.248 1.00 115.33 ? -26  DC  I OP1   1 
ATOM   7027  O  OP2   . DC  I 5  47  ? -55.516 -9.004  18.178 1.00 121.33 ? -26  DC  I OP2   1 
ATOM   7028  O  "O5'" . DC  I 5  47  ? -53.997 -10.390 19.550 1.00 139.52 ? -26  DC  I "O5'" 1 
ATOM   7029  C  "C5'" . DC  I 5  47  ? -52.790 -11.122 19.846 1.00 127.30 ? -26  DC  I "C5'" 1 
ATOM   7030  C  "C4'" . DC  I 5  47  ? -52.513 -11.056 21.329 1.00 119.37 ? -26  DC  I "C4'" 1 
ATOM   7031  O  "O4'" . DC  I 5  47  ? -52.171 -9.698  21.697 1.00 121.46 ? -26  DC  I "O4'" 1 
ATOM   7032  C  "C3'" . DC  I 5  47  ? -53.702 -11.451 22.211 1.00 121.31 ? -26  DC  I "C3'" 1 
ATOM   7033  O  "O3'" . DC  I 5  47  ? -53.282 -12.352 23.229 1.00 119.14 ? -26  DC  I "O3'" 1 
ATOM   7034  C  "C2'" . DC  I 5  47  ? -54.168 -10.142 22.822 1.00 123.57 ? -26  DC  I "C2'" 1 
ATOM   7035  C  "C1'" . DC  I 5  47  ? -52.888 -9.331  22.866 1.00 120.30 ? -26  DC  I "C1'" 1 
ATOM   7036  N  N1    . DC  I 5  47  ? -53.037 -7.863  22.867 1.00 116.46 ? -26  DC  I N1    1 
ATOM   7037  C  C2    . DC  I 5  47  ? -51.967 -7.087  23.319 1.00 121.23 ? -26  DC  I C2    1 
ATOM   7038  O  O2    . DC  I 5  47  ? -50.936 -7.656  23.710 1.00 122.11 ? -26  DC  I O2    1 
ATOM   7039  N  N3    . DC  I 5  47  ? -52.081 -5.739  23.320 1.00 124.69 ? -26  DC  I N3    1 
ATOM   7040  C  C4    . DC  I 5  47  ? -53.206 -5.164  22.886 1.00 119.29 ? -26  DC  I C4    1 
ATOM   7041  N  N4    . DC  I 5  47  ? -53.276 -3.833  22.904 1.00 120.46 ? -26  DC  I N4    1 
ATOM   7042  C  C5    . DC  I 5  47  ? -54.310 -5.931  22.417 1.00 121.46 ? -26  DC  I C5    1 
ATOM   7043  C  C6    . DC  I 5  47  ? -54.184 -7.264  22.423 1.00 124.15 ? -26  DC  I C6    1 
ATOM   7044  P  P     . DT  I 5  48  ? -53.777 -13.858 23.196 1.00 122.18 ? -25  DT  I P     1 
ATOM   7045  O  OP1   . DT  I 5  48  ? -53.306 -14.476 21.928 1.00 113.66 ? -25  DT  I OP1   1 
ATOM   7046  O  OP2   . DT  I 5  48  ? -55.213 -13.871 23.561 1.00 127.43 ? -25  DT  I OP2   1 
ATOM   7047  O  "O5'" . DT  I 5  48  ? -53.005 -14.500 24.424 1.00 121.44 ? -25  DT  I "O5'" 1 
ATOM   7048  C  "C5'" . DT  I 5  48  ? -52.988 -13.804 25.675 1.00 120.59 ? -25  DT  I "C5'" 1 
ATOM   7049  C  "C4'" . DT  I 5  48  ? -51.588 -13.340 26.007 1.00 109.63 ? -25  DT  I "C4'" 1 
ATOM   7050  O  "O4'" . DT  I 5  48  ? -51.471 -11.922 25.734 1.00 106.58 ? -25  DT  I "O4'" 1 
ATOM   7051  C  "C3'" . DT  I 5  48  ? -51.251 -13.503 27.487 1.00 105.34 ? -25  DT  I "C3'" 1 
ATOM   7052  O  "O3'" . DT  I 5  48  ? -49.871 -13.816 27.731 1.00 95.32  ? -25  DT  I "O3'" 1 
ATOM   7053  C  "C2'" . DT  I 5  48  ? -51.709 -12.183 28.070 1.00 106.01 ? -25  DT  I "C2'" 1 
ATOM   7054  C  "C1'" . DT  I 5  48  ? -51.393 -11.194 26.958 1.00 108.74 ? -25  DT  I "C1'" 1 
ATOM   7055  N  N1    . DT  I 5  48  ? -52.323 -10.037 26.883 1.00 110.89 ? -25  DT  I N1    1 
ATOM   7056  C  C2    . DT  I 5  48  ? -51.807 -8.791  27.156 1.00 108.17 ? -25  DT  I C2    1 
ATOM   7057  O  O2    . DT  I 5  48  ? -50.636 -8.603  27.434 1.00 125.56 ? -25  DT  I O2    1 
ATOM   7058  N  N3    . DT  I 5  48  ? -52.714 -7.764  27.081 1.00 108.70 ? -25  DT  I N3    1 
ATOM   7059  C  C4    . DT  I 5  48  ? -54.059 -7.859  26.788 1.00 115.90 ? -25  DT  I C4    1 
ATOM   7060  O  O4    . DT  I 5  48  ? -54.752 -6.846  26.770 1.00 123.14 ? -25  DT  I O4    1 
ATOM   7061  C  C5    . DT  I 5  48  ? -54.539 -9.198  26.522 1.00 122.96 ? -25  DT  I C5    1 
ATOM   7062  C  C7    . DT  I 5  48  ? -55.984 -9.401  26.189 1.00 124.92 ? -25  DT  I C7    1 
ATOM   7063  C  C6    . DT  I 5  48  ? -53.659 -10.207 26.590 1.00 120.24 ? -25  DT  I C6    1 
ATOM   7064  P  P     . DC  I 5  49  ? -49.467 -14.857 28.904 1.00 89.04  ? -24  DC  I P     1 
ATOM   7065  O  OP1   . DC  I 5  49  ? -48.166 -15.459 28.532 1.00 74.99  ? -24  DC  I OP1   1 
ATOM   7066  O  OP2   . DC  I 5  49  ? -50.636 -15.741 29.169 1.00 74.23  ? -24  DC  I OP2   1 
ATOM   7067  O  "O5'" . DC  I 5  49  ? -49.276 -13.922 30.184 1.00 74.17  ? -24  DC  I "O5'" 1 
ATOM   7068  C  "C5'" . DC  I 5  49  ? -48.592 -12.661 30.073 1.00 76.14  ? -24  DC  I "C5'" 1 
ATOM   7069  C  "C4'" . DC  I 5  49  ? -49.114 -11.681 31.095 1.00 85.45  ? -24  DC  I "C4'" 1 
ATOM   7070  O  "O4'" . DC  I 5  49  ? -50.266 -10.954 30.591 1.00 106.14 ? -24  DC  I "O4'" 1 
ATOM   7071  C  "C3'" . DC  I 5  49  ? -49.570 -12.302 32.416 1.00 91.07  ? -24  DC  I "C3'" 1 
ATOM   7072  O  "O3'" . DC  I 5  49  ? -49.215 -11.407 33.470 1.00 92.09  ? -24  DC  I "O3'" 1 
ATOM   7073  C  "C2'" . DC  I 5  49  ? -51.081 -12.309 32.290 1.00 102.14 ? -24  DC  I "C2'" 1 
ATOM   7074  C  "C1'" . DC  I 5  49  ? -51.264 -10.969 31.605 1.00 108.08 ? -24  DC  I "C1'" 1 
ATOM   7075  N  N1    . DC  I 5  49  ? -52.576 -10.667 30.992 1.00 109.27 ? -24  DC  I N1    1 
ATOM   7076  C  C2    . DC  I 5  49  ? -52.976 -9.329  30.916 1.00 111.21 ? -24  DC  I C2    1 
ATOM   7077  O  O2    . DC  I 5  49  ? -52.213 -8.449  31.342 1.00 107.48 ? -24  DC  I O2    1 
ATOM   7078  N  N3    . DC  I 5  49  ? -54.181 -9.027  30.378 1.00 117.85 ? -24  DC  I N3    1 
ATOM   7079  C  C4    . DC  I 5  49  ? -54.976 -10.003 29.933 1.00 118.77 ? -24  DC  I C4    1 
ATOM   7080  N  N4    . DC  I 5  49  ? -56.153 -9.658  29.406 1.00 122.04 ? -24  DC  I N4    1 
ATOM   7081  C  C5    . DC  I 5  49  ? -54.597 -11.376 30.005 1.00 117.26 ? -24  DC  I C5    1 
ATOM   7082  C  C6    . DC  I 5  49  ? -53.406 -11.662 30.552 1.00 112.33 ? -24  DC  I C6    1 
ATOM   7083  P  P     . DC  I 5  50  ? -47.825 -11.571 34.220 1.00 82.58  ? -23  DC  I P     1 
ATOM   7084  O  OP1   . DC  I 5  50  ? -46.741 -11.559 33.200 1.00 74.24  ? -23  DC  I OP1   1 
ATOM   7085  O  OP2   . DC  I 5  50  ? -47.963 -12.733 35.136 1.00 85.60  ? -23  DC  I OP2   1 
ATOM   7086  O  "O5'" . DC  I 5  50  ? -47.715 -10.208 35.036 1.00 68.40  ? -23  DC  I "O5'" 1 
ATOM   7087  C  "C5'" . DC  I 5  50  ? -47.279 -8.997  34.383 1.00 75.00  ? -23  DC  I "C5'" 1 
ATOM   7088  C  "C4'" . DC  I 5  50  ? -48.100 -7.824  34.863 1.00 76.81  ? -23  DC  I "C4'" 1 
ATOM   7089  O  "O4'" . DC  I 5  50  ? -49.416 -7.893  34.263 1.00 91.43  ? -23  DC  I "O4'" 1 
ATOM   7090  C  "C3'" . DC  I 5  50  ? -48.320 -7.804  36.378 1.00 79.58  ? -23  DC  I "C3'" 1 
ATOM   7091  O  "O3'" . DC  I 5  50  ? -47.909 -6.542  36.912 1.00 73.76  ? -23  DC  I "O3'" 1 
ATOM   7092  C  "C2'" . DC  I 5  50  ? -49.802 -8.114  36.544 1.00 86.21  ? -23  DC  I "C2'" 1 
ATOM   7093  C  "C1'" . DC  I 5  50  ? -50.390 -7.595  35.247 1.00 94.04  ? -23  DC  I "C1'" 1 
ATOM   7094  N  N1    . DC  I 5  50  ? -51.673 -8.189  34.818 1.00 102.43 ? -23  DC  I N1    1 
ATOM   7095  C  C2    . DC  I 5  50  ? -52.721 -7.340  34.429 1.00 102.31 ? -23  DC  I C2    1 
ATOM   7096  O  O2    . DC  I 5  50  ? -52.551 -6.113  34.476 1.00 103.02 ? -23  DC  I O2    1 
ATOM   7097  N  N3    . DC  I 5  50  ? -53.893 -7.879  34.021 1.00 107.48 ? -23  DC  I N3    1 
ATOM   7098  C  C4    . DC  I 5  50  ? -54.040 -9.206  33.987 1.00 109.49 ? -23  DC  I C4    1 
ATOM   7099  N  N4    . DC  I 5  50  ? -55.211 -9.695  33.574 1.00 113.92 ? -23  DC  I N4    1 
ATOM   7100  C  C5    . DC  I 5  50  ? -52.989 -10.092 34.369 1.00 111.46 ? -23  DC  I C5    1 
ATOM   7101  C  C6    . DC  I 5  50  ? -51.833 -9.546  34.773 1.00 101.60 ? -23  DC  I C6    1 
ATOM   7102  P  P     . DA  I 5  51  ? -47.853 -6.334  38.497 1.00 73.36  ? -22  DA  I P     1 
ATOM   7103  O  OP1   . DA  I 5  51  ? -46.578 -5.648  38.826 1.00 77.31  ? -22  DA  I OP1   1 
ATOM   7104  O  OP2   . DA  I 5  51  ? -48.169 -7.643  39.128 1.00 69.45  ? -22  DA  I OP2   1 
ATOM   7105  O  "O5'" . DA  I 5  51  ? -48.999 -5.256  38.768 1.00 87.83  ? -22  DA  I "O5'" 1 
ATOM   7106  C  "C5'" . DA  I 5  51  ? -48.906 -3.923  38.197 1.00 91.58  ? -22  DA  I "C5'" 1 
ATOM   7107  C  "C4'" . DA  I 5  51  ? -50.114 -3.063  38.505 1.00 86.06  ? -22  DA  I "C4'" 1 
ATOM   7108  O  "O4'" . DA  I 5  51  ? -51.301 -3.592  37.873 1.00 82.47  ? -22  DA  I "O4'" 1 
ATOM   7109  C  "C3'" . DA  I 5  51  ? -50.460 -2.875  39.983 1.00 82.06  ? -22  DA  I "C3'" 1 
ATOM   7110  O  "O3'" . DA  I 5  51  ? -50.758 -1.493  40.193 1.00 92.61  ? -22  DA  I "O3'" 1 
ATOM   7111  C  "C2'" . DA  I 5  51  ? -51.643 -3.797  40.199 1.00 84.44  ? -22  DA  I "C2'" 1 
ATOM   7112  C  "C1'" . DA  I 5  51  ? -52.307 -3.865  38.835 1.00 91.42  ? -22  DA  I "C1'" 1 
ATOM   7113  N  N9    . DA  I 5  51  ? -52.869 -5.170  38.511 1.00 108.34 ? -22  DA  I N9    1 
ATOM   7114  C  C8    . DA  I 5  51  ? -52.287 -6.396  38.715 1.00 108.28 ? -22  DA  I C8    1 
ATOM   7115  N  N7    . DA  I 5  51  ? -53.009 -7.402  38.285 1.00 114.96 ? -22  DA  I N7    1 
ATOM   7116  C  C5    . DA  I 5  51  ? -54.134 -6.796  37.744 1.00 119.10 ? -22  DA  I C5    1 
ATOM   7117  C  C6    . DA  I 5  51  ? -55.280 -7.319  37.126 1.00 121.49 ? -22  DA  I C6    1 
ATOM   7118  N  N6    . DA  I 5  51  ? -55.488 -8.624  36.941 1.00 119.17 ? -22  DA  I N6    1 
ATOM   7119  N  N1    . DA  I 5  51  ? -56.220 -6.445  36.703 1.00 129.12 ? -22  DA  I N1    1 
ATOM   7120  C  C2    . DA  I 5  51  ? -56.010 -5.135  36.893 1.00 128.23 ? -22  DA  I C2    1 
ATOM   7121  N  N3    . DA  I 5  51  ? -54.973 -4.523  37.462 1.00 124.39 ? -22  DA  I N3    1 
ATOM   7122  C  C4    . DA  I 5  51  ? -54.059 -5.421  37.871 1.00 121.97 ? -22  DA  I C4    1 
ATOM   7123  P  P     . DT  I 5  52  ? -51.265 -0.947  41.621 1.00 105.91 ? -21  DT  I P     1 
ATOM   7124  O  OP1   . DT  I 5  52  ? -50.779 0.449   41.769 1.00 98.45  ? -21  DT  I OP1   1 
ATOM   7125  O  OP2   . DT  I 5  52  ? -50.934 -1.947  42.670 1.00 93.45  ? -21  DT  I OP2   1 
ATOM   7126  O  "O5'" . DT  I 5  52  ? -52.852 -0.969  41.469 1.00 107.39 ? -21  DT  I "O5'" 1 
ATOM   7127  C  "C5'" . DT  I 5  52  ? -53.532 -0.504  40.287 1.00 106.73 ? -21  DT  I "C5'" 1 
ATOM   7128  C  "C4'" . DT  I 5  52  ? -55.009 -0.783  40.431 1.00 114.64 ? -21  DT  I "C4'" 1 
ATOM   7129  O  "O4'" . DT  I 5  52  ? -55.284 -2.132  39.990 1.00 115.17 ? -21  DT  I "O4'" 1 
ATOM   7130  C  "C3'" . DT  I 5  52  ? -55.523 -0.692  41.874 1.00 122.45 ? -21  DT  I "C3'" 1 
ATOM   7131  O  "O3'" . DT  I 5  52  ? -56.603 0.239   42.004 1.00 129.35 ? -21  DT  I "O3'" 1 
ATOM   7132  C  "C2'" . DT  I 5  52  ? -55.950 -2.110  42.215 1.00 114.85 ? -21  DT  I "C2'" 1 
ATOM   7133  C  "C1'" . DT  I 5  52  ? -56.246 -2.699  40.854 1.00 115.42 ? -21  DT  I "C1'" 1 
ATOM   7134  N  N1    . DT  I 5  52  ? -56.129 -4.161  40.759 1.00 115.63 ? -21  DT  I N1    1 
ATOM   7135  C  C2    . DT  I 5  52  ? -57.071 -4.841  40.019 1.00 119.88 ? -21  DT  I C2    1 
ATOM   7136  O  O2    . DT  I 5  52  ? -57.998 -4.288  39.451 1.00 119.11 ? -21  DT  I O2    1 
ATOM   7137  N  N3    . DT  I 5  52  ? -56.884 -6.200  39.966 1.00 125.90 ? -21  DT  I N3    1 
ATOM   7138  C  C4    . DT  I 5  52  ? -55.871 -6.928  40.562 1.00 122.74 ? -21  DT  I C4    1 
ATOM   7139  O  O4    . DT  I 5  52  ? -55.828 -8.147  40.419 1.00 121.53 ? -21  DT  I O4    1 
ATOM   7140  C  C5    . DT  I 5  52  ? -54.916 -6.149  41.319 1.00 117.09 ? -21  DT  I C5    1 
ATOM   7141  C  C7    . DT  I 5  52  ? -53.784 -6.851  42.002 1.00 105.57 ? -21  DT  I C7    1 
ATOM   7142  C  C6    . DT  I 5  52  ? -55.088 -4.823  41.374 1.00 117.57 ? -21  DT  I C6    1 
ATOM   7143  P  P     . DC  I 5  53  ? -57.108 0.673   43.462 1.00 122.55 ? -20  DC  I P     1 
ATOM   7144  O  OP1   . DC  I 5  53  ? -57.193 2.157   43.479 1.00 121.95 ? -20  DC  I OP1   1 
ATOM   7145  O  OP2   . DC  I 5  53  ? -56.242 0.006   44.470 1.00 118.24 ? -20  DC  I OP2   1 
ATOM   7146  O  "O5'" . DC  I 5  53  ? -58.541 -0.029  43.559 1.00 121.04 ? -20  DC  I "O5'" 1 
ATOM   7147  C  "C5'" . DC  I 5  53  ? -59.252 -0.491  42.380 1.00 129.02 ? -20  DC  I "C5'" 1 
ATOM   7148  C  "C4'" . DC  I 5  53  ? -60.395 -1.418  42.736 1.00 137.49 ? -20  DC  I "C4'" 1 
ATOM   7149  O  "O4'" . DC  I 5  53  ? -60.012 -2.799  42.510 1.00 135.69 ? -20  DC  I "O4'" 1 
ATOM   7150  C  "C3'" . DC  I 5  53  ? -60.881 -1.359  44.188 1.00 148.24 ? -20  DC  I "C3'" 1 
ATOM   7151  O  "O3'" . DC  I 5  53  ? -62.296 -1.561  44.262 1.00 158.16 ? -20  DC  I "O3'" 1 
ATOM   7152  C  "C2'" . DC  I 5  53  ? -60.186 -2.544  44.824 1.00 142.96 ? -20  DC  I "C2'" 1 
ATOM   7153  C  "C1'" . DC  I 5  53  ? -60.271 -3.549  43.690 1.00 143.23 ? -20  DC  I "C1'" 1 
ATOM   7154  N  N1    . DC  I 5  53  ? -59.316 -4.672  43.749 1.00 145.20 ? -20  DC  I N1    1 
ATOM   7155  C  C2    . DC  I 5  53  ? -59.520 -5.776  42.915 1.00 143.23 ? -20  DC  I C2    1 
ATOM   7156  O  O2    . DC  I 5  53  ? -60.483 -5.769  42.135 1.00 141.52 ? -20  DC  I O2    1 
ATOM   7157  N  N3    . DC  I 5  53  ? -58.657 -6.819  42.976 1.00 141.22 ? -20  DC  I N3    1 
ATOM   7158  C  C4    . DC  I 5  53  ? -57.631 -6.786  43.831 1.00 135.84 ? -20  DC  I C4    1 
ATOM   7159  N  N4    . DC  I 5  53  ? -56.801 -7.832  43.858 1.00 135.56 ? -20  DC  I N4    1 
ATOM   7160  C  C5    . DC  I 5  53  ? -57.407 -5.679  44.697 1.00 128.86 ? -20  DC  I C5    1 
ATOM   7161  C  C6    . DC  I 5  53  ? -58.266 -4.655  44.626 1.00 139.71 ? -20  DC  I C6    1 
ATOM   7162  P  P     . DA  I 5  54  ? -63.114 -1.010  45.517 1.00 153.53 ? -19  DA  I P     1 
ATOM   7163  O  OP1   . DA  I 5  54  ? -63.591 0.352   45.174 1.00 147.56 ? -19  DA  I OP1   1 
ATOM   7164  O  OP2   . DA  I 5  54  ? -62.281 -1.210  46.733 1.00 144.81 ? -19  DA  I OP2   1 
ATOM   7165  O  "O5'" . DA  I 5  54  ? -64.358 -2.001  45.606 1.00 141.33 ? -19  DA  I "O5'" 1 
ATOM   7166  C  "C5'" . DA  I 5  54  ? -65.241 -2.207  44.490 1.00 144.86 ? -19  DA  I "C5'" 1 
ATOM   7167  C  "C4'" . DA  I 5  54  ? -65.845 -3.589  44.573 1.00 153.35 ? -19  DA  I "C4'" 1 
ATOM   7168  O  "O4'" . DA  I 5  54  ? -64.788 -4.575  44.444 1.00 161.38 ? -19  DA  I "O4'" 1 
ATOM   7169  C  "C3'" . DA  I 5  54  ? -66.547 -3.891  45.900 1.00 161.89 ? -19  DA  I "C3'" 1 
ATOM   7170  O  "O3'" . DA  I 5  54  ? -67.751 -4.649  45.706 1.00 161.58 ? -19  DA  I "O3'" 1 
ATOM   7171  C  "C2'" . DA  I 5  54  ? -65.502 -4.675  46.671 1.00 171.12 ? -19  DA  I "C2'" 1 
ATOM   7172  C  "C1'" . DA  I 5  54  ? -64.808 -5.447  45.566 1.00 168.91 ? -19  DA  I "C1'" 1 
ATOM   7173  N  N9    . DA  I 5  54  ? -63.429 -5.829  45.879 1.00 165.61 ? -19  DA  I N9    1 
ATOM   7174  C  C8    . DA  I 5  54  ? -62.440 -5.048  46.427 1.00 150.89 ? -19  DA  I C8    1 
ATOM   7175  N  N7    . DA  I 5  54  ? -61.309 -5.683  46.616 1.00 143.14 ? -19  DA  I N7    1 
ATOM   7176  C  C5    . DA  I 5  54  ? -61.574 -6.972  46.177 1.00 147.84 ? -19  DA  I C5    1 
ATOM   7177  C  C6    . DA  I 5  54  ? -60.779 -8.128  46.110 1.00 142.76 ? -19  DA  I C6    1 
ATOM   7178  N  N6    . DA  I 5  54  ? -59.505 -8.169  46.504 1.00 142.02 ? -19  DA  I N6    1 
ATOM   7179  N  N1    . DA  I 5  54  ? -61.345 -9.253  45.620 1.00 142.99 ? -19  DA  I N1    1 
ATOM   7180  C  C2    . DA  I 5  54  ? -62.624 -9.208  45.225 1.00 150.72 ? -19  DA  I C2    1 
ATOM   7181  N  N3    . DA  I 5  54  ? -63.472 -8.180  45.235 1.00 159.52 ? -19  DA  I N3    1 
ATOM   7182  C  C4    . DA  I 5  54  ? -62.877 -7.079  45.727 1.00 159.49 ? -19  DA  I C4    1 
ATOM   7183  P  P     . DA  I 5  55  ? -68.616 -5.180  46.970 1.00 155.41 ? -18  DA  I P     1 
ATOM   7184  O  OP1   . DA  I 5  55  ? -70.052 -5.144  46.588 1.00 149.33 ? -18  DA  I OP1   1 
ATOM   7185  O  OP2   . DA  I 5  55  ? -68.172 -4.456  48.194 1.00 130.77 ? -18  DA  I OP2   1 
ATOM   7186  O  "O5'" . DA  I 5  55  ? -68.178 -6.710  47.089 1.00 158.25 ? -18  DA  I "O5'" 1 
ATOM   7187  C  "C5'" . DA  I 5  55  ? -68.639 -7.708  46.147 1.00 157.15 ? -18  DA  I "C5'" 1 
ATOM   7188  C  "C4'" . DA  I 5  55  ? -68.174 -9.086  46.562 1.00 155.63 ? -18  DA  I "C4'" 1 
ATOM   7189  O  "O4'" . DA  I 5  55  ? -66.746 -9.060  46.807 1.00 162.55 ? -18  DA  I "O4'" 1 
ATOM   7190  C  "C3'" . DA  I 5  55  ? -68.795 -9.618  47.853 1.00 154.45 ? -18  DA  I "C3'" 1 
ATOM   7191  O  "O3'" . DA  I 5  55  ? -68.881 -11.047 47.789 1.00 148.79 ? -18  DA  I "O3'" 1 
ATOM   7192  C  "C2'" . DA  I 5  55  ? -67.796 -9.171  48.903 1.00 153.47 ? -18  DA  I "C2'" 1 
ATOM   7193  C  "C1'" . DA  I 5  55  ? -66.495 -9.425  48.161 1.00 161.26 ? -18  DA  I "C1'" 1 
ATOM   7194  N  N9    . DA  I 5  55  ? -65.326 -8.676  48.624 1.00 157.55 ? -18  DA  I N9    1 
ATOM   7195  C  C8    . DA  I 5  55  ? -65.249 -7.371  49.049 1.00 146.42 ? -18  DA  I C8    1 
ATOM   7196  N  N7    . DA  I 5  55  ? -64.040 -6.998  49.394 1.00 130.65 ? -18  DA  I N7    1 
ATOM   7197  C  C5    . DA  I 5  55  ? -63.270 -8.133  49.186 1.00 134.20 ? -18  DA  I C5    1 
ATOM   7198  C  C6    . DA  I 5  55  ? -61.901 -8.392  49.366 1.00 117.36 ? -18  DA  I C6    1 
ATOM   7199  N  N6    . DA  I 5  55  ? -61.030 -7.488  49.814 1.00 110.45 ? -18  DA  I N6    1 
ATOM   7200  N  N1    . DA  I 5  55  ? -61.453 -9.630  49.068 1.00 119.38 ? -18  DA  I N1    1 
ATOM   7201  C  C2    . DA  I 5  55  ? -62.327 -10.539 48.614 1.00 129.46 ? -18  DA  I C2    1 
ATOM   7202  N  N3    . DA  I 5  55  ? -63.634 -10.414 48.401 1.00 134.46 ? -18  DA  I N3    1 
ATOM   7203  C  C4    . DA  I 5  55  ? -64.048 -9.173  48.710 1.00 145.78 ? -18  DA  I C4    1 
ATOM   7204  P  P     . DA  I 5  56  ? -69.831 -11.846 48.800 1.00 155.56 ? -17  DA  I P     1 
ATOM   7205  O  OP1   . DA  I 5  56  ? -71.190 -11.891 48.206 1.00 165.16 ? -17  DA  I OP1   1 
ATOM   7206  O  OP2   . DA  I 5  56  ? -69.641 -11.281 50.164 1.00 141.49 ? -17  DA  I OP2   1 
ATOM   7207  O  "O5'" . DA  I 5  56  ? -69.255 -13.334 48.780 1.00 155.66 ? -17  DA  I "O5'" 1 
ATOM   7208  C  "C5'" . DA  I 5  56  ? -68.147 -13.734 47.943 1.00 156.64 ? -17  DA  I "C5'" 1 
ATOM   7209  C  "C4'" . DA  I 5  56  ? -67.055 -14.406 48.750 1.00 154.21 ? -17  DA  I "C4'" 1 
ATOM   7210  O  "O4'" . DA  I 5  56  ? -66.013 -13.449 49.063 1.00 146.83 ? -17  DA  I "O4'" 1 
ATOM   7211  C  "C3'" . DA  I 5  56  ? -67.479 -15.037 50.085 1.00 158.03 ? -17  DA  I "C3'" 1 
ATOM   7212  O  "O3'" . DA  I 5  56  ? -67.049 -16.407 50.131 1.00 153.92 ? -17  DA  I "O3'" 1 
ATOM   7213  C  "C2'" . DA  I 5  56  ? -66.815 -14.157 51.132 1.00 155.91 ? -17  DA  I "C2'" 1 
ATOM   7214  C  "C1'" . DA  I 5  56  ? -65.598 -13.639 50.402 1.00 147.88 ? -17  DA  I "C1'" 1 
ATOM   7215  N  N9    . DA  I 5  56  ? -65.103 -12.362 50.910 1.00 140.79 ? -17  DA  I N9    1 
ATOM   7216  C  C8    . DA  I 5  56  ? -65.805 -11.207 51.155 1.00 140.33 ? -17  DA  I C8    1 
ATOM   7217  N  N7    . DA  I 5  56  ? -65.069 -10.231 51.627 1.00 130.82 ? -17  DA  I N7    1 
ATOM   7218  C  C5    . DA  I 5  56  ? -63.798 -10.783 51.709 1.00 131.92 ? -17  DA  I C5    1 
ATOM   7219  C  C6    . DA  I 5  56  ? -62.564 -10.261 52.139 1.00 122.28 ? -17  DA  I C6    1 
ATOM   7220  N  N6    . DA  I 5  56  ? -62.401 -9.014  52.583 1.00 122.18 ? -17  DA  I N6    1 
ATOM   7221  N  N1    . DA  I 5  56  ? -61.490 -11.078 52.098 1.00 118.63 ? -17  DA  I N1    1 
ATOM   7222  C  C2    . DA  I 5  56  ? -61.651 -12.330 51.650 1.00 122.75 ? -17  DA  I C2    1 
ATOM   7223  N  N3    . DA  I 5  56  ? -62.757 -12.935 51.223 1.00 124.90 ? -17  DA  I N3    1 
ATOM   7224  C  C4    . DA  I 5  56  ? -63.807 -12.096 51.276 1.00 134.17 ? -17  DA  I C4    1 
ATOM   7225  P  P     . DA  I 5  57  ? -66.997 -17.223 51.521 1.00 147.67 ? -16  DA  I P     1 
ATOM   7226  O  OP1   . DA  I 5  57  ? -67.368 -18.633 51.239 1.00 135.97 ? -16  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I 5  57  ? -67.724 -16.455 52.568 1.00 142.79 ? -16  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I 5  57  ? -65.449 -17.185 51.881 1.00 163.00 ? -16  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I 5  57  ? -64.465 -17.635 50.928 1.00 152.89 ? -16  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I 5  57  ? -63.102 -17.690 51.577 1.00 137.43 ? -16  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I 5  57  ? -62.706 -16.352 51.965 1.00 127.03 ? -16  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I 5  57  ? -63.024 -18.540 52.849 1.00 132.89 ? -16  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I 5  57  ? -61.805 -19.289 52.845 1.00 130.58 ? -16  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I 5  57  ? -63.079 -17.511 53.965 1.00 126.08 ? -16  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I 5  57  ? -62.351 -16.339 53.338 1.00 127.56 ? -16  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I 5  57  ? -62.707 -15.031 53.877 1.00 131.33 ? -16  DA  I N9    1 
ATOM   7237  C  C8    . DA  I 5  57  ? -63.951 -14.462 53.986 1.00 141.39 ? -16  DA  I C8    1 
ATOM   7238  N  N7    . DA  I 5  57  ? -63.937 -13.257 54.503 1.00 145.06 ? -16  DA  I N7    1 
ATOM   7239  C  C5    . DA  I 5  57  ? -62.592 -13.015 54.747 1.00 130.61 ? -16  DA  I C5    1 
ATOM   7240  C  C6    . DA  I 5  57  ? -61.911 -11.908 55.284 1.00 120.40 ? -16  DA  I C6    1 
ATOM   7241  N  N6    . DA  I 5  57  ? -62.517 -10.796 55.702 1.00 123.10 ? -16  DA  I N6    1 
ATOM   7242  N  N1    . DA  I 5  57  ? -60.567 -11.988 55.389 1.00 117.92 ? -16  DA  I N1    1 
ATOM   7243  C  C2    . DA  I 5  57  ? -59.957 -13.103 54.969 1.00 129.73 ? -16  DA  I C2    1 
ATOM   7244  N  N3    . DA  I 5  57  ? -60.487 -14.206 54.444 1.00 136.00 ? -16  DA  I N3    1 
ATOM   7245  C  C4    . DA  I 5  57  ? -61.824 -14.097 54.361 1.00 134.50 ? -16  DA  I C4    1 
ATOM   7246  P  P     . DG  I 5  58  ? -61.564 -20.470 53.899 1.00 128.39 ? -15  DG  I P     1 
ATOM   7247  O  OP1   . DG  I 5  58  ? -61.441 -21.736 53.129 1.00 97.14  ? -15  DG  I OP1   1 
ATOM   7248  O  OP2   . DG  I 5  58  ? -62.577 -20.352 54.986 1.00 119.20 ? -15  DG  I OP2   1 
ATOM   7249  O  "O5'" . DG  I 5  58  ? -60.156 -20.088 54.544 1.00 123.37 ? -15  DG  I "O5'" 1 
ATOM   7250  C  "C5'" . DG  I 5  58  ? -59.734 -18.709 54.666 1.00 116.82 ? -15  DG  I "C5'" 1 
ATOM   7251  C  "C4'" . DG  I 5  58  ? -58.852 -18.496 55.877 1.00 125.81 ? -15  DG  I "C4'" 1 
ATOM   7252  O  "O4'" . DG  I 5  58  ? -59.125 -17.181 56.420 1.00 120.95 ? -15  DG  I "O4'" 1 
ATOM   7253  C  "C3'" . DG  I 5  58  ? -59.086 -19.452 57.047 1.00 130.50 ? -15  DG  I "C3'" 1 
ATOM   7254  O  "O3'" . DG  I 5  58  ? -57.963 -19.500 57.947 1.00 121.27 ? -15  DG  I "O3'" 1 
ATOM   7255  C  "C2'" . DG  I 5  58  ? -60.243 -18.779 57.759 1.00 135.31 ? -15  DG  I "C2'" 1 
ATOM   7256  C  "C1'" . DG  I 5  58  ? -59.839 -17.311 57.645 1.00 126.70 ? -15  DG  I "C1'" 1 
ATOM   7257  N  N9    . DG  I 5  58  ? -60.920 -16.331 57.639 1.00 126.23 ? -15  DG  I N9    1 
ATOM   7258  C  C8    . DG  I 5  58  ? -62.248 -16.525 57.335 1.00 127.55 ? -15  DG  I C8    1 
ATOM   7259  N  N7    . DG  I 5  58  ? -62.956 -15.431 57.417 1.00 120.19 ? -15  DG  I N7    1 
ATOM   7260  C  C5    . DG  I 5  58  ? -62.043 -14.459 57.802 1.00 123.42 ? -15  DG  I C5    1 
ATOM   7261  C  C6    . DG  I 5  58  ? -62.223 -13.072 58.055 1.00 121.39 ? -15  DG  I C6    1 
ATOM   7262  O  O6    . DG  I 5  58  ? -63.261 -12.405 57.986 1.00 121.51 ? -15  DG  I O6    1 
ATOM   7263  N  N1    . DG  I 5  58  ? -61.027 -12.457 58.411 1.00 123.29 ? -15  DG  I N1    1 
ATOM   7264  C  C2    . DG  I 5  58  ? -59.814 -13.093 58.524 1.00 114.51 ? -15  DG  I C2    1 
ATOM   7265  N  N2    . DG  I 5  58  ? -58.774 -12.329 58.886 1.00 110.06 ? -15  DG  I N2    1 
ATOM   7266  N  N3    . DG  I 5  58  ? -59.633 -14.383 58.292 1.00 110.03 ? -15  DG  I N3    1 
ATOM   7267  C  C4    . DG  I 5  58  ? -60.781 -14.999 57.939 1.00 120.67 ? -15  DG  I C4    1 
ATOM   7268  P  P     . DG  I 5  59  ? -56.675 -20.433 57.645 1.00 105.19 ? -14  DG  I P     1 
ATOM   7269  O  OP1   . DG  I 5  59  ? -56.539 -20.593 56.177 1.00 100.88 ? -14  DG  I OP1   1 
ATOM   7270  O  OP2   . DG  I 5  59  ? -56.748 -21.635 58.511 1.00 87.73  ? -14  DG  I OP2   1 
ATOM   7271  O  "O5'" . DG  I 5  59  ? -55.461 -19.509 58.097 1.00 98.63  ? -14  DG  I "O5'" 1 
ATOM   7272  C  "C5'" . DG  I 5  59  ? -54.888 -18.569 57.174 1.00 101.71 ? -14  DG  I "C5'" 1 
ATOM   7273  C  "C4'" . DG  I 5  59  ? -54.269 -17.400 57.907 1.00 107.90 ? -14  DG  I "C4'" 1 
ATOM   7274  O  "O4'" . DG  I 5  59  ? -55.287 -16.603 58.557 1.00 113.19 ? -14  DG  I "O4'" 1 
ATOM   7275  C  "C3'" . DG  I 5  59  ? -53.299 -17.758 59.024 1.00 105.86 ? -14  DG  I "C3'" 1 
ATOM   7276  O  "O3'" . DG  I 5  59  ? -52.509 -16.585 59.224 1.00 101.71 ? -14  DG  I "O3'" 1 
ATOM   7277  C  "C2'" . DG  I 5  59  ? -54.230 -17.927 60.206 1.00 108.41 ? -14  DG  I "C2'" 1 
ATOM   7278  C  "C1'" . DG  I 5  59  ? -55.191 -16.764 59.973 1.00 114.94 ? -14  DG  I "C1'" 1 
ATOM   7279  N  N9    . DG  I 5  59  ? -56.547 -16.919 60.485 1.00 122.76 ? -14  DG  I N9    1 
ATOM   7280  C  C8    . DG  I 5  59  ? -57.322 -18.054 60.492 1.00 128.12 ? -14  DG  I C8    1 
ATOM   7281  N  N7    . DG  I 5  59  ? -58.518 -17.854 60.974 1.00 130.00 ? -14  DG  I N7    1 
ATOM   7282  C  C5    . DG  I 5  59  ? -58.541 -16.501 61.284 1.00 126.61 ? -14  DG  I C5    1 
ATOM   7283  C  C6    . DG  I 5  59  ? -59.578 -15.700 61.828 1.00 127.37 ? -14  DG  I C6    1 
ATOM   7284  O  O6    . DG  I 5  59  ? -60.720 -16.039 62.162 1.00 122.65 ? -14  DG  I O6    1 
ATOM   7285  N  N1    . DG  I 5  59  ? -59.172 -14.377 61.986 1.00 128.17 ? -14  DG  I N1    1 
ATOM   7286  C  C2    . DG  I 5  59  ? -57.931 -13.887 61.654 1.00 123.53 ? -14  DG  I C2    1 
ATOM   7287  N  N2    . DG  I 5  59  ? -57.730 -12.579 61.872 1.00 121.34 ? -14  DG  I N2    1 
ATOM   7288  N  N3    . DG  I 5  59  ? -56.962 -14.622 61.136 1.00 112.82 ? -14  DG  I N3    1 
ATOM   7289  C  C4    . DG  I 5  59  ? -57.333 -15.909 60.981 1.00 116.44 ? -14  DG  I C4    1 
ATOM   7290  P  P     . DC  I 5  60  ? -51.055 -16.674 59.841 1.00 83.45  ? -13  DC  I P     1 
ATOM   7291  O  OP1   . DC  I 5  60  ? -50.105 -16.496 58.709 1.00 77.10  ? -13  DC  I OP1   1 
ATOM   7292  O  OP2   . DC  I 5  60  ? -50.989 -17.872 60.729 1.00 74.48  ? -13  DC  I OP2   1 
ATOM   7293  O  "O5'" . DC  I 5  60  ? -51.019 -15.437 60.848 1.00 82.12  ? -13  DC  I "O5'" 1 
ATOM   7294  C  "C5'" . DC  I 5  60  ? -51.391 -14.098 60.435 1.00 86.26  ? -13  DC  I "C5'" 1 
ATOM   7295  C  "C4'" . DC  I 5  60  ? -51.844 -13.277 61.621 1.00 88.32  ? -13  DC  I "C4'" 1 
ATOM   7296  O  "O4'" . DC  I 5  60  ? -53.168 -13.713 62.029 1.00 93.57  ? -13  DC  I "O4'" 1 
ATOM   7297  C  "C3'" . DC  I 5  60  ? -50.965 -13.386 62.871 1.00 88.13  ? -13  DC  I "C3'" 1 
ATOM   7298  O  "O3'" . DC  I 5  60  ? -50.915 -12.160 63.595 1.00 80.92  ? -13  DC  I "O3'" 1 
ATOM   7299  C  "C2'" . DC  I 5  60  ? -51.719 -14.369 63.744 1.00 97.80  ? -13  DC  I "C2'" 1 
ATOM   7300  C  "C1'" . DC  I 5  60  ? -53.160 -14.005 63.422 1.00 103.14 ? -13  DC  I "C1'" 1 
ATOM   7301  N  N1    . DC  I 5  60  ? -54.154 -15.068 63.672 1.00 108.86 ? -13  DC  I N1    1 
ATOM   7302  C  C2    . DC  I 5  60  ? -55.366 -14.739 64.294 1.00 99.70  ? -13  DC  I C2    1 
ATOM   7303  O  O2    . DC  I 5  60  ? -55.567 -13.563 64.630 1.00 96.20  ? -13  DC  I O2    1 
ATOM   7304  N  N3    . DC  I 5  60  ? -56.279 -15.714 64.519 1.00 97.60  ? -13  DC  I N3    1 
ATOM   7305  C  C4    . DC  I 5  60  ? -56.018 -16.972 64.150 1.00 105.44 ? -13  DC  I C4    1 
ATOM   7306  N  N4    . DC  I 5  60  ? -56.942 -17.905 64.389 1.00 96.35  ? -13  DC  I N4    1 
ATOM   7307  C  C5    . DC  I 5  60  ? -54.794 -17.331 63.515 1.00 114.26 ? -13  DC  I C5    1 
ATOM   7308  C  C6    . DC  I 5  60  ? -53.900 -16.357 63.297 1.00 111.98 ? -13  DC  I C6    1 
ATOM   7309  P  P     . DA  I 5  61  ? -49.604 -11.285 63.588 1.00 82.83  ? -12  DA  I P     1 
ATOM   7310  O  OP1   . DA  I 5  61  ? -49.486 -10.679 62.242 1.00 82.63  ? -12  DA  I OP1   1 
ATOM   7311  O  OP2   . DA  I 5  61  ? -48.504 -12.098 64.160 1.00 81.45  ? -12  DA  I OP2   1 
ATOM   7312  O  "O5'" . DA  I 5  61  ? -49.911 -10.134 64.645 1.00 89.51  ? -12  DA  I "O5'" 1 
ATOM   7313  C  "C5'" . DA  I 5  61  ? -50.875 -9.084  64.378 1.00 90.99  ? -12  DA  I "C5'" 1 
ATOM   7314  C  "C4'" . DA  I 5  61  ? -51.687 -8.788  65.619 1.00 82.63  ? -12  DA  I "C4'" 1 
ATOM   7315  O  "O4'" . DA  I 5  61  ? -52.588 -9.889  65.882 1.00 85.18  ? -12  DA  I "O4'" 1 
ATOM   7316  C  "C3'" . DA  I 5  61  ? -50.868 -8.588  66.898 1.00 81.06  ? -12  DA  I "C3'" 1 
ATOM   7317  O  "O3'" . DA  I 5  61  ? -51.355 -7.427  67.563 1.00 85.32  ? -12  DA  I "O3'" 1 
ATOM   7318  C  "C2'" . DA  I 5  61  ? -51.095 -9.863  67.693 1.00 78.07  ? -12  DA  I "C2'" 1 
ATOM   7319  C  "C1'" . DA  I 5  61  ? -52.472 -10.301 67.232 1.00 85.96  ? -12  DA  I "C1'" 1 
ATOM   7320  N  N9    . DA  I 5  61  ? -52.716 -11.737 67.274 1.00 93.74  ? -12  DA  I N9    1 
ATOM   7321  C  C8    . DA  I 5  61  ? -51.844 -12.760 67.000 1.00 101.85 ? -12  DA  I C8    1 
ATOM   7322  N  N7    . DA  I 5  61  ? -52.374 -13.952 67.121 1.00 104.28 ? -12  DA  I N7    1 
ATOM   7323  C  C5    . DA  I 5  61  ? -53.687 -13.697 67.485 1.00 118.30 ? -12  DA  I C5    1 
ATOM   7324  C  C6    . DA  I 5  61  ? -54.769 -14.544 67.766 1.00 129.74 ? -12  DA  I C6    1 
ATOM   7325  N  N6    . DA  I 5  61  ? -54.694 -15.875 67.712 1.00 135.16 ? -12  DA  I N6    1 
ATOM   7326  N  N1    . DA  I 5  61  ? -55.945 -13.971 68.105 1.00 134.57 ? -12  DA  I N1    1 
ATOM   7327  C  C2    . DA  I 5  61  ? -56.016 -12.634 68.154 1.00 132.46 ? -12  DA  I C2    1 
ATOM   7328  N  N3    . DA  I 5  61  ? -55.066 -11.732 67.916 1.00 129.11 ? -12  DA  I N3    1 
ATOM   7329  C  C4    . DA  I 5  61  ? -53.912 -12.337 67.581 1.00 116.37 ? -12  DA  I C4    1 
ATOM   7330  P  P     . DT  I 5  62  ? -50.550 -6.779  68.775 1.00 101.78 ? -11  DT  I P     1 
ATOM   7331  O  OP1   . DT  I 5  62  ? -50.828 -5.320  68.752 1.00 97.62  ? -11  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I 5  62  ? -49.139 -7.237  68.713 1.00 97.55  ? -11  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I 5  62  ? -51.262 -7.451  70.034 1.00 99.26  ? -11  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I 5  62  ? -52.597 -7.052  70.390 1.00 101.36 ? -11  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I 5  62  ? -53.238 -8.030  71.347 1.00 100.51 ? -11  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I 5  62  ? -53.475 -9.299  70.707 1.00 103.99 ? -11  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I 5  62  ? -52.436 -8.379  72.593 1.00 96.00  ? -11  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I 5  62  ? -52.630 -7.409  73.628 1.00 104.55 ? -11  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I 5  62  ? -53.033 -9.717  72.999 1.00 106.44 ? -11  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I 5  62  ? -53.681 -10.267 71.726 1.00 103.86 ? -11  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I 5  62  ? -53.102 -11.542 71.274 1.00 108.55 ? -11  DT  I N1    1 
ATOM   7342  C  C2    . DT  I 5  62  ? -53.947 -12.600 71.030 1.00 112.21 ? -11  DT  I C2    1 
ATOM   7343  O  O2    . DT  I 5  62  ? -55.157 -12.526 71.143 1.00 114.90 ? -11  DT  I O2    1 
ATOM   7344  N  N3    . DT  I 5  62  ? -53.320 -13.755 70.634 1.00 118.03 ? -11  DT  I N3    1 
ATOM   7345  C  C4    . DT  I 5  62  ? -51.962 -13.954 70.473 1.00 114.45 ? -11  DT  I C4    1 
ATOM   7346  O  O4    . DT  I 5  62  ? -51.544 -15.047 70.109 1.00 107.79 ? -11  DT  I O4    1 
ATOM   7347  C  C5    . DT  I 5  62  ? -51.133 -12.804 70.755 1.00 115.40 ? -11  DT  I C5    1 
ATOM   7348  C  C7    . DT  I 5  62  ? -49.650 -12.923 70.604 1.00 113.17 ? -11  DT  I C7    1 
ATOM   7349  C  C6    . DT  I 5  62  ? -51.737 -11.672 71.138 1.00 114.76 ? -11  DT  I C6    1 
ATOM   7350  P  P     . DG  I 5  63  ? -51.712 -7.441  74.950 1.00 125.74 ? -10  DG  I P     1 
ATOM   7351  O  OP1   . DG  I 5  63  ? -50.867 -6.223  74.947 1.00 121.43 ? -10  DG  I OP1   1 
ATOM   7352  O  OP2   . DG  I 5  63  ? -51.070 -8.770  75.046 1.00 128.04 ? -10  DG  I OP2   1 
ATOM   7353  O  "O5'" . DG  I 5  63  ? -52.752 -7.345  76.157 1.00 130.45 ? -10  DG  I "O5'" 1 
ATOM   7354  C  "C5'" . DG  I 5  63  ? -53.812 -8.310  76.347 1.00 131.40 ? -10  DG  I "C5'" 1 
ATOM   7355  C  "C4'" . DG  I 5  63  ? -53.546 -9.234  77.517 1.00 137.33 ? -10  DG  I "C4'" 1 
ATOM   7356  O  "O4'" . DG  I 5  63  ? -53.372 -10.582 77.013 1.00 138.18 ? -10  DG  I "O4'" 1 
ATOM   7357  C  "C3'" . DG  I 5  63  ? -52.319 -8.923  78.388 1.00 135.71 ? -10  DG  I "C3'" 1 
ATOM   7358  O  "O3'" . DG  I 5  63  ? -52.677 -8.738  79.779 1.00 130.18 ? -10  DG  I "O3'" 1 
ATOM   7359  C  "C2'" . DG  I 5  63  ? -51.322 -10.014 78.022 1.00 140.65 ? -10  DG  I "C2'" 1 
ATOM   7360  C  "C1'" . DG  I 5  63  ? -52.193 -11.168 77.539 1.00 137.65 ? -10  DG  I "C1'" 1 
ATOM   7361  N  N9    . DG  I 5  63  ? -51.613 -12.021 76.503 1.00 131.11 ? -10  DG  I N9    1 
ATOM   7362  C  C8    . DG  I 5  63  ? -50.536 -11.738 75.696 1.00 118.56 ? -10  DG  I C8    1 
ATOM   7363  N  N7    . DG  I 5  63  ? -50.253 -12.701 74.863 1.00 116.37 ? -10  DG  I N7    1 
ATOM   7364  C  C5    . DG  I 5  63  ? -51.195 -13.682 75.137 1.00 132.12 ? -10  DG  I C5    1 
ATOM   7365  C  C6    . DG  I 5  63  ? -51.386 -14.962 74.553 1.00 138.14 ? -10  DG  I C6    1 
ATOM   7366  O  O6    . DG  I 5  63  ? -50.742 -15.498 73.643 1.00 126.75 ? -10  DG  I O6    1 
ATOM   7367  N  N1    . DG  I 5  63  ? -52.459 -15.633 75.132 1.00 141.66 ? -10  DG  I N1    1 
ATOM   7368  C  C2    . DG  I 5  63  ? -53.254 -15.135 76.135 1.00 134.43 ? -10  DG  I C2    1 
ATOM   7369  N  N2    . DG  I 5  63  ? -54.250 -15.930 76.552 1.00 135.56 ? -10  DG  I N2    1 
ATOM   7370  N  N3    . DG  I 5  63  ? -53.087 -13.943 76.686 1.00 131.87 ? -10  DG  I N3    1 
ATOM   7371  C  C4    . DG  I 5  63  ? -52.044 -13.278 76.146 1.00 132.65 ? -10  DG  I C4    1 
ATOM   7372  P  P     . DT  I 5  64  ? -52.580 -9.933  80.901 1.00 142.68 ? -9   DT  I P     1 
ATOM   7373  O  OP1   . DT  I 5  64  ? -53.268 -9.452  82.123 1.00 151.62 ? -9   DT  I OP1   1 
ATOM   7374  O  OP2   . DT  I 5  64  ? -51.164 -10.377 81.007 1.00 124.87 ? -9   DT  I OP2   1 
ATOM   7375  O  "O5'" . DT  I 5  64  ? -53.469 -11.120 80.309 1.00 134.06 ? -9   DT  I "O5'" 1 
ATOM   7376  C  "C5'" . DT  I 5  64  ? -54.454 -11.816 81.108 1.00 131.95 ? -9   DT  I "C5'" 1 
ATOM   7377  C  "C4'" . DT  I 5  64  ? -54.061 -13.257 81.355 1.00 141.19 ? -9   DT  I "C4'" 1 
