data_5XFR
# 
_entry.id   5XFR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5XFR         
WWPDB D_1300002969 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5XFN PDB . 
unspecified 5XFO PDB . 
unspecified 5XFP PDB . 
unspecified 5XFQ PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5XFR 
_pdbx_database_status.recvd_initial_deposition_date   2017-04-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wang, Z.' 1 ? 
'Li, H.'   2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            549 
_citation.language                  ? 
_citation.page_first                287 
_citation.page_last                 291 
_citation.title                     'Polycomb-like proteins link the PRC2 complex to CpG islands' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature23881 
_citation.pdbx_database_id_PubMed   28869966 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, H.'        1  
primary 'Liefke, R.'    2  
primary 'Jiang, J.'     3  
primary 'Kurland, J.V.' 4  
primary 'Tian, W.'      5  
primary 'Deng, P.'      6  
primary 'Zhang, W.'     7  
primary 'He, Q.'        8  
primary 'Patel, D.J.'   9  
primary 'Bulyk, M.L.'   10 
primary 'Shi, Y.'       11 
primary 'Wang, Z.'      12 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5XFR 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     137.743 
_cell.length_a_esd                 ? 
_cell.length_b                     137.743 
_cell.length_b_esd                 ? 
_cell.length_c                     101.226 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5XFR 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Metal-response element-binding transcription factor 2' 36445.160 2   ? ? 'UNP residues 43-358' ? 
2 polymer     syn 'Peptide from Histone H3.1'                             924.145   2   ? ? ?                     ? 
3 polymer     syn 
;DNA (5'-D(*GP*GP*GP*CP*GP*GP*CP*CP*GP*CP*CP*CP*T)-3')
;
3969.561  2   ? ? ?                     ? 
4 non-polymer syn 'ZINC ION'                                              65.409    8   ? ? ?                     ? 
5 water       nat water                                                   18.015    331 ? ? ?                     ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Metal regulatory transcription factor 2,Metal-response element DNA-binding protein M96,Polycomb-like protein 2,hPCl2' 
2 
'Histone H3/a,Histone H3/b,Histone H3/c,Histone H3/d,Histone H3/f,Histone H3/h,Histone H3/i,Histone H3/j,Histone H3/k,Histone H3/l' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;SACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVI
CDKCGQGYHQLCHTPHIDCSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQ
CYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIH
KKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVA
;
;SACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVI
CDKCGQGYHQLCHTPHIDCSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQ
CYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIH
KKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVA
;
A,B ? 
2 'polypeptide(L)'        no yes 'GGV(M3L)KPHR' GGVKKPHR C,D ? 
3 polydeoxyribonucleotide no no  '(DG)(DG)(DG)(DC)(DG)(DG)(DC)(DC)(DG)(DC)(DC)(DC)(DT)' GGGCGGCCGCCCT E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   CYS n 
1 4   LYS n 
1 5   PHE n 
1 6   GLU n 
1 7   GLU n 
1 8   GLY n 
1 9   GLN n 
1 10  ASP n 
1 11  VAL n 
1 12  LEU n 
1 13  ALA n 
1 14  ARG n 
1 15  TRP n 
1 16  SER n 
1 17  ASP n 
1 18  GLY n 
1 19  LEU n 
1 20  PHE n 
1 21  TYR n 
1 22  LEU n 
1 23  GLY n 
1 24  THR n 
1 25  ILE n 
1 26  LYS n 
1 27  LYS n 
1 28  ILE n 
1 29  ASN n 
1 30  ILE n 
1 31  LEU n 
1 32  LYS n 
1 33  GLN n 
1 34  SER n 
1 35  CYS n 
1 36  PHE n 
1 37  ILE n 
1 38  ILE n 
1 39  PHE n 
1 40  GLU n 
1 41  ASP n 
1 42  SER n 
1 43  SER n 
1 44  LYS n 
1 45  SER n 
1 46  TRP n 
1 47  VAL n 
1 48  LEU n 
1 49  TRP n 
1 50  LYS n 
1 51  ASP n 
1 52  ILE n 
1 53  GLN n 
1 54  THR n 
1 55  GLY n 
1 56  ALA n 
1 57  THR n 
1 58  GLY n 
1 59  SER n 
1 60  GLY n 
1 61  GLU n 
1 62  MET n 
1 63  VAL n 
1 64  CYS n 
1 65  THR n 
1 66  ILE n 
1 67  CYS n 
1 68  GLN n 
1 69  GLU n 
1 70  GLU n 
1 71  TYR n 
1 72  SER n 
1 73  GLU n 
1 74  ALA n 
1 75  PRO n 
1 76  ASN n 
1 77  GLU n 
1 78  MET n 
1 79  VAL n 
1 80  ILE n 
1 81  CYS n 
1 82  ASP n 
1 83  LYS n 
1 84  CYS n 
1 85  GLY n 
1 86  GLN n 
1 87  GLY n 
1 88  TYR n 
1 89  HIS n 
1 90  GLN n 
1 91  LEU n 
1 92  CYS n 
1 93  HIS n 
1 94  THR n 
1 95  PRO n 
1 96  HIS n 
1 97  ILE n 
1 98  ASP n 
1 99  CYS n 
1 100 SER n 
1 101 VAL n 
1 102 ILE n 
1 103 ASP n 
1 104 SER n 
1 105 ASP n 
1 106 GLU n 
1 107 LYS n 
1 108 TRP n 
1 109 LEU n 
1 110 CYS n 
1 111 ARG n 
1 112 GLN n 
1 113 CYS n 
1 114 VAL n 
1 115 PHE n 
1 116 ALA n 
1 117 THR n 
1 118 THR n 
1 119 THR n 
1 120 LYS n 
1 121 ARG n 
1 122 GLY n 
1 123 GLY n 
1 124 ALA n 
1 125 LEU n 
1 126 LYS n 
1 127 LYS n 
1 128 GLY n 
1 129 PRO n 
1 130 ASN n 
1 131 ALA n 
1 132 LYS n 
1 133 ALA n 
1 134 LEU n 
1 135 GLN n 
1 136 VAL n 
1 137 MET n 
1 138 LYS n 
1 139 GLN n 
1 140 THR n 
1 141 LEU n 
1 142 PRO n 
1 143 TYR n 
1 144 SER n 
1 145 VAL n 
1 146 ALA n 
1 147 ASP n 
1 148 LEU n 
1 149 GLU n 
1 150 TRP n 
1 151 ASP n 
1 152 ALA n 
1 153 GLY n 
1 154 HIS n 
1 155 LYS n 
1 156 THR n 
1 157 ASN n 
1 158 VAL n 
1 159 GLN n 
1 160 GLN n 
1 161 CYS n 
1 162 TYR n 
1 163 CYS n 
1 164 TYR n 
1 165 CYS n 
1 166 GLY n 
1 167 GLY n 
1 168 PRO n 
1 169 GLY n 
1 170 ASP n 
1 171 TRP n 
1 172 TYR n 
1 173 LEU n 
1 174 LYS n 
1 175 MET n 
1 176 LEU n 
1 177 GLN n 
1 178 CYS n 
1 179 CYS n 
1 180 LYS n 
1 181 CYS n 
1 182 LYS n 
1 183 GLN n 
1 184 TRP n 
1 185 PHE n 
1 186 HIS n 
1 187 GLU n 
1 188 ALA n 
1 189 CYS n 
1 190 VAL n 
1 191 GLN n 
1 192 CYS n 
1 193 LEU n 
1 194 GLN n 
1 195 LYS n 
1 196 PRO n 
1 197 MET n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 ASP n 
1 202 ARG n 
1 203 PHE n 
1 204 TYR n 
1 205 THR n 
1 206 PHE n 
1 207 ILE n 
1 208 CYS n 
1 209 SER n 
1 210 VAL n 
1 211 CYS n 
1 212 SER n 
1 213 SER n 
1 214 GLY n 
1 215 PRO n 
1 216 GLU n 
1 217 TYR n 
1 218 LEU n 
1 219 LYS n 
1 220 ARG n 
1 221 LEU n 
1 222 PRO n 
1 223 LEU n 
1 224 GLN n 
1 225 TRP n 
1 226 VAL n 
1 227 ASP n 
1 228 ILE n 
1 229 ALA n 
1 230 HIS n 
1 231 LEU n 
1 232 CYS n 
1 233 LEU n 
1 234 TYR n 
1 235 ASN n 
1 236 LEU n 
1 237 SER n 
1 238 VAL n 
1 239 ILE n 
1 240 HIS n 
1 241 LYS n 
1 242 LYS n 
1 243 LYS n 
1 244 TYR n 
1 245 PHE n 
1 246 ASP n 
1 247 SER n 
1 248 GLU n 
1 249 LEU n 
1 250 GLU n 
1 251 LEU n 
1 252 MET n 
1 253 THR n 
1 254 TYR n 
1 255 ILE n 
1 256 ASN n 
1 257 GLU n 
1 258 ASN n 
1 259 TRP n 
1 260 ASP n 
1 261 ARG n 
1 262 LEU n 
1 263 HIS n 
1 264 PRO n 
1 265 GLY n 
1 266 GLU n 
1 267 LEU n 
1 268 ALA n 
1 269 ASP n 
1 270 THR n 
1 271 PRO n 
1 272 LYS n 
1 273 SER n 
1 274 GLU n 
1 275 ARG n 
1 276 TYR n 
1 277 GLU n 
1 278 HIS n 
1 279 VAL n 
1 280 LEU n 
1 281 GLU n 
1 282 ALA n 
1 283 LEU n 
1 284 ASN n 
1 285 ASP n 
1 286 TYR n 
1 287 LYS n 
1 288 THR n 
1 289 MET n 
1 290 PHE n 
1 291 MET n 
1 292 SER n 
1 293 GLY n 
1 294 LYS n 
1 295 GLU n 
1 296 ILE n 
1 297 LYS n 
1 298 LYS n 
1 299 LYS n 
1 300 LYS n 
1 301 HIS n 
1 302 LEU n 
1 303 PHE n 
1 304 GLY n 
1 305 LEU n 
1 306 ARG n 
1 307 ILE n 
1 308 ARG n 
1 309 VAL n 
1 310 PRO n 
1 311 PRO n 
1 312 VAL n 
1 313 PRO n 
1 314 PRO n 
1 315 ASN n 
1 316 VAL n 
1 317 ALA n 
2 1   GLY n 
2 2   GLY n 
2 3   VAL n 
2 4   M3L n 
2 5   LYS n 
2 6   PRO n 
2 7   HIS n 
2 8   ARG n 
3 1   DG  n 
3 2   DG  n 
3 3   DG  n 
3 4   DC  n 
3 5   DG  n 
3 6   DG  n 
3 7   DC  n 
3 8   DC  n 
3 9   DG  n 
3 10  DC  n 
3 11  DC  n 
3 12  DC  n 
3 13  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   317 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MTF2, PCL2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 8  'Homo sapiens'        Human 9606  ? 
3 1 sample 1 13 'synthetic construct' ?     32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MTF2_HUMAN Q9Y483 ? 1 
;ACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVIC
DKCGQGYHQLCHTPHIDCSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQC
YCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHK
KKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVA
;
43 
2 UNP H31_HUMAN  P68431 ? 2 GGVKKPHR 34 
3 PDB 5XFR       5XFR   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5XFR A 2 ? 317 ? Q9Y483 43 ? 358 ? 43 358 
2 1 5XFR B 2 ? 317 ? Q9Y483 43 ? 358 ? 43 358 
3 2 5XFR C 1 ? 8   ? P68431 34 ? 41  ? 33 40  
4 2 5XFR D 1 ? 8   ? P68431 34 ? 41  ? 33 40  
5 3 5XFR E 1 ? 13  ? 5XFR   1  ? 13  ? 1  13  
6 3 5XFR F 1 ? 13  ? 5XFR   1  ? 13  ? 1  13  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5XFR SER A 1 ? UNP Q9Y483 ? ? 'expression tag' 42 1 
2 5XFR SER B 1 ? UNP Q9Y483 ? ? 'expression tag' 42 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
M3L 'L-peptide linking' n N-TRIMETHYLLYSINE                    ? 'C9 H21 N2 O2 1'  189.275 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5XFR 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.35 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.32 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.1M MES monohydrate-pH 6.5, 0.2M ammonium sulfate, 25% PEG monomethyl ether 5000, 10% glycerol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-10-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97853 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL19U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97853 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL19U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5XFR 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.25 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       52840 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  16.9 
_reflns.pdbx_Rmerge_I_obs                0.124 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.25 
_reflns_shell.d_res_low                   2.30 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           3473 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.894 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             17.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5XFR 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.250 
_refine.ls_d_res_low                             46.593 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     52775 
_refine.ls_number_reflns_R_free                  2689 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_percent_reflns_R_free                 5.10 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2043 
_refine.ls_R_factor_R_free                       0.2309 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2029 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5XFN 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.05 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.24 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4979 
_refine_hist.pdbx_number_atoms_nucleic_acid   526 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             331 
_refine_hist.number_atoms_total               5844 
_refine_hist.d_res_high                       2.250 
_refine_hist.d_res_low                        46.593 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 5698 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.634  ? 7803 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 18.064 ? 2153 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.027  ? 827  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 889  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2498 2.2907  . . 152 2571 100.00 . . . 0.2373 . 0.2269 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2907 2.3347  . . 149 2618 100.00 . . . 0.3095 . 0.2328 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3347 2.3824  . . 151 2584 100.00 . . . 0.2644 . 0.2278 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3824 2.4342  . . 131 2590 100.00 . . . 0.2762 . 0.2349 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4342 2.4908  . . 116 2641 100.00 . . . 0.2703 . 0.2226 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4908 2.5531  . . 127 2661 100.00 . . . 0.2189 . 0.2348 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5531 2.6221  . . 147 2599 100.00 . . . 0.2932 . 0.2324 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6221 2.6993  . . 133 2629 100.00 . . . 0.2618 . 0.2266 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6993 2.7864  . . 146 2614 100.00 . . . 0.2643 . 0.2253 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7864 2.8859  . . 150 2620 100.00 . . . 0.2611 . 0.2250 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8859 3.0015  . . 132 2639 100.00 . . . 0.2902 . 0.2253 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0015 3.1381  . . 148 2625 100.00 . . . 0.2681 . 0.2325 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1381 3.3035  . . 125 2640 100.00 . . . 0.1992 . 0.2135 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3035 3.5104  . . 139 2662 100.00 . . . 0.2262 . 0.1998 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5104 3.7813  . . 143 2639 100.00 . . . 0.2157 . 0.1872 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7813 4.1616  . . 137 2673 100.00 . . . 0.2026 . 0.1766 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1616 4.7633  . . 162 2633 100.00 . . . 0.1961 . 0.1656 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7633 5.9992  . . 151 2699 100.00 . . . 0.2006 . 0.1913 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.9992 46.6026 . . 150 2749 99.00  . . . 0.2323 . 0.1903 . . . . . . . . . . 
# 
_struct.entry_id                     5XFR 
_struct.title                        'Ternary complex of MTF2, DNA and histone' 
_struct.pdbx_descriptor              'Metal-response element-binding transcription factor 2, Peptide from Histone H3.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5XFR 
_struct_keywords.text            'MTF2, PCL2, DNA, histone, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 110 ? THR A 119 ? CYS A 151 THR A 160 1 ? 10 
HELX_P HELX_P2  AA2 GLY A 128 ? LYS A 138 ? GLY A 169 LYS A 179 1 ? 11 
HELX_P HELX_P3  AA3 SER A 144 ? LEU A 148 ? SER A 185 LEU A 189 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 188 ? VAL A 190 ? ALA A 229 VAL A 231 5 ? 3  
HELX_P HELX_P5  AA5 CYS A 208 ? SER A 213 ? CYS A 249 SER A 254 1 ? 6  
HELX_P HELX_P6  AA6 GLN A 224 ? LYS A 241 ? GLN A 265 LYS A 282 1 ? 18 
HELX_P HELX_P7  AA7 GLU A 250 ? ASN A 258 ? GLU A 291 ASN A 299 1 ? 9  
HELX_P HELX_P8  AA8 ASN A 258 ? HIS A 263 ? ASN A 299 HIS A 304 1 ? 6  
HELX_P HELX_P9  AA9 GLY A 265 ? THR A 270 ? GLY A 306 THR A 311 5 ? 6  
HELX_P HELX_P10 AB1 PRO A 271 ? TYR A 286 ? PRO A 312 TYR A 327 1 ? 16 
HELX_P HELX_P11 AB2 LYS A 294 ? LYS A 297 ? LYS A 335 LYS A 338 5 ? 4  
HELX_P HELX_P12 AB3 CYS B 110 ? THR B 117 ? CYS B 151 THR B 158 1 ? 8  
HELX_P HELX_P13 AB4 GLY B 128 ? LYS B 138 ? GLY B 169 LYS B 179 1 ? 11 
HELX_P HELX_P14 AB5 SER B 144 ? LEU B 148 ? SER B 185 LEU B 189 5 ? 5  
HELX_P HELX_P15 AB6 ALA B 188 ? VAL B 190 ? ALA B 229 VAL B 231 5 ? 3  
HELX_P HELX_P16 AB7 CYS B 208 ? SER B 213 ? CYS B 249 SER B 254 1 ? 6  
HELX_P HELX_P17 AB8 GLN B 224 ? LYS B 241 ? GLN B 265 LYS B 282 1 ? 18 
HELX_P HELX_P18 AB9 GLU B 250 ? ASN B 258 ? GLU B 291 ASN B 299 1 ? 9  
HELX_P HELX_P19 AC1 ASN B 258 ? HIS B 263 ? ASN B 299 HIS B 304 1 ? 6  
HELX_P HELX_P20 AC2 PRO B 264 ? ALA B 268 ? PRO B 305 ALA B 309 5 ? 5  
HELX_P HELX_P21 AC3 PRO B 271 ? TYR B 286 ? PRO B 312 TYR B 327 1 ? 16 
HELX_P HELX_P22 AC4 LYS B 294 ? LYS B 297 ? LYS B 335 LYS B 338 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A CYS 64  SG  ? ? ? 1_555 G ZN  .  ZN ? ? A CYS 105 A ZN  401 1_555 ? ? ? ? ? ? ?            2.438 ? 
metalc2  metalc ?    ? A CYS 67  SG  ? ? ? 1_555 G ZN  .  ZN ? ? A CYS 108 A ZN  401 1_555 ? ? ? ? ? ? ?            2.447 ? 
metalc3  metalc ?    ? A CYS 81  SG  ? ? ? 1_555 H ZN  .  ZN ? ? A CYS 122 A ZN  402 1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc4  metalc ?    ? A CYS 84  SG  ? ? ? 1_555 H ZN  .  ZN ? ? A CYS 125 A ZN  402 1_555 ? ? ? ? ? ? ?            2.372 ? 
metalc5  metalc ?    ? A HIS 89  ND1 ? ? ? 1_555 G ZN  .  ZN ? ? A HIS 130 A ZN  401 1_555 ? ? ? ? ? ? ?            2.009 ? 
metalc6  metalc ?    ? A CYS 92  SG  ? ? ? 1_555 G ZN  .  ZN ? ? A CYS 133 A ZN  401 1_555 ? ? ? ? ? ? ?            2.398 ? 
metalc7  metalc ?    ? A CYS 110 SG  ? ? ? 1_555 H ZN  .  ZN ? ? A CYS 151 A ZN  402 1_555 ? ? ? ? ? ? ?            2.369 ? 
metalc8  metalc ?    ? A CYS 113 SG  ? ? ? 1_555 H ZN  .  ZN ? ? A CYS 154 A ZN  402 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc9  metalc ?    ? A CYS 163 SG  ? ? ? 1_555 J ZN  .  ZN ? ? A CYS 204 A ZN  404 1_555 ? ? ? ? ? ? ?            2.470 ? 
metalc10 metalc ?    ? A CYS 165 SG  ? ? ? 1_555 J ZN  .  ZN ? ? A CYS 206 A ZN  404 1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc11 metalc ?    ? A CYS 178 SG  ? ? ? 1_555 I ZN  .  ZN ? ? A CYS 219 A ZN  403 1_555 ? ? ? ? ? ? ?            2.421 ? 
metalc12 metalc ?    ? A CYS 181 SG  ? ? ? 1_555 I ZN  .  ZN ? ? A CYS 222 A ZN  403 1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc13 metalc ?    ? A HIS 186 ND1 ? ? ? 1_555 J ZN  .  ZN ? ? A HIS 227 A ZN  404 1_555 ? ? ? ? ? ? ?            2.150 ? 
metalc14 metalc ?    ? A CYS 189 SG  ? ? ? 1_555 J ZN  .  ZN ? ? A CYS 230 A ZN  404 1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc15 metalc ?    ? A CYS 208 SG  ? ? ? 1_555 I ZN  .  ZN ? ? A CYS 249 A ZN  403 1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc16 metalc ?    ? A CYS 211 SG  ? ? ? 1_555 I ZN  .  ZN ? ? A CYS 252 A ZN  403 1_555 ? ? ? ? ? ? ?            2.410 ? 
metalc17 metalc ?    ? B CYS 64  SG  ? ? ? 1_555 L ZN  .  ZN ? ? B CYS 105 B ZN  402 1_555 ? ? ? ? ? ? ?            2.898 ? 
metalc18 metalc ?    ? B CYS 81  SG  ? ? ? 1_555 K ZN  .  ZN ? ? B CYS 122 B ZN  401 1_555 ? ? ? ? ? ? ?            2.485 ? 
metalc19 metalc ?    ? B CYS 84  SG  ? ? ? 1_555 K ZN  .  ZN ? ? B CYS 125 B ZN  401 1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc20 metalc ?    ? B HIS 89  ND1 ? ? ? 1_555 L ZN  .  ZN ? ? B HIS 130 B ZN  402 1_555 ? ? ? ? ? ? ?            2.455 ? 
metalc21 metalc ?    ? B CYS 92  SG  ? ? ? 1_555 L ZN  .  ZN ? ? B CYS 133 B ZN  402 1_555 ? ? ? ? ? ? ?            2.465 ? 
metalc22 metalc ?    ? B CYS 110 SG  ? ? ? 1_555 K ZN  .  ZN ? ? B CYS 151 B ZN  401 1_555 ? ? ? ? ? ? ?            2.465 ? 
metalc23 metalc ?    ? B CYS 113 SG  ? ? ? 1_555 K ZN  .  ZN ? ? B CYS 154 B ZN  401 1_555 ? ? ? ? ? ? ?            2.424 ? 
metalc24 metalc ?    ? B CYS 163 SG  ? ? ? 1_555 M ZN  .  ZN ? ? B CYS 204 B ZN  403 1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc25 metalc ?    ? B CYS 165 SG  ? ? ? 1_555 M ZN  .  ZN ? ? B CYS 206 B ZN  403 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc26 metalc ?    ? B CYS 178 SG  ? ? ? 1_555 N ZN  .  ZN ? ? B CYS 219 B ZN  404 1_555 ? ? ? ? ? ? ?            2.366 ? 
metalc27 metalc ?    ? B CYS 181 SG  ? ? ? 1_555 N ZN  .  ZN ? ? B CYS 222 B ZN  404 1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc28 metalc ?    ? B HIS 186 ND1 ? ? ? 1_555 M ZN  .  ZN ? ? B HIS 227 B ZN  403 1_555 ? ? ? ? ? ? ?            2.170 ? 
metalc29 metalc ?    ? B CYS 189 SG  ? ? ? 1_555 M ZN  .  ZN ? ? B CYS 230 B ZN  403 1_555 ? ? ? ? ? ? ?            2.375 ? 
metalc30 metalc ?    ? B CYS 208 SG  ? ? ? 1_555 N ZN  .  ZN ? ? B CYS 249 B ZN  404 1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc31 metalc ?    ? B CYS 211 SG  ? ? ? 1_555 N ZN  .  ZN ? ? B CYS 252 B ZN  404 1_555 ? ? ? ? ? ? ?            2.331 ? 
covale1  covale both ? C M3L 4   C   ? ? ? 1_555 C LYS 5  N  ? ? C M3L 36  C LYS 37  1_555 ? ? ? ? ? ? ?            1.330 ? 
covale2  covale both ? D M3L 4   C   ? ? ? 1_555 D LYS 5  N  ? ? D M3L 36  D LYS 37  1_555 ? ? ? ? ? ? ?            1.329 ? 
hydrog1  hydrog ?    ? E DG  1   N1  ? ? ? 1_555 F DC  12 N3 ? ? E DG  1   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? E DG  1   N2  ? ? ? 1_555 F DC  12 O2 ? ? E DG  1   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? E DG  1   O6  ? ? ? 1_555 F DC  12 N4 ? ? E DG  1   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? E DG  2   N1  ? ? ? 1_555 F DC  11 N3 ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? E DG  2   N2  ? ? ? 1_555 F DC  11 O2 ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? E DG  2   O6  ? ? ? 1_555 F DC  11 N4 ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? E DG  3   N1  ? ? ? 1_555 F DC  10 N3 ? ? E DG  3   F DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? E DG  3   N2  ? ? ? 1_555 F DC  10 O2 ? ? E DG  3   F DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? E DG  3   O6  ? ? ? 1_555 F DC  10 N4 ? ? E DG  3   F DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? E DC  4   N3  ? ? ? 1_555 F DG  9  N1 ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? E DC  4   N4  ? ? ? 1_555 F DG  9  O6 ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? E DC  4   O2  ? ? ? 1_555 F DG  9  N2 ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? E DG  5   N1  ? ? ? 1_555 F DC  8  N3 ? ? E DG  5   F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? E DG  5   N2  ? ? ? 1_555 F DC  8  O2 ? ? E DG  5   F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? E DG  5   O6  ? ? ? 1_555 F DC  8  N4 ? ? E DG  5   F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? E DG  6   N1  ? ? ? 1_555 F DC  7  N3 ? ? E DG  6   F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? E DG  6   N2  ? ? ? 1_555 F DC  7  O2 ? ? E DG  6   F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? E DG  6   O6  ? ? ? 1_555 F DC  7  N4 ? ? E DG  6   F DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? E DC  7   N3  ? ? ? 1_555 F DG  6  N1 ? ? E DC  7   F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? E DC  7   N4  ? ? ? 1_555 F DG  6  O6 ? ? E DC  7   F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? E DC  7   O2  ? ? ? 1_555 F DG  6  N2 ? ? E DC  7   F DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? E DC  8   N3  ? ? ? 1_555 F DG  5  N1 ? ? E DC  8   F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? E DC  8   N4  ? ? ? 1_555 F DG  5  O6 ? ? E DC  8   F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? E DC  8   O2  ? ? ? 1_555 F DG  5  N2 ? ? E DC  8   F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? E DG  9   N1  ? ? ? 1_555 F DC  4  N3 ? ? E DG  9   F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? E DG  9   N2  ? ? ? 1_555 F DC  4  O2 ? ? E DG  9   F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? E DG  9   O6  ? ? ? 1_555 F DC  4  N4 ? ? E DG  9   F DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? E DC  10  N3  ? ? ? 1_555 F DG  3  N1 ? ? E DC  10  F DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? E DC  10  N4  ? ? ? 1_555 F DG  3  O6 ? ? E DC  10  F DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? E DC  10  O2  ? ? ? 1_555 F DG  3  N2 ? ? E DC  10  F DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? E DC  11  N3  ? ? ? 1_555 F DG  2  N1 ? ? E DC  11  F DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? E DC  11  N4  ? ? ? 1_555 F DG  2  O6 ? ? E DC  11  F DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? E DC  11  O2  ? ? ? 1_555 F DG  2  N2 ? ? E DC  11  F DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? E DC  12  N3  ? ? ? 1_555 F DG  1  N1 ? ? E DC  12  F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? E DC  12  N4  ? ? ? 1_555 F DG  1  O6 ? ? E DC  12  F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? E DC  12  O2  ? ? ? 1_555 F DG  1  N2 ? ? E DC  12  F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 74 A . ? ALA 115 A PRO 75 A ? PRO 116 A 1 1.93  
2 THR 94 A . ? THR 135 A PRO 95 A ? PRO 136 A 1 -0.07 
3 ALA 74 B . ? ALA 115 B PRO 75 B ? PRO 116 B 1 6.27  
4 THR 94 B . ? THR 135 B PRO 95 B ? PRO 136 B 1 2.06  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 3 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 44  ? LEU A 48  ? LYS A 85  LEU A 89  
AA1 2 SER A 34  ? PHE A 39  ? SER A 75  PHE A 80  
AA1 3 PHE A 20  ? ASN A 29  ? PHE A 61  ASN A 70  
AA1 4 ASP A 10  ? ARG A 14  ? ASP A 51  ARG A 55  
AA1 5 ILE A 52  ? THR A 54  ? ILE A 93  THR A 95  
AA2 1 MET A 78  ? ILE A 80  ? MET A 119 ILE A 121 
AA2 2 GLY A 87  ? HIS A 89  ? GLY A 128 HIS A 130 
AA3 1 MET A 175 ? GLN A 177 ? MET A 216 GLN A 218 
AA3 2 TRP A 184 ? HIS A 186 ? TRP A 225 HIS A 227 
AA4 1 TYR A 204 ? ILE A 207 ? TYR A 245 ILE A 248 
AA4 2 TYR A 217 ? ARG A 220 ? TYR A 258 ARG A 261 
AA5 1 PHE A 245 ? ASP A 246 ? PHE A 286 ASP A 287 
AA5 2 LEU A 302 ? LEU A 305 ? LEU A 343 LEU A 346 
AA5 3 PHE A 290 ? SER A 292 ? PHE A 331 SER A 333 
AA6 1 LYS B 44  ? LEU B 48  ? LYS B 85  LEU B 89  
AA6 2 SER B 34  ? PHE B 39  ? SER B 75  PHE B 80  
AA6 3 PHE B 20  ? ASN B 29  ? PHE B 61  ASN B 70  
AA6 4 ASP B 10  ? ARG B 14  ? ASP B 51  ARG B 55  
AA6 5 ILE B 52  ? GLN B 53  ? ILE B 93  GLN B 94  
AA7 1 MET B 78  ? ILE B 80  ? MET B 119 ILE B 121 
AA7 2 GLY B 87  ? HIS B 89  ? GLY B 128 HIS B 130 
AA8 1 MET B 175 ? GLN B 177 ? MET B 216 GLN B 218 
AA8 2 TRP B 184 ? HIS B 186 ? TRP B 225 HIS B 227 
AA9 1 TYR B 204 ? ILE B 207 ? TYR B 245 ILE B 248 
AA9 2 TYR B 217 ? ARG B 220 ? TYR B 258 ARG B 261 
AB1 1 PHE B 245 ? ASP B 246 ? PHE B 286 ASP B 287 
AB1 2 LEU B 302 ? LEU B 305 ? LEU B 343 LEU B 346 
AB1 3 PHE B 290 ? SER B 292 ? PHE B 331 SER B 333 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O SER A 45  ? O SER A 86  N ILE A 37  ? N ILE A 78  
AA1 2 3 O PHE A 36  ? O PHE A 77  N LYS A 26  ? N LYS A 67  
AA1 3 4 O TYR A 21  ? O TYR A 62  N ALA A 13  ? N ALA A 54  
AA1 4 5 N LEU A 12  ? N LEU A 53  O GLN A 53  ? O GLN A 94  
AA2 1 2 N VAL A 79  ? N VAL A 120 O TYR A 88  ? O TYR A 129 
AA3 1 2 N LEU A 176 ? N LEU A 217 O PHE A 185 ? O PHE A 226 
AA4 1 2 N ILE A 207 ? N ILE A 248 O TYR A 217 ? O TYR A 258 
AA5 1 2 N PHE A 245 ? N PHE A 286 O PHE A 303 ? O PHE A 344 
AA5 2 3 O GLY A 304 ? O GLY A 345 N MET A 291 ? N MET A 332 
AA6 1 2 O SER B 45  ? O SER B 86  N ILE B 37  ? N ILE B 78  
AA6 2 3 O PHE B 36  ? O PHE B 77  N LYS B 26  ? N LYS B 67  
AA6 3 4 O TYR B 21  ? O TYR B 62  N ALA B 13  ? N ALA B 54  
AA6 4 5 N LEU B 12  ? N LEU B 53  O GLN B 53  ? O GLN B 94  
AA7 1 2 N VAL B 79  ? N VAL B 120 O TYR B 88  ? O TYR B 129 
AA8 1 2 N LEU B 176 ? N LEU B 217 O PHE B 185 ? O PHE B 226 
AA9 1 2 N THR B 205 ? N THR B 246 O LYS B 219 ? O LYS B 260 
AB1 1 2 N PHE B 245 ? N PHE B 286 O PHE B 303 ? O PHE B 344 
AB1 2 3 O GLY B 304 ? O GLY B 345 N MET B 291 ? N MET B 332 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 401 ? 4 'binding site for residue ZN A 401' 
AC2 Software A ZN 402 ? 4 'binding site for residue ZN A 402' 
AC3 Software A ZN 403 ? 4 'binding site for residue ZN A 403' 
AC4 Software A ZN 404 ? 4 'binding site for residue ZN A 404' 
AC5 Software B ZN 401 ? 4 'binding site for residue ZN B 401' 
AC6 Software B ZN 402 ? 4 'binding site for residue ZN B 402' 
AC7 Software B ZN 403 ? 4 'binding site for residue ZN B 403' 
AC8 Software B ZN 404 ? 4 'binding site for residue ZN B 404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 64  ? CYS A 105 . ? 1_555 ? 
2  AC1 4 CYS A 67  ? CYS A 108 . ? 1_555 ? 
3  AC1 4 HIS A 89  ? HIS A 130 . ? 1_555 ? 
4  AC1 4 CYS A 92  ? CYS A 133 . ? 1_555 ? 
5  AC2 4 CYS A 81  ? CYS A 122 . ? 1_555 ? 
6  AC2 4 CYS A 84  ? CYS A 125 . ? 1_555 ? 
7  AC2 4 CYS A 110 ? CYS A 151 . ? 1_555 ? 
8  AC2 4 CYS A 113 ? CYS A 154 . ? 1_555 ? 
9  AC3 4 CYS A 178 ? CYS A 219 . ? 1_555 ? 
10 AC3 4 CYS A 181 ? CYS A 222 . ? 1_555 ? 
11 AC3 4 CYS A 208 ? CYS A 249 . ? 1_555 ? 
12 AC3 4 CYS A 211 ? CYS A 252 . ? 1_555 ? 
13 AC4 4 CYS A 163 ? CYS A 204 . ? 1_555 ? 
14 AC4 4 CYS A 165 ? CYS A 206 . ? 1_555 ? 
15 AC4 4 HIS A 186 ? HIS A 227 . ? 1_555 ? 
16 AC4 4 CYS A 189 ? CYS A 230 . ? 1_555 ? 
17 AC5 4 CYS B 81  ? CYS B 122 . ? 1_555 ? 
18 AC5 4 CYS B 84  ? CYS B 125 . ? 1_555 ? 
19 AC5 4 CYS B 110 ? CYS B 151 . ? 1_555 ? 
20 AC5 4 CYS B 113 ? CYS B 154 . ? 1_555 ? 
21 AC6 4 CYS B 64  ? CYS B 105 . ? 1_555 ? 
22 AC6 4 CYS B 67  ? CYS B 108 . ? 1_555 ? 
23 AC6 4 HIS B 89  ? HIS B 130 . ? 1_555 ? 
24 AC6 4 CYS B 92  ? CYS B 133 . ? 1_555 ? 
25 AC7 4 CYS B 163 ? CYS B 204 . ? 1_555 ? 
26 AC7 4 CYS B 165 ? CYS B 206 . ? 1_555 ? 
27 AC7 4 HIS B 186 ? HIS B 227 . ? 1_555 ? 
28 AC7 4 CYS B 189 ? CYS B 230 . ? 1_555 ? 
29 AC8 4 CYS B 178 ? CYS B 219 . ? 1_555 ? 
30 AC8 4 CYS B 181 ? CYS B 222 . ? 1_555 ? 
31 AC8 4 CYS B 208 ? CYS B 249 . ? 1_555 ? 
32 AC8 4 CYS B 211 ? CYS B 252 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5XFR 
_atom_sites.fract_transf_matrix[1][1]   0.007260 
_atom_sites.fract_transf_matrix[1][2]   0.004192 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008383 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009879 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . CYS A 1 3   ? 18.620  81.785  12.130  1.00 70.71  ? 44  CYS A N     1 
ATOM   2    C  CA    . CYS A 1 3   ? 19.007  81.507  10.752  1.00 70.32  ? 44  CYS A CA    1 
ATOM   3    C  C     . CYS A 1 3   ? 20.524  81.438  10.604  1.00 69.01  ? 44  CYS A C     1 
ATOM   4    O  O     . CYS A 1 3   ? 21.178  80.574  11.191  1.00 70.09  ? 44  CYS A O     1 
ATOM   5    C  CB    . CYS A 1 3   ? 18.435  82.570  9.811   1.00 68.12  ? 44  CYS A CB    1 
ATOM   6    S  SG    . CYS A 1 3   ? 16.628  82.630  9.761   1.00 85.49  ? 44  CYS A SG    1 
ATOM   7    N  N     . LYS A 1 4   ? 21.076  82.355  9.815   1.00 65.26  ? 45  LYS A N     1 
ATOM   8    C  CA    . LYS A 1 4   ? 22.515  82.412  9.579   1.00 59.95  ? 45  LYS A CA    1 
ATOM   9    C  C     . LYS A 1 4   ? 23.290  82.765  10.843  1.00 56.76  ? 45  LYS A C     1 
ATOM   10   O  O     . LYS A 1 4   ? 24.476  82.457  10.963  1.00 54.40  ? 45  LYS A O     1 
ATOM   11   C  CB    . LYS A 1 4   ? 22.838  83.439  8.489   1.00 60.43  ? 45  LYS A CB    1 
ATOM   12   C  CG    . LYS A 1 4   ? 22.244  83.141  7.121   1.00 60.99  ? 45  LYS A CG    1 
ATOM   13   C  CD    . LYS A 1 4   ? 22.333  84.365  6.217   1.00 62.42  ? 45  LYS A CD    1 
ATOM   14   C  CE    . LYS A 1 4   ? 23.732  84.971  6.238   1.00 61.60  ? 45  LYS A CE    1 
ATOM   15   N  NZ    . LYS A 1 4   ? 23.801  86.255  5.484   1.00 67.39  ? 45  LYS A NZ    1 
ATOM   16   N  N     . PHE A 1 5   ? 22.611  83.413  11.784  1.00 54.93  ? 46  PHE A N     1 
ATOM   17   C  CA    . PHE A 1 5   ? 23.281  84.031  12.922  1.00 51.97  ? 46  PHE A CA    1 
ATOM   18   C  C     . PHE A 1 5   ? 23.037  83.315  14.246  1.00 52.46  ? 46  PHE A C     1 
ATOM   19   O  O     . PHE A 1 5   ? 22.050  82.598  14.409  1.00 57.69  ? 46  PHE A O     1 
ATOM   20   C  CB    . PHE A 1 5   ? 22.835  85.489  13.050  1.00 56.04  ? 46  PHE A CB    1 
ATOM   21   C  CG    . PHE A 1 5   ? 22.587  86.165  11.732  1.00 54.11  ? 46  PHE A CG    1 
ATOM   22   C  CD1   . PHE A 1 5   ? 23.642  86.633  10.969  1.00 50.32  ? 46  PHE A CD1   1 
ATOM   23   C  CD2   . PHE A 1 5   ? 21.296  86.334  11.258  1.00 52.03  ? 46  PHE A CD2   1 
ATOM   24   C  CE1   . PHE A 1 5   ? 23.415  87.256  9.755   1.00 50.11  ? 46  PHE A CE1   1 
ATOM   25   C  CE2   . PHE A 1 5   ? 21.063  86.957  10.046  1.00 52.47  ? 46  PHE A CE2   1 
ATOM   26   C  CZ    . PHE A 1 5   ? 22.124  87.419  9.294   1.00 48.65  ? 46  PHE A CZ    1 
ATOM   27   N  N     . GLU A 1 6   ? 23.952  83.523  15.187  1.00 47.53  ? 47  GLU A N     1 
ATOM   28   C  CA    . GLU A 1 6   ? 23.783  83.063  16.559  1.00 51.09  ? 47  GLU A CA    1 
ATOM   29   C  C     . GLU A 1 6   ? 24.430  84.076  17.495  1.00 46.55  ? 47  GLU A C     1 
ATOM   30   O  O     . GLU A 1 6   ? 25.303  84.837  17.081  1.00 40.83  ? 47  GLU A O     1 
ATOM   31   C  CB    . GLU A 1 6   ? 24.392  81.675  16.758  1.00 53.33  ? 47  GLU A CB    1 
ATOM   32   C  CG    . GLU A 1 6   ? 25.906  81.639  16.646  1.00 57.37  ? 47  GLU A CG    1 
ATOM   33   C  CD    . GLU A 1 6   ? 26.454  80.226  16.663  1.00 64.30  ? 47  GLU A CD    1 
ATOM   34   O  OE1   . GLU A 1 6   ? 25.712  79.296  16.279  1.00 66.16  ? 47  GLU A OE1   1 
ATOM   35   O  OE2   . GLU A 1 6   ? 27.624  80.044  17.063  1.00 61.75  ? 47  GLU A OE2   1 
ATOM   36   N  N     . GLU A 1 7   ? 23.996  84.089  18.750  1.00 45.87  ? 48  GLU A N     1 
ATOM   37   C  CA    . GLU A 1 7   ? 24.506  85.051  19.720  1.00 45.16  ? 48  GLU A CA    1 
ATOM   38   C  C     . GLU A 1 7   ? 26.004  84.877  19.954  1.00 45.47  ? 48  GLU A C     1 
ATOM   39   O  O     . GLU A 1 7   ? 26.522  83.761  19.927  1.00 40.57  ? 48  GLU A O     1 
ATOM   40   C  CB    . GLU A 1 7   ? 23.741  84.925  21.038  1.00 45.86  ? 48  GLU A CB    1 
ATOM   41   C  CG    . GLU A 1 7   ? 22.266  85.281  20.916  1.00 53.61  ? 48  GLU A CG    1 
ATOM   42   C  CD    . GLU A 1 7   ? 21.430  84.735  22.059  1.00 64.32  ? 48  GLU A CD    1 
ATOM   43   O  OE1   . GLU A 1 7   ? 21.829  83.713  22.656  1.00 65.59  ? 48  GLU A OE1   1 
ATOM   44   O  OE2   . GLU A 1 7   ? 20.371  85.328  22.361  1.00 64.96  ? 48  GLU A OE2   1 
ATOM   45   N  N     . GLY A 1 8   ? 26.697  85.992  20.167  1.00 45.52  ? 49  GLY A N     1 
ATOM   46   C  CA    . GLY A 1 8   ? 28.129  85.972  20.404  1.00 41.91  ? 49  GLY A CA    1 
ATOM   47   C  C     . GLY A 1 8   ? 28.950  86.036  19.130  1.00 44.83  ? 49  GLY A C     1 
ATOM   48   O  O     . GLY A 1 8   ? 30.172  86.180  19.177  1.00 46.08  ? 49  GLY A O     1 
ATOM   49   N  N     . GLN A 1 9   ? 28.278  85.928  17.988  1.00 43.83  ? 50  GLN A N     1 
ATOM   50   C  CA    . GLN A 1 9   ? 28.946  85.975  16.691  1.00 44.13  ? 50  GLN A CA    1 
ATOM   51   C  C     . GLN A 1 9   ? 29.382  87.395  16.337  1.00 42.51  ? 50  GLN A C     1 
ATOM   52   O  O     . GLN A 1 9   ? 28.602  88.340  16.457  1.00 44.37  ? 50  GLN A O     1 
ATOM   53   C  CB    . GLN A 1 9   ? 28.025  85.418  15.602  1.00 42.24  ? 50  GLN A CB    1 
ATOM   54   C  CG    . GLN A 1 9   ? 28.628  85.394  14.210  1.00 40.13  ? 50  GLN A CG    1 
ATOM   55   C  CD    . GLN A 1 9   ? 27.678  84.808  13.181  1.00 46.39  ? 50  GLN A CD    1 
ATOM   56   O  OE1   . GLN A 1 9   ? 26.565  84.397  13.509  1.00 45.74  ? 50  GLN A OE1   1 
ATOM   57   N  NE2   . GLN A 1 9   ? 28.115  84.768  11.927  1.00 43.79  ? 50  GLN A NE2   1 
ATOM   58   N  N     . ASP A 1 10  ? 30.633  87.541  15.910  1.00 45.33  ? 51  ASP A N     1 
ATOM   59   C  CA    . ASP A 1 10  ? 31.144  88.839  15.485  1.00 39.69  ? 51  ASP A CA    1 
ATOM   60   C  C     . ASP A 1 10  ? 30.807  89.079  14.020  1.00 44.44  ? 51  ASP A C     1 
ATOM   61   O  O     . ASP A 1 10  ? 31.093  88.241  13.165  1.00 42.46  ? 51  ASP A O     1 
ATOM   62   C  CB    . ASP A 1 10  ? 32.655  88.931  15.705  1.00 42.52  ? 51  ASP A CB    1 
ATOM   63   C  CG    . ASP A 1 10  ? 33.024  89.040  17.172  1.00 45.93  ? 51  ASP A CG    1 
ATOM   64   O  OD1   . ASP A 1 10  ? 32.177  89.496  17.968  1.00 43.69  ? 51  ASP A OD1   1 
ATOM   65   O  OD2   . ASP A 1 10  ? 34.165  88.675  17.526  1.00 50.81  ? 51  ASP A OD2   1 
ATOM   66   N  N     . VAL A 1 11  ? 30.192  90.223  13.737  1.00 39.89  ? 52  VAL A N     1 
ATOM   67   C  CA    . VAL A 1 11  ? 29.735  90.528  12.386  1.00 36.43  ? 52  VAL A CA    1 
ATOM   68   C  C     . VAL A 1 11  ? 30.049  91.960  11.964  1.00 36.53  ? 52  VAL A C     1 
ATOM   69   O  O     . VAL A 1 11  ? 30.455  92.791  12.778  1.00 42.50  ? 52  VAL A O     1 
ATOM   70   C  CB    . VAL A 1 11  ? 28.213  90.314  12.248  1.00 35.31  ? 52  VAL A CB    1 
ATOM   71   C  CG1   . VAL A 1 11  ? 27.852  88.847  12.426  1.00 37.29  ? 52  VAL A CG1   1 
ATOM   72   C  CG2   . VAL A 1 11  ? 27.464  91.183  13.250  1.00 33.55  ? 52  VAL A CG2   1 
ATOM   73   N  N     . LEU A 1 12  ? 29.859  92.235  10.677  1.00 42.09  ? 53  LEU A N     1 
ATOM   74   C  CA    . LEU A 1 12  ? 29.886  93.597  10.162  1.00 29.08  ? 53  LEU A CA    1 
ATOM   75   C  C     . LEU A 1 12  ? 28.453  94.086  9.996   1.00 34.88  ? 53  LEU A C     1 
ATOM   76   O  O     . LEU A 1 12  ? 27.675  93.494  9.248   1.00 32.37  ? 53  LEU A O     1 
ATOM   77   C  CB    . LEU A 1 12  ? 30.633  93.671  8.828   1.00 36.20  ? 53  LEU A CB    1 
ATOM   78   C  CG    . LEU A 1 12  ? 32.152  93.502  8.852   1.00 43.38  ? 53  LEU A CG    1 
ATOM   79   C  CD1   . LEU A 1 12  ? 32.724  93.614  7.446   1.00 34.85  ? 53  LEU A CD1   1 
ATOM   80   C  CD2   . LEU A 1 12  ? 32.784  94.531  9.773   1.00 33.99  ? 53  LEU A CD2   1 
ATOM   81   N  N     . ALA A 1 13  ? 28.101  95.158  10.698  1.00 36.17  ? 54  ALA A N     1 
ATOM   82   C  CA    . ALA A 1 13  ? 26.737  95.676  10.648  1.00 33.27  ? 54  ALA A CA    1 
ATOM   83   C  C     . ALA A 1 13  ? 26.676  97.038  9.965   1.00 34.20  ? 54  ALA A C     1 
ATOM   84   O  O     . ALA A 1 13  ? 27.415  97.958  10.318  1.00 34.27  ? 54  ALA A O     1 
ATOM   85   C  CB    . ALA A 1 13  ? 26.152  95.761  12.049  1.00 24.67  ? 54  ALA A CB    1 
ATOM   86   N  N     . ARG A 1 14  ? 25.784  97.157  8.987   1.00 32.23  ? 55  ARG A N     1 
ATOM   87   C  CA    . ARG A 1 14  ? 25.627  98.393  8.235   1.00 30.94  ? 55  ARG A CA    1 
ATOM   88   C  C     . ARG A 1 14  ? 24.706  99.367  8.962   1.00 30.32  ? 55  ARG A C     1 
ATOM   89   O  O     . ARG A 1 14  ? 23.541  99.064  9.217   1.00 30.90  ? 55  ARG A O     1 
ATOM   90   C  CB    . ARG A 1 14  ? 25.084  98.103  6.836   1.00 30.11  ? 55  ARG A CB    1 
ATOM   91   C  CG    . ARG A 1 14  ? 24.962  99.335  5.958   1.00 31.30  ? 55  ARG A CG    1 
ATOM   92   C  CD    . ARG A 1 14  ? 24.115  99.051  4.730   1.00 32.95  ? 55  ARG A CD    1 
ATOM   93   N  NE    . ARG A 1 14  ? 24.854  98.381  3.664   1.00 38.01  ? 55  ARG A NE    1 
ATOM   94   C  CZ    . ARG A 1 14  ? 24.349  97.420  2.897   1.00 37.23  ? 55  ARG A CZ    1 
ATOM   95   N  NH1   . ARG A 1 14  ? 23.101  97.005  3.085   1.00 32.13  ? 55  ARG A NH1   1 
ATOM   96   N  NH2   . ARG A 1 14  ? 25.094  96.869  1.947   1.00 42.56  ? 55  ARG A NH2   1 
ATOM   97   N  N     . TRP A 1 15  ? 25.243  100.537 9.292   1.00 24.25  ? 56  TRP A N     1 
ATOM   98   C  CA    . TRP A 1 15  ? 24.485  101.580 9.974   1.00 26.92  ? 56  TRP A CA    1 
ATOM   99   C  C     . TRP A 1 15  ? 23.705  102.428 8.965   1.00 29.37  ? 56  TRP A C     1 
ATOM   100  O  O     . TRP A 1 15  ? 23.842  102.249 7.753   1.00 22.73  ? 56  TRP A O     1 
ATOM   101  C  CB    . TRP A 1 15  ? 25.434  102.448 10.810  1.00 26.84  ? 56  TRP A CB    1 
ATOM   102  C  CG    . TRP A 1 15  ? 24.760  103.437 11.711  1.00 29.98  ? 56  TRP A CG    1 
ATOM   103  C  CD1   . TRP A 1 15  ? 24.861  104.796 11.652  1.00 33.31  ? 56  TRP A CD1   1 
ATOM   104  C  CD2   . TRP A 1 15  ? 23.874  103.147 12.799  1.00 33.24  ? 56  TRP A CD2   1 
ATOM   105  N  NE1   . TRP A 1 15  ? 24.099  105.371 12.638  1.00 35.53  ? 56  TRP A NE1   1 
ATOM   106  C  CE2   . TRP A 1 15  ? 23.482  104.381 13.357  1.00 34.29  ? 56  TRP A CE2   1 
ATOM   107  C  CE3   . TRP A 1 15  ? 23.376  101.966 13.358  1.00 34.76  ? 56  TRP A CE3   1 
ATOM   108  C  CZ2   . TRP A 1 15  ? 22.614  104.467 14.443  1.00 38.50  ? 56  TRP A CZ2   1 
ATOM   109  C  CZ3   . TRP A 1 15  ? 22.515  102.054 14.438  1.00 39.22  ? 56  TRP A CZ3   1 
ATOM   110  C  CH2   . TRP A 1 15  ? 22.143  103.296 14.969  1.00 43.25  ? 56  TRP A CH2   1 
ATOM   111  N  N     . SER A 1 16  ? 22.893  103.356 9.463   1.00 27.84  ? 57  SER A N     1 
ATOM   112  C  CA    . SER A 1 16  ? 22.052  104.186 8.606   1.00 27.03  ? 57  SER A CA    1 
ATOM   113  C  C     . SER A 1 16  ? 22.841  105.260 7.850   1.00 29.15  ? 57  SER A C     1 
ATOM   114  O  O     . SER A 1 16  ? 22.254  106.135 7.212   1.00 25.64  ? 57  SER A O     1 
ATOM   115  C  CB    . SER A 1 16  ? 20.945  104.841 9.434   1.00 25.18  ? 57  SER A CB    1 
ATOM   116  O  OG    . SER A 1 16  ? 21.483  105.521 10.553  1.00 31.66  ? 57  SER A OG    1 
ATOM   117  N  N     . ASP A 1 17  ? 24.167  105.196 7.928   1.00 25.95  ? 58  ASP A N     1 
ATOM   118  C  CA    . ASP A 1 17  ? 25.018  106.086 7.148   1.00 21.37  ? 58  ASP A CA    1 
ATOM   119  C  C     . ASP A 1 17  ? 25.575  105.355 5.928   1.00 21.83  ? 58  ASP A C     1 
ATOM   120  O  O     . ASP A 1 17  ? 26.327  105.926 5.138   1.00 20.71  ? 58  ASP A O     1 
ATOM   121  C  CB    . ASP A 1 17  ? 26.159  106.645 8.005   1.00 23.98  ? 58  ASP A CB    1 
ATOM   122  C  CG    . ASP A 1 17  ? 26.974  105.556 8.686   1.00 29.85  ? 58  ASP A CG    1 
ATOM   123  O  OD1   . ASP A 1 17  ? 26.739  104.360 8.413   1.00 26.23  ? 58  ASP A OD1   1 
ATOM   124  O  OD2   . ASP A 1 17  ? 27.862  105.901 9.495   1.00 30.47  ? 58  ASP A OD2   1 
ATOM   125  N  N     . GLY A 1 18  ? 25.200  104.087 5.788   1.00 25.17  ? 59  GLY A N     1 
ATOM   126  C  CA    . GLY A 1 18  ? 25.638  103.271 4.669   1.00 22.14  ? 59  GLY A CA    1 
ATOM   127  C  C     . GLY A 1 18  ? 26.960  102.571 4.920   1.00 24.32  ? 59  GLY A C     1 
ATOM   128  O  O     . GLY A 1 18  ? 27.458  101.840 4.063   1.00 28.60  ? 59  GLY A O     1 
ATOM   129  N  N     . LEU A 1 19  ? 27.530  102.789 6.100   1.00 27.16  ? 60  LEU A N     1 
ATOM   130  C  CA    . LEU A 1 19  ? 28.833  102.226 6.432   1.00 33.51  ? 60  LEU A CA    1 
ATOM   131  C  C     . LEU A 1 19  ? 28.709  101.010 7.343   1.00 29.35  ? 60  LEU A C     1 
ATOM   132  O  O     . LEU A 1 19  ? 27.823  100.950 8.195   1.00 26.45  ? 60  LEU A O     1 
ATOM   133  C  CB    . LEU A 1 19  ? 29.714  103.285 7.095   1.00 29.25  ? 60  LEU A CB    1 
ATOM   134  C  CG    . LEU A 1 19  ? 30.069  104.495 6.231   1.00 30.45  ? 60  LEU A CG    1 
ATOM   135  C  CD1   . LEU A 1 19  ? 30.825  105.533 7.044   1.00 29.59  ? 60  LEU A CD1   1 
ATOM   136  C  CD2   . LEU A 1 19  ? 30.884  104.055 5.029   1.00 27.60  ? 60  LEU A CD2   1 
ATOM   137  N  N     . PHE A 1 20  ? 29.604  100.046 7.153   1.00 32.73  ? 61  PHE A N     1 
ATOM   138  C  CA    . PHE A 1 20  ? 29.634  98.847  7.982   1.00 32.71  ? 61  PHE A CA    1 
ATOM   139  C  C     . PHE A 1 20  ? 30.489  99.058  9.229   1.00 39.70  ? 61  PHE A C     1 
ATOM   140  O  O     . PHE A 1 20  ? 31.548  99.683  9.170   1.00 42.01  ? 61  PHE A O     1 
ATOM   141  C  CB    . PHE A 1 20  ? 30.162  97.653  7.181   1.00 32.33  ? 61  PHE A CB    1 
ATOM   142  C  CG    . PHE A 1 20  ? 29.139  97.028  6.276   1.00 29.63  ? 61  PHE A CG    1 
ATOM   143  C  CD1   . PHE A 1 20  ? 28.260  96.075  6.763   1.00 32.42  ? 61  PHE A CD1   1 
ATOM   144  C  CD2   . PHE A 1 20  ? 29.059  97.387  4.940   1.00 35.90  ? 61  PHE A CD2   1 
ATOM   145  C  CE1   . PHE A 1 20  ? 27.316  95.494  5.938   1.00 34.71  ? 61  PHE A CE1   1 
ATOM   146  C  CE2   . PHE A 1 20  ? 28.116  96.809  4.108   1.00 38.05  ? 61  PHE A CE2   1 
ATOM   147  C  CZ    . PHE A 1 20  ? 27.243  95.862  4.608   1.00 32.10  ? 61  PHE A CZ    1 
ATOM   148  N  N     . TYR A 1 21  ? 30.021  98.532  10.357  1.00 36.28  ? 62  TYR A N     1 
ATOM   149  C  CA    . TYR A 1 21  ? 30.748  98.636  11.619  1.00 36.98  ? 62  TYR A CA    1 
ATOM   150  C  C     . TYR A 1 21  ? 30.886  97.265  12.267  1.00 39.92  ? 62  TYR A C     1 
ATOM   151  O  O     . TYR A 1 21  ? 29.994  96.423  12.148  1.00 31.36  ? 62  TYR A O     1 
ATOM   152  C  CB    . TYR A 1 21  ? 30.042  99.597  12.579  1.00 37.62  ? 62  TYR A CB    1 
ATOM   153  C  CG    . TYR A 1 21  ? 29.984  101.029 12.099  1.00 44.21  ? 62  TYR A CG    1 
ATOM   154  C  CD1   . TYR A 1 21  ? 29.009  101.441 11.201  1.00 36.40  ? 62  TYR A CD1   1 
ATOM   155  C  CD2   . TYR A 1 21  ? 30.899  101.972 12.551  1.00 48.15  ? 62  TYR A CD2   1 
ATOM   156  C  CE1   . TYR A 1 21  ? 28.951  102.748 10.759  1.00 39.09  ? 62  TYR A CE1   1 
ATOM   157  C  CE2   . TYR A 1 21  ? 30.848  103.283 12.116  1.00 52.07  ? 62  TYR A CE2   1 
ATOM   158  C  CZ    . TYR A 1 21  ? 29.872  103.665 11.220  1.00 45.05  ? 62  TYR A CZ    1 
ATOM   159  O  OH    . TYR A 1 21  ? 29.815  104.968 10.783  1.00 37.13  ? 62  TYR A OH    1 
ATOM   160  N  N     . LEU A 1 22  ? 32.002  97.045  12.954  1.00 39.71  ? 63  LEU A N     1 
ATOM   161  C  CA    . LEU A 1 22  ? 32.223  95.787  13.656  1.00 42.12  ? 63  LEU A CA    1 
ATOM   162  C  C     . LEU A 1 22  ? 31.336  95.710  14.891  1.00 37.11  ? 63  LEU A C     1 
ATOM   163  O  O     . LEU A 1 22  ? 31.258  96.658  15.673  1.00 41.85  ? 63  LEU A O     1 
ATOM   164  C  CB    . LEU A 1 22  ? 33.692  95.630  14.052  1.00 42.99  ? 63  LEU A CB    1 
ATOM   165  C  CG    . LEU A 1 22  ? 34.041  94.313  14.749  1.00 47.20  ? 63  LEU A CG    1 
ATOM   166  C  CD1   . LEU A 1 22  ? 33.846  93.130  13.808  1.00 46.32  ? 63  LEU A CD1   1 
ATOM   167  C  CD2   . LEU A 1 22  ? 35.461  94.342  15.297  1.00 46.14  ? 63  LEU A CD2   1 
ATOM   168  N  N     . GLY A 1 23  ? 30.664  94.578  15.060  1.00 36.64  ? 64  GLY A N     1 
ATOM   169  C  CA    . GLY A 1 23  ? 29.764  94.403  16.182  1.00 37.09  ? 64  GLY A CA    1 
ATOM   170  C  C     . GLY A 1 23  ? 29.560  92.949  16.550  1.00 37.25  ? 64  GLY A C     1 
ATOM   171  O  O     . GLY A 1 23  ? 29.948  92.047  15.806  1.00 37.52  ? 64  GLY A O     1 
ATOM   172  N  N     . THR A 1 24  ? 28.947  92.723  17.706  1.00 38.63  ? 65  THR A N     1 
ATOM   173  C  CA    . THR A 1 24  ? 28.678  91.372  18.178  1.00 37.88  ? 65  THR A CA    1 
ATOM   174  C  C     . THR A 1 24  ? 27.192  91.201  18.478  1.00 35.61  ? 65  THR A C     1 
ATOM   175  O  O     . THR A 1 24  ? 26.577  92.045  19.132  1.00 39.13  ? 65  THR A O     1 
ATOM   176  C  CB    . THR A 1 24  ? 29.502  91.037  19.438  1.00 42.38  ? 65  THR A CB    1 
ATOM   177  O  OG1   . THR A 1 24  ? 30.888  91.309  19.197  1.00 39.96  ? 65  THR A OG1   1 
ATOM   178  C  CG2   . THR A 1 24  ? 29.336  89.571  19.812  1.00 41.48  ? 65  THR A CG2   1 
ATOM   179  N  N     . ILE A 1 25  ? 26.623  90.106  17.987  1.00 35.31  ? 66  ILE A N     1 
ATOM   180  C  CA    . ILE A 1 25  ? 25.208  89.819  18.173  1.00 36.46  ? 66  ILE A CA    1 
ATOM   181  C  C     . ILE A 1 25  ? 24.908  89.386  19.604  1.00 43.89  ? 66  ILE A C     1 
ATOM   182  O  O     . ILE A 1 25  ? 25.508  88.439  20.114  1.00 44.89  ? 66  ILE A O     1 
ATOM   183  C  CB    . ILE A 1 25  ? 24.733  88.720  17.207  1.00 38.80  ? 66  ILE A CB    1 
ATOM   184  C  CG1   . ILE A 1 25  ? 25.026  89.120  15.759  1.00 37.07  ? 66  ILE A CG1   1 
ATOM   185  C  CG2   . ILE A 1 25  ? 23.251  88.438  17.407  1.00 38.46  ? 66  ILE A CG2   1 
ATOM   186  C  CD1   . ILE A 1 25  ? 24.676  88.055  14.752  1.00 36.33  ? 66  ILE A CD1   1 
ATOM   187  N  N     . LYS A 1 26  ? 23.977  90.084  20.247  1.00 43.08  ? 67  LYS A N     1 
ATOM   188  C  CA    . LYS A 1 26  ? 23.584  89.764  21.614  1.00 43.74  ? 67  LYS A CA    1 
ATOM   189  C  C     . LYS A 1 26  ? 22.214  89.093  21.653  1.00 49.29  ? 67  LYS A C     1 
ATOM   190  O  O     . LYS A 1 26  ? 21.970  88.205  22.469  1.00 53.93  ? 67  LYS A O     1 
ATOM   191  C  CB    . LYS A 1 26  ? 23.579  91.026  22.477  1.00 44.06  ? 67  LYS A CB    1 
ATOM   192  C  CG    . LYS A 1 26  ? 24.933  91.711  22.580  1.00 43.95  ? 67  LYS A CG    1 
ATOM   193  C  CD    . LYS A 1 26  ? 25.918  90.893  23.403  1.00 56.53  ? 67  LYS A CD    1 
ATOM   194  C  CE    . LYS A 1 26  ? 25.478  90.790  24.857  1.00 64.67  ? 67  LYS A CE    1 
ATOM   195  N  NZ    . LYS A 1 26  ? 26.479  90.069  25.692  1.00 70.13  ? 67  LYS A NZ    1 
ATOM   196  N  N     . LYS A 1 27  ? 21.322  89.527  20.768  1.00 45.17  ? 68  LYS A N     1 
ATOM   197  C  CA    . LYS A 1 27  ? 19.994  88.933  20.657  1.00 44.06  ? 68  LYS A CA    1 
ATOM   198  C  C     . LYS A 1 27  ? 19.601  88.732  19.199  1.00 46.53  ? 68  LYS A C     1 
ATOM   199  O  O     . LYS A 1 27  ? 20.144  89.380  18.303  1.00 43.04  ? 68  LYS A O     1 
ATOM   200  C  CB    . LYS A 1 27  ? 18.944  89.802  21.352  1.00 44.40  ? 68  LYS A CB    1 
ATOM   201  C  CG    . LYS A 1 27  ? 19.082  89.899  22.860  1.00 50.98  ? 68  LYS A CG    1 
ATOM   202  C  CD    . LYS A 1 27  ? 17.923  90.690  23.444  1.00 54.19  ? 68  LYS A CD    1 
ATOM   203  C  CE    . LYS A 1 27  ? 18.124  90.977  24.922  1.00 57.20  ? 68  LYS A CE    1 
ATOM   204  N  NZ    . LYS A 1 27  ? 17.032  91.841  25.453  1.00 55.55  ? 68  LYS A NZ    1 
ATOM   205  N  N     . ILE A 1 28  ? 18.650  87.833  18.971  1.00 44.04  ? 69  ILE A N     1 
ATOM   206  C  CA    . ILE A 1 28  ? 18.118  87.593  17.636  1.00 40.52  ? 69  ILE A CA    1 
ATOM   207  C  C     . ILE A 1 28  ? 16.595  87.650  17.655  1.00 45.84  ? 69  ILE A C     1 
ATOM   208  O  O     . ILE A 1 28  ? 15.954  87.068  18.530  1.00 47.73  ? 69  ILE A O     1 
ATOM   209  C  CB    . ILE A 1 28  ? 18.566  86.228  17.076  1.00 42.65  ? 69  ILE A CB    1 
ATOM   210  C  CG1   . ILE A 1 28  ? 20.091  86.129  17.052  1.00 48.95  ? 69  ILE A CG1   1 
ATOM   211  C  CG2   . ILE A 1 28  ? 18.002  86.011  15.680  1.00 37.28  ? 69  ILE A CG2   1 
ATOM   212  C  CD1   . ILE A 1 28  ? 20.604  84.839  16.455  1.00 43.39  ? 69  ILE A CD1   1 
ATOM   213  N  N     . ASN A 1 29  ? 16.018  88.358  16.690  1.00 40.61  ? 70  ASN A N     1 
ATOM   214  C  CA    . ASN A 1 29  ? 14.570  88.430  16.563  1.00 38.41  ? 70  ASN A CA    1 
ATOM   215  C  C     . ASN A 1 29  ? 14.121  87.878  15.215  1.00 42.93  ? 70  ASN A C     1 
ATOM   216  O  O     . ASN A 1 29  ? 14.309  88.513  14.178  1.00 37.92  ? 70  ASN A O     1 
ATOM   217  C  CB    . ASN A 1 29  ? 14.087  89.871  16.741  1.00 35.61  ? 70  ASN A CB    1 
ATOM   218  C  CG    . ASN A 1 29  ? 12.591  89.962  16.977  1.00 42.34  ? 70  ASN A CG    1 
ATOM   219  O  OD1   . ASN A 1 29  ? 11.806  89.232  16.372  1.00 41.97  ? 70  ASN A OD1   1 
ATOM   220  N  ND2   . ASN A 1 29  ? 12.189  90.862  17.866  1.00 43.55  ? 70  ASN A ND2   1 
ATOM   221  N  N     . ILE A 1 30  ? 13.526  86.691  15.241  1.00 41.10  ? 71  ILE A N     1 
ATOM   222  C  CA    . ILE A 1 30  ? 13.106  86.016  14.020  1.00 41.01  ? 71  ILE A CA    1 
ATOM   223  C  C     . ILE A 1 30  ? 11.966  86.768  13.336  1.00 39.31  ? 71  ILE A C     1 
ATOM   224  O  O     . ILE A 1 30  ? 11.968  86.945  12.117  1.00 42.34  ? 71  ILE A O     1 
ATOM   225  C  CB    . ILE A 1 30  ? 12.661  84.562  14.300  1.00 47.11  ? 71  ILE A CB    1 
ATOM   226  C  CG1   . ILE A 1 30  ? 13.734  83.806  15.092  1.00 48.53  ? 71  ILE A CG1   1 
ATOM   227  C  CG2   . ILE A 1 30  ? 12.345  83.839  12.998  1.00 43.37  ? 71  ILE A CG2   1 
ATOM   228  C  CD1   . ILE A 1 30  ? 13.487  83.753  16.589  1.00 53.53  ? 71  ILE A CD1   1 
ATOM   229  N  N     . LEU A 1 31  ? 11.002  87.216  14.133  1.00 38.81  ? 72  LEU A N     1 
ATOM   230  C  CA    . LEU A 1 31  ? 9.820   87.901  13.619  1.00 37.63  ? 72  LEU A CA    1 
ATOM   231  C  C     . LEU A 1 31  ? 10.173  89.225  12.944  1.00 39.61  ? 72  LEU A C     1 
ATOM   232  O  O     . LEU A 1 31  ? 9.621   89.567  11.899  1.00 36.44  ? 72  LEU A O     1 
ATOM   233  C  CB    . LEU A 1 31  ? 8.821   88.146  14.751  1.00 35.64  ? 72  LEU A CB    1 
ATOM   234  C  CG    . LEU A 1 31  ? 7.372   88.412  14.343  1.00 41.67  ? 72  LEU A CG    1 
ATOM   235  C  CD1   . LEU A 1 31  ? 6.787   87.197  13.635  1.00 34.70  ? 72  LEU A CD1   1 
ATOM   236  C  CD2   . LEU A 1 31  ? 6.534   88.791  15.556  1.00 37.90  ? 72  LEU A CD2   1 
ATOM   237  N  N     . LYS A 1 32  ? 11.094  89.965  13.551  1.00 38.95  ? 73  LYS A N     1 
ATOM   238  C  CA    . LYS A 1 32  ? 11.515  91.255  13.019  1.00 39.12  ? 73  LYS A CA    1 
ATOM   239  C  C     . LYS A 1 32  ? 12.622  91.094  11.988  1.00 37.32  ? 73  LYS A C     1 
ATOM   240  O  O     . LYS A 1 32  ? 12.982  92.052  11.304  1.00 38.17  ? 73  LYS A O     1 
ATOM   241  C  CB    . LYS A 1 32  ? 11.993  92.172  14.147  1.00 41.36  ? 73  LYS A CB    1 
ATOM   242  C  CG    . LYS A 1 32  ? 10.935  92.512  15.182  1.00 50.26  ? 73  LYS A CG    1 
ATOM   243  C  CD    . LYS A 1 32  ? 10.452  93.946  15.026  1.00 54.86  ? 73  LYS A CD    1 
ATOM   244  C  CE    . LYS A 1 32  ? 9.492   94.330  16.143  1.00 59.29  ? 73  LYS A CE    1 
ATOM   245  N  NZ    . LYS A 1 32  ? 9.014   95.740  16.029  1.00 62.54  ? 73  LYS A NZ    1 
ATOM   246  N  N     . GLN A 1 33  ? 13.157  89.878  11.890  1.00 37.48  ? 74  GLN A N     1 
ATOM   247  C  CA    . GLN A 1 33  ? 14.295  89.582  11.023  1.00 37.07  ? 74  GLN A CA    1 
ATOM   248  C  C     . GLN A 1 33  ? 15.468  90.514  11.330  1.00 33.96  ? 74  GLN A C     1 
ATOM   249  O  O     . GLN A 1 33  ? 16.088  91.073  10.425  1.00 35.44  ? 74  GLN A O     1 
ATOM   250  C  CB    . GLN A 1 33  ? 13.895  89.689  9.547   1.00 37.57  ? 74  GLN A CB    1 
ATOM   251  C  CG    . GLN A 1 33  ? 12.761  88.760  9.138   1.00 44.70  ? 74  GLN A CG    1 
ATOM   252  C  CD    . GLN A 1 33  ? 12.307  88.991  7.708   1.00 51.75  ? 74  GLN A CD    1 
ATOM   253  O  OE1   . GLN A 1 33  ? 11.354  89.730  7.460   1.00 54.40  ? 74  GLN A OE1   1 
ATOM   254  N  NE2   . GLN A 1 33  ? 12.992  88.362  6.760   1.00 47.94  ? 74  GLN A NE2   1 
ATOM   255  N  N     . SER A 1 34  ? 15.764  90.673  12.616  1.00 31.75  ? 75  SER A N     1 
ATOM   256  C  CA    . SER A 1 34  ? 16.803  91.594  13.058  1.00 37.77  ? 75  SER A CA    1 
ATOM   257  C  C     . SER A 1 34  ? 17.691  90.977  14.127  1.00 39.00  ? 75  SER A C     1 
ATOM   258  O  O     . SER A 1 34  ? 17.393  89.908  14.659  1.00 39.49  ? 75  SER A O     1 
ATOM   259  C  CB    . SER A 1 34  ? 16.178  92.881  13.595  1.00 33.74  ? 75  SER A CB    1 
ATOM   260  O  OG    . SER A 1 34  ? 15.321  93.464  12.631  1.00 40.83  ? 75  SER A OG    1 
ATOM   261  N  N     . CYS A 1 35  ? 18.783  91.665  14.436  1.00 32.44  ? 76  CYS A N     1 
ATOM   262  C  CA    . CYS A 1 35  ? 19.669  91.256  15.516  1.00 31.85  ? 76  CYS A CA    1 
ATOM   263  C  C     . CYS A 1 35  ? 20.036  92.453  16.380  1.00 38.19  ? 76  CYS A C     1 
ATOM   264  O  O     . CYS A 1 35  ? 20.272  93.550  15.871  1.00 40.90  ? 76  CYS A O     1 
ATOM   265  C  CB    . CYS A 1 35  ? 20.935  90.599  14.966  1.00 32.11  ? 76  CYS A CB    1 
ATOM   266  S  SG    . CYS A 1 35  ? 20.658  89.039  14.102  1.00 45.41  ? 76  CYS A SG    1 
ATOM   267  N  N     . PHE A 1 36  ? 20.069  92.238  17.690  1.00 37.48  ? 77  PHE A N     1 
ATOM   268  C  CA    . PHE A 1 36  ? 20.506  93.269  18.620  1.00 38.22  ? 77  PHE A CA    1 
ATOM   269  C  C     . PHE A 1 36  ? 22.027  93.218  18.720  1.00 40.30  ? 77  PHE A C     1 
ATOM   270  O  O     . PHE A 1 36  ? 22.595  92.225  19.174  1.00 39.74  ? 77  PHE A O     1 
ATOM   271  C  CB    . PHE A 1 36  ? 19.851  93.079  19.990  1.00 38.65  ? 77  PHE A CB    1 
ATOM   272  C  CG    . PHE A 1 36  ? 19.901  94.301  20.862  1.00 43.11  ? 77  PHE A CG    1 
ATOM   273  C  CD1   . PHE A 1 36  ? 19.394  95.508  20.408  1.00 44.22  ? 77  PHE A CD1   1 
ATOM   274  C  CD2   . PHE A 1 36  ? 20.441  94.243  22.137  1.00 43.38  ? 77  PHE A CD2   1 
ATOM   275  C  CE1   . PHE A 1 36  ? 19.435  96.637  21.202  1.00 44.89  ? 77  PHE A CE1   1 
ATOM   276  C  CE2   . PHE A 1 36  ? 20.482  95.370  22.938  1.00 43.64  ? 77  PHE A CE2   1 
ATOM   277  C  CZ    . PHE A 1 36  ? 19.978  96.568  22.469  1.00 46.60  ? 77  PHE A CZ    1 
ATOM   278  N  N     . ILE A 1 37  ? 22.684  94.287  18.283  1.00 39.13  ? 78  ILE A N     1 
ATOM   279  C  CA    . ILE A 1 37  ? 24.135  94.279  18.131  1.00 35.85  ? 78  ILE A CA    1 
ATOM   280  C  C     . ILE A 1 37  ? 24.824  95.333  18.991  1.00 46.35  ? 78  ILE A C     1 
ATOM   281  O  O     . ILE A 1 37  ? 24.404  96.489  19.029  1.00 48.21  ? 78  ILE A O     1 
ATOM   282  C  CB    . ILE A 1 37  ? 24.530  94.497  16.653  1.00 38.44  ? 78  ILE A CB    1 
ATOM   283  C  CG1   . ILE A 1 37  ? 24.006  93.346  15.792  1.00 36.47  ? 78  ILE A CG1   1 
ATOM   284  C  CG2   . ILE A 1 37  ? 26.040  94.630  16.503  1.00 38.08  ? 78  ILE A CG2   1 
ATOM   285  C  CD1   . ILE A 1 37  ? 24.385  93.456  14.338  1.00 38.27  ? 78  ILE A CD1   1 
ATOM   286  N  N     . ILE A 1 38  ? 25.876  94.920  19.692  1.00 40.84  ? 79  ILE A N     1 
ATOM   287  C  CA    . ILE A 1 38  ? 26.724  95.855  20.420  1.00 45.69  ? 79  ILE A CA    1 
ATOM   288  C  C     . ILE A 1 38  ? 27.932  96.211  19.561  1.00 40.44  ? 79  ILE A C     1 
ATOM   289  O  O     . ILE A 1 38  ? 28.529  95.344  18.925  1.00 41.25  ? 79  ILE A O     1 
ATOM   290  C  CB    . ILE A 1 38  ? 27.194  95.283  21.783  1.00 44.52  ? 79  ILE A CB    1 
ATOM   291  C  CG1   . ILE A 1 38  ? 27.859  93.914  21.613  1.00 39.00  ? 79  ILE A CG1   1 
ATOM   292  C  CG2   . ILE A 1 38  ? 26.030  95.161  22.744  1.00 48.94  ? 79  ILE A CG2   1 
ATOM   293  C  CD1   . ILE A 1 38  ? 29.364  93.947  21.741  1.00 52.66  ? 79  ILE A CD1   1 
ATOM   294  N  N     . PHE A 1 39  ? 28.282  97.492  19.536  1.00 42.94  ? 80  PHE A N     1 
ATOM   295  C  CA    . PHE A 1 39  ? 29.401  97.954  18.724  1.00 47.36  ? 80  PHE A CA    1 
ATOM   296  C  C     . PHE A 1 39  ? 30.620  98.264  19.584  1.00 49.18  ? 80  PHE A C     1 
ATOM   297  O  O     . PHE A 1 39  ? 30.572  98.139  20.807  1.00 49.15  ? 80  PHE A O     1 
ATOM   298  C  CB    . PHE A 1 39  ? 28.992  99.180  17.909  1.00 45.65  ? 80  PHE A CB    1 
ATOM   299  C  CG    . PHE A 1 39  ? 27.870  98.915  16.948  1.00 41.86  ? 80  PHE A CG    1 
ATOM   300  C  CD1   . PHE A 1 39  ? 28.133  98.466  15.665  1.00 39.02  ? 80  PHE A CD1   1 
ATOM   301  C  CD2   . PHE A 1 39  ? 26.552  99.102  17.331  1.00 43.89  ? 80  PHE A CD2   1 
ATOM   302  C  CE1   . PHE A 1 39  ? 27.103  98.215  14.777  1.00 37.69  ? 80  PHE A CE1   1 
ATOM   303  C  CE2   . PHE A 1 39  ? 25.518  98.854  16.448  1.00 42.37  ? 80  PHE A CE2   1 
ATOM   304  C  CZ    . PHE A 1 39  ? 25.794  98.410  15.170  1.00 37.62  ? 80  PHE A CZ    1 
ATOM   305  N  N     . GLU A 1 40  ? 31.709  98.666  18.938  1.00 49.79  ? 81  GLU A N     1 
ATOM   306  C  CA    . GLU A 1 40  ? 32.976  98.890  19.628  1.00 51.19  ? 81  GLU A CA    1 
ATOM   307  C  C     . GLU A 1 40  ? 32.897  100.022 20.648  1.00 51.32  ? 81  GLU A C     1 
ATOM   308  O  O     . GLU A 1 40  ? 33.684  100.066 21.593  1.00 56.69  ? 81  GLU A O     1 
ATOM   309  C  CB    . GLU A 1 40  ? 34.085  99.181  18.618  1.00 52.72  ? 81  GLU A CB    1 
ATOM   310  C  CG    . GLU A 1 40  ? 34.494  97.977  17.792  1.00 49.64  ? 81  GLU A CG    1 
ATOM   311  C  CD    . GLU A 1 40  ? 35.614  98.297  16.826  1.00 62.58  ? 81  GLU A CD    1 
ATOM   312  O  OE1   . GLU A 1 40  ? 35.884  99.497  16.607  1.00 71.45  ? 81  GLU A OE1   1 
ATOM   313  O  OE2   . GLU A 1 40  ? 36.226  97.351  16.289  1.00 66.45  ? 81  GLU A OE2   1 
ATOM   314  N  N     . ASP A 1 41  ? 31.950  100.934 20.455  1.00 52.83  ? 82  ASP A N     1 
ATOM   315  C  CA    . ASP A 1 41  ? 31.733  102.016 21.408  1.00 50.33  ? 82  ASP A CA    1 
ATOM   316  C  C     . ASP A 1 41  ? 30.713  101.602 22.465  1.00 50.04  ? 82  ASP A C     1 
ATOM   317  O  O     . ASP A 1 41  ? 30.170  102.445 23.181  1.00 50.14  ? 82  ASP A O     1 
ATOM   318  C  CB    . ASP A 1 41  ? 31.269  103.284 20.689  1.00 55.68  ? 82  ASP A CB    1 
ATOM   319  C  CG    . ASP A 1 41  ? 29.924  103.111 20.012  1.00 57.40  ? 82  ASP A CG    1 
ATOM   320  O  OD1   . ASP A 1 41  ? 29.571  101.962 19.675  1.00 58.89  ? 82  ASP A OD1   1 
ATOM   321  O  OD2   . ASP A 1 41  ? 29.220  104.125 19.816  1.00 56.56  ? 82  ASP A OD2   1 
ATOM   322  N  N     . SER A 1 42  ? 30.455  100.296 22.535  1.00 52.12  ? 83  SER A N     1 
ATOM   323  C  CA    . SER A 1 42  ? 29.522  99.697  23.494  1.00 52.05  ? 83  SER A CA    1 
ATOM   324  C  C     . SER A 1 42  ? 28.075  100.151 23.288  1.00 51.15  ? 83  SER A C     1 
ATOM   325  O  O     . SER A 1 42  ? 27.207  99.866  24.114  1.00 53.99  ? 83  SER A O     1 
ATOM   326  C  CB    . SER A 1 42  ? 29.961  99.995  24.932  1.00 55.81  ? 83  SER A CB    1 
ATOM   327  O  OG    . SER A 1 42  ? 31.261  99.489  25.184  1.00 53.93  ? 83  SER A OG    1 
ATOM   328  N  N     . SER A 1 43  ? 27.814  100.847 22.186  1.00 52.18  ? 84  SER A N     1 
ATOM   329  C  CA    . SER A 1 43  ? 26.453  101.251 21.857  1.00 47.78  ? 84  SER A CA    1 
ATOM   330  C  C     . SER A 1 43  ? 25.683  100.050 21.325  1.00 47.07  ? 84  SER A C     1 
ATOM   331  O  O     . SER A 1 43  ? 26.251  99.182  20.662  1.00 46.19  ? 84  SER A O     1 
ATOM   332  C  CB    . SER A 1 43  ? 26.449  102.390 20.834  1.00 50.56  ? 84  SER A CB    1 
ATOM   333  O  OG    . SER A 1 43  ? 27.034  101.983 19.610  1.00 50.46  ? 84  SER A OG    1 
ATOM   334  N  N     . LYS A 1 44  ? 24.390  100.002 21.622  1.00 49.09  ? 85  LYS A N     1 
ATOM   335  C  CA    . LYS A 1 44  ? 23.565  98.860  21.245  1.00 45.25  ? 85  LYS A CA    1 
ATOM   336  C  C     . LYS A 1 44  ? 22.378  99.283  20.383  1.00 52.06  ? 85  LYS A C     1 
ATOM   337  O  O     . LYS A 1 44  ? 21.715  100.280 20.671  1.00 53.93  ? 85  LYS A O     1 
ATOM   338  C  CB    . LYS A 1 44  ? 23.071  98.133  22.497  1.00 52.59  ? 85  LYS A CB    1 
ATOM   339  C  CG    . LYS A 1 44  ? 24.123  97.995  23.589  1.00 52.48  ? 85  LYS A CG    1 
ATOM   340  C  CD    . LYS A 1 44  ? 23.585  97.251  24.801  1.00 57.03  ? 85  LYS A CD    1 
ATOM   341  C  CE    . LYS A 1 44  ? 24.658  97.095  25.869  1.00 66.58  ? 85  LYS A CE    1 
ATOM   342  N  NZ    . LYS A 1 44  ? 25.203  98.411  26.302  1.00 60.59  ? 85  LYS A NZ    1 
ATOM   343  N  N     . SER A 1 45  ? 22.108  98.520  19.329  1.00 42.09  ? 86  SER A N     1 
ATOM   344  C  CA    . SER A 1 45  ? 20.995  98.831  18.437  1.00 43.54  ? 86  SER A CA    1 
ATOM   345  C  C     . SER A 1 45  ? 20.531  97.610  17.649  1.00 39.00  ? 86  SER A C     1 
ATOM   346  O  O     . SER A 1 45  ? 21.281  96.650  17.476  1.00 37.05  ? 86  SER A O     1 
ATOM   347  C  CB    . SER A 1 45  ? 21.385  99.951  17.471  1.00 42.44  ? 86  SER A CB    1 
ATOM   348  O  OG    . SER A 1 45  ? 20.312  100.264 16.603  1.00 53.69  ? 86  SER A OG    1 
ATOM   349  N  N     . TRP A 1 46  ? 19.290  97.655  17.175  1.00 37.83  ? 87  TRP A N     1 
ATOM   350  C  CA    . TRP A 1 46  ? 18.750  96.589  16.339  1.00 37.64  ? 87  TRP A CA    1 
ATOM   351  C  C     . TRP A 1 46  ? 19.129  96.800  14.878  1.00 33.63  ? 87  TRP A C     1 
ATOM   352  O  O     . TRP A 1 46  ? 18.967  97.892  14.333  1.00 33.28  ? 87  TRP A O     1 
ATOM   353  C  CB    . TRP A 1 46  ? 17.228  96.504  16.479  1.00 35.26  ? 87  TRP A CB    1 
ATOM   354  C  CG    . TRP A 1 46  ? 16.776  95.956  17.795  1.00 40.00  ? 87  TRP A CG    1 
ATOM   355  C  CD1   . TRP A 1 46  ? 16.421  96.670  18.901  1.00 38.76  ? 87  TRP A CD1   1 
ATOM   356  C  CD2   . TRP A 1 46  ? 16.630  94.573  18.145  1.00 39.58  ? 87  TRP A CD2   1 
ATOM   357  N  NE1   . TRP A 1 46  ? 16.061  95.819  19.918  1.00 45.74  ? 87  TRP A NE1   1 
ATOM   358  C  CE2   . TRP A 1 46  ? 16.182  94.527  19.479  1.00 44.50  ? 87  TRP A CE2   1 
ATOM   359  C  CE3   . TRP A 1 46  ? 16.834  93.372  17.459  1.00 38.28  ? 87  TRP A CE3   1 
ATOM   360  C  CZ2   . TRP A 1 46  ? 15.935  93.326  20.142  1.00 39.13  ? 87  TRP A CZ2   1 
ATOM   361  C  CZ3   . TRP A 1 46  ? 16.590  92.181  18.120  1.00 38.13  ? 87  TRP A CZ3   1 
ATOM   362  C  CH2   . TRP A 1 46  ? 16.144  92.167  19.447  1.00 41.87  ? 87  TRP A CH2   1 
ATOM   363  N  N     . VAL A 1 47  ? 19.640  95.747  14.250  1.00 35.49  ? 88  VAL A N     1 
ATOM   364  C  CA    . VAL A 1 47  ? 20.053  95.815  12.856  1.00 33.86  ? 88  VAL A CA    1 
ATOM   365  C  C     . VAL A 1 47  ? 19.365  94.732  12.036  1.00 32.98  ? 88  VAL A C     1 
ATOM   366  O  O     . VAL A 1 47  ? 19.377  93.559  12.411  1.00 33.01  ? 88  VAL A O     1 
ATOM   367  C  CB    . VAL A 1 47  ? 21.579  95.670  12.718  1.00 27.04  ? 88  VAL A CB    1 
ATOM   368  C  CG1   . VAL A 1 47  ? 21.997  95.745  11.255  1.00 28.03  ? 88  VAL A CG1   1 
ATOM   369  C  CG2   . VAL A 1 47  ? 22.282  96.740  13.534  1.00 26.28  ? 88  VAL A CG2   1 
ATOM   370  N  N     . LEU A 1 48  ? 18.759  95.135  10.922  1.00 32.35  ? 89  LEU A N     1 
ATOM   371  C  CA    . LEU A 1 48  ? 18.109  94.198  10.010  1.00 25.86  ? 89  LEU A CA    1 
ATOM   372  C  C     . LEU A 1 48  ? 19.109  93.194  9.441   1.00 31.47  ? 89  LEU A C     1 
ATOM   373  O  O     . LEU A 1 48  ? 20.291  93.504  9.281   1.00 32.34  ? 89  LEU A O     1 
ATOM   374  C  CB    . LEU A 1 48  ? 17.416  94.953  8.872   1.00 26.45  ? 89  LEU A CB    1 
ATOM   375  C  CG    . LEU A 1 48  ? 16.254  95.869  9.263   1.00 33.59  ? 89  LEU A CG    1 
ATOM   376  C  CD1   . LEU A 1 48  ? 15.860  96.766  8.100   1.00 23.79  ? 89  LEU A CD1   1 
ATOM   377  C  CD2   . LEU A 1 48  ? 15.056  95.057  9.742   1.00 31.20  ? 89  LEU A CD2   1 
ATOM   378  N  N     . TRP A 1 49  ? 18.624  91.993  9.138   1.00 31.93  ? 90  TRP A N     1 
ATOM   379  C  CA    . TRP A 1 49  ? 19.472  90.927  8.611   1.00 35.51  ? 90  TRP A CA    1 
ATOM   380  C  C     . TRP A 1 49  ? 20.094  91.307  7.273   1.00 31.71  ? 90  TRP A C     1 
ATOM   381  O  O     . TRP A 1 49  ? 21.197  90.867  6.949   1.00 33.93  ? 90  TRP A O     1 
ATOM   382  C  CB    . TRP A 1 49  ? 18.674  89.629  8.461   1.00 37.31  ? 90  TRP A CB    1 
ATOM   383  C  CG    . TRP A 1 49  ? 18.301  88.996  9.764   1.00 37.20  ? 90  TRP A CG    1 
ATOM   384  C  CD1   . TRP A 1 49  ? 18.765  89.334  11.002  1.00 32.33  ? 90  TRP A CD1   1 
ATOM   385  C  CD2   . TRP A 1 49  ? 17.382  87.915  9.960   1.00 36.19  ? 90  TRP A CD2   1 
ATOM   386  N  NE1   . TRP A 1 49  ? 18.193  88.529  11.957  1.00 37.20  ? 90  TRP A NE1   1 
ATOM   387  C  CE2   . TRP A 1 49  ? 17.340  87.649  11.343  1.00 38.26  ? 90  TRP A CE2   1 
ATOM   388  C  CE3   . TRP A 1 49  ? 16.592  87.146  9.101   1.00 37.15  ? 90  TRP A CE3   1 
ATOM   389  C  CZ2   . TRP A 1 49  ? 16.537  86.648  11.886  1.00 41.24  ? 90  TRP A CZ2   1 
ATOM   390  C  CZ3   . TRP A 1 49  ? 15.796  86.153  9.641   1.00 43.70  ? 90  TRP A CZ3   1 
ATOM   391  C  CH2   . TRP A 1 49  ? 15.774  85.913  11.020  1.00 43.80  ? 90  TRP A CH2   1 
ATOM   392  N  N     . LYS A 1 50  ? 19.386  92.128  6.502   1.00 28.59  ? 91  LYS A N     1 
ATOM   393  C  CA    . LYS A 1 50  ? 19.880  92.580  5.205   1.00 28.80  ? 91  LYS A CA    1 
ATOM   394  C  C     . LYS A 1 50  ? 21.106  93.475  5.357   1.00 26.53  ? 91  LYS A C     1 
ATOM   395  O  O     . LYS A 1 50  ? 21.864  93.669  4.408   1.00 29.56  ? 91  LYS A O     1 
ATOM   396  C  CB    . LYS A 1 50  ? 18.788  93.334  4.444   1.00 35.46  ? 91  LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 50  ? 18.487  94.718  5.006   1.00 32.85  ? 91  LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 50  ? 17.545  95.494  4.103   1.00 36.33  ? 91  LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 50  ? 17.264  96.882  4.659   1.00 28.85  ? 91  LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 50  ? 18.497  97.716  4.739   1.00 29.34  ? 91  LYS A NZ    1 
ATOM   401  N  N     . ASP A 1 51  ? 21.291  94.020  6.555   1.00 28.02  ? 92  ASP A N     1 
ATOM   402  C  CA    . ASP A 1 51  ? 22.398  94.928  6.826   1.00 29.67  ? 92  ASP A CA    1 
ATOM   403  C  C     . ASP A 1 51  ? 23.490  94.256  7.650   1.00 30.02  ? 92  ASP A C     1 
ATOM   404  O  O     . ASP A 1 51  ? 24.383  94.923  8.172   1.00 26.55  ? 92  ASP A O     1 
ATOM   405  C  CB    . ASP A 1 51  ? 21.890  96.177  7.546   1.00 26.80  ? 92  ASP A CB    1 
ATOM   406  C  CG    . ASP A 1 51  ? 20.906  96.967  6.710   1.00 27.56  ? 92  ASP A CG    1 
ATOM   407  O  OD1   . ASP A 1 51  ? 21.174  97.158  5.505   1.00 27.43  ? 92  ASP A OD1   1 
ATOM   408  O  OD2   . ASP A 1 51  ? 19.863  97.393  7.252   1.00 27.35  ? 92  ASP A OD2   1 
ATOM   409  N  N     . ILE A 1 52  ? 23.415  92.935  7.769   1.00 30.47  ? 93  ILE A N     1 
ATOM   410  C  CA    . ILE A 1 52  ? 24.417  92.189  8.522   1.00 33.84  ? 93  ILE A CA    1 
ATOM   411  C  C     . ILE A 1 52  ? 25.275  91.336  7.596   1.00 36.17  ? 93  ILE A C     1 
ATOM   412  O  O     . ILE A 1 52  ? 24.764  90.532  6.819   1.00 32.22  ? 93  ILE A O     1 
ATOM   413  C  CB    . ILE A 1 52  ? 23.772  91.291  9.590   1.00 36.65  ? 93  ILE A CB    1 
ATOM   414  C  CG1   . ILE A 1 52  ? 22.990  92.141  10.591  1.00 33.01  ? 93  ILE A CG1   1 
ATOM   415  C  CG2   . ILE A 1 52  ? 24.837  90.475  10.311  1.00 34.79  ? 93  ILE A CG2   1 
ATOM   416  C  CD1   . ILE A 1 52  ? 22.346  91.340  11.697  1.00 34.59  ? 93  ILE A CD1   1 
ATOM   417  N  N     . GLN A 1 53  ? 26.586  91.522  7.691   1.00 36.35  ? 94  GLN A N     1 
ATOM   418  C  CA    . GLN A 1 53  ? 27.529  90.812  6.840   1.00 40.01  ? 94  GLN A CA    1 
ATOM   419  C  C     . GLN A 1 53  ? 28.254  89.718  7.619   1.00 47.46  ? 94  GLN A C     1 
ATOM   420  O  O     . GLN A 1 53  ? 29.059  90.006  8.505   1.00 47.07  ? 94  GLN A O     1 
ATOM   421  C  CB    . GLN A 1 53  ? 28.531  91.795  6.238   1.00 45.51  ? 94  GLN A CB    1 
ATOM   422  C  CG    . GLN A 1 53  ? 29.543  91.172  5.301   1.00 52.63  ? 94  GLN A CG    1 
ATOM   423  C  CD    . GLN A 1 53  ? 30.449  92.208  4.665   1.00 54.26  ? 94  GLN A CD    1 
ATOM   424  O  OE1   . GLN A 1 53  ? 30.055  93.359  4.466   1.00 47.11  ? 94  GLN A OE1   1 
ATOM   425  N  NE2   . GLN A 1 53  ? 31.673  91.806  4.346   1.00 57.11  ? 94  GLN A NE2   1 
ATOM   426  N  N     . THR A 1 54  ? 27.960  88.464  7.291   1.00 49.39  ? 95  THR A N     1 
ATOM   427  C  CA    . THR A 1 54  ? 28.584  87.336  7.972   1.00 58.89  ? 95  THR A CA    1 
ATOM   428  C  C     . THR A 1 54  ? 30.033  87.160  7.530   1.00 60.59  ? 95  THR A C     1 
ATOM   429  O  O     . THR A 1 54  ? 30.319  86.965  6.347   1.00 61.22  ? 95  THR A O     1 
ATOM   430  C  CB    . THR A 1 54  ? 27.814  86.029  7.726   1.00 58.39  ? 95  THR A CB    1 
ATOM   431  O  OG1   . THR A 1 54  ? 26.497  86.141  8.279   1.00 62.43  ? 95  THR A OG1   1 
ATOM   432  C  CG2   . THR A 1 54  ? 28.534  84.861  8.382   1.00 61.47  ? 95  THR A CG2   1 
ATOM   433  N  N     . GLY A 1 55  ? 30.943  87.225  8.494   1.00 63.60  ? 96  GLY A N     1 
ATOM   434  C  CA    . GLY A 1 55  ? 32.363  87.188  8.208   1.00 65.66  ? 96  GLY A CA    1 
ATOM   435  C  C     . GLY A 1 55  ? 32.980  88.548  8.463   1.00 74.85  ? 96  GLY A C     1 
ATOM   436  O  O     . GLY A 1 55  ? 32.290  89.566  8.396   1.00 64.48  ? 96  GLY A O     1 
ATOM   437  N  N     . ALA A 1 56  ? 34.278  88.556  8.761   1.00 75.26  ? 97  ALA A N     1 
ATOM   438  C  CA    . ALA A 1 56  ? 35.013  89.782  9.072   1.00 65.40  ? 97  ALA A CA    1 
ATOM   439  C  C     . ALA A 1 56  ? 34.383  90.531  10.242  1.00 63.06  ? 97  ALA A C     1 
ATOM   440  O  O     . ALA A 1 56  ? 33.740  89.928  11.102  1.00 57.36  ? 97  ALA A O     1 
ATOM   441  C  CB    . ALA A 1 56  ? 35.096  90.686  7.842   1.00 61.62  ? 97  ALA A CB    1 
ATOM   442  N  N     . MET A 1 62  ? 36.813  75.974  -3.877  1.00 63.42  ? 103 MET A N     1 
ATOM   443  C  CA    . MET A 1 62  ? 36.416  77.278  -4.398  1.00 63.37  ? 103 MET A CA    1 
ATOM   444  C  C     . MET A 1 62  ? 35.055  77.210  -5.082  1.00 63.02  ? 103 MET A C     1 
ATOM   445  O  O     . MET A 1 62  ? 34.906  76.592  -6.137  1.00 63.55  ? 103 MET A O     1 
ATOM   446  C  CB    . MET A 1 62  ? 37.470  77.808  -5.372  1.00 60.95  ? 103 MET A CB    1 
ATOM   447  C  CG    . MET A 1 62  ? 37.065  79.081  -6.097  1.00 64.29  ? 103 MET A CG    1 
ATOM   448  S  SD    . MET A 1 62  ? 36.586  80.407  -4.973  1.00 68.37  ? 103 MET A SD    1 
ATOM   449  C  CE    . MET A 1 62  ? 38.104  80.634  -4.052  1.00 63.56  ? 103 MET A CE    1 
ATOM   450  N  N     . VAL A 1 63  ? 34.064  77.851  -4.474  1.00 59.20  ? 104 VAL A N     1 
ATOM   451  C  CA    . VAL A 1 63  ? 32.710  77.853  -5.011  1.00 59.21  ? 104 VAL A CA    1 
ATOM   452  C  C     . VAL A 1 63  ? 32.198  79.287  -5.149  1.00 60.05  ? 104 VAL A C     1 
ATOM   453  O  O     . VAL A 1 63  ? 32.637  80.181  -4.422  1.00 51.53  ? 104 VAL A O     1 
ATOM   454  C  CB    . VAL A 1 63  ? 31.757  77.012  -4.120  1.00 57.20  ? 104 VAL A CB    1 
ATOM   455  C  CG1   . VAL A 1 63  ? 30.808  77.900  -3.319  1.00 57.46  ? 104 VAL A CG1   1 
ATOM   456  C  CG2   . VAL A 1 63  ? 30.979  76.017  -4.962  1.00 60.46  ? 104 VAL A CG2   1 
ATOM   457  N  N     . CYS A 1 64  ? 31.294  79.511  -6.100  1.00 54.89  ? 105 CYS A N     1 
ATOM   458  C  CA    . CYS A 1 64  ? 30.689  80.827  -6.276  1.00 49.66  ? 105 CYS A CA    1 
ATOM   459  C  C     . CYS A 1 64  ? 29.859  81.180  -5.051  1.00 48.85  ? 105 CYS A C     1 
ATOM   460  O  O     . CYS A 1 64  ? 29.031  80.393  -4.613  1.00 47.59  ? 105 CYS A O     1 
ATOM   461  C  CB    . CYS A 1 64  ? 29.822  80.868  -7.536  1.00 47.31  ? 105 CYS A CB    1 
ATOM   462  S  SG    . CYS A 1 64  ? 28.940  82.431  -7.785  1.00 42.86  ? 105 CYS A SG    1 
ATOM   463  N  N     . THR A 1 65  ? 30.080  82.362  -4.491  1.00 43.47  ? 106 THR A N     1 
ATOM   464  C  CA    . THR A 1 65  ? 29.389  82.744  -3.266  1.00 49.39  ? 106 THR A CA    1 
ATOM   465  C  C     . THR A 1 65  ? 27.903  82.993  -3.502  1.00 45.60  ? 106 THR A C     1 
ATOM   466  O  O     . THR A 1 65  ? 27.098  82.923  -2.574  1.00 46.59  ? 106 THR A O     1 
ATOM   467  C  CB    . THR A 1 65  ? 30.011  84.001  -2.644  1.00 52.63  ? 106 THR A CB    1 
ATOM   468  O  OG1   . THR A 1 65  ? 29.646  85.149  -3.418  1.00 54.28  ? 106 THR A OG1   1 
ATOM   469  C  CG2   . THR A 1 65  ? 31.517  83.875  -2.617  1.00 50.45  ? 106 THR A CG2   1 
ATOM   470  N  N     . ILE A 1 66  ? 27.543  83.281  -4.748  1.00 45.52  ? 107 ILE A N     1 
ATOM   471  C  CA    . ILE A 1 66  ? 26.163  83.612  -5.077  1.00 40.06  ? 107 ILE A CA    1 
ATOM   472  C  C     . ILE A 1 66  ? 25.298  82.365  -5.258  1.00 44.31  ? 107 ILE A C     1 
ATOM   473  O  O     . ILE A 1 66  ? 24.254  82.232  -4.618  1.00 46.96  ? 107 ILE A O     1 
ATOM   474  C  CB    . ILE A 1 66  ? 26.087  84.472  -6.353  1.00 45.38  ? 107 ILE A CB    1 
ATOM   475  C  CG1   . ILE A 1 66  ? 26.738  85.835  -6.112  1.00 38.16  ? 107 ILE A CG1   1 
ATOM   476  C  CG2   . ILE A 1 66  ? 24.643  84.662  -6.784  1.00 38.13  ? 107 ILE A CG2   1 
ATOM   477  C  CD1   . ILE A 1 66  ? 26.042  86.659  -5.049  1.00 36.65  ? 107 ILE A CD1   1 
ATOM   478  N  N     . CYS A 1 67  ? 25.738  81.454  -6.122  1.00 42.81  ? 108 CYS A N     1 
ATOM   479  C  CA    . CYS A 1 67  ? 24.943  80.277  -6.468  1.00 45.96  ? 108 CYS A CA    1 
ATOM   480  C  C     . CYS A 1 67  ? 25.464  78.999  -5.816  1.00 52.09  ? 108 CYS A C     1 
ATOM   481  O  O     . CYS A 1 67  ? 24.809  77.956  -5.871  1.00 52.78  ? 108 CYS A O     1 
ATOM   482  C  CB    . CYS A 1 67  ? 24.907  80.093  -7.983  1.00 40.23  ? 108 CYS A CB    1 
ATOM   483  S  SG    . CYS A 1 67  ? 26.472  79.524  -8.683  1.00 45.85  ? 108 CYS A SG    1 
ATOM   484  N  N     . GLN A 1 68  ? 26.649  79.088  -5.218  1.00 52.31  ? 109 GLN A N     1 
ATOM   485  C  CA    . GLN A 1 68  ? 27.279  77.968  -4.517  1.00 53.06  ? 109 GLN A CA    1 
ATOM   486  C  C     . GLN A 1 68  ? 27.494  76.754  -5.417  1.00 53.43  ? 109 GLN A C     1 
ATOM   487  O  O     . GLN A 1 68  ? 27.344  75.612  -4.983  1.00 56.20  ? 109 GLN A O     1 
ATOM   488  C  CB    . GLN A 1 68  ? 26.459  77.584  -3.285  1.00 52.46  ? 109 GLN A CB    1 
ATOM   489  C  CG    . GLN A 1 68  ? 26.150  78.769  -2.383  1.00 57.44  ? 109 GLN A CG    1 
ATOM   490  C  CD    . GLN A 1 68  ? 25.811  78.359  -0.966  1.00 72.00  ? 109 GLN A CD    1 
ATOM   491  O  OE1   . GLN A 1 68  ? 26.344  77.379  -0.446  1.00 80.97  ? 109 GLN A OE1   1 
ATOM   492  N  NE2   . GLN A 1 68  ? 24.920  79.111  -0.330  1.00 75.74  ? 109 GLN A NE2   1 
ATOM   493  N  N     . GLU A 1 69  ? 27.851  77.015  -6.671  1.00 51.89  ? 110 GLU A N     1 
ATOM   494  C  CA    . GLU A 1 69  ? 28.255  75.964  -7.599  1.00 54.81  ? 110 GLU A CA    1 
ATOM   495  C  C     . GLU A 1 69  ? 29.670  76.250  -8.095  1.00 54.92  ? 110 GLU A C     1 
ATOM   496  O  O     . GLU A 1 69  ? 30.123  77.394  -8.061  1.00 58.17  ? 110 GLU A O     1 
ATOM   497  C  CB    . GLU A 1 69  ? 27.274  75.859  -8.767  1.00 52.76  ? 110 GLU A CB    1 
ATOM   498  C  CG    . GLU A 1 69  ? 25.837  75.595  -8.333  1.00 56.82  ? 110 GLU A CG    1 
ATOM   499  C  CD    . GLU A 1 69  ? 24.919  75.273  -9.498  1.00 61.35  ? 110 GLU A CD    1 
ATOM   500  O  OE1   . GLU A 1 69  ? 25.415  74.774  -10.531 1.00 66.28  ? 110 GLU A OE1   1 
ATOM   501  O  OE2   . GLU A 1 69  ? 23.700  75.521  -9.383  1.00 52.71  ? 110 GLU A OE2   1 
ATOM   502  N  N     . GLU A 1 70  ? 30.369  75.215  -8.547  1.00 59.85  ? 111 GLU A N     1 
ATOM   503  C  CA    . GLU A 1 70  ? 31.799  75.335  -8.815  1.00 56.75  ? 111 GLU A CA    1 
ATOM   504  C  C     . GLU A 1 70  ? 32.184  75.182  -10.285 1.00 59.17  ? 111 GLU A C     1 
ATOM   505  O  O     . GLU A 1 70  ? 33.365  75.039  -10.604 1.00 63.08  ? 111 GLU A O     1 
ATOM   506  C  CB    . GLU A 1 70  ? 32.562  74.309  -7.975  1.00 62.90  ? 111 GLU A CB    1 
ATOM   507  C  CG    . GLU A 1 70  ? 31.861  72.967  -7.862  1.00 67.38  ? 111 GLU A CG    1 
ATOM   508  C  CD    . GLU A 1 70  ? 32.411  72.113  -6.736  1.00 74.96  ? 111 GLU A CD    1 
ATOM   509  O  OE1   . GLU A 1 70  ? 31.671  71.866  -5.760  1.00 72.94  ? 111 GLU A OE1   1 
ATOM   510  O  OE2   . GLU A 1 70  ? 33.582  71.688  -6.825  1.00 72.52  ? 111 GLU A OE2   1 
ATOM   511  N  N     . TYR A 1 71  ? 31.201  75.221  -11.179 1.00 57.94  ? 112 TYR A N     1 
ATOM   512  C  CA    . TYR A 1 71  ? 31.490  75.150  -12.608 1.00 57.49  ? 112 TYR A CA    1 
ATOM   513  C  C     . TYR A 1 71  ? 32.108  76.463  -13.080 1.00 60.80  ? 112 TYR A C     1 
ATOM   514  O  O     . TYR A 1 71  ? 31.807  77.526  -12.538 1.00 62.02  ? 112 TYR A O     1 
ATOM   515  C  CB    . TYR A 1 71  ? 30.224  74.829  -13.413 1.00 63.14  ? 112 TYR A CB    1 
ATOM   516  C  CG    . TYR A 1 71  ? 29.129  75.874  -13.320 1.00 61.56  ? 112 TYR A CG    1 
ATOM   517  C  CD1   . TYR A 1 71  ? 29.080  76.942  -14.209 1.00 59.18  ? 112 TYR A CD1   1 
ATOM   518  C  CD2   . TYR A 1 71  ? 28.137  75.783  -12.353 1.00 61.91  ? 112 TYR A CD2   1 
ATOM   519  C  CE1   . TYR A 1 71  ? 28.079  77.896  -14.129 1.00 57.11  ? 112 TYR A CE1   1 
ATOM   520  C  CE2   . TYR A 1 71  ? 27.131  76.731  -12.267 1.00 61.73  ? 112 TYR A CE2   1 
ATOM   521  C  CZ    . TYR A 1 71  ? 27.107  77.785  -13.156 1.00 63.90  ? 112 TYR A CZ    1 
ATOM   522  O  OH    . TYR A 1 71  ? 26.108  78.729  -13.070 1.00 56.50  ? 112 TYR A OH    1 
ATOM   523  N  N     . SER A 1 72  ? 32.973  76.386  -14.087 1.00 59.36  ? 113 SER A N     1 
ATOM   524  C  CA    . SER A 1 72  ? 33.642  77.574  -14.607 1.00 55.76  ? 113 SER A CA    1 
ATOM   525  C  C     . SER A 1 72  ? 34.126  77.378  -16.039 1.00 57.58  ? 113 SER A C     1 
ATOM   526  O  O     . SER A 1 72  ? 35.020  76.573  -16.297 1.00 64.80  ? 113 SER A O     1 
ATOM   527  C  CB    . SER A 1 72  ? 34.823  77.957  -13.712 1.00 57.64  ? 113 SER A CB    1 
ATOM   528  O  OG    . SER A 1 72  ? 35.512  79.082  -14.234 1.00 52.65  ? 113 SER A OG    1 
