data_5XOU
# 
_entry.id   5XOU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5XOU         
WWPDB D_1300003895 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5XOU 
_pdbx_database_status.recvd_initial_deposition_date   2017-05-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Sheng, G.' 1 ? 
'Wang, J.'  2 ? 
'Zhao, H.'  3 ? 
'Wang, Y.'  4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            45 
_citation.language                  ? 
_citation.page_first                9149 
_citation.page_last                 9163 
_citation.title                     
'Structure/cleavage-based insights into helical perturbations at bulge sites within T. thermophilus Argonaute silencing complexes' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkx547 
_citation.pdbx_database_id_PubMed   28911094 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sheng, G.'    1 
primary 'Gogakos, T.'  2 
primary 'Wang, J.'     3 
primary 'Zhao, H.'     4 
primary 'Serganov, A.' 5 
primary 'Juranek, S.'  6 
primary 'Tuschl, T.'   7 
primary 'Patel, D.J.'  8 
primary 'Wang, Y.'     9 
# 
_cell.entry_id           5XOU 
_cell.length_a           112.747 
_cell.length_b           114.982 
_cell.length_c           160.441 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5XOU 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TtAgo (D546N)'                                                  76727.750 2  ? D546N ? ? 
2 polymer     syn 
;DNA (5'-D(P*TP*GP*AP*GP*GP*TP*AP*TP*GP*GP*TP*TP*GP*T)-3')
;
6892.458  2  ? ?     ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*CP*AP*AP*CP*CP*TP*AP*CP*TP*AP*CP*CP*TP*CP*G)-3')
;
5708.726  2  ? ?     ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                                  24.305    2  ? ?     ? ? 
5 water       nat water                                                            18.015    19 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Uncharacterized protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLA
RMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDS
GAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGR
VAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPK
LMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKE
EGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAG
GRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRNGRVPQDEFALALEA
LAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTR
LYPASGFAFPRLPAPLHLADRLVKEVGRLGIRHLKEVDREKLFFV
;
;MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLA
RMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDS
GAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGR
VAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPK
LMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKE
EGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAG
GRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRNGRVPQDEFALALEA
LAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTR
LYPASGFAFPRLPAPLHLADRLVKEVGRLGIRHLKEVDREKLFFV
;
A,B ? 
2 polydeoxyribonucleotide no no 
;(DT)(DG)(DA)(DG)(DG)(DT)(DA)(DT)(DG)(DT)(DA)(DG)(DG)(DT)(DT)(DG)(DT)(DA)(DT)(DA)
(DG)(DT)
;
TGAGGTATGTAGGTTGTATAGT C,E ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DT)(DA)(DC)(DA)(DA)(DC)(DC)(DT)(DA)(DC)(DT)(DA)(DC)(DC)(DT)(DC)(DG)' TATACAACCTACTACCTCG 
D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   HIS n 
1 4   LEU n 
1 5   GLY n 
1 6   LYS n 
1 7   THR n 
1 8   GLU n 
1 9   VAL n 
1 10  PHE n 
1 11  LEU n 
1 12  ASN n 
1 13  ARG n 
1 14  PHE n 
1 15  ALA n 
1 16  LEU n 
1 17  ARG n 
1 18  PRO n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  GLU n 
1 23  GLU n 
1 24  LEU n 
1 25  ARG n 
1 26  PRO n 
1 27  TRP n 
1 28  ARG n 
1 29  LEU n 
1 30  GLU n 
1 31  VAL n 
1 32  VAL n 
1 33  LEU n 
1 34  ASP n 
1 35  PRO n 
1 36  PRO n 
1 37  PRO n 
1 38  GLY n 
1 39  ARG n 
1 40  GLU n 
1 41  GLU n 
1 42  VAL n 
1 43  TYR n 
1 44  PRO n 
1 45  LEU n 
1 46  LEU n 
1 47  ALA n 
1 48  GLN n 
1 49  VAL n 
1 50  ALA n 
1 51  ARG n 
1 52  ARG n 
1 53  ALA n 
1 54  GLY n 
1 55  GLY n 
1 56  VAL n 
1 57  THR n 
1 58  VAL n 
1 59  ARG n 
1 60  MET n 
1 61  GLY n 
1 62  ASP n 
1 63  GLY n 
1 64  LEU n 
1 65  ALA n 
1 66  SER n 
1 67  TRP n 
1 68  SER n 
1 69  PRO n 
1 70  PRO n 
1 71  GLU n 
1 72  VAL n 
1 73  LEU n 
1 74  VAL n 
1 75  LEU n 
1 76  GLU n 
1 77  GLY n 
1 78  THR n 
1 79  LEU n 
1 80  ALA n 
1 81  ARG n 
1 82  MET n 
1 83  GLY n 
1 84  GLN n 
1 85  THR n 
1 86  TYR n 
1 87  ALA n 
1 88  TYR n 
1 89  ARG n 
1 90  LEU n 
1 91  TYR n 
1 92  PRO n 
1 93  LYS n 
1 94  GLY n 
1 95  ARG n 
1 96  ARG n 
1 97  PRO n 
1 98  LEU n 
1 99  ASP n 
1 100 PRO n 
1 101 LYS n 
1 102 ASP n 
1 103 PRO n 
1 104 GLY n 
1 105 GLU n 
1 106 ARG n 
1 107 SER n 
1 108 VAL n 
1 109 LEU n 
1 110 SER n 
1 111 ALA n 
1 112 LEU n 
1 113 ALA n 
1 114 ARG n 
1 115 ARG n 
1 116 LEU n 
1 117 LEU n 
1 118 GLN n 
1 119 GLU n 
1 120 ARG n 
1 121 LEU n 
1 122 ARG n 
1 123 ARG n 
1 124 LEU n 
1 125 GLU n 
1 126 GLY n 
1 127 VAL n 
1 128 TRP n 
1 129 VAL n 
1 130 GLU n 
1 131 GLY n 
1 132 LEU n 
1 133 ALA n 
1 134 VAL n 
1 135 TYR n 
1 136 ARG n 
1 137 ARG n 
1 138 GLU n 
1 139 HIS n 
1 140 ALA n 
1 141 ARG n 
1 142 GLY n 
1 143 PRO n 
1 144 GLY n 
1 145 TRP n 
1 146 ARG n 
1 147 VAL n 
1 148 LEU n 
1 149 GLY n 
1 150 GLY n 
1 151 ALA n 
1 152 VAL n 
1 153 LEU n 
1 154 ASP n 
1 155 LEU n 
1 156 TRP n 
1 157 VAL n 
1 158 SER n 
1 159 ASP n 
1 160 SER n 
1 161 GLY n 
1 162 ALA n 
1 163 PHE n 
1 164 LEU n 
1 165 LEU n 
1 166 GLU n 
1 167 VAL n 
1 168 ASP n 
1 169 PRO n 
1 170 ALA n 
1 171 TYR n 
1 172 ARG n 
1 173 ILE n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 MET n 
1 178 SER n 
1 179 LEU n 
1 180 GLU n 
1 181 ALA n 
1 182 TRP n 
1 183 LEU n 
1 184 ALA n 
1 185 GLN n 
1 186 GLY n 
1 187 HIS n 
1 188 PRO n 
1 189 LEU n 
1 190 PRO n 
1 191 LYS n 
1 192 ARG n 
1 193 VAL n 
1 194 ARG n 
1 195 ASN n 
1 196 ALA n 
1 197 TYR n 
1 198 ASP n 
1 199 ARG n 
1 200 ARG n 
1 201 THR n 
1 202 TRP n 
1 203 GLU n 
1 204 LEU n 
1 205 LEU n 
1 206 ARG n 
1 207 LEU n 
1 208 GLY n 
1 209 GLU n 
1 210 GLU n 
1 211 ASP n 
1 212 PRO n 
1 213 LYS n 
1 214 GLU n 
1 215 LEU n 
1 216 PRO n 
1 217 LEU n 
1 218 PRO n 
1 219 GLY n 
1 220 GLY n 
1 221 LEU n 
1 222 SER n 
1 223 LEU n 
1 224 LEU n 
1 225 ASP n 
1 226 TYR n 
1 227 HIS n 
1 228 ALA n 
1 229 SER n 
1 230 LYS n 
1 231 GLY n 
1 232 ARG n 
1 233 LEU n 
1 234 GLN n 
1 235 GLY n 
1 236 ARG n 
1 237 GLU n 
1 238 GLY n 
1 239 GLY n 
1 240 ARG n 
1 241 VAL n 
1 242 ALA n 
1 243 TRP n 
1 244 VAL n 
1 245 ALA n 
1 246 ASP n 
1 247 PRO n 
1 248 LYS n 
1 249 ASP n 
1 250 PRO n 
1 251 ARG n 
1 252 LYS n 
1 253 PRO n 
1 254 ILE n 
1 255 PRO n 
1 256 HIS n 
1 257 LEU n 
1 258 THR n 
1 259 GLY n 
1 260 LEU n 
1 261 LEU n 
1 262 VAL n 
1 263 PRO n 
1 264 VAL n 
1 265 LEU n 
1 266 THR n 
1 267 LEU n 
1 268 GLU n 
1 269 ASP n 
1 270 LEU n 
1 271 HIS n 
1 272 GLU n 
1 273 GLU n 
1 274 GLU n 
1 275 GLY n 
1 276 SER n 
1 277 LEU n 
1 278 ALA n 
1 279 LEU n 
1 280 SER n 
1 281 LEU n 
1 282 PRO n 
1 283 TRP n 
1 284 GLU n 
1 285 GLU n 
1 286 ARG n 
1 287 ARG n 
1 288 ARG n 
1 289 ARG n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 ILE n 
1 294 ALA n 
1 295 SER n 
1 296 TRP n 
1 297 ILE n 
1 298 GLY n 
1 299 ARG n 
1 300 ARG n 
1 301 LEU n 
1 302 GLY n 
1 303 LEU n 
1 304 GLY n 
1 305 THR n 
1 306 PRO n 
1 307 GLU n 
1 308 ALA n 
1 309 VAL n 
1 310 ARG n 
1 311 ALA n 
1 312 GLN n 
1 313 ALA n 
1 314 TYR n 
1 315 ARG n 
1 316 LEU n 
1 317 SER n 
1 318 ILE n 
1 319 PRO n 
1 320 LYS n 
1 321 LEU n 
1 322 MET n 
1 323 GLY n 
1 324 ARG n 
1 325 ARG n 
1 326 ALA n 
1 327 VAL n 
1 328 SER n 
1 329 LYS n 
1 330 PRO n 
1 331 ALA n 
1 332 ASP n 
1 333 ALA n 
1 334 LEU n 
1 335 ARG n 
1 336 VAL n 
1 337 GLY n 
1 338 PHE n 
1 339 TYR n 
1 340 ARG n 
1 341 ALA n 
1 342 GLN n 
1 343 GLU n 
1 344 THR n 
1 345 ALA n 
1 346 LEU n 
1 347 ALA n 
1 348 LEU n 
1 349 LEU n 
1 350 ARG n 
1 351 LEU n 
1 352 ASP n 
1 353 GLY n 
1 354 ALA n 
1 355 GLN n 
1 356 GLY n 
1 357 TRP n 
1 358 PRO n 
1 359 GLU n 
1 360 PHE n 
1 361 LEU n 
1 362 ARG n 
1 363 ARG n 
1 364 ALA n 
1 365 LEU n 
1 366 LEU n 
1 367 ARG n 
1 368 ALA n 
1 369 PHE n 
1 370 GLY n 
1 371 ALA n 
1 372 SER n 
1 373 GLY n 
1 374 ALA n 
1 375 SER n 
1 376 LEU n 
1 377 ARG n 
1 378 LEU n 
1 379 HIS n 
1 380 THR n 
1 381 LEU n 
1 382 HIS n 
1 383 ALA n 
1 384 HIS n 
1 385 PRO n 
1 386 SER n 
1 387 GLN n 
1 388 GLY n 
1 389 LEU n 
1 390 ALA n 
1 391 PHE n 
1 392 ARG n 
1 393 GLU n 
1 394 ALA n 
1 395 LEU n 
1 396 ARG n 
1 397 LYS n 
1 398 ALA n 
1 399 LYS n 
1 400 GLU n 
1 401 GLU n 
1 402 GLY n 
1 403 VAL n 
1 404 GLN n 
1 405 ALA n 
1 406 VAL n 
1 407 LEU n 
1 408 VAL n 
1 409 LEU n 
1 410 THR n 
1 411 PRO n 
1 412 PRO n 
1 413 MET n 
1 414 ALA n 
1 415 TRP n 
1 416 GLU n 
1 417 ASP n 
1 418 ARG n 
1 419 ASN n 
1 420 ARG n 
1 421 LEU n 
1 422 LYS n 
1 423 ALA n 
1 424 LEU n 
1 425 LEU n 
1 426 LEU n 
1 427 ARG n 
1 428 GLU n 
1 429 GLY n 
1 430 LEU n 
1 431 PRO n 
1 432 SER n 
1 433 GLN n 
1 434 ILE n 
1 435 LEU n 
1 436 ASN n 
1 437 VAL n 
1 438 PRO n 
1 439 LEU n 
1 440 ARG n 
1 441 GLU n 
1 442 GLU n 
1 443 GLU n 
1 444 ARG n 
1 445 HIS n 
1 446 ARG n 
1 447 TRP n 
1 448 GLU n 
1 449 ASN n 
1 450 ALA n 
1 451 LEU n 
1 452 LEU n 
1 453 GLY n 
1 454 LEU n 
1 455 LEU n 
1 456 ALA n 
1 457 LYS n 
1 458 ALA n 
1 459 GLY n 
1 460 LEU n 
1 461 GLN n 
1 462 VAL n 
1 463 VAL n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 GLY n 
1 468 ALA n 
1 469 TYR n 
1 470 PRO n 
1 471 ALA n 
1 472 GLU n 
1 473 LEU n 
1 474 ALA n 
1 475 VAL n 
1 476 GLY n 
1 477 PHE n 
1 478 ASP n 
1 479 ALA n 
1 480 GLY n 
1 481 GLY n 
1 482 ARG n 
1 483 GLU n 
1 484 SER n 
1 485 PHE n 
1 486 ARG n 
1 487 PHE n 
1 488 GLY n 
1 489 GLY n 
1 490 ALA n 
1 491 ALA n 
1 492 CYS n 
1 493 ALA n 
1 494 VAL n 
1 495 GLY n 
1 496 GLY n 
1 497 ASP n 
1 498 GLY n 
1 499 GLY n 
1 500 HIS n 
1 501 LEU n 
1 502 LEU n 
1 503 TRP n 
1 504 THR n 
1 505 LEU n 
1 506 PRO n 
1 507 GLU n 
1 508 ALA n 
1 509 GLN n 
1 510 ALA n 
1 511 GLY n 
1 512 GLU n 
1 513 ARG n 
1 514 ILE n 
1 515 PRO n 
1 516 GLN n 
1 517 GLU n 
1 518 VAL n 
1 519 VAL n 
1 520 TRP n 
1 521 ASP n 
1 522 LEU n 
1 523 LEU n 
1 524 GLU n 
1 525 GLU n 
1 526 THR n 
1 527 LEU n 
1 528 TRP n 
1 529 ALA n 
1 530 PHE n 
1 531 ARG n 
1 532 ARG n 
1 533 LYS n 
1 534 ALA n 
1 535 GLY n 
1 536 ARG n 
1 537 LEU n 
1 538 PRO n 
1 539 SER n 
1 540 ARG n 
1 541 VAL n 
1 542 LEU n 
1 543 LEU n 
1 544 LEU n 
1 545 ARG n 
1 546 ASN n 
1 547 GLY n 
1 548 ARG n 
1 549 VAL n 
1 550 PRO n 
1 551 GLN n 
1 552 ASP n 
1 553 GLU n 
1 554 PHE n 
1 555 ALA n 
1 556 LEU n 
1 557 ALA n 
1 558 LEU n 
1 559 GLU n 
1 560 ALA n 
1 561 LEU n 
1 562 ALA n 
1 563 ARG n 
1 564 GLU n 
1 565 GLY n 
1 566 ILE n 
1 567 ALA n 
1 568 TYR n 
1 569 ASP n 
1 570 LEU n 
1 571 VAL n 
1 572 SER n 
1 573 VAL n 
1 574 ARG n 
1 575 LYS n 
1 576 SER n 
1 577 GLY n 
1 578 GLY n 
1 579 GLY n 
1 580 ARG n 
1 581 VAL n 
1 582 TYR n 
1 583 PRO n 
1 584 VAL n 
1 585 GLN n 
1 586 GLY n 
1 587 ARG n 
1 588 LEU n 
1 589 ALA n 
1 590 ASP n 
1 591 GLY n 
1 592 LEU n 
1 593 TYR n 
1 594 VAL n 
1 595 PRO n 
1 596 LEU n 
1 597 GLU n 
1 598 ASP n 
1 599 LYS n 
1 600 THR n 
1 601 PHE n 
1 602 LEU n 
1 603 LEU n 
1 604 LEU n 
1 605 THR n 
1 606 VAL n 
1 607 HIS n 
1 608 ARG n 
1 609 ASP n 
1 610 PHE n 
1 611 ARG n 
1 612 GLY n 
1 613 THR n 
1 614 PRO n 
1 615 ARG n 
1 616 PRO n 
1 617 LEU n 
1 618 LYS n 
1 619 LEU n 
1 620 VAL n 
1 621 HIS n 
1 622 GLU n 
1 623 ALA n 
1 624 GLY n 
1 625 ASP n 
1 626 THR n 
1 627 PRO n 
1 628 LEU n 
1 629 GLU n 
1 630 ALA n 
1 631 LEU n 
1 632 ALA n 
1 633 HIS n 
1 634 GLN n 
1 635 ILE n 
1 636 PHE n 
1 637 HIS n 
1 638 LEU n 
1 639 THR n 
1 640 ARG n 
1 641 LEU n 
1 642 TYR n 
1 643 PRO n 
1 644 ALA n 
1 645 SER n 
1 646 GLY n 
1 647 PHE n 
1 648 ALA n 
1 649 PHE n 
1 650 PRO n 
1 651 ARG n 
1 652 LEU n 
1 653 PRO n 
1 654 ALA n 
1 655 PRO n 
1 656 LEU n 
1 657 HIS n 
1 658 LEU n 
1 659 ALA n 
1 660 ASP n 
1 661 ARG n 
1 662 LEU n 
1 663 VAL n 
1 664 LYS n 
1 665 GLU n 
1 666 VAL n 
1 667 GLY n 
1 668 ARG n 
1 669 LEU n 
1 670 GLY n 
1 671 ILE n 
1 672 ARG n 
1 673 HIS n 
1 674 LEU n 
1 675 LYS n 
1 676 GLU n 
1 677 VAL n 
1 678 ASP n 
1 679 ARG n 
1 680 GLU n 
1 681 LYS n 
1 682 LEU n 
1 683 PHE n 
1 684 PHE n 
1 685 VAL n 
2 1   DT  n 
2 2   DG  n 
2 3   DA  n 
2 4   DG  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DT  n 
2 11  DA  n 
2 12  DG  n 
2 13  DG  n 
2 14  DT  n 
2 15  DT  n 
2 16  DG  n 
2 17  DT  n 
2 18  DA  n 
2 19  DT  n 
2 20  DA  n 
2 21  DG  n 
2 22  DT  n 
3 1   DT  n 
3 2   DA  n 
3 3   DT  n 
3 4   DA  n 
3 5   DC  n 
3 6   DA  n 
3 7   DA  n 
3 8   DC  n 
3 9   DC  n 
3 10  DT  n 
3 11  DA  n 
3 12  DC  n 
3 13  DT  n 
3 14  DA  n 
3 15  DC  n 
3 16  DC  n 
3 17  DT  n 
3 18  DC  n 
3 19  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   685 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TT_P0026 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'HB27 / ATCC BAA-163 / DSM 7039' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     262724 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 22 'Thermus thermophilus' ? 274 ? 
3 1 sample 1 19 'Thermus thermophilus' ? 274 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q746M7_THET2 Q746M7 ? 1 
;MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLA
RMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDS
GAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGR
VAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPK
LMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKE
EGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAG
GRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRDGRVPQDEFALALEA
LAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTR
LYPASGFAFPRLPAPLHLADRLVKEVGRLGIRHLKEVDREKLFFV
;
1 
2 PDB 5XOU         5XOU   ? 2 ? 1 
3 PDB 5XOU         5XOU   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5XOU A 1 ? 685 ? Q746M7 1 ? 685 ? 1 685 
2 1 5XOU B 1 ? 685 ? Q746M7 1 ? 685 ? 1 685 
3 2 5XOU C 1 ? 22  ? 5XOU   1 ? 22  ? 1 22  
4 3 5XOU D 1 ? 19  ? 5XOU   1 ? 19  ? 1 19  
5 2 5XOU E 1 ? 22  ? 5XOU   1 ? 22  ? 1 22  
6 3 5XOU F 1 ? 19  ? 5XOU   1 ? 19  ? 1 19  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5XOU ASN A 546 ? UNP Q746M7 ASP 546 'engineered mutation' 546 1 
2 5XOU ASN B 546 ? UNP Q746M7 ASP 546 'engineered mutation' 546 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5XOU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.91 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.74 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            308 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '3.0 M NaAc.3H2O, 100 mM Bis-Tris propane, pH 7.0-7.2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-05-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U1 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5XOU 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   60975 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.7000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.900 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.d_res_high                  2.63 
_reflns_shell.d_res_low                   2.72 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        95.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.57 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5XOU 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     60975 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.390 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.17 
_refine.ls_d_res_high                            2.63 
_refine.ls_percent_reflns_obs                    97.3 
_refine.ls_R_factor_obs                          0.237 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.235 
_refine.ls_R_factor_R_free                       0.276 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.070 
_refine.ls_number_reflns_R_free                  3091 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4KPY 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.530 
_refine.pdbx_overall_phase_error                 31.540 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8808 
_refine_hist.pdbx_number_atoms_nucleic_acid   1267 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             19 
_refine_hist.number_atoms_total               10096 
_refine_hist.d_res_high                       2.63 
_refine_hist.d_res_low                        43.17 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.019  ? ? 10435 'X-RAY DIFFRACTION' ? 
f_angle_d          2.442  ? ? 14426 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.290 ? ? 3951  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.139  ? ? 1600  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.016  ? ? 1663  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 POSITIONAL A 4067 0.200 ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 POSITIONAL B 4067 0.200 ? ? ? ? 
3 'X-RAY DIFFRACTION' 2 1 POSITIONAL D 272  0.038 ? ? ? ? 
4 'X-RAY DIFFRACTION' 2 2 POSITIONAL F 272  0.038 ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.6290 2.6701  2335 0.4848 88.00  0.4686 . . 134 . . . . 
'X-RAY DIFFRACTION' . 2.6701 2.7139  2532 0.4306 95.00  0.4269 . . 125 . . . . 
'X-RAY DIFFRACTION' . 2.7139 2.7607  2648 0.3663 98.00  0.4026 . . 132 . . . . 
'X-RAY DIFFRACTION' . 2.7607 2.8108  2624 0.3538 98.00  0.3742 . . 169 . . . . 
'X-RAY DIFFRACTION' . 2.8108 2.8649  2605 0.3246 99.00  0.3686 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.8649 2.9234  2663 0.3031 98.00  0.3777 . . 121 . . . . 
'X-RAY DIFFRACTION' . 2.9234 2.9869  2652 0.2844 99.00  0.3290 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.9869 3.0564  2610 0.2667 99.00  0.3015 . . 157 . . . . 
'X-RAY DIFFRACTION' . 3.0564 3.1328  2676 0.2482 99.00  0.3168 . . 136 . . . . 
'X-RAY DIFFRACTION' . 3.1328 3.2175  2685 0.2367 99.00  0.2693 . . 129 . . . . 
'X-RAY DIFFRACTION' . 3.2175 3.3121  2642 0.2224 99.00  0.2913 . . 157 . . . . 
'X-RAY DIFFRACTION' . 3.3121 3.4190  2627 0.2283 98.00  0.2615 . . 143 . . . . 
'X-RAY DIFFRACTION' . 3.4190 3.5411  2606 0.2506 97.00  0.3012 . . 115 . . . . 
'X-RAY DIFFRACTION' . 3.5411 3.6828  2647 0.2630 97.00  0.2977 . . 135 . . . . 
'X-RAY DIFFRACTION' . 3.6828 3.8503  2614 0.2203 97.00  0.2445 . . 148 . . . . 
'X-RAY DIFFRACTION' . 3.8503 4.0532  2619 0.2264 97.00  0.2806 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.0532 4.3069  2693 0.1729 100.00 0.2076 . . 151 . . . . 
'X-RAY DIFFRACTION' . 4.3069 4.6391  2708 0.1610 100.00 0.2408 . . 146 . . . . 
'X-RAY DIFFRACTION' . 4.6391 5.1053  2730 0.1680 100.00 0.2185 . . 151 . . . . 
'X-RAY DIFFRACTION' . 5.1053 5.8425  2760 0.2014 100.00 0.2390 . . 139 . . . . 
'X-RAY DIFFRACTION' . 5.8425 7.3550  2781 0.2297 99.00  0.2597 . . 133 . . . . 
'X-RAY DIFFRACTION' . 7.3550 43.1746 2427 0.2471 84.00  0.2782 . . 143 . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN 'A' AND (RESSEQ 5:37 OR RESSEQ
42:47 OR RESSEQ 49:70 OR RESSEQ 72:79 OR
RESSEQ 85:123 OR RESSEQ 126:135 OR RESSEQ
281:298 OR RESSEQ 300:319 OR RESSEQ 321:
550 OR RESSEQ 552:558 OR RESSEQ 560:596
OR RESSEQ 598:608 OR RESSEQ 610:685 )
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN 'B' AND (RESSEQ 5:37 OR RESSEQ
42:47 OR RESSEQ 49:70 OR RESSEQ 72:79 OR
RESSEQ 85:123 OR RESSEQ 126:135 OR RESSEQ
281:298 OR RESSEQ 300:319 OR RESSEQ 321:
550 OR RESSEQ 552:558 OR RESSEQ 560:596
OR RESSEQ 598:608 OR RESSEQ 610:685 )
;
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;CHAIN 'D' AND (RESSEQ 5:18 )
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;CHAIN 'F' AND (RESSEQ 5:18 )
;
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                     5XOU 
_struct.title                        
'Crystal structure of T. thermophilus Argonaute protein complexed with a bulge 7T8 on the guide strand' 
_struct.pdbx_descriptor              'TtAgo (D546N)/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5XOU 
_struct_keywords.text            'Argonaute, Bulge, miRNA, mismatch, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 38  ? GLY A 54  ? GLY A 38  GLY A 54  1 ? 17 
HELX_P HELX_P2  AA2 PRO A 69  ? LEU A 73  ? PRO A 69  LEU A 73  5 ? 5  
HELX_P HELX_P3  AA3 ASP A 102 ? ARG A 122 ? ASP A 102 ARG A 122 1 ? 21 
HELX_P HELX_P4  AA4 PRO A 282 ? LEU A 301 ? PRO A 282 LEU A 301 1 ? 20 
HELX_P HELX_P5  AA5 LYS A 329 ? ALA A 331 ? LYS A 329 ALA A 331 5 ? 3  
HELX_P HELX_P6  AA6 ASP A 332 ? GLY A 337 ? ASP A 332 GLY A 337 1 ? 6  
HELX_P HELX_P7  AA7 PRO A 358 ? GLY A 373 ? PRO A 358 GLY A 373 1 ? 16 
HELX_P HELX_P8  AA8 HIS A 384 ? GLN A 387 ? HIS A 384 GLN A 387 5 ? 4  
HELX_P HELX_P9  AA9 GLY A 388 ? GLY A 402 ? GLY A 388 GLY A 402 1 ? 15 
HELX_P HELX_P10 AB1 ALA A 414 ? GLU A 428 ? ALA A 414 GLU A 428 1 ? 15 
HELX_P HELX_P11 AB2 GLU A 443 ? ALA A 458 ? GLU A 443 ALA A 458 1 ? 16 
HELX_P HELX_P12 AB3 PRO A 515 ? GLY A 535 ? PRO A 515 GLY A 535 1 ? 21 
HELX_P HELX_P13 AB4 PHE A 554 ? GLY A 565 ? PHE A 554 GLY A 565 1 ? 12 
HELX_P HELX_P14 AB5 ARG A 608 ? GLY A 612 ? ARG A 608 GLY A 612 5 ? 5  
HELX_P HELX_P15 AB6 PRO A 627 ? THR A 639 ? PRO A 627 THR A 639 1 ? 13 
HELX_P HELX_P16 AB7 PRO A 653 ? GLY A 670 ? PRO A 653 GLY A 670 1 ? 18 
HELX_P HELX_P17 AB8 ILE A 671 ? LEU A 674 ? ILE A 671 LEU A 674 5 ? 4  
HELX_P HELX_P18 AB9 GLU B 41  ? GLY B 54  ? GLU B 41  GLY B 54  1 ? 14 
HELX_P HELX_P19 AC1 PRO B 69  ? LEU B 73  ? PRO B 69  LEU B 73  5 ? 5  
HELX_P HELX_P20 AC2 ASP B 102 ? ARG B 123 ? ASP B 102 ARG B 123 1 ? 22 
HELX_P HELX_P21 AC3 PRO B 282 ? ARG B 299 ? PRO B 282 ARG B 299 1 ? 18 
HELX_P HELX_P22 AC4 LYS B 329 ? ALA B 331 ? LYS B 329 ALA B 331 5 ? 3  
HELX_P HELX_P23 AC5 ASP B 332 ? GLY B 337 ? ASP B 332 GLY B 337 1 ? 6  
HELX_P HELX_P24 AC6 PRO B 358 ? GLY B 373 ? PRO B 358 GLY B 373 1 ? 16 
HELX_P HELX_P25 AC7 HIS B 384 ? GLN B 387 ? HIS B 384 GLN B 387 5 ? 4  
HELX_P HELX_P26 AC8 GLY B 388 ? GLU B 401 ? GLY B 388 GLU B 401 1 ? 14 
HELX_P HELX_P27 AC9 ALA B 414 ? GLU B 428 ? ALA B 414 GLU B 428 1 ? 15 
HELX_P HELX_P28 AD1 GLU B 443 ? ALA B 458 ? GLU B 443 ALA B 458 1 ? 16 
HELX_P HELX_P29 AD2 PRO B 515 ? GLY B 535 ? PRO B 515 GLY B 535 1 ? 21 
HELX_P HELX_P30 AD3 PHE B 554 ? GLU B 564 ? PHE B 554 GLU B 564 1 ? 11 
HELX_P HELX_P31 AD4 PRO B 627 ? THR B 639 ? PRO B 627 THR B 639 1 ? 13 
HELX_P HELX_P32 AD5 PRO B 653 ? GLY B 670 ? PRO B 653 GLY B 670 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A VAL 685 O   ? ? ? 1_555 G MG  .  MG ? ? A VAL 685 A MG  701 1_555 ? ? ? ? ? ? ?            2.416 ? 
metalc2  metalc ? ? A VAL 685 OXT ? ? ? 1_555 G MG  .  MG ? ? A VAL 685 A MG  701 1_555 ? ? ? ? ? ? ?            2.295 ? 
metalc3  metalc ? ? B VAL 685 O   ? ? ? 1_555 H MG  .  MG ? ? B VAL 685 B MG  701 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc4  metalc ? ? B VAL 685 OXT ? ? ? 1_555 H MG  .  MG ? ? B VAL 685 B MG  701 1_555 ? ? ? ? ? ? ?            2.848 ? 
metalc5  metalc ? ? C DT  1   OP2 ? ? ? 1_555 G MG  .  MG ? ? C DT  1   A MG  701 1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc6  metalc ? ? C DA  3   OP1 ? ? ? 1_555 G MG  .  MG ? ? C DA  3   A MG  701 1_555 ? ? ? ? ? ? ?            2.107 ? 
metalc7  metalc ? ? E DT  1   OP2 ? ? ? 1_555 H MG  .  MG ? ? E DT  1   B MG  701 1_555 ? ? ? ? ? ? ?            2.058 ? 
metalc8  metalc ? ? E DA  3   OP1 ? ? ? 1_555 H MG  .  MG ? ? E DA  3   B MG  701 1_555 ? ? ? ? ? ? ?            2.170 ? 
metalc9  metalc ? ? H MG  .   MG  ? ? ? 1_555 K HOH .  O  ? ? B MG  701 E HOH 801 1_555 ? ? ? ? ? ? ?            2.696 ? 
hydrog1  hydrog ? ? C DG  2   N1  ? ? ? 1_555 D DC  18 N3 ? ? C DG  2   D DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  2   N2  ? ? ? 1_555 D DC  18 O2 ? ? C DG  2   D DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  2   O6  ? ? ? 1_555 D DC  18 N4 ? ? C DG  2   D DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DA  3   N1  ? ? ? 1_555 D DT  17 N3 ? ? C DA  3   D DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DA  3   N6  ? ? ? 1_555 D DT  17 O4 ? ? C DA  3   D DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC  16 N3 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC  16 O2 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC  16 N4 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DG  5   N1  ? ? ? 1_555 D DC  15 N3 ? ? C DG  5   D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DG  5   N2  ? ? ? 1_555 D DC  15 O2 ? ? C DG  5   D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DG  5   O6  ? ? ? 1_555 D DC  15 N4 ? ? C DG  5   D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DT  6   N3  ? ? ? 1_555 D DA  14 N1 ? ? C DT  6   D DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DT  6   O4  ? ? ? 1_555 D DA  14 N6 ? ? C DT  6   D DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DA  7   N1  ? ? ? 1_555 D DT  13 N3 ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DA  7   N6  ? ? ? 1_555 D DT  13 O4 ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  12  N1  ? ? ? 1_555 D DC  9  N3 ? ? C DG  12  D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  12  N2  ? ? ? 1_555 D DC  9  O2 ? ? C DG  12  D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  12  O6  ? ? ? 1_555 D DC  9  N4 ? ? C DG  12  D DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG  13  N1  ? ? ? 1_555 D DC  8  N3 ? ? C DG  13  D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DG  13  N2  ? ? ? 1_555 D DC  8  O2 ? ? C DG  13  D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DG  13  O6  ? ? ? 1_555 D DC  8  N4 ? ? C DG  13  D DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DT  14  N3  ? ? ? 1_555 D DA  7  N1 ? ? C DT  14  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT  14  O4  ? ? ? 1_555 D DA  7  N6 ? ? C DT  14  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  15  N3  ? ? ? 1_555 D DA  6  N1 ? ? C DT  15  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT  15  O4  ? ? ? 1_555 D DA  6  N6 ? ? C DT  15  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DG  16  N1  ? ? ? 1_555 D DC  5  N3 ? ? C DG  16  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DG  16  N2  ? ? ? 1_555 D DC  5  O2 ? ? C DG  16  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DG  16  O6  ? ? ? 1_555 D DC  5  N4 ? ? C DG  16  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DT  17  N3  ? ? ? 1_555 D DA  4  N1 ? ? C DT  17  D DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DT  17  O4  ? ? ? 1_555 D DA  4  N6 ? ? C DT  17  D DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DG  2   N1  ? ? ? 1_555 F DC  18 N3 ? ? E DG  2   F DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DG  2   N2  ? ? ? 1_555 F DC  18 O2 ? ? E DG  2   F DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DG  2   O6  ? ? ? 1_555 F DC  18 N4 ? ? E DG  2   F DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DA  3   N1  ? ? ? 1_555 F DT  17 N3 ? ? E DA  3   F DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DA  3   N6  ? ? ? 1_555 F DT  17 O4 ? ? E DA  3   F DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DG  4   N1  ? ? ? 1_555 F DC  16 N3 ? ? E DG  4   F DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DG  4   N2  ? ? ? 1_555 F DC  16 O2 ? ? E DG  4   F DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DG  4   O6  ? ? ? 1_555 F DC  16 N4 ? ? E DG  4   F DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DG  5   N1  ? ? ? 1_555 F DC  15 N3 ? ? E DG  5   F DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DG  5   N2  ? ? ? 1_555 F DC  15 O2 ? ? E DG  5   F DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DG  5   O6  ? ? ? 1_555 F DC  15 N4 ? ? E DG  5   F DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DT  6   N3  ? ? ? 1_555 F DA  14 N1 ? ? E DT  6   F DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DT  6   O4  ? ? ? 1_555 F DA  14 N6 ? ? E DT  6   F DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DA  7   N1  ? ? ? 1_555 F DT  13 N3 ? ? E DA  7   F DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DA  7   N6  ? ? ? 1_555 F DT  13 O4 ? ? E DA  7   F DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DG  9   N1  ? ? ? 1_555 F DC  12 N3 ? ? E DG  9   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DG  9   N2  ? ? ? 1_555 F DC  12 O2 ? ? E DG  9   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DG  9   O6  ? ? ? 1_555 F DC  12 N4 ? ? E DG  9   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DT  10  N3  ? ? ? 1_555 F DA  11 N1 ? ? E DT  10  F DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DT  10  O4  ? ? ? 1_555 F DA  11 N6 ? ? E DT  10  F DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DA  11  N1  ? ? ? 1_555 F DT  10 N3 ? ? E DA  11  F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DA  11  N6  ? ? ? 1_555 F DT  10 O4 ? ? E DA  11  F DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DG  12  N1  ? ? ? 1_555 F DC  9  N3 ? ? E DG  12  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DG  12  N2  ? ? ? 1_555 F DC  9  O2 ? ? E DG  12  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DG  12  O6  ? ? ? 1_555 F DC  9  N4 ? ? E DG  12  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DG  13  N1  ? ? ? 1_555 F DC  8  N3 ? ? E DG  13  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? E DG  13  N2  ? ? ? 1_555 F DC  8  O2 ? ? E DG  13  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? E DG  13  O6  ? ? ? 1_555 F DC  8  N4 ? ? E DG  13  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? E DT  14  N3  ? ? ? 1_555 F DA  7  N1 ? ? E DT  14  F DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? E DT  14  O4  ? ? ? 1_555 F DA  7  N6 ? ? E DT  14  F DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? E DT  15  N3  ? ? ? 1_555 F DA  6  N1 ? ? E DT  15  F DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? E DT  15  O4  ? ? ? 1_555 F DA  6  N6 ? ? E DT  15  F DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? E DG  16  N1  ? ? ? 1_555 F DC  5  N3 ? ? E DG  16  F DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? E DG  16  N2  ? ? ? 1_555 F DC  5  O2 ? ? E DG  16  F DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? E DG  16  O6  ? ? ? 1_555 F DC  5  N4 ? ? E DG  16  F DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 34  A . ? ASP 34  A PRO 35  A ? PRO 35  A 1 4.78   
2 GLU 125 A . ? GLU 125 A GLY 126 A ? GLY 126 A 1 -10.12 
3 VAL 437 A . ? VAL 437 A PRO 438 A ? PRO 438 A 1 1.40   
4 ASP 34  B . ? ASP 34  B PRO 35  B ? PRO 35  B 1 0.97   
5 VAL 437 B . ? VAL 437 B PRO 438 B ? PRO 438 B 1 9.80   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 14 ? 
AA2 ? 11 ? 
AA3 ? 5  ? 
AA4 ? 2  ? 
AA5 ? 4  ? 
AA6 ? 14 ? 
AA7 ? 11 ? 
AA8 ? 5  ? 
AA9 ? 2  ? 
AB1 ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? anti-parallel 
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA1 9  10 ? anti-parallel 
AA1 10 11 ? parallel      
AA1 11 12 ? parallel      
AA1 12 13 ? anti-parallel 
AA1 13 14 ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? parallel      
AA2 4  5  ? parallel      
AA2 5  6  ? anti-parallel 
AA2 6  7  ? anti-parallel 
AA2 7  8  ? anti-parallel 
AA2 8  9  ? anti-parallel 
AA2 9  10 ? anti-parallel 
AA2 10 11 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA3 3  4  ? anti-parallel 
AA3 4  5  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA5 1  2  ? parallel      
AA5 2  3  ? parallel      
AA5 3  4  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? anti-parallel 
AA6 5  6  ? anti-parallel 
AA6 6  7  ? anti-parallel 
AA6 7  8  ? anti-parallel 
AA6 8  9  ? anti-parallel 
AA6 9  10 ? anti-parallel 
AA6 10 11 ? parallel      
AA6 11 12 ? parallel      
AA6 12 13 ? anti-parallel 
AA6 13 14 ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? parallel      
AA7 4  5  ? parallel      
AA7 5  6  ? anti-parallel 
AA7 6  7  ? anti-parallel 
AA7 7  8  ? anti-parallel 
AA7 8  9  ? anti-parallel 
AA7 9  10 ? anti-parallel 
AA7 10 11 ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA8 2  3  ? anti-parallel 
AA8 3  4  ? anti-parallel 
AA8 4  5  ? anti-parallel 
AA9 1  2  ? anti-parallel 
AB1 1  2  ? parallel      
AB1 2  3  ? parallel      
AB1 3  4  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  TRP A 128 ? GLU A 130 ? TRP A 128 GLU A 130 
AA1 2  ALA A 133 ? TYR A 135 ? ALA A 133 TYR A 135 
AA1 3  GLY A 150 ? VAL A 157 ? GLY A 150 VAL A 157 
AA1 4  ALA A 162 ? ALA A 170 ? ALA A 162 ALA A 170 
AA1 5  LYS A 6   ? PRO A 18  ? LYS A 6   PRO A 18  
AA1 6  GLU A 307 ? ARG A 315 ? GLU A 307 ARG A 315 
AA1 7  LEU A 592 ? PRO A 595 ? LEU A 592 PRO A 595 
AA1 8  THR A 600 ? LEU A 604 ? THR A 600 LEU A 604 
AA1 9  LEU A 617 ? ALA A 623 ? LEU A 617 ALA A 623 
AA1 10 ALA A 567 ? ARG A 574 ? ALA A 567 ARG A 574 
AA1 11 ARG A 540 ? ASN A 546 ? ARG A 540 ASN A 546 
AA1 12 LEU A 473 ? GLY A 480 ? LEU A 473 GLY A 480 
AA1 13 ARG A 486 ? VAL A 494 ? ARG A 486 VAL A 494 
AA1 14 GLU A 507 ? GLN A 509 ? GLU A 507 GLN A 509 
AA2 1  HIS A 500 ? TRP A 503 ? HIS A 500 TRP A 503 
AA2 2  ARG A 486 ? VAL A 494 ? ARG A 486 VAL A 494 
AA2 3  LEU A 473 ? GLY A 480 ? LEU A 473 GLY A 480 
AA2 4  ARG A 540 ? ASN A 546 ? ARG A 540 ASN A 546 
AA2 5  ALA A 567 ? ARG A 574 ? ALA A 567 ARG A 574 
AA2 6  LEU A 617 ? ALA A 623 ? LEU A 617 ALA A 623 
AA2 7  THR A 600 ? LEU A 604 ? THR A 600 LEU A 604 
AA2 8  LEU A 592 ? PRO A 595 ? LEU A 592 PRO A 595 
AA2 9  GLU A 307 ? ARG A 315 ? GLU A 307 ARG A 315 
AA2 10 LYS A 6   ? PRO A 18  ? LYS A 6   PRO A 18  
AA2 11 VAL A 581 ? PRO A 583 ? VAL A 581 PRO A 583 
AA3 1  THR A 57  ? MET A 60  ? THR A 57  MET A 60  
AA3 2  GLY A 63  ? SER A 66  ? GLY A 63  SER A 66  
AA3 3  TRP A 27  ? ASP A 34  ? TRP A 27  ASP A 34  
AA3 4  GLN A 84  ? ARG A 95  ? GLN A 84  ARG A 95  
AA3 5  GLU A 76  ? ARG A 81  ? GLU A 76  ARG A 81  
AA4 1  LYS A 320 ? MET A 322 ? LYS A 320 MET A 322 
AA4 2  ALA A 464 ? SER A 466 ? ALA A 464 SER A 466 
AA5 1  LEU A 376 ? THR A 380 ? LEU A 376 THR A 380 
AA5 2  THR A 344 ? ARG A 350 ? THR A 344 ARG A 350 
AA5 3  ALA A 405 ? THR A 410 ? ALA A 405 THR A 410 
AA5 4  SER A 432 ? ASN A 436 ? SER A 432 ASN A 436 
AA6 1  TRP B 128 ? GLU B 130 ? TRP B 128 GLU B 130 
AA6 2  ALA B 133 ? ARG B 137 ? ALA B 133 ARG B 137 
AA6 3  VAL B 147 ? VAL B 157 ? VAL B 147 VAL B 157 
AA6 4  ALA B 162 ? ILE B 173 ? ALA B 162 ILE B 173 
AA6 5  LYS B 6   ? PRO B 18  ? LYS B 6   PRO B 18  
AA6 6  GLU B 307 ? ARG B 315 ? GLU B 307 ARG B 315 
AA6 7  LEU B 592 ? PRO B 595 ? LEU B 592 PRO B 595 
AA6 8  THR B 600 ? LEU B 604 ? THR B 600 LEU B 604 
AA6 9  LEU B 617 ? ALA B 623 ? LEU B 617 ALA B 623 
AA6 10 ALA B 567 ? ARG B 574 ? ALA B 567 ARG B 574 
AA6 11 ARG B 540 ? ASN B 546 ? ARG B 540 ASN B 546 
AA6 12 LEU B 473 ? GLY B 480 ? LEU B 473 GLY B 480 
AA6 13 ARG B 486 ? VAL B 494 ? ARG B 486 VAL B 494 
AA6 14 GLU B 507 ? GLN B 509 ? GLU B 507 GLN B 509 
AA7 1  HIS B 500 ? TRP B 503 ? HIS B 500 TRP B 503 
AA7 2  ARG B 486 ? VAL B 494 ? ARG B 486 VAL B 494 
AA7 3  LEU B 473 ? GLY B 480 ? LEU B 473 GLY B 480 
AA7 4  ARG B 540 ? ASN B 546 ? ARG B 540 ASN B 546 
AA7 5  ALA B 567 ? ARG B 574 ? ALA B 567 ARG B 574 
AA7 6  LEU B 617 ? ALA B 623 ? LEU B 617 ALA B 623 
AA7 7  THR B 600 ? LEU B 604 ? THR B 600 LEU B 604 
AA7 8  LEU B 592 ? PRO B 595 ? LEU B 592 PRO B 595 
AA7 9  GLU B 307 ? ARG B 315 ? GLU B 307 ARG B 315 
AA7 10 LYS B 6   ? PRO B 18  ? LYS B 6   PRO B 18  
AA7 11 VAL B 581 ? PRO B 583 ? VAL B 581 PRO B 583 
AA8 1  THR B 57  ? MET B 60  ? THR B 57  MET B 60  
AA8 2  GLY B 63  ? SER B 66  ? GLY B 63  SER B 66  
AA8 3  TRP B 27  ? ASP B 34  ? TRP B 27  ASP B 34  
AA8 4  GLN B 84  ? ARG B 95  ? GLN B 84  ARG B 95  
AA8 5  GLU B 76  ? ARG B 81  ? GLU B 76  ARG B 81  
AA9 1  LYS B 320 ? MET B 322 ? LYS B 320 MET B 322 
AA9 2  ALA B 464 ? SER B 466 ? ALA B 464 SER B 466 
AB1 1  LEU B 376 ? THR B 380 ? LEU B 376 THR B 380 
AB1 2  THR B 344 ? ARG B 350 ? THR B 344 ARG B 350 
AB1 3  ALA B 405 ? THR B 410 ? ALA B 405 THR B 410 
AB1 4  SER B 432 ? ASN B 436 ? SER B 432 ASN B 436 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N GLU A 130 ? N GLU A 130 O ALA A 133 ? O ALA A 133 
AA1 2  3  N VAL A 134 ? N VAL A 134 O ALA A 151 ? O ALA A 151 
AA1 3  4  N VAL A 152 ? N VAL A 152 O ASP A 168 ? O ASP A 168 
AA1 4  5  O LEU A 165 ? O LEU A 165 N PHE A 14  ? N PHE A 14  
AA1 5  6  N THR A 7   ? N THR A 7   O ALA A 313 ? O ALA A 313 
AA1 6  7  N TYR A 314 ? N TYR A 314 O TYR A 593 ? O TYR A 593 
AA1 7  8  N VAL A 594 ? N VAL A 594 O LEU A 602 ? O LEU A 602 
AA1 8  9  N PHE A 601 ? N PHE A 601 O LEU A 619 ? O LEU A 619 
AA1 9  10 O LYS A 618 ? O LYS A 618 N ARG A 574 ? N ARG A 574 
AA1 10 11 O VAL A 573 ? O VAL A 573 N ARG A 545 ? N ARG A 545 
AA1 11 12 O LEU A 544 ? O LEU A 544 N VAL A 475 ? N VAL A 475 
AA1 12 13 N ASP A 478 ? N ASP A 478 O GLY A 489 ? O GLY A 489 
AA1 13 14 N ARG A 486 ? N ARG A 486 O GLN A 509 ? O GLN A 509 
AA2 1  2  O HIS A 500 ? O HIS A 500 N VAL A 494 ? N VAL A 494 
AA2 2  3  O GLY A 489 ? O GLY A 489 N ASP A 478 ? N ASP A 478 
AA2 3  4  N VAL A 475 ? N VAL A 475 O LEU A 544 ? O LEU A 544 
AA2 4  5  N ARG A 545 ? N ARG A 545 O VAL A 573 ? O VAL A 573 
AA2 5  6  N ARG A 574 ? N ARG A 574 O LYS A 618 ? O LYS A 618 
AA2 6  7  O LEU A 619 ? O LEU A 619 N PHE A 601 ? N PHE A 601 
AA2 7  8  O LEU A 602 ? O LEU A 602 N VAL A 594 ? N VAL A 594 
AA2 8  9  O TYR A 593 ? O TYR A 593 N TYR A 314 ? N TYR A 314 
AA2 9  10 O ALA A 313 ? O ALA A 313 N THR A 7   ? N THR A 7   
AA2 10 11 N PHE A 10  ? N PHE A 10  O TYR A 582 ? O TYR A 582 
AA3 1  2  N VAL A 58  ? N VAL A 58  O ALA A 65  ? O ALA A 65  
AA3 2  3  O LEU A 64  ? O LEU A 64  N LEU A 29  ? N LEU A 29  
AA3 3  4  N GLU A 30  ? N GLU A 30  O TYR A 91  ? O TYR A 91  
AA3 4  5  O TYR A 86  ? O TYR A 86  N LEU A 79  ? N LEU A 79  
AA4 1  2  N MET A 322 ? N MET A 322 O ALA A 464 ? O ALA A 464 
AA5 1  2  O HIS A 379 ? O HIS A 379 N LEU A 346 ? N LEU A 346 
AA5 2  3  N ALA A 347 ? N ALA A 347 O LEU A 407 ? O LEU A 407 
AA5 3  4  N VAL A 408 ? N VAL A 408 O GLN A 433 ? O GLN A 433 
AA6 1  2  N TRP B 128 ? N TRP B 128 O TYR B 135 ? O TYR B 135 
AA6 2  3  N ARG B 136 ? N ARG B 136 O GLY B 149 ? O GLY B 149 
AA6 3  4  N LEU B 148 ? N LEU B 148 O ARG B 172 ? O ARG B 172 
AA6 4  5  O PHE B 163 ? O PHE B 163 N LEU B 16  ? N LEU B 16  
AA6 5  6  N THR B 7   ? N THR B 7   O ALA B 313 ? O ALA B 313 
AA6 6  7  N TYR B 314 ? N TYR B 314 O TYR B 593 ? O TYR B 593 
AA6 7  8  N VAL B 594 ? N VAL B 594 O LEU B 602 ? O LEU B 602 
AA6 8  9  N PHE B 601 ? N PHE B 601 O LEU B 619 ? O LEU B 619 
AA6 9  10 O ALA B 623 ? O ALA B 623 N LEU B 570 ? N LEU B 570 
AA6 10 11 O ASP B 569 ? O ASP B 569 N LEU B 543 ? N LEU B 543 
AA6 11 12 O LEU B 544 ? O LEU B 544 N VAL B 475 ? N VAL B 475 
AA6 12 13 N ASP B 478 ? N ASP B 478 O GLY B 489 ? O GLY B 489 
AA6 13 14 N ARG B 486 ? N ARG B 486 O GLN B 509 ? O GLN B 509 
AA7 1  2  O HIS B 500 ? O HIS B 500 N VAL B 494 ? N VAL B 494 
AA7 2  3  O GLY B 489 ? O GLY B 489 N ASP B 478 ? N ASP B 478 
AA7 3  4  N VAL B 475 ? N VAL B 475 O LEU B 544 ? O LEU B 544 
AA7 4  5  N LEU B 543 ? N LEU B 543 O ASP B 569 ? O ASP B 569 
AA7 5  6  N LEU B 570 ? N LEU B 570 O ALA B 623 ? O ALA B 623 
AA7 6  7  O LEU B 619 ? O LEU B 619 N PHE B 601 ? N PHE B 601 
AA7 7  8  O LEU B 602 ? O LEU B 602 N VAL B 594 ? N VAL B 594 
AA7 8  9  O TYR B 593 ? O TYR B 593 N TYR B 314 ? N TYR B 314 
AA7 9  10 O ALA B 313 ? O ALA B 313 N THR B 7   ? N THR B 7   
AA7 10 11 N PHE B 10  ? N PHE B 10  O TYR B 582 ? O TYR B 582 
AA8 1  2  N VAL B 58  ? N VAL B 58  O ALA B 65  ? O ALA B 65  
AA8 2  3  O LEU B 64  ? O LEU B 64  N LEU B 29  ? N LEU B 29  
AA8 3  4  N ARG B 28  ? N ARG B 28  O GLY B 94  ? O GLY B 94  
AA8 4  5  O TYR B 86  ? O TYR B 86  N LEU B 79  ? N LEU B 79  
AA9 1  2  N MET B 322 ? N MET B 322 O ALA B 464 ? O ALA B 464 
AB1 1  2  O HIS B 379 ? O HIS B 379 N LEU B 346 ? N LEU B 346 
AB1 2  3  N ALA B 347 ? N ALA B 347 O LEU B 407 ? O LEU B 407 
AB1 3  4  N VAL B 408 ? N VAL B 408 O GLN B 433 ? O GLN B 433 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 701 ? 5 'binding site for residue MG A 701' 
AC2 Software B MG 701 ? 5 'binding site for residue MG B 701' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLN A 433 ? GLN A 433 . ? 1_555 ? 