ATOM   7378  O  "O4'" . DT  I 5  64  ? -53.285 -13.786 80.249 1.00 150.81 ? -9   DT  I "O4'" 1 
ATOM   7379  C  "C3'" . DT  I 5  64  ? -53.231 -13.514 82.622 1.00 147.96 ? -9   DT  I "C3'" 1 
ATOM   7380  O  "O3'" . DT  I 5  64  ? -53.851 -14.522 83.435 1.00 148.93 ? -9   DT  I "O3'" 1 
ATOM   7381  C  "C2'" . DT  I 5  64  ? -51.882 -13.969 82.088 1.00 154.30 ? -9   DT  I "C2'" 1 
ATOM   7382  C  "C1'" . DT  I 5  64  ? -52.275 -14.628 80.780 1.00 155.42 ? -9   DT  I "C1'" 1 
ATOM   7383  N  N1    . DT  I 5  64  ? -51.187 -14.751 79.777 1.00 147.10 ? -9   DT  I N1    1 
ATOM   7384  C  C2    . DT  I 5  64  ? -50.976 -15.974 79.178 1.00 135.86 ? -9   DT  I C2    1 
ATOM   7385  O  O2    . DT  I 5  64  ? -51.650 -16.963 79.420 1.00 132.33 ? -9   DT  I O2    1 
ATOM   7386  N  N3    . DT  I 5  64  ? -49.942 -15.997 78.274 1.00 130.64 ? -9   DT  I N3    1 
ATOM   7387  C  C4    . DT  I 5  64  ? -49.113 -14.947 77.926 1.00 130.17 ? -9   DT  I C4    1 
ATOM   7388  O  O4    . DT  I 5  64  ? -48.227 -15.118 77.094 1.00 127.26 ? -9   DT  I O4    1 
ATOM   7389  C  C5    . DT  I 5  64  ? -49.385 -13.699 78.598 1.00 128.16 ? -9   DT  I C5    1 
ATOM   7390  C  C7    . DT  I 5  64  ? -48.535 -12.507 78.287 1.00 122.47 ? -9   DT  I C7    1 
ATOM   7391  C  C6    . DT  I 5  64  ? -50.390 -13.664 79.482 1.00 141.10 ? -9   DT  I C6    1 
ATOM   7392  P  P     . DT  I 5  65  ? -53.080 -15.150 84.706 1.00 151.75 ? -8   DT  I P     1 
ATOM   7393  O  OP1   . DT  I 5  65  ? -54.094 -15.586 85.704 1.00 142.26 ? -8   DT  I OP1   1 
ATOM   7394  O  OP2   . DT  I 5  65  ? -51.971 -14.231 85.097 1.00 140.37 ? -8   DT  I OP2   1 
ATOM   7395  O  "O5'" . DT  I 5  65  ? -52.424 -16.468 84.112 1.00 144.40 ? -8   DT  I "O5'" 1 
ATOM   7396  C  "C5'" . DT  I 5  65  ? -53.225 -17.596 83.734 1.00 143.28 ? -8   DT  I "C5'" 1 
ATOM   7397  C  "C4'" . DT  I 5  65  ? -52.311 -18.785 83.576 1.00 144.87 ? -8   DT  I "C4'" 1 
ATOM   7398  O  "O4'" . DT  I 5  65  ? -51.396 -18.528 82.480 1.00 149.24 ? -8   DT  I "O4'" 1 
ATOM   7399  C  "C3'" . DT  I 5  65  ? -51.445 -19.033 84.815 1.00 143.77 ? -8   DT  I "C3'" 1 
ATOM   7400  O  "O3'" . DT  I 5  65  ? -51.440 -20.412 85.201 1.00 128.71 ? -8   DT  I "O3'" 1 
ATOM   7401  C  "C2'" . DT  I 5  65  ? -50.070 -18.529 84.406 1.00 150.40 ? -8   DT  I "C2'" 1 
ATOM   7402  C  "C1'" . DT  I 5  65  ? -50.066 -18.777 82.908 1.00 151.78 ? -8   DT  I "C1'" 1 
ATOM   7403  N  N1    . DT  I 5  65  ? -49.148 -17.928 82.105 1.00 139.96 ? -8   DT  I N1    1 
ATOM   7404  C  C2    . DT  I 5  65  ? -48.631 -18.460 80.945 1.00 125.47 ? -8   DT  I C2    1 
ATOM   7405  O  O2    . DT  I 5  65  ? -48.905 -19.580 80.544 1.00 120.75 ? -8   DT  I O2    1 
ATOM   7406  N  N3    . DT  I 5  65  ? -47.778 -17.627 80.264 1.00 112.79 ? -8   DT  I N3    1 
ATOM   7407  C  C4    . DT  I 5  65  ? -47.397 -16.348 80.622 1.00 122.05 ? -8   DT  I C4    1 
ATOM   7408  O  O4    . DT  I 5  65  ? -46.623 -15.718 79.906 1.00 116.83 ? -8   DT  I O4    1 
ATOM   7409  C  C5    . DT  I 5  65  ? -47.972 -15.855 81.852 1.00 134.57 ? -8   DT  I C5    1 
ATOM   7410  C  C7    . DT  I 5  65  ? -47.618 -14.478 82.318 1.00 141.87 ? -8   DT  I C7    1 
ATOM   7411  C  C6    . DT  I 5  65  ? -48.804 -16.660 82.525 1.00 137.80 ? -8   DT  I C6    1 
ATOM   7412  P  P     . DC  I 5  66  ? -50.649 -20.851 86.514 1.00 116.94 ? -7   DC  I P     1 
ATOM   7413  O  OP1   . DC  I 5  66  ? -51.470 -21.848 87.250 1.00 120.68 ? -7   DC  I OP1   1 
ATOM   7414  O  OP2   . DC  I 5  66  ? -50.170 -19.611 87.187 1.00 108.19 ? -7   DC  I OP2   1 
ATOM   7415  O  "O5'" . DC  I 5  66  ? -49.377 -21.624 85.948 1.00 128.12 ? -7   DC  I "O5'" 1 
ATOM   7416  C  "C5'" . DC  I 5  66  ? -49.459 -22.600 84.886 1.00 122.64 ? -7   DC  I "C5'" 1 
ATOM   7417  C  "C4'" . DC  I 5  66  ? -48.061 -22.974 84.450 1.00 114.19 ? -7   DC  I "C4'" 1 
ATOM   7418  O  "O4'" . DC  I 5  66  ? -47.457 -21.853 83.750 1.00 109.90 ? -7   DC  I "O4'" 1 
ATOM   7419  C  "C3'" . DC  I 5  66  ? -47.115 -23.301 85.612 1.00 104.28 ? -7   DC  I "C3'" 1 
ATOM   7420  O  "O3'" . DC  I 5  66  ? -46.207 -24.352 85.291 1.00 93.90  ? -7   DC  I "O3'" 1 
ATOM   7421  C  "C2'" . DC  I 5  66  ? -46.314 -22.025 85.779 1.00 109.51 ? -7   DC  I "C2'" 1 
ATOM   7422  C  "C1'" . DC  I 5  66  ? -46.187 -21.583 84.333 1.00 112.91 ? -7   DC  I "C1'" 1 
ATOM   7423  N  N1    . DC  I 5  66  ? -45.857 -20.162 84.100 1.00 117.96 ? -7   DC  I N1    1 
ATOM   7424  C  C2    . DC  I 5  66  ? -45.463 -19.775 82.816 1.00 117.97 ? -7   DC  I C2    1 
ATOM   7425  O  O2    . DC  I 5  66  ? -45.420 -20.630 81.921 1.00 103.31 ? -7   DC  I O2    1 
ATOM   7426  N  N3    . DC  I 5  66  ? -45.152 -18.478 82.582 1.00 123.77 ? -7   DC  I N3    1 
ATOM   7427  C  C4    . DC  I 5  66  ? -45.208 -17.588 83.577 1.00 120.58 ? -7   DC  I C4    1 
ATOM   7428  N  N4    . DC  I 5  66  ? -44.888 -16.322 83.304 1.00 120.25 ? -7   DC  I N4    1 
ATOM   7429  C  C5    . DC  I 5  66  ? -45.591 -17.959 84.898 1.00 115.29 ? -7   DC  I C5    1 
ATOM   7430  C  C6    . DC  I 5  66  ? -45.899 -19.245 85.115 1.00 119.61 ? -7   DC  I C6    1 
ATOM   7431  P  P     . DA  I 5  67  ? -46.548 -25.844 85.706 1.00 100.65 ? -6   DA  I P     1 
ATOM   7432  O  OP1   . DA  I 5  67  ? -48.010 -26.027 85.516 1.00 97.96  ? -6   DA  I OP1   1 
ATOM   7433  O  OP2   . DA  I 5  67  ? -45.900 -26.111 87.018 1.00 95.40  ? -6   DA  I OP2   1 
ATOM   7434  O  "O5'" . DA  I 5  67  ? -45.789 -26.734 84.620 1.00 94.68  ? -6   DA  I "O5'" 1 
ATOM   7435  C  "C5'" . DA  I 5  67  ? -46.286 -26.852 83.269 1.00 93.12  ? -6   DA  I "C5'" 1 
ATOM   7436  C  "C4'" . DA  I 5  67  ? -45.157 -26.936 82.266 1.00 86.61  ? -6   DA  I "C4'" 1 
ATOM   7437  O  "O4'" . DA  I 5  67  ? -44.490 -25.661 82.126 1.00 84.60  ? -6   DA  I "O4'" 1 
ATOM   7438  C  "C3'" . DA  I 5  67  ? -44.057 -27.944 82.589 1.00 83.04  ? -6   DA  I "C3'" 1 
ATOM   7439  O  "O3'" . DA  I 5  67  ? -43.636 -28.543 81.367 1.00 78.02  ? -6   DA  I "O3'" 1 
ATOM   7440  C  "C2'" . DA  I 5  67  ? -42.976 -27.100 83.242 1.00 81.90  ? -6   DA  I "C2'" 1 
ATOM   7441  C  "C1'" . DA  I 5  67  ? -43.135 -25.748 82.561 1.00 84.48  ? -6   DA  I "C1'" 1 
ATOM   7442  N  N9    . DA  I 5  67  ? -42.867 -24.573 83.386 1.00 83.04  ? -6   DA  I N9    1 
ATOM   7443  C  C8    . DA  I 5  67  ? -42.999 -24.408 84.742 1.00 93.24  ? -6   DA  I C8    1 
ATOM   7444  N  N7    . DA  I 5  67  ? -42.727 -23.193 85.155 1.00 88.06  ? -6   DA  I N7    1 
ATOM   7445  C  C5    . DA  I 5  67  ? -42.415 -22.509 83.991 1.00 79.94  ? -6   DA  I C5    1 
ATOM   7446  C  C6    . DA  I 5  67  ? -42.035 -21.181 83.751 1.00 90.79  ? -6   DA  I C6    1 
ATOM   7447  N  N6    . DA  I 5  67  ? -41.905 -20.267 84.712 1.00 98.53  ? -6   DA  I N6    1 
ATOM   7448  N  N1    . DA  I 5  67  ? -41.784 -20.819 82.473 1.00 100.71 ? -6   DA  I N1    1 
ATOM   7449  C  C2    . DA  I 5  67  ? -41.908 -21.741 81.510 1.00 100.76 ? -6   DA  I C2    1 
ATOM   7450  N  N3    . DA  I 5  67  ? -42.254 -23.023 81.612 1.00 98.63  ? -6   DA  I N3    1 
ATOM   7451  C  C4    . DA  I 5  67  ? -42.498 -23.346 82.894 1.00 87.36  ? -6   DA  I C4    1 
ATOM   7452  P  P     . DG  I 5  68  ? -42.630 -29.784 81.383 1.00 90.78  ? -5   DG  I P     1 
ATOM   7453  O  OP1   . DG  I 5  68  ? -43.190 -30.845 80.523 1.00 88.01  ? -5   DG  I OP1   1 
ATOM   7454  O  OP2   . DG  I 5  68  ? -42.279 -30.108 82.789 1.00 90.16  ? -5   DG  I OP2   1 
ATOM   7455  O  "O5'" . DG  I 5  68  ? -41.320 -29.189 80.693 1.00 89.71  ? -5   DG  I "O5'" 1 
ATOM   7456  C  "C5'" . DG  I 5  68  ? -41.317 -27.942 79.966 1.00 85.36  ? -5   DG  I "C5'" 1 
ATOM   7457  C  "C4'" . DG  I 5  68  ? -39.937 -27.325 79.994 1.00 84.26  ? -5   DG  I "C4'" 1 
ATOM   7458  O  "O4'" . DG  I 5  68  ? -39.938 -26.157 80.856 1.00 80.46  ? -5   DG  I "O4'" 1 
ATOM   7459  C  "C3'" . DG  I 5  68  ? -38.848 -28.243 80.558 1.00 90.71  ? -5   DG  I "C3'" 1 
ATOM   7460  O  "O3'" . DG  I 5  68  ? -37.541 -27.919 80.074 1.00 95.67  ? -5   DG  I "O3'" 1 
ATOM   7461  C  "C2'" . DG  I 5  68  ? -38.808 -27.841 82.014 1.00 86.00  ? -5   DG  I "C2'" 1 
ATOM   7462  C  "C1'" . DG  I 5  68  ? -38.922 -26.347 81.831 1.00 86.22  ? -5   DG  I "C1'" 1 
ATOM   7463  N  N9    . DG  I 5  68  ? -39.245 -25.569 83.021 1.00 88.75  ? -5   DG  I N9    1 
ATOM   7464  C  C8    . DG  I 5  68  ? -39.690 -26.029 84.238 1.00 91.78  ? -5   DG  I C8    1 
ATOM   7465  N  N7    . DG  I 5  68  ? -39.798 -25.084 85.132 1.00 92.26  ? -5   DG  I N7    1 
ATOM   7466  C  C5    . DG  I 5  68  ? -39.363 -23.940 84.476 1.00 89.29  ? -5   DG  I C5    1 
ATOM   7467  C  C6    . DG  I 5  68  ? -39.254 -22.603 84.933 1.00 90.35  ? -5   DG  I C6    1 
ATOM   7468  O  O6    . DG  I 5  68  ? -39.528 -22.146 86.047 1.00 97.53  ? -5   DG  I O6    1 
ATOM   7469  N  N1    . DG  I 5  68  ? -38.769 -21.759 83.938 1.00 93.06  ? -5   DG  I N1    1 
ATOM   7470  C  C2    . DG  I 5  68  ? -38.432 -22.153 82.665 1.00 94.43  ? -5   DG  I C2    1 
ATOM   7471  N  N2    . DG  I 5  68  ? -37.981 -21.194 81.846 1.00 99.31  ? -5   DG  I N2    1 
ATOM   7472  N  N3    . DG  I 5  68  ? -38.529 -23.396 82.228 1.00 86.98  ? -5   DG  I N3    1 
ATOM   7473  C  C4    . DG  I 5  68  ? -39.004 -24.229 83.177 1.00 87.24  ? -5   DG  I C4    1 
ATOM   7474  P  P     . DC  I 5  69  ? -36.927 -28.660 78.803 1.00 85.69  ? -4   DC  I P     1 
ATOM   7475  O  OP1   . DC  I 5  69  ? -38.021 -28.854 77.806 1.00 72.89  ? -4   DC  I OP1   1 
ATOM   7476  O  OP2   . DC  I 5  69  ? -36.153 -29.835 79.289 1.00 71.13  ? -4   DC  I OP2   1 
ATOM   7477  O  "O5'" . DC  I 5  69  ? -35.974 -27.525 78.235 1.00 75.24  ? -4   DC  I "O5'" 1 
ATOM   7478  C  "C5'" . DC  I 5  69  ? -36.565 -26.459 77.497 1.00 76.36  ? -4   DC  I "C5'" 1 
ATOM   7479  C  "C4'" . DC  I 5  69  ? -35.782 -25.194 77.732 1.00 78.62  ? -4   DC  I "C4'" 1 
ATOM   7480  O  "O4'" . DC  I 5  69  ? -36.094 -24.653 79.034 1.00 75.53  ? -4   DC  I "O4'" 1 
ATOM   7481  C  "C3'" . DC  I 5  69  ? -34.271 -25.391 77.679 1.00 76.58  ? -4   DC  I "C3'" 1 
ATOM   7482  O  "O3'" . DC  I 5  69  ? -33.752 -24.464 76.729 1.00 69.76  ? -4   DC  I "O3'" 1 
ATOM   7483  C  "C2'" . DC  I 5  69  ? -33.805 -25.094 79.091 1.00 80.48  ? -4   DC  I "C2'" 1 
ATOM   7484  C  "C1'" . DC  I 5  69  ? -34.917 -24.255 79.691 1.00 79.69  ? -4   DC  I "C1'" 1 
ATOM   7485  N  N1    . DC  I 5  69  ? -35.089 -24.535 81.121 1.00 91.45  ? -4   DC  I N1    1 
ATOM   7486  C  C2    . DC  I 5  69  ? -34.965 -23.494 82.045 1.00 90.72  ? -4   DC  I C2    1 
ATOM   7487  O  O2    . DC  I 5  69  ? -34.750 -22.346 81.630 1.00 93.31  ? -4   DC  I O2    1 
ATOM   7488  N  N3    . DC  I 5  69  ? -35.091 -23.764 83.363 1.00 90.11  ? -4   DC  I N3    1 
ATOM   7489  C  C4    . DC  I 5  69  ? -35.319 -25.016 83.768 1.00 97.95  ? -4   DC  I C4    1 
ATOM   7490  N  N4    . DC  I 5  69  ? -35.445 -25.241 85.078 1.00 101.87 ? -4   DC  I N4    1 
ATOM   7491  C  C5    . DC  I 5  69  ? -35.425 -26.098 82.848 1.00 93.32  ? -4   DC  I C5    1 
ATOM   7492  C  C6    . DC  I 5  69  ? -35.301 -25.816 81.548 1.00 88.93  ? -4   DC  I C6    1 
ATOM   7493  P  P     . DT  I 5  70  ? -32.219 -24.464 76.366 1.00 63.05  ? -3   DT  I P     1 
ATOM   7494  O  OP1   . DT  I 5  70  ? -32.140 -24.278 74.891 1.00 60.54  ? -3   DT  I OP1   1 
ATOM   7495  O  OP2   . DT  I 5  70  ? -31.541 -25.624 77.022 1.00 50.03  ? -3   DT  I OP2   1 
ATOM   7496  O  "O5'" . DT  I 5  70  ? -31.681 -23.197 77.157 1.00 59.61  ? -3   DT  I "O5'" 1 
ATOM   7497  C  "C5'" . DT  I 5  70  ? -32.229 -21.897 76.902 1.00 64.11  ? -3   DT  I "C5'" 1 
ATOM   7498  C  "C4'" . DT  I 5  70  ? -31.656 -20.911 77.892 1.00 68.57  ? -3   DT  I "C4'" 1 
ATOM   7499  O  "O4'" . DT  I 5  70  ? -31.972 -21.343 79.233 1.00 80.40  ? -3   DT  I "O4'" 1 
ATOM   7500  C  "C3'" . DT  I 5  70  ? -30.135 -20.795 77.847 1.00 74.21  ? -3   DT  I "C3'" 1 
ATOM   7501  O  "O3'" . DT  I 5  70  ? -29.808 -19.429 78.036 1.00 75.27  ? -3   DT  I "O3'" 1 
ATOM   7502  C  "C2'" . DT  I 5  70  ? -29.669 -21.656 79.006 1.00 73.22  ? -3   DT  I "C2'" 1 
ATOM   7503  C  "C1'" . DT  I 5  70  ? -30.787 -21.424 80.004 1.00 78.96  ? -3   DT  I "C1'" 1 
ATOM   7504  N  N1    . DT  I 5  70  ? -30.992 -22.460 81.034 1.00 81.99  ? -3   DT  I N1    1 
ATOM   7505  C  C2    . DT  I 5  70  ? -31.301 -22.039 82.307 1.00 81.17  ? -3   DT  I C2    1 
ATOM   7506  O  O2    . DT  I 5  70  ? -31.385 -20.861 82.616 1.00 80.65  ? -3   DT  I O2    1 
ATOM   7507  N  N3    . DT  I 5  70  ? -31.500 -23.052 83.213 1.00 79.22  ? -3   DT  I N3    1 
ATOM   7508  C  C4    . DT  I 5  70  ? -31.427 -24.411 82.973 1.00 80.51  ? -3   DT  I C4    1 
ATOM   7509  O  O4    . DT  I 5  70  ? -31.621 -25.203 83.886 1.00 81.05  ? -3   DT  I O4    1 
ATOM   7510  C  C5    . DT  I 5  70  ? -31.100 -24.781 81.616 1.00 88.99  ? -3   DT  I C5    1 
ATOM   7511  C  C7    . DT  I 5  70  ? -30.994 -26.232 81.265 1.00 90.40  ? -3   DT  I C7    1 
ATOM   7512  C  C6    . DT  I 5  70  ? -30.912 -23.800 80.723 1.00 85.84  ? -3   DT  I C6    1 
ATOM   7513  P  P     . DG  I 5  71  ? -28.347 -18.938 77.746 1.00 74.20  ? -2   DG  I P     1 
ATOM   7514  O  OP1   . DG  I 5  71  ? -28.445 -17.602 77.100 1.00 67.65  ? -2   DG  I OP1   1 
ATOM   7515  O  OP2   . DG  I 5  71  ? -27.584 -20.064 77.188 1.00 67.25  ? -2   DG  I OP2   1 
ATOM   7516  O  "O5'" . DG  I 5  71  ? -27.718 -18.756 79.190 1.00 79.14  ? -2   DG  I "O5'" 1 
ATOM   7517  C  "C5'" . DG  I 5  71  ? -28.207 -17.732 80.067 1.00 82.20  ? -2   DG  I "C5'" 1 
ATOM   7518  C  "C4'" . DG  I 5  71  ? -27.650 -17.977 81.446 1.00 77.69  ? -2   DG  I "C4'" 1 
ATOM   7519  O  "O4'" . DG  I 5  71  ? -28.086 -19.275 81.907 1.00 78.45  ? -2   DG  I "O4'" 1 
ATOM   7520  C  "C3'" . DG  I 5  71  ? -26.121 -18.007 81.489 1.00 81.05  ? -2   DG  I "C3'" 1 
ATOM   7521  O  "O3'" . DG  I 5  71  ? -25.741 -17.222 82.608 1.00 89.88  ? -2   DG  I "O3'" 1 
ATOM   7522  C  "C2'" . DG  I 5  71  ? -25.787 -19.477 81.676 1.00 76.79  ? -2   DG  I "C2'" 1 
ATOM   7523  C  "C1'" . DG  I 5  71  ? -26.978 -19.934 82.487 1.00 81.07  ? -2   DG  I "C1'" 1 
ATOM   7524  N  N9    . DG  I 5  71  ? -27.259 -21.365 82.498 1.00 80.23  ? -2   DG  I N9    1 
ATOM   7525  C  C8    . DG  I 5  71  ? -27.071 -22.266 81.479 1.00 84.91  ? -2   DG  I C8    1 
ATOM   7526  N  N7    . DG  I 5  71  ? -27.424 -23.480 81.799 1.00 83.14  ? -2   DG  I N7    1 
ATOM   7527  C  C5    . DG  I 5  71  ? -27.852 -23.377 83.113 1.00 89.73  ? -2   DG  I C5    1 
ATOM   7528  C  C6    . DG  I 5  71  ? -28.346 -24.367 83.993 1.00 94.70  ? -2   DG  I C6    1 
ATOM   7529  O  O6    . DG  I 5  71  ? -28.510 -25.573 83.779 1.00 102.33 ? -2   DG  I O6    1 
ATOM   7530  N  N1    . DG  I 5  71  ? -28.672 -23.830 85.234 1.00 95.62  ? -2   DG  I N1    1 
ATOM   7531  C  C2    . DG  I 5  71  ? -28.532 -22.510 85.583 1.00 96.42  ? -2   DG  I C2    1 
ATOM   7532  N  N2    . DG  I 5  71  ? -28.899 -22.182 86.829 1.00 103.41 ? -2   DG  I N2    1 
ATOM   7533  N  N3    . DG  I 5  71  ? -28.082 -21.575 84.765 1.00 93.60  ? -2   DG  I N3    1 
ATOM   7534  C  C4    . DG  I 5  71  ? -27.764 -22.076 83.555 1.00 86.40  ? -2   DG  I C4    1 
ATOM   7535  P  P     . DA  I 5  72  ? -24.349 -16.483 82.641 1.00 88.68  ? -1   DA  I P     1 
ATOM   7536  O  OP1   . DA  I 5  72  ? -24.538 -15.146 82.031 1.00 83.59  ? -1   DA  I OP1   1 
ATOM   7537  O  OP2   . DA  I 5  72  ? -23.311 -17.419 82.154 1.00 81.39  ? -1   DA  I OP2   1 
ATOM   7538  O  "O5'" . DA  I 5  72  ? -24.096 -16.308 84.204 1.00 94.91  ? -1   DA  I "O5'" 1 
ATOM   7539  C  "C5'" . DA  I 5  72  ? -25.185 -15.993 85.097 1.00 95.61  ? -1   DA  I "C5'" 1 
ATOM   7540  C  "C4'" . DA  I 5  72  ? -24.992 -16.654 86.443 1.00 97.67  ? -1   DA  I "C4'" 1 
ATOM   7541  O  "O4'" . DA  I 5  72  ? -25.453 -18.026 86.408 1.00 92.89  ? -1   DA  I "O4'" 1 
ATOM   7542  C  "C3'" . DA  I 5  72  ? -23.554 -16.701 86.963 1.00 96.00  ? -1   DA  I "C3'" 1 
ATOM   7543  O  "O3'" . DA  I 5  72  ? -23.557 -16.320 88.344 1.00 106.66 ? -1   DA  I "O3'" 1 
ATOM   7544  C  "C2'" . DA  I 5  72  ? -23.152 -18.152 86.778 1.00 89.74  ? -1   DA  I "C2'" 1 
ATOM   7545  C  "C1'" . DA  I 5  72  ? -24.467 -18.884 86.949 1.00 86.15  ? -1   DA  I "C1'" 1 
ATOM   7546  N  N9    . DA  I 5  72  ? -24.548 -20.151 86.231 1.00 87.91  ? -1   DA  I N9    1 
ATOM   7547  C  C8    . DA  I 5  72  ? -24.260 -20.379 84.909 1.00 87.64  ? -1   DA  I C8    1 
ATOM   7548  N  N7    . DA  I 5  72  ? -24.449 -21.620 84.535 1.00 85.59  ? -1   DA  I N7    1 
ATOM   7549  C  C5    . DA  I 5  72  ? -24.899 -22.251 85.684 1.00 85.97  ? -1   DA  I C5    1 
ATOM   7550  C  C6    . DA  I 5  72  ? -25.278 -23.576 85.948 1.00 84.05  ? -1   DA  I C6    1 
ATOM   7551  N  N6    . DA  I 5  72  ? -25.259 -24.544 85.033 1.00 85.73  ? -1   DA  I N6    1 
ATOM   7552  N  N1    . DA  I 5  72  ? -25.683 -23.878 87.199 1.00 88.23  ? -1   DA  I N1    1 
ATOM   7553  C  C2    . DA  I 5  72  ? -25.699 -22.905 88.119 1.00 97.32  ? -1   DA  I C2    1 
ATOM   7554  N  N3    . DA  I 5  72  ? -25.367 -21.621 87.993 1.00 96.92  ? -1   DA  I N3    1 
ATOM   7555  C  C4    . DA  I 5  72  ? -24.970 -21.356 86.736 1.00 92.07  ? -1   DA  I C4    1 
ATOM   7556  P  P     . DA  I 5  73  ? -22.187 -16.032 89.115 1.00 106.62 ? 0    DA  I P     1 
ATOM   7557  O  OP1   . DA  I 5  73  ? -22.359 -14.779 89.895 1.00 95.89  ? 0    DA  I OP1   1 
ATOM   7558  O  OP2   . DA  I 5  73  ? -21.073 -16.144 88.135 1.00 105.60 ? 0    DA  I OP2   1 
ATOM   7559  O  "O5'" . DA  I 5  73  ? -22.082 -17.265 90.117 1.00 92.17  ? 0    DA  I "O5'" 1 
ATOM   7560  C  "C5'" . DA  I 5  73  ? -23.252 -17.928 90.620 1.00 89.11  ? 0    DA  I "C5'" 1 
ATOM   7561  C  "C4'" . DA  I 5  73  ? -22.823 -19.068 91.512 1.00 98.75  ? 0    DA  I "C4'" 1 
ATOM   7562  O  "O4'" . DA  I 5  73  ? -23.017 -20.334 90.842 1.00 100.81 ? 0    DA  I "O4'" 1 
ATOM   7563  C  "C3'" . DA  I 5  73  ? -21.353 -19.046 91.929 1.00 102.51 ? 0    DA  I "C3'" 1 
ATOM   7564  O  "O3'" . DA  I 5  73  ? -21.273 -19.523 93.270 1.00 114.99 ? 0    DA  I "O3'" 1 
ATOM   7565  C  "C2'" . DA  I 5  73  ? -20.693 -20.000 90.952 1.00 96.06  ? 0    DA  I "C2'" 1 
ATOM   7566  C  "C1'" . DA  I 5  73  ? -21.781 -21.030 90.723 1.00 96.43  ? 0    DA  I "C1'" 1 
ATOM   7567  N  N9    . DA  I 5  73  ? -21.747 -21.648 89.401 1.00 102.39 ? 0    DA  I N9    1 
ATOM   7568  C  C8    . DA  I 5  73  ? -21.458 -21.051 88.198 1.00 97.21  ? 0    DA  I C8    1 
ATOM   7569  N  N7    . DA  I 5  73  ? -21.530 -21.865 87.175 1.00 99.65  ? 0    DA  I N7    1 
ATOM   7570  C  C5    . DA  I 5  73  ? -21.915 -23.074 87.737 1.00 106.83 ? 0    DA  I C5    1 
ATOM   7571  C  C6    . DA  I 5  73  ? -22.164 -24.339 87.179 1.00 114.87 ? 0    DA  I C6    1 
ATOM   7572  N  N6    . DA  I 5  73  ? -22.060 -24.605 85.876 1.00 115.59 ? 0    DA  I N6    1 
ATOM   7573  N  N1    . DA  I 5  73  ? -22.528 -25.335 88.017 1.00 122.84 ? 0    DA  I N1    1 
ATOM   7574  C  C2    . DA  I 5  73  ? -22.627 -25.067 89.326 1.00 122.46 ? 0    DA  I C2    1 
ATOM   7575  N  N3    . DA  I 5  73  ? -22.416 -23.920 89.969 1.00 112.30 ? 0    DA  I N3    1 
ATOM   7576  C  C4    . DA  I 5  73  ? -22.057 -22.953 89.107 1.00 103.03 ? 0    DA  I C4    1 
ATOM   7577  P  P     . DT  I 5  74  ? -19.873 -19.685 93.978 1.00 114.24 ? 1    DT  I P     1 
ATOM   7578  O  OP1   . DT  I 5  74  ? -20.057 -19.323 95.409 1.00 116.67 ? 1    DT  I OP1   1 
ATOM   7579  O  OP2   . DT  I 5  74  ? -18.851 -18.985 93.155 1.00 111.39 ? 1    DT  I OP2   1 
ATOM   7580  O  "O5'" . DT  I 5  74  ? -19.598 -21.246 93.842 1.00 105.93 ? 1    DT  I "O5'" 1 
ATOM   7581  C  "C5'" . DT  I 5  74  ? -20.594 -22.195 94.245 1.00 100.88 ? 1    DT  I "C5'" 1 
ATOM   7582  C  "C4'" . DT  I 5  74  ? -20.056 -23.593 94.070 1.00 103.83 ? 1    DT  I "C4'" 1 
ATOM   7583  O  "O4'" . DT  I 5  74  ? -20.214 -24.014 92.696 1.00 114.74 ? 1    DT  I "O4'" 1 
ATOM   7584  C  "C3'" . DT  I 5  74  ? -18.569 -23.749 94.396 1.00 103.72 ? 1    DT  I "C3'" 1 
ATOM   7585  O  "O3'" . DT  I 5  74  ? -18.460 -24.853 95.295 1.00 108.16 ? 1    DT  I "O3'" 1 
ATOM   7586  C  "C2'" . DT  I 5  74  ? -17.916 -24.001 93.045 1.00 104.33 ? 1    DT  I "C2'" 1 
ATOM   7587  C  "C1'" . DT  I 5  74  ? -19.037 -24.683 92.283 1.00 103.14 ? 1    DT  I "C1'" 1 
ATOM   7588  N  N1    . DT  I 5  74  ? -18.976 -24.614 90.808 1.00 94.31  ? 1    DT  I N1    1 
ATOM   7589  C  C2    . DT  I 5  74  ? -19.231 -25.762 90.089 1.00 91.53  ? 1    DT  I C2    1 
ATOM   7590  O  O2    . DT  I 5  74  ? -19.473 -26.840 90.612 1.00 88.44  ? 1    DT  I O2    1 
ATOM   7591  N  N3    . DT  I 5  74  ? -19.174 -25.607 88.726 1.00 88.24  ? 1    DT  I N3    1 
ATOM   7592  C  C4    . DT  I 5  74  ? -18.910 -24.444 88.028 1.00 90.43  ? 1    DT  I C4    1 
ATOM   7593  O  O4    . DT  I 5  74  ? -18.911 -24.454 86.799 1.00 92.80  ? 1    DT  I O4    1 
ATOM   7594  C  C5    . DT  I 5  74  ? -18.663 -23.277 88.844 1.00 89.58  ? 1    DT  I C5    1 
ATOM   7595  C  C7    . DT  I 5  74  ? -18.369 -21.972 88.173 1.00 89.16  ? 1    DT  I C7    1 
ATOM   7596  C  C6    . DT  I 5  74  ? -18.718 -23.416 90.175 1.00 91.04  ? 1    DT  I C6    1 
ATOM   7597  P  P     . DC  I 5  75  ? -17.081 -25.173 96.022 1.00 110.78 ? 2    DC  I P     1 
ATOM   7598  O  OP1   . DC  I 5  75  ? -17.403 -25.638 97.393 1.00 117.05 ? 2    DC  I OP1   1 
ATOM   7599  O  OP2   . DC  I 5  75  ? -16.181 -24.003 95.852 1.00 102.60 ? 2    DC  I OP2   1 
ATOM   7600  O  "O5'" . DC  I 5  75  ? -16.540 -26.419 95.186 1.00 108.80 ? 2    DC  I "O5'" 1 
ATOM   7601  C  "C5'" . DC  I 5  75  ? -17.342 -27.614 95.064 1.00 109.79 ? 2    DC  I "C5'" 1 
ATOM   7602  C  "C4'" . DC  I 5  75  ? -16.701 -28.591 94.107 1.00 114.94 ? 2    DC  I "C4'" 1 
ATOM   7603  O  "O4'" . DC  I 5  75  ? -16.872 -28.132 92.745 1.00 122.65 ? 2    DC  I "O4'" 1 
ATOM   7604  C  "C3'" . DC  I 5  75  ? -15.200 -28.795 94.314 1.00 113.87 ? 2    DC  I "C3'" 1 
ATOM   7605  O  "O3'" . DC  I 5  75  ? -14.975 -30.176 94.583 1.00 116.93 ? 2    DC  I "O3'" 1 
ATOM   7606  C  "C2'" . DC  I 5  75  ? -14.562 -28.333 93.011 1.00 114.63 ? 2    DC  I "C2'" 1 
ATOM   7607  C  "C1'" . DC  I 5  75  ? -15.697 -28.384 92.000 1.00 109.65 ? 2    DC  I "C1'" 1 
ATOM   7608  N  N1    . DC  I 5  75  ? -15.624 -27.373 90.927 1.00 102.72 ? 2    DC  I N1    1 
ATOM   7609  C  C2    . DC  I 5  75  ? -15.935 -27.739 89.609 1.00 95.56  ? 2    DC  I C2    1 
ATOM   7610  O  O2    . DC  I 5  75  ? -16.242 -28.916 89.367 1.00 82.75  ? 2    DC  I O2    1 
ATOM   7611  N  N3    . DC  I 5  75  ? -15.878 -26.803 88.633 1.00 88.14  ? 2    DC  I N3    1 
ATOM   7612  C  C4    . DC  I 5  75  ? -15.538 -25.546 88.932 1.00 90.87  ? 2    DC  I C4    1 
ATOM   7613  N  N4    . DC  I 5  75  ? -15.493 -24.655 87.939 1.00 85.13  ? 2    DC  I N4    1 
ATOM   7614  C  C5    . DC  I 5  75  ? -15.227 -25.146 90.265 1.00 98.93  ? 2    DC  I C5    1 
ATOM   7615  C  C6    . DC  I 5  75  ? -15.290 -26.080 91.223 1.00 101.23 ? 2    DC  I C6    1 
ATOM   7616  P  P     . DA  I 5  76  ? -13.606 -30.643 95.244 1.00 125.88 ? 3    DA  I P     1 
ATOM   7617  O  OP1   . DA  I 5  76  ? -13.885 -31.000 96.655 1.00 129.88 ? 3    DA  I OP1   1 
ATOM   7618  O  OP2   . DA  I 5  76  ? -12.563 -29.625 94.932 1.00 107.11 ? 3    DA  I OP2   1 
ATOM   7619  O  "O5'" . DA  I 5  76  ? -13.308 -32.007 94.479 1.00 128.05 ? 3    DA  I "O5'" 1 
ATOM   7620  C  "C5'" . DA  I 5  76  ? -14.379 -32.913 94.125 1.00 131.13 ? 3    DA  I "C5'" 1 
ATOM   7621  C  "C4'" . DA  I 5  76  ? -14.068 -33.611 92.821 1.00 126.60 ? 3    DA  I "C4'" 1 
ATOM   7622  O  "O4'" . DA  I 5  76  ? -14.137 -32.666 91.726 1.00 124.01 ? 3    DA  I "O4'" 1 
ATOM   7623  C  "C3'" . DA  I 5  76  ? -12.672 -34.231 92.751 1.00 123.73 ? 3    DA  I "C3'" 1 
ATOM   7624  O  "O3'" . DA  I 5  76  ? -12.780 -35.496 92.098 1.00 118.46 ? 3    DA  I "O3'" 1 
ATOM   7625  C  "C2'" . DA  I 5  76  ? -11.873 -33.204 91.966 1.00 120.60 ? 3    DA  I "C2'" 1 
ATOM   7626  C  "C1'" . DA  I 5  76  ? -12.917 -32.686 90.998 1.00 120.24 ? 3    DA  I "C1'" 1 
ATOM   7627  N  N9    . DA  I 5  76  ? -12.689 -31.342 90.473 1.00 112.32 ? 3    DA  I N9    1 
ATOM   7628  C  C8    . DA  I 5  76  ? -12.205 -30.235 91.124 1.00 112.56 ? 3    DA  I C8    1 
ATOM   7629  N  N7    . DA  I 5  76  ? -12.139 -29.165 90.369 1.00 110.57 ? 3    DA  I N7    1 
ATOM   7630  C  C5    . DA  I 5  76  ? -12.618 -29.594 89.139 1.00 111.83 ? 3    DA  I C5    1 
ATOM   7631  C  C6    . DA  I 5  76  ? -12.806 -28.932 87.910 1.00 101.46 ? 3    DA  I C6    1 
ATOM   7632  N  N6    . DA  I 5  76  ? -12.522 -27.644 87.709 1.00 94.07  ? 3    DA  I N6    1 
ATOM   7633  N  N1    . DA  I 5  76  ? -13.298 -29.652 86.880 1.00 96.16  ? 3    DA  I N1    1 
ATOM   7634  C  C2    . DA  I 5  76  ? -13.583 -30.947 87.079 1.00 102.68 ? 3    DA  I C2    1 
ATOM   7635  N  N3    . DA  I 5  76  ? -13.451 -31.678 88.184 1.00 106.71 ? 3    DA  I N3    1 
ATOM   7636  C  C4    . DA  I 5  76  ? -12.960 -30.934 89.190 1.00 115.39 ? 3    DA  I C4    1 
ATOM   7637  P  P     . DG  I 5  77  ? -11.550 -36.522 92.105 1.00 123.10 ? 4    DG  I P     1 
ATOM   7638  O  OP1   . DG  I 5  77  ? -11.768 -37.505 93.199 1.00 122.68 ? 4    DG  I OP1   1 
ATOM   7639  O  OP2   . DG  I 5  77  ? -10.279 -35.738 92.050 1.00 105.90 ? 4    DG  I OP2   1 
ATOM   7640  O  "O5'" . DG  I 5  77  ? -11.762 -37.344 90.755 1.00 116.89 ? 4    DG  I "O5'" 1 
ATOM   7641  C  "C5'" . DG  I 5  77  ? -12.727 -36.934 89.764 1.00 107.22 ? 4    DG  I "C5'" 1 
ATOM   7642  C  "C4'" . DG  I 5  77  ? -12.046 -36.590 88.459 1.00 92.75  ? 4    DG  I "C4'" 1 
ATOM   7643  O  "O4'" . DG  I 5  77  ? -11.738 -35.178 88.358 1.00 84.79  ? 4    DG  I "O4'" 1 
ATOM   7644  C  "C3'" . DG  I 5  77  ? -10.733 -37.319 88.183 1.00 82.75  ? 4    DG  I "C3'" 1 
ATOM   7645  O  "O3'" . DG  I 5  77  ? -10.898 -37.664 86.824 1.00 84.27  ? 4    DG  I "O3'" 1 
ATOM   7646  C  "C2'" . DG  I 5  77  ? -9.673  -36.242 88.347 1.00 80.10  ? 4    DG  I "C2'" 1 
ATOM   7647  C  "C1'" . DG  I 5  77  ? -10.430 -35.042 87.823 1.00 84.79  ? 4    DG  I "C1'" 1 
ATOM   7648  N  N9    . DG  I 5  77  ? -9.934  -33.707 88.161 1.00 92.43  ? 4    DG  I N9    1 
ATOM   7649  C  C8    . DG  I 5  77  ? -9.293  -33.305 89.307 1.00 91.23  ? 4    DG  I C8    1 
ATOM   7650  N  N7    . DG  I 5  77  ? -9.002  -32.032 89.310 1.00 88.95  ? 4    DG  I N7    1 
ATOM   7651  C  C5    . DG  I 5  77  ? -9.466  -31.570 88.087 1.00 91.39  ? 4    DG  I C5    1 
ATOM   7652  C  C6    . DG  I 5  77  ? -9.414  -30.272 87.514 1.00 95.71  ? 4    DG  I C6    1 
ATOM   7653  O  O6    . DG  I 5  77  ? -8.939  -29.236 87.992 1.00 92.90  ? 4    DG  I O6    1 
ATOM   7654  N  N1    . DG  I 5  77  ? -10.001 -30.246 86.254 1.00 99.42  ? 4    DG  I N1    1 
ATOM   7655  C  C2    . DG  I 5  77  ? -10.558 -31.329 85.620 1.00 105.72 ? 4    DG  I C2    1 
ATOM   7656  N  N2    . DG  I 5  77  ? -11.075 -31.102 84.404 1.00 113.77 ? 4    DG  I N2    1 
ATOM   7657  N  N3    . DG  I 5  77  ? -10.606 -32.544 86.140 1.00 99.63  ? 4    DG  I N3    1 
ATOM   7658  C  C4    . DG  I 5  77  ? -10.047 -32.590 87.367 1.00 94.26  ? 4    DG  I C4    1 
ATOM   7659  P  P     . DC  I 5  78  ? -10.106 -38.856 86.222 1.00 95.99  ? 5    DC  I P     1 
ATOM   7660  O  OP1   . DC  I 5  78  ? -11.095 -39.896 85.841 1.00 94.26  ? 5    DC  I OP1   1 
ATOM   7661  O  OP2   . DC  I 5  78  ? -8.992  -39.169 87.148 1.00 92.55  ? 5    DC  I OP2   1 
ATOM   7662  O  "O5'" . DC  I 5  78  ? -9.469  -38.235 84.894 1.00 111.88 ? 5    DC  I "O5'" 1 
ATOM   7663  C  "C5'" . DC  I 5  78  ? -10.116 -37.188 84.125 1.00 105.06 ? 5    DC  I "C5'" 1 
ATOM   7664  C  "C4'" . DC  I 5  78  ? -9.091  -36.339 83.404 1.00 101.03 ? 5    DC  I "C4'" 1 
ATOM   7665  O  "O4'" . DC  I 5  78  ? -8.738  -35.179 84.202 1.00 94.44  ? 5    DC  I "O4'" 1 
ATOM   7666  C  "C3'" . DC  I 5  78  ? -7.766  -37.040 83.079 1.00 100.68 ? 5    DC  I "C3'" 1 
ATOM   7667  O  "O3'" . DC  I 5  78  ? -7.232  -36.622 81.820 1.00 103.23 ? 5    DC  I "O3'" 1 
ATOM   7668  C  "C2'" . DC  I 5  78  ? -6.822  -36.501 84.133 1.00 102.03 ? 5    DC  I "C2'" 1 
ATOM   7669  C  "C1'" . DC  I 5  78  ? -7.320  -35.075 84.245 1.00 99.97  ? 5    DC  I "C1'" 1 
ATOM   7670  N  N1    . DC  I 5  78  ? -6.945  -34.350 85.472 1.00 102.12 ? 5    DC  I N1    1 
ATOM   7671  C  C2    . DC  I 5  78  ? -7.020  -32.957 85.470 1.00 101.50 ? 5    DC  I C2    1 
ATOM   7672  O  O2    . DC  I 5  78  ? -7.409  -32.380 84.445 1.00 108.20 ? 5    DC  I O2    1 
ATOM   7673  N  N3    . DC  I 5  78  ? -6.677  -32.274 86.586 1.00 109.81 ? 5    DC  I N3    1 
ATOM   7674  C  C4    . DC  I 5  78  ? -6.270  -32.935 87.673 1.00 108.47 ? 5    DC  I C4    1 
ATOM   7675  N  N4    . DC  I 5  78  ? -5.943  -32.223 88.754 1.00 112.99 ? 5    DC  I N4    1 
ATOM   7676  C  C5    . DC  I 5  78  ? -6.174  -34.356 87.698 1.00 103.04 ? 5    DC  I C5    1 
ATOM   7677  C  C6    . DC  I 5  78  ? -6.515  -35.017 86.586 1.00 102.54 ? 5    DC  I C6    1 
ATOM   7678  P  P     . DT  I 5  79  ? -7.356  -37.560 80.542 1.00 97.09  ? 6    DT  I P     1 
ATOM   7679  O  OP1   . DT  I 5  79  ? -8.616  -38.342 80.666 1.00 99.93  ? 6    DT  I OP1   1 
ATOM   7680  O  OP2   . DT  I 5  79  ? -6.035  -38.229 80.312 1.00 77.52  ? 6    DT  I OP2   1 
ATOM   7681  O  "O5'" . DT  I 5  79  ? -7.635  -36.527 79.367 1.00 90.83  ? 6    DT  I "O5'" 1 
ATOM   7682  C  "C5'" . DT  I 5  79  ? -8.690  -35.557 79.459 1.00 82.12  ? 6    DT  I "C5'" 1 
ATOM   7683  C  "C4'" . DT  I 5  79  ? -8.170  -34.223 78.977 1.00 73.51  ? 6    DT  I "C4'" 1 
ATOM   7684  O  "O4'" . DT  I 5  79  ? -7.477  -33.541 80.052 1.00 69.37  ? 6    DT  I "O4'" 1 
ATOM   7685  C  "C3'" . DT  I 5  79  ? -7.165  -34.306 77.828 1.00 70.60  ? 6    DT  I "C3'" 1 
ATOM   7686  O  "O3'" . DT  I 5  79  ? -7.194  -33.068 77.130 1.00 71.22  ? 6    DT  I "O3'" 1 
ATOM   7687  C  "C2'" . DT  I 5  79  ? -5.835  -34.275 78.545 1.00 73.05  ? 6    DT  I "C2'" 1 
ATOM   7688  C  "C1'" . DT  I 5  79  ? -6.143  -33.262 79.636 1.00 75.38  ? 6    DT  I "C1'" 1 
ATOM   7689  N  N1    . DT  I 5  79  ? -5.278  -33.291 80.826 1.00 79.67  ? 6    DT  I N1    1 
ATOM   7690  C  C2    . DT  I 5  79  ? -5.185  -32.135 81.566 1.00 84.35  ? 6    DT  I C2    1 
ATOM   7691  O  O2    . DT  I 5  79  ? -5.772  -31.107 81.271 1.00 76.33  ? 6    DT  I O2    1 
ATOM   7692  N  N3    . DT  I 5  79  ? -4.376  -32.227 82.671 1.00 89.78  ? 6    DT  I N3    1 
ATOM   7693  C  C4    . DT  I 5  79  ? -3.670  -33.335 83.099 1.00 94.01  ? 6    DT  I C4    1 
ATOM   7694  O  O4    . DT  I 5  79  ? -2.983  -33.265 84.114 1.00 108.44 ? 6    DT  I O4    1 
ATOM   7695  C  C5    . DT  I 5  79  ? -3.814  -34.514 82.273 1.00 89.18  ? 6    DT  I C5    1 
ATOM   7696  C  C7    . DT  I 5  79  ? -3.089  -35.766 82.656 1.00 91.36  ? 6    DT  I C7    1 
ATOM   7697  C  C6    . DT  I 5  79  ? -4.600  -34.433 81.193 1.00 82.36  ? 6    DT  I C6    1 
ATOM   7698  P  P     . DG  I 5  80  ? -7.228  -32.977 75.557 1.00 63.18  ? 7    DG  I P     1 
ATOM   7699  O  OP1   . DG  I 5  80  ? -8.580  -32.490 75.203 1.00 57.96  ? 7    DG  I OP1   1 
ATOM   7700  O  OP2   . DG  I 5  80  ? -6.667  -34.213 74.967 1.00 60.57  ? 7    DG  I OP2   1 
ATOM   7701  O  "O5'" . DG  I 5  80  ? -6.177  -31.815 75.288 1.00 63.10  ? 7    DG  I "O5'" 1 
ATOM   7702  C  "C5'" . DG  I 5  80  ? -6.407  -30.520 75.883 1.00 62.89  ? 7    DG  I "C5'" 1 
ATOM   7703  C  "C4'" . DG  I 5  80  ? -5.111  -29.856 76.285 1.00 61.21  ? 7    DG  I "C4'" 1 
ATOM   7704  O  "O4'" . DG  I 5  80  ? -4.571  -30.514 77.453 1.00 64.14  ? 7    DG  I "O4'" 1 
ATOM   7705  C  "C3'" . DG  I 5  80  ? -3.985  -29.847 75.240 1.00 60.18  ? 7    DG  I "C3'" 1 
ATOM   7706  O  "O3'" . DG  I 5  80  ? -3.435  -28.533 75.290 1.00 55.40  ? 7    DG  I "O3'" 1 
ATOM   7707  C  "C2'" . DG  I 5  80  ? -2.997  -30.867 75.773 1.00 59.89  ? 7    DG  I "C2'" 1 
ATOM   7708  C  "C1'" . DG  I 5  80  ? -3.176  -30.663 77.264 1.00 69.07  ? 7    DG  I "C1'" 1 
ATOM   7709  N  N9    . DG  I 5  80  ? -2.706  -31.731 78.141 1.00 70.86  ? 7    DG  I N9    1 
ATOM   7710  C  C8    . DG  I 5  80  ? -2.769  -33.089 77.939 1.00 75.24  ? 7    DG  I C8    1 
ATOM   7711  N  N7    . DG  I 5  80  ? -2.248  -33.776 78.918 1.00 74.98  ? 7    DG  I N7    1 
ATOM   7712  C  C5    . DG  I 5  80  ? -1.803  -32.813 79.812 1.00 84.10  ? 7    DG  I C5    1 
ATOM   7713  C  C6    . DG  I 5  80  ? -1.144  -32.951 81.056 1.00 83.62  ? 7    DG  I C6    1 
ATOM   7714  O  O6    . DG  I 5  80  ? -0.817  -33.988 81.644 1.00 90.45  ? 7    DG  I O6    1 
ATOM   7715  N  N1    . DG  I 5  80  ? -0.868  -31.713 81.627 1.00 85.16  ? 7    DG  I N1    1 
ATOM   7716  C  C2    . DG  I 5  80  ? -1.194  -30.499 81.077 1.00 74.63  ? 7    DG  I C2    1 
ATOM   7717  N  N2    . DG  I 5  80  ? -0.858  -29.414 81.786 1.00 74.86  ? 7    DG  I N2    1 
ATOM   7718  N  N3    . DG  I 5  80  ? -1.814  -30.358 79.923 1.00 80.80  ? 7    DG  I N3    1 
ATOM   7719  C  C4    . DG  I 5  80  ? -2.081  -31.547 79.346 1.00 76.36  ? 7    DG  I C4    1 
ATOM   7720  P  P     . DA  I 5  81  ? -2.479  -27.962 74.163 1.00 57.66  ? 8    DA  I P     1 
ATOM   7721  O  OP1   . DA  I 5  81  ? -3.311  -27.290 73.133 1.00 60.23  ? 8    DA  I OP1   1 
ATOM   7722  O  OP2   . DA  I 5  81  ? -1.494  -28.994 73.758 1.00 55.64  ? 8    DA  I OP2   1 
ATOM   7723  O  "O5'" . DA  I 5  81  ? -1.677  -26.850 74.968 1.00 60.31  ? 8    DA  I "O5'" 1 
ATOM   7724  C  "C5'" . DA  I 5  81  ? -2.214  -26.292 76.193 1.00 56.60  ? 8    DA  I "C5'" 1 
ATOM   7725  C  "C4'" . DA  I 5  81  ? -1.132  -25.572 76.964 1.00 56.06  ? 8    DA  I "C4'" 1 
ATOM   7726  O  "O4'" . DA  I 5  81  ? -0.570  -26.460 77.962 1.00 56.05  ? 8    DA  I "O4'" 1 
ATOM   7727  C  "C3'" . DA  I 5  81  ? 0.051   -25.091 76.128 1.00 54.93  ? 8    DA  I "C3'" 1 
ATOM   7728  O  "O3'" . DA  I 5  81  ? 0.533   -23.889 76.728 1.00 59.63  ? 8    DA  I "O3'" 1 
ATOM   7729  C  "C2'" . DA  I 5  81  ? 1.030   -26.246 76.219 1.00 52.91  ? 8    DA  I "C2'" 1 
ATOM   7730  C  "C1'" . DA  I 5  81  ? 0.750   -26.845 77.594 1.00 60.27  ? 8    DA  I "C1'" 1 