ATOM   529  N  N     . GLU A 1 73  ? 33.535  78.126  -16.966 1.00 54.66  ? 114 GLU A N     1 
ATOM   530  C  CA    . GLU A 1 73  ? 33.928  78.065  -18.368 1.00 55.87  ? 114 GLU A CA    1 
ATOM   531  C  C     . GLU A 1 73  ? 33.482  79.320  -19.110 1.00 51.94  ? 114 GLU A C     1 
ATOM   532  O  O     . GLU A 1 73  ? 32.436  79.891  -18.806 1.00 53.94  ? 114 GLU A O     1 
ATOM   533  C  CB    . GLU A 1 73  ? 33.345  76.818  -19.037 1.00 60.95  ? 114 GLU A CB    1 
ATOM   534  C  CG    . GLU A 1 73  ? 31.826  76.769  -19.054 1.00 70.62  ? 114 GLU A CG    1 
ATOM   535  C  CD    . GLU A 1 73  ? 31.293  75.477  -19.641 1.00 76.11  ? 114 GLU A CD    1 
ATOM   536  O  OE1   . GLU A 1 73  ? 31.734  74.395  -19.197 1.00 76.06  ? 114 GLU A OE1   1 
ATOM   537  O  OE2   . GLU A 1 73  ? 30.437  75.542  -20.549 1.00 80.15  ? 114 GLU A OE2   1 
ATOM   538  N  N     . ALA A 1 74  ? 34.285  79.748  -20.079 1.00 52.47  ? 115 ALA A N     1 
ATOM   539  C  CA    . ALA A 1 74  ? 33.975  80.933  -20.871 1.00 57.38  ? 115 ALA A CA    1 
ATOM   540  C  C     . ALA A 1 74  ? 32.675  80.743  -21.650 1.00 57.53  ? 115 ALA A C     1 
ATOM   541  O  O     . ALA A 1 74  ? 32.378  79.637  -22.101 1.00 62.37  ? 115 ALA A O     1 
ATOM   542  C  CB    . ALA A 1 74  ? 35.127  81.251  -21.817 1.00 57.85  ? 115 ALA A CB    1 
ATOM   543  N  N     . PRO A 1 75  ? 31.894  81.824  -21.814 1.00 51.88  ? 116 PRO A N     1 
ATOM   544  C  CA    . PRO A 1 75  ? 32.188  83.183  -21.350 1.00 53.88  ? 116 PRO A CA    1 
ATOM   545  C  C     . PRO A 1 75  ? 31.606  83.505  -19.974 1.00 48.29  ? 116 PRO A C     1 
ATOM   546  O  O     . PRO A 1 75  ? 31.308  84.666  -19.700 1.00 50.55  ? 116 PRO A O     1 
ATOM   547  C  CB    . PRO A 1 75  ? 31.538  84.057  -22.426 1.00 50.15  ? 116 PRO A CB    1 
ATOM   548  C  CG    . PRO A 1 75  ? 30.442  83.191  -23.030 1.00 50.49  ? 116 PRO A CG    1 
ATOM   549  C  CD    . PRO A 1 75  ? 30.609  81.775  -22.529 1.00 49.73  ? 116 PRO A CD    1 
ATOM   550  N  N     . ASN A 1 76  ? 31.446  82.492  -19.128 1.00 44.83  ? 117 ASN A N     1 
ATOM   551  C  CA    . ASN A 1 76  ? 30.946  82.697  -17.773 1.00 42.63  ? 117 ASN A CA    1 
ATOM   552  C  C     . ASN A 1 76  ? 31.868  82.031  -16.760 1.00 41.30  ? 117 ASN A C     1 
ATOM   553  O  O     . ASN A 1 76  ? 31.537  80.991  -16.194 1.00 40.27  ? 117 ASN A O     1 
ATOM   554  C  CB    . ASN A 1 76  ? 29.521  82.156  -17.634 1.00 38.14  ? 117 ASN A CB    1 
ATOM   555  C  CG    . ASN A 1 76  ? 28.909  82.461  -16.278 1.00 40.55  ? 117 ASN A CG    1 
ATOM   556  O  OD1   . ASN A 1 76  ? 29.304  83.414  -15.605 1.00 42.31  ? 117 ASN A OD1   1 
ATOM   557  N  ND2   . ASN A 1 76  ? 27.941  81.649  -15.869 1.00 40.02  ? 117 ASN A ND2   1 
ATOM   558  N  N     . GLU A 1 77  ? 33.032  82.635  -16.545 1.00 47.55  ? 118 GLU A N     1 
ATOM   559  C  CA    . GLU A 1 77  ? 34.063  82.047  -15.697 1.00 48.32  ? 118 GLU A CA    1 
ATOM   560  C  C     . GLU A 1 77  ? 33.938  82.487  -14.242 1.00 45.77  ? 118 GLU A C     1 
ATOM   561  O  O     . GLU A 1 77  ? 33.269  83.473  -13.936 1.00 43.37  ? 118 GLU A O     1 
ATOM   562  C  CB    . GLU A 1 77  ? 35.453  82.411  -16.225 1.00 46.53  ? 118 GLU A CB    1 
ATOM   563  C  CG    . GLU A 1 77  ? 35.639  82.174  -17.716 1.00 53.62  ? 118 GLU A CG    1 
ATOM   564  C  CD    . GLU A 1 77  ? 37.074  82.386  -18.163 1.00 58.42  ? 118 GLU A CD    1 
ATOM   565  O  OE1   . GLU A 1 77  ? 37.990  81.856  -17.498 1.00 60.14  ? 118 GLU A OE1   1 
ATOM   566  O  OE2   . GLU A 1 77  ? 37.287  83.086  -19.176 1.00 57.24  ? 118 GLU A OE2   1 
ATOM   567  N  N     . MET A 1 78  ? 34.590  81.746  -13.351 1.00 47.71  ? 119 MET A N     1 
ATOM   568  C  CA    . MET A 1 78  ? 34.625  82.088  -11.934 1.00 44.49  ? 119 MET A CA    1 
ATOM   569  C  C     . MET A 1 78  ? 35.725  83.111  -11.669 1.00 46.57  ? 119 MET A C     1 
ATOM   570  O  O     . MET A 1 78  ? 36.904  82.831  -11.881 1.00 48.19  ? 119 MET A O     1 
ATOM   571  C  CB    . MET A 1 78  ? 34.849  80.836  -11.081 1.00 45.91  ? 119 MET A CB    1 
ATOM   572  C  CG    . MET A 1 78  ? 34.913  81.101  -9.585  1.00 49.33  ? 119 MET A CG    1 
ATOM   573  S  SD    . MET A 1 78  ? 33.347  80.800  -8.740  1.00 59.99  ? 119 MET A SD    1 
ATOM   574  C  CE    . MET A 1 78  ? 33.191  79.024  -8.921  1.00 60.18  ? 119 MET A CE    1 
ATOM   575  N  N     . VAL A 1 79  ? 35.337  84.297  -11.211 1.00 41.99  ? 120 VAL A N     1 
ATOM   576  C  CA    . VAL A 1 79  ? 36.304  85.356  -10.950 1.00 41.38  ? 120 VAL A CA    1 
ATOM   577  C  C     . VAL A 1 79  ? 36.535  85.513  -9.453  1.00 39.73  ? 120 VAL A C     1 
ATOM   578  O  O     . VAL A 1 79  ? 35.585  85.570  -8.673  1.00 41.73  ? 120 VAL A O     1 
ATOM   579  C  CB    . VAL A 1 79  ? 35.846  86.703  -11.541 1.00 45.77  ? 120 VAL A CB    1 
ATOM   580  C  CG1   . VAL A 1 79  ? 36.976  87.720  -11.473 1.00 45.49  ? 120 VAL A CG1   1 
ATOM   581  C  CG2   . VAL A 1 79  ? 35.375  86.519  -12.977 1.00 40.95  ? 120 VAL A CG2   1 
ATOM   582  N  N     . ILE A 1 80  ? 37.804  85.574  -9.060  1.00 40.65  ? 121 ILE A N     1 
ATOM   583  C  CA    . ILE A 1 80  ? 38.177  85.692  -7.654  1.00 40.45  ? 121 ILE A CA    1 
ATOM   584  C  C     . ILE A 1 80  ? 38.399  87.148  -7.265  1.00 39.94  ? 121 ILE A C     1 
ATOM   585  O  O     . ILE A 1 80  ? 39.111  87.878  -7.954  1.00 40.71  ? 121 ILE A O     1 
ATOM   586  C  CB    . ILE A 1 80  ? 39.464  84.899  -7.337  1.00 43.77  ? 121 ILE A CB    1 
ATOM   587  C  CG1   . ILE A 1 80  ? 39.379  83.477  -7.894  1.00 47.18  ? 121 ILE A CG1   1 
ATOM   588  C  CG2   . ILE A 1 80  ? 39.726  84.879  -5.837  1.00 39.18  ? 121 ILE A CG2   1 
ATOM   589  C  CD1   . ILE A 1 80  ? 38.277  82.647  -7.282  1.00 48.39  ? 121 ILE A CD1   1 
ATOM   590  N  N     . CYS A 1 81  ? 37.792  87.566  -6.158  1.00 40.73  ? 122 CYS A N     1 
ATOM   591  C  CA    . CYS A 1 81  ? 37.993  88.915  -5.645  1.00 40.47  ? 122 CYS A CA    1 
ATOM   592  C  C     . CYS A 1 81  ? 39.394  89.059  -5.062  1.00 42.09  ? 122 CYS A C     1 
ATOM   593  O  O     . CYS A 1 81  ? 39.814  88.255  -4.233  1.00 39.47  ? 122 CYS A O     1 
ATOM   594  C  CB    . CYS A 1 81  ? 36.944  89.256  -4.587  1.00 40.94  ? 122 CYS A CB    1 
ATOM   595  S  SG    . CYS A 1 81  ? 37.114  90.918  -3.898  1.00 35.12  ? 122 CYS A SG    1 
ATOM   596  N  N     . ASP A 1 82  ? 40.112  90.090  -5.490  1.00 43.17  ? 123 ASP A N     1 
ATOM   597  C  CA    . ASP A 1 82  ? 41.501  90.266  -5.082  1.00 44.61  ? 123 ASP A CA    1 
ATOM   598  C  C     . ASP A 1 82  ? 41.647  90.838  -3.675  1.00 42.64  ? 123 ASP A C     1 
ATOM   599  O  O     . ASP A 1 82  ? 42.758  91.141  -3.239  1.00 47.54  ? 123 ASP A O     1 
ATOM   600  C  CB    . ASP A 1 82  ? 42.230  91.157  -6.085  1.00 48.10  ? 123 ASP A CB    1 
ATOM   601  C  CG    . ASP A 1 82  ? 42.741  90.380  -7.282  1.00 58.72  ? 123 ASP A CG    1 
ATOM   602  O  OD1   . ASP A 1 82  ? 43.468  89.384  -7.075  1.00 59.34  ? 123 ASP A OD1   1 
ATOM   603  O  OD2   . ASP A 1 82  ? 42.410  90.754  -8.426  1.00 58.21  ? 123 ASP A OD2   1 
ATOM   604  N  N     . LYS A 1 83  ? 40.533  90.978  -2.964  1.00 42.98  ? 124 LYS A N     1 
ATOM   605  C  CA    . LYS A 1 83  ? 40.583  91.460  -1.588  1.00 44.61  ? 124 LYS A CA    1 
ATOM   606  C  C     . LYS A 1 83  ? 40.042  90.430  -0.600  1.00 44.79  ? 124 LYS A C     1 
ATOM   607  O  O     . LYS A 1 83  ? 40.744  90.026  0.327   1.00 45.08  ? 124 LYS A O     1 
ATOM   608  C  CB    . LYS A 1 83  ? 39.813  92.773  -1.446  1.00 48.96  ? 124 LYS A CB    1 
ATOM   609  C  CG    . LYS A 1 83  ? 39.910  93.379  -0.056  1.00 48.59  ? 124 LYS A CG    1 
ATOM   610  C  CD    . LYS A 1 83  ? 39.328  94.778  -0.013  1.00 45.59  ? 124 LYS A CD    1 
ATOM   611  C  CE    . LYS A 1 83  ? 39.501  95.397  1.363   1.00 47.31  ? 124 LYS A CE    1 
ATOM   612  N  NZ    . LYS A 1 83  ? 38.764  94.637  2.412   1.00 47.10  ? 124 LYS A NZ    1 
ATOM   613  N  N     . CYS A 1 84  ? 38.796  90.008  -0.793  1.00 44.07  ? 125 CYS A N     1 
ATOM   614  C  CA    . CYS A 1 84  ? 38.175  89.070  0.138   1.00 45.03  ? 125 CYS A CA    1 
ATOM   615  C  C     . CYS A 1 84  ? 38.375  87.622  -0.303  1.00 42.01  ? 125 CYS A C     1 
ATOM   616  O  O     . CYS A 1 84  ? 38.053  86.690  0.435   1.00 46.69  ? 125 CYS A O     1 
ATOM   617  C  CB    . CYS A 1 84  ? 36.682  89.375  0.300   1.00 35.13  ? 125 CYS A CB    1 
ATOM   618  S  SG    . CYS A 1 84  ? 35.641  88.945  -1.110  1.00 43.19  ? 125 CYS A SG    1 
ATOM   619  N  N     . GLY A 1 85  ? 38.909  87.440  -1.507  1.00 41.50  ? 126 GLY A N     1 
ATOM   620  C  CA    . GLY A 1 85  ? 39.255  86.117  -1.998  1.00 44.42  ? 126 GLY A CA    1 
ATOM   621  C  C     . GLY A 1 85  ? 38.077  85.282  -2.457  1.00 44.56  ? 126 GLY A C     1 
ATOM   622  O  O     . GLY A 1 85  ? 38.250  84.151  -2.913  1.00 45.37  ? 126 GLY A O     1 
ATOM   623  N  N     . GLN A 1 86  ? 36.875  85.836  -2.346  1.00 42.22  ? 127 GLN A N     1 
ATOM   624  C  CA    . GLN A 1 86  ? 35.669  85.101  -2.705  1.00 41.73  ? 127 GLN A CA    1 
ATOM   625  C  C     . GLN A 1 86  ? 35.456  85.050  -4.216  1.00 40.26  ? 127 GLN A C     1 
ATOM   626  O  O     . GLN A 1 86  ? 35.841  85.965  -4.944  1.00 36.97  ? 127 GLN A O     1 
ATOM   627  C  CB    . GLN A 1 86  ? 34.453  85.716  -2.016  1.00 43.97  ? 127 GLN A CB    1 
ATOM   628  C  CG    . GLN A 1 86  ? 34.473  85.569  -0.503  1.00 50.36  ? 127 GLN A CG    1 
ATOM   629  C  CD    . GLN A 1 86  ? 33.086  85.631  0.106   1.00 59.65  ? 127 GLN A CD    1 
ATOM   630  O  OE1   . GLN A 1 86  ? 32.477  84.600  0.396   1.00 71.43  ? 127 GLN A OE1   1 
ATOM   631  N  NE2   . GLN A 1 86  ? 32.579  86.842  0.303   1.00 62.55  ? 127 GLN A NE2   1 
ATOM   632  N  N     . GLY A 1 87  ? 34.839  83.966  -4.677  1.00 40.59  ? 128 GLY A N     1 
ATOM   633  C  CA    . GLY A 1 87  ? 34.648  83.736  -6.097  1.00 41.84  ? 128 GLY A CA    1 
ATOM   634  C  C     . GLY A 1 87  ? 33.253  84.067  -6.590  1.00 41.20  ? 128 GLY A C     1 
ATOM   635  O  O     . GLY A 1 87  ? 32.263  83.860  -5.886  1.00 41.40  ? 128 GLY A O     1 
ATOM   636  N  N     . TYR A 1 88  ? 33.182  84.589  -7.811  1.00 35.96  ? 129 TYR A N     1 
ATOM   637  C  CA    . TYR A 1 88  ? 31.915  84.955  -8.434  1.00 38.02  ? 129 TYR A CA    1 
ATOM   638  C  C     . TYR A 1 88  ? 31.894  84.552  -9.902  1.00 34.12  ? 129 TYR A C     1 
ATOM   639  O  O     . TYR A 1 88  ? 32.859  84.789  -10.627 1.00 36.60  ? 129 TYR A O     1 
ATOM   640  C  CB    . TYR A 1 88  ? 31.664  86.464  -8.326  1.00 37.07  ? 129 TYR A CB    1 
ATOM   641  C  CG    . TYR A 1 88  ? 31.507  86.998  -6.921  1.00 31.29  ? 129 TYR A CG    1 
ATOM   642  C  CD1   . TYR A 1 88  ? 30.248  87.213  -6.376  1.00 39.05  ? 129 TYR A CD1   1 
ATOM   643  C  CD2   . TYR A 1 88  ? 32.617  87.308  -6.146  1.00 40.13  ? 129 TYR A CD2   1 
ATOM   644  C  CE1   . TYR A 1 88  ? 30.098  87.711  -5.094  1.00 39.58  ? 129 TYR A CE1   1 
ATOM   645  C  CE2   . TYR A 1 88  ? 32.477  87.802  -4.862  1.00 37.43  ? 129 TYR A CE2   1 
ATOM   646  C  CZ    . TYR A 1 88  ? 31.216  88.003  -4.343  1.00 40.45  ? 129 TYR A CZ    1 
ATOM   647  O  OH    . TYR A 1 88  ? 31.070  88.498  -3.067  1.00 50.57  ? 129 TYR A OH    1 
ATOM   648  N  N     . HIS A 1 89  ? 30.797  83.943  -10.340 1.00 37.10  ? 130 HIS A N     1 
ATOM   649  C  CA    . HIS A 1 89  ? 30.572  83.750  -11.767 1.00 38.57  ? 130 HIS A CA    1 
ATOM   650  C  C     . HIS A 1 89  ? 30.368  85.114  -12.418 1.00 35.26  ? 130 HIS A C     1 
ATOM   651  O  O     . HIS A 1 89  ? 29.892  86.047  -11.771 1.00 33.16  ? 130 HIS A O     1 
ATOM   652  C  CB    . HIS A 1 89  ? 29.361  82.849  -12.024 1.00 37.63  ? 130 HIS A CB    1 
ATOM   653  C  CG    . HIS A 1 89  ? 29.608  81.400  -11.738 1.00 42.29  ? 130 HIS A CG    1 
ATOM   654  N  ND1   . HIS A 1 89  ? 28.886  80.693  -10.802 1.00 33.01  ? 130 HIS A ND1   1 
ATOM   655  C  CD2   . HIS A 1 89  ? 30.491  80.523  -12.272 1.00 42.84  ? 130 HIS A CD2   1 
ATOM   656  C  CE1   . HIS A 1 89  ? 29.316  79.444  -10.767 1.00 47.43  ? 130 HIS A CE1   1 
ATOM   657  N  NE2   . HIS A 1 89  ? 30.290  79.315  -11.649 1.00 48.91  ? 130 HIS A NE2   1 
ATOM   658  N  N     . GLN A 1 90  ? 30.730  85.231  -13.692 1.00 36.93  ? 131 GLN A N     1 
ATOM   659  C  CA    . GLN A 1 90  ? 30.578  86.491  -14.411 1.00 39.75  ? 131 GLN A CA    1 
ATOM   660  C  C     . GLN A 1 90  ? 29.120  86.939  -14.451 1.00 36.63  ? 131 GLN A C     1 
ATOM   661  O  O     . GLN A 1 90  ? 28.825  88.133  -14.395 1.00 36.34  ? 131 GLN A O     1 
ATOM   662  C  CB    . GLN A 1 90  ? 31.121  86.371  -15.838 1.00 35.65  ? 131 GLN A CB    1 
ATOM   663  C  CG    . GLN A 1 90  ? 32.616  86.113  -15.928 1.00 40.87  ? 131 GLN A CG    1 
ATOM   664  C  CD    . GLN A 1 90  ? 33.137  86.251  -17.346 1.00 43.80  ? 131 GLN A CD    1 
ATOM   665  O  OE1   . GLN A 1 90  ? 32.976  87.294  -17.979 1.00 44.20  ? 131 GLN A OE1   1 
ATOM   666  N  NE2   . GLN A 1 90  ? 33.755  85.193  -17.856 1.00 45.45  ? 131 GLN A NE2   1 
ATOM   667  N  N     . LEU A 1 91  ? 28.212  85.972  -14.536 1.00 33.70  ? 132 LEU A N     1 
ATOM   668  C  CA    . LEU A 1 91  ? 26.792  86.266  -14.675 1.00 37.75  ? 132 LEU A CA    1 
ATOM   669  C  C     . LEU A 1 91  ? 26.040  86.160  -13.351 1.00 39.88  ? 132 LEU A C     1 
ATOM   670  O  O     . LEU A 1 91  ? 24.818  86.310  -13.309 1.00 36.40  ? 132 LEU A O     1 
ATOM   671  C  CB    . LEU A 1 91  ? 26.164  85.331  -15.707 1.00 31.71  ? 132 LEU A CB    1 
ATOM   672  C  CG    . LEU A 1 91  ? 26.775  85.411  -17.106 1.00 35.29  ? 132 LEU A CG    1 
ATOM   673  C  CD1   . LEU A 1 91  ? 26.112  84.414  -18.040 1.00 32.25  ? 132 LEU A CD1   1 
ATOM   674  C  CD2   . LEU A 1 91  ? 26.652  86.822  -17.653 1.00 34.32  ? 132 LEU A CD2   1 
ATOM   675  N  N     . CYS A 1 92  ? 26.770  85.903  -12.272 1.00 34.83  ? 133 CYS A N     1 
ATOM   676  C  CA    . CYS A 1 92  ? 26.160  85.830  -10.950 1.00 34.82  ? 133 CYS A CA    1 
ATOM   677  C  C     . CYS A 1 92  ? 26.379  87.123  -10.173 1.00 35.04  ? 133 CYS A C     1 
ATOM   678  O  O     . CYS A 1 92  ? 25.615  87.449  -9.264  1.00 38.78  ? 133 CYS A O     1 
ATOM   679  C  CB    . CYS A 1 92  ? 26.716  84.642  -10.164 1.00 36.01  ? 133 CYS A CB    1 
ATOM   680  S  SG    . CYS A 1 92  ? 26.004  83.047  -10.623 1.00 43.52  ? 133 CYS A SG    1 
ATOM   681  N  N     . HIS A 1 93  ? 27.423  87.857  -10.540 1.00 35.34  ? 134 HIS A N     1 
ATOM   682  C  CA    . HIS A 1 93  ? 27.755  89.110  -9.875  1.00 33.96  ? 134 HIS A CA    1 
ATOM   683  C  C     . HIS A 1 93  ? 26.798  90.222  -10.296 1.00 34.10  ? 134 HIS A C     1 
ATOM   684  O  O     . HIS A 1 93  ? 26.231  90.184  -11.387 1.00 33.24  ? 134 HIS A O     1 
ATOM   685  C  CB    . HIS A 1 93  ? 29.198  89.511  -10.186 1.00 32.55  ? 134 HIS A CB    1 
ATOM   686  C  CG    . HIS A 1 93  ? 29.710  90.634  -9.340  1.00 35.30  ? 134 HIS A CG    1 
ATOM   687  N  ND1   . HIS A 1 93  ? 30.183  90.444  -8.061  1.00 42.04  ? 134 HIS A ND1   1 
ATOM   688  C  CD2   . HIS A 1 93  ? 29.822  91.961  -9.590  1.00 29.47  ? 134 HIS A CD2   1 
ATOM   689  C  CE1   . HIS A 1 93  ? 30.565  91.605  -7.558  1.00 32.94  ? 134 HIS A CE1   1 
ATOM   690  N  NE2   . HIS A 1 93  ? 30.357  92.540  -8.466  1.00 33.68  ? 134 HIS A NE2   1 
ATOM   691  N  N     . THR A 1 94  ? 26.619  91.208  -9.423  1.00 34.34  ? 135 THR A N     1 
ATOM   692  C  CA    . THR A 1 94  ? 25.771  92.355  -9.724  1.00 36.22  ? 135 THR A CA    1 
ATOM   693  C  C     . THR A 1 94  ? 26.582  93.643  -9.657  1.00 32.29  ? 135 THR A C     1 
ATOM   694  O  O     . THR A 1 94  ? 26.981  94.069  -8.573  1.00 38.62  ? 135 THR A O     1 
ATOM   695  C  CB    . THR A 1 94  ? 24.578  92.452  -8.755  1.00 37.18  ? 135 THR A CB    1 
ATOM   696  O  OG1   . THR A 1 94  ? 23.757  91.285  -8.883  1.00 35.20  ? 135 THR A OG1   1 
ATOM   697  C  CG2   . THR A 1 94  ? 23.746  93.691  -9.053  1.00 35.68  ? 135 THR A CG2   1 
ATOM   698  N  N     . PRO A 1 95  ? 26.836  94.268  -10.819 1.00 31.35  ? 136 PRO A N     1 
ATOM   699  C  CA    . PRO A 1 95  ? 26.402  93.818  -12.146 1.00 30.94  ? 136 PRO A CA    1 
ATOM   700  C  C     . PRO A 1 95  ? 27.310  92.737  -12.733 1.00 35.46  ? 136 PRO A C     1 
ATOM   701  O  O     . PRO A 1 95  ? 28.287  92.348  -12.094 1.00 37.54  ? 136 PRO A O     1 
ATOM   702  C  CB    . PRO A 1 95  ? 26.477  95.096  -12.979 1.00 32.72  ? 136 PRO A CB    1 
ATOM   703  C  CG    . PRO A 1 95  ? 27.609  95.846  -12.370 1.00 34.88  ? 136 PRO A CG    1 
ATOM   704  C  CD    . PRO A 1 95  ? 27.566  95.547  -10.888 1.00 34.78  ? 136 PRO A CD    1 
ATOM   705  N  N     . HIS A 1 96  ? 26.987  92.265  -13.933 1.00 37.56  ? 137 HIS A N     1 
ATOM   706  C  CA    . HIS A 1 96  ? 27.763  91.210  -14.581 1.00 37.99  ? 137 HIS A CA    1 
ATOM   707  C  C     . HIS A 1 96  ? 29.218  91.617  -14.781 1.00 39.02  ? 137 HIS A C     1 
ATOM   708  O  O     . HIS A 1 96  ? 29.513  92.774  -15.076 1.00 37.03  ? 137 HIS A O     1 
ATOM   709  C  CB    . HIS A 1 96  ? 27.146  90.838  -15.932 1.00 36.12  ? 137 HIS A CB    1 
ATOM   710  C  CG    . HIS A 1 96  ? 25.774  90.240  -15.824 1.00 34.94  ? 137 HIS A CG    1 
ATOM   711  N  ND1   . HIS A 1 96  ? 25.274  89.737  -14.650 1.00 32.87  ? 137 HIS A ND1   1 
ATOM   712  C  CD2   . HIS A 1 96  ? 24.806  90.074  -16.759 1.00 27.42  ? 137 HIS A CD2   1 
ATOM   713  C  CE1   . HIS A 1 96  ? 24.046  89.279  -14.858 1.00 32.89  ? 137 HIS A CE1   1 
ATOM   714  N  NE2   . HIS A 1 96  ? 23.743  89.473  -16.124 1.00 34.20  ? 137 HIS A NE2   1 
ATOM   715  N  N     . ILE A 1 97  ? 30.122  90.657  -14.617 1.00 39.03  ? 138 ILE A N     1 
ATOM   716  C  CA    . ILE A 1 97  ? 31.544  90.905  -14.813 1.00 41.98  ? 138 ILE A CA    1 
ATOM   717  C  C     . ILE A 1 97  ? 31.912  90.785  -16.284 1.00 44.60  ? 138 ILE A C     1 
ATOM   718  O  O     . ILE A 1 97  ? 31.745  89.727  -16.889 1.00 39.94  ? 138 ILE A O     1 
ATOM   719  C  CB    . ILE A 1 97  ? 32.412  89.926  -14.004 1.00 38.94  ? 138 ILE A CB    1 
ATOM   720  C  CG1   . ILE A 1 97  ? 31.935  89.858  -12.554 1.00 37.58  ? 138 ILE A CG1   1 
ATOM   721  C  CG2   . ILE A 1 97  ? 33.881  90.327  -14.083 1.00 39.67  ? 138 ILE A CG2   1 
ATOM   722  C  CD1   . ILE A 1 97  ? 32.578  88.747  -11.759 1.00 37.45  ? 138 ILE A CD1   1 
ATOM   723  N  N     . ASP A 1 98  ? 32.413  91.875  -16.855 1.00 49.31  ? 139 ASP A N     1 
ATOM   724  C  CA    . ASP A 1 98  ? 32.823  91.879  -18.251 1.00 46.50  ? 139 ASP A CA    1 
ATOM   725  C  C     . ASP A 1 98  ? 34.043  90.984  -18.439 1.00 53.04  ? 139 ASP A C     1 
ATOM   726  O  O     . ASP A 1 98  ? 34.885  90.875  -17.547 1.00 51.42  ? 139 ASP A O     1 
ATOM   727  C  CB    . ASP A 1 98  ? 33.128  93.303  -18.719 1.00 51.10  ? 139 ASP A CB    1 
ATOM   728  C  CG    . ASP A 1 98  ? 33.121  93.434  -20.228 1.00 59.77  ? 139 ASP A CG    1 
ATOM   729  O  OD1   . ASP A 1 98  ? 32.146  93.996  -20.771 1.00 64.72  ? 139 ASP A OD1   1 
ATOM   730  O  OD2   . ASP A 1 98  ? 34.084  92.968  -20.873 1.00 63.58  ? 139 ASP A OD2   1 
ATOM   731  N  N     . CYS A 1 99  ? 34.133  90.348  -19.603 1.00 53.89  ? 140 CYS A N     1 
ATOM   732  C  CA    . CYS A 1 99  ? 35.245  89.452  -19.909 1.00 60.39  ? 140 CYS A CA    1 
ATOM   733  C  C     . CYS A 1 99  ? 36.559  90.216  -20.039 1.00 61.78  ? 140 CYS A C     1 
ATOM   734  O  O     . CYS A 1 99  ? 37.636  89.618  -20.059 1.00 66.86  ? 140 CYS A O     1 
ATOM   735  C  CB    . CYS A 1 99  ? 34.961  88.670  -21.192 1.00 56.37  ? 140 CYS A CB    1 
ATOM   736  S  SG    . CYS A 1 99  ? 34.466  89.702  -22.593 1.00 79.87  ? 140 CYS A SG    1 
ATOM   737  N  N     . SER A 1 100 ? 36.458  91.539  -20.130 1.00 59.66  ? 141 SER A N     1 
ATOM   738  C  CA    . SER A 1 100 ? 37.625  92.410  -20.179 1.00 60.21  ? 141 SER A CA    1 
ATOM   739  C  C     . SER A 1 100 ? 38.439  92.301  -18.897 1.00 61.68  ? 141 SER A C     1 
ATOM   740  O  O     . SER A 1 100 ? 39.664  92.423  -18.914 1.00 66.50  ? 141 SER A O     1 
ATOM   741  C  CB    . SER A 1 100 ? 37.199  93.861  -20.402 1.00 60.91  ? 141 SER A CB    1 
ATOM   742  O  OG    . SER A 1 100 ? 36.208  93.950  -21.412 1.00 71.42  ? 141 SER A OG    1 
ATOM   743  N  N     . VAL A 1 101 ? 37.743  92.075  -17.787 1.00 59.94  ? 142 VAL A N     1 
ATOM   744  C  CA    . VAL A 1 101 ? 38.371  91.968  -16.475 1.00 60.94  ? 142 VAL A CA    1 
ATOM   745  C  C     . VAL A 1 101 ? 39.383  90.827  -16.427 1.00 63.55  ? 142 VAL A C     1 
ATOM   746  O  O     . VAL A 1 101 ? 40.486  90.983  -15.902 1.00 66.41  ? 142 VAL A O     1 
ATOM   747  C  CB    . VAL A 1 101 ? 37.313  91.762  -15.370 1.00 51.57  ? 142 VAL A CB    1 
ATOM   748  C  CG1   . VAL A 1 101 ? 37.978  91.523  -14.023 1.00 45.53  ? 142 VAL A CG1   1 
ATOM   749  C  CG2   . VAL A 1 101 ? 36.374  92.959  -15.307 1.00 50.26  ? 142 VAL A CG2   1 
ATOM   750  N  N     . ILE A 1 102 ? 39.005  89.683  -16.988 1.00 58.85  ? 143 ILE A N     1 
ATOM   751  C  CA    . ILE A 1 102 ? 39.871  88.512  -16.999 1.00 62.89  ? 143 ILE A CA    1 
ATOM   752  C  C     . ILE A 1 102 ? 41.033  88.701  -17.975 1.00 66.70  ? 143 ILE A C     1 
ATOM   753  O  O     . ILE A 1 102 ? 42.082  88.070  -17.840 1.00 66.62  ? 143 ILE A O     1 
ATOM   754  C  CB    . ILE A 1 102 ? 39.083  87.239  -17.369 1.00 66.23  ? 143 ILE A CB    1 
ATOM   755  C  CG1   . ILE A 1 102 ? 37.720  87.241  -16.673 1.00 64.79  ? 143 ILE A CG1   1 
ATOM   756  C  CG2   . ILE A 1 102 ? 39.872  85.990  -17.006 1.00 60.50  ? 143 ILE A CG2   1 
ATOM   757  C  CD1   . ILE A 1 102 ? 36.901  85.997  -16.920 1.00 56.12  ? 143 ILE A CD1   1 
ATOM   758  N  N     . ASP A 1 103 ? 40.845  89.584  -18.951 1.00 67.59  ? 144 ASP A N     1 
ATOM   759  C  CA    . ASP A 1 103 ? 41.880  89.869  -19.940 1.00 72.02  ? 144 ASP A CA    1 
ATOM   760  C  C     . ASP A 1 103 ? 42.813  90.988  -19.484 1.00 73.49  ? 144 ASP A C     1 
ATOM   761  O  O     . ASP A 1 103 ? 43.211  91.834  -20.285 1.00 71.52  ? 144 ASP A O     1 
ATOM   762  C  CB    . ASP A 1 103 ? 41.249  90.243  -21.285 1.00 67.04  ? 144 ASP A CB    1 
ATOM   763  C  CG    . ASP A 1 103 ? 40.370  89.142  -21.846 1.00 73.50  ? 144 ASP A CG    1 
ATOM   764  O  OD1   . ASP A 1 103 ? 40.540  87.976  -21.434 1.00 78.30  ? 144 ASP A OD1   1 
ATOM   765  O  OD2   . ASP A 1 103 ? 39.511  89.442  -22.702 1.00 70.00  ? 144 ASP A OD2   1 
ATOM   766  N  N     . SER A 1 104 ? 43.164  90.993  -18.202 1.00 72.12  ? 145 SER A N     1 
ATOM   767  C  CA    . SER A 1 104 ? 44.026  92.041  -17.666 1.00 75.29  ? 145 SER A CA    1 
ATOM   768  C  C     . SER A 1 104 ? 44.812  91.578  -16.445 1.00 78.55  ? 145 SER A C     1 
ATOM   769  O  O     . SER A 1 104 ? 44.455  90.594  -15.797 1.00 77.79  ? 145 SER A O     1 
ATOM   770  C  CB    . SER A 1 104 ? 43.200  93.276  -17.302 1.00 72.88  ? 145 SER A CB    1 
ATOM   771  O  OG    . SER A 1 104 ? 42.391  93.031  -16.164 1.00 75.67  ? 145 SER A OG    1 
ATOM   772  N  N     . ASP A 1 105 ? 45.884  92.302  -16.142 1.00 83.62  ? 146 ASP A N     1 
ATOM   773  C  CA    . ASP A 1 105 ? 46.693  92.039  -14.959 1.00 84.68  ? 146 ASP A CA    1 
ATOM   774  C  C     . ASP A 1 105 ? 46.143  92.819  -13.769 1.00 81.41  ? 146 ASP A C     1 
ATOM   775  O  O     . ASP A 1 105 ? 46.437  92.505  -12.614 1.00 82.08  ? 146 ASP A O     1 
ATOM   776  C  CB    . ASP A 1 105 ? 48.158  92.406  -15.219 1.00 88.32  ? 146 ASP A CB    1 
ATOM   777  C  CG    . ASP A 1 105 ? 49.024  92.278  -13.980 1.00 91.07  ? 146 ASP A CG    1 
ATOM   778  O  OD1   . ASP A 1 105 ? 49.329  91.135  -13.580 1.00 88.51  ? 146 ASP A OD1   1 
ATOM   779  O  OD2   . ASP A 1 105 ? 49.402  93.322  -13.407 1.00 95.06  ? 146 ASP A OD2   1 
ATOM   780  N  N     . GLU A 1 106 ? 45.333  93.832  -14.062 1.00 81.18  ? 147 GLU A N     1 
ATOM   781  C  CA    . GLU A 1 106 ? 44.741  94.669  -13.026 1.00 77.40  ? 147 GLU A CA    1 
ATOM   782  C  C     . GLU A 1 106 ? 43.835  93.870  -12.097 1.00 69.66  ? 147 GLU A C     1 
ATOM   783  O  O     . GLU A 1 106 ? 43.178  92.917  -12.516 1.00 70.51  ? 147 GLU A O     1 
ATOM   784  C  CB    . GLU A 1 106 ? 43.954  95.822  -13.648 1.00 72.02  ? 147 GLU A CB    1 
ATOM   785  C  CG    . GLU A 1 106 ? 44.600  97.182  -13.451 1.00 78.41  ? 147 GLU A CG    1 
ATOM   786  C  CD    . GLU A 1 106 ? 43.585  98.309  -13.407 1.00 86.39  ? 147 GLU A CD    1 
ATOM   787  O  OE1   . GLU A 1 106 ? 42.729  98.380  -14.315 1.00 87.70  ? 147 GLU A OE1   1 
ATOM   788  O  OE2   . GLU A 1 106 ? 43.638  99.119  -12.457 1.00 79.36  ? 147 GLU A OE2   1 
ATOM   789  N  N     . LYS A 1 107 ? 43.810  94.273  -10.831 1.00 66.95  ? 148 LYS A N     1 
ATOM   790  C  CA    . LYS A 1 107 ? 43.020  93.592  -9.815  1.00 62.90  ? 148 LYS A CA    1 
ATOM   791  C  C     . LYS A 1 107 ? 41.523  93.710  -10.065 1.00 53.24  ? 148 LYS A C     1 
ATOM   792  O  O     . LYS A 1 107 ? 41.070  94.587  -10.802 1.00 47.91  ? 148 LYS A O     1 
ATOM   793  C  CB    . LYS A 1 107 ? 43.346  94.151  -8.429  1.00 62.78  ? 148 LYS A CB    1 
ATOM   794  C  CG    . LYS A 1 107 ? 44.811  94.058  -8.044  1.00 65.27  ? 148 LYS A CG    1 
ATOM   795  C  CD    . LYS A 1 107 ? 45.280  92.616  -8.021  1.00 64.62  ? 148 LYS A CD    1 
ATOM   796  C  CE    . LYS A 1 107 ? 46.645  92.497  -7.371  1.00 65.79  ? 148 LYS A CE    1 
ATOM   797  N  NZ    . LYS A 1 107 ? 46.599  92.897  -5.938  1.00 68.90  ? 148 LYS A NZ    1 
ATOM   798  N  N     . TRP A 1 108 ? 40.759  92.822  -9.440  1.00 47.74  ? 149 TRP A N     1 
ATOM   799  C  CA    . TRP A 1 108 ? 39.308  92.931  -9.454  1.00 49.76  ? 149 TRP A CA    1 
ATOM   800  C  C     . TRP A 1 108 ? 38.740  92.780  -8.051  1.00 44.43  ? 149 TRP A C     1 
ATOM   801  O  O     . TRP A 1 108 ? 39.061  91.828  -7.336  1.00 42.16  ? 149 TRP A O     1 
ATOM   802  C  CB    . TRP A 1 108 ? 38.683  91.890  -10.381 1.00 41.90  ? 149 TRP A CB    1 
ATOM   803  C  CG    . TRP A 1 108 ? 37.183  91.928  -10.368 1.00 40.95  ? 149 TRP A CG    1 
ATOM   804  C  CD1   . TRP A 1 108 ? 36.378  92.774  -11.076 1.00 42.37  ? 149 TRP A CD1   1 
ATOM   805  C  CD2   . TRP A 1 108 ? 36.309  91.090  -9.603  1.00 37.43  ? 149 TRP A CD2   1 
ATOM   806  N  NE1   . TRP A 1 108 ? 35.058  92.512  -10.801 1.00 37.79  ? 149 TRP A NE1   1 
ATOM   807  C  CE2   . TRP A 1 108 ? 34.989  91.482  -9.900  1.00 37.15  ? 149 TRP A CE2   1 
ATOM   808  C  CE3   . TRP A 1 108 ? 36.515  90.045  -8.698  1.00 35.75  ? 149 TRP A CE3   1 
ATOM   809  C  CZ2   . TRP A 1 108 ? 33.880  90.867  -9.322  1.00 38.54  ? 149 TRP A CZ2   1 
ATOM   810  C  CZ3   . TRP A 1 108 ? 35.414  89.435  -8.127  1.00 35.43  ? 149 TRP A CZ3   1 
ATOM   811  C  CH2   . TRP A 1 108 ? 34.113  89.846  -8.442  1.00 36.50  ? 149 TRP A CH2   1 
ATOM   812  N  N     . LEU A 1 109 ? 37.900  93.733  -7.664  1.00 42.46  ? 150 LEU A N     1 
ATOM   813  C  CA    . LEU A 1 109 ? 37.184  93.659  -6.402  1.00 38.48  ? 150 LEU A CA    1 
ATOM   814  C  C     . LEU A 1 109 ? 35.708  93.416  -6.667  1.00 36.45  ? 150 LEU A C     1 
ATOM   815  O  O     . LEU A 1 109 ? 35.158  93.916  -7.647  1.00 33.61  ? 150 LEU A O     1 
ATOM   816  C  CB    . LEU A 1 109 ? 37.363  94.942  -5.589  1.00 39.05  ? 150 LEU A CB    1 
ATOM   817  C  CG    . LEU A 1 109 ? 38.783  95.337  -5.188  1.00 48.32  ? 150 LEU A CG    1 
ATOM   818  C  CD1   . LEU A 1 109 ? 38.752  96.340  -4.040  1.00 41.45  ? 150 LEU A CD1   1 
ATOM   819  C  CD2   . LEU A 1 109 ? 39.594  94.111  -4.818  1.00 44.89  ? 150 LEU A CD2   1 
ATOM   820  N  N     . CYS A 1 110 ? 35.069  92.642  -5.799  1.00 35.29  ? 151 CYS A N     1 
ATOM   821  C  CA    . CYS A 1 110 ? 33.632  92.437  -5.900  1.00 35.79  ? 151 CYS A CA    1 
ATOM   822  C  C     . CYS A 1 110 ? 32.896  93.686  -5.426  1.00 33.78  ? 151 CYS A C     1 
ATOM   823  O  O     . CYS A 1 110 ? 33.497  94.568  -4.812  1.00 31.87  ? 151 CYS A O     1 
ATOM   824  C  CB    . CYS A 1 110 ? 33.198  91.221  -5.084  1.00 35.50  ? 151 CYS A CB    1 
ATOM   825  S  SG    . CYS A 1 110 ? 33.371  91.416  -3.300  1.00 34.86  ? 151 CYS A SG    1 
ATOM   826  N  N     . ARG A 1 111 ? 31.599  93.752  -5.714  1.00 33.70  ? 152 ARG A N     1 
ATOM   827  C  CA    . ARG A 1 111 ? 30.764  94.891  -5.339  1.00 34.21  ? 152 ARG A CA    1 
ATOM   828  C  C     . ARG A 1 111 ? 30.875  95.206  -3.853  1.00 35.47  ? 152 ARG A C     1 
ATOM   829  O  O     . ARG A 1 111 ? 30.970  96.368  -3.456  1.00 31.98  ? 152 ARG A O     1 
ATOM   830  C  CB    . ARG A 1 111 ? 29.304  94.618  -5.703  1.00 34.90  ? 152 ARG A CB    1 
ATOM   831  C  CG    . ARG A 1 111 ? 28.345  95.728  -5.308  1.00 35.81  ? 152 ARG A CG    1 
ATOM   832  C  CD    . ARG A 1 111 ? 26.901  95.320  -5.542  1.00 32.44  ? 152 ARG A CD    1 
ATOM   833  N  NE    . ARG A 1 111 ? 25.988  96.444  -5.360  1.00 37.35  ? 152 ARG A NE    1 
ATOM   834  C  CZ    . ARG A 1 111 ? 25.668  97.302  -6.322  1.00 32.02  ? 152 ARG A CZ    1 
ATOM   835  N  NH1   . ARG A 1 111 ? 26.188  97.163  -7.535  1.00 35.23  ? 152 ARG A NH1   1 
ATOM   836  N  NH2   . ARG A 1 111 ? 24.830  98.299  -6.073  1.00 36.96  ? 152 ARG A NH2   1 
ATOM   837  N  N     . GLN A 1 112 ? 30.867  94.154  -3.043  1.00 27.70  ? 153 GLN A N     1 
ATOM   838  C  CA    . GLN A 1 112 ? 30.992  94.272  -1.598  1.00 35.49  ? 153 GLN A CA    1 
ATOM   839  C  C     . GLN A 1 112 ? 32.278  94.990  -1.190  1.00 35.69  ? 153 GLN A C     1 
ATOM   840  O  O     . GLN A 1 112 ? 32.255  95.911  -0.374  1.00 35.45  ? 153 GLN A O     1 
ATOM   841  C  CB    . GLN A 1 112 ? 30.936  92.882  -0.966  1.00 45.81  ? 153 GLN A CB    1 
ATOM   842  C  CG    . GLN A 1 112 ? 31.086  92.860  0.540   1.00 44.19  ? 153 GLN A CG    1 
ATOM   843  C  CD    . GLN A 1 112 ? 31.211  91.447  1.079   1.00 57.73  ? 153 GLN A CD    1 
ATOM   844  O  OE1   . GLN A 1 112 ? 32.202  90.759  0.827   1.00 56.83  ? 153 GLN A OE1   1 
ATOM   845  N  NE2   . GLN A 1 112 ? 30.199  91.001  1.814   1.00 60.44  ? 153 GLN A NE2   1 
ATOM   846  N  N     . CYS A 1 113 ? 33.396  94.567  -1.772  1.00 34.63  ? 154 CYS A N     1 
ATOM   847  C  CA    . CYS A 1 113 ? 34.697  95.140  -1.443  1.00 33.68  ? 154 CYS A CA    1 
ATOM   848  C  C     . CYS A 1 113 ? 34.887  96.515  -2.075  1.00 31.73  ? 154 CYS A C     1 
ATOM   849  O  O     . CYS A 1 113 ? 35.591  97.365  -1.529  1.00 36.37  ? 154 CYS A O     1 
ATOM   850  C  CB    . CYS A 1 113 ? 35.823  94.198  -1.880  1.00 30.49  ? 154 CYS A CB    1 
ATOM   851  S  SG    . CYS A 1 113 ? 35.990  92.716  -0.855  1.00 40.86  ? 154 CYS A SG    1 
ATOM   852  N  N     . VAL A 1 114 ? 34.259  96.730  -3.226  1.00 32.20  ? 155 VAL A N     1 
ATOM   853  C  CA    . VAL A 1 114 ? 34.331  98.023  -3.894  1.00 32.29  ? 155 VAL A CA    1 
ATOM   854  C  C     . VAL A 1 114 ? 33.695  99.098  -3.020  1.00 30.28  ? 155 VAL A C     1 
ATOM   855  O  O     . VAL A 1 114 ? 34.287  100.152 -2.788  1.00 32.24  ? 155 VAL A O     1 
ATOM   856  C  CB    . VAL A 1 114 ? 33.642  97.991  -5.270  1.00 33.35  ? 155 VAL A CB    1 
ATOM   857  C  CG1   . VAL A 1 114 ? 33.421  99.401  -5.788  1.00 31.28  ? 155 VAL A CG1   1 
ATOM   858  C  CG2   . VAL A 1 114 ? 34.469  97.181  -6.258  1.00 34.05  ? 155 VAL A CG2   1 
ATOM   859  N  N     . PHE A 1 115 ? 32.495  98.816  -2.522  1.00 31.44  ? 156 PHE A N     1 
ATOM   860  C  CA    . PHE A 1 115 ? 31.806  99.732  -1.621  1.00 31.07  ? 156 PHE A CA    1 
ATOM   861  C  C     . PHE A 1 115 ? 32.595  99.960  -0.338  1.00 34.19  ? 156 PHE A C     1 
ATOM   862  O  O     . PHE A 1 115 ? 32.676  101.082 0.160   1.00 32.24  ? 156 PHE A O     1 
ATOM   863  C  CB    . PHE A 1 115 ? 30.412  99.200  -1.285  1.00 32.48  ? 156 PHE A CB    1 
ATOM   864  C  CG    . PHE A 1 115 ? 29.353  99.632  -2.252  1.00 34.30  ? 156 PHE A CG    1 
ATOM   865  C  CD1   . PHE A 1 115 ? 29.246  99.032  -3.494  1.00 31.50  ? 156 PHE A CD1   1 
ATOM   866  C  CD2   . PHE A 1 115 ? 28.462  100.637 -1.919  1.00 26.83  ? 156 PHE A CD2   1 
ATOM   867  C  CE1   . PHE A 1 115 ? 28.271  99.429  -4.387  1.00 30.49  ? 156 PHE A CE1   1 
ATOM   868  C  CE2   . PHE A 1 115 ? 27.485  101.039 -2.807  1.00 32.97  ? 156 PHE A CE2   1 
ATOM   869  C  CZ    . PHE A 1 115 ? 27.389  100.434 -4.043  1.00 26.81  ? 156 PHE A CZ    1 
ATOM   870  N  N     . ALA A 1 116 ? 33.186  98.891  0.185   1.00 33.55  ? 157 ALA A N     1 
ATOM   871  C  CA    . ALA A 1 116 ? 33.891  98.951  1.459   1.00 35.21  ? 157 ALA A CA    1 
ATOM   872  C  C     . ALA A 1 116 ? 35.138  99.830  1.394   1.00 31.72  ? 157 ALA A C     1 
ATOM   873  O  O     . ALA A 1 116 ? 35.499  100.475 2.377   1.00 32.79  ? 157 ALA A O     1 
ATOM   874  C  CB    . ALA A 1 116 ? 34.262  97.548  1.918   1.00 31.11  ? 157 ALA A CB    1 
ATOM   875  N  N     . THR A 1 117 ? 35.788  99.861  0.236   1.00 30.78  ? 158 THR A N     1 
ATOM   876  C  CA    . THR A 1 117 ? 37.048  100.585 0.097   1.00 36.08  ? 158 THR A CA    1 
ATOM   877  C  C     . THR A 1 117 ? 36.867  102.003 -0.444  1.00 36.38  ? 158 THR A C     1 
ATOM   878  O  O     . THR A 1 117 ? 37.817  102.785 -0.474  1.00 39.20  ? 158 THR A O     1 
ATOM   879  C  CB    . THR A 1 117 ? 38.027  99.828  -0.827  1.00 36.70  ? 158 THR A CB    1 
ATOM   880  O  OG1   . THR A 1 117 ? 37.418  99.616  -2.106  1.00 36.23  ? 158 THR A OG1   1 
ATOM   881  C  CG2   . THR A 1 117 ? 38.398  98.485  -0.222  1.00 37.79  ? 158 THR A CG2   1 
ATOM   882  N  N     . THR A 1 118 ? 35.649  102.334 -0.860  1.00 31.61  ? 159 THR A N     1 
ATOM   883  C  CA    . THR A 1 118 ? 35.394  103.626 -1.490  1.00 32.80  ? 159 THR A CA    1 
ATOM   884  C  C     . THR A 1 118 ? 34.433  104.499 -0.686  1.00 35.94  ? 159 THR A C     1 
ATOM   885  O  O     . THR A 1 118 ? 34.667  105.698 -0.533  1.00 33.32  ? 159 THR A O     1 
ATOM   886  C  CB    . THR A 1 118 ? 34.830  103.451 -2.911  1.00 33.09  ? 159 THR A CB    1 
ATOM   887  O  OG1   . THR A 1 118 ? 33.664  102.621 -2.863  1.00 36.09  ? 159 THR A OG1   1 
ATOM   888  C  CG2   . THR A 1 118 ? 35.864  102.806 -3.818  1.00 37.04  ? 159 THR A CG2   1 
ATOM   889  N  N     . THR A 1 119 ? 33.356  103.903 -0.180  1.00 29.86  ? 160 THR A N     1 
ATOM   890  C  CA    . THR A 1 119 ? 32.383  104.646 0.618   1.00 31.79  ? 160 THR A CA    1 
ATOM   891  C  C     . THR A 1 119 ? 33.023  105.131 1.914   1.00 32.75  ? 160 THR A C     1 
ATOM   892  O  O     . THR A 1 119 ? 33.759  104.394 2.569   1.00 32.79  ? 160 THR A O     1 
ATOM   893  C  CB    . THR A 1 119 ? 31.140  103.804 0.943   1.00 25.41  ? 160 THR A CB    1 
ATOM   894  O  OG1   . THR A 1 119 ? 31.529  102.631 1.669   1.00 32.69  ? 160 THR A OG1   1 
ATOM   895  C  CG2   . THR A 1 119 ? 30.426  103.395 -0.338  1.00 28.65  ? 160 THR A CG2   1 
ATOM   896  N  N     . LYS A 1 120 ? 32.726  106.373 2.282   1.00 32.16  ? 161 LYS A N     1 
ATOM   897  C  CA    . LYS A 1 120 ? 33.470  107.060 3.329   1.00 32.63  ? 161 LYS A CA    1 
ATOM   898  C  C     . LYS A 1 120 ? 32.702  108.283 3.831   1.00 30.12  ? 161 LYS A C     1 
ATOM   899  O  O     . LYS A 1 120 ? 32.025  108.953 3.051   1.00 30.55  ? 161 LYS A O     1 
ATOM   900  C  CB    . LYS A 1 120 ? 34.846  107.463 2.788   1.00 31.31  ? 161 LYS A CB    1 
ATOM   901  C  CG    . LYS A 1 120 ? 35.711  108.281 3.727   1.00 39.49  ? 161 LYS A CG    1 
ATOM   902  C  CD    . LYS A 1 120 ? 36.962  108.768 3.008   1.00 41.41  ? 161 LYS A CD    1 
ATOM   903  C  CE    . LYS A 1 120 ? 37.818  109.644 3.906   1.00 53.23  ? 161 LYS A CE    1 
ATOM   904  N  NZ    . LYS A 1 120 ? 38.978  110.215 3.166   1.00 65.49  ? 161 LYS A NZ    1 
ATOM   905  N  N     . ARG A 1 121 ? 32.796  108.564 5.130   1.00 29.43  ? 162 ARG A N     1 
ATOM   906  C  CA    . ARG A 1 121 ? 32.162  109.750 5.706   1.00 29.57  ? 162 ARG A CA    1 
ATOM   907  C  C     . ARG A 1 121 ? 32.588  111.023 4.986   1.00 30.58  ? 162 ARG A C     1 
ATOM   908  O  O     . ARG A 1 121 ? 33.765  111.207 4.676   1.00 32.30  ? 162 ARG A O     1 
ATOM   909  C  CB    . ARG A 1 121 ? 32.491  109.882 7.193   1.00 35.97  ? 162 ARG A CB    1 
ATOM   910  C  CG    . ARG A 1 121 ? 31.619  109.061 8.118   1.00 39.81  ? 162 ARG A CG    1 
ATOM   911  C  CD    . ARG A 1 121 ? 31.688  109.616 9.531   1.00 43.03  ? 162 ARG A CD    1 
ATOM   912  N  NE    . ARG A 1 121 ? 31.257  108.646 10.532  1.00 47.46  ? 162 ARG A NE    1 
ATOM   913  C  CZ    . ARG A 1 121 ? 32.068  107.766 11.108  1.00 53.70  ? 162 ARG A CZ    1 
ATOM   914  N  NH1   . ARG A 1 121 ? 33.352  107.733 10.776  1.00 56.88  ? 162 ARG A NH1   1 
ATOM   915  N  NH2   . ARG A 1 121 ? 31.597  106.918 12.014  1.00 56.20  ? 162 ARG A NH2   1 
ATOM   916  N  N     . GLY A 1 122 ? 31.624  111.899 4.726   1.00 29.99  ? 163 GLY A N     1 
ATOM   917  C  CA    . GLY A 1 122 ? 31.897  113.147 4.039   1.00 28.08  ? 163 GLY A CA    1 
ATOM   918  C  C     . GLY A 1 122 ? 31.818  113.012 2.531   1.00 30.31  ? 163 GLY A C     1 
ATOM   919  O  O     . GLY A 1 122 ? 31.872  114.006 1.808   1.00 32.76  ? 163 GLY A O     1 
ATOM   920  N  N     . GLY A 1 123 ? 31.690  111.777 2.055   1.00 26.48  ? 164 GLY A N     1 
ATOM   921  C  CA    . GLY A 1 123 ? 31.608  111.514 0.630   1.00 26.57  ? 164 GLY A CA    1 
ATOM   922  C  C     . GLY A 1 123 ? 32.572  110.432 0.185   1.00 29.42  ? 164 GLY A C     1 
ATOM   923  O  O     . GLY A 1 123 ? 33.701  110.362 0.667   1.00 30.09  ? 164 GLY A O     1 
ATOM   924  N  N     . ALA A 1 124 ? 32.123  109.589 -0.740  1.00 28.77  ? 165 ALA A N     1 
ATOM   925  C  CA    . ALA A 1 124 ? 32.938  108.488 -1.244  1.00 30.61  ? 165 ALA A CA    1 
ATOM   926  C  C     . ALA A 1 124 ? 34.123  109.000 -2.055  1.00 31.90  ? 165 ALA A C     1 
ATOM   927  O  O     . ALA A 1 124 ? 34.135  110.150 -2.496  1.00 32.36  ? 165 ALA A O     1 
ATOM   928  C  CB    . ALA A 1 124 ? 32.089  107.542 -2.084  1.00 24.51  ? 165 ALA A CB    1 
ATOM   929  N  N     . LEU A 1 125 ? 35.118  108.136 -2.245  1.00 35.24  ? 166 LEU A N     1 
ATOM   930  C  CA    . LEU A 1 125 ? 36.319  108.487 -2.997  1.00 36.85  ? 166 LEU A CA    1 
ATOM   931  C  C     . LEU A 1 125 ? 35.978  108.869 -4.432  1.00 33.51  ? 166 LEU A C     1 
ATOM   932  O  O     . LEU A 1 125 ? 35.169  108.210 -5.084  1.00 35.47  ? 166 LEU A O     1 
ATOM   933  C  CB    . LEU A 1 125 ? 37.315  107.327 -2.990  1.00 38.07  ? 166 LEU A CB    1 
ATOM   934  C  CG    . LEU A 1 125 ? 37.851  106.894 -1.625  1.00 40.47  ? 166 LEU A CG    1 
ATOM   935  C  CD1   . LEU A 1 125 ? 38.804  105.717 -1.774  1.00 43.06  ? 166 LEU A CD1   1 
ATOM   936  C  CD2   . LEU A 1 125 ? 38.535  108.059 -0.928  1.00 41.19  ? 166 LEU A CD2   1 
ATOM   937  N  N     . LYS A 1 126 ? 36.599  109.939 -4.917  1.00 34.33  ? 167 LYS A N     1 
ATOM   938  C  CA    . LYS A 1 126 ? 36.322  110.437 -6.258  1.00 40.61  ? 167 LYS A CA    1 
ATOM   939  C  C     . LYS A 1 126 ? 37.294  109.886 -7.295  1.00 40.92  ? 167 LYS A C     1 
ATOM   940  O  O     . LYS A 1 126 ? 36.929  109.700 -8.455  1.00 41.92  ? 167 LYS A O     1 
ATOM   941  C  CB    . LYS A 1 126 ? 36.363  111.966 -6.283  1.00 41.07  ? 167 LYS A CB    1 
ATOM   942  C  CG    . LYS A 1 126 ? 35.241  112.644 -5.519  1.00 38.21  ? 167 LYS A CG    1 
ATOM   943  C  CD    . LYS A 1 126 ? 35.224  114.140 -5.802  1.00 41.81  ? 167 LYS A CD    1 
ATOM   944  C  CE    . LYS A 1 126 ? 34.045  114.822 -5.131  1.00 34.74  ? 167 LYS A CE    1 
ATOM   945  N  NZ    . LYS A 1 126 ? 34.193  114.833 -3.653  1.00 35.79  ? 167 LYS A NZ    1 
ATOM   946  N  N     . LYS A 1 127 ? 38.530  109.629 -6.881  1.00 42.91  ? 168 LYS A N     1 
ATOM   947  C  CA    . LYS A 1 127 ? 39.558  109.198 -7.822  1.00 51.60  ? 168 LYS A CA    1 
ATOM   948  C  C     . LYS A 1 127 ? 40.179  107.856 -7.447  1.00 47.44  ? 168 LYS A C     1 
ATOM   949  O  O     . LYS A 1 127 ? 40.169  107.455 -6.282  1.00 47.58  ? 168 LYS A O     1 
ATOM   950  C  CB    . LYS A 1 127 ? 40.647  110.268 -7.936  1.00 55.47  ? 168 LYS A CB    1 
ATOM   951  C  CG    . LYS A 1 127 ? 40.294  111.399 -8.895  1.00 56.24  ? 168 LYS A CG    1 
ATOM   952  C  CD    . LYS A 1 127 ? 40.342  112.759 -8.216  1.00 59.43  ? 168 LYS A CD    1 
ATOM   953  C  CE    . LYS A 1 127 ? 41.751  113.104 -7.758  1.00 65.73  ? 168 LYS A CE    1 
ATOM   954  N  NZ    . LYS A 1 127 ? 41.827  114.487 -7.205  1.00 63.67  ? 168 LYS A NZ    1 
ATOM   955  N  N     . GLY A 1 128 ? 40.718  107.170 -8.451  1.00 56.23  ? 169 GLY A N     1 
ATOM   956  C  CA    . GLY A 1 128 ? 41.311  105.858 -8.261  1.00 53.45  ? 169 GLY A CA    1 
ATOM   957  C  C     . GLY A 1 128 ? 40.538  104.779 -8.997  1.00 54.79  ? 169 GLY A C     1 
ATOM   958  O  O     . GLY A 1 128 ? 39.369  104.972 -9.331  1.00 54.87  ? 169 GLY A O     1 
ATOM   959  N  N     . PRO A 1 129 ? 41.190  103.635 -9.264  1.00 59.10  ? 170 PRO A N     1 
ATOM   960  C  CA    . PRO A 1 129 ? 40.540  102.502 -9.934  1.00 56.73  ? 170 PRO A CA    1 
ATOM   961  C  C     . PRO A 1 129 ? 39.315  101.998 -9.171  1.00 47.08  ? 170 PRO A C     1 
ATOM   962  O  O     . PRO A 1 129 ? 38.319  101.617 -9.787  1.00 48.89  ? 170 PRO A O     1 
ATOM   963  C  CB    . PRO A 1 129 ? 41.639  101.435 -9.969  1.00 59.72  ? 170 PRO A CB    1 
ATOM   964  C  CG    . PRO A 1 129 ? 42.916  102.208 -9.900  1.00 63.81  ? 170 PRO A CG    1 
ATOM   965  C  CD    . PRO A 1 129 ? 42.620  103.383 -9.015  1.00 58.37  ? 170 PRO A CD    1 
ATOM   966  N  N     . ASN A 1 130 ? 39.393  102.002 -7.845  1.00 46.21  ? 171 ASN A N     1 
ATOM   967  C  CA    . ASN A 1 130 ? 38.271  101.586 -7.012  1.00 46.25  ? 171 ASN A CA    1 
ATOM   968  C  C     . ASN A 1 130 ? 37.112  102.572 -7.103  1.00 44.48  ? 171 ASN A C     1 
ATOM   969  O  O     . ASN A 1 130 ? 35.947  102.173 -7.158  1.00 41.73  ? 171 ASN A O     1 
ATOM   970  C  CB    . ASN A 1 130 ? 38.715  101.425 -5.557  1.00 48.12  ? 171 ASN A CB    1 
ATOM   971  C  CG    . ASN A 1 130 ? 39.527  100.164 -5.332  1.00 52.76  ? 171 ASN A CG    1 
ATOM   972  O  OD1   . ASN A 1 130 ? 39.441  99.213  -6.109  1.00 54.04  ? 171 ASN A OD1   1 
ATOM   973  N  ND2   . ASN A 1 130 ? 40.314  100.146 -4.262  1.00 46.33  ? 171 ASN A ND2   1 
ATOM   974  N  N     . ALA A 1 131 ? 37.440  103.860 -7.122  1.00 42.42  ? 172 ALA A N     1 
ATOM   975  C  CA    . ALA A 1 131 ? 36.430  104.902 -7.255  1.00 42.34  ? 172 ALA A CA    1 
ATOM   976  C  C     . ALA A 1 131 ? 35.753  104.807 -8.617  1.00 41.43  ? 172 ALA A C     1 
ATOM   977  O  O     . ALA A 1 131 ? 34.556  105.066 -8.745  1.00 39.75  ? 172 ALA A O     1 
ATOM   978  C  CB    . ALA A 1 131 ? 37.049  106.278 -7.057  1.00 39.45  ? 172 ALA A CB    1 
ATOM   979  N  N     . LYS A 1 132 ? 36.525  104.426 -9.629  1.00 41.20  ? 173 LYS A N     1 
ATOM   980  C  CA    . LYS A 1 132 ? 35.988  104.244 -10.971 1.00 40.96  ? 173 LYS A CA    1 
ATOM   981  C  C     . LYS A 1 132 ? 35.032  103.053 -11.000 1.00 38.32  ? 173 LYS A C     1 
ATOM   982  O  O     . LYS A 1 132 ? 34.034  103.063 -11.721 1.00 38.43  ? 173 LYS A O     1 
ATOM   983  C  CB    . LYS A 1 132 ? 37.125  104.054 -11.984 1.00 48.22  ? 173 LYS A CB    1 
ATOM   984  C  CG    . LYS A 1 132 ? 37.143  102.695 -12.675 1.00 56.66  ? 173 LYS A CG    1 
ATOM   985  C  CD    . LYS A 1 132 ? 38.476  102.426 -13.350 1.00 63.15  ? 173 LYS A CD    1 
ATOM   986  C  CE    . LYS A 1 132 ? 38.556  100.991 -13.845 1.00 65.78  ? 173 LYS A CE    1 
ATOM   987  N  NZ    . LYS A 1 132 ? 38.329  100.016 -12.739 1.00 60.73  ? 173 LYS A NZ    1 
ATOM   988  N  N     . ALA A 1 133 ? 35.337  102.037 -10.197 1.00 38.30  ? 174 ALA A N     1 
ATOM   989  C  CA    . ALA A 1 133 ? 34.543  100.815 -10.160 1.00 36.41  ? 174 ALA A CA    1 
ATOM   990  C  C     . ALA A 1 133 ? 33.239  101.031 -9.405  1.00 30.24  ? 174 ALA A C     1 
ATOM   991  O  O     . ALA A 1 133 ? 32.212  100.441 -9.741  1.00 33.91  ? 174 ALA A O     1 
ATOM   992  C  CB    . ALA A 1 133 ? 35.341  99.684  -9.529  1.00 34.20  ? 174 ALA A CB    1 
ATOM   993  N  N     . LEU A 1 134 ? 33.290  101.877 -8.382  1.00 31.02  ? 175 LEU A N     1 
ATOM   994  C  CA    . LEU A 1 134 ? 32.103  102.215 -7.609  1.00 30.76  ? 175 LEU A CA    1 
ATOM   995  C  C     . LEU A 1 134 ? 31.073  102.917 -8.479  1.00 29.06  ? 175 LEU A C     1 
ATOM   996  O  O     . LEU A 1 134 ? 29.891  102.577 -8.455  1.00 28.38  ? 175 LEU A O     1 
ATOM   997  C  CB    . LEU A 1 134 ? 32.473  103.099 -6.419  1.00 26.87  ? 175 LEU A CB    1 
ATOM   998  C  CG    . LEU A 1 134 ? 31.285  103.673 -5.645  1.00 30.63  ? 175 LEU A CG    1 
ATOM   999  C  CD1   . LEU A 1 134 ? 30.482  102.548 -5.022  1.00 27.47  ? 175 LEU A CD1   1 
ATOM   1000 C  CD2   . LEU A 1 134 ? 31.740  104.667 -4.586  1.00 27.89  ? 175 LEU A CD2   1 
ATOM   1001 N  N     . GLN A 1 135 ? 31.532  103.894 -9.254  1.00 32.89  ? 176 GLN A N     1 
ATOM   1002 C  CA    . GLN A 1 135 ? 30.640  104.680 -10.095 1.00 36.58  ? 176 GLN A CA    1 
ATOM   1003 C  C     . GLN A 1 135 ? 29.992  103.812 -11.165 1.00 31.45  ? 176 GLN A C     1 
ATOM   1004 O  O     . GLN A 1 135 ? 28.894  104.106 -11.634 1.00 38.62  ? 176 GLN A O     1 
ATOM   1005 C  CB    . GLN A 1 135 ? 31.397  105.842 -10.738 1.00 33.18  ? 176 GLN A CB    1 
ATOM   1006 C  CG    . GLN A 1 135 ? 30.499  106.860 -11.418 1.00 40.79  ? 176 GLN A CG    1 
ATOM   1007 C  CD    . GLN A 1 135 ? 31.135  108.233 -11.494 1.00 41.19  ? 176 GLN A CD    1 
ATOM   1008 O  OE1   . GLN A 1 135 ? 31.253  108.931 -10.486 1.00 41.02  ? 176 GLN A OE1   1 
ATOM   1009 N  NE2   . GLN A 1 135 ? 31.556  108.626 -12.690 1.00 48.24  ? 176 GLN A NE2   1 
ATOM   1010 N  N     . VAL A 1 136 ? 30.677  102.737 -11.541 1.00 33.73  ? 177 VAL A N     1 
ATOM   1011 C  CA    . VAL A 1 136 ? 30.146  101.795 -12.517 1.00 36.59  ? 177 VAL A CA    1 
ATOM   1012 C  C     . VAL A 1 136 ? 29.116  100.867 -11.882 1.00 32.80  ? 177 VAL A C     1 
ATOM   1013 O  O     . VAL A 1 136 ? 27.984  100.764 -12.355 1.00 32.49  ? 177 VAL A O     1 
ATOM   1014 C  CB    . VAL A 1 136 ? 31.266  100.943 -13.153 1.00 40.91  ? 177 VAL A CB    1 
ATOM   1015 C  CG1   . VAL A 1 136 ? 30.673  99.806  -13.971 1.00 30.93  ? 177 VAL A CG1   1 
ATOM   1016 C  CG2   . VAL A 1 136 ? 32.170  101.808 -14.015 1.00 44.55  ? 177 VAL A CG2   1 
ATOM   1017 N  N     . MET A 1 137 ? 29.516  100.203 -10.802 1.00 31.08  ? 178 MET A N     1 
ATOM   1018 C  CA    . MET A 1 137 ? 28.693  99.169  -10.182 1.00 34.34  ? 178 MET A CA    1 
ATOM   1019 C  C     . MET A 1 137 ? 27.425  99.700  -9.517  1.00 30.17  ? 178 MET A C     1 
ATOM   1020 O  O     . MET A 1 137 ? 26.415  98.999  -9.454  1.00 28.24  ? 178 MET A O     1 
ATOM   1021 C  CB    . MET A 1 137 ? 29.515  98.393  -9.150  1.00 32.92  ? 178 MET A CB    1 
ATOM   1022 C  CG    . MET A 1 137 ? 30.616  97.538  -9.747  1.00 30.52  ? 178 MET A CG    1 
ATOM   1023 S  SD    . MET A 1 137 ? 31.389  96.469  -8.519  1.00 35.07  ? 178 MET A SD    1 
ATOM   1024 C  CE    . MET A 1 137 ? 32.641  95.657  -9.510  1.00 34.02  ? 178 MET A CE    1 
ATOM   1025 N  N     . LYS A 1 138 ? 27.473  100.930 -9.017  1.00 29.13  ? 179 LYS A N     1 
ATOM   1026 C  CA    . LYS A 1 138 ? 26.339  101.473 -8.278  1.00 32.24  ? 179 LYS A CA    1 
ATOM   1027 C  C     . LYS A 1 138 ? 25.236  101.950 -9.218  1.00 32.64  ? 179 LYS A C     1 
ATOM   1028 O  O     . LYS A 1 138 ? 24.169  102.367 -8.771  1.00 32.69  ? 179 LYS A O     1 
ATOM   1029 C  CB    . LYS A 1 138 ? 26.785  102.610 -7.355  1.00 32.23  ? 179 LYS A CB    1 
ATOM   1030 C  CG    . LYS A 1 138 ? 27.057  103.942 -8.036  1.00 28.76  ? 179 LYS A CG    1 
ATOM   1031 C  CD    . LYS A 1 138 ? 27.611  104.932 -7.022  1.00 32.22  ? 179 LYS A CD    1 
ATOM   1032 C  CE    . LYS A 1 138 ? 27.735  106.338 -7.587  1.00 33.67  ? 179 LYS A CE    1 
ATOM   1033 N  NZ    . LYS A 1 138 ? 28.244  107.283 -6.546  1.00 33.46  ? 179 LYS A NZ    1 
ATOM   1034 N  N     . GLN A 1 139 ? 25.494  101.880 -10.521 1.00 30.35  ? 180 GLN A N     1 
ATOM   1035 C  CA    . GLN A 1 139 ? 24.467  102.178 -11.513 1.00 34.31  ? 180 GLN A CA    1 
ATOM   1036 C  C     . GLN A 1 139 ? 23.442  101.051 -11.558 1.00 29.00  ? 180 GLN A C     1 
ATOM   1037 O  O     . GLN A 1 139 ? 22.359  101.205 -12.119 1.00 38.14  ? 180 GLN A O     1 
ATOM   1038 C  CB    . GLN A 1 139 ? 25.086  102.388 -12.895 1.00 32.71  ? 180 GLN A CB    1 
ATOM   1039 C  CG    . GLN A 1 139 ? 26.046  103.560 -12.965 1.00 33.43  ? 180 GLN A CG    1 
ATOM   1040 C  CD    . GLN A 1 139 ? 26.636  103.756 -14.349 1.00 35.34  ? 180 GLN A CD    1 
ATOM   1041 O  OE1   . GLN A 1 139 ? 26.001  103.450 -15.359 1.00 36.24  ? 180 GLN A OE1   1 
ATOM   1042 N  NE2   . GLN A 1 139 ? 27.861  104.267 -14.401 1.00 36.02  ? 180 GLN A NE2   1 
ATOM   1043 N  N     . THR A 1 140 ? 23.798  99.916  -10.964 1.00 33.19  ? 181 THR A N     1 
ATOM   1044 C  CA    . THR A 1 140 ? 22.900  98.771  -10.879 1.00 30.66  ? 181 THR A CA    1 
ATOM   1045 C  C     . THR A 1 140 ? 22.518  98.507  -9.427  1.00 35.99  ? 181 THR A C     1 
ATOM   1046 O  O     . THR A 1 140 ? 23.370  98.186  -8.599  1.00 34.09  ? 181 THR A O     1 
ATOM   1047 C  CB    . THR A 1 140 ? 23.537  97.501  -11.474 1.00 35.81  ? 181 THR A CB    1 
ATOM   1048 O  OG1   . THR A 1 140 ? 24.038  97.781  -12.787 1.00 33.18  ? 181 THR A OG1   1 
ATOM   1049 C  CG2   . THR A 1 140 ? 22.514  96.377  -11.550 1.00 29.20  ? 181 THR A CG2   1 
ATOM   1050 N  N     . LEU A 1 141 ? 21.233  98.645  -9.122  1.00 30.86  ? 182 LEU A N     1 
ATOM   1051 C  CA    . LEU A 1 141 ? 20.750  98.460  -7.759  1.00 33.00  ? 182 LEU A CA    1 
ATOM   1052 C  C     . LEU A 1 141 ? 20.696  96.984  -7.382  1.00 35.75  ? 182 LEU A C     1 
ATOM   1053 O  O     . LEU A 1 141 ? 20.328  96.145  -8.200  1.00 34.73  ? 182 LEU A O     1 
ATOM   1054 C  CB    . LEU A 1 141 ? 19.368  99.094  -7.591  1.00 27.86  ? 182 LEU A CB    1 
ATOM   1055 C  CG    . LEU A 1 141 ? 19.302  100.617 -7.730  1.00 33.86  ? 182 LEU A CG    1 
ATOM   1056 C  CD1   . LEU A 1 141 ? 17.858  101.089 -7.720  1.00 26.91  ? 182 LEU A CD1   1 
ATOM   1057 C  CD2   . LEU A 1 141 ? 20.102  101.298 -6.625  1.00 27.97  ? 182 LEU A CD2   1 
ATOM   1058 N  N     . PRO A 1 142 ? 21.070  96.666  -6.134  1.00 39.60  ? 183 PRO A N     1 
ATOM   1059 C  CA    . PRO A 1 142 ? 21.013  95.300  -5.609  1.00 34.72  ? 183 PRO A CA    1 
ATOM   1060 C  C     . PRO A 1 142 ? 19.621  94.942  -5.099  1.00 37.72  ? 183 PRO A C     1 
ATOM   1061 O  O     . PRO A 1 142 ? 19.446  93.911  -4.450  1.00 39.01  ? 183 PRO A O     1 
ATOM   1062 C  CB    . PRO A 1 142 ? 22.021  95.332  -4.462  1.00 37.10  ? 183 PRO A CB    1 
ATOM   1063 C  CG    . PRO A 1 142 ? 21.935  96.730  -3.958  1.00 33.92  ? 183 PRO A CG    1 
ATOM   1064 C  CD    . PRO A 1 142 ? 21.661  97.602  -5.162  1.00 30.57  ? 183 PRO A CD    1 
ATOM   1065 N  N     . TYR A 1 143 ? 18.646  95.797  -5.386  1.00 35.59  ? 184 TYR A N     1 
ATOM   1066 C  CA    . TYR A 1 143 ? 17.272  95.564  -4.961  1.00 33.70  ? 184 TYR A CA    1 
ATOM   1067 C  C     . TYR A 1 143 ? 16.289  96.060  -6.014  1.00 31.47  ? 184 TYR A C     1 
ATOM   1068 O  O     . TYR A 1 143 ? 16.678  96.718  -6.980  1.00 36.33  ? 184 TYR A O     1 
ATOM   1069 C  CB    . TYR A 1 143 ? 16.999  96.245  -3.617  1.00 31.42  ? 184 TYR A CB    1 
ATOM   1070 C  CG    . TYR A 1 143 ? 17.192  97.748  -3.631  1.00 32.94  ? 184 TYR A CG    1 
ATOM   1071 C  CD1   . TYR A 1 143 ? 18.429  98.311  -3.344  1.00 29.75  ? 184 TYR A CD1   1 
ATOM   1072 C  CD2   . TYR A 1 143 ? 16.136  98.602  -3.924  1.00 31.17  ? 184 TYR A CD2   1 
ATOM   1073 C  CE1   . TYR A 1 143 ? 18.609  99.682  -3.352  1.00 31.93  ? 184 TYR A CE1   1 
ATOM   1074 C  CE2   . TYR A 1 143 ? 16.307  99.974  -3.936  1.00 28.58  ? 184 TYR A CE2   1 
ATOM   1075 C  CZ    . TYR A 1 143 ? 17.545  100.508 -3.649  1.00 33.17  ? 184 TYR A CZ    1 
ATOM   1076 O  OH    . TYR A 1 143 ? 17.718  101.874 -3.660  1.00 28.44  ? 184 TYR A OH    1 
ATOM   1077 N  N     . SER A 1 144 ? 15.013  95.742  -5.821  1.00 33.90  ? 185 SER A N     1 
ATOM   1078 C  CA    . SER A 1 144 ? 13.970  96.170  -6.743  1.00 42.75  ? 185 SER A CA    1 
ATOM   1079 C  C     . SER A 1 144 ? 13.219  97.372  -6.188  1.00 33.37  ? 185 SER A C     1 
ATOM   1080 O  O     . SER A 1 144 ? 12.711  97.334  -5.069  1.00 39.93  ? 185 SER A O     1 
ATOM   1081 C  CB    . SER A 1 144 ? 12.997  95.025  -7.023  1.00 46.20  ? 185 SER A CB    1 
ATOM   1082 O  OG    . SER A 1 144 ? 13.690  93.873  -7.468  1.00 51.58  ? 185 SER A OG    1 
ATOM   1083 N  N     . VAL A 1 145 ? 13.150  98.437  -6.979  1.00 41.10  ? 186 VAL A N     1 
ATOM   1084 C  CA    . VAL A 1 145 ? 12.474  99.660  -6.564  1.00 41.49  ? 186 VAL A CA    1 
ATOM   1085 C  C     . VAL A 1 145 ? 10.967  99.459  -6.425  1.00 46.60  ? 186 VAL A C     1 
ATOM   1086 O  O     . VAL A 1 145 ? 10.294  100.225 -5.736  1.00 42.10  ? 186 VAL A O     1 
ATOM   1087 C  CB    . VAL A 1 145 ? 12.733  100.809 -7.555  1.00 46.09  ? 186 VAL A CB    1 
ATOM   1088 C  CG1   . VAL A 1 145 ? 14.211  101.161 -7.580  1.00 43.64  ? 186 VAL A CG1   1 
ATOM   1089 C  CG2   . VAL A 1 145 ? 12.245  100.433 -8.948  1.00 44.19  ? 186 VAL A CG2   1 
ATOM   1090 N  N     . ALA A 1 146 ? 10.444  98.425  -7.078  1.00 42.21  ? 187 ALA A N     1 
ATOM   1091 C  CA    . ALA A 1 146 ? 9.012   98.146  -7.059  1.00 42.36  ? 187 ALA A CA    1 
ATOM   1092 C  C     . ALA A 1 146 ? 8.572   97.507  -5.743  1.00 47.07  ? 187 ALA A C     1 
ATOM   1093 O  O     . ALA A 1 146 ? 7.405   97.594  -5.366  1.00 50.29  ? 187 ALA A O     1 
ATOM   1094 C  CB    . ALA A 1 146 ? 8.635   97.251  -8.232  1.00 50.12  ? 187 ALA A CB    1 
ATOM   1095 N  N     . ASP A 1 147 ? 9.507   96.866  -5.049  1.00 41.81  ? 188 ASP A N     1 
ATOM   1096 C  CA    . ASP A 1 147 ? 9.197   96.216  -3.778  1.00 45.11  ? 188 ASP A CA    1 
ATOM   1097 C  C     . ASP A 1 147 ? 9.094   97.223  -2.636  1.00 42.26  ? 188 ASP A C     1 
ATOM   1098 O  O     . ASP A 1 147 ? 8.592   96.901  -1.558  1.00 46.65  ? 188 ASP A O     1 
ATOM   1099 C  CB    . ASP A 1 147 ? 10.252  95.157  -3.443  1.00 48.98  ? 188 ASP A CB    1 
ATOM   1100 C  CG    . ASP A 1 147 ? 10.167  93.942  -4.349  1.00 54.82  ? 188 ASP A CG    1 
ATOM   1101 O  OD1   . ASP A 1 147 ? 9.142   93.789  -5.046  1.00 56.29  ? 188 ASP A OD1   1 
ATOM   1102 O  OD2   . ASP A 1 147 ? 11.121  93.134  -4.357  1.00 56.65  ? 188 ASP A OD2   1 
ATOM   1103 N  N     . LEU A 1 148 ? 9.565   98.442  -2.877  1.00 39.42  ? 189 LEU A N     1 
ATOM   1104 C  CA    . LEU A 1 148 ? 9.603   99.466  -1.839  1.00 38.19  ? 189 LEU A CA    1 
ATOM   1105 C  C     . LEU A 1 148 ? 8.230   100.078 -1.581  1.00 30.79  ? 189 LEU A C     1 
ATOM   1106 O  O     . LEU A 1 148 ? 7.581   100.583 -2.496  1.00 36.36  ? 189 LEU A O     1 
ATOM   1107 C  CB    . LEU A 1 148 ? 10.599  100.565 -2.210  1.00 32.17  ? 189 LEU A CB    1 
ATOM   1108 C  CG    . LEU A 1 148 ? 12.053  100.124 -2.383  1.00 32.33  ? 189 LEU A CG    1 
ATOM   1109 C  CD1   . LEU A 1 148 ? 12.970  101.329 -2.522  1.00 31.26  ? 189 LEU A CD1   1 
ATOM   1110 C  CD2   . LEU A 1 148 ? 12.485  99.245  -1.219  1.00 32.11  ? 189 LEU A CD2   1 
ATOM   1111 N  N     . GLU A 1 149 ? 7.799   100.032 -0.325  1.00 34.16  ? 190 GLU A N     1 
ATOM   1112 C  CA    . GLU A 1 149 ? 6.528   100.619 0.078   1.00 33.65  ? 190 GLU A CA    1 
ATOM   1113 C  C     . GLU A 1 149 ? 6.758   101.942 0.809   1.00 33.66  ? 190 GLU A C     1 
ATOM   1114 O  O     . GLU A 1 149 ? 7.028   101.959 2.010   1.00 34.60  ? 190 GLU A O     1 
ATOM   1115 C  CB    . GLU A 1 149 ? 5.751   99.643  0.962   1.00 36.21  ? 190 GLU A CB    1 
ATOM   1116 C  CG    . GLU A 1 149 ? 5.570   98.261  0.344   1.00 38.43  ? 190 GLU A CG    1 
ATOM   1117 C  CD    . GLU A 1 149 ? 4.886   97.282  1.282   1.00 52.21  ? 190 GLU A CD    1 
ATOM   1118 O  OE1   . GLU A 1 149 ? 3.640   97.309  1.365   1.00 58.81  ? 190 GLU A OE1   1 
ATOM   1119 O  OE2   . GLU A 1 149 ? 5.594   96.485  1.936   1.00 58.01  ? 190 GLU A OE2   1 
ATOM   1120 N  N     . TRP A 1 150 ? 6.649   103.047 0.078   1.00 32.98  ? 191 TRP A N     1 
ATOM   1121 C  CA    . TRP A 1 150 ? 6.952   104.366 0.626   1.00 31.81  ? 191 TRP A CA    1 
ATOM   1122 C  C     . TRP A 1 150 ? 5.802   104.953 1.435   1.00 32.75  ? 191 TRP A C     1 
ATOM   1123 O  O     . TRP A 1 150 ? 4.644   104.586 1.246   1.00 35.77  ? 191 TRP A O     1 
ATOM   1124 C  CB    . TRP A 1 150 ? 7.320   105.333 -0.500  1.00 29.93  ? 191 TRP A CB    1 
ATOM   1125 C  CG    . TRP A 1 150 ? 8.629   105.031 -1.153  1.00 30.67  ? 191 TRP A CG    1 
ATOM   1126 C  CD1   . TRP A 1 150 ? 8.836   104.251 -2.252  1.00 29.97  ? 191 TRP A CD1   1 
ATOM   1127 C  CD2   . TRP A 1 150 ? 9.917   105.510 -0.752  1.00 27.19  ? 191 TRP A CD2   1 
ATOM   1128 N  NE1   . TRP A 1 150 ? 10.174  104.211 -2.560  1.00 28.00  ? 191 TRP A NE1   1 
ATOM   1129 C  CE2   . TRP A 1 150 ? 10.860  104.976 -1.653  1.00 29.24  ? 191 TRP A CE2   1 
ATOM   1130 C  CE3   . TRP A 1 150 ? 10.366  106.335 0.284   1.00 28.98  ? 191 TRP A CE3   1 
ATOM   1131 C  CZ2   . TRP A 1 150 ? 12.223  105.243 -1.553  1.00 27.25  ? 191 TRP A CZ2   1 
ATOM   1132 C  CZ3   . TRP A 1 150 ? 11.720  106.598 0.384   1.00 26.65  ? 191 TRP A CZ3   1 
ATOM   1133 C  CH2   . TRP A 1 150 ? 12.632  106.054 -0.530  1.00 25.28  ? 191 TRP A CH2   1 
ATOM   1134 N  N     . ASP A 1 151 ? 6.132   105.873 2.338   1.00 31.96  ? 192 ASP A N     1 
ATOM   1135 C  CA    . ASP A 1 151 ? 5.112   106.623 3.058   1.00 30.56  ? 192 ASP A CA    1 
ATOM   1136 C  C     . ASP A 1 151 ? 4.604   107.764 2.182   1.00 32.93  ? 192 ASP A C     1 
ATOM   1137 O  O     . ASP A 1 151 ? 5.033   107.914 1.037   1.00 33.00  ? 192 ASP A O     1 
ATOM   1138 C  CB    . ASP A 1 151 ? 5.649   107.157 4.392   1.00 32.92  ? 192 ASP A CB    1 
ATOM   1139 C  CG    . ASP A 1 151 ? 6.966   107.909 4.248   1.00 35.92  ? 192 ASP A CG    1 
ATOM   1140 O  OD1   . ASP A 1 151 ? 7.346   108.272 3.114   1.00 34.97  ? 192 ASP A OD1   1 
ATOM   1141 O  OD2   . ASP A 1 151 ? 7.625   108.145 5.283   1.00 37.15  ? 192 ASP A OD2   1 
ATOM   1142 N  N     . ALA A 1 152 ? 3.695   108.567 2.726   1.00 38.58  ? 193 ALA A N     1 
ATOM   1143 C  CA    . ALA A 1 152 ? 3.039   109.624 1.960   1.00 40.68  ? 193 ALA A CA    1 
ATOM   1144 C  C     . ALA A 1 152 ? 4.024   110.653 1.409   1.00 35.74  ? 193 ALA A C     1 
ATOM   1145 O  O     . ALA A 1 152 ? 3.932   111.049 0.248   1.00 36.66  ? 193 ALA A O     1 
ATOM   1146 C  CB    . ALA A 1 152 ? 1.988   110.314 2.819   1.00 35.57  ? 193 ALA A CB    1 
ATOM   1147 N  N     . GLY A 1 153 ? 4.966   111.080 2.241   1.00 32.06  ? 194 GLY A N     1 
ATOM   1148 C  CA    . GLY A 1 153 ? 5.914   112.106 1.845   1.00 33.53  ? 194 GLY A CA    1 
ATOM   1149 C  C     . GLY A 1 153 ? 7.123   111.577 1.095   1.00 33.47  ? 194 GLY A C     1 
ATOM   1150 O  O     . GLY A 1 153 ? 8.032   112.339 0.766   1.00 34.50  ? 194 GLY A O     1 
ATOM   1151 N  N     . HIS A 1 154 ? 7.124   110.273 0.826   1.00 31.75  ? 195 HIS A N     1 
ATOM   1152 C  CA    . HIS A 1 154 ? 8.237   109.593 0.161   1.00 30.39  ? 195 HIS A CA    1 
ATOM   1153 C  C     . HIS A 1 154 ? 9.555   109.832 0.896   1.00 29.79  ? 195 HIS A C     1 
ATOM   1154 O  O     . HIS A 1 154 ? 10.587  110.096 0.278   1.00 25.59  ? 195 HIS A O     1 
ATOM   1155 C  CB    . HIS A 1 154 ? 8.359   110.042 -1.299  1.00 28.66  ? 195 HIS A CB    1 
ATOM   1156 C  CG    . HIS A 1 154 ? 8.967   109.011 -2.198  1.00 29.62  ? 195 HIS A CG    1 
ATOM   1157 N  ND1   . HIS A 1 154 ? 8.209   108.139 -2.950  1.00 32.84  ? 195 HIS A ND1   1 
ATOM   1158 C  CD2   . HIS A 1 154 ? 10.261  108.704 -2.459  1.00 27.00  ? 195 HIS A CD2   1 
ATOM   1159 C  CE1   . HIS A 1 154 ? 9.008   107.345 -3.640  1.00 29.31  ? 195 HIS A CE1   1 
ATOM   1160 N  NE2   . HIS A 1 154 ? 10.259  107.668 -3.359  1.00 28.77  ? 195 HIS A NE2   1 
ATOM   1161 N  N     . LYS A 1 155 ? 9.506   109.739 2.220   1.00 32.28  ? 196 LYS A N     1 
ATOM   1162 C  CA    . LYS A 1 155 ? 10.680  109.951 3.057   1.00 30.21  ? 196 LYS A CA    1 
ATOM   1163 C  C     . LYS A 1 155 ? 11.242  108.625 3.553   1.00 32.47  ? 196 LYS A C     1 
ATOM   1164 O  O     . LYS A 1 155 ? 12.458  108.442 3.626   1.00 27.38  ? 196 LYS A O     1 
ATOM   1165 C  CB    . LYS A 1 155 ? 10.335  110.847 4.249   1.00 29.39  ? 196 LYS A CB    1 
ATOM   1166 C  CG    . LYS A 1 155 ? 9.793   112.215 3.873   1.00 36.07  ? 196 LYS A CG    1 
ATOM   1167 C  CD    . LYS A 1 155 ? 10.813  113.014 3.083   1.00 30.68  ? 196 LYS A CD    1 
ATOM   1168 C  CE    . LYS A 1 155 ? 10.372  114.458 2.929   1.00 35.23  ? 196 LYS A CE    1 
ATOM   1169 N  NZ    . LYS A 1 155 ? 9.025   114.562 2.302   1.00 36.34  ? 196 LYS A NZ    1 
ATOM   1170 N  N     . THR A 1 156 ? 10.348  107.708 3.909   1.00 28.85  ? 197 THR A N     1 
ATOM   1171 C  CA    . THR A 1 156 ? 10.746  106.391 4.390   1.00 29.27  ? 197 THR A CA    1 
ATOM   1172 C  C     . THR A 1 156 ? 9.971   105.281 3.687   1.00 31.95  ? 197 THR A C     1 
ATOM   1173 O  O     . THR A 1 156 ? 8.839   105.484 3.249   1.00 29.31  ? 197 THR A O     1 
ATOM   1174 C  CB    . THR A 1 156 ? 10.527  106.248 5.915   1.00 34.87  ? 197 THR A CB    1 
ATOM   1175 O  OG1   . THR A 1 156 ? 9.122   106.243 6.200   1.00 31.12  ? 197 THR A OG1   1 
ATOM   1176 C  CG2   . THR A 1 156 ? 11.194  107.386 6.677   1.00 24.30  ? 197 THR A CG2   1 
ATOM   1177 N  N     . ASN A 1 157 ? 10.588  104.108 3.579   1.00 30.03  ? 198 ASN A N     1 
ATOM   1178 C  CA    . ASN A 1 157 ? 9.882   102.913 3.134   1.00 31.51  ? 198 ASN A CA    1 
ATOM   1179 C  C     . ASN A 1 157 ? 9.983   101.829 4.202   1.00 33.75  ? 198 ASN A C     1 
ATOM   1180 O  O     . ASN A 1 157 ? 10.932  101.812 4.984   1.00 31.21  ? 198 ASN A O     1 
ATOM   1181 C  CB    . ASN A 1 157 ? 10.424  102.409 1.791   1.00 27.63  ? 198 ASN A CB    1 
ATOM   1182 C  CG    . ASN A 1 157 ? 11.905  102.086 1.835   1.00 30.86  ? 198 ASN A CG    1 
ATOM   1183 O  OD1   . ASN A 1 157 ? 12.315  101.070 2.396   1.00 27.53  ? 198 ASN A OD1   1 
ATOM   1184 N  ND2   . ASN A 1 157 ? 12.716  102.944 1.225   1.00 29.19  ? 198 ASN A ND2   1 
ATOM   1185 N  N     . VAL A 1 158 ? 9.003   100.930 4.236   1.00 34.18  ? 199 VAL A N     1 
ATOM   1186 C  CA    . VAL A 1 158 ? 8.925   99.929  5.298   1.00 36.06  ? 199 VAL A CA    1 
ATOM   1187 C  C     . VAL A 1 158 ? 10.073  98.918  5.241   1.00 30.55  ? 199 VAL A C     1 
ATOM   1188 O  O     . VAL A 1 158 ? 10.386  98.273  6.242   1.00 33.32  ? 199 VAL A O     1 
ATOM   1189 C  CB    . VAL A 1 158 ? 7.581   99.164  5.257   1.00 34.27  ? 199 VAL A CB    1 
ATOM   1190 C  CG1   . VAL A 1 158 ? 6.412   100.131 5.387   1.00 36.05  ? 199 VAL A CG1   1 
ATOM   1191 C  CG2   . VAL A 1 158 ? 7.463   98.355  3.980   1.00 44.01  ? 199 VAL A CG2   1 
ATOM   1192 N  N     . GLN A 1 159 ? 10.700  98.787  4.076   1.00 31.50  ? 200 GLN A N     1 
ATOM   1193 C  CA    . GLN A 1 159 ? 11.830  97.876  3.915   1.00 31.33  ? 200 GLN A CA    1 
ATOM   1194 C  C     . GLN A 1 159 ? 13.117  98.478  4.467   1.00 32.87  ? 200 GLN A C     1 
ATOM   1195 O  O     . GLN A 1 159 ? 14.115  97.774  4.633   1.00 28.29  ? 200 GLN A O     1 
ATOM   1196 C  CB    . GLN A 1 159 ? 12.030  97.509  2.442   1.00 31.81  ? 200 GLN A CB    1 
ATOM   1197 C  CG    . GLN A 1 159 ? 10.985  96.562  1.876   1.00 31.21  ? 200 GLN A CG    1 
ATOM   1198 C  CD    . GLN A 1 159 ? 9.666   97.247  1.585   1.00 38.36  ? 200 GLN A CD    1 
ATOM   1199 O  OE1   . GLN A 1 159 ? 9.592   98.474  1.507   1.00 33.18  ? 200 GLN A OE1   1 
ATOM   1200 N  NE2   . GLN A 1 159 ? 8.613   96.454  1.425   1.00 45.84  ? 200 GLN A NE2   1 
ATOM   1201 N  N     . GLN A 1 160 ? 13.081  99.779  4.749   1.00 28.75  ? 201 GLN A N     1 
ATOM   1202 C  CA    . GLN A 1 160 ? 14.264  100.532 5.161   1.00 29.05  ? 201 GLN A CA    1 
ATOM   1203 C  C     . GLN A 1 160 ? 15.408  100.313 4.181   1.00 29.93  ? 201 GLN A C     1 
ATOM   1204 O  O     . GLN A 1 160 ? 16.556  100.103 4.578   1.00 27.09  ? 201 GLN A O     1 
ATOM   1205 C  CB    . GLN A 1 160 ? 14.695  100.141 6.572   1.00 30.72  ? 201 GLN A CB    1 
ATOM   1206 C  CG    . GLN A 1 160 ? 13.650  100.411 7.632   1.00 20.71  ? 201 GLN A CG    1 
ATOM   1207 C  CD    . GLN A 1 160 ? 14.201  100.227 9.026   1.00 30.48  ? 201 GLN A CD    1 
ATOM   1208 O  OE1   . GLN A 1 160 ? 13.559  99.627  9.887   1.00 34.63  ? 201 GLN A OE1   1 
ATOM   1209 N  NE2   . GLN A 1 160 ? 15.402  100.742 9.257   1.00 22.81  ? 201 GLN A NE2   1 
ATOM   1210 N  N     . CYS A 1 161 ? 15.076  100.361 2.897   1.00 27.49  ? 202 CYS A N     1 
ATOM   1211 C  CA    . CYS A 1 161 ? 16.033  100.096 1.834   1.00 26.45  ? 202 CYS A CA    1 
ATOM   1212 C  C     . CYS A 1 161 ? 16.254  101.356 1.004   1.00 27.21  ? 202 CYS A C     1 
ATOM   1213 O  O     . CYS A 1 161 ? 15.333  101.845 0.350   1.00 22.72  ? 202 CYS A O     1 
ATOM   1214 C  CB    . CYS A 1 161 ? 15.534  98.944  0.957   1.00 27.79  ? 202 CYS A CB    1 
ATOM   1215 S  SG    . CYS A 1 161 ? 16.654  98.433  -0.359  1.00 32.58  ? 202 CYS A SG    1 
ATOM   1216 N  N     . TYR A 1 162 ? 17.473  101.885 1.036   1.00 28.65  ? 203 TYR A N     1 
ATOM   1217 C  CA    . TYR A 1 162 ? 17.770  103.143 0.360   1.00 26.26  ? 203 TYR A CA    1 
ATOM   1218 C  C     . TYR A 1 162 ? 19.062  103.077 -0.441  1.00 26.65  ? 203 TYR A C     1 
ATOM   1219 O  O     . TYR A 1 162 ? 19.797  102.092 -0.372  1.00 25.09  ? 203 TYR A O     1 
ATOM   1220 C  CB    . TYR A 1 162 ? 17.868  104.284 1.377   1.00 23.72  ? 203 TYR A CB    1 
ATOM   1221 C  CG    . TYR A 1 162 ? 16.701  104.375 2.332   1.00 28.23  ? 203 TYR A CG    1 
ATOM   1222 C  CD1   . TYR A 1 162 ? 15.567  105.104 2.004   1.00 25.69  ? 203 TYR A CD1   1 
ATOM   1223 C  CD2   . TYR A 1 162 ? 16.736  103.737 3.567   1.00 27.87  ? 203 TYR A CD2   1 
ATOM   1224 C  CE1   . TYR A 1 162 ? 14.499  105.194 2.874   1.00 28.23  ? 203 TYR A CE1   1 
ATOM   1225 C  CE2   . TYR A 1 162 ? 15.671  103.819 4.444   1.00 25.83  ? 203 TYR A CE2   1 
ATOM   1226 C  CZ    . TYR A 1 162 ? 14.555  104.550 4.092   1.00 27.43  ? 203 TYR A CZ    1 
ATOM   1227 O  OH    . TYR A 1 162 ? 13.490  104.641 4.957   1.00 29.56  ? 203 TYR A OH    1 
ATOM   1228 N  N     . CYS A 1 163 ? 19.315  104.135 -1.208  1.00 20.80  ? 204 CYS A N     1 
ATOM   1229 C  CA    . CYS A 1 163 ? 20.624  104.391 -1.801  1.00 22.21  ? 204 CYS A CA    1 
ATOM   1230 C  C     . CYS A 1 163 ? 21.071  103.327 -2.804  1.00 25.95  ? 204 CYS A C     1 
ATOM   1231 O  O     . CYS A 1 163 ? 20.278  102.487 -3.229  1.00 24.48  ? 204 CYS A O     1 
ATOM   1232 C  CB    . CYS A 1 163 ? 21.668  104.532 -0.686  1.00 18.77  ? 204 CYS A CB    1 
ATOM   1233 S  SG    . CYS A 1 163 ? 23.239  105.241 -1.204  1.00 25.72  ? 204 CYS A SG    1 
ATOM   1234 N  N     . TYR A 1 164 ? 22.344  103.384 -3.188  1.00 25.27  ? 205 TYR A N     1 
ATOM   1235 C  CA    . TYR A 1 164 ? 22.926  102.381 -4.076  1.00 26.41  ? 205 TYR A CA    1 
ATOM   1236 C  C     . TYR A 1 164 ? 23.213  101.092 -3.313  1.00 31.41  ? 205 TYR A C     1 
ATOM   1237 O  O     . TYR A 1 164 ? 23.291  100.013 -3.898  1.00 28.62  ? 205 TYR A O     1 
ATOM   1238 C  CB    . TYR A 1 164 ? 24.227  102.883 -4.708  1.00 21.68  ? 205 TYR A CB    1 
ATOM   1239 C  CG    . TYR A 1 164 ? 24.163  104.250 -5.354  1.00 29.84  ? 205 TYR A CG    1 
ATOM   1240 C  CD1   . TYR A 1 164 ? 23.547  104.434 -6.585  1.00 27.53  ? 205 TYR A CD1   1 
ATOM   1241 C  CD2   . TYR A 1 164 ? 24.751  105.351 -4.747  1.00 23.93  ? 205 TYR A CD2   1 
ATOM   1242 C  CE1   . TYR A 1 164 ? 23.503  105.681 -7.184  1.00 27.94  ? 205 TYR A CE1   1 
ATOM   1243 C  CE2   . TYR A 1 164 ? 24.712  106.600 -5.335  1.00 29.05  ? 205 TYR A CE2   1 
ATOM   1244 C  CZ    . TYR A 1 164 ? 24.087  106.760 -6.553  1.00 30.49  ? 205 TYR A CZ    1 
ATOM   1245 O  OH    . TYR A 1 164 ? 24.050  108.003 -7.139  1.00 26.13  ? 205 TYR A OH    1 
ATOM   1246 N  N     . CYS A 1 165 ? 23.374  101.224 -2.000  1.00 30.56  ? 206 CYS A N     1 
ATOM   1247 C  CA    . CYS A 1 165 ? 23.841  100.130 -1.155  1.00 26.32  ? 206 CYS A CA    1 
ATOM   1248 C  C     . CYS A 1 165 ? 22.715  99.223  -0.672  1.00 27.90  ? 206 CYS A C     1 
ATOM   1249 O  O     . CYS A 1 165 ? 22.946  98.058  -0.343  1.00 30.74  ? 206 CYS A O     1 
ATOM   1250 C  CB    . CYS A 1 165 ? 24.601  100.693 0.046   1.00 24.60  ? 206 CYS A CB    1 
ATOM   1251 S  SG    . CYS A 1 165 ? 23.644  101.854 1.046   1.00 26.37  ? 206 CYS A SG    1 
ATOM   1252 N  N     . GLY A 1 166 ? 21.500  99.759  -0.624  1.00 28.03  ? 207 GLY A N     1 
ATOM   1253 C  CA    . GLY A 1 166 ? 20.352  99.000  -0.163  1.00 23.28  ? 207 GLY A CA    1 
ATOM   1254 C  C     . GLY A 1 166 ? 20.243  98.977  1.349   1.00 32.24  ? 207 GLY A C     1 
ATOM   1255 O  O     . GLY A 1 166 ? 19.497  98.179  1.918   1.00 28.11  ? 207 GLY A O     1 
ATOM   1256 N  N     . GLY A 1 167 ? 20.987  99.862  2.003   1.00 26.26  ? 208 GLY A N     1 
ATOM   1257 C  CA    . GLY A 1 167 ? 21.009  99.909  3.452   1.00 27.41  ? 208 GLY A CA    1 
ATOM   1258 C  C     . GLY A 1 167 ? 19.972  100.838 4.050   1.00 26.04  ? 208 GLY A C     1 
ATOM   1259 O  O     . GLY A 1 167 ? 19.198  101.460 3.323   1.00 22.61  ? 208 GLY A O     1 
ATOM   1260 N  N     . PRO A 1 168 ? 19.953  100.938 5.387   1.00 26.17  ? 209 PRO A N     1 
ATOM   1261 C  CA    . PRO A 1 168 ? 19.010  101.802 6.097   1.00 24.21  ? 209 PRO A CA    1 
ATOM   1262 C  C     . PRO A 1 168 ? 19.426  103.261 5.982   1.00 22.93  ? 209 PRO A C     1 
ATOM   1263 O  O     . PRO A 1 168 ? 20.543  103.539 5.544   1.00 23.30  ? 209 PRO A O     1 
ATOM   1264 C  CB    . PRO A 1 168 ? 19.112  101.311 7.539   1.00 27.21  ? 209 PRO A CB    1 
ATOM   1265 C  CG    . PRO A 1 168 ? 20.530  100.870 7.657   1.00 23.73  ? 209 PRO A CG    1 
ATOM   1266 C  CD    . PRO A 1 168 ? 20.913  100.305 6.308   1.00 26.10  ? 209 PRO A CD    1 
ATOM   1267 N  N     . GLY A 1 169 ? 18.550  104.180 6.367   1.00 23.84  ? 210 GLY A N     1 
ATOM   1268 C  CA    . GLY A 1 169 ? 18.890  105.586 6.290   1.00 26.47  ? 210 GLY A CA    1 
ATOM   1269 C  C     . GLY A 1 169 ? 17.819  106.524 6.801   1.00 28.90  ? 210 GLY A C     1 
ATOM   1270 O  O     . GLY A 1 169 ? 16.631  106.199 6.794   1.00 27.02  ? 210 GLY A O     1 
ATOM   1271 N  N     . ASP A 1 170 ? 18.259  107.692 7.256   1.00 24.98  ? 211 ASP A N     1 
ATOM   1272 C  CA    . ASP A 1 170 ? 17.361  108.773 7.637   1.00 27.81  ? 211 ASP A CA    1 
ATOM   1273 C  C     . ASP A 1 170 ? 17.529  109.924 6.653   1.00 26.43  ? 211 ASP A C     1 
ATOM   1274 O  O     . ASP A 1 170 ? 18.607  110.514 6.555   1.00 24.16  ? 211 ASP A O     1 
ATOM   1275 C  CB    . ASP A 1 170 ? 17.642  109.233 9.068   1.00 26.05  ? 211 ASP A CB    1 
ATOM   1276 C  CG    . ASP A 1 170 ? 17.413  108.132 10.088  1.00 28.47  ? 211 ASP A CG    1 
ATOM   1277 O  OD1   . ASP A 1 170 ? 16.354  107.471 10.022  1.00 33.01  ? 211 ASP A OD1   1 
ATOM   1278 O  OD2   . ASP A 1 170 ? 18.295  107.918 10.947  1.00 27.97  ? 211 ASP A OD2   1 
ATOM   1279 N  N     . TRP A 1 171 ? 16.461  110.233 5.924   1.00 24.63  ? 212 TRP A N     1 
ATOM   1280 C  CA    . TRP A 1 171 ? 16.517  111.214 4.846   1.00 23.34  ? 212 TRP A CA    1 
ATOM   1281 C  C     . TRP A 1 171 ? 17.035  112.572 5.307   1.00 25.58  ? 212 TRP A C     1 
ATOM   1282 O  O     . TRP A 1 171 ? 17.690  113.283 4.546   1.00 21.87  ? 212 TRP A O     1 
ATOM   1283 C  CB    . TRP A 1 171 ? 15.135  111.382 4.210   1.00 24.64  ? 212 TRP A CB    1 
ATOM   1284 C  CG    . TRP A 1 171 ? 14.113  111.960 5.135   1.00 26.49  ? 212 TRP A CG    1 
ATOM   1285 C  CD1   . TRP A 1 171 ? 13.298  111.275 5.986   1.00 24.16  ? 212 TRP A CD1   1 
ATOM   1286 C  CD2   . TRP A 1 171 ? 13.794  113.346 5.302   1.00 27.35  ? 212 TRP A CD2   1 
ATOM   1287 N  NE1   . TRP A 1 171 ? 12.491  112.146 6.673   1.00 26.69  ? 212 TRP A NE1   1 
ATOM   1288 C  CE2   . TRP A 1 171 ? 12.777  113.426 6.272   1.00 27.04  ? 212 TRP A CE2   1 
ATOM   1289 C  CE3   . TRP A 1 171 ? 14.273  114.529 4.728   1.00 25.47  ? 212 TRP A CE3   1 
ATOM   1290 C  CZ2   . TRP A 1 171 ? 12.227  114.639 6.681   1.00 32.65  ? 212 TRP A CZ2   1 
ATOM   1291 C  CZ3   . TRP A 1 171 ? 13.726  115.733 5.134   1.00 29.00  ? 212 TRP A CZ3   1 
ATOM   1292 C  CH2   . TRP A 1 171 ? 12.714  115.779 6.100   1.00 26.03  ? 212 TRP A CH2   1 
ATOM   1293 N  N     . TYR A 1 172 ? 16.752  112.926 6.557   1.00 22.88  ? 213 TYR A N     1 
ATOM   1294 C  CA    . TYR A 1 172 ? 17.131  114.236 7.075   1.00 25.29  ? 213 TYR A CA    1 
ATOM   1295 C  C     . TYR A 1 172 ? 18.526  114.231 7.694   1.00 21.20  ? 213 TYR A C     1 
ATOM   1296 O  O     . TYR A 1 172 ? 19.014  115.269 8.142   1.00 23.73  ? 213 TYR A O     1 
ATOM   1297 C  CB    . TYR A 1 172 ? 16.102  114.723 8.101   1.00 24.36  ? 213 TYR A CB    1 
ATOM   1298 C  CG    . TYR A 1 172 ? 15.900  113.796 9.281   1.00 24.37  ? 213 TYR A CG    1 
ATOM   1299 C  CD1   . TYR A 1 172 ? 15.036  112.710 9.198   1.00 30.54  ? 213 TYR A CD1   1 
ATOM   1300 C  CD2   . TYR A 1 172 ? 16.563  114.013 10.482  1.00 25.87  ? 213 TYR A CD2   1 
ATOM   1301 C  CE1   . TYR A 1 172 ? 14.846  111.863 10.274  1.00 29.83  ? 213 TYR A CE1   1 
ATOM   1302 C  CE2   . TYR A 1 172 ? 16.378  113.171 11.565  1.00 30.22  ? 213 TYR A CE2   1 
ATOM   1303 C  CZ    . TYR A 1 172 ? 15.519  112.099 11.455  1.00 31.50  ? 213 TYR A CZ    1 
ATOM   1304 O  OH    . TYR A 1 172 ? 15.333  111.261 12.529  1.00 33.77  ? 213 TYR A OH    1 
ATOM   1305 N  N     . LEU A 1 173 ? 19.169  113.066 7.706   1.00 21.66  ? 214 LEU A N     1 
ATOM   1306 C  CA    . LEU A 1 173 ? 20.514  112.943 8.260   1.00 23.32  ? 214 LEU A CA    1 
ATOM   1307 C  C     . LEU A 1 173 ? 21.537  112.552 7.199   1.00 23.88  ? 214 LEU A C     1 
ATOM   1308 O  O     . LEU A 1 173 ? 21.830  111.370 7.016   1.00 19.64  ? 214 LEU A O     1 
ATOM   1309 C  CB    . LEU A 1 173 ? 20.536  111.919 9.398   1.00 22.87  ? 214 LEU A CB    1 
ATOM   1310 C  CG    . LEU A 1 173 ? 19.709  112.266 10.635  1.00 27.52  ? 214 LEU A CG    1 
ATOM   1311 C  CD1   . LEU A 1 173 ? 19.850  111.184 11.696  1.00 29.75  ? 214 LEU A CD1   1 
ATOM   1312 C  CD2   . LEU A 1 173 ? 20.105  113.627 11.189  1.00 23.63  ? 214 LEU A CD2   1 
ATOM   1313 N  N     . LYS A 1 174 ? 22.071  113.557 6.510   1.00 21.79  ? 215 LYS A N     1 
ATOM   1314 C  CA    . LYS A 1 174 ? 23.123  113.370 5.513   1.00 20.70  ? 215 LYS A CA    1 
ATOM   1315 C  C     . LYS A 1 174 ? 22.715  112.434 4.377   1.00 21.65  ? 215 LYS A C     1 
ATOM   1316 O  O     . LYS A 1 174 ? 23.395  111.446 4.102   1.00 23.98  ? 215 LYS A O     1 
ATOM   1317 C  CB    . LYS A 1 174 ? 24.400  112.851 6.181   1.00 21.52  ? 215 LYS A CB    1 
ATOM   1318 C  CG    . LYS A 1 174 ? 25.100  113.886 7.051   1.00 21.84  ? 215 LYS A CG    1 
ATOM   1319 C  CD    . LYS A 1 174 ? 26.314  113.302 7.755   1.00 23.48  ? 215 LYS A CD    1 
ATOM   1320 C  CE    . LYS A 1 174 ? 27.073  114.373 8.525   1.00 22.08  ? 215 LYS A CE    1 
ATOM   1321 N  NZ    . LYS A 1 174 ? 27.711  115.369 7.616   1.00 22.10  ? 215 LYS A NZ    1 
ATOM   1322 N  N     . MET A 1 175 ? 21.602  112.751 3.721   1.00 22.10  ? 216 MET A N     1 
ATOM   1323 C  CA    . MET A 1 175 ? 21.169  112.013 2.539   1.00 22.88  ? 216 MET A CA    1 
ATOM   1324 C  C     . MET A 1 175 ? 20.660  112.961 1.455   1.00 24.14  ? 216 MET A C     1 
ATOM   1325 O  O     . MET A 1 175 ? 20.065  113.998 1.752   1.00 19.71  ? 216 MET A O     1 
ATOM   1326 C  CB    . MET A 1 175 ? 20.080  110.996 2.894   1.00 21.85  ? 216 MET A CB    1 
ATOM   1327 C  CG    . MET A 1 175 ? 20.523  109.914 3.867   1.00 25.12  ? 216 MET A CG    1 
ATOM   1328 S  SD    . MET A 1 175 ? 19.323  108.577 4.016   1.00 24.80  ? 216 MET A SD    1 
ATOM   1329 C  CE    . MET A 1 175 ? 19.622  107.687 2.491   1.00 19.18  ? 216 MET A CE    1 
ATOM   1330 N  N     . LEU A 1 176 ? 20.904  112.590 0.200   1.00 20.81  ? 217 LEU A N     1 
ATOM   1331 C  CA    . LEU A 1 176 ? 20.437  113.351 -0.955  1.00 20.33  ? 217 LEU A CA    1 
ATOM   1332 C  C     . LEU A 1 176 ? 19.317  112.619 -1.678  1.00 22.46  ? 217 LEU A C     1 
ATOM   1333 O  O     . LEU A 1 176 ? 19.424  111.423 -1.947  1.00 20.92  ? 217 LEU A O     1 
ATOM   1334 C  CB    . LEU A 1 176 ? 21.583  113.607 -1.937  1.00 20.79  ? 217 LEU A CB    1 
ATOM   1335 C  CG    . LEU A 1 176 ? 22.660  114.628 -1.582  1.00 28.99  ? 217 LEU A CG    1 
ATOM   1336 C  CD1   . LEU A 1 176 ? 23.807  114.520 -2.576  1.00 24.81  ? 217 LEU A CD1   1 
ATOM   1337 C  CD2   . LEU A 1 176 ? 22.083  116.037 -1.573  1.00 20.60  ? 217 LEU A CD2   1 
ATOM   1338 N  N     . GLN A 1 177 ? 18.250  113.338 -2.005  1.00 19.66  ? 218 GLN A N     1 
ATOM   1339 C  CA    . GLN A 1 177 ? 17.162  112.755 -2.777  1.00 22.97  ? 218 GLN A CA    1 
ATOM   1340 C  C     . GLN A 1 177 ? 17.338  113.041 -4.262  1.00 22.07  ? 218 GLN A C     1 
ATOM   1341 O  O     . GLN A 1 177 ? 17.488  114.195 -4.667  1.00 24.79  ? 218 GLN A O     1 
ATOM   1342 C  CB    . GLN A 1 177 ? 15.811  113.286 -2.303  1.00 21.11  ? 218 GLN A CB    1 
ATOM   1343 C  CG    . GLN A 1 177 ? 14.627  112.634 -2.995  1.00 23.42  ? 218 GLN A CG    1 
ATOM   1344 C  CD    . GLN A 1 177 ? 13.301  113.204 -2.540  1.00 23.94  ? 218 GLN A CD    1 
ATOM   1345 O  OE1   . GLN A 1 177 ? 13.196  114.390 -2.227  1.00 27.54  ? 218 GLN A OE1   1 
ATOM   1346 N  NE2   . GLN A 1 177 ? 12.279  112.358 -2.495  1.00 22.58  ? 218 GLN A NE2   1 
ATOM   1347 N  N     . CYS A 1 178 ? 17.328  111.984 -5.069  1.00 22.65  ? 219 CYS A N     1 
ATOM   1348 C  CA    . CYS A 1 178 ? 17.400  112.133 -6.517  1.00 24.12  ? 219 CYS A CA    1 
ATOM   1349 C  C     . CYS A 1 178 ? 16.107  112.754 -7.024  1.00 25.60  ? 219 CYS A C     1 
ATOM   1350 O  O     . CYS A 1 178 ? 15.023  112.295 -6.675  1.00 24.35  ? 219 CYS A O     1 
ATOM   1351 C  CB    . CYS A 1 178 ? 17.647  110.784 -7.196  1.00 22.51  ? 219 CYS A CB    1 
ATOM   1352 S  SG    . CYS A 1 178 ? 17.727  110.863 -9.009  1.00 25.40  ? 219 CYS A SG    1 
ATOM   1353 N  N     . CYS A 1 179 ? 16.218  113.794 -7.844  1.00 24.07  ? 220 CYS A N     1 
ATOM   1354 C  CA    . CYS A 1 179 ? 15.036  114.501 -8.331  1.00 27.33  ? 220 CYS A CA    1 
ATOM   1355 C  C     . CYS A 1 179 ? 14.264  113.689 -9.367  1.00 26.61  ? 220 CYS A C     1 
ATOM   1356 O  O     . CYS A 1 179 ? 13.157  114.060 -9.750  1.00 33.12  ? 220 CYS A O     1 
ATOM   1357 C  CB    . CYS A 1 179 ? 15.428  115.859 -8.920  1.00 22.35  ? 220 CYS A CB    1 
ATOM   1358 S  SG    . CYS A 1 179 ? 16.523  115.781 -10.353 1.00 29.14  ? 220 CYS A SG    1 
ATOM   1359 N  N     . LYS A 1 180 ? 14.850  112.581 -9.814  1.00 24.75  ? 221 LYS A N     1 
ATOM   1360 C  CA    . LYS A 1 180 ? 14.211  111.726 -10.811 1.00 28.06  ? 221 LYS A CA    1 
ATOM   1361 C  C     . LYS A 1 180 ? 13.486  110.537 -10.177 1.00 31.07  ? 221 LYS A C     1 
ATOM   1362 O  O     . LYS A 1 180 ? 12.264  110.420 -10.281 1.00 29.44  ? 221 LYS A O     1 
ATOM   1363 C  CB    . LYS A 1 180 ? 15.242  111.221 -11.824 1.00 28.07  ? 221 LYS A CB    1 