2  AC1 5 VAL A 685 ? VAL A 685 . ? 1_555 ? 
3  AC1 5 DT  C 1   ? DT  C 1   . ? 1_555 ? 
4  AC1 5 DG  C 2   ? DG  C 2   . ? 1_555 ? 
5  AC1 5 DA  C 3   ? DA  C 3   . ? 1_555 ? 
6  AC2 5 ARG B 661 ? ARG B 661 . ? 1_555 ? 
7  AC2 5 VAL B 685 ? VAL B 685 . ? 1_555 ? 
8  AC2 5 DT  E 1   ? DT  E 1   . ? 1_555 ? 
9  AC2 5 DA  E 3   ? DA  E 3   . ? 1_555 ? 
10 AC2 5 HOH K .   ? HOH E 801 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5XOU 
_atom_sites.fract_transf_matrix[1][1]   0.008869 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008697 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006233 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LEU A 1 4   ? 17.811  2.997   64.744  1.00 71.89  ? 4   LEU A N     1 
ATOM   2     C  CA    . LEU A 1 4   ? 17.219  4.311   64.926  1.00 75.70  ? 4   LEU A CA    1 
ATOM   3     C  C     . LEU A 1 4   ? 17.396  4.878   66.334  1.00 87.73  ? 4   LEU A C     1 
ATOM   4     O  O     . LEU A 1 4   ? 17.703  4.150   67.286  1.00 98.54  ? 4   LEU A O     1 
ATOM   5     C  CB    . LEU A 1 4   ? 15.726  4.267   64.581  1.00 71.69  ? 4   LEU A CB    1 
ATOM   6     N  N     . GLY A 1 5   ? 17.253  6.200   66.403  1.00 78.36  ? 5   GLY A N     1 
ATOM   7     C  CA    . GLY A 1 5   ? 16.825  6.948   67.569  1.00 88.87  ? 5   GLY A CA    1 
ATOM   8     C  C     . GLY A 1 5   ? 15.703  7.928   67.199  1.00 85.20  ? 5   GLY A C     1 
ATOM   9     O  O     . GLY A 1 5   ? 15.879  8.754   66.295  1.00 79.46  ? 5   GLY A O     1 
ATOM   10    N  N     . LYS A 1 6   ? 14.547  7.846   67.835  1.00 87.15  ? 6   LYS A N     1 
ATOM   11    C  CA    . LYS A 1 6   ? 13.485  8.786   67.513  1.00 80.94  ? 6   LYS A CA    1 
ATOM   12    C  C     . LYS A 1 6   ? 13.831  10.151  68.052  1.00 76.96  ? 6   LYS A C     1 
ATOM   13    O  O     . LYS A 1 6   ? 14.499  10.261  69.052  1.00 92.93  ? 6   LYS A O     1 
ATOM   14    C  CB    . LYS A 1 6   ? 12.138  8.328   68.067  1.00 81.29  ? 6   LYS A CB    1 
ATOM   15    C  CG    . LYS A 1 6   ? 11.603  9.175   69.204  1.00 94.95  ? 6   LYS A CG    1 
ATOM   16    C  CD    . LYS A 1 6   ? 10.601  10.227  68.753  1.00 110.36 ? 6   LYS A CD    1 
ATOM   17    C  CE    . LYS A 1 6   ? 10.273  11.209  69.877  1.00 107.60 ? 6   LYS A CE    1 
ATOM   18    N  NZ    . LYS A 1 6   ? 9.349   10.682  70.924  1.00 94.77  ? 6   LYS A NZ    1 
ATOM   19    N  N     . THR A 1 7   ? 13.381  11.186  67.373  1.00 63.38  ? 7   THR A N     1 
ATOM   20    C  CA    . THR A 1 7   ? 13.625  12.554  67.782  1.00 63.63  ? 7   THR A CA    1 
ATOM   21    C  C     . THR A 1 7   ? 12.553  13.483  67.218  1.00 78.07  ? 7   THR A C     1 
ATOM   22    O  O     . THR A 1 7   ? 11.592  13.036  66.614  1.00 87.21  ? 7   THR A O     1 
ATOM   23    C  CB    . THR A 1 7   ? 15.016  13.011  67.367  1.00 30.00  ? 7   THR A CB    1 
ATOM   24    O  OG1   . THR A 1 7   ? 15.302  14.273  67.945  1.00 30.00  ? 7   THR A OG1   1 
ATOM   25    C  CG2   . THR A 1 7   ? 15.082  13.175  65.914  1.00 30.00  ? 7   THR A CG2   1 
ATOM   26    N  N     . GLU A 1 8   ? 12.696  14.780  67.424  1.00 66.03  ? 8   GLU A N     1 
ATOM   27    C  CA    . GLU A 1 8   ? 11.687  15.704  66.948  1.00 69.19  ? 8   GLU A CA    1 
ATOM   28    C  C     . GLU A 1 8   ? 12.278  16.904  66.279  1.00 68.88  ? 8   GLU A C     1 
ATOM   29    O  O     . GLU A 1 8   ? 13.230  17.462  66.757  1.00 71.95  ? 8   GLU A O     1 
ATOM   30    C  CB    . GLU A 1 8   ? 10.795  16.163  68.105  1.00 81.23  ? 8   GLU A CB    1 
ATOM   31    C  CG    . GLU A 1 8   ? 9.747   15.160  68.561  1.00 92.50  ? 8   GLU A CG    1 
ATOM   32    C  CD    . GLU A 1 8   ? 8.670   15.782  69.432  1.00 103.35 ? 8   GLU A CD    1 
ATOM   33    O  OE1   . GLU A 1 8   ? 7.481   15.465  69.228  1.00 110.86 ? 8   GLU A OE1   1 
ATOM   34    O  OE2   . GLU A 1 8   ? 9.006   16.584  70.324  1.00 108.20 ? 8   GLU A OE2   1 
ATOM   35    N  N     . VAL A 1 9   ? 11.685  17.311  65.172  1.00 71.62  ? 9   VAL A N     1 
ATOM   36    C  CA    . VAL A 1 9   ? 12.161  18.469  64.444  1.00 65.22  ? 9   VAL A CA    1 
ATOM   37    C  C     . VAL A 1 9   ? 10.990  19.405  64.228  1.00 64.34  ? 9   VAL A C     1 
ATOM   38    O  O     . VAL A 1 9   ? 9.830   18.987  64.250  1.00 64.24  ? 9   VAL A O     1 
ATOM   39    C  CB    . VAL A 1 9   ? 12.809  18.068  63.087  1.00 57.67  ? 9   VAL A CB    1 
ATOM   40    C  CG1   . VAL A 1 9   ? 13.972  17.049  63.301  1.00 46.96  ? 9   VAL A CG1   1 
ATOM   41    C  CG2   . VAL A 1 9   ? 11.789  17.473  62.179  1.00 42.34  ? 9   VAL A CG2   1 
ATOM   42    N  N     . PHE A 1 10  ? 11.309  20.674  64.001  1.00 67.74  ? 10  PHE A N     1 
ATOM   43    C  CA    . PHE A 1 10  ? 10.377  21.664  63.492  1.00 73.98  ? 10  PHE A CA    1 
ATOM   44    C  C     . PHE A 1 10  ? 10.481  21.654  61.982  1.00 84.64  ? 10  PHE A C     1 
ATOM   45    O  O     . PHE A 1 10  ? 11.584  21.531  61.430  1.00 98.72  ? 10  PHE A O     1 
ATOM   46    C  CB    . PHE A 1 10  ? 10.721  23.062  64.009  1.00 77.58  ? 10  PHE A CB    1 
ATOM   47    C  CG    . PHE A 1 10  ? 10.479  23.245  65.483  1.00 88.48  ? 10  PHE A CG    1 
ATOM   48    C  CD1   . PHE A 1 10  ? 9.212   23.138  66.042  1.00 87.15  ? 10  PHE A CD1   1 
ATOM   49    C  CD2   . PHE A 1 10  ? 11.555  23.570  66.313  1.00 89.72  ? 10  PHE A CD2   1 
ATOM   50    C  CE1   . PHE A 1 10  ? 9.029   23.303  67.409  1.00 77.80  ? 10  PHE A CE1   1 
ATOM   51    C  CE2   . PHE A 1 10  ? 11.369  23.746  67.671  1.00 84.76  ? 10  PHE A CE2   1 
ATOM   52    C  CZ    . PHE A 1 10  ? 10.110  23.604  68.216  1.00 72.34  ? 10  PHE A CZ    1 
ATOM   53    N  N     . LEU A 1 11  ? 9.349   21.803  61.308  1.00 85.63  ? 11  LEU A N     1 
ATOM   54    C  CA    . LEU A 1 11  ? 9.390   22.107  59.892  1.00 65.65  ? 11  LEU A CA    1 
ATOM   55    C  C     . LEU A 1 11  ? 9.238   23.621  59.802  1.00 62.28  ? 11  LEU A C     1 
ATOM   56    O  O     . LEU A 1 11  ? 8.767   24.236  60.749  1.00 76.81  ? 11  LEU A O     1 
ATOM   57    C  CB    . LEU A 1 11  ? 8.277   21.362  59.160  1.00 53.69  ? 11  LEU A CB    1 
ATOM   58    C  CG    . LEU A 1 11  ? 8.205   19.843  59.387  1.00 56.90  ? 11  LEU A CG    1 
ATOM   59    C  CD1   . LEU A 1 11  ? 7.097   19.224  58.549  1.00 55.15  ? 11  LEU A CD1   1 
ATOM   60    C  CD2   . LEU A 1 11  ? 9.499   19.134  59.106  1.00 56.60  ? 11  LEU A CD2   1 
ATOM   61    N  N     . ASN A 1 12  ? 9.558   24.225  58.666  1.00 58.07  ? 12  ASN A N     1 
ATOM   62    C  CA    . ASN A 1 12  ? 9.306   25.653  58.503  1.00 62.97  ? 12  ASN A CA    1 
ATOM   63    C  C     . ASN A 1 12  ? 7.848   25.928  58.099  1.00 54.05  ? 12  ASN A C     1 
ATOM   64    O  O     . ASN A 1 12  ? 7.561   26.747  57.239  1.00 49.23  ? 12  ASN A O     1 
ATOM   65    C  CB    . ASN A 1 12  ? 10.283  26.244  57.474  1.00 67.97  ? 12  ASN A CB    1 
ATOM   66    C  CG    . ASN A 1 12  ? 10.128  25.626  56.093  1.00 70.90  ? 12  ASN A CG    1 
ATOM   67    O  OD1   . ASN A 1 12  ? 9.746   24.464  55.951  1.00 71.78  ? 12  ASN A OD1   1 
ATOM   68    N  ND2   . ASN A 1 12  ? 10.398  26.409  55.074  1.00 67.35  ? 12  ASN A ND2   1 
ATOM   69    N  N     . ARG A 1 13  ? 6.937   25.280  58.814  1.00 57.53  ? 13  ARG A N     1 
ATOM   70    C  CA    . ARG A 1 13  ? 5.504   25.454  58.634  1.00 68.80  ? 13  ARG A CA    1 
ATOM   71    C  C     . ARG A 1 13  ? 4.920   25.800  59.975  1.00 81.92  ? 13  ARG A C     1 
ATOM   72    O  O     . ARG A 1 13  ? 5.423   25.398  61.024  1.00 82.14  ? 13  ARG A O     1 
ATOM   73    C  CB    . ARG A 1 13  ? 4.827   24.182  58.096  1.00 75.17  ? 13  ARG A CB    1 
ATOM   74    C  CG    . ARG A 1 13  ? 5.491   23.755  56.884  1.00 78.84  ? 13  ARG A CG    1 
ATOM   75    C  CD    . ARG A 1 13  ? 5.278   22.461  56.203  1.00 77.05  ? 13  ARG A CD    1 
ATOM   76    N  NE    . ARG A 1 13  ? 4.306   21.394  56.168  1.00 72.66  ? 13  ARG A NE    1 
ATOM   77    C  CZ    . ARG A 1 13  ? 4.681   20.341  55.453  1.00 67.64  ? 13  ARG A CZ    1 
ATOM   78    N  NH1   . ARG A 1 13  ? 5.888   20.412  54.889  1.00 74.83  ? 13  ARG A NH1   1 
ATOM   79    N  NH2   . ARG A 1 13  ? 3.937   19.265  55.292  1.00 58.73  ? 13  ARG A NH2   1 
ATOM   80    N  N     . PHE A 1 14  ? 3.819   26.524  59.924  1.00 87.04  ? 14  PHE A N     1 
ATOM   81    C  CA    . PHE A 1 14  ? 3.222   27.059  61.124  1.00 79.21  ? 14  PHE A CA    1 
ATOM   82    C  C     . PHE A 1 14  ? 1.720   26.923  61.015  1.00 77.98  ? 14  PHE A C     1 
ATOM   83    O  O     . PHE A 1 14  ? 1.118   27.348  60.022  1.00 79.40  ? 14  PHE A O     1 
ATOM   84    C  CB    . PHE A 1 14  ? 3.620   28.514  61.328  1.00 75.08  ? 14  PHE A CB    1 
ATOM   85    C  CG    . PHE A 1 14  ? 5.093   28.730  61.500  1.00 69.63  ? 14  PHE A CG    1 
ATOM   86    C  CD1   . PHE A 1 14  ? 5.923   28.850  60.404  1.00 71.37  ? 14  PHE A CD1   1 
ATOM   87    C  CD2   . PHE A 1 14  ? 5.640   28.850  62.753  1.00 81.25  ? 14  PHE A CD2   1 
ATOM   88    C  CE1   . PHE A 1 14  ? 7.276   29.073  60.556  1.00 76.13  ? 14  PHE A CE1   1 
ATOM   89    C  CE2   . PHE A 1 14  ? 6.990   29.076  62.913  1.00 86.33  ? 14  PHE A CE2   1 
ATOM   90    C  CZ    . PHE A 1 14  ? 7.810   29.195  61.807  1.00 82.33  ? 14  PHE A CZ    1 
ATOM   91    N  N     . ALA A 1 15  ? 1.125   26.290  62.013  1.00 74.06  ? 15  ALA A N     1 
ATOM   92    C  CA    . ALA A 1 15  ? -0.311  26.175  62.068  1.00 68.00  ? 15  ALA A CA    1 
ATOM   93    C  C     . ALA A 1 15  ? -0.948  27.477  62.502  1.00 73.85  ? 15  ALA A C     1 
ATOM   94    O  O     . ALA A 1 15  ? -0.510  28.092  63.480  1.00 83.78  ? 15  ALA A O     1 
ATOM   95    C  CB    . ALA A 1 15  ? -0.713  25.067  63.007  1.00 63.31  ? 15  ALA A CB    1 
ATOM   96    N  N     . LEU A 1 16  ? -1.915  27.942  61.712  1.00 68.84  ? 16  LEU A N     1 
ATOM   97    C  CA    . LEU A 1 16  ? -2.659  29.132  62.075  1.00 73.24  ? 16  LEU A CA    1 
ATOM   98    C  C     . LEU A 1 16  ? -4.106  28.750  62.343  1.00 75.54  ? 16  LEU A C     1 
ATOM   99    O  O     . LEU A 1 16  ? -4.404  27.576  62.567  1.00 82.69  ? 16  LEU A O     1 
ATOM   100   C  CB    . LEU A 1 16  ? -2.574  30.210  61.002  1.00 82.21  ? 16  LEU A CB    1 
ATOM   101   C  CG    . LEU A 1 16  ? -1.159  30.606  60.626  1.00 83.17  ? 16  LEU A CG    1 
ATOM   102   C  CD1   . LEU A 1 16  ? -1.101  31.372  59.312  1.00 76.16  ? 16  LEU A CD1   1 
ATOM   103   C  CD2   . LEU A 1 16  ? -0.708  31.457  61.776  1.00 89.42  ? 16  LEU A CD2   1 
ATOM   104   N  N     . ARG A 1 17  ? -5.021  29.696  62.204  1.00 67.43  ? 17  ARG A N     1 
ATOM   105   C  CA    . ARG A 1 17  ? -6.394  29.449  62.642  1.00 72.25  ? 17  ARG A CA    1 
ATOM   106   C  C     . ARG A 1 17  ? -7.127  28.399  61.818  1.00 80.82  ? 17  ARG A C     1 
ATOM   107   O  O     . ARG A 1 17  ? -6.766  28.133  60.671  1.00 90.82  ? 17  ARG A O     1 
ATOM   108   C  CB    . ARG A 1 17  ? -7.201  30.761  62.661  1.00 64.16  ? 17  ARG A CB    1 
ATOM   109   C  CG    . ARG A 1 17  ? -7.542  31.367  61.321  1.00 56.46  ? 17  ARG A CG    1 
ATOM   110   C  CD    . ARG A 1 17  ? -8.574  32.448  61.540  1.00 73.30  ? 17  ARG A CD    1 
ATOM   111   N  NE    . ARG A 1 17  ? -8.959  33.159  60.328  1.00 85.12  ? 17  ARG A NE    1 
ATOM   112   C  CZ    . ARG A 1 17  ? -9.746  32.656  59.386  1.00 76.81  ? 17  ARG A CZ    1 
ATOM   113   N  NH1   . ARG A 1 17  ? -10.179 31.412  59.473  1.00 67.26  ? 17  ARG A NH1   1 
ATOM   114   N  NH2   . ARG A 1 17  ? -10.061 33.387  58.335  1.00 73.05  ? 17  ARG A NH2   1 
ATOM   115   N  N     . PRO A 1 18  ? -8.082  27.702  62.443  1.00 69.55  ? 18  PRO A N     1 
ATOM   116   C  CA    . PRO A 1 18  ? -8.988  26.831  61.692  1.00 63.51  ? 18  PRO A CA    1 
ATOM   117   C  C     . PRO A 1 18  ? -9.794  27.665  60.667  1.00 77.88  ? 18  PRO A C     1 
ATOM   118   O  O     . PRO A 1 18  ? -10.079 28.840  60.944  1.00 95.20  ? 18  PRO A O     1 
ATOM   119   C  CB    . PRO A 1 18  ? -9.917  26.281  62.749  1.00 58.32  ? 18  PRO A CB    1 
ATOM   120   C  CG    . PRO A 1 18  ? -9.172  26.416  64.013  1.00 76.84  ? 18  PRO A CG    1 
ATOM   121   C  CD    . PRO A 1 18  ? -8.338  27.651  63.884  1.00 79.41  ? 18  PRO A CD    1 
ATOM   122   N  N     . LEU A 1 19  ? -10.147 27.083  59.524  1.00 69.54  ? 19  LEU A N     1 
ATOM   123   C  CA    . LEU A 1 19  ? -11.036 27.776  58.589  1.00 76.95  ? 19  LEU A CA    1 
ATOM   124   C  C     . LEU A 1 19  ? -12.397 27.994  59.231  1.00 78.77  ? 19  LEU A C     1 
ATOM   125   O  O     . LEU A 1 19  ? -12.977 27.050  59.764  1.00 69.11  ? 19  LEU A O     1 
ATOM   126   C  CB    . LEU A 1 19  ? -11.176 26.996  57.269  1.00 62.64  ? 19  LEU A CB    1 
ATOM   127   C  CG    . LEU A 1 19  ? -10.115 27.281  56.195  1.00 53.99  ? 19  LEU A CG    1 
ATOM   128   C  CD1   . LEU A 1 19  ? -8.710  26.939  56.634  1.00 61.25  ? 19  LEU A CD1   1 
ATOM   129   C  CD2   . LEU A 1 19  ? -10.434 26.546  54.900  1.00 55.85  ? 19  LEU A CD2   1 
ATOM   130   N  N     . ASN A 1 20  ? -12.922 29.217  59.156  1.00 78.64  ? 20  ASN A N     1 
ATOM   131   C  CA    . ASN A 1 20  ? -14.253 29.506  59.712  1.00 85.75  ? 20  ASN A CA    1 
ATOM   132   C  C     . ASN A 1 20  ? -15.367 28.818  58.869  1.00 75.36  ? 20  ASN A C     1 
ATOM   133   O  O     . ASN A 1 20  ? -15.088 28.303  57.782  1.00 65.31  ? 20  ASN A O     1 
ATOM   134   C  CB    . ASN A 1 20  ? -14.391 31.036  60.033  1.00 84.35  ? 20  ASN A CB    1 
ATOM   135   C  CG    . ASN A 1 20  ? -14.312 31.952  58.834  1.00 74.35  ? 20  ASN A CG    1 
ATOM   136   O  OD1   . ASN A 1 20  ? -14.925 31.719  57.809  1.00 68.97  ? 20  ASN A OD1   1 
ATOM   137   N  ND2   . ASN A 1 20  ? -13.562 33.053  58.993  1.00 84.78  ? 20  ASN A ND2   1 
ATOM   138   N  N     . PRO A 1 21  ? -16.613 28.698  59.426  1.00 78.45  ? 21  PRO A N     1 
ATOM   139   C  CA    . PRO A 1 21  ? -17.674 27.948  58.720  1.00 66.05  ? 21  PRO A CA    1 
ATOM   140   C  C     . PRO A 1 21  ? -18.089 28.504  57.398  1.00 87.67  ? 21  PRO A C     1 
ATOM   141   O  O     . PRO A 1 21  ? -18.670 27.789  56.565  1.00 94.76  ? 21  PRO A O     1 
ATOM   142   C  CB    . PRO A 1 21  ? -18.847 28.041  59.717  1.00 53.05  ? 21  PRO A CB    1 
ATOM   143   C  CG    . PRO A 1 21  ? -18.564 29.128  60.577  1.00 66.99  ? 21  PRO A CG    1 
ATOM   144   C  CD    . PRO A 1 21  ? -17.087 29.175  60.753  1.00 79.86  ? 21  PRO A CD    1 
ATOM   145   N  N     . GLU A 1 22  ? -17.680 29.742  57.202  1.00 89.45  ? 22  GLU A N     1 
ATOM   146   C  CA    . GLU A 1 22  ? -17.837 30.454  56.026  1.00 98.85  ? 22  GLU A CA    1 
ATOM   147   C  C     . GLU A 1 22  ? -16.789 30.077  54.961  1.00 80.76  ? 22  GLU A C     1 
ATOM   148   O  O     . GLU A 1 22  ? -17.171 29.955  53.836  1.00 77.91  ? 22  GLU A O     1 
ATOM   149   C  CB    . GLU A 1 22  ? -17.881 31.969  56.224  1.00 114.26 ? 22  GLU A CB    1 
ATOM   150   C  CG    . GLU A 1 22  ? -18.630 32.346  57.443  1.00 122.74 ? 22  GLU A CG    1 
ATOM   151   C  CD    . GLU A 1 22  ? -19.629 33.425  57.110  1.00 128.52 ? 22  GLU A CD    1 
ATOM   152   O  OE1   . GLU A 1 22  ? -19.673 33.727  55.906  1.00 123.51 ? 22  GLU A OE1   1 
ATOM   153   O  OE2   . GLU A 1 22  ? -20.389 33.899  58.006  1.00 137.78 ? 22  GLU A OE2   1 
ATOM   154   N  N     . GLU A 1 23  ? -15.540 29.870  55.334  1.00 86.89  ? 23  GLU A N     1 
ATOM   155   C  CA    . GLU A 1 23  ? -14.491 29.529  54.367  1.00 88.46  ? 23  GLU A CA    1 
ATOM   156   C  C     . GLU A 1 23  ? -14.660 28.079  53.926  1.00 98.25  ? 23  GLU A C     1 
ATOM   157   O  O     . GLU A 1 23  ? -14.266 27.673  52.827  1.00 87.42  ? 23  GLU A O     1 
ATOM   158   C  CB    . GLU A 1 23  ? -13.103 29.792  54.945  1.00 68.58  ? 23  GLU A CB    1 
ATOM   159   C  CG    . GLU A 1 23  ? -12.991 31.251  55.325  1.00 60.70  ? 23  GLU A CG    1 
ATOM   160   C  CD    . GLU A 1 23  ? -11.911 31.502  56.354  1.00 69.75  ? 23  GLU A CD    1 
ATOM   161   O  OE1   . GLU A 1 23  ? -11.255 32.448  56.551  1.00 82.24  ? 23  GLU A OE1   1 
ATOM   162   O  OE2   . GLU A 1 23  ? -11.492 30.629  57.007  1.00 64.47  ? 23  GLU A OE2   1 
ATOM   163   N  N     . LEU A 1 24  ? -15.394 27.322  54.739  1.00 97.45  ? 24  LEU A N     1 
ATOM   164   C  CA    . LEU A 1 24  ? -15.651 25.944  54.395  1.00 101.09 ? 24  LEU A CA    1 
ATOM   165   C  C     . LEU A 1 24  ? -16.804 25.810  53.399  1.00 112.38 ? 24  LEU A C     1 
ATOM   166   O  O     . LEU A 1 24  ? -16.992 24.752  52.837  1.00 84.75  ? 24  LEU A O     1 
ATOM   167   C  CB    . LEU A 1 24  ? -15.961 25.127  55.645  1.00 97.09  ? 24  LEU A CB    1 
ATOM   168   C  CG    . LEU A 1 24  ? -14.799 24.835  56.632  1.00 95.41  ? 24  LEU A CG    1 
ATOM   169   C  CD1   . LEU A 1 24  ? -15.282 24.178  57.940  1.00 97.16  ? 24  LEU A CD1   1 
ATOM   170   C  CD2   . LEU A 1 24  ? -13.718 24.014  55.955  1.00 83.99  ? 24  LEU A CD2   1 
ATOM   171   N  N     . ARG A 1 25  ? -17.609 26.840  53.183  1.00 106.74 ? 25  ARG A N     1 
ATOM   172   C  CA    . ARG A 1 25  ? -18.666 26.740  52.171  1.00 108.38 ? 25  ARG A CA    1 
ATOM   173   C  C     . ARG A 1 25  ? -18.402 27.927  51.205  1.00 100.50 ? 25  ARG A C     1 
ATOM   174   O  O     . ARG A 1 25  ? -18.996 29.013  51.309  1.00 121.88 ? 25  ARG A O     1 
ATOM   175   C  CB    . ARG A 1 25  ? -20.110 26.740  52.718  1.00 115.68 ? 25  ARG A CB    1 
ATOM   176   C  CG    . ARG A 1 25  ? -20.308 27.885  53.607  1.00 126.48 ? 25  ARG A CG    1 
ATOM   177   C  CD    . ARG A 1 25  ? -21.630 28.362  54.105  1.00 136.65 ? 25  ARG A CD    1 
ATOM   178   N  NE    . ARG A 1 25  ? -21.106 29.594  54.688  1.00 138.65 ? 25  ARG A NE    1 
ATOM   179   C  CZ    . ARG A 1 25  ? -21.714 30.726  55.029  1.00 135.27 ? 25  ARG A CZ    1 
ATOM   180   N  NH1   . ARG A 1 25  ? -20.925 31.693  55.462  1.00 129.75 ? 25  ARG A NH1   1 
ATOM   181   N  NH2   . ARG A 1 25  ? -23.028 30.933  54.879  1.00 139.72 ? 25  ARG A NH2   1 
ATOM   182   N  N     . PRO A 1 26  ? -17.428 27.764  50.332  1.00 105.33 ? 26  PRO A N     1 
ATOM   183   C  CA    . PRO A 1 26  ? -17.140 28.902  49.451  1.00 90.36  ? 26  PRO A CA    1 
ATOM   184   C  C     . PRO A 1 26  ? -18.233 29.055  48.448  1.00 85.47  ? 26  PRO A C     1 
ATOM   185   O  O     . PRO A 1 26  ? -18.956 28.080  48.224  1.00 68.10  ? 26  PRO A O     1 
ATOM   186   C  CB    . PRO A 1 26  ? -15.812 28.504  48.786  1.00 74.65  ? 26  PRO A CB    1 
ATOM   187   C  CG    . PRO A 1 26  ? -15.818 26.975  48.880  1.00 76.30  ? 26  PRO A CG    1 
ATOM   188   C  CD    . PRO A 1 26  ? -16.549 26.607  50.109  1.00 85.32  ? 26  PRO A CD    1 
ATOM   189   N  N     . TRP A 1 27  ? -18.365 30.249  47.867  1.00 88.90  ? 27  TRP A N     1 
ATOM   190   C  CA    . TRP A 1 27  ? -19.364 30.503  46.852  1.00 88.85  ? 27  TRP A CA    1 
ATOM   191   C  C     . TRP A 1 27  ? -18.954 29.889  45.563  1.00 88.24  ? 27  TRP A C     1 
ATOM   192   O  O     . TRP A 1 27  ? -17.793 29.947  45.166  1.00 84.83  ? 27  TRP A O     1 
ATOM   193   C  CB    . TRP A 1 27  ? -19.534 31.998  46.603  1.00 87.14  ? 27  TRP A CB    1 
ATOM   194   C  CG    . TRP A 1 27  ? -20.343 32.789  47.563  1.00 91.08  ? 27  TRP A CG    1 
ATOM   195   C  CD1   . TRP A 1 27  ? -21.685 33.000  47.484  1.00 86.44  ? 27  TRP A CD1   1 
ATOM   196   C  CD2   . TRP A 1 27  ? -19.881 33.554  48.688  1.00 105.71 ? 27  TRP A CD2   1 
ATOM   197   N  NE1   . TRP A 1 27  ? -22.099 33.817  48.494  1.00 100.75 ? 27  TRP A NE1   1 
ATOM   198   C  CE2   . TRP A 1 27  ? -21.011 34.188  49.243  1.00 111.54 ? 27  TRP A CE2   1 
ATOM   199   C  CE3   . TRP A 1 27  ? -18.627 33.774  49.277  1.00 111.72 ? 27  TRP A CE3   1 
ATOM   200   C  CZ2   . TRP A 1 27  ? -20.933 35.016  50.366  1.00 118.41 ? 27  TRP A CZ2   1 
ATOM   201   C  CZ3   . TRP A 1 27  ? -18.560 34.593  50.404  1.00 118.70 ? 27  TRP A CZ3   1 
ATOM   202   C  CH2   . TRP A 1 27  ? -19.709 35.193  50.938  1.00 121.64 ? 27  TRP A CH2   1 
ATOM   203   N  N     . ARG A 1 28  ? -19.917 29.287  44.888  1.00 95.09  ? 28  ARG A N     1 
ATOM   204   C  CA    . ARG A 1 28  ? -19.538 28.801  43.597  1.00 91.75  ? 28  ARG A CA    1 
ATOM   205   C  C     . ARG A 1 28  ? -20.167 29.697  42.535  1.00 81.71  ? 28  ARG A C     1 
ATOM   206   O  O     . ARG A 1 28  ? -21.291 30.176  42.651  1.00 73.37  ? 28  ARG A O     1 
ATOM   207   C  CB    . ARG A 1 28  ? -19.731 27.303  43.430  1.00 96.76  ? 28  ARG A CB    1 
ATOM   208   C  CG    . ARG A 1 28  ? -20.408 26.760  42.297  1.00 108.30 ? 28  ARG A CG    1 
ATOM   209   C  CD    . ARG A 1 28  ? -20.796 25.335  42.603  1.00 118.63 ? 28  ARG A CD    1 
ATOM   210   N  NE    . ARG A 1 28  ? -21.961 24.919  41.858  1.00 121.44 ? 28  ARG A NE    1 
ATOM   211   C  CZ    . ARG A 1 28  ? -22.052 24.753  40.545  1.00 122.80 ? 28  ARG A CZ    1 
ATOM   212   N  NH1   . ARG A 1 28  ? -23.215 24.411  40.011  1.00 129.70 ? 28  ARG A NH1   1 
ATOM   213   N  NH2   . ARG A 1 28  ? -21.004 24.981  39.752  1.00 113.75 ? 28  ARG A NH2   1 
ATOM   214   N  N     . LEU A 1 29  ? -19.430 29.849  41.447  1.00 84.38  ? 29  LEU A N     1 
ATOM   215   C  CA    . LEU A 1 29  ? -19.864 30.667  40.349  1.00 79.81  ? 29  LEU A CA    1 
ATOM   216   C  C     . LEU A 1 29  ? -19.624 29.935  39.056  1.00 84.10  ? 29  LEU A C     1 
ATOM   217   O  O     . LEU A 1 29  ? -18.593 29.281  38.870  1.00 75.35  ? 29  LEU A O     1 
ATOM   218   C  CB    . LEU A 1 29  ? -19.059 31.965  40.293  1.00 82.07  ? 29  LEU A CB    1 
ATOM   219   C  CG    . LEU A 1 29  ? -18.981 33.122  41.283  1.00 86.63  ? 29  LEU A CG    1 
ATOM   220   C  CD1   . LEU A 1 29  ? -20.283 33.785  41.590  1.00 89.68  ? 29  LEU A CD1   1 
ATOM   221   C  CD2   . LEU A 1 29  ? -18.302 32.644  42.549  1.00 93.65  ? 29  LEU A CD2   1 
ATOM   222   N  N     . GLU A 1 30  ? -20.589 30.098  38.157  1.00 89.72  ? 30  GLU A N     1 
ATOM   223   C  CA    . GLU A 1 30  ? -20.520 29.601  36.793  1.00 95.11  ? 30  GLU A CA    1 
ATOM   224   C  C     . GLU A 1 30  ? -19.934 30.634  35.877  1.00 82.94  ? 30  GLU A C     1 
ATOM   225   O  O     . GLU A 1 30  ? -20.394 31.775  35.883  1.00 84.29  ? 30  GLU A O     1 
ATOM   226   C  CB    . GLU A 1 30  ? -21.905 29.549  36.214  1.00 111.73 ? 30  GLU A CB    1 
ATOM   227   C  CG    . GLU A 1 30  ? -22.772 28.449  36.191  1.00 118.17 ? 30  GLU A CG    1 
ATOM   228   C  CD    . GLU A 1 30  ? -22.680 27.632  34.964  1.00 125.39 ? 30  GLU A CD    1 
ATOM   229   O  OE1   . GLU A 1 30  ? -22.954 28.128  33.831  1.00 129.29 ? 30  GLU A OE1   1 
ATOM   230   O  OE2   . GLU A 1 30  ? -22.269 26.460  35.155  1.00 127.94 ? 30  GLU A OE2   1 
ATOM   231   N  N     . VAL A 1 31  ? -19.079 30.220  34.959  1.00 80.91  ? 31  VAL A N     1 
ATOM   232   C  CA    . VAL A 1 31  ? -18.447 31.170  34.054  1.00 82.80  ? 31  VAL A CA    1 
ATOM   233   C  C     . VAL A 1 31  ? -19.023 31.068  32.632  1.00 92.05  ? 31  VAL A C     1 
ATOM   234   O  O     . VAL A 1 31  ? -18.992 29.995  32.018  1.00 103.93 ? 31  VAL A O     1 
ATOM   235   C  CB    . VAL A 1 31  ? -16.945 30.988  33.959  1.00 84.46  ? 31  VAL A CB    1 
ATOM   236   C  CG1   . VAL A 1 31  ? -16.383 32.030  33.002  1.00 66.13  ? 31  VAL A CG1   1 
ATOM   237   C  CG2   . VAL A 1 31  ? -16.314 31.111  35.311  1.00 91.45  ? 31  VAL A CG2   1 
ATOM   238   N  N     . VAL A 1 32  ? -19.461 32.183  32.068  1.00 83.67  ? 32  VAL A N     1 
ATOM   239   C  CA    . VAL A 1 32  ? -19.840 32.196  30.670  1.00 81.80  ? 32  VAL A CA    1 
ATOM   240   C  C     . VAL A 1 32  ? -18.983 33.125  29.822  1.00 90.63  ? 32  VAL A C     1 
ATOM   241   O  O     . VAL A 1 32  ? -18.933 34.319  30.024  1.00 93.14  ? 32  VAL A O     1 
ATOM   242   C  CB    . VAL A 1 32  ? -21.292 32.623  30.488  1.00 78.67  ? 32  VAL A CB    1 
ATOM   243   C  CG1   . VAL A 1 32  ? -21.635 32.690  29.014  1.00 85.78  ? 32  VAL A CG1   1 
ATOM   244   C  CG2   . VAL A 1 32  ? -22.201 31.706  31.240  1.00 79.17  ? 32  VAL A CG2   1 
ATOM   245   N  N     . LEU A 1 33  ? -18.214 32.513  28.938  1.00 92.74  ? 33  LEU A N     1 
ATOM   246   C  CA    . LEU A 1 33  ? -17.334 33.212  28.024  1.00 102.89 ? 33  LEU A CA    1 
ATOM   247   C  C     . LEU A 1 33  ? -17.853 33.351  26.579  1.00 115.23 ? 33  LEU A C     1 
ATOM   248   O  O     . LEU A 1 33  ? -18.446 32.419  26.037  1.00 125.30 ? 33  LEU A O     1 
ATOM   249   C  CB    . LEU A 1 33  ? -15.980 32.504  27.995  1.00 113.29 ? 33  LEU A CB    1 
ATOM   250   C  CG    . LEU A 1 33  ? -15.104 32.560  29.240  1.00 111.96 ? 33  LEU A CG    1 
ATOM   251   C  CD1   . LEU A 1 33  ? -14.174 31.340  29.294  1.00 116.74 ? 33  LEU A CD1   1 
ATOM   252   C  CD2   . LEU A 1 33  ? -14.338 33.857  29.217  1.00 105.36 ? 33  LEU A CD2   1 
ATOM   253   N  N     . ASP A 1 34  ? -17.594 34.496  25.961  1.00 116.82 ? 34  ASP A N     1 
ATOM   254   C  CA    . ASP A 1 34  ? -17.958 34.796  24.566  1.00 113.56 ? 34  ASP A CA    1 
ATOM   255   C  C     . ASP A 1 34  ? -16.835 35.480  23.764  1.00 116.89 ? 34  ASP A C     1 
ATOM   256   O  O     . ASP A 1 34  ? -16.526 36.646  23.986  1.00 96.72  ? 34  ASP A O     1 
ATOM   257   C  CB    . ASP A 1 34  ? -19.287 35.567  24.482  1.00 105.23 ? 34  ASP A CB    1 
ATOM   258   C  CG    . ASP A 1 34  ? -19.651 35.952  23.041  1.00 110.74 ? 34  ASP A CG    1 
ATOM   259   O  OD1   . ASP A 1 34  ? -19.145 35.341  22.079  1.00 118.68 ? 34  ASP A OD1   1 
ATOM   260   O  OD2   . ASP A 1 34  ? -20.635 36.714  22.848  1.00 112.25 ? 34  ASP A OD2   1 
ATOM   261   N  N     . PRO A 1 35  ? -16.244 34.725  22.806  1.00 127.74 ? 35  PRO A N     1 
ATOM   262   C  CA    . PRO A 1 35  ? -16.630 33.355  22.388  1.00 129.06 ? 35  PRO A CA    1 
ATOM   263   C  C     . PRO A 1 35  ? -16.162 32.179  23.283  1.00 127.37 ? 35  PRO A C     1 
ATOM   264   O  O     . PRO A 1 35  ? -15.239 32.331  24.104  1.00 134.77 ? 35  PRO A O     1 
ATOM   265   C  CB    . PRO A 1 35  ? -15.979 33.230  20.984  1.00 134.10 ? 35  PRO A CB    1 
ATOM   266   C  CG    . PRO A 1 35  ? -14.847 34.150  21.020  1.00 130.86 ? 35  PRO A CG    1 
ATOM   267   C  CD    . PRO A 1 35  ? -15.263 35.312  21.880  1.00 127.13 ? 35  PRO A CD    1 
ATOM   268   N  N     . PRO A 1 36  ? -16.793 31.034  23.129  1.00 122.71 ? 36  PRO A N     1 
ATOM   269   C  CA    . PRO A 1 36  ? -16.279 29.846  23.800  1.00 121.21 ? 36  PRO A CA    1 
ATOM   270   C  C     . PRO A 1 36  ? -14.939 29.322  23.240  1.00 131.97 ? 36  PRO A C     1 
ATOM   271   O  O     . PRO A 1 36  ? -14.777 29.124  22.042  1.00 140.09 ? 36  PRO A O     1 
ATOM   272   C  CB    . PRO A 1 36  ? -17.376 28.803  23.620  1.00 112.22 ? 36  PRO A CB    1 
ATOM   273   C  CG    . PRO A 1 36  ? -18.573 29.595  23.096  1.00 108.99 ? 36  PRO A CG    1 
ATOM   274   C  CD    . PRO A 1 36  ? -17.995 30.752  22.385  1.00 107.35 ? 36  PRO A CD    1 
ATOM   275   N  N     . PRO A 1 37  ? -13.988 29.056  24.180  1.00 132.78 ? 37  PRO A N     1 
ATOM   276   C  CA    . PRO A 1 37  ? -12.580 28.722  23.900  1.00 136.13 ? 37  PRO A CA    1 
ATOM   277   C  C     . PRO A 1 37  ? -12.376 27.314  23.381  1.00 133.19 ? 37  PRO A C     1 
ATOM   278   O  O     . PRO A 1 37  ? -13.239 26.409  23.585  1.00 134.98 ? 37  PRO A O     1 
ATOM   279   C  CB    . PRO A 1 37  ? -11.902 28.930  25.182  1.00 141.49 ? 37  PRO A CB    1 
ATOM   280   C  CG    . PRO A 1 37  ? -12.995 28.755  26.245  1.00 141.05 ? 37  PRO A CG    1 
ATOM   281   C  CD    . PRO A 1 37  ? -14.206 29.298  25.586  1.00 137.61 ? 37  PRO A CD    1 
ATOM   282   N  N     . GLY A 1 38  ? -11.234 27.087  22.726  1.00 132.46 ? 38  GLY A N     1 
ATOM   283   C  CA    . GLY A 1 38  ? -10.872 25.813  22.212  1.00 128.00 ? 38  GLY A CA    1 
ATOM   284   C  C     . GLY A 1 38  ? -10.340 25.108  23.455  1.00 118.55 ? 38  GLY A C     1 
ATOM   285   O  O     . GLY A 1 38  ? -10.241 25.733  24.524  1.00 109.04 ? 38  GLY A O     1 
ATOM   286   N  N     . ARG A 1 39  ? -9.920  23.853  23.331  1.00 116.82 ? 39  ARG A N     1 
ATOM   287   C  CA    . ARG A 1 39  ? -9.480  23.075  24.492  1.00 117.33 ? 39  ARG A CA    1 
ATOM   288   C  C     . ARG A 1 39  ? -8.259  23.647  25.183  1.00 111.43 ? 39  ARG A C     1 
ATOM   289   O  O     . ARG A 1 39  ? -8.303  23.893  26.410  1.00 113.96 ? 39  ARG A O     1 
ATOM   290   C  CB    . ARG A 1 39  ? -9.249  21.637  23.993  1.00 117.54 ? 39  ARG A CB    1 
ATOM   291   C  CG    . ARG A 1 39  ? -8.936  20.618  25.063  1.00 124.37 ? 39  ARG A CG    1 
ATOM   292   C  CD    . ARG A 1 39  ? -8.665  19.273  24.398  1.00 132.49 ? 39  ARG A CD    1 
ATOM   293   N  NE    . ARG A 1 39  ? -8.328  18.247  25.376  1.00 141.41 ? 39  ARG A NE    1 
ATOM   294   C  CZ    . ARG A 1 39  ? -7.091  17.952  25.766  1.00 142.68 ? 39  ARG A CZ    1 
ATOM   295   N  NH1   . ARG A 1 39  ? -6.058  18.587  25.237  1.00 140.88 ? 39  ARG A NH1   1 
ATOM   296   N  NH2   . ARG A 1 39  ? -6.895  17.009  26.675  1.00 145.91 ? 39  ARG A NH2   1 
ATOM   297   N  N     . GLU A 1 40  ? -7.361  24.236  24.398  1.00 111.19 ? 40  GLU A N     1 
ATOM   298   C  CA    . GLU A 1 40  ? -6.091  24.703  24.965  1.00 97.99  ? 40  GLU A CA    1 
ATOM   299   C  C     . GLU A 1 40  ? -6.259  25.999  25.675  1.00 97.08  ? 40  GLU A C     1 
ATOM   300   O  O     . GLU A 1 40  ? -5.464  26.324  26.578  1.00 80.78  ? 40  GLU A O     1 
ATOM   301   C  CB    . GLU A 1 40  ? -5.031  24.813  23.849  1.00 96.20  ? 40  GLU A CB    1 
ATOM   302   N  N     . GLU A 1 41  ? -7.260  26.769  25.307  1.00 116.62 ? 41  GLU A N     1 
ATOM   303   C  CA    . GLU A 1 41  ? -7.392  28.010  25.986  1.00 116.69 ? 41  GLU A CA    1 
ATOM   304   C  C     . GLU A 1 41  ? -8.383  27.906  27.181  1.00 100.03 ? 41  GLU A C     1 
ATOM   305   O  O     . GLU A 1 41  ? -8.385  28.836  27.944  1.00 87.28  ? 41  GLU A O     1 
ATOM   306   C  CB    . GLU A 1 41  ? -7.874  29.117  25.002  1.00 98.84  ? 41  GLU A CB    1 
ATOM   307   N  N     . VAL A 1 42  ? -9.256  26.872  27.344  1.00 101.44 ? 42  VAL A N     1 
ATOM   308   C  CA    . VAL A 1 42  ? -10.215 27.016  28.471  1.00 97.83  ? 42  VAL A CA    1 
ATOM   309   C  C     . VAL A 1 42  ? -9.587  27.041  29.928  1.00 109.70 ? 42  VAL A C     1 
ATOM   310   O  O     . VAL A 1 42  ? -9.829  27.992  30.627  1.00 105.13 ? 42  VAL A O     1 
ATOM   311   C  CB    . VAL A 1 42  ? -11.474 26.104  28.394  1.00 122.67 ? 42  VAL A CB    1 
ATOM   312   C  CG1   . VAL A 1 42  ? -11.160 24.657  28.515  1.00 127.21 ? 42  VAL A CG1   1 
ATOM   313   C  CG2   . VAL A 1 42  ? -12.500 26.482  29.629  1.00 114.22 ? 42  VAL A CG2   1 
ATOM   314   N  N     . TYR A 1 43  ? -8.795  26.084  30.371  1.00 108.16 ? 43  TYR A N     1 
ATOM   315   C  CA    . TYR A 1 43  ? -8.272  26.131  31.772  1.00 109.47 ? 43  TYR A CA    1 
ATOM   316   C  C     . TYR A 1 43  ? -7.444  27.375  32.091  1.00 111.62 ? 43  TYR A C     1 
ATOM   317   O  O     . TYR A 1 43  ? -7.671  28.018  33.121  1.00 123.83 ? 43  TYR A O     1 
ATOM   318   C  CB    . TYR A 1 43  ? -7.366  24.916  32.119  1.00 95.11  ? 43  TYR A CB    1 
ATOM   319   C  CG    . TYR A 1 43  ? -8.049  23.589  32.441  1.00 96.89  ? 43  TYR A CG    1 
ATOM   320   C  CD1   . TYR A 1 43  ? -9.132  23.500  33.321  1.00 98.05  ? 43  TYR A CD1   1 
ATOM   321   C  CD2   . TYR A 1 43  ? -7.638  22.429  31.800  1.00 99.34  ? 43  TYR A CD2   1 
ATOM   322   C  CE1   . TYR A 1 43  ? -9.732  22.287  33.564  1.00 105.84 ? 43  TYR A CE1   1 
ATOM   323   C  CE2   . TYR A 1 43  ? -8.237  21.224  32.026  1.00 104.25 ? 43  TYR A CE2   1 
ATOM   324   C  CZ    . TYR A 1 43  ? -9.284  21.146  32.907  1.00 113.69 ? 43  TYR A CZ    1 
ATOM   325   O  OH    . TYR A 1 43  ? -9.910  19.937  33.158  1.00 124.82 ? 43  TYR A OH    1 
ATOM   326   N  N     . PRO A 1 44  ? -6.524  27.779  31.202  1.00 100.36 ? 44  PRO A N     1 
ATOM   327   C  CA    . PRO A 1 44  ? -5.870  29.031  31.578  1.00 92.85  ? 44  PRO A CA    1 
ATOM   328   C  C     . PRO A 1 44  ? -6.778  30.222  31.506  1.00 104.04 ? 44  PRO A C     1 
ATOM   329   O  O     . PRO A 1 44  ? -6.651  31.119  32.341  1.00 106.72 ? 44  PRO A O     1 
ATOM   330   C  CB    . PRO A 1 44  ? -4.781  29.195  30.529  1.00 78.58  ? 44  PRO A CB    1 
ATOM   331   C  CG    . PRO A 1 44  ? -5.220  28.351  29.395  1.00 93.24  ? 44  PRO A CG    1 
ATOM   332   C  CD    . PRO A 1 44  ? -5.921  27.183  30.012  1.00 99.87  ? 44  PRO A CD    1 
ATOM   333   N  N     . LEU A 1 45  ? -7.811  30.146  30.692  1.00 108.05 ? 45  LEU A N     1 
ATOM   334   C  CA    . LEU A 1 45  ? -8.695  31.277  30.570  1.00 109.13 ? 45  LEU A CA    1 
ATOM   335   C  C     . LEU A 1 45  ? -9.586  31.460  31.784  1.00 111.10 ? 45  LEU A C     1 
ATOM   336   O  O     . LEU A 1 45  ? -9.771  32.581  32.261  1.00 101.06 ? 45  LEU A O     1 
ATOM   337   C  CB    . LEU A 1 45  ? -9.602  31.067  29.394  1.00 109.04 ? 45  LEU A CB    1 
ATOM   338   C  CG    . LEU A 1 45  ? -10.005 32.188  28.488  1.00 105.60 ? 45  LEU A CG    1 
ATOM   339   C  CD1   . LEU A 1 45  ? -8.783  33.048  28.092  1.00 93.26  ? 45  LEU A CD1   1 
ATOM   340   C  CD2   . LEU A 1 45  ? -10.629 31.387  27.362  1.00 114.00 ? 45  LEU A CD2   1 
ATOM   341   N  N     . LEU A 1 46  ? -10.006 30.336  32.368  1.00 118.25 ? 46  LEU A N     1 
ATOM   342   C  CA    . LEU A 1 46  ? -10.768 30.397  33.579  1.00 105.53 ? 46  LEU A CA    1 
ATOM   343   C  C     . LEU A 1 46  ? -9.881  30.993  34.663  1.00 92.02  ? 46  LEU A C     1 
ATOM   344   O  O     . LEU A 1 46  ? -10.309 31.855  35.414  1.00 90.52  ? 46  LEU A O     1 
ATOM   345   C  CB    . LEU A 1 46  ? -11.320 29.038  34.025  1.00 104.39 ? 46  LEU A CB    1 
ATOM   346   C  CG    . LEU A 1 46  ? -12.196 28.330  32.988  1.00 98.24  ? 46  LEU A CG    1 
ATOM   347   C  CD1   . LEU A 1 46  ? -12.840 27.101  33.606  1.00 103.14 ? 46  LEU A CD1   1 
ATOM   348   C  CD2   . LEU A 1 46  ? -13.238 29.332  32.494  1.00 91.96  ? 46  LEU A CD2   1 