ATOM   7731  N  N9    . DA  I 5  81  ? 0.821   -28.306 77.654 1.00 67.63  ? 8    DA  I N9    1 
ATOM   7732  C  C8    . DA  I 5  81  ? 0.378   -29.214 76.726 1.00 65.60  ? 8    DA  I C8    1 
ATOM   7733  N  N7    . DA  I 5  81  ? 0.571   -30.461 77.074 1.00 63.29  ? 8    DA  I N7    1 
ATOM   7734  C  C5    . DA  I 5  81  ? 1.187   -30.370 78.313 1.00 77.51  ? 8    DA  I C5    1 
ATOM   7735  C  C6    . DA  I 5  81  ? 1.649   -31.344 79.211 1.00 78.26  ? 8    DA  I C6    1 
ATOM   7736  N  N6    . DA  I 5  81  ? 1.567   -32.655 78.987 1.00 83.05  ? 8    DA  I N6    1 
ATOM   7737  N  N1    . DA  I 5  81  ? 2.219   -30.918 80.358 1.00 77.21  ? 8    DA  I N1    1 
ATOM   7738  C  C2    . DA  I 5  81  ? 2.292   -29.602 80.589 1.00 72.66  ? 8    DA  I C2    1 
ATOM   7739  N  N3    . DA  I 5  81  ? 1.892   -28.591 79.825 1.00 76.03  ? 8    DA  I N3    1 
ATOM   7740  C  C4    . DA  I 5  81  ? 1.345   -29.048 78.684 1.00 77.39  ? 8    DA  I C4    1 
ATOM   7741  P  P     . DA  I 5  82  ? 1.740   -23.078 76.086 1.00 59.25  ? 9    DA  I P     1 
ATOM   7742  O  OP1   . DA  I 5  82  ? 1.475   -21.641 76.360 1.00 53.37  ? 9    DA  I OP1   1 
ATOM   7743  O  OP2   . DA  I 5  82  ? 1.967   -23.579 74.705 1.00 58.38  ? 9    DA  I OP2   1 
ATOM   7744  O  "O5'" . DA  I 5  82  ? 3.012   -23.580 76.896 1.00 61.88  ? 9    DA  I "O5'" 1 
ATOM   7745  C  "C5'" . DA  I 5  82  ? 3.090   -23.349 78.316 1.00 61.38  ? 9    DA  I "C5'" 1 
ATOM   7746  C  "C4'" . DA  I 5  82  ? 4.297   -24.042 78.900 1.00 57.83  ? 9    DA  I "C4'" 1 
ATOM   7747  O  "O4'" . DA  I 5  82  ? 4.089   -25.470 78.870 1.00 55.24  ? 9    DA  I "O4'" 1 
ATOM   7748  C  "C3'" . DA  I 5  82  ? 5.636   -23.770 78.205 1.00 54.95  ? 9    DA  I "C3'" 1 
ATOM   7749  O  "O3'" . DA  I 5  82  ? 6.488   -23.148 79.176 1.00 67.13  ? 9    DA  I "O3'" 1 
ATOM   7750  C  "C2'" . DA  I 5  82  ? 6.121   -25.144 77.772 1.00 58.36  ? 9    DA  I "C2'" 1 
ATOM   7751  C  "C1'" . DA  I 5  82  ? 5.325   -26.111 78.629 1.00 61.65  ? 9    DA  I "C1'" 1 
ATOM   7752  N  N9    . DA  I 5  82  ? 5.039   -27.417 78.034 1.00 67.09  ? 9    DA  I N9    1 
ATOM   7753  C  C8    . DA  I 5  82  ? 4.551   -27.677 76.778 1.00 76.67  ? 9    DA  I C8    1 
ATOM   7754  N  N7    . DA  I 5  82  ? 4.360   -28.951 76.539 1.00 80.84  ? 9    DA  I N7    1 
ATOM   7755  C  C5    . DA  I 5  82  ? 4.742   -29.573 77.718 1.00 87.47  ? 9    DA  I C5    1 
ATOM   7756  C  C6    . DA  I 5  82  ? 4.783   -30.922 78.105 1.00 91.42  ? 9    DA  I C6    1 
ATOM   7757  N  N6    . DA  I 5  82  ? 4.415   -31.930 77.314 1.00 96.23  ? 9    DA  I N6    1 
ATOM   7758  N  N1    . DA  I 5  82  ? 5.220   -31.206 79.350 1.00 91.10  ? 9    DA  I N1    1 
ATOM   7759  C  C2    . DA  I 5  82  ? 5.591   -30.196 80.142 1.00 92.02  ? 9    DA  I C2    1 
ATOM   7760  N  N3    . DA  I 5  82  ? 5.601   -28.889 79.892 1.00 94.27  ? 9    DA  I N3    1 
ATOM   7761  C  C4    . DA  I 5  82  ? 5.157   -28.640 78.649 1.00 81.19  ? 9    DA  I C4    1 
ATOM   7762  P  P     . DC  I 5  83  ? 7.945   -22.545 78.808 1.00 69.70  ? 10   DC  I P     1 
ATOM   7763  O  OP1   . DC  I 5  83  ? 8.224   -21.459 79.797 1.00 68.27  ? 10   DC  I OP1   1 
ATOM   7764  O  OP2   . DC  I 5  83  ? 8.004   -22.278 77.352 1.00 70.05  ? 10   DC  I OP2   1 
ATOM   7765  O  "O5'" . DC  I 5  83  ? 8.927   -23.777 79.030 1.00 69.62  ? 10   DC  I "O5'" 1 
ATOM   7766  C  "C5'" . DC  I 5  83  ? 8.821   -24.598 80.208 1.00 69.42  ? 10   DC  I "C5'" 1 
ATOM   7767  C  "C4'" . DC  I 5  83  ? 9.770   -25.768 80.118 1.00 70.44  ? 10   DC  I "C4'" 1 
ATOM   7768  O  "O4'" . DC  I 5  83  ? 9.086   -26.925 79.570 1.00 69.57  ? 10   DC  I "O4'" 1 
ATOM   7769  C  "C3'" . DC  I 5  83  ? 11.001  -25.545 79.233 1.00 68.99  ? 10   DC  I "C3'" 1 
ATOM   7770  O  "O3'" . DC  I 5  83  ? 12.130  -26.093 79.923 1.00 77.10  ? 10   DC  I "O3'" 1 
ATOM   7771  C  "C2'" . DC  I 5  83  ? 10.660  -26.325 77.977 1.00 69.74  ? 10   DC  I "C2'" 1 
ATOM   7772  C  "C1'" . DC  I 5  83  ? 9.938   -27.504 78.598 1.00 74.48  ? 10   DC  I "C1'" 1 
ATOM   7773  N  N1    . DC  I 5  83  ? 9.119   -28.328 77.698 1.00 84.73  ? 10   DC  I N1    1 
ATOM   7774  C  C2    . DC  I 5  83  ? 8.784   -29.625 78.097 1.00 86.82  ? 10   DC  I C2    1 
ATOM   7775  O  O2    . DC  I 5  83  ? 9.176   -30.033 79.195 1.00 95.67  ? 10   DC  I O2    1 
ATOM   7776  N  N3    . DC  I 5  83  ? 8.033   -30.397 77.281 1.00 90.13  ? 10   DC  I N3    1 
ATOM   7777  C  C4    . DC  I 5  83  ? 7.640   -29.925 76.097 1.00 86.47  ? 10   DC  I C4    1 
ATOM   7778  N  N4    . DC  I 5  83  ? 6.908   -30.721 75.323 1.00 88.88  ? 10   DC  I N4    1 
ATOM   7779  C  C5    . DC  I 5  83  ? 7.967   -28.608 75.664 1.00 88.55  ? 10   DC  I C5    1 
ATOM   7780  C  C6    . DC  I 5  83  ? 8.703   -27.851 76.486 1.00 88.27  ? 10   DC  I C6    1 
ATOM   7781  P  P     . DA  I 5  84  ? 13.639  -25.749 79.488 1.00 79.67  ? 11   DA  I P     1 
ATOM   7782  O  OP1   . DA  I 5  84  ? 13.921  -24.374 79.930 1.00 62.32  ? 11   DA  I OP1   1 
ATOM   7783  O  OP2   . DA  I 5  84  ? 13.826  -26.086 78.055 1.00 72.88  ? 11   DA  I OP2   1 
ATOM   7784  O  "O5'" . DA  I 5  84  ? 14.466  -26.853 80.289 1.00 84.96  ? 11   DA  I "O5'" 1 
ATOM   7785  C  "C5'" . DA  I 5  84  ? 13.799  -27.880 81.067 1.00 92.29  ? 11   DA  I "C5'" 1 
ATOM   7786  C  "C4'" . DA  I 5  84  ? 14.430  -29.240 80.865 1.00 97.69  ? 11   DA  I "C4'" 1 
ATOM   7787  O  "O4'" . DA  I 5  84  ? 13.588  -30.040 80.001 1.00 98.62  ? 11   DA  I "O4'" 1 
ATOM   7788  C  "C3'" . DA  I 5  84  ? 15.813  -29.256 80.210 1.00 106.63 ? 11   DA  I "C3'" 1 
ATOM   7789  O  "O3'" . DA  I 5  84  ? 16.527  -30.419 80.660 1.00 120.37 ? 11   DA  I "O3'" 1 
ATOM   7790  C  "C2'" . DA  I 5  84  ? 15.471  -29.372 78.740 1.00 106.86 ? 11   DA  I "C2'" 1 
ATOM   7791  C  "C1'" . DA  I 5  84  ? 14.290  -30.335 78.795 1.00 111.00 ? 11   DA  I "C1'" 1 
ATOM   7792  N  N9    . DA  I 5  84  ? 13.354  -30.217 77.677 1.00 114.45 ? 11   DA  I N9    1 
ATOM   7793  C  C8    . DA  I 5  84  ? 13.025  -29.087 76.970 1.00 113.17 ? 11   DA  I C8    1 
ATOM   7794  N  N7    . DA  I 5  84  ? 12.173  -29.301 75.998 1.00 114.79 ? 11   DA  I N7    1 
ATOM   7795  C  C5    . DA  I 5  84  ? 11.929  -30.665 76.064 1.00 114.07 ? 11   DA  I C5    1 
ATOM   7796  C  C6    . DA  I 5  84  ? 11.113  -31.515 75.302 1.00 112.23 ? 11   DA  I C6    1 
ATOM   7797  N  N6    . DA  I 5  84  ? 10.354  -31.095 74.288 1.00 100.76 ? 11   DA  I N6    1 
ATOM   7798  N  N1    . DA  I 5  84  ? 11.096  -32.827 75.626 1.00 120.70 ? 11   DA  I N1    1 
ATOM   7799  C  C2    . DA  I 5  84  ? 11.857  -33.246 76.646 1.00 113.90 ? 11   DA  I C2    1 
ATOM   7800  N  N3    . DA  I 5  84  ? 12.666  -32.543 77.435 1.00 111.98 ? 11   DA  I N3    1 
ATOM   7801  C  C4    . DA  I 5  84  ? 12.656  -31.244 77.088 1.00 112.49 ? 11   DA  I C4    1 
ATOM   7802  P  P     . DT  I 5  85  ? 18.072  -30.675 80.253 1.00 113.64 ? 12   DT  I P     1 
ATOM   7803  O  OP1   . DT  I 5  85  ? 18.807  -31.074 81.485 1.00 105.25 ? 12   DT  I OP1   1 
ATOM   7804  O  OP2   . DT  I 5  85  ? 18.552  -29.522 79.437 1.00 102.79 ? 12   DT  I OP2   1 
ATOM   7805  O  "O5'" . DT  I 5  85  ? 17.979  -31.948 79.302 1.00 107.64 ? 12   DT  I "O5'" 1 
ATOM   7806  C  "C5'" . DT  I 5  85  ? 17.118  -33.062 79.615 1.00 114.34 ? 12   DT  I "C5'" 1 
ATOM   7807  C  "C4'" . DT  I 5  85  ? 17.108  -34.025 78.453 1.00 120.72 ? 12   DT  I "C4'" 1 
ATOM   7808  O  "O4'" . DT  I 5  85  ? 16.069  -33.638 77.515 1.00 126.69 ? 12   DT  I "O4'" 1 
ATOM   7809  C  "C3'" . DT  I 5  85  ? 18.417  -34.036 77.653 1.00 124.03 ? 12   DT  I "C3'" 1 
ATOM   7810  O  "O3'" . DT  I 5  85  ? 18.795  -35.359 77.259 1.00 125.15 ? 12   DT  I "O3'" 1 
ATOM   7811  C  "C2'" . DT  I 5  85  ? 18.091  -33.177 76.446 1.00 127.80 ? 12   DT  I "C2'" 1 
ATOM   7812  C  "C1'" . DT  I 5  85  ? 16.638  -33.561 76.217 1.00 130.35 ? 12   DT  I "C1'" 1 
ATOM   7813  N  N1    . DT  I 5  85  ? 15.817  -32.639 75.390 1.00 129.11 ? 12   DT  I N1    1 
ATOM   7814  C  C2    . DT  I 5  85  ? 14.742  -33.177 74.718 1.00 115.45 ? 12   DT  I C2    1 
ATOM   7815  O  O2    . DT  I 5  85  ? 14.418  -34.350 74.810 1.00 96.61  ? 12   DT  I O2    1 
ATOM   7816  N  N3    . DT  I 5  85  ? 14.044  -32.281 73.944 1.00 117.55 ? 12   DT  I N3    1 
ATOM   7817  C  C4    . DT  I 5  85  ? 14.313  -30.934 73.776 1.00 123.58 ? 12   DT  I C4    1 
ATOM   7818  O  O4    . DT  I 5  85  ? 13.592  -30.251 73.052 1.00 104.79 ? 12   DT  I O4    1 
ATOM   7819  C  C5    . DT  I 5  85  ? 15.460  -30.438 74.505 1.00 130.65 ? 12   DT  I C5    1 
ATOM   7820  C  C7    . DT  I 5  85  ? 15.829  -28.993 74.387 1.00 125.23 ? 12   DT  I C7    1 
ATOM   7821  C  C6    . DT  I 5  85  ? 16.151  -31.306 75.257 1.00 136.94 ? 12   DT  I C6    1 
ATOM   7822  P  P     . DG  I 5  86  ? 20.336  -35.694 76.984 1.00 120.64 ? 13   DG  I P     1 
ATOM   7823  O  OP1   . DG  I 5  86  ? 20.886  -36.313 78.213 1.00 124.72 ? 13   DG  I OP1   1 
ATOM   7824  O  OP2   . DG  I 5  86  ? 20.981  -34.482 76.398 1.00 104.45 ? 13   DG  I OP2   1 
ATOM   7825  O  "O5'" . DG  I 5  86  ? 20.290  -36.815 75.851 1.00 118.00 ? 13   DG  I "O5'" 1 
ATOM   7826  C  "C5'" . DG  I 5  86  ? 19.307  -37.872 75.842 1.00 116.44 ? 13   DG  I "C5'" 1 
ATOM   7827  C  "C4'" . DG  I 5  86  ? 18.986  -38.280 74.421 1.00 117.87 ? 13   DG  I "C4'" 1 
ATOM   7828  O  "O4'" . DG  I 5  86  ? 18.066  -37.326 73.831 1.00 123.36 ? 13   DG  I "O4'" 1 
ATOM   7829  C  "C3'" . DG  I 5  86  ? 20.181  -38.348 73.463 1.00 118.34 ? 13   DG  I "C3'" 1 
ATOM   7830  O  "O3'" . DG  I 5  86  ? 20.020  -39.461 72.565 1.00 106.94 ? 13   DG  I "O3'" 1 
ATOM   7831  C  "C2'" . DG  I 5  86  ? 20.121  -37.004 72.754 1.00 117.40 ? 13   DG  I "C2'" 1 
ATOM   7832  C  "C1'" . DG  I 5  86  ? 18.619  -36.830 72.615 1.00 125.60 ? 13   DG  I "C1'" 1 
ATOM   7833  N  N9    . DG  I 5  86  ? 18.133  -35.467 72.417 1.00 125.58 ? 13   DG  I N9    1 
ATOM   7834  C  C8    . DG  I 5  86  ? 18.565  -34.323 73.043 1.00 129.46 ? 13   DG  I C8    1 
ATOM   7835  N  N7    . DG  I 5  86  ? 17.921  -33.253 72.659 1.00 118.49 ? 13   DG  I N7    1 
ATOM   7836  C  C5    . DG  I 5  86  ? 17.012  -33.719 71.720 1.00 120.54 ? 13   DG  I C5    1 
ATOM   7837  C  C6    . DG  I 5  86  ? 16.047  -33.021 70.952 1.00 117.84 ? 13   DG  I C6    1 
ATOM   7838  O  O6    . DG  I 5  86  ? 15.787  -31.813 70.957 1.00 114.09 ? 13   DG  I O6    1 
ATOM   7839  N  N1    . DG  I 5  86  ? 15.341  -33.879 70.115 1.00 126.96 ? 13   DG  I N1    1 
ATOM   7840  C  C2    . DG  I 5  86  ? 15.538  -35.237 70.027 1.00 128.52 ? 13   DG  I C2    1 
ATOM   7841  N  N2    . DG  I 5  86  ? 14.751  -35.896 69.166 1.00 130.63 ? 13   DG  I N2    1 
ATOM   7842  N  N3    . DG  I 5  86  ? 16.431  -35.901 70.742 1.00 132.71 ? 13   DG  I N3    1 
ATOM   7843  C  C4    . DG  I 5  86  ? 17.128  -35.085 71.561 1.00 128.80 ? 13   DG  I C4    1 
ATOM   7844  P  P     . DC  I 5  87  ? 21.153  -39.810 71.476 1.00 102.37 ? 14   DC  I P     1 
ATOM   7845  O  OP1   . DC  I 5  87  ? 21.362  -41.278 71.475 1.00 106.44 ? 14   DC  I OP1   1 
ATOM   7846  O  OP2   . DC  I 5  87  ? 22.285  -38.863 71.628 1.00 92.45  ? 14   DC  I OP2   1 
ATOM   7847  O  "O5'" . DC  I 5  87  ? 20.494  -39.400 70.092 1.00 110.24 ? 14   DC  I "O5'" 1 
ATOM   7848  C  "C5'" . DC  I 5  87  ? 19.402  -40.138 69.528 1.00 111.42 ? 14   DC  I "C5'" 1 
ATOM   7849  C  "C4'" . DC  I 5  87  ? 18.919  -39.404 68.301 1.00 106.27 ? 14   DC  I "C4'" 1 
ATOM   7850  O  "O4'" . DC  I 5  87  ? 18.547  -38.059 68.693 1.00 96.85  ? 14   DC  I "O4'" 1 
ATOM   7851  C  "C3'" . DC  I 5  87  ? 19.981  -39.254 67.199 1.00 99.06  ? 14   DC  I "C3'" 1 
ATOM   7852  O  "O3'" . DC  I 5  87  ? 19.520  -39.658 65.900 1.00 87.13  ? 14   DC  I "O3'" 1 
ATOM   7853  C  "C2'" . DC  I 5  87  ? 20.310  -37.769 67.210 1.00 100.34 ? 14   DC  I "C2'" 1 
ATOM   7854  C  "C1'" . DC  I 5  87  ? 19.003  -37.178 67.690 1.00 102.38 ? 14   DC  I "C1'" 1 
ATOM   7855  N  N1    . DC  I 5  87  ? 19.058  -35.828 68.265 1.00 109.92 ? 14   DC  I N1    1 
ATOM   7856  C  C2    . DC  I 5  87  ? 18.323  -34.816 67.643 1.00 115.44 ? 14   DC  I C2    1 
ATOM   7857  O  O2    . DC  I 5  87  ? 17.682  -35.088 66.615 1.00 108.39 ? 14   DC  I O2    1 
ATOM   7858  N  N3    . DC  I 5  87  ? 18.340  -33.568 68.165 1.00 111.02 ? 14   DC  I N3    1 
ATOM   7859  C  C4    . DC  I 5  87  ? 19.050  -33.316 69.267 1.00 103.93 ? 14   DC  I C4    1 
ATOM   7860  N  N4    . DC  I 5  87  ? 19.036  -32.072 69.746 1.00 103.84 ? 14   DC  I N4    1 
ATOM   7861  C  C5    . DC  I 5  87  ? 19.801  -34.331 69.927 1.00 111.35 ? 14   DC  I C5    1 
ATOM   7862  C  C6    . DC  I 5  87  ? 19.772  -35.564 69.401 1.00 111.73 ? 14   DC  I C6    1 
ATOM   7863  P  P     . DC  I 5  88  ? 19.222  -41.211 65.584 1.00 88.47  ? 15   DC  I P     1 
ATOM   7864  O  OP1   . DC  I 5  88  ? 18.845  -41.875 66.859 1.00 76.70  ? 15   DC  I OP1   1 
ATOM   7865  O  OP2   . DC  I 5  88  ? 20.316  -41.741 64.730 1.00 74.58  ? 15   DC  I OP2   1 
ATOM   7866  O  "O5'" . DC  I 5  88  ? 17.908  -41.157 64.681 1.00 95.17  ? 15   DC  I "O5'" 1 
ATOM   7867  C  "C5'" . DC  I 5  88  ? 16.615  -40.843 65.259 1.00 88.33  ? 15   DC  I "C5'" 1 
ATOM   7868  C  "C4'" . DC  I 5  88  ? 15.779  -40.003 64.317 1.00 80.88  ? 15   DC  I "C4'" 1 
ATOM   7869  O  "O4'" . DC  I 5  88  ? 16.305  -38.657 64.225 1.00 76.69  ? 15   DC  I "O4'" 1 
ATOM   7870  C  "C3'" . DC  I 5  88  ? 15.698  -40.512 62.878 1.00 78.83  ? 15   DC  I "C3'" 1 
ATOM   7871  O  "O3'" . DC  I 5  88  ? 14.417  -40.177 62.346 1.00 79.20  ? 15   DC  I "O3'" 1 
ATOM   7872  C  "C2'" . DC  I 5  88  ? 16.782  -39.724 62.175 1.00 77.24  ? 15   DC  I "C2'" 1 
ATOM   7873  C  "C1'" . DC  I 5  88  ? 16.695  -38.385 62.883 1.00 86.09  ? 15   DC  I "C1'" 1 
ATOM   7874  N  N1    . DC  I 5  88  ? 17.936  -37.595 62.916 1.00 100.85 ? 15   DC  I N1    1 
ATOM   7875  C  C2    . DC  I 5  88  ? 17.829  -36.214 63.092 1.00 106.37 ? 15   DC  I C2    1 
ATOM   7876  O  O2    . DC  I 5  88  ? 16.700  -35.713 63.217 1.00 93.45  ? 15   DC  I O2    1 
ATOM   7877  N  N3    . DC  I 5  88  ? 18.954  -35.461 63.123 1.00 123.30 ? 15   DC  I N3    1 
ATOM   7878  C  C4    . DC  I 5  88  ? 20.148  -36.040 62.977 1.00 120.47 ? 15   DC  I C4    1 
ATOM   7879  N  N4    . DC  I 5  88  ? 21.232  -35.262 63.008 1.00 116.51 ? 15   DC  I N4    1 
ATOM   7880  C  C5    . DC  I 5  88  ? 20.285  -37.446 62.786 1.00 116.71 ? 15   DC  I C5    1 
ATOM   7881  C  C6    . DC  I 5  88  ? 19.164  -38.179 62.764 1.00 108.74 ? 15   DC  I C6    1 
ATOM   7882  P  P     . DT  I 5  89  ? 13.876  -40.826 60.988 1.00 82.70  ? 16   DT  I P     1 
ATOM   7883  O  OP1   . DT  I 5  89  ? 12.579  -41.497 61.296 1.00 67.88  ? 16   DT  I OP1   1 
ATOM   7884  O  OP2   . DT  I 5  89  ? 14.984  -41.562 60.322 1.00 80.05  ? 16   DT  I OP2   1 
ATOM   7885  O  "O5'" . DT  I 5  89  ? 13.580  -39.541 60.102 1.00 77.31  ? 16   DT  I "O5'" 1 
ATOM   7886  C  "C5'" . DT  I 5  89  ? 12.912  -38.430 60.709 1.00 73.96  ? 16   DT  I "C5'" 1 
ATOM   7887  C  "C4'" . DT  I 5  89  ? 13.208  -37.163 59.945 1.00 74.76  ? 16   DT  I "C4'" 1 
ATOM   7888  O  "O4'" . DT  I 5  89  ? 14.556  -36.696 60.178 1.00 69.09  ? 16   DT  I "O4'" 1 
ATOM   7889  C  "C3'" . DT  I 5  89  ? 13.043  -37.264 58.429 1.00 72.62  ? 16   DT  I "C3'" 1 
ATOM   7890  O  "O3'" . DT  I 5  89  ? 12.017  -36.311 58.122 1.00 67.65  ? 16   DT  I "O3'" 1 
ATOM   7891  C  "C2'" . DT  I 5  89  ? 14.439  -36.977 57.891 1.00 72.29  ? 16   DT  I "C2'" 1 
ATOM   7892  C  "C1'" . DT  I 5  89  ? 15.043  -36.127 58.990 1.00 72.39  ? 16   DT  I "C1'" 1 
ATOM   7893  N  N1    . DT  I 5  89  ? 16.517  -36.098 59.086 1.00 82.76  ? 16   DT  I N1    1 
ATOM   7894  C  C2    . DT  I 5  89  ? 17.140  -34.871 59.133 1.00 87.23  ? 16   DT  I C2    1 
ATOM   7895  O  O2    . DT  I 5  89  ? 16.537  -33.812 59.059 1.00 84.89  ? 16   DT  I O2    1 
ATOM   7896  N  N3    . DT  I 5  89  ? 18.507  -34.928 59.256 1.00 100.92 ? 16   DT  I N3    1 
ATOM   7897  C  C4    . DT  I 5  89  ? 19.291  -36.064 59.352 1.00 97.55  ? 16   DT  I C4    1 
ATOM   7898  O  O4    . DT  I 5  89  ? 20.509  -35.958 59.470 1.00 87.66  ? 16   DT  I O4    1 
ATOM   7899  C  C5    . DT  I 5  89  ? 18.568  -37.316 59.305 1.00 90.77  ? 16   DT  I C5    1 
ATOM   7900  C  C7    . DT  I 5  89  ? 19.332  -38.598 59.392 1.00 91.97  ? 16   DT  I C7    1 
ATOM   7901  C  C6    . DT  I 5  89  ? 17.235  -37.270 59.189 1.00 86.42  ? 16   DT  I C6    1 
ATOM   7902  P  P     . DT  I 5  90  ? 11.412  -36.215 56.672 1.00 69.04  ? 17   DT  I P     1 
ATOM   7903  O  OP1   . DT  I 5  90  ? 9.962   -36.553 56.767 1.00 69.20  ? 17   DT  I OP1   1 
ATOM   7904  O  OP2   . DT  I 5  90  ? 12.326  -36.898 55.712 1.00 59.23  ? 17   DT  I OP2   1 
ATOM   7905  O  "O5'" . DT  I 5  90  ? 11.637  -34.697 56.248 1.00 63.99  ? 17   DT  I "O5'" 1 
ATOM   7906  C  "C5'" . DT  I 5  90  ? 11.580  -33.638 57.208 1.00 60.78  ? 17   DT  I "C5'" 1 
ATOM   7907  C  "C4'" . DT  I 5  90  ? 12.641  -32.616 56.884 1.00 66.44  ? 17   DT  I "C4'" 1 
ATOM   7908  O  "O4'" . DT  I 5  90  ? 13.958  -33.203 57.007 1.00 71.70  ? 17   DT  I "O4'" 1 
ATOM   7909  C  "C3'" . DT  I 5  90  ? 12.555  -32.034 55.469 1.00 66.68  ? 17   DT  I "C3'" 1 
ATOM   7910  O  "O3'" . DT  I 5  90  ? 12.177  -30.660 55.617 1.00 61.69  ? 17   DT  I "O3'" 1 
ATOM   7911  C  "C2'" . DT  I 5  90  ? 13.938  -32.284 54.875 1.00 73.25  ? 17   DT  I "C2'" 1 
ATOM   7912  C  "C1'" . DT  I 5  90  ? 14.806  -32.530 56.100 1.00 80.87  ? 17   DT  I "C1'" 1 
ATOM   7913  N  N1    . DT  I 5  90  ? 16.016  -33.361 55.921 1.00 95.87  ? 17   DT  I N1    1 
ATOM   7914  C  C2    . DT  I 5  90  ? 17.254  -32.787 56.111 1.00 91.26  ? 17   DT  I C2    1 
ATOM   7915  O  O2    . DT  I 5  90  ? 17.409  -31.604 56.365 1.00 85.74  ? 17   DT  I O2    1 
ATOM   7916  N  N3    . DT  I 5  90  ? 18.312  -33.650 55.971 1.00 96.45  ? 17   DT  I N3    1 
ATOM   7917  C  C4    . DT  I 5  90  ? 18.257  -35.000 55.676 1.00 97.87  ? 17   DT  I C4    1 
ATOM   7918  O  O4    . DT  I 5  90  ? 19.294  -35.649 55.584 1.00 100.77 ? 17   DT  I O4    1 
ATOM   7919  C  C5    . DT  I 5  90  ? 16.928  -35.539 55.505 1.00 108.74 ? 17   DT  I C5    1 
ATOM   7920  C  C7    . DT  I 5  90  ? 16.770  -36.991 55.180 1.00 103.19 ? 17   DT  I C7    1 
ATOM   7921  C  C6    . DT  I 5  90  ? 15.888  -34.706 55.645 1.00 107.06 ? 17   DT  I C6    1 
ATOM   7922  P  P     . DT  I 5  91  ? 11.970  -29.744 54.350 1.00 59.53  ? 18   DT  I P     1 
ATOM   7923  O  OP1   . DT  I 5  91  ? 10.977  -28.713 54.699 1.00 64.33  ? 18   DT  I OP1   1 
ATOM   7924  O  OP2   . DT  I 5  91  ? 11.775  -30.620 53.165 1.00 54.28  ? 18   DT  I OP2   1 
ATOM   7925  O  "O5'" . DT  I 5  91  ? 13.372  -28.990 54.204 1.00 66.90  ? 18   DT  I "O5'" 1 
ATOM   7926  C  "C5'" . DT  I 5  91  ? 14.064  -28.408 55.337 1.00 66.18  ? 18   DT  I "C5'" 1 
ATOM   7927  C  "C4'" . DT  I 5  91  ? 15.463  -27.972 54.954 1.00 72.81  ? 18   DT  I "C4'" 1 
ATOM   7928  O  "O4'" . DT  I 5  91  ? 16.375  -29.105 54.896 1.00 74.32  ? 18   DT  I "O4'" 1 
ATOM   7929  C  "C3'" . DT  I 5  91  ? 15.574  -27.254 53.605 1.00 73.89  ? 18   DT  I "C3'" 1 
ATOM   7930  O  "O3'" . DT  I 5  91  ? 16.355  -26.067 53.765 1.00 78.92  ? 18   DT  I "O3'" 1 
ATOM   7931  C  "C2'" . DT  I 5  91  ? 16.241  -28.277 52.701 1.00 74.02  ? 18   DT  I "C2'" 1 
ATOM   7932  C  "C1'" . DT  I 5  91  ? 17.105  -29.064 53.678 1.00 79.95  ? 18   DT  I "C1'" 1 
ATOM   7933  N  N1    . DT  I 5  91  ? 17.436  -30.458 53.289 1.00 90.17  ? 18   DT  I N1    1 
ATOM   7934  C  C2    . DT  I 5  91  ? 18.706  -30.927 53.552 1.00 103.91 ? 18   DT  I C2    1 
ATOM   7935  O  O2    . DT  I 5  91  ? 19.571  -30.253 54.086 1.00 109.42 ? 18   DT  I O2    1 
ATOM   7936  N  N3    . DT  I 5  91  ? 18.927  -32.226 53.167 1.00 109.71 ? 18   DT  I N3    1 
ATOM   7937  C  C4    . DT  I 5  91  ? 18.031  -33.080 52.554 1.00 104.05 ? 18   DT  I C4    1 
ATOM   7938  O  O4    . DT  I 5  91  ? 18.374  -34.221 52.263 1.00 106.65 ? 18   DT  I O4    1 
ATOM   7939  C  C5    . DT  I 5  91  ? 16.725  -32.521 52.298 1.00 103.20 ? 18   DT  I C5    1 
ATOM   7940  C  C7    . DT  I 5  91  ? 15.691  -33.371 51.629 1.00 97.20  ? 18   DT  I C7    1 
ATOM   7941  C  C6    . DT  I 5  91  ? 16.495  -31.255 52.674 1.00 101.51 ? 18   DT  I C6    1 
ATOM   7942  P  P     . DT  I 5  92  ? 16.375  -24.936 52.626 1.00 86.64  ? 19   DT  I P     1 
ATOM   7943  O  OP1   . DT  I 5  92  ? 16.284  -23.618 53.300 1.00 90.78  ? 19   DT  I OP1   1 
ATOM   7944  O  OP2   . DT  I 5  92  ? 15.416  -25.299 51.560 1.00 83.25  ? 19   DT  I OP2   1 
ATOM   7945  O  "O5'" . DT  I 5  92  ? 17.808  -25.118 51.958 1.00 101.10 ? 19   DT  I "O5'" 1 
ATOM   7946  C  "C5'" . DT  I 5  92  ? 19.005  -25.118 52.758 1.00 104.11 ? 19   DT  I "C5'" 1 
ATOM   7947  C  "C4'" . DT  I 5  92  ? 20.186  -25.565 51.929 1.00 105.81 ? 19   DT  I "C4'" 1 
ATOM   7948  O  "O4'" . DT  I 5  92  ? 20.173  -27.007 51.795 1.00 103.44 ? 19   DT  I "O4'" 1 
ATOM   7949  C  "C3'" . DT  I 5  92  ? 20.240  -25.006 50.502 1.00 108.78 ? 19   DT  I "C3'" 1 
ATOM   7950  O  "O3'" . DT  I 5  92  ? 21.574  -24.536 50.267 1.00 108.39 ? 19   DT  I "O3'" 1 
ATOM   7951  C  "C2'" . DT  I 5  92  ? 19.833  -26.191 49.639 1.00 101.81 ? 19   DT  I "C2'" 1 
ATOM   7952  C  "C1'" . DT  I 5  92  ? 20.421  -27.337 50.439 1.00 106.64 ? 19   DT  I "C1'" 1 
ATOM   7953  N  N1    . DT  I 5  92  ? 19.877  -28.685 50.195 1.00 108.98 ? 19   DT  I N1    1 
ATOM   7954  C  C2    . DT  I 5  92  ? 20.730  -29.751 50.369 1.00 109.49 ? 19   DT  I C2    1 
ATOM   7955  O  O2    . DT  I 5  92  ? 21.902  -29.622 50.684 1.00 98.57  ? 19   DT  I O2    1 
ATOM   7956  N  N3    . DT  I 5  92  ? 20.163  -30.982 50.142 1.00 108.72 ? 19   DT  I N3    1 
ATOM   7957  C  C4    . DT  I 5  92  ? 18.855  -31.244 49.777 1.00 108.99 ? 19   DT  I C4    1 
ATOM   7958  O  O4    . DT  I 5  92  ? 18.486  -32.404 49.614 1.00 101.67 ? 19   DT  I O4    1 
ATOM   7959  C  C5    . DT  I 5  92  ? 18.016  -30.078 49.615 1.00 112.81 ? 19   DT  I C5    1 
ATOM   7960  C  C7    . DT  I 5  92  ? 16.586  -30.263 49.216 1.00 117.48 ? 19   DT  I C7    1 
ATOM   7961  C  C6    . DT  I 5  92  ? 18.560  -28.874 49.834 1.00 113.82 ? 19   DT  I C6    1 
ATOM   7962  P  P     . DG  I 5  93  ? 22.013  -23.994 48.829 1.00 107.23 ? 20   DG  I P     1 
ATOM   7963  O  OP1   . DG  I 5  93  ? 22.965  -22.885 49.049 1.00 112.70 ? 20   DG  I OP1   1 
ATOM   7964  O  OP2   . DG  I 5  93  ? 20.795  -23.775 47.998 1.00 105.99 ? 20   DG  I OP2   1 
ATOM   7965  O  "O5'" . DG  I 5  93  ? 22.811  -25.226 48.220 1.00 110.58 ? 20   DG  I "O5'" 1 
ATOM   7966  C  "C5'" . DG  I 5  93  ? 24.175  -25.478 48.605 1.00 125.58 ? 20   DG  I "C5'" 1 
ATOM   7967  C  "C4'" . DG  I 5  93  ? 24.855  -26.327 47.558 1.00 136.15 ? 20   DG  I "C4'" 1 
ATOM   7968  O  "O4'" . DG  I 5  93  ? 24.172  -27.600 47.470 1.00 133.79 ? 20   DG  I "O4'" 1 
ATOM   7969  C  "C3'" . DG  I 5  93  ? 24.816  -25.755 46.141 1.00 140.34 ? 20   DG  I "C3'" 1 
ATOM   7970  O  "O3'" . DG  I 5  93  ? 25.960  -26.249 45.443 1.00 144.01 ? 20   DG  I "O3'" 1 
ATOM   7971  C  "C2'" . DG  I 5  93  ? 23.535  -26.351 45.592 1.00 137.00 ? 20   DG  I "C2'" 1 
ATOM   7972  C  "C1'" . DG  I 5  93  ? 23.630  -27.750 46.164 1.00 134.45 ? 20   DG  I "C1'" 1 
ATOM   7973  N  N9    . DG  I 5  93  ? 22.370  -28.470 46.280 1.00 140.46 ? 20   DG  I N9    1 
ATOM   7974  C  C8    . DG  I 5  93  ? 21.100  -27.947 46.316 1.00 146.19 ? 20   DG  I C8    1 
ATOM   7975  N  N7    . DG  I 5  93  ? 20.174  -28.860 46.421 1.00 145.24 ? 20   DG  I N7    1 
ATOM   7976  C  C5    . DG  I 5  93  ? 20.874  -30.058 46.457 1.00 138.64 ? 20   DG  I C5    1 
ATOM   7977  C  C6    . DG  I 5  93  ? 20.406  -31.393 46.563 1.00 137.71 ? 20   DG  I C6    1 
ATOM   7978  O  O6    . DG  I 5  93  ? 19.241  -31.796 46.646 1.00 126.87 ? 20   DG  I O6    1 
ATOM   7979  N  N1    . DG  I 5  93  ? 21.458  -32.304 46.560 1.00 141.37 ? 20   DG  I N1    1 
ATOM   7980  C  C2    . DG  I 5  93  ? 22.788  -31.975 46.469 1.00 150.63 ? 20   DG  I C2    1 
ATOM   7981  N  N2    . DG  I 5  93  ? 23.656  -32.998 46.481 1.00 152.73 ? 20   DG  I N2    1 
ATOM   7982  N  N3    . DG  I 5  93  ? 23.236  -30.735 46.368 1.00 158.23 ? 20   DG  I N3    1 
ATOM   7983  C  C4    . DG  I 5  93  ? 22.231  -29.834 46.369 1.00 146.53 ? 20   DG  I C4    1 
ATOM   7984  P  P     . DA  I 5  94  ? 26.186  -25.929 43.895 1.00 151.85 ? 21   DA  I P     1 
ATOM   7985  O  OP1   . DA  I 5  94  ? 26.795  -24.577 43.800 1.00 153.45 ? 21   DA  I OP1   1 
ATOM   7986  O  OP2   . DA  I 5  94  ? 24.932  -26.216 43.151 1.00 136.66 ? 21   DA  I OP2   1 
ATOM   7987  O  "O5'" . DA  I 5  94  ? 27.238  -27.046 43.458 1.00 157.98 ? 21   DA  I "O5'" 1 
ATOM   7988  C  "C5'" . DA  I 5  94  ? 27.533  -28.198 44.286 1.00 147.34 ? 21   DA  I "C5'" 1 
ATOM   7989  C  "C4'" . DA  I 5  94  ? 27.446  -29.474 43.481 1.00 141.78 ? 21   DA  I "C4'" 1 
ATOM   7990  O  "O4'" . DA  I 5  94  ? 26.169  -30.115 43.735 1.00 128.84 ? 21   DA  I "O4'" 1 
ATOM   7991  C  "C3'" . DA  I 5  94  ? 27.523  -29.302 41.958 1.00 149.25 ? 21   DA  I "C3'" 1 
ATOM   7992  O  "O3'" . DA  I 5  94  ? 28.235  -30.398 41.366 1.00 151.87 ? 21   DA  I "O3'" 1 
ATOM   7993  C  "C2'" . DA  I 5  94  ? 26.063  -29.331 41.553 1.00 144.81 ? 21   DA  I "C2'" 1 
ATOM   7994  C  "C1'" . DA  I 5  94  ? 25.566  -30.407 42.485 1.00 139.30 ? 21   DA  I "C1'" 1 
ATOM   7995  N  N9    . DA  I 5  94  ? 24.119  -30.455 42.666 1.00 144.93 ? 21   DA  I N9    1 
ATOM   7996  C  C8    . DA  I 5  94  ? 23.190  -29.456 42.497 1.00 149.50 ? 21   DA  I C8    1 
ATOM   7997  N  N7    . DA  I 5  94  ? 21.955  -29.844 42.706 1.00 142.24 ? 21   DA  I N7    1 
ATOM   7998  C  C5    . DA  I 5  94  ? 22.077  -31.191 43.016 1.00 146.82 ? 21   DA  I C5    1 
ATOM   7999  C  C6    . DA  I 5  94  ? 21.129  -32.176 43.343 1.00 145.35 ? 21   DA  I C6    1 
ATOM   8000  N  N6    . DA  I 5  94  ? 19.817  -31.945 43.418 1.00 140.57 ? 21   DA  I N6    1 
ATOM   8001  N  N1    . DA  I 5  94  ? 21.582  -33.425 43.594 1.00 146.11 ? 21   DA  I N1    1 
ATOM   8002  C  C2    . DA  I 5  94  ? 22.899  -33.657 43.520 1.00 151.12 ? 21   DA  I C2    1 
ATOM   8003  N  N3    . DA  I 5  94  ? 23.887  -32.812 43.227 1.00 147.84 ? 21   DA  I N3    1 
ATOM   8004  C  C4    . DA  I 5  94  ? 23.403  -31.582 42.983 1.00 146.53 ? 21   DA  I C4    1 
ATOM   8005  P  P     . DT  I 5  95  ? 28.299  -30.586 39.764 1.00 138.31 ? 22   DT  I P     1 
ATOM   8006  O  OP1   . DT  I 5  95  ? 29.731  -30.678 39.386 1.00 154.24 ? 22   DT  I OP1   1 
ATOM   8007  O  OP2   . DT  I 5  95  ? 27.463  -29.536 39.132 1.00 119.06 ? 22   DT  I OP2   1 
ATOM   8008  O  "O5'" . DT  I 5  95  ? 27.613  -32.011 39.538 1.00 138.14 ? 22   DT  I "O5'" 1 
ATOM   8009  C  "C5'" . DT  I 5  95  ? 28.317  -33.083 38.864 1.00 158.17 ? 22   DT  I "C5'" 1 
ATOM   8010  C  "C4'" . DT  I 5  95  ? 27.439  -34.304 38.693 1.00 173.43 ? 22   DT  I "C4'" 1 
ATOM   8011  O  "O4'" . DT  I 5  95  ? 26.147  -34.073 39.315 1.00 192.70 ? 22   DT  I "O4'" 1 
ATOM   8012  C  "C3'" . DT  I 5  95  ? 27.133  -34.691 37.239 1.00 185.67 ? 22   DT  I "C3'" 1 
ATOM   8013  O  "O3'" . DT  I 5  95  ? 27.017  -36.112 37.042 1.00 185.40 ? 22   DT  I "O3'" 1 
ATOM   8014  C  "C2'" . DT  I 5  95  ? 25.758  -34.093 37.024 1.00 197.76 ? 22   DT  I "C2'" 1 
ATOM   8015  C  "C1'" . DT  I 5  95  ? 25.140  -34.414 38.372 1.00 204.09 ? 22   DT  I "C1'" 1 
ATOM   8016  N  N1    . DT  I 5  95  ? 23.890  -33.705 38.737 1.00 201.56 ? 22   DT  I N1    1 
ATOM   8017  C  C2    . DT  I 5  95  ? 23.053  -34.305 39.654 1.00 185.01 ? 22   DT  I C2    1 
ATOM   8018  O  O2    . DT  I 5  95  ? 23.308  -35.370 40.194 1.00 160.52 ? 22   DT  I O2    1 
ATOM   8019  N  N3    . DT  I 5  95  ? 21.903  -33.604 39.924 1.00 179.98 ? 22   DT  I N3    1 
ATOM   8020  C  C4    . DT  I 5  95  ? 21.512  -32.398 39.374 1.00 180.25 ? 22   DT  I C4    1 
ATOM   8021  O  O4    . DT  I 5  95  ? 20.449  -31.887 39.714 1.00 154.02 ? 22   DT  I O4    1 
ATOM   8022  C  C5    . DT  I 5  95  ? 22.429  -31.833 38.409 1.00 191.91 ? 22   DT  I C5    1 
ATOM   8023  C  C7    . DT  I 5  95  ? 22.089  -30.528 37.760 1.00 188.00 ? 22   DT  I C7    1 
ATOM   8024  C  C6    . DT  I 5  95  ? 23.553  -32.508 38.138 1.00 199.85 ? 22   DT  I C6    1 
ATOM   8025  P  P     . DG  I 5  96  ? 27.140  -36.736 35.559 1.00 201.66 ? 23   DG  I P     1 
ATOM   8026  O  OP1   . DG  I 5  96  ? 28.344  -37.602 35.537 1.00 208.88 ? 23   DG  I OP1   1 
ATOM   8027  O  OP2   . DG  I 5  96  ? 27.006  -35.625 34.581 1.00 206.82 ? 23   DG  I OP2   1 
ATOM   8028  O  "O5'" . DG  I 5  96  ? 25.863  -37.683 35.393 1.00 185.24 ? 23   DG  I "O5'" 1 
ATOM   8029  C  "C5'" . DG  I 5  96  ? 25.514  -38.260 34.099 1.00 178.76 ? 23   DG  I "C5'" 1 
ATOM   8030  C  "C4'" . DG  I 5  96  ? 24.375  -39.249 34.240 1.00 181.04 ? 23   DG  I "C4'" 1 
ATOM   8031  O  "O4'" . DG  I 5  96  ? 23.494  -38.771 35.280 1.00 188.31 ? 23   DG  I "O4'" 1 
ATOM   8032  C  "C3'" . DG  I 5  96  ? 23.470  -39.419 33.018 1.00 179.34 ? 23   DG  I "C3'" 1 
ATOM   8033  O  "O3'" . DG  I 5  96  ? 22.682  -40.627 33.068 1.00 172.59 ? 23   DG  I "O3'" 1 
ATOM   8034  C  "C2'" . DG  I 5  96  ? 22.500  -38.270 33.188 1.00 177.78 ? 23   DG  I "C2'" 1 
ATOM   8035  C  "C1'" . DG  I 5  96  ? 22.300  -38.255 34.699 1.00 179.97 ? 23   DG  I "C1'" 1 
ATOM   8036  N  N9    . DG  I 5  96  ? 22.074  -36.918 35.233 1.00 173.49 ? 23   DG  I N9    1 
ATOM   8037  C  C8    . DG  I 5  96  ? 22.969  -36.106 35.888 1.00 164.94 ? 23   DG  I C8    1 
ATOM   8038  N  N7    . DG  I 5  96  ? 22.461  -34.951 36.222 1.00 156.67 ? 23   DG  I N7    1 
ATOM   8039  C  C5    . DG  I 5  96  ? 21.156  -35.001 35.753 1.00 160.57 ? 23   DG  I C5    1 
ATOM   8040  C  C6    . DG  I 5  96  ? 20.117  -34.037 35.816 1.00 147.91 ? 23   DG  I C6    1 
ATOM   8041  O  O6    . DG  I 5  96  ? 20.143  -32.908 36.322 1.00 143.58 ? 23   DG  I O6    1 
ATOM   8042  N  N1    . DG  I 5  96  ? 18.954  -34.498 35.206 1.00 128.70 ? 23   DG  I N1    1 
ATOM   8043  C  C2    . DG  I 5  96  ? 18.806  -35.731 34.618 1.00 129.97 ? 23   DG  I C2    1 
ATOM   8044  N  N2    . DG  I 5  96  ? 17.605  -35.997 34.093 1.00 128.47 ? 23   DG  I N2    1 
ATOM   8045  N  N3    . DG  I 5  96  ? 19.765  -36.637 34.553 1.00 141.91 ? 23   DG  I N3    1 
ATOM   8046  C  C4    . DG  I 5  96  ? 20.905  -36.208 35.134 1.00 163.02 ? 23   DG  I C4    1 
ATOM   8047  P  P     . DG  I 5  97  ? 21.823  -41.130 31.774 1.00 162.76 ? 24   DG  I P     1 
ATOM   8048  O  OP1   . DG  I 5  97  ? 21.959  -42.605 31.651 1.00 150.38 ? 24   DG  I OP1   1 
ATOM   8049  O  OP2   . DG  I 5  97  ? 22.134  -40.245 30.624 1.00 148.86 ? 24   DG  I OP2   1 
ATOM   8050  O  "O5'" . DG  I 5  97  ? 20.296  -40.937 32.186 1.00 169.18 ? 24   DG  I "O5'" 1 
ATOM   8051  C  "C5'" . DG  I 5  97  ? 19.275  -41.730 31.529 1.00 159.52 ? 24   DG  I "C5'" 1 
ATOM   8052  C  "C4'" . DG  I 5  97  ? 17.989  -40.952 31.344 1.00 156.69 ? 24   DG  I "C4'" 1 
ATOM   8053  O  "O4'" . DG  I 5  97  ? 18.131  -39.585 31.797 1.00 164.86 ? 24   DG  I "O4'" 1 
ATOM   8054  C  "C3'" . DG  I 5  97  ? 17.483  -40.851 29.903 1.00 152.14 ? 24   DG  I "C3'" 1 
ATOM   8055  O  "O3'" . DG  I 5  97  ? 16.057  -40.947 29.891 1.00 143.56 ? 24   DG  I "O3'" 1 
ATOM   8056  C  "C2'" . DG  I 5  97  ? 17.941  -39.470 29.470 1.00 151.63 ? 24   DG  I "C2'" 1 
ATOM   8057  C  "C1'" . DG  I 5  97  ? 17.763  -38.690 30.755 1.00 153.48 ? 24   DG  I "C1'" 1 
ATOM   8058  N  N9    . DG  I 5  97  ? 18.574  -37.487 30.904 1.00 153.87 ? 24   DG  I N9    1 
ATOM   8059  C  C8    . DG  I 5  97  ? 19.946  -37.397 30.904 1.00 157.57 ? 24   DG  I C8    1 
ATOM   8060  N  N7    . DG  I 5  97  ? 20.378  -36.184 31.119 1.00 156.60 ? 24   DG  I N7    1 
ATOM   8061  C  C5    . DG  I 5  97  ? 19.224  -35.433 31.287 1.00 151.77 ? 24   DG  I C5    1 
ATOM   8062  C  C6    . DG  I 5  97  ? 19.057  -34.049 31.554 1.00 152.35 ? 24   DG  I C6    1 
ATOM   8063  O  O6    . DG  I 5  97  ? 19.925  -33.180 31.695 1.00 154.62 ? 24   DG  I O6    1 
ATOM   8064  N  N1    . DG  I 5  97  ? 17.712  -33.707 31.651 1.00 146.61 ? 24   DG  I N1    1 
ATOM   8065  C  C2    . DG  I 5  97  ? 16.663  -34.581 31.508 1.00 142.28 ? 24   DG  I C2    1 
ATOM   8066  N  N2    . DG  I 5  97  ? 15.436  -34.062 31.646 1.00 144.46 ? 24   DG  I N2    1 
ATOM   8067  N  N3    . DG  I 5  97  ? 16.805  -35.872 31.265 1.00 140.11 ? 24   DG  I N3    1 
ATOM   8068  C  C4    . DG  I 5  97  ? 18.103  -36.225 31.162 1.00 147.20 ? 24   DG  I C4    1 
ATOM   8069  P  P     . DA  I 5  98  ? 15.368  -42.385 29.832 1.00 145.42 ? 25   DA  I P     1 
ATOM   8070  O  OP1   . DA  I 5  98  ? 15.904  -43.195 30.956 1.00 139.11 ? 25   DA  I OP1   1 
ATOM   8071  O  OP2   . DA  I 5  98  ? 15.457  -42.876 28.436 1.00 144.30 ? 25   DA  I OP2   1 
ATOM   8072  O  "O5'" . DA  I 5  98  ? 13.827  -42.086 30.090 1.00 151.64 ? 25   DA  I "O5'" 1 
ATOM   8073  C  "C5'" . DA  I 5  98  ? 13.261  -42.142 31.410 1.00 140.33 ? 25   DA  I "C5'" 1 
ATOM   8074  C  "C4'" . DA  I 5  98  ? 12.255  -41.027 31.573 1.00 130.91 ? 25   DA  I "C4'" 1 
ATOM   8075  O  "O4'" . DA  I 5  98  ? 12.886  -39.752 31.292 1.00 130.13 ? 25   DA  I "O4'" 1 
ATOM   8076  C  "C3'" . DA  I 5  98  ? 11.050  -41.109 30.637 1.00 124.38 ? 25   DA  I "C3'" 1 
ATOM   8077  O  "O3'" . DA  I 5  98  ? 9.903   -40.612 31.341 1.00 114.53 ? 25   DA  I "O3'" 1 
ATOM   8078  C  "C2'" . DA  I 5  98  ? 11.461  -40.223 29.474 1.00 127.82 ? 25   DA  I "C2'" 1 
ATOM   8079  C  "C1'" . DA  I 5  98  ? 12.251  -39.130 30.179 1.00 130.82 ? 25   DA  I "C1'" 1 
ATOM   8080  N  N9    . DA  I 5  98  ? 13.285  -38.476 29.377 1.00 131.80 ? 25   DA  I N9    1 
ATOM   8081  C  C8    . DA  I 5  98  ? 14.194  -39.042 28.518 1.00 138.28 ? 25   DA  I C8    1 
ATOM   8082  N  N7    . DA  I 5  98  ? 14.998  -38.175 27.953 1.00 141.16 ? 25   DA  I N7    1 
ATOM   8083  C  C5    . DA  I 5  98  ? 14.594  -36.955 28.476 1.00 132.49 ? 25   DA  I C5    1 