ATOM   1364 C  CG    . LYS A 1 180 ? 16.027  112.323 -12.520 1.00 30.03  ? 221 LYS A CG    1 
ATOM   1365 C  CD    . LYS A 1 180 ? 15.107  113.293 -13.247 1.00 35.45  ? 221 LYS A CD    1 
ATOM   1366 C  CE    . LYS A 1 180 ? 15.904  114.375 -13.964 1.00 41.52  ? 221 LYS A CE    1 
ATOM   1367 N  NZ    . LYS A 1 180 ? 15.029  115.421 -14.571 1.00 49.80  ? 221 LYS A NZ    1 
ATOM   1368 N  N     . CYS A 1 181 ? 14.241  109.658 -9.524  1.00 28.67  ? 222 CYS A N     1 
ATOM   1369 C  CA    . CYS A 1 181 ? 13.675  108.429 -8.970  1.00 27.71  ? 222 CYS A CA    1 
ATOM   1370 C  C     . CYS A 1 181 ? 13.162  108.611 -7.544  1.00 27.43  ? 222 CYS A C     1 
ATOM   1371 O  O     . CYS A 1 181 ? 12.535  107.709 -6.987  1.00 31.58  ? 222 CYS A O     1 
ATOM   1372 C  CB    . CYS A 1 181 ? 14.709  107.300 -9.009  1.00 30.43  ? 222 CYS A CB    1 
ATOM   1373 S  SG    . CYS A 1 181 ? 16.170  107.577 -7.977  1.00 23.08  ? 222 CYS A SG    1 
ATOM   1374 N  N     . LYS A 1 182 ? 13.446  109.775 -6.963  1.00 26.83  ? 223 LYS A N     1 
ATOM   1375 C  CA    . LYS A 1 182 ? 12.975  110.158 -5.627  1.00 26.33  ? 223 LYS A CA    1 
ATOM   1376 C  C     . LYS A 1 182 ? 13.527  109.275 -4.507  1.00 23.80  ? 223 LYS A C     1 
ATOM   1377 O  O     . LYS A 1 182 ? 13.082  109.369 -3.364  1.00 25.43  ? 223 LYS A O     1 
ATOM   1378 C  CB    . LYS A 1 182 ? 11.442  110.157 -5.574  1.00 28.25  ? 223 LYS A CB    1 
ATOM   1379 C  CG    . LYS A 1 182 ? 10.781  110.957 -6.687  1.00 32.71  ? 223 LYS A CG    1 
ATOM   1380 C  CD    . LYS A 1 182 ? 11.284  112.393 -6.735  1.00 35.22  ? 223 LYS A CD    1 
ATOM   1381 C  CE    . LYS A 1 182 ? 10.613  113.168 -7.863  1.00 38.71  ? 223 LYS A CE    1 
ATOM   1382 N  NZ    . LYS A 1 182 ? 11.065  114.587 -7.932  1.00 42.42  ? 223 LYS A NZ    1 
ATOM   1383 N  N     . GLN A 1 183 ? 14.500  108.430 -4.831  1.00 22.31  ? 224 GLN A N     1 
ATOM   1384 C  CA    . GLN A 1 183 ? 15.179  107.623 -3.823  1.00 26.46  ? 224 GLN A CA    1 
ATOM   1385 C  C     . GLN A 1 183 ? 16.207  108.477 -3.079  1.00 23.82  ? 224 GLN A C     1 
ATOM   1386 O  O     . GLN A 1 183 ? 16.769  109.418 -3.645  1.00 22.29  ? 224 GLN A O     1 
ATOM   1387 C  CB    . GLN A 1 183 ? 15.848  106.404 -4.470  1.00 23.36  ? 224 GLN A CB    1 
ATOM   1388 C  CG    . GLN A 1 183 ? 16.727  105.566 -3.540  1.00 24.28  ? 224 GLN A CG    1 
ATOM   1389 C  CD    . GLN A 1 183 ? 15.956  104.935 -2.393  1.00 31.81  ? 224 GLN A CD    1 
ATOM   1390 O  OE1   . GLN A 1 183 ? 15.627  105.598 -1.407  1.00 25.16  ? 224 GLN A OE1   1 
ATOM   1391 N  NE2   . GLN A 1 183 ? 15.672  103.643 -2.513  1.00 22.44  ? 224 GLN A NE2   1 
ATOM   1392 N  N     . TRP A 1 184 ? 16.442  108.154 -1.810  1.00 22.10  ? 225 TRP A N     1 
ATOM   1393 C  CA    . TRP A 1 184 ? 17.416  108.879 -1.002  1.00 20.58  ? 225 TRP A CA    1 
ATOM   1394 C  C     . TRP A 1 184 ? 18.760  108.161 -0.984  1.00 21.83  ? 225 TRP A C     1 
ATOM   1395 O  O     . TRP A 1 184 ? 18.818  106.934 -0.913  1.00 25.29  ? 225 TRP A O     1 
ATOM   1396 C  CB    . TRP A 1 184 ? 16.888  109.066 0.420   1.00 19.78  ? 225 TRP A CB    1 
ATOM   1397 C  CG    . TRP A 1 184 ? 15.670  109.928 0.468   1.00 22.73  ? 225 TRP A CG    1 
ATOM   1398 C  CD1   . TRP A 1 184 ? 14.380  109.537 0.253   1.00 24.29  ? 225 TRP A CD1   1 
ATOM   1399 C  CD2   . TRP A 1 184 ? 15.623  111.334 0.738   1.00 19.99  ? 225 TRP A CD2   1 
ATOM   1400 N  NE1   . TRP A 1 184 ? 13.533  110.612 0.377   1.00 25.23  ? 225 TRP A NE1   1 
ATOM   1401 C  CE2   . TRP A 1 184 ? 14.272  111.727 0.674   1.00 23.04  ? 225 TRP A CE2   1 
ATOM   1402 C  CE3   . TRP A 1 184 ? 16.593  112.298 1.030   1.00 21.21  ? 225 TRP A CE3   1 
ATOM   1403 C  CZ2   . TRP A 1 184 ? 13.865  113.042 0.892   1.00 20.98  ? 225 TRP A CZ2   1 
ATOM   1404 C  CZ3   . TRP A 1 184 ? 16.188  113.603 1.246   1.00 23.96  ? 225 TRP A CZ3   1 
ATOM   1405 C  CH2   . TRP A 1 184 ? 14.836  113.963 1.174   1.00 24.11  ? 225 TRP A CH2   1 
ATOM   1406 N  N     . PHE A 1 185 ? 19.840  108.932 -1.050  1.00 22.99  ? 226 PHE A N     1 
ATOM   1407 C  CA    . PHE A 1 185 ? 21.177  108.361 -1.163  1.00 20.82  ? 226 PHE A CA    1 
ATOM   1408 C  C     . PHE A 1 185 ? 22.121  108.891 -0.085  1.00 22.52  ? 226 PHE A C     1 
ATOM   1409 O  O     . PHE A 1 185 ? 22.138  110.087 0.202   1.00 23.58  ? 226 PHE A O     1 
ATOM   1410 C  CB    . PHE A 1 185 ? 21.745  108.643 -2.557  1.00 21.85  ? 226 PHE A CB    1 
ATOM   1411 C  CG    . PHE A 1 185 ? 20.983  107.971 -3.666  1.00 27.25  ? 226 PHE A CG    1 
ATOM   1412 C  CD1   . PHE A 1 185 ? 21.435  106.779 -4.207  1.00 26.10  ? 226 PHE A CD1   1 
ATOM   1413 C  CD2   . PHE A 1 185 ? 19.810  108.521 -4.159  1.00 18.57  ? 226 PHE A CD2   1 
ATOM   1414 C  CE1   . PHE A 1 185 ? 20.737  106.151 -5.219  1.00 22.02  ? 226 PHE A CE1   1 
ATOM   1415 C  CE2   . PHE A 1 185 ? 19.107  107.896 -5.172  1.00 30.74  ? 226 PHE A CE2   1 
ATOM   1416 C  CZ    . PHE A 1 185 ? 19.573  106.710 -5.703  1.00 24.75  ? 226 PHE A CZ    1 
ATOM   1417 N  N     . HIS A 1 186 ? 22.911  107.993 0.498   1.00 23.04  ? 227 HIS A N     1 
ATOM   1418 C  CA    . HIS A 1 186 ? 23.830  108.347 1.580   1.00 24.44  ? 227 HIS A CA    1 
ATOM   1419 C  C     . HIS A 1 186 ? 24.922  109.315 1.137   1.00 20.45  ? 227 HIS A C     1 
ATOM   1420 O  O     . HIS A 1 186 ? 25.407  109.248 0.007   1.00 22.84  ? 227 HIS A O     1 
ATOM   1421 C  CB    . HIS A 1 186 ? 24.490  107.092 2.163   1.00 22.44  ? 227 HIS A CB    1 
ATOM   1422 C  CG    . HIS A 1 186 ? 23.533  106.150 2.824   1.00 22.83  ? 227 HIS A CG    1 
ATOM   1423 N  ND1   . HIS A 1 186 ? 23.234  104.909 2.305   1.00 18.90  ? 227 HIS A ND1   1 
ATOM   1424 C  CD2   . HIS A 1 186 ? 22.813  106.265 3.965   1.00 19.81  ? 227 HIS A CD2   1 
ATOM   1425 C  CE1   . HIS A 1 186 ? 22.368  104.301 3.097   1.00 22.69  ? 227 HIS A CE1   1 
ATOM   1426 N  NE2   . HIS A 1 186 ? 22.095  105.102 4.110   1.00 24.96  ? 227 HIS A NE2   1 
ATOM   1427 N  N     . GLU A 1 187 ? 25.302  110.210 2.042   1.00 21.71  ? 228 GLU A N     1 
ATOM   1428 C  CA    . GLU A 1 187 ? 26.454  111.078 1.838   1.00 19.49  ? 228 GLU A CA    1 
ATOM   1429 C  C     . GLU A 1 187 ? 27.701  110.246 1.555   1.00 25.43  ? 228 GLU A C     1 
ATOM   1430 O  O     . GLU A 1 187 ? 28.500  110.574 0.678   1.00 21.41  ? 228 GLU A O     1 
ATOM   1431 C  CB    . GLU A 1 187 ? 26.675  111.965 3.065   1.00 23.38  ? 228 GLU A CB    1 
ATOM   1432 C  CG    . GLU A 1 187 ? 28.014  112.683 3.098   1.00 23.86  ? 228 GLU A CG    1 
ATOM   1433 C  CD    . GLU A 1 187 ? 28.307  113.302 4.452   1.00 28.42  ? 228 GLU A CD    1 
ATOM   1434 O  OE1   . GLU A 1 187 ? 28.020  114.504 4.639   1.00 24.88  ? 228 GLU A OE1   1 
ATOM   1435 O  OE2   . GLU A 1 187 ? 28.823  112.582 5.332   1.00 28.41  ? 228 GLU A OE2   1 
ATOM   1436 N  N     . ALA A 1 188 ? 27.841  109.150 2.294   1.00 23.65  ? 229 ALA A N     1 
ATOM   1437 C  CA    . ALA A 1 188 ? 29.024  108.304 2.214   1.00 24.12  ? 229 ALA A CA    1 
ATOM   1438 C  C     . ALA A 1 188 ? 29.119  107.527 0.901   1.00 21.80  ? 229 ALA A C     1 
ATOM   1439 O  O     . ALA A 1 188 ? 30.191  107.040 0.544   1.00 23.32  ? 229 ALA A O     1 
ATOM   1440 C  CB    . ALA A 1 188 ? 29.049  107.339 3.391   1.00 22.27  ? 229 ALA A CB    1 
ATOM   1441 N  N     . CYS A 1 189 ? 28.007  107.419 0.180   1.00 21.21  ? 230 CYS A N     1 
ATOM   1442 C  CA    . CYS A 1 189 ? 27.963  106.599 -1.030  1.00 21.01  ? 230 CYS A CA    1 
ATOM   1443 C  C     . CYS A 1 189 ? 28.007  107.413 -2.325  1.00 26.26  ? 230 CYS A C     1 
ATOM   1444 O  O     . CYS A 1 189 ? 28.190  106.853 -3.407  1.00 27.05  ? 230 CYS A O     1 
ATOM   1445 C  CB    . CYS A 1 189 ? 26.708  105.721 -1.023  1.00 20.09  ? 230 CYS A CB    1 
ATOM   1446 S  SG    . CYS A 1 189 ? 26.645  104.484 0.304   1.00 24.42  ? 230 CYS A SG    1 
ATOM   1447 N  N     . VAL A 1 190 ? 27.834  108.726 -2.226  1.00 26.20  ? 231 VAL A N     1 
ATOM   1448 C  CA    . VAL A 1 190 ? 27.872  109.569 -3.417  1.00 23.37  ? 231 VAL A CA    1 
ATOM   1449 C  C     . VAL A 1 190 ? 29.280  110.108 -3.651  1.00 23.24  ? 231 VAL A C     1 
ATOM   1450 O  O     . VAL A 1 190 ? 30.097  110.161 -2.730  1.00 25.00  ? 231 VAL A O     1 
ATOM   1451 C  CB    . VAL A 1 190 ? 26.876  110.744 -3.323  1.00 24.15  ? 231 VAL A CB    1 
ATOM   1452 C  CG1   . VAL A 1 190 ? 25.447  110.223 -3.233  1.00 21.36  ? 231 VAL A CG1   1 
ATOM   1453 C  CG2   . VAL A 1 190 ? 27.206  111.629 -2.134  1.00 19.20  ? 231 VAL A CG2   1 
ATOM   1454 N  N     . GLN A 1 191 ? 29.560  110.500 -4.888  1.00 21.40  ? 232 GLN A N     1 
ATOM   1455 C  CA    . GLN A 1 191 ? 30.895  110.947 -5.261  1.00 31.17  ? 232 GLN A CA    1 
ATOM   1456 C  C     . GLN A 1 191 ? 30.872  112.345 -5.867  1.00 30.99  ? 232 GLN A C     1 
ATOM   1457 O  O     . GLN A 1 191 ? 31.763  112.711 -6.633  1.00 32.40  ? 232 GLN A O     1 
ATOM   1458 C  CB    . GLN A 1 191 ? 31.524  109.960 -6.248  1.00 26.95  ? 232 GLN A CB    1 
ATOM   1459 C  CG    . GLN A 1 191 ? 31.644  108.540 -5.715  1.00 29.55  ? 232 GLN A CG    1 
ATOM   1460 C  CD    . GLN A 1 191 ? 32.023  107.543 -6.794  1.00 32.18  ? 232 GLN A CD    1 
ATOM   1461 O  OE1   . GLN A 1 191 ? 33.174  107.119 -6.888  1.00 34.86  ? 232 GLN A OE1   1 
ATOM   1462 N  NE2   . GLN A 1 191 ? 31.051  107.163 -7.613  1.00 30.99  ? 232 GLN A NE2   1 
ATOM   1463 N  N     . CYS A 1 192 ? 29.854  113.127 -5.522  1.00 25.60  ? 233 CYS A N     1 
ATOM   1464 C  CA    . CYS A 1 192 ? 29.668  114.437 -6.138  1.00 29.13  ? 233 CYS A CA    1 
ATOM   1465 C  C     . CYS A 1 192 ? 29.743  115.595 -5.145  1.00 28.57  ? 233 CYS A C     1 
ATOM   1466 O  O     . CYS A 1 192 ? 29.721  116.759 -5.544  1.00 30.17  ? 233 CYS A O     1 
ATOM   1467 C  CB    . CYS A 1 192 ? 28.327  114.480 -6.876  1.00 27.81  ? 233 CYS A CB    1 
ATOM   1468 S  SG    . CYS A 1 192 ? 26.890  114.045 -5.859  1.00 27.23  ? 233 CYS A SG    1 
ATOM   1469 N  N     . LEU A 1 193 ? 29.834  115.281 -3.857  1.00 28.72  ? 234 LEU A N     1 
ATOM   1470 C  CA    . LEU A 1 193 ? 29.854  116.315 -2.825  1.00 29.56  ? 234 LEU A CA    1 
ATOM   1471 C  C     . LEU A 1 193 ? 31.202  117.022 -2.741  1.00 35.44  ? 234 LEU A C     1 
ATOM   1472 O  O     . LEU A 1 193 ? 32.252  116.401 -2.902  1.00 33.86  ? 234 LEU A O     1 
ATOM   1473 C  CB    . LEU A 1 193 ? 29.499  115.717 -1.463  1.00 27.18  ? 234 LEU A CB    1 
ATOM   1474 C  CG    . LEU A 1 193 ? 28.035  115.320 -1.270  1.00 30.49  ? 234 LEU A CG    1 
ATOM   1475 C  CD1   . LEU A 1 193 ? 27.860  114.522 0.009   1.00 26.18  ? 234 LEU A CD1   1 
ATOM   1476 C  CD2   . LEU A 1 193 ? 27.146  116.557 -1.258  1.00 22.76  ? 234 LEU A CD2   1 
ATOM   1477 N  N     . GLN A 1 194 ? 31.159  118.326 -2.484  1.00 32.55  ? 235 GLN A N     1 
ATOM   1478 C  CA    . GLN A 1 194 ? 32.369  119.116 -2.295  1.00 37.11  ? 235 GLN A CA    1 
ATOM   1479 C  C     . GLN A 1 194 ? 32.644  119.296 -0.807  1.00 35.45  ? 235 GLN A C     1 
ATOM   1480 O  O     . GLN A 1 194 ? 33.792  119.437 -0.387  1.00 41.37  ? 235 GLN A O     1 
ATOM   1481 C  CB    . GLN A 1 194 ? 32.241  120.480 -2.980  1.00 39.72  ? 235 GLN A CB    1 
ATOM   1482 C  CG    . GLN A 1 194 ? 31.815  120.415 -4.441  1.00 42.09  ? 235 GLN A CG    1 
ATOM   1483 C  CD    . GLN A 1 194 ? 32.833  119.712 -5.320  1.00 52.05  ? 235 GLN A CD    1 
ATOM   1484 O  OE1   . GLN A 1 194 ? 34.023  119.668 -5.002  1.00 57.76  ? 235 GLN A OE1   1 
ATOM   1485 N  NE2   . GLN A 1 194 ? 32.369  119.156 -6.433  1.00 53.09  ? 235 GLN A NE2   1 
ATOM   1486 N  N     . LYS A 1 195 ? 31.574  119.291 -0.018  1.00 33.47  ? 236 LYS A N     1 
ATOM   1487 C  CA    . LYS A 1 195 ? 31.658  119.472 1.428   1.00 33.75  ? 236 LYS A CA    1 
ATOM   1488 C  C     . LYS A 1 195 ? 30.658  118.554 2.129   1.00 34.43  ? 236 LYS A C     1 
ATOM   1489 O  O     . LYS A 1 195 ? 29.633  118.198 1.547   1.00 30.83  ? 236 LYS A O     1 
ATOM   1490 C  CB    . LYS A 1 195 ? 31.391  120.934 1.802   1.00 33.27  ? 236 LYS A CB    1 
ATOM   1491 C  CG    . LYS A 1 195 ? 32.419  121.922 1.267   1.00 42.91  ? 236 LYS A CG    1 
ATOM   1492 C  CD    . LYS A 1 195 ? 32.007  123.356 1.571   1.00 48.23  ? 236 LYS A CD    1 
ATOM   1493 C  CE    . LYS A 1 195 ? 33.059  124.358 1.111   1.00 52.91  ? 236 LYS A CE    1 
ATOM   1494 N  NZ    . LYS A 1 195 ? 32.918  124.721 -0.330  1.00 52.11  ? 236 LYS A NZ    1 
ATOM   1495 N  N     . PRO A 1 196 ? 30.957  118.156 3.377   1.00 30.83  ? 237 PRO A N     1 
ATOM   1496 C  CA    . PRO A 1 196 ? 30.022  117.339 4.159   1.00 29.76  ? 237 PRO A CA    1 
ATOM   1497 C  C     . PRO A 1 196 ? 28.651  117.998 4.286   1.00 28.95  ? 237 PRO A C     1 
ATOM   1498 O  O     . PRO A 1 196 ? 28.563  119.219 4.405   1.00 28.43  ? 237 PRO A O     1 
ATOM   1499 C  CB    . PRO A 1 196 ? 30.707  117.231 5.524   1.00 31.06  ? 237 PRO A CB    1 
ATOM   1500 C  CG    . PRO A 1 196 ? 32.152  117.380 5.224   1.00 28.95  ? 237 PRO A CG    1 
ATOM   1501 C  CD    . PRO A 1 196 ? 32.232  118.361 4.086   1.00 29.76  ? 237 PRO A CD    1 
ATOM   1502 N  N     . MET A 1 197 ? 27.596  117.192 4.251   1.00 26.61  ? 238 MET A N     1 
ATOM   1503 C  CA    . MET A 1 197 ? 26.239  117.720 4.274   1.00 28.44  ? 238 MET A CA    1 
ATOM   1504 C  C     . MET A 1 197 ? 25.804  118.171 5.661   1.00 27.89  ? 238 MET A C     1 
ATOM   1505 O  O     . MET A 1 197 ? 26.261  117.644 6.677   1.00 26.20  ? 238 MET A O     1 
ATOM   1506 C  CB    . MET A 1 197 ? 25.248  116.676 3.760   1.00 22.96  ? 238 MET A CB    1 
ATOM   1507 C  CG    . MET A 1 197 ? 25.436  116.281 2.312   1.00 27.50  ? 238 MET A CG    1 
ATOM   1508 S  SD    . MET A 1 197 ? 24.185  115.085 1.819   1.00 26.02  ? 238 MET A SD    1 
ATOM   1509 C  CE    . MET A 1 197 ? 22.693  116.028 2.122   1.00 21.80  ? 238 MET A CE    1 
ATOM   1510 N  N     . LEU A 1 198 ? 24.912  119.156 5.683   1.00 24.92  ? 239 LEU A N     1 
ATOM   1511 C  CA    . LEU A 1 198 ? 24.208  119.543 6.897   1.00 25.72  ? 239 LEU A CA    1 
ATOM   1512 C  C     . LEU A 1 198 ? 22.933  118.720 7.008   1.00 24.37  ? 239 LEU A C     1 
ATOM   1513 O  O     . LEU A 1 198 ? 22.407  118.246 6.002   1.00 21.49  ? 239 LEU A O     1 
ATOM   1514 C  CB    . LEU A 1 198 ? 23.880  121.036 6.883   1.00 24.27  ? 239 LEU A CB    1 
ATOM   1515 C  CG    . LEU A 1 198 ? 25.062  122.003 6.904   1.00 34.69  ? 239 LEU A CG    1 
ATOM   1516 C  CD1   . LEU A 1 198 ? 24.692  123.312 6.234   1.00 39.42  ? 239 LEU A CD1   1 
ATOM   1517 C  CD2   . LEU A 1 198 ? 25.496  122.249 8.333   1.00 36.93  ? 239 LEU A CD2   1 
ATOM   1518 N  N     . PHE A 1 199 ? 22.437  118.546 8.227   1.00 23.19  ? 240 PHE A N     1 
ATOM   1519 C  CA    . PHE A 1 199 ? 21.201  117.807 8.440   1.00 19.55  ? 240 PHE A CA    1 
ATOM   1520 C  C     . PHE A 1 199 ? 20.022  118.541 7.812   1.00 23.82  ? 240 PHE A C     1 
ATOM   1521 O  O     . PHE A 1 199 ? 19.886  119.753 7.962   1.00 24.16  ? 240 PHE A O     1 
ATOM   1522 C  CB    . PHE A 1 199 ? 20.952  117.590 9.934   1.00 21.86  ? 240 PHE A CB    1 
ATOM   1523 C  CG    . PHE A 1 199 ? 21.975  116.714 10.599  1.00 23.70  ? 240 PHE A CG    1 
ATOM   1524 C  CD1   . PHE A 1 199 ? 22.685  115.777 9.866   1.00 23.83  ? 240 PHE A CD1   1 
ATOM   1525 C  CD2   . PHE A 1 199 ? 22.227  116.827 11.958  1.00 23.57  ? 240 PHE A CD2   1 
ATOM   1526 C  CE1   . PHE A 1 199 ? 23.626  114.969 10.475  1.00 23.99  ? 240 PHE A CE1   1 
ATOM   1527 C  CE2   . PHE A 1 199 ? 23.167  116.023 12.573  1.00 24.78  ? 240 PHE A CE2   1 
ATOM   1528 C  CZ    . PHE A 1 199 ? 23.867  115.093 11.831  1.00 26.06  ? 240 PHE A CZ    1 
ATOM   1529 N  N     . GLY A 1 200 ? 19.181  117.802 7.096   1.00 20.59  ? 241 GLY A N     1 
ATOM   1530 C  CA    . GLY A 1 200 ? 17.970  118.363 6.525   1.00 26.54  ? 241 GLY A CA    1 
ATOM   1531 C  C     . GLY A 1 200 ? 18.196  119.337 5.381   1.00 25.96  ? 241 GLY A C     1 
ATOM   1532 O  O     . GLY A 1 200 ? 17.286  120.072 5.000   1.00 29.73  ? 241 GLY A O     1 
ATOM   1533 N  N     . ASP A 1 201 ? 19.403  119.343 4.827   1.00 24.37  ? 242 ASP A N     1 
ATOM   1534 C  CA    . ASP A 1 201 ? 19.729  120.241 3.724   1.00 26.01  ? 242 ASP A CA    1 
ATOM   1535 C  C     . ASP A 1 201 ? 19.251  119.655 2.397   1.00 19.92  ? 242 ASP A C     1 
ATOM   1536 O  O     . ASP A 1 201 ? 19.887  118.760 1.843   1.00 20.94  ? 242 ASP A O     1 
ATOM   1537 C  CB    . ASP A 1 201 ? 21.238  120.505 3.682   1.00 22.92  ? 242 ASP A CB    1 
ATOM   1538 C  CG    . ASP A 1 201 ? 21.612  121.670 2.779   1.00 23.63  ? 242 ASP A CG    1 
ATOM   1539 O  OD1   . ASP A 1 201 ? 20.791  122.073 1.930   1.00 23.43  ? 242 ASP A OD1   1 
ATOM   1540 O  OD2   . ASP A 1 201 ? 22.743  122.182 2.915   1.00 22.85  ? 242 ASP A OD2   1 
ATOM   1541 N  N     . ARG A 1 202 ? 18.129  120.162 1.893   1.00 21.86  ? 243 ARG A N     1 
ATOM   1542 C  CA    . ARG A 1 202 ? 17.572  119.681 0.632   1.00 26.80  ? 243 ARG A CA    1 
ATOM   1543 C  C     . ARG A 1 202 ? 17.766  120.699 -0.484  1.00 25.40  ? 243 ARG A C     1 
ATOM   1544 O  O     . ARG A 1 202 ? 17.144  120.601 -1.543  1.00 23.02  ? 243 ARG A O     1 
ATOM   1545 C  CB    . ARG A 1 202 ? 16.087  119.361 0.787   1.00 22.45  ? 243 ARG A CB    1 
ATOM   1546 C  CG    . ARG A 1 202 ? 15.770  118.490 1.982   1.00 30.85  ? 243 ARG A CG    1 
ATOM   1547 C  CD    . ARG A 1 202 ? 14.272  118.345 2.161   1.00 25.36  ? 243 ARG A CD    1 
ATOM   1548 N  NE    . ARG A 1 202 ? 13.678  117.496 1.135   1.00 32.72  ? 243 ARG A NE    1 
ATOM   1549 C  CZ    . ARG A 1 202 ? 12.373  117.284 1.011   1.00 41.05  ? 243 ARG A CZ    1 
ATOM   1550 N  NH1   . ARG A 1 202 ? 11.526  117.868 1.849   1.00 40.96  ? 243 ARG A NH1   1 
ATOM   1551 N  NH2   . ARG A 1 202 ? 11.917  116.491 0.050   1.00 35.02  ? 243 ARG A NH2   1 
ATOM   1552 N  N     . PHE A 1 203 ? 18.635  121.676 -0.243  1.00 20.90  ? 244 PHE A N     1 
ATOM   1553 C  CA    . PHE A 1 203 ? 18.904  122.723 -1.224  1.00 20.92  ? 244 PHE A CA    1 
ATOM   1554 C  C     . PHE A 1 203 ? 19.899  122.251 -2.277  1.00 25.24  ? 244 PHE A C     1 
ATOM   1555 O  O     . PHE A 1 203 ? 20.915  122.899 -2.531  1.00 22.58  ? 244 PHE A O     1 
ATOM   1556 C  CB    . PHE A 1 203 ? 19.411  123.987 -0.528  1.00 21.73  ? 244 PHE A CB    1 
ATOM   1557 C  CG    . PHE A 1 203 ? 18.319  124.797 0.113   1.00 24.95  ? 244 PHE A CG    1 
ATOM   1558 C  CD1   . PHE A 1 203 ? 17.658  124.325 1.235   1.00 24.96  ? 244 PHE A CD1   1 
ATOM   1559 C  CD2   . PHE A 1 203 ? 17.944  126.021 -0.415  1.00 23.72  ? 244 PHE A CD2   1 
ATOM   1560 C  CE1   . PHE A 1 203 ? 16.646  125.061 1.821   1.00 29.31  ? 244 PHE A CE1   1 
ATOM   1561 C  CE2   . PHE A 1 203 ? 16.936  126.763 0.171   1.00 21.42  ? 244 PHE A CE2   1 
ATOM   1562 C  CZ    . PHE A 1 203 ? 16.286  126.281 1.289   1.00 23.63  ? 244 PHE A CZ    1 
ATOM   1563 N  N     . TYR A 1 204 ? 19.589  121.110 -2.884  1.00 24.81  ? 245 TYR A N     1 
ATOM   1564 C  CA    . TYR A 1 204 ? 20.392  120.550 -3.960  1.00 20.38  ? 245 TYR A CA    1 
ATOM   1565 C  C     . TYR A 1 204 ? 19.501  120.081 -5.099  1.00 25.15  ? 245 TYR A C     1 
ATOM   1566 O  O     . TYR A 1 204 ? 18.338  119.730 -4.890  1.00 21.57  ? 245 TYR A O     1 
ATOM   1567 C  CB    . TYR A 1 204 ? 21.228  119.364 -3.473  1.00 21.49  ? 245 TYR A CB    1 
ATOM   1568 C  CG    . TYR A 1 204 ? 22.260  119.673 -2.414  1.00 24.34  ? 245 TYR A CG    1 
ATOM   1569 C  CD1   . TYR A 1 204 ? 23.562  120.011 -2.761  1.00 17.92  ? 245 TYR A CD1   1 
ATOM   1570 C  CD2   . TYR A 1 204 ? 21.940  119.595 -1.065  1.00 19.47  ? 245 TYR A CD2   1 
ATOM   1571 C  CE1   . TYR A 1 204 ? 24.512  120.281 -1.793  1.00 22.55  ? 245 TYR A CE1   1 
ATOM   1572 C  CE2   . TYR A 1 204 ? 22.883  119.861 -0.090  1.00 21.02  ? 245 TYR A CE2   1 
ATOM   1573 C  CZ    . TYR A 1 204 ? 24.167  120.204 -0.460  1.00 26.32  ? 245 TYR A CZ    1 
ATOM   1574 O  OH    . TYR A 1 204 ? 25.110  120.472 0.507   1.00 28.49  ? 245 TYR A OH    1 
ATOM   1575 N  N     . THR A 1 205 ? 20.053  120.068 -6.305  1.00 22.86  ? 246 THR A N     1 
ATOM   1576 C  CA    . THR A 1 205 ? 19.444  119.329 -7.397  1.00 23.46  ? 246 THR A CA    1 
ATOM   1577 C  C     . THR A 1 205 ? 20.331  118.129 -7.683  1.00 17.55  ? 246 THR A C     1 
ATOM   1578 O  O     . THR A 1 205 ? 21.458  118.278 -8.153  1.00 23.12  ? 246 THR A O     1 
ATOM   1579 C  CB    . THR A 1 205 ? 19.274  120.177 -8.658  1.00 24.67  ? 246 THR A CB    1 
ATOM   1580 O  OG1   . THR A 1 205 ? 18.344  121.234 -8.394  1.00 25.24  ? 246 THR A OG1   1 
ATOM   1581 C  CG2   . THR A 1 205 ? 18.742  119.320 -9.798  1.00 26.93  ? 246 THR A CG2   1 
ATOM   1582 N  N     . PHE A 1 206 ? 19.824  116.941 -7.379  1.00 23.13  ? 247 PHE A N     1 
ATOM   1583 C  CA    . PHE A 1 206 ? 20.636  115.736 -7.437  1.00 22.08  ? 247 PHE A CA    1 
ATOM   1584 C  C     . PHE A 1 206 ? 20.065  114.687 -8.379  1.00 21.39  ? 247 PHE A C     1 
ATOM   1585 O  O     . PHE A 1 206 ? 18.880  114.362 -8.316  1.00 22.33  ? 247 PHE A O     1 
ATOM   1586 C  CB    . PHE A 1 206 ? 20.788  115.143 -6.034  1.00 22.77  ? 247 PHE A CB    1 
ATOM   1587 C  CG    . PHE A 1 206 ? 21.498  113.821 -6.006  1.00 19.99  ? 247 PHE A CG    1 
ATOM   1588 C  CD1   . PHE A 1 206 ? 22.827  113.726 -6.384  1.00 20.54  ? 247 PHE A CD1   1 
ATOM   1589 C  CD2   . PHE A 1 206 ? 20.842  112.674 -5.589  1.00 23.59  ? 247 PHE A CD2   1 
ATOM   1590 C  CE1   . PHE A 1 206 ? 23.486  112.511 -6.356  1.00 24.79  ? 247 PHE A CE1   1 
ATOM   1591 C  CE2   . PHE A 1 206 ? 21.493  111.457 -5.557  1.00 21.47  ? 247 PHE A CE2   1 
ATOM   1592 C  CZ    . PHE A 1 206 ? 22.817  111.375 -5.941  1.00 20.57  ? 247 PHE A CZ    1 
ATOM   1593 N  N     . ILE A 1 207 ? 20.921  114.162 -9.250  1.00 20.99  ? 248 ILE A N     1 
ATOM   1594 C  CA    . ILE A 1 207 ? 20.563  113.036 -10.103 1.00 23.16  ? 248 ILE A CA    1 
ATOM   1595 C  C     . ILE A 1 207 ? 21.539  111.889 -9.859  1.00 19.85  ? 248 ILE A C     1 
ATOM   1596 O  O     . ILE A 1 207 ? 22.738  112.019 -10.113 1.00 22.27  ? 248 ILE A O     1 
ATOM   1597 C  CB    . ILE A 1 207 ? 20.570  113.413 -11.597 1.00 24.53  ? 248 ILE A CB    1 
ATOM   1598 C  CG1   . ILE A 1 207 ? 19.653  114.611 -11.850 1.00 21.11  ? 248 ILE A CG1   1 
ATOM   1599 C  CG2   . ILE A 1 207 ? 20.139  112.224 -12.446 1.00 24.77  ? 248 ILE A CG2   1 
ATOM   1600 C  CD1   . ILE A 1 207 ? 19.621  115.063 -13.291 1.00 26.09  ? 248 ILE A CD1   1 
ATOM   1601 N  N     . CYS A 1 208 ? 21.021  110.771 -9.358  1.00 25.36  ? 249 CYS A N     1 
ATOM   1602 C  CA    . CYS A 1 208 ? 21.861  109.636 -8.995  1.00 25.56  ? 249 CYS A CA    1 
ATOM   1603 C  C     . CYS A 1 208 ? 22.449  108.955 -10.226 1.00 31.30  ? 249 CYS A C     1 
ATOM   1604 O  O     . CYS A 1 208 ? 21.998  109.184 -11.350 1.00 26.58  ? 249 CYS A O     1 
ATOM   1605 C  CB    . CYS A 1 208 ? 21.066  108.626 -8.172  1.00 25.55  ? 249 CYS A CB    1 
ATOM   1606 S  SG    . CYS A 1 208 ? 19.921  107.630 -9.139  1.00 24.56  ? 249 CYS A SG    1 
ATOM   1607 N  N     . SER A 1 209 ? 23.456  108.116 -10.000 1.00 30.12  ? 250 SER A N     1 
ATOM   1608 C  CA    . SER A 1 209 ? 24.142  107.414 -11.079 1.00 29.70  ? 250 SER A CA    1 
ATOM   1609 C  C     . SER A 1 209 ? 23.243  106.397 -11.773 1.00 29.64  ? 250 SER A C     1 
ATOM   1610 O  O     . SER A 1 209 ? 23.461  106.057 -12.935 1.00 30.78  ? 250 SER A O     1 
ATOM   1611 C  CB    . SER A 1 209 ? 25.393  106.718 -10.543 1.00 25.68  ? 250 SER A CB    1 
ATOM   1612 O  OG    . SER A 1 209 ? 26.407  107.658 -10.237 1.00 29.13  ? 250 SER A OG    1 
ATOM   1613 N  N     . VAL A 1 210 ? 22.240  105.906 -11.055 1.00 29.38  ? 251 VAL A N     1 
ATOM   1614 C  CA    . VAL A 1 210 ? 21.303  104.949 -11.626 1.00 27.82  ? 251 VAL A CA    1 
ATOM   1615 C  C     . VAL A 1 210 ? 20.469  105.613 -12.722 1.00 38.04  ? 251 VAL A C     1 
ATOM   1616 O  O     . VAL A 1 210 ? 20.259  105.037 -13.790 1.00 35.27  ? 251 VAL A O     1 
ATOM   1617 C  CB    . VAL A 1 210 ? 20.375  104.355 -10.549 1.00 32.73  ? 251 VAL A CB    1 
ATOM   1618 C  CG1   . VAL A 1 210 ? 19.391  103.373 -11.171 1.00 31.35  ? 251 VAL A CG1   1 
ATOM   1619 C  CG2   . VAL A 1 210 ? 21.194  103.678 -9.457  1.00 26.92  ? 251 VAL A CG2   1 
ATOM   1620 N  N     . CYS A 1 211 ? 20.013  106.833 -12.457 1.00 35.17  ? 252 CYS A N     1 
ATOM   1621 C  CA    . CYS A 1 211 ? 19.194  107.572 -13.412 1.00 33.22  ? 252 CYS A CA    1 
ATOM   1622 C  C     . CYS A 1 211 ? 20.023  108.204 -14.527 1.00 28.57  ? 252 CYS A C     1 
ATOM   1623 O  O     . CYS A 1 211 ? 19.533  108.402 -15.638 1.00 31.29  ? 252 CYS A O     1 
ATOM   1624 C  CB    . CYS A 1 211 ? 18.393  108.658 -12.691 1.00 23.23  ? 252 CYS A CB    1 
ATOM   1625 S  SG    . CYS A 1 211 ? 17.079  108.032 -11.626 1.00 26.94  ? 252 CYS A SG    1 
ATOM   1626 N  N     . SER A 1 212 ? 21.277  108.521 -14.228 1.00 32.12  ? 253 SER A N     1 
ATOM   1627 C  CA    . SER A 1 212 ? 22.135  109.209 -15.186 1.00 31.64  ? 253 SER A CA    1 
ATOM   1628 C  C     . SER A 1 212 ? 22.950  108.237 -16.032 1.00 34.73  ? 253 SER A C     1 
ATOM   1629 O  O     . SER A 1 212 ? 23.500  108.622 -17.067 1.00 32.75  ? 253 SER A O     1 
ATOM   1630 C  CB    . SER A 1 212 ? 23.077  110.171 -14.464 1.00 25.47  ? 253 SER A CB    1 
ATOM   1631 O  OG    . SER A 1 212 ? 24.025  109.464 -13.683 1.00 36.35  ? 253 SER A OG    1 
ATOM   1632 N  N     . SER A 1 213 ? 23.023  106.985 -15.584 1.00 30.26  ? 254 SER A N     1 
ATOM   1633 C  CA    . SER A 1 213 ? 23.840  105.960 -16.232 1.00 34.85  ? 254 SER A CA    1 
ATOM   1634 C  C     . SER A 1 213 ? 25.280  106.439 -16.396 1.00 34.54  ? 254 SER A C     1 
ATOM   1635 O  O     . SER A 1 213 ? 25.888  106.274 -17.452 1.00 37.74  ? 254 SER A O     1 
ATOM   1636 C  CB    . SER A 1 213 ? 23.245  105.568 -17.586 1.00 32.07  ? 254 SER A CB    1 
ATOM   1637 O  OG    . SER A 1 213 ? 21.956  105.000 -17.421 1.00 38.57  ? 254 SER A OG    1 
ATOM   1638 N  N     . GLY A 1 214 ? 25.810  107.038 -15.336 1.00 32.69  ? 255 GLY A N     1 
ATOM   1639 C  CA    . GLY A 1 214 ? 27.152  107.587 -15.344 1.00 29.50  ? 255 GLY A CA    1 
ATOM   1640 C  C     . GLY A 1 214 ? 27.396  108.389 -14.082 1.00 31.44  ? 255 GLY A C     1 
ATOM   1641 O  O     . GLY A 1 214 ? 26.860  108.057 -13.027 1.00 31.89  ? 255 GLY A O     1 
ATOM   1642 N  N     . PRO A 1 215 ? 28.206  109.452 -14.181 1.00 30.46  ? 256 PRO A N     1 
ATOM   1643 C  CA    . PRO A 1 215 ? 28.487  110.319 -13.031 1.00 30.53  ? 256 PRO A CA    1 
ATOM   1644 C  C     . PRO A 1 215 ? 27.224  110.985 -12.484 1.00 33.88  ? 256 PRO A C     1 
ATOM   1645 O  O     . PRO A 1 215 ? 26.286  111.259 -13.235 1.00 30.12  ? 256 PRO A O     1 
ATOM   1646 C  CB    . PRO A 1 215 ? 29.449  111.367 -13.604 1.00 35.34  ? 256 PRO A CB    1 
ATOM   1647 C  CG    . PRO A 1 215 ? 30.035  110.729 -14.821 1.00 34.95  ? 256 PRO A CG    1 
ATOM   1648 C  CD    . PRO A 1 215 ? 28.947  109.869 -15.383 1.00 30.50  ? 256 PRO A CD    1 
ATOM   1649 N  N     . GLU A 1 216 ? 27.203  111.229 -11.179 1.00 27.94  ? 257 GLU A N     1 
ATOM   1650 C  CA    . GLU A 1 216 ? 26.079  111.908 -10.546 1.00 31.00  ? 257 GLU A CA    1 
ATOM   1651 C  C     . GLU A 1 216 ? 26.054  113.382 -10.925 1.00 23.99  ? 257 GLU A C     1 
ATOM   1652 O  O     . GLU A 1 216 ? 27.097  113.981 -11.186 1.00 28.73  ? 257 GLU A O     1 
ATOM   1653 C  CB    . GLU A 1 216 ? 26.149  111.760 -9.025  1.00 24.54  ? 257 GLU A CB    1 
ATOM   1654 C  CG    . GLU A 1 216 ? 25.935  110.344 -8.528  1.00 23.99  ? 257 GLU A CG    1 
ATOM   1655 C  CD    . GLU A 1 216 ? 26.711  110.051 -7.260  1.00 25.16  ? 257 GLU A CD    1 
ATOM   1656 O  OE1   . GLU A 1 216 ? 27.757  110.697 -7.038  1.00 26.57  ? 257 GLU A OE1   1 
ATOM   1657 O  OE2   . GLU A 1 216 ? 26.275  109.173 -6.486  1.00 26.72  ? 257 GLU A OE2   1 
ATOM   1658 N  N     . TYR A 1 217 ? 24.858  113.957 -10.966 1.00 26.60  ? 258 TYR A N     1 
ATOM   1659 C  CA    . TYR A 1 217 ? 24.709  115.391 -11.176 1.00 24.10  ? 258 TYR A CA    1 
ATOM   1660 C  C     . TYR A 1 217 ? 24.340  116.074 -9.866  1.00 24.34  ? 258 TYR A C     1 
ATOM   1661 O  O     . TYR A 1 217 ? 23.438  115.627 -9.156  1.00 26.22  ? 258 TYR A O     1 
ATOM   1662 C  CB    . TYR A 1 217 ? 23.648  115.682 -12.236 1.00 21.46  ? 258 TYR A CB    1 
ATOM   1663 C  CG    . TYR A 1 217 ? 23.381  117.157 -12.435 1.00 25.41  ? 258 TYR A CG    1 
ATOM   1664 C  CD1   . TYR A 1 217 ? 24.193  117.927 -13.258 1.00 30.12  ? 258 TYR A CD1   1 
ATOM   1665 C  CD2   . TYR A 1 217 ? 22.316  117.782 -11.797 1.00 27.28  ? 258 TYR A CD2   1 
ATOM   1666 C  CE1   . TYR A 1 217 ? 23.952  119.277 -13.440 1.00 28.95  ? 258 TYR A CE1   1 
ATOM   1667 C  CE2   . TYR A 1 217 ? 22.068  119.130 -11.973 1.00 27.82  ? 258 TYR A CE2   1 
ATOM   1668 C  CZ    . TYR A 1 217 ? 22.887  119.872 -12.794 1.00 36.21  ? 258 TYR A CZ    1 
ATOM   1669 O  OH    . TYR A 1 217 ? 22.636  121.214 -12.967 1.00 39.70  ? 258 TYR A OH    1 
ATOM   1670 N  N     . LEU A 1 218 ? 25.036  117.160 -9.549  1.00 25.57  ? 259 LEU A N     1 
ATOM   1671 C  CA    . LEU A 1 218 ? 24.779  117.881 -8.311  1.00 26.51  ? 259 LEU A CA    1 
ATOM   1672 C  C     . LEU A 1 218 ? 24.933  119.385 -8.492  1.00 27.01  ? 259 LEU A C     1 
ATOM   1673 O  O     . LEU A 1 218 ? 25.985  119.868 -8.908  1.00 26.23  ? 259 LEU A O     1 
ATOM   1674 C  CB    . LEU A 1 218 ? 25.716  117.393 -7.207  1.00 24.86  ? 259 LEU A CB    1 
ATOM   1675 C  CG    . LEU A 1 218 ? 25.415  117.949 -5.816  1.00 25.88  ? 259 LEU A CG    1 
ATOM   1676 C  CD1   . LEU A 1 218 ? 24.082  117.414 -5.312  1.00 22.55  ? 259 LEU A CD1   1 
ATOM   1677 C  CD2   . LEU A 1 218 ? 26.536  117.620 -4.843  1.00 28.35  ? 259 LEU A CD2   1 
ATOM   1678 N  N     . LYS A 1 219 ? 23.875  120.121 -8.176  1.00 27.11  ? 260 LYS A N     1 
ATOM   1679 C  CA    . LYS A 1 219 ? 23.927  121.573 -8.221  1.00 29.25  ? 260 LYS A CA    1 
ATOM   1680 C  C     . LYS A 1 219 ? 23.372  122.165 -6.935  1.00 24.30  ? 260 LYS A C     1 
ATOM   1681 O  O     . LYS A 1 219 ? 22.285  121.799 -6.488  1.00 22.77  ? 260 LYS A O     1 
ATOM   1682 C  CB    . LYS A 1 219 ? 23.157  122.111 -9.427  1.00 27.52  ? 260 LYS A CB    1 
ATOM   1683 C  CG    . LYS A 1 219 ? 23.189  123.624 -9.537  1.00 33.98  ? 260 LYS A CG    1 
ATOM   1684 C  CD    . LYS A 1 219 ? 22.653  124.093 -10.876 1.00 36.69  ? 260 LYS A CD    1 
ATOM   1685 C  CE    . LYS A 1 219 ? 22.697  125.609 -10.978 1.00 43.83  ? 260 LYS A CE    1 
ATOM   1686 N  NZ    . LYS A 1 219 ? 24.067  126.140 -10.729 1.00 46.91  ? 260 LYS A NZ    1 
ATOM   1687 N  N     . ARG A 1 220 ? 24.131  123.079 -6.345  1.00 24.52  ? 261 ARG A N     1 
ATOM   1688 C  CA    . ARG A 1 220 ? 23.736  123.726 -5.104  1.00 25.33  ? 261 ARG A CA    1 
ATOM   1689 C  C     . ARG A 1 220 ? 22.693  124.811 -5.349  1.00 26.94  ? 261 ARG A C     1 
ATOM   1690 O  O     . ARG A 1 220 ? 22.924  125.747 -6.113  1.00 30.64  ? 261 ARG A O     1 
ATOM   1691 C  CB    . ARG A 1 220 ? 24.962  124.319 -4.410  1.00 30.63  ? 261 ARG A CB    1 
ATOM   1692 C  CG    . ARG A 1 220 ? 24.657  125.063 -3.127  1.00 31.20  ? 261 ARG A CG    1 
ATOM   1693 C  CD    . ARG A 1 220 ? 23.944  124.183 -2.128  1.00 33.35  ? 261 ARG A CD    1 
ATOM   1694 N  NE    . ARG A 1 220 ? 24.037  124.738 -0.783  1.00 31.64  ? 261 ARG A NE    1 
ATOM   1695 C  CZ    . ARG A 1 220 ? 23.461  124.202 0.287   1.00 31.12  ? 261 ARG A CZ    1 
ATOM   1696 N  NH1   . ARG A 1 220 ? 22.737  123.098 0.167   1.00 23.02  ? 261 ARG A NH1   1 
ATOM   1697 N  NH2   . ARG A 1 220 ? 23.605  124.773 1.474   1.00 29.64  ? 261 ARG A NH2   1 
ATOM   1698 N  N     . LEU A 1 221 ? 21.543  124.675 -4.697  1.00 24.83  ? 262 LEU A N     1 
ATOM   1699 C  CA    . LEU A 1 221 ? 20.474  125.660 -4.809  1.00 23.75  ? 262 LEU A CA    1 
ATOM   1700 C  C     . LEU A 1 221 ? 20.716  126.833 -3.859  1.00 25.90  ? 262 LEU A C     1 
ATOM   1701 O  O     . LEU A 1 221 ? 21.224  126.648 -2.753  1.00 24.08  ? 262 LEU A O     1 
ATOM   1702 C  CB    . LEU A 1 221 ? 19.118  125.012 -4.523  1.00 22.42  ? 262 LEU A CB    1 
ATOM   1703 C  CG    . LEU A 1 221 ? 18.738  123.851 -5.445  1.00 26.93  ? 262 LEU A CG    1 
ATOM   1704 C  CD1   . LEU A 1 221 ? 17.346  123.333 -5.116  1.00 22.28  ? 262 LEU A CD1   1 
ATOM   1705 C  CD2   . LEU A 1 221 ? 18.830  124.267 -6.907  1.00 28.22  ? 262 LEU A CD2   1 
ATOM   1706 N  N     . PRO A 1 222 ? 20.352  128.049 -4.290  1.00 23.72  ? 263 PRO A N     1 
ATOM   1707 C  CA    . PRO A 1 222 ? 20.612  129.256 -3.498  1.00 27.67  ? 263 PRO A CA    1 
ATOM   1708 C  C     . PRO A 1 222 ? 19.773  129.326 -2.224  1.00 23.93  ? 263 PRO A C     1 
ATOM   1709 O  O     . PRO A 1 222 ? 18.615  128.906 -2.218  1.00 22.26  ? 263 PRO A O     1 
ATOM   1710 C  CB    . PRO A 1 222 ? 20.239  130.388 -4.459  1.00 31.17  ? 263 PRO A CB    1 
ATOM   1711 C  CG    . PRO A 1 222 ? 19.228  129.781 -5.371  1.00 32.30  ? 263 PRO A CG    1 
ATOM   1712 C  CD    . PRO A 1 222 ? 19.671  128.359 -5.560  1.00 26.62  ? 263 PRO A CD    1 
ATOM   1713 N  N     . LEU A 1 223 ? 20.366  129.846 -1.154  1.00 23.38  ? 264 LEU A N     1 
ATOM   1714 C  CA    . LEU A 1 223 ? 19.661  130.022 0.110   1.00 20.81  ? 264 LEU A CA    1 
ATOM   1715 C  C     . LEU A 1 223 ? 19.384  131.493 0.394   1.00 23.77  ? 264 LEU A C     1 
ATOM   1716 O  O     . LEU A 1 223 ? 20.259  132.343 0.215   1.00 26.97  ? 264 LEU A O     1 
ATOM   1717 C  CB    . LEU A 1 223 ? 20.464  129.430 1.272   1.00 25.18  ? 264 LEU A CB    1 
ATOM   1718 C  CG    . LEU A 1 223 ? 20.485  127.918 1.500   1.00 28.01  ? 264 LEU A CG    1 
ATOM   1719 C  CD1   . LEU A 1 223 ? 21.379  127.216 0.493   1.00 24.00  ? 264 LEU A CD1   1 
ATOM   1720 C  CD2   . LEU A 1 223 ? 20.936  127.617 2.922   1.00 27.20  ? 264 LEU A CD2   1 
ATOM   1721 N  N     . GLN A 1 224 ? 18.164  131.785 0.836   1.00 28.19  ? 265 GLN A N     1 
ATOM   1722 C  CA    . GLN A 1 224 ? 17.830  133.104 1.357   1.00 25.08  ? 265 GLN A CA    1 
ATOM   1723 C  C     . GLN A 1 224 ? 18.337  133.204 2.791   1.00 25.15  ? 265 GLN A C     1 
ATOM   1724 O  O     . GLN A 1 224 ? 18.764  132.203 3.368   1.00 25.00  ? 265 GLN A O     1 
ATOM   1725 C  CB    . GLN A 1 224 ? 16.321  133.347 1.299   1.00 23.82  ? 265 GLN A CB    1 
ATOM   1726 C  CG    . GLN A 1 224 ? 15.698  133.072 -0.060  1.00 23.29  ? 265 GLN A CG    1 
ATOM   1727 C  CD    . GLN A 1 224 ? 16.029  134.142 -1.079  1.00 25.45  ? 265 GLN A CD    1 
ATOM   1728 O  OE1   . GLN A 1 224 ? 16.603  135.178 -0.744  1.00 25.47  ? 265 GLN A OE1   1 
ATOM   1729 N  NE2   . GLN A 1 224 ? 15.661  133.901 -2.331  1.00 27.28  ? 265 GLN A NE2   1 
ATOM   1730 N  N     . TRP A 1 225 ? 18.301  134.401 3.369   1.00 25.89  ? 266 TRP A N     1 
ATOM   1731 C  CA    . TRP A 1 225 ? 18.746  134.572 4.748   1.00 22.03  ? 266 TRP A CA    1 
ATOM   1732 C  C     . TRP A 1 225 ? 17.862  133.769 5.702   1.00 23.06  ? 266 TRP A C     1 
ATOM   1733 O  O     . TRP A 1 225 ? 18.344  133.214 6.692   1.00 23.40  ? 266 TRP A O     1 
ATOM   1734 C  CB    . TRP A 1 225 ? 18.757  136.053 5.140   1.00 29.33  ? 266 TRP A CB    1 
ATOM   1735 C  CG    . TRP A 1 225 ? 19.950  136.807 4.621   1.00 23.96  ? 266 TRP A CG    1 
ATOM   1736 C  CD1   . TRP A 1 225 ? 19.951  137.820 3.703   1.00 22.95  ? 266 TRP A CD1   1 
ATOM   1737 C  CD2   . TRP A 1 225 ? 21.319  136.599 4.989   1.00 23.59  ? 266 TRP A CD2   1 
ATOM   1738 N  NE1   . TRP A 1 225 ? 21.236  138.257 3.482   1.00 23.78  ? 266 TRP A NE1   1 
ATOM   1739 C  CE2   . TRP A 1 225 ? 22.094  137.522 4.258   1.00 24.03  ? 266 TRP A CE2   1 
ATOM   1740 C  CE3   . TRP A 1 225 ? 21.964  135.722 5.866   1.00 23.53  ? 266 TRP A CE3   1 
ATOM   1741 C  CZ2   . TRP A 1 225 ? 23.481  137.593 4.380   1.00 28.32  ? 266 TRP A CZ2   1 
ATOM   1742 C  CZ3   . TRP A 1 225 ? 23.340  135.793 5.985   1.00 25.83  ? 266 TRP A CZ3   1 
ATOM   1743 C  CH2   . TRP A 1 225 ? 24.083  136.722 5.247   1.00 28.94  ? 266 TRP A CH2   1 
ATOM   1744 N  N     . VAL A 1 226 ? 16.572  133.691 5.390   1.00 16.45  ? 267 VAL A N     1 
ATOM   1745 C  CA    . VAL A 1 226 ? 15.645  132.910 6.202   1.00 23.30  ? 267 VAL A CA    1 
ATOM   1746 C  C     . VAL A 1 226 ? 15.964  131.418 6.130   1.00 27.52  ? 267 VAL A C     1 
ATOM   1747 O  O     . VAL A 1 226 ? 15.743  130.688 7.093   1.00 26.06  ? 267 VAL A O     1 
ATOM   1748 C  CB    . VAL A 1 226 ? 14.180  133.136 5.777   1.00 24.00  ? 267 VAL A CB    1 
ATOM   1749 C  CG1   . VAL A 1 226 ? 13.713  134.527 6.186   1.00 20.72  ? 267 VAL A CG1   1 
ATOM   1750 C  CG2   . VAL A 1 226 ? 14.015  132.921 4.278   1.00 22.43  ? 267 VAL A CG2   1 
ATOM   1751 N  N     . ASP A 1 227 ? 16.487  130.975 4.988   1.00 21.95  ? 268 ASP A N     1 
ATOM   1752 C  CA    . ASP A 1 227 ? 16.871  129.578 4.802   1.00 22.01  ? 268 ASP A CA    1 
ATOM   1753 C  C     . ASP A 1 227 ? 18.116  129.245 5.609   1.00 21.32  ? 268 ASP A C     1 
ATOM   1754 O  O     . ASP A 1 227 ? 18.227  128.161 6.179   1.00 21.87  ? 268 ASP A O     1 
ATOM   1755 C  CB    . ASP A 1 227 ? 17.115  129.275 3.321   1.00 19.63  ? 268 ASP A CB    1 
ATOM   1756 C  CG    . ASP A 1 227 ? 15.868  129.448 2.477   1.00 22.41  ? 268 ASP A CG    1 
ATOM   1757 O  OD1   . ASP A 1 227 ? 14.767  129.123 2.970   1.00 23.99  ? 268 ASP A OD1   1 
ATOM   1758 O  OD2   . ASP A 1 227 ? 15.987  129.916 1.324   1.00 24.16  ? 268 ASP A OD2   1 
ATOM   1759 N  N     . ILE A 1 228 ? 19.054  130.185 5.642   1.00 20.48  ? 269 ILE A N     1 
ATOM   1760 C  CA    . ILE A 1 228 ? 20.286  130.014 6.397   1.00 22.91  ? 269 ILE A CA    1 
ATOM   1761 C  C     . ILE A 1 228 ? 19.989  129.880 7.888   1.00 27.59  ? 269 ILE A C     1 
ATOM   1762 O  O     . ILE A 1 228 ? 20.523  128.997 8.563   1.00 26.02  ? 269 ILE A O     1 
ATOM   1763 C  CB    . ILE A 1 228 ? 21.253  131.190 6.163   1.00 26.02  ? 269 ILE A CB    1 
ATOM   1764 C  CG1   . ILE A 1 228 ? 21.699  131.222 4.698   1.00 23.68  ? 269 ILE A CG1   1 
ATOM   1765 C  CG2   . ILE A 1 228 ? 22.458  131.083 7.084   1.00 24.77  ? 269 ILE A CG2   1 
ATOM   1766 C  CD1   . ILE A 1 228 ? 22.672  132.336 4.367   1.00 22.68  ? 269 ILE A CD1   1 
ATOM   1767 N  N     . ALA A 1 229 ? 19.127  130.757 8.392   1.00 22.70  ? 270 ALA A N     1 
ATOM   1768 C  CA    . ALA A 1 229 ? 18.718  130.713 9.790   1.00 26.07  ? 270 ALA A CA    1 
ATOM   1769 C  C     . ALA A 1 229 ? 17.928  129.442 10.089  1.00 24.43  ? 270 ALA A C     1 
ATOM   1770 O  O     . ALA A 1 229 ? 18.158  128.782 11.101  1.00 22.82  ? 270 ALA A O     1 
ATOM   1771 C  CB    . ALA A 1 229 ? 17.897  131.946 10.142  1.00 20.11  ? 270 ALA A CB    1 
ATOM   1772 N  N     . HIS A 1 230 ? 17.007  129.098 9.197   1.00 20.27  ? 271 HIS A N     1 
ATOM   1773 C  CA    . HIS A 1 230 ? 16.157  127.926 9.379   1.00 20.57  ? 271 HIS A CA    1 
ATOM   1774 C  C     . HIS A 1 230 ? 16.967  126.632 9.392   1.00 26.67  ? 271 HIS A C     1 
ATOM   1775 O  O     . HIS A 1 230 ? 16.793  125.787 10.271  1.00 24.38  ? 271 HIS A O     1 
ATOM   1776 C  CB    . HIS A 1 230 ? 15.101  127.874 8.276   1.00 26.03  ? 271 HIS A CB    1 
ATOM   1777 C  CG    . HIS A 1 230 ? 13.975  126.928 8.552   1.00 25.78  ? 271 HIS A CG    1 
ATOM   1778 N  ND1   . HIS A 1 230 ? 12.692  127.158 8.107   1.00 26.32  ? 271 HIS A ND1   1 
ATOM   1779 C  CD2   . HIS A 1 230 ? 13.938  125.747 9.213   1.00 23.86  ? 271 HIS A CD2   1 
ATOM   1780 C  CE1   . HIS A 1 230 ? 11.911  126.163 8.487   1.00 24.94  ? 271 HIS A CE1   1 
ATOM   1781 N  NE2   . HIS A 1 230 ? 12.643  125.293 9.159   1.00 22.68  ? 271 HIS A NE2   1 
ATOM   1782 N  N     . LEU A 1 231 ? 17.851  126.484 8.411   1.00 22.20  ? 272 LEU A N     1 
ATOM   1783 C  CA    . LEU A 1 231 ? 18.657  125.278 8.283   1.00 24.10  ? 272 LEU A CA    1 
ATOM   1784 C  C     . LEU A 1 231 ? 19.569  125.091 9.491   1.00 26.17  ? 272 LEU A C     1 
ATOM   1785 O  O     . LEU A 1 231 ? 19.713  123.983 10.005  1.00 22.91  ? 272 LEU A O     1 
ATOM   1786 C  CB    . LEU A 1 231 ? 19.486  125.323 6.997   1.00 17.22  ? 272 LEU A CB    1 
ATOM   1787 C  CG    . LEU A 1 231 ? 20.385  124.117 6.724   1.00 23.13  ? 272 LEU A CG    1 
ATOM   1788 C  CD1   . LEU A 1 231 ? 19.565  122.834 6.681   1.00 20.88  ? 272 LEU A CD1   1 
ATOM   1789 C  CD2   . LEU A 1 231 ? 21.157  124.311 5.426   1.00 21.25  ? 272 LEU A CD2   1 
ATOM   1790 N  N     . CYS A 1 232 ? 20.174  126.182 9.947   1.00 22.26  ? 273 CYS A N     1 
ATOM   1791 C  CA    . CYS A 1 232 ? 21.112  126.116 11.059  1.00 26.56  ? 273 CYS A CA    1 
ATOM   1792 C  C     . CYS A 1 232 ? 20.396  125.955 12.399  1.00 23.94  ? 273 CYS A C     1 
ATOM   1793 O  O     . CYS A 1 232 ? 20.914  125.306 13.306  1.00 29.49  ? 273 CYS A O     1 
ATOM   1794 C  CB    . CYS A 1 232 ? 22.004  127.356 11.071  1.00 23.76  ? 273 CYS A CB    1 
ATOM   1795 S  SG    . CYS A 1 232 ? 23.149  127.425 9.669   1.00 25.18  ? 273 CYS A SG    1 
ATOM   1796 N  N     . LEU A 1 233 ? 19.207  126.538 12.521  1.00 25.83  ? 274 LEU A N     1 
ATOM   1797 C  CA    . LEU A 1 233 ? 18.383  126.322 13.706  1.00 26.86  ? 274 LEU A CA    1 
ATOM   1798 C  C     . LEU A 1 233 ? 17.936  124.867 13.784  1.00 30.87  ? 274 LEU A C     1 
ATOM   1799 O  O     . LEU A 1 233 ? 17.900  124.274 14.863  1.00 29.06  ? 274 LEU A O     1 
ATOM   1800 C  CB    . LEU A 1 233 ? 17.160  127.241 13.704  1.00 23.93  ? 274 LEU A CB    1 
ATOM   1801 C  CG    . LEU A 1 233 ? 17.218  128.484 14.593  1.00 30.61  ? 274 LEU A CG    1 
ATOM   1802 C  CD1   . LEU A 1 233 ? 15.870  129.189 14.603  1.00 26.64  ? 274 LEU A CD1   1 
ATOM   1803 C  CD2   . LEU A 1 233 ? 17.644  128.109 16.003  1.00 27.87  ? 274 LEU A CD2   1 
ATOM   1804 N  N     . TYR A 1 234 ? 17.595  124.301 12.629  1.00 24.24  ? 275 TYR A N     1 
ATOM   1805 C  CA    . TYR A 1 234 ? 17.174  122.909 12.542  1.00 24.31  ? 275 TYR A CA    1 
ATOM   1806 C  C     . TYR A 1 234 ? 18.307  121.970 12.945  1.00 24.53  ? 275 TYR A C     1 
ATOM   1807 O  O     . TYR A 1 234 ? 18.095  121.010 13.685  1.00 25.39  ? 275 TYR A O     1 
ATOM   1808 C  CB    . TYR A 1 234 ? 16.692  122.579 11.125  1.00 19.31  ? 275 TYR A CB    1 
ATOM   1809 C  CG    . TYR A 1 234 ? 16.349  121.122 10.931  1.00 22.65  ? 275 TYR A CG    1 
ATOM   1810 C  CD1   . TYR A 1 234 ? 15.134  120.611 11.367  1.00 23.61  ? 275 TYR A CD1   1 
ATOM   1811 C  CD2   . TYR A 1 234 ? 17.243  120.254 10.317  1.00 20.85  ? 275 TYR A CD2   1 
ATOM   1812 C  CE1   . TYR A 1 234 ? 14.820  119.277 11.200  1.00 23.83  ? 275 TYR A CE1   1 
ATOM   1813 C  CE2   . TYR A 1 234 ? 16.938  118.920 10.143  1.00 21.05  ? 275 TYR A CE2   1 
ATOM   1814 C  CZ    . TYR A 1 234 ? 15.725  118.436 10.585  1.00 25.27  ? 275 TYR A CZ    1 
ATOM   1815 O  OH    . TYR A 1 234 ? 15.418  117.105 10.414  1.00 31.31  ? 275 TYR A OH    1 
ATOM   1816 N  N     . ASN A 1 235 ? 19.508  122.256 12.452  1.00 21.10  ? 276 ASN A N     1 
ATOM   1817 C  CA    . ASN A 1 235 ? 20.683  121.460 12.783  1.00 22.98  ? 276 ASN A CA    1 
ATOM   1818 C  C     . ASN A 1 235 ? 20.988  121.492 14.277  1.00 31.39  ? 276 ASN A C     1 
ATOM   1819 O  O     . ASN A 1 235 ? 21.285  120.461 14.880  1.00 24.59  ? 276 ASN A O     1 
ATOM   1820 C  CB    . ASN A 1 235 ? 21.894  121.948 11.988  1.00 23.12  ? 276 ASN A CB    1 
ATOM   1821 C  CG    . ASN A 1 235 ? 22.014  121.270 10.636  1.00 29.28  ? 276 ASN A CG    1 
ATOM   1822 O  OD1   . ASN A 1 235 ? 21.336  121.638 9.675   1.00 23.30  ? 276 ASN A OD1   1 
ATOM   1823 N  ND2   . ASN A 1 235 ? 22.885  120.272 10.555  1.00 21.89  ? 276 ASN A ND2   1 
ATOM   1824 N  N     . LEU A 1 236 ? 20.905  122.681 14.866  1.00 27.83  ? 277 LEU A N     1 
ATOM   1825 C  CA    . LEU A 1 236 ? 21.135  122.850 16.295  1.00 29.46  ? 277 LEU A CA    1 
ATOM   1826 C  C     . LEU A 1 236 ? 20.094  122.089 17.103  1.00 27.85  ? 277 LEU A C     1 
ATOM   1827 O  O     . LEU A 1 236 ? 20.417  121.460 18.110  1.00 32.02  ? 277 LEU A O     1 
ATOM   1828 C  CB    . LEU A 1 236 ? 21.117  124.333 16.676  1.00 23.14  ? 277 LEU A CB    1 
ATOM   1829 C  CG    . LEU A 1 236 ? 22.329  125.166 16.252  1.00 24.60  ? 277 LEU A CG    1 
ATOM   1830 C  CD1   . LEU A 1 236 ? 22.071  126.644 16.499  1.00 30.56  ? 277 LEU A CD1   1 
ATOM   1831 C  CD2   . LEU A 1 236 ? 23.586  124.708 16.981  1.00 27.43  ? 277 LEU A CD2   1 
ATOM   1832 N  N     . SER A 1 237 ? 18.846  122.142 16.648  1.00 27.69  ? 278 SER A N     1 
ATOM   1833 C  CA    . SER A 1 237 ? 17.745  121.483 17.343  1.00 25.63  ? 278 SER A CA    1 
ATOM   1834 C  C     . SER A 1 237 ? 17.886  119.965 17.326  1.00 32.93  ? 278 SER A C     1 
ATOM   1835 O  O     . SER A 1 237 ? 17.576  119.296 18.310  1.00 31.73  ? 278 SER A O     1 
ATOM   1836 C  CB    . SER A 1 237 ? 16.405  121.882 16.723  1.00 28.66  ? 278 SER A CB    1 
ATOM   1837 O  OG    . SER A 1 237 ? 16.192  123.278 16.817  1.00 37.85  ? 278 SER A OG    1 
ATOM   1838 N  N     . VAL A 1 238 ? 18.343  119.425 16.200  1.00 29.71  ? 279 VAL A N     1 
ATOM   1839 C  CA    . VAL A 1 238 ? 18.539  117.986 16.062  1.00 27.36  ? 279 VAL A CA    1 
ATOM   1840 C  C     . VAL A 1 238 ? 19.724  117.511 16.899  1.00 31.07  ? 279 VAL A C     1 
ATOM   1841 O  O     . VAL A 1 238 ? 19.640  116.504 17.604  1.00 34.53  ? 279 VAL A O     1 
ATOM   1842 C  CB    . VAL A 1 238 ? 18.763  117.589 14.586  1.00 29.72  ? 279 VAL A CB    1 
ATOM   1843 C  CG1   . VAL A 1 238 ? 19.212  116.136 14.480  1.00 24.85  ? 279 VAL A CG1   1 
ATOM   1844 C  CG2   . VAL A 1 238 ? 17.498  117.829 13.775  1.00 24.00  ? 279 VAL A CG2   1 
ATOM   1845 N  N     . ILE A 1 239 ? 20.824  118.250 16.826  1.00 28.13  ? 280 ILE A N     1 
ATOM   1846 C  CA    . ILE A 1 239 ? 22.045  117.888 17.537  1.00 32.03  ? 280 ILE A CA    1 
ATOM   1847 C  C     . ILE A 1 239 ? 21.898  117.979 19.057  1.00 34.84  ? 280 ILE A C     1 
ATOM   1848 O  O     . ILE A 1 239 ? 22.270  117.054 19.781  1.00 39.79  ? 280 ILE A O     1 
ATOM   1849 C  CB    . ILE A 1 239 ? 23.225  118.781 17.100  1.00 32.26  ? 280 ILE A CB    1 
ATOM   1850 C  CG1   . ILE A 1 239 ? 23.607  118.494 15.646  1.00 32.46  ? 280 ILE A CG1   1 
ATOM   1851 C  CG2   . ILE A 1 239 ? 24.421  118.567 18.011  1.00 35.78  ? 280 ILE A CG2   1 
ATOM   1852 C  CD1   . ILE A 1 239 ? 24.684  119.413 15.104  1.00 25.10  ? 280 ILE A CD1   1 
ATOM   1853 N  N     . HIS A 1 240 ? 21.352  119.091 19.536  1.00 31.30  ? 281 HIS A N     1 
ATOM   1854 C  CA    . HIS A 1 240 ? 21.299  119.352 20.972  1.00 31.25  ? 281 HIS A CA    1 
ATOM   1855 C  C     . HIS A 1 240 ? 19.960  118.975 21.601  1.00 35.09  ? 281 HIS A C     1 
ATOM   1856 O  O     . HIS A 1 240 ? 19.792  119.079 22.817  1.00 34.04  ? 281 HIS A O     1 
ATOM   1857 C  CB    . HIS A 1 240 ? 21.609  120.825 21.247  1.00 30.89  ? 281 HIS A CB    1 
ATOM   1858 C  CG    . HIS A 1 240 ? 22.954  121.255 20.760  1.00 27.80  ? 281 HIS A CG    1 
ATOM   1859 N  ND1   . HIS A 1 240 ? 24.127  120.898 21.392  1.00 36.50  ? 281 HIS A ND1   1 
ATOM   1860 C  CD2   . HIS A 1 240 ? 23.322  122.012 19.696  1.00 25.50  ? 281 HIS A CD2   1 
ATOM   1861 C  CE1   . HIS A 1 240 ? 25.153  121.414 20.743  1.00 31.83  ? 281 HIS A CE1   1 
ATOM   1862 N  NE2   . HIS A 1 240 ? 24.689  122.096 19.707  1.00 29.48  ? 281 HIS A NE2   1 
ATOM   1863 N  N     . LYS A 1 241 ? 19.017  118.540 20.769  1.00 32.34  ? 282 LYS A N     1 
ATOM   1864 C  CA    . LYS A 1 241 ? 17.717  118.061 21.238  1.00 38.16  ? 282 LYS A CA    1 
ATOM   1865 C  C     . LYS A 1 241 ? 16.970  119.084 22.096  1.00 39.60  ? 282 LYS A C     1 
ATOM   1866 O  O     . LYS A 1 241 ? 16.475  118.757 23.174  1.00 35.51  ? 282 LYS A O     1 
ATOM   1867 C  CB    . LYS A 1 241 ? 17.891  116.754 22.017  1.00 42.85  ? 282 LYS A CB    1 
ATOM   1868 C  CG    . LYS A 1 241 ? 18.373  115.597 21.158  1.00 44.75  ? 282 LYS A CG    1 
ATOM   1869 C  CD    . LYS A 1 241 ? 19.064  114.522 21.979  1.00 56.48  ? 282 LYS A CD    1 
ATOM   1870 C  CE    . LYS A 1 241 ? 19.653  113.453 21.072  1.00 63.17  ? 282 LYS A CE    1 
ATOM   1871 N  NZ    . LYS A 1 241 ? 20.523  112.496 21.810  1.00 72.23  ? 282 LYS A NZ    1 
ATOM   1872 N  N     . LYS A 1 242 ? 16.897  120.321 21.616  1.00 37.14  ? 283 LYS A N     1 
ATOM   1873 C  CA    . LYS A 1 242 ? 16.092  121.346 22.272  1.00 39.61  ? 283 LYS A CA    1 
ATOM   1874 C  C     . LYS A 1 242 ? 15.590  122.352 21.243  1.00 36.11  ? 283 LYS A C     1 
ATOM   1875 O  O     . LYS A 1 242 ? 15.983  122.307 20.077  1.00 32.77  ? 283 LYS A O     1 
ATOM   1876 C  CB    . LYS A 1 242 ? 16.883  122.049 23.381  1.00 35.27  ? 283 LYS A CB    1 
ATOM   1877 C  CG    . LYS A 1 242 ? 18.091  122.840 22.919  1.00 35.96  ? 283 LYS A CG    1 
ATOM   1878 C  CD    . LYS A 1 242 ? 18.736  123.567 24.092  1.00 38.14  ? 283 LYS A CD    1 
ATOM   1879 C  CE    . LYS A 1 242 ? 19.983  124.322 23.665  1.00 40.61  ? 283 LYS A CE    1 
ATOM   1880 N  NZ    . LYS A 1 242 ? 20.625  125.036 24.802  1.00 46.86  ? 283 LYS A NZ    1 
ATOM   1881 N  N     . LYS A 1 243 ? 14.721  123.258 21.678  1.00 32.25  ? 284 LYS A N     1 
ATOM   1882 C  CA    . LYS A 1 243 ? 14.025  124.146 20.755  1.00 30.01  ? 284 LYS A CA    1 
ATOM   1883 C  C     . LYS A 1 243 ? 14.637  125.544 20.678  1.00 37.16  ? 284 LYS A C     1 
ATOM   1884 O  O     . LYS A 1 243 ? 14.926  126.041 19.590  1.00 31.24  ? 284 LYS A O     1 
ATOM   1885 C  CB    . LYS A 1 243 ? 12.551  124.248 21.152  1.00 31.08  ? 284 LYS A CB    1 
ATOM   1886 C  CG    . LYS A 1 243 ? 11.729  125.197 20.298  1.00 28.69  ? 284 LYS A CG    1 
ATOM   1887 C  CD    . LYS A 1 243 ? 10.258  125.093 20.658  1.00 25.78  ? 284 LYS A CD    1 
ATOM   1888 C  CE    . LYS A 1 243 ? 9.423   126.116 19.912  1.00 28.81  ? 284 LYS A CE    1 
ATOM   1889 N  NZ    . LYS A 1 243 ? 7.972   125.948 20.208  1.00 29.38  ? 284 LYS A NZ    1 
ATOM   1890 N  N     . TYR A 1 244 ? 14.833  126.173 21.833  1.00 30.19  ? 285 TYR A N     1 
ATOM   1891 C  CA    . TYR A 1 244 ? 15.261  127.568 21.876  1.00 29.06  ? 285 TYR A CA    1 
ATOM   1892 C  C     . TYR A 1 244 ? 16.775  127.724 21.951  1.00 30.96  ? 285 TYR A C     1 
ATOM   1893 O  O     . TYR A 1 244 ? 17.446  127.033 22.715  1.00 36.36  ? 285 TYR A O     1 
ATOM   1894 C  CB    . TYR A 1 244 ? 14.601  128.280 23.059  1.00 29.67  ? 285 TYR A CB    1 
ATOM   1895 C  CG    . TYR A 1 244 ? 13.113  128.460 22.878  1.00 25.54  ? 285 TYR A CG    1 
ATOM   1896 C  CD1   . TYR A 1 244 ? 12.608  129.561 22.200  1.00 24.59  ? 285 TYR A CD1   1 
ATOM   1897 C  CD2   . TYR A 1 244 ? 12.214  127.522 23.368  1.00 28.47  ? 285 TYR A CD2   1 
ATOM   1898 C  CE1   . TYR A 1 244 ? 11.250  129.729 22.023  1.00 26.57  ? 285 TYR A CE1   1 
ATOM   1899 C  CE2   . TYR A 1 244 ? 10.852  127.681 23.194  1.00 23.02  ? 285 TYR A CE2   1 
ATOM   1900 C  CZ    . TYR A 1 244 ? 10.377  128.788 22.521  1.00 25.16  ? 285 TYR A CZ    1 
ATOM   1901 O  OH    . TYR A 1 244 ? 9.023   128.958 22.344  1.00 31.39  ? 285 TYR A OH    1 
ATOM   1902 N  N     . PHE A 1 245 ? 17.304  128.639 21.143  1.00 27.71  ? 286 PHE A N     1 
ATOM   1903 C  CA    . PHE A 1 245 ? 18.736  128.914 21.110  1.00 28.81  ? 286 PHE A CA    1 
ATOM   1904 C  C     . PHE A 1 245 ? 19.009  130.411 21.140  1.00 30.46  ? 286 PHE A C     1 
ATOM   1905 O  O     . PHE A 1 245 ? 18.195  131.210 20.673  1.00 30.60  ? 286 PHE A O     1 
ATOM   1906 C  CB    . PHE A 1 245 ? 19.378  128.302 19.862  1.00 30.41  ? 286 PHE A CB    1 
ATOM   1907 C  CG    . PHE A 1 245 ? 19.321  126.803 19.822  1.00 28.36  ? 286 PHE A CG    1 
ATOM   1908 C  CD1   . PHE A 1 245 ? 18.187  126.155 19.365  1.00 29.01  ? 286 PHE A CD1   1 
ATOM   1909 C  CD2   . PHE A 1 245 ? 20.403  126.044 20.231  1.00 30.97  ? 286 PHE A CD2   1 
ATOM   1910 C  CE1   . PHE A 1 245 ? 18.130  124.778 19.323  1.00 34.46  ? 286 PHE A CE1   1 
ATOM   1911 C  CE2   . PHE A 1 245 ? 20.353  124.665 20.191  1.00 31.67  ? 286 PHE A CE2   1 
ATOM   1912 C  CZ    . PHE A 1 245 ? 19.215  124.032 19.737  1.00 32.39  ? 286 PHE A CZ    1 
ATOM   1913 N  N     . ASP A 1 246 ? 20.158  130.788 21.690  1.00 29.24  ? 287 ASP A N     1 
ATOM   1914 C  CA    . ASP A 1 246 ? 20.572  132.183 21.692  1.00 37.31  ? 287 ASP A CA    1 
ATOM   1915 C  C     . ASP A 1 246 ? 20.946  132.612 20.279  1.00 35.49  ? 287 ASP A C     1 
ATOM   1916 O  O     . ASP A 1 246 ? 21.829  132.019 19.659  1.00 30.75  ? 287 ASP A O     1 
ATOM   1917 C  CB    . ASP A 1 246 ? 21.748  132.406 22.640  1.00 34.93  ? 287 ASP A CB    1 
ATOM   1918 C  CG    . ASP A 1 246 ? 22.099  133.873 22.792  1.00 41.78  ? 287 ASP A CG    1 
ATOM   1919 O  OD1   . ASP A 1 246 ? 22.766  134.427 21.892  1.00 44.08  ? 287 ASP A OD1   1 
ATOM   1920 O  OD2   . ASP A 1 246 ? 21.707  134.473 23.814  1.00 48.50  ? 287 ASP A OD2   1 
ATOM   1921 N  N     . SER A 1 247 ? 20.278  133.649 19.781  1.00 34.52  ? 288 SER A N     1 
ATOM   1922 C  CA    . SER A 1 247 ? 20.444  134.079 18.396  1.00 34.19  ? 288 SER A CA    1 
ATOM   1923 C  C     . SER A 1 247 ? 21.880  134.487 18.066  1.00 36.24  ? 288 SER A C     1 
ATOM   1924 O  O     . SER A 1 247 ? 22.364  134.227 16.965  1.00 36.13  ? 288 SER A O     1 
ATOM   1925 C  CB    . SER A 1 247 ? 19.490  135.236 18.082  1.00 30.11  ? 288 SER A CB    1 
ATOM   1926 O  OG    . SER A 1 247 ? 19.835  136.403 18.808  1.00 39.02  ? 288 SER A OG    1 
ATOM   1927 N  N     . GLU A 1 248 ? 22.564  135.116 19.017  1.00 36.61  ? 289 GLU A N     1 
ATOM   1928 C  CA    . GLU A 1 248 ? 23.917  135.611 18.775  1.00 39.87  ? 289 GLU A CA    1 
ATOM   1929 C  C     . GLU A 1 248 ? 24.997  134.629 19.225  1.00 40.42  ? 289 GLU A C     1 
ATOM   1930 O  O     . GLU A 1 248 ? 25.969  134.394 18.507  1.00 42.31  ? 289 GLU A O     1 
ATOM   1931 C  CB    . GLU A 1 248 ? 24.123  136.959 19.474  1.00 46.54  ? 289 GLU A CB    1 
ATOM   1932 C  CG    . GLU A 1 248 ? 25.509  137.561 19.281  1.00 52.53  ? 289 GLU A CG    1 
ATOM   1933 C  CD    . GLU A 1 248 ? 25.654  138.920 19.945  1.00 58.33  ? 289 GLU A CD    1 
ATOM   1934 O  OE1   . GLU A 1 248 ? 24.702  139.358 20.626  1.00 59.42  ? 289 GLU A OE1   1 
ATOM   1935 O  OE2   . GLU A 1 248 ? 26.719  139.551 19.783  1.00 62.99  ? 289 GLU A OE2   1 
ATOM   1936 N  N     . LEU A 1 249 ? 24.825  134.055 20.410  1.00 40.16  ? 290 LEU A N     1 
ATOM   1937 C  CA    . LEU A 1 249 ? 25.867  133.226 21.006  1.00 43.42  ? 290 LEU A CA    1 
ATOM   1938 C  C     . LEU A 1 249 ? 25.828  131.773 20.537  1.00 41.74  ? 290 LEU A C     1 
ATOM   1939 O  O     . LEU A 1 249 ? 26.856  131.096 20.518  1.00 43.01  ? 290 LEU A O     1 
ATOM   1940 C  CB    . LEU A 1 249 ? 25.768  133.273 22.532  1.00 47.25  ? 290 LEU A CB    1 
ATOM   1941 C  CG    . LEU A 1 249 ? 25.845  134.670 23.152  1.00 50.56  ? 290 LEU A CG    1 
ATOM   1942 C  CD1   . LEU A 1 249 ? 25.870  134.592 24.672  1.00 58.50  ? 290 LEU A CD1   1 
ATOM   1943 C  CD2   . LEU A 1 249 ? 27.059  135.418 22.626  1.00 51.15  ? 290 LEU A CD2   1 
ATOM   1944 N  N     . GLU A 1 250 ? 24.647  131.294 20.164  1.00 35.80  ? 291 GLU A N     1 
ATOM   1945 C  CA    . GLU A 1 250 ? 24.494  129.902 19.754  1.00 35.67  ? 291 GLU A CA    1 
ATOM   1946 C  C     . GLU A 1 250 ? 24.248  129.754 18.253  1.00 34.32  ? 291 GLU A C     1 
ATOM   1947 O  O     . GLU A 1 250 ? 24.997  129.064 17.561  1.00 33.58  ? 291 GLU A O     1 
ATOM   1948 C  CB    . GLU A 1 250 ? 23.359  129.242 20.540  1.00 32.14  ? 291 GLU A CB    1 
ATOM   1949 C  CG    . GLU A 1 250 ? 23.680  129.028 22.013  1.00 35.40  ? 291 GLU A CG    1 
ATOM   1950 C  CD    . GLU A 1 250 ? 22.550  128.356 22.768  1.00 35.75  ? 291 GLU A CD    1 
ATOM   1951 O  OE1   . GLU A 1 250 ? 22.757  127.228 23.265  1.00 39.02  ? 291 GLU A OE1   1 
ATOM   1952 O  OE2   . GLU A 1 250 ? 21.460  128.957 22.873  1.00 36.45  ? 291 GLU A OE2   1 
ATOM   1953 N  N     . LEU A 1 251 ? 23.200  130.402 17.752  1.00 30.63  ? 292 LEU A N     1 
ATOM   1954 C  CA    . LEU A 1 251 ? 22.854  130.306 16.337  1.00 31.83  ? 292 LEU A CA    1 
ATOM   1955 C  C     . LEU A 1 251 ? 23.918  130.934 15.443  1.00 33.12  ? 292 LEU A C     1 
ATOM   1956 O  O     . LEU A 1 251 ? 24.437  130.285 14.534  1.00 28.85  ? 292 LEU A O     1 
ATOM   1957 C  CB    . LEU A 1 251 ? 21.502  130.967 16.065  1.00 28.11  ? 292 LEU A CB    1 
ATOM   1958 C  CG    . LEU A 1 251 ? 21.067  130.968 14.597  1.00 34.86  ? 292 LEU A CG    1 
ATOM   1959 C  CD1   . LEU A 1 251 ? 20.989  129.545 14.052  1.00 28.96  ? 292 LEU A CD1   1 
ATOM   1960 C  CD2   . LEU A 1 251 ? 19.739  131.692 14.418  1.00 30.26  ? 292 LEU A CD2   1 
ATOM   1961 N  N     . MET A 1 252 ? 24.241  132.196 15.707  1.00 30.17  ? 293 MET A N     1 
ATOM   1962 C  CA    . MET A 1 252 ? 25.185  132.932 14.875  1.00 30.44  ? 293 MET A CA    1 
ATOM   1963 C  C     . MET A 1 252 ? 26.579  132.310 14.920  1.00 33.80  ? 293 MET A C     1 
ATOM   1964 O  O     . MET A 1 252 ? 27.327  132.373 13.944  1.00 31.32  ? 293 MET A O     1 
ATOM   1965 C  CB    . MET A 1 252 ? 25.247  134.396 15.310  1.00 30.66  ? 293 MET A CB    1 
ATOM   1966 C  CG    . MET A 1 252 ? 25.849  135.311 14.264  1.00 38.49  ? 293 MET A CG    1 
ATOM   1967 S  SD    . MET A 1 252 ? 24.898  135.289 12.733  1.00 36.35  ? 293 MET A SD    1 
ATOM   1968 C  CE    . MET A 1 252 ? 26.196  134.953 11.549  1.00 29.34  ? 293 MET A CE    1 
ATOM   1969 N  N     . THR A 1 253 ? 26.919  131.709 16.056  1.00 32.76  ? 294 THR A N     1 
ATOM   1970 C  CA    . THR A 1 253 ? 28.189  131.008 16.201  1.00 32.20  ? 294 THR A CA    1 
ATOM   1971 C  C     . THR A 1 253 ? 28.247  129.804 15.262  1.00 30.54  ? 294 THR A C     1 
ATOM   1972 O  O     . THR A 1 253 ? 29.245  129.588 14.575  1.00 37.40  ? 294 THR A O     1 
ATOM   1973 C  CB    . THR A 1 253 ? 28.413  130.538 17.652  1.00 36.10  ? 294 THR A CB    1 
ATOM   1974 O  OG1   . THR A 1 253 ? 28.445  131.675 18.525  1.00 40.42  ? 294 THR A OG1   1 
ATOM   1975 C  CG2   . THR A 1 253 ? 29.725  129.778 17.772  1.00 35.61  ? 294 THR A CG2   1 
ATOM   1976 N  N     . TYR A 1 254 ? 27.166  129.031 15.237  1.00 31.44  ? 295 TYR A N     1 
ATOM   1977 C  CA    . TYR A 1 254 ? 27.064  127.863 14.368  1.00 34.52  ? 295 TYR A CA    1 
ATOM   1978 C  C     . TYR A 1 254 ? 27.150  128.262 12.897  1.00 31.84  ? 295 TYR A C     1 
ATOM   1979 O  O     . TYR A 1 254 ? 27.844  127.619 12.108  1.00 34.28  ? 295 TYR A O     1 
ATOM   1980 C  CB    . TYR A 1 254 ? 25.754  127.112 14.636  1.00 32.09  ? 295 TYR A CB    1 
ATOM   1981 C  CG    . TYR A 1 254 ? 25.591  125.840 13.834  1.00 35.09  ? 295 TYR A CG    1 
ATOM   1982 C  CD1   . TYR A 1 254 ? 26.039  124.622 14.330  1.00 37.01  ? 295 TYR A CD1   1 
ATOM   1983 C  CD2   . TYR A 1 254 ? 24.987  125.856 12.583  1.00 29.54  ? 295 TYR A CD2   1 
ATOM   1984 C  CE1   . TYR A 1 254 ? 25.892  123.456 13.600  1.00 36.19  ? 295 TYR A CE1   1 
ATOM   1985 C  CE2   . TYR A 1 254 ? 24.839  124.699 11.847  1.00 28.70  ? 295 TYR A CE2   1 
ATOM   1986 C  CZ    . TYR A 1 254 ? 25.292  123.502 12.358  1.00 37.93  ? 295 TYR A CZ    1 
ATOM   1987 O  OH    . TYR A 1 254 ? 25.141  122.350 11.623  1.00 32.85  ? 295 TYR A OH    1 
ATOM   1988 N  N     . ILE A 1 255 ? 26.439  129.327 12.541  1.00 30.84  ? 296 ILE A N     1 
ATOM   1989 C  CA    . ILE A 1 255 ? 26.398  129.819 11.168  1.00 29.50  ? 296 ILE A CA    1 
ATOM   1990 C  C     . ILE A 1 255 ? 27.781  130.224 10.663  1.00 32.53  ? 296 ILE A C     1 
ATOM   1991 O  O     . ILE A 1 255 ? 28.177  129.859 9.556   1.00 26.96  ? 296 ILE A O     1 
ATOM   1992 C  CB    . ILE A 1 255 ? 25.440  131.021 11.037  1.00 27.72  ? 296 ILE A CB    1 
ATOM   1993 C  CG1   . ILE A 1 255 ? 24.005  130.599 11.362  1.00 25.96  ? 296 ILE A CG1   1 
ATOM   1994 C  CG2   . ILE A 1 255 ? 25.520  131.623 9.641   1.00 29.70  ? 296 ILE A CG2   1 
ATOM   1995 C  CD1   . ILE A 1 255 ? 22.998  131.727 11.275  1.00 25.48  ? 296 ILE A CD1   1 
ATOM   1996 N  N     . ASN A 1 256 ? 28.512  130.975 11.481  1.00 31.70  ? 297 ASN A N     1 
ATOM   1997 C  CA    . ASN A 1 256 ? 29.853  131.425 11.116  1.00 33.78  ? 297 ASN A CA    1 
ATOM   1998 C  C     . ASN A 1 256 ? 30.850  130.277 11.021  1.00 35.56  ? 297 ASN A C     1 
ATOM   1999 O  O     . ASN A 1 256 ? 31.726  130.275 10.155  1.00 34.77  ? 297 ASN A O     1 
ATOM   2000 C  CB    . ASN A 1 256 ? 30.360  132.463 12.119  1.00 31.04  ? 297 ASN A CB    1 
ATOM   2001 C  CG    . ASN A 1 256 ? 29.695  133.813 11.948  1.00 32.86  ? 297 ASN A CG    1 
ATOM   2002 O  OD1   . ASN A 1 256 ? 29.309  134.190 10.842  1.00 38.69  ? 297 ASN A OD1   1 
ATOM   2003 N  ND2   . ASN A 1 256 ? 29.556  134.549 13.044  1.00 34.21  ? 297 ASN A ND2   1 
ATOM   2004 N  N     . GLU A 1 257 ? 30.716  129.303 11.916  1.00 32.62  ? 298 GLU A N     1 
ATOM   2005 C  CA    . GLU A 1 257 ? 31.606  128.149 11.928  1.00 37.68  ? 298 GLU A CA    1 
ATOM   2006 C  C     . GLU A 1 257 ? 31.326  127.217 10.754  1.00 34.52  ? 298 GLU A C     1 
ATOM   2007 O  O     . GLU A 1 257 ? 32.203  126.469 10.321  1.00 37.75  ? 298 GLU A O     1 
ATOM   2008 C  CB    . GLU A 1 257 ? 31.477  127.384 13.246  1.00 36.39  ? 298 GLU A CB    1 
ATOM   2009 C  CG    . GLU A 1 257 ? 32.089  128.096 14.440  1.00 48.82  ? 298 GLU A CG    1 
ATOM   2010 C  CD    . GLU A 1 257 ? 31.954  127.300 15.725  1.00 62.33  ? 298 GLU A CD    1 
ATOM   2011 O  OE1   . GLU A 1 257 ? 31.270  126.254 15.711  1.00 63.06  ? 298 GLU A OE1   1 
ATOM   2012 O  OE2   . GLU A 1 257 ? 32.533  127.720 16.750  1.00 67.07  ? 298 GLU A OE2   1 
ATOM   2013 N  N     . ASN A 1 258 ? 30.102  127.268 10.241  1.00 30.35  ? 299 ASN A N     1 
ATOM   2014 C  CA    . ASN A 1 258 ? 29.707  126.416 9.126   1.00 32.46  ? 299 ASN A CA    1 
ATOM   2015 C  C     . ASN A 1 258 ? 29.420  127.213 7.859   1.00 33.94  ? 299 ASN A C     1 
ATOM   2016 O  O     . ASN A 1 258 ? 28.718  126.736 6.967   1.00 34.00  ? 299 ASN A O     1 
ATOM   2017 C  CB    . ASN A 1 258 ? 28.478  125.584 9.502   1.00 30.86  ? 299 ASN A CB    1 
ATOM   2018 C  CG    . ASN A 1 258 ? 28.753  124.617 10.638  1.00 33.28  ? 299 ASN A CG    1 
ATOM   2019 O  OD1   . ASN A 1 258 ? 28.441  124.895 11.796  1.00 36.91  ? 299 ASN A OD1   1 
ATOM   2020 N  ND2   . ASN A 1 258 ? 29.344  123.476 10.310  1.00 31.26  ? 299 ASN A ND2   1 
ATOM   2021 N  N     . TRP A 1 259 ? 29.970  128.421 7.780   1.00 30.12  ? 300 TRP A N     1 
ATOM   2022 C  CA    . TRP A 1 259 ? 29.678  129.321 6.669   1.00 32.12  ? 300 TRP A CA    1 
ATOM   2023 C  C     . TRP A 1 259 ? 30.142  128.765 5.326   1.00 34.80  ? 300 TRP A C     1 
ATOM   2024 O  O     . TRP A 1 259 ? 29.413  128.833 4.336   1.00 34.22  ? 300 TRP A O     1 
ATOM   2025 C  CB    . TRP A 1 259 ? 30.314  130.691 6.905   1.00 34.91  ? 300 TRP A CB    1 
ATOM   2026 C  CG    . TRP A 1 259 ? 29.895  131.707 5.887   1.00 34.64  ? 300 TRP A CG    1 
ATOM   2027 C  CD1   . TRP A 1 259 ? 30.648  132.208 4.867   1.00 32.00  ? 300 TRP A CD1   1 
ATOM   2028 C  CD2   . TRP A 1 259 ? 28.610  132.332 5.782   1.00 27.92  ? 300 TRP A CD2   1 
ATOM   2029 N  NE1   . TRP A 1 259 ? 29.916  133.114 4.139   1.00 33.62  ? 300 TRP A NE1   1 
ATOM   2030 C  CE2   . TRP A 1 259 ? 28.661  133.207 4.680   1.00 30.10  ? 300 TRP A CE2   1 
ATOM   2031 C  CE3   . TRP A 1 259 ? 27.423  132.239 6.516   1.00 30.54  ? 300 TRP A CE3   1 
ATOM   2032 C  CZ2   . TRP A 1 259 ? 27.571  133.985 4.294   1.00 27.82  ? 300 TRP A CZ2   1 
ATOM   2033 C  CZ3   . TRP A 1 259 ? 26.341  133.012 6.130   1.00 24.28  ? 300 TRP A CZ3   1 
ATOM   2034 C  CH2   . TRP A 1 259 ? 26.423  133.874 5.029   1.00 28.73  ? 300 TRP A CH2   1 
ATOM   2035 N  N     . ASP A 1 260 ? 31.353  128.222 5.291   1.00 38.83  ? 301 ASP A N     1 
ATOM   2036 C  CA    . ASP A 1 260 ? 31.875  127.629 4.066   1.00 40.98  ? 301 ASP A CA    1 
ATOM   2037 C  C     . ASP A 1 260 ? 31.092  126.377 3.693   1.00 37.96  ? 301 ASP A C     1 
ATOM   2038 O  O     . ASP A 1 260 ? 30.780  126.156 2.523   1.00 34.49  ? 301 ASP A O     1 
ATOM   2039 C  CB    . ASP A 1 260 ? 33.360  127.297 4.212   1.00 42.25  ? 301 ASP A CB    1 
ATOM   2040 C  CG    . ASP A 1 260 ? 34.239  128.528 4.131   1.00 54.03  ? 301 ASP A CG    1 
ATOM   2041 O  OD1   . ASP A 1 260 ? 34.617  128.915 3.004   1.00 62.38  ? 301 ASP A OD1   1 
ATOM   2042 O  OD2   . ASP A 1 260 ? 34.552  129.109 5.191   1.00 62.61  ? 301 ASP A OD2   1 
ATOM   2043 N  N     . ARG A 1 261 ? 30.764  125.570 4.697   1.00 32.34  ? 302 ARG A N     1 
ATOM   2044 C  CA    . ARG A 1 261 ? 30.030  124.331 4.471   1.00 37.29  ? 302 ARG A CA    1 
ATOM   2045 C  C     . ARG A 1 261 ? 28.591  124.619 4.050   1.00 34.24  ? 302 ARG A C     1 
ATOM   2046 O  O     . ARG A 1 261 ? 27.927  123.772 3.453   1.00 36.48  ? 302 ARG A O     1 
ATOM   2047 C  CB    . ARG A 1 261 ? 30.052  123.457 5.725   1.00 33.81  ? 302 ARG A CB    1 
ATOM   2048 C  CG    . ARG A 1 261 ? 29.841  121.984 5.438   1.00 35.54  ? 302 ARG A CG    1 
ATOM   2049 C  CD    . ARG A 1 261 ? 30.127  121.130 6.658   1.00 33.25  ? 302 ARG A CD    1 
ATOM   2050 N  NE    . ARG A 1 261 ? 29.148  121.337 7.720   1.00 42.01  ? 302 ARG A NE    1 
ATOM   2051 C  CZ    . ARG A 1 261 ? 29.041  120.559 8.792   1.00 51.75  ? 302 ARG A CZ    1 
ATOM   2052 N  NH1   . ARG A 1 261 ? 29.852  119.520 8.940   1.00 59.47  ? 302 ARG A NH1   1 
ATOM   2053 N  NH2   . ARG A 1 261 ? 28.123  120.816 9.713   1.00 45.47  ? 302 ARG A NH2   1 
ATOM   2054 N  N     . LEU A 1 262 ? 28.119  125.824 4.357   1.00 32.11  ? 303 LEU A N     1 
ATOM   2055 C  CA    . LEU A 1 262 ? 26.776  126.248 3.982   1.00 32.84  ? 303 LEU A CA    1 
ATOM   2056 C  C     . LEU A 1 262 ? 26.664  126.561 2.493   1.00 32.23  ? 303 LEU A C     1 
ATOM   2057 O  O     . LEU A 1 262 ? 25.578  126.427 1.924   1.00 26.36  ? 303 LEU A O     1 
ATOM   2058 C  CB    . LEU A 1 262 ? 26.356  127.474 4.800   1.00 30.58  ? 303 LEU A CB    1 
ATOM   2059 C  CG    . LEU A 1 262 ? 25.643  127.237 6.133   1.00 36.28  ? 303 LEU A CG    1 
ATOM   2060 C  CD1   . LEU A 1 262 ? 25.760  128.464 7.021   1.00 29.94  ? 303 LEU A CD1   1 
ATOM   2061 C  CD2   . LEU A 1 262 ? 24.180  126.875 5.905   1.00 31.32  ? 303 LEU A CD2   1 
ATOM   2062 N  N     . HIS A 1 263 ? 27.728  127.090 1.920   1.00 32.02  ? 304 HIS A N     1 
ATOM   2063 C  CA    . HIS A 1 263 ? 27.771  127.416 0.503   1.00 35.02  ? 304 HIS A CA    1 
ATOM   2064 C  C     . HIS A 1 263 ? 26.500  128.007 -0.051  1.00 35.57  ? 304 HIS A C     1 
ATOM   2065 O  O     . HIS A 1 263 ? 25.923  127.443 -0.909  1.00 33.89  ? 304 HIS A O     1 
ATOM   2066 C  CB    . HIS A 1 263 ? 28.498  126.448 -0.450  1.00 38.43  ? 304 HIS A CB    1 
ATOM   2067 C  CG    . HIS A 1 263 ? 28.224  124.996 -0.255  1.00 40.31  ? 304 HIS A CG    1 
ATOM   2068 N  ND1   . HIS A 1 263 ? 27.136  124.501 0.416   1.00 48.34  ? 304 HIS A ND1   1 
ATOM   2069 C  CD2   . HIS A 1 263 ? 28.904  123.922 -0.696  1.00 43.28  ? 304 HIS A CD2   1 
ATOM   2070 C  CE1   . HIS A 1 263 ? 27.162  123.190 0.389   1.00 40.71  ? 304 HIS A CE1   1 
ATOM   2071 N  NE2   . HIS A 1 263 ? 28.231  122.815 -0.271  1.00 42.53  ? 304 HIS A NE2   1 
ATOM   2072 N  N     . PRO A 1 264 ? 26.051  129.110 0.512   1.00 36.29  ? 305 PRO A N     1 
ATOM   2073 C  CA    . PRO A 1 264 ? 24.708  129.633 0.250   1.00 34.40  ? 305 PRO A CA    1 
ATOM   2074 C  C     . PRO A 1 264 ? 24.546  130.222 -1.147  1.00 41.16  ? 305 PRO A C     1 
ATOM   2075 O  O     . PRO A 1 264 ? 23.419  130.332 -1.626  1.00 36.14  ? 305 PRO A O     1 
ATOM   2076 C  CB    . PRO A 1 264 ? 24.550  130.717 1.320   1.00 33.43  ? 305 PRO A CB    1 
ATOM   2077 C  CG    . PRO A 1 264 ? 25.941  131.201 1.552   1.00 34.21  ? 305 PRO A CG    1 
ATOM   2078 C  CD    . PRO A 1 264 ? 26.811  129.978 1.429   1.00 28.79  ? 305 PRO A CD    1 
ATOM   2079 N  N     . GLY A 1 265 ? 25.650  130.592 -1.788  1.00 37.47  ? 306 GLY A N     1 
ATOM   2080 C  CA    . GLY A 1 265 ? 25.594  131.148 -3.128  1.00 36.74  ? 306 GLY A CA    1 
ATOM   2081 C  C     . GLY A 1 265 ? 25.964  132.618 -3.183  1.00 38.14  ? 306 GLY A C     1 
ATOM   2082 O  O     . GLY A 1 265 ? 27.098  132.994 -2.896  1.00 33.84  ? 306 GLY A O     1 
ATOM   2083 N  N     . GLU A 1 266 ? 24.998  133.453 -3.549  1.00 36.47  ? 307 GLU A N     1 
ATOM   2084 C  CA    . GLU A 1 266 ? 25.251  134.876 -3.734  1.00 38.13  ? 307 GLU A CA    1 
ATOM   2085 C  C     . GLU A 1 266 ? 25.528  135.585 -2.412  1.00 40.87  ? 307 GLU A C     1 
ATOM   2086 O  O     . GLU A 1 266 ? 26.163  136.639 -2.385  1.00 40.62  ? 307 GLU A O     1 
ATOM   2087 C  CB    . GLU A 1 266 ? 24.067  135.539 -4.435  1.00 43.08  ? 307 GLU A CB    1 
ATOM   2088 C  CG    . GLU A 1 266 ? 24.435  136.804 -5.181  1.00 54.26  ? 307 GLU A CG    1 
ATOM   2089 C  CD    . GLU A 1 266 ? 25.294  136.520 -6.395  1.00 65.39  ? 307 GLU A CD    1 
ATOM   2090 O  OE1   . GLU A 1 266 ? 25.134  135.434 -6.995  1.00 62.14  ? 307 GLU A OE1   1 
ATOM   2091 O  OE2   . GLU A 1 266 ? 26.134  137.376 -6.743  1.00 70.70  ? 307 GLU A OE2   1 
ATOM   2092 N  N     . LEU A 1 267 ? 25.051  135.001 -1.318  1.00 33.46  ? 308 LEU A N     1 
ATOM   2093 C  CA    . LEU A 1 267 ? 25.213  135.601 0.001   1.00 32.94  ? 308 LEU A CA    1 
ATOM   2094 C  C     . LEU A 1 267 ? 26.533  135.202 0.652   1.00 37.07  ? 308 LEU A C     1 
ATOM   2095 O  O     . LEU A 1 267 ? 26.831  135.620 1.769   1.00 34.67  ? 308 LEU A O     1 
ATOM   2096 C  CB    . LEU A 1 267 ? 24.050  135.204 0.914   1.00 32.45  ? 308 LEU A CB    1 
ATOM   2097 C  CG    . LEU A 1 267 ? 22.646  135.621 0.471   1.00 31.79  ? 308 LEU A CG    1 
ATOM   2098 C  CD1   . LEU A 1 267 ? 21.618  135.203 1.511   1.00 31.26  ? 308 LEU A CD1   1 
ATOM   2099 C  CD2   . LEU A 1 267 ? 22.584  137.119 0.223   1.00 30.79  ? 308 LEU A CD2   1 
ATOM   2100 N  N     . ALA A 1 268 ? 27.323  134.399 -0.052  1.00 35.95  ? 309 ALA A N     1 
ATOM   2101 C  CA    . ALA A 1 268 ? 28.558  133.860 0.507   1.00 38.87  ? 309 ALA A CA    1 
ATOM   2102 C  C     . ALA A 1 268 ? 29.611  134.940 0.739   1.00 39.43  ? 309 ALA A C     1 
ATOM   2103 O  O     . ALA A 1 268 ? 30.440  134.820 1.641   1.00 34.92  ? 309 ALA A O     1 
ATOM   2104 C  CB    . ALA A 1 268 ? 29.115  132.773 -0.400  1.00 36.44  ? 309 ALA A CB    1 
ATOM   2105 N  N     . ASP A 1 269 ? 29.574  135.995 -0.070  1.00 36.21  ? 310 ASP A N     1 
ATOM   2106 C  CA    . ASP A 1 269 ? 30.568  137.060 0.026   1.00 35.79  ? 310 ASP A CA    1 
ATOM   2107 C  C     . ASP A 1 269 ? 30.284  138.021 1.177   1.00 40.36  ? 310 ASP A C     1 
ATOM   2108 O  O     . ASP A 1 269 ? 31.071  138.929 1.443   1.00 45.34  ? 310 ASP A O     1 
ATOM   2109 C  CB    . ASP A 1 269 ? 30.649  137.835 -1.294  1.00 45.37  ? 310 ASP A CB    1 
ATOM   2110 C  CG    . ASP A 1 269 ? 29.290  138.325 -1.776  1.00 50.96  ? 310 ASP A CG    1 
ATOM   2111 O  OD1   . ASP A 1 269 ? 28.542  138.934 -0.981  1.00 57.83  ? 310 ASP A OD1   1 
ATOM   2112 O  OD2   . ASP A 1 269 ? 28.970  138.098 -2.961  1.00 61.48  ? 310 ASP A OD2   1 
ATOM   2113 N  N     . THR A 1 270 ? 29.157  137.818 1.852   1.00 40.62  ? 311 THR A N     1 
ATOM   2114 C  CA    . THR A 1 270 ? 28.766  138.670 2.970   1.00 40.14  ? 311 THR A CA    1 
ATOM   2115 C  C     . THR A 1 270 ? 29.797  138.620 4.094   1.00 37.25  ? 311 THR A C     1 
ATOM   2116 O  O     . THR A 1 270 ? 30.109  137.545 4.606   1.00 39.28  ? 311 THR A O     1 
ATOM   2117 C  CB    . THR A 1 270 ? 27.386  138.265 3.530   1.00 34.31  ? 311 THR A CB    1 
ATOM   2118 O  OG1   . THR A 1 270 ? 26.402  138.349 2.491   1.00 36.13  ? 311 THR A OG1   1 
ATOM   2119 C  CG2   . THR A 1 270 ? 26.982  139.176 4.679   1.00 35.14  ? 311 THR A CG2   1 
ATOM   2120 N  N     . PRO A 1 271 ? 30.338  139.789 4.472   1.00 40.13  ? 312 PRO A N     1 
ATOM   2121 C  CA    . PRO A 1 271 ? 31.295  139.905 5.579   1.00 39.78  ? 312 PRO A CA    1 
ATOM   2122 C  C     . PRO A 1 271 ? 30.731  139.340 6.880   1.00 38.00  ? 312 PRO A C     1 
ATOM   2123 O  O     . PRO A 1 271 ? 29.540  139.497 7.149   1.00 39.43  ? 312 PRO A O     1 
ATOM   2124 C  CB    . PRO A 1 271 ? 31.526  141.415 5.690   1.00 43.84  ? 312 PRO A CB    1 
ATOM   2125 C  CG    . PRO A 1 271 ? 31.207  141.944 4.335   1.00 42.72  ? 312 PRO A CG    1 
ATOM   2126 C  CD    . PRO A 1 271 ? 30.096  141.084 3.814   1.00 44.45  ? 312 PRO A CD    1 
ATOM   2127 N  N     . LYS A 1 272 ? 31.586  138.691 7.666   1.00 35.20  ? 313 LYS A N     1 
ATOM   2128 C  CA    . LYS A 1 272 ? 31.177  138.039 8.908   1.00 37.21  ? 313 LYS A CA    1 
ATOM   2129 C  C     . LYS A 1 272 ? 30.418  138.974 9.846   1.00 38.29  ? 313 LYS A C     1 
ATOM   2130 O  O     . LYS A 1 272 ? 29.413  138.589 10.444  1.00 33.85  ? 313 LYS A O     1 
ATOM   2131 C  CB    . LYS A 1 272 ? 32.403  137.470 9.626   1.00 36.73  ? 313 LYS A CB    1 
ATOM   2132 C  CG    . LYS A 1 272 ? 32.083  136.701 10.893  1.00 37.73  ? 313 LYS A CG    1 
ATOM   2133 C  CD    . LYS A 1 272 ? 33.353  136.158 11.524  1.00 39.83  ? 313 LYS A CD    1 
ATOM   2134 C  CE    . LYS A 1 272 ? 33.051  135.317 12.753  1.00 51.76  ? 313 LYS A CE    1 
ATOM   2135 N  NZ    . LYS A 1 272 ? 34.293  134.772 13.369  1.00 51.88  ? 313 LYS A NZ    1 
ATOM   2136 N  N     . SER A 1 273 ? 30.898  140.208 9.958   1.00 37.27  ? 314 SER A N     1 
ATOM   2137 C  CA    . SER A 1 273 ? 30.300  141.192 10.852  1.00 44.99  ? 314 SER A CA    1 
ATOM   2138 C  C     . SER A 1 273 ? 28.912  141.628 10.393  1.00 43.02  ? 314 SER A C     1 
ATOM   2139 O  O     . SER A 1 273 ? 28.108  142.114 11.187  1.00 48.07  ? 314 SER A O     1 
ATOM   2140 C  CB    . SER A 1 273 ? 31.211  142.414 10.969  1.00 48.08  ? 314 SER A CB    1 
ATOM   2141 O  OG    . SER A 1 273 ? 31.375  143.046 9.710   1.00 52.75  ? 314 SER A OG    1 
ATOM   2142 N  N     . GLU A 1 274 ? 28.642  141.452 9.104   1.00 39.71  ? 315 GLU A N     1 
ATOM   2143 C  CA    . GLU A 1 274 ? 27.390  141.902 8.509   1.00 37.93  ? 315 GLU A CA    1 
ATOM   2144 C  C     . GLU A 1 274 ? 26.319  140.814 8.539   1.00 35.75  ? 315 GLU A C     1 
ATOM   2145 O  O     . GLU A 1 274 ? 25.125  141.100 8.456   1.00 38.06  ? 315 GLU A O     1 
ATOM   2146 C  CB    . GLU A 1 274 ? 27.635  142.366 7.070   1.00 42.69  ? 315 GLU A CB    1 
ATOM   2147 C  CG    . GLU A 1 274 ? 26.431  142.999 6.398   1.00 48.38  ? 315 GLU A CG    1 
ATOM   2148 C  CD    . GLU A 1 274 ? 26.736  143.478 4.991   1.00 55.35  ? 315 GLU A CD    1 
ATOM   2149 O  OE1   . GLU A 1 274 ? 25.795  143.561 4.175   1.00 52.29  ? 315 GLU A OE1   1 
ATOM   2150 O  OE2   . GLU A 1 274 ? 27.916  143.771 4.700   1.00 53.59  ? 315 GLU A OE2   1 
ATOM   2151 N  N     . ARG A 1 275 ? 26.755  139.566 8.675   1.00 34.79  ? 316 ARG A N     1 
ATOM   2152 C  CA    . ARG A 1 275 ? 25.849  138.424 8.611   1.00 30.44  ? 316 ARG A CA    1 
ATOM   2153 C  C     . ARG A 1 275 ? 24.780  138.444 9.704   1.00 31.93  ? 316 ARG A C     1 
ATOM   2154 O  O     . ARG A 1 275 ? 23.623  138.110 9.448   1.00 28.15  ? 316 ARG A O     1 
ATOM   2155 C  CB    . ARG A 1 275 ? 26.639  137.117 8.693   1.00 30.93  ? 316 ARG A CB    1 
ATOM   2156 C  CG    . ARG A 1 275 ? 27.629  136.917 7.557   1.00 27.92  ? 316 ARG A CG    1 
ATOM   2157 C  CD    . ARG A 1 275 ? 28.556  135.748 7.848   1.00 31.11  ? 316 ARG A CD    1 
ATOM   2158 N  NE    . ARG A 1 275 ? 29.675  135.689 6.912   1.00 33.35  ? 316 ARG A NE    1 
ATOM   2159 C  CZ    . ARG A 1 275 ? 30.776  134.971 7.109   1.00 34.54  ? 316 ARG A CZ    1 
ATOM   2160 N  NH1   . ARG A 1 275 ? 30.912  134.250 8.215   1.00 32.91  ? 316 ARG A NH1   1 
ATOM   2161 N  NH2   . ARG A 1 275 ? 31.746  134.976 6.205   1.00 32.47  ? 316 ARG A NH2   1 
ATOM   2162 N  N     . TYR A 1 276 ? 25.161  138.842 10.916  1.00 26.64  ? 317 TYR A N     1 
ATOM   2163 C  CA    . TYR A 1 276 ? 24.237  138.810 12.047  1.00 30.09  ? 317 TYR A CA    1 
ATOM   2164 C  C     . TYR A 1 276 ? 23.071  139.781 11.867  1.00 28.83  ? 317 TYR A C     1 
ATOM   2165 O  O     . TYR A 1 276 ? 21.959  139.515 12.323  1.00 26.11  ? 317 TYR A O     1 
ATOM   2166 C  CB    . TYR A 1 276 ? 24.972  139.110 13.356  1.00 33.93  ? 317 TYR A CB    1 
ATOM   2167 C  CG    . TYR A 1 276 ? 24.076  139.018 14.570  1.00 37.69  ? 317 TYR A CG    1 
ATOM   2168 C  CD1   . TYR A 1 276 ? 23.449  137.824 14.899  1.00 35.76  ? 317 TYR A CD1   1 
ATOM   2169 C  CD2   . TYR A 1 276 ? 23.854  140.121 15.384  1.00 35.87  ? 317 TYR A CD2   1 
ATOM   2170 C  CE1   . TYR A 1 276 ? 22.626  137.729 16.002  1.00 37.53  ? 317 TYR A CE1   1 
ATOM   2171 C  CE2   . TYR A 1 276 ? 23.032  140.035 16.494  1.00 35.91  ? 317 TYR A CE2   1 
ATOM   2172 C  CZ    . TYR A 1 276 ? 22.420  138.836 16.796  1.00 40.94  ? 317 TYR A CZ    1 
ATOM   2173 O  OH    . TYR A 1 276 ? 21.599  138.737 17.896  1.00 42.34  ? 317 TYR A OH    1 
ATOM   2174 N  N     . GLU A 1 277 ? 23.332  140.904 11.204  1.00 29.81  ? 318 GLU A N     1 
ATOM   2175 C  CA    . GLU A 1 277 ? 22.290  141.881 10.905  1.00 28.21  ? 318 GLU A CA    1 
ATOM   2176 C  C     . GLU A 1 277 ? 21.143  141.243 10.130  1.00 24.36  ? 318 GLU A C     1 
ATOM   2177 O  O     . GLU A 1 277 ? 19.973  141.421 10.469  1.00 26.39  ? 318 GLU A O     1 
ATOM   2178 C  CB    . GLU A 1 277 ? 22.866  143.056 10.108  1.00 30.96  ? 318 GLU A CB    1 
ATOM   2179 C  CG    . GLU A 1 277 ? 21.814  143.888 9.382   1.00 32.51  ? 318 GLU A CG    1 
ATOM   2180 C  CD    . GLU A 1 277 ? 22.425  144.952 8.484   1.00 39.65  ? 318 GLU A CD    1 
ATOM   2181 O  OE1   . GLU A 1 277 ? 23.670  145.047 8.436   1.00 47.22  ? 318 GLU A OE1   1 
ATOM   2182 O  OE2   . GLU A 1 277 ? 21.664  145.691 7.825   1.00 43.51  ? 318 GLU A OE2   1 
ATOM   2183 N  N     . HIS A 1 278 ? 21.491  140.485 9.097   1.00 24.48  ? 319 HIS A N     1 
ATOM   2184 C  CA    . HIS A 1 278 ? 20.496  139.879 8.223   1.00 29.27  ? 319 HIS A CA    1 
ATOM   2185 C  C     . HIS A 1 278 ? 19.875  138.628 8.839   1.00 23.16  ? 319 HIS A C     1 
ATOM   2186 O  O     . HIS A 1 278 ? 18.708  138.324 8.591   1.00 21.31  ? 319 HIS A O     1 
ATOM   2187 C  CB    . HIS A 1 278 ? 21.122  139.555 6.867   1.00 27.48  ? 319 HIS A CB    1 
ATOM   2188 C  CG    . HIS A 1 278 ? 21.631  140.761 6.140   1.00 29.44  ? 319 HIS A CG    1 
ATOM   2189 N  ND1   . HIS A 1 278 ? 22.974  140.999 5.940   1.00 32.28  ? 319 HIS A ND1   1 
ATOM   2190 C  CD2   . HIS A 1 278 ? 20.976  141.806 5.580   1.00 27.28  ? 319 HIS A CD2   1 
ATOM   2191 C  CE1   . HIS A 1 278 ? 23.124  142.134 5.281   1.00 30.34  ? 319 HIS A CE1   1 
ATOM   2192 N  NE2   . HIS A 1 278 ? 21.927  142.644 5.050   1.00 36.25  ? 319 HIS A NE2   1 
ATOM   2193 N  N     . VAL A 1 279 ? 20.651  137.909 9.643   1.00 24.90  ? 320 VAL A N     1 
ATOM   2194 C  CA    . VAL A 1 279 ? 20.138  136.731 10.334  1.00 21.02  ? 320 VAL A CA    1 
ATOM   2195 C  C     . VAL A 1 279 ? 19.115  137.133 11.392  1.00 26.19  ? 320 VAL A C     1 
ATOM   2196 O  O     . VAL A 1 279 ? 18.048  136.525 11.500  1.00 23.10  ? 320 VAL A O     1 
ATOM   2197 C  CB    . VAL A 1 279 ? 21.271  135.922 10.995  1.00 24.17  ? 320 VAL A CB    1 
ATOM   2198 C  CG1   . VAL A 1 279 ? 20.702  134.865 11.933  1.00 23.90  ? 320 VAL A CG1   1 
ATOM   2199 C  CG2   . VAL A 1 279 ? 22.152  135.278 9.935   1.00 24.82  ? 320 VAL A CG2   1 