ATOM   349   N  N     . ALA A 1 47  ? -8.596  30.644  34.645  1.00 94.45  ? 47  ALA A N     1 
ATOM   350   C  CA    . ALA A 1 47  ? -7.733  31.197  35.674  1.00 89.37  ? 47  ALA A CA    1 
ATOM   351   C  C     . ALA A 1 47  ? -7.653  32.714  35.518  1.00 89.61  ? 47  ALA A C     1 
ATOM   352   O  O     . ALA A 1 47  ? -7.746  33.429  36.521  1.00 80.25  ? 47  ALA A O     1 
ATOM   353   C  CB    . ALA A 1 47  ? -6.348  30.568  35.582  1.00 87.83  ? 47  ALA A CB    1 
ATOM   354   N  N     . GLN A 1 48  ? -7.582  33.233  34.270  1.00 92.83  ? 48  GLN A N     1 
ATOM   355   C  CA    . GLN A 1 48  ? -7.487  34.693  34.109  1.00 80.74  ? 48  GLN A CA    1 
ATOM   356   C  C     . GLN A 1 48  ? -8.783  35.323  34.596  1.00 93.64  ? 48  GLN A C     1 
ATOM   357   O  O     . GLN A 1 48  ? -8.758  36.349  35.298  1.00 88.41  ? 48  GLN A O     1 
ATOM   358   C  CB    . GLN A 1 48  ? -7.224  35.072  32.675  1.00 72.10  ? 48  GLN A CB    1 
ATOM   359   N  N     . VAL A 1 49  ? -9.909  34.700  34.253  1.00 96.63  ? 49  VAL A N     1 
ATOM   360   C  CA    . VAL A 1 49  ? -11.165 35.228  34.745  1.00 88.35  ? 49  VAL A CA    1 
ATOM   361   C  C     . VAL A 1 49  ? -11.229 35.246  36.253  1.00 87.24  ? 49  VAL A C     1 
ATOM   362   O  O     . VAL A 1 49  ? -11.609 36.271  36.823  1.00 75.12  ? 49  VAL A O     1 
ATOM   363   C  CB    . VAL A 1 49  ? -12.342 34.359  34.246  1.00 96.98  ? 49  VAL A CB    1 
ATOM   364   C  CG1   . VAL A 1 49  ? -13.639 34.748  34.944  1.00 89.69  ? 49  VAL A CG1   1 
ATOM   365   C  CG2   . VAL A 1 49  ? -12.453 34.378  32.730  1.00 107.58 ? 49  VAL A CG2   1 
ATOM   366   N  N     . ALA A 1 50  ? -10.623 34.238  36.884  1.00 99.00  ? 50  ALA A N     1 
ATOM   367   C  CA    . ALA A 1 50  ? -10.624 34.157  38.338  1.00 80.22  ? 50  ALA A CA    1 
ATOM   368   C  C     . ALA A 1 50  ? -9.920  35.378  38.895  1.00 75.09  ? 50  ALA A C     1 
ATOM   369   O  O     . ALA A 1 50  ? -10.416 36.041  39.766  1.00 68.61  ? 50  ALA A O     1 
ATOM   370   C  CB    . ALA A 1 50  ? -9.942  32.884  38.811  1.00 72.35  ? 50  ALA A CB    1 
ATOM   371   N  N     . ARG A 1 51  ? -8.781  35.696  38.318  1.00 78.74  ? 51  ARG A N     1 
ATOM   372   C  CA    . ARG A 1 51  ? -8.101  36.850  38.800  1.00 82.77  ? 51  ARG A CA    1 
ATOM   373   C  C     . ARG A 1 51  ? -8.838  38.159  38.511  1.00 79.49  ? 51  ARG A C     1 
ATOM   374   O  O     . ARG A 1 51  ? -8.972  39.032  39.400  1.00 75.23  ? 51  ARG A O     1 
ATOM   375   C  CB    . ARG A 1 51  ? -6.655  36.694  38.306  1.00 98.85  ? 51  ARG A CB    1 
ATOM   376   C  CG    . ARG A 1 51  ? -5.634  37.655  38.544  1.00 109.18 ? 51  ARG A CG    1 
ATOM   377   C  CD    . ARG A 1 51  ? -4.439  37.455  37.644  1.00 118.38 ? 51  ARG A CD    1 
ATOM   378   N  NE    . ARG A 1 51  ? -4.612  37.785  36.270  1.00 130.54 ? 51  ARG A NE    1 
ATOM   379   C  CZ    . ARG A 1 51  ? -3.803  37.320  35.321  1.00 130.15 ? 51  ARG A CZ    1 
ATOM   380   N  NH1   . ARG A 1 51  ? -2.751  36.592  35.656  1.00 129.08 ? 51  ARG A NH1   1 
ATOM   381   N  NH2   . ARG A 1 51  ? -3.993  37.641  34.021  1.00 131.02 ? 51  ARG A NH2   1 
ATOM   382   N  N     . ARG A 1 52  ? -9.302  38.354  37.298  1.00 88.44  ? 52  ARG A N     1 
ATOM   383   C  CA    . ARG A 1 52  ? -9.938  39.608  36.967  1.00 82.35  ? 52  ARG A CA    1 
ATOM   384   C  C     . ARG A 1 52  ? -11.258 39.850  37.760  1.00 82.97  ? 52  ARG A C     1 
ATOM   385   O  O     . ARG A 1 52  ? -11.636 40.994  37.926  1.00 83.02  ? 52  ARG A O     1 
ATOM   386   C  CB    . ARG A 1 52  ? -9.903  39.602  35.449  1.00 78.86  ? 52  ARG A CB    1 
ATOM   387   C  CG    . ARG A 1 52  ? -10.513 40.464  34.646  1.00 74.29  ? 52  ARG A CG    1 
ATOM   388   C  CD    . ARG A 1 52  ? -9.919  41.092  33.399  1.00 97.96  ? 52  ARG A CD    1 
ATOM   389   N  NE    . ARG A 1 52  ? -9.019  42.198  33.037  1.00 114.45 ? 52  ARG A NE    1 
ATOM   390   C  CZ    . ARG A 1 52  ? -9.077  43.463  33.456  1.00 129.02 ? 52  ARG A CZ    1 
ATOM   391   N  NH1   . ARG A 1 52  ? -9.701  43.807  34.551  1.00 122.68 ? 52  ARG A NH1   1 
ATOM   392   N  NH2   . ARG A 1 52  ? -8.261  44.340  32.981  1.00 140.71 ? 52  ARG A NH2   1 
ATOM   393   N  N     . ALA A 1 53  ? -11.956 38.807  38.229  1.00 89.43  ? 53  ALA A N     1 
ATOM   394   C  CA    . ALA A 1 53  ? -13.158 38.975  39.078  1.00 77.85  ? 53  ALA A CA    1 
ATOM   395   C  C     . ALA A 1 53  ? -12.773 39.649  40.404  1.00 85.27  ? 53  ALA A C     1 
ATOM   396   O  O     . ALA A 1 53  ? -13.573 40.297  41.069  1.00 68.53  ? 53  ALA A O     1 
ATOM   397   C  CB    . ALA A 1 53  ? -13.803 37.650  39.346  1.00 71.22  ? 53  ALA A CB    1 
ATOM   398   N  N     . GLY A 1 54  ? -11.518 39.484  40.787  1.00 99.58  ? 54  GLY A N     1 
ATOM   399   C  CA    . GLY A 1 54  ? -11.001 40.061  42.024  1.00 88.70  ? 54  GLY A CA    1 
ATOM   400   C  C     . GLY A 1 54  ? -11.297 39.273  43.288  1.00 75.90  ? 54  GLY A C     1 
ATOM   401   O  O     . GLY A 1 54  ? -11.770 38.150  43.227  1.00 67.58  ? 54  GLY A O     1 
ATOM   402   N  N     . GLY A 1 55  ? -11.160 39.924  44.436  1.00 82.18  ? 55  GLY A N     1 
ATOM   403   C  CA    . GLY A 1 55  ? -11.297 39.270  45.728  1.00 72.16  ? 55  GLY A CA    1 
ATOM   404   C  C     . GLY A 1 55  ? -10.473 38.011  45.892  1.00 81.19  ? 55  GLY A C     1 
ATOM   405   O  O     . GLY A 1 55  ? -9.436  37.871  45.251  1.00 98.36  ? 55  GLY A O     1 
ATOM   406   N  N     . VAL A 1 56  ? -11.047 36.995  46.508  1.00 77.46  ? 56  VAL A N     1 
ATOM   407   C  CA    . VAL A 1 56  ? -10.312 35.769  46.655  1.00 77.78  ? 56  VAL A CA    1 
ATOM   408   C  C     . VAL A 1 56  ? -11.054 34.657  45.982  1.00 81.19  ? 56  VAL A C     1 
ATOM   409   O  O     . VAL A 1 56  ? -11.940 34.025  46.560  1.00 73.20  ? 56  VAL A O     1 
ATOM   410   C  CB    . VAL A 1 56  ? -10.150 35.412  48.167  1.00 53.27  ? 56  VAL A CB    1 
ATOM   411   C  CG1   . VAL A 1 56  ? -9.499  34.037  48.383  1.00 62.73  ? 56  VAL A CG1   1 
ATOM   412   C  CG2   . VAL A 1 56  ? -9.314  36.456  48.836  1.00 48.27  ? 56  VAL A CG2   1 
ATOM   413   N  N     . THR A 1 57  ? -10.693 34.487  44.696  1.00 81.81  ? 57  THR A N     1 
ATOM   414   C  CA    . THR A 1 57  ? -11.403 33.578  43.806  1.00 75.68  ? 57  THR A CA    1 
ATOM   415   C  C     . THR A 1 57  ? -10.424 32.720  42.998  1.00 84.56  ? 57  THR A C     1 
ATOM   416   O  O     . THR A 1 57  ? -9.446  33.229  42.476  1.00 82.49  ? 57  THR A O     1 
ATOM   417   C  CB    . THR A 1 57  ? -12.280 34.373  42.823  1.00 64.90  ? 57  THR A CB    1 
ATOM   418   O  OG1   . THR A 1 57  ? -13.004 35.400  43.525  1.00 50.43  ? 57  THR A OG1   1 
ATOM   419   C  CG2   . THR A 1 57  ? -13.236 33.444  42.100  1.00 61.03  ? 57  THR A CG2   1 
ATOM   420   N  N     . VAL A 1 58  ? -10.779 31.459  42.764  1.00 91.54  ? 58  VAL A N     1 
ATOM   421   C  CA    . VAL A 1 58  ? -9.907  30.492  42.073  1.00 84.36  ? 58  VAL A CA    1 
ATOM   422   C  C     . VAL A 1 58  ? -10.740 29.607  41.169  1.00 79.75  ? 58  VAL A C     1 
ATOM   423   O  O     . VAL A 1 58  ? -11.960 29.589  41.294  1.00 74.46  ? 58  VAL A O     1 
ATOM   424   C  CB    . VAL A 1 58  ? -9.109  29.568  43.064  1.00 67.62  ? 58  VAL A CB    1 
ATOM   425   C  CG1   . VAL A 1 58  ? -8.152  30.369  43.924  1.00 77.20  ? 58  VAL A CG1   1 
ATOM   426   C  CG2   . VAL A 1 58  ? -10.047 28.754  43.955  1.00 57.94  ? 58  VAL A CG2   1 
ATOM   427   N  N     . ARG A 1 59  ? -10.099 28.908  40.236  1.00 83.89  ? 59  ARG A N     1 
ATOM   428   C  CA    . ARG A 1 59  ? -10.840 27.941  39.430  1.00 85.65  ? 59  ARG A CA    1 
ATOM   429   C  C     . ARG A 1 59  ? -11.198 26.754  40.337  1.00 79.76  ? 59  ARG A C     1 
ATOM   430   O  O     . ARG A 1 59  ? -10.367 26.252  41.106  1.00 79.69  ? 59  ARG A O     1 
ATOM   431   C  CB    . ARG A 1 59  ? -10.101 27.527  38.161  1.00 99.56  ? 59  ARG A CB    1 
ATOM   432   C  CG    . ARG A 1 59  ? -10.728 26.304  37.472  1.00 113.48 ? 59  ARG A CG    1 
ATOM   433   C  CD    . ARG A 1 59  ? -10.113 25.975  36.108  1.00 114.67 ? 59  ARG A CD    1 
ATOM   434   N  NE    . ARG A 1 59  ? -8.662  25.731  36.181  1.00 105.13 ? 59  ARG A NE    1 
ATOM   435   C  CZ    . ARG A 1 59  ? -8.067  24.624  36.623  1.00 114.31 ? 59  ARG A CZ    1 
ATOM   436   N  NH1   . ARG A 1 59  ? -8.773  23.628  37.124  1.00 126.04 ? 59  ARG A NH1   1 
ATOM   437   N  NH2   . ARG A 1 59  ? -6.747  24.572  36.641  1.00 116.79 ? 59  ARG A NH2   1 
ATOM   438   N  N     . MET A 1 60  ? -12.409 26.246  40.152  1.00 83.82  ? 60  MET A N     1 
ATOM   439   C  CA    . MET A 1 60  ? -12.863 25.023  40.783  1.00 93.03  ? 60  MET A CA    1 
ATOM   440   C  C     . MET A 1 60  ? -13.680 24.287  39.785  1.00 116.72 ? 60  MET A C     1 
ATOM   441   O  O     . MET A 1 60  ? -14.757 24.712  39.371  1.00 120.18 ? 60  MET A O     1 
ATOM   442   C  CB    . MET A 1 60  ? -13.734 25.325  42.015  1.00 74.63  ? 60  MET A CB    1 
ATOM   443   C  CG    . MET A 1 60  ? -14.304 24.089  42.667  1.00 68.14  ? 60  MET A CG    1 
ATOM   444   S  SD    . MET A 1 60  ? -15.597 24.326  43.897  1.00 107.03 ? 60  MET A SD    1 
ATOM   445   C  CE    . MET A 1 60  ? -16.657 25.566  43.173  1.00 109.14 ? 60  MET A CE    1 
ATOM   446   N  N     . GLY A 1 61  ? -13.140 23.143  39.408  1.00 119.04 ? 61  GLY A N     1 
ATOM   447   C  CA    . GLY A 1 61  ? -13.753 22.363  38.372  1.00 125.20 ? 61  GLY A CA    1 
ATOM   448   C  C     . GLY A 1 61  ? -13.680 23.150  37.089  1.00 125.98 ? 61  GLY A C     1 
ATOM   449   O  O     . GLY A 1 61  ? -12.656 23.731  36.728  1.00 122.16 ? 61  GLY A O     1 
ATOM   450   N  N     . ASP A 1 62  ? -14.834 23.202  36.449  1.00 127.17 ? 62  ASP A N     1 
ATOM   451   C  CA    . ASP A 1 62  ? -15.028 24.007  35.251  1.00 127.69 ? 62  ASP A CA    1 
ATOM   452   C  C     . ASP A 1 62  ? -15.567 25.393  35.528  1.00 131.08 ? 62  ASP A C     1 
ATOM   453   O  O     . ASP A 1 62  ? -15.904 26.154  34.599  1.00 119.58 ? 62  ASP A O     1 
ATOM   454   C  CB    . ASP A 1 62  ? -15.997 23.163  34.400  1.00 130.10 ? 62  ASP A CB    1 
ATOM   455   C  CG    . ASP A 1 62  ? -17.361 23.023  35.083  1.00 133.31 ? 62  ASP A CG    1 
ATOM   456   O  OD1   . ASP A 1 62  ? -17.407 22.730  36.291  1.00 133.40 ? 62  ASP A OD1   1 
ATOM   457   O  OD2   . ASP A 1 62  ? -18.392 23.070  34.360  1.00 135.51 ? 62  ASP A OD2   1 
ATOM   458   N  N     . GLY A 1 63  ? -15.508 25.808  36.782  1.00 129.12 ? 63  GLY A N     1 
ATOM   459   C  CA    . GLY A 1 63  ? -16.082 27.082  37.183  1.00 122.04 ? 63  GLY A CA    1 
ATOM   460   C  C     . GLY A 1 63  ? -15.199 27.799  38.184  1.00 111.59 ? 63  GLY A C     1 
ATOM   461   O  O     . GLY A 1 63  ? -13.978 27.644  38.168  1.00 116.07 ? 63  GLY A O     1 
ATOM   462   N  N     . LEU A 1 64  ? -15.818 28.536  39.095  1.00 99.44  ? 64  LEU A N     1 
ATOM   463   C  CA    . LEU A 1 64  ? -15.074 29.365  40.025  1.00 77.92  ? 64  LEU A CA    1 
ATOM   464   C  C     . LEU A 1 64  ? -15.560 29.164  41.442  1.00 87.49  ? 64  LEU A C     1 
ATOM   465   O  O     . LEU A 1 64  ? -16.730 28.871  41.677  1.00 96.90  ? 64  LEU A O     1 
ATOM   466   C  CB    . LEU A 1 64  ? -15.155 30.851  39.641  1.00 69.72  ? 64  LEU A CB    1 
ATOM   467   C  CG    . LEU A 1 64  ? -14.111 31.532  38.728  1.00 59.37  ? 64  LEU A CG    1 
ATOM   468   C  CD1   . LEU A 1 64  ? -13.643 30.675  37.593  1.00 72.61  ? 64  LEU A CD1   1 
ATOM   469   C  CD2   . LEU A 1 64  ? -14.617 32.872  38.194  1.00 45.10  ? 64  LEU A CD2   1 
ATOM   470   N  N     . ALA A 1 65  ? -14.634 29.281  42.386  1.00 84.16  ? 65  ALA A N     1 
ATOM   471   C  CA    . ALA A 1 65  ? -14.953 29.382  43.803  1.00 74.80  ? 65  ALA A CA    1 
ATOM   472   C  C     . ALA A 1 65  ? -14.428 30.659  44.419  1.00 74.76  ? 65  ALA A C     1 
ATOM   473   O  O     . ALA A 1 65  ? -13.301 31.067  44.130  1.00 81.53  ? 65  ALA A O     1 
ATOM   474   C  CB    . ALA A 1 65  ? -14.390 28.181  44.560  1.00 69.68  ? 65  ALA A CB    1 
ATOM   475   N  N     . SER A 1 66  ? -15.237 31.315  45.243  1.00 74.00  ? 66  SER A N     1 
ATOM   476   C  CA    . SER A 1 66  ? -14.795 32.571  45.812  1.00 68.73  ? 66  SER A CA    1 
ATOM   477   C  C     . SER A 1 66  ? -15.110 32.536  47.298  1.00 68.64  ? 66  SER A C     1 
ATOM   478   O  O     . SER A 1 66  ? -16.182 32.073  47.690  1.00 54.95  ? 66  SER A O     1 
ATOM   479   C  CB    . SER A 1 66  ? -15.486 33.751  45.125  1.00 60.71  ? 66  SER A CB    1 
ATOM   480   O  OG    . SER A 1 66  ? -14.975 34.967  45.626  1.00 64.52  ? 66  SER A OG    1 
ATOM   481   N  N     . TRP A 1 67  ? -14.235 33.127  48.111  1.00 76.02  ? 67  TRP A N     1 
ATOM   482   C  CA    . TRP A 1 67  ? -14.550 33.385  49.514  1.00 70.73  ? 67  TRP A CA    1 
ATOM   483   C  C     . TRP A 1 67  ? -15.001 34.813  49.695  1.00 66.00  ? 67  TRP A C     1 
ATOM   484   O  O     . TRP A 1 67  ? -15.307 35.250  50.811  1.00 56.21  ? 67  TRP A O     1 
ATOM   485   C  CB    . TRP A 1 67  ? -13.307 33.187  50.375  1.00 81.30  ? 67  TRP A CB    1 
ATOM   486   C  CG    . TRP A 1 67  ? -12.991 31.793  50.757  1.00 86.34  ? 67  TRP A CG    1 
ATOM   487   C  CD1   . TRP A 1 67  ? -13.837 30.727  50.755  1.00 87.90  ? 67  TRP A CD1   1 
ATOM   488   C  CD2   . TRP A 1 67  ? -11.754 31.324  51.293  1.00 79.57  ? 67  TRP A CD2   1 
ATOM   489   N  NE1   . TRP A 1 67  ? -13.188 29.608  51.210  1.00 82.35  ? 67  TRP A NE1   1 
ATOM   490   C  CE2   . TRP A 1 67  ? -11.907 29.952  51.556  1.00 83.20  ? 67  TRP A CE2   1 
ATOM   491   C  CE3   . TRP A 1 67  ? -10.523 31.928  51.555  1.00 77.06  ? 67  TRP A CE3   1 
ATOM   492   C  CZ2   . TRP A 1 67  ? -10.875 29.169  52.072  1.00 86.11  ? 67  TRP A CZ2   1 
ATOM   493   C  CZ3   . TRP A 1 67  ? -9.497  31.152  52.071  1.00 81.04  ? 67  TRP A CZ3   1 
ATOM   494   C  CH2   . TRP A 1 67  ? -9.678  29.784  52.321  1.00 85.65  ? 67  TRP A CH2   1 
ATOM   495   N  N     . SER A 1 68  ? -15.251 35.465  48.574  1.00 69.81  ? 68  SER A N     1 
ATOM   496   C  CA    . SER A 1 68  ? -15.857 36.769  48.586  1.00 75.61  ? 68  SER A CA    1 
ATOM   497   C  C     . SER A 1 68  ? -17.210 36.568  47.959  1.00 81.21  ? 68  SER A C     1 
ATOM   498   O  O     . SER A 1 68  ? -17.344 35.868  46.963  1.00 92.26  ? 68  SER A O     1 
ATOM   499   C  CB    . SER A 1 68  ? -14.961 37.743  47.812  1.00 79.84  ? 68  SER A CB    1 
ATOM   500   O  OG    . SER A 1 68  ? -15.457 39.058  47.825  1.00 79.71  ? 68  SER A OG    1 
ATOM   501   N  N     . PRO A 1 69  ? -18.227 37.236  48.498  1.00 79.35  ? 69  PRO A N     1 
ATOM   502   C  CA    . PRO A 1 69  ? -19.520 37.143  47.822  1.00 81.27  ? 69  PRO A CA    1 
ATOM   503   C  C     . PRO A 1 69  ? -19.514 37.756  46.435  1.00 100.12 ? 69  PRO A C     1 
ATOM   504   O  O     . PRO A 1 69  ? -18.726 38.671  46.149  1.00 124.63 ? 69  PRO A O     1 
ATOM   505   C  CB    . PRO A 1 69  ? -20.454 37.925  48.757  1.00 82.78  ? 69  PRO A CB    1 
ATOM   506   C  CG    . PRO A 1 69  ? -19.544 38.812  49.562  1.00 90.63  ? 69  PRO A CG    1 
ATOM   507   C  CD    . PRO A 1 69  ? -18.288 38.038  49.729  1.00 87.93  ? 69  PRO A CD    1 
ATOM   508   N  N     . PRO A 1 70  ? -20.342 37.193  45.546  1.00 91.71  ? 70  PRO A N     1 
ATOM   509   C  CA    . PRO A 1 70  ? -20.427 37.597  44.130  1.00 91.28  ? 70  PRO A CA    1 
ATOM   510   C  C     . PRO A 1 70  ? -20.685 39.093  43.980  1.00 86.72  ? 70  PRO A C     1 
ATOM   511   O  O     . PRO A 1 70  ? -20.266 39.715  43.000  1.00 92.07  ? 70  PRO A O     1 
ATOM   512   C  CB    . PRO A 1 70  ? -21.589 36.751  43.582  1.00 84.99  ? 70  PRO A CB    1 
ATOM   513   C  CG    . PRO A 1 70  ? -22.267 36.172  44.811  1.00 82.69  ? 70  PRO A CG    1 
ATOM   514   C  CD    . PRO A 1 70  ? -21.191 36.028  45.837  1.00 77.08  ? 70  PRO A CD    1 
ATOM   515   N  N     . GLU A 1 71  ? -21.428 39.636  44.936  1.00 81.87  ? 71  GLU A N     1 
ATOM   516   C  CA    . GLU A 1 71  ? -21.780 41.044  44.908  1.00 84.86  ? 71  GLU A CA    1 
ATOM   517   C  C     . GLU A 1 71  ? -20.538 41.956  44.997  1.00 84.12  ? 71  GLU A C     1 
ATOM   518   O  O     . GLU A 1 71  ? -20.652 43.124  44.648  1.00 95.87  ? 71  GLU A O     1 
ATOM   519   C  CB    . GLU A 1 71  ? -22.805 41.356  45.981  1.00 77.07  ? 71  GLU A CB    1 
ATOM   520   C  CG    . GLU A 1 71  ? -24.208 40.815  45.696  1.00 70.83  ? 71  GLU A CG    1 
ATOM   521   C  CD    . GLU A 1 71  ? -24.344 39.322  45.884  1.00 88.26  ? 71  GLU A CD    1 
ATOM   522   O  OE1   . GLU A 1 71  ? -25.249 38.746  45.246  1.00 89.06  ? 71  GLU A OE1   1 
ATOM   523   O  OE2   . GLU A 1 71  ? -23.505 38.712  46.585  1.00 100.82 ? 71  GLU A OE2   1 
ATOM   524   N  N     . VAL A 1 72  ? -19.398 41.507  45.553  1.00 74.78  ? 72  VAL A N     1 
ATOM   525   C  CA    . VAL A 1 72  ? -18.176 42.314  45.515  1.00 82.67  ? 72  VAL A CA    1 
ATOM   526   C  C     . VAL A 1 72  ? -17.093 41.706  44.575  1.00 91.57  ? 72  VAL A C     1 
ATOM   527   O  O     . VAL A 1 72  ? -15.887 42.058  44.667  1.00 103.63 ? 72  VAL A O     1 
ATOM   528   C  CB    . VAL A 1 72  ? -17.611 42.494  46.905  1.00 84.30  ? 72  VAL A CB    1 
ATOM   529   C  CG1   . VAL A 1 72  ? -18.571 43.337  47.691  1.00 75.98  ? 72  VAL A CG1   1 
ATOM   530   C  CG2   . VAL A 1 72  ? -17.528 41.173  47.590  1.00 82.82  ? 72  VAL A CG2   1 
ATOM   531   N  N     . LEU A 1 73  ? -17.569 40.975  43.579  1.00 77.97  ? 73  LEU A N     1 
ATOM   532   C  CA    . LEU A 1 73  ? -16.707 40.528  42.529  1.00 74.00  ? 73  LEU A CA    1 
ATOM   533   C  C     . LEU A 1 73  ? -17.090 41.303  41.272  1.00 74.30  ? 73  LEU A C     1 
ATOM   534   O  O     . LEU A 1 73  ? -18.206 41.814  41.179  1.00 77.42  ? 73  LEU A O     1 
ATOM   535   C  CB    . LEU A 1 73  ? -16.887 38.995  42.337  1.00 60.30  ? 73  LEU A CB    1 
ATOM   536   C  CG    . LEU A 1 73  ? -16.327 38.081  43.416  1.00 58.61  ? 73  LEU A CG    1 
ATOM   537   C  CD1   . LEU A 1 73  ? -16.465 36.591  43.030  1.00 64.21  ? 73  LEU A CD1   1 
ATOM   538   C  CD2   . LEU A 1 73  ? -14.857 38.439  43.634  1.00 66.23  ? 73  LEU A CD2   1 
ATOM   539   N  N     . VAL A 1 74  ? -16.186 41.459  40.319  1.00 69.37  ? 74  VAL A N     1 
ATOM   540   C  CA    . VAL A 1 74  ? -16.537 41.961  39.003  1.00 77.67  ? 74  VAL A CA    1 
ATOM   541   C  C     . VAL A 1 74  ? -17.091 40.860  38.161  1.00 70.55  ? 74  VAL A C     1 
ATOM   542   O  O     . VAL A 1 74  ? -16.376 40.215  37.407  1.00 77.12  ? 74  VAL A O     1 
ATOM   543   C  CB    . VAL A 1 74  ? -15.468 42.660  38.151  1.00 103.67 ? 74  VAL A CB    1 
ATOM   544   C  CG1   . VAL A 1 74  ? -15.408 44.103  38.410  1.00 107.57 ? 74  VAL A CG1   1 
ATOM   545   C  CG2   . VAL A 1 74  ? -14.110 42.076  38.537  1.00 125.58 ? 74  VAL A CG2   1 
ATOM   546   N  N     . LEU A 1 75  ? -18.415 40.704  38.254  1.00 67.68  ? 75  LEU A N     1 
ATOM   547   C  CA    . LEU A 1 75  ? -19.063 39.580  37.618  1.00 73.58  ? 75  LEU A CA    1 
ATOM   548   C  C     . LEU A 1 75  ? -19.113 39.740  36.105  1.00 80.47  ? 75  LEU A C     1 
ATOM   549   O  O     . LEU A 1 75  ? -19.097 38.738  35.364  1.00 83.76  ? 75  LEU A O     1 
ATOM   550   C  CB    . LEU A 1 75  ? -20.494 39.362  38.108  1.00 64.44  ? 75  LEU A CB    1 
ATOM   551   C  CG    . LEU A 1 75  ? -20.673 39.190  39.608  1.00 63.62  ? 75  LEU A CG    1 
ATOM   552   C  CD1   . LEU A 1 75  ? -22.174 39.064  39.919  1.00 49.05  ? 75  LEU A CD1   1 
ATOM   553   C  CD2   . LEU A 1 75  ? -19.826 38.079  40.206  1.00 37.32  ? 75  LEU A CD2   1 
ATOM   554   N  N     . GLU A 1 76  ? -19.178 40.966  35.598  1.00 63.71  ? 76  GLU A N     1 
ATOM   555   C  CA    . GLU A 1 76  ? -19.111 41.133  34.149  1.00 69.30  ? 76  GLU A CA    1 
ATOM   556   C  C     . GLU A 1 76  ? -17.879 41.889  33.663  1.00 69.24  ? 76  GLU A C     1 
ATOM   557   O  O     . GLU A 1 76  ? -17.556 42.932  34.212  1.00 66.79  ? 76  GLU A O     1 
ATOM   558   C  CB    . GLU A 1 76  ? -20.347 41.909  33.731  1.00 78.88  ? 76  GLU A CB    1 
ATOM   559   C  CG    . GLU A 1 76  ? -21.624 41.190  34.104  1.00 95.08  ? 76  GLU A CG    1 
ATOM   560   C  CD    . GLU A 1 76  ? -22.839 41.968  33.701  1.00 112.15 ? 76  GLU A CD    1 
ATOM   561   O  OE1   . GLU A 1 76  ? -22.713 42.791  32.780  1.00 127.05 ? 76  GLU A OE1   1 
ATOM   562   O  OE2   . GLU A 1 76  ? -23.934 41.745  34.288  1.00 108.03 ? 76  GLU A OE2   1 
ATOM   563   N  N     . GLY A 1 77  ? -17.202 41.365  32.629  1.00 73.51  ? 77  GLY A N     1 
ATOM   564   C  CA    . GLY A 1 77  ? -15.995 42.027  32.109  1.00 75.84  ? 77  GLY A CA    1 
ATOM   565   C  C     . GLY A 1 77  ? -15.358 41.447  30.842  1.00 88.86  ? 77  GLY A C     1 
ATOM   566   O  O     . GLY A 1 77  ? -16.006 40.684  30.136  1.00 102.47 ? 77  GLY A O     1 
ATOM   567   N  N     . THR A 1 78  ? -14.160 41.943  30.485  1.00 83.01  ? 78  THR A N     1 
ATOM   568   C  CA    . THR A 1 78  ? -13.414 41.445  29.292  1.00 104.47 ? 78  THR A CA    1 
ATOM   569   C  C     . THR A 1 78  ? -11.978 40.908  29.612  1.00 107.32 ? 78  THR A C     1 
ATOM   570   O  O     . THR A 1 78  ? -11.332 41.279  30.611  1.00 92.75  ? 78  THR A O     1 
ATOM   571   C  CB    . THR A 1 78  ? -13.296 42.490  28.175  1.00 118.77 ? 78  THR A CB    1 
ATOM   572   O  OG1   . THR A 1 78  ? -11.928 42.780  27.901  1.00 137.15 ? 78  THR A OG1   1 
ATOM   573   C  CG2   . THR A 1 78  ? -14.075 43.768  28.622  1.00 121.23 ? 78  THR A CG2   1 
ATOM   574   N  N     . LEU A 1 79  ? -11.419 40.176  28.655  1.00 113.52 ? 79  LEU A N     1 
ATOM   575   C  CA    . LEU A 1 79  ? -10.201 39.420  28.763  1.00 117.86 ? 79  LEU A CA    1 
ATOM   576   C  C     . LEU A 1 79  ? -9.535  39.477  27.427  1.00 122.11 ? 79  LEU A C     1 
ATOM   577   O  O     . LEU A 1 79  ? -10.073 39.070  26.378  1.00 135.17 ? 79  LEU A O     1 
ATOM   578   C  CB    . LEU A 1 79  ? -10.361 37.982  29.187  1.00 115.18 ? 79  LEU A CB    1 
ATOM   579   C  CG    . LEU A 1 79  ? -10.624 37.778  30.672  1.00 110.89 ? 79  LEU A CG    1 
ATOM   580   C  CD1   . LEU A 1 79  ? -11.867 37.729  31.109  1.00 108.15 ? 79  LEU A CD1   1 
ATOM   581   C  CD2   . LEU A 1 79  ? -10.232 36.517  30.976  1.00 118.22 ? 79  LEU A CD2   1 
ATOM   582   N  N     . ALA A 1 80  ? -8.378  40.128  27.472  1.00 127.57 ? 80  ALA A N     1 
ATOM   583   C  CA    . ALA A 1 80  ? -7.526  40.219  26.346  1.00 116.32 ? 80  ALA A CA    1 
ATOM   584   C  C     . ALA A 1 80  ? -6.592  39.060  26.675  1.00 119.39 ? 80  ALA A C     1 
ATOM   585   O  O     . ALA A 1 80  ? -5.988  39.021  27.749  1.00 116.43 ? 80  ALA A O     1 
ATOM   586   C  CB    . ALA A 1 80  ? -6.817  41.572  26.285  1.00 94.74  ? 80  ALA A CB    1 
ATOM   587   N  N     . ARG A 1 81  ? -6.507  38.127  25.736  1.00 129.07 ? 81  ARG A N     1 
ATOM   588   C  CA    . ARG A 1 81  ? -5.699  36.919  25.909  1.00 133.43 ? 81  ARG A CA    1 
ATOM   589   C  C     . ARG A 1 81  ? -5.111  36.581  24.559  1.00 143.27 ? 81  ARG A C     1 
ATOM   590   O  O     . ARG A 1 81  ? -5.849  36.235  23.610  1.00 142.43 ? 81  ARG A O     1 
ATOM   591   C  CB    . ARG A 1 81  ? -6.526  35.765  26.457  1.00 129.17 ? 81  ARG A CB    1 
ATOM   592   N  N     . MET A 1 82  ? -3.812  36.771  24.420  1.00 145.88 ? 82  MET A N     1 
ATOM   593   C  CA    . MET A 1 82  ? -3.207  36.532  23.135  1.00 144.77 ? 82  MET A CA    1 
ATOM   594   C  C     . MET A 1 82  ? -3.819  37.584  22.242  1.00 139.57 ? 82  MET A C     1 
ATOM   595   O  O     . MET A 1 82  ? -4.287  37.290  21.149  1.00 130.08 ? 82  MET A O     1 
ATOM   596   C  CB    . MET A 1 82  ? -3.574  35.154  22.637  1.00 146.20 ? 82  MET A CB    1 
ATOM   597   N  N     . GLY A 1 83  ? -3.839  38.818  22.730  1.00 137.65 ? 83  GLY A N     1 
ATOM   598   C  CA    . GLY A 1 83  ? -4.402  39.927  21.983  1.00 145.11 ? 83  GLY A CA    1 
ATOM   599   C  C     . GLY A 1 83  ? -5.838  39.721  21.535  1.00 149.04 ? 83  GLY A C     1 
ATOM   600   O  O     . GLY A 1 83  ? -6.564  40.686  21.320  1.00 140.12 ? 83  GLY A O     1 
ATOM   601   N  N     . GLN A 1 84  ? -6.248  38.462  21.395  1.00 146.91 ? 84  GLN A N     1 
ATOM   602   C  CA    . GLN A 1 84  ? -7.598  38.120  20.974  1.00 147.20 ? 84  GLN A CA    1 
ATOM   603   C  C     . GLN A 1 84  ? -8.523  38.647  22.022  1.00 153.47 ? 84  GLN A C     1 
ATOM   604   O  O     . GLN A 1 84  ? -8.089  39.301  22.951  1.00 164.85 ? 84  GLN A O     1 
ATOM   605   C  CB    . GLN A 1 84  ? -7.753  36.619  20.852  1.00 144.13 ? 84  GLN A CB    1 
ATOM   606   N  N     . THR A 1 85  ? -9.807  38.373  21.910  1.00 155.62 ? 85  THR A N     1 
ATOM   607   C  CA    . THR A 1 85  ? -10.676 38.914  22.938  1.00 139.83 ? 85  THR A CA    1 
ATOM   608   C  C     . THR A 1 85  ? -11.971 38.200  23.422  1.00 177.86 ? 85  THR A C     1 
ATOM   609   O  O     . THR A 1 85  ? -12.887 37.992  22.614  1.00 171.96 ? 85  THR A O     1 
ATOM   610   C  CB    . THR A 1 85  ? -11.026 40.366  22.560  1.00 118.50 ? 85  THR A CB    1 
ATOM   611   O  OG1   . THR A 1 85  ? -9.833  41.150  22.572  1.00 116.26 ? 85  THR A OG1   1 
ATOM   612   C  CG2   . THR A 1 85  ? -12.047 40.926  23.530  1.00 99.18  ? 85  THR A CG2   1 
ATOM   613   N  N     . TYR A 1 86  ? -12.010 37.802  24.702  1.00 152.28 ? 86  TYR A N     1 
ATOM   614   C  CA    . TYR A 1 86  ? -13.207 37.222  25.358  1.00 145.86 ? 86  TYR A CA    1 
ATOM   615   C  C     . TYR A 1 86  ? -13.976 38.170  26.324  1.00 113.64 ? 86  TYR A C     1 
ATOM   616   O  O     . TYR A 1 86  ? -13.392 39.025  26.997  1.00 109.51 ? 86  TYR A O     1 
ATOM   617   C  CB    . TYR A 1 86  ? -12.816 35.945  26.087  1.00 137.38 ? 86  TYR A CB    1 
ATOM   618   C  CG    . TYR A 1 86  ? -12.291 34.878  25.166  1.00 135.09 ? 86  TYR A CG    1 
ATOM   619   C  CD1   . TYR A 1 86  ? -12.806 34.710  23.887  1.00 139.00 ? 86  TYR A CD1   1 
ATOM   620   C  CD2   . TYR A 1 86  ? -11.239 34.059  25.537  1.00 138.77 ? 86  TYR A CD2   1 
ATOM   621   C  CE1   . TYR A 1 86  ? -12.312 33.698  22.998  1.00 144.64 ? 86  TYR A CE1   1 
ATOM   622   C  CE2   . TYR A 1 86  ? -10.746 33.067  24.669  1.00 138.67 ? 86  TYR A CE2   1 
ATOM   623   C  CZ    . TYR A 1 86  ? -11.266 32.870  23.422  1.00 140.79 ? 86  TYR A CZ    1 
ATOM   624   O  OH    . TYR A 1 86  ? -10.750 31.914  22.632  1.00 143.86 ? 86  TYR A OH    1 
ATOM   625   N  N     . ALA A 1 87  ? -15.307 38.100  26.285  1.00 111.22 ? 87  ALA A N     1 
ATOM   626   C  CA    . ALA A 1 87  ? -16.187 38.779  27.260  1.00 79.06  ? 87  ALA A CA    1 
ATOM   627   C  C     . ALA A 1 87  ? -16.667 37.745  28.234  1.00 85.75  ? 87  ALA A C     1 
ATOM   628   O  O     . ALA A 1 87  ? -17.193 36.704  27.826  1.00 104.93 ? 87  ALA A O     1 
ATOM   629   C  CB    . ALA A 1 87  ? -17.343 39.484  26.587  1.00 58.93  ? 87  ALA A CB    1 
ATOM   630   N  N     . TYR A 1 88  ? -16.522 38.005  29.519  1.00 82.47  ? 88  TYR A N     1 
ATOM   631   C  CA    . TYR A 1 88  ? -16.999 37.075  30.529  1.00 80.51  ? 88  TYR A CA    1 
ATOM   632   C  C     . TYR A 1 88  ? -18.180 37.599  31.364  1.00 69.70  ? 88  TYR A C     1 
ATOM   633   O  O     . TYR A 1 88  ? -18.300 38.783  31.602  1.00 63.44  ? 88  TYR A O     1 
ATOM   634   C  CB    . TYR A 1 88  ? -15.858 36.684  31.498  1.00 68.26  ? 88  TYR A CB    1 
ATOM   635   C  CG    . TYR A 1 88  ? -15.514 37.770  32.522  1.00 71.91  ? 88  TYR A CG    1 
ATOM   636   C  CD1   . TYR A 1 88  ? -16.208 37.880  33.723  1.00 76.65  ? 88  TYR A CD1   1 
ATOM   637   C  CD2   . TYR A 1 88  ? -14.474 38.635  32.317  1.00 76.75  ? 88  TYR A CD2   1 
ATOM   638   C  CE1   . TYR A 1 88  ? -15.891 38.851  34.633  1.00 77.84  ? 88  TYR A CE1   1 
ATOM   639   C  CE2   . TYR A 1 88  ? -14.106 39.589  33.244  1.00 83.32  ? 88  TYR A CE2   1 
ATOM   640   C  CZ    . TYR A 1 88  ? -14.841 39.700  34.408  1.00 84.68  ? 88  TYR A CZ    1 
ATOM   641   O  OH    . TYR A 1 88  ? -14.530 40.666  35.346  1.00 83.49  ? 88  TYR A OH    1 
ATOM   642   N  N     . ARG A 1 89  ? -19.064 36.668  31.723  1.00 68.38  ? 89  ARG A N     1 
ATOM   643   C  CA    . ARG A 1 89  ? -20.043 36.940  32.767  1.00 71.14  ? 89  ARG A CA    1 
ATOM   644   C  C     . ARG A 1 89  ? -20.055 35.799  33.802  1.00 74.96  ? 89  ARG A C     1 
ATOM   645   O  O     . ARG A 1 89  ? -20.117 34.647  33.432  1.00 85.94  ? 89  ARG A O     1 
ATOM   646   C  CB    . ARG A 1 89  ? -21.420 37.135  32.190  1.00 72.80  ? 89  ARG A CB    1 
ATOM   647   C  CG    . ARG A 1 89  ? -22.448 37.441  33.249  1.00 77.12  ? 89  ARG A CG    1 
ATOM   648   C  CD    . ARG A 1 89  ? -23.722 37.956  32.704  1.00 82.50  ? 89  ARG A CD    1 
ATOM   649   N  NE    . ARG A 1 89  ? -24.664 38.282  33.762  1.00 97.75  ? 89  ARG A NE    1 
ATOM   650   C  CZ    . ARG A 1 89  ? -25.912 38.694  33.574  1.00 114.93 ? 89  ARG A CZ    1 
ATOM   651   N  NH1   . ARG A 1 89  ? -26.352 38.891  32.340  1.00 112.81 ? 89  ARG A NH1   1 
ATOM   652   N  NH2   . ARG A 1 89  ? -26.696 38.942  34.607  1.00 132.51 ? 89  ARG A NH2   1 
ATOM   653   N  N     . LEU A 1 90  ? -20.017 36.169  35.069  1.00 72.22  ? 90  LEU A N     1 
ATOM   654   C  CA    . LEU A 1 90  ? -20.088 35.170  36.135  1.00 75.22  ? 90  LEU A CA    1 
ATOM   655   C  C     . LEU A 1 90  ? -21.501 35.124  36.678  1.00 76.80  ? 90  LEU A C     1 
ATOM   656   O  O     . LEU A 1 90  ? -22.043 36.165  37.026  1.00 80.39  ? 90  LEU A O     1 
ATOM   657   C  CB    . LEU A 1 90  ? -19.056 35.514  37.220  1.00 80.14  ? 90  LEU A CB    1 
ATOM   658   C  CG    . LEU A 1 90  ? -17.636 35.725  36.659  1.00 89.49  ? 90  LEU A CG    1 
ATOM   659   C  CD1   . LEU A 1 90  ? -16.632 35.903  37.761  1.00 92.21  ? 90  LEU A CD1   1 
ATOM   660   C  CD2   . LEU A 1 90  ? -17.222 34.563  35.769  1.00 97.58  ? 90  LEU A CD2   1 
ATOM   661   N  N     . TYR A 1 91  ? -22.068 33.929  36.809  1.00 85.36  ? 91  TYR A N     1 
ATOM   662   C  CA    . TYR A 1 91  ? -23.400 33.783  37.389  1.00 84.27  ? 91  TYR A CA    1 
ATOM   663   C  C     . TYR A 1 91  ? -23.270 33.031  38.701  1.00 85.72  ? 91  TYR A C     1 
ATOM   664   O  O     . TYR A 1 91  ? -22.823 31.874  38.710  1.00 88.81  ? 91  TYR A O     1 
ATOM   665   C  CB    . TYR A 1 91  ? -24.374 33.035  36.469  1.00 82.57  ? 91  TYR A CB    1 
ATOM   666   C  CG    . TYR A 1 91  ? -24.703 33.794  35.208  1.00 85.31  ? 91  TYR A CG    1 
ATOM   667   C  CD1   . TYR A 1 91  ? -25.760 34.677  35.156  1.00 89.14  ? 91  TYR A CD1   1 
ATOM   668   C  CD2   . TYR A 1 91  ? -24.040 33.496  34.012  1.00 84.67  ? 91  TYR A CD2   1 
ATOM   669   C  CE1   . TYR A 1 91  ? -26.061 35.365  33.989  1.00 89.65  ? 91  TYR A CE1   1 
ATOM   670   C  CE2   . TYR A 1 91  ? -24.353 34.149  32.832  1.00 80.50  ? 91  TYR A CE2   1 
ATOM   671   C  CZ    . TYR A 1 91  ? -25.364 35.082  32.827  1.00 81.84  ? 91  TYR A CZ    1 
ATOM   672   O  OH    . TYR A 1 91  ? -25.685 35.733  31.661  1.00 81.55  ? 91  TYR A OH    1 
ATOM   673   N  N     . PRO A 1 92  ? -23.637 33.673  39.814  1.00 84.97  ? 92  PRO A N     1 
ATOM   674   C  CA    . PRO A 1 92  ? -23.513 32.951  41.089  1.00 97.10  ? 92  PRO A CA    1 
ATOM   675   C  C     . PRO A 1 92  ? -24.487 31.795  41.174  1.00 93.82  ? 92  PRO A C     1 
ATOM   676   O  O     . PRO A 1 92  ? -25.636 31.873  40.771  1.00 79.50  ? 92  PRO A O     1 
ATOM   677   C  CB    . PRO A 1 92  ? -23.739 34.055  42.136  1.00 96.86  ? 92  PRO A CB    1 
ATOM   678   C  CG    . PRO A 1 92  ? -24.501 35.068  41.460  1.00 86.81  ? 92  PRO A CG    1 
ATOM   679   C  CD    . PRO A 1 92  ? -24.110 35.051  40.009  1.00 81.11  ? 92  PRO A CD    1 
ATOM   680   N  N     . LYS A 1 93  ? -23.952 30.666  41.605  1.00 95.70  ? 93  LYS A N     1 
ATOM   681   C  CA    . LYS A 1 93  ? -24.775 29.489  41.676  1.00 96.69  ? 93  LYS A CA    1 
ATOM   682   C  C     . LYS A 1 93  ? -24.729 28.829  43.067  1.00 85.73  ? 93  LYS A C     1 
ATOM   683   O  O     . LYS A 1 93  ? -24.499 27.631  43.170  1.00 80.53  ? 93  LYS A O     1 
ATOM   684   C  CB    . LYS A 1 93  ? -24.310 28.525  40.611  1.00 101.68 ? 93  LYS A CB    1 
ATOM   685   C  CG    . LYS A 1 93  ? -24.603 29.025  39.213  1.00 106.85 ? 93  LYS A CG    1 
ATOM   686   C  CD    . LYS A 1 93  ? -25.746 28.371  38.530  1.00 115.65 ? 93  LYS A CD    1 
ATOM   687   C  CE    . LYS A 1 93  ? -26.887 29.294  38.155  1.00 119.85 ? 93  LYS A CE    1 
ATOM   688   N  NZ    . LYS A 1 93  ? -27.133 28.901  36.716  1.00 115.18 ? 93  LYS A NZ    1 
ATOM   689   N  N     . GLY A 1 94  ? -24.964 29.623  44.115  1.00 89.27  ? 94  GLY A N     1 
ATOM   690   C  CA    . GLY A 1 94  ? -25.014 29.177  45.497  1.00 86.92  ? 94  GLY A CA    1 
ATOM   691   C  C     . GLY A 1 94  ? -23.637 28.701  45.959  1.00 82.79  ? 94  GLY A C     1 
ATOM   692   O  O     . GLY A 1 94  ? -22.674 28.794  45.205  1.00 79.32  ? 94  GLY A O     1 
ATOM   693   N  N     . ARG A 1 95  ? -23.462 28.354  47.229  1.00 89.93  ? 95  ARG A N     1 
ATOM   694   C  CA    . ARG A 1 95  ? -22.159 27.844  47.679  1.00 99.28  ? 95  ARG A CA    1 
ATOM   695   C  C     . ARG A 1 95  ? -22.024 26.321  47.765  1.00 97.57  ? 95  ARG A C     1 
ATOM   696   O  O     . ARG A 1 95  ? -23.020 25.652  48.085  1.00 98.77  ? 95  ARG A O     1 
ATOM   697   C  CB    . ARG A 1 95  ? -21.782 28.532  48.966  1.00 104.47 ? 95  ARG A CB    1 
ATOM   698   C  CG    . ARG A 1 95  ? -22.064 30.018  48.963  1.00 110.78 ? 95  ARG A CG    1 
ATOM   699   C  CD    . ARG A 1 95  ? -21.622 30.496  50.227  1.00 116.33 ? 95  ARG A CD    1 
ATOM   700   N  NE    . ARG A 1 95  ? -21.896 31.881  50.542  1.00 121.27 ? 95  ARG A NE    1 
ATOM   701   C  CZ    . ARG A 1 95  ? -21.862 32.188  51.809  1.00 114.58 ? 95  ARG A CZ    1 
ATOM   702   N  NH1   . ARG A 1 95  ? -22.069 33.386  52.337  1.00 122.23 ? 95  ARG A NH1   1 
ATOM   703   N  NH2   . ARG A 1 95  ? -21.608 31.149  52.535  1.00 91.36  ? 95  ARG A NH2   1 