ATOM   8084  C  C6    . DA  I 5  98  ? 15.049  -35.641 28.275 1.00 124.14 ? 25   DA  I C6    1 
ATOM   8085  N  N6    . DA  I 5  98  ? 16.053  -35.322 27.458 1.00 123.67 ? 25   DA  I N6    1 
ATOM   8086  N  N1    . DA  I 5  98  ? 14.422  -34.650 28.947 1.00 128.68 ? 25   DA  I N1    1 
ATOM   8087  C  C2    . DA  I 5  98  ? 13.406  -34.968 29.759 1.00 120.15 ? 25   DA  I C2    1 
ATOM   8088  N  N3    . DA  I 5  98  ? 12.897  -36.164 30.040 1.00 125.78 ? 25   DA  I N3    1 
ATOM   8089  C  C4    . DA  I 5  98  ? 13.540  -37.126 29.356 1.00 130.91 ? 25   DA  I C4    1 
ATOM   8090  P  P     . DG  I 5  99  ? 8.440   -40.657 30.682 1.00 107.72 ? 26   DG  I P     1 
ATOM   8091  O  OP1   . DG  I 5  99  ? 7.464   -40.903 31.773 1.00 96.36  ? 26   DG  I OP1   1 
ATOM   8092  O  OP2   . DG  I 5  99  ? 8.470   -41.572 29.514 1.00 97.84  ? 26   DG  I OP2   1 
ATOM   8093  O  "O5'" . DG  I 5  99  ? 8.265   -39.185 30.095 1.00 103.65 ? 26   DG  I "O5'" 1 
ATOM   8094  C  "C5'" . DG  I 5  99  ? 8.425   -38.011 30.917 1.00 92.84  ? 26   DG  I "C5'" 1 
ATOM   8095  C  "C4'" . DG  I 5  99  ? 8.248   -36.764 30.085 1.00 87.16  ? 26   DG  I "C4'" 1 
ATOM   8096  O  "O4'" . DG  I 5  99  ? 9.452   -36.515 29.311 1.00 94.21  ? 26   DG  I "O4'" 1 
ATOM   8097  C  "C3'" . DG  I 5  99  ? 7.110   -36.839 29.066 1.00 87.71  ? 26   DG  I "C3'" 1 
ATOM   8098  O  "O3'" . DG  I 5  99  ? 6.531   -35.538 28.922 1.00 91.18  ? 26   DG  I "O3'" 1 
ATOM   8099  C  "C2'" . DG  I 5  99  ? 7.831   -37.176 27.773 1.00 91.91  ? 26   DG  I "C2'" 1 
ATOM   8100  C  "C1'" . DG  I 5  99  ? 9.086   -36.337 27.946 1.00 102.71 ? 26   DG  I "C1'" 1 
ATOM   8101  N  N9    . DG  I 5  99  ? 10.248  -36.640 27.102 1.00 114.52 ? 26   DG  I N9    1 
ATOM   8102  C  C8    . DG  I 5  99  ? 10.546  -37.818 26.456 1.00 112.60 ? 26   DG  I C8    1 
ATOM   8103  N  N7    . DG  I 5  99  ? 11.652  -37.755 25.763 1.00 111.29 ? 26   DG  I N7    1 
ATOM   8104  C  C5    . DG  I 5  99  ? 12.103  -36.455 25.949 1.00 117.97 ? 26   DG  I C5    1 
ATOM   8105  C  C6    . DG  I 5  99  ? 13.258  -35.798 25.444 1.00 123.19 ? 26   DG  I C6    1 
ATOM   8106  O  O6    . DG  I 5  99  ? 14.143  -36.251 24.711 1.00 118.78 ? 26   DG  I O6    1 
ATOM   8107  N  N1    . DG  I 5  99  ? 13.332  -34.480 25.885 1.00 133.27 ? 26   DG  I N1    1 
ATOM   8108  C  C2    . DG  I 5  99  ? 12.414  -33.869 26.704 1.00 137.31 ? 26   DG  I C2    1 
ATOM   8109  N  N2    . DG  I 5  99  ? 12.660  -32.587 27.019 1.00 130.23 ? 26   DG  I N2    1 
ATOM   8110  N  N3    . DG  I 5  99  ? 11.336  -34.470 27.183 1.00 132.73 ? 26   DG  I N3    1 
ATOM   8111  C  C4    . DG  I 5  99  ? 11.243  -35.751 26.766 1.00 120.16 ? 26   DG  I C4    1 
ATOM   8112  P  P     . DC  I 5  100 ? 5.038   -35.221 29.410 1.00 71.28  ? 27   DC  I P     1 
ATOM   8113  O  OP1   . DC  I 5  100 ? 4.926   -35.642 30.819 1.00 72.21  ? 27   DC  I OP1   1 
ATOM   8114  O  OP2   . DC  I 5  100 ? 4.096   -35.727 28.388 1.00 67.62  ? 27   DC  I OP2   1 
ATOM   8115  O  "O5'" . DC  I 5  100 ? 4.977   -33.633 29.343 1.00 91.06  ? 27   DC  I "O5'" 1 
ATOM   8116  C  "C5'" . DC  I 5  100 ? 6.039   -32.845 29.920 1.00 99.84  ? 27   DC  I "C5'" 1 
ATOM   8117  C  "C4'" . DC  I 5  100 ? 6.704   -31.983 28.870 1.00 100.46 ? 27   DC  I "C4'" 1 
ATOM   8118  O  "O4'" . DC  I 5  100 ? 7.569   -32.755 28.002 1.00 96.32  ? 27   DC  I "O4'" 1 
ATOM   8119  C  "C3'" . DC  I 5  100 ? 5.736   -31.232 27.955 1.00 97.77  ? 27   DC  I "C3'" 1 
ATOM   8120  O  "O3'" . DC  I 5  100 ? 5.985   -29.844 28.178 1.00 108.12 ? 27   DC  I "O3'" 1 
ATOM   8121  C  "C2'" . DC  I 5  100 ? 6.109   -31.691 26.553 1.00 93.64  ? 27   DC  I "C2'" 1 
ATOM   8122  C  "C1'" . DC  I 5  100 ? 7.542   -32.156 26.725 1.00 94.60  ? 27   DC  I "C1'" 1 
ATOM   8123  N  N1    . DC  I 5  100 ? 8.073   -33.134 25.750 1.00 98.54  ? 27   DC  I N1    1 
ATOM   8124  C  C2    . DC  I 5  100 ? 9.306   -32.871 25.133 1.00 106.51 ? 27   DC  I C2    1 
ATOM   8125  O  O2    . DC  I 5  100 ? 9.896   -31.812 25.394 1.00 100.90 ? 27   DC  I O2    1 
ATOM   8126  N  N3    . DC  I 5  100 ? 9.813   -33.770 24.258 1.00 106.22 ? 27   DC  I N3    1 
ATOM   8127  C  C4    . DC  I 5  100 ? 9.148   -34.899 24.001 1.00 106.57 ? 27   DC  I C4    1 
ATOM   8128  N  N4    . DC  I 5  100 ? 9.689   -35.757 23.134 1.00 105.14 ? 27   DC  I N4    1 
ATOM   8129  C  C5    . DC  I 5  100 ? 7.894   -35.193 24.615 1.00 104.38 ? 27   DC  I C5    1 
ATOM   8130  C  C6    . DC  I 5  100 ? 7.402   -34.295 25.482 1.00 97.82  ? 27   DC  I C6    1 
ATOM   8131  P  P     . DA  I 5  101 ? 4.862   -28.747 27.881 1.00 113.38 ? 28   DA  I P     1 
ATOM   8132  O  OP1   . DA  I 5  101 ? 4.478   -28.137 29.175 1.00 76.73  ? 28   DA  I OP1   1 
ATOM   8133  O  OP2   . DA  I 5  101 ? 3.836   -29.361 26.982 1.00 104.56 ? 28   DA  I OP2   1 
ATOM   8134  O  "O5'" . DA  I 5  101 ? 5.651   -27.629 27.059 1.00 120.23 ? 28   DA  I "O5'" 1 
ATOM   8135  C  "C5'" . DA  I 5  101 ? 7.068   -27.741 26.781 1.00 122.88 ? 28   DA  I "C5'" 1 
ATOM   8136  C  "C4'" . DA  I 5  101 ? 7.350   -27.710 25.295 1.00 120.15 ? 28   DA  I "C4'" 1 
ATOM   8137  O  "O4'" . DA  I 5  101 ? 7.636   -29.036 24.784 1.00 119.65 ? 28   DA  I "O4'" 1 
ATOM   8138  C  "C3'" . DA  I 5  101 ? 6.240   -27.154 24.396 1.00 124.85 ? 28   DA  I "C3'" 1 
ATOM   8139  O  "O3'" . DA  I 5  101 ? 6.893   -26.325 23.435 1.00 138.15 ? 28   DA  I "O3'" 1 
ATOM   8140  C  "C2'" . DA  I 5  101 ? 5.723   -28.387 23.674 1.00 120.96 ? 28   DA  I "C2'" 1 
ATOM   8141  C  "C1'" . DA  I 5  101 ? 7.035   -29.112 23.502 1.00 119.75 ? 28   DA  I "C1'" 1 
ATOM   8142  N  N9    . DA  I 5  101 ? 6.998   -30.513 23.084 1.00 118.50 ? 28   DA  I N9    1 
ATOM   8143  C  C8    . DA  I 5  101 ? 6.133   -31.516 23.450 1.00 119.07 ? 28   DA  I C8    1 
ATOM   8144  N  N7    . DA  I 5  101 ? 6.393   -32.670 22.885 1.00 117.27 ? 28   DA  I N7    1 
ATOM   8145  C  C5    . DA  I 5  101 ? 7.492   -32.406 22.079 1.00 114.36 ? 28   DA  I C5    1 
ATOM   8146  C  C6    . DA  I 5  101 ? 8.243   -33.215 21.208 1.00 106.04 ? 28   DA  I C6    1 
ATOM   8147  N  N6    . DA  I 5  101 ? 7.989   -34.510 20.999 1.00 101.29 ? 28   DA  I N6    1 
ATOM   8148  N  N1    . DA  I 5  101 ? 9.276   -32.642 20.552 1.00 103.42 ? 28   DA  I N1    1 
ATOM   8149  C  C2    . DA  I 5  101 ? 9.529   -31.343 20.762 1.00 101.58 ? 28   DA  I C2    1 
ATOM   8150  N  N3    . DA  I 5  101 ? 8.894   -30.480 21.554 1.00 102.53 ? 28   DA  I N3    1 
ATOM   8151  C  C4    . DA  I 5  101 ? 7.875   -31.082 22.192 1.00 111.04 ? 28   DA  I C4    1 
ATOM   8152  P  P     . DG  I 5  102 ? 6.229   -24.971 22.931 1.00 139.43 ? 29   DG  I P     1 
ATOM   8153  O  OP1   . DG  I 5  102 ? 6.607   -23.897 23.888 1.00 127.87 ? 29   DG  I OP1   1 
ATOM   8154  O  OP2   . DG  I 5  102 ? 4.794   -25.242 22.656 1.00 126.57 ? 29   DG  I OP2   1 
ATOM   8155  O  "O5'" . DG  I 5  102 ? 6.965   -24.745 21.536 1.00 129.30 ? 29   DG  I "O5'" 1 
ATOM   8156  C  "C5'" . DG  I 5  102 ? 8.405   -24.667 21.450 1.00 133.48 ? 29   DG  I "C5'" 1 
ATOM   8157  C  "C4'" . DG  I 5  102 ? 8.894   -25.277 20.157 1.00 135.68 ? 29   DG  I "C4'" 1 
ATOM   8158  O  "O4'" . DG  I 5  102 ? 8.657   -26.704 20.188 1.00 139.13 ? 29   DG  I "O4'" 1 
ATOM   8159  C  "C3'" . DG  I 5  102 ? 8.206   -24.749 18.894 1.00 143.10 ? 29   DG  I "C3'" 1 
ATOM   8160  O  "O3'" . DG  I 5  102 ? 9.155   -24.350 17.898 1.00 153.00 ? 29   DG  I "O3'" 1 
ATOM   8161  C  "C2'" . DG  I 5  102 ? 7.339   -25.908 18.431 1.00 139.69 ? 29   DG  I "C2'" 1 
ATOM   8162  C  "C1'" . DG  I 5  102 ? 8.058   -27.126 18.978 1.00 135.96 ? 29   DG  I "C1'" 1 
ATOM   8163  N  N9    . DG  I 5  102 ? 7.173   -28.244 19.285 1.00 140.50 ? 29   DG  I N9    1 
ATOM   8164  C  C8    . DG  I 5  102 ? 6.064   -28.220 20.097 1.00 141.66 ? 29   DG  I C8    1 
ATOM   8165  N  N7    . DG  I 5  102 ? 5.459   -29.374 20.173 1.00 144.98 ? 29   DG  I N7    1 
ATOM   8166  C  C5    . DG  I 5  102 ? 6.212   -30.211 19.361 1.00 142.39 ? 29   DG  I C5    1 
ATOM   8167  C  C6    . DG  I 5  102 ? 6.048   -31.588 19.056 1.00 137.41 ? 29   DG  I C6    1 
ATOM   8168  O  O6    . DG  I 5  102 ? 5.170   -32.364 19.450 1.00 123.39 ? 29   DG  I O6    1 
ATOM   8169  N  N1    . DG  I 5  102 ? 7.040   -32.042 18.193 1.00 146.00 ? 29   DG  I N1    1 
ATOM   8170  C  C2    . DG  I 5  102 ? 8.061   -31.273 17.689 1.00 150.42 ? 29   DG  I C2    1 
ATOM   8171  N  N2    . DG  I 5  102 ? 8.920   -31.895 16.870 1.00 153.59 ? 29   DG  I N2    1 
ATOM   8172  N  N3    . DG  I 5  102 ? 8.227   -29.990 17.968 1.00 142.31 ? 29   DG  I N3    1 
ATOM   8173  C  C4    . DG  I 5  102 ? 7.274   -29.528 18.805 1.00 142.56 ? 29   DG  I C4    1 
ATOM   8174  P  P     . DT  I 5  103 ? 8.675   -23.496 16.618 1.00 166.67 ? 30   DT  I P     1 
ATOM   8175  O  OP1   . DT  I 5  103 ? 9.767   -22.549 16.267 1.00 161.71 ? 30   DT  I OP1   1 
ATOM   8176  O  OP2   . DT  I 5  103 ? 7.305   -22.979 16.887 1.00 149.23 ? 30   DT  I OP2   1 
ATOM   8177  O  "O5'" . DT  I 5  103 ? 8.547   -24.594 15.468 1.00 159.00 ? 30   DT  I "O5'" 1 
ATOM   8178  C  "C5'" . DT  I 5  103 ? 9.504   -24.669 14.391 1.00 152.01 ? 30   DT  I "C5'" 1 
ATOM   8179  C  "C4'" . DT  I 5  103 ? 9.346   -25.960 13.620 1.00 152.24 ? 30   DT  I "C4'" 1 
ATOM   8180  O  "O4'" . DT  I 5  103 ? 8.777   -26.989 14.461 1.00 141.72 ? 30   DT  I "O4'" 1 
ATOM   8181  C  "C3'" . DT  I 5  103 ? 8.440   -25.881 12.386 1.00 154.51 ? 30   DT  I "C3'" 1 
ATOM   8182  O  "O3'" . DT  I 5  103 ? 9.213   -25.894 11.177 1.00 168.77 ? 30   DT  I "O3'" 1 
ATOM   8183  C  "C2'" . DT  I 5  103 ? 7.550   -27.113 12.489 1.00 154.33 ? 30   DT  I "C2'" 1 
ATOM   8184  C  "C1'" . DT  I 5  103 ? 8.163   -27.933 13.611 1.00 146.32 ? 30   DT  I "C1'" 1 
ATOM   8185  N  N1    . DT  I 5  103 ? 7.180   -28.695 14.405 1.00 150.53 ? 30   DT  I N1    1 
ATOM   8186  C  C2    . DT  I 5  103 ? 7.138   -30.065 14.270 1.00 154.19 ? 30   DT  I C2    1 
ATOM   8187  O  O2    . DT  I 5  103 ? 7.890   -30.689 13.538 1.00 152.22 ? 30   DT  I O2    1 
ATOM   8188  N  N3    . DT  I 5  103 ? 6.180   -30.686 15.035 1.00 155.73 ? 30   DT  I N3    1 
ATOM   8189  C  C4    . DT  I 5  103 ? 5.280   -30.084 15.895 1.00 150.99 ? 30   DT  I C4    1 
ATOM   8190  O  O4    . DT  I 5  103 ? 4.478   -30.772 16.520 1.00 149.75 ? 30   DT  I O4    1 
ATOM   8191  C  C5    . DT  I 5  103 ? 5.373   -28.644 15.978 1.00 150.08 ? 30   DT  I C5    1 
ATOM   8192  C  C7    . DT  I 5  103 ? 4.438   -27.906 16.882 1.00 147.42 ? 30   DT  I C7    1 
ATOM   8193  C  C6    . DT  I 5  103 ? 6.306   -28.030 15.239 1.00 154.06 ? 30   DT  I C6    1 
ATOM   8194  P  P     . DT  I 5  104 ? 8.516   -25.595 9.759  1.00 158.77 ? 31   DT  I P     1 
ATOM   8195  O  OP1   . DT  I 5  104 ? 9.584   -25.281 8.775  1.00 162.37 ? 31   DT  I OP1   1 
ATOM   8196  O  OP2   . DT  I 5  104 ? 7.402   -24.636 9.980  1.00 153.44 ? 31   DT  I OP2   1 
ATOM   8197  O  "O5'" . DT  I 5  104 ? 7.899   -27.003 9.352  1.00 154.66 ? 31   DT  I "O5'" 1 
ATOM   8198  C  "C5'" . DT  I 5  104 ? 8.735   -28.159 9.169  1.00 153.35 ? 31   DT  I "C5'" 1 
ATOM   8199  C  "C4'" . DT  I 5  104 ? 7.893   -29.320 8.693  1.00 160.33 ? 31   DT  I "C4'" 1 
ATOM   8200  O  "O4'" . DT  I 5  104 ? 7.108   -29.843 9.793  1.00 157.71 ? 31   DT  I "O4'" 1 
ATOM   8201  C  "C3'" . DT  I 5  104 ? 6.888   -28.971 7.589  1.00 161.26 ? 31   DT  I "C3'" 1 
ATOM   8202  O  "O3'" . DT  I 5  104 ? 6.870   -29.995 6.594  1.00 162.28 ? 31   DT  I "O3'" 1 
ATOM   8203  C  "C2'" . DT  I 5  104 ? 5.554   -28.955 8.310  1.00 158.30 ? 31   DT  I "C2'" 1 
ATOM   8204  C  "C1'" . DT  I 5  104 ? 5.780   -30.043 9.338  1.00 159.12 ? 31   DT  I "C1'" 1 
ATOM   8205  N  N1    . DT  I 5  104 ? 4.883   -30.020 10.511 1.00 160.34 ? 31   DT  I N1    1 
ATOM   8206  C  C2    . DT  I 5  104 ? 4.253   -31.192 10.870 1.00 161.80 ? 31   DT  I C2    1 
ATOM   8207  O  O2    . DT  I 5  104 ? 4.392   -32.240 10.260 1.00 148.36 ? 31   DT  I O2    1 
ATOM   8208  N  N3    . DT  I 5  104 ? 3.440   -31.089 11.971 1.00 164.71 ? 31   DT  I N3    1 
ATOM   8209  C  C4    . DT  I 5  104 ? 3.203   -29.959 12.732 1.00 164.79 ? 31   DT  I C4    1 
ATOM   8210  O  O4    . DT  I 5  104 ? 2.446   -30.021 13.697 1.00 166.97 ? 31   DT  I O4    1 
ATOM   8211  C  C5    . DT  I 5  104 ? 3.899   -28.767 12.300 1.00 162.69 ? 31   DT  I C5    1 
ATOM   8212  C  C7    . DT  I 5  104 ? 3.700   -27.493 13.060 1.00 162.00 ? 31   DT  I C7    1 
ATOM   8213  C  C6    . DT  I 5  104 ? 4.694   -28.857 11.226 1.00 162.88 ? 31   DT  I C6    1 
ATOM   8214  P  P     . DT  I 5  105 ? 6.697   -29.613 5.059  1.00 167.95 ? 32   DT  I P     1 
ATOM   8215  O  OP1   . DT  I 5  105 ? 8.047   -29.587 4.444  1.00 179.64 ? 32   DT  I OP1   1 
ATOM   8216  O  OP2   . DT  I 5  105 ? 5.832   -28.407 4.983  1.00 146.68 ? 32   DT  I OP2   1 
ATOM   8217  O  "O5'" . DT  I 5  105 ? 5.912   -30.866 4.464  1.00 171.55 ? 32   DT  I "O5'" 1 
ATOM   8218  C  "C5'" . DT  I 5  105 ? 6.343   -32.214 4.733  1.00 172.81 ? 32   DT  I "C5'" 1 
ATOM   8219  C  "C4'" . DT  I 5  105 ? 5.149   -33.109 4.966  1.00 177.69 ? 32   DT  I "C4'" 1 
ATOM   8220  O  "O4'" . DT  I 5  105 ? 4.574   -32.861 6.272  1.00 183.14 ? 32   DT  I "O4'" 1 
ATOM   8221  C  "C3'" . DT  I 5  105 ? 4.005   -32.942 3.955  1.00 177.82 ? 32   DT  I "C3'" 1 
ATOM   8222  O  "O3'" . DT  I 5  105 ? 3.926   -34.143 3.173  1.00 173.54 ? 32   DT  I "O3'" 1 
ATOM   8223  C  "C2'" . DT  I 5  105 ? 2.800   -32.578 4.816  1.00 185.86 ? 32   DT  I "C2'" 1 
ATOM   8224  C  "C1'" . DT  I 5  105 ? 3.191   -33.131 6.172  1.00 190.54 ? 32   DT  I "C1'" 1 
ATOM   8225  N  N1    . DT  I 5  105 ? 2.507   -32.532 7.345  1.00 195.71 ? 32   DT  I N1    1 
ATOM   8226  C  C2    . DT  I 5  105 ? 1.893   -33.384 8.237  1.00 195.55 ? 32   DT  I C2    1 
ATOM   8227  O  O2    . DT  I 5  105 ? 1.902   -34.599 8.115  1.00 186.64 ? 32   DT  I O2    1 
ATOM   8228  N  N3    . DT  I 5  105 ? 1.268   -32.759 9.289  1.00 195.34 ? 32   DT  I N3    1 
ATOM   8229  C  C4    . DT  I 5  105 ? 1.191   -31.399 9.526  1.00 192.47 ? 32   DT  I C4    1 
ATOM   8230  O  O4    . DT  I 5  105 ? 0.596   -30.983 10.517 1.00 183.86 ? 32   DT  I O4    1 
ATOM   8231  C  C5    . DT  I 5  105 ? 1.850   -30.564 8.546  1.00 193.33 ? 32   DT  I C5    1 
ATOM   8232  C  C7    . DT  I 5  105 ? 1.821   -29.078 8.721  1.00 187.89 ? 32   DT  I C7    1 
ATOM   8233  C  C6    . DT  I 5  105 ? 2.464   -31.164 7.518  1.00 197.07 ? 32   DT  I C6    1 
ATOM   8234  P  P     . DC  I 5  106 ? 2.516   -34.821 2.827  1.00 181.47 ? 33   DC  I P     1 
ATOM   8235  O  OP1   . DC  I 5  106 ? 2.771   -35.974 1.924  1.00 182.92 ? 33   DC  I OP1   1 
ATOM   8236  O  OP2   . DC  I 5  106 ? 1.583   -33.748 2.392  1.00 178.79 ? 33   DC  I OP2   1 
ATOM   8237  O  "O5'" . DC  I 5  106 ? 2.057   -35.410 4.234  1.00 179.70 ? 33   DC  I "O5'" 1 
ATOM   8238  C  "C5'" . DC  I 5  106 ? 1.543   -36.746 4.360  1.00 176.20 ? 33   DC  I "C5'" 1 
ATOM   8239  C  "C4'" . DC  I 5  106 ? 0.053   -36.707 4.609  1.00 171.49 ? 33   DC  I "C4'" 1 
ATOM   8240  O  "O4'" . DC  I 5  106 ? -0.286  -35.610 5.492  1.00 173.96 ? 33   DC  I "O4'" 1 
ATOM   8241  C  "C3'" . DC  I 5  106 ? -0.817  -36.529 3.362  1.00 158.38 ? 33   DC  I "C3'" 1 
ATOM   8242  O  "O3'" . DC  I 5  106 ? -1.909  -37.430 3.480  1.00 152.72 ? 33   DC  I "O3'" 1 
ATOM   8243  C  "C2'" . DC  I 5  106 ? -1.331  -35.106 3.475  1.00 154.27 ? 33   DC  I "C2'" 1 
ATOM   8244  C  "C1'" . DC  I 5  106 ? -1.430  -34.949 4.980  1.00 159.31 ? 33   DC  I "C1'" 1 
ATOM   8245  N  N1    . DC  I 5  106 ? -1.432  -33.574 5.507  1.00 154.34 ? 33   DC  I N1    1 
ATOM   8246  C  C2    . DC  I 5  106 ? -1.990  -33.344 6.769  1.00 144.26 ? 33   DC  I C2    1 
ATOM   8247  O  O2    . DC  I 5  106 ? -2.476  -34.299 7.392  1.00 129.46 ? 33   DC  I O2    1 
ATOM   8248  N  N3    . DC  I 5  106 ? -1.987  -32.089 7.274  1.00 150.71 ? 33   DC  I N3    1 
ATOM   8249  C  C4    . DC  I 5  106 ? -1.452  -31.087 6.571  1.00 150.43 ? 33   DC  I C4    1 
ATOM   8250  N  N4    . DC  I 5  106 ? -1.471  -29.864 7.106  1.00 141.10 ? 33   DC  I N4    1 
ATOM   8251  C  C5    . DC  I 5  106 ? -0.871  -31.296 5.287  1.00 158.06 ? 33   DC  I C5    1 
ATOM   8252  C  C6    . DC  I 5  106 ? -0.878  -32.543 4.800  1.00 158.94 ? 33   DC  I C6    1 
ATOM   8253  P  P     . DC  I 5  107 ? -2.646  -37.955 2.188  1.00 153.32 ? 34   DC  I P     1 
ATOM   8254  O  OP1   . DC  I 5  107 ? -1.702  -38.840 1.466  1.00 168.11 ? 34   DC  I OP1   1 
ATOM   8255  O  OP2   . DC  I 5  107 ? -3.239  -36.783 1.492  1.00 144.34 ? 34   DC  I OP2   1 
ATOM   8256  O  "O5'" . DC  I 5  107 ? -3.816  -38.850 2.795  1.00 149.62 ? 34   DC  I "O5'" 1 
ATOM   8257  C  "C5'" . DC  I 5  107 ? -3.708  -39.427 4.117  1.00 151.68 ? 34   DC  I "C5'" 1 
ATOM   8258  C  "C4'" . DC  I 5  107 ? -4.842  -38.961 5.005  1.00 145.90 ? 34   DC  I "C4'" 1 
ATOM   8259  O  "O4'" . DC  I 5  107 ? -4.674  -37.568 5.369  1.00 145.41 ? 34   DC  I "O4'" 1 
ATOM   8260  C  "C3'" . DC  I 5  107 ? -6.241  -39.062 4.385  1.00 143.26 ? 34   DC  I "C3'" 1 
ATOM   8261  O  "O3'" . DC  I 5  107 ? -7.192  -39.521 5.344  1.00 132.66 ? 34   DC  I "O3'" 1 
ATOM   8262  C  "C2'" . DC  I 5  107 ? -6.600  -37.621 4.081  1.00 143.06 ? 34   DC  I "C2'" 1 
ATOM   8263  C  "C1'" . DC  I 5  107 ? -5.940  -36.939 5.257  1.00 144.21 ? 34   DC  I "C1'" 1 
ATOM   8264  N  N1    . DC  I 5  107 ? -5.731  -35.488 5.135  1.00 143.97 ? 34   DC  I N1    1 
ATOM   8265  C  C2    . DC  I 5  107 ? -6.142  -34.665 6.188  1.00 140.86 ? 34   DC  I C2    1 
ATOM   8266  O  O2    . DC  I 5  107 ? -6.664  -35.186 7.186  1.00 124.85 ? 34   DC  I O2    1 
ATOM   8267  N  N3    . DC  I 5  107 ? -5.953  -33.328 6.096  1.00 147.89 ? 34   DC  I N3    1 
ATOM   8268  C  C4    . DC  I 5  107 ? -5.383  -32.809 5.005  1.00 151.72 ? 34   DC  I C4    1 
ATOM   8269  N  N4    . DC  I 5  107 ? -5.220  -31.484 4.953  1.00 154.06 ? 34   DC  I N4    1 
ATOM   8270  C  C5    . DC  I 5  107 ? -4.956  -33.624 3.918  1.00 147.30 ? 34   DC  I C5    1 
ATOM   8271  C  C6    . DC  I 5  107 ? -5.150  -34.945 4.022  1.00 145.87 ? 34   DC  I C6    1 
ATOM   8272  P  P     . DA  I 5  108 ? -7.371  -41.075 5.615  1.00 138.31 ? 35   DA  I P     1 
ATOM   8273  O  OP1   . DA  I 5  108 ? -6.040  -41.651 5.935  1.00 118.99 ? 35   DA  I OP1   1 
ATOM   8274  O  OP2   . DA  I 5  108 ? -8.191  -41.639 4.513  1.00 136.03 ? 35   DA  I OP2   1 
ATOM   8275  O  "O5'" . DA  I 5  108 ? -8.219  -41.097 6.960  1.00 143.58 ? 35   DA  I "O5'" 1 
ATOM   8276  C  "C5'" . DA  I 5  108 ? -7.697  -40.499 8.166  1.00 141.49 ? 35   DA  I "C5'" 1 
ATOM   8277  C  "C4'" . DA  I 5  108 ? -8.709  -39.568 8.796  1.00 131.58 ? 35   DA  I "C4'" 1 
ATOM   8278  O  "O4'" . DA  I 5  108 ? -8.634  -38.262 8.174  1.00 120.00 ? 35   DA  I "O4'" 1 
ATOM   8279  C  "C3'" . DA  I 5  108 ? -10.178 -40.008 8.702  1.00 126.94 ? 35   DA  I "C3'" 1 
ATOM   8280  O  "O3'" . DA  I 5  108 ? -10.739 -40.074 10.026 1.00 118.23 ? 35   DA  I "O3'" 1 
ATOM   8281  C  "C2'" . DA  I 5  108 ? -10.797 -38.993 7.751  1.00 121.11 ? 35   DA  I "C2'" 1 
ATOM   8282  C  "C1'" . DA  I 5  108 ? -9.948  -37.767 8.005  1.00 118.34 ? 35   DA  I "C1'" 1 
ATOM   8283  N  N9    . DA  I 5  108 ? -9.920  -36.794 6.920  1.00 114.73 ? 35   DA  I N9    1 
ATOM   8284  C  C8    . DA  I 5  108 ? -9.975  -37.035 5.571  1.00 121.72 ? 35   DA  I C8    1 
ATOM   8285  N  N7    . DA  I 5  108 ? -9.900  -35.952 4.839  1.00 124.80 ? 35   DA  I N7    1 
ATOM   8286  C  C5    . DA  I 5  108 ? -9.780  -34.928 5.768  1.00 118.24 ? 35   DA  I C5    1 
ATOM   8287  C  C6    . DA  I 5  108 ? -9.653  -33.534 5.630  1.00 126.47 ? 35   DA  I C6    1 
ATOM   8288  N  N6    . DA  I 5  108 ? -9.638  -32.904 4.453  1.00 133.27 ? 35   DA  I N6    1 
ATOM   8289  N  N1    . DA  I 5  108 ? -9.558  -32.797 6.759  1.00 121.21 ? 35   DA  I N1    1 
ATOM   8290  C  C2    . DA  I 5  108 ? -9.579  -33.428 7.939  1.00 123.83 ? 35   DA  I C2    1 
ATOM   8291  N  N3    . DA  I 5  108 ? -9.689  -34.731 8.195  1.00 127.16 ? 35   DA  I N3    1 
ATOM   8292  C  C4    . DA  I 5  108 ? -9.790  -35.433 7.054  1.00 116.69 ? 35   DA  I C4    1 
ATOM   8293  P  P     . DA  I 5  109 ? -12.297 -39.777 10.291 1.00 119.04 ? 36   DA  I P     1 
ATOM   8294  O  OP1   . DA  I 5  109 ? -12.619 -40.229 11.665 1.00 104.91 ? 36   DA  I OP1   1 
ATOM   8295  O  OP2   . DA  I 5  109 ? -13.081 -40.304 9.147  1.00 123.27 ? 36   DA  I OP2   1 
ATOM   8296  O  "O5'" . DA  I 5  109 ? -12.382 -38.187 10.241 1.00 119.38 ? 36   DA  I "O5'" 1 
ATOM   8297  C  "C5'" . DA  I 5  109 ? -11.727 -37.365 11.229 1.00 116.25 ? 36   DA  I "C5'" 1 
ATOM   8298  C  "C4'" . DA  I 5  109 ? -12.365 -35.996 11.270 1.00 117.45 ? 36   DA  I "C4'" 1 
ATOM   8299  O  "O4'" . DA  I 5  109 ? -12.089 -35.281 10.040 1.00 119.24 ? 36   DA  I "O4'" 1 
ATOM   8300  C  "C3'" . DA  I 5  109 ? -13.892 -35.996 11.419 1.00 119.75 ? 36   DA  I "C3'" 1 
ATOM   8301  O  "O3'" . DA  I 5  109 ? -14.272 -34.946 12.319 1.00 123.14 ? 36   DA  I "O3'" 1 
ATOM   8302  C  "C2'" . DA  I 5  109 ? -14.372 -35.722 10.006 1.00 122.51 ? 36   DA  I "C2'" 1 
ATOM   8303  C  "C1'" . DA  I 5  109 ? -13.310 -34.743 9.553  1.00 123.16 ? 36   DA  I "C1'" 1 
ATOM   8304  N  N9    . DA  I 5  109 ? -13.191 -34.557 8.106  1.00 126.33 ? 36   DA  I N9    1 
ATOM   8305  C  C8    . DA  I 5  109 ? -13.397 -35.475 7.107  1.00 126.57 ? 36   DA  I C8    1 
ATOM   8306  N  N7    . DA  I 5  109 ? -13.230 -34.989 5.901  1.00 130.26 ? 36   DA  I N7    1 
ATOM   8307  C  C5    . DA  I 5  109 ? -12.910 -33.657 6.120  1.00 131.18 ? 36   DA  I C5    1 
ATOM   8308  C  C6    . DA  I 5  109 ? -12.611 -32.598 5.243  1.00 136.76 ? 36   DA  I C6    1 
ATOM   8309  N  N6    . DA  I 5  109 ? -12.591 -32.721 3.913  1.00 139.34 ? 36   DA  I N6    1 
ATOM   8310  N  N1    . DA  I 5  109 ? -12.325 -31.394 5.786  1.00 132.52 ? 36   DA  I N1    1 
ATOM   8311  C  C2    . DA  I 5  109 ? -12.341 -31.273 7.119  1.00 126.31 ? 36   DA  I C2    1 
ATOM   8312  N  N3    . DA  I 5  109 ? -12.605 -32.193 8.045  1.00 127.14 ? 36   DA  I N3    1 
ATOM   8313  C  C4    . DA  I 5  109 ? -12.884 -33.377 7.473  1.00 124.47 ? 36   DA  I C4    1 
ATOM   8314  P  P     . DA  I 5  110 ? -15.784 -34.818 12.855 1.00 120.59 ? 37   DA  I P     1 
ATOM   8315  O  OP1   . DA  I 5  110 ? -15.794 -35.169 14.297 1.00 114.55 ? 37   DA  I OP1   1 
ATOM   8316  O  OP2   . DA  I 5  110 ? -16.686 -35.519 11.900 1.00 103.28 ? 37   DA  I OP2   1 
ATOM   8317  O  "O5'" . DA  I 5  110 ? -16.060 -33.251 12.788 1.00 110.39 ? 37   DA  I "O5'" 1 
ATOM   8318  C  "C5'" . DA  I 5  110 ? -15.035 -32.298 13.126 1.00 102.03 ? 37   DA  I "C5'" 1 
ATOM   8319  C  "C4'" . DA  I 5  110 ? -15.325 -30.976 12.455 1.00 103.39 ? 37   DA  I "C4'" 1 
ATOM   8320  O  "O4'" . DA  I 5  110 ? -14.956 -31.060 11.055 1.00 105.90 ? 37   DA  I "O4'" 1 
ATOM   8321  C  "C3'" . DA  I 5  110 ? -16.793 -30.534 12.483 1.00 93.93  ? 37   DA  I "C3'" 1 
ATOM   8322  O  "O3'" . DA  I 5  110 ? -16.876 -29.116 12.694 1.00 90.01  ? 37   DA  I "O3'" 1 
ATOM   8323  C  "C2'" . DA  I 5  110 ? -17.297 -30.942 11.113 1.00 102.30 ? 37   DA  I "C2'" 1 
ATOM   8324  C  "C1'" . DA  I 5  110 ? -16.071 -30.691 10.253 1.00 114.29 ? 37   DA  I "C1'" 1 
ATOM   8325  N  N9    . DA  I 5  110 ? -16.034 -31.473 9.013  1.00 123.03 ? 37   DA  I N9    1 
ATOM   8326  C  C8    . DA  I 5  110 ? -16.264 -32.818 8.849  1.00 129.05 ? 37   DA  I C8    1 
ATOM   8327  N  N7    . DA  I 5  110 ? -16.193 -33.218 7.602  1.00 123.67 ? 37   DA  I N7    1 
ATOM   8328  C  C5    . DA  I 5  110 ? -15.917 -32.056 6.896  1.00 125.67 ? 37   DA  I C5    1 
ATOM   8329  C  C6    . DA  I 5  110 ? -15.726 -31.806 5.527  1.00 133.69 ? 37   DA  I C6    1 
ATOM   8330  N  N6    . DA  I 5  110 ? -15.782 -32.751 4.588  1.00 135.16 ? 37   DA  I N6    1 
ATOM   8331  N  N1    . DA  I 5  110 ? -15.460 -30.535 5.152  1.00 141.37 ? 37   DA  I N1    1 
ATOM   8332  C  C2    . DA  I 5  110 ? -15.397 -29.587 6.097  1.00 142.61 ? 37   DA  I C2    1 
ATOM   8333  N  N3    . DA  I 5  110 ? -15.564 -29.698 7.414  1.00 122.52 ? 37   DA  I N3    1 
ATOM   8334  C  C4    . DA  I 5  110 ? -15.823 -30.973 7.752  1.00 120.04 ? 37   DA  I C4    1 
ATOM   8335  P  P     . DT  I 5  111 ? -18.291 -28.353 12.607 1.00 91.08  ? 38   DT  I P     1 
ATOM   8336  O  OP1   . DT  I 5  111 ? -18.389 -27.391 13.741 1.00 79.04  ? 38   DT  I OP1   1 
ATOM   8337  O  OP2   . DT  I 5  111 ? -19.350 -29.380 12.405 1.00 81.09  ? 38   DT  I OP2   1 
ATOM   8338  O  "O5'" . DT  I 5  111 ? -18.121 -27.426 11.326 1.00 89.48  ? 38   DT  I "O5'" 1 
ATOM   8339  C  "C5'" . DT  I 5  111 ? -16.938 -26.614 11.161 1.00 106.58 ? 38   DT  I "C5'" 1 
ATOM   8340  C  "C4'" . DT  I 5  111 ? -17.010 -25.839 9.866  1.00 113.65 ? 38   DT  I "C4'" 1 
ATOM   8341  O  "O4'" . DT  I 5  111 ? -16.871 -26.753 8.746  1.00 119.90 ? 38   DT  I "O4'" 1 
ATOM   8342  C  "C3'" . DT  I 5  111 ? -18.330 -25.084 9.660  1.00 115.83 ? 38   DT  I "C3'" 1 
ATOM   8343  O  "O3'" . DT  I 5  111 ? -18.071 -23.707 9.339  1.00 113.75 ? 38   DT  I "O3'" 1 
ATOM   8344  C  "C2'" . DT  I 5  111 ? -19.038 -25.883 8.575  1.00 122.13 ? 38   DT  I "C2'" 1 
ATOM   8345  C  "C1'" . DT  I 5  111 ? -17.887 -26.495 7.790  1.00 124.82 ? 38   DT  I "C1'" 1 
ATOM   8346  N  N1    . DT  I 5  111 ? -18.196 -27.767 7.084  1.00 122.40 ? 38   DT  I N1    1 
ATOM   8347  C  C2    . DT  I 5  111 ? -18.020 -27.826 5.716  1.00 121.72 ? 38   DT  I C2    1 
ATOM   8348  O  O2    . DT  I 5  111 ? -17.607 -26.888 5.054  1.00 118.36 ? 38   DT  I O2    1 
ATOM   8349  N  N3    . DT  I 5  111 ? -18.332 -29.038 5.150  1.00 113.34 ? 38   DT  I N3    1 
ATOM   8350  C  C4    . DT  I 5  111 ? -18.793 -30.168 5.799  1.00 115.21 ? 38   DT  I C4    1 
ATOM   8351  O  O4    . DT  I 5  111 ? -19.024 -31.189 5.159  1.00 111.70 ? 38   DT  I O4    1 
ATOM   8352  C  C5    . DT  I 5  111 ? -18.962 -30.033 7.230  1.00 117.15 ? 38   DT  I C5    1 
ATOM   8353  C  C7    . DT  I 5  111 ? -19.463 -31.204 8.016  1.00 120.51 ? 38   DT  I C7    1 
ATOM   8354  C  C6    . DT  I 5  111 ? -18.659 -28.856 7.793  1.00 108.00 ? 38   DT  I C6    1 
ATOM   8355  P  P     . DA  I 5  112 ? -19.284 -22.651 9.172  1.00 115.36 ? 39   DA  I P     1 
ATOM   8356  O  OP1   . DA  I 5  112 ? -18.737 -21.278 9.324  1.00 108.30 ? 39   DA  I OP1   1 
ATOM   8357  O  OP2   . DA  I 5  112 ? -20.413 -23.095 10.025 1.00 108.27 ? 39   DA  I OP2   1 
ATOM   8358  O  "O5'" . DA  I 5  112 ? -19.703 -22.820 7.642  1.00 131.38 ? 39   DA  I "O5'" 1 
ATOM   8359  C  "C5'" . DA  I 5  112 ? -18.737 -22.715 6.573  1.00 133.52 ? 39   DA  I "C5'" 1 
ATOM   8360  C  "C4'" . DA  I 5  112 ? -19.396 -22.946 5.231  1.00 137.14 ? 39   DA  I "C4'" 1 
ATOM   8361  O  "O4'" . DA  I 5  112 ? -19.478 -24.365 4.946  1.00 133.91 ? 39   DA  I "O4'" 1 
ATOM   8362  C  "C3'" . DA  I 5  112 ? -20.824 -22.398 5.100  1.00 137.69 ? 39   DA  I "C3'" 1 
ATOM   8363  O  "O3'" . DA  I 5  112 ? -20.901 -21.462 4.017  1.00 140.90 ? 39   DA  I "O3'" 1 
ATOM   8364  C  "C2'" . DA  I 5  112 ? -21.678 -23.636 4.870  1.00 135.06 ? 39   DA  I "C2'" 1 
ATOM   8365  C  "C1'" . DA  I 5  112 ? -20.693 -24.615 4.270  1.00 132.99 ? 39   DA  I "C1'" 1 
ATOM   8366  N  N9    . DA  I 5  112 ? -21.049 -26.019 4.468  1.00 137.47 ? 39   DA  I N9    1 
ATOM   8367  C  C8    . DA  I 5  112 ? -21.219 -26.690 5.654  1.00 136.91 ? 39   DA  I C8    1 
ATOM   8368  N  N7    . DA  I 5  112 ? -21.567 -27.946 5.506  1.00 133.40 ? 39   DA  I N7    1 
ATOM   8369  C  C5    . DA  I 5  112 ? -21.645 -28.109 4.130  1.00 144.44 ? 39   DA  I C5    1 
ATOM   8370  C  C6    . DA  I 5  112 ? -21.972 -29.215 3.327  1.00 147.92 ? 39   DA  I C6    1 
ATOM   8371  N  N6    . DA  I 5  112 ? -22.291 -30.415 3.816  1.00 143.67 ? 39   DA  I N6    1 
ATOM   8372  N  N1    . DA  I 5  112 ? -21.960 -29.045 1.986  1.00 149.81 ? 39   DA  I N1    1 
ATOM   8373  C  C2    . DA  I 5  112 ? -21.640 -27.839 1.497  1.00 157.50 ? 39   DA  I C2    1 
ATOM   8374  N  N3    . DA  I 5  112 ? -21.312 -26.724 2.150  1.00 156.22 ? 39   DA  I N3    1 
ATOM   8375  C  C4    . DA  I 5  112 ? -21.334 -26.929 3.479  1.00 146.55 ? 39   DA  I C4    1 
ATOM   8376  P  P     . DC  I 5  113 ? -22.222 -20.573 3.803  1.00 135.70 ? 40   DC  I P     1 
ATOM   8377  O  OP1   . DC  I 5  113 ? -21.899 -19.172 4.177  1.00 124.58 ? 40   DC  I OP1   1 
ATOM   8378  O  OP2   . DC  I 5  113 ? -23.358 -21.256 4.478  1.00 123.34 ? 40   DC  I OP2   1 
ATOM   8379  O  "O5'" . DC  I 5  113 ? -22.430 -20.625 2.222  1.00 135.21 ? 40   DC  I "O5'" 1 
ATOM   8380  C  "C5'" . DC  I 5  113 ? -21.912 -21.704 1.407  1.00 130.87 ? 40   DC  I "C5'" 1 
ATOM   8381  C  "C4'" . DC  I 5  113 ? -23.032 -22.437 0.703  1.00 133.33 ? 40   DC  I "C4'" 1 
ATOM   8382  O  "O4'" . DC  I 5  113 ? -23.165 -23.767 1.256  1.00 128.89 ? 40   DC  I "O4'" 1 
ATOM   8383  C  "C3'" . DC  I 5  113 ? -24.424 -21.790 0.795  1.00 140.70 ? 40   DC  I "C3'" 1 
ATOM   8384  O  "O3'" . DC  I 5  113 ? -24.895 -21.368 -0.495 1.00 141.99 ? 40   DC  I "O3'" 1 
ATOM   8385  C  "C2'" . DC  I 5  113 ? -25.307 -22.871 1.404  1.00 137.73 ? 40   DC  I "C2'" 1 
ATOM   8386  C  "C1'" . DC  I 5  113 ? -24.524 -24.145 1.148  1.00 142.58 ? 40   DC  I "C1'" 1 
ATOM   8387  N  N1    . DC  I 5  113 ? -24.773 -25.250 2.094  1.00 141.64 ? 40   DC  I N1    1 
ATOM   8388  C  C2    . DC  I 5  113 ? -24.923 -26.552 1.592  1.00 142.71 ? 40   DC  I C2    1 
ATOM   8389  O  O2    . DC  I 5  113 ? -24.840 -26.739 0.368  1.00 126.57 ? 40   DC  I O2    1 
ATOM   8390  N  N3    . DC  I 5  113 ? -25.150 -27.570 2.454  1.00 146.08 ? 40   DC  I N3    1 
ATOM   8391  C  C4    . DC  I 5  113 ? -25.233 -27.328 3.765  1.00 136.58 ? 40   DC  I C4    1 
ATOM   8392  N  N4    . DC  I 5  113 ? -25.453 -28.361 4.578  1.00 134.19 ? 40   DC  I N4    1 
ATOM   8393  C  C5    . DC  I 5  113 ? -25.093 -26.013 4.300  1.00 128.98 ? 40   DC  I C5    1 
ATOM   8394  C  C6    . DC  I 5  113 ? -24.864 -25.015 3.438  1.00 129.41 ? 40   DC  I C6    1 
ATOM   8395  P  P     . DA  I 5  114 ? -26.378 -20.756 -0.662 1.00 137.79 ? 41   DA  I P     1 
ATOM   8396  O  OP1   . DA  I 5  114 ? -26.326 -19.698 -1.697 1.00 131.53 ? 41   DA  I OP1   1 
ATOM   8397  O  OP2   . DA  I 5  114 ? -26.893 -20.416 0.684  1.00 135.25 ? 41   DA  I OP2   1 
ATOM   8398  O  "O5'" . DA  I 5  114 ? -27.220 -21.998 -1.202 1.00 132.69 ? 41   DA  I "O5'" 1 
ATOM   8399  C  "C5'" . DA  I 5  114 ? -26.685 -22.892 -2.198 1.00 138.31 ? 41   DA  I "C5'" 1 
ATOM   8400  C  "C4'" . DA  I 5  114 ? -27.604 -24.076 -2.396 1.00 144.77 ? 41   DA  I "C4'" 1 
ATOM   8401  O  "O4'" . DA  I 5  114 ? -27.362 -25.061 -1.357 1.00 147.63 ? 41   DA  I "O4'" 1 
ATOM   8402  C  "C3'" . DA  I 5  114 ? -29.102 -23.759 -2.315 1.00 153.09 ? 41   DA  I "C3'" 1 
ATOM   8403  O  "O3'" . DA  I 5  114 ? -29.837 -24.614 -3.204 1.00 162.27 ? 41   DA  I "O3'" 1 
ATOM   8404  C  "C2'" . DA  I 5  114 ? -29.430 -24.132 -0.885 1.00 151.65 ? 41   DA  I "C2'" 1 
ATOM   8405  C  "C1'" . DA  I 5  114 ? -28.618 -25.400 -0.790 1.00 155.47 ? 41   DA  I "C1'" 1 
ATOM   8406  N  N9    . DA  I 5  114 ? -28.407 -25.902 0.565  1.00 160.35 ? 41   DA  I N9    1 
ATOM   8407  C  C8    . DA  I 5  114 ? -28.095 -25.194 1.701  1.00 163.80 ? 41   DA  I C8    1 
ATOM   8408  N  N7    . DA  I 5  114 ? -28.020 -25.935 2.780  1.00 153.78 ? 41   DA  I N7    1 
ATOM   8409  C  C5    . DA  I 5  114 ? -28.328 -27.211 2.329  1.00 158.13 ? 41   DA  I C5    1 
ATOM   8410  C  C6    . DA  I 5  114 ? -28.415 -28.449 2.986  1.00 154.80 ? 41   DA  I C6    1 
ATOM   8411  N  N6    . DA  I 5  114 ? -28.199 -28.604 4.293  1.00 139.96 ? 41   DA  I N6    1 
ATOM   8412  N  N1    . DA  I 5  114 ? -28.742 -29.533 2.247  1.00 153.68 ? 41   DA  I N1    1 
ATOM   8413  C  C2    . DA  I 5  114 ? -28.963 -29.372 0.936  1.00 150.20 ? 41   DA  I C2    1 
ATOM   8414  N  N3    . DA  I 5  114 ? -28.905 -28.261 0.204  1.00 154.62 ? 41   DA  I N3    1 
ATOM   8415  C  C4    . DA  I 5  114 ? -28.579 -27.204 0.969  1.00 157.46 ? 41   DA  I C4    1 
ATOM   8416  P  P     . DC  I 5  115 ? -31.438 -24.477 -3.363 1.00 152.97 ? 42   DC  I P     1 
ATOM   8417  O  OP1   . DC  I 5  115 ? -31.703 -23.541 -4.484 1.00 162.95 ? 42   DC  I OP1   1 
ATOM   8418  O  OP2   . DC  I 5  115 ? -32.041 -24.199 -2.037 1.00 136.00 ? 42   DC  I OP2   1 
ATOM   8419  O  "O5'" . DC  I 5  115 ? -31.895 -25.944 -3.798 1.00 165.05 ? 42   DC  I "O5'" 1 
ATOM   8420  C  "C5'" . DC  I 5  115 ? -30.971 -27.052 -3.897 1.00 171.58 ? 42   DC  I "C5'" 1 
ATOM   8421  C  "C4'" . DC  I 5  115 ? -31.515 -28.257 -3.164 1.00 173.47 ? 42   DC  I "C4'" 1 
ATOM   8422  O  "O4'" . DC  I 5  115 ? -31.127 -28.179 -1.772 1.00 170.29 ? 42   DC  I "O4'" 1 
ATOM   8423  C  "C3'" . DC  I 5  115 ? -33.045 -28.415 -3.189 1.00 169.85 ? 42   DC  I "C3'" 1 
ATOM   8424  O  "O3'" . DC  I 5  115 ? -33.392 -29.575 -3.973 1.00 166.39 ? 42   DC  I "O3'" 1 
ATOM   8425  C  "C2'" . DC  I 5  115 ? -33.448 -28.409 -1.720 1.00 173.74 ? 42   DC  I "C2'" 1 
ATOM   8426  C  "C1'" . DC  I 5  115 ? -32.161 -28.715 -0.973 1.00 170.71 ? 42   DC  I "C1'" 1 
ATOM   8427  N  N1    . DC  I 5  115 ? -32.085 -28.085 0.360  1.00 161.70 ? 42   DC  I N1    1 
ATOM   8428  C  C2    . DC  I 5  115 ? -32.256 -28.880 1.499  1.00 145.89 ? 42   DC  I C2    1 
ATOM   8429  O  O2    . DC  I 5  115 ? -32.441 -30.099 1.360  1.00 131.54 ? 42   DC  I O2    1 
ATOM   8430  N  N3    . DC  I 5  115 ? -32.210 -28.300 2.722  1.00 137.59 ? 42   DC  I N3    1 
ATOM   8431  C  C4    . DC  I 5  115 ? -32.012 -26.983 2.829  1.00 125.85 ? 42   DC  I C4    1 
ATOM   8432  N  N4    . DC  I 5  115 ? -31.972 -26.453 4.051  1.00 116.00 ? 42   DC  I N4    1 
ATOM   8433  C  C5    . DC  I 5  115 ? -31.842 -26.151 1.686  1.00 138.06 ? 42   DC  I C5    1 
ATOM   8434  C  C6    . DC  I 5  115 ? -31.894 -26.736 0.482  1.00 155.33 ? 42   DC  I C6    1 
ATOM   8435  P  P     . DT  I 5  116 ? -34.734 -30.441 -3.695 1.00 156.85 ? 43   DT  I P     1 
ATOM   8436  O  OP1   . DT  I 5  116 ? -35.003 -31.262 -4.907 1.00 146.59 ? 43   DT  I OP1   1 