ATOM   2200 N  N     . LEU A 1 280 ? 19.440  138.167 12.161  1.00 24.33  ? 321 LEU A N     1 
ATOM   2201 C  CA    . LEU A 1 280 ? 18.559  138.635 13.224  1.00 26.48  ? 321 LEU A CA    1 
ATOM   2202 C  C     . LEU A 1 280 ? 17.242  139.154 12.659  1.00 22.81  ? 321 LEU A C     1 
ATOM   2203 O  O     . LEU A 1 280 ? 16.180  138.926 13.235  1.00 24.32  ? 321 LEU A O     1 
ATOM   2204 C  CB    . LEU A 1 280 ? 19.243  139.725 14.051  1.00 25.56  ? 321 LEU A CB    1 
ATOM   2205 C  CG    . LEU A 1 280 ? 18.485  140.214 15.287  1.00 35.49  ? 321 LEU A CG    1 
ATOM   2206 C  CD1   . LEU A 1 280 ? 18.154  139.047 16.205  1.00 31.83  ? 321 LEU A CD1   1 
ATOM   2207 C  CD2   . LEU A 1 280 ? 19.297  141.266 16.027  1.00 33.76  ? 321 LEU A CD2   1 
ATOM   2208 N  N     . GLU A 1 281 ? 17.313  139.850 11.530  1.00 24.01  ? 322 GLU A N     1 
ATOM   2209 C  CA    . GLU A 1 281 ? 16.104  140.357 10.891  1.00 26.58  ? 322 GLU A CA    1 
ATOM   2210 C  C     . GLU A 1 281 ? 15.255  139.209 10.359  1.00 18.99  ? 322 GLU A C     1 
ATOM   2211 O  O     . GLU A 1 281 ? 14.033  139.229 10.487  1.00 25.05  ? 322 GLU A O     1 
ATOM   2212 C  CB    . GLU A 1 281 ? 16.450  141.332 9.764   1.00 28.88  ? 322 GLU A CB    1 
ATOM   2213 C  CG    . GLU A 1 281 ? 17.022  142.655 10.249  1.00 35.53  ? 322 GLU A CG    1 
ATOM   2214 C  CD    . GLU A 1 281 ? 17.336  143.610 9.113   1.00 37.54  ? 322 GLU A CD    1 
ATOM   2215 O  OE1   . GLU A 1 281 ? 16.955  143.315 7.962   1.00 37.67  ? 322 GLU A OE1   1 
ATOM   2216 O  OE2   . GLU A 1 281 ? 17.967  144.657 9.371   1.00 45.70  ? 322 GLU A OE2   1 
ATOM   2217 N  N     . ALA A 1 282 ? 15.909  138.210 9.771   1.00 20.93  ? 323 ALA A N     1 
ATOM   2218 C  CA    . ALA A 1 282 ? 15.222  137.028 9.259   1.00 23.09  ? 323 ALA A CA    1 
ATOM   2219 C  C     . ALA A 1 282 ? 14.468  136.308 10.375  1.00 21.76  ? 323 ALA A C     1 
ATOM   2220 O  O     . ALA A 1 282 ? 13.357  135.820 10.171  1.00 22.37  ? 323 ALA A O     1 
ATOM   2221 C  CB    . ALA A 1 282 ? 16.215  136.082 8.590   1.00 22.80  ? 323 ALA A CB    1 
ATOM   2222 N  N     . LEU A 1 283 ? 15.077  136.252 11.556  1.00 23.68  ? 324 LEU A N     1 
ATOM   2223 C  CA    . LEU A 1 283 ? 14.451  135.625 12.715  1.00 22.41  ? 324 LEU A CA    1 
ATOM   2224 C  C     . LEU A 1 283 ? 13.204  136.384 13.155  1.00 27.82  ? 324 LEU A C     1 
ATOM   2225 O  O     . LEU A 1 283 ? 12.221  135.785 13.593  1.00 25.99  ? 324 LEU A O     1 
ATOM   2226 C  CB    . LEU A 1 283 ? 15.441  135.537 13.877  1.00 25.68  ? 324 LEU A CB    1 
ATOM   2227 C  CG    . LEU A 1 283 ? 16.597  134.548 13.732  1.00 25.85  ? 324 LEU A CG    1 
ATOM   2228 C  CD1   . LEU A 1 283 ? 17.613  134.748 14.845  1.00 24.22  ? 324 LEU A CD1   1 
ATOM   2229 C  CD2   . LEU A 1 283 ? 16.073  133.121 13.734  1.00 26.45  ? 324 LEU A CD2   1 
ATOM   2230 N  N     . ASN A 1 284 ? 13.251  137.707 13.036  1.00 23.83  ? 325 ASN A N     1 
ATOM   2231 C  CA    . ASN A 1 284 ? 12.140  138.551 13.457  1.00 28.52  ? 325 ASN A CA    1 
ATOM   2232 C  C     . ASN A 1 284 ? 11.077  138.742 12.378  1.00 25.83  ? 325 ASN A C     1 
ATOM   2233 O  O     . ASN A 1 284 ? 9.912   138.987 12.688  1.00 28.14  ? 325 ASN A O     1 
ATOM   2234 C  CB    . ASN A 1 284 ? 12.659  139.918 13.912  1.00 25.34  ? 325 ASN A CB    1 
ATOM   2235 C  CG    . ASN A 1 284 ? 13.371  139.855 15.251  1.00 31.35  ? 325 ASN A CG    1 
ATOM   2236 O  OD1   . ASN A 1 284 ? 12.735  139.763 16.300  1.00 36.90  ? 325 ASN A OD1   1 
ATOM   2237 N  ND2   . ASN A 1 284 ? 14.697  139.909 15.221  1.00 30.82  ? 325 ASN A ND2   1 
ATOM   2238 N  N     . ASP A 1 285 ? 11.475  138.627 11.114  1.00 27.90  ? 326 ASP A N     1 
ATOM   2239 C  CA    . ASP A 1 285 ? 10.558  138.874 10.003  1.00 25.53  ? 326 ASP A CA    1 
ATOM   2240 C  C     . ASP A 1 285 ? 9.713   137.651 9.658   1.00 24.16  ? 326 ASP A C     1 
ATOM   2241 O  O     . ASP A 1 285 ? 8.529   137.777 9.345   1.00 29.54  ? 326 ASP A O     1 
ATOM   2242 C  CB    . ASP A 1 285 ? 11.331  139.337 8.765   1.00 25.25  ? 326 ASP A CB    1 
ATOM   2243 C  CG    . ASP A 1 285 ? 11.988  140.689 8.963   1.00 28.78  ? 326 ASP A CG    1 
ATOM   2244 O  OD1   . ASP A 1 285 ? 11.534  141.443 9.850   1.00 31.43  ? 326 ASP A OD1   1 
ATOM   2245 O  OD2   . ASP A 1 285 ? 12.958  140.998 8.237   1.00 29.39  ? 326 ASP A OD2   1 
ATOM   2246 N  N     . TYR A 1 286 ? 10.321  136.471 9.711   1.00 28.89  ? 327 TYR A N     1 
ATOM   2247 C  CA    . TYR A 1 286 ? 9.616   135.239 9.367   1.00 25.59  ? 327 TYR A CA    1 
ATOM   2248 C  C     . TYR A 1 286 ? 8.948   134.648 10.600  1.00 27.45  ? 327 TYR A C     1 
ATOM   2249 O  O     . TYR A 1 286 ? 9.401   133.639 11.142  1.00 25.71  ? 327 TYR A O     1 
ATOM   2250 C  CB    . TYR A 1 286 ? 10.571  134.219 8.744   1.00 23.16  ? 327 TYR A CB    1 
ATOM   2251 C  CG    . TYR A 1 286 ? 9.927   133.326 7.703   1.00 21.76  ? 327 TYR A CG    1 
ATOM   2252 C  CD1   . TYR A 1 286 ? 8.550   133.325 7.509   1.00 21.89  ? 327 TYR A CD1   1 
ATOM   2253 C  CD2   . TYR A 1 286 ? 10.699  132.489 6.907   1.00 23.09  ? 327 TYR A CD2   1 
ATOM   2254 C  CE1   . TYR A 1 286 ? 7.962   132.513 6.553   1.00 25.69  ? 327 TYR A CE1   1 
ATOM   2255 C  CE2   . TYR A 1 286 ? 10.118  131.673 5.949   1.00 19.12  ? 327 TYR A CE2   1 
ATOM   2256 C  CZ    . TYR A 1 286 ? 8.751   131.689 5.776   1.00 27.10  ? 327 TYR A CZ    1 
ATOM   2257 O  OH    . TYR A 1 286 ? 8.172   130.878 4.825   1.00 21.51  ? 327 TYR A OH    1 
ATOM   2258 N  N     . LYS A 1 287 ? 7.865   135.289 11.029  1.00 29.63  ? 328 LYS A N     1 
ATOM   2259 C  CA    . LYS A 1 287 ? 7.140   134.901 12.235  1.00 33.33  ? 328 LYS A CA    1 
ATOM   2260 C  C     . LYS A 1 287 ? 6.579   133.486 12.143  1.00 30.55  ? 328 LYS A C     1 
ATOM   2261 O  O     . LYS A 1 287 ? 6.464   132.792 13.152  1.00 30.66  ? 328 LYS A O     1 
ATOM   2262 C  CB    . LYS A 1 287 ? 6.000   135.887 12.506  1.00 39.64  ? 328 LYS A CB    1 
ATOM   2263 C  CG    . LYS A 1 287 ? 6.419   137.348 12.543  1.00 42.37  ? 328 LYS A CG    1 
ATOM   2264 C  CD    . LYS A 1 287 ? 6.604   137.838 13.970  1.00 48.37  ? 328 LYS A CD    1 
ATOM   2265 C  CE    . LYS A 1 287 ? 6.943   139.320 14.000  1.00 47.91  ? 328 LYS A CE    1 
ATOM   2266 N  NZ    . LYS A 1 287 ? 7.073   139.813 15.396  1.00 53.66  ? 328 LYS A NZ    1 
ATOM   2267 N  N     . THR A 1 288 ? 6.227   133.067 10.932  1.00 26.12  ? 329 THR A N     1 
ATOM   2268 C  CA    . THR A 1 288 ? 5.653   131.743 10.705  1.00 27.40  ? 329 THR A CA    1 
ATOM   2269 C  C     . THR A 1 288 ? 6.611   130.623 11.106  1.00 25.83  ? 329 THR A C     1 
ATOM   2270 O  O     . THR A 1 288 ? 6.202   129.625 11.699  1.00 26.59  ? 329 THR A O     1 
ATOM   2271 C  CB    . THR A 1 288 ? 5.257   131.557 9.226   1.00 29.43  ? 329 THR A CB    1 
ATOM   2272 O  OG1   . THR A 1 288 ? 4.314   132.569 8.855   1.00 29.54  ? 329 THR A OG1   1 
ATOM   2273 C  CG2   . THR A 1 288 ? 4.640   130.182 8.994   1.00 23.79  ? 329 THR A CG2   1 
ATOM   2274 N  N     . MET A 1 289 ? 7.889   130.799 10.789  1.00 21.94  ? 330 MET A N     1 
ATOM   2275 C  CA    . MET A 1 289 ? 8.882   129.758 11.029  1.00 25.49  ? 330 MET A CA    1 
ATOM   2276 C  C     . MET A 1 289 ? 9.600   129.915 12.364  1.00 26.98  ? 330 MET A C     1 
ATOM   2277 O  O     . MET A 1 289 ? 9.866   128.927 13.047  1.00 28.61  ? 330 MET A O     1 
ATOM   2278 C  CB    . MET A 1 289 ? 9.914   129.738 9.897   1.00 24.79  ? 330 MET A CB    1 
ATOM   2279 C  CG    . MET A 1 289 ? 9.327   129.419 8.532   1.00 27.49  ? 330 MET A CG    1 
ATOM   2280 S  SD    . MET A 1 289 ? 8.512   127.816 8.489   1.00 27.72  ? 330 MET A SD    1 
ATOM   2281 C  CE    . MET A 1 289 ? 7.942   127.779 6.791   1.00 31.58  ? 330 MET A CE    1 
ATOM   2282 N  N     . PHE A 1 290 ? 9.919   131.152 12.730  1.00 23.82  ? 331 PHE A N     1 
ATOM   2283 C  CA    . PHE A 1 290 ? 10.760  131.401 13.895  1.00 25.31  ? 331 PHE A CA    1 
ATOM   2284 C  C     . PHE A 1 290 ? 9.965   131.913 15.092  1.00 30.00  ? 331 PHE A C     1 
ATOM   2285 O  O     . PHE A 1 290 ? 9.064   132.740 14.956  1.00 27.80  ? 331 PHE A O     1 
ATOM   2286 C  CB    . PHE A 1 290 ? 11.873  132.383 13.534  1.00 25.64  ? 331 PHE A CB    1 
ATOM   2287 C  CG    . PHE A 1 290 ? 12.688  131.953 12.349  1.00 26.87  ? 331 PHE A CG    1 
ATOM   2288 C  CD1   . PHE A 1 290 ? 13.408  130.770 12.384  1.00 24.68  ? 331 PHE A CD1   1 
ATOM   2289 C  CD2   . PHE A 1 290 ? 12.730  132.723 11.198  1.00 22.91  ? 331 PHE A CD2   1 
ATOM   2290 C  CE1   . PHE A 1 290 ? 14.157  130.362 11.295  1.00 23.83  ? 331 PHE A CE1   1 
ATOM   2291 C  CE2   . PHE A 1 290 ? 13.479  132.323 10.105  1.00 24.33  ? 331 PHE A CE2   1 
ATOM   2292 C  CZ    . PHE A 1 290 ? 14.193  131.140 10.154  1.00 27.55  ? 331 PHE A CZ    1 
ATOM   2293 N  N     . MET A 1 291 ? 10.320  131.411 16.269  1.00 31.65  ? 332 MET A N     1 
ATOM   2294 C  CA    . MET A 1 291 ? 9.570   131.676 17.487  1.00 34.37  ? 332 MET A CA    1 
ATOM   2295 C  C     . MET A 1 291 ? 10.463  132.291 18.558  1.00 28.55  ? 332 MET A C     1 
ATOM   2296 O  O     . MET A 1 291 ? 11.387  131.643 19.048  1.00 26.62  ? 332 MET A O     1 
ATOM   2297 C  CB    . MET A 1 291 ? 8.944   130.376 17.993  1.00 35.16  ? 332 MET A CB    1 
ATOM   2298 C  CG    . MET A 1 291 ? 7.932   130.537 19.103  1.00 36.09  ? 332 MET A CG    1 
ATOM   2299 S  SD    . MET A 1 291 ? 7.139   128.964 19.486  1.00 40.92  ? 332 MET A SD    1 
ATOM   2300 C  CE    . MET A 1 291 ? 6.038   129.452 20.813  1.00 37.80  ? 332 MET A CE    1 
ATOM   2301 N  N     . SER A 1 292 ? 10.194  133.543 18.915  1.00 28.01  ? 333 SER A N     1 
ATOM   2302 C  CA    . SER A 1 292 ? 10.974  134.210 19.950  1.00 31.72  ? 333 SER A CA    1 
ATOM   2303 C  C     . SER A 1 292 ? 10.596  133.700 21.335  1.00 29.04  ? 333 SER A C     1 
ATOM   2304 O  O     . SER A 1 292 ? 9.480   133.227 21.549  1.00 28.19  ? 333 SER A O     1 
ATOM   2305 C  CB    . SER A 1 292 ? 10.783  135.724 19.885  1.00 35.85  ? 333 SER A CB    1 
ATOM   2306 O  OG    . SER A 1 292 ? 11.470  136.358 20.949  1.00 35.30  ? 333 SER A OG    1 
ATOM   2307 N  N     . GLY A 1 293 ? 11.531  133.801 22.274  1.00 28.64  ? 334 GLY A N     1 
ATOM   2308 C  CA    . GLY A 1 293 ? 11.293  133.358 23.635  1.00 32.64  ? 334 GLY A CA    1 
ATOM   2309 C  C     . GLY A 1 293 ? 10.260  134.201 24.357  1.00 34.52  ? 334 GLY A C     1 
ATOM   2310 O  O     . GLY A 1 293 ? 9.686   133.768 25.355  1.00 29.38  ? 334 GLY A O     1 
ATOM   2311 N  N     . LYS A 1 294 ? 10.021  135.405 23.846  1.00 34.09  ? 335 LYS A N     1 
ATOM   2312 C  CA    . LYS A 1 294 ? 9.076   136.333 24.454  1.00 33.25  ? 335 LYS A CA    1 
ATOM   2313 C  C     . LYS A 1 294 ? 7.652   135.793 24.410  1.00 34.49  ? 335 LYS A C     1 
ATOM   2314 O  O     . LYS A 1 294 ? 6.814   136.168 25.230  1.00 35.38  ? 335 LYS A O     1 
ATOM   2315 C  CB    . LYS A 1 294 ? 9.140   137.689 23.750  1.00 39.61  ? 335 LYS A CB    1 
ATOM   2316 C  CG    . LYS A 1 294 ? 8.734   137.641 22.283  1.00 41.12  ? 335 LYS A CG    1 
ATOM   2317 C  CD    . LYS A 1 294 ? 9.019   138.959 21.578  1.00 49.02  ? 335 LYS A CD    1 
ATOM   2318 C  CE    . LYS A 1 294 ? 8.719   138.868 20.086  1.00 51.28  ? 335 LYS A CE    1 
ATOM   2319 N  NZ    . LYS A 1 294 ? 9.072   140.123 19.362  1.00 54.41  ? 335 LYS A NZ    1 
ATOM   2320 N  N     . GLU A 1 295 ? 7.386   134.908 23.454  1.00 29.87  ? 336 GLU A N     1 
ATOM   2321 C  CA    . GLU A 1 295 ? 6.046   134.361 23.275  1.00 29.46  ? 336 GLU A CA    1 
ATOM   2322 C  C     . GLU A 1 295 ? 5.678   133.382 24.385  1.00 29.25  ? 336 GLU A C     1 
ATOM   2323 O  O     . GLU A 1 295 ? 4.509   133.035 24.551  1.00 31.97  ? 336 GLU A O     1 
ATOM   2324 C  CB    . GLU A 1 295 ? 5.926   133.681 21.910  1.00 31.85  ? 336 GLU A CB    1 
ATOM   2325 C  CG    . GLU A 1 295 ? 6.191   134.620 20.748  1.00 33.68  ? 336 GLU A CG    1 
ATOM   2326 C  CD    . GLU A 1 295 ? 6.053   133.943 19.401  1.00 35.97  ? 336 GLU A CD    1 
ATOM   2327 O  OE1   . GLU A 1 295 ? 5.303   132.950 19.299  1.00 34.52  ? 336 GLU A OE1   1 
ATOM   2328 O  OE2   . GLU A 1 295 ? 6.704   134.405 18.442  1.00 40.46  ? 336 GLU A OE2   1 
ATOM   2329 N  N     . ILE A 1 296 ? 6.679   132.941 25.141  1.00 27.66  ? 337 ILE A N     1 
ATOM   2330 C  CA    . ILE A 1 296 ? 6.444   132.075 26.293  1.00 31.41  ? 337 ILE A CA    1 
ATOM   2331 C  C     . ILE A 1 296 ? 7.061   132.676 27.557  1.00 33.89  ? 337 ILE A C     1 
ATOM   2332 O  O     . ILE A 1 296 ? 7.480   131.951 28.462  1.00 30.80  ? 337 ILE A O     1 
ATOM   2333 C  CB    . ILE A 1 296 ? 7.010   130.658 26.069  1.00 29.38  ? 337 ILE A CB    1 
ATOM   2334 C  CG1   . ILE A 1 296 ? 8.508   130.716 25.774  1.00 26.83  ? 337 ILE A CG1   1 
ATOM   2335 C  CG2   . ILE A 1 296 ? 6.277   129.964 24.933  1.00 32.32  ? 337 ILE A CG2   1 
ATOM   2336 C  CD1   . ILE A 1 296 ? 9.177   129.365 25.793  1.00 33.94  ? 337 ILE A CD1   1 
ATOM   2337 N  N     . LYS A 1 297 ? 7.115   134.007 27.595  1.00 31.13  ? 338 LYS A N     1 
ATOM   2338 C  CA    . LYS A 1 297 ? 7.592   134.758 28.757  1.00 36.10  ? 338 LYS A CA    1 
ATOM   2339 C  C     . LYS A 1 297 ? 9.054   134.492 29.092  1.00 33.64  ? 338 LYS A C     1 
ATOM   2340 O  O     . LYS A 1 297 ? 9.451   134.577 30.253  1.00 31.59  ? 338 LYS A O     1 
ATOM   2341 C  CB    . LYS A 1 297 ? 6.733   134.449 29.986  1.00 27.73  ? 338 LYS A CB    1 
ATOM   2342 C  CG    . LYS A 1 297 ? 5.292   134.893 29.878  1.00 31.91  ? 338 LYS A CG    1 
ATOM   2343 C  CD    . LYS A 1 297 ? 4.510   134.402 31.080  1.00 37.52  ? 338 LYS A CD    1 
ATOM   2344 C  CE    . LYS A 1 297 ? 3.392   135.356 31.440  1.00 37.89  ? 338 LYS A CE    1 
ATOM   2345 N  NZ    . LYS A 1 297 ? 2.813   135.013 32.765  1.00 33.52  ? 338 LYS A NZ    1 
ATOM   2346 N  N     . LYS A 1 298 ? 9.855   134.168 28.083  1.00 32.28  ? 339 LYS A N     1 
ATOM   2347 C  CA    . LYS A 1 298 ? 11.287  133.989 28.295  1.00 27.04  ? 339 LYS A CA    1 
ATOM   2348 C  C     . LYS A 1 298 ? 12.077  135.058 27.546  1.00 28.60  ? 339 LYS A C     1 
ATOM   2349 O  O     . LYS A 1 298 ? 11.490  135.957 26.944  1.00 31.03  ? 339 LYS A O     1 
ATOM   2350 C  CB    . LYS A 1 298 ? 11.727  132.586 27.869  1.00 32.88  ? 339 LYS A CB    1 
ATOM   2351 C  CG    . LYS A 1 298 ? 11.237  131.489 28.808  1.00 33.15  ? 339 LYS A CG    1 
ATOM   2352 C  CD    . LYS A 1 298 ? 11.854  130.140 28.481  1.00 37.78  ? 339 LYS A CD    1 
ATOM   2353 C  CE    . LYS A 1 298 ? 11.443  129.090 29.502  1.00 43.50  ? 339 LYS A CE    1 
ATOM   2354 N  NZ    . LYS A 1 298 ? 11.865  129.458 30.884  1.00 44.34  ? 339 LYS A NZ    1 
ATOM   2355 N  N     . LYS A 1 299 ? 13.403  134.957 27.598  1.00 28.71  ? 340 LYS A N     1 
ATOM   2356 C  CA    . LYS A 1 299 ? 14.289  135.956 27.001  1.00 35.59  ? 340 LYS A CA    1 
ATOM   2357 C  C     . LYS A 1 299 ? 13.971  136.174 25.521  1.00 40.47  ? 340 LYS A C     1 
ATOM   2358 O  O     . LYS A 1 299 ? 13.768  135.218 24.771  1.00 34.70  ? 340 LYS A O     1 
ATOM   2359 C  CB    . LYS A 1 299 ? 15.751  135.538 27.174  1.00 37.33  ? 340 LYS A CB    1 
ATOM   2360 C  CG    . LYS A 1 299 ? 16.710  136.695 27.427  1.00 50.28  ? 340 LYS A CG    1 
ATOM   2361 C  CD    . LYS A 1 299 ? 16.661  137.164 28.877  1.00 54.97  ? 340 LYS A CD    1 
ATOM   2362 C  CE    . LYS A 1 299 ? 17.730  138.212 29.171  1.00 51.79  ? 340 LYS A CE    1 
ATOM   2363 N  NZ    . LYS A 1 299 ? 17.490  139.487 28.439  1.00 55.04  ? 340 LYS A NZ    1 
ATOM   2364 N  N     . LYS A 1 300 ? 13.926  137.438 25.110  1.00 39.36  ? 341 LYS A N     1 
ATOM   2365 C  CA    . LYS A 1 300 ? 13.461  137.800 23.773  1.00 38.18  ? 341 LYS A CA    1 
ATOM   2366 C  C     . LYS A 1 300 ? 14.392  137.332 22.655  1.00 36.89  ? 341 LYS A C     1 
ATOM   2367 O  O     . LYS A 1 300 ? 13.930  137.000 21.563  1.00 34.80  ? 341 LYS A O     1 
ATOM   2368 C  CB    . LYS A 1 300 ? 13.264  139.316 23.679  1.00 39.30  ? 341 LYS A CB    1 
ATOM   2369 C  CG    . LYS A 1 300 ? 14.499  140.128 24.031  1.00 46.28  ? 341 LYS A CG    1 
ATOM   2370 C  CD    . LYS A 1 300 ? 14.175  141.607 24.158  1.00 51.36  ? 341 LYS A CD    1 
ATOM   2371 C  CE    . LYS A 1 300 ? 13.618  142.168 22.861  1.00 61.61  ? 341 LYS A CE    1 
ATOM   2372 N  NZ    . LYS A 1 300 ? 13.336  143.627 22.970  1.00 66.83  ? 341 LYS A NZ    1 
ATOM   2373 N  N     . HIS A 1 301 ? 15.695  137.301 22.918  1.00 31.33  ? 342 HIS A N     1 
ATOM   2374 C  CA    . HIS A 1 301 ? 16.651  136.948 21.873  1.00 38.66  ? 342 HIS A CA    1 
ATOM   2375 C  C     . HIS A 1 301 ? 16.897  135.442 21.795  1.00 38.75  ? 342 HIS A C     1 
ATOM   2376 O  O     . HIS A 1 301 ? 17.824  134.990 21.122  1.00 36.05  ? 342 HIS A O     1 
ATOM   2377 C  CB    . HIS A 1 301 ? 17.972  137.696 22.075  1.00 39.35  ? 342 HIS A CB    1 
ATOM   2378 C  CG    . HIS A 1 301 ? 18.624  137.442 23.398  1.00 50.85  ? 342 HIS A CG    1 
ATOM   2379 N  ND1   . HIS A 1 301 ? 18.499  138.303 24.468  1.00 56.42  ? 342 HIS A ND1   1 
ATOM   2380 C  CD2   . HIS A 1 301 ? 19.421  136.432 23.820  1.00 53.58  ? 342 HIS A CD2   1 
ATOM   2381 C  CE1   . HIS A 1 301 ? 19.187  137.832 25.493  1.00 53.84  ? 342 HIS A CE1   1 
ATOM   2382 N  NE2   . HIS A 1 301 ? 19.754  136.696 25.126  1.00 52.06  ? 342 HIS A NE2   1 
ATOM   2383 N  N     . LEU A 1 302 ? 16.063  134.671 22.485  1.00 34.98  ? 343 LEU A N     1 
ATOM   2384 C  CA    . LEU A 1 302 ? 16.023  133.227 22.294  1.00 33.73  ? 343 LEU A CA    1 
ATOM   2385 C  C     . LEU A 1 302 ? 15.065  132.912 21.155  1.00 29.66  ? 343 LEU A C     1 
ATOM   2386 O  O     . LEU A 1 302 ? 13.944  133.417 21.127  1.00 31.97  ? 343 LEU A O     1 
ATOM   2387 C  CB    . LEU A 1 302 ? 15.584  132.506 23.570  1.00 29.36  ? 343 LEU A CB    1 
ATOM   2388 C  CG    . LEU A 1 302 ? 16.587  132.424 24.720  1.00 33.02  ? 343 LEU A CG    1 
ATOM   2389 C  CD1   . LEU A 1 302 ? 15.969  131.693 25.904  1.00 29.57  ? 343 LEU A CD1   1 
ATOM   2390 C  CD2   . LEU A 1 302 ? 17.867  131.738 24.269  1.00 31.51  ? 343 LEU A CD2   1 
ATOM   2391 N  N     . PHE A 1 303 ? 15.508  132.085 20.214  1.00 25.02  ? 344 PHE A N     1 
ATOM   2392 C  CA    . PHE A 1 303 ? 14.683  131.739 19.063  1.00 25.88  ? 344 PHE A CA    1 
ATOM   2393 C  C     . PHE A 1 303 ? 14.656  130.238 18.800  1.00 26.43  ? 344 PHE A C     1 
ATOM   2394 O  O     . PHE A 1 303 ? 15.653  129.541 18.993  1.00 27.39  ? 344 PHE A O     1 
ATOM   2395 C  CB    . PHE A 1 303 ? 15.173  132.477 17.816  1.00 24.90  ? 344 PHE A CB    1 
ATOM   2396 C  CG    . PHE A 1 303 ? 14.699  133.899 17.731  1.00 25.01  ? 344 PHE A CG    1 
ATOM   2397 C  CD1   . PHE A 1 303 ? 13.478  134.199 17.149  1.00 24.79  ? 344 PHE A CD1   1 
ATOM   2398 C  CD2   . PHE A 1 303 ? 15.469  134.934 18.234  1.00 31.11  ? 344 PHE A CD2   1 
ATOM   2399 C  CE1   . PHE A 1 303 ? 13.035  135.506 17.068  1.00 30.94  ? 344 PHE A CE1   1 
ATOM   2400 C  CE2   . PHE A 1 303 ? 15.030  136.243 18.157  1.00 31.73  ? 344 PHE A CE2   1 
ATOM   2401 C  CZ    . PHE A 1 303 ? 13.813  136.529 17.574  1.00 31.12  ? 344 PHE A CZ    1 
ATOM   2402 N  N     . GLY A 1 304 ? 13.503  129.749 18.357  1.00 25.12  ? 345 GLY A N     1 
ATOM   2403 C  CA    . GLY A 1 304 ? 13.344  128.350 18.015  1.00 27.32  ? 345 GLY A CA    1 
ATOM   2404 C  C     . GLY A 1 304 ? 12.350  128.166 16.886  1.00 29.63  ? 345 GLY A C     1 
ATOM   2405 O  O     . GLY A 1 304 ? 11.555  129.061 16.593  1.00 30.19  ? 345 GLY A O     1 
ATOM   2406 N  N     . LEU A 1 305 ? 12.400  127.004 16.243  1.00 28.02  ? 346 LEU A N     1 
ATOM   2407 C  CA    . LEU A 1 305 ? 11.456  126.682 15.184  1.00 26.21  ? 346 LEU A CA    1 
ATOM   2408 C  C     . LEU A 1 305 ? 10.120  126.269 15.782  1.00 27.31  ? 346 LEU A C     1 
ATOM   2409 O  O     . LEU A 1 305 ? 10.077  125.512 16.751  1.00 30.08  ? 346 LEU A O     1 
ATOM   2410 C  CB    . LEU A 1 305 ? 12.001  125.565 14.291  1.00 26.05  ? 346 LEU A CB    1 
ATOM   2411 C  CG    . LEU A 1 305 ? 13.324  125.823 13.565  1.00 32.54  ? 346 LEU A CG    1 
ATOM   2412 C  CD1   . LEU A 1 305 ? 13.802  124.557 12.866  1.00 26.85  ? 346 LEU A CD1   1 
ATOM   2413 C  CD2   . LEU A 1 305 ? 13.196  126.977 12.571  1.00 25.08  ? 346 LEU A CD2   1 
ATOM   2414 N  N     . ARG A 1 306 ? 9.030   126.772 15.211  1.00 31.67  ? 347 ARG A N     1 
ATOM   2415 C  CA    . ARG A 1 306 ? 7.702   126.353 15.641  1.00 31.31  ? 347 ARG A CA    1 
ATOM   2416 C  C     . ARG A 1 306 ? 7.513   124.876 15.324  1.00 32.45  ? 347 ARG A C     1 
ATOM   2417 O  O     . ARG A 1 306 ? 6.960   124.122 16.124  1.00 36.45  ? 347 ARG A O     1 
ATOM   2418 C  CB    . ARG A 1 306 ? 6.611   127.185 14.966  1.00 33.53  ? 347 ARG A CB    1 
ATOM   2419 C  CG    . ARG A 1 306 ? 6.670   128.667 15.277  1.00 36.82  ? 347 ARG A CG    1 
ATOM   2420 C  CD    . ARG A 1 306 ? 5.420   129.380 14.791  1.00 26.63  ? 347 ARG A CD    1 
ATOM   2421 N  NE    . ARG A 1 306 ? 5.579   130.831 14.826  1.00 35.87  ? 347 ARG A NE    1 
ATOM   2422 C  CZ    . ARG A 1 306 ? 5.358   131.583 15.900  1.00 31.33  ? 347 ARG A CZ    1 
ATOM   2423 N  NH1   . ARG A 1 306 ? 4.966   131.021 17.035  1.00 28.05  ? 347 ARG A NH1   1 
ATOM   2424 N  NH2   . ARG A 1 306 ? 5.529   132.897 15.838  1.00 31.50  ? 347 ARG A NH2   1 
ATOM   2425 N  N     . ILE A 1 307 ? 7.974   124.477 14.143  1.00 32.68  ? 348 ILE A N     1 
ATOM   2426 C  CA    . ILE A 1 307 ? 7.949   123.081 13.725  1.00 31.41  ? 348 ILE A CA    1 
ATOM   2427 C  C     . ILE A 1 307 ? 9.365   122.638 13.378  1.00 30.97  ? 348 ILE A C     1 
ATOM   2428 O  O     . ILE A 1 307 ? 9.997   123.211 12.489  1.00 32.90  ? 348 ILE A O     1 
ATOM   2429 C  CB    . ILE A 1 307 ? 7.032   122.857 12.502  1.00 33.08  ? 348 ILE A CB    1 
ATOM   2430 C  CG1   . ILE A 1 307 ? 5.693   123.579 12.677  1.00 35.62  ? 348 ILE A CG1   1 
ATOM   2431 C  CG2   . ILE A 1 307 ? 6.818   121.371 12.262  1.00 32.78  ? 348 ILE A CG2   1 
ATOM   2432 C  CD1   . ILE A 1 307 ? 4.859   123.055 13.819  1.00 43.21  ? 348 ILE A CD1   1 
ATOM   2433 N  N     . ARG A 1 308 ? 9.867   121.625 14.076  1.00 25.93  ? 349 ARG A N     1 
ATOM   2434 C  CA    . ARG A 1 308 ? 11.228  121.155 13.836  1.00 29.05  ? 349 ARG A CA    1 
ATOM   2435 C  C     . ARG A 1 308 ? 11.326  120.372 12.527  1.00 31.43  ? 349 ARG A C     1 
ATOM   2436 O  O     . ARG A 1 308 ? 11.467  119.149 12.530  1.00 30.05  ? 349 ARG A O     1 
ATOM   2437 C  CB    . ARG A 1 308 ? 11.717  120.296 15.003  1.00 26.35  ? 349 ARG A CB    1 
ATOM   2438 C  CG    . ARG A 1 308 ? 13.221  120.051 14.991  1.00 30.65  ? 349 ARG A CG    1 
ATOM   2439 C  CD    . ARG A 1 308 ? 13.677  119.238 16.193  1.00 35.11  ? 349 ARG A CD    1 
ATOM   2440 N  NE    . ARG A 1 308 ? 13.299  119.867 17.456  1.00 47.25  ? 349 ARG A NE    1 
ATOM   2441 C  CZ    . ARG A 1 308 ? 13.739  119.479 18.648  1.00 49.96  ? 349 ARG A CZ    1 
ATOM   2442 N  NH1   . ARG A 1 308 ? 14.587  118.463 18.747  1.00 44.95  ? 349 ARG A NH1   1 
ATOM   2443 N  NH2   . ARG A 1 308 ? 13.336  120.112 19.742  1.00 42.22  ? 349 ARG A NH2   1 
ATOM   2444 N  N     . VAL A 1 309 ? 11.245  121.088 11.411  1.00 25.61  ? 350 VAL A N     1 
ATOM   2445 C  CA    . VAL A 1 309 ? 11.404  120.488 10.092  1.00 27.55  ? 350 VAL A CA    1 
ATOM   2446 C  C     . VAL A 1 309 ? 12.361  121.340 9.263   1.00 30.34  ? 350 VAL A C     1 
ATOM   2447 O  O     . VAL A 1 309 ? 12.487  122.542 9.501   1.00 25.10  ? 350 VAL A O     1 
ATOM   2448 C  CB    . VAL A 1 309 ? 10.049  120.341 9.357   1.00 30.37  ? 350 VAL A CB    1 
ATOM   2449 C  CG1   . VAL A 1 309 ? 9.168   119.311 10.057  1.00 27.52  ? 350 VAL A CG1   1 
ATOM   2450 C  CG2   . VAL A 1 309 ? 9.340   121.683 9.255   1.00 29.75  ? 350 VAL A CG2   1 
ATOM   2451 N  N     . PRO A 1 310 ? 13.060  120.717 8.301   1.00 25.10  ? 351 PRO A N     1 
ATOM   2452 C  CA    . PRO A 1 310 ? 13.988  121.452 7.435   1.00 25.17  ? 351 PRO A CA    1 
ATOM   2453 C  C     . PRO A 1 310 ? 13.297  122.536 6.605   1.00 25.10  ? 351 PRO A C     1 
ATOM   2454 O  O     . PRO A 1 310 ? 12.086  122.466 6.393   1.00 24.62  ? 351 PRO A O     1 
ATOM   2455 C  CB    . PRO A 1 310 ? 14.557  120.355 6.529   1.00 29.04  ? 351 PRO A CB    1 
ATOM   2456 C  CG    . PRO A 1 310 ? 14.404  119.101 7.315   1.00 29.26  ? 351 PRO A CG    1 
ATOM   2457 C  CD    . PRO A 1 310 ? 13.113  119.265 8.050   1.00 26.38  ? 351 PRO A CD    1 
ATOM   2458 N  N     . PRO A 1 311 ? 14.062  123.538 6.146   1.00 25.36  ? 352 PRO A N     1 
ATOM   2459 C  CA    . PRO A 1 311 ? 13.502  124.575 5.271   1.00 25.41  ? 352 PRO A CA    1 
ATOM   2460 C  C     . PRO A 1 311 ? 13.117  124.024 3.897   1.00 26.28  ? 352 PRO A C     1 
ATOM   2461 O  O     . PRO A 1 311 ? 13.686  123.030 3.447   1.00 23.21  ? 352 PRO A O     1 
ATOM   2462 C  CB    . PRO A 1 311 ? 14.643  125.591 5.155   1.00 24.92  ? 352 PRO A CB    1 
ATOM   2463 C  CG    . PRO A 1 311 ? 15.881  124.806 5.442   1.00 23.28  ? 352 PRO A CG    1 
ATOM   2464 C  CD    . PRO A 1 311 ? 15.482  123.778 6.454   1.00 23.63  ? 352 PRO A CD    1 
ATOM   2465 N  N     . VAL A 1 312 ? 12.152  124.665 3.245   1.00 28.25  ? 353 VAL A N     1 
ATOM   2466 C  CA    . VAL A 1 312 ? 11.692  124.226 1.932   1.00 26.83  ? 353 VAL A CA    1 
ATOM   2467 C  C     . VAL A 1 312 ? 12.593  124.761 0.825   1.00 24.65  ? 353 VAL A C     1 
ATOM   2468 O  O     . VAL A 1 312 ? 12.786  125.969 0.707   1.00 24.32  ? 353 VAL A O     1 
ATOM   2469 C  CB    . VAL A 1 312 ? 10.244  124.675 1.660   1.00 30.31  ? 353 VAL A CB    1 
ATOM   2470 C  CG1   . VAL A 1 312 ? 9.782   124.177 0.298   1.00 29.22  ? 353 VAL A CG1   1 
ATOM   2471 C  CG2   . VAL A 1 312 ? 9.318   124.177 2.757   1.00 31.00  ? 353 VAL A CG2   1 
ATOM   2472 N  N     . PRO A 1 313 ? 13.152  123.858 0.009   1.00 22.45  ? 354 PRO A N     1 
ATOM   2473 C  CA    . PRO A 1 313 ? 14.004  124.272 -1.111  1.00 23.70  ? 354 PRO A CA    1 
ATOM   2474 C  C     . PRO A 1 313 ? 13.182  124.904 -2.233  1.00 19.48  ? 354 PRO A C     1 
ATOM   2475 O  O     . PRO A 1 313 ? 12.000  124.596 -2.365  1.00 21.60  ? 354 PRO A O     1 
ATOM   2476 C  CB    . PRO A 1 313 ? 14.648  122.958 -1.562  1.00 20.01  ? 354 PRO A CB    1 
ATOM   2477 C  CG    . PRO A 1 313 ? 13.654  121.913 -1.184  1.00 24.67  ? 354 PRO A CG    1 
ATOM   2478 C  CD    . PRO A 1 313 ? 13.030  122.392 0.101   1.00 24.89  ? 354 PRO A CD    1 
ATOM   2479 N  N     . PRO A 1 314 ? 13.797  125.794 -3.025  1.00 23.22  ? 355 PRO A N     1 
ATOM   2480 C  CA    . PRO A 1 314 ? 13.084  126.441 -4.132  1.00 26.04  ? 355 PRO A CA    1 
ATOM   2481 C  C     . PRO A 1 314 ? 12.975  125.526 -5.348  1.00 25.69  ? 355 PRO A C     1 
ATOM   2482 O  O     . PRO A 1 314 ? 13.794  124.620 -5.494  1.00 27.75  ? 355 PRO A O     1 
ATOM   2483 C  CB    . PRO A 1 314 ? 13.959  127.658 -4.439  1.00 26.53  ? 355 PRO A CB    1 
ATOM   2484 C  CG    . PRO A 1 314 ? 15.338  127.208 -4.079  1.00 25.97  ? 355 PRO A CG    1 
ATOM   2485 C  CD    . PRO A 1 314 ? 15.180  126.286 -2.894  1.00 22.79  ? 355 PRO A CD    1 
ATOM   2486 N  N     . ASN A 1 315 ? 11.972  125.748 -6.195  1.00 32.52  ? 356 ASN A N     1 
ATOM   2487 C  CA    . ASN A 1 315 ? 11.876  125.034 -7.465  1.00 35.32  ? 356 ASN A CA    1 
ATOM   2488 C  C     . ASN A 1 315 ? 12.900  125.574 -8.454  1.00 33.66  ? 356 ASN A C     1 
ATOM   2489 O  O     . ASN A 1 315 ? 13.103  126.784 -8.541  1.00 42.33  ? 356 ASN A O     1 
ATOM   2490 C  CB    . ASN A 1 315 ? 10.467  125.146 -8.053  1.00 32.72  ? 356 ASN A CB    1 
ATOM   2491 C  CG    . ASN A 1 315 ? 9.442   124.361 -7.261  1.00 38.17  ? 356 ASN A CG    1 
ATOM   2492 O  OD1   . ASN A 1 315 ? 8.256   124.691 -7.255  1.00 54.58  ? 356 ASN A OD1   1 
ATOM   2493 N  ND2   . ASN A 1 315 ? 9.899   123.315 -6.582  1.00 43.96  ? 356 ASN A ND2   1 
ATOM   2494 N  N     . VAL A 1 316 ? 13.548  124.678 -9.192  1.00 41.91  ? 357 VAL A N     1 
ATOM   2495 C  CA    . VAL A 1 316 ? 14.580  125.080 -10.143 1.00 41.56  ? 357 VAL A CA    1 
ATOM   2496 C  C     . VAL A 1 316 ? 13.964  125.500 -11.472 1.00 48.19  ? 357 VAL A C     1 
ATOM   2497 O  O     . VAL A 1 316 ? 13.361  126.567 -11.576 1.00 52.95  ? 357 VAL A O     1 
ATOM   2498 C  CB    . VAL A 1 316 ? 15.597  123.950 -10.389 1.00 48.35  ? 357 VAL A CB    1 
ATOM   2499 C  CG1   . VAL A 1 316 ? 15.647  123.026 -9.188  1.00 42.80  ? 357 VAL A CG1   1 
ATOM   2500 C  CG2   . VAL A 1 316 ? 15.243  123.168 -11.649 1.00 57.96  ? 357 VAL A CG2   1 
ATOM   2501 N  N     . LYS B 1 4   ? -23.821 113.049 -16.095 1.00 81.21  ? 45  LYS B N     1 
ATOM   2502 C  CA    . LYS B 1 4   ? -23.927 112.354 -14.818 1.00 73.86  ? 45  LYS B CA    1 
ATOM   2503 C  C     . LYS B 1 4   ? -24.214 110.869 -15.032 1.00 76.59  ? 45  LYS B C     1 
ATOM   2504 O  O     . LYS B 1 4   ? -24.871 110.487 -16.001 1.00 75.21  ? 45  LYS B O     1 
ATOM   2505 C  CB    . LYS B 1 4   ? -25.023 112.984 -13.950 1.00 73.86  ? 45  LYS B CB    1 
ATOM   2506 C  CG    . LYS B 1 4   ? -24.712 112.998 -12.455 1.00 73.60  ? 45  LYS B CG    1 
ATOM   2507 C  CD    . LYS B 1 4   ? -25.894 113.519 -11.647 1.00 76.53  ? 45  LYS B CD    1 
ATOM   2508 C  CE    . LYS B 1 4   ? -25.520 113.718 -10.183 1.00 84.75  ? 45  LYS B CE    1 
ATOM   2509 N  NZ    . LYS B 1 4   ? -26.697 114.112 -9.355  1.00 86.27  ? 45  LYS B NZ    1 
ATOM   2510 N  N     . PHE B 1 5   ? -23.704 110.036 -14.130 1.00 75.04  ? 46  PHE B N     1 
ATOM   2511 C  CA    . PHE B 1 5   ? -24.001 108.608 -14.150 1.00 68.79  ? 46  PHE B CA    1 
ATOM   2512 C  C     . PHE B 1 5   ? -25.018 108.276 -13.066 1.00 69.67  ? 46  PHE B C     1 
ATOM   2513 O  O     . PHE B 1 5   ? -25.421 109.148 -12.297 1.00 70.35  ? 46  PHE B O     1 
ATOM   2514 C  CB    . PHE B 1 5   ? -22.734 107.774 -13.942 1.00 64.20  ? 46  PHE B CB    1 
ATOM   2515 C  CG    . PHE B 1 5   ? -21.609 108.121 -14.875 1.00 66.02  ? 46  PHE B CG    1 
ATOM   2516 C  CD1   . PHE B 1 5   ? -21.648 107.738 -16.205 1.00 60.14  ? 46  PHE B CD1   1 
ATOM   2517 C  CD2   . PHE B 1 5   ? -20.501 108.813 -14.415 1.00 64.84  ? 46  PHE B CD2   1 
ATOM   2518 C  CE1   . PHE B 1 5   ? -20.608 108.052 -17.062 1.00 60.17  ? 46  PHE B CE1   1 
ATOM   2519 C  CE2   . PHE B 1 5   ? -19.460 109.129 -15.267 1.00 62.76  ? 46  PHE B CE2   1 
ATOM   2520 C  CZ    . PHE B 1 5   ? -19.514 108.748 -16.591 1.00 61.42  ? 46  PHE B CZ    1 
ATOM   2521 N  N     . GLU B 1 6   ? -25.427 107.013 -13.008 1.00 66.96  ? 47  GLU B N     1 
ATOM   2522 C  CA    . GLU B 1 6   ? -26.287 106.535 -11.930 1.00 64.41  ? 47  GLU B CA    1 
ATOM   2523 C  C     . GLU B 1 6   ? -26.163 105.023 -11.779 1.00 60.70  ? 47  GLU B C     1 
ATOM   2524 O  O     . GLU B 1 6   ? -25.936 104.308 -12.755 1.00 61.19  ? 47  GLU B O     1 
ATOM   2525 C  CB    . GLU B 1 6   ? -27.745 106.932 -12.174 1.00 66.90  ? 47  GLU B CB    1 
ATOM   2526 C  CG    . GLU B 1 6   ? -28.325 106.443 -13.488 1.00 70.07  ? 47  GLU B CG    1 
ATOM   2527 C  CD    . GLU B 1 6   ? -29.769 106.869 -13.674 1.00 77.46  ? 47  GLU B CD    1 
ATOM   2528 O  OE1   . GLU B 1 6   ? -30.338 107.470 -12.737 1.00 79.50  ? 47  GLU B OE1   1 
ATOM   2529 O  OE2   . GLU B 1 6   ? -30.335 106.606 -14.755 1.00 80.74  ? 47  GLU B OE2   1 
ATOM   2530 N  N     . GLU B 1 7   ? -26.309 104.545 -10.548 1.00 57.56  ? 48  GLU B N     1 
ATOM   2531 C  CA    . GLU B 1 7   ? -26.129 103.131 -10.245 1.00 58.30  ? 48  GLU B CA    1 
ATOM   2532 C  C     . GLU B 1 7   ? -27.161 102.264 -10.962 1.00 56.23  ? 48  GLU B C     1 
ATOM   2533 O  O     . GLU B 1 7   ? -28.364 102.510 -10.873 1.00 56.85  ? 48  GLU B O     1 
ATOM   2534 C  CB    . GLU B 1 7   ? -26.203 102.904 -8.733  1.00 55.07  ? 48  GLU B CB    1 
ATOM   2535 C  CG    . GLU B 1 7   ? -25.379 103.900 -7.927  1.00 60.20  ? 48  GLU B CG    1 
ATOM   2536 C  CD    . GLU B 1 7   ? -25.388 103.604 -6.439  1.00 69.07  ? 48  GLU B CD    1 
ATOM   2537 O  OE1   . GLU B 1 7   ? -25.225 102.423 -6.067  1.00 70.28  ? 48  GLU B OE1   1 
ATOM   2538 O  OE2   . GLU B 1 7   ? -25.562 104.551 -5.642  1.00 73.02  ? 48  GLU B OE2   1 
ATOM   2539 N  N     . GLY B 1 8   ? -26.679 101.254 -11.679 1.00 51.74  ? 49  GLY B N     1 
ATOM   2540 C  CA    . GLY B 1 8   ? -27.549 100.345 -12.402 1.00 45.46  ? 49  GLY B CA    1 
ATOM   2541 C  C     . GLY B 1 8   ? -27.619 100.639 -13.888 1.00 50.14  ? 49  GLY B C     1 
ATOM   2542 O  O     . GLY B 1 8   ? -28.318 99.953  -14.633 1.00 52.20  ? 49  GLY B O     1 
ATOM   2543 N  N     . GLN B 1 9   ? -26.885 101.660 -14.320 1.00 50.29  ? 50  GLN B N     1 
ATOM   2544 C  CA    . GLN B 1 9   ? -26.905 102.084 -15.716 1.00 51.41  ? 50  GLN B CA    1 
ATOM   2545 C  C     . GLN B 1 9   ? -26.008 101.217 -16.597 1.00 45.83  ? 50  GLN B C     1 
ATOM   2546 O  O     . GLN B 1 9   ? -24.894 100.862 -16.209 1.00 50.65  ? 50  GLN B O     1 
ATOM   2547 C  CB    . GLN B 1 9   ? -26.480 103.550 -15.827 1.00 49.84  ? 50  GLN B CB    1 
ATOM   2548 C  CG    . GLN B 1 9   ? -26.435 104.084 -17.250 1.00 49.46  ? 50  GLN B CG    1 
ATOM   2549 C  CD    . GLN B 1 9   ? -25.917 105.507 -17.323 1.00 53.41  ? 50  GLN B CD    1 
ATOM   2550 O  OE1   . GLN B 1 9   ? -25.542 106.099 -16.310 1.00 57.89  ? 50  GLN B OE1   1 
ATOM   2551 N  NE2   . GLN B 1 9   ? -25.894 106.065 -18.528 1.00 50.68  ? 50  GLN B NE2   1 
ATOM   2552 N  N     . ASP B 1 10  ? -26.505 100.875 -17.781 1.00 48.67  ? 51  ASP B N     1 
ATOM   2553 C  CA    . ASP B 1 10  ? -25.706 100.159 -18.768 1.00 50.42  ? 51  ASP B CA    1 
ATOM   2554 C  C     . ASP B 1 10  ? -24.753 101.115 -19.466 1.00 51.18  ? 51  ASP B C     1 
ATOM   2555 O  O     . ASP B 1 10  ? -25.167 102.167 -19.951 1.00 49.21  ? 51  ASP B O     1 
ATOM   2556 C  CB    . ASP B 1 10  ? -26.603 99.469  -19.794 1.00 52.66  ? 51  ASP B CB    1 
ATOM   2557 C  CG    . ASP B 1 10  ? -27.114 98.128  -19.312 1.00 64.41  ? 51  ASP B CG    1 
ATOM   2558 O  OD1   . ASP B 1 10  ? -27.038 97.862  -18.094 1.00 63.45  ? 51  ASP B OD1   1 
ATOM   2559 O  OD2   . ASP B 1 10  ? -27.591 97.337  -20.153 1.00 71.43  ? 51  ASP B OD2   1 
ATOM   2560 N  N     . VAL B 1 11  ? -23.475 100.749 -19.508 1.00 48.37  ? 52  VAL B N     1 
ATOM   2561 C  CA    . VAL B 1 11  ? -22.457 101.586 -20.135 1.00 47.18  ? 52  VAL B CA    1 
ATOM   2562 C  C     . VAL B 1 11  ? -21.443 100.770 -20.929 1.00 47.17  ? 52  VAL B C     1 
ATOM   2563 O  O     . VAL B 1 11  ? -21.410 99.542  -20.847 1.00 43.61  ? 52  VAL B O     1 
ATOM   2564 C  CB    . VAL B 1 11  ? -21.677 102.421 -19.093 1.00 45.75  ? 52  VAL B CB    1 
ATOM   2565 C  CG1   . VAL B 1 11  ? -22.566 103.487 -18.470 1.00 47.42  ? 52  VAL B CG1   1 
ATOM   2566 C  CG2   . VAL B 1 11  ? -21.072 101.516 -18.027 1.00 46.60  ? 52  VAL B CG2   1 
ATOM   2567 N  N     . LEU B 1 12  ? -20.620 101.474 -21.700 1.00 44.27  ? 53  LEU B N     1 
ATOM   2568 C  CA    . LEU B 1 12  ? -19.465 100.876 -22.356 1.00 42.47  ? 53  LEU B CA    1 
ATOM   2569 C  C     . LEU B 1 12  ? -18.194 101.364 -21.673 1.00 44.60  ? 53  LEU B C     1 
ATOM   2570 O  O     . LEU B 1 12  ? -17.945 102.568 -21.598 1.00 45.67  ? 53  LEU B O     1 
ATOM   2571 C  CB    . LEU B 1 12  ? -19.435 101.222 -23.846 1.00 47.39  ? 53  LEU B CB    1 
ATOM   2572 C  CG    . LEU B 1 12  ? -20.305 100.373 -24.772 1.00 48.70  ? 53  LEU B CG    1 
ATOM   2573 C  CD1   . LEU B 1 12  ? -20.189 100.864 -26.205 1.00 41.38  ? 53  LEU B CD1   1 
ATOM   2574 C  CD2   . LEU B 1 12  ? -19.906 98.909  -24.670 1.00 43.68  ? 53  LEU B CD2   1 
ATOM   2575 N  N     . ALA B 1 13  ? -17.396 100.430 -21.170 1.00 41.97  ? 54  ALA B N     1 
ATOM   2576 C  CA    . ALA B 1 13  ? -16.186 100.781 -20.436 1.00 40.52  ? 54  ALA B CA    1 
ATOM   2577 C  C     . ALA B 1 13  ? -14.932 100.322 -21.169 1.00 38.27  ? 54  ALA B C     1 
ATOM   2578 O  O     . ALA B 1 13  ? -14.802 99.149  -21.522 1.00 34.30  ? 54  ALA B O     1 
ATOM   2579 C  CB    . ALA B 1 13  ? -16.228 100.184 -19.040 1.00 34.89  ? 54  ALA B CB    1 
ATOM   2580 N  N     . ARG B 1 14  ? -14.007 101.252 -21.391 1.00 35.72  ? 55  ARG B N     1 
ATOM   2581 C  CA    . ARG B 1 14  ? -12.744 100.920 -22.037 1.00 37.40  ? 55  ARG B CA    1 
ATOM   2582 C  C     . ARG B 1 14  ? -11.774 100.300 -21.037 1.00 30.11  ? 55  ARG B C     1 
ATOM   2583 O  O     . ARG B 1 14  ? -11.466 100.895 -20.004 1.00 40.10  ? 55  ARG B O     1 
ATOM   2584 C  CB    . ARG B 1 14  ? -12.114 102.157 -22.679 1.00 34.89  ? 55  ARG B CB    1 
ATOM   2585 C  CG    . ARG B 1 14  ? -10.868 101.837 -23.492 1.00 34.18  ? 55  ARG B CG    1 
ATOM   2586 C  CD    . ARG B 1 14  ? -10.065 103.083 -23.835 1.00 32.55  ? 55  ARG B CD    1 
ATOM   2587 N  NE    . ARG B 1 14  ? -10.723 103.936 -24.821 1.00 42.64  ? 55  ARG B NE    1 
ATOM   2588 C  CZ    . ARG B 1 14  ? -11.038 105.212 -24.617 1.00 41.63  ? 55  ARG B CZ    1 
ATOM   2589 N  NH1   . ARG B 1 14  ? -10.755 105.793 -23.457 1.00 31.41  ? 55  ARG B NH1   1 
ATOM   2590 N  NH2   . ARG B 1 14  ? -11.634 105.908 -25.577 1.00 43.04  ? 55  ARG B NH2   1 
ATOM   2591 N  N     . TRP B 1 15  ? -11.298 99.101  -21.354 1.00 28.28  ? 56  TRP B N     1 
ATOM   2592 C  CA    . TRP B 1 15  ? -10.361 98.385  -20.497 1.00 27.96  ? 56  TRP B CA    1 
ATOM   2593 C  C     . TRP B 1 15  ? -8.926  98.815  -20.816 1.00 29.11  ? 56  TRP B C     1 
ATOM   2594 O  O     . TRP B 1 15  ? -8.696  99.598  -21.739 1.00 22.53  ? 56  TRP B O     1 
ATOM   2595 C  CB    . TRP B 1 15  ? -10.543 96.870  -20.668 1.00 27.78  ? 56  TRP B CB    1 
ATOM   2596 C  CG    . TRP B 1 15  ? -9.777  96.028  -19.687 1.00 29.22  ? 56  TRP B CG    1 
ATOM   2597 C  CD1   . TRP B 1 15  ? -8.776  95.145  -19.973 1.00 31.78  ? 56  TRP B CD1   1 
ATOM   2598 C  CD2   . TRP B 1 15  ? -9.940  96.002  -18.263 1.00 37.37  ? 56  TRP B CD2   1 
ATOM   2599 N  NE1   . TRP B 1 15  ? -8.311  94.566  -18.817 1.00 36.88  ? 56  TRP B NE1   1 
ATOM   2600 C  CE2   . TRP B 1 15  ? -9.008  95.075  -17.753 1.00 38.35  ? 56  TRP B CE2   1 
ATOM   2601 C  CE3   . TRP B 1 15  ? -10.784 96.670  -17.371 1.00 40.40  ? 56  TRP B CE3   1 
ATOM   2602 C  CZ2   . TRP B 1 15  ? -8.898  94.800  -16.391 1.00 45.39  ? 56  TRP B CZ2   1 
ATOM   2603 C  CZ3   . TRP B 1 15  ? -10.673 96.395  -16.019 1.00 41.33  ? 56  TRP B CZ3   1 
ATOM   2604 C  CH2   . TRP B 1 15  ? -9.737  95.468  -15.542 1.00 49.89  ? 56  TRP B CH2   1 
ATOM   2605 N  N     . SER B 1 16  ? -7.965  98.307  -20.051 1.00 24.72  ? 57  SER B N     1 
ATOM   2606 C  CA    . SER B 1 16  ? -6.566  98.684  -20.220 1.00 27.05  ? 57  SER B CA    1 
ATOM   2607 C  C     . SER B 1 16  ? -5.928  98.080  -21.473 1.00 31.17  ? 57  SER B C     1 
ATOM   2608 O  O     . SER B 1 16  ? -4.719  98.195  -21.675 1.00 28.52  ? 57  SER B O     1 
ATOM   2609 C  CB    . SER B 1 16  ? -5.764  98.282  -18.983 1.00 25.58  ? 57  SER B CB    1 
ATOM   2610 O  OG    . SER B 1 16  ? -6.035  96.942  -18.612 1.00 32.80  ? 57  SER B OG    1 
ATOM   2611 N  N     . ASP B 1 17  ? -6.737  97.440  -22.311 1.00 27.51  ? 58  ASP B N     1 
ATOM   2612 C  CA    . ASP B 1 17  ? -6.260  96.920  -23.589 1.00 24.45  ? 58  ASP B CA    1 
ATOM   2613 C  C     . ASP B 1 17  ? -6.754  97.786  -24.746 1.00 28.95  ? 58  ASP B C     1 
ATOM   2614 O  O     . ASP B 1 17  ? -6.547  97.457  -25.915 1.00 25.59  ? 58  ASP B O     1 
ATOM   2615 C  CB    . ASP B 1 17  ? -6.703  95.466  -23.781 1.00 22.98  ? 58  ASP B CB    1 
ATOM   2616 C  CG    . ASP B 1 17  ? -8.209  95.295  -23.697 1.00 28.68  ? 58  ASP B CG    1 
ATOM   2617 O  OD1   . ASP B 1 17  ? -8.909  96.263  -23.330 1.00 33.02  ? 58  ASP B OD1   1 
ATOM   2618 O  OD2   . ASP B 1 17  ? -8.694  94.182  -23.986 1.00 33.46  ? 58  ASP B OD2   1 
ATOM   2619 N  N     . GLY B 1 18  ? -7.414  98.891  -24.410 1.00 25.76  ? 59  GLY B N     1 
ATOM   2620 C  CA    . GLY B 1 18  ? -7.878  99.841  -25.404 1.00 25.60  ? 59  GLY B CA    1 
ATOM   2621 C  C     . GLY B 1 18  ? -9.257  99.535  -25.960 1.00 28.87  ? 59  GLY B C     1 
ATOM   2622 O  O     . GLY B 1 18  ? -9.805  100.316 -26.737 1.00 28.14  ? 59  GLY B O     1 
ATOM   2623 N  N     . LEU B 1 19  ? -9.823  98.403  -25.556 1.00 29.41  ? 60  LEU B N     1 
ATOM   2624 C  CA    . LEU B 1 19  ? -11.106 97.953  -26.088 1.00 32.30  ? 60  LEU B CA    1 
ATOM   2625 C  C     . LEU B 1 19  ? -12.265 98.267  -25.149 1.00 33.56  ? 60  LEU B C     1 
ATOM   2626 O  O     . LEU B 1 19  ? -12.097 98.298  -23.930 1.00 28.12  ? 60  LEU B O     1 
ATOM   2627 C  CB    . LEU B 1 19  ? -11.061 96.450  -26.366 1.00 29.10  ? 60  LEU B CB    1 
ATOM   2628 C  CG    . LEU B 1 19  ? -9.961  95.991  -27.323 1.00 31.94  ? 60  LEU B CG    1 
ATOM   2629 C  CD1   . LEU B 1 19  ? -9.915  94.475  -27.399 1.00 35.77  ? 60  LEU B CD1   1 
ATOM   2630 C  CD2   . LEU B 1 19  ? -10.175 96.596  -28.701 1.00 34.01  ? 60  LEU B CD2   1 
ATOM   2631 N  N     . PHE B 1 20  ? -13.443 98.490  -25.724 1.00 38.07  ? 61  PHE B N     1 
ATOM   2632 C  CA    . PHE B 1 20  ? -14.639 98.770  -24.936 1.00 37.00  ? 61  PHE B CA    1 
ATOM   2633 C  C     . PHE B 1 20  ? -15.408 97.498  -24.597 1.00 42.70  ? 61  PHE B C     1 
ATOM   2634 O  O     . PHE B 1 20  ? -15.570 96.617  -25.439 1.00 46.46  ? 61  PHE B O     1 
ATOM   2635 C  CB    . PHE B 1 20  ? -15.555 99.746  -25.678 1.00 40.07  ? 61  PHE B CB    1 
ATOM   2636 C  CG    . PHE B 1 20  ? -15.159 101.185 -25.521 1.00 42.10  ? 61  PHE B CG    1 
ATOM   2637 C  CD1   . PHE B 1 20  ? -15.534 101.898 -24.394 1.00 41.10  ? 61  PHE B CD1   1 
ATOM   2638 C  CD2   . PHE B 1 20  ? -14.415 101.826 -26.497 1.00 41.08  ? 61  PHE B CD2   1 
ATOM   2639 C  CE1   . PHE B 1 20  ? -15.173 103.223 -24.242 1.00 45.90  ? 61  PHE B CE1   1 
ATOM   2640 C  CE2   . PHE B 1 20  ? -14.051 103.152 -26.351 1.00 40.55  ? 61  PHE B CE2   1 
ATOM   2641 C  CZ    . PHE B 1 20  ? -14.430 103.850 -25.221 1.00 42.04  ? 61  PHE B CZ    1 
ATOM   2642 N  N     . TYR B 1 21  ? -15.881 97.412  -23.357 1.00 38.59  ? 62  TYR B N     1 
ATOM   2643 C  CA    . TYR B 1 21  ? -16.663 96.267  -22.905 1.00 43.47  ? 62  TYR B CA    1 
ATOM   2644 C  C     . TYR B 1 21  ? -17.968 96.723  -22.263 1.00 42.73  ? 62  TYR B C     1 
ATOM   2645 O  O     . TYR B 1 21  ? -17.997 97.710  -21.526 1.00 37.36  ? 62  TYR B O     1 
ATOM   2646 C  CB    . TYR B 1 21  ? -15.861 95.420  -21.913 1.00 46.32  ? 62  TYR B CB    1 
ATOM   2647 C  CG    . TYR B 1 21  ? -14.624 94.778  -22.500 1.00 45.82  ? 62  TYR B CG    1 
ATOM   2648 C  CD1   . TYR B 1 21  ? -14.654 93.472  -22.972 1.00 47.33  ? 62  TYR B CD1   1 
ATOM   2649 C  CD2   . TYR B 1 21  ? -13.425 95.475  -22.577 1.00 38.77  ? 62  TYR B CD2   1 
ATOM   2650 C  CE1   . TYR B 1 21  ? -13.525 92.879  -23.507 1.00 53.02  ? 62  TYR B CE1   1 
ATOM   2651 C  CE2   . TYR B 1 21  ? -12.291 94.891  -23.111 1.00 36.08  ? 62  TYR B CE2   1 
ATOM   2652 C  CZ    . TYR B 1 21  ? -12.347 93.594  -23.573 1.00 42.13  ? 62  TYR B CZ    1 
ATOM   2653 O  OH    . TYR B 1 21  ? -11.220 93.009  -24.104 1.00 36.00  ? 62  TYR B OH    1 
ATOM   2654 N  N     . LEU B 1 22  ? -19.046 96.000  -22.545 1.00 44.39  ? 63  LEU B N     1 
ATOM   2655 C  CA    . LEU B 1 22  ? -20.351 96.319  -21.979 1.00 43.74  ? 63  LEU B CA    1 
ATOM   2656 C  C     . LEU B 1 22  ? -20.378 95.978  -20.492 1.00 42.57  ? 63  LEU B C     1 
ATOM   2657 O  O     . LEU B 1 22  ? -19.931 94.906  -20.086 1.00 42.19  ? 63  LEU B O     1 
ATOM   2658 C  CB    . LEU B 1 22  ? -21.457 95.569  -22.728 1.00 50.06  ? 63  LEU B CB    1 
ATOM   2659 C  CG    . LEU B 1 22  ? -22.907 96.009  -22.502 1.00 57.03  ? 63  LEU B CG    1 
ATOM   2660 C  CD1   . LEU B 1 22  ? -23.716 95.817  -23.774 1.00 61.37  ? 63  LEU B CD1   1 
ATOM   2661 C  CD2   . LEU B 1 22  ? -23.550 95.252  -21.345 1.00 60.35  ? 63  LEU B CD2   1 
ATOM   2662 N  N     . GLY B 1 23  ? -20.899 96.895  -19.683 1.00 40.81  ? 64  GLY B N     1 
ATOM   2663 C  CA    . GLY B 1 23  ? -20.951 96.692  -18.247 1.00 40.71  ? 64  GLY B CA    1 
ATOM   2664 C  C     . GLY B 1 23  ? -22.075 97.451  -17.571 1.00 38.68  ? 64  GLY B C     1 
ATOM   2665 O  O     . GLY B 1 23  ? -22.793 98.219  -18.211 1.00 42.18  ? 64  GLY B O     1 
ATOM   2666 N  N     . THR B 1 24  ? -22.225 97.233  -16.268 1.00 33.08  ? 65  THR B N     1 
ATOM   2667 C  CA    . THR B 1 24  ? -23.267 97.889  -15.486 1.00 39.56  ? 65  THR B CA    1 
ATOM   2668 C  C     . THR B 1 24  ? -22.673 98.605  -14.277 1.00 41.04  ? 65  THR B C     1 
ATOM   2669 O  O     . THR B 1 24  ? -21.943 98.004  -13.486 1.00 40.15  ? 65  THR B O     1 
ATOM   2670 C  CB    . THR B 1 24  ? -24.335 96.881  -15.006 1.00 43.84  ? 65  THR B CB    1 
ATOM   2671 O  OG1   . THR B 1 24  ? -25.019 96.328  -16.137 1.00 43.70  ? 65  THR B OG1   1 
ATOM   2672 C  CG2   . THR B 1 24  ? -25.349 97.562  -14.095 1.00 46.88  ? 65  THR B CG2   1 
ATOM   2673 N  N     . ILE B 1 25  ? -22.986 99.890  -14.140 1.00 42.84  ? 66  ILE B N     1 
ATOM   2674 C  CA    . ILE B 1 25  ? -22.511 100.674 -13.006 1.00 47.66  ? 66  ILE B CA    1 
ATOM   2675 C  C     . ILE B 1 25  ? -23.168 100.220 -11.708 1.00 47.23  ? 66  ILE B C     1 
ATOM   2676 O  O     . ILE B 1 25  ? -24.380 100.349 -11.540 1.00 47.42  ? 66  ILE B O     1 
ATOM   2677 C  CB    . ILE B 1 25  ? -22.784 102.179 -13.199 1.00 45.83  ? 66  ILE B CB    1 
ATOM   2678 C  CG1   . ILE B 1 25  ? -22.112 102.691 -14.474 1.00 46.07  ? 66  ILE B CG1   1 
ATOM   2679 C  CG2   . ILE B 1 25  ? -22.298 102.965 -11.990 1.00 46.90  ? 66  ILE B CG2   1 
ATOM   2680 C  CD1   . ILE B 1 25  ? -22.366 104.158 -14.751 1.00 45.60  ? 66  ILE B CD1   1 
ATOM   2681 N  N     . LYS B 1 26  ? -22.368 99.687  -10.792 1.00 46.06  ? 67  LYS B N     1 
ATOM   2682 C  CA    . LYS B 1 26  ? -22.885 99.262  -9.498  1.00 47.63  ? 67  LYS B CA    1 
ATOM   2683 C  C     . LYS B 1 26  ? -22.685 100.357 -8.453  1.00 52.21  ? 67  LYS B C     1 
ATOM   2684 O  O     . LYS B 1 26  ? -23.586 100.647 -7.665  1.00 55.57  ? 67  LYS B O     1 
ATOM   2685 C  CB    . LYS B 1 26  ? -22.215 97.962  -9.044  1.00 45.58  ? 67  LYS B CB    1 
ATOM   2686 C  CG    . LYS B 1 26  ? -22.867 97.327  -7.823  1.00 49.87  ? 67  LYS B CG    1 
ATOM   2687 C  CD    . LYS B 1 26  ? -22.206 96.010  -7.452  1.00 49.61  ? 67  LYS B CD    1 
ATOM   2688 C  CE    . LYS B 1 26  ? -22.906 95.356  -6.269  1.00 48.41  ? 67  LYS B CE    1 
ATOM   2689 N  NZ    . LYS B 1 26  ? -22.277 94.061  -5.886  1.00 57.07  ? 67  LYS B NZ    1 
ATOM   2690 N  N     . LYS B 1 27  ? -21.501 100.964 -8.453  1.00 51.00  ? 68  LYS B N     1 
ATOM   2691 C  CA    . LYS B 1 27  ? -21.174 102.028 -7.505  1.00 51.40  ? 68  LYS B CA    1 
ATOM   2692 C  C     . LYS B 1 27  ? -20.580 103.242 -8.211  1.00 53.93  ? 68  LYS B C     1 
ATOM   2693 O  O     . LYS B 1 27  ? -20.134 103.151 -9.355  1.00 51.61  ? 68  LYS B O     1 
ATOM   2694 C  CB    . LYS B 1 27  ? -20.192 101.525 -6.444  1.00 50.53  ? 68  LYS B CB    1 
ATOM   2695 C  CG    . LYS B 1 27  ? -20.514 100.144 -5.896  1.00 59.11  ? 68  LYS B CG    1 
ATOM   2696 C  CD    . LYS B 1 27  ? -19.508 99.716  -4.841  1.00 54.81  ? 68  LYS B CD    1 
ATOM   2697 C  CE    . LYS B 1 27  ? -19.735 98.271  -4.425  1.00 56.18  ? 68  LYS B CE    1 
ATOM   2698 N  NZ    . LYS B 1 27  ? -18.815 97.875  -3.323  1.00 62.62  ? 68  LYS B NZ    1 
ATOM   2699 N  N     . ILE B 1 28  ? -20.573 104.377 -7.519  1.00 53.59  ? 69  ILE B N     1 
ATOM   2700 C  CA    . ILE B 1 28  ? -19.962 105.593 -8.045  1.00 52.94  ? 69  ILE B CA    1 
ATOM   2701 C  C     . ILE B 1 28  ? -19.099 106.279 -6.989  1.00 59.01  ? 69  ILE B C     1 
ATOM   2702 O  O     . ILE B 1 28  ? -19.578 106.620 -5.908  1.00 57.08  ? 69  ILE B O     1 
ATOM   2703 C  CB    . ILE B 1 28  ? -21.019 106.599 -8.549  1.00 53.32  ? 69  ILE B CB    1 
ATOM   2704 C  CG1   . ILE B 1 28  ? -21.846 105.997 -9.688  1.00 56.12  ? 69  ILE B CG1   1 
ATOM   2705 C  CG2   . ILE B 1 28  ? -20.348 107.882 -9.006  1.00 61.82  ? 69  ILE B CG2   1 
ATOM   2706 C  CD1   . ILE B 1 28  ? -22.896 106.936 -10.248 1.00 56.12  ? 69  ILE B CD1   1 
ATOM   2707 N  N     . ASN B 1 29  ? -17.823 106.474 -7.307  1.00 59.68  ? 70  ASN B N     1 
ATOM   2708 C  CA    . ASN B 1 29  ? -16.923 107.223 -6.435  1.00 62.41  ? 70  ASN B CA    1 
ATOM   2709 C  C     . ASN B 1 29  ? -16.773 108.656 -6.955  1.00 64.45  ? 70  ASN B C     1 
ATOM   2710 O  O     . ASN B 1 29  ? -16.278 108.872 -8.061  1.00 66.53  ? 70  ASN B O     1 
ATOM   2711 C  CB    . ASN B 1 29  ? -15.562 106.527 -6.338  1.00 63.00  ? 70  ASN B CB    1 
ATOM   2712 C  CG    . ASN B 1 29  ? -14.875 106.771 -5.006  1.00 61.59  ? 70  ASN B CG    1 
ATOM   2713 O  OD1   . ASN B 1 29  ? -14.261 107.815 -4.796  1.00 69.66  ? 70  ASN B OD1   1 
ATOM   2714 N  ND2   . ASN B 1 29  ? -14.974 105.803 -4.099  1.00 64.64  ? 70  ASN B ND2   1 
ATOM   2715 N  N     . ILE B 1 30  ? -17.201 109.628 -6.150  1.00 69.05  ? 71  ILE B N     1 
ATOM   2716 C  CA    . ILE B 1 30  ? -17.377 111.006 -6.616  1.00 73.51  ? 71  ILE B CA    1 
ATOM   2717 C  C     . ILE B 1 30  ? -16.113 111.686 -7.146  1.00 73.86  ? 71  ILE B C     1 
ATOM   2718 O  O     . ILE B 1 30  ? -16.189 112.422 -8.128  1.00 71.87  ? 71  ILE B O     1 
ATOM   2719 C  CB    . ILE B 1 30  ? -17.985 111.892 -5.513  1.00 73.21  ? 71  ILE B CB    1 
ATOM   2720 C  CG1   . ILE B 1 30  ? -17.144 111.838 -4.236  1.00 74.28  ? 71  ILE B CG1   1 
ATOM   2721 C  CG2   . ILE B 1 30  ? -19.429 111.471 -5.267  1.00 72.15  ? 71  ILE B CG2   1 
ATOM   2722 C  CD1   . ILE B 1 30  ? -17.198 113.111 -3.415  1.00 76.06  ? 71  ILE B CD1   1 
ATOM   2723 N  N     . LEU B 1 31  ? -14.965 111.467 -6.506  1.00 67.40  ? 72  LEU B N     1 
ATOM   2724 C  CA    . LEU B 1 31  ? -13.702 111.829 -7.148  1.00 71.72  ? 72  LEU B CA    1 
ATOM   2725 C  C     . LEU B 1 31  ? -12.520 110.944 -6.745  1.00 71.74  ? 72  LEU B C     1 
ATOM   2726 O  O     . LEU B 1 31  ? -11.469 111.428 -6.334  1.00 71.22  ? 72  LEU B O     1 
ATOM   2727 C  CB    . LEU B 1 31  ? -13.356 113.314 -6.923  1.00 74.45  ? 72  LEU B CB    1 
ATOM   2728 C  CG    . LEU B 1 31  ? -13.087 114.091 -5.618  1.00 76.74  ? 72  LEU B CG    1 
ATOM   2729 C  CD1   . LEU B 1 31  ? -13.544 113.402 -4.311  1.00 72.23  ? 72  LEU B CD1   1 
ATOM   2730 C  CD2   . LEU B 1 31  ? -11.613 114.530 -5.539  1.00 73.84  ? 72  LEU B CD2   1 
ATOM   2731 N  N     . LYS B 1 32  ? -12.721 109.635 -6.865  1.00 71.69  ? 73  LYS B N     1 
ATOM   2732 C  CA    . LYS B 1 32  ? -11.652 108.755 -7.303  1.00 64.87  ? 73  LYS B CA    1 
ATOM   2733 C  C     . LYS B 1 32  ? -11.908 108.732 -8.796  1.00 63.72  ? 73  LYS B C     1 
ATOM   2734 O  O     . LYS B 1 32  ? -11.169 108.140 -9.585  1.00 67.30  ? 73  LYS B O     1 
ATOM   2735 C  CB    . LYS B 1 32  ? -11.712 107.364 -6.664  1.00 65.08  ? 73  LYS B CB    1 
ATOM   2736 C  CG    . LYS B 1 32  ? -10.673 107.125 -5.569  1.00 70.37  ? 73  LYS B CG    1 
ATOM   2737 C  CD    . LYS B 1 32  ? -9.254  107.294 -6.098  1.00 69.76  ? 73  LYS B CD    1 
ATOM   2738 C  CE    . LYS B 1 32  ? -8.725  106.018 -6.741  1.00 71.71  ? 73  LYS B CE    1 
ATOM   2739 N  NZ    . LYS B 1 32  ? -8.425  104.964 -5.730  1.00 67.68  ? 73  LYS B NZ    1 
ATOM   2740 N  N     . GLN B 1 33  ? -13.004 109.408 -9.141  1.00 62.95  ? 74  GLN B N     1 
ATOM   2741 C  CA    . GLN B 1 33  ? -13.424 109.699 -10.501 1.00 65.23  ? 74  GLN B CA    1 
ATOM   2742 C  C     . GLN B 1 33  ? -13.641 108.411 -11.283 1.00 60.66  ? 74  GLN B C     1 
ATOM   2743 O  O     . GLN B 1 33  ? -13.352 108.331 -12.476 1.00 57.95  ? 74  GLN B O     1 
ATOM   2744 C  CB    . GLN B 1 33  ? -12.404 110.616 -11.190 1.00 66.43  ? 74  GLN B CB    1 
ATOM   2745 C  CG    . GLN B 1 33  ? -11.856 111.719 -10.283 1.00 69.47  ? 74  GLN B CG    1 
ATOM   2746 C  CD    . GLN B 1 33  ? -11.463 112.968 -11.043 1.00 76.22  ? 74  GLN B CD    1 
ATOM   2747 O  OE1   . GLN B 1 33  ? -12.305 113.626 -11.654 1.00 78.60  ? 74  GLN B OE1   1 
ATOM   2748 N  NE2   . GLN B 1 33  ? -10.181 113.309 -11.001 1.00 75.04  ? 74  GLN B NE2   1 
ATOM   2749 N  N     . SER B 1 34  ? -14.179 107.411 -10.594 1.00 54.37  ? 75  SER B N     1 
ATOM   2750 C  CA    . SER B 1 34  ? -14.358 106.089 -11.171 1.00 58.17  ? 75  SER B CA    1 
ATOM   2751 C  C     . SER B 1 34  ? -15.737 105.523 -10.863 1.00 58.53  ? 75  SER B C     1 
ATOM   2752 O  O     . SER B 1 34  ? -16.439 106.013 -9.978  1.00 57.73  ? 75  SER B O     1 
ATOM   2753 C  CB    . SER B 1 34  ? -13.277 105.141 -10.653 1.00 53.09  ? 75  SER B CB    1 
ATOM   2754 O  OG    . SER B 1 34  ? -12.019 105.789 -10.633 1.00 59.26  ? 75  SER B OG    1 
ATOM   2755 N  N     . CYS B 1 35  ? -16.118 104.496 -11.614 1.00 51.83  ? 76  CYS B N     1 
ATOM   2756 C  CA    . CYS B 1 35  ? -17.328 103.737 -11.338 1.00 45.28  ? 76  CYS B CA    1 
ATOM   2757 C  C     . CYS B 1 35  ? -16.974 102.266 -11.199 1.00 46.60  ? 76  CYS B C     1 
ATOM   2758 O  O     . CYS B 1 35  ? -16.253 101.716 -12.032 1.00 47.55  ? 76  CYS B O     1 
ATOM   2759 C  CB    . CYS B 1 35  ? -18.365 103.924 -12.446 1.00 45.08  ? 76  CYS B CB    1 
ATOM   2760 S  SG    . CYS B 1 35  ? -18.973 105.612 -12.629 1.00 54.27  ? 76  CYS B SG    1 
ATOM   2761 N  N     . PHE B 1 36  ? -17.472 101.632 -10.143 1.00 46.20  ? 77  PHE B N     1 
ATOM   2762 C  CA    . PHE B 1 36  ? -17.273 100.201 -9.968  1.00 44.11  ? 77  PHE B CA    1 
ATOM   2763 C  C     . PHE B 1 36  ? -18.217 99.451  -10.900 1.00 45.80  ? 77  PHE B C     1 
ATOM   2764 O  O     . PHE B 1 36  ? -19.433 99.463  -10.711 1.00 48.76  ? 77  PHE B O     1 
ATOM   2765 C  CB    . PHE B 1 36  ? -17.501 99.788  -8.514  1.00 47.16  ? 77  PHE B CB    1 
ATOM   2766 C  CG    . PHE B 1 36  ? -17.006 98.408  -8.194  1.00 46.43  ? 77  PHE B CG    1 
ATOM   2767 C  CD1   . PHE B 1 36  ? -15.654 98.111  -8.265  1.00 43.11  ? 77  PHE B CD1   1 
ATOM   2768 C  CD2   . PHE B 1 36  ? -17.888 97.409  -7.817  1.00 43.09  ? 77  PHE B CD2   1 
ATOM   2769 C  CE1   . PHE B 1 36  ? -15.191 96.844  -7.973  1.00 41.81  ? 77  PHE B CE1   1 
ATOM   2770 C  CE2   . PHE B 1 36  ? -17.432 96.138  -7.522  1.00 46.15  ? 77  PHE B CE2   1 
ATOM   2771 C  CZ    . PHE B 1 36  ? -16.081 95.856  -7.599  1.00 47.37  ? 77  PHE B CZ    1 
ATOM   2772 N  N     . ILE B 1 37  ? -17.646 98.802  -11.909 1.00 40.95  ? 78  ILE B N     1 
ATOM   2773 C  CA    . ILE B 1 37  ? -18.434 98.211  -12.985 1.00 42.76  ? 78  ILE B CA    1 
ATOM   2774 C  C     . ILE B 1 37  ? -18.351 96.689  -13.018 1.00 43.72  ? 78  ILE B C     1 
ATOM   2775 O  O     . ILE B 1 37  ? -17.266 96.113  -12.944 1.00 44.77  ? 78  ILE B O     1 
ATOM   2776 C  CB    . ILE B 1 37  ? -17.986 98.757  -14.355 1.00 42.81  ? 78  ILE B CB    1 
ATOM   2777 C  CG1   . ILE B 1 37  ? -18.112 100.281 -14.383 1.00 41.32  ? 78  ILE B CG1   1 
ATOM   2778 C  CG2   . ILE B 1 37  ? -18.794 98.129  -15.479 1.00 40.99  ? 78  ILE B CG2   1 
ATOM   2779 C  CD1   . ILE B 1 37  ? -17.715 100.900 -15.700 1.00 47.62  ? 78  ILE B CD1   1 
ATOM   2780 N  N     . ILE B 1 38  ? -19.506 96.042  -13.128 1.00 44.40  ? 79  ILE B N     1 
ATOM   2781 C  CA    . ILE B 1 38  ? -19.548 94.603  -13.332 1.00 45.82  ? 79  ILE B CA    1 
ATOM   2782 C  C     . ILE B 1 38  ? -19.733 94.313  -14.817 1.00 45.57  ? 79  ILE B C     1 
ATOM   2783 O  O     . ILE B 1 38  ? -20.594 94.899  -15.476 1.00 39.07  ? 79  ILE B O     1 
ATOM   2784 C  CB    . ILE B 1 38  ? -20.671 93.933  -12.508 1.00 50.37  ? 79  ILE B CB    1 
ATOM   2785 C  CG1   . ILE B 1 38  ? -20.808 92.460  -12.897 1.00 49.67  ? 79  ILE B CG1   1 
ATOM   2786 C  CG2   . ILE B 1 38  ? -21.991 94.669  -12.693 1.00 44.74  ? 79  ILE B CG2   1 
ATOM   2787 C  CD1   . ILE B 1 38  ? -21.675 91.654  -11.959 1.00 49.50  ? 79  ILE B CD1   1 
ATOM   2788 N  N     . PHE B 1 39  ? -18.901 93.422  -15.344 1.00 43.09  ? 80  PHE B N     1 
ATOM   2789 C  CA    . PHE B 1 39  ? -18.935 93.089  -16.761 1.00 44.17  ? 80  PHE B CA    1 
ATOM   2790 C  C     . PHE B 1 39  ? -19.758 91.826  -17.013 1.00 49.92  ? 80  PHE B C     1 
ATOM   2791 O  O     . PHE B 1 39  ? -20.251 91.201  -16.073 1.00 41.96  ? 80  PHE B O     1 
ATOM   2792 C  CB    . PHE B 1 39  ? -17.512 92.927  -17.298 1.00 45.63  ? 80  PHE B CB    1 
ATOM   2793 C  CG    . PHE B 1 39  ? -16.679 94.172  -17.179 1.00 44.76  ? 80  PHE B CG    1 
ATOM   2794 C  CD1   . PHE B 1 39  ? -16.694 95.129  -18.181 1.00 43.08  ? 80  PHE B CD1   1 
ATOM   2795 C  CD2   . PHE B 1 39  ? -15.888 94.391  -16.062 1.00 45.27  ? 80  PHE B CD2   1 
ATOM   2796 C  CE1   . PHE B 1 39  ? -15.933 96.279  -18.075 1.00 42.16  ? 80  PHE B CE1   1 
ATOM   2797 C  CE2   . PHE B 1 39  ? -15.124 95.540  -15.950 1.00 46.28  ? 80  PHE B CE2   1 
ATOM   2798 C  CZ    . PHE B 1 39  ? -15.147 96.484  -16.959 1.00 38.55  ? 80  PHE B CZ    1 
ATOM   2799 N  N     . GLU B 1 40  ? -19.903 91.460  -18.283 1.00 47.32  ? 81  GLU B N     1 
ATOM   2800 C  CA    . GLU B 1 40  ? -20.791 90.370  -18.681 1.00 47.15  ? 81  GLU B CA    1 
ATOM   2801 C  C     . GLU B 1 40  ? -20.375 89.011  -18.123 1.00 51.65  ? 81  GLU B C     1 
ATOM   2802 O  O     . GLU B 1 40  ? -21.209 88.118  -17.974 1.00 50.73  ? 81  GLU B O     1 
ATOM   2803 C  CB    . GLU B 1 40  ? -20.878 90.292  -20.206 1.00 46.39  ? 81  GLU B CB    1 
ATOM   2804 C  CG    . GLU B 1 40  ? -21.643 91.444  -20.837 1.00 50.07  ? 81  GLU B CG    1 
ATOM   2805 C  CD    . GLU B 1 40  ? -21.696 91.351  -22.350 1.00 56.87  ? 81  GLU B CD    1 
ATOM   2806 O  OE1   . GLU B 1 40  ? -20.821 90.679  -22.936 1.00 61.81  ? 81  GLU B OE1   1 
ATOM   2807 O  OE2   . GLU B 1 40  ? -22.614 91.948  -22.951 1.00 59.85  ? 81  GLU B OE2   1 
ATOM   2808 N  N     . ASP B 1 41  ? -19.091 88.855  -17.814 1.00 47.48  ? 82  ASP B N     1 
ATOM   2809 C  CA    . ASP B 1 41  ? -18.595 87.607  -17.242 1.00 47.62  ? 82  ASP B CA    1 
ATOM   2810 C  C     . ASP B 1 41  ? -18.570 87.682  -15.718 1.00 48.45  ? 82  ASP B C     1 
ATOM   2811 O  O     . ASP B 1 41  ? -17.824 86.951  -15.064 1.00 51.72  ? 82  ASP B O     1 
ATOM   2812 C  CB    . ASP B 1 41  ? -17.198 87.287  -17.776 1.00 51.41  ? 82  ASP B CB    1 
ATOM   2813 C  CG    . ASP B 1 41  ? -16.166 88.315  -17.358 1.00 54.38  ? 82  ASP B CG    1 
ATOM   2814 O  OD1   . ASP B 1 41  ? -16.547 89.486  -17.153 1.00 51.05  ? 82  ASP B OD1   1 
ATOM   2815 O  OD2   . ASP B 1 41  ? -14.976 87.955  -17.234 1.00 56.64  ? 82  ASP B OD2   1 
ATOM   2816 N  N     . SER B 1 42  ? -19.383 88.582  -15.171 1.00 47.53  ? 83  SER B N     1 
ATOM   2817 C  CA    . SER B 1 42  ? -19.493 88.800  -13.728 1.00 51.34  ? 83  SER B CA    1 
ATOM   2818 C  C     . SER B 1 42  ? -18.174 89.244  -13.095 1.00 51.44  ? 83  SER B C     1 
ATOM   2819 O  O     . SER B 1 42  ? -18.004 89.164  -11.877 1.00 51.81  ? 83  SER B O     1 
ATOM   2820 C  CB    . SER B 1 42  ? -20.011 87.537  -13.030 1.00 49.62  ? 83  SER B CB    1 
ATOM   2821 O  OG    . SER B 1 42  ? -21.277 87.155  -13.541 1.00 50.68  ? 83  SER B OG    1 
ATOM   2822 N  N     . SER B 1 43  ? -17.245 89.717  -13.922 1.00 48.96  ? 84  SER B N     1 
ATOM   2823 C  CA    . SER B 1 43  ? -16.001 90.290  -13.421 1.00 48.44  ? 84  SER B CA    1 
ATOM   2824 C  C     . SER B 1 43  ? -16.232 91.747  -13.036 1.00 46.36  ? 84  SER B C     1 
ATOM   2825 O  O     . SER B 1 43  ? -17.025 92.445  -13.669 1.00 47.46  ? 84  SER B O     1 
ATOM   2826 C  CB    . SER B 1 43  ? -14.886 90.176  -14.463 1.00 48.67  ? 84  SER B CB    1 
ATOM   2827 O  OG    . SER B 1 43  ? -15.220 90.878  -15.647 1.00 46.09  ? 84  SER B OG    1 
ATOM   2828 N  N     . LYS B 1 44  ? -15.542 92.203  -11.997 1.00 45.74  ? 85  LYS B N     1 
ATOM   2829 C  CA    . LYS B 1 44  ? -15.796 93.526  -11.436 1.00 46.84  ? 85  LYS B CA    1 
ATOM   2830 C  C     . LYS B 1 44  ? -14.515 94.347  -11.304 1.00 48.49  ? 85  LYS B C     1 
ATOM   2831 O  O     . LYS B 1 44  ? -13.462 93.817  -10.945 1.00 48.44  ? 85  LYS B O     1 
ATOM   2832 C  CB    . LYS B 1 44  ? -16.486 93.383  -10.076 1.00 46.78  ? 85  LYS B CB    1 
ATOM   2833 C  CG    . LYS B 1 44  ? -17.740 92.513  -10.124 1.00 47.07  ? 85  LYS B CG    1 
ATOM   2834 C  CD    . LYS B 1 44  ? -18.060 91.876  -8.780  1.00 47.31  ? 85  LYS B CD    1 
ATOM   2835 C  CE    . LYS B 1 44  ? -19.116 92.662  -8.023  1.00 52.45  ? 85  LYS B CE    1 
ATOM   2836 N  NZ    . LYS B 1 44  ? -19.510 91.977  -6.760  1.00 60.56  ? 85  LYS B NZ    1 
ATOM   2837 N  N     . SER B 1 45  ? -14.611 95.642  -11.595 1.00 40.25  ? 86  SER B N     1 
ATOM   2838 C  CA    . SER B 1 45  ? -13.452 96.528  -11.554 1.00 43.55  ? 86  SER B CA    1 
ATOM   2839 C  C     . SER B 1 45  ? -13.850 98.002  -11.519 1.00 42.42  ? 86  SER B C     1 
ATOM   2840 O  O     . SER B 1 45  ? -14.958 98.364  -11.911 1.00 42.30  ? 86  SER B O     1 
ATOM   2841 C  CB    . SER B 1 45  ? -12.546 96.275  -12.760 1.00 44.13  ? 86  SER B CB    1 
ATOM   2842 O  OG    . SER B 1 45  ? -11.519 97.248  -12.833 1.00 50.33  ? 86  SER B OG    1 
ATOM   2843 N  N     . TRP B 1 46  ? -12.934 98.846  -11.051 1.00 42.33  ? 87  TRP B N     1 
ATOM   2844 C  CA    . TRP B 1 46  ? -13.129 100.292 -11.082 1.00 42.47  ? 87  TRP B CA    1 
ATOM   2845 C  C     . TRP B 1 46  ? -12.662 100.864 -12.419 1.00 40.19  ? 87  TRP B C     1 
ATOM   2846 O  O     . TRP B 1 46  ? -11.589 100.514 -12.908 1.00 45.10  ? 87  TRP B O     1 
ATOM   2847 C  CB    . TRP B 1 46  ? -12.384 100.966 -9.926  1.00 44.16  ? 87  TRP B CB    1 
ATOM   2848 C  CG    . TRP B 1 46  ? -13.030 100.757 -8.590  1.00 47.84  ? 87  TRP B CG    1 
ATOM   2849 C  CD1   . TRP B 1 46  ? -12.718 99.803  -7.665  1.00 50.61  ? 87  TRP B CD1   1 
ATOM   2850 C  CD2   . TRP B 1 46  ? -14.104 101.523 -8.031  1.00 49.05  ? 87  TRP B CD2   1 
ATOM   2851 N  NE1   . TRP B 1 46  ? -13.532 99.929  -6.563  1.00 48.97  ? 87  TRP B NE1   1 
ATOM   2852 C  CE2   . TRP B 1 46  ? -14.392 100.976 -6.764  1.00 49.30  ? 87  TRP B CE2   1 
ATOM   2853 C  CE3   . TRP B 1 46  ? -14.851 102.617 -8.479  1.00 48.78  ? 87  TRP B CE3   1 
ATOM   2854 C  CZ2   . TRP B 1 46  ? -15.394 101.487 -5.941  1.00 48.55  ? 87  TRP B CZ2   1 
ATOM   2855 C  CZ3   . TRP B 1 46  ? -15.845 103.121 -7.661  1.00 52.93  ? 87  TRP B CZ3   1 
ATOM   2856 C  CH2   . TRP B 1 46  ? -16.107 102.557 -6.406  1.00 54.59  ? 87  TRP B CH2   1 
ATOM   2857 N  N     . VAL B 1 47  ? -13.470 101.738 -13.011 1.00 45.83  ? 88  VAL B N     1 
ATOM   2858 C  CA    . VAL B 1 47  ? -13.145 102.325 -14.309 1.00 39.24  ? 88  VAL B CA    1 
ATOM   2859 C  C     . VAL B 1 47  ? -13.249 103.844 -14.268 1.00 47.10  ? 88  VAL B C     1 
ATOM   2860 O  O     . VAL B 1 47  ? -14.266 104.389 -13.842 1.00 45.39  ? 88  VAL B O     1 
ATOM   2861 C  CB    . VAL B 1 47  ? -14.073 101.793 -15.421 1.00 37.26  ? 88  VAL B CB    1 
ATOM   2862 C  CG1   . VAL B 1 47  ? -13.735 102.440 -16.760 1.00 34.33  ? 88  VAL B CG1   1 
ATOM   2863 C  CG2   . VAL B 1 47  ? -13.984 100.276 -15.515 1.00 40.48  ? 88  VAL B CG2   1 
ATOM   2864 N  N     . LEU B 1 48  ? -12.194 104.519 -14.716 1.00 43.33  ? 89  LEU B N     1 
ATOM   2865 C  CA    . LEU B 1 48  ? -12.165 105.978 -14.752 1.00 44.62  ? 89  LEU B CA    1 
ATOM   2866 C  C     . LEU B 1 48  ? -13.231 106.524 -15.695 1.00 44.74  ? 89  LEU B C     1 
ATOM   2867 O  O     . LEU B 1 48  ? -13.590 105.877 -16.680 1.00 44.68  ? 89  LEU B O     1 
ATOM   2868 C  CB    . LEU B 1 48  ? -10.779 106.478 -15.171 1.00 41.73  ? 89  LEU B CB    1 
ATOM   2869 C  CG    . LEU B 1 48  ? -9.629  106.142 -14.218 1.00 44.64  ? 89  LEU B CG    1 
ATOM   2870 C  CD1   . LEU B 1 48  ? -8.281  106.411 -14.871 1.00 43.43  ? 89  LEU B CD1   1 
ATOM   2871 C  CD2   . LEU B 1 48  ? -9.758  106.919 -12.912 1.00 51.76  ? 89  LEU B CD2   1 
ATOM   2872 N  N     . TRP B 1 49  ? -13.729 107.718 -15.387 1.00 47.68  ? 90  TRP B N     1 
ATOM   2873 C  CA    . TRP B 1 49  ? -14.832 108.317 -16.135 1.00 46.51  ? 90  TRP B CA    1 
ATOM   2874 C  C     . TRP B 1 49  ? -14.482 108.600 -17.588 1.00 43.71  ? 90  TRP B C     1 
ATOM   2875 O  O     . TRP B 1 49  ? -15.352 108.565 -18.457 1.00 45.13  ? 90  TRP B O     1 
ATOM   2876 C  CB    . TRP B 1 49  ? -15.287 109.612 -15.465 1.00 57.57  ? 90  TRP B CB    1 
ATOM   2877 C  CG    . TRP B 1 49  ? -15.999 109.395 -14.178 1.00 60.82  ? 90  TRP B CG    1 
ATOM   2878 C  CD1   . TRP B 1 49  ? -16.537 108.225 -13.726 1.00 60.66  ? 90  TRP B CD1   1 
ATOM   2879 C  CD2   . TRP B 1 49  ? -16.250 110.371 -13.165 1.00 66.86  ? 90  TRP B CD2   1 
ATOM   2880 N  NE1   . TRP B 1 49  ? -17.110 108.415 -12.493 1.00 60.36  ? 90  TRP B NE1   1 
ATOM   2881 C  CE2   . TRP B 1 49  ? -16.947 109.725 -12.126 1.00 68.13  ? 90  TRP B CE2   1 
ATOM   2882 C  CE3   . TRP B 1 49  ? -15.952 111.731 -13.035 1.00 71.48  ? 90  TRP B CE3   1 
ATOM   2883 C  CZ2   . TRP B 1 49  ? -17.351 110.391 -10.973 1.00 69.39  ? 90  TRP B CZ2   1 
ATOM   2884 C  CZ3   . TRP B 1 49  ? -16.354 112.390 -11.891 1.00 73.44  ? 90  TRP B CZ3   1 
ATOM   2885 C  CH2   . TRP B 1 49  ? -17.048 111.721 -10.877 1.00 71.86  ? 90  TRP B CH2   1 
ATOM   2886 N  N     . LYS B 1 50  ? -13.210 108.882 -17.847 1.00 42.67  ? 91  LYS B N     1 
ATOM   2887 C  CA    . LYS B 1 50  ? -12.748 109.157 -19.203 1.00 41.42  ? 91  LYS B CA    1 
ATOM   2888 C  C     . LYS B 1 50  ? -12.836 107.910 -20.076 1.00 35.22  ? 91  LYS B C     1 
ATOM   2889 O  O     . LYS B 1 50  ? -12.752 107.991 -21.301 1.00 37.54  ? 91  LYS B O     1 
ATOM   2890 C  CB    . LYS B 1 50  ? -11.309 109.676 -19.187 1.00 40.73  ? 91  LYS B CB    1 
ATOM   2891 C  CG    . LYS B 1 50  ? -10.287 108.632 -18.758 1.00 39.17  ? 91  LYS B CG    1 
ATOM   2892 C  CD    . LYS B 1 50  ? -8.867  109.144 -18.916 1.00 40.20  ? 91  LYS B CD    1 
ATOM   2893 C  CE    . LYS B 1 50  ? -7.853  108.071 -18.553 1.00 34.55  ? 91  LYS B CE    1 
ATOM   2894 N  NZ    . LYS B 1 50  ? -7.967  106.878 -19.439 1.00 28.77  ? 91  LYS B NZ    1 
ATOM   2895 N  N     . ASP B 1 51  ? -13.000 106.759 -19.431 1.00 37.27  ? 92  ASP B N     1 
ATOM   2896 C  CA    . ASP B 1 51  ? -13.061 105.480 -20.126 1.00 41.56  ? 92  ASP B CA    1 
ATOM   2897 C  C     . ASP B 1 51  ? -14.464 104.891 -20.109 1.00 38.35  ? 92  ASP B C     1 
ATOM   2898 O  O     . ASP B 1 51  ? -14.658 103.724 -20.448 1.00 41.12  ? 92  ASP B O     1 
ATOM   2899 C  CB    . ASP B 1 51  ? -12.080 104.493 -19.498 1.00 36.74  ? 92  ASP B CB    1 
ATOM   2900 C  CG    . ASP B 1 51  ? -10.648 104.982 -19.560 1.00 39.52  ? 92  ASP B CG    1 
ATOM   2901 O  OD1   . ASP B 1 51  ? -10.233 105.469 -20.636 1.00 33.91  ? 92  ASP B OD1   1 
ATOM   2902 O  OD2   . ASP B 1 51  ? -9.942  104.889 -18.532 1.00 35.98  ? 92  ASP B OD2   1 
ATOM   2903 N  N     . ILE B 1 52  ? -15.437 105.701 -19.705 1.00 44.42  ? 93  ILE B N     1 
ATOM   2904 C  CA    . ILE B 1 52  ? -16.829 105.265 -19.660 1.00 46.32  ? 93  ILE B CA    1 
ATOM   2905 C  C     . ILE B 1 52  ? -17.659 105.979 -20.724 1.00 45.88  ? 93  ILE B C     1 
ATOM   2906 O  O     . ILE B 1 52  ? -17.712 107.208 -20.763 1.00 43.65  ? 93  ILE B O     1 
ATOM   2907 C  CB    . ILE B 1 52  ? -17.452 105.508 -18.272 1.00 48.30  ? 93  ILE B CB    1 
ATOM   2908 C  CG1   . ILE B 1 52  ? -16.693 104.716 -17.206 1.00 45.68  ? 93  ILE B CG1   1 
ATOM   2909 C  CG2   . ILE B 1 52  ? -18.925 105.119 -18.273 1.00 49.23  ? 93  ILE B CG2   1 
ATOM   2910 C  CD1   . ILE B 1 52  ? -17.259 104.870 -15.812 1.00 50.01  ? 93  ILE B CD1   1 
ATOM   2911 N  N     . GLN B 1 53  ? -18.305 105.200 -21.586 1.00 44.04  ? 94  GLN B N     1 
ATOM   2912 C  CA    . GLN B 1 53  ? -19.098 105.754 -22.676 1.00 46.74  ? 94  GLN B CA    1 
ATOM   2913 C  C     . GLN B 1 53  ? -20.588 105.509 -22.454 1.00 57.25  ? 94  GLN B C     1 
ATOM   2914 O  O     . GLN B 1 53  ? -21.027 104.365 -22.333 1.00 51.50  ? 94  GLN B O     1 
ATOM   2915 C  CB    . GLN B 1 53  ? -18.652 105.152 -24.010 1.00 54.10  ? 94  GLN B CB    1 
ATOM   2916 C  CG    . GLN B 1 53  ? -19.300 105.770 -25.237 1.00 54.24  ? 94  GLN B CG    1 
ATOM   2917 C  CD    . GLN B 1 53  ? -18.769 105.179 -26.532 1.00 58.30  ? 94  GLN B CD    1 
ATOM   2918 O  OE1   . GLN B 1 53  ? -17.954 104.254 -26.519 1.00 50.62  ? 94  GLN B OE1   1 
ATOM   2919 N  NE2   . GLN B 1 53  ? -19.226 105.714 -27.658 1.00 61.48  ? 94  GLN B NE2   1 
ATOM   2920 N  N     . THR B 1 54  ? -21.360 106.590 -22.395 1.00 61.20  ? 95  THR B N     1 
ATOM   2921 C  CA    . THR B 1 54  ? -22.801 106.492 -22.190 1.00 60.38  ? 95  THR B CA    1 
ATOM   2922 C  C     . THR B 1 54  ? -23.548 106.466 -23.519 1.00 62.16  ? 95  THR B C     1 
ATOM   2923 O  O     . THR B 1 54  ? -24.691 106.015 -23.591 1.00 68.65  ? 95  THR B O     1 
ATOM   2924 C  CB    . THR B 1 54  ? -23.335 107.659 -21.338 1.00 57.24  ? 95  THR B CB    1 
ATOM   2925 O  OG1   . THR B 1 54  ? -23.016 108.904 -21.972 1.00 62.61  ? 95  THR B OG1   1 
ATOM   2926 C  CG2   . THR B 1 54  ? -22.720 107.629 -19.948 1.00 50.87  ? 95  THR B CG2   1 
ATOM   2927 N  N     . CYS B 1 64  ? -24.135 119.338 -30.924 1.00 84.29  ? 105 CYS B N     1 
ATOM   2928 C  CA    . CYS B 1 64  ? -22.978 118.458 -31.040 1.00 77.19  ? 105 CYS B CA    1 
ATOM   2929 C  C     . CYS B 1 64  ? -22.834 117.566 -29.814 1.00 79.53  ? 105 CYS B C     1 
ATOM   2930 O  O     . CYS B 1 64  ? -23.346 117.880 -28.740 1.00 81.36  ? 105 CYS B O     1 
ATOM   2931 C  CB    . CYS B 1 64  ? -21.700 119.275 -31.243 1.00 74.03  ? 105 CYS B CB    1 
ATOM   2932 S  SG    . CYS B 1 64  ? -20.179 118.297 -31.270 1.00 73.93  ? 105 CYS B SG    1 
ATOM   2933 N  N     . THR B 1 65  ? -22.133 116.451 -29.981 1.00 69.56  ? 106 THR B N     1 
ATOM   2934 C  CA    . THR B 1 65  ? -21.885 115.537 -28.875 1.00 72.39  ? 106 THR B CA    1 
ATOM   2935 C  C     . THR B 1 65  ? -20.746 116.082 -28.011 1.00 73.42  ? 106 THR B C     1 
ATOM   2936 O  O     . THR B 1 65  ? -20.550 115.655 -26.872 1.00 71.73  ? 106 THR B O     1 
ATOM   2937 C  CB    . THR B 1 65  ? -21.545 114.117 -29.381 1.00 74.85  ? 106 THR B CB    1 
ATOM   2938 O  OG1   . THR B 1 65  ? -22.448 113.751 -30.433 1.00 70.25  ? 106 THR B OG1   1 
ATOM   2939 C  CG2   . THR B 1 65  ? -21.654 113.099 -28.256 1.00 70.70  ? 106 THR B CG2   1 
ATOM   2940 N  N     . ILE B 1 66  ? -20.010 117.045 -28.560 1.00 73.07  ? 107 ILE B N     1 
ATOM   2941 C  CA    . ILE B 1 66  ? -18.872 117.644 -27.870 1.00 77.21  ? 107 ILE B CA    1 
ATOM   2942 C  C     . ILE B 1 66  ? -19.184 119.077 -27.426 1.00 75.13  ? 107 ILE B C     1 
ATOM   2943 O  O     . ILE B 1 66  ? -18.418 119.689 -26.681 1.00 75.59  ? 107 ILE B O     1 
ATOM   2944 C  CB    . ILE B 1 66  ? -17.610 117.650 -28.773 1.00 75.13  ? 107 ILE B CB    1 
ATOM   2945 C  CG1   . ILE B 1 66  ? -17.533 116.369 -29.607 1.00 67.62  ? 107 ILE B CG1   1 
ATOM   2946 C  CG2   . ILE B 1 66  ? -16.340 117.813 -27.945 1.00 73.33  ? 107 ILE B CG2   1 
ATOM   2947 C  CD1   . ILE B 1 66  ? -17.244 115.124 -28.796 1.00 63.31  ? 107 ILE B CD1   1 
ATOM   2948 N  N     . CYS B 1 67  ? -20.320 119.606 -27.870 1.00 76.71  ? 108 CYS B N     1 
ATOM   2949 C  CA    . CYS B 1 67  ? -20.633 121.013 -27.635 1.00 82.38  ? 108 CYS B CA    1 
ATOM   2950 C  C     . CYS B 1 67  ? -22.054 121.244 -27.110 1.00 88.74  ? 108 CYS B C     1 
ATOM   2951 O  O     . CYS B 1 67  ? -22.356 122.321 -26.593 1.00 88.73  ? 108 CYS B O     1 
ATOM   2952 C  CB    . CYS B 1 67  ? -20.420 121.809 -28.924 1.00 81.50  ? 108 CYS B CB    1 
ATOM   2953 S  SG    . CYS B 1 67  ? -20.211 123.586 -28.692 1.00 87.65  ? 108 CYS B SG    1 
ATOM   2954 N  N     . GLN B 1 68  ? -22.920 120.242 -27.260 1.00 90.93  ? 109 GLN B N     1 
ATOM   2955 C  CA    . GLN B 1 68  ? -24.290 120.280 -26.726 1.00 92.26  ? 109 GLN B CA    1 
ATOM   2956 C  C     . GLN B 1 68  ? -25.165 121.386 -27.315 1.00 89.85  ? 109 GLN B C     1 
ATOM   2957 O  O     . GLN B 1 68  ? -26.194 121.745 -26.740 1.00 87.32  ? 109 GLN B O     1 
ATOM   2958 C  CB    . GLN B 1 68  ? -24.266 120.429 -25.201 1.00 88.50  ? 109 GLN B CB    1 
ATOM   2959 C  CG    . GLN B 1 68  ? -23.721 119.225 -24.464 1.00 87.32  ? 109 GLN B CG    1 
ATOM   2960 C  CD    . GLN B 1 68  ? -24.596 118.004 -24.641 1.00 96.69  ? 109 GLN B CD    1 
ATOM   2961 O  OE1   . GLN B 1 68  ? -25.818 118.112 -24.763 1.00 100.25 ? 109 GLN B OE1   1 
ATOM   2962 N  NE2   . GLN B 1 68  ? -23.976 116.830 -24.661 1.00 94.02  ? 109 GLN B NE2   1 
ATOM   2963 N  N     . GLU B 1 69  ? -24.765 121.917 -28.463 1.00 92.06  ? 110 GLU B N     1 
ATOM   2964 C  CA    . GLU B 1 69  ? -25.481 123.034 -29.072 1.00 93.40  ? 110 GLU B CA    1 
ATOM   2965 C  C     . GLU B 1 69  ? -26.048 122.647 -30.444 1.00 96.42  ? 110 GLU B C     1 
ATOM   2966 O  O     . GLU B 1 69  ? -25.447 121.858 -31.166 1.00 95.48  ? 110 GLU B O     1 
ATOM   2967 C  CB    . GLU B 1 69  ? -24.557 124.249 -29.181 1.00 91.30  ? 110 GLU B CB    1 
ATOM   2968 C  CG    . GLU B 1 69  ? -24.310 124.968 -27.862 1.00 91.83  ? 110 GLU B CG    1 
ATOM   2969 C  CD    . GLU B 1 69  ? -24.639 126.446 -27.944 1.00 97.15  ? 110 GLU B CD    1 
ATOM   2970 O  OE1   . GLU B 1 69  ? -25.608 126.804 -28.649 1.00 101.13 ? 110 GLU B OE1   1 
ATOM   2971 O  OE2   . GLU B 1 69  ? -23.923 127.252 -27.315 1.00 95.50  ? 110 GLU B OE2   1 
ATOM   2972 N  N     . GLU B 1 70  ? -27.204 123.206 -30.796 1.00 98.56  ? 111 GLU B N     1 
ATOM   2973 C  CA    . GLU B 1 70  ? -27.954 122.758 -31.967 1.00 98.30  ? 111 GLU B CA    1 
ATOM   2974 C  C     . GLU B 1 70  ? -27.589 123.468 -33.271 1.00 98.36  ? 111 GLU B C     1 
ATOM   2975 O  O     . GLU B 1 70  ? -27.953 122.999 -34.362 1.00 97.45  ? 111 GLU B O     1 
ATOM   2976 C  CB    . GLU B 1 70  ? -29.455 122.937 -31.730 1.00 99.66  ? 111 GLU B CB    1 
ATOM   2977 C  CG    . GLU B 1 70  ? -30.034 122.188 -30.538 1.00 103.74 ? 111 GLU B CG    1 
ATOM   2978 C  CD    . GLU B 1 70  ? -31.512 122.483 -30.371 1.00 107.18 ? 111 GLU B CD    1 
ATOM   2979 O  OE1   . GLU B 1 70  ? -31.979 123.461 -30.989 1.00 109.51 ? 111 GLU B OE1   1 
ATOM   2980 O  OE2   . GLU B 1 70  ? -32.205 121.754 -29.632 1.00 104.49 ? 111 GLU B OE2   1 
ATOM   2981 N  N     . TYR B 1 71  ? -26.890 124.596 -33.167 1.00 97.77  ? 112 TYR B N     1 
ATOM   2982 C  CA    . TYR B 1 71  ? -26.641 125.432 -34.338 1.00 97.44  ? 112 TYR B CA    1 
ATOM   2983 C  C     . TYR B 1 71  ? -25.691 124.805 -35.354 1.00 92.60  ? 112 TYR B C     1 
ATOM   2984 O  O     . TYR B 1 71  ? -24.580 124.412 -35.008 1.00 93.80  ? 112 TYR B O     1 
ATOM   2985 C  CB    . TYR B 1 71  ? -26.118 126.811 -33.896 1.00 101.46 ? 112 TYR B CB    1 
ATOM   2986 C  CG    . TYR B 1 71  ? -24.782 126.861 -33.150 1.00 99.77  ? 112 TYR B CG    1 
ATOM   2987 C  CD1   . TYR B 1 71  ? -23.594 127.072 -33.831 1.00 95.97  ? 112 TYR B CD1   1 
ATOM   2988 C  CD2   . TYR B 1 71  ? -24.724 126.772 -31.764 1.00 99.52  ? 112 TYR B CD2   1 
ATOM   2989 C  CE1   . TYR B 1 71  ? -22.375 127.144 -33.164 1.00 93.78  ? 112 TYR B CE1   1 
ATOM   2990 C  CE2   . TYR B 1 71  ? -23.506 126.843 -31.080 1.00 98.66  ? 112 TYR B CE2   1 
ATOM   2991 C  CZ    . TYR B 1 71  ? -22.330 127.028 -31.791 1.00 98.70  ? 112 TYR B CZ    1 
ATOM   2992 O  OH    . TYR B 1 71  ? -21.104 127.106 -31.160 1.00 99.66  ? 112 TYR B OH    1 
ATOM   2993 N  N     . SER B 1 72  ? -26.157 124.686 -36.597 1.00 94.41  ? 113 SER B N     1 
ATOM   2994 C  CA    . SER B 1 72  ? -25.308 124.250 -37.699 1.00 91.41  ? 113 SER B CA    1 
ATOM   2995 C  C     . SER B 1 72  ? -24.759 125.462 -38.443 1.00 91.48  ? 113 SER B C     1 
ATOM   2996 O  O     . SER B 1 72  ? -25.476 126.098 -39.218 1.00 93.10  ? 113 SER B O     1 
ATOM   2997 C  CB    . SER B 1 72  ? -26.076 123.342 -38.668 1.00 87.63  ? 113 SER B CB    1 
ATOM   2998 O  OG    . SER B 1 72  ? -25.349 123.182 -39.874 1.00 86.77  ? 113 SER B OG    1 
ATOM   2999 N  N     . GLU B 1 73  ? -23.494 125.790 -38.201 1.00 86.32  ? 114 GLU B N     1 
ATOM   3000 C  CA    . GLU B 1 73  ? -22.877 126.939 -38.856 1.00 88.68  ? 114 GLU B CA    1 
ATOM   3001 C  C     . GLU B 1 73  ? -22.428 126.621 -40.280 1.00 80.99  ? 114 GLU B C     1 
ATOM   3002 O  O     . GLU B 1 73  ? -22.837 125.620 -40.870 1.00 86.59  ? 114 GLU B O     1 
ATOM   3003 C  CB    . GLU B 1 73  ? -21.675 127.446 -38.053 1.00 89.23  ? 114 GLU B CB    1 
ATOM   3004 C  CG    . GLU B 1 73  ? -22.005 128.122 -36.734 1.00 91.11  ? 114 GLU B CG    1 
ATOM   3005 C  CD    . GLU B 1 73  ? -20.802 128.834 -36.139 1.00 89.49  ? 114 GLU B CD    1 
ATOM   3006 O  OE1   . GLU B 1 73  ? -20.302 129.785 -36.778 1.00 92.38  ? 114 GLU B OE1   1 
ATOM   3007 O  OE2   . GLU B 1 73  ? -20.352 128.443 -35.041 1.00 82.01  ? 114 GLU B OE2   1 
ATOM   3008 N  N     . ALA B 1 74  ? -21.588 127.498 -40.819 1.00 80.92  ? 115 ALA B N     1 
ATOM   3009 C  CA    . ALA B 1 74  ? -20.957 127.304 -42.120 1.00 77.11  ? 115 ALA B CA    1 
ATOM   3010 C  C     . ALA B 1 74  ? -19.783 128.271 -42.246 1.00 79.70  ? 115 ALA B C     1 
ATOM   3011 O  O     . ALA B 1 74  ? -19.969 129.483 -42.151 1.00 81.30  ? 115 ALA B O     1 
ATOM   3012 C  CB    . ALA B 1 74  ? -21.957 127.513 -43.248 1.00 76.43  ? 115 ALA B CB    1 
ATOM   3013 N  N     . PRO B 1 75  ? -18.566 127.744 -42.472 1.00 77.91  ? 116 PRO B N     1 
ATOM   3014 C  CA    . PRO B 1 75  ? -18.220 126.344 -42.742 1.00 74.28  ? 116 PRO B CA    1 
ATOM   3015 C  C     . PRO B 1 75  ? -17.999 125.477 -41.498 1.00 76.55  ? 116 PRO B C     1 
ATOM   3016 O  O     . PRO B 1 75  ? -17.172 124.564 -41.535 1.00 73.50  ? 116 PRO B O     1 
ATOM   3017 C  CB    . PRO B 1 75  ? -16.918 126.472 -43.528 1.00 73.55  ? 116 PRO B CB    1 
ATOM   3018 C  CG    . PRO B 1 75  ? -16.261 127.666 -42.917 1.00 69.46  ? 116 PRO B CG    1 
ATOM   3019 C  CD    . PRO B 1 75  ? -17.375 128.612 -42.518 1.00 73.60  ? 116 PRO B CD    1 
ATOM   3020 N  N     . ASN B 1 76  ? -18.723 125.756 -40.420 1.00 76.86  ? 117 ASN B N     1 
ATOM   3021 C  CA    . ASN B 1 76  ? -18.676 124.915 -39.230 1.00 76.74  ? 117 ASN B CA    1 
ATOM   3022 C  C     . ASN B 1 76  ? -19.954 124.086 -39.122 1.00 78.30  ? 117 ASN B C     1 
ATOM   3023 O  O     . ASN B 1 76  ? -20.643 124.115 -38.101 1.00 78.00  ? 117 ASN B O     1 
ATOM   3024 C  CB    . ASN B 1 76  ? -18.479 125.769 -37.976 1.00 74.99  ? 117 ASN B CB    1 
ATOM   3025 C  CG    . ASN B 1 76  ? -17.971 124.966 -36.795 1.00 73.44  ? 117 ASN B CG    1 
ATOM   3026 O  OD1   . ASN B 1 76  ? -18.035 123.737 -36.790 1.00 73.46  ? 117 ASN B OD1   1 
ATOM   3027 N  ND2   . ASN B 1 76  ? -17.466 125.660 -35.781 1.00 66.30  ? 117 ASN B ND2   1 
ATOM   3028 N  N     . GLU B 1 77  ? -20.261 123.347 -40.186 1.00 76.04  ? 118 GLU B N     1 
ATOM   3029 C  CA    . GLU B 1 77  ? -21.513 122.600 -40.273 1.00 77.13  ? 118 GLU B CA    1 
ATOM   3030 C  C     . GLU B 1 77  ? -21.576 121.416 -39.316 1.00 73.71  ? 118 GLU B C     1 
ATOM   3031 O  O     . GLU B 1 77  ? -20.554 120.838 -38.946 1.00 70.33  ? 118 GLU B O     1 
ATOM   3032 C  CB    . GLU B 1 77  ? -21.742 122.100 -41.702 1.00 76.70  ? 118 GLU B CB    1 
ATOM   3033 C  CG    . GLU B 1 77  ? -21.974 123.195 -42.729 1.00 79.61  ? 118 GLU B CG    1 
ATOM   3034 C  CD    . GLU B 1 77  ? -22.599 122.667 -44.005 1.00 76.48  ? 118 GLU B CD    1 