ATOM   704   N  N     . ARG A 1 96  ? -20.808 25.775  47.661  1.00 96.02  ? 96  ARG A N     1 
ATOM   705   C  CA    . ARG A 1 96  ? -20.758 24.384  47.975  1.00 104.44 ? 96  ARG A CA    1 
ATOM   706   C  C     . ARG A 1 96  ? -19.880 24.097  49.168  1.00 109.50 ? 96  ARG A C     1 
ATOM   707   O  O     . ARG A 1 96  ? -18.727 24.598  49.280  1.00 115.65 ? 96  ARG A O     1 
ATOM   708   C  CB    . ARG A 1 96  ? -20.157 23.537  46.843  1.00 108.90 ? 96  ARG A CB    1 
ATOM   709   C  CG    . ARG A 1 96  ? -18.689 23.695  46.515  1.00 114.74 ? 96  ARG A CG    1 
ATOM   710   C  CD    . ARG A 1 96  ? -18.258 22.806  45.354  1.00 125.73 ? 96  ARG A CD    1 
ATOM   711   N  NE    . ARG A 1 96  ? -19.207 21.747  45.055  1.00 130.10 ? 96  ARG A NE    1 
ATOM   712   C  CZ    . ARG A 1 96  ? -18.912 20.603  44.430  1.00 132.46 ? 96  ARG A CZ    1 
ATOM   713   N  NH1   . ARG A 1 96  ? -17.677 20.343  44.033  1.00 129.04 ? 96  ARG A NH1   1 
ATOM   714   N  NH2   . ARG A 1 96  ? -19.874 19.710  44.212  1.00 134.63 ? 96  ARG A NH2   1 
ATOM   715   N  N     . PRO A 1 97  ? -20.385 23.234  50.056  1.00 107.27 ? 97  PRO A N     1 
ATOM   716   C  CA    . PRO A 1 97  ? -19.605 22.980  51.252  1.00 106.37 ? 97  PRO A CA    1 
ATOM   717   C  C     . PRO A 1 97  ? -18.335 22.261  50.834  1.00 101.20 ? 97  PRO A C     1 
ATOM   718   O  O     . PRO A 1 97  ? -18.428 21.199  50.222  1.00 71.21  ? 97  PRO A O     1 
ATOM   719   C  CB    . PRO A 1 97  ? -20.578 22.135  52.099  1.00 107.63 ? 97  PRO A CB    1 
ATOM   720   C  CG    . PRO A 1 97  ? -21.977 22.515  51.540  1.00 106.56 ? 97  PRO A CG    1 
ATOM   721   C  CD    . PRO A 1 97  ? -21.754 22.707  50.105  1.00 105.69 ? 97  PRO A CD    1 
ATOM   722   N  N     . LEU A 1 98  ? -17.178 22.729  51.304  1.00 113.94 ? 98  LEU A N     1 
ATOM   723   C  CA    . LEU A 1 98  ? -15.981 21.937  51.068  1.00 117.29 ? 98  LEU A CA    1 
ATOM   724   C  C     . LEU A 1 98  ? -15.431 21.336  52.310  1.00 125.78 ? 98  LEU A C     1 
ATOM   725   O  O     . LEU A 1 98  ? -15.429 21.933  53.394  1.00 133.15 ? 98  LEU A O     1 
ATOM   726   C  CB    . LEU A 1 98  ? -14.809 22.713  50.503  1.00 109.30 ? 98  LEU A CB    1 
ATOM   727   C  CG    . LEU A 1 98  ? -14.663 22.768  49.011  1.00 101.07 ? 98  LEU A CG    1 
ATOM   728   C  CD1   . LEU A 1 98  ? -15.642 22.937  48.286  1.00 106.65 ? 98  LEU A CD1   1 
ATOM   729   C  CD2   . LEU A 1 98  ? -13.772 23.349  48.450  1.00 97.96  ? 98  LEU A CD2   1 
ATOM   730   N  N     . ASP A 1 99  ? -14.933 20.145  52.146  1.00 132.26 ? 99  ASP A N     1 
ATOM   731   C  CA    . ASP A 1 99  ? -14.423 19.495  53.319  1.00 135.36 ? 99  ASP A CA    1 
ATOM   732   C  C     . ASP A 1 99  ? -12.922 19.192  53.310  1.00 122.45 ? 99  ASP A C     1 
ATOM   733   O  O     . ASP A 1 99  ? -12.465 18.432  52.455  1.00 88.72  ? 99  ASP A O     1 
ATOM   734   C  CB    . ASP A 1 99  ? -15.342 18.397  53.729  1.00 142.01 ? 99  ASP A CB    1 
ATOM   735   C  CG    . ASP A 1 99  ? -14.768 17.531  54.745  1.00 147.47 ? 99  ASP A CG    1 
ATOM   736   O  OD1   . ASP A 1 99  ? -13.848 17.867  55.503  1.00 150.24 ? 99  ASP A OD1   1 
ATOM   737   O  OD2   . ASP A 1 99  ? -15.607 16.759  55.141  1.00 146.50 ? 99  ASP A OD2   1 
ATOM   738   N  N     . PRO A 1 100 ? -12.178 19.702  54.282  1.00 124.63 ? 100 PRO A N     1 
ATOM   739   C  CA    . PRO A 1 100 ? -10.741 19.461  54.245  1.00 127.72 ? 100 PRO A CA    1 
ATOM   740   C  C     . PRO A 1 100 ? -10.298 17.966  54.162  1.00 137.79 ? 100 PRO A C     1 
ATOM   741   O  O     . PRO A 1 100 ? -9.140  17.750  53.848  1.00 132.92 ? 100 PRO A O     1 
ATOM   742   C  CB    . PRO A 1 100 ? -10.268 20.062  55.573  1.00 132.44 ? 100 PRO A CB    1 
ATOM   743   C  CG    . PRO A 1 100 ? -11.306 21.136  55.929  1.00 135.66 ? 100 PRO A CG    1 
ATOM   744   C  CD    . PRO A 1 100 ? -12.589 20.518  55.445  1.00 130.99 ? 100 PRO A CD    1 
ATOM   745   N  N     . LYS A 1 101 ? -11.166 16.958  54.420  1.00 145.48 ? 101 LYS A N     1 
ATOM   746   C  CA    . LYS A 1 101 ? -10.663 15.576  54.324  1.00 146.16 ? 101 LYS A CA    1 
ATOM   747   C  C     . LYS A 1 101 ? -10.537 15.000  52.937  1.00 145.73 ? 101 LYS A C     1 
ATOM   748   O  O     . LYS A 1 101 ? -9.681  14.205  52.632  1.00 141.09 ? 101 LYS A O     1 
ATOM   749   C  CB    . LYS A 1 101 ? -11.645 14.562  54.988  1.00 136.48 ? 101 LYS A CB    1 
ATOM   750   C  CG    . LYS A 1 101 ? -12.838 15.099  55.733  1.00 139.20 ? 101 LYS A CG    1 
ATOM   751   C  CD    . LYS A 1 101 ? -13.883 14.026  56.198  1.00 136.67 ? 101 LYS A CD    1 
ATOM   752   C  CE    . LYS A 1 101 ? -14.977 14.852  56.823  1.00 137.81 ? 101 LYS A CE    1 
ATOM   753   N  NZ    . LYS A 1 101 ? -16.393 14.897  57.114  1.00 136.33 ? 101 LYS A NZ    1 
ATOM   754   N  N     . ASP A 1 102 ? -11.384 15.423  52.019  1.00 136.38 ? 102 ASP A N     1 
ATOM   755   C  CA    . ASP A 1 102 ? -11.233 14.919  50.664  1.00 141.86 ? 102 ASP A CA    1 
ATOM   756   C  C     . ASP A 1 102 ? -9.999  15.626  50.129  1.00 139.53 ? 102 ASP A C     1 
ATOM   757   O  O     . ASP A 1 102 ? -9.791  16.790  50.440  1.00 150.54 ? 102 ASP A O     1 
ATOM   758   C  CB    . ASP A 1 102 ? -12.452 15.237  49.811  1.00 147.59 ? 102 ASP A CB    1 
ATOM   759   C  CG    . ASP A 1 102 ? -12.388 14.595  48.449  1.00 140.42 ? 102 ASP A CG    1 
ATOM   760   O  OD1   . ASP A 1 102 ? -11.365 14.779  47.752  1.00 138.88 ? 102 ASP A OD1   1 
ATOM   761   O  OD2   . ASP A 1 102 ? -13.360 13.906  48.086  1.00 139.05 ? 102 ASP A OD2   1 
ATOM   762   N  N     . PRO A 1 103 ? -9.158  14.894  49.305  1.00 142.98 ? 103 PRO A N     1 
ATOM   763   C  CA    . PRO A 1 103 ? -7.952  15.617  48.868  1.00 134.79 ? 103 PRO A CA    1 
ATOM   764   C  C     . PRO A 1 103 ? -8.168  16.502  47.659  1.00 128.02 ? 103 PRO A C     1 
ATOM   765   O  O     . PRO A 1 103 ? -7.305  17.301  47.316  1.00 126.86 ? 103 PRO A O     1 
ATOM   766   C  CB    . PRO A 1 103 ? -7.002  14.494  48.498  1.00 131.30 ? 103 PRO A CB    1 
ATOM   767   C  CG    . PRO A 1 103 ? -7.887  13.564  47.781  1.00 131.35 ? 103 PRO A CG    1 
ATOM   768   C  CD    . PRO A 1 103 ? -9.132  13.525  48.620  1.00 136.27 ? 103 PRO A CD    1 
ATOM   769   N  N     . GLY A 1 104 ? -9.308  16.353  47.008  1.00 133.80 ? 104 GLY A N     1 
ATOM   770   C  CA    . GLY A 1 104 ? -9.604  17.166  45.849  1.00 120.77 ? 104 GLY A CA    1 
ATOM   771   C  C     . GLY A 1 104 ? -10.256 18.415  46.375  1.00 107.35 ? 104 GLY A C     1 
ATOM   772   O  O     . GLY A 1 104 ? -9.699  19.493  46.291  1.00 100.74 ? 104 GLY A O     1 
ATOM   773   N  N     . GLU A 1 105 ? -11.440 18.242  46.944  1.00 108.41 ? 105 GLU A N     1 
ATOM   774   C  CA    . GLU A 1 105 ? -12.184 19.336  47.521  1.00 111.78 ? 105 GLU A CA    1 
ATOM   775   C  C     . GLU A 1 105 ? -11.255 20.173  48.391  1.00 116.00 ? 105 GLU A C     1 
ATOM   776   O  O     . GLU A 1 105 ? -11.510 21.335  48.642  1.00 121.47 ? 105 GLU A O     1 
ATOM   777   C  CB    . GLU A 1 105 ? -13.396 18.814  48.303  1.00 30.00  ? 105 GLU A CB    1 
ATOM   778   C  CG    . GLU A 1 105 ? -14.356 18.018  47.423  1.00 30.00  ? 105 GLU A CG    1 
ATOM   779   C  CD    . GLU A 1 105 ? -15.764 17.850  47.985  1.00 30.00  ? 105 GLU A CD    1 
ATOM   780   O  OE1   . GLU A 1 105 ? -16.705 17.659  47.189  1.00 30.00  ? 105 GLU A OE1   1 
ATOM   781   O  OE2   . GLU A 1 105 ? -15.939 17.887  49.216  1.00 30.00  ? 105 GLU A OE2   1 
ATOM   782   N  N     . ARG A 1 106 ? -10.158 19.589  48.832  1.00 106.34 ? 106 ARG A N     1 
ATOM   783   C  CA    . ARG A 1 106 ? -9.220  20.314  49.653  1.00 105.42 ? 106 ARG A CA    1 
ATOM   784   C  C     . ARG A 1 106 ? -8.284  21.089  48.770  1.00 108.16 ? 106 ARG A C     1 
ATOM   785   O  O     . ARG A 1 106 ? -7.926  22.201  49.078  1.00 115.16 ? 106 ARG A O     1 
ATOM   786   C  CB    . ARG A 1 106 ? -8.436  19.350  50.538  1.00 98.51  ? 106 ARG A CB    1 
ATOM   787   C  CG    . ARG A 1 106 ? -7.141  19.906  51.093  1.00 102.15 ? 106 ARG A CG    1 
ATOM   788   C  CD    . ARG A 1 106 ? -6.668  19.100  52.278  1.00 106.83 ? 106 ARG A CD    1 
ATOM   789   N  NE    . ARG A 1 106 ? -6.061  17.838  51.884  1.00 108.75 ? 106 ARG A NE    1 
ATOM   790   C  CZ    . ARG A 1 106 ? -4.757  17.643  51.734  1.00 114.28 ? 106 ARG A CZ    1 
ATOM   791   N  NH1   . ARG A 1 106 ? -3.905  18.633  51.932  1.00 121.73 ? 106 ARG A NH1   1 
ATOM   792   N  NH2   . ARG A 1 106 ? -4.307  16.454  51.379  1.00 116.42 ? 106 ARG A NH2   1 
ATOM   793   N  N     . SER A 1 107 ? -7.871  20.494  47.670  1.00 107.13 ? 107 SER A N     1 
ATOM   794   C  CA    . SER A 1 107 ? -6.952  21.172  46.777  1.00 103.80 ? 107 SER A CA    1 
ATOM   795   C  C     . SER A 1 107 ? -7.511  22.529  46.429  1.00 99.94  ? 107 SER A C     1 
ATOM   796   O  O     . SER A 1 107 ? -6.786  23.439  46.066  1.00 96.81  ? 107 SER A O     1 
ATOM   797   C  CB    . SER A 1 107 ? -6.737  20.348  45.520  1.00 99.03  ? 107 SER A CB    1 
ATOM   798   N  N     . VAL A 1 108 ? -8.820  22.648  46.539  1.00 99.47  ? 108 VAL A N     1 
ATOM   799   C  CA    . VAL A 1 108 ? -9.499  23.896  46.211  1.00 95.05  ? 108 VAL A CA    1 
ATOM   800   C  C     . VAL A 1 108 ? -9.359  24.929  47.338  1.00 94.93  ? 108 VAL A C     1 
ATOM   801   O  O     . VAL A 1 108 ? -9.089  26.109  47.088  1.00 98.07  ? 108 VAL A O     1 
ATOM   802   C  CB    . VAL A 1 108 ? -10.996 23.655  45.938  1.00 83.88  ? 108 VAL A CB    1 
ATOM   803   C  CG1   . VAL A 1 108 ? -11.661 24.945  45.540  1.00 78.33  ? 108 VAL A CG1   1 
ATOM   804   C  CG2   . VAL A 1 108 ? -11.173 22.662  44.830  1.00 89.12  ? 108 VAL A CG2   1 
ATOM   805   N  N     . LEU A 1 109 ? -9.499  24.455  48.576  1.00 85.34  ? 109 LEU A N     1 
ATOM   806   C  CA    . LEU A 1 109 ? -9.326  25.276  49.766  1.00 75.90  ? 109 LEU A CA    1 
ATOM   807   C  C     . LEU A 1 109 ? -7.904  25.872  49.848  1.00 80.55  ? 109 LEU A C     1 
ATOM   808   O  O     . LEU A 1 109 ? -7.718  26.997  50.306  1.00 83.48  ? 109 LEU A O     1 
ATOM   809   C  CB    . LEU A 1 109 ? -9.640  24.448  51.005  1.00 75.79  ? 109 LEU A CB    1 
ATOM   810   C  CG    . LEU A 1 109 ? -11.097 24.061  51.230  1.00 89.63  ? 109 LEU A CG    1 
ATOM   811   C  CD1   . LEU A 1 109 ? -11.197 23.153  52.441  1.00 95.50  ? 109 LEU A CD1   1 
ATOM   812   C  CD2   . LEU A 1 109 ? -11.990 25.268  51.419  1.00 107.21 ? 109 LEU A CD2   1 
ATOM   813   N  N     . SER A 1 110 ? -6.895  25.069  49.509  1.00 79.63  ? 110 SER A N     1 
ATOM   814   C  CA    . SER A 1 110 ? -5.504  25.524  49.508  1.00 74.88  ? 110 SER A CA    1 
ATOM   815   C  C     . SER A 1 110 ? -5.293  26.556  48.431  1.00 77.31  ? 110 SER A C     1 
ATOM   816   O  O     . SER A 1 110 ? -4.550  27.516  48.616  1.00 72.41  ? 110 SER A O     1 
ATOM   817   C  CB    . SER A 1 110 ? -4.529  24.362  49.315  1.00 70.85  ? 110 SER A CB    1 
ATOM   818   O  OG    . SER A 1 110 ? -4.508  23.550  50.476  1.00 87.53  ? 110 SER A OG    1 
ATOM   819   N  N     . ALA A 1 111 ? -5.935  26.347  47.290  1.00 80.39  ? 111 ALA A N     1 
ATOM   820   C  CA    . ALA A 1 111 ? -5.861  27.339  46.233  1.00 79.71  ? 111 ALA A CA    1 
ATOM   821   C  C     . ALA A 1 111 ? -6.434  28.672  46.704  1.00 79.17  ? 111 ALA A C     1 
ATOM   822   O  O     . ALA A 1 111 ? -5.820  29.737  46.528  1.00 79.75  ? 111 ALA A O     1 
ATOM   823   C  CB    . ALA A 1 111 ? -6.583  26.852  45.015  1.00 73.30  ? 111 ALA A CB    1 
ATOM   824   N  N     . LEU A 1 112 ? -7.601  28.600  47.338  1.00 78.68  ? 112 LEU A N     1 
ATOM   825   C  CA    . LEU A 1 112 ? -8.193  29.780  47.941  1.00 74.58  ? 112 LEU A CA    1 
ATOM   826   C  C     . LEU A 1 112 ? -7.293  30.402  49.008  1.00 76.99  ? 112 LEU A C     1 
ATOM   827   O  O     . LEU A 1 112 ? -7.175  31.623  49.088  1.00 76.46  ? 112 LEU A O     1 
ATOM   828   C  CB    . LEU A 1 112 ? -9.538  29.416  48.584  1.00 67.80  ? 112 LEU A CB    1 
ATOM   829   C  CG    . LEU A 1 112 ? -10.698 29.144  47.634  1.00 75.55  ? 112 LEU A CG    1 
ATOM   830   C  CD1   . LEU A 1 112 ? -11.761 28.349  48.372  1.00 76.52  ? 112 LEU A CD1   1 
ATOM   831   C  CD2   . LEU A 1 112 ? -11.273 30.440  47.015  1.00 77.07  ? 112 LEU A CD2   1 
ATOM   832   N  N     . ALA A 1 113 ? -6.588  29.556  49.761  1.00 69.26  ? 113 ALA A N     1 
ATOM   833   C  CA    . ALA A 1 113 ? -5.716  30.045  50.797  1.00 49.64  ? 113 ALA A CA    1 
ATOM   834   C  C     . ALA A 1 113 ? -4.536  30.812  50.228  1.00 63.61  ? 113 ALA A C     1 
ATOM   835   O  O     . ALA A 1 113 ? -4.215  31.899  50.698  1.00 67.49  ? 113 ALA A O     1 
ATOM   836   C  CB    . ALA A 1 113 ? -5.233  28.895  51.632  1.00 52.26  ? 113 ALA A CB    1 
ATOM   837   N  N     . ARG A 1 114 ? -3.894  30.260  49.206  1.00 70.09  ? 114 ARG A N     1 
ATOM   838   C  CA    . ARG A 1 114 ? -2.800  30.968  48.552  1.00 72.83  ? 114 ARG A CA    1 
ATOM   839   C  C     . ARG A 1 114 ? -3.233  32.276  47.959  1.00 69.27  ? 114 ARG A C     1 
ATOM   840   O  O     . ARG A 1 114 ? -2.536  33.288  48.072  1.00 73.07  ? 114 ARG A O     1 
ATOM   841   C  CB    . ARG A 1 114 ? -2.183  30.151  47.419  1.00 81.48  ? 114 ARG A CB    1 
ATOM   842   C  CG    . ARG A 1 114 ? -1.559  28.858  47.830  1.00 97.64  ? 114 ARG A CG    1 
ATOM   843   C  CD    . ARG A 1 114 ? -1.126  28.057  46.632  1.00 105.71 ? 114 ARG A CD    1 
ATOM   844   N  NE    . ARG A 1 114 ? 0.050   28.609  45.980  1.00 109.15 ? 114 ARG A NE    1 
ATOM   845   C  CZ    . ARG A 1 114 ? 1.262   28.101  46.136  1.00 107.81 ? 114 ARG A CZ    1 
ATOM   846   N  NH1   . ARG A 1 114 ? 1.418   27.046  46.932  1.00 110.78 ? 114 ARG A NH1   1 
ATOM   847   N  NH2   . ARG A 1 114 ? 2.306   28.643  45.519  1.00 102.99 ? 114 ARG A NH2   1 
ATOM   848   N  N     . ARG A 1 115 ? -4.384  32.268  47.300  1.00 61.06  ? 115 ARG A N     1 
ATOM   849   C  CA    . ARG A 1 115 ? -4.868  33.521  46.782  1.00 71.24  ? 115 ARG A CA    1 
ATOM   850   C  C     . ARG A 1 115 ? -5.096  34.560  47.920  1.00 81.79  ? 115 ARG A C     1 
ATOM   851   O  O     . ARG A 1 115 ? -4.660  35.702  47.807  1.00 83.81  ? 115 ARG A O     1 
ATOM   852   C  CB    . ARG A 1 115 ? -6.215  33.333  46.096  1.00 78.94  ? 115 ARG A CB    1 
ATOM   853   C  CG    . ARG A 1 115 ? -6.712  34.335  45.039  1.00 83.91  ? 115 ARG A CG    1 
ATOM   854   C  CD    . ARG A 1 115 ? -5.832  34.604  43.869  1.00 92.17  ? 115 ARG A CD    1 
ATOM   855   N  NE    . ARG A 1 115 ? -6.234  33.503  42.935  1.00 113.17 ? 115 ARG A NE    1 
ATOM   856   C  CZ    . ARG A 1 115 ? -6.817  33.630  41.725  1.00 118.52 ? 115 ARG A CZ    1 
ATOM   857   N  NH1   . ARG A 1 115 ? -7.023  34.826  41.198  1.00 112.00 ? 115 ARG A NH1   1 
ATOM   858   N  NH2   . ARG A 1 115 ? -7.129  32.557  40.993  1.00 123.48 ? 115 ARG A NH2   1 
ATOM   859   N  N     . LEU A 1 116 ? -5.750  34.139  49.004  1.00 82.11  ? 116 LEU A N     1 
ATOM   860   C  CA    . LEU A 1 116 ? -5.970  34.995  50.168  1.00 70.07  ? 116 LEU A CA    1 
ATOM   861   C  C     . LEU A 1 116 ? -4.636  35.572  50.618  1.00 84.24  ? 116 LEU A C     1 
ATOM   862   O  O     . LEU A 1 116 ? -4.524  36.753  50.825  1.00 100.12 ? 116 LEU A O     1 
ATOM   863   C  CB    . LEU A 1 116 ? -6.666  34.245  51.309  1.00 50.87  ? 116 LEU A CB    1 
ATOM   864   C  CG    . LEU A 1 116 ? -6.916  34.846  52.703  1.00 45.35  ? 116 LEU A CG    1 
ATOM   865   C  CD1   . LEU A 1 116 ? -7.892  33.944  53.450  1.00 47.63  ? 116 LEU A CD1   1 
ATOM   866   C  CD2   . LEU A 1 116 ? -5.749  35.168  53.620  1.00 39.40  ? 116 LEU A CD2   1 
ATOM   867   N  N     . LEU A 1 117 ? -3.618  34.730  50.769  1.00 83.70  ? 117 LEU A N     1 
ATOM   868   C  CA    . LEU A 1 117 ? -2.301  35.187  51.206  1.00 74.71  ? 117 LEU A CA    1 
ATOM   869   C  C     . LEU A 1 117 ? -1.670  36.237  50.321  1.00 75.78  ? 117 LEU A C     1 
ATOM   870   O  O     . LEU A 1 117 ? -1.230  37.272  50.782  1.00 67.21  ? 117 LEU A O     1 
ATOM   871   C  CB    . LEU A 1 117 ? -1.347  33.990  51.251  1.00 73.63  ? 117 LEU A CB    1 
ATOM   872   C  CG    . LEU A 1 117 ? 0.035   34.379  51.741  1.00 74.04  ? 117 LEU A CG    1 
ATOM   873   C  CD1   . LEU A 1 117 ? 0.034   35.067  53.113  1.00 71.93  ? 117 LEU A CD1   1 
ATOM   874   C  CD2   . LEU A 1 117 ? 0.959   33.179  51.673  1.00 78.75  ? 117 LEU A CD2   1 
ATOM   875   N  N     . GLN A 1 118 ? -1.605  35.929  49.035  1.00 86.64  ? 118 GLN A N     1 
ATOM   876   C  CA    . GLN A 1 118 ? -1.032  36.791  48.030  1.00 97.48  ? 118 GLN A CA    1 
ATOM   877   C  C     . GLN A 1 118 ? -1.787  38.107  48.064  1.00 102.40 ? 118 GLN A C     1 
ATOM   878   O  O     . GLN A 1 118 ? -1.135  39.208  48.162  1.00 99.21  ? 118 GLN A O     1 
ATOM   879   C  CB    . GLN A 1 118 ? -1.105  36.121  46.668  1.00 100.62 ? 118 GLN A CB    1 
ATOM   880   C  CG    . GLN A 1 118 ? -0.602  36.878  45.464  1.00 103.05 ? 118 GLN A CG    1 
ATOM   881   C  CD    . GLN A 1 118 ? -0.986  36.140  44.201  1.00 104.38 ? 118 GLN A CD    1 
ATOM   882   O  OE1   . GLN A 1 118 ? -1.990  35.446  44.148  1.00 97.23  ? 118 GLN A OE1   1 
ATOM   883   N  NE2   . GLN A 1 118 ? -0.088  36.205  43.196  1.00 109.88 ? 118 GLN A NE2   1 
ATOM   884   N  N     . GLU A 1 119 ? -3.129  38.044  48.026  1.00 104.32 ? 119 GLU A N     1 
ATOM   885   C  CA    . GLU A 1 119 ? -4.030  39.205  47.996  1.00 102.33 ? 119 GLU A CA    1 
ATOM   886   C  C     . GLU A 1 119 ? -3.935  40.103  49.204  1.00 98.33  ? 119 GLU A C     1 
ATOM   887   O  O     . GLU A 1 119 ? -3.922  41.316  49.104  1.00 116.53 ? 119 GLU A O     1 
ATOM   888   C  CB    . GLU A 1 119 ? -5.475  38.703  47.914  1.00 107.69 ? 119 GLU A CB    1 
ATOM   889   C  CG    . GLU A 1 119 ? -6.276  39.066  46.644  1.00 113.29 ? 119 GLU A CG    1 
ATOM   890   C  CD    . GLU A 1 119 ? -6.108  38.327  45.321  1.00 125.37 ? 119 GLU A CD    1 
ATOM   891   O  OE1   . GLU A 1 119 ? -6.885  37.298  45.246  1.00 127.68 ? 119 GLU A OE1   1 
ATOM   892   O  OE2   . GLU A 1 119 ? -5.436  38.719  44.417  1.00 118.42 ? 119 GLU A OE2   1 
ATOM   893   N  N     . ARG A 1 120 ? -3.855  39.437  50.346  1.00 100.11 ? 120 ARG A N     1 
ATOM   894   C  CA    . ARG A 1 120 ? -3.783  40.162  51.592  1.00 87.92  ? 120 ARG A CA    1 
ATOM   895   C  C     . ARG A 1 120 ? -2.430  40.789  51.751  1.00 90.25  ? 120 ARG A C     1 
ATOM   896   O  O     . ARG A 1 120 ? -2.386  41.865  52.252  1.00 82.13  ? 120 ARG A O     1 
ATOM   897   C  CB    . ARG A 1 120 ? -4.060  39.333  52.848  1.00 78.70  ? 120 ARG A CB    1 
ATOM   898   C  CG    . ARG A 1 120 ? -5.484  38.785  52.919  1.00 81.22  ? 120 ARG A CG    1 
ATOM   899   C  CD    . ARG A 1 120 ? -5.953  38.575  54.368  1.00 75.96  ? 120 ARG A CD    1 
ATOM   900   N  NE    . ARG A 1 120 ? -7.306  38.029  54.401  1.00 74.74  ? 120 ARG A NE    1 
ATOM   901   C  CZ    . ARG A 1 120 ? -7.988  37.772  55.511  1.00 80.07  ? 120 ARG A CZ    1 
ATOM   902   N  NH1   . ARG A 1 120 ? -7.420  37.982  56.686  1.00 84.51  ? 120 ARG A NH1   1 
ATOM   903   N  NH2   . ARG A 1 120 ? -9.223  37.276  55.450  1.00 82.22  ? 120 ARG A NH2   1 
ATOM   904   N  N     . LEU A 1 121 ? -1.353  40.131  51.274  1.00 95.94  ? 121 LEU A N     1 
ATOM   905   C  CA    . LEU A 1 121 ? -0.038  40.731  51.283  1.00 77.27  ? 121 LEU A CA    1 
ATOM   906   C  C     . LEU A 1 121 ? 0.077   41.984  50.400  1.00 102.55 ? 121 LEU A C     1 
ATOM   907   O  O     . LEU A 1 121 ? 0.759   42.933  50.770  1.00 95.91  ? 121 LEU A O     1 
ATOM   908   C  CB    . LEU A 1 121 ? 1.021   39.749  50.816  1.00 70.43  ? 121 LEU A CB    1 
ATOM   909   C  CG    . LEU A 1 121 ? 1.413   38.543  51.625  1.00 78.03  ? 121 LEU A CG    1 
ATOM   910   C  CD1   . LEU A 1 121 ? 2.516   37.763  50.881  1.00 83.91  ? 121 LEU A CD1   1 
ATOM   911   C  CD2   . LEU A 1 121 ? 1.769   38.880  53.054  1.00 76.66  ? 121 LEU A CD2   1 
ATOM   912   N  N     . ARG A 1 122 ? -0.567  41.983  49.218  1.00 109.64 ? 122 ARG A N     1 
ATOM   913   C  CA    . ARG A 1 122 ? -0.514  43.209  48.406  1.00 105.64 ? 122 ARG A CA    1 
ATOM   914   C  C     . ARG A 1 122 ? -1.048  44.427  49.055  1.00 96.50  ? 122 ARG A C     1 
ATOM   915   O  O     . ARG A 1 122 ? -0.828  45.531  48.608  1.00 102.13 ? 122 ARG A O     1 
ATOM   916   C  CB    . ARG A 1 122 ? -1.293  43.264  47.134  1.00 112.13 ? 122 ARG A CB    1 
ATOM   917   C  CG    . ARG A 1 122 ? -2.405  42.508  46.980  1.00 117.78 ? 122 ARG A CG    1 
ATOM   918   C  CD    . ARG A 1 122 ? -2.971  42.746  45.697  1.00 128.49 ? 122 ARG A CD    1 
ATOM   919   N  NE    . ARG A 1 122 ? -3.947  41.658  45.548  1.00 139.11 ? 122 ARG A NE    1 
ATOM   920   C  CZ    . ARG A 1 122 ? -4.755  41.528  44.496  1.00 144.75 ? 122 ARG A CZ    1 
ATOM   921   N  NH1   . ARG A 1 122 ? -4.999  42.404  43.570  1.00 148.49 ? 122 ARG A NH1   1 
ATOM   922   N  NH2   . ARG A 1 122 ? -5.529  40.590  44.460  1.00 148.05 ? 122 ARG A NH2   1 
ATOM   923   N  N     . ARG A 1 123 ? -1.889  44.211  50.044  1.00 92.49  ? 123 ARG A N     1 
ATOM   924   C  CA    . ARG A 1 123 ? -2.617  45.286  50.604  1.00 83.37  ? 123 ARG A CA    1 
ATOM   925   C  C     . ARG A 1 123 ? -2.024  45.739  51.927  1.00 79.32  ? 123 ARG A C     1 
ATOM   926   O  O     . ARG A 1 123 ? -2.636  46.431  52.742  1.00 70.40  ? 123 ARG A O     1 
ATOM   927   C  CB    . ARG A 1 123 ? -3.995  44.605  50.672  1.00 82.60  ? 123 ARG A CB    1 
ATOM   928   C  CG    . ARG A 1 123 ? -5.086  44.839  51.500  1.00 86.01  ? 123 ARG A CG    1 
ATOM   929   C  CD    . ARG A 1 123 ? -6.548  44.276  51.193  1.00 107.89 ? 123 ARG A CD    1 
ATOM   930   N  NE    . ARG A 1 123 ? -6.953  43.380  50.099  1.00 112.34 ? 123 ARG A NE    1 
ATOM   931   C  CZ    . ARG A 1 123 ? -7.547  43.775  48.978  1.00 114.74 ? 123 ARG A CZ    1 
ATOM   932   N  NH1   . ARG A 1 123 ? -8.045  44.990  48.951  1.00 119.62 ? 123 ARG A NH1   1 
ATOM   933   N  NH2   . ARG A 1 123 ? -7.887  42.903  48.018  1.00 117.93 ? 123 ARG A NH2   1 
ATOM   934   N  N     . LEU A 1 124 ? -0.785  45.355  52.170  1.00 93.60  ? 124 LEU A N     1 
ATOM   935   C  CA    . LEU A 1 124 ? -0.013  45.788  53.300  1.00 95.00  ? 124 LEU A CA    1 
ATOM   936   C  C     . LEU A 1 124 ? 0.793   46.972  52.880  1.00 97.06  ? 124 LEU A C     1 
ATOM   937   O  O     . LEU A 1 124 ? 1.224   47.035  51.730  1.00 103.00 ? 124 LEU A O     1 
ATOM   938   C  CB    . LEU A 1 124 ? 0.860   44.675  53.877  1.00 99.58  ? 124 LEU A CB    1 
ATOM   939   C  CG    . LEU A 1 124 ? -0.178  43.812  54.635  1.00 102.18 ? 124 LEU A CG    1 
ATOM   940   C  CD1   . LEU A 1 124 ? -0.650  43.122  53.621  1.00 107.02 ? 124 LEU A CD1   1 
ATOM   941   C  CD2   . LEU A 1 124 ? 0.302   42.732  55.441  1.00 96.39  ? 124 LEU A CD2   1 
ATOM   942   N  N     . GLU A 1 125 ? 0.996   47.897  53.802  1.00 98.98  ? 125 GLU A N     1 
ATOM   943   C  CA    . GLU A 1 125 ? 1.826   49.036  53.519  1.00 101.58 ? 125 GLU A CA    1 
ATOM   944   C  C     . GLU A 1 125 ? 2.858   49.214  54.675  1.00 93.86  ? 125 GLU A C     1 
ATOM   945   O  O     . GLU A 1 125 ? 2.579   48.650  55.736  1.00 98.11  ? 125 GLU A O     1 
ATOM   946   C  CB    . GLU A 1 125 ? 0.830   50.251  53.529  1.00 137.65 ? 125 GLU A CB    1 
ATOM   947   C  CG    . GLU A 1 125 ? 1.195   51.412  54.405  1.00 135.96 ? 125 GLU A CG    1 
ATOM   948   C  CD    . GLU A 1 125 ? 1.445   52.639  53.592  1.00 141.51 ? 125 GLU A CD    1 
ATOM   949   O  OE1   . GLU A 1 125 ? 1.321   52.556  52.349  1.00 152.52 ? 125 GLU A OE1   1 
ATOM   950   O  OE2   . GLU A 1 125 ? 1.743   53.694  54.178  1.00 138.80 ? 125 GLU A OE2   1 
ATOM   951   N  N     . GLY A 1 126 ? 4.112   49.688  54.491  1.00 88.29  ? 126 GLY A N     1 
ATOM   952   C  CA    . GLY A 1 126 ? 4.980   49.992  53.392  1.00 77.64  ? 126 GLY A CA    1 
ATOM   953   C  C     . GLY A 1 126 ? 6.001   48.805  53.478  1.00 127.78 ? 126 GLY A C     1 
ATOM   954   O  O     . GLY A 1 126 ? 7.046   48.910  54.187  1.00 119.89 ? 126 GLY A O     1 
ATOM   955   N  N     . VAL A 1 127 ? 5.723   47.697  52.806  1.00 117.52 ? 127 VAL A N     1 
ATOM   956   C  CA    . VAL A 1 127 ? 6.624   46.551  52.730  1.00 109.49 ? 127 VAL A CA    1 
ATOM   957   C  C     . VAL A 1 127 ? 6.748   46.175  51.273  1.00 118.55 ? 127 VAL A C     1 
ATOM   958   O  O     . VAL A 1 127 ? 5.889   46.538  50.447  1.00 117.19 ? 127 VAL A O     1 
ATOM   959   C  CB    . VAL A 1 127 ? 6.109   45.406  53.573  1.00 92.12  ? 127 VAL A CB    1 
ATOM   960   N  N     . TRP A 1 128 ? 7.745   45.371  50.945  1.00 115.08 ? 128 TRP A N     1 
ATOM   961   C  CA    . TRP A 1 128 ? 7.957   44.995  49.545  1.00 101.53 ? 128 TRP A CA    1 
ATOM   962   C  C     . TRP A 1 128 ? 7.449   43.661  49.061  1.00 103.75 ? 128 TRP A C     1 
ATOM   963   O  O     . TRP A 1 128 ? 7.999   42.612  49.320  1.00 115.05 ? 128 TRP A O     1 
ATOM   964   C  CB    . TRP A 1 128 ? 9.474   45.259  49.229  1.00 119.07 ? 128 TRP A CB    1 
ATOM   965   C  CG    . TRP A 1 128 ? 9.909   44.772  47.871  1.00 126.39 ? 128 TRP A CG    1 
ATOM   966   C  CD1   . TRP A 1 128 ? 10.252  43.492  47.619  1.00 135.54 ? 128 TRP A CD1   1 
ATOM   967   C  CD2   . TRP A 1 128 ? 9.528   45.291  46.582  1.00 126.04 ? 128 TRP A CD2   1 
ATOM   968   N  NE1   . TRP A 1 128 ? 10.449  43.267  46.300  1.00 138.08 ? 128 TRP A NE1   1 
ATOM   969   C  CE2   . TRP A 1 128 ? 9.950   44.341  45.623  1.00 128.19 ? 128 TRP A CE2   1 
ATOM   970   C  CE3   . TRP A 1 128 ? 8.984   46.505  46.134  1.00 123.37 ? 128 TRP A CE3   1 
ATOM   971   C  CZ2   . TRP A 1 128 ? 9.869   44.568  44.276  1.00 127.52 ? 128 TRP A CZ2   1 
ATOM   972   C  CZ3   . TRP A 1 128 ? 8.882   46.709  44.781  1.00 126.61 ? 128 TRP A CZ3   1 
ATOM   973   C  CH2   . TRP A 1 128 ? 9.316   45.739  43.872  1.00 127.94 ? 128 TRP A CH2   1 
ATOM   974   N  N     . VAL A 1 129 ? 6.319   43.735  48.358  1.00 104.76 ? 129 VAL A N     1 
ATOM   975   C  CA    . VAL A 1 129 ? 5.675   42.528  47.857  1.00 93.02  ? 129 VAL A CA    1 
ATOM   976   C  C     . VAL A 1 129 ? 5.893   42.166  46.356  1.00 102.14 ? 129 VAL A C     1 
ATOM   977   O  O     . VAL A 1 129 ? 5.606   42.956  45.450  1.00 107.50 ? 129 VAL A O     1 
ATOM   978   C  CB    . VAL A 1 129 ? 4.166   42.614  48.163  1.00 81.11  ? 129 VAL A CB    1 
ATOM   979   C  CG1   . VAL A 1 129 ? 3.438   41.368  47.650  1.00 83.77  ? 129 VAL A CG1   1 
ATOM   980   C  CG2   . VAL A 1 129 ? 3.984   42.728  49.667  1.00 63.73  ? 129 VAL A CG2   1 
ATOM   981   N  N     . GLU A 1 130 ? 6.296   40.918  46.136  1.00 92.38  ? 130 GLU A N     1 
ATOM   982   C  CA    . GLU A 1 130 ? 6.454   40.306  44.815  1.00 95.67  ? 130 GLU A CA    1 
ATOM   983   C  C     . GLU A 1 130 ? 5.755   38.966  44.754  1.00 96.71  ? 130 GLU A C     1 
ATOM   984   O  O     . GLU A 1 130 ? 6.350   37.945  45.066  1.00 98.72  ? 130 GLU A O     1 
ATOM   985   C  CB    . GLU A 1 130 ? 7.920   40.113  44.413  1.00 111.27 ? 130 GLU A CB    1 
ATOM   986   C  CG    . GLU A 1 130 ? 8.704   41.333  43.989  1.00 120.57 ? 130 GLU A CG    1 
ATOM   987   C  CD    . GLU A 1 130 ? 10.115  40.951  43.516  1.00 125.57 ? 130 GLU A CD    1 
ATOM   988   O  OE1   . GLU A 1 130 ? 10.398  39.748  43.309  1.00 124.19 ? 130 GLU A OE1   1 
ATOM   989   O  OE2   . GLU A 1 130 ? 10.876  41.886  43.211  1.00 136.04 ? 130 GLU A OE2   1 
ATOM   990   N  N     . GLY A 1 131 ? 4.474   38.970  44.393  1.00 102.03 ? 131 GLY A N     1 
ATOM   991   C  CA    . GLY A 1 131 ? 3.712   37.747  44.398  1.00 106.98 ? 131 GLY A CA    1 
ATOM   992   C  C     . GLY A 1 131 ? 3.579   37.321  45.840  1.00 103.68 ? 131 GLY A C     1 
ATOM   993   O  O     . GLY A 1 131 ? 2.991   38.016  46.660  1.00 99.66  ? 131 GLY A O     1 
ATOM   994   N  N     . LEU A 1 132 ? 4.213   36.204  46.155  1.00 107.50 ? 132 LEU A N     1 
ATOM   995   C  CA    . LEU A 1 132 ? 4.195   35.618  47.472  1.00 88.78  ? 132 LEU A CA    1 
ATOM   996   C  C     . LEU A 1 132 ? 5.446   35.971  48.306  1.00 81.96  ? 132 LEU A C     1 
ATOM   997   O  O     . LEU A 1 132 ? 5.665   35.356  49.338  1.00 84.90  ? 132 LEU A O     1 
ATOM   998   C  CB    . LEU A 1 132 ? 4.088   34.115  47.325  1.00 78.79  ? 132 LEU A CB    1 
ATOM   999   C  CG    . LEU A 1 132 ? 2.692   33.689  46.882  1.00 69.59  ? 132 LEU A CG    1 
ATOM   1000  C  CD1   . LEU A 1 132 ? 2.606   32.168  46.606  1.00 72.19  ? 132 LEU A CD1   1 
ATOM   1001  C  CD2   . LEU A 1 132 ? 1.564   34.223  47.746  1.00 60.36  ? 132 LEU A CD2   1 
ATOM   1002  N  N     . ALA A 1 133 ? 6.304   36.873  47.828  1.00 79.01  ? 133 ALA A N     1 
ATOM   1003  C  CA    . ALA A 1 133 ? 7.473   37.291  48.623  1.00 90.55  ? 133 ALA A CA    1 
ATOM   1004  C  C     . ALA A 1 133 ? 7.345   38.680  49.234  1.00 89.70  ? 133 ALA A C     1 
ATOM   1005  O  O     . ALA A 1 133 ? 6.794   39.578  48.624  1.00 100.88 ? 133 ALA A O     1 
ATOM   1006  C  CB    . ALA A 1 133 ? 8.759   37.241  47.751  1.00 91.06  ? 133 ALA A CB    1 
ATOM   1007  N  N     . VAL A 1 134 ? 7.804   38.836  50.470  1.00 82.53  ? 134 VAL A N     1 
ATOM   1008  C  CA    . VAL A 1 134 ? 7.781   40.142  51.127  1.00 88.32  ? 134 VAL A CA    1 
ATOM   1009  C  C     . VAL A 1 134 ? 9.173   40.484  51.631  1.00 92.17  ? 134 VAL A C     1 
ATOM   1010  O  O     . VAL A 1 134 ? 9.899   39.621  52.135  1.00 96.97  ? 134 VAL A O     1 
ATOM   1011  C  CB    . VAL A 1 134 ? 6.788   40.204  52.321  1.00 62.16  ? 134 VAL A CB    1 
ATOM   1012  C  CG1   . VAL A 1 134 ? 5.360   40.144  51.807  1.00 80.16  ? 134 VAL A CG1   1 
ATOM   1013  C  CG2   . VAL A 1 134 ? 7.044   39.091  53.331  1.00 51.70  ? 134 VAL A CG2   1 
ATOM   1014  N  N     . TYR A 1 135 ? 9.559   41.743  51.487  1.00 80.88  ? 135 TYR A N     1 
ATOM   1015  C  CA    . TYR A 1 135 ? 10.822  42.175  52.044  1.00 96.40  ? 135 TYR A CA    1 
ATOM   1016  C  C     . TYR A 1 135 ? 10.612  43.364  52.983  1.00 95.31  ? 135 TYR A C     1 
ATOM   1017  O  O     . TYR A 1 135 ? 9.989   44.384  52.652  1.00 98.34  ? 135 TYR A O     1 
ATOM   1018  C  CB    . TYR A 1 135 ? 11.810  42.473  50.891  1.00 108.18 ? 135 TYR A CB    1 
ATOM   1019  C  CG    . TYR A 1 135 ? 12.013  41.305  49.922  1.00 112.01 ? 135 TYR A CG    1 
ATOM   1020  C  CD1   . TYR A 1 135 ? 12.912  40.283  50.218  1.00 117.12 ? 135 TYR A CD1   1 
ATOM   1021  C  CD2   . TYR A 1 135 ? 11.198  41.133  48.820  1.00 111.13 ? 135 TYR A CD2   1 
ATOM   1022  C  CE1   . TYR A 1 135 ? 13.079  39.203  49.360  1.00 117.84 ? 135 TYR A CE1   1 
ATOM   1023  C  CE2   . TYR A 1 135 ? 11.341  40.070  47.964  1.00 112.44 ? 135 TYR A CE2   1 
ATOM   1024  C  CZ    . TYR A 1 135 ? 12.272  39.103  48.237  1.00 118.09 ? 135 TYR A CZ    1 
ATOM   1025  O  OH    . TYR A 1 135 ? 12.388  38.054  47.366  1.00 121.83 ? 135 TYR A OH    1 
ATOM   1026  N  N     . ARG A 1 136 ? 11.021  43.068  54.216  1.00 92.22  ? 136 ARG A N     1 
ATOM   1027  C  CA    . ARG A 1 136 ? 10.822  43.833  55.435  1.00 76.69  ? 136 ARG A CA    1 
ATOM   1028  C  C     . ARG A 1 136 ? 12.112  44.577  55.830  1.00 94.00  ? 136 ARG A C     1 
ATOM   1029  O  O     . ARG A 1 136 ? 12.875  44.039  56.652  1.00 92.32  ? 136 ARG A O     1 
ATOM   1030  C  CB    . ARG A 1 136 ? 10.333  42.909  56.562  1.00 68.84  ? 136 ARG A CB    1 
ATOM   1031  N  N     . ARG A 1 137 ? 12.391  45.747  55.260  1.00 96.77  ? 137 ARG A N     1 
ATOM   1032  C  CA    . ARG A 1 137 ? 13.621  46.512  55.575  1.00 105.38 ? 137 ARG A CA    1 
ATOM   1033  C  C     . ARG A 1 137 ? 14.904  45.838  55.053  1.00 107.21 ? 137 ARG A C     1 
ATOM   1034  O  O     . ARG A 1 137 ? 14.985  45.484  53.877  1.00 104.84 ? 137 ARG A O     1 
ATOM   1035  C  CB    . ARG A 1 137 ? 13.734  46.779  57.100  1.00 113.32 ? 137 ARG A CB    1 
ATOM   1036  N  N     . GLU A 1 138 ? 15.914  45.679  55.905  1.00 111.91 ? 138 GLU A N     1 
ATOM   1037  C  CA    . GLU A 1 138 ? 17.181  45.103  55.445  1.00 114.83 ? 138 GLU A CA    1 
ATOM   1038  C  C     . GLU A 1 138 ? 17.911  44.325  56.542  1.00 108.84 ? 138 GLU A C     1 
ATOM   1039  O  O     . GLU A 1 138 ? 18.659  43.383  56.261  1.00 97.53  ? 138 GLU A O     1 
ATOM   1040  C  CB    . GLU A 1 138 ? 18.090  46.207  54.880  1.00 115.64 ? 138 GLU A CB    1 
ATOM   1041  N  N     . VAL A 1 147 ? 21.111  45.269  49.951  1.00 93.06  ? 147 VAL A N     1 
ATOM   1042  C  CA    . VAL A 1 147 ? 19.714  45.320  49.530  1.00 106.82 ? 147 VAL A CA    1 
ATOM   1043  C  C     . VAL A 1 147 ? 18.728  45.104  50.687  1.00 127.71 ? 147 VAL A C     1 
ATOM   1044  O  O     . VAL A 1 147 ? 19.083  45.234  51.867  1.00 132.92 ? 147 VAL A O     1 
ATOM   1045  C  CB    . VAL A 1 147 ? 19.459  44.297  48.439  1.00 105.40 ? 147 VAL A CB    1 
ATOM   1046  N  N     . LEU A 1 148 ? 17.498  44.730  50.337  1.00 121.73 ? 148 LEU A N     1 
ATOM   1047  C  CA    . LEU A 1 148 ? 16.456  44.424  51.321  1.00 128.15 ? 148 LEU A CA    1 
ATOM   1048  C  C     . LEU A 1 148 ? 16.478  42.975  51.823  1.00 129.24 ? 148 LEU A C     1 
ATOM   1049  O  O     . LEU A 1 148 ? 17.019  42.096  51.163  1.00 136.77 ? 148 LEU A O     1 
ATOM   1050  C  CB    . LEU A 1 148 ? 15.085  44.757  50.732  1.00 130.05 ? 148 LEU A CB    1 
ATOM   1051  N  N     . GLY A 1 149 ? 15.880  42.742  52.992  1.00 121.52 ? 149 GLY A N     1 
ATOM   1052  C  CA    . GLY A 1 149 ? 15.752  41.398  53.568  1.00 113.58 ? 149 GLY A CA    1 
ATOM   1053  C  C     . GLY A 1 149 ? 14.299  41.045  53.886  1.00 104.06 ? 149 GLY A C     1 
ATOM   1054  O  O     . GLY A 1 149 ? 13.557  41.875  54.389  1.00 104.93 ? 149 GLY A O     1 
ATOM   1055  N  N     . GLY A 1 150 ? 13.896  39.805  53.644  1.00 98.22  ? 150 GLY A N     1 
ATOM   1056  C  CA    . GLY A 1 150 ? 12.518  39.439  53.919  1.00 92.09  ? 150 GLY A CA    1 
ATOM   1057  C  C     . GLY A 1 150 ? 12.249  37.952  53.930  1.00 80.88  ? 150 GLY A C     1 