ATOM   8437  O  OP2   . DT  I 5  116 ? -35.793 -29.528 -3.180 1.00 135.70 ? 43   DT  I OP2   1 
ATOM   8438  O  "O5'" . DT  I 5  116 ? -34.277 -31.420 -2.523 1.00 159.91 ? 43   DT  I "O5'" 1 
ATOM   8439  C  "C5'" . DT  I 5  116 ? -34.678 -32.803 -2.466 1.00 153.37 ? 43   DT  I "C5'" 1 
ATOM   8440  C  "C4'" . DT  I 5  116 ? -35.543 -33.035 -1.250 1.00 148.02 ? 43   DT  I "C4'" 1 
ATOM   8441  O  "O4'" . DT  I 5  116 ? -35.153 -32.123 -0.197 1.00 157.40 ? 43   DT  I "O4'" 1 
ATOM   8442  C  "C3'" . DT  I 5  116 ? -37.040 -32.801 -1.486 1.00 143.79 ? 43   DT  I "C3'" 1 
ATOM   8443  O  "O3'" . DT  I 5  116 ? -37.735 -34.059 -1.572 1.00 143.19 ? 43   DT  I "O3'" 1 
ATOM   8444  C  "C2'" . DT  I 5  116 ? -37.457 -31.833 -0.386 1.00 150.04 ? 43   DT  I "C2'" 1 
ATOM   8445  C  "C1'" . DT  I 5  116 ? -36.294 -31.866 0.595  1.00 157.74 ? 43   DT  I "C1'" 1 
ATOM   8446  N  N1    . DT  I 5  116 ? -36.064 -30.616 1.364  1.00 152.00 ? 43   DT  I N1    1 
ATOM   8447  C  C2    . DT  I 5  116 ? -35.833 -30.716 2.720  1.00 133.16 ? 43   DT  I C2    1 
ATOM   8448  O  O2    . DT  I 5  116 ? -35.774 -31.781 3.312  1.00 118.17 ? 43   DT  I O2    1 
ATOM   8449  N  N3    . DT  I 5  116 ? -35.663 -29.515 3.361  1.00 131.92 ? 43   DT  I N3    1 
ATOM   8450  C  C4    . DT  I 5  116 ? -35.704 -28.254 2.798  1.00 143.92 ? 43   DT  I C4    1 
ATOM   8451  O  O4    . DT  I 5  116 ? -35.520 -27.266 3.501  1.00 151.31 ? 43   DT  I O4    1 
ATOM   8452  C  C5    . DT  I 5  116 ? -35.968 -28.221 1.377  1.00 146.70 ? 43   DT  I C5    1 
ATOM   8453  C  C7    . DT  I 5  116 ? -36.036 -26.899 0.681  1.00 145.17 ? 43   DT  I C7    1 
ATOM   8454  C  C6    . DT  I 5  116 ? -36.135 -29.388 0.740  1.00 150.97 ? 43   DT  I C6    1 
ATOM   8455  P  P     . DT  I 5  117 ? -38.569 -34.663 -0.333 1.00 143.86 ? 44   DT  I P     1 
ATOM   8456  O  OP1   . DT  I 5  117 ? -38.859 -36.091 -0.623 1.00 132.32 ? 44   DT  I OP1   1 
ATOM   8457  O  OP2   . DT  I 5  117 ? -39.700 -33.744 -0.040 1.00 135.93 ? 44   DT  I OP2   1 
ATOM   8458  O  "O5'" . DT  I 5  117 ? -37.516 -34.619 0.863  1.00 164.10 ? 44   DT  I "O5'" 1 
ATOM   8459  C  "C5'" . DT  I 5  117 ? -37.068 -35.814 1.540  1.00 158.13 ? 44   DT  I "C5'" 1 
ATOM   8460  C  "C4'" . DT  I 5  117 ? -37.371 -35.735 3.020  1.00 144.75 ? 44   DT  I "C4'" 1 
ATOM   8461  O  "O4'" . DT  I 5  117 ? -37.301 -34.366 3.491  1.00 143.04 ? 44   DT  I "O4'" 1 
ATOM   8462  C  "C3'" . DT  I 5  117 ? -38.750 -36.256 3.442  1.00 134.82 ? 44   DT  I "C3'" 1 
ATOM   8463  O  "O3'" . DT  I 5  117 ? -38.523 -37.162 4.526  1.00 130.62 ? 44   DT  I "O3'" 1 
ATOM   8464  C  "C2'" . DT  I 5  117 ? -39.509 -34.997 3.832  1.00 131.15 ? 44   DT  I "C2'" 1 
ATOM   8465  C  "C1'" . DT  I 5  117 ? -38.384 -34.146 4.379  1.00 140.49 ? 44   DT  I "C1'" 1 
ATOM   8466  N  N1    . DT  I 5  117 ? -38.627 -32.689 4.463  1.00 139.38 ? 44   DT  I N1    1 
ATOM   8467  C  C2    . DT  I 5  117 ? -38.511 -32.087 5.698  1.00 133.43 ? 44   DT  I C2    1 
ATOM   8468  O  O2    . DT  I 5  117 ? -38.241 -32.702 6.718  1.00 123.88 ? 44   DT  I O2    1 
ATOM   8469  N  N3    . DT  I 5  117 ? -38.732 -30.733 5.699  1.00 128.90 ? 44   DT  I N3    1 
ATOM   8470  C  C4    . DT  I 5  117 ? -39.043 -29.937 4.613  1.00 134.21 ? 44   DT  I C4    1 
ATOM   8471  O  O4    . DT  I 5  117 ? -39.215 -28.733 4.768  1.00 122.53 ? 44   DT  I O4    1 
ATOM   8472  C  C5    . DT  I 5  117 ? -39.147 -30.632 3.348  1.00 147.41 ? 44   DT  I C5    1 
ATOM   8473  C  C7    . DT  I 5  117 ? -39.488 -29.853 2.117  1.00 148.78 ? 44   DT  I C7    1 
ATOM   8474  C  C6    . DT  I 5  117 ? -38.935 -31.955 3.337  1.00 144.10 ? 44   DT  I C6    1 
ATOM   8475  P  P     . DT  I 5  118 ? -39.743 -37.832 5.303  1.00 129.91 ? 45   DT  I P     1 
ATOM   8476  O  OP1   . DT  I 5  118 ? -39.373 -39.244 5.610  1.00 119.21 ? 45   DT  I OP1   1 
ATOM   8477  O  OP2   . DT  I 5  118 ? -40.998 -37.507 4.573  1.00 117.55 ? 45   DT  I OP2   1 
ATOM   8478  O  "O5'" . DT  I 5  118 ? -39.796 -37.007 6.664  1.00 141.21 ? 45   DT  I "O5'" 1 
ATOM   8479  C  "C5'" . DT  I 5  118 ? -39.018 -37.369 7.824  1.00 132.95 ? 45   DT  I "C5'" 1 
ATOM   8480  C  "C4'" . DT  I 5  118 ? -39.480 -36.541 8.999  1.00 121.93 ? 45   DT  I "C4'" 1 
ATOM   8481  O  "O4'" . DT  I 5  118 ? -39.457 -35.149 8.620  1.00 116.33 ? 45   DT  I "O4'" 1 
ATOM   8482  C  "C3'" . DT  I 5  118 ? -40.929 -36.822 9.400  1.00 127.27 ? 45   DT  I "C3'" 1 
ATOM   8483  O  "O3'" . DT  I 5  118 ? -41.117 -37.826 10.409 1.00 125.49 ? 45   DT  I "O3'" 1 
ATOM   8484  C  "C2'" . DT  I 5  118 ? -41.473 -35.465 9.818  1.00 127.78 ? 45   DT  I "C2'" 1 
ATOM   8485  C  "C1'" . DT  I 5  118 ? -40.428 -34.446 9.380  1.00 126.43 ? 45   DT  I "C1'" 1 
ATOM   8486  N  N1    . DT  I 5  118 ? -40.979 -33.366 8.538  1.00 125.99 ? 45   DT  I N1    1 
ATOM   8487  C  C2    . DT  I 5  118 ? -41.092 -32.102 9.076  1.00 127.61 ? 45   DT  I C2    1 
ATOM   8488  O  O2    . DT  I 5  118 ? -40.731 -31.823 10.206 1.00 122.64 ? 45   DT  I O2    1 
ATOM   8489  N  N3    . DT  I 5  118 ? -41.630 -31.166 8.229  1.00 133.56 ? 45   DT  I N3    1 
ATOM   8490  C  C4    . DT  I 5  118 ? -42.058 -31.363 6.930  1.00 140.19 ? 45   DT  I C4    1 
ATOM   8491  O  O4    . DT  I 5  118 ? -42.517 -30.420 6.288  1.00 120.34 ? 45   DT  I O4    1 
ATOM   8492  C  C5    . DT  I 5  118 ? -41.921 -32.716 6.434  1.00 145.28 ? 45   DT  I C5    1 
ATOM   8493  C  C7    . DT  I 5  118 ? -42.360 -33.027 5.038  1.00 148.71 ? 45   DT  I C7    1 
ATOM   8494  C  C6    . DT  I 5  118 ? -41.402 -33.638 7.255  1.00 135.68 ? 45   DT  I C6    1 
ATOM   8495  P  P     . DT  I 5  119 ? -40.163 -37.934 11.686 1.00 111.51 ? 46   DT  I P     1 
ATOM   8496  O  OP1   . DT  I 5  119 ? -38.838 -38.460 11.225 1.00 97.91  ? 46   DT  I OP1   1 
ATOM   8497  O  OP2   . DT  I 5  119 ? -40.922 -38.648 12.746 1.00 99.44  ? 46   DT  I OP2   1 
ATOM   8498  O  "O5'" . DT  I 5  119 ? -40.050 -36.429 12.193 1.00 119.12 ? 46   DT  I "O5'" 1 
ATOM   8499  C  "C5'" . DT  I 5  119 ? -38.811 -35.900 12.703 1.00 118.47 ? 46   DT  I "C5'" 1 
ATOM   8500  C  "C4'" . DT  I 5  119 ? -39.075 -34.702 13.585 1.00 114.45 ? 46   DT  I "C4'" 1 
ATOM   8501  O  "O4'" . DT  I 5  119 ? -39.920 -33.738 12.907 1.00 115.65 ? 46   DT  I "O4'" 1 
ATOM   8502  C  "C3'" . DT  I 5  119 ? -39.749 -35.018 14.922 1.00 113.89 ? 46   DT  I "C3'" 1 
ATOM   8503  O  "O3'" . DT  I 5  119 ? -38.917 -34.421 15.925 1.00 114.64 ? 46   DT  I "O3'" 1 
ATOM   8504  C  "C2'" . DT  I 5  119 ? -41.152 -34.440 14.783 1.00 119.73 ? 46   DT  I "C2'" 1 
ATOM   8505  C  "C1'" . DT  I 5  119 ? -41.002 -33.334 13.738 1.00 126.73 ? 46   DT  I "C1'" 1 
ATOM   8506  N  N1    . DT  I 5  119 ? -42.179 -33.065 12.854 1.00 128.41 ? 46   DT  I N1    1 
ATOM   8507  C  C2    . DT  I 5  119 ? -42.471 -31.762 12.490 1.00 125.73 ? 46   DT  I C2    1 
ATOM   8508  O  O2    . DT  I 5  119 ? -41.843 -30.794 12.888 1.00 98.03  ? 46   DT  I O2    1 
ATOM   8509  N  N3    . DT  I 5  119 ? -43.542 -31.634 11.639 1.00 135.12 ? 46   DT  I N3    1 
ATOM   8510  C  C4    . DT  I 5  119 ? -44.329 -32.649 11.125 1.00 144.30 ? 46   DT  I C4    1 
ATOM   8511  O  O4    . DT  I 5  119 ? -45.264 -32.376 10.377 1.00 152.23 ? 46   DT  I O4    1 
ATOM   8512  C  C5    . DT  I 5  119 ? -43.964 -33.986 11.544 1.00 138.59 ? 46   DT  I C5    1 
ATOM   8513  C  C7    . DT  I 5  119 ? -44.767 -35.149 11.048 1.00 132.45 ? 46   DT  I C7    1 
ATOM   8514  C  C6    . DT  I 5  119 ? -42.921 -34.124 12.374 1.00 129.64 ? 46   DT  I C6    1 
ATOM   8515  P  P     . DG  I 5  120 ? -39.111 -34.720 17.490 1.00 104.22 ? 47   DG  I P     1 
ATOM   8516  O  OP1   . DG  I 5  120 ? -37.764 -34.952 18.082 1.00 77.64  ? 47   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I 5  120 ? -40.174 -35.749 17.643 1.00 104.33 ? 47   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I 5  120 ? -39.643 -33.318 18.025 1.00 94.65  ? 47   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I 5  120 ? -39.035 -32.080 17.589 1.00 93.03  ? 47   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I 5  120 ? -40.004 -30.933 17.754 1.00 93.74  ? 47   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I 5  120 ? -41.057 -31.053 16.770 1.00 104.42 ? 47   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I 5  120 ? -40.698 -30.879 19.117 1.00 100.39 ? 47   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I 5  120 ? -40.723 -29.534 19.599 1.00 90.67  ? 47   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I 5  120 ? -42.086 -31.436 18.841 1.00 103.08 ? 47   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I 5  120 ? -42.329 -31.011 17.403 1.00 110.85 ? 47   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I 5  120 ? -43.247 -31.844 16.626 1.00 115.87 ? 47   DG  I N9    1 
ATOM   8527  C  C8    . DG  I 5  120 ? -43.472 -33.194 16.754 1.00 122.11 ? 47   DG  I C8    1 
ATOM   8528  N  N7    . DG  I 5  120 ? -44.336 -33.653 15.890 1.00 118.44 ? 47   DG  I N7    1 
ATOM   8529  C  C5    . DG  I 5  120 ? -44.708 -32.539 15.151 1.00 119.19 ? 47   DG  I C5    1 
ATOM   8530  C  C6    . DG  I 5  120 ? -45.626 -32.414 14.076 1.00 118.18 ? 47   DG  I C6    1 
ATOM   8531  O  O6    . DG  I 5  120 ? -46.316 -33.293 13.544 1.00 108.38 ? 47   DG  I O6    1 
ATOM   8532  N  N1    . DG  I 5  120 ? -45.695 -31.102 13.615 1.00 121.41 ? 47   DG  I N1    1 
ATOM   8533  C  C2    . DG  I 5  120 ? -44.972 -30.047 14.121 1.00 121.99 ? 47   DG  I C2    1 
ATOM   8534  N  N2    . DG  I 5  120 ? -45.176 -28.854 13.544 1.00 121.96 ? 47   DG  I N2    1 
ATOM   8535  N  N3    . DG  I 5  120 ? -44.122 -30.151 15.126 1.00 121.02 ? 47   DG  I N3    1 
ATOM   8536  C  C4    . DG  I 5  120 ? -44.042 -31.415 15.591 1.00 117.38 ? 47   DG  I C4    1 
ATOM   8537  P  P     . DG  I 5  121 ? -40.858 -29.240 21.165 1.00 86.94  ? 48   DG  I P     1 
ATOM   8538  O  OP1   . DG  I 5  121 ? -39.523 -28.795 21.641 1.00 86.71  ? 48   DG  I OP1   1 
ATOM   8539  O  OP2   . DG  I 5  121 ? -41.505 -30.411 21.810 1.00 83.43  ? 48   DG  I OP2   1 
ATOM   8540  O  "O5'" . DG  I 5  121 ? -41.884 -28.017 21.192 1.00 92.43  ? 48   DG  I "O5'" 1 
ATOM   8541  C  "C5'" . DG  I 5  121 ? -41.570 -26.799 20.473 1.00 107.21 ? 48   DG  I "C5'" 1 
ATOM   8542  C  "C4'" . DG  I 5  121 ? -42.811 -26.061 20.022 1.00 107.18 ? 48   DG  I "C4'" 1 
ATOM   8543  O  "O4'" . DG  I 5  121 ? -43.519 -26.825 19.017 1.00 105.25 ? 48   DG  I "O4'" 1 
ATOM   8544  C  "C3'" . DG  I 5  121 ? -43.835 -25.765 21.118 1.00 103.81 ? 48   DG  I "C3'" 1 
ATOM   8545  O  "O3'" . DG  I 5  121 ? -44.456 -24.501 20.906 1.00 98.60  ? 48   DG  I "O3'" 1 
ATOM   8546  C  "C2'" . DG  I 5  121 ? -44.880 -26.837 20.905 1.00 112.70 ? 48   DG  I "C2'" 1 
ATOM   8547  C  "C1'" . DG  I 5  121 ? -44.882 -26.903 19.396 1.00 115.70 ? 48   DG  I "C1'" 1 
ATOM   8548  N  N9    . DG  I 5  121 ? -45.438 -28.128 18.840 1.00 125.57 ? 48   DG  I N9    1 
ATOM   8549  C  C8    . DG  I 5  121 ? -45.302 -29.409 19.318 1.00 127.10 ? 48   DG  I C8    1 
ATOM   8550  N  N7    . DG  I 5  121 ? -45.931 -30.295 18.594 1.00 120.58 ? 48   DG  I N7    1 
ATOM   8551  C  C5    . DG  I 5  121 ? -46.519 -29.552 17.581 1.00 132.34 ? 48   DG  I C5    1 
ATOM   8552  C  C6    . DG  I 5  121 ? -47.326 -29.964 16.494 1.00 158.21 ? 48   DG  I C6    1 
ATOM   8553  O  O6    . DG  I 5  121 ? -47.697 -31.107 16.201 1.00 172.85 ? 48   DG  I O6    1 
ATOM   8554  N  N1    . DG  I 5  121 ? -47.711 -28.883 15.705 1.00 171.16 ? 48   DG  I N1    1 
ATOM   8555  C  C2    . DG  I 5  121 ? -47.362 -27.573 15.933 1.00 150.21 ? 48   DG  I C2    1 
ATOM   8556  N  N2    . DG  I 5  121 ? -47.831 -26.670 15.059 1.00 148.61 ? 48   DG  I N2    1 
ATOM   8557  N  N3    . DG  I 5  121 ? -46.613 -27.177 16.946 1.00 131.57 ? 48   DG  I N3    1 
ATOM   8558  C  C4    . DG  I 5  121 ? -46.228 -28.212 17.723 1.00 129.53 ? 48   DG  I C4    1 
ATOM   8559  P  P     . DT  I 5  122 ? -45.415 -23.918 22.028 1.00 109.76 ? 49   DT  I P     1 
ATOM   8560  O  OP1   . DT  I 5  122 ? -44.718 -22.779 22.692 1.00 104.67 ? 49   DT  I OP1   1 
ATOM   8561  O  OP2   . DT  I 5  122 ? -45.939 -25.057 22.823 1.00 101.66 ? 49   DT  I OP2   1 
ATOM   8562  O  "O5'" . DT  I 5  122 ? -46.661 -23.359 21.218 1.00 114.51 ? 49   DT  I "O5'" 1 
ATOM   8563  C  "C5'" . DT  I 5  122 ? -46.590 -23.005 19.830 1.00 114.21 ? 49   DT  I "C5'" 1 
ATOM   8564  C  "C4'" . DT  I 5  122 ? -47.993 -23.032 19.279 1.00 112.29 ? 49   DT  I "C4'" 1 
ATOM   8565  O  "O4'" . DT  I 5  122 ? -48.304 -24.378 18.840 1.00 117.37 ? 49   DT  I "O4'" 1 
ATOM   8566  C  "C3'" . DT  I 5  122 ? -49.056 -22.667 20.318 1.00 116.71 ? 49   DT  I "C3'" 1 
ATOM   8567  O  "O3'" . DT  I 5  122 ? -49.965 -21.755 19.702 1.00 131.97 ? 49   DT  I "O3'" 1 
ATOM   8568  C  "C2'" . DT  I 5  122 ? -49.643 -24.013 20.712 1.00 115.87 ? 49   DT  I "C2'" 1 
ATOM   8569  C  "C1'" . DT  I 5  122 ? -49.534 -24.787 19.412 1.00 118.33 ? 49   DT  I "C1'" 1 
ATOM   8570  N  N1    . DT  I 5  122 ? -49.544 -26.275 19.489 1.00 122.25 ? 49   DT  I N1    1 
ATOM   8571  C  C2    . DT  I 5  122 ? -49.854 -26.965 18.337 1.00 119.83 ? 49   DT  I C2    1 
ATOM   8572  O  O2    . DT  I 5  122 ? -50.097 -26.415 17.276 1.00 123.05 ? 49   DT  I O2    1 
ATOM   8573  N  N3    . DT  I 5  122 ? -49.867 -28.332 18.473 1.00 117.63 ? 49   DT  I N3    1 
ATOM   8574  C  C4    . DT  I 5  122 ? -49.614 -29.060 19.619 1.00 116.22 ? 49   DT  I C4    1 
ATOM   8575  O  O4    . DT  I 5  122 ? -49.660 -30.287 19.587 1.00 109.60 ? 49   DT  I O4    1 
ATOM   8576  C  C5    . DT  I 5  122 ? -49.308 -28.274 20.794 1.00 124.35 ? 49   DT  I C5    1 
ATOM   8577  C  C7    . DT  I 5  122 ? -49.023 -28.977 22.085 1.00 127.54 ? 49   DT  I C7    1 
ATOM   8578  C  C6    . DT  I 5  122 ? -49.290 -26.939 20.672 1.00 123.47 ? 49   DT  I C6    1 
ATOM   8579  P  P     . DA  I 5  123 ? -51.023 -20.910 20.566 1.00 138.85 ? 50   DA  I P     1 
ATOM   8580  O  OP1   . DA  I 5  123 ? -50.468 -19.547 20.783 1.00 133.55 ? 50   DA  I OP1   1 
ATOM   8581  O  OP2   . DA  I 5  123 ? -51.451 -21.727 21.733 1.00 120.51 ? 50   DA  I OP2   1 
ATOM   8582  O  "O5'" . DA  I 5  123 ? -52.243 -20.778 19.550 1.00 147.87 ? 50   DA  I "O5'" 1 
ATOM   8583  C  "C5'" . DA  I 5  123 ? -52.212 -21.412 18.249 1.00 151.98 ? 50   DA  I "C5'" 1 
ATOM   8584  C  "C4'" . DA  I 5  123 ? -53.377 -22.362 18.099 1.00 151.74 ? 50   DA  I "C4'" 1 
ATOM   8585  O  "O4'" . DA  I 5  123 ? -52.980 -23.719 18.428 1.00 139.82 ? 50   DA  I "O4'" 1 
ATOM   8586  C  "C3'" . DA  I 5  123 ? -54.574 -22.049 19.003 1.00 157.84 ? 50   DA  I "C3'" 1 
ATOM   8587  O  "O3'" . DA  I 5  123 ? -55.777 -22.248 18.259 1.00 167.59 ? 50   DA  I "O3'" 1 
ATOM   8588  C  "C2'" . DA  I 5  123 ? -54.464 -23.105 20.085 1.00 153.99 ? 50   DA  I "C2'" 1 
ATOM   8589  C  "C1'" . DA  I 5  123 ? -54.020 -24.261 19.223 1.00 152.41 ? 50   DA  I "C1'" 1 
ATOM   8590  N  N9    . DA  I 5  123 ? -53.522 -25.450 19.912 1.00 158.81 ? 50   DA  I N9    1 
ATOM   8591  C  C8    . DA  I 5  123 ? -52.979 -25.566 21.169 1.00 154.01 ? 50   DA  I C8    1 
ATOM   8592  N  N7    . DA  I 5  123 ? -52.679 -26.799 21.502 1.00 150.88 ? 50   DA  I N7    1 
ATOM   8593  C  C5    . DA  I 5  123 ? -53.064 -27.545 20.397 1.00 163.59 ? 50   DA  I C5    1 
ATOM   8594  C  C6    . DA  I 5  123 ? -53.015 -28.924 20.120 1.00 163.77 ? 50   DA  I C6    1 
ATOM   8595  N  N6    . DA  I 5  123 ? -52.528 -29.831 20.967 1.00 158.50 ? 50   DA  I N6    1 
ATOM   8596  N  N1    . DA  I 5  123 ? -53.492 -29.343 18.927 1.00 158.40 ? 50   DA  I N1    1 
ATOM   8597  C  C2    . DA  I 5  123 ? -53.984 -28.432 18.077 1.00 158.47 ? 50   DA  I C2    1 
ATOM   8598  N  N3    . DA  I 5  123 ? -54.083 -27.112 18.223 1.00 162.78 ? 50   DA  I N3    1 
ATOM   8599  C  C4    . DA  I 5  123 ? -53.602 -26.729 19.418 1.00 164.97 ? 50   DA  I C4    1 
ATOM   8600  P  P     . DG  I 5  124 ? -57.152 -21.608 18.752 1.00 170.07 ? 51   DG  I P     1 
ATOM   8601  O  OP1   . DG  I 5  124 ? -56.974 -20.135 18.817 1.00 171.27 ? 51   DG  I OP1   1 
ATOM   8602  O  OP2   . DG  I 5  124 ? -57.602 -22.344 19.962 1.00 155.56 ? 51   DG  I OP2   1 
ATOM   8603  O  "O5'" . DG  I 5  124 ? -58.138 -21.932 17.543 1.00 179.37 ? 51   DG  I "O5'" 1 
ATOM   8604  C  "C5'" . DG  I 5  124 ? -57.918 -23.052 16.655 1.00 184.73 ? 51   DG  I "C5'" 1 
ATOM   8605  C  "C4'" . DG  I 5  124 ? -58.603 -24.293 17.181 1.00 191.89 ? 51   DG  I "C4'" 1 
ATOM   8606  O  "O4'" . DG  I 5  124 ? -57.647 -25.134 17.858 1.00 181.75 ? 51   DG  I "O4'" 1 
ATOM   8607  C  "C3'" . DG  I 5  124 ? -59.713 -24.037 18.203 1.00 206.76 ? 51   DG  I "C3'" 1 
ATOM   8608  O  "O3'" . DG  I 5  124 ? -61.003 -24.000 17.581 1.00 222.24 ? 51   DG  I "O3'" 1 
ATOM   8609  C  "C2'" . DG  I 5  124 ? -59.589 -25.191 19.187 1.00 199.75 ? 51   DG  I "C2'" 1 
ATOM   8610  C  "C1'" . DG  I 5  124 ? -58.353 -25.970 18.754 1.00 185.00 ? 51   DG  I "C1'" 1 
ATOM   8611  N  N9    . DG  I 5  124 ? -57.467 -26.287 19.867 1.00 191.64 ? 51   DG  I N9    1 
ATOM   8612  C  C8    . DG  I 5  124 ? -56.934 -25.401 20.772 1.00 200.23 ? 51   DG  I C8    1 
ATOM   8613  N  N7    . DG  I 5  124 ? -56.188 -25.977 21.674 1.00 203.11 ? 51   DG  I N7    1 
ATOM   8614  C  C5    . DG  I 5  124 ? -56.236 -27.326 21.350 1.00 194.14 ? 51   DG  I C5    1 
ATOM   8615  C  C6    . DG  I 5  124 ? -55.625 -28.446 21.977 1.00 179.95 ? 51   DG  I C6    1 
ATOM   8616  O  O6    . DG  I 5  124 ? -54.885 -28.467 22.969 1.00 149.08 ? 51   DG  I O6    1 
ATOM   8617  N  N1    . DG  I 5  124 ? -55.943 -29.633 21.323 1.00 184.66 ? 51   DG  I N1    1 
ATOM   8618  C  C2    . DG  I 5  124 ? -56.748 -29.733 20.214 1.00 194.35 ? 51   DG  I C2    1 
ATOM   8619  N  N2    . DG  I 5  124 ? -56.941 -30.969 19.730 1.00 190.73 ? 51   DG  I N2    1 
ATOM   8620  N  N3    . DG  I 5  124 ? -57.326 -28.698 19.624 1.00 201.26 ? 51   DG  I N3    1 
ATOM   8621  C  C4    . DG  I 5  124 ? -57.030 -27.535 20.241 1.00 198.07 ? 51   DG  I C4    1 
ATOM   8622  P  P     . DT  I 5  125 ? -62.303 -23.562 18.427 1.00 212.77 ? 52   DT  I P     1 
ATOM   8623  O  OP1   . DT  I 5  125 ? -63.047 -22.548 17.633 1.00 210.89 ? 52   DT  I OP1   1 
ATOM   8624  O  OP2   . DT  I 5  125 ? -61.877 -23.237 19.815 1.00 191.85 ? 52   DT  I OP2   1 
ATOM   8625  O  "O5'" . DT  I 5  125 ? -63.175 -24.896 18.480 1.00 203.47 ? 52   DT  I "O5'" 1 
ATOM   8626  C  "C5'" . DT  I 5  125 ? -62.804 -26.103 17.776 1.00 191.39 ? 52   DT  I "C5'" 1 
ATOM   8627  C  "C4'" . DT  I 5  125 ? -62.892 -27.296 18.700 1.00 186.49 ? 52   DT  I "C4'" 1 
ATOM   8628  O  "O4'" . DT  I 5  125 ? -61.610 -27.552 19.313 1.00 175.47 ? 52   DT  I "O4'" 1 
ATOM   8629  C  "C3'" . DT  I 5  125 ? -63.882 -27.145 19.860 1.00 189.28 ? 52   DT  I "C3'" 1 
ATOM   8630  O  "O3'" . DT  I 5  125 ? -65.109 -27.823 19.564 1.00 197.57 ? 52   DT  I "O3'" 1 
ATOM   8631  C  "C2'" . DT  I 5  125 ? -63.149 -27.724 21.062 1.00 186.66 ? 52   DT  I "C2'" 1 
ATOM   8632  C  "C1'" . DT  I 5  125 ? -61.850 -28.275 20.498 1.00 182.50 ? 52   DT  I "C1'" 1 
ATOM   8633  N  N1    . DT  I 5  125 ? -60.701 -28.084 21.400 1.00 203.77 ? 52   DT  I N1    1 
ATOM   8634  C  C2    . DT  I 5  125 ? -59.916 -29.176 21.696 1.00 214.54 ? 52   DT  I C2    1 
ATOM   8635  O  O2    . DT  I 5  125 ? -60.102 -30.283 21.215 1.00 191.49 ? 52   DT  I O2    1 
ATOM   8636  N  N3    . DT  I 5  125 ? -58.890 -28.921 22.575 1.00 224.68 ? 52   DT  I N3    1 
ATOM   8637  C  C4    . DT  I 5  125 ? -58.595 -27.716 23.187 1.00 224.99 ? 52   DT  I C4    1 
ATOM   8638  O  O4    . DT  I 5  125 ? -57.639 -27.638 23.955 1.00 223.93 ? 52   DT  I O4    1 
ATOM   8639  C  C5    . DT  I 5  125 ? -59.467 -26.615 22.837 1.00 217.74 ? 52   DT  I C5    1 
ATOM   8640  C  C7    . DT  I 5  125 ? -59.220 -25.269 23.443 1.00 204.33 ? 52   DT  I C7    1 
ATOM   8641  C  C6    . DT  I 5  125 ? -60.468 -26.854 21.981 1.00 213.16 ? 52   DT  I C6    1 
ATOM   8642  P  P     . DA  I 5  126 ? -66.202 -28.078 20.715 1.00 191.14 ? 53   DA  I P     1 
ATOM   8643  O  OP1   . DA  I 5  126 ? -67.533 -28.179 20.067 1.00 187.41 ? 53   DA  I OP1   1 
ATOM   8644  O  OP2   . DA  I 5  126 ? -65.989 -27.071 21.787 1.00 188.97 ? 53   DA  I OP2   1 
ATOM   8645  O  "O5'" . DA  I 5  126 ? -65.801 -29.515 21.281 1.00 195.51 ? 53   DA  I "O5'" 1 
ATOM   8646  C  "C5'" . DA  I 5  126 ? -65.077 -30.477 20.477 1.00 196.71 ? 53   DA  I "C5'" 1 
ATOM   8647  C  "C4'" . DA  I 5  126 ? -64.389 -31.503 21.349 1.00 192.88 ? 53   DA  I "C4'" 1 
ATOM   8648  O  "O4'" . DA  I 5  126 ? -63.118 -31.009 21.832 1.00 198.35 ? 53   DA  I "O4'" 1 
ATOM   8649  C  "C3'" . DA  I 5  126 ? -65.180 -31.934 22.589 1.00 190.97 ? 53   DA  I "C3'" 1 
ATOM   8650  O  "O3'" . DA  I 5  126 ? -65.703 -33.245 22.342 1.00 191.09 ? 53   DA  I "O3'" 1 
ATOM   8651  C  "C2'" . DA  I 5  126 ? -64.199 -31.765 23.743 1.00 195.76 ? 53   DA  I "C2'" 1 
ATOM   8652  C  "C1'" . DA  I 5  126 ? -62.852 -31.659 23.057 1.00 202.85 ? 53   DA  I "C1'" 1 
ATOM   8653  N  N9    . DA  I 5  126 ? -61.860 -30.875 23.796 1.00 209.38 ? 53   DA  I N9    1 
ATOM   8654  C  C8    . DA  I 5  126 ? -61.955 -29.575 24.230 1.00 208.13 ? 53   DA  I C8    1 
ATOM   8655  N  N7    . DA  I 5  126 ? -60.905 -29.164 24.900 1.00 198.84 ? 53   DA  I N7    1 
ATOM   8656  C  C5    . DA  I 5  126 ? -60.070 -30.272 24.925 1.00 184.60 ? 53   DA  I C5    1 
ATOM   8657  C  C6    . DA  I 5  126 ? -58.793 -30.484 25.477 1.00 167.73 ? 53   DA  I C6    1 
ATOM   8658  N  N6    . DA  I 5  126 ? -58.113 -29.552 26.147 1.00 157.05 ? 53   DA  I N6    1 
ATOM   8659  N  N1    . DA  I 5  126 ? -58.236 -31.705 25.321 1.00 161.31 ? 53   DA  I N1    1 
ATOM   8660  C  C2    . DA  I 5  126 ? -58.919 -32.641 24.650 1.00 168.44 ? 53   DA  I C2    1 
ATOM   8661  N  N3    . DA  I 5  126 ? -60.120 -32.559 24.079 1.00 182.49 ? 53   DA  I N3    1 
ATOM   8662  C  C4    . DA  I 5  126 ? -60.647 -31.335 24.253 1.00 194.43 ? 53   DA  I C4    1 
ATOM   8663  P  P     . DT  I 5  127 ? -65.199 -34.522 23.166 1.00 197.40 ? 54   DT  I P     1 
ATOM   8664  O  OP1   . DT  I 5  127 ? -65.831 -35.720 22.559 1.00 195.54 ? 54   DT  I OP1   1 
ATOM   8665  O  OP2   . DT  I 5  127 ? -65.421 -34.250 24.611 1.00 197.75 ? 54   DT  I OP2   1 
ATOM   8666  O  "O5'" . DT  I 5  127 ? -63.634 -34.576 22.857 1.00 173.91 ? 54   DT  I "O5'" 1 
ATOM   8667  C  "C5'" . DT  I 5  127 ? -62.945 -35.827 22.613 1.00 163.58 ? 54   DT  I "C5'" 1 
ATOM   8668  C  "C4'" . DT  I 5  127 ? -62.280 -36.361 23.865 1.00 154.37 ? 54   DT  I "C4'" 1 
ATOM   8669  O  "O4'" . DT  I 5  127 ? -61.515 -35.318 24.518 1.00 155.92 ? 54   DT  I "O4'" 1 
ATOM   8670  C  "C3'" . DT  I 5  127 ? -63.217 -36.945 24.937 1.00 145.90 ? 54   DT  I "C3'" 1 
ATOM   8671  O  "O3'" . DT  I 5  127 ? -62.915 -38.325 25.209 1.00 134.27 ? 54   DT  I "O3'" 1 
ATOM   8672  C  "C2'" . DT  I 5  127 ? -62.984 -36.064 26.155 1.00 142.77 ? 54   DT  I "C2'" 1 
ATOM   8673  C  "C1'" . DT  I 5  127 ? -61.583 -35.536 25.914 1.00 149.50 ? 54   DT  I "C1'" 1 
ATOM   8674  N  N1    . DT  I 5  127 ? -61.243 -34.268 26.602 1.00 147.67 ? 54   DT  I N1    1 
ATOM   8675  C  C2    . DT  I 5  127 ? -59.985 -34.145 27.154 1.00 137.63 ? 54   DT  I C2    1 
ATOM   8676  O  O2    . DT  I 5  127 ? -59.135 -35.021 27.085 1.00 110.14 ? 54   DT  I O2    1 
ATOM   8677  N  N3    . DT  I 5  127 ? -59.751 -32.945 27.781 1.00 129.65 ? 54   DT  I N3    1 
ATOM   8678  C  C4    . DT  I 5  127 ? -60.631 -31.887 27.916 1.00 126.94 ? 54   DT  I C4    1 
ATOM   8679  O  O4    . DT  I 5  127 ? -60.278 -30.870 28.503 1.00 121.41 ? 54   DT  I O4    1 
ATOM   8680  C  C5    . DT  I 5  127 ? -61.934 -32.087 27.322 1.00 136.81 ? 54   DT  I C5    1 
ATOM   8681  C  C7    . DT  I 5  127 ? -62.955 -30.998 27.422 1.00 134.95 ? 54   DT  I C7    1 
ATOM   8682  C  C6    . DT  I 5  127 ? -62.172 -33.252 26.705 1.00 143.05 ? 54   DT  I C6    1 
ATOM   8683  P  P     . DC  I 5  128 ? -63.600 -39.103 26.462 1.00 128.71 ? 55   DC  I P     1 
ATOM   8684  O  OP1   . DC  I 5  128 ? -63.728 -40.542 26.109 1.00 111.28 ? 55   DC  I OP1   1 
ATOM   8685  O  OP2   . DC  I 5  128 ? -64.787 -38.331 26.919 1.00 127.23 ? 55   DC  I OP2   1 
ATOM   8686  O  "O5'" . DC  I 5  128 ? -62.484 -39.009 27.592 1.00 139.43 ? 55   DC  I "O5'" 1 
ATOM   8687  C  "C5'" . DC  I 5  128 ? -61.112 -39.324 27.279 1.00 140.94 ? 55   DC  I "C5'" 1 
ATOM   8688  C  "C4'" . DC  I 5  128 ? -60.242 -39.228 28.512 1.00 130.17 ? 55   DC  I "C4'" 1 
ATOM   8689  O  "O4'" . DC  I 5  128 ? -60.049 -37.840 28.879 1.00 125.45 ? 55   DC  I "O4'" 1 
ATOM   8690  C  "C3'" . DC  I 5  128 ? -60.803 -39.925 29.754 1.00 125.13 ? 55   DC  I "C3'" 1 
ATOM   8691  O  "O3'" . DC  I 5  128 ? -59.739 -40.641 30.387 1.00 112.33 ? 55   DC  I "O3'" 1 
ATOM   8692  C  "C2'" . DC  I 5  128 ? -61.340 -38.780 30.593 1.00 123.15 ? 55   DC  I "C2'" 1 
ATOM   8693  C  "C1'" . DC  I 5  128 ? -60.372 -37.663 30.249 1.00 124.90 ? 55   DC  I "C1'" 1 
ATOM   8694  N  N1    . DC  I 5  128 ? -60.886 -36.295 30.421 1.00 126.82 ? 55   DC  I N1    1 
ATOM   8695  C  C2    . DC  I 5  128 ? -60.324 -35.499 31.418 1.00 129.88 ? 55   DC  I C2    1 
ATOM   8696  O  O2    . DC  I 5  128 ? -59.428 -35.976 32.128 1.00 135.55 ? 55   DC  I O2    1 
ATOM   8697  N  N3    . DC  I 5  128 ? -60.768 -34.231 31.583 1.00 136.85 ? 55   DC  I N3    1 
ATOM   8698  C  C4    . DC  I 5  128 ? -61.733 -33.754 30.794 1.00 127.69 ? 55   DC  I C4    1 
ATOM   8699  N  N4    . DC  I 5  128 ? -62.142 -32.500 30.994 1.00 123.02 ? 55   DC  I N4    1 
ATOM   8700  C  C5    . DC  I 5  128 ? -62.323 -34.544 29.766 1.00 128.39 ? 55   DC  I C5    1 
ATOM   8701  C  C6    . DC  I 5  128 ? -61.871 -35.797 29.614 1.00 132.26 ? 55   DC  I C6    1 
ATOM   8702  P  P     . DT  I 5  129 ? -60.039 -41.859 31.389 1.00 113.82 ? 56   DT  I P     1 
ATOM   8703  O  OP1   . DT  I 5  129 ? -59.268 -43.053 30.924 1.00 96.02  ? 56   DT  I OP1   1 
ATOM   8704  O  OP2   . DT  I 5  129 ? -61.505 -41.953 31.591 1.00 105.85 ? 56   DT  I OP2   1 
ATOM   8705  O  "O5'" . DT  I 5  129 ? -59.399 -41.350 32.759 1.00 120.63 ? 56   DT  I "O5'" 1 
ATOM   8706  C  "C5'" . DT  I 5  129 ? -58.069 -40.778 32.820 1.00 110.42 ? 56   DT  I "C5'" 1 
ATOM   8707  C  "C4'" . DT  I 5  129 ? -57.839 -40.128 34.165 1.00 107.13 ? 56   DT  I "C4'" 1 
ATOM   8708  O  "O4'" . DT  I 5  129 ? -58.423 -38.798 34.190 1.00 105.85 ? 56   DT  I "O4'" 1 
ATOM   8709  C  "C3'" . DT  I 5  129 ? -58.462 -40.885 35.340 1.00 105.57 ? 56   DT  I "C3'" 1 
ATOM   8710  O  "O3'" . DT  I 5  129 ? -57.551 -40.916 36.440 1.00 98.15  ? 56   DT  I "O3'" 1 
ATOM   8711  C  "C2'" . DT  I 5  129 ? -59.715 -40.082 35.650 1.00 109.72 ? 56   DT  I "C2'" 1 
ATOM   8712  C  "C1'" . DT  I 5  129 ? -59.252 -38.671 35.337 1.00 106.54 ? 56   DT  I "C1'" 1 
ATOM   8713  N  N1    . DT  I 5  129 ? -60.307 -37.672 35.038 1.00 112.88 ? 56   DT  I N1    1 
ATOM   8714  C  C2    . DT  I 5  129 ? -60.173 -36.431 35.616 1.00 118.24 ? 56   DT  I C2    1 
ATOM   8715  O  O2    . DT  I 5  129 ? -59.246 -36.138 36.353 1.00 106.30 ? 56   DT  I O2    1 
ATOM   8716  N  N3    . DT  I 5  129 ? -61.170 -35.540 35.302 1.00 124.89 ? 56   DT  I N3    1 
ATOM   8717  C  C4    . DT  I 5  129 ? -62.260 -35.762 34.481 1.00 121.95 ? 56   DT  I C4    1 
ATOM   8718  O  O4    . DT  I 5  129 ? -63.072 -34.863 34.287 1.00 121.28 ? 56   DT  I O4    1 
ATOM   8719  C  C5    . DT  I 5  129 ? -62.338 -37.085 33.905 1.00 122.36 ? 56   DT  I C5    1 
ATOM   8720  C  C7    . DT  I 5  129 ? -63.487 -37.419 33.007 1.00 126.41 ? 56   DT  I C7    1 
ATOM   8721  C  C6    . DT  I 5  129 ? -61.370 -37.962 34.207 1.00 121.35 ? 56   DT  I C6    1 
ATOM   8722  P  P     . DG  I 5  130 ? -56.480 -42.109 36.586 1.00 97.29  ? 57   DG  I P     1 
ATOM   8723  O  OP1   . DG  I 5  130 ? -55.852 -42.354 35.259 1.00 92.10  ? 57   DG  I OP1   1 
ATOM   8724  O  OP2   . DG  I 5  130 ? -57.141 -43.231 37.301 1.00 95.19  ? 57   DG  I OP2   1 
ATOM   8725  O  "O5'" . DG  I 5  130 ? -55.394 -41.460 37.556 1.00 96.40  ? 57   DG  I "O5'" 1 
ATOM   8726  C  "C5'" . DG  I 5  130 ? -54.607 -40.329 37.134 1.00 93.06  ? 57   DG  I "C5'" 1 
ATOM   8727  C  "C4'" . DG  I 5  130 ? -54.338 -39.367 38.270 1.00 87.67  ? 57   DG  I "C4'" 1 
ATOM   8728  O  "O4'" . DG  I 5  130 ? -55.456 -38.469 38.448 1.00 79.02  ? 57   DG  I "O4'" 1 
ATOM   8729  C  "C3'" . DG  I 5  130 ? -54.064 -39.963 39.649 1.00 91.56  ? 57   DG  I "C3'" 1 
ATOM   8730  O  "O3'" . DG  I 5  130 ? -53.046 -39.128 40.234 1.00 94.97  ? 57   DG  I "O3'" 1 
ATOM   8731  C  "C2'" . DG  I 5  130 ? -55.437 -39.935 40.311 1.00 92.89  ? 57   DG  I "C2'" 1 
ATOM   8732  C  "C1'" . DG  I 5  130 ? -56.134 -38.730 39.673 1.00 87.96  ? 57   DG  I "C1'" 1 
ATOM   8733  N  N9    . DG  I 5  130 ? -57.558 -38.860 39.361 1.00 95.34  ? 57   DG  I N9    1 
ATOM   8734  C  C8    . DG  I 5  130 ? -58.219 -39.989 38.940 1.00 96.71  ? 57   DG  I C8    1 
ATOM   8735  N  N7    . DG  I 5  130 ? -59.480 -39.775 38.677 1.00 101.25 ? 57   DG  I N7    1 
ATOM   8736  C  C5    . DG  I 5  130 ? -59.657 -38.419 38.912 1.00 98.02  ? 57   DG  I C5    1 
ATOM   8737  C  C6    . DG  I 5  130 ? -60.817 -37.607 38.798 1.00 105.39 ? 57   DG  I C6    1 
ATOM   8738  O  O6    . DG  I 5  130 ? -61.957 -37.936 38.445 1.00 111.93 ? 57   DG  I O6    1 
ATOM   8739  N  N1    . DG  I 5  130 ? -60.553 -36.286 39.143 1.00 100.39 ? 57   DG  I N1    1 
ATOM   8740  C  C2    . DG  I 5  130 ? -59.334 -35.807 39.551 1.00 95.26  ? 57   DG  I C2    1 
ATOM   8741  N  N2    . DG  I 5  130 ? -59.278 -34.500 39.838 1.00 101.78 ? 57   DG  I N2    1 
ATOM   8742  N  N3    . DG  I 5  130 ? -58.247 -36.551 39.663 1.00 94.43  ? 57   DG  I N3    1 
ATOM   8743  C  C4    . DG  I 5  130 ? -58.479 -37.838 39.330 1.00 91.36  ? 57   DG  I C4    1 
ATOM   8744  P  P     . DC  I 5  131 ? -52.419 -39.417 41.689 1.00 93.69  ? 58   DC  I P     1 
ATOM   8745  O  OP1   . DC  I 5  131 ? -51.020 -38.925 41.684 1.00 93.61  ? 58   DC  I OP1   1 
ATOM   8746  O  OP2   . DC  I 5  131 ? -52.686 -40.835 42.036 1.00 95.21  ? 58   DC  I OP2   1 
ATOM   8747  O  "O5'" . DC  I 5  131 ? -53.214 -38.410 42.637 1.00 80.95  ? 58   DC  I "O5'" 1 
ATOM   8748  C  "C5'" . DC  I 5  131 ? -53.560 -37.089 42.172 1.00 85.94  ? 58   DC  I "C5'" 1 
ATOM   8749  C  "C4'" . DC  I 5  131 ? -54.519 -36.397 43.115 1.00 94.14  ? 58   DC  I "C4'" 1 
ATOM   8750  O  "O4'" . DC  I 5  131 ? -55.887 -36.559 42.653 1.00 103.13 ? 58   DC  I "O4'" 1 
ATOM   8751  C  "C3'" . DC  I 5  131 ? -54.505 -36.917 44.553 1.00 96.08  ? 58   DC  I "C3'" 1 
ATOM   8752  O  "O3'" . DC  I 5  131 ? -54.763 -35.847 45.465 1.00 94.42  ? 58   DC  I "O3'" 1 
ATOM   8753  C  "C2'" . DC  I 5  131 ? -55.681 -37.873 44.571 1.00 102.54 ? 58   DC  I "C2'" 1 
ATOM   8754  C  "C1'" . DC  I 5  131 ? -56.665 -37.085 43.723 1.00 111.09 ? 58   DC  I "C1'" 1 
ATOM   8755  N  N1    . DC  I 5  131 ? -57.807 -37.830 43.151 1.00 115.83 ? 58   DC  I N1    1 
ATOM   8756  C  C2    . DC  I 5  131 ? -58.995 -37.137 42.886 1.00 108.53 ? 58   DC  I C2    1 
ATOM   8757  O  O2    . DC  I 5  131 ? -59.045 -35.921 43.122 1.00 113.14 ? 58   DC  I O2    1 
ATOM   8758  N  N3    . DC  I 5  131 ? -60.048 -37.805 42.366 1.00 106.94 ? 58   DC  I N3    1 
ATOM   8759  C  C4    . DC  I 5  131 ? -59.954 -39.115 42.123 1.00 100.26 ? 58   DC  I C4    1 
ATOM   8760  N  N4    . DC  I 5  131 ? -61.020 -39.733 41.610 1.00 100.11 ? 58   DC  I N4    1 
ATOM   8761  C  C5    . DC  I 5  131 ? -58.761 -39.848 42.393 1.00 98.51  ? 58   DC  I C5    1 
ATOM   8762  C  C6    . DC  I 5  131 ? -57.725 -39.174 42.908 1.00 107.35 ? 58   DC  I C6    1 
ATOM   8763  P  P     . DA  I 5  132 ? -53.556 -35.085 46.192 1.00 92.03  ? 59   DA  I P     1 
ATOM   8764  O  OP1   . DA  I 5  132 ? -52.610 -34.626 45.143 1.00 81.29  ? 59   DA  I OP1   1 
ATOM   8765  O  OP2   . DA  I 5  132 ? -53.087 -35.913 47.338 1.00 77.47  ? 59   DA  I OP2   1 
ATOM   8766  O  "O5'" . DA  I 5  132 ? -54.258 -33.772 46.742 1.00 86.86  ? 59   DA  I "O5'" 1 
ATOM   8767  C  "C5'" . DA  I 5  132 ? -54.566 -32.724 45.808 1.00 98.57  ? 59   DA  I "C5'" 1 
ATOM   8768  C  "C4'" . DA  I 5  132 ? -55.727 -31.897 46.304 1.00 100.32 ? 59   DA  I "C4'" 1 
ATOM   8769  O  "O4'" . DA  I 5  132 ? -56.961 -32.614 46.104 1.00 94.50  ? 59   DA  I "O4'" 1 
ATOM   8770  C  "C3'" . DA  I 5  132 ? -55.681 -31.523 47.785 1.00 101.37 ? 59   DA  I "C3'" 1 
ATOM   8771  O  "O3'" . DA  I 5  132 ? -55.952 -30.110 47.853 1.00 101.50 ? 59   DA  I "O3'" 1 
ATOM   8772  C  "C2'" . DA  I 5  132 ? -56.593 -32.547 48.447 1.00 95.80  ? 59   DA  I "C2'" 1 
ATOM   8773  C  "C1'" . DA  I 5  132 ? -57.521 -33.034 47.336 1.00 95.24  ? 59   DA  I "C1'" 1 
ATOM   8774  N  N9    . DA  I 5  132 ? -57.719 -34.480 47.250 1.00 104.69 ? 59   DA  I N9    1 
ATOM   8775  C  C8    . DA  I 5  132 ? -56.861 -35.475 47.651 1.00 108.60 ? 59   DA  I C8    1 
ATOM   8776  N  N7    . DA  I 5  132 ? -57.310 -36.685 47.419 1.00 99.53  ? 59   DA  I N7    1 
ATOM   8777  C  C5    . DA  I 5  132 ? -58.534 -36.473 46.799 1.00 104.00 ? 59   DA  I C5    1 
ATOM   8778  C  C6    . DA  I 5  132 ? -59.501 -37.358 46.290 1.00 97.78  ? 59   DA  I C6    1 
ATOM   8779  N  N6    . DA  I 5  132 ? -59.383 -38.686 46.331 1.00 100.48 ? 59   DA  I N6    1 
ATOM   8780  N  N1    . DA  I 5  132 ? -60.610 -36.824 45.734 1.00 97.08  ? 59   DA  I N1    1 
ATOM   8781  C  C2    . DA  I 5  132 ? -60.732 -35.491 45.702 1.00 102.10 ? 59   DA  I C2    1 
ATOM   8782  N  N3    . DA  I 5  132 ? -59.892 -34.557 46.144 1.00 107.15 ? 59   DA  I N3    1 
ATOM   8783  C  C4    . DA  I 5  132 ? -58.797 -35.120 46.685 1.00 109.29 ? 59   DA  I C4    1 
ATOM   8784  P  P     . DG  I 5  133 ? -57.031 -29.484 48.856 1.00 100.86 ? 60   DG  I P     1 
ATOM   8785  O  OP1   . DG  I 5  133 ? -57.104 -28.026 48.571 1.00 93.85  ? 60   DG  I OP1   1 
ATOM   8786  O  OP2   . DG  I 5  133 ? -56.712 -29.951 50.237 1.00 86.13  ? 60   DG  I OP2   1 
ATOM   8787  O  "O5'" . DG  I 5  133 ? -58.404 -30.131 48.365 1.00 102.59 ? 60   DG  I "O5'" 1 
ATOM   8788  C  "C5'" . DG  I 5  133 ? -59.660 -29.443 48.548 1.00 107.25 ? 60   DG  I "C5'" 1 