ATOM   3035 O  OE1   . GLU B 1 77  ? -22.031 122.905 -45.092 1.00 75.90  ? 118 GLU B OE1   1 
ATOM   3036 O  OE2   . GLU B 1 77  ? -23.663 122.017 -43.921 1.00 73.54  ? 118 GLU B OE2   1 
ATOM   3037 N  N     . MET B 1 78  ? -22.798 121.066 -38.930 1.00 74.39  ? 119 MET B N     1 
ATOM   3038 C  CA    . MET B 1 78  ? -23.064 119.907 -38.090 1.00 72.00  ? 119 MET B CA    1 
ATOM   3039 C  C     . MET B 1 78  ? -23.074 118.628 -38.923 1.00 71.61  ? 119 MET B C     1 
ATOM   3040 O  O     . MET B 1 78  ? -23.882 118.484 -39.841 1.00 69.53  ? 119 MET B O     1 
ATOM   3041 C  CB    . MET B 1 78  ? -24.402 120.077 -37.370 1.00 75.77  ? 119 MET B CB    1 
ATOM   3042 C  CG    . MET B 1 78  ? -24.783 118.932 -36.451 1.00 72.57  ? 119 MET B CG    1 
ATOM   3043 S  SD    . MET B 1 78  ? -24.142 119.143 -34.783 1.00 74.09  ? 119 MET B SD    1 
ATOM   3044 C  CE    . MET B 1 78  ? -25.251 118.072 -33.873 1.00 73.02  ? 119 MET B CE    1 
ATOM   3045 N  N     . VAL B 1 79  ? -22.176 117.703 -38.601 1.00 72.73  ? 120 VAL B N     1 
ATOM   3046 C  CA    . VAL B 1 79  ? -22.076 116.446 -39.337 1.00 68.97  ? 120 VAL B CA    1 
ATOM   3047 C  C     . VAL B 1 79  ? -22.535 115.276 -38.471 1.00 64.54  ? 120 VAL B C     1 
ATOM   3048 O  O     . VAL B 1 79  ? -22.145 115.162 -37.309 1.00 64.50  ? 120 VAL B O     1 
ATOM   3049 C  CB    . VAL B 1 79  ? -20.634 116.190 -39.827 1.00 66.45  ? 120 VAL B CB    1 
ATOM   3050 C  CG1   . VAL B 1 79  ? -20.585 114.963 -40.724 1.00 62.88  ? 120 VAL B CG1   1 
ATOM   3051 C  CG2   . VAL B 1 79  ? -20.100 117.409 -40.565 1.00 66.99  ? 120 VAL B CG2   1 
ATOM   3052 N  N     . ILE B 1 80  ? -23.367 114.411 -39.042 1.00 61.16  ? 121 ILE B N     1 
ATOM   3053 C  CA    . ILE B 1 80  ? -23.897 113.267 -38.311 1.00 64.73  ? 121 ILE B CA    1 
ATOM   3054 C  C     . ILE B 1 80  ? -23.229 111.969 -38.763 1.00 66.21  ? 121 ILE B C     1 
ATOM   3055 O  O     . ILE B 1 80  ? -23.178 111.673 -39.959 1.00 65.07  ? 121 ILE B O     1 
ATOM   3056 C  CB    . ILE B 1 80  ? -25.423 113.149 -38.491 1.00 64.42  ? 121 ILE B CB    1 
ATOM   3057 C  CG1   . ILE B 1 80  ? -26.091 114.505 -38.252 1.00 61.04  ? 121 ILE B CG1   1 
ATOM   3058 C  CG2   . ILE B 1 80  ? -25.990 112.095 -37.557 1.00 61.92  ? 121 ILE B CG2   1 
ATOM   3059 C  CD1   . ILE B 1 80  ? -27.590 114.499 -38.465 1.00 57.96  ? 121 ILE B CD1   1 
ATOM   3060 N  N     . CYS B 1 81  ? -22.712 111.204 -37.803 1.00 64.40  ? 122 CYS B N     1 
ATOM   3061 C  CA    . CYS B 1 81  ? -22.067 109.926 -38.094 1.00 65.06  ? 122 CYS B CA    1 
ATOM   3062 C  C     . CYS B 1 81  ? -23.047 108.980 -38.779 1.00 62.60  ? 122 CYS B C     1 
ATOM   3063 O  O     . CYS B 1 81  ? -24.241 108.999 -38.487 1.00 64.63  ? 122 CYS B O     1 
ATOM   3064 C  CB    . CYS B 1 81  ? -21.520 109.291 -36.813 1.00 60.05  ? 122 CYS B CB    1 
ATOM   3065 S  SG    . CYS B 1 81  ? -20.739 107.674 -37.050 1.00 54.69  ? 122 CYS B SG    1 
ATOM   3066 N  N     . ASP B 1 82  ? -22.540 108.157 -39.691 1.00 63.33  ? 123 ASP B N     1 
ATOM   3067 C  CA    . ASP B 1 82  ? -23.400 107.287 -40.487 1.00 66.78  ? 123 ASP B CA    1 
ATOM   3068 C  C     . ASP B 1 82  ? -23.535 105.883 -39.906 1.00 65.03  ? 123 ASP B C     1 
ATOM   3069 O  O     . ASP B 1 82  ? -23.959 104.959 -40.597 1.00 66.54  ? 123 ASP B O     1 
ATOM   3070 C  CB    . ASP B 1 82  ? -22.879 107.204 -41.924 1.00 58.67  ? 123 ASP B CB    1 
ATOM   3071 C  CG    . ASP B 1 82  ? -22.889 108.548 -42.625 1.00 66.83  ? 123 ASP B CG    1 
ATOM   3072 O  OD1   . ASP B 1 82  ? -23.607 109.457 -42.161 1.00 71.88  ? 123 ASP B OD1   1 
ATOM   3073 O  OD2   . ASP B 1 82  ? -22.180 108.696 -43.641 1.00 64.41  ? 123 ASP B OD2   1 
ATOM   3074 N  N     . LYS B 1 83  ? -23.174 105.727 -38.637 1.00 63.35  ? 124 LYS B N     1 
ATOM   3075 C  CA    . LYS B 1 83  ? -23.358 104.455 -37.947 1.00 61.66  ? 124 LYS B CA    1 
ATOM   3076 C  C     . LYS B 1 83  ? -24.087 104.638 -36.620 1.00 61.05  ? 124 LYS B C     1 
ATOM   3077 O  O     . LYS B 1 83  ? -25.124 104.016 -36.387 1.00 59.60  ? 124 LYS B O     1 
ATOM   3078 C  CB    . LYS B 1 83  ? -22.015 103.754 -37.713 1.00 64.15  ? 124 LYS B CB    1 
ATOM   3079 C  CG    . LYS B 1 83  ? -22.088 102.652 -36.665 1.00 61.42  ? 124 LYS B CG    1 
ATOM   3080 C  CD    . LYS B 1 83  ? -20.971 101.633 -36.805 1.00 63.24  ? 124 LYS B CD    1 
ATOM   3081 C  CE    . LYS B 1 83  ? -21.106 100.561 -35.734 1.00 63.79  ? 124 LYS B CE    1 
ATOM   3082 N  NZ    . LYS B 1 83  ? -20.324 99.337  -36.053 1.00 64.25  ? 124 LYS B NZ    1 
ATOM   3083 N  N     . CYS B 1 84  ? -23.545 105.486 -35.752 1.00 61.66  ? 125 CYS B N     1 
ATOM   3084 C  CA    . CYS B 1 84  ? -24.167 105.728 -34.455 1.00 58.13  ? 125 CYS B CA    1 
ATOM   3085 C  C     . CYS B 1 84  ? -25.156 106.885 -34.533 1.00 57.90  ? 125 CYS B C     1 
ATOM   3086 O  O     . CYS B 1 84  ? -25.989 107.062 -33.645 1.00 60.24  ? 125 CYS B O     1 
ATOM   3087 C  CB    . CYS B 1 84  ? -23.110 106.007 -33.384 1.00 55.88  ? 125 CYS B CB    1 
ATOM   3088 S  SG    . CYS B 1 84  ? -22.339 107.636 -33.483 1.00 64.22  ? 125 CYS B SG    1 
ATOM   3089 N  N     . GLY B 1 85  ? -25.058 107.670 -35.600 1.00 54.39  ? 126 GLY B N     1 
ATOM   3090 C  CA    . GLY B 1 85  ? -26.003 108.742 -35.849 1.00 62.29  ? 126 GLY B CA    1 
ATOM   3091 C  C     . GLY B 1 85  ? -25.933 109.891 -34.861 1.00 65.45  ? 126 GLY B C     1 
ATOM   3092 O  O     . GLY B 1 85  ? -26.946 110.530 -34.575 1.00 64.91  ? 126 GLY B O     1 
ATOM   3093 N  N     . GLN B 1 86  ? -24.739 110.160 -34.342 1.00 60.24  ? 127 GLN B N     1 
ATOM   3094 C  CA    . GLN B 1 86  ? -24.548 111.282 -33.429 1.00 63.85  ? 127 GLN B CA    1 
ATOM   3095 C  C     . GLN B 1 86  ? -23.836 112.434 -34.133 1.00 61.93  ? 127 GLN B C     1 
ATOM   3096 O  O     . GLN B 1 86  ? -22.978 112.217 -34.990 1.00 57.59  ? 127 GLN B O     1 
ATOM   3097 C  CB    . GLN B 1 86  ? -23.771 110.840 -32.188 1.00 64.30  ? 127 GLN B CB    1 
ATOM   3098 C  CG    . GLN B 1 86  ? -24.461 109.733 -31.404 1.00 64.59  ? 127 GLN B CG    1 
ATOM   3099 C  CD    . GLN B 1 86  ? -24.074 109.725 -29.939 1.00 74.63  ? 127 GLN B CD    1 
ATOM   3100 O  OE1   . GLN B 1 86  ? -23.370 110.617 -29.468 1.00 79.38  ? 127 GLN B OE1   1 
ATOM   3101 N  NE2   . GLN B 1 86  ? -24.537 108.717 -29.209 1.00 79.52  ? 127 GLN B NE2   1 
ATOM   3102 N  N     . GLY B 1 87  ? -24.201 113.660 -33.766 1.00 63.93  ? 128 GLY B N     1 
ATOM   3103 C  CA    . GLY B 1 87  ? -23.745 114.840 -34.478 1.00 63.81  ? 128 GLY B CA    1 
ATOM   3104 C  C     . GLY B 1 87  ? -22.475 115.483 -33.953 1.00 63.90  ? 128 GLY B C     1 
ATOM   3105 O  O     . GLY B 1 87  ? -22.193 115.454 -32.755 1.00 62.81  ? 128 GLY B O     1 
ATOM   3106 N  N     . TYR B 1 88  ? -21.709 116.070 -34.868 1.00 64.75  ? 129 TYR B N     1 
ATOM   3107 C  CA    . TYR B 1 88  ? -20.460 116.744 -34.532 1.00 64.34  ? 129 TYR B CA    1 
ATOM   3108 C  C     . TYR B 1 88  ? -20.273 117.991 -35.390 1.00 64.12  ? 129 TYR B C     1 
ATOM   3109 O  O     . TYR B 1 88  ? -20.494 117.952 -36.600 1.00 61.41  ? 129 TYR B O     1 
ATOM   3110 C  CB    . TYR B 1 88  ? -19.264 115.804 -34.724 1.00 65.26  ? 129 TYR B CB    1 
ATOM   3111 C  CG    . TYR B 1 88  ? -19.239 114.610 -33.796 1.00 67.04  ? 129 TYR B CG    1 
ATOM   3112 C  CD1   . TYR B 1 88  ? -18.555 114.659 -32.589 1.00 64.75  ? 129 TYR B CD1   1 
ATOM   3113 C  CD2   . TYR B 1 88  ? -19.887 113.429 -34.133 1.00 59.74  ? 129 TYR B CD2   1 
ATOM   3114 C  CE1   . TYR B 1 88  ? -18.525 113.569 -31.739 1.00 67.63  ? 129 TYR B CE1   1 
ATOM   3115 C  CE2   . TYR B 1 88  ? -19.866 112.336 -33.288 1.00 65.04  ? 129 TYR B CE2   1 
ATOM   3116 C  CZ    . TYR B 1 88  ? -19.182 112.411 -32.094 1.00 68.45  ? 129 TYR B CZ    1 
ATOM   3117 O  OH    . TYR B 1 88  ? -19.155 111.323 -31.251 1.00 69.67  ? 129 TYR B OH    1 
ATOM   3118 N  N     . HIS B 1 89  ? -19.872 119.095 -34.768 1.00 69.20  ? 130 HIS B N     1 
ATOM   3119 C  CA    . HIS B 1 89  ? -19.467 120.275 -35.525 1.00 70.33  ? 130 HIS B CA    1 
ATOM   3120 C  C     . HIS B 1 89  ? -18.133 119.988 -36.211 1.00 67.23  ? 130 HIS B C     1 
ATOM   3121 O  O     . HIS B 1 89  ? -17.360 119.149 -35.745 1.00 59.07  ? 130 HIS B O     1 
ATOM   3122 C  CB    . HIS B 1 89  ? -19.357 121.509 -34.624 1.00 68.57  ? 130 HIS B CB    1 
ATOM   3123 C  CG    . HIS B 1 89  ? -20.671 122.163 -34.326 1.00 72.20  ? 130 HIS B CG    1 
ATOM   3124 N  ND1   . HIS B 1 89  ? -21.421 121.858 -33.211 1.00 67.64  ? 130 HIS B ND1   1 
ATOM   3125 C  CD2   . HIS B 1 89  ? -21.369 123.109 -35.000 1.00 74.26  ? 130 HIS B CD2   1 
ATOM   3126 C  CE1   . HIS B 1 89  ? -22.524 122.587 -33.210 1.00 77.56  ? 130 HIS B CE1   1 
ATOM   3127 N  NE2   . HIS B 1 89  ? -22.516 123.354 -34.285 1.00 82.44  ? 130 HIS B NE2   1 
ATOM   3128 N  N     . GLN B 1 90  ? -17.869 120.678 -37.317 1.00 69.08  ? 131 GLN B N     1 
ATOM   3129 C  CA    . GLN B 1 90  ? -16.661 120.430 -38.101 1.00 66.98  ? 131 GLN B CA    1 
ATOM   3130 C  C     . GLN B 1 90  ? -15.389 120.711 -37.306 1.00 66.03  ? 131 GLN B C     1 
ATOM   3131 O  O     . GLN B 1 90  ? -14.339 120.134 -37.583 1.00 63.43  ? 131 GLN B O     1 
ATOM   3132 C  CB    . GLN B 1 90  ? -16.664 121.273 -39.379 1.00 66.94  ? 131 GLN B CB    1 
ATOM   3133 C  CG    . GLN B 1 90  ? -17.635 120.789 -40.443 1.00 68.31  ? 131 GLN B CG    1 
ATOM   3134 C  CD    . GLN B 1 90  ? -17.341 121.375 -41.811 1.00 68.91  ? 131 GLN B CD    1 
ATOM   3135 O  OE1   . GLN B 1 90  ? -18.219 121.949 -42.456 1.00 73.49  ? 131 GLN B OE1   1 
ATOM   3136 N  NE2   . GLN B 1 90  ? -16.101 121.226 -42.265 1.00 59.70  ? 131 GLN B NE2   1 
ATOM   3137 N  N     . LEU B 1 91  ? -15.493 121.589 -36.314 1.00 62.85  ? 132 LEU B N     1 
ATOM   3138 C  CA    . LEU B 1 91  ? -14.333 122.008 -35.536 1.00 65.98  ? 132 LEU B CA    1 
ATOM   3139 C  C     . LEU B 1 91  ? -14.411 121.552 -34.080 1.00 57.26  ? 132 LEU B C     1 
ATOM   3140 O  O     . LEU B 1 91  ? -13.611 121.976 -33.245 1.00 59.00  ? 132 LEU B O     1 
ATOM   3141 C  CB    . LEU B 1 91  ? -14.182 123.530 -35.604 1.00 64.24  ? 132 LEU B CB    1 
ATOM   3142 C  CG    . LEU B 1 91  ? -13.917 124.101 -37.000 1.00 65.41  ? 132 LEU B CG    1 
ATOM   3143 C  CD1   . LEU B 1 91  ? -14.030 125.619 -37.004 1.00 62.83  ? 132 LEU B CD1   1 
ATOM   3144 C  CD2   . LEU B 1 91  ? -12.550 123.661 -37.507 1.00 62.00  ? 132 LEU B CD2   1 
ATOM   3145 N  N     . CYS B 1 92  ? -15.378 120.689 -33.785 1.00 54.45  ? 133 CYS B N     1 
ATOM   3146 C  CA    . CYS B 1 92  ? -15.521 120.117 -32.450 1.00 60.68  ? 133 CYS B CA    1 
ATOM   3147 C  C     . CYS B 1 92  ? -15.004 118.682 -32.416 1.00 60.29  ? 133 CYS B C     1 
ATOM   3148 O  O     . CYS B 1 92  ? -14.607 118.176 -31.365 1.00 62.45  ? 133 CYS B O     1 
ATOM   3149 C  CB    . CYS B 1 92  ? -16.981 120.160 -31.997 1.00 56.61  ? 133 CYS B CB    1 
ATOM   3150 S  SG    . CYS B 1 92  ? -17.566 121.799 -31.511 1.00 61.97  ? 133 CYS B SG    1 
ATOM   3151 N  N     . HIS B 1 93  ? -15.013 118.032 -33.575 1.00 59.61  ? 134 HIS B N     1 
ATOM   3152 C  CA    . HIS B 1 93  ? -14.534 116.662 -33.685 1.00 54.99  ? 134 HIS B CA    1 
ATOM   3153 C  C     . HIS B 1 93  ? -13.012 116.620 -33.593 1.00 58.51  ? 134 HIS B C     1 
ATOM   3154 O  O     . HIS B 1 93  ? -12.339 117.606 -33.893 1.00 58.74  ? 134 HIS B O     1 
ATOM   3155 C  CB    . HIS B 1 93  ? -15.006 116.032 -34.998 1.00 52.96  ? 134 HIS B CB    1 
ATOM   3156 C  CG    . HIS B 1 93  ? -14.769 114.556 -35.079 1.00 56.11  ? 134 HIS B CG    1 
ATOM   3157 N  ND1   . HIS B 1 93  ? -13.605 114.015 -35.583 1.00 54.20  ? 134 HIS B ND1   1 
ATOM   3158 C  CD2   . HIS B 1 93  ? -15.544 113.508 -34.715 1.00 55.62  ? 134 HIS B CD2   1 
ATOM   3159 C  CE1   . HIS B 1 93  ? -13.675 112.697 -35.528 1.00 52.04  ? 134 HIS B CE1   1 
ATOM   3160 N  NE2   . HIS B 1 93  ? -14.841 112.363 -35.005 1.00 55.73  ? 134 HIS B NE2   1 
ATOM   3161 N  N     . THR B 1 94  ? -12.474 115.479 -33.175 1.00 56.01  ? 135 THR B N     1 
ATOM   3162 C  CA    . THR B 1 94  ? -11.029 115.307 -33.068 1.00 54.97  ? 135 THR B CA    1 
ATOM   3163 C  C     . THR B 1 94  ? -10.554 114.126 -33.909 1.00 47.73  ? 135 THR B C     1 
ATOM   3164 O  O     . THR B 1 94  ? -10.765 112.974 -33.533 1.00 48.12  ? 135 THR B O     1 
ATOM   3165 C  CB    . THR B 1 94  ? -10.595 115.093 -31.609 1.00 49.09  ? 135 THR B CB    1 
ATOM   3166 O  OG1   . THR B 1 94  ? -11.081 116.170 -30.800 1.00 51.39  ? 135 THR B OG1   1 
ATOM   3167 C  CG2   . THR B 1 94  ? -9.075  115.025 -31.507 1.00 43.53  ? 135 THR B CG2   1 
ATOM   3168 N  N     . PRO B 1 95  ? -9.897  114.407 -35.047 1.00 45.99  ? 136 PRO B N     1 
ATOM   3169 C  CA    . PRO B 1 95  ? -9.553  115.745 -35.542 1.00 47.53  ? 136 PRO B CA    1 
ATOM   3170 C  C     . PRO B 1 95  ? -10.725 116.452 -36.221 1.00 52.77  ? 136 PRO B C     1 
ATOM   3171 O  O     . PRO B 1 95  ? -11.811 115.881 -36.328 1.00 52.13  ? 136 PRO B O     1 
ATOM   3172 C  CB    . PRO B 1 95  ? -8.442  115.459 -36.550 1.00 43.22  ? 136 PRO B CB    1 
ATOM   3173 C  CG    . PRO B 1 95  ? -8.794  114.120 -37.092 1.00 41.02  ? 136 PRO B CG    1 
ATOM   3174 C  CD    . PRO B 1 95  ? -9.395  113.350 -35.943 1.00 41.65  ? 136 PRO B CD    1 
ATOM   3175 N  N     . HIS B 1 96  ? -10.497 117.681 -36.674 1.00 52.81  ? 137 HIS B N     1 
ATOM   3176 C  CA    . HIS B 1 96  ? -11.550 118.483 -37.288 1.00 55.24  ? 137 HIS B CA    1 
ATOM   3177 C  C     . HIS B 1 96  ? -11.987 117.899 -38.627 1.00 57.84  ? 137 HIS B C     1 
ATOM   3178 O  O     . HIS B 1 96  ? -11.195 117.271 -39.330 1.00 57.92  ? 137 HIS B O     1 
ATOM   3179 C  CB    . HIS B 1 96  ? -11.081 119.928 -37.478 1.00 60.67  ? 137 HIS B CB    1 
ATOM   3180 C  CG    . HIS B 1 96  ? -10.585 120.575 -36.221 1.00 57.50  ? 137 HIS B CG    1 
ATOM   3181 N  ND1   . HIS B 1 96  ? -10.800 120.037 -34.972 1.00 58.19  ? 137 HIS B ND1   1 
ATOM   3182 C  CD2   . HIS B 1 96  ? -9.880  121.715 -36.025 1.00 54.44  ? 137 HIS B CD2   1 
ATOM   3183 C  CE1   . HIS B 1 96  ? -10.249 120.818 -34.058 1.00 57.25  ? 137 HIS B CE1   1 
ATOM   3184 N  NE2   . HIS B 1 96  ? -9.684  121.841 -34.671 1.00 59.71  ? 137 HIS B NE2   1 
ATOM   3185 N  N     . ILE B 1 97  ? -13.253 118.112 -38.975 1.00 60.96  ? 138 ILE B N     1 
ATOM   3186 C  CA    . ILE B 1 97  ? -13.799 117.618 -40.233 1.00 63.50  ? 138 ILE B CA    1 
ATOM   3187 C  C     . ILE B 1 97  ? -13.840 118.711 -41.293 1.00 65.73  ? 138 ILE B C     1 
ATOM   3188 O  O     . ILE B 1 97  ? -14.573 119.689 -41.156 1.00 68.77  ? 138 ILE B O     1 
ATOM   3189 C  CB    . ILE B 1 97  ? -15.224 117.066 -40.056 1.00 63.36  ? 138 ILE B CB    1 
ATOM   3190 C  CG1   . ILE B 1 97  ? -15.423 116.523 -38.641 1.00 61.60  ? 138 ILE B CG1   1 
ATOM   3191 C  CG2   . ILE B 1 97  ? -15.515 116.005 -41.108 1.00 60.38  ? 138 ILE B CG2   1 
ATOM   3192 C  CD1   . ILE B 1 97  ? -16.873 116.282 -38.289 1.00 57.43  ? 138 ILE B CD1   1 
ATOM   3193 N  N     . ASP B 1 98  ? -13.057 118.545 -42.353 1.00 65.64  ? 139 ASP B N     1 
ATOM   3194 C  CA    . ASP B 1 98  ? -13.087 119.490 -43.461 1.00 72.74  ? 139 ASP B CA    1 
ATOM   3195 C  C     . ASP B 1 98  ? -14.023 118.975 -44.547 1.00 75.12  ? 139 ASP B C     1 
ATOM   3196 O  O     . ASP B 1 98  ? -14.656 117.932 -44.378 1.00 75.07  ? 139 ASP B O     1 
ATOM   3197 C  CB    . ASP B 1 98  ? -11.684 119.714 -44.027 1.00 77.71  ? 139 ASP B CB    1 
ATOM   3198 C  CG    . ASP B 1 98  ? -11.219 118.566 -44.900 1.00 75.62  ? 139 ASP B CG    1 
ATOM   3199 O  OD1   . ASP B 1 98  ? -11.250 118.711 -46.141 1.00 77.20  ? 139 ASP B OD1   1 
ATOM   3200 O  OD2   . ASP B 1 98  ? -10.831 117.516 -44.347 1.00 74.85  ? 139 ASP B OD2   1 
ATOM   3201 N  N     . CYS B 1 99  ? -14.107 119.714 -45.651 1.00 77.99  ? 140 CYS B N     1 
ATOM   3202 C  CA    . CYS B 1 99  ? -14.904 119.316 -46.810 1.00 79.06  ? 140 CYS B CA    1 
ATOM   3203 C  C     . CYS B 1 99  ? -16.363 119.048 -46.447 1.00 74.91  ? 140 CYS B C     1 
ATOM   3204 O  O     . CYS B 1 99  ? -17.267 119.296 -47.245 1.00 72.23  ? 140 CYS B O     1 
ATOM   3205 C  CB    . CYS B 1 99  ? -14.293 118.078 -47.475 1.00 75.15  ? 140 CYS B CB    1 
ATOM   3206 S  SG    . CYS B 1 99  ? -15.267 117.394 -48.835 1.00 91.69  ? 140 CYS B SG    1 
ATOM   3207 N  N     . LYS B 1 107 ? -19.569 109.283 -47.103 1.00 45.39  ? 148 LYS B N     1 
ATOM   3208 C  CA    . LYS B 1 107 ? -19.936 108.565 -45.888 1.00 61.20  ? 148 LYS B CA    1 
ATOM   3209 C  C     . LYS B 1 107 ? -18.912 108.799 -44.778 1.00 54.96  ? 148 LYS B C     1 
ATOM   3210 O  O     . LYS B 1 107 ? -17.731 108.494 -44.940 1.00 50.23  ? 148 LYS B O     1 
ATOM   3211 C  CB    . LYS B 1 107 ? -20.079 107.071 -46.178 1.00 60.19  ? 148 LYS B CB    1 
ATOM   3212 C  CG    . LYS B 1 107 ? -20.517 106.243 -44.985 1.00 61.25  ? 148 LYS B CG    1 
ATOM   3213 C  CD    . LYS B 1 107 ? -21.047 104.885 -45.420 1.00 58.60  ? 148 LYS B CD    1 
ATOM   3214 C  CE    . LYS B 1 107 ? -22.289 105.032 -46.288 1.00 63.65  ? 148 LYS B CE    1 
ATOM   3215 N  NZ    . LYS B 1 107 ? -22.848 103.715 -46.707 1.00 49.98  ? 148 LYS B NZ    1 
ATOM   3216 N  N     . TRP B 1 108 ? -19.375 109.335 -43.651 1.00 50.80  ? 149 TRP B N     1 
ATOM   3217 C  CA    . TRP B 1 108 ? -18.479 109.733 -42.568 1.00 53.19  ? 149 TRP B CA    1 
ATOM   3218 C  C     . TRP B 1 108 ? -18.745 108.985 -41.264 1.00 52.76  ? 149 TRP B C     1 
ATOM   3219 O  O     . TRP B 1 108 ? -19.893 108.727 -40.901 1.00 49.45  ? 149 TRP B O     1 
ATOM   3220 C  CB    . TRP B 1 108 ? -18.583 111.242 -42.319 1.00 51.00  ? 149 TRP B CB    1 
ATOM   3221 C  CG    . TRP B 1 108 ? -17.682 111.727 -41.217 1.00 54.45  ? 149 TRP B CG    1 
ATOM   3222 C  CD1   . TRP B 1 108 ? -16.340 111.959 -41.300 1.00 50.74  ? 149 TRP B CD1   1 
ATOM   3223 C  CD2   . TRP B 1 108 ? -18.059 112.035 -39.866 1.00 53.42  ? 149 TRP B CD2   1 
ATOM   3224 N  NE1   . TRP B 1 108 ? -15.857 112.391 -40.088 1.00 54.90  ? 149 TRP B NE1   1 
ATOM   3225 C  CE2   . TRP B 1 108 ? -16.891 112.447 -39.191 1.00 51.22  ? 149 TRP B CE2   1 
ATOM   3226 C  CE3   . TRP B 1 108 ? -19.267 112.001 -39.162 1.00 58.63  ? 149 TRP B CE3   1 
ATOM   3227 C  CZ2   . TRP B 1 108 ? -16.897 112.821 -37.849 1.00 48.54  ? 149 TRP B CZ2   1 
ATOM   3228 C  CZ3   . TRP B 1 108 ? -19.270 112.377 -37.829 1.00 54.76  ? 149 TRP B CZ3   1 
ATOM   3229 C  CH2   . TRP B 1 108 ? -18.093 112.782 -37.188 1.00 50.48  ? 149 TRP B CH2   1 
ATOM   3230 N  N     . LEU B 1 109 ? -17.663 108.653 -40.564 1.00 49.98  ? 150 LEU B N     1 
ATOM   3231 C  CA    . LEU B 1 109 ? -17.733 107.996 -39.264 1.00 52.99  ? 150 LEU B CA    1 
ATOM   3232 C  C     . LEU B 1 109 ? -16.943 108.780 -38.220 1.00 50.27  ? 150 LEU B C     1 
ATOM   3233 O  O     . LEU B 1 109 ? -15.866 109.298 -38.514 1.00 41.64  ? 150 LEU B O     1 
ATOM   3234 C  CB    . LEU B 1 109 ? -17.203 106.564 -39.359 1.00 52.08  ? 150 LEU B CB    1 
ATOM   3235 C  CG    . LEU B 1 109 ? -18.171 105.521 -39.917 1.00 50.37  ? 150 LEU B CG    1 
ATOM   3236 C  CD1   . LEU B 1 109 ? -17.485 104.621 -40.930 1.00 56.01  ? 150 LEU B CD1   1 
ATOM   3237 C  CD2   . LEU B 1 109 ? -18.745 104.700 -38.778 1.00 58.49  ? 150 LEU B CD2   1 
ATOM   3238 N  N     . CYS B 1 110 ? -17.475 108.866 -37.005 1.00 47.22  ? 151 CYS B N     1 
ATOM   3239 C  CA    . CYS B 1 110 ? -16.811 109.617 -35.945 1.00 47.33  ? 151 CYS B CA    1 
ATOM   3240 C  C     . CYS B 1 110 ? -15.679 108.806 -35.324 1.00 50.85  ? 151 CYS B C     1 
ATOM   3241 O  O     . CYS B 1 110 ? -15.537 107.617 -35.600 1.00 52.49  ? 151 CYS B O     1 
ATOM   3242 C  CB    . CYS B 1 110 ? -17.811 110.035 -34.868 1.00 44.88  ? 151 CYS B CB    1 
ATOM   3243 S  SG    . CYS B 1 110 ? -18.358 108.704 -33.777 1.00 51.57  ? 151 CYS B SG    1 
ATOM   3244 N  N     . ARG B 1 111 ? -14.887 109.457 -34.477 1.00 52.13  ? 152 ARG B N     1 
ATOM   3245 C  CA    . ARG B 1 111 ? -13.679 108.854 -33.919 1.00 52.54  ? 152 ARG B CA    1 
ATOM   3246 C  C     . ARG B 1 111 ? -13.955 107.579 -33.130 1.00 48.87  ? 152 ARG B C     1 
ATOM   3247 O  O     . ARG B 1 111 ? -13.309 106.554 -33.349 1.00 49.90  ? 152 ARG B O     1 
ATOM   3248 C  CB    . ARG B 1 111 ? -12.950 109.859 -33.023 1.00 43.84  ? 152 ARG B CB    1 
ATOM   3249 C  CG    . ARG B 1 111 ? -11.635 109.340 -32.460 1.00 43.39  ? 152 ARG B CG    1 
ATOM   3250 C  CD    . ARG B 1 111 ? -10.971 110.365 -31.556 1.00 42.60  ? 152 ARG B CD    1 
ATOM   3251 N  NE    . ARG B 1 111 ? -9.636  109.946 -31.140 1.00 39.67  ? 152 ARG B NE    1 
ATOM   3252 C  CZ    . ARG B 1 111 ? -8.520  110.243 -31.799 1.00 38.49  ? 152 ARG B CZ    1 
ATOM   3253 N  NH1   . ARG B 1 111 ? -8.575  110.966 -32.911 1.00 32.69  ? 152 ARG B NH1   1 
ATOM   3254 N  NH2   . ARG B 1 111 ? -7.349  109.819 -31.347 1.00 35.36  ? 152 ARG B NH2   1 
ATOM   3255 N  N     . GLN B 1 112 ? -14.913 107.638 -32.212 1.00 51.47  ? 153 GLN B N     1 
ATOM   3256 C  CA    . GLN B 1 112 ? -15.169 106.497 -31.341 1.00 52.95  ? 153 GLN B CA    1 
ATOM   3257 C  C     . GLN B 1 112 ? -15.952 105.395 -32.049 1.00 51.56  ? 153 GLN B C     1 
ATOM   3258 O  O     . GLN B 1 112 ? -16.113 104.300 -31.513 1.00 57.96  ? 153 GLN B O     1 
ATOM   3259 C  CB    . GLN B 1 112 ? -15.902 106.941 -30.078 1.00 52.22  ? 153 GLN B CB    1 
ATOM   3260 C  CG    . GLN B 1 112 ? -15.166 106.551 -28.807 1.00 58.50  ? 153 GLN B CG    1 
ATOM   3261 C  CD    . GLN B 1 112 ? -15.674 107.283 -27.584 1.00 63.29  ? 153 GLN B CD    1 
ATOM   3262 O  OE1   . GLN B 1 112 ? -16.712 107.944 -27.628 1.00 71.86  ? 153 GLN B OE1   1 
ATOM   3263 N  NE2   . GLN B 1 112 ? -14.940 107.174 -26.483 1.00 59.50  ? 153 GLN B NE2   1 
ATOM   3264 N  N     . CYS B 1 113 ? -16.433 105.686 -33.252 1.00 50.72  ? 154 CYS B N     1 
ATOM   3265 C  CA    . CYS B 1 113 ? -17.015 104.655 -34.103 1.00 52.39  ? 154 CYS B CA    1 
ATOM   3266 C  C     . CYS B 1 113 ? -15.933 104.065 -34.994 1.00 47.61  ? 154 CYS B C     1 
ATOM   3267 O  O     . CYS B 1 113 ? -15.967 102.884 -35.334 1.00 46.04  ? 154 CYS B O     1 
ATOM   3268 C  CB    . CYS B 1 113 ? -18.156 105.216 -34.950 1.00 55.60  ? 154 CYS B CB    1 
ATOM   3269 S  SG    . CYS B 1 113 ? -19.769 105.150 -34.152 1.00 61.22  ? 154 CYS B SG    1 
ATOM   3270 N  N     . VAL B 1 114 ? -14.973 104.902 -35.370 1.00 48.22  ? 155 VAL B N     1 
ATOM   3271 C  CA    . VAL B 1 114 ? -13.828 104.452 -36.145 1.00 42.50  ? 155 VAL B CA    1 
ATOM   3272 C  C     . VAL B 1 114 ? -12.976 103.503 -35.308 1.00 45.31  ? 155 VAL B C     1 
ATOM   3273 O  O     . VAL B 1 114 ? -12.569 102.440 -35.777 1.00 44.27  ? 155 VAL B O     1 
ATOM   3274 C  CB    . VAL B 1 114 ? -12.973 105.639 -36.628 1.00 41.81  ? 155 VAL B CB    1 
ATOM   3275 C  CG1   . VAL B 1 114 ? -11.609 105.166 -37.064 1.00 39.10  ? 155 VAL B CG1   1 
ATOM   3276 C  CG2   . VAL B 1 114 ? -13.668 106.366 -37.767 1.00 49.62  ? 155 VAL B CG2   1 
ATOM   3277 N  N     . PHE B 1 115 ? -12.725 103.887 -34.061 1.00 36.11  ? 156 PHE B N     1 
ATOM   3278 C  CA    . PHE B 1 115 ? -11.942 103.064 -33.148 1.00 42.06  ? 156 PHE B CA    1 
ATOM   3279 C  C     . PHE B 1 115 ? -12.653 101.756 -32.806 1.00 41.23  ? 156 PHE B C     1 
ATOM   3280 O  O     . PHE B 1 115 ? -12.023 100.700 -32.725 1.00 35.74  ? 156 PHE B O     1 
ATOM   3281 C  CB    . PHE B 1 115 ? -11.628 103.841 -31.866 1.00 36.97  ? 156 PHE B CB    1 
ATOM   3282 C  CG    . PHE B 1 115 ? -10.323 104.586 -31.915 1.00 38.24  ? 156 PHE B CG    1 
ATOM   3283 C  CD1   . PHE B 1 115 ? -10.217 105.786 -32.599 1.00 35.34  ? 156 PHE B CD1   1 
ATOM   3284 C  CD2   . PHE B 1 115 ? -9.202  104.083 -31.276 1.00 30.45  ? 156 PHE B CD2   1 
ATOM   3285 C  CE1   . PHE B 1 115 ? -9.015  106.469 -32.646 1.00 40.55  ? 156 PHE B CE1   1 
ATOM   3286 C  CE2   . PHE B 1 115 ? -7.998  104.762 -31.318 1.00 30.35  ? 156 PHE B CE2   1 
ATOM   3287 C  CZ    . PHE B 1 115 ? -7.905  105.957 -32.003 1.00 32.96  ? 156 PHE B CZ    1 
ATOM   3288 N  N     . ALA B 1 116 ? -13.966 101.830 -32.615 1.00 42.40  ? 157 ALA B N     1 
ATOM   3289 C  CA    . ALA B 1 116 ? -14.751 100.666 -32.217 1.00 42.00  ? 157 ALA B CA    1 
ATOM   3290 C  C     . ALA B 1 116 ? -14.769 99.584  -33.293 1.00 40.04  ? 157 ALA B C     1 
ATOM   3291 O  O     . ALA B 1 116 ? -14.743 98.393  -32.985 1.00 35.88  ? 157 ALA B O     1 
ATOM   3292 C  CB    . ALA B 1 116 ? -16.174 101.084 -31.874 1.00 41.07  ? 157 ALA B CB    1 
ATOM   3293 N  N     . THR B 1 117 ? -14.807 100.002 -34.554 1.00 37.35  ? 158 THR B N     1 
ATOM   3294 C  CA    . THR B 1 117 ? -14.936 99.061  -35.662 1.00 40.61  ? 158 THR B CA    1 
ATOM   3295 C  C     . THR B 1 117 ? -13.591 98.632  -36.240 1.00 41.72  ? 158 THR B C     1 
ATOM   3296 O  O     . THR B 1 117 ? -13.542 97.854  -37.193 1.00 39.91  ? 158 THR B O     1 
ATOM   3297 C  CB    . THR B 1 117 ? -15.785 99.654  -36.804 1.00 43.12  ? 158 THR B CB    1 
ATOM   3298 O  OG1   . THR B 1 117 ? -15.137 100.819 -37.330 1.00 45.85  ? 158 THR B OG1   1 
ATOM   3299 C  CG2   . THR B 1 117 ? -17.163 100.037 -36.298 1.00 47.84  ? 158 THR B CG2   1 
ATOM   3300 N  N     . THR B 1 118 ? -12.503 99.135  -35.666 1.00 37.56  ? 159 THR B N     1 
ATOM   3301 C  CA    . THR B 1 118 ? -11.173 98.837  -36.188 1.00 35.22  ? 159 THR B CA    1 
ATOM   3302 C  C     . THR B 1 118 ? -10.262 98.193  -35.150 1.00 31.15  ? 159 THR B C     1 
ATOM   3303 O  O     . THR B 1 118 ? -9.551  97.236  -35.453 1.00 35.75  ? 159 THR B O     1 
ATOM   3304 C  CB    . THR B 1 118 ? -10.485 100.106 -36.726 1.00 40.32  ? 159 THR B CB    1 
ATOM   3305 O  OG1   . THR B 1 118 ? -10.549 101.143 -35.740 1.00 42.51  ? 159 THR B OG1   1 
ATOM   3306 C  CG2   . THR B 1 118 ? -11.169 100.583 -37.988 1.00 35.97  ? 159 THR B CG2   1 
ATOM   3307 N  N     . THR B 1 119 ? -10.278 98.721  -33.931 1.00 30.92  ? 160 THR B N     1 
ATOM   3308 C  CA    . THR B 1 119 ? -9.414  98.205  -32.874 1.00 29.98  ? 160 THR B CA    1 
ATOM   3309 C  C     . THR B 1 119 ? -9.885  96.838  -32.393 1.00 31.97  ? 160 THR B C     1 
ATOM   3310 O  O     . THR B 1 119 ? -11.072 96.631  -32.145 1.00 35.13  ? 160 THR B O     1 
ATOM   3311 C  CB    . THR B 1 119 ? -9.346  99.164  -31.672 1.00 27.21  ? 160 THR B CB    1 
ATOM   3312 O  OG1   . THR B 1 119 ? -10.660 99.360  -31.136 1.00 28.71  ? 160 THR B OG1   1 
ATOM   3313 C  CG2   . THR B 1 119 ? -8.766  100.507 -32.094 1.00 28.62  ? 160 THR B CG2   1 
ATOM   3314 N  N     . LYS B 1 120 ? -8.944  95.910  -32.261 1.00 30.58  ? 161 LYS B N     1 
ATOM   3315 C  CA    . LYS B 1 120 ? -9.259  94.553  -31.832 1.00 36.50  ? 161 LYS B CA    1 
ATOM   3316 C  C     . LYS B 1 120 ? -7.999  93.820  -31.389 1.00 30.22  ? 161 LYS B C     1 
ATOM   3317 O  O     . LYS B 1 120 ? -6.888  94.194  -31.770 1.00 24.60  ? 161 LYS B O     1 
ATOM   3318 C  CB    . LYS B 1 120 ? -9.948  93.784  -32.961 1.00 37.01  ? 161 LYS B CB    1 
ATOM   3319 C  CG    . LYS B 1 120 ? -9.076  93.589  -34.187 1.00 36.98  ? 161 LYS B CG    1 
ATOM   3320 C  CD    . LYS B 1 120 ? -9.903  93.174  -35.390 1.00 47.54  ? 161 LYS B CD    1 
ATOM   3321 C  CE    . LYS B 1 120 ? -9.019  92.771  -36.557 1.00 46.51  ? 161 LYS B CE    1 
ATOM   3322 N  NZ    . LYS B 1 120 ? -8.304  91.488  -36.308 1.00 53.32  ? 161 LYS B NZ    1 
ATOM   3323 N  N     . ARG B 1 121 ? -8.182  92.776  -30.584 1.00 31.65  ? 162 ARG B N     1 
ATOM   3324 C  CA    . ARG B 1 121 ? -7.069  91.969  -30.094 1.00 30.04  ? 162 ARG B CA    1 
ATOM   3325 C  C     . ARG B 1 121 ? -6.241  91.408  -31.241 1.00 30.01  ? 162 ARG B C     1 
ATOM   3326 O  O     . ARG B 1 121 ? -6.785  90.930  -32.235 1.00 28.77  ? 162 ARG B O     1 
ATOM   3327 C  CB    . ARG B 1 121 ? -7.579  90.823  -29.219 1.00 31.45  ? 162 ARG B CB    1 
ATOM   3328 C  CG    . ARG B 1 121 ? -8.335  91.271  -27.986 1.00 35.75  ? 162 ARG B CG    1 
ATOM   3329 C  CD    . ARG B 1 121 ? -8.852  90.082  -27.196 1.00 39.61  ? 162 ARG B CD    1 
ATOM   3330 N  NE    . ARG B 1 121 ? -9.688  90.494  -26.073 1.00 45.56  ? 162 ARG B NE    1 
ATOM   3331 C  CZ    . ARG B 1 121 ? -10.306 89.647  -25.256 1.00 55.49  ? 162 ARG B CZ    1 
ATOM   3332 N  NH1   . ARG B 1 121 ? -10.180 88.340  -25.441 1.00 50.26  ? 162 ARG B NH1   1 
ATOM   3333 N  NH2   . ARG B 1 121 ? -11.050 90.105  -24.258 1.00 50.65  ? 162 ARG B NH2   1 
ATOM   3334 N  N     . GLY B 1 122 ? -4.923  91.472  -31.097 1.00 26.85  ? 163 GLY B N     1 
ATOM   3335 C  CA    . GLY B 1 122 ? -4.024  90.977  -32.121 1.00 23.74  ? 163 GLY B CA    1 
ATOM   3336 C  C     . GLY B 1 122 ? -3.570  92.070  -33.068 1.00 25.02  ? 163 GLY B C     1 
ATOM   3337 O  O     . GLY B 1 122 ? -2.641  91.873  -33.852 1.00 26.43  ? 163 GLY B O     1 
ATOM   3338 N  N     . GLY B 1 123 ? -4.222  93.227  -32.996 1.00 27.24  ? 164 GLY B N     1 
ATOM   3339 C  CA    . GLY B 1 123 ? -3.888  94.346  -33.860 1.00 24.11  ? 164 GLY B CA    1 
ATOM   3340 C  C     . GLY B 1 123 ? -5.094  94.864  -34.622 1.00 31.02  ? 164 GLY B C     1 
ATOM   3341 O  O     . GLY B 1 123 ? -5.969  94.091  -35.011 1.00 28.60  ? 164 GLY B O     1 
ATOM   3342 N  N     . ALA B 1 124 ? -5.138  96.176  -34.836 1.00 30.44  ? 165 ALA B N     1 
ATOM   3343 C  CA    . ALA B 1 124 ? -6.259  96.806  -35.527 1.00 31.04  ? 165 ALA B CA    1 
ATOM   3344 C  C     . ALA B 1 124 ? -6.276  96.465  -37.014 1.00 29.07  ? 165 ALA B C     1 
ATOM   3345 O  O     . ALA B 1 124 ? -5.258  96.066  -37.583 1.00 26.60  ? 165 ALA B O     1 
ATOM   3346 C  CB    . ALA B 1 124 ? -6.217  98.314  -35.336 1.00 28.18  ? 165 ALA B CB    1 
ATOM   3347 N  N     . LEU B 1 125 ? -7.443  96.626  -37.631 1.00 29.07  ? 166 LEU B N     1 
ATOM   3348 C  CA    . LEU B 1 125 ? -7.614  96.375  -39.058 1.00 33.81  ? 166 LEU B CA    1 
ATOM   3349 C  C     . LEU B 1 125 ? -6.685  97.255  -39.885 1.00 32.98  ? 166 LEU B C     1 
ATOM   3350 O  O     . LEU B 1 125 ? -6.499  98.431  -39.577 1.00 31.24  ? 166 LEU B O     1 
ATOM   3351 C  CB    . LEU B 1 125 ? -9.068  96.613  -39.469 1.00 32.54  ? 166 LEU B CB    1 
ATOM   3352 C  CG    . LEU B 1 125 ? -10.095 95.597  -38.968 1.00 34.56  ? 166 LEU B CG    1 
ATOM   3353 C  CD1   . LEU B 1 125 ? -11.504 96.131  -39.167 1.00 40.35  ? 166 LEU B CD1   1 
ATOM   3354 C  CD2   . LEU B 1 125 ? -9.919  94.273  -39.690 1.00 37.73  ? 166 LEU B CD2   1 
ATOM   3355 N  N     . LYS B 1 126 ? -6.104  96.680  -40.933 1.00 28.33  ? 167 LYS B N     1 
ATOM   3356 C  CA    . LYS B 1 126 ? -5.157  97.401  -41.775 1.00 35.65  ? 167 LYS B CA    1 
ATOM   3357 C  C     . LYS B 1 126 ? -5.783  97.850  -43.092 1.00 37.65  ? 167 LYS B C     1 
ATOM   3358 O  O     . LYS B 1 126 ? -5.309  98.796  -43.721 1.00 35.67  ? 167 LYS B O     1 
ATOM   3359 C  CB    . LYS B 1 126 ? -3.930  96.535  -42.063 1.00 39.97  ? 167 LYS B CB    1 
ATOM   3360 C  CG    . LYS B 1 126 ? -3.311  95.899  -40.834 1.00 32.01  ? 167 LYS B CG    1 
ATOM   3361 C  CD    . LYS B 1 126 ? -1.992  95.229  -41.172 1.00 36.97  ? 167 LYS B CD    1 
ATOM   3362 C  CE    . LYS B 1 126 ? -1.373  94.591  -39.944 1.00 37.54  ? 167 LYS B CE    1 
ATOM   3363 N  NZ    . LYS B 1 126 ? 0.048   94.219  -40.197 1.00 39.75  ? 167 LYS B NZ    1 
ATOM   3364 N  N     . LYS B 1 127 ? -6.845  97.168  -43.507 1.00 36.70  ? 168 LYS B N     1 
ATOM   3365 C  CA    . LYS B 1 127 ? -7.459  97.440  -44.801 1.00 40.60  ? 168 LYS B CA    1 
ATOM   3366 C  C     . LYS B 1 127 ? -8.933  97.806  -44.689 1.00 32.91  ? 168 LYS B C     1 
ATOM   3367 O  O     . LYS B 1 127 ? -9.624  97.392  -43.758 1.00 33.74  ? 168 LYS B O     1 
ATOM   3368 C  CB    . LYS B 1 127 ? -7.297  96.234  -45.727 1.00 39.87  ? 168 LYS B CB    1 
ATOM   3369 C  CG    . LYS B 1 127 ? -5.883  96.035  -46.236 1.00 47.32  ? 168 LYS B CG    1 
ATOM   3370 C  CD    . LYS B 1 127 ? -5.818  94.911  -47.253 1.00 59.98  ? 168 LYS B CD    1 
ATOM   3371 C  CE    . LYS B 1 127 ? -4.484  94.908  -47.985 1.00 62.60  ? 168 LYS B CE    1 
ATOM   3372 N  NZ    . LYS B 1 127 ? -4.448  93.865  -49.046 1.00 67.88  ? 168 LYS B NZ    1 
ATOM   3373 N  N     . GLY B 1 128 ? -9.407  98.587  -45.654 1.00 40.46  ? 169 GLY B N     1 
ATOM   3374 C  CA    . GLY B 1 128 ? -10.792 99.014  -45.680 1.00 41.08  ? 169 GLY B CA    1 
ATOM   3375 C  C     . GLY B 1 128 ? -10.940 100.479 -45.322 1.00 45.86  ? 169 GLY B C     1 
ATOM   3376 O  O     . GLY B 1 128 ? -9.993  101.103 -44.845 1.00 44.24  ? 169 GLY B O     1 
ATOM   3377 N  N     . PRO B 1 129 ? -12.136 101.038 -45.558 1.00 50.45  ? 170 PRO B N     1 
ATOM   3378 C  CA    . PRO B 1 129 ? -12.438 102.444 -45.273 1.00 49.66  ? 170 PRO B CA    1 
ATOM   3379 C  C     . PRO B 1 129 ? -12.287 102.792 -43.796 1.00 41.85  ? 170 PRO B C     1 
ATOM   3380 O  O     . PRO B 1 129 ? -11.742 103.845 -43.469 1.00 45.78  ? 170 PRO B O     1 
ATOM   3381 C  CB    . PRO B 1 129 ? -13.898 102.585 -45.716 1.00 49.41  ? 170 PRO B CB    1 
ATOM   3382 C  CG    . PRO B 1 129 ? -14.098 101.494 -46.705 1.00 53.74  ? 170 PRO B CG    1 
ATOM   3383 C  CD    . PRO B 1 129 ? -13.269 100.354 -46.203 1.00 49.48  ? 170 PRO B CD    1 
ATOM   3384 N  N     . ASN B 1 130 ? -12.770 101.918 -42.919 1.00 42.13  ? 171 ASN B N     1 
ATOM   3385 C  CA    . ASN B 1 130 ? -12.672 102.149 -41.483 1.00 44.48  ? 171 ASN B CA    1 
ATOM   3386 C  C     . ASN B 1 130 ? -11.221 102.174 -41.014 1.00 44.02  ? 171 ASN B C     1 
ATOM   3387 O  O     . ASN B 1 130 ? -10.838 103.010 -40.194 1.00 40.71  ? 171 ASN B O     1 
ATOM   3388 C  CB    . ASN B 1 130 ? -13.456 101.083 -40.715 1.00 42.67  ? 171 ASN B CB    1 
ATOM   3389 C  CG    . ASN B 1 130 ? -14.944 101.144 -40.991 1.00 45.70  ? 171 ASN B CG    1 
ATOM   3390 O  OD1   . ASN B 1 130 ? -15.460 102.164 -41.448 1.00 50.86  ? 171 ASN B OD1   1 
ATOM   3391 N  ND2   . ASN B 1 130 ? -15.646 100.052 -40.707 1.00 45.38  ? 171 ASN B ND2   1 
ATOM   3392 N  N     . ALA B 1 131 ? -10.419 101.254 -41.542 1.00 37.36  ? 172 ALA B N     1 
ATOM   3393 C  CA    . ALA B 1 131 ? -9.007  101.164 -41.187 1.00 38.76  ? 172 ALA B CA    1 
ATOM   3394 C  C     . ALA B 1 131 ? -8.244  102.411 -41.628 1.00 41.38  ? 172 ALA B C     1 
ATOM   3395 O  O     . ALA B 1 131 ? -7.329  102.864 -40.939 1.00 34.52  ? 172 ALA B O     1 
ATOM   3396 C  CB    . ALA B 1 131 ? -8.387  99.918  -41.798 1.00 30.66  ? 172 ALA B CB    1 
ATOM   3397 N  N     . LYS B 1 132 ? -8.625  102.963 -42.777 1.00 39.54  ? 173 LYS B N     1 
ATOM   3398 C  CA    . LYS B 1 132 ? -8.003  104.179 -43.290 1.00 39.77  ? 173 LYS B CA    1 
ATOM   3399 C  C     . LYS B 1 132 ? -8.426  105.403 -42.485 1.00 37.32  ? 173 LYS B C     1 
ATOM   3400 O  O     . LYS B 1 132 ? -7.653  106.348 -42.325 1.00 39.24  ? 173 LYS B O     1 
ATOM   3401 C  CB    . LYS B 1 132 ? -8.346  104.378 -44.769 1.00 36.52  ? 173 LYS B CB    1 
ATOM   3402 C  CG    . LYS B 1 132 ? -7.521  103.516 -45.713 1.00 51.23  ? 173 LYS B CG    1 
ATOM   3403 C  CD    . LYS B 1 132 ? -7.889  103.758 -47.170 1.00 60.18  ? 173 LYS B CD    1 
ATOM   3404 C  CE    . LYS B 1 132 ? -6.961  102.993 -48.106 1.00 61.72  ? 173 LYS B CE    1 
ATOM   3405 N  NZ    . LYS B 1 132 ? -7.361  103.149 -49.534 1.00 79.08  ? 173 LYS B NZ    1 
ATOM   3406 N  N     . ALA B 1 133 ? -9.657  105.382 -41.982 1.00 33.59  ? 174 ALA B N     1 
ATOM   3407 C  CA    . ALA B 1 133 ? -10.151 106.463 -41.141 1.00 35.49  ? 174 ALA B CA    1 
ATOM   3408 C  C     . ALA B 1 133 ? -9.413  106.454 -39.811 1.00 40.36  ? 174 ALA B C     1 
ATOM   3409 O  O     . ALA B 1 133 ? -9.165  107.504 -39.219 1.00 39.92  ? 174 ALA B O     1 
ATOM   3410 C  CB    . ALA B 1 133 ? -11.647 106.335 -40.926 1.00 32.08  ? 174 ALA B CB    1 
ATOM   3411 N  N     . LEU B 1 134 ? -9.064  105.257 -39.351 1.00 36.93  ? 175 LEU B N     1 
ATOM   3412 C  CA    . LEU B 1 134 ? -8.292  105.099 -38.127 1.00 35.23  ? 175 LEU B CA    1 
ATOM   3413 C  C     . LEU B 1 134 ? -6.882  105.639 -38.307 1.00 34.38  ? 175 LEU B C     1 
ATOM   3414 O  O     . LEU B 1 134 ? -6.354  106.316 -37.429 1.00 28.86  ? 175 LEU B O     1 
ATOM   3415 C  CB    . LEU B 1 134 ? -8.244  103.631 -37.705 1.00 29.19  ? 175 LEU B CB    1 
ATOM   3416 C  CG    . LEU B 1 134 ? -7.430  103.350 -36.440 1.00 32.30  ? 175 LEU B CG    1 
ATOM   3417 C  CD1   . LEU B 1 134 ? -8.046  104.048 -35.235 1.00 30.41  ? 175 LEU B CD1   1 
ATOM   3418 C  CD2   . LEU B 1 134 ? -7.294  101.857 -36.189 1.00 27.22  ? 175 LEU B CD2   1 
ATOM   3419 N  N     . GLN B 1 135 ? -6.284  105.340 -39.456 1.00 30.70  ? 176 GLN B N     1 
ATOM   3420 C  CA    . GLN B 1 135 ? -4.926  105.777 -39.758 1.00 31.83  ? 176 GLN B CA    1 
ATOM   3421 C  C     . GLN B 1 135 ? -4.812  107.302 -39.760 1.00 37.20  ? 176 GLN B C     1 
ATOM   3422 O  O     . GLN B 1 135 ? -3.777  107.858 -39.391 1.00 35.09  ? 176 GLN B O     1 
ATOM   3423 C  CB    . GLN B 1 135 ? -4.477  105.212 -41.107 1.00 30.91  ? 176 GLN B CB    1 
ATOM   3424 C  CG    . GLN B 1 135 ? -3.035  105.526 -41.460 1.00 32.45  ? 176 GLN B CG    1 
ATOM   3425 C  CD    . GLN B 1 135 ? -2.061  105.020 -40.415 1.00 35.86  ? 176 GLN B CD    1 
ATOM   3426 O  OE1   . GLN B 1 135 ? -1.485  105.801 -39.656 1.00 38.43  ? 176 GLN B OE1   1 
ATOM   3427 N  NE2   . GLN B 1 135 ? -1.869  103.707 -40.371 1.00 31.35  ? 176 GLN B NE2   1 
ATOM   3428 N  N     . VAL B 1 136 ? -5.883  107.973 -40.171 1.00 36.61  ? 177 VAL B N     1 
ATOM   3429 C  CA    . VAL B 1 136 ? -5.905  109.431 -40.207 1.00 36.18  ? 177 VAL B CA    1 
ATOM   3430 C  C     . VAL B 1 136 ? -6.131  110.024 -38.820 1.00 32.66  ? 177 VAL B C     1 
ATOM   3431 O  O     . VAL B 1 136 ? -5.388  110.902 -38.381 1.00 28.66  ? 177 VAL B O     1 
ATOM   3432 C  CB    . VAL B 1 136 ? -6.997  109.951 -41.159 1.00 42.32  ? 177 VAL B CB    1 
ATOM   3433 C  CG1   . VAL B 1 136 ? -7.175  111.453 -40.998 1.00 35.36  ? 177 VAL B CG1   1 
ATOM   3434 C  CG2   . VAL B 1 136 ? -6.660  109.591 -42.598 1.00 34.68  ? 177 VAL B CG2   1 
ATOM   3435 N  N     . MET B 1 137 ? -7.155  109.533 -38.130 1.00 28.37  ? 178 MET B N     1 
ATOM   3436 C  CA    . MET B 1 137 ? -7.529  110.079 -36.829 1.00 32.61  ? 178 MET B CA    1 
ATOM   3437 C  C     . MET B 1 137 ? -6.525  109.723 -35.733 1.00 31.02  ? 178 MET B C     1 
ATOM   3438 O  O     . MET B 1 137 ? -6.454  110.401 -34.708 1.00 31.25  ? 178 MET B O     1 
ATOM   3439 C  CB    . MET B 1 137 ? -8.927  109.597 -36.437 1.00 34.68  ? 178 MET B CB    1 
ATOM   3440 C  CG    . MET B 1 137 ? -10.022 110.052 -37.393 1.00 39.95  ? 178 MET B CG    1 
ATOM   3441 S  SD    . MET B 1 137 ? -11.680 109.607 -36.841 1.00 44.78  ? 178 MET B SD    1 
ATOM   3442 C  CE    . MET B 1 137 ? -12.671 110.263 -38.181 1.00 46.95  ? 178 MET B CE    1 
ATOM   3443 N  N     . LYS B 1 138 ? -5.750  108.664 -35.949 1.00 28.76  ? 179 LYS B N     1 
ATOM   3444 C  CA    . LYS B 1 138 ? -4.732  108.251 -34.985 1.00 31.20  ? 179 LYS B CA    1 
ATOM   3445 C  C     . LYS B 1 138 ? -3.632  109.291 -34.841 1.00 28.28  ? 179 LYS B C     1 
ATOM   3446 O  O     . LYS B 1 138 ? -2.981  109.380 -33.800 1.00 30.62  ? 179 LYS B O     1 
ATOM   3447 C  CB    . LYS B 1 138 ? -4.113  106.913 -35.392 1.00 27.86  ? 179 LYS B CB    1 
ATOM   3448 C  CG    . LYS B 1 138 ? -4.668  105.720 -34.642 1.00 38.32  ? 179 LYS B CG    1 
ATOM   3449 C  CD    . LYS B 1 138 ? -4.237  104.408 -35.283 1.00 33.10  ? 179 LYS B CD    1 
ATOM   3450 C  CE    . LYS B 1 138 ? -2.754  104.387 -35.599 1.00 30.12  ? 179 LYS B CE    1 
ATOM   3451 N  NZ    . LYS B 1 138 ? -2.328  103.066 -36.136 1.00 32.02  ? 179 LYS B NZ    1 
ATOM   3452 N  N     . GLN B 1 139 ? -3.428  110.077 -35.892 1.00 25.63  ? 180 GLN B N     1 
ATOM   3453 C  CA    . GLN B 1 139 ? -2.337  111.043 -35.927 1.00 29.89  ? 180 GLN B CA    1 
ATOM   3454 C  C     . GLN B 1 139 ? -2.587  112.225 -35.001 1.00 29.24  ? 180 GLN B C     1 
ATOM   3455 O  O     . GLN B 1 139 ? -1.695  113.040 -34.778 1.00 31.37  ? 180 GLN B O     1 
ATOM   3456 C  CB    . GLN B 1 139 ? -2.115  111.534 -37.358 1.00 24.84  ? 180 GLN B CB    1 
ATOM   3457 C  CG    . GLN B 1 139 ? -1.890  110.405 -38.344 1.00 27.61  ? 180 GLN B CG    1 
ATOM   3458 C  CD    . GLN B 1 139 ? -1.698  110.884 -39.768 1.00 33.56  ? 180 GLN B CD    1 
ATOM   3459 O  OE1   . GLN B 1 139 ? -1.981  110.155 -40.718 1.00 33.54  ? 180 GLN B OE1   1 
ATOM   3460 N  NE2   . GLN B 1 139 ? -1.206  112.108 -39.925 1.00 30.21  ? 180 GLN B NE2   1 
ATOM   3461 N  N     . THR B 1 140 ? -3.801  112.313 -34.465 1.00 25.18  ? 181 THR B N     1 
ATOM   3462 C  CA    . THR B 1 140 ? -4.168  113.391 -33.552 1.00 31.65  ? 181 THR B CA    1 
ATOM   3463 C  C     . THR B 1 140 ? -4.659  112.828 -32.222 1.00 35.07  ? 181 THR B C     1 
ATOM   3464 O  O     . THR B 1 140 ? -5.613  112.050 -32.181 1.00 36.16  ? 181 THR B O     1 
ATOM   3465 C  CB    . THR B 1 140 ? -5.260  114.301 -34.155 1.00 38.31  ? 181 THR B CB    1 
ATOM   3466 O  OG1   . THR B 1 140 ? -4.798  114.856 -35.392 1.00 35.37  ? 181 THR B OG1   1 
ATOM   3467 C  CG2   . THR B 1 140 ? -5.603  115.434 -33.198 1.00 41.18  ? 181 THR B CG2   1 
ATOM   3468 N  N     . LEU B 1 141 ? -4.002  113.224 -31.137 1.00 29.24  ? 182 LEU B N     1 
ATOM   3469 C  CA    . LEU B 1 141 ? -4.351  112.738 -29.809 1.00 30.93  ? 182 LEU B CA    1 
ATOM   3470 C  C     . LEU B 1 141 ? -5.533  113.508 -29.230 1.00 36.44  ? 182 LEU B C     1 
ATOM   3471 O  O     . LEU B 1 141 ? -5.653  114.715 -29.432 1.00 39.32  ? 182 LEU B O     1 
ATOM   3472 C  CB    . LEU B 1 141 ? -3.147  112.840 -28.870 1.00 30.84  ? 182 LEU B CB    1 
ATOM   3473 C  CG    . LEU B 1 141 ? -1.904  112.048 -29.281 1.00 35.03  ? 182 LEU B CG    1 
ATOM   3474 C  CD1   . LEU B 1 141 ? -0.748  112.347 -28.339 1.00 26.23  ? 182 LEU B CD1   1 
ATOM   3475 C  CD2   . LEU B 1 141 ? -2.197  110.553 -29.319 1.00 24.26  ? 182 LEU B CD2   1 
ATOM   3476 N  N     . PRO B 1 142 ? -6.413  112.804 -28.503 1.00 32.88  ? 183 PRO B N     1 
ATOM   3477 C  CA    . PRO B 1 142 ? -7.576  113.405 -27.845 1.00 34.32  ? 183 PRO B CA    1 
ATOM   3478 C  C     . PRO B 1 142 ? -7.211  114.030 -26.502 1.00 33.72  ? 183 PRO B C     1 
ATOM   3479 O  O     . PRO B 1 142 ? -8.094  114.398 -25.729 1.00 40.84  ? 183 PRO B O     1 
ATOM   3480 C  CB    . PRO B 1 142 ? -8.512  112.214 -27.654 1.00 30.02  ? 183 PRO B CB    1 
ATOM   3481 C  CG    . PRO B 1 142 ? -7.582  111.069 -27.452 1.00 28.86  ? 183 PRO B CG    1 
ATOM   3482 C  CD    . PRO B 1 142 ? -6.372  111.344 -28.312 1.00 28.56  ? 183 PRO B CD    1 
ATOM   3483 N  N     . TYR B 1 143 ? -5.914  114.139 -26.235 1.00 33.79  ? 184 TYR B N     1 
ATOM   3484 C  CA    . TYR B 1 143 ? -5.428  114.717 -24.990 1.00 36.06  ? 184 TYR B CA    1 
ATOM   3485 C  C     . TYR B 1 143 ? -4.134  115.482 -25.234 1.00 36.50  ? 184 TYR B C     1 
ATOM   3486 O  O     . TYR B 1 143 ? -3.555  115.407 -26.318 1.00 42.12  ? 184 TYR B O     1 
ATOM   3487 C  CB    . TYR B 1 143 ? -5.210  113.626 -23.938 1.00 35.04  ? 184 TYR B CB    1 
ATOM   3488 C  CG    . TYR B 1 143 ? -4.224  112.555 -24.360 1.00 33.38  ? 184 TYR B CG    1 
ATOM   3489 C  CD1   . TYR B 1 143 ? -4.646  111.428 -25.055 1.00 28.22  ? 184 TYR B CD1   1 
ATOM   3490 C  CD2   . TYR B 1 143 ? -2.870  112.672 -24.065 1.00 34.68  ? 184 TYR B CD2   1 
ATOM   3491 C  CE1   . TYR B 1 143 ? -3.749  110.447 -25.443 1.00 28.80  ? 184 TYR B CE1   1 
ATOM   3492 C  CE2   . TYR B 1 143 ? -1.965  111.698 -24.452 1.00 32.83  ? 184 TYR B CE2   1 
ATOM   3493 C  CZ    . TYR B 1 143 ? -2.410  110.588 -25.139 1.00 32.03  ? 184 TYR B CZ    1 
ATOM   3494 O  OH    . TYR B 1 143 ? -1.512  109.618 -25.522 1.00 30.58  ? 184 TYR B OH    1 
ATOM   3495 N  N     . SER B 1 144 ? -3.685  116.216 -24.223 1.00 40.03  ? 185 SER B N     1 
ATOM   3496 C  CA    . SER B 1 144 ? -2.442  116.968 -24.326 1.00 44.74  ? 185 SER B CA    1 
ATOM   3497 C  C     . SER B 1 144 ? -1.294  116.200 -23.681 1.00 40.14  ? 185 SER B C     1 
ATOM   3498 O  O     . SER B 1 144 ? -1.409  115.724 -22.551 1.00 38.59  ? 185 SER B O     1 
ATOM   3499 C  CB    . SER B 1 144 ? -2.589  118.347 -23.679 1.00 54.20  ? 185 SER B CB    1 
ATOM   3500 O  OG    . SER B 1 144 ? -1.406  119.111 -23.835 1.00 58.99  ? 185 SER B OG    1 
ATOM   3501 N  N     . VAL B 1 145 ? -0.188  116.084 -24.409 1.00 42.10  ? 186 VAL B N     1 
ATOM   3502 C  CA    . VAL B 1 145 ? 0.987   115.379 -23.913 1.00 38.86  ? 186 VAL B CA    1 
ATOM   3503 C  C     . VAL B 1 145 ? 1.627   116.108 -22.736 1.00 47.47  ? 186 VAL B C     1 
ATOM   3504 O  O     . VAL B 1 145 ? 2.392   115.520 -21.973 1.00 50.90  ? 186 VAL B O     1 
ATOM   3505 C  CB    . VAL B 1 145 ? 2.041   115.197 -25.021 1.00 47.81  ? 186 VAL B CB    1 
ATOM   3506 C  CG1   . VAL B 1 145 ? 1.566   114.180 -26.047 1.00 45.52  ? 186 VAL B CG1   1 
ATOM   3507 C  CG2   . VAL B 1 145 ? 2.353   116.533 -25.681 1.00 46.20  ? 186 VAL B CG2   1 
ATOM   3508 N  N     . ALA B 1 146 ? 1.307   117.390 -22.592 1.00 43.63  ? 187 ALA B N     1 
ATOM   3509 C  CA    . ALA B 1 146 ? 1.868   118.212 -21.527 1.00 49.98  ? 187 ALA B CA    1 
ATOM   3510 C  C     . ALA B 1 146 ? 1.204   117.935 -20.181 1.00 50.31  ? 187 ALA B C     1 
ATOM   3511 O  O     . ALA B 1 146 ? 1.815   118.122 -19.130 1.00 52.71  ? 187 ALA B O     1 
ATOM   3512 C  CB    . ALA B 1 146 ? 1.741   119.688 -21.879 1.00 44.91  ? 187 ALA B CB    1 
ATOM   3513 N  N     . ASP B 1 147 ? -0.048  117.487 -20.217 1.00 47.43  ? 188 ASP B N     1 
ATOM   3514 C  CA    . ASP B 1 147 ? -0.824  117.280 -18.998 1.00 47.12  ? 188 ASP B CA    1 
ATOM   3515 C  C     . ASP B 1 147 ? -0.568  115.917 -18.361 1.00 47.41  ? 188 ASP B C     1 
ATOM   3516 O  O     . ASP B 1 147 ? -1.242  115.539 -17.401 1.00 53.18  ? 188 ASP B O     1 
ATOM   3517 C  CB    . ASP B 1 147 ? -2.318  117.436 -19.287 1.00 50.73  ? 188 ASP B CB    1 
ATOM   3518 C  CG    . ASP B 1 147 ? -2.659  118.791 -19.876 1.00 58.92  ? 188 ASP B CG    1 
ATOM   3519 O  OD1   . ASP B 1 147 ? -1.863  119.737 -19.692 1.00 63.07  ? 188 ASP B OD1   1 
ATOM   3520 O  OD2   . ASP B 1 147 ? -3.724  118.910 -20.519 1.00 57.48  ? 188 ASP B OD2   1 
ATOM   3521 N  N     . LEU B 1 148 ? 0.402   115.180 -18.894 1.00 40.39  ? 189 LEU B N     1 
ATOM   3522 C  CA    . LEU B 1 148 ? 0.718   113.855 -18.370 1.00 40.00  ? 189 LEU B CA    1 
ATOM   3523 C  C     . LEU B 1 148 ? 1.854   113.905 -17.355 1.00 36.48  ? 189 LEU B C     1 
ATOM   3524 O  O     . LEU B 1 148 ? 2.869   114.567 -17.572 1.00 36.85  ? 189 LEU B O     1 
ATOM   3525 C  CB    . LEU B 1 148 ? 1.076   112.896 -19.507 1.00 35.75  ? 189 LEU B CB    1 
ATOM   3526 C  CG    . LEU B 1 148 ? -0.048  112.560 -20.489 1.00 41.33  ? 189 LEU B CG    1 
ATOM   3527 C  CD1   . LEU B 1 148 ? 0.383   111.453 -21.441 1.00 30.29  ? 189 LEU B CD1   1 
ATOM   3528 C  CD2   . LEU B 1 148 ? -1.326  112.178 -19.748 1.00 31.52  ? 189 LEU B CD2   1 
ATOM   3529 N  N     . GLU B 1 149 ? 1.676   113.190 -16.250 1.00 34.92  ? 190 GLU B N     1 
ATOM   3530 C  CA    . GLU B 1 149 ? 2.671   113.148 -15.187 1.00 35.08  ? 190 GLU B CA    1 
ATOM   3531 C  C     . GLU B 1 149 ? 3.235   111.737 -15.029 1.00 30.05  ? 190 GLU B C     1 
ATOM   3532 O  O     . GLU B 1 149 ? 2.615   110.877 -14.403 1.00 31.44  ? 190 GLU B O     1 
ATOM   3533 C  CB    . GLU B 1 149 ? 2.057   113.636 -13.875 1.00 41.77  ? 190 GLU B CB    1 
ATOM   3534 C  CG    . GLU B 1 149 ? 3.017   113.698 -12.702 1.00 44.88  ? 190 GLU B CG    1 
ATOM   3535 C  CD    . GLU B 1 149 ? 2.379   114.316 -11.470 1.00 56.26  ? 190 GLU B CD    1 
ATOM   3536 O  OE1   . GLU B 1 149 ? 1.428   115.113 -11.626 1.00 49.69  ? 190 GLU B OE1   1 
ATOM   3537 O  OE2   . GLU B 1 149 ? 2.821   114.000 -10.345 1.00 57.35  ? 190 GLU B OE2   1 
ATOM   3538 N  N     . TRP B 1 150 ? 4.416   111.510 -15.597 1.00 27.90  ? 191 TRP B N     1 
ATOM   3539 C  CA    . TRP B 1 150 ? 5.008   110.175 -15.648 1.00 29.77  ? 191 TRP B CA    1 
ATOM   3540 C  C     . TRP B 1 150 ? 5.866   109.839 -14.434 1.00 32.73  ? 191 TRP B C     1 
ATOM   3541 O  O     . TRP B 1 150 ? 6.373   110.729 -13.753 1.00 31.40  ? 191 TRP B O     1 
ATOM   3542 C  CB    . TRP B 1 150 ? 5.857   110.027 -16.911 1.00 27.56  ? 191 TRP B CB    1 
ATOM   3543 C  CG    . TRP B 1 150 ? 5.070   110.071 -18.176 1.00 30.59  ? 191 TRP B CG    1 
ATOM   3544 C  CD1   . TRP B 1 150 ? 4.717   111.181 -18.887 1.00 32.20  ? 191 TRP B CD1   1 
ATOM   3545 C  CD2   . TRP B 1 150 ? 4.540   108.951 -18.889 1.00 27.16  ? 191 TRP B CD2   1 
ATOM   3546 N  NE1   . TRP B 1 150 ? 3.997   110.820 -20.001 1.00 27.26  ? 191 TRP B NE1   1 
ATOM   3547 C  CE2   . TRP B 1 150 ? 3.873   109.455 -20.025 1.00 27.21  ? 191 TRP B CE2   1 
ATOM   3548 C  CE3   . TRP B 1 150 ? 4.561   107.568 -18.677 1.00 26.92  ? 191 TRP B CE3   1 
ATOM   3549 C  CZ2   . TRP B 1 150 ? 3.236   108.627 -20.946 1.00 25.11  ? 191 TRP B CZ2   1 
ATOM   3550 C  CZ3   . TRP B 1 150 ? 3.928   106.747 -19.592 1.00 25.39  ? 191 TRP B CZ3   1 
ATOM   3551 C  CH2   . TRP B 1 150 ? 3.275   107.279 -20.713 1.00 23.12  ? 191 TRP B CH2   1 
ATOM   3552 N  N     . ASP B 1 151 ? 6.032   108.543 -14.177 1.00 30.60  ? 192 ASP B N     1 
ATOM   3553 C  CA    . ASP B 1 151 ? 6.944   108.088 -13.136 1.00 25.71  ? 192 ASP B CA    1 
ATOM   3554 C  C     . ASP B 1 151 ? 8.379   108.146 -13.649 1.00 32.19  ? 192 ASP B C     1 
ATOM   3555 O  O     . ASP B 1 151 ? 8.620   108.558 -14.784 1.00 32.96  ? 192 ASP B O     1 
ATOM   3556 C  CB    . ASP B 1 151 ? 6.590   106.672 -12.663 1.00 31.83  ? 192 ASP B CB    1 
ATOM   3557 C  CG    . ASP B 1 151 ? 6.469   105.674 -13.804 1.00 31.10  ? 192 ASP B CG    1 
ATOM   3558 O  OD1   . ASP B 1 151 ? 6.832   106.011 -14.950 1.00 27.69  ? 192 ASP B OD1   1 
ATOM   3559 O  OD2   . ASP B 1 151 ? 6.014   104.540 -13.544 1.00 35.54  ? 192 ASP B OD2   1 
ATOM   3560 N  N     . ALA B 1 152 ? 9.323   107.733 -12.810 1.00 31.40  ? 193 ALA B N     1 
ATOM   3561 C  CA    . ALA B 1 152 ? 10.743  107.848 -13.125 1.00 30.39  ? 193 ALA B CA    1 
ATOM   3562 C  C     . ALA B 1 152 ? 11.119  107.102 -14.402 1.00 32.33  ? 193 ALA B C     1 
ATOM   3563 O  O     . ALA B 1 152 ? 11.850  107.624 -15.241 1.00 33.67  ? 193 ALA B O     1 
ATOM   3564 C  CB    . ALA B 1 152 ? 11.579  107.345 -11.959 1.00 34.18  ? 193 ALA B CB    1 
ATOM   3565 N  N     . GLY B 1 153 ? 10.610  105.884 -14.550 1.00 32.28  ? 194 GLY B N     1 
ATOM   3566 C  CA    . GLY B 1 153 ? 10.956  105.056 -15.690 1.00 30.43  ? 194 GLY B CA    1 
ATOM   3567 C  C     . GLY B 1 153 ? 10.076  105.277 -16.905 1.00 30.50  ? 194 GLY B C     1 
ATOM   3568 O  O     . GLY B 1 153 ? 10.197  104.554 -17.893 1.00 31.40  ? 194 GLY B O     1 
ATOM   3569 N  N     . HIS B 1 154 ? 9.195   106.272 -16.828 1.00 31.92  ? 195 HIS B N     1 
ATOM   3570 C  CA    . HIS B 1 154 ? 8.265   106.594 -17.910 1.00 31.20  ? 195 HIS B CA    1 
ATOM   3571 C  C     . HIS B 1 154 ? 7.444   105.374 -18.319 1.00 34.94  ? 195 HIS B C     1 
ATOM   3572 O  O     . HIS B 1 154 ? 7.270   105.099 -19.508 1.00 27.79  ? 195 HIS B O     1 
ATOM   3573 C  CB    . HIS B 1 154 ? 9.016   107.148 -19.123 1.00 30.48  ? 195 HIS B CB    1 
ATOM   3574 C  CG    . HIS B 1 154 ? 8.201   108.075 -19.970 1.00 26.62  ? 195 HIS B CG    1 
ATOM   3575 N  ND1   . HIS B 1 154 ? 8.356   109.443 -19.934 1.00 28.15  ? 195 HIS B ND1   1 
ATOM   3576 C  CD2   . HIS B 1 154 ? 7.219   107.832 -20.871 1.00 26.69  ? 195 HIS B CD2   1 
ATOM   3577 C  CE1   . HIS B 1 154 ? 7.510   110.004 -20.779 1.00 24.82  ? 195 HIS B CE1   1 
ATOM   3578 N  NE2   . HIS B 1 154 ? 6.808   109.048 -21.360 1.00 28.97  ? 195 HIS B NE2   1 
ATOM   3579 N  N     . LYS B 1 155 ? 6.952   104.640 -17.327 1.00 30.35  ? 196 LYS B N     1 
ATOM   3580 C  CA    . LYS B 1 155 ? 6.162   103.442 -17.579 1.00 28.04  ? 196 LYS B CA    1 
ATOM   3581 C  C     . LYS B 1 155 ? 4.681   103.723 -17.365 1.00 33.00  ? 196 LYS B C     1 
ATOM   3582 O  O     . LYS B 1 155 ? 3.830   103.261 -18.128 1.00 30.67  ? 196 LYS B O     1 
ATOM   3583 C  CB    . LYS B 1 155 ? 6.615   102.296 -16.671 1.00 29.68  ? 196 LYS B CB    1 
ATOM   3584 C  CG    . LYS B 1 155 ? 8.075   101.897 -16.830 1.00 33.14  ? 196 LYS B CG    1 
ATOM   3585 C  CD    . LYS B 1 155 ? 8.356   101.315 -18.206 1.00 27.04  ? 196 LYS B CD    1 
ATOM   3586 C  CE    . LYS B 1 155 ? 9.708   100.621 -18.236 1.00 30.06  ? 196 LYS B CE    1 
ATOM   3587 N  NZ    . LYS B 1 155 ? 10.804  101.510 -17.761 1.00 32.36  ? 196 LYS B NZ    1 
ATOM   3588 N  N     . THR B 1 156 ? 4.381   104.478 -16.313 1.00 25.79  ? 197 THR B N     1 
ATOM   3589 C  CA    . THR B 1 156 ? 3.007   104.829 -15.977 1.00 27.37  ? 197 THR B CA    1 
ATOM   3590 C  C     . THR B 1 156 ? 2.864   106.328 -15.748 1.00 28.69  ? 197 THR B C     1 
ATOM   3591 O  O     . THR B 1 156 ? 3.818   106.996 -15.349 1.00 31.11  ? 197 THR B O     1 
ATOM   3592 C  CB    . THR B 1 156 ? 2.526   104.099 -14.708 1.00 28.49  ? 197 THR B CB    1 
ATOM   3593 O  OG1   . THR B 1 156 ? 3.209   104.631 -13.566 1.00 30.25  ? 197 THR B OG1   1 
ATOM   3594 C  CG2   . THR B 1 156 ? 2.794   102.603 -14.802 1.00 28.46  ? 197 THR B CG2   1 
ATOM   3595 N  N     . ASN B 1 157 ? 1.671   106.854 -16.002 1.00 30.24  ? 198 ASN B N     1 
ATOM   3596 C  CA    . ASN B 1 157 ? 1.363   108.231 -15.645 1.00 30.19  ? 198 ASN B CA    1 
ATOM   3597 C  C     . ASN B 1 157 ? 0.136   108.287 -14.746 1.00 36.60  ? 198 ASN B C     1 
ATOM   3598 O  O     . ASN B 1 157 ? -0.707  107.390 -14.777 1.00 31.19  ? 198 ASN B O     1 
ATOM   3599 C  CB    . ASN B 1 157 ? 1.151   109.093 -16.892 1.00 29.44  ? 198 ASN B CB    1 
ATOM   3600 C  CG    . ASN B 1 157 ? 0.022   108.589 -17.770 1.00 31.78  ? 198 ASN B CG    1 
ATOM   3601 O  OD1   . ASN B 1 157 ? -1.156  108.775 -17.461 1.00 29.05  ? 198 ASN B OD1   1 
ATOM   3602 N  ND2   . ASN B 1 157 ? 0.380   107.967 -18.887 1.00 31.61  ? 198 ASN B ND2   1 
ATOM   3603 N  N     . VAL B 1 158 ? 0.051   109.346 -13.947 1.00 35.55  ? 199 VAL B N     1 
ATOM   3604 C  CA    . VAL B 1 158 ? -1.020  109.517 -12.969 1.00 36.16  ? 199 VAL B CA    1 
ATOM   3605 C  C     . VAL B 1 158 ? -2.401  109.524 -13.621 1.00 32.71  ? 199 VAL B C     1 
ATOM   3606 O  O     . VAL B 1 158 ? -3.363  108.988 -13.071 1.00 33.08  ? 199 VAL B O     1 
ATOM   3607 C  CB    . VAL B 1 158 ? -0.834  110.828 -12.168 1.00 39.58  ? 199 VAL B CB    1 
ATOM   3608 C  CG1   . VAL B 1 158 ? -1.938  110.993 -11.133 1.00 36.92  ? 199 VAL B CG1   1 
ATOM   3609 C  CG2   . VAL B 1 158 ? 0.528   110.846 -11.498 1.00 37.36  ? 199 VAL B CG2   1 
ATOM   3610 N  N     . GLN B 1 159 ? -2.489  110.121 -14.804 1.00 30.27  ? 200 GLN B N     1 
ATOM   3611 C  CA    . GLN B 1 159 ? -3.765  110.253 -15.498 1.00 31.39  ? 200 GLN B CA    1 
ATOM   3612 C  C     . GLN B 1 159 ? -4.250  108.928 -16.082 1.00 32.11  ? 200 GLN B C     1 
ATOM   3613 O  O     . GLN B 1 159 ? -5.398  108.825 -16.519 1.00 30.13  ? 200 GLN B O     1 
ATOM   3614 C  CB    . GLN B 1 159 ? -3.659  111.295 -16.614 1.00 29.83  ? 200 GLN B CB    1 
ATOM   3615 C  CG    . GLN B 1 159 ? -3.537  112.736 -16.132 1.00 34.27  ? 200 GLN B CG    1 
ATOM   3616 C  CD    . GLN B 1 159 ? -2.179  113.058 -15.531 1.00 38.20  ? 200 GLN B CD    1 
ATOM   3617 O  OE1   . GLN B 1 159 ? -1.167  112.446 -15.878 1.00 36.63  ? 200 GLN B OE1   1 
ATOM   3618 N  NE2   . GLN B 1 159 ? -2.153  114.025 -14.620 1.00 37.09  ? 200 GLN B NE2   1 
ATOM   3619 N  N     . GLN B 1 160 ? -3.372  107.926 -16.080 1.00 29.44  ? 201 GLN B N     1 
ATOM   3620 C  CA    . GLN B 1 160 ? -3.633  106.639 -16.726 1.00 29.42  ? 201 GLN B CA    1 
ATOM   3621 C  C     . GLN B 1 160 ? -4.074  106.850 -18.168 1.00 31.59  ? 201 GLN B C     1 
ATOM   3622 O  O     . GLN B 1 160 ? -5.022  106.226 -18.644 1.00 27.33  ? 201 GLN B O     1 
ATOM   3623 C  CB    . GLN B 1 160 ? -4.685  105.838 -15.958 1.00 28.15  ? 201 GLN B CB    1 
ATOM   3624 C  CG    . GLN B 1 160 ? -4.237  105.404 -14.572 1.00 25.93  ? 201 GLN B CG    1 
ATOM   3625 C  CD    . GLN B 1 160 ? -5.196  104.423 -13.932 1.00 36.72  ? 201 GLN B CD    1 
ATOM   3626 O  OE1   . GLN B 1 160 ? -5.679  104.643 -12.821 1.00 39.77  ? 201 GLN B OE1   1 
ATOM   3627 N  NE2   . GLN B 1 160 ? -5.474  103.328 -14.629 1.00 29.05  ? 201 GLN B NE2   1 
ATOM   3628 N  N     . CYS B 1 161 ? -3.369  107.741 -18.853 1.00 25.75  ? 202 CYS B N     1 
ATOM   3629 C  CA    . CYS B 1 161 ? -3.732  108.141 -20.201 1.00 28.47  ? 202 CYS B CA    1 
ATOM   3630 C  C     . CYS B 1 161 ? -2.640  107.744 -21.185 1.00 30.82  ? 202 CYS B C     1 
ATOM   3631 O  O     . CYS B 1 161 ? -1.532  108.277 -21.139 1.00 31.11  ? 202 CYS B O     1 
ATOM   3632 C  CB    . CYS B 1 161 ? -3.978  109.648 -20.248 1.00 25.77  ? 202 CYS B CB    1 
ATOM   3633 S  SG    . CYS B 1 161 ? -4.669  110.242 -21.795 1.00 32.49  ? 202 CYS B SG    1 
ATOM   3634 N  N     . TYR B 1 162 ? -2.955  106.804 -22.071 1.00 29.08  ? 203 TYR B N     1 
ATOM   3635 C  CA    . TYR B 1 162 ? -1.966  106.263 -22.996 1.00 25.24  ? 203 TYR B CA    1 
ATOM   3636 C  C     . TYR B 1 162 ? -2.500  106.191 -24.418 1.00 25.38  ? 203 TYR B C     1 
ATOM   3637 O  O     . TYR B 1 162 ? -3.675  106.464 -24.664 1.00 26.26  ? 203 TYR B O     1 
ATOM   3638 C  CB    . TYR B 1 162 ? -1.524  104.865 -22.557 1.00 22.10  ? 203 TYR B CB    1 
ATOM   3639 C  CG    . TYR B 1 162 ? -1.124  104.755 -21.104 1.00 26.66  ? 203 TYR B CG    1 
ATOM   3640 C  CD1   . TYR B 1 162 ? 0.191   104.955 -20.710 1.00 25.09  ? 203 TYR B CD1   1 
ATOM   3641 C  CD2   . TYR B 1 162 ? -2.061  104.440 -20.127 1.00 26.82  ? 203 TYR B CD2   1 
ATOM   3642 C  CE1   . TYR B 1 162 ? 0.564   104.849 -19.385 1.00 25.61  ? 203 TYR B CE1   1 
ATOM   3643 C  CE2   . TYR B 1 162 ? -1.698  104.335 -18.798 1.00 25.69  ? 203 TYR B CE2   1 
ATOM   3644 C  CZ    . TYR B 1 162 ? -0.384  104.541 -18.433 1.00 27.26  ? 203 TYR B CZ    1 
ATOM   3645 O  OH    . TYR B 1 162 ? -0.015  104.437 -17.111 1.00 31.12  ? 203 TYR B OH    1 
ATOM   3646 N  N     . CYS B 1 163 ? -1.612  105.834 -25.344 1.00 25.71  ? 204 CYS B N     1 
ATOM   3647 C  CA    . CYS B 1 163 ? -1.987  105.432 -26.697 1.00 24.63  ? 204 CYS B CA    1 
ATOM   3648 C  C     . CYS B 1 163 ? -2.685  106.528 -27.498 1.00 25.70  ? 204 CYS B C     1 
ATOM   3649 O  O     . CYS B 1 163 ? -2.749  107.680 -27.072 1.00 24.39  ? 204 CYS B O     1 
ATOM   3650 C  CB    . CYS B 1 163 ? -2.881  104.191 -26.634 1.00 18.70  ? 204 CYS B CB    1 
ATOM   3651 S  SG    . CYS B 1 163 ? -3.138  103.368 -28.213 1.00 23.50  ? 204 CYS B SG    1 
ATOM   3652 N  N     . TYR B 1 164 ? -3.199  106.157 -28.668 1.00 22.87  ? 205 TYR B N     1 
ATOM   3653 C  CA    . TYR B 1 164 ? -3.976  107.079 -29.487 1.00 27.22  ? 205 TYR B CA    1 
ATOM   3654 C  C     . TYR B 1 164 ? -5.365  107.281 -28.893 1.00 27.80  ? 205 TYR B C     1 
ATOM   3655 O  O     . TYR B 1 164 ? -6.004  108.311 -29.112 1.00 28.72  ? 205 TYR B O     1 
ATOM   3656 C  CB    . TYR B 1 164 ? -4.120  106.568 -30.924 1.00 26.21  ? 205 TYR B CB    1 
ATOM   3657 C  CG    . TYR B 1 164 ? -2.844  106.107 -31.596 1.00 28.31  ? 205 TYR B CG    1 
ATOM   3658 C  CD1   . TYR B 1 164 ? -1.932  107.021 -32.106 1.00 24.10  ? 205 TYR B CD1   1 
ATOM   3659 C  CD2   . TYR B 1 164 ? -2.574  104.755 -31.754 1.00 27.16  ? 205 TYR B CD2   1 
ATOM   3660 C  CE1   . TYR B 1 164 ? -0.775  106.600 -32.736 1.00 26.15  ? 205 TYR B CE1   1 
ATOM   3661 C  CE2   . TYR B 1 164 ? -1.421  104.324 -32.381 1.00 25.12  ? 205 TYR B CE2   1 
ATOM   3662 C  CZ    . TYR B 1 164 ? -0.525  105.250 -32.871 1.00 27.07  ? 205 TYR B CZ    1 
ATOM   3663 O  OH    . TYR B 1 164 ? 0.624   104.825 -33.496 1.00 22.43  ? 205 TYR B OH    1 
ATOM   3664 N  N     . CYS B 1 165 ? -5.833  106.282 -28.152 1.00 26.10  ? 206 CYS B N     1 
ATOM   3665 C  CA    . CYS B 1 165 ? -7.207  106.266 -27.665 1.00 30.46  ? 206 CYS B CA    1 
ATOM   3666 C  C     . CYS B 1 165 ? -7.402  107.110 -26.407 1.00 31.22  ? 206 CYS B C     1 
ATOM   3667 O  O     . CYS B 1 165 ? -8.483  107.649 -26.177 1.00 30.05  ? 206 CYS B O     1 
ATOM   3668 C  CB    . CYS B 1 165 ? -7.651  104.826 -27.399 1.00 23.41  ? 206 CYS B CB    1 
ATOM   3669 S  SG    . CYS B 1 165 ? -6.575  103.907 -26.278 1.00 26.35  ? 206 CYS B SG    1 
ATOM   3670 N  N     . GLY B 1 166 ? -6.355  107.222 -25.596 1.00 27.01  ? 207 GLY B N     1 
ATOM   3671 C  CA    . GLY B 1 166 ? -6.434  107.989 -24.366 1.00 25.62  ? 207 GLY B CA    1 
ATOM   3672 C  C     . GLY B 1 166 ? -6.918  107.152 -23.200 1.00 31.05  ? 207 GLY B C     1 
ATOM   3673 O  O     . GLY B 1 166 ? -7.253  107.677 -22.139 1.00 33.64  ? 207 GLY B O     1 
ATOM   3674 N  N     . GLY B 1 167 ? -6.951  105.839 -23.396 1.00 28.68  ? 208 GLY B N     1 
ATOM   3675 C  CA    . GLY B 1 167 ? -7.426  104.935 -22.368 1.00 27.06  ? 208 GLY B CA    1 
ATOM   3676 C  C     . GLY B 1 167 ? -6.335  104.496 -21.414 1.00 27.93  ? 208 GLY B C     1 
ATOM   3677 O  O     . GLY B 1 167 ? -5.187  104.923 -21.534 1.00 22.90  ? 208 GLY B O     1 
ATOM   3678 N  N     . PRO B 1 168 ? -6.688  103.631 -20.453 1.00 25.03  ? 209 PRO B N     1 
ATOM   3679 C  CA    . PRO B 1 168 ? -5.712  103.120 -19.490 1.00 26.29  ? 209 PRO B CA    1 
ATOM   3680 C  C     . PRO B 1 168 ? -4.829  102.061 -20.134 1.00 22.95  ? 209 PRO B C     1 
ATOM   3681 O  O     . PRO B 1 168 ? -5.093  101.664 -21.267 1.00 26.24  ? 209 PRO B O     1 
ATOM   3682 C  CB    . PRO B 1 168 ? -6.590  102.521 -18.392 1.00 22.38  ? 209 PRO B CB    1 
ATOM   3683 C  CG    . PRO B 1 168 ? -7.799  102.045 -19.122 1.00 26.66  ? 209 PRO B CG    1 
ATOM   3684 C  CD    . PRO B 1 168 ? -8.012  103.006 -20.278 1.00 25.82  ? 209 PRO B CD    1 
ATOM   3685 N  N     . GLY B 1 169 ? -3.799  101.607 -19.431 1.00 24.26  ? 210 GLY B N     1 
ATOM   3686 C  CA    . GLY B 1 169 ? -2.916  100.607 -19.994 1.00 27.32  ? 210 GLY B CA    1 
ATOM   3687 C  C     . GLY B 1 169 ? -1.799  100.154 -19.081 1.00 29.75  ? 210 GLY B C     1 
ATOM   3688 O  O     . GLY B 1 169 ? -1.337  100.898 -18.216 1.00 29.32  ? 210 GLY B O     1 
ATOM   3689 N  N     . ASP B 1 170 ? -1.370  98.914  -19.285 1.00 24.19  ? 211 ASP B N     1 
ATOM   3690 C  CA    . ASP B 1 170 ? -0.232  98.356  -18.573 1.00 22.96  ? 211 ASP B CA    1 
ATOM   3691 C  C     . ASP B 1 170 ? 0.912   98.122  -19.552 1.00 27.80  ? 211 ASP B C     1 
ATOM   3692 O  O     . ASP B 1 170 ? 0.799   97.306  -20.465 1.00 24.28  ? 211 ASP B O     1 
ATOM   3693 C  CB    . ASP B 1 170 ? -0.622  97.054  -17.870 1.00 29.95  ? 211 ASP B CB    1 
ATOM   3694 C  CG    . ASP B 1 170 ? -1.682  97.264  -16.802 1.00 33.67  ? 211 ASP B CG    1 
ATOM   3695 O  OD1   . ASP B 1 170 ? -1.541  98.219  -16.008 1.00 27.86  ? 211 ASP B OD1   1 
ATOM   3696 O  OD2   . ASP B 1 170 ? -2.657  96.481  -16.763 1.00 30.52  ? 211 ASP B OD2   1 
ATOM   3697 N  N     . TRP B 1 171 ? 2.009   98.845  -19.354 1.00 27.33  ? 212 TRP B N     1 
ATOM   3698 C  CA    . TRP B 1 171 ? 3.146   98.807  -20.269 1.00 27.11  ? 212 TRP B CA    1 
ATOM   3699 C  C     . TRP B 1 171 ? 3.743   97.406  -20.397 1.00 26.72  ? 212 TRP B C     1 
ATOM   3700 O  O     . TRP B 1 171 ? 4.223   97.023  -21.467 1.00 26.72  ? 212 TRP B O     1 
ATOM   3701 C  CB    . TRP B 1 171 ? 4.228   99.785  -19.803 1.00 26.01  ? 212 TRP B CB    1 
ATOM   3702 C  CG    . TRP B 1 171 ? 4.792   99.424  -18.468 1.00 25.02  ? 212 TRP B CG    1 
ATOM   3703 C  CD1   . TRP B 1 171 ? 4.289   99.762  -17.246 1.00 27.37  ? 212 TRP B CD1   1 
ATOM   3704 C  CD2   . TRP B 1 171 ? 5.959   98.633  -18.216 1.00 27.59  ? 212 TRP B CD2   1 
ATOM   3705 N  NE1   . TRP B 1 171 ? 5.073   99.235  -16.248 1.00 26.77  ? 212 TRP B NE1   1 
ATOM   3706 C  CE2   . TRP B 1 171 ? 6.107   98.537  -16.818 1.00 23.68  ? 212 TRP B CE2   1 
ATOM   3707 C  CE3   . TRP B 1 171 ? 6.897   97.996  -19.036 1.00 25.82  ? 212 TRP B CE3   1 
ATOM   3708 C  CZ2   . TRP B 1 171 ? 7.152   97.834  -16.222 1.00 25.81  ? 212 TRP B CZ2   1 
ATOM   3709 C  CZ3   . TRP B 1 171 ? 7.933   97.297  -18.444 1.00 26.64  ? 212 TRP B CZ3   1 
ATOM   3710 C  CH2   . TRP B 1 171 ? 8.053   97.223  -17.050 1.00 25.50  ? 212 TRP B CH2   1 
ATOM   3711 N  N     . TYR B 1 172 ? 3.697   96.644  -19.307 1.00 24.08  ? 213 TYR B N     1 
ATOM   3712 C  CA    . TYR B 1 172 ? 4.356   95.341  -19.236 1.00 23.73  ? 213 TYR B CA    1 
ATOM   3713 C  C     . TYR B 1 172 ? 3.543   94.230  -19.894 1.00 23.27  ? 213 TYR B C     1 
ATOM   3714 O  O     . TYR B 1 172 ? 3.983   93.083  -19.955 1.00 21.39  ? 213 TYR B O     1 
ATOM   3715 C  CB    . TYR B 1 172 ? 4.653   94.976  -17.777 1.00 27.05  ? 213 TYR B CB    1 
ATOM   3716 C  CG    . TYR B 1 172 ? 3.454   95.081  -16.860 1.00 24.09  ? 213 TYR B CG    1 
ATOM   3717 C  CD1   . TYR B 1 172 ? 3.203   96.247  -16.149 1.00 25.86  ? 213 TYR B CD1   1 
ATOM   3718 C  CD2   . TYR B 1 172 ? 2.577   94.015  -16.705 1.00 24.35  ? 213 TYR B CD2   1 
ATOM   3719 C  CE1   . TYR B 1 172 ? 2.113   96.351  -15.311 1.00 26.49  ? 213 TYR B CE1   1 
ATOM   3720 C  CE2   . TYR B 1 172 ? 1.483   94.109  -15.870 1.00 25.77  ? 213 TYR B CE2   1 
ATOM   3721 C  CZ    . TYR B 1 172 ? 1.256   95.280  -15.175 1.00 27.62  ? 213 TYR B CZ    1 
ATOM   3722 O  OH    . TYR B 1 172 ? 0.170   95.385  -14.341 1.00 31.88  ? 213 TYR B OH    1 
ATOM   3723 N  N     . LEU B 1 173 ? 2.358   94.567  -20.386 1.00 23.43  ? 214 LEU B N     1 
ATOM   3724 C  CA    . LEU B 1 173 ? 1.559   93.591  -21.108 1.00 25.01  ? 214 LEU B CA    1 
ATOM   3725 C  C     . LEU B 1 173 ? 1.763   93.760  -22.609 1.00 24.76  ? 214 LEU B C     1 
ATOM   3726 O  O     . LEU B 1 173 ? 2.894   93.709  -23.094 1.00 25.28  ? 214 LEU B O     1 
ATOM   3727 C  CB    . LEU B 1 173 ? 0.083   93.716  -20.731 1.00 25.27  ? 214 LEU B CB    1 
ATOM   3728 C  CG    . LEU B 1 173 ? -0.205  93.348  -19.271 1.00 27.02  ? 214 LEU B CG    1 
ATOM   3729 C  CD1   . LEU B 1 173 ? -1.691  93.424  -18.962 1.00 30.97  ? 214 LEU B CD1   1 
ATOM   3730 C  CD2   . LEU B 1 173 ? 0.340   91.965  -18.950 1.00 27.03  ? 214 LEU B CD2   1 
ATOM   3731 N  N     . LYS B 1 174 ? 0.678   93.970  -23.344 1.00 19.86  ? 215 LYS B N     1 
ATOM   3732 C  CA    . LYS B 1 174 ? 0.780   94.090  -24.793 1.00 23.69  ? 215 LYS B CA    1 
ATOM   3733 C  C     . LYS B 1 174 ? 0.710   95.539  -25.271 1.00 20.45  ? 215 LYS B C     1 
ATOM   3734 O  O     . LYS B 1 174 ? -0.274  95.959  -25.879 1.00 22.40  ? 215 LYS B O     1 
ATOM   3735 C  CB    . LYS B 1 174 ? -0.309  93.248  -25.460 1.00 22.77  ? 215 LYS B CB    1 
ATOM   3736 C  CG    . LYS B 1 174 ? -0.072  91.754  -25.318 1.00 21.98  ? 215 LYS B CG    1 
ATOM   3737 C  CD    . LYS B 1 174 ? -1.131  90.937  -26.036 1.00 30.36  ? 215 LYS B CD    1 
ATOM   3738 C  CE    . LYS B 1 174 ? -0.891  89.445  -25.853 1.00 26.09  ? 215 LYS B CE    1 
ATOM   3739 N  NZ    . LYS B 1 174 ? -1.916  88.624  -26.555 1.00 31.69  ? 215 LYS B NZ    1 
ATOM   3740 N  N     . MET B 1 175 ? 1.768   96.294  -24.990 1.00 21.60  ? 216 MET B N     1 
ATOM   3741 C  CA    . MET B 1 175 ? 1.861   97.684  -25.416 1.00 26.76  ? 216 MET B CA    1 
ATOM   3742 C  C     . MET B 1 175 ? 3.238   97.968  -25.996 1.00 23.51  ? 216 MET B C     1 
ATOM   3743 O  O     . MET B 1 175 ? 4.224   97.336  -25.616 1.00 21.93  ? 216 MET B O     1 
ATOM   3744 C  CB    . MET B 1 175 ? 1.585   98.641  -24.255 1.00 25.42  ? 216 MET B CB    1 
ATOM   3745 C  CG    . MET B 1 175 ? 0.213   98.488  -23.624 1.00 26.78  ? 216 MET B CG    1 
ATOM   3746 S  SD    . MET B 1 175 ? -0.182  99.819  -22.474 1.00 27.16  ? 216 MET B SD    1 
ATOM   3747 C  CE    . MET B 1 175 ? -0.482  101.172 -23.610 1.00 18.33  ? 216 MET B CE    1 
ATOM   3748 N  N     . LEU B 1 176 ? 3.297   98.923  -26.917 1.00 23.26  ? 217 LEU B N     1 
ATOM   3749 C  CA    . LEU B 1 176 ? 4.552   99.320  -27.537 1.00 25.72  ? 217 LEU B CA    1 
ATOM   3750 C  C     . LEU B 1 176 ? 4.881   100.757 -27.186 1.00 22.97  ? 217 LEU B C     1 
ATOM   3751 O  O     . LEU B 1 176 ? 4.018   101.630 -27.256 1.00 20.04  ? 217 LEU B O     1 
ATOM   3752 C  CB    . LEU B 1 176 ? 4.479   99.169  -29.056 1.00 19.24  ? 217 LEU B CB    1 
ATOM   3753 C  CG    . LEU B 1 176 ? 4.283   97.765  -29.624 1.00 27.25  ? 217 LEU B CG    1 
ATOM   3754 C  CD1   . LEU B 1 176 ? 3.892   97.839  -31.096 1.00 24.24  ? 217 LEU B CD1   1 
ATOM   3755 C  CD2   . LEU B 1 176 ? 5.543   96.924  -29.430 1.00 22.77  ? 217 LEU B CD2   1 
ATOM   3756 N  N     . GLN B 1 177 ? 6.133   101.006 -26.823 1.00 21.67  ? 218 GLN B N     1 
ATOM   3757 C  CA    . GLN B 1 177 ? 6.574   102.364 -26.547 1.00 22.71  ? 218 GLN B CA    1 
ATOM   3758 C  C     . GLN B 1 177 ? 7.213   103.005 -27.775 1.00 17.43  ? 218 GLN B C     1 
ATOM   3759 O  O     . GLN B 1 177 ? 8.106   102.433 -28.401 1.00 21.69  ? 218 GLN B O     1 
ATOM   3760 C  CB    . GLN B 1 177 ? 7.556   102.386 -25.376 1.00 21.60  ? 218 GLN B CB    1 
ATOM   3761 C  CG    . GLN B 1 177 ? 7.996   103.787 -24.988 1.00 22.20  ? 218 GLN B CG    1 
ATOM   3762 C  CD    . GLN B 1 177 ? 8.958   103.796 -23.815 1.00 25.02  ? 218 GLN B CD    1 
ATOM   3763 O  OE1   . GLN B 1 177 ? 9.827   102.931 -23.701 1.00 23.03  ? 218 GLN B OE1   1 
ATOM   3764 N  NE2   . GLN B 1 177 ? 8.803   104.775 -22.932 1.00 23.19  ? 218 GLN B NE2   1 
ATOM   3765 N  N     . CYS B 1 178 ? 6.743   104.198 -28.117 1.00 20.16  ? 219 CYS B N     1 
ATOM   3766 C  CA    . CYS B 1 178 ? 7.319   104.951 -29.220 1.00 21.52  ? 219 CYS B CA    1 
ATOM   3767 C  C     . CYS B 1 178 ? 8.690   105.475 -28.817 1.00 19.94  ? 219 CYS B C     1 
ATOM   3768 O  O     . CYS B 1 178 ? 8.852   106.018 -27.728 1.00 25.25  ? 219 CYS B O     1 
ATOM   3769 C  CB    . CYS B 1 178 ? 6.398   106.101 -29.626 1.00 22.90  ? 219 CYS B CB    1 
ATOM   3770 S  SG    . CYS B 1 178 ? 7.048   107.147 -30.944 1.00 20.44  ? 219 CYS B SG    1 
ATOM   3771 N  N     . CYS B 1 179 ? 9.679   105.308 -29.689 1.00 21.17  ? 220 CYS B N     1 
ATOM   3772 C  CA    . CYS B 1 179 ? 11.045  105.713 -29.366 1.00 21.20  ? 220 CYS B CA    1 
ATOM   3773 C  C     . CYS B 1 179 ? 11.246  107.220 -29.512 1.00 24.25  ? 220 CYS B C     1 
ATOM   3774 O  O     . CYS B 1 179 ? 12.337  107.735 -29.264 1.00 27.44  ? 220 CYS B O     1 
ATOM   3775 C  CB    . CYS B 1 179 ? 12.053  104.966 -30.246 1.00 20.49  ? 220 CYS B CB    1 
ATOM   3776 S  SG    . CYS B 1 179 ? 12.005  105.406 -32.003 1.00 20.86  ? 220 CYS B SG    1 
ATOM   3777 N  N     . LYS B 1 180 ? 10.190  107.921 -29.914 1.00 24.40  ? 221 LYS B N     1 
ATOM   3778 C  CA    . LYS B 1 180 ? 10.247  109.368 -30.079 1.00 24.85  ? 221 LYS B CA    1 
ATOM   3779 C  C     . LYS B 1 180 ? 9.533   110.079 -28.930 1.00 27.89  ? 221 LYS B C     1 
ATOM   3780 O  O     . LYS B 1 180 ? 10.163  110.769 -28.128 1.00 22.31  ? 221 LYS B O     1 
ATOM   3781 C  CB    . LYS B 1 180 ? 9.627   109.785 -31.414 1.00 24.06  ? 221 LYS B CB    1 
ATOM   3782 C  CG    . LYS B 1 180 ? 10.253  109.138 -32.643 1.00 29.89  ? 221 LYS B CG    1 
ATOM   3783 C  CD    . LYS B 1 180 ? 11.469  109.902 -33.133 1.00 31.79  ? 221 LYS B CD    1 
ATOM   3784 C  CE    . LYS B 1 180 ? 11.902  109.403 -34.503 1.00 33.65  ? 221 LYS B CE    1 
ATOM   3785 N  NZ    . LYS B 1 180 ? 13.008  110.215 -35.075 1.00 27.72  ? 221 LYS B NZ    1 
ATOM   3786 N  N     . CYS B 1 181 ? 8.216   109.903 -28.855 1.00 24.29  ? 222 CYS B N     1 
ATOM   3787 C  CA    . CYS B 1 181 ? 7.404   110.596 -27.857 1.00 29.04  ? 222 CYS B CA    1 
ATOM   3788 C  C     . CYS B 1 181 ? 7.340   109.846 -26.526 1.00 19.54  ? 222 CYS B C     1 
ATOM   3789 O  O     . CYS B 1 181 ? 6.808   110.368 -25.545 1.00 24.86  ? 222 CYS B O     1 
ATOM   3790 C  CB    . CYS B 1 181 ? 5.989   110.817 -28.392 1.00 20.82  ? 222 CYS B CB    1 
ATOM   3791 S  SG    . CYS B 1 181 ? 5.034   109.296 -28.624 1.00 23.43  ? 222 CYS B SG    1 
ATOM   3792 N  N     . LYS B 1 182 ? 7.860   108.619 -26.516 1.00 22.00  ? 223 LYS B N     1 
ATOM   3793 C  CA    . LYS B 1 182 ? 7.957   107.781 -25.314 1.00 21.50  ? 223 LYS B CA    1 
ATOM   3794 C  C     . LYS B 1 182 ? 6.604   107.359 -24.728 1.00 20.16  ? 223 LYS B C     1 
ATOM   3795 O  O     . LYS B 1 182 ? 6.547   106.783 -23.641 1.00 19.15  ? 223 LYS B O     1 
ATOM   3796 C  CB    . LYS B 1 182 ? 8.788   108.491 -24.238 1.00 25.16  ? 223 LYS B CB    1 
ATOM   3797 C  CG    . LYS B 1 182 ? 10.208  108.816 -24.676 1.00 24.32  ? 223 LYS B CG    1 
ATOM   3798 C  CD    . LYS B 1 182 ? 10.889  107.601 -25.292 1.00 24.33  ? 223 LYS B CD    1 
ATOM   3799 C  CE    . LYS B 1 182 ? 12.386  107.823 -25.441 1.00 35.78  ? 223 LYS B CE    1 
ATOM   3800 N  NZ    . LYS B 1 182 ? 12.684  109.076 -26.183 1.00 33.40  ? 223 LYS B NZ    1 
ATOM   3801 N  N     . GLN B 1 183 ? 5.524   107.626 -25.454 1.00 19.25  ? 224 GLN B N     1 
ATOM   3802 C  CA    . GLN B 1 183 ? 4.194   107.192 -25.039 1.00 23.56  ? 224 GLN B CA    1 
ATOM   3803 C  C     . GLN B 1 183 ? 4.020   105.701 -25.340 1.00 21.55  ? 224 GLN B C     1 
ATOM   3804 O  O     . GLN B 1 183 ? 4.658   105.173 -26.250 1.00 21.68  ? 224 GLN B O     1 
ATOM   3805 C  CB    . GLN B 1 183 ? 3.121   108.033 -25.741 1.00 21.00  ? 224 GLN B CB    1 
ATOM   3806 C  CG    . GLN B 1 183 ? 1.680   107.583 -25.532 1.00 21.36  ? 224 GLN B CG    1 
ATOM   3807 C  CD    . GLN B 1 183 ? 1.246   107.629 -24.079 1.00 25.88  ? 224 GLN B CD    1 
ATOM   3808 O  OE1   . GLN B 1 183 ? 1.577   106.744 -23.290 1.00 23.38  ? 224 GLN B OE1   1 
ATOM   3809 N  NE2   . GLN B 1 183 ? 0.493   108.663 -23.721 1.00 24.29  ? 224 GLN B NE2   1 
ATOM   3810 N  N     . TRP B 1 184 ? 3.183   105.022 -24.560 1.00 20.51  ? 225 TRP B N     1 
ATOM   3811 C  CA    . TRP B 1 184 ? 2.902   103.606 -24.780 1.00 18.77  ? 225 TRP B CA    1 
ATOM   3812 C  C     . TRP B 1 184 ? 1.597   103.429 -25.547 1.00 25.50  ? 225 TRP B C     1 
ATOM   3813 O  O     . TRP B 1 184 ? 0.631   104.156 -25.314 1.00 21.43  ? 225 TRP B O     1 
ATOM   3814 C  CB    . TRP B 1 184 ? 2.842   102.854 -23.449 1.00 21.01  ? 225 TRP B CB    1 
ATOM   3815 C  CG    . TRP B 1 184 ? 4.164   102.796 -22.746 1.00 20.64  ? 225 TRP B CG    1 
ATOM   3816 C  CD1   . TRP B 1 184 ? 4.717   103.765 -21.958 1.00 21.85  ? 225 TRP B CD1   1 
ATOM   3817 C  CD2   . TRP B 1 184 ? 5.102   101.716 -22.773 1.00 19.69  ? 225 TRP B CD2   1 
ATOM   3818 N  NE1   . TRP B 1 184 ? 5.940   103.353 -21.491 1.00 19.67  ? 225 TRP B NE1   1 
ATOM   3819 C  CE2   . TRP B 1 184 ? 6.201   102.098 -21.976 1.00 20.73  ? 225 TRP B CE2   1 
ATOM   3820 C  CE3   . TRP B 1 184 ? 5.120   100.462 -23.393 1.00 22.53  ? 225 TRP B CE3   1 
ATOM   3821 C  CZ2   . TRP B 1 184 ? 7.307   101.272 -21.784 1.00 21.06  ? 225 TRP B CZ2   1 
ATOM   3822 C  CZ3   . TRP B 1 184 ? 6.217   99.643  -23.199 1.00 21.88  ? 225 TRP B CZ3   1 
ATOM   3823 C  CH2   . TRP B 1 184 ? 7.297   100.052 -22.401 1.00 27.06  ? 225 TRP B CH2   1 
ATOM   3824 N  N     . PHE B 1 185 ? 1.572   102.459 -26.459 1.00 20.90  ? 226 PHE B N     1 
ATOM   3825 C  CA    . PHE B 1 185 ? 0.429   102.268 -27.350 1.00 21.97  ? 226 PHE B CA    1 
ATOM   3826 C  C     . PHE B 1 185 ? -0.074  100.823 -27.353 1.00 21.19  ? 226 PHE B C     1 
ATOM   3827 O  O     . PHE B 1 185 ? 0.717   99.883  -27.394 1.00 20.58  ? 226 PHE B O     1 
ATOM   3828 C  CB    . PHE B 1 185 ? 0.796   102.699 -28.776 1.00 20.65  ? 226 PHE B CB    1 
ATOM   3829 C  CG    . PHE B 1 185 ? 1.147   104.158 -28.895 1.00 24.58  ? 226 PHE B CG    1 
ATOM   3830 C  CD1   . PHE B 1 185 ? 0.211   105.076 -29.344 1.00 23.04  ? 226 PHE B CD1   1 
ATOM   3831 C  CD2   . PHE B 1 185 ? 2.411   104.614 -28.552 1.00 21.85  ? 226 PHE B CD2   1 
ATOM   3832 C  CE1   . PHE B 1 185 ? 0.527   106.420 -29.446 1.00 19.92  ? 226 PHE B CE1   1 
ATOM   3833 C  CE2   . PHE B 1 185 ? 2.733   105.960 -28.652 1.00 18.69  ? 226 PHE B CE2   1 
ATOM   3834 C  CZ    . PHE B 1 185 ? 1.789   106.862 -29.098 1.00 19.68  ? 226 PHE B CZ    1 
ATOM   3835 N  N     . HIS B 1 186 ? -1.395  100.660 -27.319 1.00 20.14  ? 227 HIS B N     1 
ATOM   3836 C  CA    . HIS B 1 186 ? -2.018  99.338  -27.270 1.00 19.97  ? 227 HIS B CA    1 
ATOM   3837 C  C     . HIS B 1 186 ? -1.767  98.521  -28.534 1.00 24.52  ? 227 HIS B C     1 
ATOM   3838 O  O     . HIS B 1 186 ? -1.654  99.070  -29.631 1.00 21.86  ? 227 HIS B O     1 
ATOM   3839 C  CB    . HIS B 1 186 ? -3.530  99.462  -27.050 1.00 18.60  ? 227 HIS B CB    1 
ATOM   3840 C  CG    . HIS B 1 186 ? -3.907  100.115 -25.757 1.00 26.82  ? 227 HIS B CG    1 
ATOM   3841 N  ND1   . HIS B 1 186 ? -4.548  101.334 -25.698 1.00 17.87  ? 227 HIS B ND1   1 
ATOM   3842 C  CD2   . HIS B 1 186 ? -3.737  99.717  -24.474 1.00 21.70  ? 227 HIS B CD2   1 
ATOM   3843 C  CE1   . HIS B 1 186 ? -4.755  101.659 -24.435 1.00 23.39  ? 227 HIS B CE1   1 
ATOM   3844 N  NE2   . HIS B 1 186 ? -4.272  100.695 -23.671 1.00 20.91  ? 227 HIS B NE2   1 
ATOM   3845 N  N     . GLU B 1 187 ? -1.686  97.205  -28.367 1.00 24.99  ? 228 GLU B N     1 
ATOM   3846 C  CA    . GLU B 1 187 ? -1.615  96.288  -29.496 1.00 25.29  ? 228 GLU B CA    1 
ATOM   3847 C  C     . GLU B 1 187 ? -2.841  96.452  -30.387 1.00 22.72  ? 228 GLU B C     1 
ATOM   3848 O  O     . GLU B 1 187 ? -2.739  96.458  -31.614 1.00 21.11  ? 228 GLU B O     1 
ATOM   3849 C  CB    . GLU B 1 187 ? -1.514  94.843  -29.007 1.00 24.61  ? 228 GLU B CB    1 
ATOM   3850 C  CG    . GLU B 1 187 ? -1.697  93.811  -30.106 1.00 27.63  ? 228 GLU B CG    1 
ATOM   3851 C  CD    . GLU B 1 187 ? -2.062  92.441  -29.573 1.00 28.13  ? 228 GLU B CD    1 
ATOM   3852 O  OE1   . GLU B 1 187 ? -3.061  92.334  -28.830 1.00 30.29  ? 228 GLU B OE1   1 
ATOM   3853 O  OE2   . GLU B 1 187 ? -1.350  91.468  -29.897 1.00 27.70  ? 228 GLU B OE2   1 
ATOM   3854 N  N     . ALA B 1 188 ? -3.998  96.606  -29.752 1.00 22.56  ? 229 ALA B N     1 
ATOM   3855 C  CA    . ALA B 1 188 ? -5.271  96.669  -30.458 1.00 24.90  ? 229 ALA B CA    1 
ATOM   3856 C  C     . ALA B 1 188 ? -5.429  97.944  -31.279 1.00 27.37  ? 229 ALA B C     1 
ATOM   3857 O  O     . ALA B 1 188 ? -6.278  98.012  -32.164 1.00 29.96  ? 229 ALA B O     1 
ATOM   3858 C  CB    . ALA B 1 188 ? -6.423  96.542  -29.468 1.00 21.80  ? 229 ALA B CB    1 
ATOM   3859 N  N     . CYS B 1 189 ? -4.612  98.952  -30.993 1.00 28.22  ? 230 CYS B N     1 
ATOM   3860 C  CA    . CYS B 1 189 ? -4.777  100.251 -31.635 1.00 21.82  ? 230 CYS B CA    1 
ATOM   3861 C  C     . CYS B 1 189 ? -3.732  100.533 -32.711 1.00 22.26  ? 230 CYS B C     1 
ATOM   3862 O  O     . CYS B 1 189 ? -3.855  101.503 -33.457 1.00 24.91  ? 230 CYS B O     1 
ATOM   3863 C  CB    . CYS B 1 189 ? -4.748  101.360 -30.583 1.00 23.64  ? 230 CYS B CB    1 
ATOM   3864 S  SG    . CYS B 1 189 ? -6.037  101.217 -29.325 1.00 27.33  ? 230 CYS B SG    1 
ATOM   3865 N  N     . VAL B 1 190 ? -2.705  99.693  -32.792 1.00 22.19  ? 231 VAL B N     1 
ATOM   3866 C  CA    . VAL B 1 190 ? -1.687  99.853  -33.828 1.00 23.86  ? 231 VAL B CA    1 
ATOM   3867 C  C     . VAL B 1 190 ? -2.038  99.020  -35.057 1.00 25.62  ? 231 VAL B C     1 
ATOM   3868 O  O     . VAL B 1 190 ? -2.801  98.057  -34.968 1.00 26.97  ? 231 VAL B O     1 
ATOM   3869 C  CB    . VAL B 1 190 ? -0.284  99.455  -33.328 1.00 27.98  ? 231 VAL B CB    1 