ATOM   1058  O  O     . GLY A 1 150 ? 13.041  37.204  54.483  1.00 68.39  ? 150 GLY A O     1 
ATOM   1059  N  N     . ALA A 1 151 ? 11.089  37.541  53.421  1.00 74.82  ? 151 ALA A N     1 
ATOM   1060  C  CA    . ALA A 1 151 ? 10.754  36.122  53.322  1.00 76.03  ? 151 ALA A CA    1 
ATOM   1061  C  C     . ALA A 1 151 ? 9.839   35.766  52.139  1.00 85.86  ? 151 ALA A C     1 
ATOM   1062  O  O     . ALA A 1 151 ? 9.041   36.585  51.686  1.00 83.73  ? 151 ALA A O     1 
ATOM   1063  C  CB    . ALA A 1 151 ? 10.120  35.652  54.619  1.00 71.05  ? 151 ALA A CB    1 
ATOM   1064  N  N     . VAL A 1 152 ? 9.962   34.526  51.666  1.00 91.15  ? 152 VAL A N     1 
ATOM   1065  C  CA    . VAL A 1 152 ? 8.992   33.885  50.769  1.00 78.38  ? 152 VAL A CA    1 
ATOM   1066  C  C     . VAL A 1 152 ? 7.968   33.106  51.574  1.00 77.64  ? 152 VAL A C     1 
ATOM   1067  O  O     . VAL A 1 152 ? 8.313   32.392  52.516  1.00 83.86  ? 152 VAL A O     1 
ATOM   1068  C  CB    . VAL A 1 152 ? 9.641   32.953  49.785  1.00 69.94  ? 152 VAL A CB    1 
ATOM   1069  C  CG1   . VAL A 1 152 ? 8.579   32.298  48.933  1.00 66.81  ? 152 VAL A CG1   1 
ATOM   1070  C  CG2   . VAL A 1 152 ? 10.650  33.716  48.954  1.00 77.27  ? 152 VAL A CG2   1 
ATOM   1071  N  N     . LEU A 1 153 ? 6.705   33.250  51.197  1.00 79.71  ? 153 LEU A N     1 
ATOM   1072  C  CA    . LEU A 1 153 ? 5.617   32.691  51.979  1.00 82.21  ? 153 LEU A CA    1 
ATOM   1073  C  C     . LEU A 1 153 ? 4.706   31.800  51.188  1.00 76.98  ? 153 LEU A C     1 
ATOM   1074  O  O     . LEU A 1 153 ? 4.673   31.856  49.965  1.00 75.51  ? 153 LEU A O     1 
ATOM   1075  C  CB    . LEU A 1 153 ? 4.757   33.828  52.556  1.00 76.17  ? 153 LEU A CB    1 
ATOM   1076  C  CG    . LEU A 1 153 ? 5.597   34.965  53.132  1.00 72.73  ? 153 LEU A CG    1 
ATOM   1077  C  CD1   . LEU A 1 153 ? 4.727   36.187  53.458  1.00 76.92  ? 153 LEU A CD1   1 
ATOM   1078  C  CD2   . LEU A 1 153 ? 6.432   34.487  54.323  1.00 60.69  ? 153 LEU A CD2   1 
ATOM   1079  N  N     . ASP A 1 154 ? 4.067   30.881  51.895  1.00 78.99  ? 154 ASP A N     1 
ATOM   1080  C  CA    . ASP A 1 154 ? 2.978   30.125  51.317  1.00 77.58  ? 154 ASP A CA    1 
ATOM   1081  C  C     . ASP A 1 154 ? 1.833   29.856  52.303  1.00 73.70  ? 154 ASP A C     1 
ATOM   1082  O  O     . ASP A 1 154 ? 2.053   29.814  53.517  1.00 81.54  ? 154 ASP A O     1 
ATOM   1083  C  CB    . ASP A 1 154 ? 3.477   28.824  50.728  1.00 81.73  ? 154 ASP A CB    1 
ATOM   1084  C  CG    . ASP A 1 154 ? 2.585   28.346  49.630  1.00 82.84  ? 154 ASP A CG    1 
ATOM   1085  O  OD1   . ASP A 1 154 ? 2.592   29.026  48.589  1.00 91.48  ? 154 ASP A OD1   1 
ATOM   1086  O  OD2   . ASP A 1 154 ? 1.871   27.334  49.799  1.00 78.92  ? 154 ASP A OD2   1 
ATOM   1087  N  N     . LEU A 1 155 ? 0.636   29.627  51.764  1.00 62.70  ? 155 LEU A N     1 
ATOM   1088  C  CA    . LEU A 1 155 ? -0.565  29.284  52.543  1.00 67.48  ? 155 LEU A CA    1 
ATOM   1089  C  C     . LEU A 1 155 ? -1.301  28.160  51.903  1.00 64.43  ? 155 LEU A C     1 
ATOM   1090  O  O     . LEU A 1 155 ? -1.581  28.198  50.711  1.00 66.46  ? 155 LEU A O     1 
ATOM   1091  C  CB    . LEU A 1 155 ? -1.555  30.447  52.695  1.00 67.80  ? 155 LEU A CB    1 
ATOM   1092  C  CG    . LEU A 1 155 ? -2.018  30.710  54.128  1.00 75.37  ? 155 LEU A CG    1 
ATOM   1093  C  CD1   . LEU A 1 155 ? -0.899  30.856  55.165  1.00 78.34  ? 155 LEU A CD1   1 
ATOM   1094  C  CD2   . LEU A 1 155 ? -3.034  31.849  54.159  1.00 74.40  ? 155 LEU A CD2   1 
ATOM   1095  N  N     . TRP A 1 156 ? -1.630  27.153  52.702  1.00 47.57  ? 156 TRP A N     1 
ATOM   1096  C  CA    . TRP A 1 156 ? -2.515  26.115  52.208  1.00 62.61  ? 156 TRP A CA    1 
ATOM   1097  C  C     . TRP A 1 156 ? -3.408  25.589  53.288  1.00 73.91  ? 156 TRP A C     1 
ATOM   1098  O  O     . TRP A 1 156 ? -3.483  26.169  54.366  1.00 83.89  ? 156 TRP A O     1 
ATOM   1099  C  CB    . TRP A 1 156 ? -1.690  25.022  51.514  1.00 72.01  ? 156 TRP A CB    1 
ATOM   1100  C  CG    . TRP A 1 156 ? -0.741  24.236  52.365  1.00 71.00  ? 156 TRP A CG    1 
ATOM   1101  C  CD1   . TRP A 1 156 ? -0.988  23.076  53.023  1.00 76.95  ? 156 TRP A CD1   1 
ATOM   1102  C  CD2   . TRP A 1 156 ? 0.611   24.595  52.670  1.00 73.57  ? 156 TRP A CD2   1 
ATOM   1103  N  NE1   . TRP A 1 156 ? 0.138   22.671  53.700  1.00 81.27  ? 156 TRP A NE1   1 
ATOM   1104  C  CE2   . TRP A 1 156 ? 1.132   23.592  53.500  1.00 76.42  ? 156 TRP A CE2   1 
ATOM   1105  C  CE3   . TRP A 1 156 ? 1.437   25.669  52.306  1.00 72.30  ? 156 TRP A CE3   1 
ATOM   1106  C  CZ2   . TRP A 1 156 ? 2.444   23.620  53.970  1.00 72.61  ? 156 TRP A CZ2   1 
ATOM   1107  C  CZ3   . TRP A 1 156 ? 2.740   25.698  52.779  1.00 67.92  ? 156 TRP A CZ3   1 
ATOM   1108  C  CH2   . TRP A 1 156 ? 3.232   24.680  53.592  1.00 68.76  ? 156 TRP A CH2   1 
ATOM   1109  N  N     . VAL A 1 157 ? -4.130  24.513  52.999  1.00 77.89  ? 157 VAL A N     1 
ATOM   1110  C  CA    . VAL A 1 157 ? -5.048  24.006  53.999  1.00 84.93  ? 157 VAL A CA    1 
ATOM   1111  C  C     . VAL A 1 157 ? -4.647  22.628  54.453  1.00 98.98  ? 157 VAL A C     1 
ATOM   1112  O  O     . VAL A 1 157 ? -4.338  21.787  53.613  1.00 100.96 ? 157 VAL A O     1 
ATOM   1113  C  CB    . VAL A 1 157 ? -6.459  23.904  53.406  1.00 73.05  ? 157 VAL A CB    1 
ATOM   1114  C  CG1   . VAL A 1 157 ? -7.453  23.410  54.441  1.00 60.64  ? 157 VAL A CG1   1 
ATOM   1115  C  CG2   . VAL A 1 157 ? -6.863  25.240  52.893  1.00 84.59  ? 157 VAL A CG2   1 
ATOM   1116  N  N     . SER A 1 158 ? -4.609  22.415  55.780  1.00 97.18  ? 158 SER A N     1 
ATOM   1117  C  CA    . SER A 1 158 ? -4.286  21.062  56.244  1.00 84.89  ? 158 SER A CA    1 
ATOM   1118  C  C     . SER A 1 158 ? -5.533  20.227  56.144  1.00 86.05  ? 158 SER A C     1 
ATOM   1119  O  O     . SER A 1 158 ? -6.632  20.763  56.054  1.00 96.68  ? 158 SER A O     1 
ATOM   1120  C  CB    . SER A 1 158 ? -3.792  21.046  57.678  1.00 77.49  ? 158 SER A CB    1 
ATOM   1121  O  OG    . SER A 1 158 ? -4.825  21.436  58.554  1.00 80.19  ? 158 SER A OG    1 
ATOM   1122  N  N     . ASP A 1 159 ? -5.401  18.918  56.241  1.00 91.09  ? 159 ASP A N     1 
ATOM   1123  C  CA    . ASP A 1 159 ? -6.527  18.045  56.193  1.00 103.78 ? 159 ASP A CA    1 
ATOM   1124  C  C     . ASP A 1 159 ? -7.345  18.171  57.469  1.00 117.08 ? 159 ASP A C     1 
ATOM   1125  O  O     . ASP A 1 159 ? -8.553  17.901  57.488  1.00 125.70 ? 159 ASP A O     1 
ATOM   1126  C  CB    . ASP A 1 159 ? -6.161  16.568  55.874  1.00 118.85 ? 159 ASP A CB    1 
ATOM   1127  C  CG    . ASP A 1 159 ? -7.399  15.718  55.516  1.00 126.76 ? 159 ASP A CG    1 
ATOM   1128  O  OD1   . ASP A 1 159 ? -8.491  16.219  55.768  1.00 136.70 ? 159 ASP A OD1   1 
ATOM   1129  O  OD2   . ASP A 1 159 ? -7.311  14.688  54.799  1.00 129.62 ? 159 ASP A OD2   1 
ATOM   1130  N  N     . SER A 1 160 ? -6.776  18.758  58.495  1.00 108.55 ? 160 SER A N     1 
ATOM   1131  C  CA    . SER A 1 160 ? -7.543  18.907  59.731  1.00 104.19 ? 160 SER A CA    1 
ATOM   1132  C  C     . SER A 1 160 ? -8.242  20.250  59.599  1.00 101.47 ? 160 SER A C     1 
ATOM   1133  O  O     . SER A 1 160 ? -8.964  20.700  60.506  1.00 105.11 ? 160 SER A O     1 
ATOM   1134  C  CB    . SER A 1 160 ? -6.671  18.843  61.009  1.00 100.57 ? 160 SER A CB    1 
ATOM   1135  O  OG    . SER A 1 160 ? -5.934  20.055  61.269  1.00 98.90  ? 160 SER A OG    1 
ATOM   1136  N  N     . GLY A 1 161 ? -8.115  20.807  58.389  1.00 98.60  ? 161 GLY A N     1 
ATOM   1137  C  CA    . GLY A 1 161 ? -8.816  22.024  58.009  1.00 83.57  ? 161 GLY A CA    1 
ATOM   1138  C  C     . GLY A 1 161 ? -8.329  23.266  58.676  1.00 74.83  ? 161 GLY A C     1 
ATOM   1139  O  O     . GLY A 1 161 ? -9.127  24.087  59.128  1.00 78.28  ? 161 GLY A O     1 
ATOM   1140  N  N     . ALA A 1 162 ? -7.015  23.416  58.737  1.00 71.08  ? 162 ALA A N     1 
ATOM   1141  C  CA    . ALA A 1 162 ? -6.431  24.655  59.212  1.00 73.59  ? 162 ALA A CA    1 
ATOM   1142  C  C     . ALA A 1 162 ? -5.402  25.199  58.216  1.00 77.56  ? 162 ALA A C     1 
ATOM   1143  O  O     . ALA A 1 162 ? -4.914  24.489  57.345  1.00 72.51  ? 162 ALA A O     1 
ATOM   1144  C  CB    . ALA A 1 162 ? -5.811  24.450  60.570  1.00 63.43  ? 162 ALA A CB    1 
ATOM   1145  N  N     . PHE A 1 163 ? -5.244  26.513  58.228  1.00 73.31  ? 163 PHE A N     1 
ATOM   1146  C  CA    . PHE A 1 163 ? -4.269  27.151  57.373  1.00 65.52  ? 163 PHE A CA    1 
ATOM   1147  C  C     . PHE A 1 163 ? -2.895  26.679  57.778  1.00 67.16  ? 163 PHE A C     1 
ATOM   1148  O  O     . PHE A 1 163 ? -2.668  26.349  58.925  1.00 71.95  ? 163 PHE A O     1 
ATOM   1149  C  CB    . PHE A 1 163 ? -4.373  28.656  57.486  1.00 68.48  ? 163 PHE A CB    1 
ATOM   1150  C  CG    . PHE A 1 163 ? -5.605  29.200  56.861  1.00 69.35  ? 163 PHE A CG    1 
ATOM   1151  C  CD1   . PHE A 1 163 ? -5.788  29.116  55.489  1.00 71.97  ? 163 PHE A CD1   1 
ATOM   1152  C  CD2   . PHE A 1 163 ? -6.619  29.733  57.647  1.00 56.92  ? 163 PHE A CD2   1 
ATOM   1153  C  CE1   . PHE A 1 163 ? -6.940  29.602  54.913  1.00 72.65  ? 163 PHE A CE1   1 
ATOM   1154  C  CE2   . PHE A 1 163 ? -7.777  30.209  57.082  1.00 50.57  ? 163 PHE A CE2   1 
ATOM   1155  C  CZ    . PHE A 1 163 ? -7.941  30.146  55.713  1.00 59.67  ? 163 PHE A CZ    1 
ATOM   1156  N  N     . LEU A 1 164 ? -2.007  26.588  56.803  1.00 62.32  ? 164 LEU A N     1 
ATOM   1157  C  CA    . LEU A 1 164 ? -0.607  26.265  56.997  1.00 58.02  ? 164 LEU A CA    1 
ATOM   1158  C  C     . LEU A 1 164 ? 0.330   27.210  56.289  1.00 66.11  ? 164 LEU A C     1 
ATOM   1159  O  O     . LEU A 1 164 ? 0.221   27.384  55.059  1.00 75.76  ? 164 LEU A O     1 
ATOM   1160  C  CB    . LEU A 1 164 ? -0.301  24.847  56.575  1.00 72.77  ? 164 LEU A CB    1 
ATOM   1161  C  CG    . LEU A 1 164 ? -0.732  24.016  57.770  1.00 68.71  ? 164 LEU A CG    1 
ATOM   1162  C  CD1   . LEU A 1 164 ? -0.784  22.565  57.375  1.00 87.40  ? 164 LEU A CD1   1 
ATOM   1163  C  CD2   . LEU A 1 164 ? 0.165   24.329  58.954  1.00 55.58  ? 164 LEU A CD2   1 
ATOM   1164  N  N     . LEU A 1 165 ? 1.228   27.826  57.060  1.00 69.57  ? 165 LEU A N     1 
ATOM   1165  C  CA    . LEU A 1 165 ? 2.185   28.826  56.548  1.00 78.69  ? 165 LEU A CA    1 
ATOM   1166  C  C     . LEU A 1 165 ? 3.608   28.329  56.363  1.00 84.25  ? 165 LEU A C     1 
ATOM   1167  O  O     . LEU A 1 165 ? 4.224   27.851  57.322  1.00 90.72  ? 165 LEU A O     1 
ATOM   1168  C  CB    . LEU A 1 165 ? 2.288   29.999  57.530  1.00 73.66  ? 165 LEU A CB    1 
ATOM   1169  C  CG    . LEU A 1 165 ? 2.756   31.406  57.144  1.00 79.20  ? 165 LEU A CG    1 
ATOM   1170  C  CD1   . LEU A 1 165 ? 2.262   31.901  55.807  1.00 86.62  ? 165 LEU A CD1   1 
ATOM   1171  C  CD2   . LEU A 1 165 ? 2.427   32.407  58.267  1.00 80.62  ? 165 LEU A CD2   1 
ATOM   1172  N  N     . GLU A 1 166 ? 4.133   28.425  55.134  1.00 72.72  ? 166 GLU A N     1 
ATOM   1173  C  CA    . GLU A 1 166 ? 5.554   28.128  54.970  1.00 69.12  ? 166 GLU A CA    1 
ATOM   1174  C  C     . GLU A 1 166 ? 6.291   29.453  54.905  1.00 67.10  ? 166 GLU A C     1 
ATOM   1175  O  O     . GLU A 1 166 ? 5.835   30.388  54.245  1.00 64.67  ? 166 GLU A O     1 
ATOM   1176  C  CB    . GLU A 1 166 ? 5.853   27.265  53.762  1.00 78.59  ? 166 GLU A CB    1 
ATOM   1177  C  CG    . GLU A 1 166 ? 7.328   26.867  53.747  1.00 88.15  ? 166 GLU A CG    1 
ATOM   1178  C  CD    . GLU A 1 166 ? 7.729   26.153  52.492  1.00 96.11  ? 166 GLU A CD    1 
ATOM   1179  O  OE1   . GLU A 1 166 ? 8.876   26.341  52.028  1.00 100.06 ? 166 GLU A OE1   1 
ATOM   1180  O  OE2   . GLU A 1 166 ? 6.888   25.385  51.986  1.00 98.22  ? 166 GLU A OE2   1 
ATOM   1181  N  N     . VAL A 1 167 ? 7.402   29.559  55.625  1.00 69.02  ? 167 VAL A N     1 
ATOM   1182  C  CA    . VAL A 1 167 ? 8.110   30.833  55.697  1.00 74.73  ? 167 VAL A CA    1 
ATOM   1183  C  C     . VAL A 1 167 ? 9.564   30.495  55.465  1.00 78.90  ? 167 VAL A C     1 
ATOM   1184  O  O     . VAL A 1 167 ? 10.117  29.643  56.157  1.00 88.34  ? 167 VAL A O     1 
ATOM   1185  C  CB    . VAL A 1 167 ? 7.921   31.531  57.074  1.00 63.17  ? 167 VAL A CB    1 
ATOM   1186  C  CG1   . VAL A 1 167 ? 8.737   32.795  57.145  1.00 56.11  ? 167 VAL A CG1   1 
ATOM   1187  C  CG2   . VAL A 1 167 ? 6.466   31.845  57.321  1.00 63.04  ? 167 VAL A CG2   1 
ATOM   1188  N  N     . ASP A 1 168 ? 10.194  31.177  54.517  1.00 78.05  ? 168 ASP A N     1 
ATOM   1189  C  CA    . ASP A 1 168 ? 11.628  31.026  54.305  1.00 75.55  ? 168 ASP A CA    1 
ATOM   1190  C  C     . ASP A 1 168 ? 12.316  32.334  53.971  1.00 66.23  ? 168 ASP A C     1 
ATOM   1191  O  O     . ASP A 1 168 ? 11.963  32.956  52.979  1.00 71.09  ? 168 ASP A O     1 
ATOM   1192  C  CB    . ASP A 1 168 ? 11.924  30.011  53.196  1.00 84.00  ? 168 ASP A CB    1 
ATOM   1193  C  CG    . ASP A 1 168 ? 13.335  29.407  53.316  1.00 93.43  ? 168 ASP A CG    1 
ATOM   1194  O  OD1   . ASP A 1 168 ? 13.888  29.334  54.449  1.00 94.10  ? 168 ASP A OD1   1 
ATOM   1195  O  OD2   . ASP A 1 168 ? 13.917  29.089  52.256  1.00 95.21  ? 168 ASP A OD2   1 
ATOM   1196  N  N     . PRO A 1 169 ? 13.219  32.814  54.834  1.00 67.51  ? 169 PRO A N     1 
ATOM   1197  C  CA    . PRO A 1 169 ? 13.848  34.103  54.516  1.00 73.59  ? 169 PRO A CA    1 
ATOM   1198  C  C     . PRO A 1 169 ? 14.544  34.094  53.143  1.00 76.53  ? 169 PRO A C     1 
ATOM   1199  O  O     . PRO A 1 169 ? 15.131  33.078  52.750  1.00 68.73  ? 169 PRO A O     1 
ATOM   1200  C  CB    . PRO A 1 169 ? 14.875  34.282  55.630  1.00 72.70  ? 169 PRO A CB    1 
ATOM   1201  C  CG    . PRO A 1 169 ? 14.394  33.405  56.741  1.00 79.47  ? 169 PRO A CG    1 
ATOM   1202  C  CD    . PRO A 1 169 ? 13.734  32.232  56.082  1.00 75.78  ? 169 PRO A CD    1 
ATOM   1203  N  N     . ALA A 1 170 ? 14.454  35.226  52.437  1.00 84.56  ? 170 ALA A N     1 
ATOM   1204  C  CA    . ALA A 1 170 ? 15.018  35.392  51.096  1.00 83.13  ? 170 ALA A CA    1 
ATOM   1205  C  C     . ALA A 1 170 ? 15.427  36.840  50.813  1.00 77.72  ? 170 ALA A C     1 
ATOM   1206  O  O     . ALA A 1 170 ? 15.272  37.718  51.664  1.00 68.76  ? 170 ALA A O     1 
ATOM   1207  C  CB    . ALA A 1 170 ? 14.014  34.928  50.050  1.00 88.40  ? 170 ALA A CB    1 
ATOM   1208  N  N     . LEU A 1 281 ? 22.739  31.640  54.970  1.00 83.93  ? 281 LEU A N     1 
ATOM   1209  C  CA    . LEU A 1 281 ? 22.511  31.851  56.396  1.00 86.31  ? 281 LEU A CA    1 
ATOM   1210  C  C     . LEU A 1 281 ? 22.919  30.655  57.244  1.00 88.48  ? 281 LEU A C     1 
ATOM   1211  O  O     . LEU A 1 281 ? 22.674  29.510  56.863  1.00 96.37  ? 281 LEU A O     1 
ATOM   1212  C  CB    . LEU A 1 281 ? 21.030  32.179  56.664  1.00 87.21  ? 281 LEU A CB    1 
ATOM   1213  C  CG    . LEU A 1 281 ? 20.397  33.453  56.094  1.00 75.77  ? 281 LEU A CG    1 
ATOM   1214  C  CD1   . LEU A 1 281 ? 18.896  33.485  56.358  1.00 77.21  ? 281 LEU A CD1   1 
ATOM   1215  C  CD2   . LEU A 1 281 ? 21.043  34.667  56.721  1.00 66.06  ? 281 LEU A CD2   1 
ATOM   1216  N  N     . PRO A 1 282 ? 23.526  30.911  58.413  1.00 87.75  ? 282 PRO A N     1 
ATOM   1217  C  CA    . PRO A 1 282 ? 23.682  29.751  59.293  1.00 89.85  ? 282 PRO A CA    1 
ATOM   1218  C  C     . PRO A 1 282 ? 22.291  29.222  59.638  1.00 92.53  ? 282 PRO A C     1 
ATOM   1219  O  O     . PRO A 1 282 ? 21.346  30.024  59.687  1.00 98.20  ? 282 PRO A O     1 
ATOM   1220  C  CB    . PRO A 1 282 ? 24.401  30.337  60.523  1.00 89.36  ? 282 PRO A CB    1 
ATOM   1221  C  CG    . PRO A 1 282 ? 25.031  31.609  60.027  1.00 86.15  ? 282 PRO A CG    1 
ATOM   1222  C  CD    . PRO A 1 282 ? 24.145  32.129  58.947  1.00 83.78  ? 282 PRO A CD    1 
ATOM   1223  N  N     . TRP A 1 283 ? 22.162  27.930  59.920  1.00 86.73  ? 283 TRP A N     1 
ATOM   1224  C  CA    . TRP A 1 283 ? 20.830  27.340  60.046  1.00 83.73  ? 283 TRP A CA    1 
ATOM   1225  C  C     . TRP A 1 283 ? 20.032  27.902  61.196  1.00 88.72  ? 283 TRP A C     1 
ATOM   1226  O  O     . TRP A 1 283 ? 18.816  28.114  61.095  1.00 89.56  ? 283 TRP A O     1 
ATOM   1227  C  CB    . TRP A 1 283 ? 20.945  25.811  60.167  1.00 64.88  ? 283 TRP A CB    1 
ATOM   1228  C  CG    . TRP A 1 283 ? 21.516  25.312  61.446  1.00 68.76  ? 283 TRP A CG    1 
ATOM   1229  C  CD1   . TRP A 1 283 ? 22.823  24.983  61.672  1.00 69.37  ? 283 TRP A CD1   1 
ATOM   1230  C  CD2   . TRP A 1 283 ? 20.822  25.054  62.680  1.00 75.86  ? 283 TRP A CD2   1 
ATOM   1231  N  NE1   . TRP A 1 283 ? 22.986  24.531  62.965  1.00 76.87  ? 283 TRP A NE1   1 
ATOM   1232  C  CE2   . TRP A 1 283 ? 21.777  24.576  63.607  1.00 72.27  ? 283 TRP A CE2   1 
ATOM   1233  C  CE3   . TRP A 1 283 ? 19.494  25.179  63.092  1.00 82.06  ? 283 TRP A CE3   1 
ATOM   1234  C  CZ2   . TRP A 1 283 ? 21.444  24.231  64.914  1.00 72.34  ? 283 TRP A CZ2   1 
ATOM   1235  C  CZ3   . TRP A 1 283 ? 19.165  24.832  64.399  1.00 78.75  ? 283 TRP A CZ3   1 
ATOM   1236  C  CH2   . TRP A 1 283 ? 20.135  24.364  65.289  1.00 77.86  ? 283 TRP A CH2   1 
ATOM   1237  N  N     . GLU A 1 284 ? 20.743  28.233  62.255  1.00 87.90  ? 284 GLU A N     1 
ATOM   1238  C  CA    . GLU A 1 284 ? 20.199  28.802  63.479  1.00 88.72  ? 284 GLU A CA    1 
ATOM   1239  C  C     . GLU A 1 284 ? 19.580  30.177  63.195  1.00 91.85  ? 284 GLU A C     1 
ATOM   1240  O  O     . GLU A 1 284 ? 18.450  30.507  63.603  1.00 79.81  ? 284 GLU A O     1 
ATOM   1241  C  CB    . GLU A 1 284 ? 21.281  28.839  64.529  1.00 74.74  ? 284 GLU A CB    1 
ATOM   1242  C  CG    . GLU A 1 284 ? 22.645  28.729  63.959  1.00 93.60  ? 284 GLU A CG    1 
ATOM   1243  C  CD    . GLU A 1 284 ? 23.724  28.290  64.923  1.00 107.87 ? 284 GLU A CD    1 
ATOM   1244  O  OE1   . GLU A 1 284 ? 23.495  28.399  66.179  1.00 119.22 ? 284 GLU A OE1   1 
ATOM   1245  O  OE2   . GLU A 1 284 ? 24.859  28.121  64.492  1.00 100.96 ? 284 GLU A OE2   1 
ATOM   1246  N  N     . GLU A 1 285 ? 20.327  30.969  62.442  1.00 98.08  ? 285 GLU A N     1 
ATOM   1247  C  CA    . GLU A 1 285 ? 19.844  32.269  62.041  1.00 107.21 ? 285 GLU A CA    1 
ATOM   1248  C  C     . GLU A 1 285 ? 18.582  32.251  61.205  1.00 102.94 ? 285 GLU A C     1 
ATOM   1249  O  O     . GLU A 1 285 ? 17.630  33.049  61.403  1.00 98.40  ? 285 GLU A O     1 
ATOM   1250  C  CB    . GLU A 1 285 ? 20.871  32.946  61.147  1.00 120.91 ? 285 GLU A CB    1 
ATOM   1251  C  CG    . GLU A 1 285 ? 20.969  34.404  61.381  1.00 133.41 ? 285 GLU A CG    1 
ATOM   1252  C  CD    . GLU A 1 285 ? 22.326  34.773  61.885  1.00 146.02 ? 285 GLU A CD    1 
ATOM   1253  O  OE1   . GLU A 1 285 ? 23.200  33.893  61.930  1.00 151.83 ? 285 GLU A OE1   1 
ATOM   1254  O  OE2   . GLU A 1 285 ? 22.486  35.883  62.455  1.00 152.89 ? 285 GLU A OE2   1 
ATOM   1255  N  N     . ARG A 1 286 ? 18.618  31.356  60.230  1.00 111.87 ? 286 ARG A N     1 
ATOM   1256  C  CA    . ARG A 1 286 ? 17.518  31.164  59.324  1.00 89.79  ? 286 ARG A CA    1 
ATOM   1257  C  C     . ARG A 1 286 ? 16.303  30.767  60.171  1.00 82.64  ? 286 ARG A C     1 
ATOM   1258  O  O     . ARG A 1 286 ? 15.222  31.312  60.001  1.00 66.33  ? 286 ARG A O     1 
ATOM   1259  C  CB    . ARG A 1 286 ? 17.837  30.125  58.268  1.00 78.57  ? 286 ARG A CB    1 
ATOM   1260  C  CG    . ARG A 1 286 ? 16.677  29.924  57.299  1.00 76.43  ? 286 ARG A CG    1 
ATOM   1261  C  CD    . ARG A 1 286 ? 17.114  29.076  56.128  1.00 73.60  ? 286 ARG A CD    1 
ATOM   1262  N  NE    . ARG A 1 286 ? 18.116  29.730  55.294  1.00 64.60  ? 286 ARG A NE    1 
ATOM   1263  C  CZ    . ARG A 1 286 ? 17.815  30.529  54.270  1.00 74.07  ? 286 ARG A CZ    1 
ATOM   1264  N  NH1   . ARG A 1 286 ? 16.548  30.797  53.961  1.00 79.31  ? 286 ARG A NH1   1 
ATOM   1265  N  NH2   . ARG A 1 286 ? 18.783  31.096  53.579  1.00 70.84  ? 286 ARG A NH2   1 
ATOM   1266  N  N     . ARG A 1 287 ? 16.500  29.855  61.129  1.00 91.39  ? 287 ARG A N     1 
ATOM   1267  C  CA    . ARG A 1 287 ? 15.403  29.406  61.960  1.00 93.72  ? 287 ARG A CA    1 
ATOM   1268  C  C     . ARG A 1 287 ? 14.762  30.523  62.743  1.00 85.74  ? 287 ARG A C     1 
ATOM   1269  O  O     . ARG A 1 287 ? 13.529  30.660  62.781  1.00 85.26  ? 287 ARG A O     1 
ATOM   1270  C  CB    . ARG A 1 287 ? 15.912  28.356  62.984  1.00 53.17  ? 287 ARG A CB    1 
ATOM   1271  C  CG    . ARG A 1 287 ? 14.894  28.061  64.045  1.00 65.14  ? 287 ARG A CG    1 
ATOM   1272  C  CD    . ARG A 1 287 ? 15.226  26.873  64.913  1.00 81.36  ? 287 ARG A CD    1 
ATOM   1273  N  NE    . ARG A 1 287 ? 16.520  26.966  65.582  1.00 99.76  ? 287 ARG A NE    1 
ATOM   1274  C  CZ    . ARG A 1 287 ? 16.893  26.160  66.573  1.00 109.44 ? 287 ARG A CZ    1 
ATOM   1275  N  NH1   . ARG A 1 287 ? 16.058  25.229  67.017  1.00 112.55 ? 287 ARG A NH1   1 
ATOM   1276  N  NH2   . ARG A 1 287 ? 18.087  26.297  67.133  1.00 110.08 ? 287 ARG A NH2   1 
ATOM   1277  N  N     . ARG A 1 288 ? 15.606  31.358  63.327  1.00 84.62  ? 288 ARG A N     1 
ATOM   1278  C  CA    . ARG A 1 288 ? 15.172  32.500  64.116  1.00 85.31  ? 288 ARG A CA    1 
ATOM   1279  C  C     . ARG A 1 288 ? 14.298  33.474  63.327  1.00 83.34  ? 288 ARG A C     1 
ATOM   1280  O  O     . ARG A 1 288 ? 13.172  33.828  63.669  1.00 86.70  ? 288 ARG A O     1 
ATOM   1281  C  CB    . ARG A 1 288 ? 16.405  33.154  64.626  1.00 90.20  ? 288 ARG A CB    1 
ATOM   1282  C  CG    . ARG A 1 288 ? 16.198  33.822  65.923  1.00 102.47 ? 288 ARG A CG    1 
ATOM   1283  C  CD    . ARG A 1 288 ? 17.494  34.400  66.375  1.00 118.81 ? 288 ARG A CD    1 
ATOM   1284  N  NE    . ARG A 1 288 ? 18.580  34.461  65.390  1.00 135.07 ? 288 ARG A NE    1 
ATOM   1285  C  CZ    . ARG A 1 288 ? 19.734  35.118  65.547  1.00 135.07 ? 288 ARG A CZ    1 
ATOM   1286  N  NH1   . ARG A 1 288 ? 19.814  35.959  66.582  1.00 146.54 ? 288 ARG A NH1   1 
ATOM   1287  N  NH2   . ARG A 1 288 ? 20.673  35.095  64.572  1.00 122.68 ? 288 ARG A NH2   1 
ATOM   1288  N  N     . ARG A 1 289 ? 14.914  33.919  62.225  1.00 77.73  ? 289 ARG A N     1 
ATOM   1289  C  CA    . ARG A 1 289 ? 14.287  34.821  61.279  1.00 69.61  ? 289 ARG A CA    1 
ATOM   1290  C  C     . ARG A 1 289 ? 12.964  34.218  60.775  1.00 83.82  ? 289 ARG A C     1 
ATOM   1291  O  O     . ARG A 1 289 ? 11.984  34.939  60.557  1.00 96.79  ? 289 ARG A O     1 
ATOM   1292  C  CB    . ARG A 1 289 ? 15.287  35.181  60.191  1.00 68.65  ? 289 ARG A CB    1 
ATOM   1293  C  CG    . ARG A 1 289 ? 16.039  36.475  60.591  1.00 79.89  ? 289 ARG A CG    1 
ATOM   1294  C  CD    . ARG A 1 289 ? 17.325  36.756  59.825  1.00 86.63  ? 289 ARG A CD    1 
ATOM   1295  N  NE    . ARG A 1 289 ? 17.039  37.408  58.552  1.00 95.02  ? 289 ARG A NE    1 
ATOM   1296  C  CZ    . ARG A 1 289 ? 17.947  37.695  57.622  1.00 99.89  ? 289 ARG A CZ    1 
ATOM   1297  N  NH1   . ARG A 1 289 ? 19.226  37.412  57.829  1.00 102.30 ? 289 ARG A NH1   1 
ATOM   1298  N  NH2   . ARG A 1 289 ? 17.572  38.294  56.490  1.00 96.67  ? 289 ARG A NH2   1 
ATOM   1299  N  N     . THR A 1 290 ? 12.966  32.905  60.555  1.00 79.51  ? 290 THR A N     1 
ATOM   1300  C  CA    . THR A 1 290 ? 11.751  32.209  60.128  1.00 72.75  ? 290 THR A CA    1 
ATOM   1301  C  C     . THR A 1 290 ? 10.614  32.406  61.130  1.00 83.47  ? 290 THR A C     1 
ATOM   1302  O  O     . THR A 1 290 ? 9.501   32.690  60.725  1.00 83.88  ? 290 THR A O     1 
ATOM   1303  C  CB    . THR A 1 290 ? 12.010  30.718  59.936  1.00 58.53  ? 290 THR A CB    1 
ATOM   1304  O  OG1   . THR A 1 290 ? 12.959  30.546  58.883  1.00 59.60  ? 290 THR A OG1   1 
ATOM   1305  C  CG2   . THR A 1 290 ? 10.716  29.978  59.592  1.00 42.67  ? 290 THR A CG2   1 
ATOM   1306  N  N     . ARG A 1 291 ? 10.942  32.259  62.414  1.00 86.64  ? 291 ARG A N     1 
ATOM   1307  C  CA    . ARG A 1 291 ? 9.964   32.410  63.531  1.00 87.42  ? 291 ARG A CA    1 
ATOM   1308  C  C     . ARG A 1 291 ? 9.441   33.828  63.680  1.00 75.87  ? 291 ARG A C     1 
ATOM   1309  O  O     . ARG A 1 291 ? 8.237   34.077  63.811  1.00 73.27  ? 291 ARG A O     1 
ATOM   1310  C  CB    . ARG A 1 291 ? 10.792  32.165  64.770  1.00 94.31  ? 291 ARG A CB    1 
ATOM   1311  C  CG    . ARG A 1 291 ? 10.606  31.488  66.090  1.00 114.08 ? 291 ARG A CG    1 
ATOM   1312  C  CD    . ARG A 1 291 ? 10.932  30.157  66.124  1.00 117.77 ? 291 ARG A CD    1 
ATOM   1313  N  NE    . ARG A 1 291 ? 10.785  29.433  67.388  1.00 127.92 ? 291 ARG A NE    1 
ATOM   1314  C  CZ    . ARG A 1 291 ? 10.597  28.128  67.404  1.00 127.98 ? 291 ARG A CZ    1 
ATOM   1315  N  NH1   . ARG A 1 291 ? 10.279  27.567  66.241  1.00 134.63 ? 291 ARG A NH1   1 
ATOM   1316  N  NH2   . ARG A 1 291 ? 10.498  27.436  68.510  1.00 132.11 ? 291 ARG A NH2   1 
ATOM   1317  N  N     . GLU A 1 292 ? 10.394  34.767  63.588  1.00 67.27  ? 292 GLU A N     1 
ATOM   1318  C  CA    . GLU A 1 292 ? 10.062  36.176  63.666  1.00 80.52  ? 292 GLU A CA    1 
ATOM   1319  C  C     . GLU A 1 292 ? 9.089   36.560  62.591  1.00 91.18  ? 292 GLU A C     1 
ATOM   1320  O  O     . GLU A 1 292 ? 7.998   37.096  62.860  1.00 97.28  ? 292 GLU A O     1 
ATOM   1321  C  CB    . GLU A 1 292 ? 11.347  36.988  63.560  1.00 83.70  ? 292 GLU A CB    1 
ATOM   1322  C  CG    . GLU A 1 292 ? 12.293  36.804  64.726  1.00 87.02  ? 292 GLU A CG    1 
ATOM   1323  C  CD    . GLU A 1 292 ? 13.598  37.548  64.542  1.00 99.74  ? 292 GLU A CD    1 
ATOM   1324  O  OE1   . GLU A 1 292 ? 13.739  38.233  63.517  1.00 103.26 ? 292 GLU A OE1   1 
ATOM   1325  O  OE2   . GLU A 1 292 ? 14.468  37.482  65.441  1.00 112.66 ? 292 GLU A OE2   1 
ATOM   1326  N  N     . ILE A 1 293 ? 9.452   36.217  61.366  1.00 95.79  ? 293 ILE A N     1 
ATOM   1327  C  CA    . ILE A 1 293 ? 8.634   36.541  60.224  1.00 83.42  ? 293 ILE A CA    1 
ATOM   1328  C  C     . ILE A 1 293 ? 7.306   35.797  60.263  1.00 91.61  ? 293 ILE A C     1 
ATOM   1329  O  O     . ILE A 1 293 ? 6.277   36.385  59.940  1.00 98.22  ? 293 ILE A O     1 
ATOM   1330  C  CB    . ILE A 1 293 ? 9.403   36.250  58.921  1.00 66.97  ? 293 ILE A CB    1 
ATOM   1331  C  CG1   . ILE A 1 293 ? 10.546  37.248  58.774  1.00 72.90  ? 293 ILE A CG1   1 
ATOM   1332  C  CG2   . ILE A 1 293 ? 8.499   36.339  57.711  1.00 57.47  ? 293 ILE A CG2   1 
ATOM   1333  C  CD1   . ILE A 1 293 ? 11.479  36.932  57.653  1.00 84.46  ? 293 ILE A CD1   1 
ATOM   1334  N  N     . ALA A 1 294 ? 7.298   34.547  60.705  1.00 86.55  ? 294 ALA A N     1 
ATOM   1335  C  CA    . ALA A 1 294 ? 6.020   33.836  60.870  1.00 87.50  ? 294 ALA A CA    1 
ATOM   1336  C  C     . ALA A 1 294 ? 5.041   34.570  61.791  1.00 93.95  ? 294 ALA A C     1 
ATOM   1337  O  O     . ALA A 1 294 ? 3.864   34.659  61.461  1.00 94.65  ? 294 ALA A O     1 
ATOM   1338  C  CB    . ALA A 1 294 ? 6.242   32.401  61.392  1.00 81.94  ? 294 ALA A CB    1 
ATOM   1339  N  N     . SER A 1 295 ? 5.495   35.031  62.960  1.00 99.97  ? 295 SER A N     1 
ATOM   1340  C  CA    . SER A 1 295 ? 4.548   35.692  63.839  1.00 113.91 ? 295 SER A CA    1 
ATOM   1341  C  C     . SER A 1 295 ? 4.103   37.113  63.343  1.00 113.50 ? 295 SER A C     1 
ATOM   1342  O  O     . SER A 1 295 ? 2.916   37.458  63.300  1.00 119.05 ? 295 SER A O     1 
ATOM   1343  C  CB    . SER A 1 295 ? 5.092   35.889  65.253  1.00 125.81 ? 295 SER A CB    1 
ATOM   1344  O  OG    . SER A 1 295 ? 6.371   35.332  65.420  1.00 131.06 ? 295 SER A OG    1 
ATOM   1345  N  N     . TRP A 1 296 ? 5.116   37.840  62.836  1.00 120.81 ? 296 TRP A N     1 
ATOM   1346  C  CA    . TRP A 1 296 ? 4.908   39.166  62.286  1.00 114.03 ? 296 TRP A CA    1 
ATOM   1347  C  C     . TRP A 1 296 ? 3.835   39.029  61.222  1.00 110.44 ? 296 TRP A C     1 
ATOM   1348  O  O     . TRP A 1 296 ? 2.842   39.775  61.240  1.00 109.64 ? 296 TRP A O     1 
ATOM   1349  C  CB    . TRP A 1 296 ? 6.227   39.700  61.719  1.00 108.14 ? 296 TRP A CB    1 
ATOM   1350  C  CG    . TRP A 1 296 ? 6.299   41.140  61.264  1.00 107.66 ? 296 TRP A CG    1 
ATOM   1351  C  CD1   . TRP A 1 296 ? 6.631   42.227  62.028  1.00 112.47 ? 296 TRP A CD1   1 
ATOM   1352  C  CD2   . TRP A 1 296 ? 6.052   41.647  59.936  1.00 110.82 ? 296 TRP A CD2   1 
ATOM   1353  N  NE1   . TRP A 1 296 ? 6.596   43.378  61.260  1.00 112.71 ? 296 TRP A NE1   1 
ATOM   1354  C  CE2   . TRP A 1 296 ? 6.237   43.045  59.980  1.00 112.72 ? 296 TRP A CE2   1 
ATOM   1355  C  CE3   . TRP A 1 296 ? 5.687   41.054  58.713  1.00 103.46 ? 296 TRP A CE3   1 
ATOM   1356  C  CZ2   . TRP A 1 296 ? 6.091   43.858  58.848  1.00 110.70 ? 296 TRP A CZ2   1 
ATOM   1357  C  CZ3   . TRP A 1 296 ? 5.545   41.856  57.596  1.00 106.14 ? 296 TRP A CZ3   1 
ATOM   1358  C  CH2   . TRP A 1 296 ? 5.754   43.257  57.666  1.00 99.28  ? 296 TRP A CH2   1 
ATOM   1359  N  N     . ILE A 1 297 ? 3.984   38.084  60.290  1.00 106.18 ? 297 ILE A N     1 
ATOM   1360  C  CA    . ILE A 1 297 ? 2.929   37.875  59.338  1.00 108.48 ? 297 ILE A CA    1 
ATOM   1361  C  C     . ILE A 1 297 ? 1.583   37.366  59.859  1.00 111.00 ? 297 ILE A C     1 
ATOM   1362  O  O     . ILE A 1 297 ? 0.514   37.872  59.465  1.00 118.65 ? 297 ILE A O     1 
ATOM   1363  C  CB    . ILE A 1 297 ? 3.374   36.864  58.222  1.00 98.41  ? 297 ILE A CB    1 
ATOM   1364  C  CG1   . ILE A 1 297 ? 3.817   37.635  56.952  1.00 116.49 ? 297 ILE A CG1   1 
ATOM   1365  C  CG2   . ILE A 1 297 ? 2.200   36.288  57.526  1.00 90.53  ? 297 ILE A CG2   1 
ATOM   1366  C  CD1   . ILE A 1 297 ? 5.185   37.923  56.761  1.00 116.95 ? 297 ILE A CD1   1 
ATOM   1367  N  N     . GLY A 1 298 ? 1.592   36.344  60.697  1.00 106.62 ? 298 GLY A N     1 
ATOM   1368  C  CA    . GLY A 1 298 ? 0.335   35.824  61.223  1.00 106.27 ? 298 GLY A CA    1 
ATOM   1369  C  C     . GLY A 1 298 ? -0.636  36.747  61.927  1.00 102.19 ? 298 GLY A C     1 
ATOM   1370  O  O     . GLY A 1 298 ? -1.840  36.622  61.756  1.00 97.54  ? 298 GLY A O     1 
ATOM   1371  N  N     . ARG A 1 299 ? -0.166  37.669  62.745  1.00 99.80  ? 299 ARG A N     1 
ATOM   1372  C  CA    . ARG A 1 299 ? -1.136  38.475  63.400  1.00 107.57 ? 299 ARG A CA    1 
ATOM   1373  C  C     . ARG A 1 299 ? -1.660  39.560  62.410  1.00 112.27 ? 299 ARG A C     1 
ATOM   1374  O  O     . ARG A 1 299 ? -2.815  39.857  62.285  1.00 111.99 ? 299 ARG A O     1 
ATOM   1375  C  CB    . ARG A 1 299 ? -0.722  39.265  64.607  1.00 120.16 ? 299 ARG A CB    1 
ATOM   1376  C  CG    . ARG A 1 299 ? -2.026  39.837  65.162  1.00 128.71 ? 299 ARG A CG    1 
ATOM   1377  C  CD    . ARG A 1 299 ? -1.735  40.477  66.397  1.00 134.92 ? 299 ARG A CD    1 
ATOM   1378  N  NE    . ARG A 1 299 ? -0.877  41.579  65.906  1.00 133.54 ? 299 ARG A NE    1 
ATOM   1379  C  CZ    . ARG A 1 299 ? -0.178  42.390  66.680  1.00 130.59 ? 299 ARG A CZ    1 
ATOM   1380  N  NH1   . ARG A 1 299 ? -0.270  42.244  67.991  1.00 128.04 ? 299 ARG A NH1   1 
ATOM   1381  N  NH2   . ARG A 1 299 ? 0.578   43.346  66.150  1.00 132.02 ? 299 ARG A NH2   1 
ATOM   1382  N  N     . ARG A 1 300 ? -0.708  40.084  61.666  1.00 113.23 ? 300 ARG A N     1 
ATOM   1383  C  CA    . ARG A 1 300 ? -0.930  41.167  60.755  1.00 108.16 ? 300 ARG A CA    1 
ATOM   1384  C  C     . ARG A 1 300 ? -1.964  40.719  59.703  1.00 105.03 ? 300 ARG A C     1 
ATOM   1385  O  O     . ARG A 1 300 ? -2.755  41.551  59.186  1.00 108.52 ? 300 ARG A O     1 
ATOM   1386  C  CB    . ARG A 1 300 ? 0.387   41.665  60.222  1.00 104.78 ? 300 ARG A CB    1 
ATOM   1387  C  CG    . ARG A 1 300 ? 0.163   42.007  59.000  1.00 108.59 ? 300 ARG A CG    1 
ATOM   1388  C  CD    . ARG A 1 300 ? 0.798   43.072  58.346  1.00 125.36 ? 300 ARG A CD    1 
ATOM   1389  N  NE    . ARG A 1 300 ? 0.812   44.553  58.534  1.00 143.93 ? 300 ARG A NE    1 
ATOM   1390  C  CZ    . ARG A 1 300 ? 1.731   45.230  59.113  1.00 141.46 ? 300 ARG A CZ    1 
ATOM   1391  N  NH1   . ARG A 1 300 ? 2.542   44.416  59.463  1.00 140.40 ? 300 ARG A NH1   1 
ATOM   1392  N  NH2   . ARG A 1 300 ? 1.852   46.522  59.334  1.00 136.53 ? 300 ARG A NH2   1 
ATOM   1393  N  N     . LEU A 1 301 ? -1.929  39.444  59.327  1.00 102.26 ? 301 LEU A N     1 
ATOM   1394  C  CA    . LEU A 1 301 ? -2.824  38.963  58.325  1.00 99.57  ? 301 LEU A CA    1 
ATOM   1395  C  C     . LEU A 1 301 ? -4.092  38.429  58.950  1.00 86.07  ? 301 LEU A C     1 
ATOM   1396  O  O     . LEU A 1 301 ? -5.016  38.015  58.257  1.00 82.66  ? 301 LEU A O     1 
ATOM   1397  C  CB    . LEU A 1 301 ? -2.207  37.879  57.484  1.00 102.15 ? 301 LEU A CB    1 
ATOM   1398  C  CG    . LEU A 1 301 ? -1.455  38.615  56.414  1.00 109.77 ? 301 LEU A CG    1 
ATOM   1399  C  CD1   . LEU A 1 301 ? -0.868  37.687  55.345  1.00 123.17 ? 301 LEU A CD1   1 
ATOM   1400  C  CD2   . LEU A 1 301 ? -2.480  39.643  55.798  1.00 132.29 ? 301 LEU A CD2   1 
ATOM   1401  N  N     . GLY A 1 302 ? -4.194  38.572  60.259  1.00 82.98  ? 302 GLY A N     1 
ATOM   1402  C  CA    . GLY A 1 302 ? -5.378  38.130  60.983  1.00 83.69  ? 302 GLY A CA    1 
ATOM   1403  C  C     . GLY A 1 302 ? -5.666  36.645  60.905  1.00 84.23  ? 302 GLY A C     1 
ATOM   1404  O  O     . GLY A 1 302 ? -6.825  36.245  60.858  1.00 79.94  ? 302 GLY A O     1 
ATOM   1405  N  N     . LEU A 1 303 ? -4.618  35.824  60.886  1.00 93.76  ? 303 LEU A N     1 
ATOM   1406  C  CA    . LEU A 1 303 ? -4.734  34.356  60.810  1.00 85.57  ? 303 LEU A CA    1 
ATOM   1407  C  C     . LEU A 1 303 ? -4.501  33.707  62.174  1.00 81.31  ? 303 LEU A C     1 
ATOM   1408  O  O     . LEU A 1 303 ? -4.547  32.497  62.338  1.00 82.53  ? 303 LEU A O     1 
ATOM   1409  C  CB    . LEU A 1 303 ? -3.823  33.784  59.738  1.00 74.03  ? 303 LEU A CB    1 
ATOM   1410  C  CG    . LEU A 1 303 ? -4.297  34.286  58.375  1.00 71.62  ? 303 LEU A CG    1 
ATOM   1411  C  CD1   . LEU A 1 303 ? -3.431  33.759  57.218  1.00 84.90  ? 303 LEU A CD1   1 
ATOM   1412  C  CD2   . LEU A 1 303 ? -5.763  34.019  58.185  1.00 46.53  ? 303 LEU A CD2   1 