ATOM   8789  C  "C4'" . DG  I 5  133 ? -60.669 -30.305 49.277 1.00 112.32 ? 60   DG  I "C4'" 1 
ATOM   8790  O  "O4'" . DG  I 5  133 ? -60.468 -31.717 49.022 1.00 113.89 ? 60   DG  I "O4'" 1 
ATOM   8791  C  "C3'" . DG  I 5  133 ? -60.712 -30.166 50.805 1.00 112.06 ? 60   DG  I "C3'" 1 
ATOM   8792  O  "O3'" . DG  I 5  133 ? -62.093 -30.049 51.150 1.00 113.70 ? 60   DG  I "O3'" 1 
ATOM   8793  C  "C2'" . DG  I 5  133 ? -60.182 -31.502 51.302 1.00 105.95 ? 60   DG  I "C2'" 1 
ATOM   8794  C  "C1'" . DG  I 5  133 ? -60.754 -32.397 50.231 1.00 107.90 ? 60   DG  I "C1'" 1 
ATOM   8795  N  N9    . DG  I 5  133 ? -60.235 -33.755 50.120 1.00 104.37 ? 60   DG  I N9    1 
ATOM   8796  C  C8    . DG  I 5  133 ? -58.943 -34.189 50.287 1.00 107.86 ? 60   DG  I C8    1 
ATOM   8797  N  N7    . DG  I 5  133 ? -58.805 -35.472 50.093 1.00 95.75  ? 60   DG  I N7    1 
ATOM   8798  C  C5    . DG  I 5  133 ? -60.080 -35.907 49.760 1.00 92.52  ? 60   DG  I C5    1 
ATOM   8799  C  C6    . DG  I 5  133 ? -60.554 -37.203 49.434 1.00 93.59  ? 60   DG  I C6    1 
ATOM   8800  O  O6    . DG  I 5  133 ? -59.921 -38.264 49.379 1.00 79.89  ? 60   DG  I O6    1 
ATOM   8801  N  N1    . DG  I 5  133 ? -61.921 -37.198 49.174 1.00 105.02 ? 60   DG  I N1    1 
ATOM   8802  C  C2    . DG  I 5  133 ? -62.729 -36.088 49.222 1.00 107.56 ? 60   DG  I C2    1 
ATOM   8803  N  N2    . DG  I 5  133 ? -64.024 -36.285 48.940 1.00 115.43 ? 60   DG  I N2    1 
ATOM   8804  N  N3    . DG  I 5  133 ? -62.300 -34.875 49.526 1.00 100.07 ? 60   DG  I N3    1 
ATOM   8805  C  C4    . DG  I 5  133 ? -60.974 -34.858 49.775 1.00 99.41  ? 60   DG  I C4    1 
ATOM   8806  P  P     . DG  I 5  134 ? -62.535 -29.366 52.508 1.00 119.13 ? 61   DG  I P     1 
ATOM   8807  O  OP1   . DG  I 5  134 ? -63.050 -28.012 52.181 1.00 114.50 ? 61   DG  I OP1   1 
ATOM   8808  O  OP2   . DG  I 5  134 ? -61.418 -29.511 53.478 1.00 110.36 ? 61   DG  I OP2   1 
ATOM   8809  O  "O5'" . DG  I 5  134 ? -63.749 -30.288 52.981 1.00 122.60 ? 61   DG  I "O5'" 1 
ATOM   8810  C  "C5'" . DG  I 5  134 ? -64.849 -30.620 52.101 1.00 118.69 ? 61   DG  I "C5'" 1 
ATOM   8811  C  "C4'" . DG  I 5  134 ? -65.434 -31.969 52.456 1.00 120.93 ? 61   DG  I "C4'" 1 
ATOM   8812  O  "O4'" . DG  I 5  134 ? -64.572 -33.036 51.986 1.00 125.86 ? 61   DG  I "O4'" 1 
ATOM   8813  C  "C3'" . DG  I 5  134 ? -65.645 -32.219 53.955 1.00 118.44 ? 61   DG  I "C3'" 1 
ATOM   8814  O  "O3'" . DG  I 5  134 ? -67.011 -32.494 54.271 1.00 121.59 ? 61   DG  I "O3'" 1 
ATOM   8815  C  "C2'" . DG  I 5  134 ? -64.804 -33.446 54.255 1.00 119.01 ? 61   DG  I "C2'" 1 
ATOM   8816  C  "C1'" . DG  I 5  134 ? -64.674 -34.107 52.901 1.00 122.15 ? 61   DG  I "C1'" 1 
ATOM   8817  N  N9    . DG  I 5  134 ? -63.470 -34.924 52.796 1.00 122.84 ? 61   DG  I N9    1 
ATOM   8818  C  C8    . DG  I 5  134 ? -62.196 -34.554 53.157 1.00 120.65 ? 61   DG  I C8    1 
ATOM   8819  N  N7    . DG  I 5  134 ? -61.325 -35.516 53.019 1.00 121.11 ? 61   DG  I N7    1 
ATOM   8820  C  C5    . DG  I 5  134 ? -62.072 -36.593 52.561 1.00 115.10 ? 61   DG  I C5    1 
ATOM   8821  C  C6    . DG  I 5  134 ? -61.672 -37.914 52.235 1.00 109.09 ? 61   DG  I C6    1 
ATOM   8822  O  O6    . DG  I 5  134 ? -60.539 -38.407 52.274 1.00 99.50  ? 61   DG  I O6    1 
ATOM   8823  N  N1    . DG  I 5  134 ? -62.748 -38.684 51.805 1.00 111.44 ? 61   DG  I N1    1 
ATOM   8824  C  C2    . DG  I 5  134 ? -64.045 -38.244 51.714 1.00 119.98 ? 61   DG  I C2    1 
ATOM   8825  N  N2    . DG  I 5  134 ? -64.944 -39.143 51.286 1.00 122.24 ? 61   DG  I N2    1 
ATOM   8826  N  N3    . DG  I 5  134 ? -64.433 -37.015 52.020 1.00 121.82 ? 61   DG  I N3    1 
ATOM   8827  C  C4    . DG  I 5  134 ? -63.401 -36.249 52.435 1.00 119.02 ? 61   DG  I C4    1 
ATOM   8828  P  P     . DT  I 5  135 ? -67.419 -32.829 55.781 1.00 118.15 ? 62   DT  I P     1 
ATOM   8829  O  OP1   . DT  I 5  135 ? -68.672 -32.089 56.095 1.00 104.97 ? 62   DT  I OP1   1 
ATOM   8830  O  OP2   . DT  I 5  135 ? -66.215 -32.653 56.640 1.00 114.61 ? 62   DT  I OP2   1 
ATOM   8831  O  "O5'" . DT  I 5  135 ? -67.673 -34.397 55.733 1.00 117.21 ? 62   DT  I "O5'" 1 
ATOM   8832  C  "C5'" . DT  I 5  135 ? -68.803 -34.956 55.053 1.00 129.56 ? 62   DT  I "C5'" 1 
ATOM   8833  C  "C4'" . DT  I 5  135 ? -68.869 -36.427 55.382 1.00 139.30 ? 62   DT  I "C4'" 1 
ATOM   8834  O  "O4'" . DT  I 5  135 ? -67.676 -37.049 54.855 1.00 137.92 ? 62   DT  I "O4'" 1 
ATOM   8835  C  "C3'" . DT  I 5  135 ? -68.903 -36.722 56.888 1.00 143.76 ? 62   DT  I "C3'" 1 
ATOM   8836  O  "O3'" . DT  I 5  135 ? -70.157 -37.309 57.262 1.00 140.91 ? 62   DT  I "O3'" 1 
ATOM   8837  C  "C2'" . DT  I 5  135 ? -67.663 -37.564 57.151 1.00 145.15 ? 62   DT  I "C2'" 1 
ATOM   8838  C  "C1'" . DT  I 5  135 ? -67.145 -37.972 55.781 1.00 141.12 ? 62   DT  I "C1'" 1 
ATOM   8839  N  N1    . DT  I 5  135 ? -65.673 -37.927 55.670 1.00 138.63 ? 62   DT  I N1    1 
ATOM   8840  C  C2    . DT  I 5  135 ? -65.022 -38.984 55.070 1.00 135.93 ? 62   DT  I C2    1 
ATOM   8841  O  O2    . DT  I 5  135 ? -65.603 -39.951 54.607 1.00 134.92 ? 62   DT  I O2    1 
ATOM   8842  N  N3    . DT  I 5  135 ? -63.656 -38.862 55.026 1.00 134.31 ? 62   DT  I N3    1 
ATOM   8843  C  C4    . DT  I 5  135 ? -62.894 -37.815 55.512 1.00 135.20 ? 62   DT  I C4    1 
ATOM   8844  O  O4    . DT  I 5  135 ? -61.673 -37.842 55.392 1.00 132.33 ? 62   DT  I O4    1 
ATOM   8845  C  C5    . DT  I 5  135 ? -63.641 -36.746 56.136 1.00 137.70 ? 62   DT  I C5    1 
ATOM   8846  C  C7    . DT  I 5  135 ? -62.901 -35.571 56.694 1.00 132.06 ? 62   DT  I C7    1 
ATOM   8847  C  C6    . DT  I 5  135 ? -64.975 -36.853 56.181 1.00 139.09 ? 62   DT  I C6    1 
ATOM   8848  P  P     . DG  I 5  136 ? -70.264 -38.291 58.517 1.00 136.81 ? 63   DG  I P     1 
ATOM   8849  O  OP1   . DG  I 5  136 ? -71.706 -38.507 58.786 1.00 136.37 ? 63   DG  I OP1   1 
ATOM   8850  O  OP2   . DG  I 5  136 ? -69.407 -37.741 59.606 1.00 124.58 ? 63   DG  I OP2   1 
ATOM   8851  O  "O5'" . DG  I 5  136 ? -69.638 -39.641 57.933 1.00 144.87 ? 63   DG  I "O5'" 1 
ATOM   8852  C  "C5'" . DG  I 5  136 ? -70.289 -40.927 58.035 1.00 150.42 ? 63   DG  I "C5'" 1 
ATOM   8853  C  "C4'" . DG  I 5  136 ? -69.564 -41.788 59.043 1.00 155.49 ? 63   DG  I "C4'" 1 
ATOM   8854  O  "O4'" . DG  I 5  136 ? -68.150 -41.776 58.736 1.00 153.11 ? 63   DG  I "O4'" 1 
ATOM   8855  C  "C3'" . DG  I 5  136 ? -69.711 -41.309 60.494 1.00 163.76 ? 63   DG  I "C3'" 1 
ATOM   8856  O  "O3'" . DG  I 5  136 ? -70.480 -42.251 61.271 1.00 164.15 ? 63   DG  I "O3'" 1 
ATOM   8857  C  "C2'" . DG  I 5  136 ? -68.298 -40.934 60.925 1.00 163.22 ? 63   DG  I "C2'" 1 
ATOM   8858  C  "C1'" . DG  I 5  136 ? -67.388 -41.634 59.924 1.00 161.27 ? 63   DG  I "C1'" 1 
ATOM   8859  N  N9    . DG  I 5  136 ? -66.153 -40.924 59.586 1.00 150.70 ? 63   DG  I N9    1 
ATOM   8860  C  C8    . DG  I 5  136 ? -65.928 -39.568 59.647 1.00 139.70 ? 63   DG  I C8    1 
ATOM   8861  N  N7    . DG  I 5  136 ? -64.721 -39.232 59.278 1.00 122.67 ? 63   DG  I N7    1 
ATOM   8862  C  C5    . DG  I 5  136 ? -64.113 -40.437 58.950 1.00 121.45 ? 63   DG  I C5    1 
ATOM   8863  C  C6    . DG  I 5  136 ? -62.799 -40.706 58.486 1.00 117.71 ? 63   DG  I C6    1 
ATOM   8864  O  O6    . DG  I 5  136 ? -61.883 -39.907 58.262 1.00 121.80 ? 63   DG  I O6    1 
ATOM   8865  N  N1    . DG  I 5  136 ? -62.596 -42.068 58.287 1.00 108.97 ? 63   DG  I N1    1 
ATOM   8866  C  C2    . DG  I 5  136 ? -63.533 -43.047 58.506 1.00 108.26 ? 63   DG  I C2    1 
ATOM   8867  N  N2    . DG  I 5  136 ? -63.144 -44.305 58.253 1.00 104.68 ? 63   DG  I N2    1 
ATOM   8868  N  N3    . DG  I 5  136 ? -64.762 -42.810 58.939 1.00 115.92 ? 63   DG  I N3    1 
ATOM   8869  C  C4    . DG  I 5  136 ? -64.982 -41.492 59.138 1.00 130.36 ? 63   DG  I C4    1 
ATOM   8870  P  P     . DG  I 5  137 ? -69.792 -43.396 62.177 1.00 168.87 ? 64   DG  I P     1 
ATOM   8871  O  OP1   . DG  I 5  137 ? -70.856 -44.333 62.611 1.00 173.41 ? 64   DG  I OP1   1 
ATOM   8872  O  OP2   . DG  I 5  137 ? -68.953 -42.727 63.209 1.00 156.92 ? 64   DG  I OP2   1 
ATOM   8873  O  "O5'" . DG  I 5  137 ? -68.927 -44.238 61.134 1.00 157.39 ? 64   DG  I "O5'" 1 
ATOM   8874  C  "C5'" . DG  I 5  137 ? -68.605 -45.628 61.372 1.00 148.04 ? 64   DG  I "C5'" 1 
ATOM   8875  C  "C4'" . DG  I 5  137 ? -67.367 -45.754 62.233 1.00 148.79 ? 64   DG  I "C4'" 1 
ATOM   8876  O  "O4'" . DG  I 5  137 ? -66.401 -44.746 61.858 1.00 144.57 ? 64   DG  I "O4'" 1 
ATOM   8877  C  "C3'" . DG  I 5  137 ? -67.598 -45.587 63.744 1.00 145.35 ? 64   DG  I "C3'" 1 
ATOM   8878  O  "O3'" . DG  I 5  137 ? -67.601 -46.873 64.399 1.00 146.85 ? 64   DG  I "O3'" 1 
ATOM   8879  C  "C2'" . DG  I 5  137 ? -66.585 -44.535 64.180 1.00 139.68 ? 64   DG  I "C2'" 1 
ATOM   8880  C  "C1'" . DG  I 5  137 ? -65.630 -44.436 63.000 1.00 137.46 ? 64   DG  I "C1'" 1 
ATOM   8881  N  N9    . DG  I 5  137 ? -64.994 -43.136 62.787 1.00 123.90 ? 64   DG  I N9    1 
ATOM   8882  C  C8    . DG  I 5  137 ? -65.511 -41.886 63.030 1.00 119.06 ? 64   DG  I C8    1 
ATOM   8883  N  N7    . DG  I 5  137 ? -64.674 -40.922 62.754 1.00 108.61 ? 64   DG  I N7    1 
ATOM   8884  C  C5    . DG  I 5  137 ? -63.534 -41.576 62.308 1.00 108.22 ? 64   DG  I C5    1 
ATOM   8885  C  C6    . DG  I 5  137 ? -62.290 -41.057 61.864 1.00 105.88 ? 64   DG  I C6    1 
ATOM   8886  O  O6    . DG  I 5  137 ? -61.937 -39.875 61.770 1.00 109.20 ? 64   DG  I O6    1 
ATOM   8887  N  N1    . DG  I 5  137 ? -61.411 -42.074 61.499 1.00 96.84  ? 64   DG  I N1    1 
ATOM   8888  C  C2    . DG  I 5  137 ? -61.692 -43.418 61.556 1.00 97.81  ? 64   DG  I C2    1 
ATOM   8889  N  N2    . DG  I 5  137 ? -60.715 -44.246 61.165 1.00 96.10  ? 64   DG  I N2    1 
ATOM   8890  N  N3    . DG  I 5  137 ? -62.848 -43.913 61.966 1.00 108.45 ? 64   DG  I N3    1 
ATOM   8891  C  C4    . DG  I 5  137 ? -63.716 -42.943 62.322 1.00 115.07 ? 64   DG  I C4    1 
ATOM   8892  P  P     . DA  I 5  138 ? -66.290 -47.518 65.116 1.00 147.22 ? 65   DA  I P     1 
ATOM   8893  O  OP1   . DA  I 5  138 ? -66.646 -48.897 65.535 1.00 146.29 ? 65   DA  I OP1   1 
ATOM   8894  O  OP2   . DA  I 5  138 ? -65.796 -46.565 66.147 1.00 126.02 ? 65   DA  I OP2   1 
ATOM   8895  O  "O5'" . DA  I 5  138 ? -65.244 -47.710 63.924 1.00 146.04 ? 65   DA  I "O5'" 1 
ATOM   8896  C  "C5'" . DA  I 5  138 ? -64.646 -49.004 63.641 1.00 133.24 ? 65   DA  I "C5'" 1 
ATOM   8897  C  "C4'" . DA  I 5  138 ? -63.153 -48.995 63.895 1.00 130.80 ? 65   DA  I "C4'" 1 
ATOM   8898  O  "O4'" . DA  I 5  138 ? -62.606 -47.670 63.662 1.00 132.43 ? 65   DA  I "O4'" 1 
ATOM   8899  C  "C3'" . DA  I 5  138 ? -62.713 -49.378 65.315 1.00 128.56 ? 65   DA  I "C3'" 1 
ATOM   8900  O  "O3'" . DA  I 5  138 ? -61.503 -50.158 65.295 1.00 129.53 ? 65   DA  I "O3'" 1 
ATOM   8901  C  "C2'" . DA  I 5  138 ? -62.478 -48.028 65.961 1.00 127.32 ? 65   DA  I "C2'" 1 
ATOM   8902  C  "C1'" . DA  I 5  138 ? -61.855 -47.281 64.803 1.00 125.99 ? 65   DA  I "C1'" 1 
ATOM   8903  N  N9    . DA  I 5  138 ? -61.925 -45.828 64.930 1.00 115.80 ? 65   DA  I N9    1 
ATOM   8904  C  C8    . DA  I 5  138 ? -62.993 -45.060 65.324 1.00 117.52 ? 65   DA  I C8    1 
ATOM   8905  N  N7    . DA  I 5  138 ? -62.731 -43.777 65.376 1.00 106.86 ? 65   DA  I N7    1 
ATOM   8906  C  C5    . DA  I 5  138 ? -61.396 -43.697 65.009 1.00 104.46 ? 65   DA  I C5    1 
ATOM   8907  C  C6    . DA  I 5  138 ? -60.524 -42.610 64.871 1.00 98.56  ? 65   DA  I C6    1 
ATOM   8908  N  N6    . DA  I 5  138 ? -60.887 -41.345 65.093 1.00 96.49  ? 65   DA  I N6    1 
ATOM   8909  N  N1    . DA  I 5  138 ? -59.254 -42.867 64.485 1.00 100.04 ? 65   DA  I N1    1 
ATOM   8910  C  C2    . DA  I 5  138 ? -58.898 -44.140 64.258 1.00 103.59 ? 65   DA  I C2    1 
ATOM   8911  N  N3    . DA  I 5  138 ? -59.631 -45.248 64.356 1.00 105.68 ? 65   DA  I N3    1 
ATOM   8912  C  C4    . DA  I 5  138 ? -60.885 -44.953 64.739 1.00 108.57 ? 65   DA  I C4    1 
ATOM   8913  P  P     . DT  I 5  139 ? -60.595 -50.323 66.630 1.00 133.75 ? 66   DT  I P     1 
ATOM   8914  O  OP1   . DT  I 5  139 ? -59.830 -51.598 66.546 1.00 113.24 ? 66   DT  I OP1   1 
ATOM   8915  O  OP2   . DT  I 5  139 ? -61.448 -50.040 67.817 1.00 117.84 ? 66   DT  I OP2   1 
ATOM   8916  O  "O5'" . DT  I 5  139 ? -59.509 -49.174 66.463 1.00 133.21 ? 66   DT  I "O5'" 1 
ATOM   8917  C  "C5'" . DT  I 5  139 ? -58.332 -49.394 65.672 1.00 122.74 ? 66   DT  I "C5'" 1 
ATOM   8918  C  "C4'" . DT  I 5  139 ? -57.210 -48.522 66.180 1.00 115.30 ? 66   DT  I "C4'" 1 
ATOM   8919  O  "O4'" . DT  I 5  139 ? -57.654 -47.146 66.256 1.00 112.76 ? 66   DT  I "O4'" 1 
ATOM   8920  C  "C3'" . DT  I 5  139 ? -56.680 -48.877 67.572 1.00 105.09 ? 66   DT  I "C3'" 1 
ATOM   8921  O  "O3'" . DT  I 5  139 ? -55.254 -48.913 67.393 1.00 105.56 ? 66   DT  I "O3'" 1 
ATOM   8922  C  "C2'" . DT  I 5  139 ? -57.305 -47.815 68.469 1.00 98.49  ? 66   DT  I "C2'" 1 
ATOM   8923  C  "C1'" . DT  I 5  139 ? -57.364 -46.616 67.540 1.00 102.16 ? 66   DT  I "C1'" 1 
ATOM   8924  N  N1    . DT  I 5  139 ? -58.351 -45.540 67.814 1.00 98.27  ? 66   DT  I N1    1 
ATOM   8925  C  C2    . DT  I 5  139 ? -57.928 -44.251 67.577 1.00 97.98  ? 66   DT  I C2    1 
ATOM   8926  O  O2    . DT  I 5  139 ? -56.793 -43.977 67.223 1.00 100.05 ? 66   DT  I O2    1 
ATOM   8927  N  N3    . DT  I 5  139 ? -58.882 -43.286 67.787 1.00 91.29  ? 66   DT  I N3    1 
ATOM   8928  C  C4    . DT  I 5  139 ? -60.191 -43.478 68.181 1.00 91.77  ? 66   DT  I C4    1 
ATOM   8929  O  O4    . DT  I 5  139 ? -60.931 -42.510 68.333 1.00 86.59  ? 66   DT  I O4    1 
ATOM   8930  C  C5    . DT  I 5  139 ? -60.578 -44.858 68.383 1.00 96.89  ? 66   DT  I C5    1 
ATOM   8931  C  C7    . DT  I 5  139 ? -61.977 -45.164 68.815 1.00 102.23 ? 66   DT  I C7    1 
ATOM   8932  C  C6    . DT  I 5  139 ? -59.653 -45.808 68.181 1.00 95.11  ? 66   DT  I C6    1 
ATOM   8933  P  P     . DA  I 5  140 ? -54.233 -49.104 68.617 1.00 111.67 ? 67   DA  I P     1 
ATOM   8934  O  OP1   . DA  I 5  140 ? -53.627 -50.450 68.517 1.00 103.15 ? 67   DA  I OP1   1 
ATOM   8935  O  OP2   . DA  I 5  140 ? -54.916 -48.697 69.874 1.00 103.81 ? 67   DA  I OP2   1 
ATOM   8936  O  "O5'" . DA  I 5  140 ? -53.080 -48.066 68.255 1.00 105.78 ? 67   DA  I "O5'" 1 
ATOM   8937  C  "C5'" . DA  I 5  140 ? -53.262 -47.115 67.182 1.00 106.83 ? 67   DA  I "C5'" 1 
ATOM   8938  C  "C4'" . DA  I 5  140 ? -52.584 -45.795 67.479 1.00 111.81 ? 67   DA  I "C4'" 1 
ATOM   8939  O  "O4'" . DA  I 5  140 ? -53.575 -44.776 67.773 1.00 109.24 ? 67   DA  I "O4'" 1 
ATOM   8940  C  "C3'" . DA  I 5  140 ? -51.596 -45.774 68.649 1.00 105.12 ? 67   DA  I "C3'" 1 
ATOM   8941  O  "O3'" . DA  I 5  140 ? -50.471 -44.976 68.263 1.00 94.52  ? 67   DA  I "O3'" 1 
ATOM   8942  C  "C2'" . DA  I 5  140 ? -52.408 -45.165 69.780 1.00 103.67 ? 67   DA  I "C2'" 1 
ATOM   8943  C  "C1'" . DA  I 5  140 ? -53.334 -44.201 69.051 1.00 101.67 ? 67   DA  I "C1'" 1 
ATOM   8944  N  N9    . DA  I 5  140 ? -54.633 -43.981 69.684 1.00 92.50  ? 67   DA  I N9    1 
ATOM   8945  C  C8    . DA  I 5  140 ? -55.544 -44.941 70.044 1.00 94.85  ? 67   DA  I C8    1 
ATOM   8946  N  N7    . DA  I 5  140 ? -56.648 -44.454 70.558 1.00 95.19  ? 67   DA  I N7    1 
ATOM   8947  C  C5    . DA  I 5  140 ? -56.452 -43.081 70.530 1.00 85.38  ? 67   DA  I C5    1 
ATOM   8948  C  C6    . DA  I 5  140 ? -57.260 -42.003 70.931 1.00 90.82  ? 67   DA  I C6    1 
ATOM   8949  N  N6    . DA  I 5  140 ? -58.473 -42.147 71.469 1.00 91.05  ? 67   DA  I N6    1 
ATOM   8950  N  N1    . DA  I 5  140 ? -56.773 -40.754 70.757 1.00 95.67  ? 67   DA  I N1    1 
ATOM   8951  C  C2    . DA  I 5  140 ? -55.557 -40.611 70.212 1.00 90.61  ? 67   DA  I C2    1 
ATOM   8952  N  N3    . DA  I 5  140 ? -54.707 -41.546 69.793 1.00 87.97  ? 67   DA  I N3    1 
ATOM   8953  C  C4    . DA  I 5  140 ? -55.220 -42.775 69.984 1.00 87.90  ? 67   DA  I C4    1 
ATOM   8954  P  P     . DT  I 5  141 ? -49.206 -44.840 69.216 1.00 101.38 ? 68   DT  I P     1 
ATOM   8955  O  OP1   . DT  I 5  141 ? -48.005 -44.665 68.361 1.00 102.27 ? 68   DT  I OP1   1 
ATOM   8956  O  OP2   . DT  I 5  141 ? -49.245 -45.963 70.178 1.00 94.28  ? 68   DT  I OP2   1 
ATOM   8957  O  "O5'" . DT  I 5  141 ? -49.458 -43.437 69.935 1.00 92.32  ? 68   DT  I "O5'" 1 
ATOM   8958  C  "C5'" . DT  I 5  141 ? -49.927 -42.307 69.166 1.00 87.80  ? 68   DT  I "C5'" 1 
ATOM   8959  C  "C4'" . DT  I 5  141 ? -49.985 -41.035 69.986 1.00 89.46  ? 68   DT  I "C4'" 1 
ATOM   8960  O  "O4'" . DT  I 5  141 ? -51.308 -40.808 70.533 1.00 96.10  ? 68   DT  I "O4'" 1 
ATOM   8961  C  "C3'" . DT  I 5  141 ? -49.017 -40.934 71.163 1.00 91.43  ? 68   DT  I "C3'" 1 
ATOM   8962  O  "O3'" . DT  I 5  141 ? -48.462 -39.613 71.087 1.00 92.41  ? 68   DT  I "O3'" 1 
ATOM   8963  C  "C2'" . DT  I 5  141 ? -49.900 -41.197 72.375 1.00 89.99  ? 68   DT  I "C2'" 1 
ATOM   8964  C  "C1'" . DT  I 5  141 ? -51.244 -40.618 71.943 1.00 93.07  ? 68   DT  I "C1'" 1 
ATOM   8965  N  N1    . DT  I 5  141 ? -52.472 -41.221 72.534 1.00 93.78  ? 68   DT  I N1    1 
ATOM   8966  C  C2    . DT  I 5  141 ? -53.539 -40.389 72.810 1.00 96.88  ? 68   DT  I C2    1 
ATOM   8967  O  O2    . DT  I 5  141 ? -53.508 -39.182 72.634 1.00 89.90  ? 68   DT  I O2    1 
ATOM   8968  N  N3    . DT  I 5  141 ? -54.646 -41.026 73.318 1.00 95.54  ? 68   DT  I N3    1 
ATOM   8969  C  C4    . DT  I 5  141 ? -54.797 -42.380 73.553 1.00 91.39  ? 68   DT  I C4    1 
ATOM   8970  O  O4    . DT  I 5  141 ? -55.857 -42.808 73.998 1.00 87.12  ? 68   DT  I O4    1 
ATOM   8971  C  C5    . DT  I 5  141 ? -53.644 -43.194 73.233 1.00 83.95  ? 68   DT  I C5    1 
ATOM   8972  C  C7    . DT  I 5  141 ? -53.715 -44.672 73.450 1.00 82.00  ? 68   DT  I C7    1 
ATOM   8973  C  C6    . DT  I 5  141 ? -52.558 -42.583 72.739 1.00 89.19  ? 68   DT  I C6    1 
ATOM   8974  P  P     . DT  I 5  142 ? -47.205 -39.188 71.986 1.00 90.55  ? 69   DT  I P     1 
ATOM   8975  O  OP1   . DT  I 5  142 ? -46.370 -38.268 71.193 1.00 85.87  ? 69   DT  I OP1   1 
ATOM   8976  O  OP2   . DT  I 5  142 ? -46.605 -40.429 72.558 1.00 83.86  ? 69   DT  I OP2   1 
ATOM   8977  O  "O5'" . DT  I 5  142 ? -47.872 -38.215 73.057 1.00 81.05  ? 69   DT  I "O5'" 1 
ATOM   8978  C  "C5'" . DT  I 5  142 ? -48.737 -37.159 72.577 1.00 85.97  ? 69   DT  I "C5'" 1 
ATOM   8979  C  "C4'" . DT  I 5  142 ? -49.628 -36.635 73.679 1.00 88.21  ? 69   DT  I "C4'" 1 
ATOM   8980  O  "O4'" . DT  I 5  142 ? -50.655 -37.602 74.007 1.00 89.53  ? 69   DT  I "O4'" 1 
ATOM   8981  C  "C3'" . DT  I 5  142 ? -48.898 -36.325 74.989 1.00 88.32  ? 69   DT  I "C3'" 1 
ATOM   8982  O  "O3'" . DT  I 5  142 ? -49.154 -34.978 75.378 1.00 82.81  ? 69   DT  I "O3'" 1 
ATOM   8983  C  "C2'" . DT  I 5  142 ? -49.466 -37.321 75.985 1.00 92.57  ? 69   DT  I "C2'" 1 
ATOM   8984  C  "C1'" . DT  I 5  142 ? -50.842 -37.599 75.409 1.00 89.02  ? 69   DT  I "C1'" 1 
ATOM   8985  N  N1    . DT  I 5  142 ? -51.457 -38.884 75.787 1.00 79.68  ? 69   DT  I N1    1 
ATOM   8986  C  C2    . DT  I 5  142 ? -52.768 -38.866 76.205 1.00 82.23  ? 69   DT  I C2    1 
ATOM   8987  O  O2    . DT  I 5  142 ? -53.420 -37.838 76.307 1.00 68.84  ? 69   DT  I O2    1 
ATOM   8988  N  N3    . DT  I 5  142 ? -53.290 -40.102 76.508 1.00 82.43  ? 69   DT  I N3    1 
ATOM   8989  C  C4    . DT  I 5  142 ? -52.639 -41.321 76.441 1.00 87.34  ? 69   DT  I C4    1 
ATOM   8990  O  O4    . DT  I 5  142 ? -53.232 -42.350 76.757 1.00 101.14 ? 69   DT  I O4    1 
ATOM   8991  C  C5    . DT  I 5  142 ? -51.265 -41.264 75.992 1.00 80.37  ? 69   DT  I C5    1 
ATOM   8992  C  C7    . DT  I 5  142 ? -50.479 -42.533 75.892 1.00 77.03  ? 69   DT  I C7    1 
ATOM   8993  C  C6    . DT  I 5  142 ? -50.753 -40.065 75.688 1.00 79.34  ? 69   DT  I C6    1 
ATOM   8994  P  P     . DG  I 5  143 ? -48.313 -34.342 76.562 1.00 88.92  ? 70   DG  I P     1 
ATOM   8995  O  OP1   . DG  I 5  143 ? -48.057 -32.913 76.244 1.00 81.74  ? 70   DG  I OP1   1 
ATOM   8996  O  OP2   . DG  I 5  143 ? -47.221 -35.277 76.916 1.00 72.75  ? 70   DG  I OP2   1 
ATOM   8997  O  "O5'" . DG  I 5  143 ? -49.372 -34.282 77.736 1.00 105.35 ? 70   DG  I "O5'" 1 
ATOM   8998  C  "C5'" . DG  I 5  143 ? -50.582 -33.538 77.540 1.00 111.89 ? 70   DG  I "C5'" 1 
ATOM   8999  C  "C4'" . DG  I 5  143 ? -51.521 -33.847 78.677 1.00 109.30 ? 70   DG  I "C4'" 1 
ATOM   9000  O  "O4'" . DG  I 5  143 ? -51.934 -35.234 78.591 1.00 110.02 ? 70   DG  I "O4'" 1 
ATOM   9001  C  "C3'" . DG  I 5  143 ? -50.854 -33.699 80.044 1.00 104.65 ? 70   DG  I "C3'" 1 
ATOM   9002  O  "O3'" . DG  I 5  143 ? -51.786 -33.081 80.928 1.00 103.81 ? 70   DG  I "O3'" 1 
ATOM   9003  C  "C2'" . DG  I 5  143 ? -50.508 -35.130 80.416 1.00 98.04  ? 70   DG  I "C2'" 1 
ATOM   9004  C  "C1'" . DG  I 5  143 ? -51.739 -35.807 79.866 1.00 105.61 ? 70   DG  I "C1'" 1 
ATOM   9005  N  N9    . DG  I 5  143 ? -51.732 -37.258 79.731 1.00 104.98 ? 70   DG  I N9    1 
ATOM   9006  C  C8    . DG  I 5  143 ? -50.674 -38.096 79.466 1.00 102.09 ? 70   DG  I C8    1 
ATOM   9007  N  N7    . DG  I 5  143 ? -51.013 -39.358 79.453 1.00 98.43  ? 70   DG  I N7    1 
ATOM   9008  C  C5    . DG  I 5  143 ? -52.370 -39.351 79.748 1.00 97.40  ? 70   DG  I C5    1 
ATOM   9009  C  C6    . DG  I 5  143 ? -53.284 -40.423 79.883 1.00 91.93  ? 70   DG  I C6    1 
ATOM   9010  O  O6    . DG  I 5  143 ? -53.072 -41.633 79.757 1.00 89.77  ? 70   DG  I O6    1 
ATOM   9011  N  N1    . DG  I 5  143 ? -54.563 -39.970 80.194 1.00 97.00  ? 70   DG  I N1    1 
ATOM   9012  C  C2    . DG  I 5  143 ? -54.916 -38.652 80.358 1.00 100.89 ? 70   DG  I C2    1 
ATOM   9013  N  N2    . DG  I 5  143 ? -56.203 -38.412 80.650 1.00 105.40 ? 70   DG  I N2    1 
ATOM   9014  N  N3    . DG  I 5  143 ? -54.072 -37.643 80.235 1.00 94.28  ? 70   DG  I N3    1 
ATOM   9015  C  C4    . DG  I 5  143 ? -52.826 -38.063 79.928 1.00 100.21 ? 70   DG  I C4    1 
ATOM   9016  P  P     . DA  I 5  144 ? -51.236 -32.333 82.209 1.00 128.21 ? 71   DA  I P     1 
ATOM   9017  O  OP1   . DA  I 5  144 ? -50.774 -30.986 81.780 1.00 114.22 ? 71   DA  I OP1   1 
ATOM   9018  O  OP2   . DA  I 5  144 ? -50.289 -33.258 82.903 1.00 108.95 ? 71   DA  I OP2   1 
ATOM   9019  O  "O5'" . DA  I 5  144 ? -52.529 -32.150 83.126 1.00 128.55 ? 71   DA  I "O5'" 1 
ATOM   9020  C  "C5'" . DA  I 5  144 ? -53.878 -32.311 82.634 1.00 127.11 ? 71   DA  I "C5'" 1 
ATOM   9021  C  "C4'" . DA  I 5  144 ? -54.621 -33.355 83.441 1.00 123.96 ? 71   DA  I "C4'" 1 
ATOM   9022  O  "O4'" . DA  I 5  144 ? -54.277 -34.678 82.968 1.00 110.02 ? 71   DA  I "O4'" 1 
ATOM   9023  C  "C3'" . DA  I 5  144 ? -54.361 -33.358 84.954 1.00 122.99 ? 71   DA  I "C3'" 1 
ATOM   9024  O  "O3'" . DA  I 5  144 ? -55.588 -33.136 85.662 1.00 139.57 ? 71   DA  I "O3'" 1 
ATOM   9025  C  "C2'" . DA  I 5  144 ? -53.811 -34.747 85.242 1.00 107.14 ? 71   DA  I "C2'" 1 
ATOM   9026  C  "C1'" . DA  I 5  144 ? -54.290 -35.564 84.061 1.00 94.97  ? 71   DA  I "C1'" 1 
ATOM   9027  N  N9    . DA  I 5  144 ? -53.402 -36.671 83.741 1.00 88.91  ? 71   DA  I N9    1 
ATOM   9028  C  C8    . DA  I 5  144 ? -52.052 -36.608 83.504 1.00 86.25  ? 71   DA  I C8    1 
ATOM   9029  N  N7    . DA  I 5  144 ? -51.503 -37.773 83.261 1.00 84.52  ? 71   DA  I N7    1 
ATOM   9030  C  C5    . DA  I 5  144 ? -52.561 -38.665 83.353 1.00 87.05  ? 71   DA  I C5    1 
ATOM   9031  C  C6    . DA  I 5  144 ? -52.636 -40.061 83.210 1.00 86.30  ? 71   DA  I C6    1 
ATOM   9032  N  N6    . DA  I 5  144 ? -51.585 -40.831 82.923 1.00 86.53  ? 71   DA  I N6    1 
ATOM   9033  N  N1    . DA  I 5  144 ? -53.843 -40.647 83.375 1.00 81.54  ? 71   DA  I N1    1 
ATOM   9034  C  C2    . DA  I 5  144 ? -54.896 -39.871 83.665 1.00 86.41  ? 71   DA  I C2    1 
ATOM   9035  N  N3    . DA  I 5  144 ? -54.950 -38.550 83.830 1.00 88.67  ? 71   DA  I N3    1 
ATOM   9036  C  C4    . DA  I 5  144 ? -53.736 -38.001 83.656 1.00 89.39  ? 71   DA  I C4    1 
ATOM   9037  P  P     . DT  I 5  145 ? -55.598 -32.748 87.229 1.00 129.43 ? 72   DT  I P     1 
ATOM   9038  O  OP1   . DT  I 5  145 ? -56.885 -32.050 87.493 1.00 107.28 ? 72   DT  I OP1   1 
ATOM   9039  O  OP2   . DT  I 5  145 ? -54.311 -32.077 87.574 1.00 112.06 ? 72   DT  I OP2   1 
ATOM   9040  O  "O5'" . DT  I 5  145 ? -55.562 -34.171 87.949 1.00 121.15 ? 72   DT  I "O5'" 1 
ATOM   9041  C  "C5'" . DT  I 5  145 ? -56.634 -35.117 87.780 1.00 119.77 ? 72   DT  I "C5'" 1 
ATOM   9042  C  "C4'" . DT  I 5  145 ? -56.317 -36.428 88.463 1.00 118.77 ? 72   DT  I "C4'" 1 
ATOM   9043  O  "O4'" . DT  I 5  145 ? -55.613 -37.303 87.563 1.00 115.88 ? 72   DT  I "O4'" 1 
ATOM   9044  C  "C3'" . DT  I 5  145 ? -55.423 -36.350 89.698 1.00 120.74 ? 72   DT  I "C3'" 1 
ATOM   9045  O  "O3'" . DT  I 5  145 ? -56.216 -36.126 90.870 1.00 119.02 ? 72   DT  I "O3'" 1 
ATOM   9046  C  "C2'" . DT  I 5  145 ? -54.729 -37.705 89.720 1.00 118.42 ? 72   DT  I "C2'" 1 
ATOM   9047  C  "C1'" . DT  I 5  145 ? -55.015 -38.320 88.345 1.00 119.21 ? 72   DT  I "C1'" 1 
ATOM   9048  N  N1    . DT  I 5  145 ? -53.821 -38.807 87.625 1.00 121.70 ? 72   DT  I N1    1 
ATOM   9049  C  C2    . DT  I 5  145 ? -53.814 -40.113 87.191 1.00 111.23 ? 72   DT  I C2    1 
ATOM   9050  O  O2    . DT  I 5  145 ? -54.753 -40.873 87.357 1.00 117.99 ? 72   DT  I O2    1 
ATOM   9051  N  N3    . DT  I 5  145 ? -52.663 -40.497 86.548 1.00 104.29 ? 72   DT  I N3    1 
ATOM   9052  C  C4    . DT  I 5  145 ? -51.545 -39.721 86.303 1.00 110.60 ? 72   DT  I C4    1 
ATOM   9053  O  O4    . DT  I 5  145 ? -50.583 -40.205 85.711 1.00 109.03 ? 72   DT  I O4    1 
ATOM   9054  C  C5    . DT  I 5  145 ? -51.623 -38.358 86.785 1.00 112.84 ? 72   DT  I C5    1 
ATOM   9055  C  C7    . DT  I 5  145 ? -50.459 -37.443 86.571 1.00 116.37 ? 72   DT  I C7    1 
ATOM   9056  C  C6    . DT  I 5  145 ? -52.741 -37.976 87.415 1.00 122.59 ? 72   DT  I C6    1 
ATOM   9057  O  "O5'" . DA  J 6  1   ? -49.818 -50.278 85.140 1.00 133.97 ? -72  DA  J "O5'" 1 
ATOM   9058  C  "C5'" . DA  J 6  1   ? -51.149 -50.603 84.697 1.00 133.83 ? -72  DA  J "C5'" 1 
ATOM   9059  C  "C4'" . DA  J 6  1   ? -52.184 -50.189 85.720 1.00 131.79 ? -72  DA  J "C4'" 1 
ATOM   9060  O  "O4'" . DA  J 6  1   ? -51.591 -49.373 86.760 1.00 134.11 ? -72  DA  J "O4'" 1 
ATOM   9061  C  "C3'" . DA  J 6  1   ? -53.346 -49.376 85.152 1.00 127.53 ? -72  DA  J "C3'" 1 
ATOM   9062  O  "O3'" . DA  J 6  1   ? -54.355 -50.316 84.749 1.00 127.03 ? -72  DA  J "O3'" 1 
ATOM   9063  C  "C2'" . DA  J 6  1   ? -53.704 -48.433 86.291 1.00 124.26 ? -72  DA  J "C2'" 1 
ATOM   9064  C  "C1'" . DA  J 6  1   ? -52.380 -48.217 87.014 1.00 125.23 ? -72  DA  J "C1'" 1 
ATOM   9065  N  N9    . DA  J 6  1   ? -51.605 -47.044 86.597 1.00 122.67 ? -72  DA  J N9    1 
ATOM   9066  C  C8    . DA  J 6  1   ? -50.334 -47.038 86.074 1.00 116.47 ? -72  DA  J C8    1 
ATOM   9067  N  N7    . DA  J 6  1   ? -49.880 -45.839 85.802 1.00 108.72 ? -72  DA  J N7    1 
ATOM   9068  C  C5    . DA  J 6  1   ? -50.919 -44.997 86.171 1.00 104.12 ? -72  DA  J C5    1 
ATOM   9069  C  C6    . DA  J 6  1   ? -51.067 -43.598 86.120 1.00 94.26  ? -72  DA  J C6    1 
ATOM   9070  N  N6    . DA  J 6  1   ? -50.122 -42.771 85.670 1.00 94.04  ? -72  DA  J N6    1 
ATOM   9071  N  N1    . DA  J 6  1   ? -52.230 -43.073 86.559 1.00 88.96  ? -72  DA  J N1    1 
ATOM   9072  C  C2    . DA  J 6  1   ? -53.176 -43.904 87.020 1.00 101.58 ? -72  DA  J C2    1 
ATOM   9073  N  N3    . DA  J 6  1   ? -53.158 -45.235 87.110 1.00 111.85 ? -72  DA  J N3    1 
ATOM   9074  C  C4    . DA  J 6  1   ? -51.986 -45.725 86.669 1.00 114.27 ? -72  DA  J C4    1 
ATOM   9075  P  P     . DT  J 6  2   ? -55.840 -49.837 84.355 1.00 131.85 ? -71  DT  J P     1 
ATOM   9076  O  OP1   . DT  J 6  2   ? -56.648 -51.050 84.070 1.00 131.16 ? -71  DT  J OP1   1 
ATOM   9077  O  OP2   . DT  J 6  2   ? -55.727 -48.787 83.311 1.00 110.95 ? -71  DT  J OP2   1 
ATOM   9078  O  "O5'" . DT  J 6  2   ? -56.373 -49.211 85.720 1.00 130.36 ? -71  DT  J "O5'" 1 
ATOM   9079  C  "C5'" . DT  J 6  2   ? -57.776 -49.094 86.010 1.00 133.29 ? -71  DT  J "C5'" 1 
ATOM   9080  C  "C4'" . DT  J 6  2   ? -58.242 -47.699 85.672 1.00 129.54 ? -71  DT  J "C4'" 1 
ATOM   9081  O  "O4'" . DT  J 6  2   ? -57.118 -46.792 85.744 1.00 125.39 ? -71  DT  J "O4'" 1 
ATOM   9082  C  "C3'" . DT  J 6  2   ? -58.803 -47.560 84.252 1.00 135.42 ? -71  DT  J "C3'" 1 
ATOM   9083  O  "O3'" . DT  J 6  2   ? -60.238 -47.555 84.169 1.00 143.53 ? -71  DT  J "O3'" 1 
ATOM   9084  C  "C2'" . DT  J 6  2   ? -58.156 -46.296 83.709 1.00 136.80 ? -71  DT  J "C2'" 1 
ATOM   9085  C  "C1'" . DT  J 6  2   ? -57.389 -45.706 84.882 1.00 131.18 ? -71  DT  J "C1'" 1 
ATOM   9086  N  N1    . DT  J 6  2   ? -56.102 -45.085 84.481 1.00 127.61 ? -71  DT  J N1    1 
ATOM   9087  C  C2    . DT  J 6  2   ? -56.050 -43.710 84.403 1.00 120.08 ? -71  DT  J C2    1 
ATOM   9088  O  O2    . DT  J 6  2   ? -56.987 -42.987 84.706 1.00 119.48 ? -71  DT  J O2    1 
ATOM   9089  N  N3    . DT  J 6  2   ? -54.845 -43.206 83.975 1.00 109.14 ? -71  DT  J N3    1 
ATOM   9090  C  C4    . DT  J 6  2   ? -53.723 -43.924 83.605 1.00 110.23 ? -71  DT  J C4    1 
ATOM   9091  O  O4    . DT  J 6  2   ? -52.709 -43.333 83.250 1.00 99.51  ? -71  DT  J O4    1 
ATOM   9092  C  C5    . DT  J 6  2   ? -53.854 -45.362 83.689 1.00 115.09 ? -71  DT  J C5    1 
ATOM   9093  C  C7    . DT  J 6  2   ? -52.690 -46.221 83.305 1.00 103.33 ? -71  DT  J C7    1 
ATOM   9094  C  C6    . DT  J 6  2   ? -55.025 -45.864 84.107 1.00 124.84 ? -71  DT  J C6    1 
ATOM   9095  P  P     . DC  J 6  3   ? -61.134 -46.445 84.929 1.00 161.19 ? -70  DC  J P     1 
ATOM   9096  O  OP1   . DC  J 6  3   ? -60.852 -46.533 86.385 1.00 162.52 ? -70  DC  J OP1   1 
ATOM   9097  O  OP2   . DC  J 6  3   ? -62.535 -46.572 84.444 1.00 151.30 ? -70  DC  J OP2   1 
ATOM   9098  O  "O5'" . DC  J 6  3   ? -60.588 -45.053 84.375 1.00 154.32 ? -70  DC  J "O5'" 1 
ATOM   9099  C  "C5'" . DC  J 6  3   ? -60.908 -43.824 85.058 1.00 144.43 ? -70  DC  J "C5'" 1 
ATOM   9100  C  "C4'" . DC  J 6  3   ? -60.954 -42.657 84.097 1.00 139.10 ? -70  DC  J "C4'" 1 
ATOM   9101  O  "O4'" . DC  J 6  3   ? -59.641 -42.410 83.537 1.00 133.86 ? -70  DC  J "O4'" 1 
ATOM   9102  C  "C3'" . DC  J 6  3   ? -61.897 -42.809 82.900 1.00 130.25 ? -70  DC  J "C3'" 1 
ATOM   9103  O  "O3'" . DC  J 6  3   ? -62.513 -41.540 82.670 1.00 126.04 ? -70  DC  J "O3'" 1 
ATOM   9104  C  "C2'" . DC  J 6  3   ? -60.958 -43.170 81.766 1.00 129.89 ? -70  DC  J "C2'" 1 
ATOM   9105  C  "C1'" . DC  J 6  3   ? -59.744 -42.328 82.123 1.00 130.77 ? -70  DC  J "C1'" 1 
ATOM   9106  N  N1    . DC  J 6  3   ? -58.455 -42.761 81.553 1.00 125.53 ? -70  DC  J N1    1 
ATOM   9107  C  C2    . DC  J 6  3   ? -57.457 -41.803 81.337 1.00 110.08 ? -70  DC  J C2    1 
ATOM   9108  O  O2    . DC  J 6  3   ? -57.698 -40.615 81.602 1.00 101.42 ? -70  DC  J O2    1 
ATOM   9109  N  N3    . DC  J 6  3   ? -56.263 -42.196 80.836 1.00 100.62 ? -70  DC  J N3    1 
ATOM   9110  C  C4    . DC  J 6  3   ? -56.048 -43.485 80.558 1.00 115.18 ? -70  DC  J C4    1 
ATOM   9111  N  N4    . DC  J 6  3   ? -54.857 -43.830 80.063 1.00 115.17 ? -70  DC  J N4    1 
ATOM   9112  C  C5    . DC  J 6  3   ? -57.046 -44.479 80.770 1.00 115.90 ? -70  DC  J C5    1 
ATOM   9113  C  C6    . DC  J 6  3   ? -58.222 -44.078 81.267 1.00 121.77 ? -70  DC  J C6    1 
ATOM   9114  P  P     . DA  J 6  4   ? -63.690 -41.396 81.610 1.00 136.93 ? -69  DA  J P     1 
ATOM   9115  O  OP1   . DA  J 6  4   ? -64.970 -41.593 82.330 1.00 133.55 ? -69  DA  J OP1   1 
ATOM   9116  O  OP2   . DA  J 6  4   ? -63.370 -42.270 80.446 1.00 125.18 ? -69  DA  J OP2   1 
ATOM   9117  O  "O5'" . DA  J 6  4   ? -63.629 -39.856 81.181 1.00 125.63 ? -69  DA  J "O5'" 1 
ATOM   9118  C  "C5'" . DA  J 6  4   ? -62.628 -38.927 81.676 1.00 124.41 ? -69  DA  J "C5'" 1 
ATOM   9119  C  "C4'" . DA  J 6  4   ? -62.017 -38.116 80.551 1.00 118.82 ? -69  DA  J "C4'" 1 
ATOM   9120  O  "O4'" . DA  J 6  4   ? -60.728 -38.683 80.186 1.00 109.26 ? -69  DA  J "O4'" 1 
ATOM   9121  C  "C3'" . DA  J 6  4   ? -62.825 -38.075 79.248 1.00 115.52 ? -69  DA  J "C3'" 1 
ATOM   9122  O  "O3'" . DA  J 6  4   ? -62.530 -36.924 78.451 1.00 115.05 ? -69  DA  J "O3'" 1 
ATOM   9123  C  "C2'" . DA  J 6  4   ? -62.201 -39.196 78.445 1.00 113.51 ? -69  DA  J "C2'" 1 
ATOM   9124  C  "C1'" . DA  J 6  4   ? -60.744 -38.941 78.786 1.00 108.73 ? -69  DA  J "C1'" 1 
ATOM   9125  N  N9    . DA  J 6  4   ? -59.805 -40.024 78.495 1.00 100.74 ? -69  DA  J N9    1 
ATOM   9126  C  C8    . DA  J 6  4   ? -60.020 -41.381 78.472 1.00 98.37  ? -69  DA  J C8    1 
ATOM   9127  N  N7    . DA  J 6  4   ? -58.963 -42.077 78.130 1.00 88.59  ? -69  DA  J N7    1 
ATOM   9128  C  C5    . DA  J 6  4   ? -57.996 -41.113 77.881 1.00 90.46  ? -69  DA  J C5    1 
ATOM   9129  C  C6    . DA  J 6  4   ? -56.653 -41.202 77.479 1.00 84.12  ? -69  DA  J C6    1 
ATOM   9130  N  N6    . DA  J 6  4   ? -56.026 -42.356 77.246 1.00 85.48  ? -69  DA  J N6    1 
ATOM   9131  N  N1    . DA  J 6  4   ? -55.965 -40.049 77.325 1.00 80.53  ? -69  DA  J N1    1 
ATOM   9132  C  C2    . DA  J 6  4   ? -56.592 -38.890 77.566 1.00 80.97  ? -69  DA  J C2    1 
ATOM   9133  N  N3    . DA  J 6  4   ? -57.847 -38.678 77.951 1.00 88.12  ? -69  DA  J N3    1 
ATOM   9134  C  C4    . DA  J 6  4   ? -58.503 -39.844 78.095 1.00 97.91  ? -69  DA  J C4    1 
ATOM   9135  P  P     . DA  J 6  5   ? -63.369 -35.581 78.587 1.00 121.60 ? -68  DA  J P     1 
ATOM   9136  O  OP1   . DA  J 6  5   ? -63.375 -35.196 80.025 1.00 112.48 ? -68  DA  J OP1   1 
ATOM   9137  O  OP2   . DA  J 6  5   ? -64.650 -35.757 77.854 1.00 119.66 ? -68  DA  J OP2   1 
ATOM   9138  O  "O5'" . DA  J 6  5   ? -62.510 -34.551 77.720 1.00 131.78 ? -68  DA  J "O5'" 1 
ATOM   9139  C  "C5'" . DA  J 6  5   ? -61.279 -33.970 78.225 1.00 129.31 ? -68  DA  J "C5'" 1 
ATOM   9140  C  "C4'" . DA  J 6  5   ? -60.232 -33.813 77.141 1.00 115.27 ? -68  DA  J "C4'" 1 
ATOM   9141  O  "O4'" . DA  J 6  5   ? -59.551 -35.070 76.901 1.00 109.79 ? -68  DA  J "O4'" 1 
ATOM   9142  C  "C3'" . DA  J 6  5   ? -60.737 -33.327 75.777 1.00 110.67 ? -68  DA  J "C3'" 1 