ATOM   3870 C  CG1   . VAL B 1 190 ? 0.111   100.295 -32.122 1.00 27.88  ? 231 VAL B CG1   1 
ATOM   3871 C  CG2   . VAL B 1 190 ? -0.237  97.977  -32.997 1.00 24.83  ? 231 VAL B CG2   1 
ATOM   3872 N  N     . GLN B 1 191 ? -1.481  99.398  -36.203 1.00 22.82  ? 232 GLN B N     1 
ATOM   3873 C  CA    . GLN B 1 191 ? -1.812  98.751  -37.469 1.00 27.63  ? 232 GLN B CA    1 
ATOM   3874 C  C     . GLN B 1 191 ? -0.565  98.304  -38.224 1.00 30.98  ? 232 GLN B C     1 
ATOM   3875 O  O     . GLN B 1 191 ? -0.577  98.197  -39.449 1.00 37.63  ? 232 GLN B O     1 
ATOM   3876 C  CB    . GLN B 1 191 ? -2.632  99.698  -38.347 1.00 25.39  ? 232 GLN B CB    1 
ATOM   3877 C  CG    . GLN B 1 191 ? -3.937  100.154 -37.718 1.00 26.76  ? 232 GLN B CG    1 
ATOM   3878 C  CD    . GLN B 1 191 ? -4.576  101.306 -38.470 1.00 35.15  ? 232 GLN B CD    1 
ATOM   3879 O  OE1   . GLN B 1 191 ? -4.142  102.454 -38.358 1.00 28.77  ? 232 GLN B OE1   1 
ATOM   3880 N  NE2   . GLN B 1 191 ? -5.615  101.006 -39.242 1.00 30.90  ? 232 GLN B NE2   1 
ATOM   3881 N  N     . CYS B 1 192 ? 0.509   98.038  -37.489 1.00 27.63  ? 233 CYS B N     1 
ATOM   3882 C  CA    . CYS B 1 192 ? 1.788   97.706  -38.110 1.00 25.98  ? 233 CYS B CA    1 
ATOM   3883 C  C     . CYS B 1 192 ? 2.296   96.317  -37.732 1.00 21.84  ? 233 CYS B C     1 
ATOM   3884 O  O     . CYS B 1 192 ? 3.381   95.915  -38.148 1.00 28.90  ? 233 CYS B O     1 
ATOM   3885 C  CB    . CYS B 1 192 ? 2.838   98.753  -37.734 1.00 26.72  ? 233 CYS B CB    1 
ATOM   3886 S  SG    . CYS B 1 192 ? 3.038   98.992  -35.953 1.00 25.45  ? 233 CYS B SG    1 
ATOM   3887 N  N     . LEU B 1 193 ? 1.515   95.588  -36.943 1.00 24.31  ? 234 LEU B N     1 
ATOM   3888 C  CA    . LEU B 1 193 ? 1.940   94.277  -36.464 1.00 29.38  ? 234 LEU B CA    1 
ATOM   3889 C  C     . LEU B 1 193 ? 1.773   93.192  -37.522 1.00 26.22  ? 234 LEU B C     1 
ATOM   3890 O  O     . LEU B 1 193 ? 0.701   93.041  -38.102 1.00 23.98  ? 234 LEU B O     1 
ATOM   3891 C  CB    . LEU B 1 193 ? 1.160   93.894  -35.205 1.00 27.27  ? 234 LEU B CB    1 
ATOM   3892 C  CG    . LEU B 1 193 ? 1.473   94.692  -33.940 1.00 25.40  ? 234 LEU B CG    1 
ATOM   3893 C  CD1   . LEU B 1 193 ? 0.438   94.408  -32.873 1.00 22.67  ? 234 LEU B CD1   1 
ATOM   3894 C  CD2   . LEU B 1 193 ? 2.864   94.349  -33.439 1.00 22.17  ? 234 LEU B CD2   1 
ATOM   3895 N  N     . GLN B 1 194 ? 2.843   92.440  -37.764 1.00 26.26  ? 235 GLN B N     1 
ATOM   3896 C  CA    . GLN B 1 194 ? 2.803   91.305  -38.681 1.00 31.96  ? 235 GLN B CA    1 
ATOM   3897 C  C     . GLN B 1 194 ? 2.392   90.040  -37.936 1.00 33.74  ? 235 GLN B C     1 
ATOM   3898 O  O     . GLN B 1 194 ? 1.777   89.138  -38.503 1.00 33.97  ? 235 GLN B O     1 
ATOM   3899 C  CB    . GLN B 1 194 ? 4.164   91.104  -39.353 1.00 32.09  ? 235 GLN B CB    1 
ATOM   3900 C  CG    . GLN B 1 194 ? 4.597   92.252  -40.251 1.00 34.80  ? 235 GLN B CG    1 
ATOM   3901 C  CD    . GLN B 1 194 ? 3.763   92.347  -41.513 1.00 39.61  ? 235 GLN B CD    1 
ATOM   3902 O  OE1   . GLN B 1 194 ? 2.717   92.996  -41.533 1.00 48.26  ? 235 GLN B OE1   1 
ATOM   3903 N  NE2   . GLN B 1 194 ? 4.220   91.692  -42.574 1.00 46.37  ? 235 GLN B NE2   1 
ATOM   3904 N  N     . LYS B 1 195 ? 2.745   89.987  -36.656 1.00 31.49  ? 236 LYS B N     1 
ATOM   3905 C  CA    . LYS B 1 195 ? 2.413   88.857  -35.799 1.00 29.17  ? 236 LYS B CA    1 
ATOM   3906 C  C     . LYS B 1 195 ? 1.775   89.355  -34.506 1.00 25.76  ? 236 LYS B C     1 
ATOM   3907 O  O     . LYS B 1 195 ? 2.016   90.488  -34.094 1.00 24.93  ? 236 LYS B O     1 
ATOM   3908 C  CB    . LYS B 1 195 ? 3.666   88.033  -35.490 1.00 30.29  ? 236 LYS B CB    1 
ATOM   3909 C  CG    . LYS B 1 195 ? 4.352   87.443  -36.710 1.00 30.18  ? 236 LYS B CG    1 
ATOM   3910 C  CD    . LYS B 1 195 ? 3.568   86.282  -37.293 1.00 34.74  ? 236 LYS B CD    1 
ATOM   3911 C  CE    . LYS B 1 195 ? 4.308   85.671  -38.473 1.00 44.44  ? 236 LYS B CE    1 
ATOM   3912 N  NZ    . LYS B 1 195 ? 3.582   84.513  -39.064 1.00 53.58  ? 236 LYS B NZ    1 
ATOM   3913 N  N     . PRO B 1 196 ? 0.952   88.511  -33.865 1.00 28.59  ? 237 PRO B N     1 
ATOM   3914 C  CA    . PRO B 1 196 ? 0.370   88.854  -32.564 1.00 27.29  ? 237 PRO B CA    1 
ATOM   3915 C  C     . PRO B 1 196 ? 1.450   89.153  -31.524 1.00 23.20  ? 237 PRO B C     1 
ATOM   3916 O  O     . PRO B 1 196 ? 2.427   88.408  -31.408 1.00 21.87  ? 237 PRO B O     1 
ATOM   3917 C  CB    . PRO B 1 196 ? -0.422  87.597  -32.187 1.00 28.17  ? 237 PRO B CB    1 
ATOM   3918 C  CG    . PRO B 1 196 ? -0.696  86.918  -33.478 1.00 30.84  ? 237 PRO B CG    1 
ATOM   3919 C  CD    . PRO B 1 196 ? 0.480   87.204  -34.355 1.00 30.11  ? 237 PRO B CD    1 
ATOM   3920 N  N     . MET B 1 197 ? 1.271   90.245  -30.788 1.00 21.50  ? 238 MET B N     1 
ATOM   3921 C  CA    . MET B 1 197 ? 2.242   90.668  -29.787 1.00 24.48  ? 238 MET B CA    1 
ATOM   3922 C  C     . MET B 1 197 ? 2.344   89.674  -28.642 1.00 19.78  ? 238 MET B C     1 
ATOM   3923 O  O     . MET B 1 197 ? 1.355   89.054  -28.254 1.00 20.64  ? 238 MET B O     1 
ATOM   3924 C  CB    . MET B 1 197 ? 1.873   92.042  -29.226 1.00 22.40  ? 238 MET B CB    1 
ATOM   3925 C  CG    . MET B 1 197 ? 2.917   93.113  -29.456 1.00 31.60  ? 238 MET B CG    1 
ATOM   3926 S  SD    . MET B 1 197 ? 2.610   94.566  -28.436 1.00 29.45  ? 238 MET B SD    1 
ATOM   3927 C  CE    . MET B 1 197 ? 3.820   94.311  -27.145 1.00 23.11  ? 238 MET B CE    1 
ATOM   3928 N  N     . LEU B 1 198 ? 3.553   89.527  -28.113 1.00 24.35  ? 239 LEU B N     1 
ATOM   3929 C  CA    . LEU B 1 198 ? 3.773   88.790  -26.877 1.00 22.52  ? 239 LEU B CA    1 
ATOM   3930 C  C     . LEU B 1 198 ? 3.732   89.761  -25.704 1.00 21.62  ? 239 LEU B C     1 
ATOM   3931 O  O     . LEU B 1 198 ? 4.064   90.936  -25.861 1.00 21.53  ? 239 LEU B O     1 
ATOM   3932 C  CB    . LEU B 1 198 ? 5.113   88.054  -26.916 1.00 23.32  ? 239 LEU B CB    1 
ATOM   3933 C  CG    . LEU B 1 198 ? 5.230   86.894  -27.903 1.00 26.50  ? 239 LEU B CG    1 
ATOM   3934 C  CD1   . LEU B 1 198 ? 6.683   86.643  -28.272 1.00 26.01  ? 239 LEU B CD1   1 
ATOM   3935 C  CD2   . LEU B 1 198 ? 4.610   85.648  -27.302 1.00 26.04  ? 239 LEU B CD2   1 
ATOM   3936 N  N     . PHE B 1 199 ? 3.318   89.276  -24.537 1.00 21.18  ? 240 PHE B N     1 
ATOM   3937 C  CA    . PHE B 1 199 ? 3.320   90.098  -23.332 1.00 20.75  ? 240 PHE B CA    1 
ATOM   3938 C  C     . PHE B 1 199 ? 4.731   90.579  -23.021 1.00 17.97  ? 240 PHE B C     1 
ATOM   3939 O  O     . PHE B 1 199 ? 5.682   89.798  -23.052 1.00 19.54  ? 240 PHE B O     1 
ATOM   3940 C  CB    . PHE B 1 199 ? 2.757   89.324  -22.136 1.00 21.30  ? 240 PHE B CB    1 
ATOM   3941 C  CG    . PHE B 1 199 ? 1.281   89.060  -22.220 1.00 21.15  ? 240 PHE B CG    1 
ATOM   3942 C  CD1   . PHE B 1 199 ? 0.372   90.096  -22.092 1.00 22.07  ? 240 PHE B CD1   1 
ATOM   3943 C  CD2   . PHE B 1 199 ? 0.801   87.774  -22.412 1.00 21.16  ? 240 PHE B CD2   1 
ATOM   3944 C  CE1   . PHE B 1 199 ? -0.988  89.859  -22.163 1.00 23.85  ? 240 PHE B CE1   1 
ATOM   3945 C  CE2   . PHE B 1 199 ? -0.560  87.530  -22.485 1.00 26.31  ? 240 PHE B CE2   1 
ATOM   3946 C  CZ    . PHE B 1 199 ? -1.454  88.576  -22.359 1.00 26.08  ? 240 PHE B CZ    1 
ATOM   3947 N  N     . GLY B 1 200 ? 4.861   91.872  -22.741 1.00 21.84  ? 241 GLY B N     1 
ATOM   3948 C  CA    . GLY B 1 200 ? 6.125   92.444  -22.315 1.00 22.10  ? 241 GLY B CA    1 
ATOM   3949 C  C     . GLY B 1 200 ? 7.253   92.354  -23.327 1.00 22.67  ? 241 GLY B C     1 
ATOM   3950 O  O     . GLY B 1 200 ? 8.424   92.308  -22.950 1.00 24.33  ? 241 GLY B O     1 
ATOM   3951 N  N     . ASP B 1 201 ? 6.906   92.327  -24.611 1.00 21.39  ? 242 ASP B N     1 
ATOM   3952 C  CA    . ASP B 1 201 ? 7.909   92.275  -25.671 1.00 21.82  ? 242 ASP B CA    1 
ATOM   3953 C  C     . ASP B 1 201 ? 8.357   93.689  -26.023 1.00 22.42  ? 242 ASP B C     1 
ATOM   3954 O  O     . ASP B 1 201 ? 7.629   94.433  -26.680 1.00 19.71  ? 242 ASP B O     1 
ATOM   3955 C  CB    . ASP B 1 201 ? 7.356   91.561  -26.911 1.00 19.80  ? 242 ASP B CB    1 
ATOM   3956 C  CG    . ASP B 1 201 ? 8.449   91.136  -27.886 1.00 24.68  ? 242 ASP B CG    1 
ATOM   3957 O  OD1   . ASP B 1 201 ? 9.538   91.748  -27.886 1.00 23.81  ? 242 ASP B OD1   1 
ATOM   3958 O  OD2   . ASP B 1 201 ? 8.215   90.184  -28.662 1.00 25.57  ? 242 ASP B OD2   1 
ATOM   3959 N  N     . ARG B 1 202 ? 9.556   94.057  -25.583 1.00 19.68  ? 243 ARG B N     1 
ATOM   3960 C  CA    . ARG B 1 202 ? 10.063  95.405  -25.811 1.00 24.74  ? 243 ARG B CA    1 
ATOM   3961 C  C     . ARG B 1 202 ? 11.136  95.443  -26.892 1.00 25.66  ? 243 ARG B C     1 
ATOM   3962 O  O     . ARG B 1 202 ? 11.682  96.504  -27.199 1.00 21.77  ? 243 ARG B O     1 
ATOM   3963 C  CB    . ARG B 1 202 ? 10.621  95.988  -24.514 1.00 24.06  ? 243 ARG B CB    1 
ATOM   3964 C  CG    . ARG B 1 202 ? 9.618   96.016  -23.375 1.00 25.66  ? 243 ARG B CG    1 
ATOM   3965 C  CD    . ARG B 1 202 ? 10.237  96.601  -22.119 1.00 28.64  ? 243 ARG B CD    1 
ATOM   3966 N  NE    . ARG B 1 202 ? 10.661  97.984  -22.315 1.00 32.44  ? 243 ARG B NE    1 
ATOM   3967 C  CZ    . ARG B 1 202 ? 11.322  98.699  -21.410 1.00 32.33  ? 243 ARG B CZ    1 
ATOM   3968 N  NH1   . ARG B 1 202 ? 11.643  98.160  -20.242 1.00 30.00  ? 243 ARG B NH1   1 
ATOM   3969 N  NH2   . ARG B 1 202 ? 11.666  99.952  -21.675 1.00 31.47  ? 243 ARG B NH2   1 
ATOM   3970 N  N     . PHE B 1 203 ? 11.433  94.286  -27.472 1.00 22.37  ? 244 PHE B N     1 
ATOM   3971 C  CA    . PHE B 1 203 ? 12.465  94.193  -28.499 1.00 24.01  ? 244 PHE B CA    1 
ATOM   3972 C  C     . PHE B 1 203 ? 11.948  94.687  -29.846 1.00 26.34  ? 244 PHE B C     1 
ATOM   3973 O  O     . PHE B 1 203 ? 11.930  93.950  -30.833 1.00 25.67  ? 244 PHE B O     1 
ATOM   3974 C  CB    . PHE B 1 203 ? 12.980  92.758  -28.603 1.00 25.07  ? 244 PHE B CB    1 
ATOM   3975 C  CG    . PHE B 1 203 ? 13.855  92.356  -27.454 1.00 25.53  ? 244 PHE B CG    1 
ATOM   3976 C  CD1   . PHE B 1 203 ? 13.300  92.012  -26.233 1.00 27.79  ? 244 PHE B CD1   1 
ATOM   3977 C  CD2   . PHE B 1 203 ? 15.233  92.343  -27.587 1.00 28.70  ? 244 PHE B CD2   1 
ATOM   3978 C  CE1   . PHE B 1 203 ? 14.102  91.654  -25.169 1.00 33.34  ? 244 PHE B CE1   1 
ATOM   3979 C  CE2   . PHE B 1 203 ? 16.041  91.984  -26.529 1.00 31.25  ? 244 PHE B CE2   1 
ATOM   3980 C  CZ    . PHE B 1 203 ? 15.474  91.639  -25.317 1.00 29.20  ? 244 PHE B CZ    1 
ATOM   3981 N  N     . TYR B 1 204 ? 11.527  95.948  -29.863 1.00 23.85  ? 245 TYR B N     1 
ATOM   3982 C  CA    . TYR B 1 204 ? 11.036  96.611  -31.064 1.00 25.46  ? 245 TYR B CA    1 
ATOM   3983 C  C     . TYR B 1 204 ? 11.541  98.044  -31.130 1.00 24.32  ? 245 TYR B C     1 
ATOM   3984 O  O     . TYR B 1 204 ? 11.730  98.697  -30.102 1.00 22.16  ? 245 TYR B O     1 
ATOM   3985 C  CB    . TYR B 1 204 ? 9.506   96.640  -31.105 1.00 21.31  ? 245 TYR B CB    1 
ATOM   3986 C  CG    . TYR B 1 204 ? 8.814   95.315  -31.313 1.00 27.97  ? 245 TYR B CG    1 
ATOM   3987 C  CD1   . TYR B 1 204 ? 8.657   94.784  -32.587 1.00 24.00  ? 245 TYR B CD1   1 
ATOM   3988 C  CD2   . TYR B 1 204 ? 8.276   94.616  -30.240 1.00 21.04  ? 245 TYR B CD2   1 
ATOM   3989 C  CE1   . TYR B 1 204 ? 8.007   93.582  -32.784 1.00 25.65  ? 245 TYR B CE1   1 
ATOM   3990 C  CE2   . TYR B 1 204 ? 7.624   93.413  -30.427 1.00 24.81  ? 245 TYR B CE2   1 
ATOM   3991 C  CZ    . TYR B 1 204 ? 7.493   92.900  -31.702 1.00 28.74  ? 245 TYR B CZ    1 
ATOM   3992 O  OH    . TYR B 1 204 ? 6.846   91.702  -31.901 1.00 22.81  ? 245 TYR B OH    1 
ATOM   3993 N  N     . THR B 1 205 ? 11.744  98.535  -32.343 1.00 27.05  ? 246 THR B N     1 
ATOM   3994 C  CA    . THR B 1 205 ? 11.899  99.962  -32.552 1.00 24.21  ? 246 THR B CA    1 
ATOM   3995 C  C     . THR B 1 205 ? 10.595  100.459 -33.151 1.00 22.49  ? 246 THR B C     1 
ATOM   3996 O  O     . THR B 1 205 ? 10.265  100.137 -34.291 1.00 25.16  ? 246 THR B O     1 
ATOM   3997 C  CB    . THR B 1 205 ? 13.077  100.296 -33.471 1.00 26.86  ? 246 THR B CB    1 
ATOM   3998 O  OG1   . THR B 1 205 ? 14.299  99.878  -32.850 1.00 25.96  ? 246 THR B OG1   1 
ATOM   3999 C  CG2   . THR B 1 205 ? 13.136  101.794 -33.728 1.00 25.76  ? 246 THR B CG2   1 
ATOM   4000 N  N     . PHE B 1 206 ? 9.847   101.226 -32.366 1.00 23.63  ? 247 PHE B N     1 
ATOM   4001 C  CA    . PHE B 1 206 ? 8.512   101.652 -32.758 1.00 19.57  ? 247 PHE B CA    1 
ATOM   4002 C  C     . PHE B 1 206 ? 8.366   103.170 -32.802 1.00 23.69  ? 247 PHE B C     1 
ATOM   4003 O  O     . PHE B 1 206 ? 8.791   103.875 -31.887 1.00 23.76  ? 247 PHE B O     1 
ATOM   4004 C  CB    . PHE B 1 206 ? 7.477   101.056 -31.799 1.00 23.43  ? 247 PHE B CB    1 
ATOM   4005 C  CG    . PHE B 1 206 ? 6.075   101.535 -32.039 1.00 23.08  ? 247 PHE B CG    1 
ATOM   4006 C  CD1   . PHE B 1 206 ? 5.383   101.154 -33.177 1.00 21.96  ? 247 PHE B CD1   1 
ATOM   4007 C  CD2   . PHE B 1 206 ? 5.441   102.352 -31.116 1.00 22.76  ? 247 PHE B CD2   1 
ATOM   4008 C  CE1   . PHE B 1 206 ? 4.089   101.589 -33.397 1.00 18.91  ? 247 PHE B CE1   1 
ATOM   4009 C  CE2   . PHE B 1 206 ? 4.144   102.789 -31.328 1.00 18.85  ? 247 PHE B CE2   1 
ATOM   4010 C  CZ    . PHE B 1 206 ? 3.468   102.407 -32.471 1.00 21.50  ? 247 PHE B CZ    1 
ATOM   4011 N  N     . ILE B 1 207 ? 7.766   103.662 -33.880 1.00 21.07  ? 248 ILE B N     1 
ATOM   4012 C  CA    . ILE B 1 207 ? 7.418   105.072 -33.995 1.00 21.42  ? 248 ILE B CA    1 
ATOM   4013 C  C     . ILE B 1 207 ? 5.927   105.187 -34.298 1.00 24.15  ? 248 ILE B C     1 
ATOM   4014 O  O     . ILE B 1 207 ? 5.453   104.676 -35.313 1.00 22.00  ? 248 ILE B O     1 
ATOM   4015 C  CB    . ILE B 1 207 ? 8.232   105.783 -35.092 1.00 22.93  ? 248 ILE B CB    1 
ATOM   4016 C  CG1   . ILE B 1 207 ? 9.731   105.575 -34.870 1.00 22.51  ? 248 ILE B CG1   1 
ATOM   4017 C  CG2   . ILE B 1 207 ? 7.902   107.268 -35.119 1.00 22.32  ? 248 ILE B CG2   1 
ATOM   4018 C  CD1   . ILE B 1 207 ? 10.598  106.204 -35.935 1.00 22.84  ? 248 ILE B CD1   1 
ATOM   4019 N  N     . CYS B 1 208 ? 5.192   105.850 -33.410 1.00 18.67  ? 249 CYS B N     1 
ATOM   4020 C  CA    . CYS B 1 208 ? 3.739   105.936 -33.525 1.00 22.20  ? 249 CYS B CA    1 
ATOM   4021 C  C     . CYS B 1 208 ? 3.296   106.776 -34.719 1.00 23.43  ? 249 CYS B C     1 
ATOM   4022 O  O     . CYS B 1 208 ? 4.116   107.399 -35.394 1.00 20.22  ? 249 CYS B O     1 
ATOM   4023 C  CB    . CYS B 1 208 ? 3.141   106.511 -32.242 1.00 22.99  ? 249 CYS B CB    1 
ATOM   4024 S  SG    . CYS B 1 208 ? 3.435   108.274 -32.002 1.00 21.32  ? 249 CYS B SG    1 
ATOM   4025 N  N     . SER B 1 209 ? 1.990   106.795 -34.967 1.00 21.01  ? 250 SER B N     1 
ATOM   4026 C  CA    . SER B 1 209 ? 1.433   107.522 -36.102 1.00 25.88  ? 250 SER B CA    1 
ATOM   4027 C  C     . SER B 1 209 ? 1.426   109.032 -35.890 1.00 26.23  ? 250 SER B C     1 
ATOM   4028 O  O     . SER B 1 209 ? 1.378   109.798 -36.852 1.00 21.87  ? 250 SER B O     1 
ATOM   4029 C  CB    . SER B 1 209 ? 0.013   107.039 -36.397 1.00 26.52  ? 250 SER B CB    1 
ATOM   4030 O  OG    . SER B 1 209 ? 0.037   105.772 -37.026 1.00 29.22  ? 250 SER B OG    1 
ATOM   4031 N  N     . VAL B 1 210 ? 1.464   109.458 -34.631 1.00 22.86  ? 251 VAL B N     1 
ATOM   4032 C  CA    . VAL B 1 210 ? 1.519   110.880 -34.323 1.00 19.83  ? 251 VAL B CA    1 
ATOM   4033 C  C     . VAL B 1 210 ? 2.877   111.447 -34.730 1.00 21.41  ? 251 VAL B C     1 
ATOM   4034 O  O     . VAL B 1 210 ? 2.959   112.470 -35.410 1.00 21.49  ? 251 VAL B O     1 
ATOM   4035 C  CB    . VAL B 1 210 ? 1.272   111.152 -32.824 1.00 27.35  ? 251 VAL B CB    1 
ATOM   4036 C  CG1   . VAL B 1 210 ? 1.274   112.650 -32.551 1.00 27.03  ? 251 VAL B CG1   1 
ATOM   4037 C  CG2   . VAL B 1 210 ? -0.041  110.526 -32.376 1.00 19.67  ? 251 VAL B CG2   1 
ATOM   4038 N  N     . CYS B 1 211 ? 3.940   110.764 -34.315 1.00 23.78  ? 252 CYS B N     1 
ATOM   4039 C  CA    . CYS B 1 211 ? 5.301   111.180 -34.633 1.00 23.87  ? 252 CYS B CA    1 
ATOM   4040 C  C     . CYS B 1 211 ? 5.618   110.969 -36.110 1.00 28.68  ? 252 CYS B C     1 
ATOM   4041 O  O     . CYS B 1 211 ? 6.469   111.655 -36.679 1.00 24.74  ? 252 CYS B O     1 
ATOM   4042 C  CB    . CYS B 1 211 ? 6.309   110.417 -33.771 1.00 20.61  ? 252 CYS B CB    1 
ATOM   4043 S  SG    . CYS B 1 211 ? 6.148   110.707 -31.993 1.00 23.44  ? 252 CYS B SG    1 
ATOM   4044 N  N     . SER B 1 212 ? 4.935   110.009 -36.726 1.00 19.13  ? 253 SER B N     1 
ATOM   4045 C  CA    . SER B 1 212 ? 5.172   109.693 -38.129 1.00 26.56  ? 253 SER B CA    1 
ATOM   4046 C  C     . SER B 1 212 ? 4.322   110.564 -39.044 1.00 26.85  ? 253 SER B C     1 
ATOM   4047 O  O     . SER B 1 212 ? 4.654   110.744 -40.215 1.00 24.75  ? 253 SER B O     1 
ATOM   4048 C  CB    . SER B 1 212 ? 4.885   108.214 -38.408 1.00 22.10  ? 253 SER B CB    1 
ATOM   4049 O  OG    . SER B 1 212 ? 5.760   107.372 -37.678 1.00 24.93  ? 253 SER B OG    1 
ATOM   4050 N  N     . SER B 1 213 ? 3.236   111.105 -38.496 1.00 22.30  ? 254 SER B N     1 
ATOM   4051 C  CA    . SER B 1 213 ? 2.231   111.817 -39.284 1.00 27.00  ? 254 SER B CA    1 
ATOM   4052 C  C     . SER B 1 213 ? 1.767   110.929 -40.434 1.00 26.55  ? 254 SER B C     1 
ATOM   4053 O  O     . SER B 1 213 ? 1.632   111.377 -41.572 1.00 29.67  ? 254 SER B O     1 
ATOM   4054 C  CB    . SER B 1 213 ? 2.775   113.148 -39.810 1.00 23.72  ? 254 SER B CB    1 
ATOM   4055 O  OG    . SER B 1 213 ? 3.102   114.020 -38.742 1.00 25.66  ? 254 SER B OG    1 
ATOM   4056 N  N     . GLY B 1 214 ? 1.538   109.660 -40.114 1.00 29.36  ? 255 GLY B N     1 
ATOM   4057 C  CA    . GLY B 1 214 ? 1.156   108.657 -41.089 1.00 27.24  ? 255 GLY B CA    1 
ATOM   4058 C  C     . GLY B 1 214 ? 1.322   107.278 -40.480 1.00 30.43  ? 255 GLY B C     1 
ATOM   4059 O  O     . GLY B 1 214 ? 1.450   107.154 -39.264 1.00 29.50  ? 255 GLY B O     1 
ATOM   4060 N  N     . PRO B 1 215 ? 1.325   106.233 -41.322 1.00 31.39  ? 256 PRO B N     1 
ATOM   4061 C  CA    . PRO B 1 215 ? 1.490   104.843 -40.880 1.00 25.04  ? 256 PRO B CA    1 
ATOM   4062 C  C     . PRO B 1 215 ? 2.703   104.640 -39.969 1.00 26.56  ? 256 PRO B C     1 
ATOM   4063 O  O     . PRO B 1 215 ? 3.740   105.282 -40.150 1.00 19.67  ? 256 PRO B O     1 
ATOM   4064 C  CB    . PRO B 1 215 ? 1.662   104.080 -42.194 1.00 27.34  ? 256 PRO B CB    1 
ATOM   4065 C  CG    . PRO B 1 215 ? 0.907   104.892 -43.185 1.00 29.86  ? 256 PRO B CG    1 
ATOM   4066 C  CD    . PRO B 1 215 ? 1.099   106.326 -42.776 1.00 24.87  ? 256 PRO B CD    1 
ATOM   4067 N  N     . GLU B 1 216 ? 2.556   103.749 -38.995 1.00 21.69  ? 257 GLU B N     1 
ATOM   4068 C  CA    . GLU B 1 216 ? 3.582   103.504 -37.987 1.00 25.32  ? 257 GLU B CA    1 
ATOM   4069 C  C     . GLU B 1 216 ? 4.833   102.825 -38.539 1.00 26.57  ? 257 GLU B C     1 
ATOM   4070 O  O     . GLU B 1 216 ? 4.808   102.206 -39.604 1.00 26.69  ? 257 GLU B O     1 
ATOM   4071 C  CB    . GLU B 1 216 ? 3.000   102.651 -36.859 1.00 24.17  ? 257 GLU B CB    1 
ATOM   4072 C  CG    . GLU B 1 216 ? 1.861   103.321 -36.110 1.00 24.52  ? 257 GLU B CG    1 
ATOM   4073 C  CD    . GLU B 1 216 ? 0.753   102.355 -35.745 1.00 28.71  ? 257 GLU B CD    1 
ATOM   4074 O  OE1   . GLU B 1 216 ? 0.636   101.307 -36.414 1.00 27.87  ? 257 GLU B OE1   1 
ATOM   4075 O  OE2   . GLU B 1 216 ? -0.001  102.644 -34.791 1.00 23.32  ? 257 GLU B OE2   1 
ATOM   4076 N  N     . TYR B 1 217 ? 5.928   102.955 -37.797 1.00 21.88  ? 258 TYR B N     1 
ATOM   4077 C  CA    . TYR B 1 217 ? 7.162   102.239 -38.095 1.00 22.28  ? 258 TYR B CA    1 
ATOM   4078 C  C     . TYR B 1 217 ? 7.407   101.183 -37.029 1.00 24.23  ? 258 TYR B C     1 
ATOM   4079 O  O     . TYR B 1 217 ? 7.345   101.475 -35.833 1.00 23.93  ? 258 TYR B O     1 
ATOM   4080 C  CB    . TYR B 1 217 ? 8.349   103.201 -38.171 1.00 23.24  ? 258 TYR B CB    1 
ATOM   4081 C  CG    . TYR B 1 217 ? 9.697   102.514 -38.227 1.00 26.54  ? 258 TYR B CG    1 
ATOM   4082 C  CD1   . TYR B 1 217 ? 10.170  101.965 -39.412 1.00 22.17  ? 258 TYR B CD1   1 
ATOM   4083 C  CD2   . TYR B 1 217 ? 10.502  102.423 -37.097 1.00 22.40  ? 258 TYR B CD2   1 
ATOM   4084 C  CE1   . TYR B 1 217 ? 11.402  101.339 -39.469 1.00 21.02  ? 258 TYR B CE1   1 
ATOM   4085 C  CE2   . TYR B 1 217 ? 11.735  101.797 -37.145 1.00 20.11  ? 258 TYR B CE2   1 
ATOM   4086 C  CZ    . TYR B 1 217 ? 12.181  101.258 -38.333 1.00 25.81  ? 258 TYR B CZ    1 
ATOM   4087 O  OH    . TYR B 1 217 ? 13.409  100.638 -38.384 1.00 21.76  ? 258 TYR B OH    1 
ATOM   4088 N  N     . LEU B 1 218 ? 7.683   99.958  -37.462 1.00 22.27  ? 259 LEU B N     1 
ATOM   4089 C  CA    . LEU B 1 218 ? 7.943   98.866  -36.532 1.00 24.10  ? 259 LEU B CA    1 
ATOM   4090 C  C     . LEU B 1 218 ? 9.066   97.962  -37.028 1.00 24.87  ? 259 LEU B C     1 
ATOM   4091 O  O     . LEU B 1 218 ? 8.979   97.375  -38.107 1.00 23.58  ? 259 LEU B O     1 
ATOM   4092 C  CB    . LEU B 1 218 ? 6.676   98.043  -36.303 1.00 22.57  ? 259 LEU B CB    1 
ATOM   4093 C  CG    . LEU B 1 218 ? 6.778   97.000  -35.187 1.00 27.88  ? 259 LEU B CG    1 
ATOM   4094 C  CD1   . LEU B 1 218 ? 6.955   97.678  -33.832 1.00 24.28  ? 259 LEU B CD1   1 
ATOM   4095 C  CD2   . LEU B 1 218 ? 5.564   96.087  -35.182 1.00 23.23  ? 259 LEU B CD2   1 
ATOM   4096 N  N     . LYS B 1 219 ? 10.120  97.852  -36.228 1.00 24.46  ? 260 LYS B N     1 
ATOM   4097 C  CA    . LYS B 1 219 ? 11.258  97.014  -36.578 1.00 24.07  ? 260 LYS B CA    1 
ATOM   4098 C  C     . LYS B 1 219 ? 11.626  96.094  -35.425 1.00 28.98  ? 260 LYS B C     1 
ATOM   4099 O  O     . LYS B 1 219 ? 11.863  96.551  -34.304 1.00 24.24  ? 260 LYS B O     1 
ATOM   4100 C  CB    . LYS B 1 219 ? 12.463  97.871  -36.964 1.00 20.67  ? 260 LYS B CB    1 
ATOM   4101 C  CG    . LYS B 1 219 ? 13.660  97.073  -37.452 1.00 28.37  ? 260 LYS B CG    1 
ATOM   4102 C  CD    . LYS B 1 219 ? 13.358  96.389  -38.776 1.00 27.01  ? 260 LYS B CD    1 
ATOM   4103 C  CE    . LYS B 1 219 ? 14.600  95.737  -39.358 1.00 30.47  ? 260 LYS B CE    1 
ATOM   4104 N  NZ    . LYS B 1 219 ? 14.330  95.146  -40.695 1.00 33.88  ? 260 LYS B NZ    1 
ATOM   4105 N  N     . ARG B 1 220 ? 11.675  94.797  -35.706 1.00 24.80  ? 261 ARG B N     1 
ATOM   4106 C  CA    . ARG B 1 220 ? 12.005  93.814  -34.686 1.00 26.16  ? 261 ARG B CA    1 
ATOM   4107 C  C     . ARG B 1 220 ? 13.496  93.855  -34.357 1.00 23.86  ? 261 ARG B C     1 
ATOM   4108 O  O     . ARG B 1 220 ? 14.342  93.756  -35.247 1.00 36.72  ? 261 ARG B O     1 
ATOM   4109 C  CB    . ARG B 1 220 ? 11.597  92.411  -35.140 1.00 29.26  ? 261 ARG B CB    1 
ATOM   4110 C  CG    . ARG B 1 220 ? 11.760  91.345  -34.068 1.00 34.68  ? 261 ARG B CG    1 
ATOM   4111 C  CD    . ARG B 1 220 ? 10.503  91.174  -33.227 1.00 38.38  ? 261 ARG B CD    1 
ATOM   4112 N  NE    . ARG B 1 220 ? 10.670  90.114  -32.234 1.00 36.94  ? 261 ARG B NE    1 
ATOM   4113 C  CZ    . ARG B 1 220 ? 10.544  90.282  -30.922 1.00 28.04  ? 261 ARG B CZ    1 
ATOM   4114 N  NH1   . ARG B 1 220 ? 10.233  91.473  -30.426 1.00 25.46  ? 261 ARG B NH1   1 
ATOM   4115 N  NH2   . ARG B 1 220 ? 10.720  89.254  -30.102 1.00 40.04  ? 261 ARG B NH2   1 
ATOM   4116 N  N     . LEU B 1 221 ? 13.811  94.023  -33.077 1.00 26.82  ? 262 LEU B N     1 
ATOM   4117 C  CA    . LEU B 1 221 ? 15.193  93.978  -32.619 1.00 27.96  ? 262 LEU B CA    1 
ATOM   4118 C  C     . LEU B 1 221 ? 15.643  92.526  -32.487 1.00 29.91  ? 262 LEU B C     1 
ATOM   4119 O  O     . LEU B 1 221 ? 14.834  91.647  -32.190 1.00 29.07  ? 262 LEU B O     1 
ATOM   4120 C  CB    . LEU B 1 221 ? 15.347  94.718  -31.285 1.00 29.82  ? 262 LEU B CB    1 
ATOM   4121 C  CG    . LEU B 1 221 ? 15.071  96.225  -31.319 1.00 32.47  ? 262 LEU B CG    1 
ATOM   4122 C  CD1   . LEU B 1 221 ? 15.185  96.836  -29.930 1.00 29.32  ? 262 LEU B CD1   1 
ATOM   4123 C  CD2   . LEU B 1 221 ? 16.010  96.923  -32.294 1.00 32.24  ? 262 LEU B CD2   1 
ATOM   4124 N  N     . PRO B 1 222 ? 16.937  92.267  -32.726 1.00 27.36  ? 263 PRO B N     1 
ATOM   4125 C  CA    . PRO B 1 222 ? 17.493  90.913  -32.613 1.00 34.76  ? 263 PRO B CA    1 
ATOM   4126 C  C     . PRO B 1 222 ? 17.348  90.335  -31.207 1.00 27.49  ? 263 PRO B C     1 
ATOM   4127 O  O     . PRO B 1 222 ? 17.412  91.070  -30.222 1.00 29.15  ? 263 PRO B O     1 
ATOM   4128 C  CB    . PRO B 1 222 ? 18.969  91.110  -32.973 1.00 33.73  ? 263 PRO B CB    1 
ATOM   4129 C  CG    . PRO B 1 222 ? 18.994  92.345  -33.799 1.00 36.73  ? 263 PRO B CG    1 
ATOM   4130 C  CD    . PRO B 1 222 ? 17.936  93.231  -33.216 1.00 31.08  ? 263 PRO B CD    1 
ATOM   4131 N  N     . LEU B 1 223 ? 17.148  89.025  -31.124 1.00 30.02  ? 264 LEU B N     1 
ATOM   4132 C  CA    . LEU B 1 223 ? 16.991  88.355  -29.840 1.00 29.60  ? 264 LEU B CA    1 
ATOM   4133 C  C     . LEU B 1 223 ? 18.178  87.452  -29.532 1.00 30.91  ? 264 LEU B C     1 
ATOM   4134 O  O     . LEU B 1 223 ? 18.666  86.734  -30.404 1.00 32.44  ? 264 LEU B O     1 
ATOM   4135 C  CB    . LEU B 1 223 ? 15.704  87.530  -29.819 1.00 33.62  ? 264 LEU B CB    1 
ATOM   4136 C  CG    . LEU B 1 223 ? 14.367  88.254  -29.969 1.00 33.36  ? 264 LEU B CG    1 
ATOM   4137 C  CD1   . LEU B 1 223 ? 13.255  87.236  -30.154 1.00 33.57  ? 264 LEU B CD1   1 
ATOM   4138 C  CD2   . LEU B 1 223 ? 14.096  89.125  -28.758 1.00 30.66  ? 264 LEU B CD2   1 
ATOM   4139 N  N     . GLN B 1 224 ? 18.646  87.498  -28.290 1.00 30.00  ? 265 GLN B N     1 
ATOM   4140 C  CA    . GLN B 1 224 ? 19.608  86.516  -27.809 1.00 30.48  ? 265 GLN B CA    1 
ATOM   4141 C  C     . GLN B 1 224 ? 18.837  85.355  -27.194 1.00 31.16  ? 265 GLN B C     1 
ATOM   4142 O  O     . GLN B 1 224 ? 17.635  85.468  -26.949 1.00 30.16  ? 265 GLN B O     1 
ATOM   4143 C  CB    . GLN B 1 224 ? 20.571  87.136  -26.794 1.00 31.55  ? 265 GLN B CB    1 
ATOM   4144 C  CG    . GLN B 1 224 ? 21.382  88.298  -27.346 1.00 38.95  ? 265 GLN B CG    1 
ATOM   4145 C  CD    . GLN B 1 224 ? 22.219  87.905  -28.548 1.00 44.42  ? 265 GLN B CD    1 
ATOM   4146 O  OE1   . GLN B 1 224 ? 22.898  86.877  -28.537 1.00 46.34  ? 265 GLN B OE1   1 
ATOM   4147 N  NE2   . GLN B 1 224 ? 22.171  88.721  -29.597 1.00 50.34  ? 265 GLN B NE2   1 
ATOM   4148 N  N     . TRP B 1 225 ? 19.517  84.240  -26.951 1.00 29.23  ? 266 TRP B N     1 
ATOM   4149 C  CA    . TRP B 1 225 ? 18.856  83.067  -26.390 1.00 30.17  ? 266 TRP B CA    1 
ATOM   4150 C  C     . TRP B 1 225 ? 18.290  83.348  -25.001 1.00 25.82  ? 266 TRP B C     1 
ATOM   4151 O  O     . TRP B 1 225 ? 17.239  82.822  -24.637 1.00 26.26  ? 266 TRP B O     1 
ATOM   4152 C  CB    . TRP B 1 225 ? 19.819  81.882  -26.337 1.00 28.95  ? 266 TRP B CB    1 
ATOM   4153 C  CG    . TRP B 1 225 ? 20.090  81.282  -27.682 1.00 31.60  ? 266 TRP B CG    1 
ATOM   4154 C  CD1   . TRP B 1 225 ? 21.268  81.304  -28.369 1.00 27.44  ? 266 TRP B CD1   1 
ATOM   4155 C  CD2   . TRP B 1 225 ? 19.155  80.580  -28.509 1.00 29.20  ? 266 TRP B CD2   1 
ATOM   4156 N  NE1   . TRP B 1 225 ? 21.127  80.650  -29.570 1.00 28.99  ? 266 TRP B NE1   1 
ATOM   4157 C  CE2   . TRP B 1 225 ? 19.838  80.197  -29.680 1.00 31.72  ? 266 TRP B CE2   1 
ATOM   4158 C  CE3   . TRP B 1 225 ? 17.808  80.233  -28.371 1.00 29.63  ? 266 TRP B CE3   1 
ATOM   4159 C  CZ2   . TRP B 1 225 ? 19.220  79.487  -30.706 1.00 30.54  ? 266 TRP B CZ2   1 
ATOM   4160 C  CZ3   . TRP B 1 225 ? 17.196  79.528  -29.389 1.00 32.62  ? 266 TRP B CZ3   1 
ATOM   4161 C  CH2   . TRP B 1 225 ? 17.902  79.163  -30.542 1.00 30.82  ? 266 TRP B CH2   1 
ATOM   4162 N  N     . VAL B 1 226 ? 18.985  84.183  -24.234 1.00 28.89  ? 267 VAL B N     1 
ATOM   4163 C  CA    . VAL B 1 226 ? 18.524  84.547  -22.899 1.00 27.41  ? 267 VAL B CA    1 
ATOM   4164 C  C     . VAL B 1 226 ? 17.282  85.435  -22.990 1.00 28.80  ? 267 VAL B C     1 
ATOM   4165 O  O     . VAL B 1 226 ? 16.419  85.406  -22.111 1.00 28.52  ? 267 VAL B O     1 
ATOM   4166 C  CB    . VAL B 1 226 ? 19.635  85.262  -22.088 1.00 30.14  ? 267 VAL B CB    1 
ATOM   4167 C  CG1   . VAL B 1 226 ? 20.085  86.546  -22.782 1.00 25.75  ? 267 VAL B CG1   1 
ATOM   4168 C  CG2   . VAL B 1 226 ? 19.167  85.543  -20.665 1.00 20.65  ? 267 VAL B CG2   1 
ATOM   4169 N  N     . ASP B 1 227 ? 17.188  86.207  -24.069 1.00 28.29  ? 268 ASP B N     1 
ATOM   4170 C  CA    . ASP B 1 227 ? 16.026  87.053  -24.308 1.00 27.58  ? 268 ASP B CA    1 
ATOM   4171 C  C     . ASP B 1 227 ? 14.807  86.198  -24.645 1.00 25.78  ? 268 ASP B C     1 
ATOM   4172 O  O     . ASP B 1 227 ? 13.707  86.448  -24.155 1.00 24.19  ? 268 ASP B O     1 
ATOM   4173 C  CB    . ASP B 1 227 ? 16.308  88.052  -25.433 1.00 27.15  ? 268 ASP B CB    1 
ATOM   4174 C  CG    . ASP B 1 227 ? 17.475  88.972  -25.119 1.00 28.42  ? 268 ASP B CG    1 
ATOM   4175 O  OD1   . ASP B 1 227 ? 17.630  89.362  -23.942 1.00 31.31  ? 268 ASP B OD1   1 
ATOM   4176 O  OD2   . ASP B 1 227 ? 18.240  89.305  -26.049 1.00 30.00  ? 268 ASP B OD2   1 
ATOM   4177 N  N     . ILE B 1 228 ? 15.014  85.185  -25.480 1.00 24.81  ? 269 ILE B N     1 
ATOM   4178 C  CA    . ILE B 1 228 ? 13.950  84.260  -25.854 1.00 27.26  ? 269 ILE B CA    1 
ATOM   4179 C  C     . ILE B 1 228 ? 13.423  83.505  -24.634 1.00 23.94  ? 269 ILE B C     1 
ATOM   4180 O  O     . ILE B 1 228 ? 12.212  83.352  -24.456 1.00 22.09  ? 269 ILE B O     1 
ATOM   4181 C  CB    . ILE B 1 228 ? 14.435  83.248  -26.909 1.00 26.51  ? 269 ILE B CB    1 
ATOM   4182 C  CG1   . ILE B 1 228 ? 14.803  83.966  -28.210 1.00 31.79  ? 269 ILE B CG1   1 
ATOM   4183 C  CG2   . ILE B 1 228 ? 13.372  82.198  -27.171 1.00 25.40  ? 269 ILE B CG2   1 
ATOM   4184 C  CD1   . ILE B 1 228 ? 15.321  83.041  -29.296 1.00 32.50  ? 269 ILE B CD1   1 
ATOM   4185 N  N     . ALA B 1 229 ? 14.345  83.042  -23.793 1.00 22.58  ? 270 ALA B N     1 
ATOM   4186 C  CA    . ALA B 1 229 ? 13.990  82.301  -22.587 1.00 25.48  ? 270 ALA B CA    1 
ATOM   4187 C  C     . ALA B 1 229 ? 13.207  83.182  -21.620 1.00 23.56  ? 270 ALA B C     1 
ATOM   4188 O  O     . ALA B 1 229 ? 12.158  82.782  -21.114 1.00 21.41  ? 270 ALA B O     1 
ATOM   4189 C  CB    . ALA B 1 229 ? 15.240  81.751  -21.914 1.00 26.60  ? 270 ALA B CB    1 
ATOM   4190 N  N     . HIS B 1 230 ? 13.719  84.386  -21.381 1.00 25.32  ? 271 HIS B N     1 
ATOM   4191 C  CA    . HIS B 1 230 ? 13.094  85.330  -20.460 1.00 25.31  ? 271 HIS B CA    1 
ATOM   4192 C  C     . HIS B 1 230 ? 11.705  85.738  -20.944 1.00 26.85  ? 271 HIS B C     1 
ATOM   4193 O  O     . HIS B 1 230 ? 10.738  85.700  -20.182 1.00 25.10  ? 271 HIS B O     1 
ATOM   4194 C  CB    . HIS B 1 230 ? 13.983  86.567  -20.286 1.00 23.71  ? 271 HIS B CB    1 
ATOM   4195 C  CG    . HIS B 1 230 ? 13.559  87.478  -19.173 1.00 29.73  ? 271 HIS B CG    1 
ATOM   4196 N  ND1   . HIS B 1 230 ? 14.418  88.383  -18.591 1.00 33.66  ? 271 HIS B ND1   1 
ATOM   4197 C  CD2   . HIS B 1 230 ? 12.368  87.631  -18.545 1.00 29.48  ? 271 HIS B CD2   1 
ATOM   4198 C  CE1   . HIS B 1 230 ? 13.777  89.053  -17.647 1.00 27.34  ? 271 HIS B CE1   1 
ATOM   4199 N  NE2   . HIS B 1 230 ? 12.533  88.616  -17.600 1.00 30.73  ? 271 HIS B NE2   1 
ATOM   4200 N  N     . LEU B 1 231 ? 11.612  86.120  -22.213 1.00 21.88  ? 272 LEU B N     1 
ATOM   4201 C  CA    . LEU B 1 231 ? 10.357  86.606  -22.777 1.00 24.46  ? 272 LEU B CA    1 
ATOM   4202 C  C     . LEU B 1 231 ? 9.257   85.547  -22.739 1.00 21.32  ? 272 LEU B C     1 
ATOM   4203 O  O     . LEU B 1 231 ? 8.108   85.849  -22.421 1.00 21.06  ? 272 LEU B O     1 
ATOM   4204 C  CB    . LEU B 1 231 ? 10.571  87.084  -24.215 1.00 20.89  ? 272 LEU B CB    1 
ATOM   4205 C  CG    . LEU B 1 231 ? 9.359   87.695  -24.919 1.00 29.64  ? 272 LEU B CG    1 
ATOM   4206 C  CD1   . LEU B 1 231 ? 8.846   88.907  -24.153 1.00 22.59  ? 272 LEU B CD1   1 
ATOM   4207 C  CD2   . LEU B 1 231 ? 9.701   88.066  -26.356 1.00 24.30  ? 272 LEU B CD2   1 
ATOM   4208 N  N     . CYS B 1 232 ? 9.613   84.308  -23.058 1.00 19.72  ? 273 CYS B N     1 
ATOM   4209 C  CA    . CYS B 1 232 ? 8.631   83.233  -23.113 1.00 23.26  ? 273 CYS B CA    1 
ATOM   4210 C  C     . CYS B 1 232 ? 8.252   82.737  -21.718 1.00 24.33  ? 273 CYS B C     1 
ATOM   4211 O  O     . CYS B 1 232 ? 7.094   82.400  -21.471 1.00 23.80  ? 273 CYS B O     1 
ATOM   4212 C  CB    . CYS B 1 232 ? 9.154   82.083  -23.972 1.00 23.53  ? 273 CYS B CB    1 
ATOM   4213 S  SG    . CYS B 1 232 ? 9.223   82.484  -25.739 1.00 26.68  ? 273 CYS B SG    1 
ATOM   4214 N  N     . LEU B 1 233 ? 9.222   82.698  -20.808 1.00 24.93  ? 274 LEU B N     1 
ATOM   4215 C  CA    . LEU B 1 233 ? 8.935   82.375  -19.413 1.00 23.67  ? 274 LEU B CA    1 
ATOM   4216 C  C     . LEU B 1 233 ? 7.992   83.415  -18.826 1.00 25.12  ? 274 LEU B C     1 
ATOM   4217 O  O     . LEU B 1 233 ? 7.078   83.086  -18.070 1.00 25.31  ? 274 LEU B O     1 
ATOM   4218 C  CB    . LEU B 1 233 ? 10.218  82.307  -18.581 1.00 28.76  ? 274 LEU B CB    1 
ATOM   4219 C  CG    . LEU B 1 233 ? 10.739  80.921  -18.200 1.00 31.21  ? 274 LEU B CG    1 
ATOM   4220 C  CD1   . LEU B 1 233 ? 11.870  81.044  -17.188 1.00 30.97  ? 274 LEU B CD1   1 
ATOM   4221 C  CD2   . LEU B 1 233 ? 9.618   80.046  -17.658 1.00 20.58  ? 274 LEU B CD2   1 
ATOM   4222 N  N     . TYR B 1 234 ? 8.224   84.673  -19.185 1.00 20.79  ? 275 TYR B N     1 
ATOM   4223 C  CA    . TYR B 1 234 ? 7.386   85.771  -18.727 1.00 21.89  ? 275 TYR B CA    1 
ATOM   4224 C  C     . TYR B 1 234 ? 5.959   85.615  -19.240 1.00 25.55  ? 275 TYR B C     1 
ATOM   4225 O  O     . TYR B 1 234 ? 4.999   85.834  -18.503 1.00 27.54  ? 275 TYR B O     1 
ATOM   4226 C  CB    . TYR B 1 234 ? 7.971   87.111  -19.179 1.00 21.55  ? 275 TYR B CB    1 
ATOM   4227 C  CG    . TYR B 1 234 ? 7.111   88.305  -18.833 1.00 25.41  ? 275 TYR B CG    1 
ATOM   4228 C  CD1   . TYR B 1 234 ? 7.120   88.842  -17.554 1.00 24.77  ? 275 TYR B CD1   1 
ATOM   4229 C  CD2   . TYR B 1 234 ? 6.294   88.897  -19.787 1.00 19.99  ? 275 TYR B CD2   1 
ATOM   4230 C  CE1   . TYR B 1 234 ? 6.338   89.933  -17.231 1.00 24.21  ? 275 TYR B CE1   1 
ATOM   4231 C  CE2   . TYR B 1 234 ? 5.506   89.990  -19.476 1.00 21.22  ? 275 TYR B CE2   1 
ATOM   4232 C  CZ    . TYR B 1 234 ? 5.532   90.502  -18.195 1.00 27.83  ? 275 TYR B CZ    1 
ATOM   4233 O  OH    . TYR B 1 234 ? 4.753   91.589  -17.874 1.00 24.07  ? 275 TYR B OH    1 
ATOM   4234 N  N     . ASN B 1 235 ? 5.830   85.229  -20.505 1.00 20.35  ? 276 ASN B N     1 
ATOM   4235 C  CA    . ASN B 1 235 ? 4.522   85.035  -21.119 1.00 23.21  ? 276 ASN B CA    1 
ATOM   4236 C  C     . ASN B 1 235 ? 3.753   83.868  -20.513 1.00 23.39  ? 276 ASN B C     1 
ATOM   4237 O  O     . ASN B 1 235 ? 2.548   83.964  -20.281 1.00 22.82  ? 276 ASN B O     1 
ATOM   4238 C  CB    . ASN B 1 235 ? 4.673   84.831  -22.624 1.00 22.30  ? 276 ASN B CB    1 
ATOM   4239 C  CG    . ASN B 1 235 ? 4.656   86.136  -23.389 1.00 24.26  ? 276 ASN B CG    1 
ATOM   4240 O  OD1   . ASN B 1 235 ? 5.657   86.850  -23.446 1.00 22.67  ? 276 ASN B OD1   1 
ATOM   4241 N  ND2   . ASN B 1 235 ? 3.513   86.458  -23.979 1.00 21.06  ? 276 ASN B ND2   1 
ATOM   4242 N  N     . LEU B 1 236 ? 4.452   82.766  -20.263 1.00 19.49  ? 277 LEU B N     1 
ATOM   4243 C  CA    . LEU B 1 236 ? 3.846   81.613  -19.608 1.00 26.13  ? 277 LEU B CA    1 
ATOM   4244 C  C     . LEU B 1 236 ? 3.392   81.981  -18.201 1.00 27.00  ? 277 LEU B C     1 
ATOM   4245 O  O     . LEU B 1 236 ? 2.336   81.542  -17.743 1.00 27.12  ? 277 LEU B O     1 
ATOM   4246 C  CB    . LEU B 1 236 ? 4.827   80.438  -19.561 1.00 24.40  ? 277 LEU B CB    1 
ATOM   4247 C  CG    . LEU B 1 236 ? 5.129   79.763  -20.901 1.00 29.27  ? 277 LEU B CG    1 
ATOM   4248 C  CD1   . LEU B 1 236 ? 6.232   78.728  -20.743 1.00 27.44  ? 277 LEU B CD1   1 
ATOM   4249 C  CD2   . LEU B 1 236 ? 3.872   79.128  -21.486 1.00 27.58  ? 277 LEU B CD2   1 
ATOM   4250 N  N     . SER B 1 237 ? 4.194   82.799  -17.526 1.00 22.77  ? 278 SER B N     1 
ATOM   4251 C  CA    . SER B 1 237 ? 3.895   83.233  -16.167 1.00 26.98  ? 278 SER B CA    1 
ATOM   4252 C  C     . SER B 1 237 ? 2.644   84.101  -16.113 1.00 32.51  ? 278 SER B C     1 
ATOM   4253 O  O     . SER B 1 237 ? 1.818   83.957  -15.213 1.00 28.79  ? 278 SER B O     1 
ATOM   4254 C  CB    . SER B 1 237 ? 5.082   83.998  -15.580 1.00 24.09  ? 278 SER B CB    1 
ATOM   4255 O  OG    . SER B 1 237 ? 6.239   83.183  -15.531 1.00 28.83  ? 278 SER B OG    1 
ATOM   4256 N  N     . VAL B 1 238 ? 2.516   85.006  -17.078 1.00 24.51  ? 279 VAL B N     1 
ATOM   4257 C  CA    . VAL B 1 238 ? 1.362   85.894  -17.153 1.00 28.74  ? 279 VAL B CA    1 
ATOM   4258 C  C     . VAL B 1 238 ? 0.090   85.120  -17.492 1.00 25.85  ? 279 VAL B C     1 
ATOM   4259 O  O     . VAL B 1 238 ? -0.955  85.310  -16.868 1.00 28.40  ? 279 VAL B O     1 
ATOM   4260 C  CB    . VAL B 1 238 ? 1.578   87.010  -18.204 1.00 28.92  ? 279 VAL B CB    1 
ATOM   4261 C  CG1   . VAL B 1 238 ? 0.284   87.769  -18.458 1.00 21.84  ? 279 VAL B CG1   1 
ATOM   4262 C  CG2   . VAL B 1 238 ? 2.686   87.958  -17.760 1.00 28.55  ? 279 VAL B CG2   1 
ATOM   4263 N  N     . ILE B 1 239 ? 0.191   84.238  -18.479 1.00 25.97  ? 280 ILE B N     1 
ATOM   4264 C  CA    . ILE B 1 239 ? -0.959  83.486  -18.966 1.00 27.63  ? 280 ILE B CA    1 
ATOM   4265 C  C     . ILE B 1 239 ? -1.498  82.502  -17.926 1.00 31.20  ? 280 ILE B C     1 
ATOM   4266 O  O     . ILE B 1 239 ? -2.708  82.414  -17.712 1.00 36.29  ? 280 ILE B O     1 
ATOM   4267 C  CB    . ILE B 1 239 ? -0.599  82.724  -20.262 1.00 32.13  ? 280 ILE B CB    1 
ATOM   4268 C  CG1   . ILE B 1 239 ? -0.374  83.708  -21.414 1.00 27.14  ? 280 ILE B CG1   1 
ATOM   4269 C  CG2   . ILE B 1 239 ? -1.684  81.721  -20.628 1.00 29.80  ? 280 ILE B CG2   1 
ATOM   4270 C  CD1   . ILE B 1 239 ? 0.116   83.049  -22.688 1.00 27.23  ? 280 ILE B CD1   1 
ATOM   4271 N  N     . HIS B 1 240 ? -0.602  81.778  -17.265 1.00 27.51  ? 281 HIS B N     1 
ATOM   4272 C  CA    . HIS B 1 240 ? -1.018  80.709  -16.360 1.00 32.12  ? 281 HIS B CA    1 
ATOM   4273 C  C     . HIS B 1 240 ? -1.033  81.116  -14.888 1.00 31.46  ? 281 HIS B C     1 
ATOM   4274 O  O     . HIS B 1 240 ? -1.448  80.332  -14.034 1.00 29.70  ? 281 HIS B O     1 
ATOM   4275 C  CB    . HIS B 1 240 ? -0.112  79.491  -16.538 1.00 31.66  ? 281 HIS B CB    1 
ATOM   4276 C  CG    . HIS B 1 240 ? -0.136  78.918  -17.919 1.00 32.91  ? 281 HIS B CG    1 
ATOM   4277 N  ND1   . HIS B 1 240 ? -1.227  78.244  -18.426 1.00 33.15  ? 281 HIS B ND1   1 
ATOM   4278 C  CD2   . HIS B 1 240 ? 0.796   78.916  -18.900 1.00 28.97  ? 281 HIS B CD2   1 
ATOM   4279 C  CE1   . HIS B 1 240 ? -0.965  77.853  -19.660 1.00 34.74  ? 281 HIS B CE1   1 
ATOM   4280 N  NE2   . HIS B 1 240 ? 0.256   78.248  -19.972 1.00 30.49  ? 281 HIS B NE2   1 
ATOM   4281 N  N     . LYS B 1 241 ? -0.584  82.334  -14.599 1.00 28.41  ? 282 LYS B N     1 
ATOM   4282 C  CA    . LYS B 1 241 ? -0.505  82.835  -13.225 1.00 33.02  ? 282 LYS B CA    1 
ATOM   4283 C  C     . LYS B 1 241 ? 0.257   81.889  -12.299 1.00 34.85  ? 282 LYS B C     1 
ATOM   4284 O  O     . LYS B 1 241 ? -0.197  81.589  -11.195 1.00 37.97  ? 282 LYS B O     1 
ATOM   4285 C  CB    . LYS B 1 241 ? -1.905  83.090  -12.657 1.00 34.20  ? 282 LYS B CB    1 
ATOM   4286 C  CG    . LYS B 1 241 ? -2.462  84.476  -12.938 1.00 38.11  ? 282 LYS B CG    1 
ATOM   4287 C  CD    . LYS B 1 241 ? -3.121  84.554  -14.304 1.00 44.27  ? 282 LYS B CD    1 
ATOM   4288 C  CE    . LYS B 1 241 ? -3.826  85.890  -14.499 1.00 53.90  ? 282 LYS B CE    1 
ATOM   4289 N  NZ    . LYS B 1 241 ? -4.617  85.930  -15.762 1.00 57.86  ? 282 LYS B NZ    1 
ATOM   4290 N  N     . LYS B 1 242 ? 1.412   81.417  -12.756 1.00 34.64  ? 283 LYS B N     1 
ATOM   4291 C  CA    . LYS B 1 242 ? 2.273   80.576  -11.931 1.00 33.36  ? 283 LYS B CA    1 
ATOM   4292 C  C     . LYS B 1 242 ? 3.740   80.906  -12.188 1.00 29.23  ? 283 LYS B C     1 
ATOM   4293 O  O     . LYS B 1 242 ? 4.064   81.644  -13.119 1.00 33.01  ? 283 LYS B O     1 
ATOM   4294 C  CB    . LYS B 1 242 ? 1.995   79.094  -12.195 1.00 34.45  ? 283 LYS B CB    1 
ATOM   4295 C  CG    . LYS B 1 242 ? 1.940   78.733  -13.663 1.00 35.67  ? 283 LYS B CG    1 
ATOM   4296 C  CD    . LYS B 1 242 ? 1.519   77.291  -13.875 1.00 44.59  ? 283 LYS B CD    1 
ATOM   4297 C  CE    . LYS B 1 242 ? 2.557   76.323  -13.337 1.00 40.98  ? 283 LYS B CE    1 
ATOM   4298 N  NZ    . LYS B 1 242 ? 2.226   74.916  -13.705 1.00 48.42  ? 283 LYS B NZ    1 
ATOM   4299 N  N     . LYS B 1 243 ? 4.625   80.362  -11.360 1.00 33.92  ? 284 LYS B N     1 
ATOM   4300 C  CA    . LYS B 1 243 ? 6.035   80.727  -11.417 1.00 31.87  ? 284 LYS B CA    1 
ATOM   4301 C  C     . LYS B 1 243 ? 6.888   79.711  -12.175 1.00 31.02  ? 284 LYS B C     1 
ATOM   4302 O  O     . LYS B 1 243 ? 7.594   80.069  -13.117 1.00 30.24  ? 284 LYS B O     1 
ATOM   4303 C  CB    . LYS B 1 243 ? 6.586   80.910  -10.001 1.00 32.88  ? 284 LYS B CB    1 
ATOM   4304 C  CG    . LYS B 1 243 ? 8.038   81.355  -9.954  1.00 35.06  ? 284 LYS B CG    1 
ATOM   4305 C  CD    . LYS B 1 243 ? 8.488   81.588  -8.524  1.00 38.03  ? 284 LYS B CD    1 
ATOM   4306 C  CE    . LYS B 1 243 ? 9.924   82.066  -8.464  1.00 38.31  ? 284 LYS B CE    1 
ATOM   4307 N  NZ    . LYS B 1 243 ? 10.349  82.298  -7.060  1.00 39.60  ? 284 LYS B NZ    1 
ATOM   4308 N  N     . TYR B 1 244 ? 6.819   78.448  -11.768 1.00 31.20  ? 285 TYR B N     1 
ATOM   4309 C  CA    . TYR B 1 244 ? 7.709   77.425  -12.313 1.00 30.18  ? 285 TYR B CA    1 
ATOM   4310 C  C     . TYR B 1 244 ? 7.135   76.702  -13.524 1.00 28.90  ? 285 TYR B C     1 
ATOM   4311 O  O     . TYR B 1 244 ? 5.952   76.369  -13.567 1.00 31.88  ? 285 TYR B O     1 
ATOM   4312 C  CB    . TYR B 1 244 ? 8.066   76.408  -11.228 1.00 29.15  ? 285 TYR B CB    1 
ATOM   4313 C  CG    . TYR B 1 244 ? 8.921   76.991  -10.129 1.00 31.67  ? 285 TYR B CG    1 
ATOM   4314 C  CD1   . TYR B 1 244 ? 10.305  76.999  -10.230 1.00 30.32  ? 285 TYR B CD1   1 
ATOM   4315 C  CD2   . TYR B 1 244 ? 8.343   77.548  -8.994  1.00 33.07  ? 285 TYR B CD2   1 
ATOM   4316 C  CE1   . TYR B 1 244 ? 11.092  77.538  -9.229  1.00 31.93  ? 285 TYR B CE1   1 
ATOM   4317 C  CE2   . TYR B 1 244 ? 9.121   78.089  -7.989  1.00 28.66  ? 285 TYR B CE2   1 
ATOM   4318 C  CZ    . TYR B 1 244 ? 10.493  78.080  -8.111  1.00 29.88  ? 285 TYR B CZ    1 
ATOM   4319 O  OH    . TYR B 1 244 ? 11.266  78.619  -7.110  1.00 36.96  ? 285 TYR B OH    1 
ATOM   4320 N  N     . PHE B 1 245 ? 7.992   76.461  -14.509 1.00 27.97  ? 286 PHE B N     1 
ATOM   4321 C  CA    . PHE B 1 245 ? 7.599   75.729  -15.703 1.00 28.68  ? 286 PHE B CA    1 
ATOM   4322 C  C     . PHE B 1 245 ? 8.674   74.723  -16.089 1.00 27.29  ? 286 PHE B C     1 
ATOM   4323 O  O     . PHE B 1 245 ? 9.863   74.984  -15.914 1.00 30.12  ? 286 PHE B O     1 
ATOM   4324 C  CB    . PHE B 1 245 ? 7.341   76.688  -16.866 1.00 26.06  ? 286 PHE B CB    1 
ATOM   4325 C  CG    . PHE B 1 245 ? 6.232   77.663  -16.613 1.00 26.32  ? 286 PHE B CG    1 
ATOM   4326 C  CD1   . PHE B 1 245 ? 4.932   77.358  -16.976 1.00 25.24  ? 286 PHE B CD1   1 
ATOM   4327 C  CD2   . PHE B 1 245 ? 6.489   78.887  -16.018 1.00 23.61  ? 286 PHE B CD2   1 
ATOM   4328 C  CE1   . PHE B 1 245 ? 3.909   78.253  -16.748 1.00 28.78  ? 286 PHE B CE1   1 
ATOM   4329 C  CE2   . PHE B 1 245 ? 5.471   79.786  -15.786 1.00 27.78  ? 286 PHE B CE2   1 
ATOM   4330 C  CZ    . PHE B 1 245 ? 4.179   79.469  -16.153 1.00 28.65  ? 286 PHE B CZ    1 
ATOM   4331 N  N     . ASP B 1 246 ? 8.253   73.575  -16.611 1.00 24.71  ? 287 ASP B N     1 
ATOM   4332 C  CA    . ASP B 1 246 ? 9.193   72.582  -17.120 1.00 30.73  ? 287 ASP B CA    1 
ATOM   4333 C  C     . ASP B 1 246 ? 9.933   73.155  -18.326 1.00 28.52  ? 287 ASP B C     1 
ATOM   4334 O  O     . ASP B 1 246 ? 9.313   73.575  -19.303 1.00 26.33  ? 287 ASP B O     1 
ATOM   4335 C  CB    . ASP B 1 246 ? 8.472   71.286  -17.499 1.00 31.30  ? 287 ASP B CB    1 
ATOM   4336 C  CG    . ASP B 1 246 ? 9.430   70.132  -17.747 1.00 36.29  ? 287 ASP B CG    1 
ATOM   4337 O  OD1   . ASP B 1 246 ? 10.078  70.111  -18.815 1.00 34.61  ? 287 ASP B OD1   1 
ATOM   4338 O  OD2   . ASP B 1 246 ? 9.528   69.241  -16.877 1.00 41.49  ? 287 ASP B OD2   1 
ATOM   4339 N  N     . SER B 1 247 ? 11.260  73.172  -18.247 1.00 30.39  ? 288 SER B N     1 
ATOM   4340 C  CA    . SER B 1 247 ? 12.085  73.804  -19.273 1.00 32.12  ? 288 SER B CA    1 
ATOM   4341 C  C     . SER B 1 247 ? 11.897  73.169  -20.646 1.00 32.98  ? 288 SER B C     1 
ATOM   4342 O  O     . SER B 1 247 ? 11.963  73.852  -21.669 1.00 33.29  ? 288 SER B O     1 
ATOM   4343 C  CB    . SER B 1 247 ? 13.561  73.744  -18.876 1.00 30.26  ? 288 SER B CB    1 
ATOM   4344 O  OG    . SER B 1 247 ? 13.989  72.403  -18.713 1.00 37.36  ? 288 SER B OG    1 
ATOM   4345 N  N     . GLU B 1 248 ? 11.657  71.863  -20.666 1.00 33.78  ? 289 GLU B N     1 
ATOM   4346 C  CA    . GLU B 1 248 ? 11.540  71.137  -21.925 1.00 32.10  ? 289 GLU B CA    1 
ATOM   4347 C  C     . GLU B 1 248 ? 10.094  70.972  -22.379 1.00 35.18  ? 289 GLU B C     1 
ATOM   4348 O  O     . GLU B 1 248 ? 9.766   71.233  -23.537 1.00 39.87  ? 289 GLU B O     1 
ATOM   4349 C  CB    . GLU B 1 248 ? 12.196  69.761  -21.805 1.00 35.07  ? 289 GLU B CB    1 
ATOM   4350 C  CG    . GLU B 1 248 ? 12.090  68.919  -23.066 1.00 39.65  ? 289 GLU B CG    1 
ATOM   4351 C  CD    . GLU B 1 248 ? 12.786  67.579  -22.935 1.00 50.08  ? 289 GLU B CD    1 
ATOM   4352 O  OE1   . GLU B 1 248 ? 13.359  67.309  -21.858 1.00 48.01  ? 289 GLU B OE1   1 
ATOM   4353 O  OE2   . GLU B 1 248 ? 12.763  66.797  -23.908 1.00 58.41  ? 289 GLU B OE2   1 
ATOM   4354 N  N     . LEU B 1 249 ? 9.233   70.541  -21.465 1.00 28.07  ? 290 LEU B N     1 
ATOM   4355 C  CA    . LEU B 1 249 ? 7.863   70.180  -21.818 1.00 30.39  ? 290 LEU B CA    1 
ATOM   4356 C  C     . LEU B 1 249 ? 6.900   71.364  -21.827 1.00 30.25  ? 290 LEU B C     1 
ATOM   4357 O  O     . LEU B 1 249 ? 5.818   71.283  -22.408 1.00 31.47  ? 290 LEU B O     1 
ATOM   4358 C  CB    . LEU B 1 249 ? 7.343   69.107  -20.860 1.00 30.24  ? 290 LEU B CB    1 
ATOM   4359 C  CG    . LEU B 1 249 ? 8.056   67.755  -20.923 1.00 41.20  ? 290 LEU B CG    1 
ATOM   4360 C  CD1   . LEU B 1 249 ? 7.436   66.780  -19.939 1.00 37.49  ? 290 LEU B CD1   1 
ATOM   4361 C  CD2   . LEU B 1 249 ? 8.016   67.195  -22.338 1.00 32.14  ? 290 LEU B CD2   1 
ATOM   4362 N  N     . GLU B 1 250 ? 7.285   72.461  -21.184 1.00 22.87  ? 291 GLU B N     1 
ATOM   4363 C  CA    . GLU B 1 250 ? 6.418   73.631  -21.122 1.00 27.54  ? 291 GLU B CA    1 
ATOM   4364 C  C     . GLU B 1 250 ? 7.050   74.848  -21.789 1.00 30.58  ? 291 GLU B C     1 
ATOM   4365 O  O     . GLU B 1 250 ? 6.455   75.451  -22.682 1.00 24.50  ? 291 GLU B O     1 
ATOM   4366 C  CB    . GLU B 1 250 ? 6.059   73.949  -19.669 1.00 26.54  ? 291 GLU B CB    1 
ATOM   4367 C  CG    . GLU B 1 250 ? 5.107   72.939  -19.044 1.00 32.46  ? 291 GLU B CG    1 
ATOM   4368 C  CD    . GLU B 1 250 ? 4.697   73.309  -17.632 1.00 33.22  ? 291 GLU B CD    1 
ATOM   4369 O  OE1   . GLU B 1 250 ? 5.585   73.406  -16.759 1.00 34.22  ? 291 GLU B OE1   1 
ATOM   4370 O  OE2   . GLU B 1 250 ? 3.487   73.506  -17.397 1.00 34.78  ? 291 GLU B OE2   1 
ATOM   4371 N  N     . LEU B 1 251 ? 8.256   75.205  -21.359 1.00 25.49  ? 292 LEU B N     1 
ATOM   4372 C  CA    . LEU B 1 251 ? 8.940   76.374  -21.902 1.00 25.73  ? 292 LEU B CA    1 
ATOM   4373 C  C     . LEU B 1 251 ? 9.354   76.167  -23.356 1.00 30.74  ? 292 LEU B C     1 
ATOM   4374 O  O     . LEU B 1 251 ? 9.019   76.971  -24.225 1.00 27.34  ? 292 LEU B O     1 
ATOM   4375 C  CB    . LEU B 1 251 ? 10.167  76.716  -21.058 1.00 20.58  ? 292 LEU B CB    1 
ATOM   4376 C  CG    . LEU B 1 251 ? 11.022  77.872  -21.582 1.00 27.96  ? 292 LEU B CG    1 
ATOM   4377 C  CD1   . LEU B 1 251 ? 10.191  79.145  -21.716 1.00 19.60  ? 292 LEU B CD1   1 
ATOM   4378 C  CD2   . LEU B 1 251 ? 12.230  78.102  -20.684 1.00 25.70  ? 292 LEU B CD2   1 
ATOM   4379 N  N     . MET B 1 252 ? 10.081  75.087  -23.615 1.00 31.41  ? 293 MET B N     1 
ATOM   4380 C  CA    . MET B 1 252 ? 10.591  74.813  -24.953 1.00 28.83  ? 293 MET B CA    1 
ATOM   4381 C  C     . MET B 1 252 ? 9.455   74.563  -25.935 1.00 33.38  ? 293 MET B C     1 
ATOM   4382 O  O     . MET B 1 252 ? 9.559   74.885  -27.120 1.00 30.76  ? 293 MET B O     1 
ATOM   4383 C  CB    . MET B 1 252 ? 11.536  73.612  -24.929 1.00 29.63  ? 293 MET B CB    1 
ATOM   4384 C  CG    . MET B 1 252 ? 12.443  73.536  -26.136 1.00 40.01  ? 293 MET B CG    1 
ATOM   4385 S  SD    . MET B 1 252 ? 13.430  75.034  -26.295 1.00 38.48  ? 293 MET B SD    1 
ATOM   4386 C  CE    . MET B 1 252 ? 12.968  75.560  -27.941 1.00 34.88  ? 293 MET B CE    1 
ATOM   4387 N  N     . THR B 1 253 ? 8.373   73.981  -25.429 1.00 31.76  ? 294 THR B N     1 
ATOM   4388 C  CA    . THR B 1 253 ? 7.180   73.737  -26.226 1.00 32.94  ? 294 THR B CA    1 
ATOM   4389 C  C     . THR B 1 253 ? 6.562   75.058  -26.668 1.00 32.78  ? 294 THR B C     1 
ATOM   4390 O  O     . THR B 1 253 ? 6.211   75.228  -27.834 1.00 30.80  ? 294 THR B O     1 
ATOM   4391 C  CB    . THR B 1 253 ? 6.140   72.913  -25.441 1.00 32.48  ? 294 THR B CB    1 
ATOM   4392 O  OG1   . THR B 1 253 ? 6.660   71.601  -25.194 1.00 40.38  ? 294 THR B OG1   1 
ATOM   4393 C  CG2   . THR B 1 253 ? 4.840   72.799  -26.221 1.00 33.77  ? 294 THR B CG2   1 
ATOM   4394 N  N     . TYR B 1 254 ? 6.443   75.996  -25.732 1.00 24.83  ? 295 TYR B N     1 
ATOM   4395 C  CA    . TYR B 1 254 ? 5.883   77.309  -26.035 1.00 29.58  ? 295 TYR B CA    1 
ATOM   4396 C  C     . TYR B 1 254 ? 6.764   78.081  -27.009 1.00 29.67  ? 295 TYR B C     1 
ATOM   4397 O  O     . TYR B 1 254 ? 6.263   78.805  -27.866 1.00 30.44  ? 295 TYR B O     1 
ATOM   4398 C  CB    . TYR B 1 254 ? 5.692   78.126  -24.757 1.00 26.85  ? 295 TYR B CB    1 
ATOM   4399 C  CG    . TYR B 1 254 ? 4.989   79.448  -24.980 1.00 29.09  ? 295 TYR B CG    1 
ATOM   4400 C  CD1   . TYR B 1 254 ? 3.603   79.517  -25.026 1.00 28.76  ? 295 TYR B CD1   1 
ATOM   4401 C  CD2   . TYR B 1 254 ? 5.708   80.627  -25.142 1.00 28.18  ? 295 TYR B CD2   1 
ATOM   4402 C  CE1   . TYR B 1 254 ? 2.951   80.720  -25.227 1.00 29.29  ? 295 TYR B CE1   1 
ATOM   4403 C  CE2   . TYR B 1 254 ? 5.064   81.837  -25.344 1.00 26.53  ? 295 TYR B CE2   1 
ATOM   4404 C  CZ    . TYR B 1 254 ? 3.685   81.876  -25.385 1.00 28.46  ? 295 TYR B CZ    1 
ATOM   4405 O  OH    . TYR B 1 254 ? 3.035   83.074  -25.585 1.00 29.97  ? 295 TYR B OH    1 
ATOM   4406 N  N     . ILE B 1 255 ? 8.076   77.933  -26.864 1.00 26.93  ? 296 ILE B N     1 
ATOM   4407 C  CA    . ILE B 1 255 ? 9.017   78.595  -27.758 1.00 28.48  ? 296 ILE B CA    1 
ATOM   4408 C  C     . ILE B 1 255 ? 8.862   78.075  -29.184 1.00 31.70  ? 296 ILE B C     1 
ATOM   4409 O  O     . ILE B 1 255 ? 8.777   78.854  -30.135 1.00 25.14  ? 296 ILE B O     1 
ATOM   4410 C  CB    . ILE B 1 255 ? 10.475  78.398  -27.293 1.00 28.14  ? 296 ILE B CB    1 
ATOM   4411 C  CG1   . ILE B 1 255 ? 10.700  79.084  -25.945 1.00 29.62  ? 296 ILE B CG1   1 
ATOM   4412 C  CG2   . ILE B 1 255 ? 11.446  78.944  -28.327 1.00 25.80  ? 296 ILE B CG2   1 
ATOM   4413 C  CD1   . ILE B 1 255 ? 12.097  78.899  -25.393 1.00 24.75  ? 296 ILE B CD1   1 
ATOM   4414 N  N     . ASN B 1 256 ? 8.811   76.755  -29.326 1.00 31.81  ? 297 ASN B N     1 
ATOM   4415 C  CA    . ASN B 1 256 ? 8.697   76.133  -30.639 1.00 34.49  ? 297 ASN B CA    1 
ATOM   4416 C  C     . ASN B 1 256 ? 7.368   76.447  -31.319 1.00 29.94  ? 297 ASN B C     1 
ATOM   4417 O  O     . ASN B 1 256 ? 7.324   76.680  -32.528 1.00 34.22  ? 297 ASN B O     1 
ATOM   4418 C  CB    . ASN B 1 256 ? 8.885   74.620  -30.528 1.00 33.64  ? 297 ASN B CB    1 
ATOM   4419 C  CG    . ASN B 1 256 ? 10.312  74.236  -30.197 1.00 38.40  ? 297 ASN B CG    1 
ATOM   4420 O  OD1   . ASN B 1 256 ? 10.558  73.306  -29.430 1.00 40.77  ? 297 ASN B OD1   1 
ATOM   4421 N  ND2   . ASN B 1 256 ? 11.265  74.960  -30.772 1.00 33.83  ? 297 ASN B ND2   1 
ATOM   4422 N  N     . GLU B 1 257 ? 6.292   76.461  -30.538 1.00 26.26  ? 298 GLU B N     1 
ATOM   4423 C  CA    . GLU B 1 257 ? 4.963   76.751  -31.070 1.00 26.25  ? 298 GLU B CA    1 
ATOM   4424 C  C     . GLU B 1 257 ? 4.828   78.211  -31.498 1.00 31.76  ? 298 GLU B C     1 
ATOM   4425 O  O     . GLU B 1 257 ? 3.977   78.544  -32.322 1.00 30.27  ? 298 GLU B O     1 
ATOM   4426 C  CB    . GLU B 1 257 ? 3.884   76.412  -30.036 1.00 27.67  ? 298 GLU B CB    1 
ATOM   4427 C  CG    . GLU B 1 257 ? 3.730   74.926  -29.738 1.00 34.72  ? 298 GLU B CG    1 
ATOM   4428 C  CD    . GLU B 1 257 ? 2.959   74.185  -30.813 1.00 46.51  ? 298 GLU B CD    1 
ATOM   4429 O  OE1   . GLU B 1 257 ? 2.493   74.835  -31.772 1.00 47.69  ? 298 GLU B OE1   1 
ATOM   4430 O  OE2   . GLU B 1 257 ? 2.814   72.950  -30.694 1.00 53.75  ? 298 GLU B OE2   1 
ATOM   4431 N  N     . ASN B 1 258 ? 5.666   79.076  -30.935 1.00 25.59  ? 299 ASN B N     1 
ATOM   4432 C  CA    . ASN B 1 258 ? 5.628   80.501  -31.252 1.00 27.93  ? 299 ASN B CA    1 
ATOM   4433 C  C     . ASN B 1 258 ? 6.911   80.993  -31.915 1.00 28.25  ? 299 ASN B C     1 
ATOM   4434 O  O     . ASN B 1 258 ? 7.280   82.157  -31.772 1.00 29.57  ? 299 ASN B O     1 
ATOM   4435 C  CB    . ASN B 1 258 ? 5.367   81.321  -29.985 1.00 26.72  ? 299 ASN B CB    1 
ATOM   4436 C  CG    . ASN B 1 258 ? 4.010   81.037  -29.373 1.00 27.85  ? 299 ASN B CG    1 
ATOM   4437 O  OD1   . ASN B 1 258 ? 3.889   80.250  -28.432 1.00 26.85  ? 299 ASN B OD1   1 
ATOM   4438 N  ND2   . ASN B 1 258 ? 2.977   81.680  -29.904 1.00 24.32  ? 299 ASN B ND2   1 
ATOM   4439 N  N     . TRP B 1 259 ? 7.582   80.107  -32.643 1.00 22.51  ? 300 TRP B N     1 
ATOM   4440 C  CA    . TRP B 1 259 ? 8.883   80.424  -33.223 1.00 28.74  ? 300 TRP B CA    1 
ATOM   4441 C  C     . TRP B 1 259 ? 8.797   81.534  -34.270 1.00 26.84  ? 300 TRP B C     1 
ATOM   4442 O  O     . TRP B 1 259 ? 9.611   82.456  -34.271 1.00 27.57  ? 300 TRP B O     1 
ATOM   4443 C  CB    . TRP B 1 259 ? 9.507   79.170  -33.836 1.00 25.57  ? 300 TRP B CB    1 
ATOM   4444 C  CG    . TRP B 1 259 ? 10.951  79.333  -34.183 1.00 30.06  ? 300 TRP B CG    1 
ATOM   4445 C  CD1   . TRP B 1 259 ? 11.501  79.317  -35.431 1.00 30.23  ? 300 TRP B CD1   1 
ATOM   4446 C  CD2   . TRP B 1 259 ? 12.034  79.545  -33.270 1.00 29.79  ? 300 TRP B CD2   1 
ATOM   4447 N  NE1   . TRP B 1 259 ? 12.860  79.501  -35.351 1.00 30.55  ? 300 TRP B NE1   1 
ATOM   4448 C  CE2   . TRP B 1 259 ? 13.212  79.644  -34.035 1.00 28.92  ? 300 TRP B CE2   1 
ATOM   4449 C  CE3   . TRP B 1 259 ? 12.122  79.658  -31.878 1.00 32.49  ? 300 TRP B CE3   1 
ATOM   4450 C  CZ2   . TRP B 1 259 ? 14.463  79.852  -33.457 1.00 29.37  ? 300 TRP B CZ2   1 
ATOM   4451 C  CZ3   . TRP B 1 259 ? 13.364  79.865  -31.306 1.00 27.54  ? 300 TRP B CZ3   1 
ATOM   4452 C  CH2   . TRP B 1 259 ? 14.517  79.960  -32.094 1.00 29.51  ? 300 TRP B CH2   1 
ATOM   4453 N  N     . ASP B 1 260 ? 7.810   81.446  -35.156 1.00 23.00  ? 301 ASP B N     1 
ATOM   4454 C  CA    . ASP B 1 260 ? 7.613   82.465  -36.184 1.00 30.94  ? 301 ASP B CA    1 
ATOM   4455 C  C     . ASP B 1 260 ? 7.103   83.769  -35.578 1.00 27.40  ? 301 ASP B C     1 
ATOM   4456 O  O     . ASP B 1 260 ? 7.480   84.857  -36.009 1.00 29.22  ? 301 ASP B O     1 
ATOM   4457 C  CB    . ASP B 1 260 ? 6.638   81.969  -37.253 1.00 32.11  ? 301 ASP B CB    1 
ATOM   4458 C  CG    . ASP B 1 260 ? 7.302   81.066  -38.272 1.00 42.29  ? 301 ASP B CG    1 
ATOM   4459 O  OD1   . ASP B 1 260 ? 8.379   80.512  -37.968 1.00 42.61  ? 301 ASP B OD1   1 
ATOM   4460 O  OD2   . ASP B 1 260 ? 6.746   80.910  -39.379 1.00 57.28  ? 301 ASP B OD2   1 
ATOM   4461 N  N     . ARG B 1 261 ? 6.241   83.642  -34.576 1.00 30.44  ? 302 ARG B N     1 
ATOM   4462 C  CA    . ARG B 1 261 ? 5.668   84.788  -33.877 1.00 29.55  ? 302 ARG B CA    1 
ATOM   4463 C  C     . ARG B 1 261 ? 6.744   85.585  -33.140 1.00 29.84  ? 302 ARG B C     1 
ATOM   4464 O  O     . ARG B 1 261 ? 6.583   86.775  -32.872 1.00 31.02  ? 302 ARG B O     1 
ATOM   4465 C  CB    . ARG B 1 261 ? 4.592   84.306  -32.901 1.00 29.44  ? 302 ARG B CB    1 
ATOM   4466 C  CG    . ARG B 1 261 ? 3.868   85.395  -32.134 1.00 29.34  ? 302 ARG B CG    1 
ATOM   4467 C  CD    . ARG B 1 261 ? 2.924   84.771  -31.127 1.00 22.23  ? 302 ARG B CD    1 
ATOM   4468 N  NE    . ARG B 1 261 ? 2.308   85.753  -30.244 1.00 24.85  ? 302 ARG B NE    1 
ATOM   4469 C  CZ    . ARG B 1 261 ? 1.648   85.435  -29.135 1.00 26.84  ? 302 ARG B CZ    1 
ATOM   4470 N  NH1   . ARG B 1 261 ? 1.533   84.162  -28.779 1.00 24.70  ? 302 ARG B NH1   1 
ATOM   4471 N  NH2   . ARG B 1 261 ? 1.109   86.383  -28.381 1.00 26.16  ? 302 ARG B NH2   1 
ATOM   4472 N  N     . LEU B 1 262 ? 7.849   84.916  -32.828 1.00 27.83  ? 303 LEU B N     1 
ATOM   4473 C  CA    . LEU B 1 262 ? 8.937   85.517  -32.065 1.00 33.23  ? 303 LEU B CA    1 
ATOM   4474 C  C     . LEU B 1 262 ? 9.858   86.403  -32.900 1.00 26.18  ? 303 LEU B C     1 
ATOM   4475 O  O     . LEU B 1 262 ? 10.530  87.281  -32.359 1.00 31.39  ? 303 LEU B O     1 
ATOM   4476 C  CB    . LEU B 1 262 ? 9.766   84.420  -31.393 1.00 26.25  ? 303 LEU B CB    1 
ATOM   4477 C  CG    . LEU B 1 262 ? 9.344   83.998  -29.985 1.00 32.53  ? 303 LEU B CG    1 
ATOM   4478 C  CD1   . LEU B 1 262 ? 9.848   82.599  -29.678 1.00 24.61  ? 303 LEU B CD1   1 
ATOM   4479 C  CD2   . LEU B 1 262 ? 9.864   84.991  -28.954 1.00 28.19  ? 303 LEU B CD2   1 
ATOM   4480 N  N     . HIS B 1 263 ? 9.875   86.171  -34.212 1.00 34.31  ? 304 HIS B N     1 
ATOM   4481 C  CA    . HIS B 1 263 ? 10.854  86.788  -35.110 1.00 33.55  ? 304 HIS B CA    1 
ATOM   4482 C  C     . HIS B 1 263 ? 12.268  86.653  -34.551 1.00 29.75  ? 304 HIS B C     1 
ATOM   4483 O  O     . HIS B 1 263 ? 12.880  87.654  -34.176 1.00 34.30  ? 304 HIS B O     1 
ATOM   4484 C  CB    . HIS B 1 263 ? 10.554  88.272  -35.343 1.00 39.54  ? 304 HIS B CB    1 
ATOM   4485 C  CG    . HIS B 1 263 ? 9.114   88.578  -35.613 1.00 41.12  ? 304 HIS B CG    1 
ATOM   4486 N  ND1   . HIS B 1 263 ? 8.609   88.718  -36.887 1.00 49.21  ? 304 HIS B ND1   1 
ATOM   4487 C  CD2   . HIS B 1 263 ? 8.079   88.809  -34.770 1.00 43.28  ? 304 HIS B CD2   1 
ATOM   4488 C  CE1   . HIS B 1 263 ? 7.321   89.005  -36.819 1.00 42.95  ? 304 HIS B CE1   1 
ATOM   4489 N  NE2   . HIS B 1 263 ? 6.975   89.064  -35.546 1.00 44.11  ? 304 HIS B NE2   1 
ATOM   4490 N  N     . PRO B 1 264 ? 12.793  85.419  -34.491 1.00 34.67  ? 305 PRO B N     1 
ATOM   4491 C  CA    . PRO B 1 264 ? 14.089  85.179  -33.842 1.00 31.92  ? 305 PRO B CA    1 
ATOM   4492 C  C     . PRO B 1 264 ? 15.262  85.859  -34.546 1.00 37.69  ? 305 PRO B C     1 
ATOM   4493 O  O     . PRO B 1 264 ? 16.376  85.842  -34.024 1.00 38.04  ? 305 PRO B O     1 
ATOM   4494 C  CB    . PRO B 1 264 ? 14.239  83.653  -33.907 1.00 35.64  ? 305 PRO B CB    1 
ATOM   4495 C  CG    . PRO B 1 264 ? 12.858  83.132  -34.168 1.00 35.66  ? 305 PRO B CG    1 
ATOM   4496 C  CD    . PRO B 1 264 ? 12.205  84.174  -35.009 1.00 32.50  ? 305 PRO B CD    1 
ATOM   4497 N  N     . GLY B 1 265 ? 15.016  86.445  -35.713 1.00 36.81  ? 306 GLY B N     1 
ATOM   4498 C  CA    . GLY B 1 265 ? 16.064  87.116  -36.459 1.00 38.14  ? 306 GLY B CA    1 
ATOM   4499 C  C     . GLY B 1 265 ? 17.023  86.132  -37.098 1.00 35.60  ? 306 GLY B C     1 
ATOM   4500 O  O     . GLY B 1 265 ? 16.613  85.267  -37.870 1.00 39.84  ? 306 GLY B O     1 
ATOM   4501 N  N     . GLU B 1 266 ? 18.303  86.258  -36.769 1.00 36.07  ? 307 GLU B N     1 
ATOM   4502 C  CA    . GLU B 1 266 ? 19.327  85.399  -37.349 1.00 38.70  ? 307 GLU B CA    1 
ATOM   4503 C  C     . GLU B 1 266 ? 19.416  84.059  -36.628 1.00 43.76  ? 307 GLU B C     1 
ATOM   4504 O  O     . GLU B 1 266 ? 20.147  83.164  -37.052 1.00 45.20  ? 307 GLU B O     1 
ATOM   4505 C  CB    . GLU B 1 266 ? 20.682  86.104  -37.327 1.00 45.11  ? 307 GLU B CB    1 
ATOM   4506 C  CG    . GLU B 1 266 ? 20.730  87.341  -38.206 1.00 45.59  ? 307 GLU B CG    1 
ATOM   4507 C  CD    . GLU B 1 266 ? 22.051  88.075  -38.109 1.00 52.13  ? 307 GLU B CD    1 
ATOM   4508 O  OE1   . GLU B 1 266 ? 22.910  87.655  -37.304 1.00 58.77  ? 307 GLU B OE1   1 
ATOM   4509 O  OE2   . GLU B 1 266 ? 22.231  89.072  -38.837 1.00 51.44  ? 307 GLU B OE2   1 
ATOM   4510 N  N     . LEU B 1 267 ? 18.668  83.925  -35.537 1.00 36.12  ? 308 LEU B N     1 
ATOM   4511 C  CA    . LEU B 1 267 ? 18.592  82.663  -34.809 1.00 35.89  ? 308 LEU B CA    1 
ATOM   4512 C  C     . LEU B 1 267 ? 17.455  81.797  -35.334 1.00 36.26  ? 308 LEU B C     1 
ATOM   4513 O  O     . LEU B 1 267 ? 17.249  80.680  -34.865 1.00 35.81  ? 308 LEU B O     1 
ATOM   4514 C  CB    . LEU B 1 267 ? 18.396  82.907  -33.311 1.00 30.55  ? 308 LEU B CB    1 
ATOM   4515 C  CG    . LEU B 1 267 ? 19.585  83.410  -32.497 1.00 33.42  ? 308 LEU B CG    1 
ATOM   4516 C  CD1   . LEU B 1 267 ? 19.193  83.553  -31.034 1.00 35.82  ? 308 LEU B CD1   1 
ATOM   4517 C  CD2   . LEU B 1 267 ? 20.764  82.466  -32.645 1.00 32.52  ? 308 LEU B CD2   1 
ATOM   4518 N  N     . ALA B 1 268 ? 16.719  82.320  -36.310 1.00 34.37  ? 309 ALA B N     1 
ATOM   4519 C  CA    . ALA B 1 268 ? 15.516  81.656  -36.803 1.00 35.48  ? 309 ALA B CA    1 
ATOM   4520 C  C     . ALA B 1 268 ? 15.815  80.346  -37.526 1.00 39.09  ? 309 ALA B C     1 
ATOM   4521 O  O     . ALA B 1 268 ? 14.966  79.456  -37.579 1.00 38.93  ? 309 ALA B O     1 
ATOM   4522 C  CB    . ALA B 1 268 ? 14.742  82.592  -37.719 1.00 33.57  ? 309 ALA B CB    1 
ATOM   4523 N  N     . ASP B 1 269 ? 17.017  80.226  -38.083 1.00 38.38  ? 310 ASP B N     1 
ATOM   4524 C  CA    . ASP B 1 269 ? 17.380  79.036  -38.848 1.00 39.69  ? 310 ASP B CA    1 
ATOM   4525 C  C     . ASP B 1 269 ? 17.880  77.910  -37.950 1.00 42.75  ? 310 ASP B C     1 
ATOM   4526 O  O     . ASP B 1 269 ? 18.182  76.815  -38.426 1.00 46.37  ? 310 ASP B O     1 
ATOM   4527 C  CB    . ASP B 1 269 ? 18.437  79.372  -39.908 1.00 46.64  ? 310 ASP B CB    1 
ATOM   4528 C  CG    . ASP B 1 269 ? 19.669  80.049  -39.324 1.00 56.40  ? 310 ASP B CG    1 
ATOM   4529 O  OD1   . ASP B 1 269 ? 19.887  79.971  -38.096 1.00 56.69  ? 310 ASP B OD1   1 
ATOM   4530 O  OD2   . ASP B 1 269 ? 20.429  80.661  -40.104 1.00 62.03  ? 310 ASP B OD2   1 
ATOM   4531 N  N     . THR B 1 270 ? 17.973  78.189  -36.653 1.00 42.28  ? 311 THR B N     1 
ATOM   4532 C  CA    . THR B 1 270 ? 18.408  77.192  -35.685 1.00 41.67  ? 311 THR B CA    1 
ATOM   4533 C  C     . THR B 1 270 ? 17.472  75.991  -35.705 1.00 40.36  ? 311 THR B C     1 
ATOM   4534 O  O     . THR B 1 270 ? 16.276  76.130  -35.449 1.00 36.03  ? 311 THR B O     1 
ATOM   4535 C  CB    . THR B 1 270 ? 18.464  77.766  -34.256 1.00 38.94  ? 311 THR B CB    1 
ATOM   4536 O  OG1   . THR B 1 270 ? 19.311  78.922  -34.233 1.00 35.02  ? 311 THR B OG1   1 
ATOM   4537 C  CG2   . THR B 1 270 ? 19.001  76.727  -33.283 1.00 39.12  ? 311 THR B CG2   1 
ATOM   4538 N  N     . PRO B 1 271 ? 18.017  74.809  -36.029 1.00 44.84  ? 312 PRO B N     1 
ATOM   4539 C  CA    . PRO B 1 271 ? 17.252  73.558  -36.056 1.00 42.45  ? 312 PRO B CA    1 
ATOM   4540 C  C     . PRO B 1 271 ? 16.529  73.310  -34.737 1.00 41.84  ? 312 PRO B C     1 
ATOM   4541 O  O     . PRO B 1 271 ? 17.088  73.570  -33.670 1.00 39.25  ? 312 PRO B O     1 
ATOM   4542 C  CB    . PRO B 1 271 ? 18.327  72.497  -36.304 1.00 43.67  ? 312 PRO B CB    1 
ATOM   4543 C  CG    . PRO B 1 271 ? 19.408  73.229  -37.019 1.00 49.23  ? 312 PRO B CG    1 
ATOM   4544 C  CD    . PRO B 1 271 ? 19.423  74.600  -36.414 1.00 44.58  ? 312 PRO B CD    1 
ATOM   4545 N  N     . LYS B 1 272 ? 15.297  72.818  -34.822 1.00 38.47  ? 313 LYS B N     1 
ATOM   4546 C  CA    . LYS B 1 272 ? 14.456  72.590  -33.651 1.00 45.11  ? 313 LYS B CA    1 
ATOM   4547 C  C     . LYS B 1 272 ? 15.149  71.712  -32.609 1.00 46.65  ? 313 LYS B C     1 
ATOM   4548 O  O     . LYS B 1 272 ? 14.902  71.838  -31.409 1.00 46.19  ? 313 LYS B O     1 
ATOM   4549 C  CB    . LYS B 1 272 ? 13.130  71.961  -34.085 1.00 44.89  ? 313 LYS B CB    1 
ATOM   4550 C  CG    . LYS B 1 272 ? 12.110  71.796  -32.978 1.00 47.43  ? 313 LYS B CG    1 
ATOM   4551 C  CD    . LYS B 1 272 ? 10.783  71.317  -33.537 1.00 46.85  ? 313 LYS B CD    1 
ATOM   4552 C  CE    . LYS B 1 272 ? 9.776   71.063  -32.430 1.00 53.17  ? 313 LYS B CE    1 
ATOM   4553 N  NZ    . LYS B 1 272 ? 10.202  69.948  -31.539 1.00 60.13  ? 313 LYS B NZ    1 
ATOM   4554 N  N     . SER B 1 273 ? 16.031  70.836  -33.080 1.00 48.69  ? 314 SER B N     1 
ATOM   4555 C  CA    . SER B 1 273 ? 16.762  69.921  -32.213 1.00 52.00  ? 314 SER B CA    1 
ATOM   4556 C  C     . SER B 1 273 ? 17.821  70.643  -31.382 1.00 51.84  ? 314 SER B C     1 
ATOM   4557 O  O     . SER B 1 273 ? 18.171  70.198  -30.290 1.00 55.38  ? 314 SER B O     1 
ATOM   4558 C  CB    . SER B 1 273 ? 17.421  68.817  -33.047 1.00 51.64  ? 314 SER B CB    1 
ATOM   4559 O  OG    . SER B 1 273 ? 16.477  68.176  -33.888 1.00 55.70  ? 314 SER B OG    1 
ATOM   4560 N  N     . GLU B 1 274 ? 18.326  71.758  -31.900 1.00 44.17  ? 315 GLU B N     1 
ATOM   4561 C  CA    . GLU B 1 274 ? 19.440  72.456  -31.263 1.00 41.55  ? 315 GLU B CA    1 
ATOM   4562 C  C     . GLU B 1 274 ? 18.991  73.610  -30.375 1.00 41.06  ? 315 GLU B C     1 
ATOM   4563 O  O     . GLU B 1 274 ? 19.787  74.157  -29.611 1.00 41.87  ? 315 GLU B O     1 
ATOM   4564 C  CB    . GLU B 1 274 ? 20.407  72.982  -32.323 1.00 47.79  ? 315 GLU B CB    1 
ATOM   4565 C  CG    . GLU B 1 274 ? 20.877  71.933  -33.311 1.00 50.69  ? 315 GLU B CG    1 
ATOM   4566 C  CD    . GLU B 1 274 ? 21.813  72.505  -34.357 1.00 57.62  ? 315 GLU B CD    1 
ATOM   4567 O  OE1   . GLU B 1 274 ? 22.410  73.573  -34.102 1.00 57.19  ? 315 GLU B OE1   1 
ATOM   4568 O  OE2   . GLU B 1 274 ? 21.943  71.893  -35.436 1.00 56.73  ? 315 GLU B OE2   1 
ATOM   4569 N  N     . ARG B 1 275 ? 17.719  73.977  -30.478 1.00 36.20  ? 316 ARG B N     1 
ATOM   4570 C  CA    . ARG B 1 275 ? 17.204  75.139  -29.763 1.00 35.29  ? 316 ARG B CA    1 
ATOM   4571 C  C     . ARG B 1 275 ? 17.215  74.941  -28.251 1.00 34.64  ? 316 ARG B C     1 
ATOM   4572 O  O     . ARG B 1 275 ? 17.554  75.858  -27.505 1.00 33.45  ? 316 ARG B O     1 
ATOM   4573 C  CB    . ARG B 1 275 ? 15.785  75.465  -30.231 1.00 33.99  ? 316 ARG B CB    1 
ATOM   4574 C  CG    . ARG B 1 275 ? 15.681  75.796  -31.710 1.00 33.13  ? 316 ARG B CG    1 
ATOM   4575 C  CD    . ARG B 1 275 ? 14.235  75.980  -32.125 1.00 32.79  ? 316 ARG B CD    1 
ATOM   4576 N  NE    . ARG B 1 275 ? 14.092  76.110  -33.571 1.00 35.28  ? 316 ARG B NE    1 
ATOM   4577 C  CZ    . ARG B 1 275 ? 12.925  76.122  -34.204 1.00 32.50  ? 316 ARG B CZ    1 
ATOM   4578 N  NH1   . ARG B 1 275 ? 11.796  76.010  -33.519 1.00 30.54  ? 316 ARG B NH1   1 
ATOM   4579 N  NH2   . ARG B 1 275 ? 12.884  76.243  -35.523 1.00 38.05  ? 316 ARG B NH2   1 
ATOM   4580 N  N     . TYR B 1 276 ? 16.851  73.743  -27.803 1.00 32.53  ? 317 TYR B N     1 
ATOM   4581 C  CA    . TYR B 1 276 ? 16.734  73.472  -26.373 1.00 35.82  ? 317 TYR B CA    1 
ATOM   4582 C  C     . TYR B 1 276 ? 18.078  73.578  -25.653 1.00 34.04  ? 317 TYR B C     1 
ATOM   4583 O  O     . TYR B 1 276 ? 18.132  73.982  -24.491 1.00 31.76  ? 317 TYR B O     1 
ATOM   4584 C  CB    . TYR B 1 276 ? 16.119  72.090  -26.139 1.00 34.02  ? 317 TYR B CB    1 
ATOM   4585 C  CG    . TYR B 1 276 ? 15.882  71.766  -24.679 1.00 36.71  ? 317 TYR B CG    1 
ATOM   4586 C  CD1   . TYR B 1 276 ? 16.269  70.542  -24.146 1.00 38.03  ? 317 TYR B CD1   1 
ATOM   4587 C  CD2   . TYR B 1 276 ? 15.280  72.687  -23.832 1.00 36.65  ? 317 TYR B CD2   1 
ATOM   4588 C  CE1   . TYR B 1 276 ? 16.054  70.242  -22.812 1.00 38.37  ? 317 TYR B CE1   1 
ATOM   4589 C  CE2   . TYR B 1 276 ? 15.063  72.398  -22.496 1.00 37.76  ? 317 TYR B CE2   1 
ATOM   4590 C  CZ    . TYR B 1 276 ? 15.452  71.174  -21.992 1.00 42.01  ? 317 TYR B CZ    1 
ATOM   4591 O  OH    . TYR B 1 276 ? 15.238  70.883  -20.664 1.00 39.98  ? 317 TYR B OH    1 
ATOM   4592 N  N     . GLU B 1 277 ? 19.155  73.216  -26.346 1.00 33.67  ? 318 GLU B N     1 
ATOM   4593 C  CA    . GLU B 1 277 ? 20.504  73.324  -25.791 1.00 37.14  ? 318 GLU B CA    1 
ATOM   4594 C  C     . GLU B 1 277 ? 20.826  74.746  -25.352 1.00 31.22  ? 318 GLU B C     1 
ATOM   4595 O  O     . GLU B 1 277 ? 21.232  74.982  -24.215 1.00 32.65  ? 318 GLU B O     1 
ATOM   4596 C  CB    . GLU B 1 277 ? 21.545  72.865  -26.812 1.00 41.82  ? 318 GLU B CB    1 
ATOM   4597 C  CG    . GLU B 1 277 ? 21.642  71.366  -26.991 1.00 54.20  ? 318 GLU B CG    1 
ATOM   4598 C  CD    . GLU B 1 277 ? 22.624  70.981  -28.080 1.00 60.30  ? 318 GLU B CD    1 
ATOM   4599 O  OE1   . GLU B 1 277 ? 22.380  71.333  -29.254 1.00 56.02  ? 318 GLU B OE1   1 
ATOM   4600 O  OE2   . GLU B 1 277 ? 23.644  70.335  -27.761 1.00 68.03  ? 318 GLU B OE2   1 
ATOM   4601 N  N     . HIS B 1 278 ? 20.644  75.690  -26.269 1.00 30.86  ? 319 HIS B N     1 
ATOM   4602 C  CA    . HIS B 1 278 ? 20.961  77.086  -26.008 1.00 34.17  ? 319 HIS B CA    1 
ATOM   4603 C  C     . HIS B 1 278 ? 20.041  77.691  -24.951 1.00 27.18  ? 319 HIS B C     1 
ATOM   4604 O  O     . HIS B 1 278 ? 20.478  78.491  -24.126 1.00 28.72  ? 319 HIS B O     1 
ATOM   4605 C  CB    . HIS B 1 278 ? 20.879  77.895  -27.302 1.00 31.59  ? 319 HIS B CB    1 
ATOM   4606 C  CG    . HIS B 1 278 ? 21.741  77.360  -28.404 1.00 37.97  ? 319 HIS B CG    1 
ATOM   4607 N  ND1   . HIS B 1 278 ? 23.116  77.404  -28.359 1.00 37.67  ? 319 HIS B ND1   1 
ATOM   4608 C  CD2   . HIS B 1 278 ? 21.419  76.771  -29.581 1.00 39.28  ? 319 HIS B CD2   1 
ATOM   4609 C  CE1   . HIS B 1 278 ? 23.608  76.862  -29.461 1.00 36.40  ? 319 HIS B CE1   1 
ATOM   4610 N  NE2   . HIS B 1 278 ? 22.599  76.472  -30.218 1.00 41.00  ? 319 HIS B NE2   1 
ATOM   4611 N  N     . VAL B 1 279 ? 18.768  77.305  -24.981 1.00 23.70  ? 320 VAL B N     1 
ATOM   4612 C  CA    . VAL B 1 279 ? 17.794  77.807  -24.016 1.00 26.98  ? 320 VAL B CA    1 
ATOM   4613 C  C     . VAL B 1 279 ? 18.142  77.352  -22.603 1.00 26.57  ? 320 VAL B C     1 
ATOM   4614 O  O     . VAL B 1 279 ? 18.154  78.152  -21.668 1.00 28.02  ? 320 VAL B O     1 
ATOM   4615 C  CB    . VAL B 1 279 ? 16.364  77.347  -24.361 1.00 25.72  ? 320 VAL B CB    1 
ATOM   4616 C  CG1   . VAL B 1 279 ? 15.401  77.690  -23.233 1.00 29.30  ? 320 VAL B CG1   1 
ATOM   4617 C  CG2   . VAL B 1 279 ? 15.908  77.980  -25.660 1.00 24.56  ? 320 VAL B CG2   1 
ATOM   4618 N  N     . LEU B 1 280 ? 18.437  76.065  -22.463 1.00 30.44  ? 321 LEU B N     1 
ATOM   4619 C  CA    . LEU B 1 280 ? 18.795  75.489  -21.172 1.00 32.17  ? 321 LEU B CA    1 
ATOM   4620 C  C     . LEU B 1 280 ? 20.090  76.091  -20.634 1.00 32.98  ? 321 LEU B C     1 
ATOM   4621 O  O     . LEU B 1 280 ? 20.244  76.277  -19.426 1.00 32.22  ? 321 LEU B O     1 
ATOM   4622 C  CB    . LEU B 1 280 ? 18.927  73.971  -21.291 1.00 34.26  ? 321 LEU B CB    1 
ATOM   4623 C  CG    . LEU B 1 280 ? 19.129  73.203  -19.986 1.00 41.34  ? 321 LEU B CG    1 
ATOM   4624 C  CD1   . LEU B 1 280 ? 18.046  73.572  -18.985 1.00 31.92  ? 321 LEU B CD1   1 
ATOM   4625 C  CD2   . LEU B 1 280 ? 19.132  71.705  -20.249 1.00 34.27  ? 321 LEU B CD2   1 
ATOM   4626 N  N     . GLU B 1 281 ? 21.016  76.395  -21.537 1.00 30.53  ? 322 GLU B N     1 
ATOM   4627 C  CA    . GLU B 1 281 ? 22.283  77.008  -21.155 1.00 31.74  ? 322 GLU B CA    1 
ATOM   4628 C  C     . GLU B 1 281 ? 22.054  78.400  -20.576 1.00 34.52  ? 322 GLU B C     1 
ATOM   4629 O  O     . GLU B 1 281 ? 22.692  78.790  -19.598 1.00 31.32  ? 322 GLU B O     1 
ATOM   4630 C  CB    . GLU B 1 281 ? 23.228  77.084  -22.355 1.00 33.82  ? 322 GLU B CB    1 
ATOM   4631 C  CG    . GLU B 1 281 ? 24.599  77.650  -22.021 1.00 43.90  ? 322 GLU B CG    1 
ATOM   4632 C  CD    . GLU B 1 281 ? 25.526  77.692  -23.222 1.00 53.02  ? 322 GLU B CD    1 
ATOM   4633 O  OE1   . GLU B 1 281 ? 25.137  78.269  -24.259 1.00 52.97  ? 322 GLU B OE1   1 
ATOM   4634 O  OE2   . GLU B 1 281 ? 26.645  77.144  -23.127 1.00 61.25  ? 322 GLU B OE2   1 
ATOM   4635 N  N     . ALA B 1 282 ? 21.135  79.140  -21.188 1.00 28.75  ? 323 ALA B N     1 
ATOM   4636 C  CA    . ALA B 1 282 ? 20.797  80.481  -20.727 1.00 29.16  ? 323 ALA B CA    1 
ATOM   4637 C  C     . ALA B 1 282 ? 20.124  80.431  -19.359 1.00 27.53  ? 323 ALA B C     1 
ATOM   4638 O  O     . ALA B 1 282 ? 20.389  81.267  -18.495 1.00 25.82  ? 323 ALA B O     1 
ATOM   4639 C  CB    . ALA B 1 282 ? 19.900  81.179  -21.737 1.00 24.83  ? 323 ALA B CB    1 
ATOM   4640 N  N     . LEU B 1 283 ? 19.256  79.443  -19.171 1.00 31.28  ? 324 LEU B N     1 
ATOM   4641 C  CA    . LEU B 1 283 ? 18.558  79.261  -17.903 1.00 28.66  ? 324 LEU B CA    1 
ATOM   4642 C  C     . LEU B 1 283 ? 19.531  78.973  -16.765 1.00 28.95  ? 324 LEU B C     1 
ATOM   4643 O  O     . LEU B 1 283 ? 19.359  79.467  -15.650 1.00 28.49  ? 324 LEU B O     1 
ATOM   4644 C  CB    . LEU B 1 283 ? 17.536  78.128  -18.014 1.00 29.74  ? 324 LEU B CB    1 
ATOM   4645 C  CG    . LEU B 1 283 ? 16.345  78.356  -18.946 1.00 33.31  ? 324 LEU B CG    1 
ATOM   4646 C  CD1   . LEU B 1 283 ? 15.515  77.089  -19.068 1.00 29.49  ? 324 LEU B CD1   1 
ATOM   4647 C  CD2   . LEU B 1 283 ? 15.489  79.511  -18.448 1.00 27.80  ? 324 LEU B CD2   1 
ATOM   4648 N  N     . ASN B 1 284 ? 20.555  78.175  -17.050 1.00 30.01  ? 325 ASN B N     1 
ATOM   4649 C  CA    . ASN B 1 284 ? 21.527  77.795  -16.031 1.00 36.40  ? 325 ASN B CA    1 
ATOM   4650 C  C     . ASN B 1 284 ? 22.562  78.881  -15.757 1.00 32.61  ? 325 ASN B C     1 
ATOM   4651 O  O     . ASN B 1 284 ? 22.973  79.077  -14.615 1.00 37.01  ? 325 ASN B O     1 
ATOM   4652 C  CB    . ASN B 1 284 ? 22.234  76.497  -16.429 1.00 31.48  ? 325 ASN B CB    1 
ATOM   4653 C  CG    . ASN B 1 284 ? 21.381  75.268  -16.178 1.00 37.85  ? 325 ASN B CG    1 
ATOM   4654 O  OD1   . ASN B 1 284 ? 21.134  74.472  -17.083 1.00 37.98  ? 325 ASN B OD1   1 
ATOM   4655 N  ND2   . ASN B 1 284 ? 20.926  75.109  -14.940 1.00 35.99  ? 325 ASN B ND2   1 
ATOM   4656 N  N     . ASP B 1 285 ? 22.979  79.589  -16.803 1.00 33.66  ? 326 ASP B N     1 
ATOM   4657 C  CA    . ASP B 1 285 ? 24.019  80.604  -16.667 1.00 32.10  ? 326 ASP B CA    1 
ATOM   4658 C  C     . ASP B 1 285 ? 23.543  81.844  -15.918 1.00 35.09  ? 326 ASP B C     1 
ATOM   4659 O  O     . ASP B 1 285 ? 24.244  82.355  -15.044 1.00 36.84  ? 326 ASP B O     1 
ATOM   4660 C  CB    . ASP B 1 285 ? 24.550  81.012  -18.042 1.00 35.56  ? 326 ASP B CB    1 
ATOM   4661 C  CG    . ASP B 1 285 ? 25.488  79.980  -18.633 1.00 38.36  ? 326 ASP B CG    1 
ATOM   4662 O  OD1   . ASP B 1 285 ? 26.007  79.141  -17.866 1.00 42.65  ? 326 ASP B OD1   1 
ATOM   4663 O  OD2   . ASP B 1 285 ? 25.711  80.010  -19.861 1.00 41.35  ? 326 ASP B OD2   1 
ATOM   4664 N  N     . TYR B 1 286 ? 22.355  82.328  -16.264 1.00 28.47  ? 327 TYR B N     1 
ATOM   4665 C  CA    . TYR B 1 286 ? 21.831  83.551  -15.666 1.00 30.40  ? 327 TYR B CA    1 
ATOM   4666 C  C     . TYR B 1 286 ? 21.084  83.265  -14.365 1.00 32.11  ? 327 TYR B C     1 
ATOM   4667 O  O     . TYR B 1 286 ? 19.852  83.285  -14.321 1.00 31.25  ? 327 TYR B O     1 
ATOM   4668 C  CB    . TYR B 1 286 ? 20.926  84.278  -16.661 1.00 26.76  ? 327 TYR B CB    1 
ATOM   4669 C  CG    . TYR B 1 286 ? 21.675  84.818  -17.862 1.00 29.90  ? 327 TYR B CG    1 
ATOM   4670 C  CD1   . TYR B 1 286 ? 21.920  84.019  -18.971 1.00 25.88  ? 327 TYR B CD1   1 
ATOM   4671 C  CD2   . TYR B 1 286 ? 22.144  86.125  -17.881 1.00 28.67  ? 327 TYR B CD2   1 
ATOM   4672 C  CE1   . TYR B 1 286 ? 22.608  84.508  -20.068 1.00 29.31  ? 327 TYR B CE1   1 
ATOM   4673 C  CE2   . TYR B 1 286 ? 22.831  86.623  -18.972 1.00 28.80  ? 327 TYR B CE2   1 
ATOM   4674 C  CZ    . TYR B 1 286 ? 23.061  85.810  -20.063 1.00 33.53  ? 327 TYR B CZ    1 
ATOM   4675 O  OH    . TYR B 1 286 ? 23.744  86.298  -21.152 1.00 34.62  ? 327 TYR B OH    1 
ATOM   4676 N  N     . LYS B 1 287 ? 21.851  83.015  -13.308 1.00 29.01  ? 328 LYS B N     1 
ATOM   4677 C  CA    . LYS B 1 287 ? 21.309  82.639  -12.006 1.00 32.51  ? 328 LYS B CA    1 
ATOM   4678 C  C     . LYS B 1 287 ? 20.498  83.756  -11.358 1.00 31.81  ? 328 LYS B C     1 
ATOM   4679 O  O     . LYS B 1 287 ? 19.552  83.493  -10.618 1.00 34.76  ? 328 LYS B O     1 
ATOM   4680 C  CB    . LYS B 1 287 ? 22.444  82.224  -11.069 1.00 33.74  ? 328 LYS B CB    1 
ATOM   4681 C  CG    . LYS B 1 287 ? 23.199  80.982  -11.510 1.00 36.60  ? 328 LYS B CG    1 
ATOM   4682 C  CD    . LYS B 1 287 ? 22.441  79.719  -11.151 1.00 44.37  ? 328 LYS B CD    1 
ATOM   4683 C  CE    . LYS B 1 287 ? 23.292  78.486  -11.395 1.00 45.59  ? 328 LYS B CE    1 
ATOM   4684 N  NZ    . LYS B 1 287 ? 22.591  77.245  -10.972 1.00 50.34  ? 328 LYS B NZ    1 
ATOM   4685 N  N     . THR B 1 288 ? 20.874  85.000  -11.635 1.00 29.88  ? 329 THR B N     1 
ATOM   4686 C  CA    . THR B 1 288 ? 20.207  86.149  -11.032 1.00 34.90  ? 329 THR B CA    1 
ATOM   4687 C  C     . THR B 1 288 ? 18.842  86.410  -11.661 1.00 35.69  ? 329 THR B C     1 
ATOM   4688 O  O     . THR B 1 288 ? 18.048  87.190  -11.136 1.00 34.25  ? 329 THR B O     1 
ATOM   4689 C  CB    . THR B 1 288 ? 21.062  87.424  -11.152 1.00 35.83  ? 329 THR B CB    1 
ATOM   4690 O  OG1   . THR B 1 288 ? 21.295  87.717  -12.535 1.00 38.77  ? 329 THR B OG1   1 
ATOM   4691 C  CG2   . THR B 1 288 ? 22.393  87.239  -10.444 1.00 33.82  ? 329 THR B CG2   1 
ATOM   4692 N  N     . MET B 1 289 ? 18.574  85.752  -12.784 1.00 33.39  ? 330 MET B N     1 
ATOM   4693 C  CA    . MET B 1 289 ? 17.323  85.959  -13.505 1.00 32.25  ? 330 MET B CA    1 
ATOM   4694 C  C     . MET B 1 289 ? 16.372  84.768  -13.383 1.00 33.71  ? 330 MET B C     1 
ATOM   4695 O  O     . MET B 1 289 ? 15.160  84.948  -13.259 1.00 30.80  ? 330 MET B O     1 
ATOM   4696 C  CB    . MET B 1 289 ? 17.609  86.249  -14.980 1.00 28.45  ? 330 MET B CB    1 
ATOM   4697 C  CG    . MET B 1 289 ? 18.498  87.466  -15.202 1.00 37.86  ? 330 MET B CG    1 
ATOM   4698 S  SD    . MET B 1 289 ? 17.727  88.996  -14.633 1.00 48.63  ? 330 MET B SD    1 
ATOM   4699 C  CE    . MET B 1 289 ? 19.159  89.898  -14.040 1.00 45.44  ? 330 MET B CE    1 
ATOM   4700 N  N     . PHE B 1 290 ? 16.920  83.556  -13.411 1.00 29.45  ? 331 PHE B N     1 
ATOM   4701 C  CA    . PHE B 1 290 ? 16.095  82.351  -13.423 1.00 31.01  ? 331 PHE B CA    1 
ATOM   4702 C  C     . PHE B 1 290 ? 16.257  81.510  -12.157 1.00 36.04  ? 331 PHE B C     1 
ATOM   4703 O  O     . PHE B 1 290 ? 17.375  81.275  -11.698 1.00 32.41  ? 331 PHE B O     1 
ATOM   4704 C  CB    . PHE B 1 290 ? 16.426  81.497  -14.649 1.00 30.01  ? 331 PHE B CB    1 
ATOM   4705 C  CG    . PHE B 1 290 ? 16.361  82.246  -15.949 1.00 27.85  ? 331 PHE B CG    1 