ATOM   1413  N  N     . GLY A 1 304 ? -4.163  34.548  63.128  1.00 80.93  ? 304 GLY A N     1 
ATOM   1414  C  CA    . GLY A 1 304 ? -3.981  34.165  64.513  1.00 86.73  ? 304 GLY A CA    1 
ATOM   1415  C  C     . GLY A 1 304 ? -2.523  34.047  64.911  1.00 88.65  ? 304 GLY A C     1 
ATOM   1416  O  O     . GLY A 1 304 ? -1.658  34.629  64.246  1.00 99.43  ? 304 GLY A O     1 
ATOM   1417  N  N     . THR A 1 305 ? -2.221  33.316  65.977  1.00 77.33  ? 305 THR A N     1 
ATOM   1418  C  CA    . THR A 1 305 ? -0.840  33.279  66.374  1.00 76.41  ? 305 THR A CA    1 
ATOM   1419  C  C     . THR A 1 305 ? -0.311  31.955  65.810  1.00 79.65  ? 305 THR A C     1 
ATOM   1420  O  O     . THR A 1 305 ? -0.906  30.911  66.044  1.00 80.39  ? 305 THR A O     1 
ATOM   1421  C  CB    . THR A 1 305 ? -0.734  33.442  67.940  1.00 87.55  ? 305 THR A CB    1 
ATOM   1422  O  OG1   . THR A 1 305 ? 0.636   33.486  68.362  1.00 83.76  ? 305 THR A OG1   1 
ATOM   1423  C  CG2   . THR A 1 305 ? -1.495  32.346  68.689  1.00 91.33  ? 305 THR A CG2   1 
ATOM   1424  N  N     . PRO A 1 306 ? 0.830   32.005  65.091  1.00 86.16  ? 306 PRO A N     1 
ATOM   1425  C  CA    . PRO A 1 306 ? 1.437   30.862  64.400  1.00 85.15  ? 306 PRO A CA    1 
ATOM   1426  C  C     . PRO A 1 306 ? 2.100   29.903  65.354  1.00 85.23  ? 306 PRO A C     1 
ATOM   1427  O  O     . PRO A 1 306 ? 2.899   30.361  66.173  1.00 92.27  ? 306 PRO A O     1 
ATOM   1428  C  CB    . PRO A 1 306 ? 2.513   31.532  63.523  1.00 88.36  ? 306 PRO A CB    1 
ATOM   1429  C  CG    . PRO A 1 306 ? 2.813   32.753  64.222  1.00 91.82  ? 306 PRO A CG    1 
ATOM   1430  C  CD    . PRO A 1 306 ? 1.560   33.244  64.814  1.00 92.83  ? 306 PRO A CD    1 
ATOM   1431  N  N     . GLU A 1 307 ? 1.804   28.613  65.311  1.00 80.66  ? 307 GLU A N     1 
ATOM   1432  C  CA    . GLU A 1 307 ? 2.546   27.747  66.195  1.00 85.69  ? 307 GLU A CA    1 
ATOM   1433  C  C     . GLU A 1 307 ? 3.301   26.687  65.324  1.00 80.31  ? 307 GLU A C     1 
ATOM   1434  O  O     . GLU A 1 307 ? 2.661   25.926  64.573  1.00 80.33  ? 307 GLU A O     1 
ATOM   1435  C  CB    . GLU A 1 307 ? 1.664   27.212  67.282  1.00 94.71  ? 307 GLU A CB    1 
ATOM   1436  C  CG    . GLU A 1 307 ? 1.696   25.759  67.610  1.00 110.22 ? 307 GLU A CG    1 
ATOM   1437  C  CD    . GLU A 1 307 ? 0.991   25.576  68.948  1.00 129.35 ? 307 GLU A CD    1 
ATOM   1438  O  OE1   . GLU A 1 307 ? 0.178   26.413  69.219  1.00 133.42 ? 307 GLU A OE1   1 
ATOM   1439  O  OE2   . GLU A 1 307 ? 1.272   24.712  69.796  1.00 140.92 ? 307 GLU A OE2   1 
ATOM   1440  N  N     . ALA A 1 308 ? 4.626   26.594  65.452  1.00 79.92  ? 308 ALA A N     1 
ATOM   1441  C  CA    . ALA A 1 308 ? 5.449   25.797  64.551  1.00 76.57  ? 308 ALA A CA    1 
ATOM   1442  C  C     . ALA A 1 308 ? 5.200   24.306  64.699  1.00 77.30  ? 308 ALA A C     1 
ATOM   1443  O  O     . ALA A 1 308 ? 5.003   23.783  65.782  1.00 86.95  ? 308 ALA A O     1 
ATOM   1444  C  CB    . ALA A 1 308 ? 6.922   26.078  64.790  1.00 75.24  ? 308 ALA A CB    1 
ATOM   1445  N  N     . VAL A 1 309 ? 5.135   23.641  63.556  1.00 67.34  ? 309 VAL A N     1 
ATOM   1446  C  CA    . VAL A 1 309 ? 4.918   22.212  63.510  1.00 75.30  ? 309 VAL A CA    1 
ATOM   1447  C  C     . VAL A 1 309 ? 6.123   21.340  63.716  1.00 77.46  ? 309 VAL A C     1 
ATOM   1448  O  O     . VAL A 1 309 ? 7.214   21.555  63.226  1.00 67.37  ? 309 VAL A O     1 
ATOM   1449  C  CB    . VAL A 1 309 ? 4.178   21.727  62.196  1.00 96.25  ? 309 VAL A CB    1 
ATOM   1450  C  CG1   . VAL A 1 309 ? 3.074   22.191  61.930  1.00 96.05  ? 309 VAL A CG1   1 
ATOM   1451  C  CG2   . VAL A 1 309 ? 4.881   21.830  61.111  1.00 84.80  ? 309 VAL A CG2   1 
ATOM   1452  N  N     . ARG A 1 310 ? 5.855   20.352  64.563  1.00 78.31  ? 310 ARG A N     1 
ATOM   1453  C  CA    . ARG A 1 310 ? 6.817   19.347  64.935  1.00 73.99  ? 310 ARG A CA    1 
ATOM   1454  C  C     . ARG A 1 310 ? 6.468   18.086  64.221  1.00 74.60  ? 310 ARG A C     1 
ATOM   1455  O  O     . ARG A 1 310 ? 5.307   17.830  63.891  1.00 87.44  ? 310 ARG A O     1 
ATOM   1456  C  CB    . ARG A 1 310 ? 6.784   19.102  66.431  1.00 77.72  ? 310 ARG A CB    1 
ATOM   1457  C  CG    . ARG A 1 310 ? 7.124   20.290  67.273  1.00 80.94  ? 310 ARG A CG    1 
ATOM   1458  C  CD    . ARG A 1 310 ? 6.648   20.077  68.679  1.00 97.48  ? 310 ARG A CD    1 
ATOM   1459  N  NE    . ARG A 1 310 ? 7.082   21.158  69.553  1.00 108.80 ? 310 ARG A NE    1 
ATOM   1460  C  CZ    . ARG A 1 310 ? 8.100   21.055  70.397  1.00 108.20 ? 310 ARG A CZ    1 
ATOM   1461  N  NH1   . ARG A 1 310 ? 8.774   19.912  70.477  1.00 92.39  ? 310 ARG A NH1   1 
ATOM   1462  N  NH2   . ARG A 1 310 ? 8.437   22.089  71.161  1.00 117.72 ? 310 ARG A NH2   1 
ATOM   1463  N  N     . ALA A 1 311 ? 7.515   17.353  63.885  1.00 71.57  ? 311 ALA A N     1 
ATOM   1464  C  CA    . ALA A 1 311 ? 7.411   16.046  63.244  1.00 65.18  ? 311 ALA A CA    1 
ATOM   1465  C  C     . ALA A 1 311 ? 8.397   15.104  63.893  1.00 61.04  ? 311 ALA A C     1 
ATOM   1466  O  O     . ALA A 1 311 ? 9.422   15.542  64.413  1.00 62.39  ? 311 ALA A O     1 
ATOM   1467  C  CB    . ALA A 1 311 ? 7.678   16.164  61.773  1.00 70.32  ? 311 ALA A CB    1 
ATOM   1468  N  N     . GLN A 1 312 ? 8.000   13.857  63.972  1.00 59.52  ? 312 GLN A N     1 
ATOM   1469  C  CA    . GLN A 1 312 ? 8.863   12.809  64.479  1.00 74.70  ? 312 GLN A CA    1 
ATOM   1470  C  C     . GLN A 1 312 ? 9.941   12.508  63.427  1.00 69.20  ? 312 GLN A C     1 
ATOM   1471  O  O     . GLN A 1 312 ? 9.650   12.358  62.243  1.00 66.21  ? 312 GLN A O     1 
ATOM   1472  C  CB    . GLN A 1 312 ? 7.939   11.691  64.821  1.00 85.09  ? 312 GLN A CB    1 
ATOM   1473  C  CG    . GLN A 1 312 ? 8.255   10.663  65.772  1.00 101.84 ? 312 GLN A CG    1 
ATOM   1474  C  CD    . GLN A 1 312 ? 7.346   10.877  66.923  1.00 109.93 ? 312 GLN A CD    1 
ATOM   1475  O  OE1   . GLN A 1 312 ? 7.461   10.309  67.893  1.00 126.79 ? 312 GLN A OE1   1 
ATOM   1476  N  NE2   . GLN A 1 312 ? 6.805   12.085  66.960  1.00 110.30 ? 312 GLN A NE2   1 
ATOM   1477  N  N     . ALA A 1 313 ? 11.185  12.494  63.880  1.00 73.04  ? 313 ALA A N     1 
ATOM   1478  C  CA    . ALA A 1 313 ? 12.278  12.300  62.959  1.00 57.86  ? 313 ALA A CA    1 
ATOM   1479  C  C     . ALA A 1 313 ? 13.099  11.153  63.475  1.00 53.78  ? 313 ALA A C     1 
ATOM   1480  O  O     . ALA A 1 313 ? 13.101  10.883  64.684  1.00 56.71  ? 313 ALA A O     1 
ATOM   1481  C  CB    . ALA A 1 313 ? 13.105  13.559  62.854  1.00 48.45  ? 313 ALA A CB    1 
ATOM   1482  N  N     . TYR A 1 314 ? 13.748  10.427  62.574  1.00 48.32  ? 314 TYR A N     1 
ATOM   1483  C  CA    . TYR A 1 314 ? 14.561  9.282   62.935  1.00 56.48  ? 314 TYR A CA    1 
ATOM   1484  C  C     . TYR A 1 314 ? 15.963  9.470   62.466  1.00 61.99  ? 314 TYR A C     1 
ATOM   1485  O  O     . TYR A 1 314 ? 16.185  10.006  61.404  1.00 52.02  ? 314 TYR A O     1 
ATOM   1486  C  CB    . TYR A 1 314 ? 13.979  7.974   62.456  1.00 45.28  ? 314 TYR A CB    1 
ATOM   1487  C  CG    . TYR A 1 314 ? 12.578  7.814   62.929  1.00 67.36  ? 314 TYR A CG    1 
ATOM   1488  C  CD1   . TYR A 1 314 ? 11.527  8.481   62.297  1.00 60.16  ? 314 TYR A CD1   1 
ATOM   1489  C  CD2   . TYR A 1 314 ? 12.304  7.102   64.105  1.00 82.02  ? 314 TYR A CD2   1 
ATOM   1490  C  CE1   . TYR A 1 314 ? 10.227  8.358   62.760  1.00 65.70  ? 314 TYR A CE1   1 
ATOM   1491  C  CE2   . TYR A 1 314 ? 11.001  6.990   64.590  1.00 72.78  ? 314 TYR A CE2   1 
ATOM   1492  C  CZ    . TYR A 1 314 ? 9.970   7.614   63.908  1.00 68.02  ? 314 TYR A CZ    1 
ATOM   1493  O  OH    . TYR A 1 314 ? 8.681   7.499   64.359  1.00 71.71  ? 314 TYR A OH    1 
ATOM   1494  N  N     . ARG A 1 315 ? 16.894  9.056   63.316  1.00 55.05  ? 315 ARG A N     1 
ATOM   1495  C  CA    . ARG A 1 315 ? 18.307  9.150   63.023  1.00 52.81  ? 315 ARG A CA    1 
ATOM   1496  C  C     . ARG A 1 315 ? 18.832  7.907   62.404  1.00 44.82  ? 315 ARG A C     1 
ATOM   1497  O  O     . ARG A 1 315 ? 18.833  6.853   63.034  1.00 71.19  ? 315 ARG A O     1 
ATOM   1498  C  CB    . ARG A 1 315 ? 19.010  9.405   64.320  1.00 72.42  ? 315 ARG A CB    1 
ATOM   1499  C  CG    . ARG A 1 315 ? 18.597  10.723  64.885  1.00 81.37  ? 315 ARG A CG    1 
ATOM   1500  C  CD    . ARG A 1 315 ? 19.300  10.898  66.117  1.00 91.56  ? 315 ARG A CD    1 
ATOM   1501  N  NE    . ARG A 1 315 ? 20.031  12.148  66.157  1.00 100.69 ? 315 ARG A NE    1 
ATOM   1502  C  CZ    . ARG A 1 315 ? 20.182  12.879  67.246  1.00 111.56 ? 315 ARG A CZ    1 
ATOM   1503  N  NH1   . ARG A 1 315 ? 19.657  12.467  68.407  1.00 114.00 ? 315 ARG A NH1   1 
ATOM   1504  N  NH2   . ARG A 1 315 ? 20.882  14.003  67.163  1.00 118.16 ? 315 ARG A NH2   1 
ATOM   1505  N  N     . LEU A 1 316 ? 19.255  8.023   61.145  1.00 40.27  ? 316 LEU A N     1 
ATOM   1506  C  CA    . LEU A 1 316 ? 19.742  6.857   60.402  1.00 53.91  ? 316 LEU A CA    1 
ATOM   1507  C  C     . LEU A 1 316 ? 21.158  6.426   60.826  1.00 46.91  ? 316 LEU A C     1 
ATOM   1508  O  O     . LEU A 1 316 ? 21.937  7.220   61.325  1.00 46.81  ? 316 LEU A O     1 
ATOM   1509  C  CB    . LEU A 1 316 ? 19.647  7.109   58.900  1.00 46.00  ? 316 LEU A CB    1 
ATOM   1510  C  CG    . LEU A 1 316 ? 18.243  7.499   58.443  1.00 59.41  ? 316 LEU A CG    1 
ATOM   1511  C  CD1   . LEU A 1 316 ? 18.218  8.101   57.046  1.00 55.43  ? 316 LEU A CD1   1 
ATOM   1512  C  CD2   . LEU A 1 316 ? 17.340  6.257   58.509  1.00 66.22  ? 316 LEU A CD2   1 
ATOM   1513  N  N     . SER A 1 317 ? 21.451  5.140   60.693  1.00 47.82  ? 317 SER A N     1 
ATOM   1514  C  CA    . SER A 1 317 ? 22.792  4.648   61.042  1.00 55.19  ? 317 SER A CA    1 
ATOM   1515  C  C     . SER A 1 317 ? 23.791  5.355   60.137  1.00 60.08  ? 317 SER A C     1 
ATOM   1516  O  O     . SER A 1 317 ? 23.455  5.712   59.015  1.00 58.20  ? 317 SER A O     1 
ATOM   1517  C  CB    . SER A 1 317 ? 22.931  3.111   60.918  1.00 46.43  ? 317 SER A CB    1 
ATOM   1518  O  OG    . SER A 1 317 ? 22.896  2.691   59.573  1.00 56.49  ? 317 SER A OG    1 
ATOM   1519  N  N     . ILE A 1 318 ? 25.027  5.492   60.612  1.00 77.57  ? 318 ILE A N     1 
ATOM   1520  C  CA    . ILE A 1 318 ? 26.096  6.168   59.873  1.00 71.94  ? 318 ILE A CA    1 
ATOM   1521  C  C     . ILE A 1 318 ? 26.621  5.113   58.887  1.00 58.92  ? 318 ILE A C     1 
ATOM   1522  O  O     . ILE A 1 318 ? 26.963  3.986   59.289  1.00 45.08  ? 318 ILE A O     1 
ATOM   1523  C  CB    . ILE A 1 318 ? 27.275  6.625   60.807  1.00 52.02  ? 318 ILE A CB    1 
ATOM   1524  C  CG1   . ILE A 1 318 ? 26.931  7.798   61.710  1.00 71.67  ? 318 ILE A CG1   1 
ATOM   1525  C  CG2   . ILE A 1 318 ? 28.531  6.856   60.049  1.00 53.15  ? 318 ILE A CG2   1 
ATOM   1526  C  CD1   . ILE A 1 318 ? 26.051  7.423   62.839  1.00 82.32  ? 318 ILE A CD1   1 
ATOM   1527  N  N     . PRO A 1 319 ? 26.706  5.473   57.595  1.00 54.53  ? 319 PRO A N     1 
ATOM   1528  C  CA    . PRO A 1 319 ? 27.133  4.467   56.606  1.00 46.16  ? 319 PRO A CA    1 
ATOM   1529  C  C     . PRO A 1 319 ? 28.589  4.117   56.766  1.00 45.54  ? 319 PRO A C     1 
ATOM   1530  O  O     . PRO A 1 319 ? 29.338  5.007   57.099  1.00 38.68  ? 319 PRO A O     1 
ATOM   1531  C  CB    . PRO A 1 319 ? 26.932  5.174   55.261  1.00 58.36  ? 319 PRO A CB    1 
ATOM   1532  C  CG    . PRO A 1 319 ? 26.884  6.634   55.574  1.00 59.97  ? 319 PRO A CG    1 
ATOM   1533  C  CD    . PRO A 1 319 ? 26.336  6.762   56.990  1.00 61.52  ? 319 PRO A CD    1 
ATOM   1534  N  N     . LYS A 1 320 ? 29.003  2.890   56.468  1.00 47.99  ? 320 LYS A N     1 
ATOM   1535  C  CA    . LYS A 1 320 ? 30.404  2.521   56.606  1.00 48.26  ? 320 LYS A CA    1 
ATOM   1536  C  C     . LYS A 1 320 ? 31.163  2.455   55.302  1.00 48.80  ? 320 LYS A C     1 
ATOM   1537  O  O     . LYS A 1 320 ? 31.090  1.416   54.621  1.00 66.18  ? 320 LYS A O     1 
ATOM   1538  C  CB    . LYS A 1 320 ? 30.517  1.188   57.330  1.00 60.28  ? 320 LYS A CB    1 
ATOM   1539  N  N     . LEU A 1 321 ? 31.898  3.515   54.949  1.00 45.37  ? 321 LEU A N     1 
ATOM   1540  C  CA    . LEU A 1 321 ? 32.676  3.540   53.682  1.00 43.35  ? 321 LEU A CA    1 
ATOM   1541  C  C     . LEU A 1 321 ? 33.986  2.736   53.692  1.00 48.46  ? 321 LEU A C     1 
ATOM   1542  O  O     . LEU A 1 321 ? 34.760  2.825   54.632  1.00 60.73  ? 321 LEU A O     1 
ATOM   1543  C  CB    . LEU A 1 321 ? 33.089  4.949   53.282  1.00 43.01  ? 321 LEU A CB    1 
ATOM   1544  C  CG    . LEU A 1 321 ? 32.376  5.641   52.147  1.00 60.54  ? 321 LEU A CG    1 
ATOM   1545  C  CD1   . LEU A 1 321 ? 33.113  6.990   51.821  1.00 44.19  ? 321 LEU A CD1   1 
ATOM   1546  C  CD2   . LEU A 1 321 ? 32.308  4.691   50.977  1.00 65.91  ? 321 LEU A CD2   1 
ATOM   1547  N  N     . MET A 1 322 ? 34.258  2.024   52.607  1.00 47.46  ? 322 MET A N     1 
ATOM   1548  C  CA    . MET A 1 322 ? 35.469  1.220   52.513  1.00 56.70  ? 322 MET A CA    1 
ATOM   1549  C  C     . MET A 1 322 ? 36.314  1.592   51.299  1.00 58.33  ? 322 MET A C     1 
ATOM   1550  O  O     . MET A 1 322 ? 35.820  1.653   50.164  1.00 60.60  ? 322 MET A O     1 
ATOM   1551  C  CB    . MET A 1 322 ? 35.145  -0.277  52.424  1.00 62.46  ? 322 MET A CB    1 
ATOM   1552  C  CG    . MET A 1 322 ? 34.628  -0.881  53.703  1.00 68.84  ? 322 MET A CG    1 
ATOM   1553  S  SD    . MET A 1 322 ? 34.173  -2.601  53.446  1.00 170.83 ? 322 MET A SD    1 
ATOM   1554  C  CE    . MET A 1 322 ? 35.611  -3.158  52.530  1.00 132.88 ? 322 MET A CE    1 
ATOM   1555  N  N     . GLY A 1 323 ? 37.607  1.767   51.536  1.00 61.56  ? 323 GLY A N     1 
ATOM   1556  C  CA    . GLY A 1 323 ? 38.572  1.738   50.461  1.00 59.97  ? 323 GLY A CA    1 
ATOM   1557  C  C     . GLY A 1 323 ? 39.146  0.343   50.587  1.00 55.42  ? 323 GLY A C     1 
ATOM   1558  O  O     . GLY A 1 323 ? 38.364  -0.610  50.724  1.00 55.63  ? 323 GLY A O     1 
ATOM   1559  N  N     . ARG A 1 324 ? 40.465  0.180   50.509  1.00 51.06  ? 324 ARG A N     1 
ATOM   1560  C  CA    . ARG A 1 324 ? 41.086  -1.108  50.836  1.00 69.86  ? 324 ARG A CA    1 
ATOM   1561  C  C     . ARG A 1 324 ? 40.728  -1.401  52.276  1.00 77.12  ? 324 ARG A C     1 
ATOM   1562  O  O     . ARG A 1 324 ? 40.527  -2.567  52.656  1.00 78.47  ? 324 ARG A O     1 
ATOM   1563  C  CB    . ARG A 1 324 ? 42.588  -1.098  50.655  1.00 81.43  ? 324 ARG A CB    1 
ATOM   1564  C  CG    . ARG A 1 324 ? 43.252  -2.291  51.275  1.00 86.22  ? 324 ARG A CG    1 
ATOM   1565  C  CD    . ARG A 1 324 ? 44.488  -2.546  50.533  1.00 90.58  ? 324 ARG A CD    1 
ATOM   1566  N  NE    . ARG A 1 324 ? 45.177  -3.772  50.897  1.00 96.88  ? 324 ARG A NE    1 
ATOM   1567  C  CZ    . ARG A 1 324 ? 45.448  -4.696  49.992  1.00 96.81  ? 324 ARG A CZ    1 
ATOM   1568  N  NH1   . ARG A 1 324 ? 46.087  -5.803  50.313  1.00 104.86 ? 324 ARG A NH1   1 
ATOM   1569  N  NH2   . ARG A 1 324 ? 45.071  -4.485  48.742  1.00 95.26  ? 324 ARG A NH2   1 
ATOM   1570  N  N     . ARG A 1 325 ? 40.660  -0.336  53.074  1.00 72.32  ? 325 ARG A N     1 
ATOM   1571  C  CA    . ARG A 1 325 ? 40.063  -0.472  54.377  1.00 66.42  ? 325 ARG A CA    1 
ATOM   1572  C  C     . ARG A 1 325 ? 39.159  0.730   54.625  1.00 56.20  ? 325 ARG A C     1 
ATOM   1573  O  O     . ARG A 1 325 ? 38.975  1.571   53.753  1.00 68.19  ? 325 ARG A O     1 
ATOM   1574  C  CB    . ARG A 1 325 ? 41.074  -0.457  55.539  1.00 78.84  ? 325 ARG A CB    1 
ATOM   1575  C  CG    . ARG A 1 325 ? 42.023  0.758   55.669  1.00 98.12  ? 325 ARG A CG    1 
ATOM   1576  C  CD    . ARG A 1 325 ? 43.219  0.469   56.611  1.00 122.58 ? 325 ARG A CD    1 
ATOM   1577  N  NE    . ARG A 1 325 ? 44.024  1.664   56.870  1.00 121.74 ? 325 ARG A NE    1 
ATOM   1578  C  CZ    . ARG A 1 325 ? 43.789  2.528   57.862  1.00 119.68 ? 325 ARG A CZ    1 
ATOM   1579  N  NH1   . ARG A 1 325 ? 42.688  2.412   58.603  1.00 123.82 ? 325 ARG A NH1   1 
ATOM   1580  N  NH2   . ARG A 1 325 ? 44.569  3.582   58.027  1.00 114.48 ? 325 ARG A NH2   1 
ATOM   1581  N  N     . ALA A 1 326 ? 38.618  0.810   55.834  1.00 57.76  ? 326 ALA A N     1 
ATOM   1582  C  CA    . ALA A 1 326 ? 37.657  1.830   56.217  1.00 46.34  ? 326 ALA A CA    1 
ATOM   1583  C  C     . ALA A 1 326 ? 38.216  3.204   55.947  1.00 36.86  ? 326 ALA A C     1 
ATOM   1584  O  O     . ALA A 1 326 ? 39.383  3.461   56.196  1.00 68.23  ? 326 ALA A O     1 
ATOM   1585  C  CB    . ALA A 1 326 ? 37.219  1.686   57.651  1.00 54.55  ? 326 ALA A CB    1 
ATOM   1586  N  N     . VAL A 1 327 ? 37.367  4.093   55.478  1.00 41.61  ? 327 VAL A N     1 
ATOM   1587  C  CA    . VAL A 1 327 ? 37.676  5.506   55.247  1.00 42.83  ? 327 VAL A CA    1 
ATOM   1588  C  C     . VAL A 1 327 ? 36.497  6.347   55.754  1.00 46.82  ? 327 VAL A C     1 
ATOM   1589  O  O     . VAL A 1 327 ? 35.366  5.853   55.903  1.00 50.62  ? 327 VAL A O     1 
ATOM   1590  C  CB    . VAL A 1 327 ? 37.973  5.789   53.768  1.00 42.35  ? 327 VAL A CB    1 
ATOM   1591  C  CG1   . VAL A 1 327 ? 39.122  4.934   53.244  1.00 41.07  ? 327 VAL A CG1   1 
ATOM   1592  C  CG2   . VAL A 1 327 ? 36.716  5.590   52.948  1.00 50.48  ? 327 VAL A CG2   1 
ATOM   1593  N  N     . SER A 1 328 ? 36.745  7.628   55.989  1.00 40.08  ? 328 SER A N     1 
ATOM   1594  C  CA    . SER A 1 328 ? 35.678  8.560   56.352  1.00 53.21  ? 328 SER A CA    1 
ATOM   1595  C  C     . SER A 1 328 ? 35.272  9.387   55.180  1.00 62.43  ? 328 SER A C     1 
ATOM   1596  O  O     . SER A 1 328 ? 34.198  9.994   55.162  1.00 64.55  ? 328 SER A O     1 
ATOM   1597  C  CB    . SER A 1 328 ? 36.127  9.470   57.505  1.00 73.11  ? 328 SER A CB    1 
ATOM   1598  O  OG    . SER A 1 328 ? 37.435  9.963   57.301  1.00 67.87  ? 328 SER A OG    1 
ATOM   1599  N  N     . LYS A 1 329 ? 36.186  9.450   54.227  1.00 65.47  ? 329 LYS A N     1 
ATOM   1600  C  CA    . LYS A 1 329 ? 36.007  10.174  52.989  1.00 53.28  ? 329 LYS A CA    1 
ATOM   1601  C  C     . LYS A 1 329 ? 36.688  9.432   51.869  1.00 47.89  ? 329 LYS A C     1 
ATOM   1602  O  O     . LYS A 1 329 ? 37.605  8.663   52.122  1.00 52.81  ? 329 LYS A O     1 
ATOM   1603  C  CB    . LYS A 1 329 ? 36.486  11.609  53.233  1.00 48.95  ? 329 LYS A CB    1 
ATOM   1604  C  CG    . LYS A 1 329 ? 37.869  11.741  53.835  1.00 47.54  ? 329 LYS A CG    1 
ATOM   1605  C  CD    . LYS A 1 329 ? 38.171  13.225  54.081  1.00 49.67  ? 329 LYS A CD    1 
ATOM   1606  C  CE    . LYS A 1 329 ? 39.632  13.549  54.508  1.00 57.14  ? 329 LYS A CE    1 
ATOM   1607  N  NZ    . LYS A 1 329 ? 40.777  12.716  54.050  1.00 50.94  ? 329 LYS A NZ    1 
ATOM   1608  N  N     . PRO A 1 330 ? 36.246  9.669   50.623  1.00 51.22  ? 330 PRO A N     1 
ATOM   1609  C  CA    . PRO A 1 330 ? 36.814  8.944   49.479  1.00 60.00  ? 330 PRO A CA    1 
ATOM   1610  C  C     . PRO A 1 330 ? 38.282  9.237   49.195  1.00 60.15  ? 330 PRO A C     1 
ATOM   1611  O  O     . PRO A 1 330 ? 39.030  8.326   48.801  1.00 54.47  ? 330 PRO A O     1 
ATOM   1612  C  CB    . PRO A 1 330 ? 35.939  9.443   48.299  1.00 36.97  ? 330 PRO A CB    1 
ATOM   1613  C  CG    . PRO A 1 330 ? 34.654  9.774   48.907  1.00 41.11  ? 330 PRO A CG    1 
ATOM   1614  C  CD    . PRO A 1 330 ? 35.034  10.421  50.237  1.00 38.34  ? 330 PRO A CD    1 
ATOM   1615  N  N     . ALA A 1 331 ? 38.711  10.460  49.503  1.00 52.06  ? 331 ALA A N     1 
ATOM   1616  C  CA    . ALA A 1 331 ? 40.106  10.813  49.358  1.00 48.56  ? 331 ALA A CA    1 
ATOM   1617  C  C     . ALA A 1 331 ? 41.104  9.965   50.154  1.00 59.63  ? 331 ALA A C     1 
ATOM   1618  O  O     . ALA A 1 331 ? 42.236  9.736   49.714  1.00 56.20  ? 331 ALA A O     1 
ATOM   1619  C  CB    . ALA A 1 331 ? 40.248  12.269  49.759  1.00 35.11  ? 331 ALA A CB    1 
ATOM   1620  N  N     . ASP A 1 332 ? 40.611  9.330   51.200  1.00 65.04  ? 332 ASP A N     1 
ATOM   1621  C  CA    . ASP A 1 332 ? 41.431  8.485   52.036  1.00 65.08  ? 332 ASP A CA    1 
ATOM   1622  C  C     . ASP A 1 332 ? 41.865  7.238   51.304  1.00 61.56  ? 332 ASP A C     1 
ATOM   1623  O  O     . ASP A 1 332 ? 42.900  6.655   51.625  1.00 53.66  ? 332 ASP A O     1 
ATOM   1624  C  CB    . ASP A 1 332 ? 40.722  8.143   53.336  1.00 62.93  ? 332 ASP A CB    1 
ATOM   1625  C  CG    . ASP A 1 332 ? 40.669  9.342   54.265  1.00 67.58  ? 332 ASP A CG    1 
ATOM   1626  O  OD1   . ASP A 1 332 ? 41.686  10.076  54.303  1.00 66.78  ? 332 ASP A OD1   1 
ATOM   1627  O  OD2   . ASP A 1 332 ? 39.680  9.488   55.028  1.00 72.05  ? 332 ASP A OD2   1 
ATOM   1628  N  N     . ALA A 1 333 ? 41.070  6.828   50.318  1.00 69.51  ? 333 ALA A N     1 
ATOM   1629  C  CA    . ALA A 1 333 ? 41.438  5.651   49.535  1.00 58.64  ? 333 ALA A CA    1 
ATOM   1630  C  C     . ALA A 1 333 ? 42.820  5.860   48.858  1.00 56.40  ? 333 ALA A C     1 
ATOM   1631  O  O     . ALA A 1 333 ? 43.536  4.879   48.594  1.00 48.16  ? 333 ALA A O     1 
ATOM   1632  C  CB    . ALA A 1 333 ? 40.347  5.342   48.531  1.00 37.59  ? 333 ALA A CB    1 
ATOM   1633  N  N     . LEU A 1 334 ? 43.203  7.123   48.626  1.00 55.70  ? 334 LEU A N     1 
ATOM   1634  C  CA    . LEU A 1 334 ? 44.520  7.464   48.082  1.00 53.65  ? 334 LEU A CA    1 
ATOM   1635  C  C     . LEU A 1 334 ? 45.652  7.037   49.024  1.00 68.74  ? 334 LEU A C     1 
ATOM   1636  O  O     . LEU A 1 334 ? 46.787  6.825   48.545  1.00 75.32  ? 334 LEU A O     1 
ATOM   1637  C  CB    . LEU A 1 334 ? 44.627  8.959   47.789  1.00 48.70  ? 334 LEU A CB    1 
ATOM   1638  C  CG    . LEU A 1 334 ? 43.781  9.497   46.648  1.00 45.96  ? 334 LEU A CG    1 
ATOM   1639  C  CD1   . LEU A 1 334 ? 44.021  10.988  46.464  1.00 52.07  ? 334 LEU A CD1   1 
ATOM   1640  C  CD2   . LEU A 1 334 ? 44.233  8.764   45.411  1.00 31.78  ? 334 LEU A CD2   1 
ATOM   1641  N  N     . ARG A 1 335 ? 45.431  7.042   50.347  1.00 67.82  ? 335 ARG A N     1 
ATOM   1642  C  CA    . ARG A 1 335 ? 46.479  6.610   51.271  1.00 60.21  ? 335 ARG A CA    1 
ATOM   1643  C  C     . ARG A 1 335 ? 46.338  5.140   51.671  1.00 59.29  ? 335 ARG A C     1 
ATOM   1644  O  O     . ARG A 1 335 ? 47.351  4.488   51.921  1.00 68.84  ? 335 ARG A O     1 
ATOM   1645  C  CB    . ARG A 1 335 ? 46.596  7.457   52.541  1.00 53.07  ? 335 ARG A CB    1 
ATOM   1646  C  CG    . ARG A 1 335 ? 46.513  8.972   52.371  1.00 58.40  ? 335 ARG A CG    1 
ATOM   1647  C  CD    . ARG A 1 335 ? 45.291  9.553   53.136  1.00 111.73 ? 335 ARG A CD    1 
ATOM   1648  N  NE    . ARG A 1 335 ? 44.518  10.702  52.606  1.00 96.11  ? 335 ARG A NE    1 
ATOM   1649  C  CZ    . ARG A 1 335 ? 44.988  11.846  52.161  1.00 99.81  ? 335 ARG A CZ    1 
ATOM   1650  N  NH1   . ARG A 1 335 ? 46.200  11.868  52.000  1.00 103.37 ? 335 ARG A NH1   1 
ATOM   1651  N  NH2   . ARG A 1 335 ? 44.297  12.854  51.687  1.00 91.70  ? 335 ARG A NH2   1 
ATOM   1652  N  N     . VAL A 1 336 ? 45.124  4.631   51.789  1.00 60.48  ? 336 VAL A N     1 
ATOM   1653  C  CA    . VAL A 1 336 ? 44.931  3.309   52.366  1.00 45.35  ? 336 VAL A CA    1 
ATOM   1654  C  C     . VAL A 1 336 ? 44.744  2.323   51.242  1.00 53.53  ? 336 VAL A C     1 
ATOM   1655  O  O     . VAL A 1 336 ? 44.914  1.128   51.446  1.00 65.42  ? 336 VAL A O     1 
ATOM   1656  C  CB    . VAL A 1 336 ? 43.745  3.201   53.317  1.00 45.99  ? 336 VAL A CB    1 
ATOM   1657  C  CG1   . VAL A 1 336 ? 43.845  4.285   54.400  1.00 44.51  ? 336 VAL A CG1   1 
ATOM   1658  C  CG2   . VAL A 1 336 ? 42.436  3.227   52.551  1.00 45.66  ? 336 VAL A CG2   1 
ATOM   1659  N  N     . GLY A 1 337 ? 44.485  2.807   50.025  1.00 60.52  ? 337 GLY A N     1 
ATOM   1660  C  CA    . GLY A 1 337 ? 44.251  1.869   48.924  1.00 58.75  ? 337 GLY A CA    1 
ATOM   1661  C  C     . GLY A 1 337 ? 42.782  1.786   48.509  1.00 53.65  ? 337 GLY A C     1 
ATOM   1662  O  O     . GLY A 1 337 ? 41.885  2.112   49.287  1.00 56.02  ? 337 GLY A O     1 
ATOM   1663  N  N     . PHE A 1 338 ? 42.540  1.397   47.257  1.00 53.52  ? 338 PHE A N     1 
ATOM   1664  C  CA    . PHE A 1 338 ? 41.181  1.400   46.734  1.00 61.07  ? 338 PHE A CA    1 
ATOM   1665  C  C     . PHE A 1 338 ? 40.425  0.155   47.066  1.00 56.23  ? 338 PHE A C     1 
ATOM   1666  O  O     . PHE A 1 338 ? 41.024  -0.886  47.265  1.00 65.56  ? 338 PHE A O     1 
ATOM   1667  C  CB    . PHE A 1 338 ? 41.226  1.499   45.210  1.00 72.32  ? 338 PHE A CB    1 
ATOM   1668  C  CG    . PHE A 1 338 ? 42.134  2.560   44.721  1.00 78.55  ? 338 PHE A CG    1 
ATOM   1669  C  CD1   . PHE A 1 338 ? 41.937  3.882   45.080  1.00 79.97  ? 338 PHE A CD1   1 
ATOM   1670  C  CD2   . PHE A 1 338 ? 43.223  2.230   43.935  1.00 76.95  ? 338 PHE A CD2   1 
ATOM   1671  C  CE1   . PHE A 1 338 ? 42.805  4.860   44.638  1.00 77.56  ? 338 PHE A CE1   1 
ATOM   1672  C  CE2   . PHE A 1 338 ? 44.089  3.195   43.489  1.00 77.29  ? 338 PHE A CE2   1 
ATOM   1673  C  CZ    . PHE A 1 338 ? 43.880  4.512   43.840  1.00 79.94  ? 338 PHE A CZ    1 
ATOM   1674  N  N     . TYR A 1 339 ? 39.104  0.255   47.018  1.00 47.50  ? 339 TYR A N     1 
ATOM   1675  C  CA    . TYR A 1 339 ? 38.244  -0.866  47.263  1.00 45.31  ? 339 TYR A CA    1 
ATOM   1676  C  C     . TYR A 1 339 ? 38.555  -2.020  46.359  1.00 50.18  ? 339 TYR A C     1 
ATOM   1677  O  O     . TYR A 1 339 ? 38.577  -3.152  46.846  1.00 44.76  ? 339 TYR A O     1 
ATOM   1678  C  CB    . TYR A 1 339 ? 36.787  -0.460  47.087  1.00 56.56  ? 339 TYR A CB    1 
ATOM   1679  C  CG    . TYR A 1 339 ? 35.854  -1.565  47.425  1.00 53.97  ? 339 TYR A CG    1 
ATOM   1680  C  CD1   . TYR A 1 339 ? 35.594  -1.925  48.731  1.00 58.35  ? 339 TYR A CD1   1 
ATOM   1681  C  CD2   . TYR A 1 339 ? 35.226  -2.266  46.399  1.00 49.71  ? 339 TYR A CD2   1 
ATOM   1682  C  CE1   . TYR A 1 339 ? 34.739  -2.975  49.010  1.00 56.68  ? 339 TYR A CE1   1 
ATOM   1683  C  CE2   . TYR A 1 339 ? 34.369  -3.304  46.667  1.00 52.36  ? 339 TYR A CE2   1 
ATOM   1684  C  CZ    . TYR A 1 339 ? 34.125  -3.649  47.979  1.00 56.37  ? 339 TYR A CZ    1 
ATOM   1685  O  OH    . TYR A 1 339 ? 33.280  -4.678  48.270  1.00 66.27  ? 339 TYR A OH    1 
ATOM   1686  N  N     . ARG A 1 340 ? 38.611  -1.771  45.049  1.00 62.38  ? 340 ARG A N     1 
ATOM   1687  C  CA    . ARG A 1 340 ? 39.061  -2.806  44.159  1.00 71.39  ? 340 ARG A CA    1 
ATOM   1688  C  C     . ARG A 1 340 ? 40.023  -2.206  43.141  1.00 79.97  ? 340 ARG A C     1 
ATOM   1689  O  O     . ARG A 1 340 ? 39.612  -1.423  42.281  1.00 80.00  ? 340 ARG A O     1 
ATOM   1690  C  CB    . ARG A 1 340 ? 37.885  -3.483  43.460  1.00 61.37  ? 340 ARG A CB    1 
ATOM   1691  C  CG    . ARG A 1 340 ? 38.289  -4.607  42.563  1.00 59.81  ? 340 ARG A CG    1 
ATOM   1692  C  CD    . ARG A 1 340 ? 37.091  -5.252  41.946  1.00 70.31  ? 340 ARG A CD    1 
ATOM   1693  N  NE    . ARG A 1 340 ? 36.383  -4.309  41.080  1.00 81.53  ? 340 ARG A NE    1 
ATOM   1694  C  CZ    . ARG A 1 340 ? 35.269  -3.647  41.405  1.00 73.94  ? 340 ARG A CZ    1 
ATOM   1695  N  NH1   . ARG A 1 340 ? 34.689  -3.819  42.597  1.00 69.22  ? 340 ARG A NH1   1 
ATOM   1696  N  NH2   . ARG A 1 340 ? 34.724  -2.819  40.520  1.00 56.64  ? 340 ARG A NH2   1 
ATOM   1697  N  N     . ALA A 1 341 ? 41.274  -2.626  43.193  1.00 84.92  ? 341 ALA A N     1 
ATOM   1698  C  CA    . ALA A 1 341 ? 42.293  -2.122  42.284  1.00 84.26  ? 341 ALA A CA    1 
ATOM   1699  C  C     . ALA A 1 341 ? 42.619  -3.163  41.253  1.00 84.48  ? 341 ALA A C     1 
ATOM   1700  O  O     . ALA A 1 341 ? 42.486  -4.360  41.507  1.00 94.66  ? 341 ALA A O     1 
ATOM   1701  C  CB    . ALA A 1 341 ? 43.530  -1.691  43.014  1.00 83.81  ? 341 ALA A CB    1 
ATOM   1702  N  N     . GLN A 1 342 ? 42.944  -2.751  40.053  1.00 85.50  ? 342 GLN A N     1 
ATOM   1703  C  CA    . GLN A 1 342 ? 43.390  -3.641  39.023  1.00 79.71  ? 342 GLN A CA    1 
ATOM   1704  C  C     . GLN A 1 342 ? 44.513  -2.932  38.262  1.00 69.44  ? 342 GLN A C     1 
ATOM   1705  O  O     . GLN A 1 342 ? 44.682  -1.728  38.366  1.00 76.35  ? 342 GLN A O     1 
ATOM   1706  C  CB    . GLN A 1 342 ? 42.333  -4.191  38.111  1.00 95.61  ? 342 GLN A CB    1 
ATOM   1707  C  CG    . GLN A 1 342 ? 40.898  -3.853  38.260  1.00 114.39 ? 342 GLN A CG    1 
ATOM   1708  C  CD    . GLN A 1 342 ? 40.277  -3.517  36.940  1.00 121.75 ? 342 GLN A CD    1 
ATOM   1709  O  OE1   . GLN A 1 342 ? 40.878  -3.783  35.870  1.00 131.38 ? 342 GLN A OE1   1 
ATOM   1710  N  NE2   . GLN A 1 342 ? 39.013  -3.165  36.981  1.00 117.98 ? 342 GLN A NE2   1 
ATOM   1711  N  N     . GLU A 1 343 ? 45.286  -3.680  37.487  1.00 72.36  ? 343 GLU A N     1 
ATOM   1712  C  CA    . GLU A 1 343 ? 46.380  -3.125  36.717  1.00 86.90  ? 343 GLU A CA    1 
ATOM   1713  C  C     . GLU A 1 343 ? 45.851  -2.059  35.708  1.00 67.16  ? 343 GLU A C     1 
ATOM   1714  O  O     . GLU A 1 343 ? 44.885  -2.242  34.916  1.00 76.44  ? 343 GLU A O     1 
ATOM   1715  C  CB    . GLU A 1 343 ? 47.212  -4.268  36.106  1.00 101.04 ? 343 GLU A CB    1 
ATOM   1716  C  CG    . GLU A 1 343 ? 46.825  -4.917  34.897  1.00 112.25 ? 343 GLU A CG    1 
ATOM   1717  C  CD    . GLU A 1 343 ? 47.890  -5.771  34.255  1.00 121.69 ? 343 GLU A CD    1 
ATOM   1718  O  OE1   . GLU A 1 343 ? 48.834  -6.264  34.954  1.00 122.83 ? 343 GLU A OE1   1 
ATOM   1719  O  OE2   . GLU A 1 343 ? 47.729  -6.032  33.055  1.00 127.66 ? 343 GLU A OE2   1 
ATOM   1720  N  N     . THR A 1 344 ? 46.378  -0.861  35.929  1.00 57.64  ? 344 THR A N     1 
ATOM   1721  C  CA    . THR A 1 344 ? 45.983  0.330   35.227  1.00 38.16  ? 344 THR A CA    1 
ATOM   1722  C  C     . THR A 1 344 ? 47.141  1.030   34.534  1.00 59.64  ? 344 THR A C     1 
ATOM   1723  O  O     . THR A 1 344 ? 48.291  0.963   34.949  1.00 64.57  ? 344 THR A O     1 
ATOM   1724  C  CB    . THR A 1 344 ? 45.438  1.335   36.316  1.00 50.68  ? 344 THR A CB    1 
ATOM   1725  O  OG1   . THR A 1 344 ? 44.393  0.719   37.068  1.00 51.33  ? 344 THR A OG1   1 
ATOM   1726  C  CG2   . THR A 1 344 ? 44.952  2.658   35.733  1.00 66.45  ? 344 THR A CG2   1 
ATOM   1727  N  N     . ALA A 1 345 ? 46.790  1.748   33.481  1.00 66.73  ? 345 ALA A N     1 
ATOM   1728  C  CA    . ALA A 1 345 ? 47.725  2.537   32.722  1.00 65.70  ? 345 ALA A CA    1 
ATOM   1729  C  C     . ALA A 1 345 ? 47.081  3.876   32.535  1.00 64.76  ? 345 ALA A C     1 
ATOM   1730  O  O     . ALA A 1 345 ? 45.922  3.962   32.129  1.00 66.92  ? 345 ALA A O     1 
ATOM   1731  C  CB    . ALA A 1 345 ? 48.032  1.896   31.397  1.00 65.35  ? 345 ALA A CB    1 
ATOM   1732  N  N     . LEU A 1 346 ? 47.796  4.932   32.865  1.00 65.81  ? 346 LEU A N     1 
ATOM   1733  C  CA    . LEU A 1 346 ? 47.209  6.238   32.741  1.00 63.44  ? 346 LEU A CA    1 
ATOM   1734  C  C     . LEU A 1 346 ? 48.115  7.074   31.842  1.00 61.60  ? 346 LEU A C     1 
ATOM   1735  O  O     . LEU A 1 346 ? 49.320  6.845   31.808  1.00 66.07  ? 346 LEU A O     1 
ATOM   1736  C  CB    . LEU A 1 346 ? 47.109  6.865   34.135  1.00 62.49  ? 346 LEU A CB    1 
ATOM   1737  C  CG    . LEU A 1 346 ? 46.158  6.317   35.192  1.00 51.94  ? 346 LEU A CG    1 
ATOM   1738  C  CD1   . LEU A 1 346 ? 46.430  7.087   36.463  1.00 71.22  ? 346 LEU A CD1   1 
ATOM   1739  C  CD2   . LEU A 1 346 ? 44.669  6.440   34.812  1.00 37.07  ? 346 LEU A CD2   1 
ATOM   1740  N  N     . ALA A 1 347 ? 47.574  8.014   31.075  1.00 55.41  ? 347 ALA A N     1 
ATOM   1741  C  CA    . ALA A 1 347 ? 48.480  8.793   30.241  1.00 53.48  ? 347 ALA A CA    1 
ATOM   1742  C  C     . ALA A 1 347 ? 48.407  10.281  30.616  1.00 59.00  ? 347 ALA A C     1 
ATOM   1743  O  O     . ALA A 1 347 ? 47.333  10.781  30.963  1.00 58.75  ? 347 ALA A O     1 
ATOM   1744  C  CB    . ALA A 1 347 ? 48.179  8.589   28.798  1.00 51.96  ? 347 ALA A CB    1 
ATOM   1745  N  N     . LEU A 1 348 ? 49.508  11.005  30.428  1.00 59.44  ? 348 LEU A N     1 
ATOM   1746  C  CA    . LEU A 1 348 ? 49.531  12.444  30.667  1.00 60.00  ? 348 LEU A CA    1 
ATOM   1747  C  C     . LEU A 1 348 ? 49.649  13.234  29.378  1.00 56.03  ? 348 LEU A C     1 
ATOM   1748  O  O     . LEU A 1 348 ? 50.524  12.979  28.568  1.00 60.26  ? 348 LEU A O     1 
ATOM   1749  C  CB    . LEU A 1 348 ? 50.653  12.811  31.653  1.00 56.13  ? 348 LEU A CB    1 
ATOM   1750  C  CG    . LEU A 1 348 ? 50.790  14.290  32.026  1.00 55.03  ? 348 LEU A CG    1 
ATOM   1751  C  CD1   . LEU A 1 348 ? 49.689  14.786  32.923  1.00 56.44  ? 348 LEU A CD1   1 
ATOM   1752  C  CD2   . LEU A 1 348 ? 52.128  14.475  32.708  1.00 60.60  ? 348 LEU A CD2   1 
ATOM   1753  N  N     . LEU A 1 349 ? 48.773  14.217  29.224  1.00 53.30  ? 349 LEU A N     1 
ATOM   1754  C  CA    . LEU A 1 349 ? 48.770  15.163  28.110  1.00 53.83  ? 349 LEU A CA    1 
ATOM   1755  C  C     . LEU A 1 349 ? 48.952  16.549  28.677  1.00 62.64  ? 349 LEU A C     1 
ATOM   1756  O  O     . LEU A 1 349 ? 48.124  17.029  29.470  1.00 71.98  ? 349 LEU A O     1 
ATOM   1757  C  CB    . LEU A 1 349 ? 47.495  15.079  27.267  1.00 48.95  ? 349 LEU A CB    1 
ATOM   1758  C  CG    . LEU A 1 349 ? 47.353  16.190  26.207  1.00 57.08  ? 349 LEU A CG    1 
ATOM   1759  C  CD1   . LEU A 1 349 ? 48.442  16.161  25.176  1.00 50.99  ? 349 LEU A CD1   1 
ATOM   1760  C  CD2   . LEU A 1 349 ? 46.001  16.091  25.502  1.00 54.03  ? 349 LEU A CD2   1 
ATOM   1761  N  N     . ARG A 1 350 ? 50.077  17.151  28.314  1.00 54.02  ? 350 ARG A N     1 
ATOM   1762  C  CA    . ARG A 1 350 ? 50.421  18.479  28.752  1.00 54.35  ? 350 ARG A CA    1 
ATOM   1763  C  C     . ARG A 1 350 ? 50.084  19.525  27.700  1.00 64.62  ? 350 ARG A C     1 
ATOM   1764  O  O     . ARG A 1 350 ? 50.575  19.474  26.565  1.00 69.60  ? 350 ARG A O     1 
ATOM   1765  C  CB    . ARG A 1 350 ? 51.922  18.538  29.100  1.00 69.98  ? 350 ARG A CB    1 
ATOM   1766  C  CG    . ARG A 1 350 ? 52.250  17.813  30.381  1.00 68.15  ? 350 ARG A CG    1 
ATOM   1767  C  CD    . ARG A 1 350 ? 52.416  18.807  31.453  1.00 61.83  ? 350 ARG A CD    1 