ATOM   9143  O  "O3'" . DA  J 6  5   ? -59.917 -32.228 75.358 1.00 110.27 ? -68  DA  J "O3'" 1 
ATOM   9144  C  "C2'" . DA  J 6  5   ? -60.645 -34.560 74.889 1.00 97.58  ? -68  DA  J "C2'" 1 
ATOM   9145  C  "C1'" . DA  J 6  5   ? -59.487 -35.325 75.509 1.00 103.67 ? -68  DA  J "C1'" 1 
ATOM   9146  N  N9    . DA  J 6  5   ? -59.508 -36.774 75.319 1.00 103.82 ? -68  DA  J N9    1 
ATOM   9147  C  C8    . DA  J 6  5   ? -60.556 -37.646 75.486 1.00 113.03 ? -68  DA  J C8    1 
ATOM   9148  N  N7    . DA  J 6  5   ? -60.248 -38.896 75.233 1.00 110.67 ? -68  DA  J N7    1 
ATOM   9149  C  C5    . DA  J 6  5   ? -58.908 -38.844 74.877 1.00 97.59  ? -68  DA  J C5    1 
ATOM   9150  C  C6    . DA  J 6  5   ? -57.987 -39.840 74.504 1.00 96.39  ? -68  DA  J C6    1 
ATOM   9151  N  N6    . DA  J 6  5   ? -58.290 -41.137 74.418 1.00 95.92  ? -68  DA  J N6    1 
ATOM   9152  N  N1    . DA  J 6  5   ? -56.726 -39.453 74.216 1.00 95.22  ? -68  DA  J N1    1 
ATOM   9153  C  C2    . DA  J 6  5   ? -56.420 -38.153 74.303 1.00 102.84 ? -68  DA  J C2    1 
ATOM   9154  N  N3    . DA  J 6  5   ? -57.196 -37.125 74.643 1.00 101.13 ? -68  DA  J N3    1 
ATOM   9155  C  C4    . DA  J 6  5   ? -58.439 -37.545 74.930 1.00 99.81  ? -68  DA  J C4    1 
ATOM   9156  P  P     . DT  J 6  6   ? -60.363 -31.270 74.136 1.00 121.10 ? -67  DT  J P     1 
ATOM   9157  O  OP1   . DT  J 6  6   ? -60.109 -29.856 74.540 1.00 96.67  ? -67  DT  J OP1   1 
ATOM   9158  O  OP2   . DT  J 6  6   ? -61.721 -31.672 73.687 1.00 109.27 ? -67  DT  J OP2   1 
ATOM   9159  O  "O5'" . DT  J 6  6   ? -59.354 -31.696 72.977 1.00 124.60 ? -67  DT  J "O5'" 1 
ATOM   9160  C  "C5'" . DT  J 6  6   ? -58.000 -32.080 73.285 1.00 120.12 ? -67  DT  J "C5'" 1 
ATOM   9161  C  "C4'" . DT  J 6  6   ? -57.413 -32.958 72.203 1.00 116.85 ? -67  DT  J "C4'" 1 
ATOM   9162  O  "O4'" . DT  J 6  6   ? -57.702 -34.366 72.416 1.00 116.31 ? -67  DT  J "O4'" 1 
ATOM   9163  C  "C3'" . DT  J 6  6   ? -57.843 -32.650 70.764 1.00 111.99 ? -67  DT  J "C3'" 1 
ATOM   9164  O  "O3'" . DT  J 6  6   ? -56.613 -32.603 70.051 1.00 115.24 ? -67  DT  J "O3'" 1 
ATOM   9165  C  "C2'" . DT  J 6  6   ? -58.613 -33.891 70.347 1.00 110.25 ? -67  DT  J "C2'" 1 
ATOM   9166  C  "C1'" . DT  J 6  6   ? -57.870 -34.949 71.138 1.00 111.66 ? -67  DT  J "C1'" 1 
ATOM   9167  N  N1    . DT  J 6  6   ? -58.539 -36.258 71.302 1.00 112.01 ? -67  DT  J N1    1 
ATOM   9168  C  C2    . DT  J 6  6   ? -57.785 -37.394 71.098 1.00 104.76 ? -67  DT  J C2    1 
ATOM   9169  O  O2    . DT  J 6  6   ? -56.601 -37.363 70.808 1.00 93.29  ? -67  DT  J O2    1 
ATOM   9170  N  N3    . DT  J 6  6   ? -58.473 -38.573 71.247 1.00 102.54 ? -67  DT  J N3    1 
ATOM   9171  C  C4    . DT  J 6  6   ? -59.806 -38.726 71.580 1.00 106.42 ? -67  DT  J C4    1 
ATOM   9172  O  O4    . DT  J 6  6   ? -60.283 -39.853 71.691 1.00 101.00 ? -67  DT  J O4    1 
ATOM   9173  C  C5    . DT  J 6  6   ? -60.538 -37.492 71.775 1.00 115.30 ? -67  DT  J C5    1 
ATOM   9174  C  C7    . DT  J 6  6   ? -61.990 -37.556 72.135 1.00 120.58 ? -67  DT  J C7    1 
ATOM   9175  C  C6    . DT  J 6  6   ? -59.878 -36.337 71.623 1.00 113.07 ? -67  DT  J C6    1 
ATOM   9176  P  P     . DA  J 6  7   ? -56.429 -31.758 68.721 1.00 108.78 ? -66  DA  J P     1 
ATOM   9177  O  OP1   . DA  J 6  7   ? -55.923 -30.409 69.114 1.00 89.91  ? -66  DA  J OP1   1 
ATOM   9178  O  OP2   . DA  J 6  7   ? -57.657 -31.899 67.893 1.00 96.15  ? -66  DA  J OP2   1 
ATOM   9179  O  "O5'" . DA  J 6  7   ? -55.260 -32.571 68.012 1.00 97.47  ? -66  DA  J "O5'" 1 
ATOM   9180  C  "C5'" . DA  J 6  7   ? -54.170 -33.077 68.809 1.00 95.16  ? -66  DA  J "C5'" 1 
ATOM   9181  C  "C4'" . DA  J 6  7   ? -53.725 -34.429 68.308 1.00 98.37  ? -66  DA  J "C4'" 1 
ATOM   9182  O  "O4'" . DA  J 6  7   ? -54.745 -35.420 68.577 1.00 100.41 ? -66  DA  J "O4'" 1 
ATOM   9183  C  "C3'" . DA  J 6  7   ? -53.460 -34.486 66.801 1.00 102.77 ? -66  DA  J "C3'" 1 
ATOM   9184  O  "O3'" . DA  J 6  7   ? -52.190 -35.104 66.541 1.00 95.84  ? -66  DA  J "O3'" 1 
ATOM   9185  C  "C2'" . DA  J 6  7   ? -54.650 -35.266 66.262 1.00 107.24 ? -66  DA  J "C2'" 1 
ATOM   9186  C  "C1'" . DA  J 6  7   ? -54.939 -36.205 67.414 1.00 102.10 ? -66  DA  J "C1'" 1 
ATOM   9187  N  N9    . DA  J 6  7   ? -56.285 -36.783 67.473 1.00 98.63  ? -66  DA  J N9    1 
ATOM   9188  C  C8    . DA  J 6  7   ? -57.494 -36.140 67.600 1.00 99.98  ? -66  DA  J C8    1 
ATOM   9189  N  N7    . DA  J 6  7   ? -58.522 -36.953 67.651 1.00 94.00  ? -66  DA  J N7    1 
ATOM   9190  C  C5    . DA  J 6  7   ? -57.953 -38.216 67.556 1.00 91.94  ? -66  DA  J C5    1 
ATOM   9191  C  C6    . DA  J 6  7   ? -58.508 -39.507 67.564 1.00 88.89  ? -66  DA  J C6    1 
ATOM   9192  N  N6    . DA  J 6  7   ? -59.816 -39.750 67.661 1.00 85.24  ? -66  DA  J N6    1 
ATOM   9193  N  N1    . DA  J 6  7   ? -57.662 -40.556 67.457 1.00 90.32  ? -66  DA  J N1    1 
ATOM   9194  C  C2    . DA  J 6  7   ? -56.348 -40.313 67.355 1.00 86.81  ? -66  DA  J C2    1 
ATOM   9195  N  N3    . DA  J 6  7   ? -55.707 -39.146 67.344 1.00 85.12  ? -66  DA  J N3    1 
ATOM   9196  C  C4    . DA  J 6  7   ? -56.576 -38.126 67.448 1.00 88.74  ? -66  DA  J C4    1 
ATOM   9197  P  P     . DT  J 6  8   ? -51.571 -35.081 65.064 1.00 82.17  ? -65  DT  J P     1 
ATOM   9198  O  OP1   . DT  J 6  8   ? -50.097 -35.118 65.184 1.00 96.83  ? -65  DT  J OP1   1 
ATOM   9199  O  OP2   . DT  J 6  8   ? -52.224 -33.982 64.310 1.00 78.95  ? -65  DT  J OP2   1 
ATOM   9200  O  "O5'" . DT  J 6  8   ? -51.938 -36.523 64.509 1.00 80.46  ? -65  DT  J "O5'" 1 
ATOM   9201  C  "C5'" . DT  J 6  8   ? -51.628 -37.674 65.308 1.00 83.83  ? -65  DT  J "C5'" 1 
ATOM   9202  C  "C4'" . DT  J 6  8   ? -52.171 -38.928 64.668 1.00 89.72  ? -65  DT  J "C4'" 1 
ATOM   9203  O  "O4'" . DT  J 6  8   ? -53.585 -39.061 64.959 1.00 99.48  ? -65  DT  J "O4'" 1 
ATOM   9204  C  "C3'" . DT  J 6  8   ? -52.036 -38.989 63.143 1.00 91.04  ? -65  DT  J "C3'" 1 
ATOM   9205  O  "O3'" . DT  J 6  8   ? -51.354 -40.208 62.830 1.00 96.99  ? -65  DT  J "O3'" 1 
ATOM   9206  C  "C2'" . DT  J 6  8   ? -53.474 -38.952 62.644 1.00 93.21  ? -65  DT  J "C2'" 1 
ATOM   9207  C  "C1'" . DT  J 6  8   ? -54.226 -39.577 63.807 1.00 95.02  ? -65  DT  J "C1'" 1 
ATOM   9208  N  N1    . DT  J 6  8   ? -55.682 -39.300 63.921 1.00 89.86  ? -65  DT  J N1    1 
ATOM   9209  C  C2    . DT  J 6  8   ? -56.508 -40.353 64.245 1.00 88.33  ? -65  DT  J C2    1 
ATOM   9210  O  O2    . DT  J 6  8   ? -56.101 -41.489 64.429 1.00 96.62  ? -65  DT  J O2    1 
ATOM   9211  N  N3    . DT  J 6  8   ? -57.836 -40.028 64.344 1.00 84.62  ? -65  DT  J N3    1 
ATOM   9212  C  C4    . DT  J 6  8   ? -58.408 -38.783 64.160 1.00 94.56  ? -65  DT  J C4    1 
ATOM   9213  O  O4    . DT  J 6  8   ? -59.620 -38.643 64.291 1.00 109.40 ? -65  DT  J O4    1 
ATOM   9214  C  C5    . DT  J 6  8   ? -57.486 -37.726 63.817 1.00 94.03  ? -65  DT  J C5    1 
ATOM   9215  C  C7    . DT  J 6  8   ? -58.014 -36.341 63.611 1.00 88.33  ? -65  DT  J C7    1 
ATOM   9216  C  C6    . DT  J 6  8   ? -56.185 -38.032 63.722 1.00 95.51  ? -65  DT  J C6    1 
ATOM   9217  P  P     . DC  J 6  9   ? -50.941 -40.564 61.319 1.00 101.63 ? -64  DC  J P     1 
ATOM   9218  O  OP1   . DC  J 6  9   ? -49.558 -41.120 61.352 1.00 89.67  ? -64  DC  J OP1   1 
ATOM   9219  O  OP2   . DC  J 6  9   ? -51.284 -39.400 60.446 1.00 82.87  ? -64  DC  J OP2   1 
ATOM   9220  O  "O5'" . DC  J 6  9   ? -51.936 -41.745 60.921 1.00 100.82 ? -64  DC  J "O5'" 1 
ATOM   9221  C  "C5'" . DC  J 6  9   ? -51.991 -42.987 61.652 1.00 104.88 ? -64  DC  J "C5'" 1 
ATOM   9222  C  "C4'" . DC  J 6  9   ? -53.247 -43.739 61.275 1.00 108.85 ? -64  DC  J "C4'" 1 
ATOM   9223  O  "O4'" . DC  J 6  9   ? -54.408 -43.017 61.737 1.00 108.85 ? -64  DC  J "O4'" 1 
ATOM   9224  C  "C3'" . DC  J 6  9   ? -53.435 -43.901 59.769 1.00 107.78 ? -64  DC  J "C3'" 1 
ATOM   9225  O  "O3'" . DC  J 6  9   ? -53.033 -45.211 59.360 1.00 108.08 ? -64  DC  J "O3'" 1 
ATOM   9226  C  "C2'" . DC  J 6  9   ? -54.919 -43.663 59.536 1.00 110.00 ? -64  DC  J "C2'" 1 
ATOM   9227  C  "C1'" . DC  J 6  9   ? -55.503 -43.329 60.899 1.00 103.46 ? -64  DC  J "C1'" 1 
ATOM   9228  N  N1    . DC  J 6  9   ? -56.396 -42.164 60.879 1.00 98.85  ? -64  DC  J N1    1 
ATOM   9229  C  C2    . DC  J 6  9   ? -57.777 -42.363 60.959 1.00 100.26 ? -64  DC  J C2    1 
ATOM   9230  O  O2    . DC  J 6  9   ? -58.210 -43.520 61.059 1.00 107.46 ? -64  DC  J O2    1 
ATOM   9231  N  N3    . DC  J 6  9   ? -58.603 -41.292 60.932 1.00 97.13  ? -64  DC  J N3    1 
ATOM   9232  C  C4    . DC  J 6  9   ? -58.095 -40.062 60.825 1.00 96.85  ? -64  DC  J C4    1 
ATOM   9233  N  N4    . DC  J 6  9   ? -58.945 -39.033 60.807 1.00 100.80 ? -64  DC  J N4    1 
ATOM   9234  C  C5    . DC  J 6  9   ? -56.693 -39.832 60.727 1.00 101.57 ? -64  DC  J C5    1 
ATOM   9235  C  C6    . DC  J 6  9   ? -55.887 -40.902 60.755 1.00 94.89  ? -64  DC  J C6    1 
ATOM   9236  P  P     . DC  J 6  10  ? -52.735 -45.505 57.819 1.00 104.79 ? -63  DC  J P     1 
ATOM   9237  O  OP1   . DC  J 6  10  ? -51.613 -46.483 57.739 1.00 85.33  ? -63  DC  J OP1   1 
ATOM   9238  O  OP2   . DC  J 6  10  ? -52.639 -44.197 57.117 1.00 99.26  ? -63  DC  J OP2   1 
ATOM   9239  O  "O5'" . DC  J 6  10  ? -54.079 -46.196 57.315 1.00 106.64 ? -63  DC  J "O5'" 1 
ATOM   9240  C  "C5'" . DC  J 6  10  ? -54.786 -47.165 58.114 1.00 113.91 ? -63  DC  J "C5'" 1 
ATOM   9241  C  "C4'" . DC  J 6  10  ? -56.228 -47.242 57.670 1.00 116.64 ? -63  DC  J "C4'" 1 
ATOM   9242  O  "O4'" . DC  J 6  10  ? -56.943 -46.074 58.133 1.00 111.91 ? -63  DC  J "O4'" 1 
ATOM   9243  C  "C3'" . DC  J 6  10  ? -56.427 -47.299 56.151 1.00 121.05 ? -63  DC  J "C3'" 1 
ATOM   9244  O  "O3'" . DC  J 6  10  ? -57.085 -48.515 55.794 1.00 131.48 ? -63  DC  J "O3'" 1 
ATOM   9245  C  "C2'" . DC  J 6  10  ? -57.302 -46.099 55.824 1.00 114.16 ? -63  DC  J "C2'" 1 
ATOM   9246  C  "C1'" . DC  J 6  10  ? -57.896 -45.704 57.162 1.00 105.81 ? -63  DC  J "C1'" 1 
ATOM   9247  N  N1    . DC  J 6  10  ? -58.145 -44.266 57.305 1.00 99.95  ? -63  DC  J N1    1 
ATOM   9248  C  C2    . DC  J 6  10  ? -59.401 -43.845 57.746 1.00 108.28 ? -63  DC  J C2    1 
ATOM   9249  O  O2    . DC  J 6  10  ? -60.262 -44.700 58.010 1.00 122.68 ? -63  DC  J O2    1 
ATOM   9250  N  N3    . DC  J 6  10  ? -59.648 -42.519 57.874 1.00 101.70 ? -63  DC  J N3    1 
ATOM   9251  C  C4    . DC  J 6  10  ? -58.695 -41.632 57.578 1.00 90.33  ? -63  DC  J C4    1 
ATOM   9252  N  N4    . DC  J 6  10  ? -58.980 -40.337 57.725 1.00 85.11  ? -63  DC  J N4    1 
ATOM   9253  C  C5    . DC  J 6  10  ? -57.406 -42.035 57.121 1.00 88.91  ? -63  DC  J C5    1 
ATOM   9254  C  C6    . DC  J 6  10  ? -57.176 -43.350 57.002 1.00 94.43  ? -63  DC  J C6    1 
ATOM   9255  P  P     . DA  J 6  11  ? -57.148 -48.988 54.266 1.00 126.46 ? -62  DA  J P     1 
ATOM   9256  O  OP1   . DA  J 6  11  ? -56.889 -50.455 54.249 1.00 110.04 ? -62  DA  J OP1   1 
ATOM   9257  O  OP2   . DA  J 6  11  ? -56.319 -48.059 53.446 1.00 106.34 ? -62  DA  J OP2   1 
ATOM   9258  O  "O5'" . DA  J 6  11  ? -58.664 -48.712 53.871 1.00 116.15 ? -62  DA  J "O5'" 1 
ATOM   9259  C  "C5'" . DA  J 6  11  ? -59.739 -49.252 54.657 1.00 116.01 ? -62  DA  J "C5'" 1 
ATOM   9260  C  "C4'" . DA  J 6  11  ? -61.031 -48.577 54.267 1.00 112.20 ? -62  DA  J "C4'" 1 
ATOM   9261  O  "O4'" . DA  J 6  11  ? -61.021 -47.228 54.782 1.00 101.20 ? -62  DA  J "O4'" 1 
ATOM   9262  C  "C3'" . DA  J 6  11  ? -61.235 -48.463 52.754 1.00 108.91 ? -62  DA  J "C3'" 1 
ATOM   9263  O  "O3'" . DA  J 6  11  ? -62.279 -49.353 52.326 1.00 112.92 ? -62  DA  J "O3'" 1 
ATOM   9264  C  "C2'" . DA  J 6  11  ? -61.491 -46.980 52.514 1.00 105.14 ? -62  DA  J "C2'" 1 
ATOM   9265  C  "C1'" . DA  J 6  11  ? -61.721 -46.391 53.895 1.00 97.80  ? -62  DA  J "C1'" 1 
ATOM   9266  N  N9    . DA  J 6  11  ? -61.192 -45.040 54.057 1.00 99.50  ? -62  DA  J N9    1 
ATOM   9267  C  C8    . DA  J 6  11  ? -59.893 -44.636 53.869 1.00 90.02  ? -62  DA  J C8    1 
ATOM   9268  N  N7    . DA  J 6  11  ? -59.700 -43.358 54.089 1.00 88.31  ? -62  DA  J N7    1 
ATOM   9269  C  C5    . DA  J 6  11  ? -60.957 -42.887 54.445 1.00 95.34  ? -62  DA  J C5    1 
ATOM   9270  C  C6    . DA  J 6  11  ? -61.423 -41.607 54.795 1.00 98.09  ? -62  DA  J C6    1 
ATOM   9271  N  N6    . DA  J 6  11  ? -60.641 -40.527 54.854 1.00 94.77  ? -62  DA  J N6    1 
ATOM   9272  N  N1    . DA  J 6  11  ? -62.737 -41.472 55.083 1.00 100.60 ? -62  DA  J N1    1 
ATOM   9273  C  C2    . DA  J 6  11  ? -63.519 -42.559 55.029 1.00 105.03 ? -62  DA  J C2    1 
ATOM   9274  N  N3    . DA  J 6  11  ? -63.197 -43.815 54.714 1.00 103.25 ? -62  DA  J N3    1 
ATOM   9275  C  C4    . DA  J 6  11  ? -61.886 -43.912 54.429 1.00 100.81 ? -62  DA  J C4    1 
ATOM   9276  P  P     . DC  J 6  12  ? -62.658 -49.477 50.762 1.00 114.65 ? -61  DC  J P     1 
ATOM   9277  O  OP1   . DC  J 6  12  ? -63.131 -50.863 50.504 1.00 104.64 ? -61  DC  J OP1   1 
ATOM   9278  O  OP2   . DC  J 6  12  ? -61.513 -48.955 49.967 1.00 109.92 ? -61  DC  J OP2   1 
ATOM   9279  O  "O5'" . DC  J 6  12  ? -63.888 -48.467 50.619 1.00 108.35 ? -61  DC  J "O5'" 1 
ATOM   9280  C  "C5'" . DC  J 6  12  ? -64.714 -48.075 51.752 1.00 107.23 ? -61  DC  J "C5'" 1 
ATOM   9281  C  "C4'" . DC  J 6  12  ? -65.582 -46.889 51.391 1.00 105.75 ? -61  DC  J "C4'" 1 
ATOM   9282  O  "O4'" . DC  J 6  12  ? -64.937 -45.665 51.827 1.00 104.60 ? -61  DC  J "O4'" 1 
ATOM   9283  C  "C3'" . DC  J 6  12  ? -65.836 -46.719 49.887 1.00 109.17 ? -61  DC  J "C3'" 1 
ATOM   9284  O  "O3'" . DC  J 6  12  ? -67.185 -46.348 49.567 1.00 107.97 ? -61  DC  J "O3'" 1 
ATOM   9285  C  "C2'" . DC  J 6  12  ? -64.884 -45.603 49.501 1.00 110.89 ? -61  DC  J "C2'" 1 
ATOM   9286  C  "C1'" . DC  J 6  12  ? -64.940 -44.742 50.743 1.00 111.88 ? -61  DC  J "C1'" 1 
ATOM   9287  N  N1    . DC  J 6  12  ? -63.789 -43.832 50.895 1.00 111.01 ? -61  DC  J N1    1 
ATOM   9288  C  C2    . DC  J 6  12  ? -64.010 -42.501 51.279 1.00 110.61 ? -61  DC  J C2    1 
ATOM   9289  O  O2    . DC  J 6  12  ? -65.170 -42.125 51.508 1.00 105.75 ? -61  DC  J O2    1 
ATOM   9290  N  N3    . DC  J 6  12  ? -62.950 -41.663 51.397 1.00 107.83 ? -61  DC  J N3    1 
ATOM   9291  C  C4    . DC  J 6  12  ? -61.718 -42.106 51.130 1.00 99.69  ? -61  DC  J C4    1 
ATOM   9292  N  N4    . DC  J 6  12  ? -60.700 -41.252 51.259 1.00 86.85  ? -61  DC  J N4    1 
ATOM   9293  C  C5    . DC  J 6  12  ? -61.471 -43.448 50.719 1.00 102.81 ? -61  DC  J C5    1 
ATOM   9294  C  C6    . DC  J 6  12  ? -62.525 -44.266 50.606 1.00 105.80 ? -61  DC  J C6    1 
ATOM   9295  P  P     . DC  J 6  13  ? -67.597 -46.026 48.033 1.00 107.99 ? -60  DC  J P     1 
ATOM   9296  O  OP1   . DC  J 6  13  ? -68.965 -46.554 47.802 1.00 103.58 ? -60  DC  J OP1   1 
ATOM   9297  O  OP2   . DC  J 6  13  ? -66.486 -46.480 47.145 1.00 97.24  ? -60  DC  J OP2   1 
ATOM   9298  O  "O5'" . DC  J 6  13  ? -67.712 -44.433 48.021 1.00 109.67 ? -60  DC  J "O5'" 1 
ATOM   9299  C  "C5'" . DC  J 6  13  ? -68.593 -43.746 48.943 1.00 112.04 ? -60  DC  J "C5'" 1 
ATOM   9300  C  "C4'" . DC  J 6  13  ? -68.776 -42.301 48.538 1.00 118.12 ? -60  DC  J "C4'" 1 
ATOM   9301  O  "O4'" . DC  J 6  13  ? -67.576 -41.558 48.865 1.00 118.96 ? -60  DC  J "O4'" 1 
ATOM   9302  C  "C3'" . DC  J 6  13  ? -69.020 -42.067 47.043 1.00 125.91 ? -60  DC  J "C3'" 1 
ATOM   9303  O  "O3'" . DC  J 6  13  ? -69.954 -40.998 46.834 1.00 133.65 ? -60  DC  J "O3'" 1 
ATOM   9304  C  "C2'" . DC  J 6  13  ? -67.645 -41.683 46.531 1.00 128.96 ? -60  DC  J "C2'" 1 
ATOM   9305  C  "C1'" . DC  J 6  13  ? -67.102 -40.891 47.704 1.00 122.96 ? -60  DC  J "C1'" 1 
ATOM   9306  N  N1    . DC  J 6  13  ? -65.633 -40.825 47.779 1.00 117.97 ? -60  DC  J N1    1 
ATOM   9307  C  C2    . DC  J 6  13  ? -65.026 -39.597 48.061 1.00 117.91 ? -60  DC  J C2    1 
ATOM   9308  O  O2    . DC  J 6  13  ? -65.744 -38.603 48.253 1.00 121.35 ? -60  DC  J O2    1 
ATOM   9309  N  N3    . DC  J 6  13  ? -63.675 -39.527 48.129 1.00 107.84 ? -60  DC  J N3    1 
ATOM   9310  C  C4    . DC  J 6  13  ? -62.940 -40.622 47.920 1.00 110.09 ? -60  DC  J C4    1 
ATOM   9311  N  N4    . DC  J 6  13  ? -61.612 -40.512 47.999 1.00 100.35 ? -60  DC  J N4    1 
ATOM   9312  C  C5    . DC  J 6  13  ? -63.534 -41.882 47.620 1.00 114.64 ? -60  DC  J C5    1 
ATOM   9313  C  C6    . DC  J 6  13  ? -64.870 -41.938 47.560 1.00 114.87 ? -60  DC  J C6    1 
ATOM   9314  P  P     . DT  J 6  14  ? -70.462 -40.626 45.348 1.00 132.17 ? -59  DT  J P     1 
ATOM   9315  O  OP1   . DT  J 6  14  ? -71.835 -41.178 45.176 1.00 118.11 ? -59  DT  J OP1   1 
ATOM   9316  O  OP2   . DT  J 6  14  ? -69.401 -41.004 44.372 1.00 121.82 ? -59  DT  J OP2   1 
ATOM   9317  O  "O5'" . DT  J 6  14  ? -70.596 -39.037 45.401 1.00 124.20 ? -59  DT  J "O5'" 1 
ATOM   9318  C  "C5'" . DT  J 6  14  ? -69.828 -38.225 46.311 1.00 129.60 ? -59  DT  J "C5'" 1 
ATOM   9319  C  "C4'" . DT  J 6  14  ? -69.026 -37.180 45.567 1.00 134.41 ? -59  DT  J "C4'" 1 
ATOM   9320  O  "O4'" . DT  J 6  14  ? -67.610 -37.461 45.700 1.00 134.31 ? -59  DT  J "O4'" 1 
ATOM   9321  C  "C3'" . DT  J 6  14  ? -69.292 -37.063 44.059 1.00 138.67 ? -59  DT  J "C3'" 1 
ATOM   9322  O  "O3'" . DT  J 6  14  ? -69.376 -35.692 43.669 1.00 135.22 ? -59  DT  J "O3'" 1 
ATOM   9323  C  "C2'" . DT  J 6  14  ? -68.050 -37.664 43.429 1.00 137.18 ? -59  DT  J "C2'" 1 
ATOM   9324  C  "C1'" . DT  J 6  14  ? -67.004 -37.241 44.438 1.00 138.09 ? -59  DT  J "C1'" 1 
ATOM   9325  N  N1    . DT  J 6  14  ? -65.735 -37.989 44.394 1.00 127.40 ? -59  DT  J N1    1 
ATOM   9326  C  C2    . DT  J 6  14  ? -64.556 -37.288 44.526 1.00 124.31 ? -59  DT  J C2    1 
ATOM   9327  O  O2    . DT  J 6  14  ? -64.511 -36.080 44.698 1.00 118.62 ? -59  DT  J O2    1 
ATOM   9328  N  N3    . DT  J 6  14  ? -63.423 -38.060 44.460 1.00 118.76 ? -59  DT  J N3    1 
ATOM   9329  C  C4    . DT  J 6  14  ? -63.354 -39.428 44.275 1.00 122.81 ? -59  DT  J C4    1 
ATOM   9330  O  O4    . DT  J 6  14  ? -62.261 -39.986 44.242 1.00 115.01 ? -59  DT  J O4    1 
ATOM   9331  C  C5    . DT  J 6  14  ? -64.628 -40.097 44.134 1.00 130.83 ? -59  DT  J C5    1 
ATOM   9332  C  C7    . DT  J 6  14  ? -64.653 -41.579 43.929 1.00 127.86 ? -59  DT  J C7    1 
ATOM   9333  C  C6    . DT  J 6  14  ? -65.739 -39.353 44.196 1.00 128.40 ? -59  DT  J C6    1 
ATOM   9334  P  P     . DG  J 6  15  ? -70.045 -35.296 42.274 1.00 144.02 ? -58  DG  J P     1 
ATOM   9335  O  OP1   . DG  J 6  15  ? -71.517 -35.267 42.481 1.00 146.17 ? -58  DG  J OP1   1 
ATOM   9336  O  OP2   . DG  J 6  15  ? -69.456 -36.151 41.197 1.00 117.95 ? -58  DG  J OP2   1 
ATOM   9337  O  "O5'" . DG  J 6  15  ? -69.554 -33.797 42.038 1.00 137.52 ? -58  DG  J "O5'" 1 
ATOM   9338  C  "C5'" . DG  J 6  15  ? -69.032 -32.976 43.104 1.00 128.49 ? -58  DG  J "C5'" 1 
ATOM   9339  C  "C4'" . DG  J 6  15  ? -68.014 -31.999 42.560 1.00 121.12 ? -58  DG  J "C4'" 1 
ATOM   9340  O  "O4'" . DG  J 6  15  ? -66.726 -32.642 42.426 1.00 113.99 ? -58  DG  J "O4'" 1 
ATOM   9341  C  "C3'" . DG  J 6  15  ? -68.334 -31.419 41.184 1.00 125.21 ? -58  DG  J "C3'" 1 
ATOM   9342  O  "O3'" . DG  J 6  15  ? -68.042 -30.015 41.250 1.00 123.33 ? -58  DG  J "O3'" 1 
ATOM   9343  C  "C2'" . DG  J 6  15  ? -67.558 -32.322 40.233 1.00 122.46 ? -58  DG  J "C2'" 1 
ATOM   9344  C  "C1'" . DG  J 6  15  ? -66.351 -32.760 41.054 1.00 123.39 ? -58  DG  J "C1'" 1 
ATOM   9345  N  N9    . DG  J 6  15  ? -65.882 -34.128 40.843 1.00 119.10 ? -58  DG  J N9    1 
ATOM   9346  C  C8    . DG  J 6  15  ? -66.576 -35.189 40.312 1.00 115.16 ? -58  DG  J C8    1 
ATOM   9347  N  N7    . DG  J 6  15  ? -65.888 -36.298 40.302 1.00 109.82 ? -58  DG  J N7    1 
ATOM   9348  C  C5    . DG  J 6  15  ? -64.669 -35.950 40.867 1.00 113.72 ? -58  DG  J C5    1 
ATOM   9349  C  C6    . DG  J 6  15  ? -63.517 -36.740 41.128 1.00 111.86 ? -58  DG  J C6    1 
ATOM   9350  O  O6    . DG  J 6  15  ? -63.338 -37.942 40.898 1.00 102.76 ? -58  DG  J O6    1 
ATOM   9351  N  N1    . DG  J 6  15  ? -62.506 -35.988 41.720 1.00 115.28 ? -58  DG  J N1    1 
ATOM   9352  C  C2    . DG  J 6  15  ? -62.591 -34.650 42.026 1.00 116.05 ? -58  DG  J C2    1 
ATOM   9353  N  N2    . DG  J 6  15  ? -61.508 -34.101 42.596 1.00 108.43 ? -58  DG  J N2    1 
ATOM   9354  N  N3    . DG  J 6  15  ? -63.659 -33.905 41.789 1.00 114.94 ? -58  DG  J N3    1 
ATOM   9355  C  C4    . DG  J 6  15  ? -64.652 -34.616 41.212 1.00 116.75 ? -58  DG  J C4    1 
ATOM   9356  P  P     . DC  J 6  16  ? -67.336 -29.248 40.042 1.00 119.39 ? -57  DC  J P     1 
ATOM   9357  O  OP1   . DC  J 6  16  ? -67.490 -27.795 40.300 1.00 113.66 ? -57  DC  J OP1   1 
ATOM   9358  O  OP2   . DC  J 6  16  ? -67.834 -29.825 38.762 1.00 100.36 ? -57  DC  J OP2   1 
ATOM   9359  O  "O5'" . DC  J 6  16  ? -65.813 -29.697 40.199 1.00 129.97 ? -57  DC  J "O5'" 1 
ATOM   9360  C  "C5'" . DC  J 6  16  ? -64.753 -28.799 40.594 1.00 111.33 ? -57  DC  J "C5'" 1 
ATOM   9361  C  "C4'" . DC  J 6  16  ? -63.529 -29.045 39.740 1.00 106.00 ? -57  DC  J "C4'" 1 
ATOM   9362  O  "O4'" . DC  J 6  16  ? -63.283 -30.470 39.613 1.00 91.64  ? -57  DC  J "O4'" 1 
ATOM   9363  C  "C3'" . DC  J 6  16  ? -63.633 -28.503 38.307 1.00 102.99 ? -57  DC  J "C3'" 1 
ATOM   9364  O  "O3'" . DC  J 6  16  ? -62.432 -27.851 37.884 1.00 94.05  ? -57  DC  J "O3'" 1 
ATOM   9365  C  "C2'" . DC  J 6  16  ? -63.836 -29.752 37.471 1.00 98.42  ? -57  DC  J "C2'" 1 
ATOM   9366  C  "C1'" . DC  J 6  16  ? -63.004 -30.747 38.252 1.00 98.82  ? -57  DC  J "C1'" 1 
ATOM   9367  N  N1    . DC  J 6  16  ? -63.279 -32.169 38.008 1.00 108.27 ? -57  DC  J N1    1 
ATOM   9368  C  C2    . DC  J 6  16  ? -62.523 -33.112 38.703 1.00 104.02 ? -57  DC  J C2    1 
ATOM   9369  O  O2    . DC  J 6  16  ? -61.666 -32.716 39.503 1.00 97.89  ? -57  DC  J O2    1 
ATOM   9370  N  N3    . DC  J 6  16  ? -62.745 -34.428 38.488 1.00 111.48 ? -57  DC  J N3    1 
ATOM   9371  C  C4    . DC  J 6  16  ? -63.677 -34.812 37.614 1.00 112.80 ? -57  DC  J C4    1 
ATOM   9372  N  N4    . DC  J 6  16  ? -63.862 -36.121 37.433 1.00 116.93 ? -57  DC  J N4    1 
ATOM   9373  C  C5    . DC  J 6  16  ? -64.463 -33.871 36.890 1.00 114.47 ? -57  DC  J C5    1 
ATOM   9374  C  C6    . DC  J 6  16  ? -64.228 -32.571 37.109 1.00 115.22 ? -57  DC  J C6    1 
ATOM   9375  P  P     . DA  J 6  17  ? -62.112 -26.370 38.357 1.00 99.60  ? -56  DA  J P     1 
ATOM   9376  O  OP1   . DA  J 6  17  ? -62.902 -26.086 39.587 1.00 95.61  ? -56  DA  J OP1   1 
ATOM   9377  O  OP2   . DA  J 6  17  ? -62.225 -25.478 37.182 1.00 106.71 ? -56  DA  J OP2   1 
ATOM   9378  O  "O5'" . DA  J 6  17  ? -60.576 -26.459 38.758 1.00 104.38 ? -56  DA  J "O5'" 1 
ATOM   9379  C  "C5'" . DA  J 6  17  ? -60.176 -27.076 40.000 1.00 109.53 ? -56  DA  J "C5'" 1 
ATOM   9380  C  "C4'" . DA  J 6  17  ? -58.825 -27.737 39.862 1.00 106.02 ? -56  DA  J "C4'" 1 
ATOM   9381  O  "O4'" . DA  J 6  17  ? -58.944 -28.974 39.125 1.00 100.34 ? -56  DA  J "O4'" 1 
ATOM   9382  C  "C3'" . DA  J 6  17  ? -57.786 -26.925 39.098 1.00 108.45 ? -56  DA  J "C3'" 1 
ATOM   9383  O  "O3'" . DA  J 6  17  ? -56.507 -27.346 39.566 1.00 110.70 ? -56  DA  J "O3'" 1 
ATOM   9384  C  "C2'" . DA  J 6  17  ? -58.015 -27.355 37.662 1.00 104.52 ? -56  DA  J "C2'" 1 
ATOM   9385  C  "C1'" . DA  J 6  17  ? -58.388 -28.822 37.821 1.00 103.20 ? -56  DA  J "C1'" 1 
ATOM   9386  N  N9    . DA  J 6  17  ? -59.375 -29.306 36.863 1.00 111.03 ? -56  DA  J N9    1 
ATOM   9387  C  C8    . DA  J 6  17  ? -60.218 -28.591 36.046 1.00 112.24 ? -56  DA  J C8    1 
ATOM   9388  N  N7    . DA  J 6  17  ? -61.001 -29.341 35.311 1.00 114.99 ? -56  DA  J N7    1 
ATOM   9389  C  C5    . DA  J 6  17  ? -60.659 -30.637 35.675 1.00 112.18 ? -56  DA  J C5    1 
ATOM   9390  C  C6    . DA  J 6  17  ? -61.132 -31.893 35.259 1.00 110.63 ? -56  DA  J C6    1 
ATOM   9391  N  N6    . DA  J 6  17  ? -62.088 -32.059 34.342 1.00 111.00 ? -56  DA  J N6    1 
ATOM   9392  N  N1    . DA  J 6  17  ? -60.565 -32.990 35.809 1.00 105.96 ? -56  DA  J N1    1 
ATOM   9393  C  C2    . DA  J 6  17  ? -59.603 -32.825 36.725 1.00 98.80  ? -56  DA  J C2    1 
ATOM   9394  N  N3    . DA  J 6  17  ? -59.085 -31.699 37.206 1.00 102.08 ? -56  DA  J N3    1 
ATOM   9395  C  C4    . DA  J 6  17  ? -59.660 -30.629 36.631 1.00 111.26 ? -56  DA  J C4    1 
ATOM   9396  P  P     . DG  J 6  18  ? -55.172 -26.718 38.962 1.00 109.89 ? -55  DG  J P     1 
ATOM   9397  O  OP1   . DG  J 6  18  ? -54.314 -26.356 40.117 1.00 94.55  ? -55  DG  J OP1   1 
ATOM   9398  O  OP2   . DG  J 6  18  ? -55.540 -25.687 37.949 1.00 110.41 ? -55  DG  J OP2   1 
ATOM   9399  O  "O5'" . DG  J 6  18  ? -54.558 -27.924 38.123 1.00 90.60  ? -55  DG  J "O5'" 1 
ATOM   9400  C  "C5'" . DG  J 6  18  ? -54.421 -29.225 38.714 1.00 93.10  ? -55  DG  J "C5'" 1 
ATOM   9401  C  "C4'" . DG  J 6  18  ? -54.220 -30.252 37.629 1.00 95.04  ? -55  DG  J "C4'" 1 
ATOM   9402  O  "O4'" . DG  J 6  18  ? -55.468 -30.466 36.920 1.00 107.60 ? -55  DG  J "O4'" 1 
ATOM   9403  C  "C3'" . DG  J 6  18  ? -53.203 -29.847 36.561 1.00 96.76  ? -55  DG  J "C3'" 1 
ATOM   9404  O  "O3'" . DG  J 6  18  ? -52.548 -31.026 36.096 1.00 105.36 ? -55  DG  J "O3'" 1 
ATOM   9405  C  "C2'" . DG  J 6  18  ? -54.078 -29.360 35.425 1.00 104.06 ? -55  DG  J "C2'" 1 
ATOM   9406  C  "C1'" . DG  J 6  18  ? -55.179 -30.389 35.535 1.00 113.06 ? -55  DG  J "C1'" 1 
ATOM   9407  N  N9    . DG  J 6  18  ? -56.416 -30.149 34.797 1.00 111.66 ? -55  DG  J N9    1 
ATOM   9408  C  C8    . DG  J 6  18  ? -56.963 -28.951 34.402 1.00 105.22 ? -55  DG  J C8    1 
ATOM   9409  N  N7    . DG  J 6  18  ? -58.049 -29.095 33.692 1.00 112.96 ? -55  DG  J N7    1 
ATOM   9410  C  C5    . DG  J 6  18  ? -58.211 -30.470 33.588 1.00 113.25 ? -55  DG  J C5    1 
ATOM   9411  C  C6    . DG  J 6  18  ? -59.209 -31.233 32.929 1.00 116.58 ? -55  DG  J C6    1 
ATOM   9412  O  O6    . DG  J 6  18  ? -60.190 -30.832 32.292 1.00 120.57 ? -55  DG  J O6    1 
ATOM   9413  N  N1    . DG  J 6  18  ? -58.992 -32.600 33.083 1.00 118.49 ? -55  DG  J N1    1 
ATOM   9414  C  C2    . DG  J 6  18  ? -57.949 -33.161 33.779 1.00 104.68 ? -55  DG  J C2    1 
ATOM   9415  N  N2    . DG  J 6  18  ? -57.901 -34.498 33.810 1.00 99.72  ? -55  DG  J N2    1 
ATOM   9416  N  N3    . DG  J 6  18  ? -57.011 -32.461 34.388 1.00 104.31 ? -55  DG  J N3    1 
ATOM   9417  C  C4    . DG  J 6  18  ? -57.204 -31.132 34.256 1.00 109.24 ? -55  DG  J C4    1 
ATOM   9418  P  P     . DA  J 6  19  ? -50.996 -31.014 35.772 1.00 103.28 ? -54  DA  J P     1 
ATOM   9419  O  OP1   . DA  J 6  19  ? -50.289 -31.383 37.022 1.00 99.20  ? -54  DA  J OP1   1 
ATOM   9420  O  OP2   . DA  J 6  19  ? -50.673 -29.751 35.060 1.00 97.84  ? -54  DA  J OP2   1 
ATOM   9421  O  "O5'" . DA  J 6  19  ? -50.845 -32.180 34.701 1.00 95.27  ? -54  DA  J "O5'" 1 
ATOM   9422  C  "C5'" . DA  J 6  19  ? -50.973 -33.541 35.118 1.00 102.50 ? -54  DA  J "C5'" 1 
ATOM   9423  C  "C4'" . DA  J 6  19  ? -52.021 -34.263 34.304 1.00 103.54 ? -54  DA  J "C4'" 1 
ATOM   9424  O  "O4'" . DA  J 6  19  ? -53.206 -33.474 34.111 1.00 105.42 ? -54  DA  J "O4'" 1 
ATOM   9425  C  "C3'" . DA  J 6  19  ? -51.598 -34.676 32.902 1.00 94.82  ? -54  DA  J "C3'" 1 
ATOM   9426  O  "O3'" . DA  J 6  19  ? -50.899 -35.915 33.022 1.00 93.72  ? -54  DA  J "O3'" 1 
ATOM   9427  C  "C2'" . DA  J 6  19  ? -52.926 -34.826 32.181 1.00 96.95  ? -54  DA  J "C2'" 1 
ATOM   9428  C  "C1'" . DA  J 6  19  ? -53.936 -34.052 33.037 1.00 106.76 ? -54  DA  J "C1'" 1 
ATOM   9429  N  N9    . DA  J 6  19  ? -54.627 -32.970 32.336 1.00 113.12 ? -54  DA  J N9    1 
ATOM   9430  C  C8    . DA  J 6  19  ? -54.317 -31.633 32.377 1.00 110.21 ? -54  DA  J C8    1 
ATOM   9431  N  N7    . DA  J 6  19  ? -55.109 -30.884 31.650 1.00 114.55 ? -54  DA  J N7    1 
ATOM   9432  C  C5    . DA  J 6  19  ? -56.000 -31.787 31.090 1.00 107.81 ? -54  DA  J C5    1 
ATOM   9433  C  C6    . DA  J 6  19  ? -57.083 -31.622 30.216 1.00 103.37 ? -54  DA  J C6    1 
ATOM   9434  N  N6    . DA  J 6  19  ? -57.468 -30.437 29.737 1.00 103.30 ? -54  DA  J N6    1 
ATOM   9435  N  N1    . DA  J 6  19  ? -57.766 -32.727 29.844 1.00 109.08 ? -54  DA  J N1    1 
ATOM   9436  C  C2    . DA  J 6  19  ? -57.376 -33.914 30.326 1.00 106.13 ? -54  DA  J C2    1 
ATOM   9437  N  N3    . DA  J 6  19  ? -56.374 -34.197 31.155 1.00 103.65 ? -54  DA  J N3    1 
ATOM   9438  C  C4    . DA  J 6  19  ? -55.716 -33.077 31.503 1.00 109.80 ? -54  DA  J C4    1 
ATOM   9439  P  P     . DT  J 6  20  ? -49.819 -36.345 31.939 1.00 101.52 ? -53  DT  J P     1 
ATOM   9440  O  OP1   . DT  J 6  20  ? -49.048 -37.498 32.486 1.00 102.05 ? -53  DT  J OP1   1 
ATOM   9441  O  OP2   . DT  J 6  20  ? -49.094 -35.135 31.505 1.00 94.00  ? -53  DT  J OP2   1 
ATOM   9442  O  "O5'" . DT  J 6  20  ? -50.727 -36.898 30.752 1.00 118.18 ? -53  DT  J "O5'" 1 
ATOM   9443  C  "C5'" . DT  J 6  20  ? -51.520 -38.084 30.955 1.00 115.40 ? -53  DT  J "C5'" 1 
ATOM   9444  C  "C4'" . DT  J 6  20  ? -52.582 -38.219 29.889 1.00 115.64 ? -53  DT  J "C4'" 1 
ATOM   9445  O  "O4'" . DT  J 6  20  ? -53.370 -37.009 29.786 1.00 111.26 ? -53  DT  J "O4'" 1 
ATOM   9446  C  "C3'" . DT  J 6  20  ? -52.070 -38.516 28.477 1.00 113.93 ? -53  DT  J "C3'" 1 
ATOM   9447  O  "O3'" . DT  J 6  20  ? -52.847 -39.622 28.000 1.00 122.92 ? -53  DT  J "O3'" 1 
ATOM   9448  C  "C2'" . DT  J 6  20  ? -52.332 -37.219 27.726 1.00 110.47 ? -53  DT  J "C2'" 1 
ATOM   9449  C  "C1'" . DT  J 6  20  ? -53.584 -36.721 28.419 1.00 110.69 ? -53  DT  J "C1'" 1 
ATOM   9450  N  N1    . DT  J 6  20  ? -53.870 -35.281 28.311 1.00 118.11 ? -53  DT  J N1    1 
ATOM   9451  C  C2    . DT  J 6  20  ? -55.079 -34.874 27.789 1.00 123.51 ? -53  DT  J C2    1 
ATOM   9452  O  O2    . DT  J 6  20  ? -55.916 -35.651 27.360 1.00 142.92 ? -53  DT  J O2    1 
ATOM   9453  N  N3    . DT  J 6  20  ? -55.268 -33.513 27.774 1.00 120.54 ? -53  DT  J N3    1 
ATOM   9454  C  C4    . DT  J 6  20  ? -54.393 -32.545 28.229 1.00 124.04 ? -53  DT  J C4    1 
ATOM   9455  O  O4    . DT  J 6  20  ? -54.701 -31.358 28.150 1.00 115.98 ? -53  DT  J O4    1 
ATOM   9456  C  C5    . DT  J 6  20  ? -53.153 -33.046 28.783 1.00 126.26 ? -53  DT  J C5    1 
ATOM   9457  C  C7    . DT  J 6  20  ? -52.144 -32.073 29.308 1.00 121.68 ? -53  DT  J C7    1 
ATOM   9458  C  C6    . DT  J 6  20  ? -52.960 -34.371 28.799 1.00 125.55 ? -53  DT  J C6    1 
ATOM   9459  P  P     . DA  J 6  21  ? -52.479 -40.390 26.647 1.00 126.66 ? -52  DA  J P     1 
ATOM   9460  O  OP1   . DA  J 6  21  ? -52.888 -41.809 26.816 1.00 111.03 ? -52  DA  J OP1   1 
ATOM   9461  O  OP2   . DA  J 6  21  ? -51.072 -40.068 26.292 1.00 120.06 ? -52  DA  J OP2   1 
ATOM   9462  O  "O5'" . DA  J 6  21  ? -53.439 -39.704 25.574 1.00 137.50 ? -52  DA  J "O5'" 1 
ATOM   9463  C  "C5'" . DA  J 6  21  ? -54.875 -39.783 25.701 1.00 141.39 ? -52  DA  J "C5'" 1 
ATOM   9464  C  "C4'" . DA  J 6  21  ? -55.569 -39.105 24.540 1.00 145.22 ? -52  DA  J "C4'" 1 
ATOM   9465  O  "O4'" . DA  J 6  21  ? -55.627 -37.673 24.758 1.00 142.38 ? -52  DA  J "O4'" 1 
ATOM   9466  C  "C3'" . DA  J 6  21  ? -54.932 -39.299 23.156 1.00 141.56 ? -52  DA  J "C3'" 1 
ATOM   9467  O  "O3'" . DA  J 6  21  ? -55.981 -39.672 22.242 1.00 146.95 ? -52  DA  J "O3'" 1 
ATOM   9468  C  "C2'" . DA  J 6  21  ? -54.280 -37.953 22.885 1.00 133.46 ? -52  DA  J "C2'" 1 
ATOM   9469  C  "C1'" . DA  J 6  21  ? -55.253 -37.010 23.564 1.00 137.15 ? -52  DA  J "C1'" 1 
ATOM   9470  N  N9    . DA  J 6  21  ? -54.709 -35.702 23.926 1.00 139.32 ? -52  DA  J N9    1 
ATOM   9471  C  C8    . DA  J 6  21  ? -53.567 -35.440 24.641 1.00 131.21 ? -52  DA  J C8    1 
ATOM   9472  N  N7    . DA  J 6  21  ? -53.333 -34.161 24.813 1.00 123.05 ? -52  DA  J N7    1 
ATOM   9473  C  C5    . DA  J 6  21  ? -54.392 -33.538 24.167 1.00 133.36 ? -52  DA  J C5    1 
ATOM   9474  C  C6    . DA  J 6  21  ? -54.727 -32.184 23.986 1.00 134.75 ? -52  DA  J C6    1 
ATOM   9475  N  N6    . DA  J 6  21  ? -53.998 -31.170 24.458 1.00 127.82 ? -52  DA  J N6    1 
ATOM   9476  N  N1    . DA  J 6  21  ? -55.856 -31.901 23.299 1.00 150.04 ? -52  DA  J N1    1 
ATOM   9477  C  C2    . DA  J 6  21  ? -56.586 -32.917 22.820 1.00 154.64 ? -52  DA  J C2    1 
ATOM   9478  N  N3    . DA  J 6  21  ? -56.378 -34.229 22.930 1.00 154.76 ? -52  DA  J N3    1 
ATOM   9479  C  C4    . DA  J 6  21  ? -55.251 -34.476 23.621 1.00 143.72 ? -52  DA  J C4    1 
ATOM   9480  P  P     . DC  J 6  22  ? -55.763 -39.681 20.641 1.00 146.90 ? -51  DC  J P     1 
ATOM   9481  O  OP1   . DC  J 6  22  ? -56.860 -40.484 20.046 1.00 147.61 ? -51  DC  J OP1   1 
ATOM   9482  O  OP2   . DC  J 6  22  ? -54.352 -40.061 20.353 1.00 126.56 ? -51  DC  J OP2   1 
ATOM   9483  O  "O5'" . DC  J 6  22  ? -56.009 -38.157 20.234 1.00 147.66 ? -51  DC  J "O5'" 1 
ATOM   9484  C  "C5'" . DC  J 6  22  ? -57.336 -37.587 20.134 1.00 146.24 ? -51  DC  J "C5'" 1 
ATOM   9485  C  "C4'" . DC  J 6  22  ? -57.363 -36.534 19.049 1.00 153.93 ? -51  DC  J "C4'" 1 
ATOM   9486  O  "O4'" . DC  J 6  22  ? -56.678 -35.346 19.521 1.00 150.14 ? -51  DC  J "O4'" 1 
ATOM   9487  C  "C3'" . DC  J 6  22  ? -56.655 -36.948 17.755 1.00 162.35 ? -51  DC  J "C3'" 1 
ATOM   9488  O  "O3'" . DC  J 6  22  ? -57.324 -36.497 16.573 1.00 167.47 ? -51  DC  J "O3'" 1 
ATOM   9489  C  "C2'" . DC  J 6  22  ? -55.297 -36.285 17.870 1.00 160.08 ? -51  DC  J "C2'" 1 
ATOM   9490  C  "C1'" . DC  J 6  22  ? -55.625 -35.009 18.627 1.00 155.79 ? -51  DC  J "C1'" 1 
ATOM   9491  N  N1    . DC  J 6  22  ? -54.504 -34.469 19.417 1.00 149.62 ? -51  DC  J N1    1 
ATOM   9492  C  C2    . DC  J 6  22  ? -54.359 -33.081 19.542 1.00 143.56 ? -51  DC  J C2    1 
ATOM   9493  O  O2    . DC  J 6  22  ? -55.195 -32.338 19.006 1.00 133.10 ? -51  DC  J O2    1 
ATOM   9494  N  N3    . DC  J 6  22  ? -53.319 -32.588 20.255 1.00 144.77 ? -51  DC  J N3    1 
ATOM   9495  C  C4    . DC  J 6  22  ? -52.441 -33.423 20.819 1.00 144.28 ? -51  DC  J C4    1 