ATOM   4706 C  CD1   . PHE B 1 290 ? 15.143  82.651  -16.471 1.00 30.74  ? 331 PHE B CD1   1 
ATOM   4707 C  CD2   . PHE B 1 290 ? 17.517  82.534  -16.657 1.00 26.74  ? 331 PHE B CD2   1 
ATOM   4708 C  CE1   . PHE B 1 290 ? 15.081  83.336  -17.671 1.00 28.20  ? 331 PHE B CE1   1 
ATOM   4709 C  CE2   . PHE B 1 290 ? 17.461  83.217  -17.857 1.00 30.59  ? 331 PHE B CE2   1 
ATOM   4710 C  CZ    . PHE B 1 290 ? 16.241  83.619  -18.365 1.00 30.99  ? 331 PHE B CZ    1 
ATOM   4711 N  N     . MET B 1 291 ? 15.135  81.056  -11.603 1.00 34.95  ? 332 MET B N     1 
ATOM   4712 C  CA    . MET B 1 291 ? 15.145  80.155  -10.452 1.00 36.91  ? 332 MET B CA    1 
ATOM   4713 C  C     . MET B 1 291 ? 14.943  78.711  -10.880 1.00 33.78  ? 332 MET B C     1 
ATOM   4714 O  O     . MET B 1 291 ? 14.030  78.411  -11.645 1.00 33.27  ? 332 MET B O     1 
ATOM   4715 C  CB    . MET B 1 291 ? 14.055  80.532  -9.446  1.00 32.73  ? 332 MET B CB    1 
ATOM   4716 C  CG    . MET B 1 291 ? 14.515  81.462  -8.349  1.00 42.78  ? 332 MET B CG    1 
ATOM   4717 S  SD    . MET B 1 291 ? 13.323  81.670  -7.012  1.00 55.19  ? 332 MET B SD    1 
ATOM   4718 C  CE    . MET B 1 291 ? 13.727  80.268  -5.974  1.00 42.35  ? 332 MET B CE    1 
ATOM   4719 N  N     . SER B 1 292 ? 15.789  77.818  -10.380 1.00 32.46  ? 333 SER B N     1 
ATOM   4720 C  CA    . SER B 1 292 ? 15.601  76.393  -10.615 1.00 34.07  ? 333 SER B CA    1 
ATOM   4721 C  C     . SER B 1 292 ? 14.708  75.800  -9.533  1.00 32.80  ? 333 SER B C     1 
ATOM   4722 O  O     . SER B 1 292 ? 14.680  76.295  -8.406  1.00 28.79  ? 333 SER B O     1 
ATOM   4723 C  CB    . SER B 1 292 ? 16.941  75.660  -10.650 1.00 33.50  ? 333 SER B CB    1 
ATOM   4724 O  OG    . SER B 1 292 ? 16.742  74.264  -10.796 1.00 33.45  ? 333 SER B OG    1 
ATOM   4725 N  N     . GLY B 1 293 ? 13.982  74.740  -9.875  1.00 30.54  ? 334 GLY B N     1 
ATOM   4726 C  CA    . GLY B 1 293 ? 13.102  74.084  -8.923  1.00 36.40  ? 334 GLY B CA    1 
ATOM   4727 C  C     . GLY B 1 293 ? 13.859  73.434  -7.781  1.00 33.09  ? 334 GLY B C     1 
ATOM   4728 O  O     . GLY B 1 293 ? 13.294  73.165  -6.720  1.00 33.36  ? 334 GLY B O     1 
ATOM   4729 N  N     . LYS B 1 294 ? 15.147  73.187  -8.000  1.00 28.93  ? 335 LYS B N     1 
ATOM   4730 C  CA    . LYS B 1 294 ? 16.001  72.566  -6.994  1.00 34.23  ? 335 LYS B CA    1 
ATOM   4731 C  C     . LYS B 1 294 ? 16.182  73.466  -5.776  1.00 33.52  ? 335 LYS B C     1 
ATOM   4732 O  O     . LYS B 1 294 ? 16.526  72.996  -4.692  1.00 32.95  ? 335 LYS B O     1 
ATOM   4733 C  CB    . LYS B 1 294 ? 17.367  72.224  -7.591  1.00 32.96  ? 335 LYS B CB    1 
ATOM   4734 C  CG    . LYS B 1 294 ? 18.213  73.440  -7.942  1.00 36.29  ? 335 LYS B CG    1 
ATOM   4735 C  CD    . LYS B 1 294 ? 19.506  73.036  -8.636  1.00 43.57  ? 335 LYS B CD    1 
ATOM   4736 C  CE    . LYS B 1 294 ? 20.366  74.251  -8.964  1.00 46.93  ? 335 LYS B CE    1 
ATOM   4737 N  NZ    . LYS B 1 294 ? 21.591  73.893  -9.737  1.00 53.81  ? 335 LYS B NZ    1 
ATOM   4738 N  N     . GLU B 1 295 ? 15.947  74.762  -5.962  1.00 34.77  ? 336 GLU B N     1 
ATOM   4739 C  CA    . GLU B 1 295 ? 16.095  75.727  -4.879  1.00 34.28  ? 336 GLU B CA    1 
ATOM   4740 C  C     . GLU B 1 295 ? 14.958  75.602  -3.871  1.00 33.06  ? 336 GLU B C     1 
ATOM   4741 O  O     . GLU B 1 295 ? 15.060  76.089  -2.745  1.00 39.13  ? 336 GLU B O     1 
ATOM   4742 C  CB    . GLU B 1 295 ? 16.160  77.151  -5.436  1.00 30.50  ? 336 GLU B CB    1 
ATOM   4743 C  CG    . GLU B 1 295 ? 17.342  77.386  -6.362  1.00 32.82  ? 336 GLU B CG    1 
ATOM   4744 C  CD    . GLU B 1 295 ? 17.406  78.807  -6.888  1.00 38.18  ? 336 GLU B CD    1 
ATOM   4745 O  OE1   . GLU B 1 295 ? 16.923  79.729  -6.197  1.00 38.39  ? 336 GLU B OE1   1 
ATOM   4746 O  OE2   . GLU B 1 295 ? 17.940  78.997  -8.000  1.00 42.78  ? 336 GLU B OE2   1 
ATOM   4747 N  N     . ILE B 1 296 ? 13.875  74.950  -4.282  1.00 33.80  ? 337 ILE B N     1 
ATOM   4748 C  CA    . ILE B 1 296 ? 12.773  74.652  -3.375  1.00 29.43  ? 337 ILE B CA    1 
ATOM   4749 C  C     . ILE B 1 296 ? 12.462  73.155  -3.374  1.00 30.29  ? 337 ILE B C     1 
ATOM   4750 O  O     . ILE B 1 296 ? 11.319  72.746  -3.163  1.00 28.25  ? 337 ILE B O     1 
ATOM   4751 C  CB    . ILE B 1 296 ? 11.503  75.444  -3.740  1.00 31.44  ? 337 ILE B CB    1 
ATOM   4752 C  CG1   . ILE B 1 296 ? 11.080  75.154  -5.182  1.00 31.09  ? 337 ILE B CG1   1 
ATOM   4753 C  CG2   . ILE B 1 296 ? 11.739  76.931  -3.552  1.00 34.25  ? 337 ILE B CG2   1 
ATOM   4754 C  CD1   . ILE B 1 296 ? 9.708   75.683  -5.528  1.00 37.15  ? 337 ILE B CD1   1 
ATOM   4755 N  N     . LYS B 1 297 ? 13.496  72.353  -3.622  1.00 26.63  ? 338 LYS B N     1 
ATOM   4756 C  CA    . LYS B 1 297 ? 13.422  70.895  -3.534  1.00 27.70  ? 338 LYS B CA    1 
ATOM   4757 C  C     . LYS B 1 297 ? 12.439  70.284  -4.530  1.00 31.06  ? 338 LYS B C     1 
ATOM   4758 O  O     . LYS B 1 297 ? 11.762  69.300  -4.227  1.00 28.64  ? 338 LYS B O     1 
ATOM   4759 C  CB    . LYS B 1 297 ? 13.058  70.470  -2.109  1.00 25.42  ? 338 LYS B CB    1 
ATOM   4760 C  CG    . LYS B 1 297 ? 14.017  71.002  -1.055  1.00 28.39  ? 338 LYS B CG    1 
ATOM   4761 C  CD    . LYS B 1 297 ? 13.436  70.877  0.342   1.00 34.18  ? 338 LYS B CD    1 
ATOM   4762 C  CE    . LYS B 1 297 ? 13.171  69.429  0.702   1.00 33.68  ? 338 LYS B CE    1 
ATOM   4763 N  NZ    . LYS B 1 297 ? 12.626  69.289  2.080   1.00 28.17  ? 338 LYS B NZ    1 
ATOM   4764 N  N     . LYS B 1 298 ? 12.368  70.869  -5.720  1.00 32.24  ? 339 LYS B N     1 
ATOM   4765 C  CA    . LYS B 1 298 ? 11.600  70.284  -6.812  1.00 31.56  ? 339 LYS B CA    1 
ATOM   4766 C  C     . LYS B 1 298 ? 12.519  69.946  -7.983  1.00 27.90  ? 339 LYS B C     1 
ATOM   4767 O  O     . LYS B 1 298 ? 13.740  70.082  -7.880  1.00 23.42  ? 339 LYS B O     1 
ATOM   4768 C  CB    . LYS B 1 298 ? 10.487  71.228  -7.266  1.00 31.17  ? 339 LYS B CB    1 
ATOM   4769 C  CG    . LYS B 1 298 ? 9.369   71.416  -6.253  1.00 31.19  ? 339 LYS B CG    1 
ATOM   4770 C  CD    . LYS B 1 298 ? 8.275   72.306  -6.819  1.00 35.65  ? 339 LYS B CD    1 
ATOM   4771 C  CE    . LYS B 1 298 ? 7.134   72.489  -5.834  1.00 29.93  ? 339 LYS B CE    1 
ATOM   4772 N  NZ    . LYS B 1 298 ? 6.461   71.196  -5.536  1.00 32.67  ? 339 LYS B NZ    1 
ATOM   4773 N  N     . LYS B 1 299 ? 11.922  69.505  -9.087  1.00 32.12  ? 340 LYS B N     1 
ATOM   4774 C  CA    . LYS B 1 299 ? 12.658  69.146  -10.296 1.00 30.54  ? 340 LYS B CA    1 
ATOM   4775 C  C     . LYS B 1 299 ? 13.597  70.267  -10.726 1.00 32.77  ? 340 LYS B C     1 
ATOM   4776 O  O     . LYS B 1 299 ? 13.189  71.424  -10.814 1.00 33.02  ? 340 LYS B O     1 
ATOM   4777 C  CB    . LYS B 1 299 ? 11.683  68.818  -11.426 1.00 37.43  ? 340 LYS B CB    1 
ATOM   4778 C  CG    . LYS B 1 299 ? 12.011  67.549  -12.188 1.00 43.75  ? 340 LYS B CG    1 
ATOM   4779 C  CD    . LYS B 1 299 ? 10.865  67.156  -13.106 1.00 45.79  ? 340 LYS B CD    1 
ATOM   4780 C  CE    . LYS B 1 299 ? 9.546   67.108  -12.349 1.00 50.26  ? 340 LYS B CE    1 
ATOM   4781 N  NZ    . LYS B 1 299 ? 8.440   66.502  -13.149 1.00 57.11  ? 340 LYS B NZ    1 
ATOM   4782 N  N     . LYS B 1 300 ? 14.853  69.923  -10.987 1.00 31.95  ? 341 LYS B N     1 
ATOM   4783 C  CA    . LYS B 1 300 ? 15.854  70.928  -11.326 1.00 38.97  ? 341 LYS B CA    1 
ATOM   4784 C  C     . LYS B 1 300 ? 15.603  71.523  -12.709 1.00 33.04  ? 341 LYS B C     1 
ATOM   4785 O  O     . LYS B 1 300 ? 16.118  72.593  -13.032 1.00 32.95  ? 341 LYS B O     1 
ATOM   4786 C  CB    . LYS B 1 300 ? 17.263  70.332  -11.252 1.00 35.92  ? 341 LYS B CB    1 
ATOM   4787 C  CG    . LYS B 1 300 ? 17.566  69.272  -12.297 1.00 45.31  ? 341 LYS B CG    1 
ATOM   4788 C  CD    . LYS B 1 300 ? 18.921  68.627  -12.033 1.00 52.67  ? 341 LYS B CD    1 
ATOM   4789 C  CE    . LYS B 1 300 ? 19.281  67.611  -13.105 1.00 61.99  ? 341 LYS B CE    1 
ATOM   4790 N  NZ    . LYS B 1 300 ? 19.546  68.256  -14.420 1.00 64.06  ? 341 LYS B NZ    1 
ATOM   4791 N  N     . HIS B 1 301 ? 14.802  70.833  -13.515 1.00 34.17  ? 342 HIS B N     1 
ATOM   4792 C  CA    . HIS B 1 301 ? 14.471  71.306  -14.854 1.00 41.77  ? 342 HIS B CA    1 
ATOM   4793 C  C     . HIS B 1 301 ? 13.303  72.288  -14.817 1.00 37.68  ? 342 HIS B C     1 
ATOM   4794 O  O     . HIS B 1 301 ? 12.965  72.902  -15.829 1.00 31.84  ? 342 HIS B O     1 
ATOM   4795 C  CB    . HIS B 1 301 ? 14.147  70.128  -15.774 1.00 40.89  ? 342 HIS B CB    1 
ATOM   4796 C  CG    . HIS B 1 301 ? 15.228  69.093  -15.830 1.00 54.95  ? 342 HIS B CG    1 
ATOM   4797 N  ND1   . HIS B 1 301 ? 15.059  67.814  -15.346 1.00 61.00  ? 342 HIS B ND1   1 
ATOM   4798 C  CD2   . HIS B 1 301 ? 16.495  69.152  -16.304 1.00 57.11  ? 342 HIS B CD2   1 
ATOM   4799 C  CE1   . HIS B 1 301 ? 16.173  67.127  -15.526 1.00 58.72  ? 342 HIS B CE1   1 
ATOM   4800 N  NE2   . HIS B 1 301 ? 17.060  67.916  -16.105 1.00 64.55  ? 342 HIS B NE2   1 
ATOM   4801 N  N     . LEU B 1 302 ? 12.683  72.429  -13.650 1.00 28.34  ? 343 LEU B N     1 
ATOM   4802 C  CA    . LEU B 1 302 ? 11.659  73.448  -13.458 1.00 28.40  ? 343 LEU B CA    1 
ATOM   4803 C  C     . LEU B 1 302 ? 12.323  74.807  -13.294 1.00 29.74  ? 343 LEU B C     1 
ATOM   4804 O  O     . LEU B 1 302 ? 13.208  74.976  -12.455 1.00 31.97  ? 343 LEU B O     1 
ATOM   4805 C  CB    . LEU B 1 302 ? 10.785  73.133  -12.243 1.00 29.49  ? 343 LEU B CB    1 
ATOM   4806 C  CG    . LEU B 1 302 ? 9.742   72.024  -12.389 1.00 30.05  ? 343 LEU B CG    1 
ATOM   4807 C  CD1   . LEU B 1 302 ? 9.148   71.674  -11.036 1.00 25.66  ? 343 LEU B CD1   1 
ATOM   4808 C  CD2   . LEU B 1 302 ? 8.645   72.447  -13.357 1.00 30.02  ? 343 LEU B CD2   1 
ATOM   4809 N  N     . PHE B 1 303 ? 11.897  75.772  -14.102 1.00 26.52  ? 344 PHE B N     1 
ATOM   4810 C  CA    . PHE B 1 303 ? 12.467  77.112  -14.052 1.00 26.79  ? 344 PHE B CA    1 
ATOM   4811 C  C     . PHE B 1 303 ? 11.399  78.196  -13.976 1.00 27.18  ? 344 PHE B C     1 
ATOM   4812 O  O     . PHE B 1 303 ? 10.292  78.038  -14.491 1.00 29.27  ? 344 PHE B O     1 
ATOM   4813 C  CB    . PHE B 1 303 ? 13.365  77.358  -15.265 1.00 26.33  ? 344 PHE B CB    1 
ATOM   4814 C  CG    . PHE B 1 303 ? 14.715  76.712  -15.161 1.00 27.62  ? 344 PHE B CG    1 
ATOM   4815 C  CD1   . PHE B 1 303 ? 15.736  77.327  -14.456 1.00 27.78  ? 344 PHE B CD1   1 
ATOM   4816 C  CD2   . PHE B 1 303 ? 14.968  75.495  -15.772 1.00 25.52  ? 344 PHE B CD2   1 
ATOM   4817 C  CE1   . PHE B 1 303 ? 16.985  76.739  -14.357 1.00 30.09  ? 344 PHE B CE1   1 
ATOM   4818 C  CE2   . PHE B 1 303 ? 16.216  74.901  -15.676 1.00 32.49  ? 344 PHE B CE2   1 
ATOM   4819 C  CZ    . PHE B 1 303 ? 17.224  75.525  -14.967 1.00 28.12  ? 344 PHE B CZ    1 
ATOM   4820 N  N     . GLY B 1 304 ? 11.747  79.300  -13.326 1.00 30.56  ? 345 GLY B N     1 
ATOM   4821 C  CA    . GLY B 1 304 ? 10.868  80.448  -13.237 1.00 28.56  ? 345 GLY B CA    1 
ATOM   4822 C  C     . GLY B 1 304 ? 11.673  81.722  -13.089 1.00 27.66  ? 345 GLY B C     1 
ATOM   4823 O  O     . GLY B 1 304 ? 12.873  81.678  -12.816 1.00 33.20  ? 345 GLY B O     1 
ATOM   4824 N  N     . LEU B 1 305 ? 11.016  82.860  -13.276 1.00 28.86  ? 346 LEU B N     1 
ATOM   4825 C  CA    . LEU B 1 305 ? 11.665  84.153  -13.102 1.00 32.95  ? 346 LEU B CA    1 
ATOM   4826 C  C     . LEU B 1 305 ? 11.745  84.520  -11.625 1.00 33.89  ? 346 LEU B C     1 
ATOM   4827 O  O     . LEU B 1 305 ? 10.787  84.319  -10.879 1.00 34.85  ? 346 LEU B O     1 
ATOM   4828 C  CB    . LEU B 1 305 ? 10.912  85.240  -13.868 1.00 26.57  ? 346 LEU B CB    1 
ATOM   4829 C  CG    . LEU B 1 305 ? 10.766  85.049  -15.378 1.00 31.41  ? 346 LEU B CG    1 
ATOM   4830 C  CD1   . LEU B 1 305 ? 9.868   86.128  -15.961 1.00 25.82  ? 346 LEU B CD1   1 
ATOM   4831 C  CD2   . LEU B 1 305 ? 12.129  85.054  -16.058 1.00 27.47  ? 346 LEU B CD2   1 
ATOM   4832 N  N     . ARG B 1 306 ? 12.885  85.055  -11.200 1.00 32.74  ? 347 ARG B N     1 
ATOM   4833 C  CA    . ARG B 1 306 ? 13.019  85.520  -9.825  1.00 36.95  ? 347 ARG B CA    1 
ATOM   4834 C  C     . ARG B 1 306 ? 12.111  86.723  -9.603  1.00 41.53  ? 347 ARG B C     1 
ATOM   4835 O  O     . ARG B 1 306 ? 11.484  86.856  -8.552  1.00 49.05  ? 347 ARG B O     1 
ATOM   4836 C  CB    . ARG B 1 306 ? 14.472  85.863  -9.499  1.00 36.50  ? 347 ARG B CB    1 
ATOM   4837 C  CG    . ARG B 1 306 ? 15.380  84.645  -9.499  1.00 35.34  ? 347 ARG B CG    1 
ATOM   4838 C  CD    . ARG B 1 306 ? 16.756  84.955  -8.935  1.00 35.34  ? 347 ARG B CD    1 
ATOM   4839 N  NE    . ARG B 1 306 ? 17.645  83.811  -9.105  1.00 35.02  ? 347 ARG B NE    1 
ATOM   4840 C  CZ    . ARG B 1 306 ? 17.788  82.834  -8.216  1.00 33.66  ? 347 ARG B CZ    1 
ATOM   4841 N  NH1   . ARG B 1 306 ? 17.111  82.871  -7.077  1.00 37.92  ? 347 ARG B NH1   1 
ATOM   4842 N  NH2   . ARG B 1 306 ? 18.614  81.826  -8.463  1.00 34.56  ? 347 ARG B NH2   1 
ATOM   4843 N  N     . ILE B 1 307 ? 12.039  87.592  -10.605 1.00 40.86  ? 348 ILE B N     1 
ATOM   4844 C  CA    . ILE B 1 307 ? 11.097  88.703  -10.586 1.00 42.29  ? 348 ILE B CA    1 
ATOM   4845 C  C     . ILE B 1 307 ? 10.325  88.744  -11.901 1.00 37.04  ? 348 ILE B C     1 
ATOM   4846 O  O     . ILE B 1 307 ? 10.914  88.741  -12.983 1.00 34.07  ? 348 ILE B O     1 
ATOM   4847 C  CB    . ILE B 1 307 ? 11.805  90.048  -10.336 1.00 43.81  ? 348 ILE B CB    1 
ATOM   4848 C  CG1   . ILE B 1 307 ? 13.051  90.173  -11.214 1.00 46.48  ? 348 ILE B CG1   1 
ATOM   4849 C  CG2   . ILE B 1 307 ? 12.199  90.169  -8.875  1.00 50.01  ? 348 ILE B CG2   1 
ATOM   4850 C  CD1   . ILE B 1 307 ? 13.845  91.441  -10.976 1.00 54.07  ? 348 ILE B CD1   1 
ATOM   4851 N  N     . ARG B 1 308 ? 9.000   88.757  -11.800 1.00 36.25  ? 349 ARG B N     1 
ATOM   4852 C  CA    . ARG B 1 308 ? 8.151   88.712  -12.982 1.00 39.03  ? 349 ARG B CA    1 
ATOM   4853 C  C     . ARG B 1 308 ? 8.158   90.056  -13.701 1.00 35.31  ? 349 ARG B C     1 
ATOM   4854 O  O     . ARG B 1 308 ? 7.245   90.866  -13.541 1.00 36.67  ? 349 ARG B O     1 
ATOM   4855 C  CB    . ARG B 1 308 ? 6.725   88.318  -12.604 1.00 40.16  ? 349 ARG B CB    1 
ATOM   4856 C  CG    . ARG B 1 308 ? 6.055   87.408  -13.615 1.00 33.94  ? 349 ARG B CG    1 
ATOM   4857 C  CD    . ARG B 1 308 ? 4.567   87.685  -13.678 1.00 37.51  ? 349 ARG B CD    1 
ATOM   4858 N  NE    . ARG B 1 308 ? 4.295   89.020  -14.201 1.00 49.10  ? 349 ARG B NE    1 
ATOM   4859 C  CZ    . ARG B 1 308 ? 3.084   89.558  -14.283 1.00 55.86  ? 349 ARG B CZ    1 
ATOM   4860 N  NH1   . ARG B 1 308 ? 2.023   88.878  -13.868 1.00 59.76  ? 349 ARG B NH1   1 
ATOM   4861 N  NH2   . ARG B 1 308 ? 2.934   90.780  -14.777 1.00 42.25  ? 349 ARG B NH2   1 
ATOM   4862 N  N     . VAL B 1 309 ? 9.201   90.283  -14.492 1.00 32.50  ? 350 VAL B N     1 
ATOM   4863 C  CA    . VAL B 1 309 ? 9.396   91.545  -15.195 1.00 33.54  ? 350 VAL B CA    1 
ATOM   4864 C  C     . VAL B 1 309 ? 9.814   91.268  -16.638 1.00 29.93  ? 350 VAL B C     1 
ATOM   4865 O  O     . VAL B 1 309 ? 10.617  90.370  -16.887 1.00 32.29  ? 350 VAL B O     1 
ATOM   4866 C  CB    . VAL B 1 309 ? 10.463  92.419  -14.482 1.00 34.45  ? 350 VAL B CB    1 
ATOM   4867 C  CG1   . VAL B 1 309 ? 10.876  93.611  -15.333 1.00 33.78  ? 350 VAL B CG1   1 
ATOM   4868 C  CG2   . VAL B 1 309 ? 9.950   92.887  -13.129 1.00 41.18  ? 350 VAL B CG2   1 
ATOM   4869 N  N     . PRO B 1 310 ? 9.249   92.021  -17.597 1.00 31.36  ? 351 PRO B N     1 
ATOM   4870 C  CA    . PRO B 1 310 ? 9.629   91.887  -19.008 1.00 30.19  ? 351 PRO B CA    1 
ATOM   4871 C  C     . PRO B 1 310 ? 11.127  92.072  -19.227 1.00 32.90  ? 351 PRO B C     1 
ATOM   4872 O  O     . PRO B 1 310 ? 11.753  92.849  -18.510 1.00 34.17  ? 351 PRO B O     1 
ATOM   4873 C  CB    . PRO B 1 310 ? 8.846   93.011  -19.690 1.00 27.66  ? 351 PRO B CB    1 
ATOM   4874 C  CG    . PRO B 1 310 ? 7.669   93.227  -18.814 1.00 32.33  ? 351 PRO B CG    1 
ATOM   4875 C  CD    . PRO B 1 310 ? 8.152   92.988  -17.413 1.00 29.13  ? 351 PRO B CD    1 
ATOM   4876 N  N     . PRO B 1 311 ? 11.695  91.361  -20.210 1.00 27.21  ? 352 PRO B N     1 
ATOM   4877 C  CA    . PRO B 1 311 ? 13.114  91.490  -20.555 1.00 35.07  ? 352 PRO B CA    1 
ATOM   4878 C  C     . PRO B 1 311 ? 13.441  92.893  -21.060 1.00 34.46  ? 352 PRO B C     1 
ATOM   4879 O  O     . PRO B 1 311 ? 12.637  93.485  -21.778 1.00 33.98  ? 352 PRO B O     1 
ATOM   4880 C  CB    . PRO B 1 311 ? 13.304  90.452  -21.668 1.00 27.70  ? 352 PRO B CB    1 
ATOM   4881 C  CG    . PRO B 1 311 ? 12.140  89.525  -21.539 1.00 29.09  ? 352 PRO B CG    1 
ATOM   4882 C  CD    . PRO B 1 311 ? 11.012  90.372  -21.058 1.00 26.50  ? 352 PRO B CD    1 
ATOM   4883 N  N     . VAL B 1 312 ? 14.604  93.413  -20.685 1.00 36.99  ? 353 VAL B N     1 
ATOM   4884 C  CA    . VAL B 1 312 ? 15.022  94.737  -21.131 1.00 36.27  ? 353 VAL B CA    1 
ATOM   4885 C  C     . VAL B 1 312 ? 15.985  94.646  -22.310 1.00 34.17  ? 353 VAL B C     1 
ATOM   4886 O  O     . VAL B 1 312 ? 17.047  94.036  -22.205 1.00 42.10  ? 353 VAL B O     1 
ATOM   4887 C  CB    . VAL B 1 312 ? 15.690  95.528  -19.994 1.00 42.25  ? 353 VAL B CB    1 
ATOM   4888 C  CG1   . VAL B 1 312 ? 16.092  96.911  -20.478 1.00 47.82  ? 353 VAL B CG1   1 
ATOM   4889 C  CG2   . VAL B 1 312 ? 14.753  95.629  -18.803 1.00 47.90  ? 353 VAL B CG2   1 
ATOM   4890 N  N     . PRO B 1 313 ? 15.606  95.246  -23.445 1.00 38.56  ? 354 PRO B N     1 
ATOM   4891 C  CA    . PRO B 1 313 ? 16.469  95.309  -24.630 1.00 41.45  ? 354 PRO B CA    1 
ATOM   4892 C  C     . PRO B 1 313 ? 17.695  96.189  -24.377 1.00 45.78  ? 354 PRO B C     1 
ATOM   4893 O  O     . PRO B 1 313 ? 17.615  97.103  -23.556 1.00 43.26  ? 354 PRO B O     1 
ATOM   4894 C  CB    . PRO B 1 313 ? 15.551  95.909  -25.702 1.00 37.22  ? 354 PRO B CB    1 
ATOM   4895 C  CG    . PRO B 1 313 ? 14.499  96.634  -24.944 1.00 38.70  ? 354 PRO B CG    1 
ATOM   4896 C  CD    . PRO B 1 313 ? 14.289  95.858  -23.683 1.00 40.44  ? 354 PRO B CD    1 
ATOM   4897 N  N     . PRO B 1 314 ? 18.814  95.913  -25.072 1.00 53.87  ? 355 PRO B N     1 
ATOM   4898 C  CA    . PRO B 1 314 ? 20.124  96.552  -24.876 1.00 57.82  ? 355 PRO B CA    1 
ATOM   4899 C  C     . PRO B 1 314 ? 20.106  98.078  -24.735 1.00 62.25  ? 355 PRO B C     1 
ATOM   4900 O  O     . PRO B 1 314 ? 20.958  98.631  -24.039 1.00 68.32  ? 355 PRO B O     1 
ATOM   4901 C  CB    . PRO B 1 314 ? 20.887  96.148  -26.139 1.00 54.57  ? 355 PRO B CB    1 
ATOM   4902 C  CG    . PRO B 1 314 ? 20.330  94.819  -26.482 1.00 53.53  ? 355 PRO B CG    1 
ATOM   4903 C  CD    . PRO B 1 314 ? 18.866  94.886  -26.130 1.00 53.15  ? 355 PRO B CD    1 
ATOM   4904 N  N     . ASN B 1 315 ? 19.152  98.745  -25.376 1.00 61.00  ? 356 ASN B N     1 
ATOM   4905 C  CA    . ASN B 1 315 ? 19.125  100.205 -25.392 1.00 69.94  ? 356 ASN B CA    1 
ATOM   4906 C  C     . ASN B 1 315 ? 18.506  100.839 -24.146 1.00 69.80  ? 356 ASN B C     1 
ATOM   4907 O  O     . ASN B 1 315 ? 18.987  101.862 -23.657 1.00 62.65  ? 356 ASN B O     1 
ATOM   4908 C  CB    . ASN B 1 315 ? 18.365  100.702 -26.625 1.00 70.00  ? 356 ASN B CB    1 
ATOM   4909 C  CG    . ASN B 1 315 ? 18.850  100.060 -27.911 1.00 77.52  ? 356 ASN B CG    1 
ATOM   4910 O  OD1   . ASN B 1 315 ? 19.754  100.572 -28.572 1.00 75.31  ? 356 ASN B OD1   1 
ATOM   4911 N  ND2   . ASN B 1 315 ? 18.242  98.937  -28.277 1.00 72.16  ? 356 ASN B ND2   1 
ATOM   4912 N  N     . VAL B 1 316 ? 17.443  100.228 -23.634 1.00 67.40  ? 357 VAL B N     1 
ATOM   4913 C  CA    . VAL B 1 316 ? 16.561  100.903 -22.686 1.00 63.54  ? 357 VAL B CA    1 
ATOM   4914 C  C     . VAL B 1 316 ? 16.697  100.416 -21.244 1.00 67.94  ? 357 VAL B C     1 
ATOM   4915 O  O     . VAL B 1 316 ? 17.655  99.724  -20.895 1.00 66.94  ? 357 VAL B O     1 
ATOM   4916 C  CB    . VAL B 1 316 ? 15.089  100.745 -23.116 1.00 61.15  ? 357 VAL B CB    1 
ATOM   4917 C  CG1   . VAL B 1 316 ? 14.365  102.084 -23.047 1.00 63.15  ? 357 VAL B CG1   1 
ATOM   4918 C  CG2   . VAL B 1 316 ? 15.013  100.174 -24.524 1.00 59.04  ? 357 VAL B CG2   1 
ATOM   4919 N  N     . ALA B 1 317 ? 15.724  100.794 -20.416 1.00 66.31  ? 358 ALA B N     1 
ATOM   4920 C  CA    . ALA B 1 317 ? 15.689  100.420 -19.006 1.00 60.33  ? 358 ALA B CA    1 
ATOM   4921 C  C     . ALA B 1 317 ? 14.276  100.560 -18.442 1.00 55.12  ? 358 ALA B C     1 
ATOM   4922 O  O     . ALA B 1 317 ? 13.633  99.571  -18.089 1.00 49.96  ? 358 ALA B O     1 
ATOM   4923 C  CB    . ALA B 1 317 ? 16.661  101.269 -18.206 1.00 60.25  ? 358 ALA B CB    1 
HETATM 4924 N  N     . M3L C 2 4   ? 34.310  102.810 17.292  1.00 68.85  ? 36  M3L C N     1 
HETATM 4925 C  CA    . M3L C 2 4   ? 33.254  102.876 16.310  1.00 70.31  ? 36  M3L C CA    1 
HETATM 4926 C  CB    . M3L C 2 4   ? 31.974  103.538 16.852  1.00 63.21  ? 36  M3L C CB    1 
HETATM 4927 C  CG    . M3L C 2 4   ? 30.728  102.851 16.335  1.00 58.29  ? 36  M3L C CG    1 
HETATM 4928 C  CD    . M3L C 2 4   ? 29.586  103.849 16.242  1.00 57.75  ? 36  M3L C CD    1 
HETATM 4929 C  CE    . M3L C 2 4   ? 28.273  103.135 16.548  1.00 55.89  ? 36  M3L C CE    1 
HETATM 4930 N  NZ    . M3L C 2 4   ? 27.192  103.157 15.487  1.00 45.67  ? 36  M3L C NZ    1 
HETATM 4931 C  C     . M3L C 2 4   ? 33.632  103.621 15.032  1.00 76.23  ? 36  M3L C C     1 
HETATM 4932 O  O     . M3L C 2 4   ? 33.138  104.701 14.705  1.00 74.96  ? 36  M3L C O     1 
HETATM 4933 C  CM1   . M3L C 2 4   ? 27.500  102.223 14.365  1.00 42.76  ? 36  M3L C CM1   1 
HETATM 4934 C  CM2   . M3L C 2 4   ? 26.999  104.534 14.944  1.00 53.27  ? 36  M3L C CM2   1 
HETATM 4935 C  CM3   . M3L C 2 4   ? 25.913  102.723 16.130  1.00 39.72  ? 36  M3L C CM3   1 
ATOM   4936 N  N     . LYS C 2 5   ? 34.547  103.013 14.282  1.00 76.46  ? 37  LYS C N     1 
ATOM   4937 C  CA    . LYS C 2 5   ? 34.961  103.560 12.993  1.00 79.63  ? 37  LYS C CA    1 
ATOM   4938 C  C     . LYS C 2 5   ? 34.828  102.508 11.892  1.00 81.93  ? 37  LYS C C     1 
ATOM   4939 O  O     . LYS C 2 5   ? 34.976  101.311 12.149  1.00 81.72  ? 37  LYS C O     1 
ATOM   4940 C  CB    . LYS C 2 5   ? 36.401  104.085 13.060  1.00 83.92  ? 37  LYS C CB    1 
ATOM   4941 C  CG    . LYS C 2 5   ? 37.477  103.014 12.934  1.00 91.95  ? 37  LYS C CG    1 
ATOM   4942 C  CD    . LYS C 2 5   ? 38.869  103.628 12.878  1.00 97.14  ? 37  LYS C CD    1 
ATOM   4943 C  CE    . LYS C 2 5   ? 39.926  102.576 12.576  1.00 98.10  ? 37  LYS C CE    1 
ATOM   4944 N  NZ    . LYS C 2 5   ? 40.637  102.858 11.298  1.00 99.77  ? 37  LYS C NZ    1 
ATOM   4945 N  N     . PRO C 2 6   ? 34.526  102.953 10.662  1.00 78.51  ? 38  PRO C N     1 
ATOM   4946 C  CA    . PRO C 2 6   ? 34.429  102.045 9.516   1.00 77.09  ? 38  PRO C CA    1 
ATOM   4947 C  C     . PRO C 2 6   ? 35.783  101.802 8.854   1.00 88.63  ? 38  PRO C C     1 
ATOM   4948 O  O     . PRO C 2 6   ? 36.780  102.368 9.302   1.00 94.27  ? 38  PRO C O     1 
ATOM   4949 C  CB    . PRO C 2 6   ? 33.484  102.786 8.574   1.00 64.34  ? 38  PRO C CB    1 
ATOM   4950 C  CG    . PRO C 2 6   ? 33.772  104.224 8.844   1.00 63.14  ? 38  PRO C CG    1 
ATOM   4951 C  CD    . PRO C 2 6   ? 34.105  104.323 10.315  1.00 71.09  ? 38  PRO C CD    1 
HETATM 4952 N  N     . M3L D 2 4   ? -15.730 88.021  -21.369 1.00 75.21  ? 36  M3L D N     1 
HETATM 4953 C  CA    . M3L D 2 4   ? -16.201 89.234  -21.994 1.00 74.59  ? 36  M3L D CA    1 
HETATM 4954 C  CB    . M3L D 2 4   ? -16.014 90.473  -21.103 1.00 60.79  ? 36  M3L D CB    1 
HETATM 4955 C  CG    . M3L D 2 4   ? -14.986 90.204  -20.025 1.00 56.50  ? 36  M3L D CG    1 
HETATM 4956 C  CD    . M3L D 2 4   ? -14.679 91.475  -19.256 1.00 51.99  ? 36  M3L D CD    1 
HETATM 4957 C  CE    . M3L D 2 4   ? -13.233 91.402  -18.772 1.00 52.01  ? 36  M3L D CE    1 
HETATM 4958 N  NZ    . M3L D 2 4   ? -12.470 92.703  -18.628 1.00 49.77  ? 36  M3L D NZ    1 
HETATM 4959 C  C     . M3L D 2 4   ? -15.543 89.530  -23.340 1.00 81.24  ? 36  M3L D C     1 
HETATM 4960 O  O     . M3L D 2 4   ? -14.345 89.363  -23.574 1.00 74.60  ? 36  M3L D O     1 
HETATM 4961 C  CM1   . M3L D 2 4   ? -13.136 93.830  -19.347 1.00 46.58  ? 36  M3L D CM1   1 
HETATM 4962 C  CM2   . M3L D 2 4   ? -11.073 92.563  -19.134 1.00 43.12  ? 36  M3L D CM2   1 
HETATM 4963 C  CM3   . M3L D 2 4   ? -12.414 93.030  -17.169 1.00 44.75  ? 36  M3L D CM3   1 
ATOM   4964 N  N     . LYS D 2 5   ? -16.378 89.996  -24.263 1.00 82.07  ? 37  LYS D N     1 
ATOM   4965 C  CA    . LYS D 2 5   ? -15.940 90.291  -25.623 1.00 81.39  ? 37  LYS D CA    1 
ATOM   4966 C  C     . LYS D 2 5   ? -16.318 91.722  -26.012 1.00 84.23  ? 37  LYS D C     1 
ATOM   4967 O  O     . LYS D 2 5   ? -17.407 92.187  -25.675 1.00 83.42  ? 37  LYS D O     1 
ATOM   4968 C  CB    . LYS D 2 5   ? -16.546 89.285  -26.612 1.00 88.99  ? 37  LYS D CB    1 
ATOM   4969 C  CG    . LYS D 2 5   ? -17.657 88.405  -26.029 1.00 90.48  ? 37  LYS D CG    1 
ATOM   4970 C  CD    . LYS D 2 5   ? -17.108 87.125  -25.396 1.00 92.48  ? 37  LYS D CD    1 
ATOM   4971 C  CE    . LYS D 2 5   ? -18.086 86.541  -24.382 1.00 91.68  ? 37  LYS D CE    1 
ATOM   4972 N  NZ    . LYS D 2 5   ? -17.454 85.533  -23.483 1.00 94.22  ? 37  LYS D NZ    1 
ATOM   4973 N  N     . PRO D 2 6   ? -15.412 92.426  -26.716 1.00 81.11  ? 38  PRO D N     1 
ATOM   4974 C  CA    . PRO D 2 6   ? -15.606 93.825  -27.123 1.00 74.76  ? 38  PRO D CA    1 
ATOM   4975 C  C     . PRO D 2 6   ? -16.875 94.051  -27.943 1.00 80.95  ? 38  PRO D C     1 
ATOM   4976 O  O     . PRO D 2 6   ? -17.109 93.322  -28.906 1.00 86.73  ? 38  PRO D O     1 
ATOM   4977 C  CB    . PRO D 2 6   ? -14.362 94.119  -27.968 1.00 70.44  ? 38  PRO D CB    1 
ATOM   4978 C  CG    . PRO D 2 6   ? -13.334 93.179  -27.454 1.00 72.38  ? 38  PRO D CG    1 
ATOM   4979 C  CD    . PRO D 2 6   ? -14.081 91.925  -27.103 1.00 73.78  ? 38  PRO D CD    1 
ATOM   4980 O  "O5'" . DG  E 3 1   ? -0.876  77.811  -9.573  1.00 38.72  ? 1   DG  E "O5'" 1 
ATOM   4981 C  "C5'" . DG  E 3 1   ? -0.193  78.792  -8.801  1.00 34.75  ? 1   DG  E "C5'" 1 
ATOM   4982 C  "C4'" . DG  E 3 1   ? 0.815   78.147  -7.865  1.00 44.66  ? 1   DG  E "C4'" 1 
ATOM   4983 O  "O4'" . DG  E 3 1   ? 0.117   77.350  -6.868  1.00 42.39  ? 1   DG  E "O4'" 1 
ATOM   4984 C  "C3'" . DG  E 3 1   ? 1.812   77.187  -8.529  1.00 42.09  ? 1   DG  E "C3'" 1 
ATOM   4985 O  "O3'" . DG  E 3 1   ? 3.057   77.251  -7.845  1.00 47.70  ? 1   DG  E "O3'" 1 
ATOM   4986 C  "C2'" . DG  E 3 1   ? 1.151   75.839  -8.281  1.00 45.24  ? 1   DG  E "C2'" 1 
ATOM   4987 C  "C1'" . DG  E 3 1   ? 0.689   76.065  -6.855  1.00 39.59  ? 1   DG  E "C1'" 1 
ATOM   4988 N  N9    . DG  E 3 1   ? -0.290  75.102  -6.372  1.00 34.24  ? 1   DG  E N9    1 
ATOM   4989 C  C8    . DG  E 3 1   ? -1.015  74.205  -7.118  1.00 35.16  ? 1   DG  E C8    1 
ATOM   4990 N  N7    . DG  E 3 1   ? -1.810  73.461  -6.402  1.00 32.43  ? 1   DG  E N7    1 
ATOM   4991 C  C5    . DG  E 3 1   ? -1.594  73.890  -5.097  1.00 33.04  ? 1   DG  E C5    1 
ATOM   4992 C  C6    . DG  E 3 1   ? -2.176  73.450  -3.885  1.00 27.30  ? 1   DG  E C6    1 
ATOM   4993 O  O6    . DG  E 3 1   ? -3.025  72.564  -3.721  1.00 33.00  ? 1   DG  E O6    1 
ATOM   4994 N  N1    . DG  E 3 1   ? -1.676  74.148  -2.788  1.00 26.27  ? 1   DG  E N1    1 
ATOM   4995 C  C2    . DG  E 3 1   ? -0.734  75.148  -2.855  1.00 30.56  ? 1   DG  E C2    1 
ATOM   4996 N  N2    . DG  E 3 1   ? -0.375  75.708  -1.689  1.00 27.68  ? 1   DG  E N2    1 
ATOM   4997 N  N3    . DG  E 3 1   ? -0.182  75.571  -3.986  1.00 30.09  ? 1   DG  E N3    1 
ATOM   4998 C  C4    . DG  E 3 1   ? -0.659  74.897  -5.063  1.00 31.98  ? 1   DG  E C4    1 
ATOM   4999 P  P     . DG  E 3 2   ? 4.206   78.279  -8.299  1.00 46.93  ? 2   DG  E P     1 
ATOM   5000 O  OP1   . DG  E 3 2   ? 3.584   79.601  -8.534  1.00 45.34  ? 2   DG  E OP1   1 
ATOM   5001 O  OP2   . DG  E 3 2   ? 4.987   77.630  -9.375  1.00 35.36  ? 2   DG  E OP2   1 
ATOM   5002 O  "O5'" . DG  E 3 2   ? 5.134   78.394  -6.998  1.00 37.48  ? 2   DG  E "O5'" 1 
ATOM   5003 C  "C5'" . DG  E 3 2   ? 4.642   79.053  -5.830  1.00 36.06  ? 2   DG  E "C5'" 1 
ATOM   5004 C  "C4'" . DG  E 3 2   ? 4.829   78.197  -4.581  1.00 39.33  ? 2   DG  E "C4'" 1 
ATOM   5005 O  "O4'" . DG  E 3 2   ? 3.817   77.151  -4.532  1.00 42.17  ? 2   DG  E "O4'" 1 
ATOM   5006 C  "C3'" . DG  E 3 2   ? 6.179   77.471  -4.461  1.00 37.40  ? 2   DG  E "C3'" 1 
ATOM   5007 O  "O3'" . DG  E 3 2   ? 6.606   77.488  -3.109  1.00 35.83  ? 2   DG  E "O3'" 1 
ATOM   5008 C  "C2'" . DG  E 3 2   ? 5.814   76.050  -4.875  1.00 39.54  ? 2   DG  E "C2'" 1 
ATOM   5009 C  "C1'" . DG  E 3 2   ? 4.461   75.944  -4.202  1.00 35.60  ? 2   DG  E "C1'" 1 
ATOM   5010 N  N9    . DG  E 3 2   ? 3.646   74.816  -4.641  1.00 33.44  ? 2   DG  E N9    1 
ATOM   5011 C  C8    . DG  E 3 2   ? 3.514   74.327  -5.918  1.00 35.16  ? 2   DG  E C8    1 
ATOM   5012 N  N7    . DG  E 3 2   ? 2.711   73.301  -5.998  1.00 33.28  ? 2   DG  E N7    1 
ATOM   5013 C  C5    . DG  E 3 2   ? 2.287   73.096  -4.689  1.00 34.22  ? 2   DG  E C5    1 
ATOM   5014 C  C6    . DG  E 3 2   ? 1.405   72.126  -4.153  1.00 34.02  ? 2   DG  E C6    1 
ATOM   5015 O  O6    . DG  E 3 2   ? 0.804   71.220  -4.749  1.00 31.47  ? 2   DG  E O6    1 
ATOM   5016 N  N1    . DG  E 3 2   ? 1.253   72.273  -2.778  1.00 28.65  ? 2   DG  E N1    1 
ATOM   5017 C  C2    . DG  E 3 2   ? 1.870   73.236  -2.017  1.00 31.54  ? 2   DG  E C2    1 
ATOM   5018 N  N2    . DG  E 3 2   ? 1.598   73.221  -0.703  1.00 32.61  ? 2   DG  E N2    1 
ATOM   5019 N  N3    . DG  E 3 2   ? 2.695   74.150  -2.507  1.00 31.06  ? 2   DG  E N3    1 
ATOM   5020 C  C4    . DG  E 3 2   ? 2.856   74.020  -3.845  1.00 32.34  ? 2   DG  E C4    1 
ATOM   5021 P  P     . DG  E 3 3   ? 7.578   78.642  -2.560  1.00 43.21  ? 3   DG  E P     1 
ATOM   5022 O  OP1   . DG  E 3 3   ? 6.835   79.920  -2.630  1.00 44.91  ? 3   DG  E OP1   1 
ATOM   5023 O  OP2   . DG  E 3 3   ? 8.882   78.510  -3.245  1.00 48.29  ? 3   DG  E OP2   1 
ATOM   5024 O  "O5'" . DG  E 3 3   ? 7.781   78.256  -1.018  1.00 34.50  ? 3   DG  E "O5'" 1 
ATOM   5025 C  "C5'" . DG  E 3 3   ? 6.762   78.560  -0.067  1.00 35.75  ? 3   DG  E "C5'" 1 
ATOM   5026 C  "C4'" . DG  E 3 3   ? 6.666   77.490  1.015   1.00 41.98  ? 3   DG  E "C4'" 1 
ATOM   5027 O  "O4'" . DG  E 3 3   ? 5.931   76.343  0.512   1.00 41.51  ? 3   DG  E "O4'" 1 
ATOM   5028 C  "C3'" . DG  E 3 3   ? 7.999   76.948  1.532   1.00 42.72  ? 3   DG  E "C3'" 1 
ATOM   5029 O  "O3'" . DG  E 3 3   ? 7.917   76.742  2.938   1.00 40.85  ? 3   DG  E "O3'" 1 
ATOM   5030 C  "C2'" . DG  E 3 3   ? 8.146   75.626  0.780   1.00 37.64  ? 3   DG  E "C2'" 1 
ATOM   5031 C  "C1'" . DG  E 3 3   ? 6.697   75.168  0.681   1.00 36.26  ? 3   DG  E "C1'" 1 
ATOM   5032 N  N9    . DG  E 3 3   ? 6.436   74.293  -0.458  1.00 32.87  ? 3   DG  E N9    1 
ATOM   5033 C  C8    . DG  E 3 3   ? 6.861   74.474  -1.752  1.00 33.57  ? 3   DG  E C8    1 
ATOM   5034 N  N7    . DG  E 3 3   ? 6.464   73.535  -2.565  1.00 31.53  ? 3   DG  E N7    1 
ATOM   5035 C  C5    . DG  E 3 3   ? 5.720   72.680  -1.761  1.00 32.46  ? 3   DG  E C5    1 
ATOM   5036 C  C6    . DG  E 3 3   ? 5.039   71.485  -2.088  1.00 30.38  ? 3   DG  E C6    1 
ATOM   5037 O  O6    . DG  E 3 3   ? 4.954   70.930  -3.191  1.00 35.43  ? 3   DG  E O6    1 
ATOM   5038 N  N1    . DG  E 3 3   ? 4.411   70.927  -0.977  1.00 33.46  ? 3   DG  E N1    1 
ATOM   5039 C  C2    . DG  E 3 3   ? 4.438   71.458  0.290   1.00 32.29  ? 3   DG  E C2    1 
ATOM   5040 N  N2    . DG  E 3 3   ? 3.773   70.776  1.235   1.00 32.45  ? 3   DG  E N2    1 
ATOM   5041 N  N3    . DG  E 3 3   ? 5.073   72.578  0.611   1.00 28.92  ? 3   DG  E N3    1 
ATOM   5042 C  C4    . DG  E 3 3   ? 5.690   73.134  -0.461  1.00 30.75  ? 3   DG  E C4    1 
ATOM   5043 P  P     . DC  E 3 4   ? 9.222   76.341  3.786   1.00 42.57  ? 4   DC  E P     1 
ATOM   5044 O  OP1   . DC  E 3 4   ? 9.119   77.043  5.083   1.00 49.06  ? 4   DC  E OP1   1 
ATOM   5045 O  OP2   . DC  E 3 4   ? 10.420  76.532  2.937   1.00 49.17  ? 4   DC  E OP2   1 
ATOM   5046 O  "O5'" . DC  E 3 4   ? 9.040   74.775  4.053   1.00 40.86  ? 4   DC  E "O5'" 1 
ATOM   5047 C  "C5'" . DC  E 3 4   ? 7.950   74.323  4.843   1.00 38.52  ? 4   DC  E "C5'" 1 
ATOM   5048 C  "C4'" . DC  E 3 4   ? 7.800   72.814  4.767   1.00 40.30  ? 4   DC  E "C4'" 1 
ATOM   5049 O  "O4'" . DC  E 3 4   ? 7.523   72.411  3.399   1.00 35.47  ? 4   DC  E "O4'" 1 
ATOM   5050 C  "C3'" . DC  E 3 4   ? 9.029   72.007  5.201   1.00 38.57  ? 4   DC  E "C3'" 1 
ATOM   5051 O  "O3'" . DC  E 3 4   ? 8.613   70.895  5.970   1.00 41.98  ? 4   DC  E "O3'" 1 
ATOM   5052 C  "C2'" . DC  E 3 4   ? 9.622   71.557  3.871   1.00 38.08  ? 4   DC  E "C2'" 1 
ATOM   5053 C  "C1'" . DC  E 3 4   ? 8.352   71.323  3.077   1.00 34.87  ? 4   DC  E "C1'" 1 
ATOM   5054 N  N1    . DC  E 3 4   ? 8.549   71.286  1.607   1.00 30.69  ? 4   DC  E N1    1 
ATOM   5055 C  C2    . DC  E 3 4   ? 7.926   70.284  0.861   1.00 30.88  ? 4   DC  E C2    1 
ATOM   5056 O  O2    . DC  E 3 4   ? 7.222   69.449  1.444   1.00 27.79  ? 4   DC  E O2    1 
ATOM   5057 N  N3    . DC  E 3 4   ? 8.110   70.255  -0.481  1.00 30.46  ? 4   DC  E N3    1 
ATOM   5058 C  C4    . DC  E 3 4   ? 8.877   71.174  -1.069  1.00 29.24  ? 4   DC  E C4    1 
ATOM   5059 N  N4    . DC  E 3 4   ? 9.030   71.103  -2.396  1.00 31.55  ? 4   DC  E N4    1 
ATOM   5060 C  C5    . DC  E 3 4   ? 9.521   72.204  -0.324  1.00 27.72  ? 4   DC  E C5    1 
ATOM   5061 C  C6    . DC  E 3 4   ? 9.332   72.222  1.000   1.00 30.38  ? 4   DC  E C6    1 
ATOM   5062 P  P     . DG  E 3 5   ? 9.337   70.554  7.361   1.00 42.59  ? 5   DG  E P     1 
ATOM   5063 O  OP1   . DG  E 3 5   ? 8.873   71.550  8.353   1.00 43.38  ? 5   DG  E OP1   1 
ATOM   5064 O  OP2   . DG  E 3 5   ? 10.782  70.391  7.084   1.00 45.39  ? 5   DG  E OP2   1 
ATOM   5065 O  "O5'" . DG  E 3 5   ? 8.750   69.119  7.753   1.00 38.47  ? 5   DG  E "O5'" 1 
ATOM   5066 C  "C5'" . DG  E 3 5   ? 7.343   68.933  7.857   1.00 41.25  ? 5   DG  E "C5'" 1 
ATOM   5067 C  "C4'" . DG  E 3 5   ? 6.926   67.594  7.272   1.00 37.67  ? 5   DG  E "C4'" 1 
ATOM   5068 O  "O4'" . DG  E 3 5   ? 7.041   67.638  5.825   1.00 41.88  ? 5   DG  E "O4'" 1 
ATOM   5069 C  "C3'" . DG  E 3 5   ? 7.756   66.396  7.731   1.00 39.30  ? 5   DG  E "C3'" 1 
ATOM   5070 O  "O3'" . DG  E 3 5   ? 6.910   65.271  7.941   1.00 38.99  ? 5   DG  E "O3'" 1 
ATOM   5071 C  "C2'" . DG  E 3 5   ? 8.714   66.167  6.563   1.00 37.37  ? 5   DG  E "C2'" 1 
ATOM   5072 C  "C1'" . DG  E 3 5   ? 7.862   66.582  5.373   1.00 34.69  ? 5   DG  E "C1'" 1 
ATOM   5073 N  N9    . DG  E 3 5   ? 8.646   67.063  4.238   1.00 36.34  ? 5   DG  E N9    1 
ATOM   5074 C  C8    . DG  E 3 5   ? 9.579   68.069  4.246   1.00 34.42  ? 5   DG  E C8    1 
ATOM   5075 N  N7    . DG  E 3 5   ? 10.124  68.285  3.081   1.00 29.31  ? 5   DG  E N7    1 
ATOM   5076 C  C5    . DG  E 3 5   ? 9.511   67.363  2.245   1.00 27.14  ? 5   DG  E C5    1 
ATOM   5077 C  C6    . DG  E 3 5   ? 9.695   67.125  0.861   1.00 27.14  ? 5   DG  E C6    1 
ATOM   5078 O  O6    . DG  E 3 5   ? 10.463  67.701  0.078   1.00 25.70  ? 5   DG  E O6    1 
ATOM   5079 N  N1    . DG  E 3 5   ? 8.874   66.096  0.402   1.00 20.22  ? 5   DG  E N1    1 
ATOM   5080 C  C2    . DG  E 3 5   ? 7.986   65.392  1.181   1.00 29.70  ? 5   DG  E C2    1 
ATOM   5081 N  N2    . DG  E 3 5   ? 7.278   64.437  0.560   1.00 25.18  ? 5   DG  E N2    1 
ATOM   5082 N  N3    . DG  E 3 5   ? 7.805   65.605  2.479   1.00 29.23  ? 5   DG  E N3    1 
ATOM   5083 C  C4    . DG  E 3 5   ? 8.598   66.602  2.941   1.00 28.32  ? 5   DG  E C4    1 
ATOM   5084 P  P     . DG  E 3 6   ? 7.495   63.930  8.606   1.00 47.25  ? 6   DG  E P     1 
ATOM   5085 O  OP1   . DG  E 3 6   ? 6.356   63.198  9.202   1.00 55.88  ? 6   DG  E OP1   1 
ATOM   5086 O  OP2   . DG  E 3 6   ? 8.660   64.307  9.437   1.00 46.59  ? 6   DG  E OP2   1 
ATOM   5087 O  "O5'" . DG  E 3 6   ? 8.029   63.082  7.358   1.00 43.27  ? 6   DG  E "O5'" 1 
ATOM   5088 C  "C5'" . DG  E 3 6   ? 7.114   62.654  6.360   1.00 37.61  ? 6   DG  E "C5'" 1 
ATOM   5089 C  "C4'" . DG  E 3 6   ? 7.842   62.082  5.155   1.00 39.73  ? 6   DG  E "C4'" 1 
ATOM   5090 O  "O4'" . DG  E 3 6   ? 8.507   63.135  4.438   1.00 34.23  ? 6   DG  E "O4'" 1 
ATOM   5091 C  "C3'" . DG  E 3 6   ? 8.933   61.058  5.472   1.00 41.07  ? 6   DG  E "C3'" 1 
ATOM   5092 O  "O3'" . DG  E 3 6   ? 8.450   59.752  5.217   1.00 38.23  ? 6   DG  E "O3'" 1 
ATOM   5093 C  "C2'" . DG  E 3 6   ? 10.095  61.423  4.525   1.00 36.00  ? 6   DG  E "C2'" 1 
ATOM   5094 C  "C1'" . DG  E 3 6   ? 9.517   62.547  3.667   1.00 32.96  ? 6   DG  E "C1'" 1 
ATOM   5095 N  N9    . DG  E 3 6   ? 10.490  63.574  3.309   1.00 31.64  ? 6   DG  E N9    1 
ATOM   5096 C  C8    . DG  E 3 6   ? 11.088  64.479  4.152   1.00 26.83  ? 6   DG  E C8    1 
ATOM   5097 N  N7    . DG  E 3 6   ? 11.917  65.283  3.546   1.00 29.02  ? 6   DG  E N7    1 
ATOM   5098 C  C5    . DG  E 3 6   ? 11.863  64.887  2.214   1.00 26.15  ? 6   DG  E C5    1 
ATOM   5099 C  C6    . DG  E 3 6   ? 12.548  65.393  1.083   1.00 24.57  ? 6   DG  E C6    1 
ATOM   5100 O  O6    . DG  E 3 6   ? 13.364  66.321  1.034   1.00 24.84  ? 6   DG  E O6    1 
ATOM   5101 N  N1    . DG  E 3 6   ? 12.205  64.705  -0.080  1.00 21.00  ? 6   DG  E N1    1 
ATOM   5102 C  C2    . DG  E 3 6   ? 11.312  63.661  -0.140  1.00 25.92  ? 6   DG  E C2    1 
ATOM   5103 N  N2    . DG  E 3 6   ? 11.110  63.122  -1.351  1.00 24.29  ? 6   DG  E N2    1 
ATOM   5104 N  N3    . DG  E 3 6   ? 10.664  63.178  0.913   1.00 27.76  ? 6   DG  E N3    1 
ATOM   5105 C  C4    . DG  E 3 6   ? 10.989  63.837  2.053   1.00 28.04  ? 6   DG  E C4    1 
ATOM   5106 P  P     . DC  E 3 7   ? 9.275   58.470  5.722   1.00 42.53  ? 7   DC  E P     1 
ATOM   5107 O  OP1   . DC  E 3 7   ? 8.306   57.368  5.905   1.00 44.29  ? 7   DC  E OP1   1 
ATOM   5108 O  OP2   . DC  E 3 7   ? 10.133  58.904  6.847   1.00 43.77  ? 7   DC  E OP2   1 
ATOM   5109 O  "O5'" . DC  E 3 7   ? 10.226  58.111  4.487   1.00 42.81  ? 7   DC  E "O5'" 1 
ATOM   5110 C  "C5'" . DC  E 3 7   ? 9.652   57.748  3.240   1.00 34.73  ? 7   DC  E "C5'" 1 
ATOM   5111 C  "C4'" . DC  E 3 7   ? 10.715  57.639  2.161   1.00 37.51  ? 7   DC  E "C4'" 1 
ATOM   5112 O  "O4'" . DC  E 3 7   ? 11.239  58.960  1.847   1.00 28.91  ? 7   DC  E "O4'" 1 
ATOM   5113 C  "C3'" . DC  E 3 7   ? 11.937  56.784  2.526   1.00 34.72  ? 7   DC  E "C3'" 1 
ATOM   5114 O  "O3'" . DC  E 3 7   ? 12.336  56.032  1.397   1.00 38.08  ? 7   DC  E "O3'" 1 
ATOM   5115 C  "C2'" . DC  E 3 7   ? 12.986  57.839  2.856   1.00 35.99  ? 7   DC  E "C2'" 1 
ATOM   5116 C  "C1'" . DC  E 3 7   ? 12.641  58.870  1.801   1.00 32.91  ? 7   DC  E "C1'" 1 
ATOM   5117 N  N1    . DC  E 3 7   ? 13.236  60.213  2.031   1.00 28.50  ? 7   DC  E N1    1 
ATOM   5118 C  C2    . DC  E 3 7   ? 13.716  60.944  0.938   1.00 27.36  ? 7   DC  E C2    1 
ATOM   5119 O  O2    . DC  E 3 7   ? 13.622  60.459  -0.198  1.00 28.30  ? 7   DC  E O2    1 
ATOM   5120 N  N3    . DC  E 3 7   ? 14.262  62.165  1.153   1.00 21.28  ? 7   DC  E N3    1 
ATOM   5121 C  C4    . DC  E 3 7   ? 14.343  62.650  2.391   1.00 28.06  ? 7   DC  E C4    1 
ATOM   5122 N  N4    . DC  E 3 7   ? 14.890  63.859  2.552   1.00 26.44  ? 7   DC  E N4    1 
ATOM   5123 C  C5    . DC  E 3 7   ? 13.864  61.919  3.519   1.00 23.55  ? 7   DC  E C5    1 
ATOM   5124 C  C6    . DC  E 3 7   ? 13.327  60.714  3.295   1.00 25.41  ? 7   DC  E C6    1 
ATOM   5125 P  P     . DC  E 3 8   ? 11.905  54.494  1.234   1.00 38.03  ? 8   DC  E P     1 
ATOM   5126 O  OP1   . DC  E 3 8   ? 10.488  54.374  1.643   1.00 41.54  ? 8   DC  E OP1   1 
ATOM   5127 O  OP2   . DC  E 3 8   ? 12.939  53.663  1.891   1.00 43.61  ? 8   DC  E OP2   1 
ATOM   5128 O  "O5'" . DC  E 3 8   ? 11.999  54.254  -0.344  1.00 42.21  ? 8   DC  E "O5'" 1 
ATOM   5129 C  "C5'" . DC  E 3 8   ? 11.176  55.019  -1.224  1.00 37.25  ? 8   DC  E "C5'" 1 
ATOM   5130 C  "C4'" . DC  E 3 8   ? 11.934  55.422  -2.478  1.00 42.57  ? 8   DC  E "C4'" 1 
ATOM   5131 O  "O4'" . DC  E 3 8   ? 12.721  56.615  -2.215  1.00 34.41  ? 8   DC  E "O4'" 1 
ATOM   5132 C  "C3'" . DC  E 3 8   ? 12.909  54.375  -3.013  1.00 44.28  ? 8   DC  E "C3'" 1 
ATOM   5133 O  "O3'" . DC  E 3 8   ? 12.831  54.321  -4.432  1.00 46.73  ? 8   DC  E "O3'" 1 
ATOM   5134 C  "C2'" . DC  E 3 8   ? 14.267  54.893  -2.543  1.00 38.67  ? 8   DC  E "C2'" 1 
ATOM   5135 C  "C1'" . DC  E 3 8   ? 14.059  56.399  -2.604  1.00 35.82  ? 8   DC  E "C1'" 1 
ATOM   5136 N  N1    . DC  E 3 8   ? 14.941  57.167  -1.675  1.00 35.46  ? 8   DC  E N1    1 
ATOM   5137 C  C2    . DC  E 3 8   ? 15.810  58.139  -2.185  1.00 34.16  ? 8   DC  E C2    1 
ATOM   5138 O  O2    . DC  E 3 8   ? 15.839  58.342  -3.405  1.00 31.53  ? 8   DC  E O2    1 
ATOM   5139 N  N3    . DC  E 3 8   ? 16.599  58.829  -1.324  1.00 31.91  ? 8   DC  E N3    1 
ATOM   5140 C  C4    . DC  E 3 8   ? 16.537  58.583  -0.015  1.00 29.59  ? 8   DC  E C4    1 
ATOM   5141 N  N4    . DC  E 3 8   ? 17.335  59.289  0.793   1.00 28.20  ? 8   DC  E N4    1 
ATOM   5142 C  C5    . DC  E 3 8   ? 15.661  57.598  0.522   1.00 27.30  ? 8   DC  E C5    1 
ATOM   5143 C  C6    . DC  E 3 8   ? 14.886  56.924  -0.334  1.00 35.74  ? 8   DC  E C6    1 
ATOM   5144 P  P     . DG  E 3 9   ? 13.231  52.975  -5.214  1.00 55.43  ? 9   DG  E P     1 
ATOM   5145 O  OP1   . DG  E 3 9   ? 12.465  52.959  -6.481  1.00 52.80  ? 9   DG  E OP1   1 
ATOM   5146 O  OP2   . DG  E 3 9   ? 13.117  51.848  -4.262  1.00 47.52  ? 9   DG  E OP2   1 
ATOM   5147 O  "O5'" . DG  E 3 9   ? 14.779  53.182  -5.559  1.00 43.63  ? 9   DG  E "O5'" 1 
ATOM   5148 C  "C5'" . DG  E 3 9   ? 15.175  54.264  -6.394  1.00 46.08  ? 9   DG  E "C5'" 1 
ATOM   5149 C  "C4'" . DG  E 3 9   ? 16.666  54.530  -6.281  1.00 51.48  ? 9   DG  E "C4'" 1 
ATOM   5150 O  "O4'" . DG  E 3 9   ? 16.963  55.209  -5.028  1.00 50.41  ? 9   DG  E "O4'" 1 
ATOM   5151 C  "C3'" . DG  E 3 9   ? 17.565  53.283  -6.297  1.00 54.85  ? 9   DG  E "C3'" 1 
ATOM   5152 O  "O3'" . DG  E 3 9   ? 18.731  53.565  -7.042  1.00 64.55  ? 9   DG  E "O3'" 1 
ATOM   5153 C  "C2'" . DG  E 3 9   ? 17.910  53.118  -4.823  1.00 49.87  ? 9   DG  E "C2'" 1 
ATOM   5154 C  "C1'" . DG  E 3 9   ? 18.080  54.576  -4.455  1.00 50.94  ? 9   DG  E "C1'" 1 
ATOM   5155 N  N9    . DG  E 3 9   ? 18.122  54.841  -3.023  1.00 42.48  ? 9   DG  E N9    1 
ATOM   5156 C  C8    . DG  E 3 9   ? 17.547  54.100  -2.020  1.00 36.17  ? 9   DG  E C8    1 
ATOM   5157 N  N7    . DG  E 3 9   ? 17.770  54.583  -0.828  1.00 40.19  ? 9   DG  E N7    1 
ATOM   5158 C  C5    . DG  E 3 9   ? 18.549  55.711  -1.059  1.00 35.44  ? 9   DG  E C5    1 
ATOM   5159 C  C6    . DG  E 3 9   ? 19.099  56.643  -0.148  1.00 35.50  ? 9   DG  E C6    1 
ATOM   5160 O  O6    . DG  E 3 9   ? 19.002  56.657  1.087   1.00 34.98  ? 9   DG  E O6    1 
ATOM   5161 N  N1    . DG  E 3 9   ? 19.822  57.638  -0.802  1.00 36.17  ? 9   DG  E N1    1 
ATOM   5162 C  C2    . DG  E 3 9   ? 19.992  57.719  -2.165  1.00 37.31  ? 9   DG  E C2    1 
ATOM   5163 N  N2    . DG  E 3 9   ? 20.723  58.749  -2.614  1.00 34.40  ? 9   DG  E N2    1 
ATOM   5164 N  N3    . DG  E 3 9   ? 19.482  56.852  -3.027  1.00 33.40  ? 9   DG  E N3    1 
ATOM   5165 C  C4    . DG  E 3 9   ? 18.775  55.879  -2.405  1.00 33.39  ? 9   DG  E C4    1 
ATOM   5166 P  P     . DC  E 3 10  ? 19.129  52.673  -8.314  1.00 64.39  ? 10  DC  E P     1 
ATOM   5167 O  OP1   . DC  E 3 10  ? 18.011  52.761  -9.279  1.00 65.47  ? 10  DC  E OP1   1 
ATOM   5168 O  OP2   . DC  E 3 10  ? 19.580  51.351  -7.823  1.00 63.83  ? 10  DC  E OP2   1 
ATOM   5169 O  "O5'" . DC  E 3 10  ? 20.396  53.438  -8.919  1.00 54.39  ? 10  DC  E "O5'" 1 
ATOM   5170 C  "C5'" . DC  E 3 10  ? 20.281  54.806  -9.300  1.00 56.06  ? 10  DC  E "C5'" 1 
ATOM   5171 C  "C4'" . DC  E 3 10  ? 21.359  55.647  -8.638  1.00 59.88  ? 10  DC  E "C4'" 1 
ATOM   5172 O  "O4'" . DC  E 3 10  ? 21.150  55.667  -7.202  1.00 60.70  ? 10  DC  E "O4'" 1 
ATOM   5173 C  "C3'" . DC  E 3 10  ? 22.793  55.151  -8.857  1.00 61.05  ? 10  DC  E "C3'" 1 
ATOM   5174 O  "O3'" . DC  E 3 10  ? 23.617  56.223  -9.298  1.00 68.90  ? 10  DC  E "O3'" 1 
ATOM   5175 C  "C2'" . DC  E 3 10  ? 23.218  54.643  -7.477  1.00 60.05  ? 10  DC  E "C2'" 1 
ATOM   5176 C  "C1'" . DC  E 3 10  ? 22.390  55.524  -6.556  1.00 56.31  ? 10  DC  E "C1'" 1 
ATOM   5177 N  N1    . DC  E 3 10  ? 22.158  54.930  -5.203  1.00 48.77  ? 10  DC  E N1    1 
ATOM   5178 C  C2    . DC  E 3 10  ? 22.578  55.620  -4.061  1.00 43.94  ? 10  DC  E C2    1 
ATOM   5179 O  O2    . DC  E 3 10  ? 23.139  56.715  -4.189  1.00 45.23  ? 10  DC  E O2    1 
ATOM   5180 N  N3    . DC  E 3 10  ? 22.359  55.068  -2.841  1.00 40.36  ? 10  DC  E N3    1 
ATOM   5181 C  C4    . DC  E 3 10  ? 21.751  53.884  -2.743  1.00 44.00  ? 10  DC  E C4    1 
ATOM   5182 N  N4    . DC  E 3 10  ? 21.557  53.380  -1.519  1.00 42.89  ? 10  DC  E N4    1 
ATOM   5183 C  C5    . DC  E 3 10  ? 21.315  53.166  -3.895  1.00 45.49  ? 10  DC  E C5    1 
ATOM   5184 C  C6    . DC  E 3 10  ? 21.535  53.721  -5.092  1.00 51.47  ? 10  DC  E C6    1 
ATOM   5185 P  P     . DC  E 3 11  ? 25.035  55.921  -9.992  1.00 76.99  ? 11  DC  E P     1 
ATOM   5186 O  OP1   . DC  E 3 11  ? 25.372  57.085  -10.840 1.00 69.72  ? 11  DC  E OP1   1 
ATOM   5187 O  OP2   . DC  E 3 11  ? 24.965  54.569  -10.588 1.00 65.61  ? 11  DC  E OP2   1 
ATOM   5188 O  "O5'" . DC  E 3 11  ? 26.063  55.866  -8.766  1.00 67.51  ? 11  DC  E "O5'" 1 
ATOM   5189 C  "C5'" . DC  E 3 11  ? 26.261  57.019  -7.960  1.00 64.93  ? 11  DC  E "C5'" 1 
ATOM   5190 C  "C4'" . DC  E 3 11  ? 27.089  56.696  -6.726  1.00 63.75  ? 11  DC  E "C4'" 1 
ATOM   5191 O  "O4'" . DC  E 3 11  ? 26.272  55.994  -5.748  1.00 62.04  ? 11  DC  E "O4'" 1 
ATOM   5192 C  "C3'" . DC  E 3 11  ? 28.314  55.801  -6.969  1.00 68.32  ? 11  DC  E "C3'" 1 
ATOM   5193 O  "O3'" . DC  E 3 11  ? 29.420  56.293  -6.225  1.00 69.25  ? 11  DC  E "O3'" 1 
ATOM   5194 C  "C2'" . DC  E 3 11  ? 27.855  54.454  -6.420  1.00 62.64  ? 11  DC  E "C2'" 1 
ATOM   5195 C  "C1'" . DC  E 3 11  ? 27.026  54.923  -5.242  1.00 57.98  ? 11  DC  E "C1'" 1 
ATOM   5196 N  N1    . DC  E 3 11  ? 26.115  53.887  -4.682  1.00 52.30  ? 11  DC  E N1    1 
ATOM   5197 C  C2    . DC  E 3 11  ? 25.787  53.923  -3.322  1.00 44.88  ? 11  DC  E C2    1 
ATOM   5198 O  O2    . DC  E 3 11  ? 26.250  54.828  -2.616  1.00 48.44  ? 11  DC  E O2    1 
ATOM   5199 N  N3    . DC  E 3 11  ? 24.966  52.970  -2.819  1.00 42.02  ? 11  DC  E N3    1 
ATOM   5200 C  C4    . DC  E 3 11  ? 24.488  52.013  -3.614  1.00 44.02  ? 11  DC  E C4    1 
ATOM   5201 N  N4    . DC  E 3 11  ? 23.682  51.094  -3.071  1.00 44.45  ? 11  DC  E N4    1 
ATOM   5202 C  C5    . DC  E 3 11  ? 24.816  51.954  -5.001  1.00 48.38  ? 11  DC  E C5    1 
ATOM   5203 C  C6    . DC  E 3 11  ? 25.628  52.900  -5.487  1.00 46.14  ? 11  DC  E C6    1 
ATOM   5204 P  P     . DC  E 3 12  ? 30.519  57.239  -6.915  1.00 75.13  ? 12  DC  E P     1 
ATOM   5205 O  OP1   . DC  E 3 12  ? 29.808  58.339  -7.602  1.00 82.08  ? 12  DC  E OP1   1 
ATOM   5206 O  OP2   . DC  E 3 12  ? 31.447  56.371  -7.675  1.00 68.16  ? 12  DC  E OP2   1 
ATOM   5207 O  "O5'" . DC  E 3 12  ? 31.321  57.845  -5.671  1.00 68.39  ? 12  DC  E "O5'" 1 
ATOM   5208 C  "C5'" . DC  E 3 12  ? 30.613  58.477  -4.606  1.00 70.87  ? 12  DC  E "C5'" 1 
ATOM   5209 C  "C4'" . DC  E 3 12  ? 31.169  58.049  -3.260  1.00 71.00  ? 12  DC  E "C4'" 1 
ATOM   5210 O  "O4'" . DC  E 3 12  ? 30.156  57.313  -2.535  1.00 61.89  ? 12  DC  E "O4'" 1 
ATOM   5211 C  "C3'" . DC  E 3 12  ? 32.348  57.098  -3.336  1.00 73.30  ? 12  DC  E "C3'" 1 
ATOM   5212 O  "O3'" . DC  E 3 12  ? 33.590  57.815  -3.496  1.00 78.63  ? 12  DC  E "O3'" 1 
ATOM   5213 C  "C2'" . DC  E 3 12  ? 32.272  56.353  -2.002  1.00 68.12  ? 12  DC  E "C2'" 1 
ATOM   5214 C  "C1'" . DC  E 3 12  ? 30.767  56.330  -1.713  1.00 62.28  ? 12  DC  E "C1'" 1 
ATOM   5215 N  N1    . DC  E 3 12  ? 30.121  55.003  -1.980  1.00 52.18  ? 12  DC  E N1    1 
ATOM   5216 C  C2    . DC  E 3 12  ? 29.533  54.296  -0.924  1.00 46.74  ? 12  DC  E C2    1 
ATOM   5217 O  O2    . DC  E 3 12  ? 29.551  54.784  0.212   1.00 56.70  ? 12  DC  E O2    1 
ATOM   5218 N  N3    . DC  E 3 12  ? 28.956  53.096  -1.179  1.00 43.99  ? 12  DC  E N3    1 
ATOM   5219 C  C4    . DC  E 3 12  ? 28.956  52.605  -2.419  1.00 42.10  ? 12  DC  E C4    1 
ATOM   5220 N  N4    . DC  E 3 12  ? 28.375  51.418  -2.621  1.00 39.43  ? 12  DC  E N4    1 
ATOM   5221 C  C5    . DC  E 3 12  ? 29.555  53.306  -3.505  1.00 48.81  ? 12  DC  E C5    1 
ATOM   5222 C  C6    . DC  E 3 12  ? 30.119  54.490  -3.244  1.00 52.73  ? 12  DC  E C6    1 
ATOM   5223 P  P     . DT  E 3 13  ? 33.957  59.113  -2.614  1.00 84.98  ? 13  DT  E P     1 
ATOM   5224 O  OP1   . DT  E 3 13  ? 33.341  59.058  -1.271  1.00 77.64  ? 13  DT  E OP1   1 
ATOM   5225 O  OP2   . DT  E 3 13  ? 33.716  60.292  -3.473  1.00 84.61  ? 13  DT  E OP2   1 
ATOM   5226 O  "O5'" . DT  E 3 13  ? 35.536  58.973  -2.404  1.00 83.03  ? 13  DT  E "O5'" 1 
ATOM   5227 C  "C5'" . DT  E 3 13  ? 36.168  57.707  -2.598  1.00 76.05  ? 13  DT  E "C5'" 1 
ATOM   5228 C  "C4'" . DT  E 3 13  ? 36.452  57.027  -1.270  1.00 77.44  ? 13  DT  E "C4'" 1 
ATOM   5229 O  "O4'" . DT  E 3 13  ? 35.532  55.920  -1.085  1.00 73.87  ? 13  DT  E "O4'" 1 
ATOM   5230 C  "C3'" . DT  E 3 13  ? 37.839  56.414  -1.155  1.00 71.27  ? 13  DT  E "C3'" 1 
ATOM   5231 O  "O3'" . DT  E 3 13  ? 38.235  56.362  0.208   1.00 78.77  ? 13  DT  E "O3'" 1 
ATOM   5232 C  "C2'" . DT  E 3 13  ? 37.623  55.019  -1.728  1.00 66.20  ? 13  DT  E "C2'" 1 
ATOM   5233 C  "C1'" . DT  E 3 13  ? 36.221  54.688  -1.223  1.00 65.00  ? 13  DT  E "C1'" 1 
ATOM   5234 N  N1    . DT  E 3 13  ? 35.445  53.817  -2.152  1.00 60.78  ? 13  DT  E N1    1 
ATOM   5235 C  C2    . DT  E 3 13  ? 35.281  52.485  -1.848  1.00 58.80  ? 13  DT  E C2    1 
ATOM   5236 O  O2    . DT  E 3 13  ? 35.740  51.966  -0.845  1.00 58.54  ? 13  DT  E O2    1 
ATOM   5237 N  N3    . DT  E 3 13  ? 34.552  51.775  -2.766  1.00 57.07  ? 13  DT  E N3    1 
ATOM   5238 C  C4    . DT  E 3 13  ? 33.982  52.253  -3.932  1.00 54.87  ? 13  DT  E C4    1 
ATOM   5239 O  O4    . DT  E 3 13  ? 33.344  51.535  -4.694  1.00 56.65  ? 13  DT  E O4    1 
ATOM   5240 C  C5    . DT  E 3 13  ? 34.193  53.658  -4.191  1.00 56.65  ? 13  DT  E C5    1 
ATOM   5241 C  C7    . DT  E 3 13  ? 33.624  54.290  -5.427  1.00 62.58  ? 13  DT  E C7    1 
ATOM   5242 C  C6    . DT  E 3 13  ? 34.907  54.363  -3.299  1.00 60.44  ? 13  DT  E C6    1 
ATOM   5243 O  "O5'" . DG  F 3 1   ? 25.288  46.286  6.876   1.00 45.90  ? 1   DG  F "O5'" 1 
ATOM   5244 C  "C5'" . DG  F 3 1   ? 26.312  47.194  7.272   1.00 47.06  ? 1   DG  F "C5'" 1 
ATOM   5245 C  "C4'" . DG  F 3 1   ? 25.970  48.618  6.863   1.00 52.37  ? 1   DG  F "C4'" 1 
ATOM   5246 O  "O4'" . DG  F 3 1   ? 26.478  48.883  5.525   1.00 50.85  ? 1   DG  F "O4'" 1 
ATOM   5247 C  "C3'" . DG  F 3 1   ? 24.470  48.950  6.798   1.00 54.60  ? 1   DG  F "C3'" 1 
ATOM   5248 O  "O3'" . DG  F 3 1   ? 24.273  50.319  7.130   1.00 61.90  ? 1   DG  F "O3'" 1 
ATOM   5249 C  "C2'" . DG  F 3 1   ? 24.186  48.747  5.320   1.00 52.35  ? 1   DG  F "C2'" 1 
ATOM   5250 C  "C1'" . DG  F 3 1   ? 25.422  49.431  4.774   1.00 50.33  ? 1   DG  F "C1'" 1 
ATOM   5251 N  N9    . DG  F 3 1   ? 25.662  49.233  3.353   1.00 43.57  ? 1   DG  F N9    1 
ATOM   5252 C  C8    . DG  F 3 1   ? 25.195  48.214  2.561   1.00 45.37  ? 1   DG  F C8    1 
ATOM   5253 N  N7    . DG  F 3 1   ? 25.565  48.317  1.316   1.00 41.62  ? 1   DG  F N7    1 
ATOM   5254 C  C5    . DG  F 3 1   ? 26.319  49.485  1.280   1.00 40.07  ? 1   DG  F C5    1 
ATOM   5255 C  C6    . DG  F 3 1   ? 26.983  50.110  0.199   1.00 43.24  ? 1   DG  F C6    1 
ATOM   5256 O  O6    . DG  F 3 1   ? 27.037  49.742  -0.983  1.00 49.12  ? 1   DG  F O6    1 
ATOM   5257 N  N1    . DG  F 3 1   ? 27.633  51.278  0.598   1.00 41.03  ? 1   DG  F N1    1 
ATOM   5258 C  C2    . DG  F 3 1   ? 27.636  51.776  1.880   1.00 41.44  ? 1   DG  F C2    1 
ATOM   5259 N  N2    . DG  F 3 1   ? 28.316  52.915  2.075   1.00 41.13  ? 1   DG  F N2    1 
ATOM   5260 N  N3    . DG  F 3 1   ? 27.018  51.197  2.900   1.00 39.63  ? 1   DG  F N3    1 
ATOM   5261 C  C4    . DG  F 3 1   ? 26.383  50.060  2.526   1.00 39.89  ? 1   DG  F C4    1 
ATOM   5262 P  P     . DG  F 3 2   ? 24.097  50.806  8.651   1.00 50.00  ? 2   DG  F P     1 
ATOM   5263 O  OP1   . DG  F 3 2   ? 25.167  50.201  9.473   1.00 57.11  ? 2   DG  F OP1   1 
ATOM   5264 O  OP2   . DG  F 3 2   ? 22.683  50.600  9.030   1.00 39.22  ? 2   DG  F OP2   1 
ATOM   5265 O  "O5'" . DG  F 3 2   ? 24.381  52.379  8.562   1.00 38.51  ? 2   DG  F "O5'" 1 
ATOM   5266 C  "C5'" . DG  F 3 2   ? 25.718  52.846  8.373   1.00 39.31  ? 2   DG  F "C5'" 1 
ATOM   5267 C  "C4'" . DG  F 3 2   ? 25.830  53.785  7.175   1.00 44.14  ? 2   DG  F "C4'" 1 
ATOM   5268 O  "O4'" . DG  F 3 2   ? 25.612  53.059  5.934   1.00 50.69  ? 2   DG  F "O4'" 1 
ATOM   5269 C  "C3'" . DG  F 3 2   ? 24.842  54.963  7.144   1.00 53.27  ? 2   DG  F "C3'" 1 
ATOM   5270 O  "O3'" . DG  F 3 2   ? 25.532  56.137  6.746   1.00 56.11  ? 2   DG  F "O3'" 1 
ATOM   5271 C  "C2'" . DG  F 3 2   ? 23.854  54.535  6.060   1.00 47.86  ? 2   DG  F "C2'" 1 
ATOM   5272 C  "C1'" . DG  F 3 2   ? 24.824  53.875  5.104   1.00 51.23  ? 2   DG  F "C1'" 1 
ATOM   5273 N  N9    . DG  F 3 2   ? 24.213  53.064  4.053   1.00 43.39  ? 2   DG  F N9    1 
ATOM   5274 C  C8    . DG  F 3 2   ? 23.319  52.032  4.204   1.00 50.16  ? 2   DG  F C8    1 
ATOM   5275 N  N7    . DG  F 3 2   ? 22.957  51.491  3.071   1.00 38.57  ? 2   DG  F N7    1 
ATOM   5276 C  C5    . DG  F 3 2   ? 23.660  52.211  2.111   1.00 40.33  ? 2   DG  F C5    1 
ATOM   5277 C  C6    . DG  F 3 2   ? 23.676  52.082  0.700   1.00 40.84  ? 2   DG  F C6    1 
ATOM   5278 O  O6    . DG  F 3 2   ? 23.051  51.279  -0.005  1.00 39.09  ? 2   DG  F O6    1 
ATOM   5279 N  N1    . DG  F 3 2   ? 24.526  53.014  0.107   1.00 37.24  ? 2   DG  F N1    1 
ATOM   5280 C  C2    . DG  F 3 2   ? 25.266  53.949  0.790   1.00 39.50  ? 2   DG  F C2    1 
ATOM   5281 N  N2    . DG  F 3 2   ? 26.029  54.764  0.046   1.00 37.08  ? 2   DG  F N2    1 
ATOM   5282 N  N3    . DG  F 3 2   ? 25.260  54.079  2.109   1.00 38.84  ? 2   DG  F N3    1 
ATOM   5283 C  C4    . DG  F 3 2   ? 24.437  53.180  2.701   1.00 40.31  ? 2   DG  F C4    1 
ATOM   5284 P  P     . DG  F 3 3   ? 25.789  57.331  7.787   1.00 54.78  ? 3   DG  F P     1 
ATOM   5285 O  OP1   . DG  F 3 3   ? 27.094  57.078  8.438   1.00 65.21  ? 3   DG  F OP1   1 
ATOM   5286 O  OP2   . DG  F 3 3   ? 24.570  57.485  8.611   1.00 57.34  ? 3   DG  F OP2   1 
ATOM   5287 O  "O5'" . DG  F 3 3   ? 25.943  58.621  6.852   1.00 52.09  ? 3   DG  F "O5'" 1 
ATOM   5288 C  "C5'" . DG  F 3 3   ? 27.226  58.985  6.354   1.00 56.10  ? 3   DG  F "C5'" 1 
ATOM   5289 C  "C4'" . DG  F 3 3   ? 27.129  59.590  4.962   1.00 60.42  ? 3   DG  F "C4'" 1 
ATOM   5290 O  "O4'" . DG  F 3 3   ? 26.530  58.632  4.049   1.00 60.30  ? 3   DG  F "O4'" 1 
ATOM   5291 C  "C3'" . DG  F 3 3   ? 26.286  60.862  4.852   1.00 60.68  ? 3   DG  F "C3'" 1 
ATOM   5292 O  "O3'" . DG  F 3 3   ? 26.910  61.770  3.950   1.00 65.80  ? 3   DG  F "O3'" 1 
ATOM   5293 C  "C2'" . DG  F 3 3   ? 24.961  60.345  4.296   1.00 51.26  ? 3   DG  F "C2'" 1 
ATOM   5294 C  "C1'" . DG  F 3 3   ? 25.444  59.233  3.378   1.00 49.74  ? 3   DG  F "C1'" 1 
ATOM   5295 N  N9    . DG  F 3 3   ? 24.440  58.204  3.114   1.00 43.12  ? 3   DG  F N9    1 
ATOM   5296 C  C8    . DG  F 3 3   ? 23.740  57.472  4.042   1.00 42.09  ? 3   DG  F C8    1 
ATOM   5297 N  N7    . DG  F 3 3   ? 22.912  56.615  3.511   1.00 40.83  ? 3   DG  F N7    1 
ATOM   5298 C  C5    . DG  F 3 3   ? 23.078  56.786  2.142   1.00 41.99  ? 3   DG  F C5    1 
ATOM   5299 C  C6    . DG  F 3 3   ? 22.448  56.131  1.058   1.00 40.02  ? 3   DG  F C6    1 
ATOM   5300 O  O6    . DG  F 3 3   ? 21.589  55.239  1.094   1.00 39.93  ? 3   DG  F O6    1 
ATOM   5301 N  N1    . DG  F 3 3   ? 22.907  56.606  -0.169  1.00 35.72  ? 3   DG  F N1    1 
ATOM   5302 C  C2    . DG  F 3 3   ? 23.854  57.589  -0.326  1.00 34.34  ? 3   DG  F C2    1 
ATOM   5303 N  N2    . DG  F 3 3   ? 24.170  57.915  -1.588  1.00 35.89  ? 3   DG  F N2    1 
ATOM   5304 N  N3    . DG  F 3 3   ? 24.452  58.210  0.682   1.00 42.88  ? 3   DG  F N3    1 
ATOM   5305 C  C4    . DG  F 3 3   ? 24.017  57.759  1.882   1.00 41.15  ? 3   DG  F C4    1 
ATOM   5306 P  P     . DC  F 3 4   ? 26.569  63.340  4.003   1.00 65.63  ? 4   DC  F P     1 
ATOM   5307 O  OP1   . DC  F 3 4   ? 27.853  64.074  3.958   1.00 69.82  ? 4   DC  F OP1   1 
ATOM   5308 O  OP2   . DC  F 3 4   ? 25.625  63.564  5.119   1.00 61.60  ? 4   DC  F OP2   1 
ATOM   5309 O  "O5'" . DC  F 3 4   ? 25.797  63.611  2.629   1.00 67.00  ? 4   DC  F "O5'" 1 
ATOM   5310 C  "C5'" . DC  F 3 4   ? 26.492  63.487  1.394   1.00 57.95  ? 4   DC  F "C5'" 1 
ATOM   5311 C  "C4'" . DC  F 3 4   ? 25.523  63.374  0.230   1.00 54.35  ? 4   DC  F "C4'" 1 
ATOM   5312 O  "O4'" . DC  F 3 4   ? 24.740  62.154  0.354   1.00 50.40  ? 4   DC  F "O4'" 1 
ATOM   5313 C  "C3'" . DC  F 3 4   ? 24.506  64.515  0.110   1.00 44.98  ? 4   DC  F "C3'" 1 
ATOM   5314 O  "O3'" . DC  F 3 4   ? 24.346  64.865  -1.253  1.00 49.61  ? 4   DC  F "O3'" 1 
ATOM   5315 C  "C2'" . DC  F 3 4   ? 23.231  63.887  0.662   1.00 43.46  ? 4   DC  F "C2'" 1 
ATOM   5316 C  "C1'" . DC  F 3 4   ? 23.384  62.470  0.145   1.00 46.38  ? 4   DC  F "C1'" 1 
ATOM   5317 N  N1    . DC  F 3 4   ? 22.536  61.473  0.850   1.00 39.26  ? 4   DC  F N1    1 
ATOM   5318 C  C2    . DC  F 3 4   ? 21.868  60.492  0.110   1.00 38.52  ? 4   DC  F C2    1 
ATOM   5319 O  O2    . DC  F 3 4   ? 22.002  60.468  -1.119  1.00 41.36  ? 4   DC  F O2    1 
ATOM   5320 N  N3    . DC  F 3 4   ? 21.095  59.591  0.763   1.00 36.15  ? 4   DC  F N3    1 
ATOM   5321 C  C4    . DC  F 3 4   ? 20.977  59.651  2.090   1.00 36.89  ? 4   DC  F C4    1 
ATOM   5322 N  N4    . DC  F 3 4   ? 20.202  58.741  2.691   1.00 36.14  ? 4   DC  F N4    1 
ATOM   5323 C  C5    . DC  F 3 4   ? 21.647  60.647  2.861   1.00 34.67  ? 4   DC  F C5    1 
ATOM   5324 C  C6    . DC  F 3 4   ? 22.407  61.530  2.206   1.00 35.20  ? 4   DC  F C6    1 
ATOM   5325 P  P     . DG  F 3 5   ? 24.573  66.377  -1.740  1.00 60.06  ? 5   DG  F P     1 
ATOM   5326 O  OP1   . DG  F 3 5   ? 26.003  66.699  -1.543  1.00 70.63  ? 5   DG  F OP1   1 
ATOM   5327 O  OP2   . DG  F 3 5   ? 23.534  67.221  -1.109  1.00 62.79  ? 5   DG  F OP2   1 
ATOM   5328 O  "O5'" . DG  F 3 5   ? 24.270  66.313  -3.308  1.00 57.62  ? 5   DG  F "O5'" 1 
ATOM   5329 C  "C5'" . DG  F 3 5   ? 24.874  65.301  -4.103  1.00 53.55  ? 5   DG  F "C5'" 1 
ATOM   5330 C  "C4'" . DG  F 3 5   ? 23.858  64.669  -5.036  1.00 49.10  ? 5   DG  F "C4'" 1 
ATOM   5331 O  "O4'" . DG  F 3 5   ? 23.043  63.718  -4.302  1.00 53.19  ? 5   DG  F "O4'" 1 
ATOM   5332 C  "C3'" . DG  F 3 5   ? 22.889  65.651  -5.693  1.00 50.05  ? 5   DG  F "C3'" 1 
ATOM   5333 O  "O3'" . DG  F 3 5   ? 22.736  65.331  -7.065  1.00 57.50  ? 5   DG  F "O3'" 1 
ATOM   5334 C  "C2'" . DG  F 3 5   ? 21.588  65.444  -4.918  1.00 45.64  ? 5   DG  F "C2'" 1 
ATOM   5335 C  "C1'" . DG  F 3 5   ? 21.678  63.975  -4.536  1.00 46.85  ? 5   DG  F "C1'" 1 
ATOM   5336 N  N9    . DG  F 3 5   ? 20.936  63.650  -3.321  1.00 38.83  ? 5   DG  F N9    1 
ATOM   5337 C  C8    . DG  F 3 5   ? 21.053  64.261  -2.097  1.00 41.47  ? 5   DG  F C8    1 
ATOM   5338 N  N7    . DG  F 3 5   ? 20.262  63.763  -1.189  1.00 38.41  ? 5   DG  F N7    1 
ATOM   5339 C  C5    . DG  F 3 5   ? 19.576  62.754  -1.851  1.00 31.83  ? 5   DG  F C5    1 
ATOM   5340 C  C6    . DG  F 3 5   ? 18.585  61.863  -1.376  1.00 31.79  ? 5   DG  F C6    1 
ATOM   5341 O  O6    . DG  F 3 5   ? 18.102  61.790  -0.237  1.00 34.23  ? 5   DG  F O6    1 
ATOM   5342 N  N1    . DG  F 3 5   ? 18.151  60.996  -2.374  1.00 32.28  ? 5   DG  F N1    1 
ATOM   5343 C  C2    . DG  F 3 5   ? 18.615  60.990  -3.668  1.00 32.33  ? 5   DG  F C2    1 
ATOM   5344 N  N2    . DG  F 3 5   ? 18.075  60.077  -4.488  1.00 29.69  ? 5   DG  F N2    1 
ATOM   5345 N  N3    . DG  F 3 5   ? 19.545  61.819  -4.127  1.00 34.63  ? 5   DG  F N3    1 
ATOM   5346 C  C4    . DG  F 3 5   ? 19.979  62.670  -3.166  1.00 34.58  ? 5   DG  F C4    1 
ATOM   5347 P  P     . DG  F 3 6   ? 22.024  66.369  -8.064  1.00 59.40  ? 6   DG  F P     1 
ATOM   5348 O  OP1   . DG  F 3 6   ? 22.547  66.094  -9.420  1.00 65.18  ? 6   DG  F OP1   1 
ATOM   5349 O  OP2   . DG  F 3 6   ? 22.136  67.722  -7.474  1.00 57.49  ? 6   DG  F OP2   1 
ATOM   5350 O  "O5'" . DG  F 3 6   ? 20.486  65.941  -8.025  1.00 52.56  ? 6   DG  F "O5'" 1 
ATOM   5351 C  "C5'" . DG  F 3 6   ? 20.129  64.594  -8.283  1.00 41.05  ? 6   DG  F "C5'" 1 
ATOM   5352 C  "C4'" . DG  F 3 6   ? 18.717  64.305  -7.810  1.00 47.03  ? 6   DG  F "C4'" 1 
ATOM   5353 O  "O4'" . DG  F 3 6   ? 18.692  64.191  -6.377  1.00 36.54  ? 6   DG  F "O4'" 1 
ATOM   5354 C  "C3'" . DG  F 3 6   ? 17.686  65.381  -8.147  1.00 33.56  ? 6   DG  F "C3'" 1 
ATOM   5355 O  "O3'" . DG  F 3 6   ? 16.895  64.955  -9.242  1.00 35.08  ? 6   DG  F "O3'" 1 
ATOM   5356 C  "C2'" . DG  F 3 6   ? 16.843  65.525  -6.862  1.00 32.94  ? 6   DG  F "C2'" 1 
ATOM   5357 C  "C1'" . DG  F 3 6   ? 17.374  64.408  -5.966  1.00 33.71  ? 6   DG  F "C1'" 1 
ATOM   5358 N  N9    . DG  F 3 6   ? 17.369  64.737  -4.542  1.00 32.90  ? 6   DG  F N9    1 
ATOM   5359 C  C8    . DG  F 3 6   ? 18.064  65.744  -3.918  1.00 32.66  ? 6   DG  F C8    1 
ATOM   5360 N  N7    . DG  F 3 6   ? 17.861  65.792  -2.630  1.00 29.59  ? 6   DG  F N7    1 
ATOM   5361 C  C5    . DG  F 3 6   ? 16.977  64.748  -2.386  1.00 27.52  ? 6   DG  F C5    1 
ATOM   5362 C  C6    . DG  F 3 6   ? 16.394  64.308  -1.171  1.00 28.18  ? 6   DG  F C6    1 
ATOM   5363 O  O6    . DG  F 3 6   ? 16.550  64.771  -0.032  1.00 27.90  ? 6   DG  F O6    1 
ATOM   5364 N  N1    . DG  F 3 6   ? 15.553  63.213  -1.370  1.00 23.33  ? 6   DG  F N1    1 
ATOM   5365 C  C2    . DG  F 3 6   ? 15.308  62.623  -2.588  1.00 26.21  ? 6   DG  F C2    1 
ATOM   5366 N  N2    . DG  F 3 6   ? 14.467  61.580  -2.585  1.00 23.15  ? 6   DG  F N2    1 
ATOM   5367 N  N3    . DG  F 3 6   ? 15.846  63.028  -3.729  1.00 31.29  ? 6   DG  F N3    1 
ATOM   5368 C  C4    . DG  F 3 6   ? 16.667  64.090  -3.553  1.00 24.95  ? 6   DG  F C4    1 
ATOM   5369 P  P     . DC  F 3 7   ? 15.874  65.973  -9.948  1.00 36.18  ? 7   DC  F P     1 
ATOM   5370 O  OP1   . DC  F 3 7   ? 15.709  65.527  -11.350 1.00 41.75  ? 7   DC  F OP1   1 
ATOM   5371 O  OP2   . DC  F 3 7   ? 16.348  67.343  -9.650  1.00 30.83  ? 7   DC  F OP2   1 
ATOM   5372 O  "O5'" . DC  F 3 7   ? 14.494  65.735  -9.172  1.00 33.33  ? 7   DC  F "O5'" 1 
ATOM   5373 C  "C5'" . DC  F 3 7   ? 13.975  64.415  -9.042  1.00 33.57  ? 7   DC  F "C5'" 1 
ATOM   5374 C  "C4'" . DC  F 3 7   ? 12.836  64.371  -8.037  1.00 35.52  ? 7   DC  F "C4'" 1 
ATOM   5375 O  "O4'" . DC  F 3 7   ? 13.358  64.475  -6.682  1.00 28.75  ? 7   DC  F "O4'" 1 
ATOM   5376 C  "C3'" . DC  F 3 7   ? 11.797  65.497  -8.169  1.00 31.50  ? 7   DC  F "C3'" 1 
ATOM   5377 O  "O3'" . DC  F 3 7   ? 10.503  64.965  -7.984  1.00 34.35  ? 7   DC  F "O3'" 1 
ATOM   5378 C  "C2'" . DC  F 3 7   ? 12.161  66.415  -7.007  1.00 30.68  ? 7   DC  F "C2'" 1 
ATOM   5379 C  "C1'" . DC  F 3 7   ? 12.535  65.370  -5.979  1.00 31.86  ? 7   DC  F "C1'" 1 
ATOM   5380 N  N1    . DC  F 3 7   ? 13.255  65.899  -4.787  1.00 27.85  ? 7   DC  F N1    1 
ATOM   5381 C  C2    . DC  F 3 7   ? 12.975  65.357  -3.527  1.00 25.41  ? 7   DC  F C2    1 
ATOM   5382 O  O2    . DC  F 3 7   ? 12.147  64.441  -3.438  1.00 25.73  ? 7   DC  F O2    1 
ATOM   5383 N  N3    . DC  F 3 7   ? 13.622  65.845  -2.443  1.00 20.78  ? 7   DC  F N3    1 
ATOM   5384 C  C4    . DC  F 3 7   ? 14.503  66.832  -2.581  1.00 29.47  ? 7   DC  F C4    1 
ATOM   5385 N  N4    . DC  F 3 7   ? 15.116  67.279  -1.480  1.00 23.98  ? 7   DC  F N4    1 
ATOM   5386 C  C5    . DC  F 3 7   ? 14.800  67.403  -3.857  1.00 28.04  ? 7   DC  F C5    1 
ATOM   5387 C  C6    . DC  F 3 7   ? 14.154  66.914  -4.922  1.00 23.71  ? 7   DC  F C6    1 
ATOM   5388 P  P     . DC  F 3 8   ? 9.554   64.650  -9.239  1.00 36.27  ? 8   DC  F P     1 
ATOM   5389 O  OP1   . DC  F 3 8   ? 10.381  64.003  -10.280 1.00 37.74  ? 8   DC  F OP1   1 
ATOM   5390 O  OP2   . DC  F 3 8   ? 8.790   65.878  -9.545  1.00 42.62  ? 8   DC  F OP2   1 
ATOM   5391 O  "O5'" . DC  F 3 8   ? 8.516   63.582  -8.658  1.00 38.09  ? 8   DC  F "O5'" 1 
ATOM   5392 C  "C5'" . DC  F 3 8   ? 8.988   62.341  -8.153  1.00 36.90  ? 8   DC  F "C5'" 1 
ATOM   5393 C  "C4'" . DC  F 3 8   ? 8.199   61.916  -6.927  1.00 33.47  ? 8   DC  F "C4'" 1 
ATOM   5394 O  "O4'" . DC  F 3 8   ? 8.751   62.553  -5.746  1.00 38.79  ? 8   DC  F "O4'" 1 
ATOM   5395 C  "C3'" . DC  F 3 8   ? 6.714   62.275  -6.951  1.00 32.17  ? 8   DC  F "C3'" 1 
ATOM   5396 O  "O3'" . DC  F 3 8   ? 5.955   61.203  -6.415  1.00 35.85  ? 8   DC  F "O3'" 1 
ATOM   5397 C  "C2'" . DC  F 3 8   ? 6.642   63.511  -6.058  1.00 35.54  ? 8   DC  F "C2'" 1 
ATOM   5398 C  "C1'" . DC  F 3 8   ? 7.726   63.213  -5.036  1.00 35.27  ? 8   DC  F "C1'" 1 
ATOM   5399 N  N1    . DC  F 3 8   ? 8.307   64.432  -4.413  1.00 33.96  ? 8   DC  F N1    1 
ATOM   5400 C  C2    . DC  F 3 8   ? 8.226   64.613  -3.028  1.00 28.98  ? 8   DC  F C2    1 
ATOM   5401 O  O2    . DC  F 3 8   ? 7.663   63.755  -2.339  1.00 29.77  ? 8   DC  F O2    1 
ATOM   5402 N  N3    . DC  F 3 8   ? 8.768   65.729  -2.480  1.00 25.33  ? 8   DC  F N3    1 
ATOM   5403 C  C4    . DC  F 3 8   ? 9.370   66.631  -3.258  1.00 26.67  ? 8   DC  F C4    1 
ATOM   5404 N  N4    . DC  F 3 8   ? 9.890   67.715  -2.673  1.00 22.29  ? 8   DC  F N4    1 
ATOM   5405 C  C5    . DC  F 3 8   ? 9.459   66.464  -4.671  1.00 27.64  ? 8   DC  F C5    1 
ATOM   5406 C  C6    . DC  F 3 8   ? 8.923   65.360  -5.199  1.00 30.76  ? 8   DC  F C6    1 
ATOM   5407 P  P     . DG  F 3 9   ? 4.423   60.998  -6.853  1.00 39.65  ? 9   DG  F P     1 
ATOM   5408 O  OP1   . DG  F 3 9   ? 4.093   59.574  -6.631  1.00 39.51  ? 9   DG  F OP1   1 
ATOM   5409 O  OP2   . DG  F 3 9   ? 4.248   61.609  -8.190  1.00 40.41  ? 9   DG  F OP2   1 
ATOM   5410 O  "O5'" . DG  F 3 9   ? 3.600   61.874  -5.799  1.00 37.98  ? 9   DG  F "O5'" 1 
ATOM   5411 C  "C5'" . DG  F 3 9   ? 3.618   61.520  -4.425  1.00 37.32  ? 9   DG  F "C5'" 1 
ATOM   5412 C  "C4'" . DG  F 3 9   ? 3.086   62.651  -3.562  1.00 37.00  ? 9   DG  F "C4'" 1 
ATOM   5413 O  "O4'" . DG  F 3 9   ? 4.097   63.690  -3.426  1.00 28.99  ? 9   DG  F "O4'" 1 
ATOM   5414 C  "C3'" . DG  F 3 9   ? 1.835   63.360  -4.105  1.00 33.96  ? 9   DG  F "C3'" 1 
ATOM   5415 O  "O3'" . DG  F 3 9   ? 0.966   63.675  -3.028  1.00 40.50  ? 9   DG  F "O3'" 1 
ATOM   5416 C  "C2'" . DG  F 3 9   ? 2.422   64.635  -4.696  1.00 33.92  ? 9   DG  F "C2'" 1 
ATOM   5417 C  "C1'" . DG  F 3 9   ? 3.466   64.927  -3.640  1.00 32.89  ? 9   DG  F "C1'" 1 
ATOM   5418 N  N9    . DG  F 3 9   ? 4.450   65.935  -4.016  1.00 33.02  ? 9   DG  F N9    1 
ATOM   5419 C  C8    . DG  F 3 9   ? 4.841   66.290  -5.284  1.00 28.98  ? 9   DG  F C8    1 
ATOM   5420 N  N7    . DG  F 3 9   ? 5.731   67.245  -5.303  1.00 31.39  ? 9   DG  F N7    1 
ATOM   5421 C  C5    . DG  F 3 9   ? 5.934   67.547  -3.961  1.00 26.80  ? 9   DG  F C5    1 
ATOM   5422 C  C6    . DG  F 3 9   ? 6.786   68.503  -3.358  1.00 27.72  ? 9   DG  F C6    1 
ATOM   5423 O  O6    . DG  F 3 9   ? 7.560   69.297  -3.909  1.00 27.18  ? 9   DG  F O6    1 
ATOM   5424 N  N1    . DG  F 3 9   ? 6.684   68.480  -1.968  1.00 31.49  ? 9   DG  F N1    1 
ATOM   5425 C  C2    . DG  F 3 9   ? 5.862   67.641  -1.253  1.00 28.82  ? 9   DG  F C2    1 
ATOM   5426 N  N2    . DG  F 3 9   ? 5.898   67.764  0.081   1.00 29.41  ? 9   DG  F N2    1 
ATOM   5427 N  N3    . DG  F 3 9   ? 5.060   66.743  -1.807  1.00 28.71  ? 9   DG  F N3    1 
ATOM   5428 C  C4    . DG  F 3 9   ? 5.148   66.752  -3.159  1.00 29.76  ? 9   DG  F C4    1 
ATOM   5429 P  P     . DC  F 3 10  ? -0.246  62.699  -2.630  1.00 41.97  ? 10  DC  F P     1 
ATOM   5430 O  OP1   . DC  F 3 10  ? 0.252   61.307  -2.690  1.00 41.84  ? 10  DC  F OP1   1 
ATOM   5431 O  OP2   . DC  F 3 10  ? -1.424  63.104  -3.426  1.00 45.12  ? 10  DC  F OP2   1 
ATOM   5432 O  "O5'" . DC  F 3 10  ? -0.541  63.070  -1.100  1.00 39.54  ? 10  DC  F "O5'" 1 
ATOM   5433 C  "C5'" . DC  F 3 10  ? 0.371   62.668  -0.083  1.00 35.55  ? 10  DC  F "C5'" 1 
ATOM   5434 C  "C4'" . DC  F 3 10  ? 0.561   63.768  0.948   1.00 34.60  ? 10  DC  F "C4'" 1 
ATOM   5435 O  "O4'" . DC  F 3 10  ? 1.440   64.792  0.414   1.00 29.65  ? 10  DC  F "O4'" 1 
ATOM   5436 C  "C3'" . DC  F 3 10  ? -0.719  64.485  1.382   1.00 31.61  ? 10  DC  F "C3'" 1 
ATOM   5437 O  "O3'" . DC  F 3 10  ? -0.704  64.680  2.786   1.00 36.99  ? 10  DC  F "O3'" 1 
ATOM   5438 C  "C2'" . DC  F 3 10  ? -0.650  65.813  0.630   1.00 35.31  ? 10  DC  F "C2'" 1 
ATOM   5439 C  "C1'" . DC  F 3 10  ? 0.849   66.060  0.586   1.00 30.88  ? 10  DC  F "C1'" 1 
ATOM   5440 N  N1    . DC  F 3 10  ? 1.279   66.930  -0.541  1.00 34.33  ? 10  DC  F N1    1 
ATOM   5441 C  C2    . DC  F 3 10  ? 2.147   68.001  -0.298  1.00 33.04  ? 10  DC  F C2    1 
ATOM   5442 O  O2    . DC  F 3 10  ? 2.541   68.209  0.855   1.00 30.87  ? 10  DC  F O2    1 
ATOM   5443 N  N3    . DC  F 3 10  ? 2.531   68.782  -1.338  1.00 33.68  ? 10  DC  F N3    1 
ATOM   5444 C  C4    . DC  F 3 10  ? 2.083   68.523  -2.567  1.00 35.67  ? 10  DC  F C4    1 
ATOM   5445 N  N4    . DC  F 3 10  ? 2.489   69.319  -3.560  1.00 32.07  ? 10  DC  F N4    1 
ATOM   5446 C  C5    . DC  F 3 10  ? 1.198   67.438  -2.833  1.00 34.17  ? 10  DC  F C5    1 
ATOM   5447 C  C6    . DC  F 3 10  ? 0.827   66.674  -1.802  1.00 34.01  ? 10  DC  F C6    1 
ATOM   5448 P  P     . DC  F 3 11  ? -2.068  64.980  3.579   1.00 37.31  ? 11  DC  F P     1 
ATOM   5449 O  OP1   . DC  F 3 11  ? -1.894  64.488  4.962   1.00 38.98  ? 11  DC  F OP1   1 
ATOM   5450 O  OP2   . DC  F 3 11  ? -3.198  64.488  2.760   1.00 39.68  ? 11  DC  F OP2   1 
ATOM   5451 O  "O5'" . DC  F 3 11  ? -2.140  66.573  3.612   1.00 38.98  ? 11  DC  F "O5'" 1 
ATOM   5452 C  "C5'" . DC  F 3 11  ? -1.098  67.309  4.229   1.00 31.97  ? 11  DC  F "C5'" 1 
ATOM   5453 C  "C4'" . DC  F 3 11  ? -1.247  68.790  3.946   1.00 37.03  ? 11  DC  F "C4'" 1 
ATOM   5454 O  "O4'" . DC  F 3 11  ? -0.787  69.085  2.599   1.00 33.49  ? 11  DC  F "O4'" 1 
ATOM   5455 C  "C3'" . DC  F 3 11  ? -2.681  69.324  4.027   1.00 35.33  ? 11  DC  F "C3'" 1 
ATOM   5456 O  "O3'" . DC  F 3 11  ? -2.685  70.568  4.704   1.00 39.68  ? 11  DC  F "O3'" 1 
ATOM   5457 C  "C2'" . DC  F 3 11  ? -3.065  69.496  2.560   1.00 31.12  ? 11  DC  F "C2'" 1 
ATOM   5458 C  "C1'" . DC  F 3 11  ? -1.730  69.924  1.982   1.00 33.25  ? 11  DC  F "C1'" 1 
ATOM   5459 N  N1    . DC  F 3 11  ? -1.625  69.770  0.507   1.00 31.14  ? 11  DC  F N1    1 
ATOM   5460 C  C2    . DC  F 3 11  ? -0.765  70.607  -0.207  1.00 29.52  ? 11  DC  F C2    1 
ATOM   5461 O  O2    . DC  F 3 11  ? -0.105  71.455  0.406   1.00 35.14  ? 11  DC  F O2    1 
ATOM   5462 N  N3    . DC  F 3 11  ? -0.676  70.466  -1.552  1.00 29.35  ? 11  DC  F N3    1 
ATOM   5463 C  C4    . DC  F 3 11  ? -1.403  69.540  -2.175  1.00 32.91  ? 11  DC  F C4    1 
ATOM   5464 N  N4    . DC  F 3 11  ? -1.280  69.439  -3.502  1.00 29.53  ? 11  DC  F N4    1 
ATOM   5465 C  C5    . DC  F 3 11  ? -2.289  68.675  -1.464  1.00 29.92  ? 11  DC  F C5    1 
ATOM   5466 C  C6    . DC  F 3 11  ? -2.370  68.826  -0.137  1.00 32.26  ? 11  DC  F C6    1 
ATOM   5467 P  P     . DC  F 3 12  ? -3.936  70.990  5.617   1.00 38.66  ? 12  DC  F P     1 
ATOM   5468 O  OP1   . DC  F 3 12  ? -3.858  70.206  6.869   1.00 34.97  ? 12  DC  F OP1   1 
ATOM   5469 O  OP2   . DC  F 3 12  ? -5.150  70.912  4.773   1.00 32.62  ? 12  DC  F OP2   1 
ATOM   5470 O  "O5'" . DC  F 3 12  ? -3.661  72.532  5.942   1.00 35.54  ? 12  DC  F "O5'" 1 
ATOM   5471 C  "C5'" . DC  F 3 12  ? -2.378  72.938  6.406   1.00 35.40  ? 12  DC  F "C5'" 1 
ATOM   5472 C  "C4'" . DC  F 3 12  ? -1.818  74.064  5.552   1.00 35.83  ? 12  DC  F "C4'" 1 
ATOM   5473 O  "O4'" . DC  F 3 12  ? -1.701  73.625  4.170   1.00 34.34  ? 12  DC  F "O4'" 1 
ATOM   5474 C  "C3'" . DC  F 3 12  ? -2.663  75.340  5.514   1.00 34.57  ? 12  DC  F "C3'" 1 
ATOM   5475 O  "O3'" . DC  F 3 12  ? -1.809  76.468  5.497   1.00 45.95  ? 12  DC  F "O3'" 1 
ATOM   5476 C  "C2'" . DC  F 3 12  ? -3.405  75.204  4.187   1.00 33.30  ? 12  DC  F "C2'" 1 
ATOM   5477 C  "C1'" . DC  F 3 12  ? -2.316  74.579  3.334   1.00 25.47  ? 12  DC  F "C1'" 1 
ATOM   5478 N  N1    . DC  F 3 12  ? -2.820  73.895  2.114   1.00 30.88  ? 12  DC  F N1    1 
ATOM   5479 C  C2    . DC  F 3 12  ? -2.238  74.180  0.873   1.00 32.31  ? 12  DC  F C2    1 
ATOM   5480 O  O2    . DC  F 3 12  ? -1.314  75.001  0.813   1.00 31.23  ? 12  DC  F O2    1 
ATOM   5481 N  N3    . DC  F 3 12  ? -2.705  73.547  -0.231  1.00 29.05  ? 12  DC  F N3    1 
ATOM   5482 C  C4    . DC  F 3 12  ? -3.702  72.669  -0.125  1.00 29.94  ? 12  DC  F C4    1 
ATOM   5483 N  N4    . DC  F 3 12  ? -4.128  72.072  -1.243  1.00 23.42  ? 12  DC  F N4    1 
ATOM   5484 C  C5    . DC  F 3 12  ? -4.308  72.365  1.131   1.00 28.90  ? 12  DC  F C5    1 
ATOM   5485 C  C6    . DC  F 3 12  ? -3.839  72.995  2.213   1.00 27.33  ? 12  DC  F C6    1 
ATOM   5486 P  P     . DT  F 3 13  ? -1.744  77.472  6.748   1.00 35.70  ? 13  DT  F P     1 
ATOM   5487 O  OP1   . DT  F 3 13  ? -0.964  76.799  7.810   1.00 36.00  ? 13  DT  F OP1   1 
ATOM   5488 O  OP2   . DT  F 3 13  ? -3.120  77.941  7.034   1.00 35.31  ? 13  DT  F OP2   1 
ATOM   5489 O  "O5'" . DT  F 3 13  ? -0.863  78.687  6.190   1.00 35.51  ? 13  DT  F "O5'" 1 
ATOM   5490 C  "C5'" . DT  F 3 13  ? -0.812  78.929  4.784   1.00 32.43  ? 13  DT  F "C5'" 1 
ATOM   5491 C  "C4'" . DT  F 3 13  ? -0.009  80.179  4.464   1.00 32.82  ? 13  DT  F "C4'" 1 
ATOM   5492 O  "O4'" . DT  F 3 13  ? 0.006   81.061  5.617   1.00 32.76  ? 13  DT  F "O4'" 1 
ATOM   5493 C  "C3'" . DT  F 3 13  ? 1.455   79.934  4.100   1.00 32.04  ? 13  DT  F "C3'" 1 
ATOM   5494 O  "O3'" . DT  F 3 13  ? 1.852   80.822  3.064   1.00 35.72  ? 13  DT  F "O3'" 1 
ATOM   5495 C  "C2'" . DT  F 3 13  ? 2.187   80.232  5.404   1.00 28.23  ? 13  DT  F "C2'" 1 
ATOM   5496 C  "C1'" . DT  F 3 13  ? 1.338   81.359  5.974   1.00 34.01  ? 13  DT  F "C1'" 1 
ATOM   5497 N  N1    . DT  F 3 13  ? 1.409   81.465  7.455   1.00 31.56  ? 13  DT  F N1    1 
ATOM   5498 C  C2    . DT  F 3 13  ? 1.785   82.657  8.027   1.00 29.43  ? 13  DT  F C2    1 
ATOM   5499 O  O2    . DT  F 3 13  ? 2.067   83.649  7.378   1.00 33.26  ? 13  DT  F O2    1 
ATOM   5500 N  N3    . DT  F 3 13  ? 1.817   82.650  9.396   1.00 31.70  ? 13  DT  F N3    1 
ATOM   5501 C  C4    . DT  F 3 13  ? 1.518   81.592  10.233  1.00 29.90  ? 13  DT  F C4    1 
ATOM   5502 O  O4    . DT  F 3 13  ? 1.578   81.686  11.455  1.00 30.44  ? 13  DT  F O4    1 
ATOM   5503 C  C5    . DT  F 3 13  ? 1.129   80.370  9.568   1.00 31.08  ? 13  DT  F C5    1 
ATOM   5504 C  C7    . DT  F 3 13  ? 0.779   79.152  10.372  1.00 34.92  ? 13  DT  F C7    1 
ATOM   5505 C  C6    . DT  F 3 13  ? 1.094   80.366  8.227   1.00 30.94  ? 13  DT  F C6    1 
HETATM 5506 ZN ZN    . ZN  G 4 .   ? 27.542  81.538  -9.571  1.00 41.63  ? 401 ZN  A ZN    1 
HETATM 5507 ZN ZN    . ZN  H 4 .   ? 35.480  90.983  -2.312  1.00 38.11  ? 402 ZN  A ZN    1 
HETATM 5508 ZN ZN    . ZN  I 4 .   ? 17.777  108.468 -9.361  1.00 26.19  ? 403 ZN  A ZN    1 
HETATM 5509 ZN ZN    . ZN  J 4 .   ? 24.377  104.105 0.671   1.00 25.08  ? 404 ZN  A ZN    1 
HETATM 5510 ZN ZN    . ZN  K 4 .   ? -20.321 107.466 -34.609 1.00 54.16  ? 401 ZN  B ZN    1 
HETATM 5511 ZN ZN    . ZN  L 4 .   ? -19.949 121.184 -31.366 1.00 75.78  ? 402 ZN  B ZN    1 
HETATM 5512 ZN ZN    . ZN  M 4 .   ? -5.176  102.422 -27.468 1.00 24.76  ? 403 ZN  B ZN    1 
HETATM 5513 ZN ZN    . ZN  N 4 .   ? 5.359   108.803 -30.904 1.00 22.83  ? 404 ZN  B ZN    1 
HETATM 5514 O  O     . HOH O 5 .   ? 26.226  82.963  9.655   1.00 48.17  ? 501 HOH A O     1 
HETATM 5515 O  O     . HOH O 5 .   ? 32.113  119.238 8.472   1.00 42.07  ? 502 HOH A O     1 
HETATM 5516 O  O     . HOH O 5 .   ? 17.959  141.980 6.209   1.00 34.17  ? 503 HOH A O     1 
HETATM 5517 O  O     . HOH O 5 .   ? 22.497  132.600 -1.532  1.00 35.40  ? 504 HOH A O     1 
HETATM 5518 O  O     . HOH O 5 .   ? 26.281  98.706  -13.191 1.00 31.71  ? 505 HOH A O     1 
HETATM 5519 O  O     . HOH O 5 .   ? 34.893  111.877 2.549   1.00 40.47  ? 506 HOH A O     1 
HETATM 5520 O  O     . HOH O 5 .   ? 21.598  99.397  10.762  1.00 26.47  ? 507 HOH A O     1 
HETATM 5521 O  O     . HOH O 5 .   ? 18.611  96.032  0.928   1.00 34.94  ? 508 HOH A O     1 
HETATM 5522 O  O     . HOH O 5 .   ? 14.750  129.590 -0.863  1.00 32.59  ? 509 HOH A O     1 
HETATM 5523 O  O     . HOH O 5 .   ? 20.700  108.058 10.156  1.00 27.14  ? 510 HOH A O     1 
HETATM 5524 O  O     . HOH O 5 .   ? 28.740  108.151 10.276  1.00 32.14  ? 511 HOH A O     1 
HETATM 5525 O  O     . HOH O 5 .   ? 24.707  120.576 3.030   1.00 21.26  ? 512 HOH A O     1 
HETATM 5526 O  O     . HOH O 5 .   ? 19.363  97.864  9.708   1.00 27.84  ? 513 HOH A O     1 
HETATM 5527 O  O     . HOH O 5 .   ? 14.370  125.061 17.121  1.00 26.28  ? 514 HOH A O     1 
HETATM 5528 O  O     . HOH O 5 .   ? 24.788  89.330  -7.511  1.00 41.47  ? 515 HOH A O     1 
HETATM 5529 O  O     . HOH O 5 .   ? 18.341  115.803 4.402   1.00 23.09  ? 516 HOH A O     1 
HETATM 5530 O  O     . HOH O 5 .   ? 18.140  85.884  21.128  1.00 44.35  ? 517 HOH A O     1 
HETATM 5531 O  O     . HOH O 5 .   ? 5.907   127.052 11.333  1.00 30.29  ? 518 HOH A O     1 
HETATM 5532 O  O     . HOH O 5 .   ? 16.026  121.796 3.456   1.00 21.81  ? 519 HOH A O     1 
HETATM 5533 O  O     . HOH O 5 .   ? 32.947  132.350 9.041   1.00 40.63  ? 520 HOH A O     1 
HETATM 5534 O  O     . HOH O 5 .   ? 17.385  116.425 -6.127  1.00 21.50  ? 521 HOH A O     1 
HETATM 5535 O  O     . HOH O 5 .   ? 26.523  123.799 -7.281  1.00 33.03  ? 522 HOH A O     1 
HETATM 5536 O  O     . HOH O 5 .   ? 31.673  99.278  15.959  1.00 51.54  ? 523 HOH A O     1 
HETATM 5537 O  O     . HOH O 5 .   ? 18.813  116.340 1.479   1.00 19.10  ? 524 HOH A O     1 
HETATM 5538 O  O     . HOH O 5 .   ? 9.915   135.669 14.937  1.00 34.16  ? 525 HOH A O     1 
HETATM 5539 O  O     . HOH O 5 .   ? 27.099  121.250 3.049   1.00 26.74  ? 526 HOH A O     1 
HETATM 5540 O  O     . HOH O 5 .   ? 21.464  140.496 19.930  1.00 50.17  ? 527 HOH A O     1 