ATOM   1768  N  NE    . ARG A 1 350 ? 53.485  18.562  32.390  1.00 61.54  ? 350 ARG A NE    1 
ATOM   1769  C  CZ    . ARG A 1 350 ? 53.809  19.443  33.327  1.00 60.48  ? 350 ARG A CZ    1 
ATOM   1770  N  NH1   . ARG A 1 350 ? 54.753  19.171  34.210  1.00 73.77  ? 350 ARG A NH1   1 
ATOM   1771  N  NH2   . ARG A 1 350 ? 53.136  20.583  33.406  1.00 48.91  ? 350 ARG A NH2   1 
ATOM   1772  N  N     . LEU A 1 351 ? 49.218  20.468  28.033  1.00 71.75  ? 351 LEU A N     1 
ATOM   1773  C  CA    . LEU A 1 351 ? 48.992  21.513  27.057  1.00 72.27  ? 351 LEU A CA    1 
ATOM   1774  C  C     . LEU A 1 351 ? 49.710  22.771  27.484  1.00 82.05  ? 351 LEU A C     1 
ATOM   1775  O  O     . LEU A 1 351 ? 49.446  23.848  26.950  1.00 94.20  ? 351 LEU A O     1 
ATOM   1776  C  CB    . LEU A 1 351 ? 47.512  21.837  26.920  1.00 54.30  ? 351 LEU A CB    1 
ATOM   1777  C  CG    . LEU A 1 351 ? 46.662  20.639  26.624  1.00 52.93  ? 351 LEU A CG    1 
ATOM   1778  C  CD1   . LEU A 1 351 ? 45.195  21.066  26.446  1.00 56.31  ? 351 LEU A CD1   1 
ATOM   1779  C  CD2   . LEU A 1 351 ? 47.275  20.015  25.426  1.00 43.85  ? 351 LEU A CD2   1 
ATOM   1780  N  N     . ASP A 1 352 ? 50.728  22.637  28.317  1.00 72.47  ? 352 ASP A N     1 
ATOM   1781  C  CA    . ASP A 1 352 ? 51.298  23.842  28.884  1.00 78.63  ? 352 ASP A CA    1 
ATOM   1782  C  C     . ASP A 1 352 ? 52.743  23.952  28.415  1.00 85.00  ? 352 ASP A C     1 
ATOM   1783  O  O     . ASP A 1 352 ? 53.430  24.914  28.755  1.00 64.77  ? 352 ASP A O     1 
ATOM   1784  C  CB    . ASP A 1 352 ? 51.149  23.882  30.422  1.00 71.05  ? 352 ASP A CB    1 
ATOM   1785  C  CG    . ASP A 1 352 ? 51.935  22.772  31.153  1.00 73.54  ? 352 ASP A CG    1 
ATOM   1786  O  OD1   . ASP A 1 352 ? 52.211  21.699  30.558  1.00 67.16  ? 352 ASP A OD1   1 
ATOM   1787  O  OD2   . ASP A 1 352 ? 52.267  22.971  32.347  1.00 72.31  ? 352 ASP A OD2   1 
ATOM   1788  N  N     . GLY A 1 353 ? 53.235  22.934  27.705  1.00 92.05  ? 353 GLY A N     1 
ATOM   1789  C  CA    . GLY A 1 353 ? 54.571  23.024  27.160  1.00 94.66  ? 353 GLY A CA    1 
ATOM   1790  C  C     . GLY A 1 353 ? 55.563  22.572  28.208  1.00 101.97 ? 353 GLY A C     1 
ATOM   1791  O  O     . GLY A 1 353 ? 56.761  22.633  28.011  1.00 115.95 ? 353 GLY A O     1 
ATOM   1792  N  N     . ALA A 1 354 ? 55.090  21.931  29.254  1.00 103.12 ? 354 ALA A N     1 
ATOM   1793  C  CA    . ALA A 1 354 ? 56.038  21.549  30.266  1.00 94.91  ? 354 ALA A CA    1 
ATOM   1794  C  C     . ALA A 1 354 ? 56.349  20.086  30.366  1.00 87.75  ? 354 ALA A C     1 
ATOM   1795  O  O     . ALA A 1 354 ? 55.933  19.282  29.531  1.00 73.86  ? 354 ALA A O     1 
ATOM   1796  C  CB    . ALA A 1 354 ? 55.496  22.061  31.654  1.00 59.80  ? 354 ALA A CB    1 
ATOM   1797  N  N     . GLN A 1 355 ? 57.245  19.807  31.321  1.00 94.24  ? 355 GLN A N     1 
ATOM   1798  C  CA    . GLN A 1 355 ? 57.882  18.523  31.643  1.00 96.12  ? 355 GLN A CA    1 
ATOM   1799  C  C     . GLN A 1 355 ? 57.126  17.233  31.323  1.00 73.37  ? 355 GLN A C     1 
ATOM   1800  O  O     . GLN A 1 355 ? 56.807  16.925  30.211  1.00 80.01  ? 355 GLN A O     1 
ATOM   1801  C  CB    . GLN A 1 355 ? 58.212  18.447  33.149  1.00 120.82 ? 355 GLN A CB    1 
ATOM   1802  C  CG    . GLN A 1 355 ? 59.157  19.455  33.772  1.00 140.79 ? 355 GLN A CG    1 
ATOM   1803  C  CD    . GLN A 1 355 ? 58.747  19.823  35.171  1.00 143.67 ? 355 GLN A CD    1 
ATOM   1804  O  OE1   . GLN A 1 355 ? 57.906  19.201  35.785  1.00 138.28 ? 355 GLN A OE1   1 
ATOM   1805  N  NE2   . GLN A 1 355 ? 59.605  20.680  35.786  1.00 146.38 ? 355 GLN A NE2   1 
ATOM   1806  N  N     . GLY A 1 356 ? 57.029  16.458  32.398  1.00 68.06  ? 356 GLY A N     1 
ATOM   1807  C  CA    . GLY A 1 356 ? 56.641  15.050  32.400  1.00 65.29  ? 356 GLY A CA    1 
ATOM   1808  C  C     . GLY A 1 356 ? 55.628  15.157  33.515  1.00 69.27  ? 356 GLY A C     1 
ATOM   1809  O  O     . GLY A 1 356 ? 54.941  16.198  33.670  1.00 68.47  ? 356 GLY A O     1 
ATOM   1810  N  N     . TRP A 1 357 ? 55.404  14.070  34.226  1.00 73.04  ? 357 TRP A N     1 
ATOM   1811  C  CA    . TRP A 1 357 ? 54.494  14.082  35.353  1.00 64.43  ? 357 TRP A CA    1 
ATOM   1812  C  C     . TRP A 1 357 ? 55.049  14.962  36.438  1.00 67.58  ? 357 TRP A C     1 
ATOM   1813  O  O     . TRP A 1 357 ? 56.219  14.862  36.764  1.00 78.13  ? 357 TRP A O     1 
ATOM   1814  C  CB    . TRP A 1 357 ? 54.306  12.683  35.891  1.00 63.63  ? 357 TRP A CB    1 
ATOM   1815  C  CG    . TRP A 1 357 ? 53.412  11.863  35.115  1.00 64.74  ? 357 TRP A CG    1 
ATOM   1816  C  CD1   . TRP A 1 357 ? 53.738  11.101  34.034  1.00 68.99  ? 357 TRP A CD1   1 
ATOM   1817  C  CD2   . TRP A 1 357 ? 52.031  11.634  35.375  1.00 61.90  ? 357 TRP A CD2   1 
ATOM   1818  N  NE1   . TRP A 1 357 ? 52.628  10.441  33.572  1.00 72.39  ? 357 TRP A NE1   1 
ATOM   1819  C  CE2   . TRP A 1 357 ? 51.567  10.745  34.389  1.00 69.29  ? 357 TRP A CE2   1 
ATOM   1820  C  CE3   . TRP A 1 357 ? 51.138  12.105  36.334  1.00 55.14  ? 357 TRP A CE3   1 
ATOM   1821  C  CZ2   . TRP A 1 357 ? 50.247  10.317  34.340  1.00 67.24  ? 357 TRP A CZ2   1 
ATOM   1822  C  CZ3   . TRP A 1 357 ? 49.826  11.685  36.280  1.00 56.80  ? 357 TRP A CZ3   1 
ATOM   1823  C  CH2   . TRP A 1 357 ? 49.391  10.803  35.296  1.00 67.99  ? 357 TRP A CH2   1 
ATOM   1824  N  N     . PRO A 1 358 ? 54.237  15.875  36.996  1.00 70.92  ? 358 PRO A N     1 
ATOM   1825  C  CA    . PRO A 1 358 ? 54.769  16.486  38.223  1.00 72.82  ? 358 PRO A CA    1 
ATOM   1826  C  C     . PRO A 1 358 ? 55.042  15.375  39.243  1.00 83.48  ? 358 PRO A C     1 
ATOM   1827  O  O     . PRO A 1 358 ? 54.219  14.487  39.413  1.00 93.66  ? 358 PRO A O     1 
ATOM   1828  C  CB    . PRO A 1 358 ? 53.656  17.440  38.673  1.00 58.18  ? 358 PRO A CB    1 
ATOM   1829  C  CG    . PRO A 1 358 ? 52.940  17.795  37.403  1.00 65.18  ? 358 PRO A CG    1 
ATOM   1830  C  CD    . PRO A 1 358 ? 52.994  16.542  36.529  1.00 73.37  ? 358 PRO A CD    1 
ATOM   1831  N  N     . GLU A 1 359 ? 56.154  15.479  39.974  1.00 83.88  ? 359 GLU A N     1 
ATOM   1832  C  CA    . GLU A 1 359 ? 56.595  14.405  40.835  1.00 87.10  ? 359 GLU A CA    1 
ATOM   1833  C  C     . GLU A 1 359 ? 55.622  14.084  41.957  1.00 82.09  ? 359 GLU A C     1 
ATOM   1834  O  O     . GLU A 1 359 ? 55.426  12.927  42.293  1.00 78.97  ? 359 GLU A O     1 
ATOM   1835  C  CB    . GLU A 1 359 ? 57.991  14.685  41.420  1.00 92.09  ? 359 GLU A CB    1 
ATOM   1836  C  CG    . GLU A 1 359 ? 58.693  13.516  42.224  1.00 122.32 ? 359 GLU A CG    1 
ATOM   1837  C  CD    . GLU A 1 359 ? 58.905  12.203  41.485  1.00 121.18 ? 359 GLU A CD    1 
ATOM   1838  O  OE1   . GLU A 1 359 ? 58.508  12.052  40.319  1.00 120.51 ? 359 GLU A OE1   1 
ATOM   1839  O  OE2   . GLU A 1 359 ? 59.490  11.277  42.131  1.00 119.72 ? 359 GLU A OE2   1 
ATOM   1840  N  N     . PHE A 1 360 ? 55.023  15.089  42.552  1.00 79.94  ? 360 PHE A N     1 
ATOM   1841  C  CA    . PHE A 1 360 ? 54.089  14.808  43.648  1.00 69.87  ? 360 PHE A CA    1 
ATOM   1842  C  C     . PHE A 1 360 ? 52.866  13.991  43.162  1.00 74.55  ? 360 PHE A C     1 
ATOM   1843  O  O     . PHE A 1 360 ? 52.341  13.151  43.926  1.00 68.09  ? 360 PHE A O     1 
ATOM   1844  C  CB    . PHE A 1 360 ? 53.689  16.091  44.363  1.00 71.03  ? 360 PHE A CB    1 
ATOM   1845  C  CG    . PHE A 1 360 ? 52.959  17.101  43.527  1.00 83.28  ? 360 PHE A CG    1 
ATOM   1846  C  CD1   . PHE A 1 360 ? 51.592  17.083  43.451  1.00 88.79  ? 360 PHE A CD1   1 
ATOM   1847  C  CD2   . PHE A 1 360 ? 53.658  18.135  42.900  1.00 89.18  ? 360 PHE A CD2   1 
ATOM   1848  C  CE1   . PHE A 1 360 ? 50.907  18.054  42.711  1.00 93.02  ? 360 PHE A CE1   1 
ATOM   1849  C  CE2   . PHE A 1 360 ? 52.983  19.116  42.151  1.00 87.15  ? 360 PHE A CE2   1 
ATOM   1850  C  CZ    . PHE A 1 360 ? 51.607  19.077  42.060  1.00 88.43  ? 360 PHE A CZ    1 
ATOM   1851  N  N     . LEU A 1 361 ? 52.411  14.231  41.924  1.00 74.21  ? 361 LEU A N     1 
ATOM   1852  C  CA    . LEU A 1 361 ? 51.334  13.427  41.357  1.00 62.74  ? 361 LEU A CA    1 
ATOM   1853  C  C     . LEU A 1 361 ? 51.789  11.988  41.167  1.00 62.53  ? 361 LEU A C     1 
ATOM   1854  O  O     . LEU A 1 361 ? 51.042  11.041  41.471  1.00 56.86  ? 361 LEU A O     1 
ATOM   1855  C  CB    . LEU A 1 361 ? 50.834  13.989  40.014  1.00 59.43  ? 361 LEU A CB    1 
ATOM   1856  C  CG    . LEU A 1 361 ? 50.137  15.351  40.057  1.00 50.48  ? 361 LEU A CG    1 
ATOM   1857  C  CD1   . LEU A 1 361 ? 49.704  15.820  38.682  1.00 38.80  ? 361 LEU A CD1   1 
ATOM   1858  C  CD2   . LEU A 1 361 ? 48.967  15.299  40.990  1.00 48.27  ? 361 LEU A CD2   1 
ATOM   1859  N  N     . ARG A 1 362 ? 52.992  11.818  40.622  1.00 67.78  ? 362 ARG A N     1 
ATOM   1860  C  CA    . ARG A 1 362 ? 53.493  10.461  40.412  1.00 69.33  ? 362 ARG A CA    1 
ATOM   1861  C  C     . ARG A 1 362 ? 53.617  9.709   41.746  1.00 80.03  ? 362 ARG A C     1 
ATOM   1862  O  O     . ARG A 1 362 ? 53.193  8.563   41.854  1.00 86.10  ? 362 ARG A O     1 
ATOM   1863  C  CB    . ARG A 1 362 ? 54.823  10.508  39.659  1.00 51.52  ? 362 ARG A CB    1 
ATOM   1864  C  CG    . ARG A 1 362 ? 55.464  9.169   39.461  1.00 56.14  ? 362 ARG A CG    1 
ATOM   1865  C  CD    . ARG A 1 362 ? 56.862  9.281   38.814  1.00 75.14  ? 362 ARG A CD    1 
ATOM   1866  N  NE    . ARG A 1 362 ? 56.759  9.191   37.342  1.00 86.58  ? 362 ARG A NE    1 
ATOM   1867  C  CZ    . ARG A 1 362 ? 56.665  8.041   36.669  1.00 94.69  ? 362 ARG A CZ    1 
ATOM   1868  N  NH1   . ARG A 1 362 ? 56.666  6.883   37.330  1.00 100.33 ? 362 ARG A NH1   1 
ATOM   1869  N  NH2   . ARG A 1 362 ? 56.579  8.041   35.342  1.00 94.31  ? 362 ARG A NH2   1 
ATOM   1870  N  N     . ARG A 1 363 ? 54.220  10.365  42.750  1.00 78.29  ? 363 ARG A N     1 
ATOM   1871  C  CA    . ARG A 1 363 ? 54.292  9.720   44.045  1.00 75.43  ? 363 ARG A CA    1 
ATOM   1872  C  C     . ARG A 1 363 ? 52.939  9.368   44.600  1.00 64.15  ? 363 ARG A C     1 
ATOM   1873  O  O     . ARG A 1 363 ? 52.751  8.289   45.115  1.00 49.05  ? 363 ARG A O     1 
ATOM   1874  C  CB    . ARG A 1 363 ? 55.063  10.436  45.178  1.00 90.61  ? 363 ARG A CB    1 
ATOM   1875  C  CG    . ARG A 1 363 ? 56.511  10.350  45.254  1.00 99.08  ? 363 ARG A CG    1 
ATOM   1876  C  CD    . ARG A 1 363 ? 57.071  11.491  46.007  1.00 110.08 ? 363 ARG A CD    1 
ATOM   1877  N  NE    . ARG A 1 363 ? 56.033  12.434  46.443  1.00 113.13 ? 363 ARG A NE    1 
ATOM   1878  C  CZ    . ARG A 1 363 ? 56.196  13.752  46.583  1.00 114.31 ? 363 ARG A CZ    1 
ATOM   1879  N  NH1   . ARG A 1 363 ? 57.314  14.262  46.357  1.00 118.78 ? 363 ARG A NH1   1 
ATOM   1880  N  NH2   . ARG A 1 363 ? 55.298  14.586  46.958  1.00 104.44 ? 363 ARG A NH2   1 
ATOM   1881  N  N     . ALA A 1 364 ? 51.997  10.319  44.575  1.00 62.55  ? 364 ALA A N     1 
ATOM   1882  C  CA    . ALA A 1 364 ? 50.662  9.995   45.122  1.00 58.07  ? 364 ALA A CA    1 
ATOM   1883  C  C     . ALA A 1 364 ? 50.013  8.803   44.445  1.00 61.98  ? 364 ALA A C     1 
ATOM   1884  O  O     . ALA A 1 364 ? 49.510  7.922   45.143  1.00 76.50  ? 364 ALA A O     1 
ATOM   1885  C  CB    . ALA A 1 364 ? 49.733  11.214  44.996  1.00 39.97  ? 364 ALA A CB    1 
ATOM   1886  N  N     . LEU A 1 365 ? 50.034  8.753   43.120  1.00 59.83  ? 365 LEU A N     1 
ATOM   1887  C  CA    . LEU A 1 365 ? 49.472  7.607   42.417  1.00 58.25  ? 365 LEU A CA    1 
ATOM   1888  C  C     . LEU A 1 365 ? 50.145  6.297   42.777  1.00 67.19  ? 365 LEU A C     1 
ATOM   1889  O  O     . LEU A 1 365 ? 49.495  5.315   43.116  1.00 71.31  ? 365 LEU A O     1 
ATOM   1890  C  CB    . LEU A 1 365 ? 49.533  7.815   40.895  1.00 57.19  ? 365 LEU A CB    1 
ATOM   1891  C  CG    . LEU A 1 365 ? 48.507  8.811   40.325  1.00 55.52  ? 365 LEU A CG    1 
ATOM   1892  C  CD1   . LEU A 1 365 ? 48.761  9.174   38.848  1.00 42.88  ? 365 LEU A CD1   1 
ATOM   1893  C  CD2   . LEU A 1 365 ? 47.114  8.273   40.528  1.00 60.47  ? 365 LEU A CD2   1 
ATOM   1894  N  N     . LEU A 1 366 ? 51.466  6.327   42.739  1.00 72.16  ? 366 LEU A N     1 
ATOM   1895  C  CA    . LEU A 1 366 ? 52.303  5.181   43.076  1.00 68.13  ? 366 LEU A CA    1 
ATOM   1896  C  C     . LEU A 1 366 ? 51.950  4.671   44.455  1.00 75.10  ? 366 LEU A C     1 
ATOM   1897  O  O     . LEU A 1 366 ? 51.873  3.465   44.703  1.00 79.11  ? 366 LEU A O     1 
ATOM   1898  C  CB    . LEU A 1 366 ? 53.757  5.609   43.017  1.00 61.52  ? 366 LEU A CB    1 
ATOM   1899  C  CG    . LEU A 1 366 ? 54.335  5.345   41.628  1.00 59.16  ? 366 LEU A CG    1 
ATOM   1900  C  CD1   . LEU A 1 366 ? 55.799  5.626   41.608  1.00 67.54  ? 366 LEU A CD1   1 
ATOM   1901  C  CD2   . LEU A 1 366 ? 54.010  3.978   41.066  1.00 57.53  ? 366 LEU A CD2   1 
ATOM   1902  N  N     . ARG A 1 367 ? 51.805  5.614   45.369  1.00 74.59  ? 367 ARG A N     1 
ATOM   1903  C  CA    . ARG A 1 367 ? 51.435  5.324   46.741  1.00 80.28  ? 367 ARG A CA    1 
ATOM   1904  C  C     . ARG A 1 367 ? 50.063  4.650   46.851  1.00 77.38  ? 367 ARG A C     1 
ATOM   1905  O  O     . ARG A 1 367 ? 49.909  3.625   47.528  1.00 83.09  ? 367 ARG A O     1 
ATOM   1906  C  CB    . ARG A 1 367 ? 51.514  6.652   47.506  1.00 84.85  ? 367 ARG A CB    1 
ATOM   1907  C  CG    . ARG A 1 367 ? 51.839  6.475   48.921  1.00 99.76  ? 367 ARG A CG    1 
ATOM   1908  C  CD    . ARG A 1 367 ? 52.120  7.755   49.685  1.00 121.61 ? 367 ARG A CD    1 
ATOM   1909  N  NE    . ARG A 1 367 ? 51.048  8.505   50.323  1.00 137.11 ? 367 ARG A NE    1 
ATOM   1910  C  CZ    . ARG A 1 367 ? 50.788  9.803   50.164  1.00 148.61 ? 367 ARG A CZ    1 
ATOM   1911  N  NH1   . ARG A 1 367 ? 51.540  10.548  49.366  1.00 154.80 ? 367 ARG A NH1   1 
ATOM   1912  N  NH2   . ARG A 1 367 ? 49.772  10.361  50.831  1.00 150.83 ? 367 ARG A NH2   1 
ATOM   1913  N  N     . ALA A 1 368 ? 49.089  5.206   46.144  1.00 73.61  ? 368 ALA A N     1 
ATOM   1914  C  CA    . ALA A 1 368 ? 47.747  4.661   46.118  1.00 59.88  ? 368 ALA A CA    1 
ATOM   1915  C  C     . ALA A 1 368 ? 47.757  3.209   45.603  1.00 63.46  ? 368 ALA A C     1 
ATOM   1916  O  O     . ALA A 1 368 ? 47.102  2.312   46.180  1.00 55.12  ? 368 ALA A O     1 
ATOM   1917  C  CB    . ALA A 1 368 ? 46.849  5.534   45.282  1.00 54.81  ? 368 ALA A CB    1 
ATOM   1918  N  N     . PHE A 1 369 ? 48.480  2.970   44.505  1.00 61.78  ? 369 PHE A N     1 
ATOM   1919  C  CA    . PHE A 1 369 ? 48.494  1.619   43.947  1.00 62.87  ? 369 PHE A CA    1 
ATOM   1920  C  C     . PHE A 1 369 ? 49.345  0.639   44.723  1.00 66.20  ? 369 PHE A C     1 
ATOM   1921  O  O     . PHE A 1 369 ? 49.065  -0.568  44.716  1.00 66.45  ? 369 PHE A O     1 
ATOM   1922  C  CB    . PHE A 1 369 ? 48.961  1.634   42.493  1.00 55.94  ? 369 PHE A CB    1 
ATOM   1923  C  CG    . PHE A 1 369 ? 47.898  2.055   41.551  1.00 65.16  ? 369 PHE A CG    1 
ATOM   1924  C  CD1   . PHE A 1 369 ? 47.591  3.397   41.367  1.00 60.19  ? 369 PHE A CD1   1 
ATOM   1925  C  CD2   . PHE A 1 369 ? 47.131  1.090   40.910  1.00 67.75  ? 369 PHE A CD2   1 
ATOM   1926  C  CE1   . PHE A 1 369 ? 46.581  3.761   40.515  1.00 62.69  ? 369 PHE A CE1   1 
ATOM   1927  C  CE2   . PHE A 1 369 ? 46.108  1.449   40.056  1.00 60.28  ? 369 PHE A CE2   1 
ATOM   1928  C  CZ    . PHE A 1 369 ? 45.833  2.779   39.849  1.00 60.25  ? 369 PHE A CZ    1 
ATOM   1929  N  N     . GLY A 1 370 ? 50.309  1.159   45.475  1.00 56.69  ? 370 GLY A N     1 
ATOM   1930  C  CA    . GLY A 1 370 ? 51.108  0.317   46.327  1.00 52.97  ? 370 GLY A CA    1 
ATOM   1931  C  C     . GLY A 1 370 ? 50.243  -0.183  47.461  1.00 65.41  ? 370 GLY A C     1 
ATOM   1932  O  O     . GLY A 1 370 ? 50.200  -1.379  47.774  1.00 77.14  ? 370 GLY A O     1 
ATOM   1933  N  N     . ALA A 1 371 ? 49.497  0.741   48.043  1.00 59.88  ? 371 ALA A N     1 
ATOM   1934  C  CA    . ALA A 1 371 ? 48.581  0.381   49.105  1.00 63.33  ? 371 ALA A CA    1 
ATOM   1935  C  C     . ALA A 1 371 ? 47.519  -0.597  48.585  1.00 79.42  ? 371 ALA A C     1 
ATOM   1936  O  O     . ALA A 1 371 ? 47.071  -1.483  49.312  1.00 77.17  ? 371 ALA A O     1 
ATOM   1937  C  CB    . ALA A 1 371 ? 47.926  1.638   49.672  1.00 45.50  ? 371 ALA A CB    1 
ATOM   1938  N  N     . SER A 1 372 ? 47.093  -0.410  47.342  1.00 80.21  ? 372 SER A N     1 
ATOM   1939  C  CA    . SER A 1 372 ? 46.074  -1.269  46.758  1.00 76.62  ? 372 SER A CA    1 
ATOM   1940  C  C     . SER A 1 372 ? 46.591  -2.638  46.286  1.00 71.36  ? 372 SER A C     1 
ATOM   1941  O  O     . SER A 1 372 ? 45.801  -3.546  45.982  1.00 73.46  ? 372 SER A O     1 
ATOM   1942  C  CB    . SER A 1 372 ? 45.416  -0.538  45.610  1.00 79.48  ? 372 SER A CB    1 
ATOM   1943  O  OG    . SER A 1 372 ? 44.690  0.562   46.110  1.00 87.94  ? 372 SER A OG    1 
ATOM   1944  N  N     . GLY A 1 373 ? 47.907  -2.780  46.176  1.00 62.16  ? 373 GLY A N     1 
ATOM   1945  C  CA    . GLY A 1 373 ? 48.457  -4.032  45.686  1.00 67.75  ? 373 GLY A CA    1 
ATOM   1946  C  C     . GLY A 1 373 ? 48.259  -4.252  44.180  1.00 73.57  ? 373 GLY A C     1 
ATOM   1947  O  O     . GLY A 1 373 ? 48.139  -5.398  43.722  1.00 73.39  ? 373 GLY A O     1 
ATOM   1948  N  N     . ALA A 1 374 ? 48.049  -3.168  43.432  1.00 67.56  ? 374 ALA A N     1 
ATOM   1949  C  CA    . ALA A 1 374 ? 47.907  -3.251  41.984  1.00 55.38  ? 374 ALA A CA    1 
ATOM   1950  C  C     . ALA A 1 374 ? 49.048  -2.522  41.299  1.00 73.14  ? 374 ALA A C     1 
ATOM   1951  O  O     . ALA A 1 374 ? 49.597  -1.582  41.857  1.00 79.97  ? 374 ALA A O     1 
ATOM   1952  C  CB    . ALA A 1 374 ? 46.596  -2.686  41.538  1.00 46.69  ? 374 ALA A CB    1 
ATOM   1953  N  N     . SER A 1 375 ? 49.373  -2.925  40.078  1.00 76.84  ? 375 SER A N     1 
ATOM   1954  C  CA    . SER A 1 375 ? 50.462  -2.314  39.324  1.00 72.40  ? 375 SER A CA    1 
ATOM   1955  C  C     . SER A 1 375 ? 50.001  -1.148  38.439  1.00 65.46  ? 375 SER A C     1 
ATOM   1956  O  O     . SER A 1 375 ? 48.924  -1.177  37.839  1.00 68.88  ? 375 SER A O     1 
ATOM   1957  C  CB    . SER A 1 375 ? 51.185  -3.367  38.485  1.00 77.44  ? 375 SER A CB    1 
ATOM   1958  O  OG    . SER A 1 375 ? 50.277  -3.992  37.604  1.00 83.84  ? 375 SER A OG    1 
ATOM   1959  N  N     . LEU A 1 376 ? 50.791  -0.090  38.403  1.00 69.33  ? 376 LEU A N     1 
ATOM   1960  C  CA    . LEU A 1 376 ? 50.466  1.099   37.632  1.00 61.07  ? 376 LEU A CA    1 
ATOM   1961  C  C     . LEU A 1 376 ? 51.504  1.344   36.519  1.00 71.29  ? 376 LEU A C     1 
ATOM   1962  O  O     . LEU A 1 376 ? 52.699  1.230   36.750  1.00 81.60  ? 376 LEU A O     1 
ATOM   1963  C  CB    . LEU A 1 376 ? 50.395  2.287   38.583  1.00 54.36  ? 376 LEU A CB    1 
ATOM   1964  C  CG    . LEU A 1 376 ? 50.147  3.679   38.050  1.00 62.96  ? 376 LEU A CG    1 
ATOM   1965  C  CD1   . LEU A 1 376 ? 48.721  3.741   37.531  1.00 49.99  ? 376 LEU A CD1   1 
ATOM   1966  C  CD2   . LEU A 1 376 ? 50.355  4.677   39.201  1.00 75.13  ? 376 LEU A CD2   1 
ATOM   1967  N  N     . ARG A 1 377 ? 51.049  1.716   35.329  1.00 71.73  ? 377 ARG A N     1 
ATOM   1968  C  CA    . ARG A 1 377 ? 51.958  2.100   34.257  1.00 60.24  ? 377 ARG A CA    1 
ATOM   1969  C  C     . ARG A 1 377 ? 51.559  3.522   33.825  1.00 56.46  ? 377 ARG A C     1 
ATOM   1970  O  O     . ARG A 1 377 ? 50.398  3.795   33.548  1.00 71.97  ? 377 ARG A O     1 
ATOM   1971  C  CB    . ARG A 1 377 ? 51.917  0.999   33.193  1.00 63.05  ? 377 ARG A CB    1 
ATOM   1972  C  CG    . ARG A 1 377 ? 53.205  0.761   32.434  1.00 83.83  ? 377 ARG A CG    1 
ATOM   1973  C  CD    . ARG A 1 377 ? 52.970  -0.256  31.337  1.00 93.98  ? 377 ARG A CD    1 
ATOM   1974  N  NE    . ARG A 1 377 ? 51.541  -0.468  31.122  1.00 103.30 ? 377 ARG A NE    1 
ATOM   1975  C  CZ    . ARG A 1 377 ? 50.935  -0.297  29.954  1.00 112.33 ? 377 ARG A CZ    1 
ATOM   1976  N  NH1   . ARG A 1 377 ? 49.634  -0.497  29.831  1.00 111.10 ? 377 ARG A NH1   1 
ATOM   1977  N  NH2   . ARG A 1 377 ? 51.645  0.085   28.900  1.00 122.89 ? 377 ARG A NH2   1 
ATOM   1978  N  N     . LEU A 1 378 ? 52.506  4.449   33.877  1.00 64.71  ? 378 LEU A N     1 
ATOM   1979  C  CA    . LEU A 1 378 ? 52.283  5.851   33.483  1.00 63.64  ? 378 LEU A CA    1 
ATOM   1980  C  C     . LEU A 1 378 ? 52.890  6.191   32.116  1.00 72.97  ? 378 LEU A C     1 
ATOM   1981  O  O     . LEU A 1 378 ? 54.060  5.942   31.853  1.00 84.41  ? 378 LEU A O     1 
ATOM   1982  C  CB    . LEU A 1 378 ? 52.795  6.824   34.563  1.00 56.16  ? 378 LEU A CB    1 
ATOM   1983  C  CG    . LEU A 1 378 ? 52.191  6.706   35.986  1.00 51.75  ? 378 LEU A CG    1 
ATOM   1984  C  CD1   . LEU A 1 378 ? 52.687  7.806   36.923  1.00 45.86  ? 378 LEU A CD1   1 
ATOM   1985  C  CD2   . LEU A 1 378 ? 50.666  6.690   35.971  1.00 56.23  ? 378 LEU A CD2   1 
ATOM   1986  N  N     . HIS A 1 379 ? 52.068  6.757   31.242  1.00 70.93  ? 379 HIS A N     1 
ATOM   1987  C  CA    . HIS A 1 379 ? 52.484  7.108   29.888  1.00 66.96  ? 379 HIS A CA    1 
ATOM   1988  C  C     . HIS A 1 379 ? 52.456  8.618   29.696  1.00 64.05  ? 379 HIS A C     1 
ATOM   1989  O  O     . HIS A 1 379 ? 51.809  9.347   30.462  1.00 62.77  ? 379 HIS A O     1 
ATOM   1990  C  CB    . HIS A 1 379 ? 51.533  6.474   28.871  1.00 62.02  ? 379 HIS A CB    1 
ATOM   1991  C  CG    . HIS A 1 379 ? 51.544  4.974   28.849  1.00 75.97  ? 379 HIS A CG    1 
ATOM   1992  N  ND1   . HIS A 1 379 ? 51.994  4.241   27.772  1.00 81.78  ? 379 HIS A ND1   1 
ATOM   1993  C  CD2   . HIS A 1 379 ? 51.216  4.070   29.806  1.00 76.16  ? 379 HIS A CD2   1 
ATOM   1994  C  CE1   . HIS A 1 379 ? 51.879  2.952   28.042  1.00 73.11  ? 379 HIS A CE1   1 
ATOM   1995  N  NE2   . HIS A 1 379 ? 51.423  2.821   29.275  1.00 66.09  ? 379 HIS A NE2   1 
ATOM   1996  N  N     . THR A 1 380 ? 53.173  9.080   28.678  1.00 62.07  ? 380 THR A N     1 
ATOM   1997  C  CA    . THR A 1 380 ? 53.120  10.486  28.294  1.00 69.01  ? 380 THR A CA    1 
ATOM   1998  C  C     . THR A 1 380 ? 52.746  10.576  26.832  1.00 75.41  ? 380 THR A C     1 
ATOM   1999  O  O     . THR A 1 380 ? 53.376  9.948   25.975  1.00 75.39  ? 380 THR A O     1 
ATOM   2000  C  CB    . THR A 1 380 ? 54.428  11.215  28.524  1.00 64.48  ? 380 THR A CB    1 
ATOM   2001  O  OG1   . THR A 1 380 ? 54.700  11.221  29.925  1.00 71.03  ? 380 THR A OG1   1 
ATOM   2002  C  CG2   . THR A 1 380 ? 54.279  12.646  28.109  1.00 62.62  ? 380 THR A CG2   1 
ATOM   2003  N  N     . LEU A 1 381 ? 51.718  11.372  26.548  1.00 71.18  ? 381 LEU A N     1 
ATOM   2004  C  CA    . LEU A 1 381 ? 51.393  11.615  25.170  1.00 72.68  ? 381 LEU A CA    1 
ATOM   2005  C  C     . LEU A 1 381 ? 52.173  12.762  24.584  1.00 84.85  ? 381 LEU A C     1 
ATOM   2006  O  O     . LEU A 1 381 ? 52.006  13.925  24.976  1.00 101.06 ? 381 LEU A O     1 
ATOM   2007  C  CB    . LEU A 1 381 ? 49.897  11.942  25.078  1.00 71.64  ? 381 LEU A CB    1 
ATOM   2008  C  CG    . LEU A 1 381 ? 48.915  10.778  25.203  1.00 67.76  ? 381 LEU A CG    1 
ATOM   2009  C  CD1   . LEU A 1 381 ? 47.523  11.345  25.304  1.00 80.02  ? 381 LEU A CD1   1 
ATOM   2010  C  CD2   . LEU A 1 381 ? 48.998  9.840   24.043  1.00 55.14  ? 381 LEU A CD2   1 
ATOM   2011  N  N     . HIS A 1 382 ? 53.037  12.427  23.639  1.00 79.14  ? 382 HIS A N     1 
ATOM   2012  C  CA    . HIS A 1 382 ? 53.867  13.422  23.005  1.00 70.42  ? 382 HIS A CA    1 
ATOM   2013  C  C     . HIS A 1 382 ? 53.126  13.889  21.761  1.00 60.18  ? 382 HIS A C     1 
ATOM   2014  O  O     . HIS A 1 382 ? 53.576  13.679  20.633  1.00 65.06  ? 382 HIS A O     1 
ATOM   2015  C  CB    . HIS A 1 382 ? 55.281  12.933  22.731  1.00 72.36  ? 382 HIS A CB    1 
ATOM   2016  C  CG    . HIS A 1 382 ? 56.017  12.508  23.964  1.00 78.46  ? 382 HIS A CG    1 
ATOM   2017  N  ND1   . HIS A 1 382 ? 56.370  11.200  24.223  1.00 78.16  ? 382 HIS A ND1   1 
ATOM   2018  C  CD2   . HIS A 1 382 ? 56.476  13.235  25.013  1.00 79.32  ? 382 HIS A CD2   1 
ATOM   2019  C  CE1   . HIS A 1 382 ? 57.010  11.138  25.379  1.00 72.21  ? 382 HIS A CE1   1 
ATOM   2020  N  NE2   . HIS A 1 382 ? 57.091  12.360  25.877  1.00 73.88  ? 382 HIS A NE2   1 
ATOM   2021  N  N     . ALA A 1 383 ? 51.937  14.432  21.959  1.00 45.33  ? 383 ALA A N     1 
ATOM   2022  C  CA    . ALA A 1 383 ? 51.211  14.934  20.844  1.00 42.98  ? 383 ALA A CA    1 
ATOM   2023  C  C     . ALA A 1 383 ? 50.387  16.086  21.336  1.00 58.72  ? 383 ALA A C     1 
ATOM   2024  O  O     . ALA A 1 383 ? 50.144  16.208  22.541  1.00 63.36  ? 383 ALA A O     1 
ATOM   2025  C  CB    . ALA A 1 383 ? 50.348  13.874  20.248  1.00 38.95  ? 383 ALA A CB    1 
ATOM   2026  N  N     . HIS A 1 384 ? 50.023  16.953  20.427  1.00 54.22  ? 384 HIS A N     1 
ATOM   2027  C  CA    . HIS A 1 384 ? 49.270  18.097  20.792  1.00 59.59  ? 384 HIS A CA    1 
ATOM   2028  C  C     . HIS A 1 384 ? 48.045  18.024  19.958  1.00 67.98  ? 384 HIS A C     1 
ATOM   2029  O  O     . HIS A 1 384 ? 48.078  17.453  18.896  1.00 65.28  ? 384 HIS A O     1 
ATOM   2030  C  CB    . HIS A 1 384 ? 50.063  19.334  20.466  1.00 57.59  ? 384 HIS A CB    1 
ATOM   2031  C  CG    . HIS A 1 384 ? 49.627  20.536  21.214  1.00 58.16  ? 384 HIS A CG    1 
ATOM   2032  N  ND1   . HIS A 1 384 ? 48.663  21.389  20.747  1.00 72.09  ? 384 HIS A ND1   1 
ATOM   2033  C  CD2   . HIS A 1 384 ? 50.024  21.028  22.400  1.00 52.27  ? 384 HIS A CD2   1 
ATOM   2034  C  CE1   . HIS A 1 384 ? 48.483  22.359  21.617  1.00 78.34  ? 384 HIS A CE1   1 
ATOM   2035  N  NE2   . HIS A 1 384 ? 49.300  22.164  22.629  1.00 66.39  ? 384 HIS A NE2   1 
ATOM   2036  N  N     . PRO A 1 385 ? 46.914  18.608  20.494  1.00 64.58  ? 385 PRO A N     1 
ATOM   2037  C  CA    . PRO A 1 385 ? 45.731  18.514  19.642  1.00 67.49  ? 385 PRO A CA    1 
ATOM   2038  C  C     . PRO A 1 385 ? 45.879  19.422  18.465  1.00 75.92  ? 385 PRO A C     1 
ATOM   2039  O  O     . PRO A 1 385 ? 45.138  19.302  17.511  1.00 82.61  ? 385 PRO A O     1 
ATOM   2040  C  CB    . PRO A 1 385 ? 44.621  19.047  20.528  1.00 30.00  ? 385 PRO A CB    1 
ATOM   2041  C  CG    . PRO A 1 385 ? 45.283  20.069  21.329  1.00 30.00  ? 385 PRO A CG    1 
ATOM   2042  C  CD    . PRO A 1 385 ? 46.475  19.307  21.775  1.00 30.00  ? 385 PRO A CD    1 
ATOM   2043  N  N     . SER A 1 386 ? 46.833  20.331  18.544  1.00 75.76  ? 386 SER A N     1 
ATOM   2044  C  CA    . SER A 1 386 ? 47.068  21.279  17.485  1.00 71.51  ? 386 SER A CA    1 
ATOM   2045  C  C     . SER A 1 386 ? 47.638  20.607  16.275  1.00 73.87  ? 386 SER A C     1 
ATOM   2046  O  O     . SER A 1 386 ? 47.884  21.239  15.280  1.00 74.50  ? 386 SER A O     1 
ATOM   2047  C  CB    . SER A 1 386 ? 47.997  22.356  17.959  1.00 67.29  ? 386 SER A CB    1 
ATOM   2048  N  N     . GLN A 1 387 ? 47.847  19.312  16.346  1.00 66.85  ? 387 GLN A N     1 
ATOM   2049  C  CA    . GLN A 1 387 ? 48.384  18.633  15.177  1.00 42.38  ? 387 GLN A CA    1 
ATOM   2050  C  C     . GLN A 1 387 ? 47.251  17.954  14.426  1.00 58.47  ? 387 GLN A C     1 
ATOM   2051  O  O     . GLN A 1 387 ? 47.484  17.274  13.412  1.00 52.24  ? 387 GLN A O     1 
ATOM   2052  C  CB    . GLN A 1 387 ? 49.314  17.507  15.565  1.00 33.64  ? 387 GLN A CB    1 
ATOM   2053  C  CG    . GLN A 1 387 ? 50.462  17.812  16.405  1.00 60.65  ? 387 GLN A CG    1 
ATOM   2054  C  CD    . GLN A 1 387 ? 51.039  16.529  16.989  1.00 65.52  ? 387 GLN A CD    1 
ATOM   2055  O  OE1   . GLN A 1 387 ? 50.837  16.242  18.154  1.00 75.48  ? 387 GLN A OE1   1 
ATOM   2056  N  NE2   . GLN A 1 387 ? 51.735  15.753  16.182  1.00 61.12  ? 387 GLN A NE2   1 
ATOM   2057  N  N     . GLY A 1 388 ? 46.021  18.248  14.825  1.00 67.48  ? 388 GLY A N     1 
ATOM   2058  C  CA    . GLY A 1 388 ? 44.853  17.755  14.118  1.00 67.88  ? 388 GLY A CA    1 
ATOM   2059  C  C     . GLY A 1 388 ? 44.736  16.230  14.128  1.00 60.03  ? 388 GLY A C     1 
ATOM   2060  O  O     . GLY A 1 388 ? 44.821  15.638  15.202  1.00 58.71  ? 388 GLY A O     1 
ATOM   2061  N  N     . LEU A 1 389 ? 44.830  15.563  12.980  1.00 53.18  ? 389 LEU A N     1 
ATOM   2062  C  CA    . LEU A 1 389 ? 44.506  14.124  12.907  1.00 54.26  ? 389 LEU A CA    1 
ATOM   2063  C  C     . LEU A 1 389 ? 45.640  13.308  13.394  1.00 61.49  ? 389 LEU A C     1 
ATOM   2064  O  O     . LEU A 1 389 ? 45.427  12.211  13.907  1.00 70.44  ? 389 LEU A O     1 
ATOM   2065  C  CB    . LEU A 1 389 ? 44.047  13.622  11.521  1.00 53.01  ? 389 LEU A CB    1 
ATOM   2066  C  CG    . LEU A 1 389 ? 42.889  14.203  10.715  1.00 56.66  ? 389 LEU A CG    1 
ATOM   2067  C  CD1   . LEU A 1 389 ? 42.599  13.442  9.438   1.00 53.61  ? 389 LEU A CD1   1 
ATOM   2068  C  CD2   . LEU A 1 389 ? 41.702  13.846  11.605  1.00 42.65  ? 389 LEU A CD2   1 
ATOM   2069  N  N     . ALA A 1 390 ? 46.852  13.812  13.244  1.00 63.36  ? 390 ALA A N     1 
ATOM   2070  C  CA    . ALA A 1 390 ? 47.966  13.075  13.775  1.00 62.11  ? 390 ALA A CA    1 
ATOM   2071  C  C     . ALA A 1 390 ? 47.804  12.955  15.284  1.00 69.88  ? 390 ALA A C     1 
ATOM   2072  O  O     . ALA A 1 390 ? 48.087  11.885  15.861  1.00 73.17  ? 390 ALA A O     1 
ATOM   2073  C  CB    . ALA A 1 390 ? 49.256  13.802  13.464  1.00 75.61  ? 390 ALA A CB    1 
ATOM   2074  N  N     . PHE A 1 391 ? 47.157  13.947  15.895  1.00 67.35  ? 391 PHE A N     1 
ATOM   2075  C  CA    . PHE A 1 391 ? 46.875  13.840  17.313  1.00 66.44  ? 391 PHE A CA    1 
ATOM   2076  C  C     . PHE A 1 391 ? 45.930  12.665  17.597  1.00 52.95  ? 391 PHE A C     1 
ATOM   2077  O  O     . PHE A 1 391 ? 46.242  11.826  18.445  1.00 59.54  ? 391 PHE A O     1 
ATOM   2078  C  CB    . PHE A 1 391 ? 46.317  15.166  17.876  1.00 69.20  ? 391 PHE A CB    1 
ATOM   2079  C  CG    . PHE A 1 391 ? 46.007  15.101  19.336  1.00 64.59  ? 391 PHE A CG    1 
ATOM   2080  C  CD1   . PHE A 1 391 ? 47.041  15.005  20.249  1.00 66.23  ? 391 PHE A CD1   1 
ATOM   2081  C  CD2   . PHE A 1 391 ? 44.703  15.133  19.802  1.00 62.79  ? 391 PHE A CD2   1 
ATOM   2082  C  CE1   . PHE A 1 391 ? 46.783  14.918  21.607  1.00 67.89  ? 391 PHE A CE1   1 
ATOM   2083  C  CE2   . PHE A 1 391 ? 44.432  15.047  21.164  1.00 59.76  ? 391 PHE A CE2   1 
ATOM   2084  C  CZ    . PHE A 1 391 ? 45.472  14.941  22.065  1.00 63.61  ? 391 PHE A CZ    1 
ATOM   2085  N  N     . ARG A 1 392 ? 44.859  12.525  16.819  1.00 46.46  ? 392 ARG A N     1 
ATOM   2086  C  CA    . ARG A 1 392 ? 43.988  11.367  17.001  1.00 54.80  ? 392 ARG A CA    1 
ATOM   2087  C  C     . ARG A 1 392 ? 44.765  10.048  16.838  1.00 64.61  ? 392 ARG A C     1 
ATOM   2088  O  O     . ARG A 1 392 ? 44.601  9.127   17.665  1.00 59.13  ? 392 ARG A O     1 
ATOM   2089  C  CB    . ARG A 1 392 ? 42.784  11.437  16.070  1.00 58.81  ? 392 ARG A CB    1 
ATOM   2090  C  CG    . ARG A 1 392 ? 41.812  10.325  16.324  1.00 61.85  ? 392 ARG A CG    1 
ATOM   2091  C  CD    . ARG A 1 392 ? 40.407  10.575  15.853  1.00 61.34  ? 392 ARG A CD    1 
ATOM   2092  N  NE    . ARG A 1 392 ? 39.676  9.344   16.094  1.00 58.76  ? 392 ARG A NE    1 
ATOM   2093  C  CZ    . ARG A 1 392 ? 38.420  9.113   15.752  1.00 54.14  ? 392 ARG A CZ    1 
ATOM   2094  N  NH1   . ARG A 1 392 ? 37.915  7.933   16.035  1.00 32.04  ? 392 ARG A NH1   1 
ATOM   2095  N  NH2   . ARG A 1 392 ? 37.688  10.033  15.125  1.00 54.93  ? 392 ARG A NH2   1 
ATOM   2096  N  N     . GLU A 1 393 ? 45.705  9.998   15.893  1.00 67.09  ? 393 GLU A N     1 
ATOM   2097  C  CA    . GLU A 1 393 ? 46.536  8.800   15.791  1.00 59.13  ? 393 GLU A CA    1 
ATOM   2098  C  C     . GLU A 1 393 ? 47.295  8.428   17.030  1.00 57.70  ? 393 GLU A C     1 
ATOM   2099  O  O     . GLU A 1 393 ? 47.190  7.268   17.453  1.00 50.03  ? 393 GLU A O     1 
ATOM   2100  C  CB    . GLU A 1 393 ? 47.514  8.912   14.623  1.00 56.01  ? 393 GLU A CB    1 
ATOM   2101  C  CG    . GLU A 1 393 ? 48.232  7.583   14.387  1.00 62.65  ? 393 GLU A CG    1 
ATOM   2102  C  CD    . GLU A 1 393 ? 47.508  6.455   13.773  1.00 65.73  ? 393 GLU A CD    1 
ATOM   2103  O  OE1   . GLU A 1 393 ? 46.308  6.560   13.494  1.00 70.48  ? 393 GLU A OE1   1 
ATOM   2104  O  OE2   . GLU A 1 393 ? 48.167  5.399   13.653  1.00 70.78  ? 393 GLU A OE2   1 
ATOM   2105  N  N     . ALA A 1 394 ? 47.920  9.412   17.676  1.00 48.95  ? 394 ALA A N     1 
ATOM   2106  C  CA    . ALA A 1 394 ? 48.635  9.138   18.899  1.00 40.94  ? 394 ALA A CA    1 
ATOM   2107  C  C     . ALA A 1 394 ? 47.666  8.619   19.969  1.00 52.34  ? 394 ALA A C     1 
ATOM   2108  O  O     . ALA A 1 394 ? 47.959  7.622   20.625  1.00 51.78  ? 394 ALA A O     1 
ATOM   2109  C  CB    . ALA A 1 394 ? 49.326  10.404  19.396  1.00 32.07  ? 394 ALA A CB    1 
ATOM   2110  N  N     . LEU A 1 395 ? 46.472  9.202   20.043  1.00 47.60  ? 395 LEU A N     1 
ATOM   2111  C  CA    . LEU A 1 395 ? 45.453  8.714   20.958  1.00 53.19  ? 395 LEU A CA    1 
ATOM   2112  C  C     . LEU A 1 395 ? 45.187  7.251   20.711  1.00 53.10  ? 395 LEU A C     1 
ATOM   2113  O  O     . LEU A 1 395 ? 45.238  6.435   21.643  1.00 55.39  ? 395 LEU A O     1 
ATOM   2114  C  CB    . LEU A 1 395 ? 44.165  9.527   20.785  1.00 60.74  ? 395 LEU A CB    1 
ATOM   2115  C  CG    . LEU A 1 395 ? 44.258  10.954  21.300  1.00 65.53  ? 395 LEU A CG    1 
ATOM   2116  C  CD1   . LEU A 1 395 ? 42.926  11.660  21.232  1.00 64.69  ? 395 LEU A CD1   1 
ATOM   2117  C  CD2   . LEU A 1 395 ? 44.717  10.845  22.758  1.00 68.29  ? 395 LEU A CD2   1 
ATOM   2118  N  N     . ARG A 1 396 ? 44.949  6.910   19.449  1.00 45.78  ? 396 ARG A N     1 
ATOM   2119  C  CA    . ARG A 1 396 ? 44.680  5.524   19.130  1.00 41.45  ? 396 ARG A CA    1 
ATOM   2120  C  C     . ARG A 1 396 ? 45.785  4.589   19.519  1.00 58.23  ? 396 ARG A C     1 
ATOM   2121  O  O     . ARG A 1 396 ? 45.557  3.619   20.266  1.00 64.66  ? 396 ARG A O     1 
ATOM   2122  C  CB    . ARG A 1 396 ? 44.400  5.432   17.614  1.00 42.10  ? 396 ARG A CB    1 