ATOM   9496  N  N4    . DC  J 6  22  ? -51.428 -32.897 21.513 1.00 142.38 ? -51  DC  J N4    1 
ATOM   9497  C  C5    . DC  J 6  22  ? -52.561 -34.837 20.697 1.00 140.72 ? -51  DC  J C5    1 
ATOM   9498  C  C6    . DC  J 6  22  ? -53.593 -35.312 19.992 1.00 144.80 ? -51  DC  J C6    1 
ATOM   9499  P  P     . DT  J 6  23  ? -56.953 -37.148 15.155 1.00 173.57 ? -50  DT  J P     1 
ATOM   9500  O  OP1   . DT  J 6  23  ? -57.338 -38.581 15.201 1.00 166.69 ? -50  DT  J OP1   1 
ATOM   9501  O  OP2   . DT  J 6  23  ? -55.547 -36.795 14.826 1.00 156.60 ? -50  DT  J OP2   1 
ATOM   9502  O  "O5'" . DT  J 6  23  ? -57.907 -36.368 14.141 1.00 178.81 ? -50  DT  J "O5'" 1 
ATOM   9503  C  "C5'" . DT  J 6  23  ? -58.345 -35.009 14.378 1.00 175.96 ? -50  DT  J "C5'" 1 
ATOM   9504  C  "C4'" . DT  J 6  23  ? -57.471 -34.002 13.660 1.00 183.59 ? -50  DT  J "C4'" 1 
ATOM   9505  O  "O4'" . DT  J 6  23  ? -56.606 -33.352 14.619 1.00 172.00 ? -50  DT  J "O4'" 1 
ATOM   9506  C  "C3'" . DT  J 6  23  ? -56.554 -34.549 12.553 1.00 187.39 ? -50  DT  J "C3'" 1 
ATOM   9507  O  "O3'" . DT  J 6  23  ? -57.062 -34.263 11.231 1.00 193.61 ? -50  DT  J "O3'" 1 
ATOM   9508  C  "C2'" . DT  J 6  23  ? -55.163 -34.046 12.922 1.00 178.30 ? -50  DT  J "C2'" 1 
ATOM   9509  C  "C1'" . DT  J 6  23  ? -55.424 -32.959 13.953 1.00 173.60 ? -50  DT  J "C1'" 1 
ATOM   9510  N  N1    . DT  J 6  23  ? -54.370 -32.751 14.976 1.00 171.38 ? -50  DT  J N1    1 
ATOM   9511  C  C2    . DT  J 6  23  ? -54.418 -31.585 15.709 1.00 173.25 ? -50  DT  J C2    1 
ATOM   9512  O  O2    . DT  J 6  23  ? -55.281 -30.736 15.555 1.00 173.56 ? -50  DT  J O2    1 
ATOM   9513  N  N3    . DT  J 6  23  ? -53.411 -31.449 16.635 1.00 169.47 ? -50  DT  J N3    1 
ATOM   9514  C  C4    . DT  J 6  23  ? -52.390 -32.344 16.897 1.00 156.36 ? -50  DT  J C4    1 
ATOM   9515  O  O4    . DT  J 6  23  ? -51.551 -32.082 17.755 1.00 140.50 ? -50  DT  J O4    1 
ATOM   9516  C  C5    . DT  J 6  23  ? -52.401 -33.544 16.091 1.00 149.22 ? -50  DT  J C5    1 
ATOM   9517  C  C7    . DT  J 6  23  ? -51.334 -34.573 16.304 1.00 133.99 ? -50  DT  J C7    1 
ATOM   9518  C  C6    . DT  J 6  23  ? -53.376 -33.685 15.183 1.00 164.93 ? -50  DT  J C6    1 
ATOM   9519  P  P     . DA  J 6  24  ? -56.638 -32.944 10.388 1.00 188.66 ? -49  DA  J P     1 
ATOM   9520  O  OP1   . DA  J 6  24  ? -57.467 -32.917 9.153  1.00 172.62 ? -49  DA  J OP1   1 
ATOM   9521  O  OP2   . DA  J 6  24  ? -55.158 -32.909 10.268 1.00 166.32 ? -49  DA  J OP2   1 
ATOM   9522  O  "O5'" . DA  J 6  24  ? -57.133 -31.736 11.300 1.00 189.67 ? -49  DA  J "O5'" 1 
ATOM   9523  C  "C5'" . DA  J 6  24  ? -57.650 -30.525 10.712 1.00 194.90 ? -49  DA  J "C5'" 1 
ATOM   9524  C  "C4'" . DA  J 6  24  ? -56.636 -29.410 10.830 1.00 198.11 ? -49  DA  J "C4'" 1 
ATOM   9525  O  "O4'" . DA  J 6  24  ? -55.660 -29.749 11.845 1.00 192.62 ? -49  DA  J "O4'" 1 
ATOM   9526  C  "C3'" . DA  J 6  24  ? -55.839 -29.094 9.556  1.00 207.76 ? -49  DA  J "C3'" 1 
ATOM   9527  O  "O3'" . DA  J 6  24  ? -56.013 -27.699 9.242  1.00 218.27 ? -49  DA  J "O3'" 1 
ATOM   9528  C  "C2'" . DA  J 6  24  ? -54.428 -29.557 9.892  1.00 203.45 ? -49  DA  J "C2'" 1 
ATOM   9529  C  "C1'" . DA  J 6  24  ? -54.387 -29.342 11.388 1.00 199.87 ? -49  DA  J "C1'" 1 
ATOM   9530  N  N9    . DA  J 6  24  ? -53.376 -30.111 12.111 1.00 197.53 ? -49  DA  J N9    1 
ATOM   9531  C  C8    . DA  J 6  24  ? -52.927 -31.384 11.857 1.00 196.90 ? -49  DA  J C8    1 
ATOM   9532  N  N7    . DA  J 6  24  ? -52.004 -31.795 12.691 1.00 191.84 ? -49  DA  J N7    1 
ATOM   9533  C  C5    . DA  J 6  24  ? -51.830 -30.720 13.551 1.00 188.80 ? -49  DA  J C5    1 
ATOM   9534  C  C6    . DA  J 6  24  ? -50.985 -30.521 14.657 1.00 184.12 ? -49  DA  J C6    1 
ATOM   9535  N  N6    . DA  J 6  24  ? -50.128 -31.440 15.107 1.00 175.55 ? -49  DA  J N6    1 
ATOM   9536  N  N1    . DA  J 6  24  ? -51.061 -29.334 15.300 1.00 186.24 ? -49  DA  J N1    1 
ATOM   9537  C  C2    . DA  J 6  24  ? -51.923 -28.413 14.848 1.00 184.43 ? -49  DA  J C2    1 
ATOM   9538  N  N3    . DA  J 6  24  ? -52.763 -28.481 13.817 1.00 186.50 ? -49  DA  J N3    1 
ATOM   9539  C  C4    . DA  J 6  24  ? -52.666 -29.674 13.203 1.00 192.38 ? -49  DA  J C4    1 
ATOM   9540  P  P     . DC  J 6  25  ? -54.782 -26.781 8.760  1.00 216.68 ? -48  DC  J P     1 
ATOM   9541  O  OP1   . DC  J 6  25  ? -55.334 -25.481 8.300  1.00 208.09 ? -48  DC  J OP1   1 
ATOM   9542  O  OP2   . DC  J 6  25  ? -53.942 -27.582 7.831  1.00 205.31 ? -48  DC  J OP2   1 
ATOM   9543  O  "O5'" . DC  J 6  25  ? -53.993 -26.511 10.117 1.00 211.33 ? -48  DC  J "O5'" 1 
ATOM   9544  C  "C5'" . DC  J 6  25  ? -53.401 -25.234 10.402 1.00 212.28 ? -48  DC  J "C5'" 1 
ATOM   9545  C  "C4'" . DC  J 6  25  ? -51.937 -25.257 10.032 1.00 214.75 ? -48  DC  J "C4'" 1 
ATOM   9546  O  "O4'" . DC  J 6  25  ? -51.270 -26.308 10.771 1.00 213.56 ? -48  DC  J "O4'" 1 
ATOM   9547  C  "C3'" . DC  J 6  25  ? -51.645 -25.523 8.548  1.00 213.12 ? -48  DC  J "C3'" 1 
ATOM   9548  O  "O3'" . DC  J 6  25  ? -50.730 -24.575 7.995  1.00 224.97 ? -48  DC  J "O3'" 1 
ATOM   9549  C  "C2'" . DC  J 6  25  ? -51.005 -26.900 8.542  1.00 205.08 ? -48  DC  J "C2'" 1 
ATOM   9550  C  "C1'" . DC  J 6  25  ? -50.347 -26.939 9.907  1.00 206.92 ? -48  DC  J "C1'" 1 
ATOM   9551  N  N1    . DC  J 6  25  ? -50.037 -28.275 10.453 1.00 202.02 ? -48  DC  J N1    1 
ATOM   9552  C  C2    . DC  J 6  25  ? -49.383 -28.363 11.688 1.00 184.73 ? -48  DC  J C2    1 
ATOM   9553  O  O2    . DC  J 6  25  ? -49.099 -27.318 12.292 1.00 168.61 ? -48  DC  J O2    1 
ATOM   9554  N  N3    . DC  J 6  25  ? -49.074 -29.582 12.187 1.00 174.51 ? -48  DC  J N3    1 
ATOM   9555  C  C4    . DC  J 6  25  ? -49.390 -30.684 11.501 1.00 174.38 ? -48  DC  J C4    1 
ATOM   9556  N  N4    . DC  J 6  25  ? -49.073 -31.865 12.034 1.00 161.04 ? -48  DC  J N4    1 
ATOM   9557  C  C5    . DC  J 6  25  ? -50.053 -30.622 10.241 1.00 194.26 ? -48  DC  J C5    1 
ATOM   9558  C  C6    . DC  J 6  25  ? -50.349 -29.409 9.756  1.00 204.21 ? -48  DC  J C6    1 
ATOM   9559  P  P     . DC  J 6  26  ? -51.240 -23.126 7.541  1.00 232.02 ? -47  DC  J P     1 
ATOM   9560  O  OP1   . DC  J 6  26  ? -52.550 -22.864 8.194  1.00 226.65 ? -47  DC  J OP1   1 
ATOM   9561  O  OP2   . DC  J 6  26  ? -51.129 -23.039 6.061  1.00 227.20 ? -47  DC  J OP2   1 
ATOM   9562  O  "O5'" . DC  J 6  26  ? -50.150 -22.160 8.185  1.00 210.11 ? -47  DC  J "O5'" 1 
ATOM   9563  C  "C5'" . DC  J 6  26  ? -49.517 -22.486 9.438  1.00 184.51 ? -47  DC  J "C5'" 1 
ATOM   9564  C  "C4'" . DC  J 6  26  ? -48.154 -23.104 9.224  1.00 177.22 ? -47  DC  J "C4'" 1 
ATOM   9565  O  "O4'" . DC  J 6  26  ? -48.130 -24.503 9.589  1.00 177.21 ? -47  DC  J "O4'" 1 
ATOM   9566  C  "C3'" . DC  J 6  26  ? -47.560 -23.033 7.809  1.00 171.00 ? -47  DC  J "C3'" 1 
ATOM   9567  O  "O3'" . DC  J 6  26  ? -46.329 -22.304 7.849  1.00 186.19 ? -47  DC  J "O3'" 1 
ATOM   9568  C  "C2'" . DC  J 6  26  ? -47.263 -24.484 7.464  1.00 166.04 ? -47  DC  J "C2'" 1 
ATOM   9569  C  "C1'" . DC  J 6  26  ? -47.063 -25.055 8.851  1.00 176.21 ? -47  DC  J "C1'" 1 
ATOM   9570  N  N1    . DC  J 6  26  ? -47.077 -26.521 9.023  1.00 186.60 ? -47  DC  J N1    1 
ATOM   9571  C  C2    . DC  J 6  26  ? -46.680 -27.056 10.255 1.00 181.84 ? -47  DC  J C2    1 
ATOM   9572  O  O2    . DC  J 6  26  ? -46.364 -26.282 11.171 1.00 181.87 ? -47  DC  J O2    1 
ATOM   9573  N  N3    . DC  J 6  26  ? -46.663 -28.399 10.420 1.00 176.29 ? -47  DC  J N3    1 
ATOM   9574  C  C4    . DC  J 6  26  ? -47.012 -29.199 9.410  1.00 177.69 ? -47  DC  J C4    1 
ATOM   9575  N  N4    . DC  J 6  26  ? -46.982 -30.518 9.618  1.00 162.07 ? -47  DC  J N4    1 
ATOM   9576  C  C5    . DC  J 6  26  ? -47.407 -28.683 8.141  1.00 197.14 ? -47  DC  J C5    1 
ATOM   9577  C  C6    . DC  J 6  26  ? -47.417 -27.351 7.990  1.00 200.79 ? -47  DC  J C6    1 
ATOM   9578  P  P     . DA  J 6  27  ? -46.340 -20.701 7.816  1.00 197.28 ? -46  DA  J P     1 
ATOM   9579  O  OP1   . DA  J 6  27  ? -47.727 -20.236 8.082  1.00 201.76 ? -46  DA  J OP1   1 
ATOM   9580  O  OP2   . DA  J 6  27  ? -45.632 -20.265 6.582  1.00 188.17 ? -46  DA  J OP2   1 
ATOM   9581  O  "O5'" . DA  J 6  27  ? -45.448 -20.286 9.071  1.00 184.28 ? -46  DA  J "O5'" 1 
ATOM   9582  C  "C5'" . DA  J 6  27  ? -45.569 -20.921 10.359 1.00 159.40 ? -46  DA  J "C5'" 1 
ATOM   9583  C  "C4'" . DA  J 6  27  ? -44.308 -21.689 10.680 1.00 143.19 ? -46  DA  J "C4'" 1 
ATOM   9584  O  "O4'" . DA  J 6  27  ? -44.454 -23.098 10.379 1.00 138.49 ? -46  DA  J "O4'" 1 
ATOM   9585  C  "C3'" . DA  J 6  27  ? -43.064 -21.232 9.915  1.00 127.11 ? -46  DA  J "C3'" 1 
ATOM   9586  O  "O3'" . DA  J 6  27  ? -42.012 -21.229 10.853 1.00 121.90 ? -46  DA  J "O3'" 1 
ATOM   9587  C  "C2'" . DA  J 6  27  ? -42.810 -22.356 8.932  1.00 126.21 ? -46  DA  J "C2'" 1 
ATOM   9588  C  "C1'" . DA  J 6  27  ? -43.254 -23.535 9.764  1.00 133.95 ? -46  DA  J "C1'" 1 
ATOM   9589  N  N9    . DA  J 6  27  ? -43.540 -24.763 9.031  1.00 139.36 ? -46  DA  J N9    1 
ATOM   9590  C  C8    . DA  J 6  27  ? -43.906 -24.906 7.716  1.00 148.95 ? -46  DA  J C8    1 
ATOM   9591  N  N7    . DA  J 6  27  ? -44.099 -26.151 7.354  1.00 150.75 ? -46  DA  J N7    1 
ATOM   9592  C  C5    . DA  J 6  27  ? -43.834 -26.878 8.506  1.00 148.72 ? -46  DA  J C5    1 
ATOM   9593  C  C6    . DA  J 6  27  ? -43.852 -28.258 8.780  1.00 155.24 ? -46  DA  J C6    1 
ATOM   9594  N  N6    . DA  J 6  27  ? -44.164 -29.189 7.877  1.00 156.44 ? -46  DA  J N6    1 
ATOM   9595  N  N1    . DA  J 6  27  ? -43.535 -28.654 10.033 1.00 168.72 ? -46  DA  J N1    1 
ATOM   9596  C  C2    . DA  J 6  27  ? -43.221 -27.720 10.940 1.00 168.14 ? -46  DA  J C2    1 
ATOM   9597  N  N3    . DA  J 6  27  ? -43.165 -26.396 10.801 1.00 162.77 ? -46  DA  J N3    1 
ATOM   9598  C  C4    . DA  J 6  27  ? -43.487 -26.036 9.546  1.00 149.58 ? -46  DA  J C4    1 
ATOM   9599  P  P     . DA  J 6  28  ? -40.746 -20.350 10.598 1.00 157.10 ? -45  DA  J P     1 
ATOM   9600  O  OP1   . DA  J 6  28  ? -41.177 -18.928 10.612 1.00 162.16 ? -45  DA  J OP1   1 
ATOM   9601  O  OP2   . DA  J 6  28  ? -40.056 -20.890 9.399  1.00 149.73 ? -45  DA  J OP2   1 
ATOM   9602  O  "O5'" . DA  J 6  28  ? -39.884 -20.629 11.910 1.00 160.92 ? -45  DA  J "O5'" 1 
ATOM   9603  C  "C5'" . DA  J 6  28  ? -40.330 -21.571 12.918 1.00 148.55 ? -45  DA  J "C5'" 1 
ATOM   9604  C  "C4'" . DA  J 6  28  ? -39.499 -22.833 12.868 1.00 139.95 ? -45  DA  J "C4'" 1 
ATOM   9605  O  "O4'" . DA  J 6  28  ? -40.056 -23.793 11.933 1.00 131.72 ? -45  DA  J "O4'" 1 
ATOM   9606  C  "C3'" . DA  J 6  28  ? -38.050 -22.618 12.425 1.00 134.75 ? -45  DA  J "C3'" 1 
ATOM   9607  O  "O3'" . DA  J 6  28  ? -37.186 -23.438 13.202 1.00 125.25 ? -45  DA  J "O3'" 1 
ATOM   9608  C  "C2'" . DA  J 6  28  ? -38.038 -23.127 11.000 1.00 133.73 ? -45  DA  J "C2'" 1 
ATOM   9609  C  "C1'" . DA  J 6  28  ? -38.991 -24.289 11.138 1.00 129.83 ? -45  DA  J "C1'" 1 
ATOM   9610  N  N9    . DA  J 6  28  ? -39.542 -24.783 9.883  1.00 129.82 ? -45  DA  J N9    1 
ATOM   9611  C  C8    . DA  J 6  28  ? -39.810 -24.093 8.727  1.00 127.49 ? -45  DA  J C8    1 
ATOM   9612  N  N7    . DA  J 6  28  ? -40.285 -24.842 7.763  1.00 129.80 ? -45  DA  J N7    1 
ATOM   9613  C  C5    . DA  J 6  28  ? -40.316 -26.114 8.315  1.00 134.42 ? -45  DA  J C5    1 
ATOM   9614  C  C6    . DA  J 6  28  ? -40.718 -27.360 7.802  1.00 141.58 ? -45  DA  J C6    1 
ATOM   9615  N  N6    . DA  J 6  28  ? -41.185 -27.535 6.565  1.00 144.87 ? -45  DA  J N6    1 
ATOM   9616  N  N1    . DA  J 6  28  ? -40.625 -28.434 8.616  1.00 150.66 ? -45  DA  J N1    1 
ATOM   9617  C  C2    . DA  J 6  28  ? -40.157 -28.259 9.859  1.00 141.55 ? -45  DA  J C2    1 
ATOM   9618  N  N3    . DA  J 6  28  ? -39.750 -27.140 10.454 1.00 134.06 ? -45  DA  J N3    1 
ATOM   9619  C  C4    . DA  J 6  28  ? -39.857 -26.093 9.619  1.00 131.33 ? -45  DA  J C4    1 
ATOM   9620  P  P     . DA  J 6  29  ? -36.420 -22.809 14.417 1.00 113.05 ? -44  DA  J P     1 
ATOM   9621  O  OP1   . DA  J 6  29  ? -37.190 -23.113 15.651 1.00 119.77 ? -44  DA  J OP1   1 
ATOM   9622  O  OP2   . DA  J 6  29  ? -36.107 -21.404 14.067 1.00 121.29 ? -44  DA  J OP2   1 
ATOM   9623  O  "O5'" . DA  J 6  29  ? -35.044 -23.610 14.441 1.00 118.84 ? -44  DA  J "O5'" 1 
ATOM   9624  C  "C5'" . DA  J 6  29  ? -34.761 -24.637 13.486 1.00 110.53 ? -44  DA  J "C5'" 1 
ATOM   9625  C  "C4'" . DA  J 6  29  ? -35.142 -25.989 14.043 1.00 102.53 ? -44  DA  J "C4'" 1 
ATOM   9626  O  "O4'" . DA  J 6  29  ? -36.238 -26.552 13.286 1.00 98.58  ? -44  DA  J "O4'" 1 
ATOM   9627  C  "C3'" . DA  J 6  29  ? -34.026 -27.015 13.925 1.00 102.69 ? -44  DA  J "C3'" 1 
ATOM   9628  O  "O3'" . DA  J 6  29  ? -34.218 -28.088 14.838 1.00 101.85 ? -44  DA  J "O3'" 1 
ATOM   9629  C  "C2'" . DA  J 6  29  ? -34.216 -27.546 12.521 1.00 110.52 ? -44  DA  J "C2'" 1 
ATOM   9630  C  "C1'" . DA  J 6  29  ? -35.728 -27.487 12.328 1.00 114.00 ? -44  DA  J "C1'" 1 
ATOM   9631  N  N9    . DA  J 6  29  ? -36.143 -27.056 10.986 1.00 125.62 ? -44  DA  J N9    1 
ATOM   9632  C  C8    . DA  J 6  29  ? -36.115 -25.796 10.437 1.00 121.43 ? -44  DA  J C8    1 
ATOM   9633  N  N7    . DA  J 6  29  ? -36.556 -25.748 9.204  1.00 112.58 ? -44  DA  J N7    1 
ATOM   9634  C  C5    . DA  J 6  29  ? -36.865 -27.067 8.909  1.00 107.73 ? -44  DA  J C5    1 
ATOM   9635  C  C6    . DA  J 6  29  ? -37.370 -27.682 7.754  1.00 102.79 ? -44  DA  J C6    1 
ATOM   9636  N  N6    . DA  J 6  29  ? -37.664 -27.021 6.635  1.00 102.29 ? -44  DA  J N6    1 
ATOM   9637  N  N1    . DA  J 6  29  ? -37.570 -29.017 7.788  1.00 107.74 ? -44  DA  J N1    1 
ATOM   9638  C  C2    . DA  J 6  29  ? -37.282 -29.679 8.915  1.00 117.21 ? -44  DA  J C2    1 
ATOM   9639  N  N3    . DA  J 6  29  ? -36.798 -29.214 10.063 1.00 118.65 ? -44  DA  J N3    1 
ATOM   9640  C  C4    . DA  J 6  29  ? -36.611 -27.885 9.995  1.00 118.48 ? -44  DA  J C4    1 
ATOM   9641  P  P     . DA  J 6  30  ? -32.969 -28.950 15.333 1.00 107.12 ? -43  DA  J P     1 
ATOM   9642  O  OP1   . DA  J 6  30  ? -33.279 -29.451 16.697 1.00 106.66 ? -43  DA  J OP1   1 
ATOM   9643  O  OP2   . DA  J 6  30  ? -31.725 -28.180 15.069 1.00 90.94  ? -43  DA  J OP2   1 
ATOM   9644  O  "O5'" . DA  J 6  30  ? -32.970 -30.203 14.351 1.00 110.95 ? -43  DA  J "O5'" 1 
ATOM   9645  C  "C5'" . DA  J 6  30  ? -33.838 -31.331 14.558 1.00 102.16 ? -43  DA  J "C5'" 1 
ATOM   9646  C  "C4'" . DA  J 6  30  ? -33.725 -32.241 13.360 1.00 102.30 ? -43  DA  J "C4'" 1 
ATOM   9647  O  "O4'" . DA  J 6  30  ? -34.141 -31.512 12.177 1.00 108.50 ? -43  DA  J "O4'" 1 
ATOM   9648  C  "C3'" . DA  J 6  30  ? -32.296 -32.721 13.084 1.00 103.14 ? -43  DA  J "C3'" 1 
ATOM   9649  O  "O3'" . DA  J 6  30  ? -32.286 -34.126 12.814 1.00 105.05 ? -43  DA  J "O3'" 1 
ATOM   9650  C  "C2'" . DA  J 6  30  ? -31.857 -31.887 11.894 1.00 105.91 ? -43  DA  J "C2'" 1 
ATOM   9651  C  "C1'" . DA  J 6  30  ? -33.165 -31.681 11.156 1.00 114.99 ? -43  DA  J "C1'" 1 
ATOM   9652  N  N9    . DA  J 6  30  ? -33.230 -30.519 10.259 1.00 117.71 ? -43  DA  J N9    1 
ATOM   9653  C  C8    . DA  J 6  30  ? -32.653 -29.282 10.418 1.00 112.43 ? -43  DA  J C8    1 
ATOM   9654  N  N7    . DA  J 6  30  ? -32.899 -28.452 9.434  1.00 103.79 ? -43  DA  J N7    1 
ATOM   9655  C  C5    . DA  J 6  30  ? -33.677 -29.196 8.558  1.00 116.34 ? -43  DA  J C5    1 
ATOM   9656  C  C6    . DA  J 6  30  ? -34.263 -28.888 7.320  1.00 113.19 ? -43  DA  J C6    1 
ATOM   9657  N  N6    . DA  J 6  30  ? -34.146 -27.701 6.721  1.00 107.71 ? -43  DA  J N6    1 
ATOM   9658  N  N1    . DA  J 6  30  ? -34.979 -29.855 6.706  1.00 113.94 ? -43  DA  J N1    1 
ATOM   9659  C  C2    . DA  J 6  30  ? -35.086 -31.050 7.300  1.00 111.15 ? -43  DA  J C2    1 
ATOM   9660  N  N3    . DA  J 6  30  ? -34.584 -31.459 8.463  1.00 118.07 ? -43  DA  J N3    1 
ATOM   9661  C  C4    . DA  J 6  30  ? -33.884 -30.472 9.051  1.00 121.01 ? -43  DA  J C4    1 
ATOM   9662  P  P     . DG  J 6  31  ? -30.897 -34.926 12.639 1.00 108.34 ? -42  DG  J P     1 
ATOM   9663  O  OP1   . DG  J 6  31  ? -30.851 -36.030 13.638 1.00 108.63 ? -42  DG  J OP1   1 
ATOM   9664  O  OP2   . DG  J 6  31  ? -29.786 -33.947 12.563 1.00 103.22 ? -42  DG  J OP2   1 
ATOM   9665  O  "O5'" . DG  J 6  31  ? -31.064 -35.590 11.205 1.00 124.24 ? -42  DG  J "O5'" 1 
ATOM   9666  C  "C5'" . DG  J 6  31  ? -32.350 -36.066 10.759 1.00 124.68 ? -42  DG  J "C5'" 1 
ATOM   9667  C  "C4'" . DG  J 6  31  ? -32.377 -36.114 9.251  1.00 114.65 ? -42  DG  J "C4'" 1 
ATOM   9668  O  "O4'" . DG  J 6  31  ? -32.543 -34.770 8.740  1.00 106.32 ? -42  DG  J "O4'" 1 
ATOM   9669  C  "C3'" . DG  J 6  31  ? -31.092 -36.664 8.623  1.00 109.95 ? -42  DG  J "C3'" 1 
ATOM   9670  O  "O3'" . DG  J 6  31  ? -31.418 -37.671 7.662  1.00 109.37 ? -42  DG  J "O3'" 1 
ATOM   9671  C  "C2'" . DG  J 6  31  ? -30.430 -35.439 8.016  1.00 106.88 ? -42  DG  J "C2'" 1 
ATOM   9672  C  "C1'" . DG  J 6  31  ? -31.621 -34.563 7.687  1.00 113.52 ? -42  DG  J "C1'" 1 
ATOM   9673  N  N9    . DG  J 6  31  ? -31.349 -33.132 7.597  1.00 122.59 ? -42  DG  J N9    1 
ATOM   9674  C  C8    . DG  J 6  31  ? -30.738 -32.334 8.533  1.00 127.51 ? -42  DG  J C8    1 
ATOM   9675  N  N7    . DG  J 6  31  ? -30.643 -31.087 8.159  1.00 122.71 ? -42  DG  J N7    1 
ATOM   9676  C  C5    . DG  J 6  31  ? -31.229 -31.061 6.902  1.00 122.67 ? -42  DG  J C5    1 
ATOM   9677  C  C6    . DG  J 6  31  ? -31.414 -29.986 5.998  1.00 126.32 ? -42  DG  J C6    1 
ATOM   9678  O  O6    . DG  J 6  31  ? -31.094 -28.802 6.135  1.00 131.90 ? -42  DG  J O6    1 
ATOM   9679  N  N1    . DG  J 6  31  ? -32.039 -30.402 4.827  1.00 140.05 ? -42  DG  J N1    1 
ATOM   9680  C  C2    . DG  J 6  31  ? -32.442 -31.688 4.562  1.00 146.66 ? -42  DG  J C2    1 
ATOM   9681  N  N2    . DG  J 6  31  ? -33.035 -31.891 3.376  1.00 155.31 ? -42  DG  J N2    1 
ATOM   9682  N  N3    . DG  J 6  31  ? -32.277 -32.699 5.398  1.00 141.17 ? -42  DG  J N3    1 
ATOM   9683  C  C4    . DG  J 6  31  ? -31.668 -32.316 6.540  1.00 127.63 ? -42  DG  J C4    1 
ATOM   9684  P  P     . DT  J 6  32  ? -30.270 -38.556 6.996  1.00 108.38 ? -41  DT  J P     1 
ATOM   9685  O  OP1   . DT  J 6  32  ? -30.692 -39.974 7.070  1.00 110.70 ? -41  DT  J OP1   1 
ATOM   9686  O  OP2   . DT  J 6  32  ? -28.964 -38.151 7.567  1.00 109.99 ? -41  DT  J OP2   1 
ATOM   9687  O  "O5'" . DT  J 6  32  ? -30.259 -38.050 5.486  1.00 111.92 ? -41  DT  J "O5'" 1 
ATOM   9688  C  "C5'" . DT  J 6  32  ? -31.457 -38.014 4.692  1.00 111.50 ? -41  DT  J "C5'" 1 
ATOM   9689  C  "C4'" . DT  J 6  32  ? -31.174 -37.377 3.350  1.00 118.15 ? -41  DT  J "C4'" 1 
ATOM   9690  O  "O4'" . DT  J 6  32  ? -31.100 -35.938 3.493  1.00 112.75 ? -41  DT  J "O4'" 1 
ATOM   9691  C  "C3'" . DT  J 6  32  ? -29.862 -37.799 2.679  1.00 128.56 ? -41  DT  J "C3'" 1 
ATOM   9692  O  "O3'" . DT  J 6  32  ? -30.090 -37.931 1.272  1.00 136.10 ? -41  DT  J "O3'" 1 
ATOM   9693  C  "C2'" . DT  J 6  32  ? -28.940 -36.630 2.967  1.00 127.11 ? -41  DT  J "C2'" 1 
ATOM   9694  C  "C1'" . DT  J 6  32  ? -29.915 -35.474 2.867  1.00 124.88 ? -41  DT  J "C1'" 1 
ATOM   9695  N  N1    . DT  J 6  32  ? -29.513 -34.212 3.522  1.00 129.36 ? -41  DT  J N1    1 
ATOM   9696  C  C2    . DT  J 6  32  ? -29.823 -33.029 2.886  1.00 139.42 ? -41  DT  J C2    1 
ATOM   9697  O  O2    . DT  J 6  32  ? -30.403 -32.979 1.814  1.00 155.22 ? -41  DT  J O2    1 
ATOM   9698  N  N3    . DT  J 6  32  ? -29.427 -31.899 3.556  1.00 142.47 ? -41  DT  J N3    1 
ATOM   9699  C  C4    . DT  J 6  32  ? -28.772 -31.836 4.770  1.00 147.97 ? -41  DT  J C4    1 
ATOM   9700  O  O4    . DT  J 6  32  ? -28.484 -30.745 5.251  1.00 154.59 ? -41  DT  J O4    1 
ATOM   9701  C  C5    . DT  J 6  32  ? -28.478 -33.112 5.382  1.00 145.96 ? -41  DT  J C5    1 
ATOM   9702  C  C7    . DT  J 6  32  ? -27.767 -33.141 6.698  1.00 141.21 ? -41  DT  J C7    1 
ATOM   9703  C  C6    . DT  J 6  32  ? -28.859 -34.222 4.736  1.00 138.45 ? -41  DT  J C6    1 
ATOM   9704  P  P     . DG  J 6  33  ? -28.999 -38.608 0.310  1.00 137.28 ? -40  DG  J P     1 
ATOM   9705  O  OP1   . DG  J 6  33  ? -29.348 -40.044 0.145  1.00 137.37 ? -40  DG  J OP1   1 
ATOM   9706  O  OP2   . DG  J 6  33  ? -27.644 -38.236 0.788  1.00 135.57 ? -40  DG  J OP2   1 
ATOM   9707  O  "O5'" . DG  J 6  33  ? -29.288 -37.872 -1.070 1.00 149.01 ? -40  DG  J "O5'" 1 
ATOM   9708  C  "C5'" . DG  J 6  33  ? -28.341 -37.910 -2.141 1.00 159.30 ? -40  DG  J "C5'" 1 
ATOM   9709  C  "C4'" . DG  J 6  33  ? -27.737 -36.541 -2.350 1.00 162.11 ? -40  DG  J "C4'" 1 
ATOM   9710  O  "O4'" . DG  J 6  33  ? -27.842 -35.729 -1.153 1.00 165.01 ? -40  DG  J "O4'" 1 
ATOM   9711  C  "C3'" . DG  J 6  33  ? -26.250 -36.570 -2.714 1.00 163.23 ? -40  DG  J "C3'" 1 
ATOM   9712  O  "O3'" . DG  J 6  33  ? -26.032 -35.917 -3.960 1.00 156.43 ? -40  DG  J "O3'" 1 
ATOM   9713  C  "C2'" . DG  J 6  33  ? -25.573 -35.809 -1.586 1.00 169.86 ? -40  DG  J "C2'" 1 
ATOM   9714  C  "C1'" . DG  J 6  33  ? -26.687 -34.913 -1.102 1.00 169.32 ? -40  DG  J "C1'" 1 
ATOM   9715  N  N9    . DG  J 6  33  ? -26.510 -34.435 0.267  1.00 167.13 ? -40  DG  J N9    1 
ATOM   9716  C  C8    . DG  J 6  33  ? -26.423 -35.193 1.409  1.00 159.10 ? -40  DG  J C8    1 
ATOM   9717  N  N7    . DG  J 6  33  ? -26.229 -34.479 2.484  1.00 147.80 ? -40  DG  J N7    1 
ATOM   9718  C  C5    . DG  J 6  33  ? -26.156 -33.173 2.021  1.00 148.47 ? -40  DG  J C5    1 
ATOM   9719  C  C6    . DG  J 6  33  ? -25.950 -31.961 2.724  1.00 144.19 ? -40  DG  J C6    1 
ATOM   9720  O  O6    . DG  J 6  33  ? -25.783 -31.794 3.936  1.00 127.92 ? -40  DG  J O6    1 
ATOM   9721  N  N1    . DG  J 6  33  ? -25.944 -30.865 1.866  1.00 150.23 ? -40  DG  J N1    1 
ATOM   9722  C  C2    . DG  J 6  33  ? -26.112 -30.928 0.505  1.00 153.73 ? -40  DG  J C2    1 
ATOM   9723  N  N2    . DG  J 6  33  ? -26.073 -29.759 -0.150 1.00 160.32 ? -40  DG  J N2    1 
ATOM   9724  N  N3    . DG  J 6  33  ? -26.305 -32.054 -0.164 1.00 154.64 ? -40  DG  J N3    1 
ATOM   9725  C  C4    . DG  J 6  33  ? -26.314 -33.130 0.652  1.00 156.50 ? -40  DG  J C4    1 
ATOM   9726  P  P     . DT  J 6  34  ? -24.565 -35.856 -4.555 1.00 163.36 ? -39  DT  J P     1 
ATOM   9727  O  OP1   . DT  J 6  34  ? -24.667 -36.042 -6.022 1.00 178.80 ? -39  DT  J OP1   1 
ATOM   9728  O  OP2   . DT  J 6  34  ? -23.711 -36.781 -3.758 1.00 150.93 ? -39  DT  J OP2   1 
ATOM   9729  O  "O5'" . DT  J 6  34  ? -24.126 -34.352 -4.262 1.00 162.67 ? -39  DT  J "O5'" 1 
ATOM   9730  C  "C5'" . DT  J 6  34  ? -24.571 -33.265 -5.100 1.00 162.85 ? -39  DT  J "C5'" 1 
ATOM   9731  C  "C4'" . DT  J 6  34  ? -23.560 -32.141 -5.091 1.00 166.97 ? -39  DT  J "C4'" 1 
ATOM   9732  O  "O4'" . DT  J 6  34  ? -23.536 -31.530 -3.779 1.00 168.45 ? -39  DT  J "O4'" 1 
ATOM   9733  C  "C3'" . DT  J 6  34  ? -22.116 -32.555 -5.385 1.00 167.49 ? -39  DT  J "C3'" 1 
ATOM   9734  O  "O3'" . DT  J 6  34  ? -21.460 -31.526 -6.137 1.00 167.90 ? -39  DT  J "O3'" 1 
ATOM   9735  C  "C2'" . DT  J 6  34  ? -21.530 -32.743 -3.999 1.00 171.55 ? -39  DT  J "C2'" 1 
ATOM   9736  C  "C1'" . DT  J 6  34  ? -22.236 -31.648 -3.214 1.00 179.75 ? -39  DT  J "C1'" 1 
ATOM   9737  N  N1    . DT  J 6  34  ? -22.386 -31.892 -1.761 1.00 182.99 ? -39  DT  J N1    1 
ATOM   9738  C  C2    . DT  J 6  34  ? -22.516 -30.797 -0.935 1.00 183.53 ? -39  DT  J C2    1 
ATOM   9739  O  O2    . DT  J 6  34  ? -22.523 -29.648 -1.345 1.00 189.55 ? -39  DT  J O2    1 
ATOM   9740  N  N3    . DT  J 6  34  ? -22.645 -31.099 0.398  1.00 172.43 ? -39  DT  J N3    1 
ATOM   9741  C  C4    . DT  J 6  34  ? -22.653 -32.356 0.972  1.00 169.90 ? -39  DT  J C4    1 
ATOM   9742  O  O4    . DT  J 6  34  ? -22.780 -32.470 2.187  1.00 170.99 ? -39  DT  J O4    1 
ATOM   9743  C  C5    . DT  J 6  34  ? -22.507 -33.458 0.049  1.00 169.16 ? -39  DT  J C5    1 
ATOM   9744  C  C7    . DT  J 6  34  ? -22.505 -34.856 0.580  1.00 167.35 ? -39  DT  J C7    1 
ATOM   9745  C  C6    . DT  J 6  34  ? -22.383 -33.175 -1.254 1.00 172.15 ? -39  DT  J C6    1 
ATOM   9746  P  P     . DA  J 6  35  ? -19.859 -31.485 -6.257 1.00 176.28 ? -38  DA  J P     1 
ATOM   9747  O  OP1   . DA  J 6  35  ? -19.510 -30.990 -7.615 1.00 163.64 ? -38  DA  J OP1   1 
ATOM   9748  O  OP2   . DA  J 6  35  ? -19.321 -32.795 -5.797 1.00 158.95 ? -38  DA  J OP2   1 
ATOM   9749  O  "O5'" . DA  J 6  35  ? -19.465 -30.330 -5.233 1.00 172.27 ? -38  DA  J "O5'" 1 
ATOM   9750  C  "C5'" . DA  J 6  35  ? -20.016 -29.003 -5.370 1.00 164.23 ? -38  DA  J "C5'" 1 
ATOM   9751  C  "C4'" . DA  J 6  35  ? -19.177 -27.999 -4.613 1.00 160.45 ? -38  DA  J "C4'" 1 
ATOM   9752  O  "O4'" . DA  J 6  35  ? -19.296 -28.247 -3.195 1.00 153.41 ? -38  DA  J "O4'" 1 
ATOM   9753  C  "C3'" . DA  J 6  35  ? -17.678 -28.042 -4.903 1.00 161.89 ? -38  DA  J "C3'" 1 
ATOM   9754  O  "O3'" . DA  J 6  35  ? -17.168 -26.708 -4.765 1.00 155.43 ? -38  DA  J "O3'" 1 
ATOM   9755  C  "C2'" . DA  J 6  35  ? -17.168 -29.038 -3.876 1.00 154.06 ? -38  DA  J "C2'" 1 
ATOM   9756  C  "C1'" . DA  J 6  35  ? -18.071 -28.763 -2.681 1.00 160.90 ? -38  DA  J "C1'" 1 
ATOM   9757  N  N9    . DA  J 6  35  ? -18.387 -29.929 -1.859 1.00 163.23 ? -38  DA  J N9    1 
ATOM   9758  C  C8    . DA  J 6  35  ? -18.545 -31.236 -2.250 1.00 163.61 ? -38  DA  J C8    1 
ATOM   9759  N  N7    . DA  J 6  35  ? -18.834 -32.050 -1.265 1.00 157.02 ? -38  DA  J N7    1 
ATOM   9760  C  C5    . DA  J 6  35  ? -18.876 -31.224 -0.151 1.00 152.28 ? -38  DA  J C5    1 
ATOM   9761  C  C6    . DA  J 6  35  ? -19.137 -31.479 1.204  1.00 152.45 ? -38  DA  J C6    1 
ATOM   9762  N  N6    . DA  J 6  35  ? -19.416 -32.691 1.687  1.00 147.75 ? -38  DA  J N6    1 
ATOM   9763  N  N1    . DA  J 6  35  ? -19.098 -30.433 2.058  1.00 167.07 ? -38  DA  J N1    1 
ATOM   9764  C  C2    . DA  J 6  35  ? -18.815 -29.216 1.572  1.00 161.68 ? -38  DA  J C2    1 
ATOM   9765  N  N3    . DA  J 6  35  ? -18.557 -28.851 0.319  1.00 153.56 ? -38  DA  J N3    1 
ATOM   9766  C  C4    . DA  J 6  35  ? -18.603 -29.914 -0.503 1.00 158.31 ? -38  DA  J C4    1 
ATOM   9767  P  P     . DT  J 6  36  ? -15.606 -26.433 -4.526 1.00 149.70 ? -37  DT  J P     1 
ATOM   9768  O  OP1   . DT  J 6  36  ? -15.278 -25.114 -5.131 1.00 141.23 ? -37  DT  J OP1   1 
ATOM   9769  O  OP2   . DT  J 6  36  ? -14.841 -27.645 -4.935 1.00 143.17 ? -37  DT  J OP2   1 
ATOM   9770  O  "O5'" . DT  J 6  36  ? -15.521 -26.290 -2.942 1.00 152.65 ? -37  DT  J "O5'" 1 
ATOM   9771  C  "C5'" . DT  J 6  36  ? -16.392 -25.384 -2.230 1.00 145.30 ? -37  DT  J "C5'" 1 
ATOM   9772  C  "C4'" . DT  J 6  36  ? -15.765 -24.965 -0.920 1.00 138.79 ? -37  DT  J "C4'" 1 
ATOM   9773  O  "O4'" . DT  J 6  36  ? -16.022 -25.961 0.102  1.00 133.30 ? -37  DT  J "O4'" 1 
ATOM   9774  C  "C3'" . DT  J 6  36  ? -14.245 -24.778 -0.964 1.00 136.75 ? -37  DT  J "C3'" 1 
ATOM   9775  O  "O3'" . DT  J 6  36  ? -13.938 -23.549 -0.288 1.00 135.33 ? -37  DT  J "O3'" 1 
ATOM   9776  C  "C2'" . DT  J 6  36  ? -13.718 -26.054 -0.330 1.00 137.02 ? -37  DT  J "C2'" 1 
ATOM   9777  C  "C1'" . DT  J 6  36  ? -14.797 -26.369 0.693  1.00 143.61 ? -37  DT  J "C1'" 1 
ATOM   9778  N  N1    . DT  J 6  36  ? -14.923 -27.795 1.079  1.00 151.06 ? -37  DT  J N1    1 
ATOM   9779  C  C2    . DT  J 6  36  ? -14.905 -28.107 2.421  1.00 153.13 ? -37  DT  J C2    1 
ATOM   9780  O  O2    . DT  J 6  36  ? -14.791 -27.268 3.301  1.00 153.48 ? -37  DT  J O2    1 
ATOM   9781  N  N3    . DT  J 6  36  ? -15.028 -29.445 2.700  1.00 146.76 ? -37  DT  J N3    1 
ATOM   9782  C  C4    . DT  J 6  36  ? -15.167 -30.477 1.792  1.00 148.77 ? -37  DT  J C4    1 
ATOM   9783  O  O4    . DT  J 6  36  ? -15.273 -31.632 2.193  1.00 138.04 ? -37  DT  J O4    1 
ATOM   9784  C  C5    . DT  J 6  36  ? -15.176 -30.080 0.402  1.00 155.78 ? -37  DT  J C5    1 
ATOM   9785  C  C7    . DT  J 6  36  ? -15.315 -31.133 -0.652 1.00 154.31 ? -37  DT  J C7    1 
ATOM   9786  C  C6    . DT  J 6  36  ? -15.052 -28.776 0.119  1.00 154.71 ? -37  DT  J C6    1 
ATOM   9787  P  P     . DT  J 6  37  ? -12.414 -23.078 -0.040 1.00 143.24 ? -36  DT  J P     1 
ATOM   9788  O  OP1   . DT  J 6  37  ? -12.348 -21.606 -0.240 1.00 122.18 ? -36  DT  J OP1   1 
ATOM   9789  O  OP2   . DT  J 6  37  ? -11.489 -23.982 -0.797 1.00 128.75 ? -36  DT  J OP2   1 
ATOM   9790  O  "O5'" . DT  J 6  37  ? -12.254 -23.305 1.527  1.00 144.17 ? -36  DT  J "O5'" 1 
ATOM   9791  C  "C5'" . DT  J 6  37  ? -13.369 -23.070 2.413  1.00 128.78 ? -36  DT  J "C5'" 1 
ATOM   9792  C  "C4'" . DT  J 6  37  ? -13.030 -23.533 3.810  1.00 118.59 ? -36  DT  J "C4'" 1 
ATOM   9793  O  "O4'" . DT  J 6  37  ? -13.174 -24.971 3.900  1.00 113.01 ? -36  DT  J "O4'" 1 
ATOM   9794  C  "C3'" . DT  J 6  37  ? -11.602 -23.213 4.260  1.00 117.63 ? -36  DT  J "C3'" 1 
ATOM   9795  O  "O3'" . DT  J 6  37  ? -11.655 -22.659 5.574  1.00 121.86 ? -36  DT  J "O3'" 1 
ATOM   9796  C  "C2'" . DT  J 6  37  ? -10.889 -24.553 4.204  1.00 113.77 ? -36  DT  J "C2'" 1 
ATOM   9797  C  "C1'" . DT  J 6  37  ? -12.015 -25.531 4.489  1.00 118.48 ? -36  DT  J "C1'" 1 
ATOM   9798  N  N1    . DT  J 6  37  ? -11.822 -26.881 3.926  1.00 122.52 ? -36  DT  J N1    1 
ATOM   9799  C  C2    . DT  J 6  37  ? -11.887 -27.965 4.774  1.00 131.98 ? -36  DT  J C2    1 
ATOM   9800  O  O2    . DT  J 6  37  ? -12.103 -27.864 5.971  1.00 144.15 ? -36  DT  J O2    1 
ATOM   9801  N  N3    . DT  J 6  37  ? -11.687 -29.179 4.167  1.00 131.38 ? -36  DT  J N3    1 
ATOM   9802  C  C4    . DT  J 6  37  ? -11.432 -29.412 2.830  1.00 139.12 ? -36  DT  J C4    1 
ATOM   9803  O  O4    . DT  J 6  37  ? -11.274 -30.561 2.429  1.00 141.97 ? -36  DT  J O4    1 
ATOM   9804  C  C5    . DT  J 6  37  ? -11.378 -28.231 1.999  1.00 144.64 ? -36  DT  J C5    1 
ATOM   9805  C  C7    . DT  J 6  37  ? -11.109 -28.386 0.535  1.00 151.61 ? -36  DT  J C7    1 
ATOM   9806  C  C6    . DT  J 6  37  ? -11.571 -27.041 2.581  1.00 133.08 ? -36  DT  J C6    1 
ATOM   9807  P  P     . DT  J 6  38  ? -10.335 -22.119 6.275  1.00 127.44 ? -35  DT  J P     1 
ATOM   9808  O  OP1   . DT  J 6  38  ? -10.634 -20.766 6.820  1.00 110.38 ? -35  DT  J OP1   1 
ATOM   9809  O  OP2   . DT  J 6  38  ? -9.193  -22.311 5.335  1.00 116.51 ? -35  DT  J OP2   1 
ATOM   9810  O  "O5'" . DT  J 6  38  ? -10.120 -23.152 7.473  1.00 134.46 ? -35  DT  J "O5'" 1 
ATOM   9811  C  "C5'" . DT  J 6  38  ? -11.218 -23.864 8.095  1.00 123.09 ? -35  DT  J "C5'" 1 
ATOM   9812  C  "C4'" . DT  J 6  38  ? -10.708 -24.999 8.956  1.00 122.88 ? -35  DT  J "C4'" 1 
ATOM   9813  O  "O4'" . DT  J 6  38  ? -10.655 -26.251 8.218  1.00 117.99 ? -35  DT  J "O4'" 1 
ATOM   9814  C  "C3'" . DT  J 6  38  ? -9.306  -24.810 9.537  1.00 130.34 ? -35  DT  J "C3'" 1 
ATOM   9815  O  "O3'" . DT  J 6  38  ? -9.300  -25.401 10.831 1.00 129.93 ? -35  DT  J "O3'" 1 
ATOM   9816  C  "C2'" . DT  J 6  38  ? -8.437  -25.659 8.630  1.00 122.92 ? -35  DT  J "C2'" 1 
ATOM   9817  C  "C1'" . DT  J 6  38  ? -9.368  -26.831 8.384  1.00 116.57 ? -35  DT  J "C1'" 1 
ATOM   9818  N  N1    . DT  J 6  38  ? -9.067  -27.650 7.191  1.00 122.02 ? -35  DT  J N1    1 
ATOM   9819  C  C2    . DT  J 6  38  ? -9.198  -29.018 7.297  1.00 125.04 ? -35  DT  J C2    1 
ATOM   9820  O  O2    . DT  J 6  38  ? -9.563  -29.576 8.318  1.00 117.90 ? -35  DT  J O2    1 
ATOM   9821  N  N3    . DT  J 6  38  ? -8.891  -29.713 6.153  1.00 129.84 ? -35  DT  J N3    1 
ATOM   9822  C  C4    . DT  J 6  38  ? -8.473  -29.188 4.944  1.00 128.81 ? -35  DT  J C4    1 
ATOM   9823  O  O4    . DT  J 6  38  ? -8.237  -29.938 4.001  1.00 118.96 ? -35  DT  J O4    1 
ATOM   9824  C  C5    . DT  J 6  38  ? -8.345  -27.747 4.908  1.00 128.93 ? -35  DT  J C5    1 
ATOM   9825  C  C7    . DT  J 6  38  ? -7.897  -27.087 3.642  1.00 130.92 ? -35  DT  J C7    1 
ATOM   9826  C  C6    . DT  J 6  38  ? -8.641  -27.061 6.019  1.00 130.74 ? -35  DT  J C6    1 
ATOM   9827  P  P     . DG  J 6  39  ? -8.481  -24.755 12.024 1.00 116.29 ? -34  DG  J P     1 
ATOM   9828  O  OP1   . DG  J 6  39  ? -9.201  -23.527 12.457 1.00 108.13 ? -34  DG  J OP1   1 
ATOM   9829  O  OP2   . DG  J 6  39  ? -7.043  -24.689 11.636 1.00 100.63 ? -34  DG  J OP2   1 
ATOM   9830  O  "O5'" . DG  J 6  39  ? -8.641  -25.875 13.136 1.00 106.61 ? -34  DG  J "O5'" 1 
ATOM   9831  C  "C5'" . DG  J 6  39  ? -9.831  -26.673 13.186 1.00 108.18 ? -34  DG  J "C5'" 1 
ATOM   9832  C  "C4'" . DG  J 6  39  ? -9.462  -28.113 13.438 1.00 106.97 ? -34  DG  J "C4'" 1 
ATOM   9833  O  "O4'" . DG  J 6  39  ? -8.987  -28.708 12.211 1.00 109.54 ? -34  DG  J "O4'" 1 
ATOM   9834  C  "C3'" . DG  J 6  39  ? -8.331  -28.279 14.450 1.00 117.24 ? -34  DG  J "C3'" 1 
ATOM   9835  O  "O3'" . DG  J 6  39  ? -8.558  -29.432 15.265 1.00 121.08 ? -34  DG  J "O3'" 1 
ATOM   9836  C  "C2'" . DG  J 6  39  ? -7.110  -28.469 13.573 1.00 123.37 ? -34  DG  J "C2'" 1 
ATOM   9837  C  "C1'" . DG  J 6  39  ? -7.702  -29.264 12.431 1.00 129.41 ? -34  DG  J "C1'" 1 
ATOM   9838  N  N9    . DG  J 6  39  ? -6.961  -29.205 11.176 1.00 157.43 ? -34  DG  J N9    1 
ATOM   9839  C  C8    . DG  J 6  39  ? -6.437  -28.093 10.560 1.00 168.58 ? -34  DG  J C8    1 
ATOM   9840  N  N7    . DG  J 6  39  ? -5.824  -28.369 9.440  1.00 168.06 ? -34  DG  J N7    1 
ATOM   9841  C  C5    . DG  J 6  39  ? -5.949  -29.746 9.311  1.00 168.75 ? -34  DG  J C5    1 
ATOM   9842  C  C6    . DG  J 6  39  ? -5.485  -30.619 8.295  1.00 166.08 ? -34  DG  J C6    1 
ATOM   9843  O  O6    . DG  J 6  39  ? -4.853  -30.341 7.269  1.00 162.32 ? -34  DG  J O6    1 
ATOM   9844  N  N1    . DG  J 6  39  ? -5.831  -31.941 8.560  1.00 166.18 ? -34  DG  J N1    1 
ATOM   9845  C  C2    . DG  J 6  39  ? -6.531  -32.369 9.661  1.00 157.85 ? -34  DG  J C2    1 
ATOM   9846  N  N2    . DG  J 6  39  ? -6.766  -33.687 9.740  1.00 162.30 ? -34  DG  J N2    1 
ATOM   9847  N  N3    . DG  J 6  39  ? -6.969  -31.565 10.615 1.00 150.61 ? -34  DG  J N3    1 
ATOM   9848  C  C4    . DG  J 6  39  ? -6.645  -30.276 10.377 1.00 162.71 ? -34  DG  J C4    1 
ATOM