HETATM 5541 O  O     . HOH O 5 .   ? 33.698  112.776 -1.985  1.00 36.52  ? 528 HOH A O     1 
HETATM 5542 O  O     . HOH O 5 .   ? 30.213  113.558 7.425   1.00 27.34  ? 529 HOH A O     1 
HETATM 5543 O  O     . HOH O 5 .   ? 29.294  110.638 -9.569  1.00 31.73  ? 530 HOH A O     1 
HETATM 5544 O  O     . HOH O 5 .   ? 13.896  104.411 7.622   1.00 31.17  ? 531 HOH A O     1 
HETATM 5545 O  O     . HOH O 5 .   ? 14.116  95.142  4.002   1.00 40.89  ? 532 HOH A O     1 
HETATM 5546 O  O     . HOH O 5 .   ? 30.214  130.308 2.210   1.00 36.02  ? 533 HOH A O     1 
HETATM 5547 O  O     . HOH O 5 .   ? 12.108  106.144 -4.808  1.00 33.30  ? 534 HOH A O     1 
HETATM 5548 O  O     . HOH O 5 .   ? 30.374  96.457  1.514   1.00 40.10  ? 535 HOH A O     1 
HETATM 5549 O  O     . HOH O 5 .   ? 16.044  103.145 8.151   1.00 25.78  ? 536 HOH A O     1 
HETATM 5550 O  O     . HOH O 5 .   ? 27.765  119.883 0.235   1.00 30.37  ? 537 HOH A O     1 
HETATM 5551 O  O     . HOH O 5 .   ? 32.226  125.592 7.013   1.00 36.99  ? 538 HOH A O     1 
HETATM 5552 O  O     . HOH O 5 .   ? 10.881  102.804 -4.966  1.00 41.45  ? 539 HOH A O     1 
HETATM 5553 O  O     . HOH O 5 .   ? 10.964  126.885 4.382   1.00 31.69  ? 540 HOH A O     1 
HETATM 5554 O  O     . HOH O 5 .   ? 33.547  94.146  -12.446 1.00 40.45  ? 541 HOH A O     1 
HETATM 5555 O  O     . HOH O 5 .   ? 17.560  99.686  10.632  1.00 28.89  ? 542 HOH A O     1 
HETATM 5556 O  O     . HOH O 5 .   ? 33.809  101.995 3.958   1.00 38.81  ? 543 HOH A O     1 
HETATM 5557 O  O     . HOH O 5 .   ? 28.976  131.319 -4.057  1.00 44.43  ? 544 HOH A O     1 
HETATM 5558 O  O     . HOH O 5 .   ? 36.211  95.875  -9.307  1.00 33.75  ? 545 HOH A O     1 
HETATM 5559 O  O     . HOH O 5 .   ? 17.077  139.277 6.555   1.00 24.65  ? 546 HOH A O     1 
HETATM 5560 O  O     . HOH O 5 .   ? 25.852  145.047 10.157  1.00 43.18  ? 547 HOH A O     1 
HETATM 5561 O  O     . HOH O 5 .   ? 28.798  119.792 -2.491  1.00 34.17  ? 548 HOH A O     1 
HETATM 5562 O  O     . HOH O 5 .   ? 28.302  109.992 6.198   1.00 24.03  ? 549 HOH A O     1 
HETATM 5563 O  O     . HOH O 5 .   ? 2.318   107.853 5.035   1.00 44.66  ? 550 HOH A O     1 
HETATM 5564 O  O     . HOH O 5 .   ? 33.648  128.468 7.749   1.00 42.43  ? 551 HOH A O     1 
HETATM 5565 O  O     . HOH O 5 .   ? 23.958  109.340 5.841   1.00 21.22  ? 552 HOH A O     1 
HETATM 5566 O  O     . HOH O 5 .   ? 27.829  101.572 1.309   1.00 39.00  ? 553 HOH A O     1 
HETATM 5567 O  O     . HOH O 5 .   ? 29.895  116.510 8.934   1.00 34.01  ? 554 HOH A O     1 
HETATM 5568 O  O     . HOH O 5 .   ? 22.929  132.592 -5.233  1.00 41.74  ? 555 HOH A O     1 
HETATM 5569 O  O     . HOH O 5 .   ? 14.092  107.368 8.361   1.00 39.61  ? 556 HOH A O     1 
HETATM 5570 O  O     . HOH O 5 .   ? 20.968  108.627 7.392   1.00 26.37  ? 557 HOH A O     1 
HETATM 5571 O  O     . HOH O 5 .   ? 17.103  104.766 10.178  1.00 33.58  ? 558 HOH A O     1 
HETATM 5572 O  O     . HOH O 5 .   ? 20.919  115.757 5.188   1.00 24.69  ? 559 HOH A O     1 
HETATM 5573 O  O     . HOH O 5 .   ? 19.174  123.101 -10.333 1.00 34.08  ? 560 HOH A O     1 
HETATM 5574 O  O     . HOH O 5 .   ? 9.563   124.821 10.209  1.00 29.67  ? 561 HOH A O     1 
HETATM 5575 O  O     . HOH O 5 .   ? 13.868  121.801 -5.785  1.00 30.57  ? 562 HOH A O     1 
HETATM 5576 O  O     . HOH O 5 .   ? 4.921   110.863 5.076   1.00 43.57  ? 563 HOH A O     1 
HETATM 5577 O  O     . HOH O 5 .   ? 34.175  106.846 6.929   1.00 38.29  ? 564 HOH A O     1 
HETATM 5578 O  O     . HOH O 5 .   ? 33.345  116.386 1.297   1.00 41.64  ? 565 HOH A O     1 
HETATM 5579 O  O     . HOH O 5 .   ? 17.382  136.654 1.563   1.00 27.10  ? 566 HOH A O     1 
HETATM 5580 O  O     . HOH O 5 .   ? 30.964  112.981 -2.596  1.00 26.66  ? 567 HOH A O     1 
HETATM 5581 O  O     . HOH O 5 .   ? 19.153  127.827 24.873  1.00 42.14  ? 568 HOH A O     1 
HETATM 5582 O  O     . HOH O 5 .   ? 26.400  108.783 4.885   1.00 20.75  ? 569 HOH A O     1 
HETATM 5583 O  O     . HOH O 5 .   ? 15.022  116.510 -1.203  1.00 25.81  ? 570 HOH A O     1 
HETATM 5584 O  O     . HOH O 5 .   ? 21.573  140.695 1.957   1.00 42.75  ? 571 HOH A O     1 
HETATM 5585 O  O     . HOH O 5 .   ? 36.050  110.706 6.387   1.00 49.58  ? 572 HOH A O     1 
HETATM 5586 O  O     . HOH O 5 .   ? 32.362  136.001 3.564   1.00 44.40  ? 573 HOH A O     1 
HETATM 5587 O  O     . HOH O 5 .   ? 15.781  120.218 -7.492  1.00 29.46  ? 574 HOH A O     1 
HETATM 5588 O  O     . HOH O 5 .   ? 21.675  102.723 -14.822 1.00 40.33  ? 575 HOH A O     1 
HETATM 5589 O  O     . HOH O 5 .   ? 7.057   114.466 4.436   1.00 47.97  ? 576 HOH A O     1 
HETATM 5590 O  O     . HOH O 5 .   ? 32.973  94.428  -15.586 1.00 41.72  ? 577 HOH A O     1 
HETATM 5591 O  O     . HOH O 5 .   ? 29.592  91.618  -3.703  1.00 44.41  ? 578 HOH A O     1 
HETATM 5592 O  O     . HOH O 5 .   ? 8.760   126.441 11.989  1.00 24.46  ? 579 HOH A O     1 
HETATM 5593 O  O     . HOH O 5 .   ? 14.498  107.985 5.672   1.00 26.11  ? 580 HOH A O     1 
HETATM 5594 O  O     . HOH O 5 .   ? 24.290  118.970 23.589  1.00 46.33  ? 581 HOH A O     1 
HETATM 5595 O  O     . HOH O 5 .   ? 18.211  107.524 13.847  1.00 43.46  ? 582 HOH A O     1 
HETATM 5596 O  O     . HOH O 5 .   ? 38.228  97.827  -8.399  1.00 41.79  ? 583 HOH A O     1 
HETATM 5597 O  O     . HOH O 5 .   ? 40.506  102.508 -2.523  1.00 43.82  ? 584 HOH A O     1 
HETATM 5598 O  O     . HOH O 5 .   ? 28.045  104.162 24.271  1.00 57.62  ? 585 HOH A O     1 
HETATM 5599 O  O     . HOH O 5 .   ? 14.732  128.804 31.130  1.00 47.20  ? 586 HOH A O     1 
HETATM 5600 O  O     . HOH O 5 .   ? 9.939   113.697 -1.289  1.00 42.41  ? 587 HOH A O     1 
HETATM 5601 O  O     . HOH O 5 .   ? 11.306  94.412  10.714  1.00 46.16  ? 588 HOH A O     1 
HETATM 5602 O  O     . HOH O 5 .   ? 18.428  117.146 -3.459  1.00 30.03  ? 589 HOH A O     1 
HETATM 5603 O  O     . HOH O 5 .   ? 28.516  135.138 17.200  1.00 50.60  ? 590 HOH A O     1 
HETATM 5604 O  O     . HOH O 5 .   ? 5.399   103.008 -2.604  1.00 33.05  ? 591 HOH A O     1 
HETATM 5605 O  O     . HOH O 5 .   ? 27.410  117.762 -11.220 1.00 27.46  ? 592 HOH A O     1 
HETATM 5606 O  O     . HOH O 5 .   ? 24.560  93.397  -15.206 1.00 42.06  ? 593 HOH A O     1 
HETATM 5607 O  O     . HOH O 5 .   ? 41.261  110.175 1.261   1.00 63.35  ? 594 HOH A O     1 
HETATM 5608 O  O     . HOH O 5 .   ? 12.795  128.894 5.192   1.00 32.16  ? 595 HOH A O     1 
HETATM 5609 O  O     . HOH O 5 .   ? 7.777   103.610 5.798   1.00 37.11  ? 596 HOH A O     1 
HETATM 5610 O  O     . HOH O 5 .   ? 15.528  135.888 3.646   1.00 22.22  ? 597 HOH A O     1 
HETATM 5611 O  O     . HOH O 5 .   ? 40.131  104.538 -5.520  1.00 53.94  ? 598 HOH A O     1 
HETATM 5612 O  O     . HOH O 5 .   ? 3.727   128.329 17.643  1.00 34.24  ? 599 HOH A O     1 
HETATM 5613 O  O     . HOH O 5 .   ? 31.608  100.173 4.881   1.00 35.80  ? 600 HOH A O     1 
HETATM 5614 O  O     . HOH O 5 .   ? 29.648  123.067 13.894  1.00 40.28  ? 601 HOH A O     1 
HETATM 5615 O  O     . HOH O 5 .   ? 12.060  120.423 3.397   1.00 31.65  ? 602 HOH A O     1 
HETATM 5616 O  O     . HOH O 5 .   ? 5.769   135.219 8.536   1.00 30.91  ? 603 HOH A O     1 
HETATM 5617 O  O     . HOH O 5 .   ? 5.193   108.298 -2.603  1.00 47.09  ? 604 HOH A O     1 
HETATM 5618 O  O     . HOH O 5 .   ? 9.230   137.946 16.450  1.00 45.30  ? 605 HOH A O     1 
HETATM 5619 O  O     . HOH O 5 .   ? 17.511  116.121 -1.021  1.00 21.86  ? 606 HOH A O     1 
HETATM 5620 O  O     . HOH O 5 .   ? 19.169  99.143  -11.305 1.00 37.03  ? 607 HOH A O     1 
HETATM 5621 O  O     . HOH O 5 .   ? 27.043  90.847  -6.425  1.00 42.73  ? 608 HOH A O     1 
HETATM 5622 O  O     . HOH O 5 .   ? 24.158  114.755 18.969  1.00 44.32  ? 609 HOH A O     1 
HETATM 5623 O  O     . HOH O 5 .   ? 27.167  99.146  1.762   1.00 37.93  ? 610 HOH A O     1 
HETATM 5624 O  O     . HOH O 5 .   ? 23.123  137.101 24.595  1.00 52.29  ? 611 HOH A O     1 
HETATM 5625 O  O     . HOH O 5 .   ? 30.614  134.064 15.908  1.00 50.21  ? 612 HOH A O     1 
HETATM 5626 O  O     . HOH O 5 .   ? 17.417  100.008 17.941  1.00 39.08  ? 613 HOH A O     1 
HETATM 5627 O  O     . HOH O 5 .   ? 9.956   124.737 6.487   1.00 37.02  ? 614 HOH A O     1 
HETATM 5628 O  O     . HOH O 5 .   ? 26.877  127.503 -3.895  1.00 42.64  ? 615 HOH A O     1 
HETATM 5629 O  O     . HOH O 5 .   ? 6.176   107.262 7.924   1.00 44.25  ? 616 HOH A O     1 
HETATM 5630 O  O     . HOH O 5 .   ? 7.569   110.909 6.772   1.00 48.42  ? 617 HOH A O     1 
HETATM 5631 O  O     . HOH O 5 .   ? 40.077  85.432  -11.232 1.00 47.85  ? 618 HOH A O     1 
HETATM 5632 O  O     . HOH O 5 .   ? 19.207  104.183 12.286  1.00 41.18  ? 619 HOH A O     1 
HETATM 5633 O  O     . HOH O 5 .   ? 7.789   120.219 15.999  1.00 37.71  ? 620 HOH A O     1 
HETATM 5634 O  O     . HOH O 5 .   ? 10.702  115.719 -4.987  1.00 46.50  ? 621 HOH A O     1 
HETATM 5635 O  O     . HOH O 5 .   ? 34.112  132.869 6.616   1.00 48.45  ? 622 HOH A O     1 
HETATM 5636 O  O     . HOH O 5 .   ? 28.621  129.354 -2.129  1.00 36.69  ? 623 HOH A O     1 
HETATM 5637 O  O     . HOH O 5 .   ? 5.240   125.861 18.413  1.00 41.70  ? 624 HOH A O     1 
HETATM 5638 O  O     . HOH O 5 .   ? 25.706  96.996  -2.146  1.00 43.87  ? 625 HOH A O     1 
HETATM 5639 O  O     . HOH O 5 .   ? 13.805  143.638 10.726  1.00 36.48  ? 626 HOH A O     1 
HETATM 5640 O  O     . HOH O 5 .   ? 27.310  96.524  -0.462  1.00 47.96  ? 627 HOH A O     1 
HETATM 5641 O  O     . HOH O 5 .   ? 16.115  91.804  6.976   1.00 34.13  ? 628 HOH A O     1 
HETATM 5642 O  O     . HOH O 5 .   ? 32.825  113.944 7.179   1.00 37.76  ? 629 HOH A O     1 
HETATM 5643 O  O     . HOH O 5 .   ? 13.203  116.531 -5.895  1.00 37.53  ? 630 HOH A O     1 
HETATM 5644 O  O     . HOH O 5 .   ? 16.194  89.629  5.699   1.00 46.10  ? 631 HOH A O     1 
HETATM 5645 O  O     . HOH O 5 .   ? 5.275   103.451 4.893   1.00 45.27  ? 632 HOH A O     1 
HETATM 5646 O  O     . HOH O 5 .   ? 24.526  109.815 8.941   1.00 28.07  ? 633 HOH A O     1 
HETATM 5647 O  O     . HOH O 5 .   ? 30.167  99.132  2.358   1.00 45.70  ? 634 HOH A O     1 
HETATM 5648 O  O     . HOH O 5 .   ? 15.052  117.959 -5.458  1.00 37.35  ? 635 HOH A O     1 
HETATM 5649 O  O     . HOH O 5 .   ? 22.087  91.196  -5.031  1.00 48.71  ? 636 HOH A O     1 
HETATM 5650 O  O     . HOH O 5 .   ? 19.817  101.790 11.325  1.00 34.94  ? 637 HOH A O     1 
HETATM 5651 O  O     . HOH O 5 .   ? 3.577   126.737 12.302  1.00 42.98  ? 638 HOH A O     1 
HETATM 5652 O  O     . HOH O 5 .   ? 21.151  142.572 18.822  1.00 46.33  ? 639 HOH A O     1 
HETATM 5653 O  O     . HOH O 5 .   ? 19.481  90.281  -6.289  1.00 47.63  ? 640 HOH A O     1 
HETATM 5654 O  O     . HOH O 5 .   ? 23.215  109.158 11.181  1.00 41.83  ? 641 HOH A O     1 
HETATM 5655 O  O     . HOH O 5 .   ? 18.338  139.413 0.779   1.00 35.75  ? 642 HOH A O     1 
HETATM 5656 O  O     . HOH O 5 .   ? 24.072  104.663 18.214  1.00 53.80  ? 643 HOH A O     1 
HETATM 5657 O  O     . HOH O 5 .   ? 8.168   121.130 5.269   1.00 39.90  ? 644 HOH A O     1 
HETATM 5658 O  O     . HOH O 5 .   ? 27.579  110.252 8.769   1.00 27.20  ? 645 HOH A O     1 
HETATM 5659 O  O     . HOH O 5 .   ? 27.791  121.493 -4.626  1.00 40.74  ? 646 HOH A O     1 
HETATM 5660 O  O     . HOH O 5 .   ? 33.535  97.911  5.289   1.00 41.48  ? 647 HOH A O     1 
HETATM 5661 O  O     . HOH O 5 .   ? 15.107  95.094  1.206   1.00 49.20  ? 648 HOH A O     1 
HETATM 5662 O  O     . HOH O 5 .   ? 2.817   125.455 14.964  1.00 46.08  ? 649 HOH A O     1 
HETATM 5663 O  O     . HOH O 5 .   ? 24.124  91.936  -4.034  1.00 51.84  ? 650 HOH A O     1 
HETATM 5664 O  O     . HOH O 5 .   ? 17.420  105.016 -8.319  1.00 31.80  ? 651 HOH A O     1 
HETATM 5665 O  O     . HOH P 5 .   ? 18.717  71.047  -28.293 1.00 42.96  ? 501 HOH B O     1 
HETATM 5666 O  O     . HOH P 5 .   ? 18.109  87.047  -33.174 1.00 38.37  ? 502 HOH B O     1 
HETATM 5667 O  O     . HOH P 5 .   ? -14.784 103.404 -29.813 1.00 47.45  ? 503 HOH B O     1 
HETATM 5668 O  O     . HOH P 5 .   ? 22.769  75.749  -33.285 1.00 48.83  ? 504 HOH B O     1 
HETATM 5669 O  O     . HOH P 5 .   ? 22.504  86.298  -14.039 1.00 37.48  ? 505 HOH B O     1 
HETATM 5670 O  O     . HOH P 5 .   ? -4.065  95.577  -18.753 1.00 34.12  ? 506 HOH B O     1 
HETATM 5671 O  O     . HOH P 5 .   ? -11.399 98.523  -42.548 1.00 44.35  ? 507 HOH B O     1 
HETATM 5672 O  O     . HOH P 5 .   ? -20.611 109.283 -22.323 1.00 55.44  ? 508 HOH B O     1 
HETATM 5673 O  O     . HOH P 5 .   ? -6.387  91.345  -34.746 1.00 35.89  ? 509 HOH B O     1 
HETATM 5674 O  O     . HOH P 5 .   ? 15.697  68.608  -7.444  1.00 31.70  ? 510 HOH B O     1 
HETATM 5675 O  O     . HOH P 5 .   ? 20.166  77.286  -11.538 1.00 41.57  ? 511 HOH B O     1 
HETATM 5676 O  O     . HOH P 5 .   ? 19.921  77.698  -8.839  1.00 43.27  ? 512 HOH B O     1 
HETATM 5677 O  O     . HOH P 5 .   ? 10.172  79.998  -5.292  1.00 46.52  ? 513 HOH B O     1 
HETATM 5678 O  O     . HOH P 5 .   ? -13.960 113.770 -32.043 1.00 55.58  ? 514 HOH B O     1 
HETATM 5679 O  O     . HOH P 5 .   ? -21.643 84.645  -13.456 1.00 39.62  ? 515 HOH B O     1 
HETATM 5680 O  O     . HOH P 5 .   ? -0.112  100.261 -15.528 1.00 32.18  ? 516 HOH B O     1 
HETATM 5681 O  O     . HOH P 5 .   ? 5.003   92.545  -36.413 1.00 32.30  ? 517 HOH B O     1 
HETATM 5682 O  O     . HOH P 5 .   ? -10.862 103.683 -27.357 1.00 42.25  ? 518 HOH B O     1 
HETATM 5683 O  O     . HOH P 5 .   ? 17.021  70.593  -3.923  1.00 38.77  ? 519 HOH B O     1 
HETATM 5684 O  O     . HOH P 5 .   ? 14.437  99.423  -40.420 1.00 27.89  ? 520 HOH B O     1 
HETATM 5685 O  O     . HOH P 5 .   ? 3.508   113.186 -21.996 1.00 38.54  ? 521 HOH B O     1 
HETATM 5686 O  O     . HOH P 5 .   ? 22.415  84.388  -28.008 1.00 45.61  ? 522 HOH B O     1 
HETATM 5687 O  O     . HOH P 5 .   ? 1.154   114.042 -36.419 1.00 33.35  ? 523 HOH B O     1 
HETATM 5688 O  O     . HOH P 5 .   ? -4.596  95.948  -26.732 1.00 19.61  ? 524 HOH B O     1 
HETATM 5689 O  O     . HOH P 5 .   ? 19.617  91.477  -26.426 1.00 36.97  ? 525 HOH B O     1 
HETATM 5690 O  O     . HOH P 5 .   ? 2.885   100.799 -40.648 1.00 29.29  ? 526 HOH B O     1 
HETATM 5691 O  O     . HOH P 5 .   ? 16.020  88.815  -11.356 1.00 47.47  ? 527 HOH B O     1 
HETATM 5692 O  O     . HOH P 5 .   ? -10.241 89.923  -35.522 1.00 48.83  ? 528 HOH B O     1 
HETATM 5693 O  O     . HOH P 5 .   ? 10.909  92.675  -23.690 1.00 26.20  ? 529 HOH B O     1 
HETATM 5694 O  O     . HOH P 5 .   ? 13.498  71.895  -29.199 1.00 46.25  ? 530 HOH B O     1 
HETATM 5695 O  O     . HOH P 5 .   ? -1.909  88.992  -29.232 1.00 32.15  ? 531 HOH B O     1 
HETATM 5696 O  O     . HOH P 5 .   ? 4.631   73.672  -14.326 1.00 39.70  ? 532 HOH B O     1 
HETATM 5697 O  O     . HOH P 5 .   ? 5.660   113.742 -38.187 1.00 28.79  ? 533 HOH B O     1 
HETATM 5698 O  O     . HOH P 5 .   ? 5.013   88.722  -31.787 1.00 25.87  ? 534 HOH B O     1 
HETATM 5699 O  O     . HOH P 5 .   ? -5.036  93.278  -27.360 1.00 28.73  ? 535 HOH B O     1 
HETATM 5700 O  O     . HOH P 5 .   ? -3.754  102.262 -16.339 1.00 25.76  ? 536 HOH B O     1 
HETATM 5701 O  O     . HOH P 5 .   ? 5.818   90.225  -29.790 1.00 22.54  ? 537 HOH B O     1 
HETATM 5702 O  O     . HOH P 5 .   ? 6.805   96.736  -25.560 1.00 22.79  ? 538 HOH B O     1 
HETATM 5703 O  O     . HOH P 5 .   ? 0.320   102.321 -39.048 1.00 29.10  ? 539 HOH B O     1 
HETATM 5704 O  O     . HOH P 5 .   ? -5.646  113.419 -37.458 1.00 35.97  ? 540 HOH B O     1 
HETATM 5705 O  O     . HOH P 5 .   ? 22.551  80.046  -24.712 1.00 31.25  ? 541 HOH B O     1 
HETATM 5706 O  O     . HOH P 5 .   ? 26.246  81.903  -13.347 1.00 35.09  ? 542 HOH B O     1 
HETATM 5707 O  O     . HOH P 5 .   ? 5.183   110.266 -23.413 1.00 28.23  ? 543 HOH B O     1 
HETATM 5708 O  O     . HOH P 5 .   ? 16.058  101.294 -31.397 1.00 40.03  ? 544 HOH B O     1 
HETATM 5709 O  O     . HOH P 5 .   ? -18.269 92.832  -20.506 1.00 43.18  ? 545 HOH B O     1 
HETATM 5710 O  O     . HOH P 5 .   ? 13.092  89.417  -14.428 1.00 39.27  ? 546 HOH B O     1 
HETATM 5711 O  O     . HOH P 5 .   ? 19.291  79.299  -12.940 1.00 37.69  ? 547 HOH B O     1 
HETATM 5712 O  O     . HOH P 5 .   ? -3.303  94.184  -37.404 1.00 33.32  ? 548 HOH B O     1 
HETATM 5713 O  O     . HOH P 5 .   ? 1.671   86.309  -13.040 1.00 45.00  ? 549 HOH B O     1 
HETATM 5714 O  O     . HOH P 5 .   ? -2.577  96.660  -20.986 1.00 29.17  ? 550 HOH B O     1 
HETATM 5715 O  O     . HOH P 5 .   ? 16.947  89.102  -19.306 1.00 35.59  ? 551 HOH B O     1 
HETATM 5716 O  O     . HOH P 5 .   ? 9.075   75.494  -34.254 1.00 36.32  ? 552 HOH B O     1 
HETATM 5717 O  O     . HOH P 5 .   ? -18.908 93.609  -23.861 1.00 56.61  ? 553 HOH B O     1 
HETATM 5718 O  O     . HOH P 5 .   ? -0.647  114.532 -38.793 1.00 42.18  ? 554 HOH B O     1 
HETATM 5719 O  O     . HOH P 5 .   ? 3.801   74.878  -23.006 1.00 33.80  ? 555 HOH B O     1 
HETATM 5720 O  O     . HOH P 5 .   ? 1.936   81.262  -32.401 1.00 35.39  ? 556 HOH B O     1 
HETATM 5721 O  O     . HOH P 5 .   ? -1.202  113.639 -42.206 1.00 38.48  ? 557 HOH B O     1 
HETATM 5722 O  O     . HOH P 5 .   ? 11.206  95.504  -18.962 1.00 32.86  ? 558 HOH B O     1 
HETATM 5723 O  O     . HOH P 5 .   ? 10.820  101.376 -15.006 1.00 45.14  ? 559 HOH B O     1 
HETATM 5724 O  O     . HOH P 5 .   ? 14.103  87.437  -12.711 1.00 37.31  ? 560 HOH B O     1 
HETATM 5725 O  O     . HOH P 5 .   ? -1.220  102.596 -15.445 1.00 26.41  ? 561 HOH B O     1 
HETATM 5726 O  O     . HOH P 5 .   ? 8.299   82.687  -13.753 1.00 28.18  ? 562 HOH B O     1 
HETATM 5727 O  O     . HOH P 5 .   ? -14.720 108.453 -40.896 1.00 44.11  ? 563 HOH B O     1 
HETATM 5728 O  O     . HOH P 5 .   ? 6.401   95.782  -22.662 1.00 22.42  ? 564 HOH B O     1 
HETATM 5729 O  O     . HOH P 5 .   ? -19.552 119.744 -43.512 1.00 62.83  ? 565 HOH B O     1 
HETATM 5730 O  O     . HOH P 5 .   ? 10.503  102.021 -29.757 1.00 23.03  ? 566 HOH B O     1 
HETATM 5731 O  O     . HOH P 5 .   ? 10.228  99.762  -24.414 1.00 28.95  ? 567 HOH B O     1 
HETATM 5732 O  O     . HOH P 5 .   ? 1.243   85.590  -25.344 1.00 30.46  ? 568 HOH B O     1 
HETATM 5733 O  O     . HOH P 5 .   ? 5.302   112.248 -42.471 1.00 28.83  ? 569 HOH B O     1 
HETATM 5734 O  O     . HOH P 5 .   ? 13.858  76.909  -38.049 1.00 44.58  ? 570 HOH B O     1 
HETATM 5735 O  O     . HOH P 5 .   ? -4.208  88.626  -24.962 1.00 37.56  ? 571 HOH B O     1 
HETATM 5736 O  O     . HOH P 5 .   ? 13.020  86.516  -37.665 1.00 37.05  ? 572 HOH B O     1 
HETATM 5737 O  O     . HOH P 5 .   ? -2.833  96.354  -24.828 1.00 21.50  ? 573 HOH B O     1 
HETATM 5738 O  O     . HOH P 5 .   ? 4.714   91.184  -33.783 1.00 31.44  ? 574 HOH B O     1 
HETATM 5739 O  O     . HOH P 5 .   ? -10.086 103.151 -16.332 1.00 36.35  ? 575 HOH B O     1 
HETATM 5740 O  O     . HOH P 5 .   ? 2.837   113.322 -43.232 1.00 31.59  ? 576 HOH B O     1 
HETATM 5741 O  O     . HOH P 5 .   ? -10.768 100.764 -17.261 1.00 31.88  ? 577 HOH B O     1 
HETATM 5742 O  O     . HOH P 5 .   ? -13.643 98.689  -28.548 1.00 39.69  ? 578 HOH B O     1 
HETATM 5743 O  O     . HOH P 5 .   ? 8.975   110.368 -37.051 1.00 27.43  ? 579 HOH B O     1 
HETATM 5744 O  O     . HOH P 5 .   ? 11.037  66.813  -16.855 1.00 49.54  ? 580 HOH B O     1 
HETATM 5745 O  O     . HOH P 5 .   ? 8.426   71.430  -29.040 1.00 45.17  ? 581 HOH B O     1 
HETATM 5746 O  O     . HOH P 5 .   ? 14.079  92.527  -16.863 1.00 34.12  ? 582 HOH B O     1 
HETATM 5747 O  O     . HOH P 5 .   ? 16.094  92.026  -18.641 1.00 37.33  ? 583 HOH B O     1 
HETATM 5748 O  O     . HOH P 5 .   ? 1.469   101.506 -17.900 1.00 25.95  ? 584 HOH B O     1 
HETATM 5749 O  O     . HOH P 5 .   ? -4.048  99.668  -16.061 1.00 37.77  ? 585 HOH B O     1 
HETATM 5750 O  O     . HOH P 5 .   ? 19.367  88.650  -35.530 1.00 42.80  ? 586 HOH B O     1 
HETATM 5751 O  O     . HOH P 5 .   ? 2.379   107.186 -12.475 1.00 35.61  ? 587 HOH B O     1 
HETATM 5752 O  O     . HOH P 5 .   ? 14.904  107.526 -30.598 1.00 31.97  ? 588 HOH B O     1 
HETATM 5753 O  O     . HOH P 5 .   ? -1.343  95.786  -36.058 1.00 28.26  ? 589 HOH B O     1 
HETATM 5754 O  O     . HOH P 5 .   ? -9.891  108.023 -28.697 1.00 41.69  ? 590 HOH B O     1 
HETATM 5755 O  O     . HOH P 5 .   ? 23.123  79.844  -31.538 1.00 43.96  ? 591 HOH B O     1 
HETATM 5756 O  O     . HOH P 5 .   ? 15.270  84.673  -5.696  1.00 48.00  ? 592 HOH B O     1 
HETATM 5757 O  O     . HOH P 5 .   ? 6.032   113.826 -16.364 1.00 39.72  ? 593 HOH B O     1 
HETATM 5758 O  O     . HOH P 5 .   ? -2.128  94.734  -23.003 1.00 28.11  ? 594 HOH B O     1 
HETATM 5759 O  O     . HOH P 5 .   ? -5.144  116.392 -21.681 1.00 50.59  ? 595 HOH B O     1 
HETATM 5760 O  O     . HOH P 5 .   ? -8.224  102.371 -15.066 1.00 35.74  ? 596 HOH B O     1 
HETATM 5761 O  O     . HOH P 5 .   ? 10.288  75.948  -36.892 1.00 42.22  ? 597 HOH B O     1 
HETATM 5762 O  O     . HOH P 5 .   ? 10.798  93.638  -38.282 1.00 26.75  ? 598 HOH B O     1 
HETATM 5763 O  O     . HOH P 5 .   ? 9.387   99.411  -28.443 1.00 27.87  ? 599 HOH B O     1 
HETATM 5764 O  O     . HOH P 5 .   ? 4.597   99.434  -13.332 1.00 40.79  ? 600 HOH B O     1 
HETATM 5765 O  O     . HOH P 5 .   ? 8.178   98.933  -26.240 1.00 20.65  ? 601 HOH B O     1 
HETATM 5766 O  O     . HOH P 5 .   ? 7.660   88.643  -9.137  1.00 44.04  ? 602 HOH B O     1 
HETATM 5767 O  O     . HOH P 5 .   ? 0.148   97.583  -12.322 1.00 47.56  ? 603 HOH B O     1 
HETATM 5768 O  O     . HOH P 5 .   ? -17.790 109.933 -19.503 1.00 46.29  ? 604 HOH B O     1 
HETATM 5769 O  O     . HOH P 5 .   ? 15.946  99.067  -35.214 1.00 37.21  ? 605 HOH B O     1 
HETATM 5770 O  O     . HOH P 5 .   ? 8.877   84.852  -6.502  1.00 51.18  ? 606 HOH B O     1 
HETATM 5771 O  O     . HOH P 5 .   ? -21.976 111.285 -11.998 1.00 62.18  ? 607 HOH B O     1 
HETATM 5772 O  O     . HOH P 5 .   ? -6.466  97.856  -15.765 1.00 41.19  ? 608 HOH B O     1 
HETATM 5773 O  O     . HOH P 5 .   ? -1.517  85.798  -25.450 1.00 35.33  ? 609 HOH B O     1 
HETATM 5774 O  O     . HOH P 5 .   ? -7.346  111.176 -16.769 1.00 43.48  ? 610 HOH B O     1 
HETATM 5775 O  O     . HOH P 5 .   ? 22.033  84.333  -24.592 1.00 28.63  ? 611 HOH B O     1 
HETATM 5776 O  O     . HOH P 5 .   ? -10.500 97.635  -9.592  1.00 43.82  ? 612 HOH B O     1 
HETATM 5777 O  O     . HOH P 5 .   ? 15.763  109.366 -26.444 1.00 32.72  ? 613 HOH B O     1 
HETATM 5778 O  O     . HOH P 5 .   ? 4.208   81.311  -34.254 1.00 32.08  ? 614 HOH B O     1 
HETATM 5779 O  O     . HOH P 5 .   ? 7.947   81.512  -5.236  1.00 44.24  ? 615 HOH B O     1 
HETATM 5780 O  O     . HOH P 5 .   ? -1.893  115.521 -31.315 1.00 39.64  ? 616 HOH B O     1 
HETATM 5781 O  O     . HOH P 5 .   ? 4.851   70.261  -8.122  1.00 39.02  ? 617 HOH B O     1 
HETATM 5782 O  O     . HOH P 5 .   ? -4.125  78.018  -17.114 1.00 48.81  ? 618 HOH B O     1 
HETATM 5783 O  O     . HOH P 5 .   ? -16.853 123.975 -33.125 1.00 55.51  ? 619 HOH B O     1 
HETATM 5784 O  O     . HOH P 5 .   ? -19.563 118.218 -45.273 1.00 65.37  ? 620 HOH B O     1 
HETATM 5785 O  O     . HOH P 5 .   ? -5.586  92.855  -18.788 1.00 44.91  ? 621 HOH B O     1 
HETATM 5786 O  O     . HOH P 5 .   ? -19.817 108.027 -31.377 1.00 41.24  ? 622 HOH B O     1 
HETATM 5787 O  O     . HOH P 5 .   ? 2.985   82.602  -36.328 1.00 34.16  ? 623 HOH B O     1 
HETATM 5788 O  O     . HOH P 5 .   ? -18.183 115.982 -46.486 1.00 57.69  ? 624 HOH B O     1 
HETATM 5789 O  O     . HOH P 5 .   ? -17.943 116.361 -24.556 1.00 52.59  ? 625 HOH B O     1 
HETATM 5790 O  O     . HOH P 5 .   ? -19.555 105.681 -31.536 1.00 46.41  ? 626 HOH B O     1 
HETATM 5791 O  O     . HOH P 5 .   ? 12.502  101.508 -27.926 1.00 36.33  ? 627 HOH B O     1 
HETATM 5792 O  O     . HOH P 5 .   ? 15.483  90.435  -36.396 1.00 41.15  ? 628 HOH B O     1 
HETATM 5793 O  O     . HOH P 5 .   ? 4.395   113.406 -31.705 1.00 33.99  ? 629 HOH B O     1 
HETATM 5794 O  O     . HOH P 5 .   ? 23.016  82.001  -22.888 1.00 36.12  ? 630 HOH B O     1 
HETATM 5795 O  O     . HOH P 5 .   ? -14.697 105.960 -42.067 1.00 45.14  ? 631 HOH B O     1 
HETATM 5796 O  O     . HOH P 5 .   ? 2.980   111.637 -24.166 1.00 37.21  ? 632 HOH B O     1 
HETATM 5797 O  O     . HOH P 5 .   ? -3.957  88.317  -18.858 1.00 54.40  ? 633 HOH B O     1 
HETATM 5798 O  O     . HOH P 5 .   ? -5.031  79.464  -19.054 1.00 47.50  ? 634 HOH B O     1 
HETATM 5799 O  O     . HOH P 5 .   ? -8.247  99.598  -16.272 1.00 39.44  ? 635 HOH B O     1 
HETATM 5800 O  O     . HOH P 5 .   ? 7.946   93.514  -37.837 1.00 44.74  ? 636 HOH B O     1 
HETATM 5801 O  O     . HOH P 5 .   ? 3.128   115.812 -42.436 1.00 38.42  ? 637 HOH B O     1 
HETATM 5802 O  O     . HOH P 5 .   ? -5.437  91.755  -25.317 1.00 39.02  ? 638 HOH B O     1 
HETATM 5803 O  O     . HOH P 5 .   ? 7.391   114.653 -40.003 1.00 33.68  ? 639 HOH B O     1 
HETATM 5804 O  O     . HOH P 5 .   ? 7.102   114.180 -42.354 1.00 38.31  ? 640 HOH B O     1 
HETATM 5805 O  O     . HOH P 5 .   ? 2.935   100.915 -43.887 1.00 48.67  ? 641 HOH B O     1 
HETATM 5806 O  O     . HOH P 5 .   ? -6.977  112.249 -19.618 1.00 45.86  ? 642 HOH B O     1 
HETATM 5807 O  O     . HOH P 5 .   ? -5.853  114.471 -19.766 1.00 49.17  ? 643 HOH B O     1 
HETATM 5808 O  O     . HOH P 5 .   ? 2.475   110.925 -29.252 1.00 37.09  ? 644 HOH B O     1 
HETATM 5809 O  O     . HOH P 5 .   ? 0.765   115.423 -29.857 1.00 45.53  ? 645 HOH B O     1 
HETATM 5810 O  O     . HOH P 5 .   ? 2.780   113.328 -29.372 1.00 35.63  ? 646 HOH B O     1 
HETATM 5811 O  O     . HOH Q 5 .   ? 34.309  98.847  12.654  1.00 50.29  ? 101 HOH C O     1 
HETATM 5812 O  O     . HOH R 5 .   ? -18.402 96.750  -28.449 1.00 61.87  ? 101 HOH D O     1 
HETATM 5813 O  O     . HOH S 5 .   ? 13.481  66.852  4.564   1.00 35.41  ? 101 HOH E O     1 
HETATM 5814 O  O     . HOH S 5 .   ? 12.424  59.786  6.407   1.00 27.66  ? 102 HOH E O     1 
HETATM 5815 O  O     . HOH S 5 .   ? 9.462   60.935  0.454   1.00 36.22  ? 103 HOH E O     1 
HETATM 5816 O  O     . HOH S 5 .   ? 11.658  74.170  2.403   1.00 36.46  ? 104 HOH E O     1 
HETATM 5817 O  O     . HOH S 5 .   ? 11.637  59.135  -1.524  1.00 39.12  ? 105 HOH E O     1 
HETATM 5818 O  O     . HOH S 5 .   ? 5.646   68.720  3.686   1.00 40.85  ? 106 HOH E O     1 
HETATM 5819 O  O     . HOH S 5 .   ? 5.315   64.473  3.649   1.00 41.18  ? 107 HOH E O     1 
HETATM 5820 O  O     . HOH S 5 .   ? 15.392  65.422  5.052   1.00 27.08  ? 108 HOH E O     1 
HETATM 5821 O  O     . HOH S 5 .   ? 17.125  53.214  1.806   1.00 44.15  ? 109 HOH E O     1 
HETATM 5822 O  O     . HOH S 5 .   ? 12.195  74.794  0.121   1.00 43.69  ? 110 HOH E O     1 
HETATM 5823 O  O     . HOH S 5 .   ? 3.489   65.339  4.870   1.00 50.00  ? 111 HOH E O     1 
HETATM 5824 O  O     . HOH S 5 .   ? -4.185  77.774  -1.469  1.00 39.55  ? 112 HOH E O     1 
HETATM 5825 O  O     . HOH T 5 .   ? 27.148  49.614  10.893  1.00 41.44  ? 101 HOH F O     1 
HETATM 5826 O  O     . HOH T 5 .   ? 1.520   76.622  7.476   1.00 43.63  ? 102 HOH F O     1 
HETATM 5827 O  O     . HOH T 5 .   ? -4.380  66.109  1.006   1.00 32.89  ? 103 HOH F O     1 
HETATM 5828 O  O     . HOH T 5 .   ? 16.934  69.267  -1.253  1.00 34.13  ? 104 HOH F O     1 
HETATM 5829 O  O     . HOH T 5 .   ? -7.266  70.543  6.416   1.00 39.15  ? 105 HOH F O     1 
HETATM 5830 O  O     . HOH T 5 .   ? -5.532  63.585  3.856   1.00 36.09  ? 106 HOH F O     1 
HETATM 5831 O  O     . HOH T 5 .   ? 18.844  67.546  -0.769  1.00 37.94  ? 107 HOH F O     1 
HETATM 5832 O  O     . HOH T 5 .   ? 9.233   68.288  -8.314  1.00 32.37  ? 108 HOH F O     1 
HETATM 5833 O  O     . HOH T 5 .   ? -6.060  70.143  -1.531  1.00 35.76  ? 109 HOH F O     1 
HETATM 5834 O  O     . HOH T 5 .   ? 4.143   64.371  -0.216  1.00 33.79  ? 110 HOH F O     1 
HETATM 5835 O  O     . HOH T 5 .   ? 25.590  47.548  -2.078  1.00 50.58  ? 111 HOH F O     1 
HETATM 5836 O  O     . HOH T 5 .   ? 6.596   68.727  -7.662  1.00 36.18  ? 112 HOH F O     1 
HETATM 5837 O  O     . HOH T 5 .   ? 20.491  61.145  -6.818  1.00 52.09  ? 113 HOH F O     1 
HETATM 5838 O  O     . HOH T 5 .   ? 0.894   71.658  3.166   1.00 42.03  ? 114 HOH F O     1 
HETATM 5839 O  O     . HOH T 5 .   ? 11.726  61.920  -4.920  1.00 42.46  ? 115 HOH F O     1 
HETATM 5840 O  O     . HOH T 5 .   ? 18.336  60.843  -7.639  1.00 41.43  ? 116 HOH F O     1 
HETATM 5841 O  O     . HOH T 5 .   ? 4.023   64.858  -8.316  1.00 37.84  ? 117 HOH F O     1 
HETATM 5842 O  O     . HOH T 5 .   ? -3.061  77.842  0.832   1.00 38.34  ? 118 HOH F O     1 
HETATM 5843 O  O     . HOH T 5 .   ? 5.084   61.741  -0.824  1.00 46.64  ? 119 HOH F O     1 
HETATM 5844 O  O     . HOH T 5 .   ? -3.251  73.667  10.164  1.00 41.29  ? 120 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   42  ?   ?   ?   A . n 
A 1 2   ALA 2   43  ?   ?   ?   A . n 
A 1 3   CYS 3   44  44  CYS CYS A . n 
A 1 4   LYS 4   45  45  LYS LYS A . n 
A 1 5   PHE 5   46  46  PHE PHE A . n 
A 1 6   GLU 6   47  47  GLU GLU A . n 
A 1 7   GLU 7   48  48  GLU GLU A . n 
A 1 8   GLY 8   49  49  GLY GLY A . n 
A 1 9   GLN 9   50  50  GLN GLN A . n 
A 1 10  ASP 10  51  51  ASP ASP A . n 
A 1 11  VAL 11  52  52  VAL VAL A . n 
A 1 12  LEU 12  53  53  LEU LEU A . n 
A 1 13  ALA 13  54  54  ALA ALA A . n 
A 1 14  ARG 14  55  55  ARG ARG A . n 
A 1 15  TRP 15  56  56  TRP TRP A . n 
A 1 16  SER 16  57  57  SER SER A . n 
A 1 17  ASP 17  58  58  ASP ASP A . n 
A 1 18  GLY 18  59  59  GLY GLY A . n 
A 1 19  LEU 19  60  60  LEU LEU A . n 
A 1 20  PHE 20  61  61  PHE PHE A . n 
A 1 21  TYR 21  62  62  TYR TYR A . n 
A 1 22  LEU 22  63  63  LEU LEU A . n 
A 1 23  GLY 23  64  64  GLY GLY A . n 
A 1 24  THR 24  65  65  THR THR A . n 
A 1 25  ILE 25  66  66  ILE ILE A . n 
A 1 26  LYS 26  67  67  LYS LYS A . n 
A 1 27  LYS 27  68  68  LYS LYS A . n 
A 1 28  ILE 28  69  69  ILE ILE A . n 
A 1 29  ASN 29  70  70  ASN ASN A . n 
A 1 30  ILE 30  71  71  ILE ILE A . n 
A 1 31  LEU 31  72  72  LEU LEU A . n 
A 1 32  LYS 32  73  73  LYS LYS A . n 
A 1 33  GLN 33  74  74  GLN GLN A . n 
A 1 34  SER 34  75  75  SER SER A . n 
A 1 35  CYS 35  76  76  CYS CYS A . n 
A 1 36  PHE 36  77  77  PHE PHE A . n 
A 1 37  ILE 37  78  78  ILE ILE A . n 
A 1 38  ILE 38  79  79  ILE ILE A . n 
A 1 39  PHE 39  80  80  PHE PHE A . n 
A 1 40  GLU 40  81  81  GLU GLU A . n 
A 1 41  ASP 41  82  82  ASP ASP A . n 
A 1 42  SER 42  83  83  SER SER A . n 
A 1 43  SER 43  84  84  SER SER A . n 
A 1 44  LYS 44  85  85  LYS LYS A . n 
A 1 45  SER 45  86  86  SER SER A . n 
A 1 46  TRP 46  87  87  TRP TRP A . n 
A 1 47  VAL 47  88  88  VAL VAL A . n 
A 1 48  LEU 48  89  89  LEU LEU A . n 
A 1 49  TRP 49  90  90  TRP TRP A . n 
A 1 50  LYS 50  91  91  LYS LYS A . n 
A 1 51  ASP 51  92  92  ASP ASP A . n 
A 1 52  ILE 52  93  93  ILE ILE A . n 
A 1 53  GLN 53  94  94  GLN GLN A . n 
A 1 54  THR 54  95  95  THR THR A . n 
A 1 55  GLY 55  96  96  GLY GLY A . n 
A 1 56  ALA 56  97  97  ALA ALA A . n 
A 1 57  THR 57  98  ?   ?   ?   A . n 
A 1 58  GLY 58  99  ?   ?   ?   A . n 
A 1 59  SER 59  100 ?   ?   ?   A . n 
A 1 60  GLY 60  101 ?   ?   ?   A . n 
A 1 61  GLU 61  102 ?   ?   ?   A . n 
A 1 62  MET 62  103 103 MET MET A . n 
A 1 63  VAL 63  104 104 VAL VAL A . n 
A 1 64  CYS 64  105 105 CYS CYS A . n 
A 1 65  THR 65  106 106 THR THR A . n 
A 1 66  ILE 66  107 107 ILE ILE A . n 
A 1 67  CYS 67  108 108 CYS CYS A . n 
A 1 68  GLN 68  109 109 GLN GLN A . n 
A 1 69  GLU 69  110 110 GLU GLU A . n 
A 1 70  GLU 70  111 111 GLU GLU A . n 
A 1 71  TYR 71  112 112 TYR TYR A . n 
A 1 72  SER 72  113 113 SER SER A . n 
A 1 73  GLU 73  114 114 GLU GLU A . n 
A 1 74  ALA 74  115 115 ALA ALA A . n 
A 1 75  PRO 75  116 116 PRO PRO A . n 
A 1 76  ASN 76  117 117 ASN ASN A . n 
A 1 77  GLU 77  118 118 GLU GLU A . n 
A 1 78  MET 78  119 119 MET MET A . n 
A 1 79  VAL 79  120 120 VAL VAL A . n 
A 1 80  ILE 80  121 121 ILE ILE A . n 
A 1 81  CYS 81  122 122 CYS CYS A . n 
A 1 82  ASP 82  123 123 ASP ASP A . n 
A 1 83  LYS 83  124 124 LYS LYS A . n 
A 1 84  CYS 84  125 125 CYS CYS A . n 
A 1 85  GLY 85  126 126 GLY GLY A . n 
A 1 86  GLN 86  127 127 GLN GLN A . n 
A 1 87  GLY 87  128 128 GLY GLY A . n 
A 1 88  TYR 88  129 129 TYR TYR A . n 
A 1 89  HIS 89  130 130 HIS HIS A . n 
A 1 90  GLN 90  131 131 GLN GLN A . n 
A 1 91  LEU 91  132 132 LEU LEU A . n 
A 1 92  CYS 92  133 133 CYS CYS A . n 
A 1 93  HIS 93  134 134 HIS HIS A . n 
A 1 94  THR 94  135 135 THR THR A . n 
A 1 95  PRO 95  136 136 PRO PRO A . n 
A 1 96  HIS 96  137 137 HIS HIS A . n 
A 1 97  ILE 97  138 138 ILE ILE A . n 
A 1 98  ASP 98  139 139 ASP ASP A . n 
A 1 99  CYS 99  140 140 CYS CYS A . n 
A 1 100 SER 100 141 141 SER SER A . n 
A 1 101 VAL 101 142 142 VAL VAL A . n 
A 1 102 ILE 102 143 143 ILE ILE A . n 
A 1 103 ASP 103 144 144 ASP ASP A . n 
A 1 104 SER 104 145 145 SER SER A . n 
A 1 105 ASP 105 146 146 ASP ASP A . n 
A 1 106 GLU 106 147 147 GLU GLU A . n 
A 1 107 LYS 107 148 148 LYS LYS A . n 
A 1 108 TRP 108 149 149 TRP TRP A . n 
A 1 109 LEU 109 150 150 LEU LEU A . n 
A 1 110 CYS 110 151 151 CYS CYS A . n 
A 1 111 ARG 111 152 152 ARG ARG A . n 
A 1 112 GLN 112 153 153 GLN GLN A . n 
A 1 113 CYS 113 154 154 CYS CYS A . n 
A 1 114 VAL 114 155 155 VAL VAL A . n 
A 1 115 PHE 115 156 156 PHE PHE A . n 
A 1 116 ALA 116 157 157 ALA ALA A . n 
A 1 117 THR 117 158 158 THR THR A . n 
A 1 118 THR 118 159 159 THR THR A . n 
A 1 119 THR 119 160 160 THR THR A . n 
A 1 120 LYS 120 161 161 LYS LYS A . n 
A 1 121 ARG 121 162 162 ARG ARG A . n 
A 1 122 GLY 122 163 163 GLY GLY A . n 
A 1 123 GLY 123 164 164 GLY GLY A . n 
A 1 124 ALA 124 165 165 ALA ALA A . n 
A 1 125 LEU 125 166 166 LEU LEU A . n 
A 1 126 LYS 126 167 167 LYS LYS A . n 
A 1 127 LYS 127 168 168 LYS LYS A . n 
A 1 128 GLY 128 169 169 GLY GLY A . n 
A 1 129 PRO 129 170 170 PRO PRO A . n 
A 1 130 ASN 130 171 171 ASN ASN A . n 
A 1 131 ALA 131 172 172 ALA ALA A . n 
A 1 132 LYS 132 173 173 LYS LYS A . n 
A 1 133 ALA 133 174 174 ALA ALA A . n 
A 1 134 LEU 134 175 175 LEU LEU A . n 
A 1 135 GLN 135 176 176 GLN GLN A . n 
A 1 136 VAL 136 177 177 VAL VAL A . n 
A 1 137 MET 137 178 178 MET MET A . n 
A 1 138 LYS 138 179 179 LYS LYS A . n 
A 1 139 GLN 139 180 180 GLN GLN A . n 
A 1 140 THR 140 181 181 THR THR A . n 
A 1 141 LEU 141 182 182 LEU LEU A . n 
A 1 142 PRO 142 183 183 PRO PRO A . n 
A 1 143 TYR 143 184 184 TYR TYR A . n 
A 1 144 SER 144 185 185 SER SER A . n 
A 1 145 VAL 145 186 186 VAL VAL A . n 
A 1 146 ALA 146 187 187 ALA ALA A . n 
A 1 147 ASP 147 188 188 ASP ASP A . n 
A 1 148 LEU 148 189 189 LEU LEU A . n 
A 1 149 GLU 149 190 190 GLU GLU A . n 
A 1 150 TRP 150 191 191 TRP TRP A . n 
A 1 151 ASP 151 192 192 ASP ASP A . n 
A 1 152 ALA 152 193 193 ALA ALA A . n 
A 1 153 GLY 153 194 194 GLY GLY A . n 
A 1 154 HIS 154 195 195 HIS HIS A . n 
A 1 155 LYS 155 196 196 LYS LYS A . n 
A 1 156 THR 156 197 197 THR THR A . n 
A 1 157 ASN 157 198 198 ASN ASN A . n 
A 1 158 VAL 158 199 199 VAL VAL A . n 
A 1 159 GLN 159 200 200 GLN GLN A . n 
A 1 160 GLN 160 201 201 GLN GLN A . n 
A 1 161 CYS 161 202 202 CYS CYS A . n 
A 1 162 TYR 162 203 203 TYR TYR A . n 
A 1 163 CYS 163 204 204 CYS CYS A . n 
A 1 164 TYR 164 205 205 TYR TYR A . n 
A 1 165 CYS 165 206 206 CYS CYS A . n 
A 1 166 GLY 166 207 207 GLY GLY A . n 
A 1 167 GLY 167 208 208 GLY GLY A . n 
A 1 168 PRO 168 209 209 PRO PRO A . n 
A 1 169 GLY 169 210 210 GLY GLY A . n 
A 1 170 ASP 170 211 211 ASP ASP A . n 
A 1 171 TRP 171 212 212 TRP TRP A . n 
A 1 172 TYR 172 213 213 TYR TYR A . n 
A 1 173 LEU 173 214 214 LEU LEU A . n 
A 1 174 LYS 174 215 215 LYS LYS A . n 
A 1 175 MET 175 216 216 MET MET A . n 
A 1 176 LEU 176 217 217 LEU LEU A . n 
A 1 177 GLN 177 218 218 GLN GLN A . n 
A 1 178 CYS 178 219 219 CYS CYS A . n 
A 1 179 CYS 179 220 220 CYS CYS A . n 
A 1 180 LYS 180 221 221 LYS LYS A . n 
A 1 181 CYS 181 222 222 CYS CYS A . n 
A 1 182 LYS 182 223 223 LYS LYS A . n 
A 1 183 GLN 183 224 224 GLN GLN A . n 
A 1 184 TRP 184 225 225 TRP TRP A . n 
A 1 185 PHE 185 226 226 PHE PHE A . n 
A 1 186 HIS 186 227 227 HIS HIS A . n 
A 1 187 GLU 187 228 228 GLU GLU A . n 
A 1 188 ALA 188 229 229 ALA ALA A . n 
A 1 189 CYS 189 230 230 CYS CYS A . n 
A 1 190 VAL 190 231 231 VAL VAL A . n 
A 1 191 GLN 191 232 232 GLN GLN A . n 
A 1 192 CYS 192 233 233 CYS CYS A . n 
A 1 193 LEU 193 234 234 LEU LEU A . n 
A 1 194 GLN 194 235 235 GLN GLN A . n 
A 1 195 LYS 195 236 236 LYS LYS A . n 
A 1 196 PRO 196 237 237 PRO PRO A . n 
A 1 197 MET 197 238 238 MET MET A . n 
A 1 198 LEU 198 239 239 LEU LEU A . n 
A 1 199 PHE 199 240 240 PHE PHE A . n 
A 1 200 GLY 200 241 241 GLY GLY A . n 
A 1 201 ASP 201 242 242 ASP ASP A . n 
A 1 202 ARG 202 243 243 ARG ARG A . n 
A 1 203 PHE 203 244 244 PHE PHE A . n 
A 1 204 TYR 204 245 245 TYR TYR A . n 
A 1 205 THR 205 246 246 THR THR A . n 
A 1 206 PHE 206 247 247 PHE PHE A . n 
A 1 207 ILE 207 248 248 ILE ILE A . n 
A 1 208 CYS 208 249 249 CYS CYS A . n 
A 1 209 SER 209 250 250 SER SER A . n 
A 1 210 VAL 210 251 251 VAL VAL A . n 
A 1 211 CYS 211 252 252 CYS CYS A . n 
A 1 212 SER 212 253 253 SER SER A . n 
A 1 213 SER 213 254 254 SER SER A . n 
A 1 214 GLY 214 255 255 GLY GLY A . n 
A 1 215 PRO 215 256 256 PRO PRO A . n 
A 1 216 GLU 216 257 257 GLU GLU A . n 
A 1 217 TYR 217 258 258 TYR TYR A . n 
A 1 218 LEU 218 259 259 LEU LEU A . n 
A 1 219 LYS 219 260 260 LYS LYS A . n 
A 1 220 ARG 220 261 261 ARG ARG A . n 
A 1 221 LEU 221 262 262 LEU LEU A . n 
A 1 222 PRO 222 263 263 PRO PRO A . n 
A 1 223 LEU 223 264 264 LEU LEU A . n 
A 1 224 GLN 224 265 265 GLN GLN A . n 
A 1 225 TRP 225 266 266 TRP TRP A . n 
A 1 226 VAL 226 267 267 VAL VAL A . n 
A 1 227 ASP 227 268 268 ASP ASP A . n 
A 1 228 ILE 228 269 269 ILE ILE A . n 
A 1 229 ALA 229 270 270 ALA ALA A . n 
A 1 230 HIS 230 271 271 HIS HIS A . n 
A 1 231 LEU 231 272 272 LEU LEU A . n 
A 1 232 CYS 232 273 273 CYS CYS A . n 
A 1 233 LEU 233 274 274 LEU LEU A . n 
A 1 234 TYR 234 275 275 TYR TYR A . n 
A 1 235 ASN 235 276 276 ASN ASN A . n 
A 1 236 LEU 236 277 277 LEU LEU A . n 
A 1 237 SER 237 278 278 SER SER A . n 
A 1 238 VAL 238 279 279 VAL VAL A . n 
A 1 239 ILE 239 280 280 ILE ILE A . n 
A 1 240 HIS 240 281 281 HIS HIS A . n 
A 1 241 LYS 241 282 282 LYS LYS A . n 
A 1 242 LYS 242 283 283 LYS LYS A . n 
A 1 243 LYS 243 284 284 LYS LYS A . n 
A 1 244 TYR 244 285 285 TYR TYR A . n 
A 1 245 PHE 245 286 286 PHE PHE A . n 
A 1 246 ASP 246 287 287 ASP ASP A . n 
A 1 247 SER 247 288 288 SER SER A . n 
A 1 248 GLU 248 289 289 GLU GLU A . n 
A 1 249 LEU 249 290 290 LEU LEU A . n 
A 1 250 GLU 250 291 291 GLU GLU A . n 
A 1 251 LEU 251 292 292 LEU LEU A . n 
A 1 252 MET 252 293 293 MET MET A . n 
A 1 253 THR 253 294 294 THR THR A . n 
A 1 254 TYR 254 295 295 TYR TYR A . n 
A 1 255 ILE 255 296 296 ILE ILE A . n 
A 1 256 ASN 256 297 297 ASN ASN A . n 
A 1 257 GLU 257 298 298 GLU GLU A . n 
A 1 258 ASN 258 299 299 ASN ASN A . n 
A 1 259 TRP 259 300 300 TRP TRP A . n 
A 1 260 ASP 260 301 301 ASP ASP A . n 
A 1 261 ARG 261 302 302 ARG ARG A . n 
A 1 262 LEU 262 303 303 LEU LEU A . n 
A 1 263 HIS 263 304 304 HIS HIS A . n 
A 1 264 PRO 264 305 305 PRO PRO A . n 
A 1 265 GLY 265 306 306 GLY GLY A . n 
A 1 266 GLU 266 307 307 GLU GLU A . n 
A 1 267 LEU 267 308 308 LEU LEU A . n 
A 1 268 ALA 268 309 309 ALA ALA A . n 
A 1 269 ASP 269 310 310 ASP ASP A . n 
A 1 270 THR 270 311 311 THR THR A . n 
A 1 271 PRO 271 312 312 PRO PRO A . n 
A 1 272 LYS 272 313 313 LYS LYS A . n 
A 1 273 SER 273 314 314 SER SER A . n 
A 1 274 GLU 274 315 315 GLU GLU A . n 
A 1 275 ARG 275 316 316 ARG ARG A . n 
A 1 276 TYR 276 317 317 TYR TYR A . n 
A 1 277 GLU 277 318 318 GLU GLU A . n 
A 1 278 HIS 278 319 319 HIS HIS A . n 
A 1 279 VAL 279 320 320 VAL VAL A . n 
A 1 280 LEU 280 321 321 LEU LEU A . n 
A 1 281 GLU 281 322 322 GLU GLU A . n 
A 1 282 ALA 282 323 323 ALA ALA A . n 
A 1 283 LEU 283 324 324 LEU LEU A . n 
A 1 284 ASN 284 325 325 ASN ASN A . n 
A 1 285 ASP 285 326 326 ASP ASP A . n 
A 1 286 TYR 286 327 327 TYR TYR A . n 
A 1 287 LYS 287 328 328 LYS LYS A . n 
A 1 288 THR 288 329 329 THR THR A . n 
A 1 289 MET 289 330 330 MET MET A . n 
A 1 290 PHE 290 331 331 PHE PHE A . n 
A 1 291 MET 291 332 332 MET MET A . n 
A 1 292 SER 292 333 333 SER SER A . n 
A 1 293 GLY 293 334 334 GLY GLY A . n 
A 1 294 LYS 294 335 335 LYS LYS A . n 
A 1 295 GLU 295 336 336 GLU GLU A . n 
A 1 296 ILE 296 337 337 ILE ILE A . n 
A 1 297 LYS 297 338 338 LYS LYS A . n 
A 1 298 LYS 298 339 339 LYS LYS A . n 
A 1 299 LYS 299 340 340 LYS LYS A . n 
A 1 300 LYS 300 341 341 LYS LYS A . n 
A 1 301 HIS 301 342 342 HIS HIS A . n 
A 1 302 LEU 302 343 343 LEU LEU A . n 
A 1 303 PHE 303 344 344 PHE PHE A . n 
A 1 304 GLY 304 345 345 GLY GLY A . n 
A 1 305 LEU 305 346 346 LEU LEU A . n 
A 1 306 ARG 306 347 347 ARG ARG A . n 
A 1 307 ILE 307 348 348 ILE ILE A . n 
A 1 308 ARG 308 349 349 ARG ARG A . n 
A 1 309 VAL 309 350 350 VAL VAL A . n 
A 1 310 PRO 310 351 351 PRO PRO A . n 
A 1 311 PRO 311 352 352 PRO PRO A . n 
A 1 312 VAL 312 353 353 VAL VAL A . n 
A 1 313 PRO 313 354 354 PRO PRO A . n 
A 1 314 PRO 314 355 355 PRO PRO A . n 
A 1 315 ASN 315 356 356 ASN ASN A . n 
A 1 316 VAL 316 357 357 VAL VAL A . n 
A 1 317 ALA 317 358 ?   ?   ?   A . n 
B 1 1   SER 1   42  ?   ?   ?   B . n 
B 1 2   ALA 2   43  ?   ?   ?   B . n 
B 1 3   CYS 3   44  ?   ?   ?   B . n 
B 1 4   LYS 4   45  45  LYS LYS B . n 
B 1 5   PHE 5   46  46  PHE PHE B . n 
B 1 6   GLU 6   47  47  GLU GLU B . n 
B 1 7   GLU 7   48  48  GLU GLU B . n 
B 1 8   GLY 8   49  49  GLY GLY B . n 
B 1 9   GLN 9   50  50  GLN GLN B . n 
B 1 10  ASP 10  51  51  ASP ASP B . n 
B 1 11  VAL 11  52  52  VAL VAL B . n 
B 1 12  LEU 12  53  53  LEU LEU B . n 
B 1 13  ALA 13  54  54  ALA ALA B . n 
B 1 14  ARG 14  55  55  ARG ARG B . n 
B 1 15  TRP 15  56  56  TRP TRP B . n 
B 1 16  SER 16  57  57  SER SER B . n 
B 1 17  ASP 17  58  58  ASP ASP B . n 
B 1 18  GLY 18  59  59  GLY GLY B . n 
B 1 19  LEU 19  60  60  LEU LEU B . n 
B 1 20  PHE 20  61  61  PHE PHE B . n 
B 1 21  TYR 21  62  62  TYR TYR B . n 
B 1 22  LEU 22  63  63  LEU LEU B . n 
B 1 23  GLY 23  64  64  GLY GLY B . n 
B 1 24  THR 24  65  65  THR THR B . n 
B 1 25  ILE 25  66  66  ILE ILE B . n 
B 1 26  LYS 26  67  67  LYS LYS B . n 
B 1 27  LYS 27  68  68  LYS LYS B . n 
B 1 28  ILE 28  69  69  ILE ILE B . n 
B 1 29  ASN 29  70  70  ASN ASN B . n 
B 1 30  ILE 30  71  71  ILE ILE B . n 
B 1 31  LEU 31  72  72  LEU LEU B . n 
B 1 32  LYS 32  73  73  LYS LYS B . n 
B 1 33  GLN 33  74  74  GLN GLN B . n 
B 1 34  SER 34  75  75  SER SER B . n 
B 1 35  CYS 35  76  76  CYS CYS B . n 
B 1 36  PHE 36  77  77  PHE PHE B . n 
B 1 37  ILE 37  78  78  ILE ILE B . n 
B 1 38  ILE 38  79  79  ILE ILE B . n 
B 1 39  PHE 39  80  80  PHE PHE B . n 
B 1 40  GLU 40  81  81  GLU GLU B . n 
B 1 41  ASP 41  82  82  ASP ASP B . n 
B 1 42  SER 42  83  83  SER SER B . n 
B 1 43  SER 43  84  84  SER SER B . n 
B 1 44  LYS 44  85  85  LYS LYS B . n 
B 1 45  SER 45  86  86  SER SER B . n 
B 1 46  TRP 46  87  87  TRP TRP B . n 
B 1 47  VAL 47  88  88  VAL VAL B . n 
B 1 48  LEU 48  89  89  LEU LEU B . n 
B 1 49  TRP 49  90  90  TRP TRP B . n 
B 1 50  LYS 50  91  91  LYS LYS B . n 
B 1 51  ASP 51  92  92  ASP ASP B . n 
B 1 52  ILE 52  93  93  ILE ILE B . n 
B 1 53  GLN 53  94  94  GLN GLN B . n 
B 1 54  THR 54  95  95  THR THR B . n 
B 1 55  GLY 55  96  ?   ?   ?   B . n 
B 1 56  ALA 56  97  ?   ?   ?   B . n 
B 1 57  THR 57  98  ?   ?   ?   B . n 
B 1 58  GLY 58  99  ?   ?   ?   B . n 
B 1 59  SER 59  100 ?   ?   ?   B . n 
B 1 60  GLY 60  101 ?   ?   ?   B . n 
B 1 61  GLU 61  102 ?   ?   ?   B . n 
B 1 62  MET 62  103 ?   ?   ?   B . n 
B 1 63  VAL 63  104 ?   ?   ?   B . n 
B 1 64  CYS 64  105 105 CYS CYS B . n 
B 1 65  THR 65  106 106 THR THR B . n 
B 1 66  ILE 66  107 107 ILE ILE B . n 
B 1 67  CYS 67  108 108 CYS CYS B . n 
B 1 68  GLN 68  109 109 GLN GLN B . n 
B 1 69  GLU 69  110 110 GLU GLU B . n 
B 1 70  GLU 70  111 111 GLU GLU B . n 
B 1 71  TYR 71  112 112 TYR TYR B . n 
B 1 72  SER 72  113 113 SER SER B . n 
B 1 73  GLU 73  114 114 GLU GLU B . n 
B 1 74  ALA 74  115 115 ALA ALA B . n 
B 1 75  PRO 75  116 116 PRO PRO B . n 
B 1 76  ASN 76  117 117 ASN ASN B . n 
B 1 77  GLU 77  118 118 GLU GLU B . n 
B 1 78  MET 78  119 119 MET MET B . n 
B 1 79  VAL 79  120 120 VAL VAL B . n 
B 1 80  ILE 80  121 121 ILE ILE B . n 
B 1 81  CYS 81  122 122 CYS CYS B . n 
B 1 82  ASP 82  123 123 ASP ASP B . n 
B 1 83  LYS 83  124 124 LYS LYS B . n 
B 1 84  CYS 84  125 125 CYS CYS B . n 
B 1 85  GLY 85  126 126 GLY GLY B . n 
B 1 86  GLN 86  127 127 GLN GLN B . n 
B 1 87  GLY 87  128 128 GLY GLY B . n 
B 1 88  TYR 88  129 129 TYR TYR B . n 
B 1 89  HIS 89  130 130 HIS HIS B . n 
B 1 90  GLN 90  131 131 GLN GLN B . n 
B 1 91  LEU 91  132 132 LEU LEU B . n 
B 1 92  CYS 92  133 133 CYS CYS B . n 
B 1 93  HIS 93  134 134 HIS HIS B . n 
B 1 94  THR 94  135 135 THR THR B . n 
B 1 95  PRO 95  136 136 PRO PRO B . n 
B 1 96  HIS 96  137 137 HIS HIS B . n 
B 1 97  ILE 97  138 138 ILE ILE B . n 
B 1 98  ASP 98  139 139 ASP ASP B . n 
B 1 99  CYS 99  140 140 CYS CYS B . n 
B 1 100 SER 100 141 ?   ?   ?   B . n 
B 1 101 VAL 101 142 ?   ?   ?   B . n 
B 1 102 ILE 102 143 ?   ?   ?   B . n 
B 1 103 ASP 103 144 ?   ?   ?   B . n 
B 1 104 SER 104 145 ?   ?   ?   B . n 
B 1 105 ASP 105 146 ?   ?   ?   B . n 
B 1 106 GLU 106 147 ?   ?   ?   B . n 
B 1 107 LYS 107 148 148 LYS LYS B . n 
B 1 108 TRP 108 149 149 TRP TRP B . n 
B 1 109 LEU 109 150 150 LEU LEU B . n 
B 1 110 CYS 110 151 151 CYS CYS B . n 
B 1 111 ARG 111 152 152 ARG ARG B . n 
B 1 112 GLN 112 153 153 GLN GLN B . n 
B 1 113 CYS 113 154 154 CYS CYS B . n 
B 1 114 VAL 114 155 155 VAL VAL B . n 
B 1 115 PHE 115 156 156 PHE PHE B . n 
B 1 116 ALA 116 157 157 ALA ALA B . n 
B 1 117 THR 117 158 158 THR THR B . n 
B 1 118 THR 118 159 159 THR THR B . n 
B 1 119 THR 119 160 160 THR THR B . n 
B 1 120 LYS 120 161 161 LYS LYS B . n 
B 1 121 ARG 121 162 162 ARG ARG B . n 
B 1 122 GLY 122 163 163 GLY GLY B . n 
B 1 123 GLY 123 164 164 GLY GLY B . n 
B 1 124 ALA 124 165 165 ALA ALA B . n 
B 1 125 LEU 125 166 166 LEU LEU B . n 
B 1 126 LYS 126 167 167 LYS LYS B . n 
B 1 127 LYS 127 168 168 LYS LYS B . n 
B 1 128 GLY 128 169 169 GLY GLY B . n 
B 1 129 PRO 129 170 170 PRO PRO B . n 
B 1 130 ASN 130 171 171 ASN ASN B . n 
B 1 131 ALA 131 172 172 ALA ALA B . n 
B 1 132 LYS 132 173 173 LYS LYS B . n 
B 1 133 ALA 133 174 174 ALA ALA B . n 
B 1 134 LEU 134 175 175 LEU LEU B . n 
B 1 135 GLN 135 176 176 GLN GLN B . n 
B 1 136 VAL 136 177 177 VAL VAL B . n 
B 1 137 MET 137 178 178 MET MET B . n 
B 1 138 LYS 138 179 179 LYS LYS B . n 
B 1 139 GLN 139 180 180 GLN GLN B . n 
B 1 140 THR 140 181 181 THR THR B . n 
B 1 141 LEU 141 182 182 LEU LEU B . n 
B 1 142 PRO 142 183 183 PRO PRO B . n 
B 1 143 TYR 143 184 184 TYR TYR B . n 
B 1 144 SER 144 185 185 SER SER B . n 
B 1 145 VAL 145 186 186 VAL VAL B . n 
B 1 146 ALA 146 187 187 ALA ALA B . n 
B 1 147 ASP 147 188 188 ASP ASP B . n 
B 1 148 LEU 148 189 189 LEU LEU B . n 
B 1 149 GLU 149 190 190 GLU GLU B . n 
B 1 150 TRP 150 191 191 TRP TRP B . n 
B 1 151 ASP 151 192 192 ASP ASP B . n 
B 1 152 ALA 152 193 193 ALA ALA B . n 
B 1 153 GLY 153 194 194 GLY GLY B . n 
B 1 154 HIS 154 195 195 HIS HIS B . n 
B 1 155 LYS 155 196 196 LYS LYS B . n 
B 1 156 THR 156 197 197 THR THR B . n 
B 1 157 ASN 157 198 198 ASN ASN B . n 
B 1 158 VAL 158 199 199 VAL VAL B . n 
B 1 159 GLN 159 200 200 GLN GLN B . n 
B 1 160 GLN 160 201 201 GLN GLN B . n 
B 1 161 CYS 161 202 202 CYS CYS B . n 
B 1 162 TYR 162 203 203 TYR TYR B . n 
B 1 163 CYS 163 204 204 CYS CYS B . n 
B 1 164 TYR 164 205 205 TYR TYR B . n 
B 1 165 CYS 165 206 206 CYS CYS B . n 
B 1 166 GLY 166 207 207 GLY GLY B . n 
B 1 167 GLY 167 208 208 GLY GLY B . n 
B 1 168 PRO 168 209 209 PRO PRO B . n 
B 1 169 GLY 169 210 210 GLY GLY B . n 
B 1 170 ASP 170 211 211 ASP ASP B . n 
B 1 171 TRP 171 212 212 TRP TRP B . n 
B 1 172 TYR 172 213 213 TYR TYR B . n 
B 1 173 LEU 173 214 214 LEU LEU B . n 
B 1 174 LYS 174 215 215 LYS LYS B . n 
B 1 175 MET 175 216 216 MET MET B . n 
B 1 176 LEU 176 217 217 LEU LEU B . n 
B 1 177 GLN 177 218 218 GLN GLN B . n 
B 1 178 CYS 178 219 219 CYS CYS B . n 
B 1 179 CYS 179 220 220 CYS CYS B . n 
B 1 180 LYS 180 221 221 LYS LYS B . n 
B 1 181 CYS 181 222 222 CYS CYS B . n 
B 1 182 LYS 182 223 223 LYS LYS B . n 
B 1 183 GLN 183 224 224 GLN GLN B . n 
B 1 184 TRP 184 225 225 TRP TRP B . n 
B 1 185 PHE 185 226 226 PHE PHE B . n 
B 1 186 HIS 186 227 227 HIS HIS B . n 
B 1 187 GLU 187 228 228 GLU GLU B . n 
B 1 188 ALA 188 229 229 ALA ALA B . n 
B 1 189 CYS 189 230 230 CYS CYS B . n 
B 1 190 VAL 190 231 231 VAL VAL B . n 
B 1 191 GLN 191 232 232 GLN GLN B . n 
B 1 192 CYS 192 233 233 CYS CYS B . n 
B 1 193 LEU 193 234 234 LEU LEU B . n 
B 1 194 GLN 194 235 235 GLN GLN B . n 
B 1 195 LYS 195 236 236 LYS LYS B . n 
B 1 196 PRO 196 237 237 PRO PRO B . n 
B 1 197 MET 197 238 238 MET MET B . n 
B 1 198 LEU 198 239 239 LEU LEU B . n 
B 1 199 PHE 199 240 240 PHE PHE B . n 
B 1 200 GLY 200 241 241 GLY GLY B . n 
B 1 201 ASP 201 242 242 ASP ASP B . n 
B 1 202 ARG 202 243 243 ARG ARG B . n 
B 1 203 PHE 203 244 244 PHE PHE B . n 
B 1 204 TYR 204 245 245 TYR TYR B . n 
B 1 205 THR 205 246 246 THR THR B . n 
B 1 206 PHE 206 247 247 PHE PHE B . n 
B 1 207 ILE 207 248 248 ILE ILE B . n 
B 1 208 CYS 208 249 249 CYS CYS B . n 
B 1 209 SER 209 250 250 SER SER B . n 
B 1 210 VAL 210 251 251 VAL VAL B . n 
B 1 211 CYS 211 252 252 CYS CYS B . n 
B 1 212 SER 212 253 253 SER SER B . n 
B 1 213 SER 213 254 254 SER SER B . n 
B 1 214 GLY 214 255 255 GLY GLY B . n 
B 1 215 PRO 215 256 256 PRO PRO B . n 
B 1 216 GLU 216 257 257 GLU GLU B . n 
B 1 217 TYR 217 258 258 TYR TYR B . n 
B 1 218 LEU 218 259 259 LEU LEU B . n 
B 1 219 LYS 219 260 260 LYS LYS B . n 
B 1 220 ARG 220 261 261 ARG ARG B . n 
B 1 221 LEU 221 262 262 LEU LEU B . n 
B 1 222 PRO 222 263 263 PRO PRO B . n 
B 1 223 LEU 223 264 264 LEU LEU B . n 
B 1 224 GLN 224 265 265 GLN GLN B . n 
B 1 225 TRP 225 266 266 TRP TRP B . n 
B 1 226 VAL 226 267 267 VAL VAL B . n 
B 1 227 ASP 227 268 268 ASP ASP B . n 
B 1 228 ILE 228 269 269 ILE ILE B . n 
B 1 229 ALA 229 270 270 ALA ALA B . n 
B 1 230 HIS 230 271 271 HIS HIS B . n 
B 1 231 LEU 231 272 272 LEU LEU B . n 
B 1 232 CYS 232 273 273 CYS CYS B . n 
B 1 233 LEU 233 274 274 LEU LEU B . n 
B 1 234 TYR 234 275 275 TYR TYR B . n 
B 1 235 ASN 235 276 276 ASN ASN B . n 
B 1 236 LEU 236 277 277 LEU LEU B . n 
B 1 237 SER 237 278 278 SER SER B . n 
B 1 238 VAL 238 279 279 VAL VAL B . n 
B 1 239 ILE 239 280 280 ILE ILE B . n 
B 1 240 HIS 240 281 281 HIS HIS B . n 
B 1 241 LYS 241 282 282 LYS LYS B . n 
B 1 242 LYS 242 283 283 LYS LYS B . n 
B 1 243 LYS 243 284 284 LYS LYS B . n 
B 1 244 TYR 244 285 285 TYR TYR B . n 
B 1 245 PHE 245 286 286 PHE PHE B . n 
B 1 246 ASP 246 287 287 ASP ASP B . n 
B 1 247 SER 247 288 288 SER SER B . n 
B 1 248 GLU 248 289 289 GLU GLU B . n 
B 1 249 LEU 249 290 290 LEU LEU B . n 
B 1 250 GLU 250 291 291 GLU GLU B . n 
B 1 251 LEU 251 292 292 LEU LEU B . n 
B 1 252 MET 252 293 293 MET MET B . n 
B 1 253 THR 253 294 294 THR THR B . n 
B 1 254 TYR 254 295 295 TYR TYR B . n 
B 1 255 ILE 255 296 296 ILE ILE B . n 
B 1 256 ASN 256 297 297 ASN ASN B . n 
B 1 257 GLU 257 298 298 GLU GLU B . n 
B 1 258 ASN 258 299 299 ASN ASN B . n 
B 1 259 TRP 259 300 300 TRP TRP B . n 
B 1 260 ASP 260 301 301 ASP ASP B . n 
B 1 261 ARG 261 302 302 ARG ARG B . n 
B 1 262 LEU 262 303 303 LEU LEU B . n 
B 1 263 HIS 263 304 304 HIS HIS B . n 
B 1 264 PRO 264 305 305 PRO PRO B . n 
B 1 265 GLY 265 306 306 GLY GLY B . n 
B 1 266 GLU 266 307 307 GLU GLU B . n 
B 1 267 LEU 267 308 308 LEU LEU B . n 
B 1 268 ALA 268 309 309 ALA ALA B . n 
B 1 269 ASP 269 310 310 ASP ASP B . n 
B 1 270 THR 270 311 311 THR THR B . n 
B 1 271 PRO 271 312 312 PRO PRO B . n 
B 1 272 LYS 272 313 313 LYS LYS B . n 
B 1 273 SER 273 314 314 SER SER B . n 
B 1 274 GLU 274 315 315 GLU GLU B . n 
B 1 275 ARG 275 316 316 ARG ARG B . n 
B 1 276 TYR 276 317 317 TYR TYR B . n 
B 1 277 GLU 277 318 318 GLU GLU B . n 
B 1 278 HIS 278 319 319 HIS HIS B . n 
B 1 279 VAL 279 320 320 VAL VAL B . n 
B 1 280 LEU 280 321 321 LEU LEU B . n 
B 1 281 GLU 281 322 322 GLU GLU B . n 
B 1 282 ALA 282 323 323 ALA ALA B . n 
B 1 283 LEU 283 324 324 LEU LEU B . n 
B 1 284 ASN 284 325 325 ASN ASN B . n 
B 1 285 ASP 285 326 326 ASP ASP B . n 
B 1 286 TYR 286 327 327 TYR TYR B . n 
B 1 287 LYS 287 328 328 LYS LYS B . n 
B 1 288 THR 288 329 329 THR THR B . n 
B 1 289 MET 289 330 330 MET MET B . n 
B 1 290 PHE 290 331 331 PHE PHE B . n 
B 1 291 MET 291 332 332 MET MET B . n 
B 1 292 SER 292 333 333 SER SER B . n 
B 1 293 GLY 293 334 334 GLY GLY B . n 
B 1 294 LYS 294 335 335 LYS LYS B . n 
B 1 295 GLU 295 336 336 GLU GLU B . n 
B 1 296 ILE 296 337 337 ILE ILE B . n 
B 1 297 LYS 297 338 338 LYS LYS B . n 
B 1 298 LYS 298 339 339 LYS LYS B . n 
B 1 299 LYS 299 340 340 LYS LYS B . n 
B 1 300 LYS 300 341 341 LYS LYS B . n 
B 1 301 HIS 301 342 342 HIS HIS B . n 
B 1 302 LEU 302 343 343 LEU LEU B . n 
B 1 303 PHE 303 344 344 PHE PHE B . n 
B 1 304 GLY 304 345 345 GLY GLY B . n 
B 1 305 LEU 305 346 346 LEU LEU B . n 
B 1 306 ARG 306 347 347 ARG ARG B . n 
B 1 307 ILE 307 348 348 ILE ILE B . n 
B 1 308 ARG 308 349 349 ARG ARG B . n 
B 1 309 VAL 309 350 350 VAL VAL B . n 
B 1 310 PRO 310 351 351 PRO PRO B . n 
B 1 311 PRO 311 352 352 PRO PRO B . n 
B 1 312 VAL 312 353 353 VAL VAL B . n 
B 1 313 PRO 313 354 354 PRO PRO B . n 
B 1 314 PRO 314 355 355 PRO PRO B . n 
B 1 315 ASN 315 356 356 ASN ASN B . n 
B 1 316 VAL 316 357 357 VAL VAL B . n 
B 1 317 ALA 317 358 358 ALA ALA B . n 
C 2 1   GLY 1   33  ?   ?   ?   C . n 
C 2 2   GLY 2   34  ?   ?   ?   C . n 
C 2 3   VAL 3   35  ?   ?   ?   C . n 
C 2 4   M3L 4   36  36  M3L M3L C . n 
C 2 5   LYS 5   37  37  LYS LYS C . n 
C 2 6   PRO 6   38  38  PRO PRO C . n 
C 2 7   HIS 7   39  ?   ?   ?   C . n 
C 2 8   ARG 8   40  ?   ?   ?   C . n 
D 2 1   GLY 1   33  ?   ?   ?   D . n 
D 2 2   GLY 2   34  ?   ?   ?   D . n 
D 2 3   VAL 3   35  ?   ?   ?   D . n 
D 2 4   M3L 4   36  36  M3L M3L D . n 
D 2 5   LYS 5   37  37  LYS LYS D . n 
D 2 6   PRO 6   38  38  PRO PRO D . n 
D 2 7   HIS 7   39  ?   ?   ?   D . n 
D 2 8   ARG 8   40  ?   ?   ?   D . n 
E 3 1   DG  1   1   1   DG  DG  E . n 
E 3 2   DG  2   2   2   DG  DG  E . n 
E 3 3   DG  3   3   3   DG  DG  E . n 
E 3 4   DC  4   4   4   DC  DC  E . n 
E 3 5   DG  5   5   5   DG  DG  E . n 
E 3 6   DG  6   6   6   DG  DG  E . n 
E 3 7   DC  7   7   7   DC  DC  E . n 
E 3 8   DC  8   8   8   DC  DC  E . n 
E 3 9   DG  9   9   9   DG  DG  E . n 
E 3 10  DC  10  10  10  DC  DC  E . n 
E 3 11  DC  11  11  11  DC  DC  E . n 
E 3 12  DC  12  12  12  DC  DC  E . n 
E 3 13  DT  13  13  13  DT  DT  E . n 
F 3 1   DG  1   1   1   DG  DG  F . n 
F 3 2   DG  2   2   2   DG  DG  F . n 
F 3 3   DG  3   3   3   DG  DG  F . n 
F 3 4   DC  4   4   4   DC  DC  F . n 
F 3 5   DG  5   5   5   DG  DG  F . n 
F 3 6   DG  6   6   6   DG  DG  F . n 
F 3 7   DC  7   7   7   DC  DC  F . n 
F 3 8   DC  8   8   8   DC  DC  F . n 
F 3 9   DG  9   9   9   DG  DG  F . n 
F 3 10  DC  10  10  10  DC  DC  F . n 
F 3 11  DC  11  11  11  DC  DC  F . n 
F 3 12  DC  12  12  12  DC  DC  F . n 
F 3 13  DT  13  13  13  DT  DT  F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 ZN  1   401 1   ZN  ZN  A . 
H 4 ZN  1   402 2   ZN  ZN  A . 
I 4 ZN  1   403 3   ZN  ZN  A . 
J 4 ZN  1   404 4   ZN  ZN  A . 
K 4 ZN  1   401 5   ZN  ZN  B . 
L 4 ZN  1   402 6   ZN  ZN  B . 
M 4 ZN  1   403 7   ZN  ZN  B . 
N 4 ZN  1   404 8   ZN  ZN  B . 
O 5 HOH 1   501 162 HOH HOH A . 
O 5 HOH 2   502 140 HOH HOH A . 
O 5 HOH 3   503 27  HOH HOH A . 
O 5 HOH 4   504 68  HOH HOH A . 
O 5 HOH 5   505 122 HOH HOH A . 
O 5 HOH 6   506 101 HOH HOH A . 
O 5 HOH 7   507 21  HOH HOH A . 
O 5 HOH 8   508 331 HOH HOH A . 
O 5 HOH 9   509 23  HOH HOH A . 
O 5 HOH 10  510 17  HOH HOH A . 
O 5 HOH 11  511 45  HOH HOH A . 
O 5 HOH 12  512 11  HOH HOH A . 
O 5 HOH 13  513 46  HOH HOH A . 
O 5 HOH 14  514 143 HOH HOH A . 
O 5 HOH 15  515 141 HOH HOH A . 
O 5 HOH 16  516 18  HOH HOH A . 
O 5 HOH 17  517 213 HOH HOH A . 
O 5 HOH 18  518 7   HOH HOH A . 
O 5 HOH 19  519 14  HOH HOH A . 
O 5 HOH 20  520 167 HOH HOH A . 
O 5 HOH 21  521 1   HOH HOH A . 
O 5 HOH 22  522 32  HOH HOH A . 
O 5 HOH 23  523 280 HOH HOH A . 
O 5 HOH 24  524 24  HOH HOH A . 
O 5 HOH 25  525 35  HOH HOH A . 
O 5 HOH 26  526 73  HOH HOH A . 
O 5 HOH 27  527 302 HOH HOH A . 
O 5 HOH 28  528 124 HOH HOH A . 
O 5 HOH 29  529 100 HOH HOH A . 
O 5 HOH 30  530 129 HOH HOH A . 
O 5 HOH 31  531 175 HOH HOH A . 
O 5 HOH 32  532 248 HOH HOH A . 
O 5 HOH 33  533 41  HOH HOH A . 
O 5 HOH 34  534 50  HOH HOH A . 
O 5 HOH 35  535 258 HOH HOH A . 
O 5 HOH 36  536 20  HOH HOH A . 
O 5 HOH 37  537 89  HOH HOH A . 
O 5 HOH 38  538 19  HOH HOH A . 
O 5 HOH 39  539 183 HOH HOH A . 
O 5 HOH 40  540 43  HOH HOH A . 
O 5 HOH 41  541 309 HOH HOH A . 
O 5 HOH 42  542 110 HOH HOH A . 
O 5 HOH 43  543 166 HOH HOH A . 
O 5 HOH 44  544 212 HOH HOH A . 
O 5 HOH 45  545 95  HOH HOH A . 
O 5 HOH 46  546 39  HOH HOH A . 
O 5 HOH 47  547 232 HOH HOH A . 
O 5 HOH 48  548 88  HOH HOH A . 
O 5 HOH 49  549 121 HOH HOH A . 
O 5 HOH 50  550 147 HOH HOH A . 
O 5 HOH 51  551 169 HOH HOH A . 
O 5 HOH 52  552 48  HOH HOH A . 
O 5 HOH 53  553 286 HOH HOH A . 
O 5 HOH 54  554 263 HOH HOH A . 
O 5 HOH 55  555 64  HOH HOH A . 
O 5 HOH 56  556 207 HOH HOH A . 
O 5 HOH 57  557 5   HOH HOH A . 
O 5 HOH 58  558 238 HOH HOH A . 
O 5 HOH 59  559 40  HOH HOH A . 
O 5 HOH 60  560 37  HOH HOH A . 
O 5 HOH 61  561 51  HOH HOH A . 
O 5 HOH 62  562 102 HOH HOH A . 
O 5 HOH 63  563 255 HOH HOH A . 
O 5 HOH 64  564 103 HOH HOH A . 
O 5 HOH 65  565 78  HOH HOH A . 
O 5 HOH 66  566 33  HOH HOH A . 
O 5 HOH 67  567 12  HOH HOH A . 
O 5 HOH 68  568 240 HOH HOH A . 
O 5 HOH 69  569 29  HOH HOH A . 
O 5 HOH 70  570 61  HOH HOH A . 
O 5 HOH 71  571 182 HOH HOH A . 
O 5 HOH 72  572 211 HOH HOH A . 
O 5 HOH 73  573 253 HOH HOH A . 
O 5 HOH 74  574 84  HOH HOH A . 
O 5 HOH 75  575 236 HOH HOH A . 
O 5 HOH 76  576 325 HOH HOH A . 
O 5 HOH 77  577 242 HOH HOH A . 
O 5 HOH 78  578 326 HOH HOH A . 
O 5 HOH 79  579 2   HOH HOH A . 
O 5 HOH 80  580 76  HOH HOH A . 
O 5 HOH 81  581 319 HOH HOH A . 
O 5 HOH 82  582 44  HOH HOH A . 
O 5 HOH 83  583 177 HOH HOH A . 
O 5 HOH 84  584 297 HOH HOH A . 
O 5 HOH 85  585 241 HOH HOH A . 
O 5 HOH 86  586 278 HOH HOH A . 
O 5 HOH 87  587 328 HOH HOH A . 
O 5 HOH 88  588 209 HOH HOH A . 
O 5 HOH 89  589 171 HOH HOH A . 
O 5 HOH 90  590 254 HOH HOH A . 
O 5 HOH 91  591 56  HOH HOH A . 
O 5 HOH 92  592 148 HOH HOH A . 
O 5 HOH 93  593 218 HOH HOH A . 
O 5 HOH 94  594 320 HOH HOH A . 
O 5 HOH 95  595 223 HOH HOH A . 
O 5 HOH 96  596 67  HOH HOH A . 
O 5 HOH 97  597 52  HOH HOH A . 
O 5 HOH 98  598 277 HOH HOH A . 
O 5 HOH 99  599 179 HOH HOH A . 
O 5 HOH 100 600 200 HOH HOH A . 
O 5 HOH 101 601 77  HOH HOH A . 
O 5 HOH 102 602 54  HOH HOH A . 
O 5 HOH 103 603 172 HOH HOH A . 
O 5 HOH 104 604 181 HOH HOH A . 
O 5 HOH 105 605 55  HOH HOH A . 
O 5 HOH 106 606 9   HOH HOH A . 
O 5 HOH 107 607 159 HOH HOH A . 
O 5 HOH 108 608 127 HOH HOH A . 
O 5 HOH 109 609 227 HOH HOH A . 
O 5 HOH 110 610 156 HOH HOH A . 
O 5 HOH 111 611 237 HOH HOH A . 
O 5 HOH 112 612 300 HOH HOH A . 
O 5 HOH 113 613 204 HOH HOH A . 
O 5 HOH 114 614 289 HOH HOH A . 
O 5 HOH 115 615 79  HOH HOH A . 
O 5 HOH 116 616 205 HOH HOH A . 
O 5 HOH 117 617 234 HOH HOH A . 
O 5 HOH 118 618 225 HOH HOH A . 
O 5 HOH 119 619 59  HOH HOH A . 
O 5 HOH 120 620 113 HOH HOH A . 
O 5 HOH 121 621 198 HOH HOH A . 
O 5 HOH 122 622 216 HOH HOH A . 
O 5 HOH 123 623 63  HOH HOH A . 
O 5 HOH 124 624 244 HOH HOH A . 
O 5 HOH 125 625 290 HOH HOH A . 
O 5 HOH 126 626 75  HOH HOH A . 
O 5 HOH 127 627 294 HOH HOH A . 
O 5 HOH 128 628 274 HOH HOH A . 
O 5 HOH 129 629 186 HOH HOH A . 
O 5 HOH 130 630 112 HOH HOH A . 
O 5 HOH 131 631 322 HOH HOH A . 
O 5 HOH 132 632 314 HOH HOH A . 
O 5 HOH 133 633 69  HOH HOH A . 
O 5 HOH 134 634 287 HOH HOH A . 
O 5 HOH 135 635 260 HOH HOH A . 
O 5 HOH 136 636 161 HOH HOH A . 
O 5 HOH 137 637 153 HOH HOH A . 
O 5 HOH 138 638 178 HOH HOH A . 
O 5 HOH 139 639 327 HOH HOH A . 
O 5 HOH 140 640 214 HOH HOH A . 
O 5 HOH 141 641 47  HOH HOH A . 
O 5 HOH 142 642 104 HOH HOH A . 
O 5 HOH 143 643 249 HOH HOH A . 
O 5 HOH 144 644 284 HOH HOH A . 
O 5 HOH 145 645 65  HOH HOH A . 
O 5 HOH 146 646 219 HOH HOH A . 
O 5 HOH 147 647 317 HOH HOH A . 
O 5 HOH 148 648 229 HOH HOH A . 
O 5 HOH 149 649 323 HOH HOH A . 
O 5 HOH 150 650 217 HOH HOH A . 
O 5 HOH 151 651 164 HOH HOH A . 
P 5 HOH 1   501 58  HOH HOH B . 
P 5 HOH 2   502 157 HOH HOH B . 
P 5 HOH 3   503 226 HOH HOH B . 
P 5 HOH 4   504 201 HOH HOH B . 
P 5 HOH 5   505 22  HOH HOH B . 
P 5 HOH 6   506 189 HOH HOH B . 
P 5 HOH 7   507 266 HOH HOH B . 
P 5 HOH 8   508 281 HOH HOH B . 
P 5 HOH 9   509 136 HOH HOH B . 
P 5 HOH 10  510 128 HOH HOH B . 
P 5 HOH 11  511 158 HOH HOH B . 
P 5 HOH 12  512 202 HOH HOH B . 
P 5 HOH 13  513 272 HOH HOH B . 
P 5 HOH 14  514 301 HOH HOH B . 
P 5 HOH 15  515 120 HOH HOH B . 
P 5 HOH 16  516 85  HOH HOH B . 
P 5 HOH 17  517 174 HOH HOH B . 
P 5 HOH 18  518 188 HOH HOH B . 
P 5 HOH 19  519 199 HOH HOH B . 
P 5 HOH 20  520 49  HOH HOH B . 
P 5 HOH 21  521 193 HOH HOH B . 
P 5 HOH 22  522 279 HOH HOH B . 
P 5 HOH 23  523 109 HOH HOH B . 
P 5 HOH 24  524 4   HOH HOH B . 
P 5 HOH 25  525 42  HOH HOH B . 
P 5 HOH 26  526 105 HOH HOH B . 
P 5 HOH 27  527 276 HOH HOH B . 
P 5 HOH 28  528 180 HOH HOH B . 
P 5 HOH 29  529 25  HOH HOH B . 
P 5 HOH 30  530 30  HOH HOH B . 
P 5 HOH 31  531 146 HOH HOH B . 
P 5 HOH 32  532 28  HOH HOH B . 
P 5 HOH 33  533 70  HOH HOH B . 
P 5 HOH 34  534 66  HOH HOH B . 
P 5 HOH 35  535 119 HOH HOH B . 
P 5 HOH 36  536 80  HOH HOH B . 
P 5 HOH 37  537 3   HOH HOH B . 
P 5 HOH 38  538 15  HOH HOH B . 
P 5 HOH 39  539 83  HOH HOH B . 
P 5 HOH 40  540 99  HOH HOH B . 
P 5 HOH 41  541 74  HOH HOH B . 
P 5 HOH 42  542 126 HOH HOH B . 
P 5 HOH 43  543 86  HOH HOH B . 
P 5 HOH 44  544 252 HOH HOH B . 
P 5 HOH 45  545 31  HOH HOH B . 
P 5 HOH 46  546 106 HOH HOH B . 
P 5 HOH 47  547 206 HOH HOH B . 
P 5 HOH 48  548 269 HOH HOH B . 
P 5 HOH 49  549 72  HOH HOH B . 
P 5 HOH 50  550 144 HOH HOH B . 
P 5 HOH 51  551 313 HOH HOH B . 
P 5 HOH 52  552 60  HOH HOH B . 
P 5 HOH 53  553 330 HOH HOH B . 
P 5 HOH 54  554 192 HOH HOH B . 
P 5 HOH 55  555 190 HOH HOH B . 
P 5 HOH 56  556 185 HOH HOH B . 
P 5 HOH 57  557 53  HOH HOH B . 
P 5 HOH 58  558 163 HOH HOH B . 
P 5 HOH 59  559 107 HOH HOH B . 
P 5 HOH 60  560 150 HOH HOH B . 
P 5 HOH 61  561 117 HOH HOH B . 
P 5 HOH 62  562 123 HOH HOH B . 
P 5 HOH 63  563 81  HOH HOH B . 
P 5 HOH 64  564 36  HOH HOH B . 
P 5 HOH 65  565 310 HOH HOH B . 
P 5 HOH 66  566 16  HOH HOH B . 
P 5 HOH 67  567 26  HOH HOH B . 
P 5 HOH 68  568 93  HOH HOH B . 
P 5 HOH 69  569 97  HOH HOH B . 
P 5 HOH 70  570 246 HOH HOH B . 
P 5 HOH 71  571 142 HOH HOH B . 
P 5 HOH 72  572 165 HOH HOH B . 
P 5 HOH 73  573 34  HOH HOH B . 
P 5 HOH 74  574 96  HOH HOH B . 
P 5 HOH 75  575 154 HOH HOH B . 
P 5 HOH 76  576 10  HOH HOH B . 
P 5 HOH 77  577 62  HOH HOH B . 
P 5 HOH 78  578 257 HOH HOH B . 
P 5 HOH 79  579 135 HOH HOH B . 
P 5 HOH 80  580 256 HOH HOH B . 
P 5 HOH 81  581 293 HOH HOH B . 
P 5 HOH 82  582 196 HOH HOH B . 
P 5 HOH 83  583 108 HOH HOH B . 
P 5 HOH 84  584 118 HOH HOH B . 
P 5 HOH 85  585 195 HOH HOH B . 
P 5 HOH 86  586 92  HOH HOH B . 
P 5 HOH 87  587 267 HOH HOH B . 
P 5 HOH 88  588 264 HOH HOH B . 
P 5 HOH 89  589 90  HOH HOH B . 
P 5 HOH 90  590 155 HOH HOH B . 
P 5 HOH 91  591 222 HOH HOH B . 
P 5 HOH 92  592 316 HOH HOH B . 
P 5 HOH 93  593 298 HOH HOH B . 
P 5 HOH 94  594 82  HOH HOH B . 
P 5 HOH 95  595 208 HOH HOH B . 
P 5 HOH 96  596 168 HOH HOH B . 
P 5 HOH 97  597 220 HOH HOH B . 
P 5 HOH 98  598 87  HOH HOH B . 
P 5 HOH 99  599 13  HOH HOH B . 
P 5 HOH 100 600 259 HOH HOH B . 
P 5 HOH 101 601 6   HOH HOH B . 
P 5 HOH 102 602 71  HOH HOH B . 
P 5 HOH 103 603 247 HOH HOH B . 
P 5 HOH 104 604 251 HOH HOH B . 
P 5 HOH 105 605 38  HOH HOH B . 
P 5 HOH 106 606 231 HOH HOH B . 
P 5 HOH 107 607 283 HOH HOH B . 
P 5 HOH 108 608 98  HOH HOH B . 
P 5 HOH 109 609 152 HOH HOH B . 
P 5 HOH 110 610 221 HOH HOH B . 
P 5 HOH 111 611 8   HOH HOH B . 
P 5 HOH 112 612 285 HOH HOH B . 
P 5 HOH 113 613 203 HOH HOH B . 
P 5 HOH 114 614 57  HOH HOH B . 
P 5 HOH 115 615 239 HOH HOH B . 
P 5 HOH 116 616 315 HOH HOH B . 
P 5 HOH 117 617 275 HOH HOH B . 
P 5 HOH 118 618 307 HOH HOH B . 
P 5 HOH 119 619 194 HOH HOH B . 
P 5 HOH 120 620 288 HOH HOH B . 
P 5 HOH 121 621 311 HOH HOH B . 
P 5 HOH 122 622 116 HOH HOH B . 
P 5 HOH 123 623 230 HOH HOH B . 
P 5 HOH 124 624 270 HOH HOH B . 
P 5 HOH 125 625 228 HOH HOH B . 
P 5 HOH 126 626 137 HOH HOH B . 
P 5 HOH 127 627 111 HOH HOH B . 
P 5 HOH 128 628 250 HOH HOH B . 
P 5 HOH 129 629 233 HOH HOH B . 
P 5 HOH 130 630 94  HOH HOH B . 
P 5 HOH 131 631 170 HOH HOH B . 
P 5 HOH 132 632 318 HOH HOH B . 
P 5 HOH 133 633 305 HOH HOH B . 
P 5 HOH 134 634 303 HOH HOH B . 
P 5 HOH 135 635 149 HOH HOH B . 
P 5 HOH 136 636 91  HOH HOH B . 
P 5 HOH 137 637 306 HOH HOH B . 
P 5 HOH 138 638 282 HOH HOH B . 
P 5 HOH 139 639 115 HOH HOH B . 
P 5 HOH 140 640 125 HOH HOH B . 
P 5 HOH 141 641 262 HOH HOH B . 
P 5 HOH 142 642 295 HOH HOH B . 
P 5 HOH 143 643 299 HOH HOH B . 
P 5 HOH 144 644 291 HOH HOH B . 
P 5 HOH 145 645 321 HOH HOH B . 
P 5 HOH 146 646 197 HOH HOH B . 
Q 5 HOH 1   101 191 HOH HOH C . 
R 5 HOH 1   101 235 HOH HOH D . 
S 5 HOH 1   101 130 HOH HOH E . 
S 5 HOH 2   102 114 HOH HOH E . 
S 5 HOH 3   103 138 HOH HOH E . 
S 5 HOH 4   104 145 HOH HOH E . 
S 5 HOH 5   105 173 HOH HOH E . 
S 5 HOH 6   106 215 HOH HOH E . 
S 5 HOH 7   107 151 HOH HOH E . 
S 5 HOH 8   108 134 HOH HOH E . 
S 5 HOH 9   109 265 HOH HOH E . 
S 5 HOH 10  110 324 HOH HOH E . 
S 5 HOH 11  111 224 HOH HOH E . 
S 5 HOH 12  112 296 HOH HOH E . 
T 5 HOH 1   101 329 HOH HOH F . 
T 5 HOH 2   102 184 HOH HOH F . 
T 5 HOH 3   103 132 HOH HOH F . 
T 5 HOH 4   104 160 HOH HOH F . 
T 5 HOH 5   105 243 HOH HOH F . 
T 5 HOH 6   106 133 HOH HOH F . 
T 5 HOH 7   107 268 HOH HOH F . 
T 5 HOH 8   108 139 HOH HOH F . 
T 5 HOH 9   109 271 HOH HOH F . 
T 5 HOH 10  110 131 HOH HOH F . 
T 5 HOH 11  111 176 HOH HOH F . 
T 5 HOH 12  112 261 HOH HOH F . 
T 5 HOH 13  113 312 HOH HOH F . 
T 5 HOH 14  114 245 HOH HOH F . 
T 5 HOH 15  115 308 HOH HOH F . 
T 5 HOH 16  116 292 HOH HOH F . 
T 5 HOH 17  117 210 HOH HOH F . 
T 5 HOH 18  118 273 HOH HOH F . 
T 5 HOH 19  119 304 HOH HOH F . 
T 5 HOH 20  120 187 HOH HOH F . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C M3L 4 C M3L 36 ? LYS 'modified residue' 
2 D M3L 4 D M3L 36 ? LYS 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4240  ? 
1 MORE         -36   ? 
1 'SSA (A^2)'  36350 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 64  ? A CYS 105 ? 1_555 ZN ? G ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 67  ? A CYS 108 ? 1_555 106.6 ? 
2  SG  ? A CYS 64  ? A CYS 105 ? 1_555 ZN ? G ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 89  ? A HIS 130 ? 1_555 102.7 ? 
3  SG  ? A CYS 67  ? A CYS 108 ? 1_555 ZN ? G ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 89  ? A HIS 130 ? 1_555 99.7  ? 
4  SG  ? A CYS 64  ? A CYS 105 ? 1_555 ZN ? G ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 92  ? A CYS 133 ? 1_555 117.3 ? 
5  SG  ? A CYS 67  ? A CYS 108 ? 1_555 ZN ? G ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 92  ? A CYS 133 ? 1_555 113.4 ? 
6  ND1 ? A HIS 89  ? A HIS 130 ? 1_555 ZN ? G ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 92  ? A CYS 133 ? 1_555 115.2 ? 
7  SG  ? A CYS 81  ? A CYS 122 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 84  ? A CYS 125 ? 1_555 106.2 ? 
8  SG  ? A CYS 81  ? A CYS 122 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 110 ? A CYS 151 ? 1_555 110.7 ? 
9  SG  ? A CYS 84  ? A CYS 125 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 110 ? A CYS 151 ? 1_555 115.4 ? 
10 SG  ? A CYS 81  ? A CYS 122 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 113 ? A CYS 154 ? 1_555 107.5 ? 
11 SG  ? A CYS 84  ? A CYS 125 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 113 ? A CYS 154 ? 1_555 108.0 ? 
12 SG  ? A CYS 110 ? A CYS 151 ? 1_555 ZN ? H ZN . ? A ZN 402 ? 1_555 SG  ? A CYS 113 ? A CYS 154 ? 1_555 108.7 ? 
13 SG  ? A CYS 163 ? A CYS 204 ? 1_555 ZN ? J ZN . ? A ZN 404 ? 1_555 SG  ? A CYS 165 ? A CYS 206 ? 1_555 114.2 ? 
14 SG  ? A CYS 163 ? A CYS 204 ? 1_555 ZN ? J ZN . ? A ZN 404 ? 1_555 ND1 ? A HIS 186 ? A HIS 227 ? 1_555 99.2  ? 
15 SG  ? A CYS 165 ? A CYS 206 ? 1_555 ZN ? J ZN . ? A ZN 404 ? 1_555 ND1 ? A HIS 186 ? A HIS 227 ? 1_555 94.0  ? 
16 SG  ? A CYS 163 ? A CYS 204 ? 1_555 ZN ? J ZN . ? A ZN 404 ? 1_555 SG  ? A CYS 189 ? A CYS 230 ? 1_555 104.7 ? 
17 SG  ? A CYS 165 ? A CYS 206 ? 1_555 ZN ? J ZN . ? A ZN 404 ? 1_555 SG  ? A CYS 189 ? A CYS 230 ? 1_555 118.4 ? 
18 ND1 ? A HIS 186 ? A HIS 227 ? 1_555 ZN ? J ZN . ? A ZN 404 ? 1_555 SG  ? A CYS 189 ? A CYS 230 ? 1_555 125.2 ? 
19 SG  ? A CYS 178 ? A CYS 219 ? 1_555 ZN ? I ZN . ? A ZN 403 ? 1_555 SG  ? A CYS 181 ? A CYS 222 ? 1_555 106.3 ? 
20 SG  ? A CYS 178 ? A CYS 219 ? 1_555 ZN ? I ZN . ? A ZN 403 ? 1_555 SG  ? A CYS 208 ? A CYS 249 ? 1_555 111.3 ? 
21 SG  ? A CYS 181 ? A CYS 222 ? 1_555 ZN ? I ZN . ? A ZN 403 ? 1_555 SG  ? A CYS 208 ? A CYS 249 ? 1_555 116.7 ? 
22 SG  ? A CYS 178 ? A CYS 219 ? 1_555 ZN ? I ZN . ? A ZN 403 ? 1_555 SG  ? A CYS 211 ? A CYS 252 ? 1_555 108.0 ? 
23 SG  ? A CYS 181 ? A CYS 222 ? 1_555 ZN ? I ZN . ? A ZN 403 ? 1_555 SG  ? A CYS 211 ? A CYS 252 ? 1_555 107.0 ? 
24 SG  ? A CYS 208 ? A CYS 249 ? 1_555 ZN ? I ZN . ? A ZN 403 ? 1_555 SG  ? A CYS 211 ? A CYS 252 ? 1_555 107.0 ? 
25 SG  ? B CYS 64  ? B CYS 105 ? 1_555 ZN ? L ZN . ? B ZN 402 ? 1_555 ND1 ? B HIS 89  ? B HIS 130 ? 1_555 104.5 ? 
26 SG  ? B CYS 64  ? B CYS 105 ? 1_555 ZN ? L ZN . ? B ZN 402 ? 1_555 SG  ? B CYS 92  ? B CYS 133 ? 1_555 109.1 ? 
27 ND1 ? B HIS 89  ? B HIS 130 ? 1_555 ZN ? L ZN . ? B ZN 402 ? 1_555 SG  ? B CYS 92  ? B CYS 133 ? 1_555 117.8 ? 
28 SG  ? B CYS 81  ? B CYS 122 ? 1_555 ZN ? K ZN . ? B ZN 401 ? 1_555 SG  ? B CYS 84  ? B CYS 125 ? 1_555 108.9 ? 
29 SG  ? B CYS 81  ? B CYS 122 ? 1_555 ZN ? K ZN . ? B ZN 401 ? 1_555 SG  ? B CYS 110 ? B CYS 151 ? 1_555 115.0 ? 
30 SG  ? B CYS 84  ? B CYS 125 ? 1_555 ZN ? K ZN . ? B ZN 401 ? 1_555 SG  ? B CYS 110 ? B CYS 151 ? 1_555 119.5 ? 
31 SG  ? B CYS 81  ? B CYS 122 ? 1_555 ZN ? K ZN . ? B ZN 401 ? 1_555 SG  ? B CYS 113 ? B CYS 154 ? 1_555 107.7 ? 
32 SG  ? B CYS 84  ? B CYS 125 ? 1_555 ZN ? K ZN . ? B ZN 401 ? 1_555 SG  ? B CYS 113 ? B CYS 154 ? 1_555 100.2 ? 
33 SG  ? B CYS 110 ? B CYS 151 ? 1_555 ZN ? K ZN . ? B ZN 401 ? 1_555 SG  ? B CYS 113 ? B CYS 154 ? 1_555 103.6 ? 
34 SG  ? B CYS 163 ? B CYS 204 ? 1_555 ZN ? M ZN . ? B ZN 403 ? 1_555 SG  ? B CYS 165 ? B CYS 206 ? 1_555 114.7 ? 
35 SG  ? B CYS 163 ? B CYS 204 ? 1_555 ZN ? M ZN . ? B ZN 403 ? 1_555 ND1 ? B HIS 186 ? B HIS 227 ? 1_555 102.0 ? 
36 SG  ? B CYS 165 ? B CYS 206 ? 1_555 ZN ? M ZN . ? B ZN 403 ? 1_555 ND1 ? B HIS 186 ? B HIS 227 ? 1_555 94.3  ? 
37 SG  ? B CYS 163 ? B CYS 204 ? 1_555 ZN ? M ZN . ? B ZN 403 ? 1_555 SG  ? B CYS 189 ? B CYS 230 ? 1_555 105.6 ? 
38 SG  ? B CYS 165 ? B CYS 206 ? 1_555 ZN ? M ZN . ? B ZN 403 ? 1_555 SG  ? B CYS 189 ? B CYS 230 ? 1_555 119.9 ? 
39 ND1 ? B HIS 186 ? B HIS 227 ? 1_555 ZN ? M ZN . ? B ZN 403 ? 1_555 SG  ? B CYS 189 ? B CYS 230 ? 1_555 119.2 ? 
40 SG  ? B CYS 178 ? B CYS 219 ? 1_555 ZN ? N ZN . ? B ZN 404 ? 1_555 SG  ? B CYS 181 ? B CYS 222 ? 1_555 105.2 ? 
41 SG  ? B CYS 178 ? B CYS 219 ? 1_555 ZN ? N ZN . ? B ZN 404 ? 1_555 SG  ? B CYS 208 ? B CYS 249 ? 1_555 115.6 ? 
42 SG  ? B CYS 181 ? B CYS 222 ? 1_555 ZN ? N ZN . ? B ZN 404 ? 1_555 SG  ? B CYS 208 ? B CYS 249 ? 1_555 113.5 ? 
43 SG  ? B CYS 178 ? B CYS 219 ? 1_555 ZN ? N ZN . ? B ZN 404 ? 1_555 SG  ? B CYS 211 ? B CYS 252 ? 1_555 108.8 ? 
44 SG  ? B CYS 181 ? B CYS 222 ? 1_555 ZN ? N ZN . ? B ZN 404 ? 1_555 SG  ? B CYS 211 ? B CYS 252 ? 1_555 109.1 ? 
45 SG  ? B CYS 208 ? B CYS 249 ? 1_555 ZN ? N ZN . ? B ZN 404 ? 1_555 SG  ? B CYS 211 ? B CYS 252 ? 1_555 104.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-09-13 
2 'Structure model' 1 1 2017-09-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.journal_volume'          
7  2 'Structure model' '_citation.page_first'              
8  2 'Structure model' '_citation.page_last'               
9  2 'Structure model' '_citation.pdbx_database_id_DOI'    
10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 2 'Structure model' '_citation.title'                   
12 2 'Structure model' '_citation.year'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.8.4_1496 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .          2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .          3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .          4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA    B LEU 72 ? ? CB    B LEU 72 ? ? CG B LEU 72 ? ? 130.39 115.30 15.09 2.30 N 
2 1 "O4'" F DG  1  ? ? "C1'" F DG  1  ? ? N9 F DG  1  ? ? 110.16 108.30 1.86  0.30 N 
3 1 "O4'" F DG  9  ? ? "C1'" F DG  9  ? ? N9 F DG  9  ? ? 110.17 108.30 1.87  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 144 ? ? -88.84  39.88   
2  1 CYS A 204 ? ? 63.61   -168.37 
3  1 LYS A 221 ? ? -97.32  -63.70  
4  1 HIS A 304 ? ? 39.65   57.60   
5  1 LEU B 72  ? ? -149.67 51.83   
6  1 PRO B 116 ? ? -86.24  32.93   
7  1 ASN B 117 ? ? -105.92 54.51   
8  1 LYS B 124 ? ? -128.65 -56.03  
9  1 CYS B 204 ? ? 62.40   -171.57 
10 1 LEU B 214 ? ? -97.20  -123.59 
11 1 LYS B 215 ? ? -102.00 70.58   
12 1 LYS B 221 ? ? -104.61 -66.38  
13 1 VAL B 357 ? ? -106.78 -166.10 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   LEU 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    72 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   LYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    73 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            143.02 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 42  ? A SER 1   
2  1 Y 1 A ALA 43  ? A ALA 2   
3  1 Y 1 A THR 98  ? A THR 57  
4  1 Y 1 A GLY 99  ? A GLY 58  
5  1 Y 1 A SER 100 ? A SER 59  
6  1 Y 1 A GLY 101 ? A GLY 60  
7  1 Y 1 A GLU 102 ? A GLU 61  
8  1 Y 1 A ALA 358 ? A ALA 317 
9  1 Y 1 B SER 42  ? B SER 1   
10 1 Y 1 B ALA 43  ? B ALA 2   
11 1 Y 1 B CYS 44  ? B CYS 3   
12 1 Y 1 B GLY 96  ? B GLY 55  
13 1 Y 1 B ALA 97  ? B ALA 56  
14 1 Y 1 B THR 98  ? B THR 57  
15 1 Y 1 B GLY 99  ? B GLY 58  
16 1 Y 1 B SER 100 ? B SER 59  
17 1 Y 1 B GLY 101 ? B GLY 60  
18 1 Y 1 B GLU 102 ? B GLU 61  
19 1 Y 1 B MET 103 ? B MET 62  
20 1 Y 1 B VAL 104 ? B VAL 63  
21 1 Y 1 B SER 141 ? B SER 100 
22 1 Y 1 B VAL 142 ? B VAL 101 
23 1 Y 1 B ILE 143 ? B ILE 102 
24 1 Y 1 B ASP 144 ? B ASP 103 
25 1 Y 1 B SER 145 ? B SER 104 
26 1 Y 1 B ASP 146 ? B ASP 105 
27 1 Y 1 B GLU 147 ? B GLU 106 
28 1 Y 1 C GLY 33  ? C GLY 1   
29 1 Y 1 C GLY 34  ? C GLY 2   
30 1 Y 1 C VAL 35  ? C VAL 3   
31 1 Y 1 C HIS 39  ? C HIS 7   
32 1 Y 1 C ARG 40  ? C ARG 8   
33 1 Y 1 D GLY 33  ? D GLY 1   
34 1 Y 1 D GLY 34  ? D GLY 2   
35 1 Y 1 D VAL 35  ? D VAL 3   
36 1 Y 1 D HIS 39  ? D HIS 7   
37 1 Y 1 D ARG 40  ? D ARG 8   
# 
_ndb_struct_conf_na.entry_id   5XFR 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 E DG 1  1_555 F DC 12 1_555 -0.007 -0.198 -0.038 -3.656  -4.069  -1.932 1  E_DG1:DC12_F E 1  ? F 12 ? 19 1 
1 E DG 2  1_555 F DC 11 1_555 -0.347 -0.118 0.154  -1.290  -3.560  2.281  2  E_DG2:DC11_F E 2  ? F 11 ? 19 1 
1 E DG 3  1_555 F DC 10 1_555 0.023  -0.165 0.425  -5.085  -20.834 -2.953 3  E_DG3:DC10_F E 3  ? F 10 ? 19 1 
1 E DC 4  1_555 F DG 9  1_555 0.047  -0.267 0.202  -7.880  0.642   1.305  4  E_DC4:DG9_F  E 4  ? F 9  ? 19 1 
1 E DG 5  1_555 F DC 8  1_555 0.001  -0.174 0.435  -1.849  -14.890 -6.045 5  E_DG5:DC8_F  E 5  ? F 8  ? 19 1 
1 E DG 6  1_555 F DC 7  1_555 -0.657 -0.085 -0.565 -15.366 7.103   4.386  6  E_DG6:DC7_F  E 6  ? F 7  ? 19 1 
1 E DC 7  1_555 F DG 6  1_555 0.448  -0.009 -0.462 11.075  7.941   3.286  7  E_DC7:DG6_F  E 7  ? F 6  ? 19 1 
1 E DC 8  1_555 F DG 5  1_555 0.149  -0.279 0.571  1.996   -20.599 -7.973 8  E_DC8:DG5_F  E 8  ? F 5  ? 19 1 
1 E DG 9  1_555 F DC 4  1_555 -0.160 -0.192 0.048  2.609   -3.062  1.821  9  E_DG9:DC4_F  E 9  ? F 4  ? 19 1 
1 E DC 10 1_555 F DG 3  1_555 -0.112 0.080  0.590  4.793   -16.056 -2.280 10 E_DC10:DG3_F E 10 ? F 3  ? 19 1 
1 E DC 11 1_555 F DG 2  1_555 0.182  -0.006 -0.078 7.004   -6.547  4.251  11 E_DC11:DG2_F E 11 ? F 2  ? 19 1 
1 E DC 12 1_555 F DG 1  1_555 -0.417 -0.157 -0.027 -4.383  -2.251  -4.478 12 E_DC12:DG1_F E 12 ? F 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 E DG 1  1_555 F DC 12 1_555 E DG 2  1_555 F DC 11 1_555 0.265  1.172  3.366 -2.312 -4.784 35.562 2.584  -0.760 3.164 -7.780  
3.759   35.944 1  EE_DG1DG2:DC11DC12_FF E 1  ? F 12 ? E 2  ? F 11 ? 
1 E DG 2  1_555 F DC 11 1_555 E DG 3  1_555 F DC 10 1_555 -1.566 0.829  3.455 -7.014 4.589  39.193 0.626  1.394  3.739 6.747   
10.313  40.045 2  EE_DG2DG3:DC10DC11_FF E 2  ? F 11 ? E 3  ? F 10 ? 
1 E DG 3  1_555 F DC 10 1_555 E DC 4  1_555 F DG 9  1_555 0.978  0.527  3.483 3.103  -4.912 39.120 1.394  -1.058 3.459 -7.287  
-4.604  39.532 3  EE_DG3DC4:DG9DC10_FF  E 3  ? F 10 ? E 4  ? F 9  ? 
1 E DC 4  1_555 F DG 9  1_555 E DG 5  1_555 F DC 8  1_555 -1.550 0.755  3.186 -5.933 0.645  35.340 1.134  1.655  3.406 1.054   
9.687   35.824 4  EE_DC4DG5:DC8DG9_FF   E 4  ? F 9  ? E 5  ? F 8  ? 
1 E DG 5  1_555 F DC 8  1_555 E DG 6  1_555 F DC 7  1_555 1.672  -0.333 3.865 8.281  -6.186 33.630 0.606  -1.219 4.144 -10.391 
-13.909 35.139 5  EE_DG5DG6:DC7DC8_FF   E 5  ? F 8  ? E 6  ? F 7  ? 
1 E DG 6  1_555 F DC 7  1_555 E DC 7  1_555 F DG 6  1_555 -0.247 -0.133 2.746 -0.183 11.653 26.686 -2.397 0.459  2.474 23.854  
0.374   29.078 6  EE_DG6DC7:DG6DC7_FF   E 6  ? F 7  ? E 7  ? F 6  ? 
1 E DC 7  1_555 F DG 6  1_555 E DC 8  1_555 F DG 5  1_555 -1.833 -0.058 3.706 -8.897 -7.472 33.971 1.200  1.437  3.971 -12.349 
14.704  35.848 7  EE_DC7DC8:DG5DG6_FF   E 7  ? F 6  ? E 8  ? F 5  ? 
1 E DC 8  1_555 F DG 5  1_555 E DG 9  1_555 F DC 4  1_555 1.541  0.756  3.387 7.514  -0.910 35.115 1.368  -1.338 3.610 -1.487  
-12.278 35.896 8  EE_DC8DG9:DC4DG5_FF   E 8  ? F 5  ? E 9  ? F 4  ? 
1 E DG 9  1_555 F DC 4  1_555 E DC 10 1_555 F DG 3  1_555 -0.499 0.558  3.347 -4.258 -4.496 38.646 1.385  0.223  3.299 -6.740  
6.384   39.120 9  EE_DG9DC10:DG3DC4_FF  E 9  ? F 4  ? E 10 ? F 3  ? 
1 E DC 10 1_555 F DG 3  1_555 E DC 11 1_555 F DG 2  1_555 1.643  0.548  3.233 9.090  3.580  39.152 0.369  -1.303 3.547 5.243   
-13.314 40.306 10 EE_DC10DC11:DG2DG3_FF E 10 ? F 3  ? E 11 ? F 2  ? 
1 E DC 11 1_555 F DG 2  1_555 E DC 12 1_555 F DG 1  1_555 -0.921 0.657  3.765 -1.627 -8.325 39.056 2.053  1.136  3.590 -12.277 
2.399   39.931 11 EE_DC11DC12:DG1DG2_FF E 11 ? F 2  ? E 12 ? F 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#