ATOM   2123  C  CG    . ARG A 1 396 ? 43.831  4.142   17.053  1.00 34.88  ? 396 ARG A CG    1 
ATOM   2124  C  CD    . ARG A 1 396 ? 44.230  3.895   15.570  1.00 79.87  ? 396 ARG A CD    1 
ATOM   2125  N  NE    . ARG A 1 396 ? 45.658  3.893   15.297  1.00 89.43  ? 396 ARG A NE    1 
ATOM   2126  C  CZ    . ARG A 1 396 ? 46.426  2.814   15.410  1.00 94.15  ? 396 ARG A CZ    1 
ATOM   2127  N  NH1   . ARG A 1 396 ? 45.901  1.669   15.828  1.00 87.49  ? 396 ARG A NH1   1 
ATOM   2128  N  NH2   . ARG A 1 396 ? 47.727  2.885   15.147  1.00 98.39  ? 396 ARG A NH2   1 
ATOM   2129  N  N     . LYS A 1 397 ? 46.999  5.039   19.255  1.00 53.32  ? 397 LYS A N     1 
ATOM   2130  C  CA    . LYS A 1 397 ? 48.169  4.285   19.618  1.00 54.99  ? 397 LYS A CA    1 
ATOM   2131  C  C     . LYS A 1 397 ? 48.190  4.065   21.147  1.00 65.43  ? 397 LYS A C     1 
ATOM   2132  O  O     . LYS A 1 397 ? 48.283  2.932   21.642  1.00 61.02  ? 397 LYS A O     1 
ATOM   2133  C  CB    . LYS A 1 397 ? 49.358  5.076   19.110  1.00 65.82  ? 397 LYS A CB    1 
ATOM   2134  C  CG    . LYS A 1 397 ? 50.033  4.436   17.925  1.00 77.27  ? 397 LYS A CG    1 
ATOM   2135  C  CD    . LYS A 1 397 ? 50.908  5.481   17.235  1.00 95.66  ? 397 LYS A CD    1 
ATOM   2136  C  CE    . LYS A 1 397 ? 51.538  5.014   15.939  1.00 99.23  ? 397 LYS A CE    1 
ATOM   2137  N  NZ    . LYS A 1 397 ? 52.272  6.118   15.247  1.00 104.56 ? 397 LYS A NZ    1 
ATOM   2138  N  N     . ALA A 1 398 ? 48.002  5.126   21.900  1.00 67.31  ? 398 ALA A N     1 
ATOM   2139  C  CA    . ALA A 1 398 ? 47.985  5.031   23.338  1.00 51.83  ? 398 ALA A CA    1 
ATOM   2140  C  C     . ALA A 1 398 ? 46.960  4.063   23.851  1.00 53.80  ? 398 ALA A C     1 
ATOM   2141  O  O     . ALA A 1 398 ? 47.204  3.328   24.764  1.00 45.19  ? 398 ALA A O     1 
ATOM   2142  C  CB    . ALA A 1 398 ? 47.738  6.395   23.928  1.00 53.55  ? 398 ALA A CB    1 
ATOM   2143  N  N     . LYS A 1 399 ? 45.792  4.085   23.262  1.00 60.71  ? 399 LYS A N     1 
ATOM   2144  C  CA    . LYS A 1 399 ? 44.731  3.223   23.696  1.00 54.22  ? 399 LYS A CA    1 
ATOM   2145  C  C     . LYS A 1 399 ? 45.026  1.777   23.416  1.00 61.20  ? 399 LYS A C     1 
ATOM   2146  O  O     . LYS A 1 399 ? 44.617  0.919   24.153  1.00 59.93  ? 399 LYS A O     1 
ATOM   2147  C  CB    . LYS A 1 399 ? 43.454  3.640   23.029  1.00 30.00  ? 399 LYS A CB    1 
ATOM   2148  C  CG    . LYS A 1 399 ? 42.232  3.363   23.841  1.00 30.00  ? 399 LYS A CG    1 
ATOM   2149  C  CD    . LYS A 1 399 ? 41.542  2.184   23.244  1.00 30.00  ? 399 LYS A CD    1 
ATOM   2150  C  CE    . LYS A 1 399 ? 40.466  1.700   24.184  1.00 30.00  ? 399 LYS A CE    1 
ATOM   2151  N  NZ    . LYS A 1 399 ? 40.975  1.668   25.573  1.00 30.00  ? 399 LYS A NZ    1 
ATOM   2152  N  N     . GLU A 1 400 ? 45.739  1.499   22.342  1.00 74.32  ? 400 GLU A N     1 
ATOM   2153  C  CA    . GLU A 1 400 ? 46.078  0.130   22.021  1.00 67.80  ? 400 GLU A CA    1 
ATOM   2154  C  C     . GLU A 1 400 ? 47.085  -0.368  23.015  1.00 66.37  ? 400 GLU A C     1 
ATOM   2155  O  O     . GLU A 1 400 ? 47.043  -1.503  23.415  1.00 70.12  ? 400 GLU A O     1 
ATOM   2156  C  CB    . GLU A 1 400 ? 46.645  0.013   20.622  1.00 58.17  ? 400 GLU A CB    1 
ATOM   2157  C  CG    . GLU A 1 400 ? 46.298  -1.303  19.967  1.00 76.90  ? 400 GLU A CG    1 
ATOM   2158  C  CD    . GLU A 1 400 ? 47.255  -1.701  18.862  1.00 104.25 ? 400 GLU A CD    1 
ATOM   2159  O  OE1   . GLU A 1 400 ? 48.116  -0.892  18.492  1.00 120.01 ? 400 GLU A OE1   1 
ATOM   2160  O  OE2   . GLU A 1 400 ? 47.145  -2.832  18.354  1.00 108.56 ? 400 GLU A OE2   1 
ATOM   2161  N  N     . GLU A 1 401 ? 47.992  0.500   23.419  1.00 65.16  ? 401 GLU A N     1 
ATOM   2162  C  CA    . GLU A 1 401 ? 49.018  0.136   24.365  1.00 60.92  ? 401 GLU A CA    1 
ATOM   2163  C  C     . GLU A 1 401 ? 48.459  -0.109  25.719  1.00 62.78  ? 401 GLU A C     1 
ATOM   2164  O  O     . GLU A 1 401 ? 49.121  -0.638  26.572  1.00 81.04  ? 401 GLU A O     1 
ATOM   2165  C  CB    . GLU A 1 401 ? 50.071  1.212   24.464  1.00 80.96  ? 401 GLU A CB    1 
ATOM   2166  C  CG    . GLU A 1 401 ? 50.982  1.305   23.259  1.00 103.50 ? 401 GLU A CG    1 
ATOM   2167  C  CD    . GLU A 1 401 ? 51.958  2.454   23.356  1.00 114.79 ? 401 GLU A CD    1 
ATOM   2168  O  OE1   . GLU A 1 401 ? 52.251  2.888   24.484  1.00 111.52 ? 401 GLU A OE1   1 
ATOM   2169  O  OE2   . GLU A 1 401 ? 52.433  2.915   22.298  1.00 119.73 ? 401 GLU A OE2   1 
ATOM   2170  N  N     . GLY A 1 402 ? 47.233  0.289   25.940  1.00 63.48  ? 402 GLY A N     1 
ATOM   2171  C  CA    . GLY A 1 402 ? 46.622  0.016   27.235  1.00 64.95  ? 402 GLY A CA    1 
ATOM   2172  C  C     . GLY A 1 402 ? 46.174  1.217   28.058  1.00 65.87  ? 402 GLY A C     1 
ATOM   2173  O  O     . GLY A 1 402 ? 45.602  1.059   29.135  1.00 64.90  ? 402 GLY A O     1 
ATOM   2174  N  N     . VAL A 1 403 ? 46.396  2.427   27.566  1.00 65.23  ? 403 VAL A N     1 
ATOM   2175  C  CA    . VAL A 1 403 ? 45.986  3.584   28.351  1.00 60.65  ? 403 VAL A CA    1 
ATOM   2176  C  C     . VAL A 1 403 ? 44.465  3.570   28.540  1.00 65.79  ? 403 VAL A C     1 
ATOM   2177  O  O     . VAL A 1 403 ? 43.703  3.285   27.610  1.00 63.12  ? 403 VAL A O     1 
ATOM   2178  C  CB    . VAL A 1 403 ? 46.440  4.879   27.708  1.00 56.37  ? 403 VAL A CB    1 
ATOM   2179  C  CG1   . VAL A 1 403 ? 45.862  6.062   28.427  1.00 64.28  ? 403 VAL A CG1   1 
ATOM   2180  C  CG2   . VAL A 1 403 ? 47.956  4.913   27.671  1.00 64.83  ? 403 VAL A CG2   1 
ATOM   2181  N  N     . GLN A 1 404 ? 44.041  3.831   29.772  1.00 64.67  ? 404 GLN A N     1 
ATOM   2182  C  CA    . GLN A 1 404 ? 42.639  3.734   30.147  1.00 61.88  ? 404 GLN A CA    1 
ATOM   2183  C  C     . GLN A 1 404 ? 41.967  5.071   30.334  1.00 52.30  ? 404 GLN A C     1 
ATOM   2184  O  O     . GLN A 1 404 ? 40.739  5.164   30.231  1.00 55.21  ? 404 GLN A O     1 
ATOM   2185  C  CB    . GLN A 1 404 ? 42.517  2.911   31.405  1.00 68.50  ? 404 GLN A CB    1 
ATOM   2186  C  CG    . GLN A 1 404 ? 42.637  1.444   31.115  1.00 67.07  ? 404 GLN A CG    1 
ATOM   2187  C  CD    . GLN A 1 404 ? 42.711  0.635   32.363  1.00 69.98  ? 404 GLN A CD    1 
ATOM   2188  O  OE1   . GLN A 1 404 ? 43.459  0.959   33.283  1.00 61.01  ? 404 GLN A OE1   1 
ATOM   2189  N  NE2   . GLN A 1 404 ? 41.909  -0.417  32.424  1.00 83.89  ? 404 GLN A NE2   1 
ATOM   2190  N  N     . ALA A 1 405 ? 42.768  6.072   30.702  1.00 44.20  ? 405 ALA A N     1 
ATOM   2191  C  CA    . ALA A 1 405 ? 42.284  7.426   30.933  1.00 41.84  ? 405 ALA A CA    1 
ATOM   2192  C  C     . ALA A 1 405 ? 43.430  8.425   30.776  1.00 49.31  ? 405 ALA A C     1 
ATOM   2193  O  O     . ALA A 1 405 ? 44.604  8.046   30.861  1.00 49.64  ? 405 ALA A O     1 
ATOM   2194  C  CB    . ALA A 1 405 ? 41.633  7.536   32.336  1.00 36.15  ? 405 ALA A CB    1 
ATOM   2195  N  N     . VAL A 1 406 ? 43.103  9.698   30.553  1.00 47.72  ? 406 VAL A N     1 
ATOM   2196  C  CA    . VAL A 1 406 ? 44.147  10.700  30.387  1.00 40.35  ? 406 VAL A CA    1 
ATOM   2197  C  C     . VAL A 1 406 ? 44.025  11.849  31.367  1.00 46.09  ? 406 VAL A C     1 
ATOM   2198  O  O     . VAL A 1 406 ? 42.954  12.401  31.557  1.00 64.41  ? 406 VAL A O     1 
ATOM   2199  C  CB    . VAL A 1 406 ? 44.086  11.258  28.926  1.00 37.77  ? 406 VAL A CB    1 
ATOM   2200  C  CG1   . VAL A 1 406 ? 44.914  12.535  28.727  1.00 36.47  ? 406 VAL A CG1   1 
ATOM   2201  C  CG2   . VAL A 1 406 ? 44.507  10.192  27.944  1.00 39.68  ? 406 VAL A CG2   1 
ATOM   2202  N  N     . LEU A 1 407 ? 45.159  12.263  31.918  1.00 47.31  ? 407 LEU A N     1 
ATOM   2203  C  CA    . LEU A 1 407 ? 45.212  13.435  32.765  1.00 50.06  ? 407 LEU A CA    1 
ATOM   2204  C  C     . LEU A 1 407 ? 45.686  14.611  31.905  1.00 46.06  ? 407 LEU A C     1 
ATOM   2205  O  O     . LEU A 1 407 ? 46.760  14.559  31.322  1.00 59.56  ? 407 LEU A O     1 
ATOM   2206  C  CB    . LEU A 1 407 ? 46.140  13.191  33.977  1.00 47.36  ? 407 LEU A CB    1 
ATOM   2207  C  CG    . LEU A 1 407 ? 46.322  14.347  34.985  1.00 52.68  ? 407 LEU A CG    1 
ATOM   2208  C  CD1   . LEU A 1 407 ? 45.027  14.770  35.651  1.00 57.85  ? 407 LEU A CD1   1 
ATOM   2209  C  CD2   . LEU A 1 407 ? 47.376  14.035  36.024  1.00 47.98  ? 407 LEU A CD2   1 
ATOM   2210  N  N     . VAL A 1 408 ? 44.887  15.669  31.841  1.00 44.10  ? 408 VAL A N     1 
ATOM   2211  C  CA    . VAL A 1 408 ? 45.232  16.833  31.039  1.00 56.51  ? 408 VAL A CA    1 
ATOM   2212  C  C     . VAL A 1 408 ? 45.626  18.047  31.887  1.00 57.93  ? 408 VAL A C     1 
ATOM   2213  O  O     . VAL A 1 408 ? 44.799  18.642  32.581  1.00 64.20  ? 408 VAL A O     1 
ATOM   2214  C  CB    . VAL A 1 408 ? 44.039  17.193  30.073  1.00 39.91  ? 408 VAL A CB    1 
ATOM   2215  C  CG1   . VAL A 1 408 ? 44.359  18.303  29.128  1.00 38.97  ? 408 VAL A CG1   1 
ATOM   2216  C  CG2   . VAL A 1 408 ? 43.623  15.984  29.315  1.00 48.52  ? 408 VAL A CG2   1 
ATOM   2217  N  N     . LEU A 1 409 ? 46.904  18.398  31.817  1.00 49.18  ? 409 LEU A N     1 
ATOM   2218  C  CA    . LEU A 1 409 ? 47.429  19.594  32.472  1.00 58.59  ? 409 LEU A CA    1 
ATOM   2219  C  C     . LEU A 1 409 ? 47.406  20.783  31.542  1.00 62.10  ? 409 LEU A C     1 
ATOM   2220  O  O     . LEU A 1 409 ? 48.076  20.803  30.516  1.00 47.78  ? 409 LEU A O     1 
ATOM   2221  C  CB    . LEU A 1 409 ? 48.851  19.402  33.027  1.00 59.84  ? 409 LEU A CB    1 
ATOM   2222  C  CG    . LEU A 1 409 ? 49.092  18.361  34.104  1.00 61.03  ? 409 LEU A CG    1 
ATOM   2223  C  CD1   . LEU A 1 409 ? 50.506  18.406  34.557  1.00 58.35  ? 409 LEU A CD1   1 
ATOM   2224  C  CD2   . LEU A 1 409 ? 48.207  18.756  35.286  1.00 61.71  ? 409 LEU A CD2   1 
ATOM   2225  N  N     . THR A 1 410 ? 46.507  21.704  31.824  1.00 66.56  ? 410 THR A N     1 
ATOM   2226  C  CA    . THR A 1 410 ? 46.271  22.813  30.935  1.00 55.31  ? 410 THR A CA    1 
ATOM   2227  C  C     . THR A 1 410 ? 45.975  24.088  31.663  1.00 53.83  ? 410 THR A C     1 
ATOM   2228  O  O     . THR A 1 410 ? 45.450  24.077  32.773  1.00 57.92  ? 410 THR A O     1 
ATOM   2229  C  CB    . THR A 1 410 ? 45.127  22.488  29.982  1.00 58.41  ? 410 THR A CB    1 
ATOM   2230  O  OG1   . THR A 1 410 ? 44.842  23.662  29.221  1.00 53.52  ? 410 THR A OG1   1 
ATOM   2231  C  CG2   . THR A 1 410 ? 43.857  22.191  30.763  1.00 64.77  ? 410 THR A CG2   1 
ATOM   2232  N  N     . PRO A 1 411 ? 46.299  25.213  31.036  1.00 55.07  ? 411 PRO A N     1 
ATOM   2233  C  CA    . PRO A 1 411 ? 45.804  26.475  31.568  1.00 51.33  ? 411 PRO A CA    1 
ATOM   2234  C  C     . PRO A 1 411 ? 44.309  26.431  31.436  1.00 62.14  ? 411 PRO A C     1 
ATOM   2235  O  O     . PRO A 1 411 ? 43.814  25.623  30.654  1.00 72.75  ? 411 PRO A O     1 
ATOM   2236  C  CB    . PRO A 1 411 ? 46.415  27.517  30.633  1.00 45.38  ? 411 PRO A CB    1 
ATOM   2237  C  CG    . PRO A 1 411 ? 47.644  26.856  30.126  1.00 40.57  ? 411 PRO A CG    1 
ATOM   2238  C  CD    . PRO A 1 411 ? 47.297  25.417  29.974  1.00 51.60  ? 411 PRO A CD    1 
ATOM   2239  N  N     . PRO A 1 412 ? 43.590  27.249  32.201  1.00 62.86  ? 412 PRO A N     1 
ATOM   2240  C  CA    . PRO A 1 412 ? 42.131  27.192  32.117  1.00 51.25  ? 412 PRO A CA    1 
ATOM   2241  C  C     . PRO A 1 412 ? 41.636  27.327  30.682  1.00 53.17  ? 412 PRO A C     1 
ATOM   2242  O  O     . PRO A 1 412 ? 42.053  28.216  29.966  1.00 58.84  ? 412 PRO A O     1 
ATOM   2243  C  CB    . PRO A 1 412 ? 41.696  28.360  32.998  1.00 55.70  ? 412 PRO A CB    1 
ATOM   2244  C  CG    . PRO A 1 412 ? 42.817  28.432  34.050  1.00 59.63  ? 412 PRO A CG    1 
ATOM   2245  C  CD    . PRO A 1 412 ? 44.063  28.126  33.289  1.00 68.23  ? 412 PRO A CD    1 
ATOM   2246  N  N     . MET A 1 413 ? 40.734  26.432  30.291  1.00 57.45  ? 413 MET A N     1 
ATOM   2247  C  CA    . MET A 1 413 ? 40.244  26.334  28.920  1.00 53.46  ? 413 MET A CA    1 
ATOM   2248  C  C     . MET A 1 413 ? 38.847  26.960  28.857  1.00 62.45  ? 413 MET A C     1 
ATOM   2249  O  O     . MET A 1 413 ? 38.079  26.881  29.823  1.00 71.29  ? 413 MET A O     1 
ATOM   2250  C  CB    . MET A 1 413 ? 40.160  24.864  28.513  1.00 52.88  ? 413 MET A CB    1 
ATOM   2251  C  CG    . MET A 1 413 ? 41.468  24.089  28.596  1.00 38.23  ? 413 MET A CG    1 
ATOM   2252  S  SD    . MET A 1 413 ? 41.296  22.376  27.987  1.00 62.06  ? 413 MET A SD    1 
ATOM   2253  C  CE    . MET A 1 413 ? 41.219  22.639  26.235  1.00 37.63  ? 413 MET A CE    1 
ATOM   2254  N  N     . ALA A 1 414 ? 38.529  27.607  27.744  1.00 61.42  ? 414 ALA A N     1 
ATOM   2255  C  CA    . ALA A 1 414 ? 37.169  28.044  27.434  1.00 61.80  ? 414 ALA A CA    1 
ATOM   2256  C  C     . ALA A 1 414 ? 36.235  26.841  27.287  1.00 65.52  ? 414 ALA A C     1 
ATOM   2257  O  O     . ALA A 1 414 ? 36.704  25.783  26.876  1.00 68.23  ? 414 ALA A O     1 
ATOM   2258  C  CB    . ALA A 1 414 ? 37.163  28.884  26.192  1.00 59.98  ? 414 ALA A CB    1 
ATOM   2259  N  N     . TRP A 1 415 ? 34.964  26.976  27.672  1.00 63.05  ? 415 TRP A N     1 
ATOM   2260  C  CA    . TRP A 1 415 ? 33.994  25.904  27.571  1.00 50.43  ? 415 TRP A CA    1 
ATOM   2261  C  C     . TRP A 1 415 ? 34.032  25.140  26.232  1.00 54.45  ? 415 TRP A C     1 
ATOM   2262  O  O     . TRP A 1 415 ? 34.026  23.925  26.239  1.00 54.27  ? 415 TRP A O     1 
ATOM   2263  C  CB    . TRP A 1 415 ? 32.579  26.455  27.823  1.00 55.38  ? 415 TRP A CB    1 
ATOM   2264  C  CG    . TRP A 1 415 ? 32.126  26.359  29.282  1.00 76.48  ? 415 TRP A CG    1 
ATOM   2265  C  CD1   . TRP A 1 415 ? 32.003  27.409  30.164  1.00 83.08  ? 415 TRP A CD1   1 
ATOM   2266  C  CD2   . TRP A 1 415 ? 31.573  25.210  29.960  1.00 83.51  ? 415 TRP A CD2   1 
ATOM   2267  N  NE1   . TRP A 1 415 ? 31.522  26.967  31.374  1.00 78.53  ? 415 TRP A NE1   1 
ATOM   2268  C  CE2   . TRP A 1 415 ? 31.227  25.628  31.270  1.00 89.98  ? 415 TRP A CE2   1 
ATOM   2269  C  CE3   . TRP A 1 415 ? 31.371  23.876  29.604  1.00 82.29  ? 415 TRP A CE3   1 
ATOM   2270  C  CZ2   . TRP A 1 415 ? 30.690  24.749  32.221  1.00 97.40  ? 415 TRP A CZ2   1 
ATOM   2271  C  CZ3   . TRP A 1 415 ? 30.842  23.000  30.549  1.00 91.89  ? 415 TRP A CZ3   1 
ATOM   2272  C  CH2   . TRP A 1 415 ? 30.505  23.442  31.847  1.00 95.43  ? 415 TRP A CH2   1 
ATOM   2273  N  N     . GLU A 1 416 ? 34.122  25.846  25.095  1.00 54.25  ? 416 GLU A N     1 
ATOM   2274  C  CA    . GLU A 1 416 ? 34.095  25.172  23.814  1.00 61.82  ? 416 GLU A CA    1 
ATOM   2275  C  C     . GLU A 1 416 ? 35.350  24.286  23.631  1.00 62.84  ? 416 GLU A C     1 
ATOM   2276  O  O     . GLU A 1 416 ? 35.238  23.147  23.190  1.00 63.11  ? 416 GLU A O     1 
ATOM   2277  C  CB    . GLU A 1 416 ? 33.912  26.100  22.578  1.00 83.42  ? 416 GLU A CB    1 
ATOM   2278  C  CG    . GLU A 1 416 ? 34.430  27.469  22.639  1.00 99.22  ? 416 GLU A CG    1 
ATOM   2279  C  CD    . GLU A 1 416 ? 33.939  28.250  21.441  1.00 114.27 ? 416 GLU A CD    1 
ATOM   2280  O  OE1   . GLU A 1 416 ? 33.304  27.621  20.533  1.00 121.07 ? 416 GLU A OE1   1 
ATOM   2281  O  OE2   . GLU A 1 416 ? 34.129  29.482  21.374  1.00 116.59 ? 416 GLU A OE2   1 
ATOM   2282  N  N     . ASP A 1 417 ? 36.515  24.817  23.970  1.00 59.29  ? 417 ASP A N     1 
ATOM   2283  C  CA    . ASP A 1 417 ? 37.776  24.083  23.831  1.00 66.19  ? 417 ASP A CA    1 
ATOM   2284  C  C     . ASP A 1 417 ? 37.778  22.878  24.739  1.00 58.29  ? 417 ASP A C     1 
ATOM   2285  O  O     . ASP A 1 417 ? 38.237  21.775  24.379  1.00 52.86  ? 417 ASP A O     1 
ATOM   2286  C  CB    . ASP A 1 417 ? 38.888  25.049  24.148  1.00 74.90  ? 417 ASP A CB    1 
ATOM   2287  C  CG    . ASP A 1 417 ? 38.930  26.201  23.189  1.00 84.58  ? 417 ASP A CG    1 
ATOM   2288  O  OD1   . ASP A 1 417 ? 38.476  26.019  22.050  1.00 99.23  ? 417 ASP A OD1   1 
ATOM   2289  O  OD2   . ASP A 1 417 ? 39.237  27.341  23.600  1.00 83.02  ? 417 ASP A OD2   1 
ATOM   2290  N  N     . ARG A 1 418 ? 37.242  23.057  25.943  1.00 59.51  ? 418 ARG A N     1 
ATOM   2291  C  CA    . ARG A 1 418 ? 37.140  21.935  26.839  1.00 60.78  ? 418 ARG A CA    1 
ATOM   2292  C  C     . ARG A 1 418 ? 36.242  20.862  26.206  1.00 50.53  ? 418 ARG A C     1 
ATOM   2293  O  O     . ARG A 1 418 ? 36.656  19.716  26.045  1.00 37.38  ? 418 ARG A O     1 
ATOM   2294  C  CB    . ARG A 1 418 ? 36.660  22.424  28.229  1.00 66.84  ? 418 ARG A CB    1 
ATOM   2295  C  CG    . ARG A 1 418 ? 35.441  21.798  28.982  1.00 64.70  ? 418 ARG A CG    1 
ATOM   2296  C  CD    . ARG A 1 418 ? 35.741  20.610  29.688  1.00 67.52  ? 418 ARG A CD    1 
ATOM   2297  N  NE    . ARG A 1 418 ? 34.850  19.736  30.471  1.00 62.70  ? 418 ARG A NE    1 
ATOM   2298  C  CZ    . ARG A 1 418 ? 33.720  19.110  30.174  1.00 62.27  ? 418 ARG A CZ    1 
ATOM   2299  N  NH1   . ARG A 1 418 ? 33.035  19.358  29.071  1.00 75.12  ? 418 ARG A NH1   1 
ATOM   2300  N  NH2   . ARG A 1 418 ? 33.168  18.368  31.102  1.00 73.65  ? 418 ARG A NH2   1 
ATOM   2301  N  N     . ASN A 1 419 ? 35.045  21.249  25.799  1.00 56.79  ? 419 ASN A N     1 
ATOM   2302  C  CA    . ASN A 1 419 ? 34.116  20.307  25.180  1.00 60.47  ? 419 ASN A CA    1 
ATOM   2303  C  C     . ASN A 1 419 ? 34.695  19.587  23.988  1.00 58.58  ? 419 ASN A C     1 
ATOM   2304  O  O     . ASN A 1 419 ? 34.588  18.357  23.831  1.00 57.76  ? 419 ASN A O     1 
ATOM   2305  C  CB    . ASN A 1 419 ? 32.832  21.057  24.801  1.00 54.00  ? 419 ASN A CB    1 
ATOM   2306  C  CG    . ASN A 1 419 ? 32.023  21.455  26.028  1.00 50.40  ? 419 ASN A CG    1 
ATOM   2307  O  OD1   . ASN A 1 419 ? 32.309  20.975  27.120  1.00 64.40  ? 419 ASN A OD1   1 
ATOM   2308  N  ND2   . ASN A 1 419 ? 31.087  22.379  25.880  1.00 45.57  ? 419 ASN A ND2   1 
ATOM   2309  N  N     . ARG A 1 420 ? 35.329  20.345  23.131  1.00 66.95  ? 420 ARG A N     1 
ATOM   2310  C  CA    . ARG A 1 420 ? 35.923  19.776  21.952  1.00 66.05  ? 420 ARG A CA    1 
ATOM   2311  C  C     . ARG A 1 420 ? 37.021  18.751  22.293  1.00 43.62  ? 420 ARG A C     1 
ATOM   2312  O  O     . ARG A 1 420 ? 37.052  17.644  21.767  1.00 32.60  ? 420 ARG A O     1 
ATOM   2313  C  CB    . ARG A 1 420 ? 36.526  20.876  21.102  1.00 76.58  ? 420 ARG A CB    1 
ATOM   2314  C  CG    . ARG A 1 420 ? 37.314  20.268  20.061  1.00 88.60  ? 420 ARG A CG    1 
ATOM   2315  C  CD    . ARG A 1 420 ? 38.123  21.232  19.302  1.00 99.66  ? 420 ARG A CD    1 
ATOM   2316  N  NE    . ARG A 1 420 ? 39.381  20.499  19.291  1.00 112.68 ? 420 ARG A NE    1 
ATOM   2317  C  CZ    . ARG A 1 420 ? 40.416  20.675  18.506  1.00 118.16 ? 420 ARG A CZ    1 
ATOM   2318  N  NH1   . ARG A 1 420 ? 40.409  21.446  17.444  1.00 121.07 ? 420 ARG A NH1   1 
ATOM   2319  N  NH2   . ARG A 1 420 ? 41.407  19.884  18.720  1.00 119.62 ? 420 ARG A NH2   1 
ATOM   2320  N  N     . LEU A 1 421 ? 37.900  19.115  23.210  1.00 40.31  ? 421 LEU A N     1 
ATOM   2321  C  CA    . LEU A 1 421 ? 38.975  18.245  23.620  1.00 33.67  ? 421 LEU A CA    1 
ATOM   2322  C  C     . LEU A 1 421 ? 38.498  16.927  24.227  1.00 49.15  ? 421 LEU A C     1 
ATOM   2323  O  O     . LEU A 1 421 ? 38.942  15.829  23.851  1.00 51.74  ? 421 LEU A O     1 
ATOM   2324  C  CB    . LEU A 1 421 ? 39.823  18.996  24.623  1.00 48.81  ? 421 LEU A CB    1 
ATOM   2325  C  CG    . LEU A 1 421 ? 41.015  18.230  25.167  1.00 61.58  ? 421 LEU A CG    1 
ATOM   2326  C  CD1   . LEU A 1 421 ? 41.892  17.831  24.021  1.00 37.69  ? 421 LEU A CD1   1 
ATOM   2327  C  CD2   . LEU A 1 421 ? 41.764  19.138  26.164  1.00 77.32  ? 421 LEU A CD2   1 
ATOM   2328  N  N     . LYS A 1 422 ? 37.579  17.062  25.177  1.00 60.52  ? 422 LYS A N     1 
ATOM   2329  C  CA    . LYS A 1 422 ? 36.931  15.953  25.861  1.00 43.81  ? 422 LYS A CA    1 
ATOM   2330  C  C     . LYS A 1 422 ? 36.370  15.007  24.819  1.00 52.78  ? 422 LYS A C     1 
ATOM   2331  O  O     . LYS A 1 422 ? 36.674  13.809  24.814  1.00 54.74  ? 422 LYS A O     1 
ATOM   2332  C  CB    . LYS A 1 422 ? 35.810  16.483  26.724  1.00 45.72  ? 422 LYS A CB    1 
ATOM   2333  C  CG    . LYS A 1 422 ? 36.219  17.188  28.010  1.00 46.61  ? 422 LYS A CG    1 
ATOM   2334  C  CD    . LYS A 1 422 ? 36.223  16.304  29.173  1.00 48.87  ? 422 LYS A CD    1 
ATOM   2335  C  CE    . LYS A 1 422 ? 36.766  16.949  30.410  1.00 40.84  ? 422 LYS A CE    1 
ATOM   2336  N  NZ    . LYS A 1 422 ? 36.634  15.848  31.384  1.00 34.91  ? 422 LYS A NZ    1 
ATOM   2337  N  N     . ALA A 1 423 ? 35.500  15.562  23.965  1.00 52.07  ? 423 ALA A N     1 
ATOM   2338  C  CA    . ALA A 1 423 ? 34.850  14.790  22.923  1.00 48.70  ? 423 ALA A CA    1 
ATOM   2339  C  C     . ALA A 1 423 ? 35.858  14.058  22.027  1.00 55.76  ? 423 ALA A C     1 
ATOM   2340  O  O     . ALA A 1 423 ? 35.672  12.864  21.703  1.00 40.65  ? 423 ALA A O     1 
ATOM   2341  C  CB    . ALA A 1 423 ? 33.962  15.679  22.114  1.00 39.06  ? 423 ALA A CB    1 
ATOM   2342  N  N     . LEU A 1 424 ? 36.914  14.775  21.619  1.00 49.51  ? 424 LEU A N     1 
ATOM   2343  C  CA    . LEU A 1 424 ? 37.959  14.156  20.797  1.00 41.85  ? 424 LEU A CA    1 
ATOM   2344  C  C     . LEU A 1 424 ? 38.584  12.931  21.454  1.00 48.06  ? 424 LEU A C     1 
ATOM   2345  O  O     . LEU A 1 424 ? 38.631  11.868  20.844  1.00 55.77  ? 424 LEU A O     1 
ATOM   2346  C  CB    . LEU A 1 424 ? 39.025  15.163  20.477  1.00 51.24  ? 424 LEU A CB    1 
ATOM   2347  C  CG    . LEU A 1 424 ? 40.196  14.637  19.655  1.00 55.60  ? 424 LEU A CG    1 
ATOM   2348  C  CD1   . LEU A 1 424 ? 39.699  13.912  18.422  1.00 61.25  ? 424 LEU A CD1   1 
ATOM   2349  C  CD2   . LEU A 1 424 ? 41.050  15.834  19.298  1.00 62.23  ? 424 LEU A CD2   1 
ATOM   2350  N  N     . LEU A 1 425 ? 38.980  13.047  22.723  1.00 45.00  ? 425 LEU A N     1 
ATOM   2351  C  CA    . LEU A 1 425 ? 39.533  11.857  23.385  1.00 37.12  ? 425 LEU A CA    1 
ATOM   2352  C  C     . LEU A 1 425 ? 38.551  10.740  23.558  1.00 46.50  ? 425 LEU A C     1 
ATOM   2353  O  O     . LEU A 1 425 ? 38.889  9.553   23.463  1.00 49.46  ? 425 LEU A O     1 
ATOM   2354  C  CB    . LEU A 1 425 ? 40.325  12.104  24.687  1.00 40.06  ? 425 LEU A CB    1 
ATOM   2355  C  CG    . LEU A 1 425 ? 41.558  13.020  24.715  1.00 42.49  ? 425 LEU A CG    1 
ATOM   2356  C  CD1   . LEU A 1 425 ? 41.574  14.338  24.091  1.00 58.14  ? 425 LEU A CD1   1 
ATOM   2357  C  CD2   . LEU A 1 425 ? 42.120  13.021  26.155  1.00 48.80  ? 425 LEU A CD2   1 
ATOM   2358  N  N     . LEU A 1 426 ? 37.359  11.127  23.901  1.00 55.20  ? 426 LEU A N     1 
ATOM   2359  C  CA    . LEU A 1 426 ? 36.257  10.230  24.071  1.00 49.79  ? 426 LEU A CA    1 
ATOM   2360  C  C     . LEU A 1 426 ? 36.046  9.379   22.797  1.00 49.52  ? 426 LEU A C     1 
ATOM   2361  O  O     . LEU A 1 426 ? 35.754  8.182   22.855  1.00 42.14  ? 426 LEU A O     1 
ATOM   2362  C  CB    . LEU A 1 426 ? 35.081  11.127  24.390  1.00 50.64  ? 426 LEU A CB    1 
ATOM   2363  C  CG    . LEU A 1 426 ? 34.498  11.131  25.812  1.00 42.70  ? 426 LEU A CG    1 
ATOM   2364  C  CD1   . LEU A 1 426 ? 33.226  11.964  25.801  1.00 34.30  ? 426 LEU A CD1   1 
ATOM   2365  C  CD2   . LEU A 1 426 ? 34.378  9.805   26.529  1.00 39.58  ? 426 LEU A CD2   1 
ATOM   2366  N  N     . ARG A 1 427 ? 36.160  10.013  21.631  1.00 51.15  ? 427 ARG A N     1 
ATOM   2367  C  CA    . ARG A 1 427 ? 35.940  9.345   20.326  1.00 42.35  ? 427 ARG A CA    1 
ATOM   2368  C  C     . ARG A 1 427 ? 36.930  8.230   20.091  1.00 45.34  ? 427 ARG A C     1 
ATOM   2369  O  O     . ARG A 1 427 ? 36.683  7.321   19.280  1.00 43.85  ? 427 ARG A O     1 
ATOM   2370  C  CB    . ARG A 1 427 ? 35.866  10.446  19.277  1.00 38.93  ? 427 ARG A CB    1 
ATOM   2371  C  CG    . ARG A 1 427 ? 34.407  10.508  18.842  1.00 59.05  ? 427 ARG A CG    1 
ATOM   2372  C  CD    . ARG A 1 427 ? 33.962  11.434  17.742  1.00 77.84  ? 427 ARG A CD    1 
ATOM   2373  N  NE    . ARG A 1 427 ? 34.918  12.134  16.909  1.00 82.87  ? 427 ARG A NE    1 
ATOM   2374  C  CZ    . ARG A 1 427 ? 35.408  13.319  17.237  1.00 74.04  ? 427 ARG A CZ    1 
ATOM   2375  N  NH1   . ARG A 1 427 ? 35.428  13.535  18.451  1.00 56.17  ? 427 ARG A NH1   1 
ATOM   2376  N  NH2   . ARG A 1 427 ? 36.221  14.059  16.566  1.00 77.03  ? 427 ARG A NH2   1 
ATOM   2377  N  N     . GLU A 1 428 ? 38.070  8.322   20.775  1.00 39.71  ? 428 GLU A N     1 
ATOM   2378  C  CA    . GLU A 1 428 ? 39.036  7.227   20.802  1.00 51.66  ? 428 GLU A CA    1 
ATOM   2379  C  C     . GLU A 1 428 ? 38.924  6.370   22.054  1.00 55.03  ? 428 GLU A C     1 
ATOM   2380  O  O     . GLU A 1 428 ? 39.805  5.557   22.303  1.00 62.46  ? 428 GLU A O     1 
ATOM   2381  C  CB    . GLU A 1 428 ? 40.477  7.756   20.675  1.00 64.83  ? 428 GLU A CB    1 
ATOM   2382  C  CG    . GLU A 1 428 ? 40.912  8.043   19.246  1.00 75.20  ? 428 GLU A CG    1 
ATOM   2383  C  CD    . GLU A 1 428 ? 40.900  6.739   18.438  1.00 76.61  ? 428 GLU A CD    1 
ATOM   2384  O  OE1   . GLU A 1 428 ? 40.449  6.735   17.258  1.00 78.50  ? 428 GLU A OE1   1 
ATOM   2385  O  OE2   . GLU A 1 428 ? 41.325  5.709   19.029  1.00 64.38  ? 428 GLU A OE2   1 
ATOM   2386  N  N     . GLY A 1 429 ? 37.806  6.478   22.776  1.00 53.45  ? 429 GLY A N     1 
ATOM   2387  C  CA    . GLY A 1 429 ? 37.521  5.683   23.978  1.00 45.30  ? 429 GLY A CA    1 
ATOM   2388  C  C     . GLY A 1 429 ? 38.354  6.022   25.220  1.00 59.57  ? 429 GLY A C     1 
ATOM   2389  O  O     . GLY A 1 429 ? 38.458  5.228   26.159  1.00 67.17  ? 429 GLY A O     1 
ATOM   2390  N  N     . LEU A 1 430 ? 38.869  7.246   25.275  1.00 52.58  ? 430 LEU A N     1 
ATOM   2391  C  CA    . LEU A 1 430 ? 39.701  7.675   26.389  1.00 41.34  ? 430 LEU A CA    1 
ATOM   2392  C  C     . LEU A 1 430 ? 39.044  8.753   27.237  1.00 51.57  ? 430 LEU A C     1 
ATOM   2393  O  O     . LEU A 1 430 ? 38.973  9.911   26.816  1.00 48.61  ? 430 LEU A O     1 
ATOM   2394  C  CB    . LEU A 1 430 ? 41.038  8.181   25.874  1.00 51.42  ? 430 LEU A CB    1 
ATOM   2395  C  CG    . LEU A 1 430 ? 41.862  7.012   25.328  1.00 45.00  ? 430 LEU A CG    1 
ATOM   2396  C  CD1   . LEU A 1 430 ? 43.067  7.485   24.550  1.00 43.86  ? 430 LEU A CD1   1 
ATOM   2397  C  CD2   . LEU A 1 430 ? 42.209  6.002   26.375  1.00 44.62  ? 430 LEU A CD2   1 
ATOM   2398  N  N     . PRO A 1 431 ? 38.518  8.374   28.417  1.00 50.28  ? 431 PRO A N     1 
ATOM   2399  C  CA    . PRO A 1 431 ? 38.058  9.423   29.326  1.00 40.93  ? 431 PRO A CA    1 
ATOM   2400  C  C     . PRO A 1 431 ? 39.206  10.339  29.737  1.00 45.19  ? 431 PRO A C     1 
ATOM   2401  O  O     . PRO A 1 431 ? 40.334  9.889   29.773  1.00 52.51  ? 431 PRO A O     1 
ATOM   2402  C  CB    . PRO A 1 431 ? 37.512  8.640   30.513  1.00 38.79  ? 431 PRO A CB    1 
ATOM   2403  C  CG    . PRO A 1 431 ? 37.253  7.258   29.986  1.00 42.14  ? 431 PRO A CG    1 
ATOM   2404  C  CD    . PRO A 1 431 ? 38.307  7.025   28.968  1.00 47.51  ? 431 PRO A CD    1 
ATOM   2405  N  N     . SER A 1 432 ? 38.919  11.589  30.084  1.00 46.18  ? 432 SER A N     1 
ATOM   2406  C  CA    . SER A 1 432 ? 39.970  12.514  30.469  1.00 44.45  ? 432 SER A CA    1 
ATOM   2407  C  C     . SER A 1 432 ? 39.600  13.261  31.739  1.00 39.42  ? 432 SER A C     1 
ATOM   2408  O  O     . SER A 1 432 ? 38.447  13.495  32.001  1.00 45.82  ? 432 SER A O     1 
ATOM   2409  C  CB    . SER A 1 432 ? 40.227  13.555  29.383  1.00 38.56  ? 432 SER A CB    1 
ATOM   2410  O  OG    . SER A 1 432 ? 39.023  14.251  29.084  1.00 54.80  ? 432 SER A OG    1 
ATOM   2411  N  N     . GLN A 1 433 ? 40.606  13.650  32.506  1.00 42.37  ? 433 GLN A N     1 
ATOM   2412  C  CA    . GLN A 1 433 ? 40.420  14.491  33.661  1.00 49.41  ? 433 GLN A CA    1 
ATOM   2413  C  C     . GLN A 1 433 ? 41.222  15.756  33.456  1.00 52.14  ? 433 GLN A C     1 
ATOM   2414  O  O     . GLN A 1 433 ? 42.384  15.695  33.079  1.00 48.14  ? 433 GLN A O     1 
ATOM   2415  C  CB    . GLN A 1 433 ? 40.854  13.783  34.954  1.00 47.39  ? 433 GLN A CB    1 
ATOM   2416  C  CG    . GLN A 1 433 ? 40.837  14.681  36.179  1.00 47.02  ? 433 GLN A CG    1 
ATOM   2417  C  CD    . GLN A 1 433 ? 39.474  15.211  36.510  1.00 40.74  ? 433 GLN A CD    1 
ATOM   2418  O  OE1   . GLN A 1 433 ? 38.505  14.452  36.597  1.00 35.22  ? 433 GLN A OE1   1 
ATOM   2419  N  NE2   . GLN A 1 433 ? 39.386  16.532  36.709  1.00 38.69  ? 433 GLN A NE2   1 
ATOM   2420  N  N     . ILE A 1 434 ? 40.576  16.910  33.549  1.00 53.03  ? 434 ILE A N     1 
ATOM   2421  C  CA    . ILE A 1 434 ? 41.345  18.140  33.423  1.00 63.88  ? 434 ILE A CA    1 
ATOM   2422  C  C     . ILE A 1 434 ? 41.818  18.634  34.806  1.00 69.12  ? 434 ILE A C     1 
ATOM   2423  O  O     . ILE A 1 434 ? 41.069  18.592  35.788  1.00 70.51  ? 434 ILE A O     1 
ATOM   2424  C  CB    . ILE A 1 434 ? 40.530  19.213  32.696  1.00 55.62  ? 434 ILE A CB    1 
ATOM   2425  C  CG1   . ILE A 1 434 ? 40.332  18.783  31.235  1.00 40.03  ? 434 ILE A CG1   1 
ATOM   2426  C  CG2   . ILE A 1 434 ? 41.212  20.584  32.768  1.00 42.22  ? 434 ILE A CG2   1 
ATOM   2427  C  CD1   . ILE A 1 434 ? 39.253  19.595  30.545  1.00 44.22  ? 434 ILE A CD1   1 
ATOM   2428  N  N     . LEU A 1 435 ? 43.065  19.094  34.872  1.00 71.45  ? 435 LEU A N     1 
ATOM   2429  C  CA    . LEU A 1 435 ? 43.576  19.787  36.056  1.00 67.06  ? 435 LEU A CA    1 
ATOM   2430  C  C     . LEU A 1 435 ? 44.275  21.069  35.611  1.00 67.04  ? 435 LEU A C     1 
ATOM   2431  O  O     . LEU A 1 435 ? 45.266  21.016  34.874  1.00 72.32  ? 435 LEU A O     1 
ATOM   2432  C  CB    . LEU A 1 435 ? 44.549  18.856  36.787  1.00 54.17  ? 435 LEU A CB    1 
ATOM   2433  C  CG    . LEU A 1 435 ? 45.229  19.239  38.094  1.00 52.07  ? 435 LEU A CG    1 
ATOM   2434  C  CD1   . LEU A 1 435 ? 44.216  19.608  39.197  1.00 59.25  ? 435 LEU A CD1   1 
ATOM   2435  C  CD2   . LEU A 1 435 ? 46.121  18.093  38.534  1.00 38.03  ? 435 LEU A CD2   1 
ATOM   2436  N  N     . ASN A 1 436 ? 43.828  22.220  36.102  1.00 68.12  ? 436 ASN A N     1 
ATOM   2437  C  CA    . ASN A 1 436 ? 44.438  23.450  35.597  1.00 65.43  ? 436 ASN A CA    1 
ATOM   2438  C  C     . ASN A 1 436 ? 45.790  23.724  36.214  1.00 60.46  ? 436 ASN A C     1 
ATOM   2439  O  O     . ASN A 1 436 ? 45.999  23.456  37.393  1.00 65.47  ? 436 ASN A O     1 
ATOM   2440  C  CB    . ASN A 1 436 ? 43.503  24.632  35.827  1.00 59.99  ? 436 ASN A CB    1 
ATOM   2441  C  CG    . ASN A 1 436 ? 42.351  24.642  34.853  1.00 65.62  ? 436 ASN A CG    1 
ATOM   2442  O  OD1   . ASN A 1 436 ? 42.444  24.095  33.747  1.00 66.96  ? 436 ASN A OD1   1 
ATOM   2443  N  ND2   . ASN A 1 436 ? 41.248  25.254  35.254  1.00 74.44  ? 436 ASN A ND2   1 
ATOM   2444  N  N     . VAL A 1 437 ? 46.734  24.159  35.393  1.00 59.07  ? 437 VAL A N     1 
ATOM   2445  C  CA    . VAL A 1 437 ? 47.922  24.905  35.791  1.00 57.63  ? 437 VAL A CA    1 
ATOM   2446  C  C     . VAL A 1 437 ? 47.659  26.412  35.835  1.00 61.37  ? 437 VAL A C     1 
ATOM   2447  O  O     . VAL A 1 437 ? 46.841  26.923  35.071  1.00 61.77  ? 437 VAL A O     1 
ATOM   2448  C  CB    . VAL A 1 437 ? 49.107  24.526  34.899  1.00 59.20  ? 437 VAL A CB    1 
ATOM   2449  C  CG1   . VAL A 1 437 ? 49.570  23.108  35.241  1.00 53.09  ? 437 VAL A CG1   1 
ATOM   2450  C  CG2   . VAL A 1 437 ? 48.721  24.604  33.419  1.00 58.28  ? 437 VAL A CG2   1 
ATOM   2451  N  N     . PRO A 1 438 ? 48.386  27.147  36.682  1.00 70.88  ? 438 PRO A N     1 
ATOM   2452  C  CA    . PRO A 1 438 ? 49.458  26.769  37.604  1.00 71.02  ? 438 PRO A CA    1 
ATOM   2453  C  C     . PRO A 1 438 ? 48.971  25.852  38.726  1.00 62.78  ? 438 PRO A C     1 
ATOM   2454  O  O     . PRO A 1 438 ? 47.819  25.952  39.137  1.00 63.92  ? 438 PRO A O     1 
ATOM   2455  C  CB    . PRO A 1 438 ? 49.822  28.084  38.268  1.00 72.02  ? 438 PRO A CB    1 
ATOM   2456  C  CG    . PRO A 1 438 ? 49.421  29.086  37.396  1.00 74.85  ? 438 PRO A CG    1 
ATOM   2457  C  CD    . PRO A 1 438 ? 48.174  28.604  36.719  1.00 74.25  ? 438 PRO A CD    1 
ATOM   2458  N  N     . LEU A 1 439 ? 49.804  24.914  39.132  1.00 63.36  ? 439 LEU A N     1 
ATOM   2459  C  CA    . LEU A 1 439 ? 49.444  23.899  40.095  1.00 68.14  ? 439 LEU A CA    1 
ATOM   2460  C  C     . LEU A 1 439 ? 50.534  23.850  41.166  1.00 68.65  ? 439 LEU A C     1 
ATOM   2461  O  O     . LEU A 1 439 ? 51.679  23.578  40.853  1.00 75.79  ? 439 LEU A O     1 
ATOM   2462  C  CB    . LEU A 1 439 ? 49.285  22.540  39.434  1.00 63.99  ? 439 LEU A CB    1 
ATOM   2463  C  CG    . LEU A 1 439 ? 48.871  21.435  40.427  1.00 58.67  ? 439 LEU A CG    1 
ATOM   2464  C  CD1   . LEU A 1 439 ? 47.618  21.754  41.254  1.00 50.56  ? 439 LEU A CD1   1 
ATOM   2465  C  CD2   . LEU A 1 439 ? 48.803  20.132  39.703  1.00 55.79  ? 439 LEU A CD2   1 
ATOM   2466  N  N     . ARG A 1 440 ? 50.183  24.008  42.422  1.00 65.65  ? 440 ARG A N     1 
ATOM   2467  C  CA    . ARG A 1 440 ? 51.123  23.975  43.546  1.00 66.90  ? 440 ARG A CA    1 
ATOM   2468  C  C     . ARG A 1 440 ? 50.827  22.795  44.444  1.00 62.84  ? 440 ARG A C     1 
ATOM   2469  O  O     . ARG A 1 440 ? 49.676  22.456  44.664  1.00 76.70  ? 440 ARG A O     1 
ATOM   2470  C  CB    . ARG A 1 440 ? 51.088  25.241  44.387  1.00 80.97  ? 440 ARG A CB    1 
ATOM   2471  C  CG    . ARG A 1 440 ? 51.348  26.520  43.657  1.00 95.19  ? 440 ARG A CG    1 
ATOM   2472  C  CD    . ARG A 1 440 ? 51.036  27.686  44.560  1.00 104.76 ? 440 ARG A CD    1 
ATOM   2473  N  NE    . ARG A 1 440 ? 49.706  27.497  45.178  1.00 110.24 ? 440 ARG A NE    1 
ATOM   2474  C  CZ    . ARG A 1 440 ? 49.320  27.954  46.363  1.00 116.98 ? 440 ARG A CZ    1 
ATOM   2475  N  NH1   . ARG A 1 440 ? 50.115  28.752  47.058  1.00 122.74 ? 440 ARG A NH1   1 
ATOM   2476  N  NH2   . ARG A 1 440 ? 48.098  27.690  46.778  1.00 115.31 ? 440 ARG A NH2   1 
ATOM   2477  N  N     . GLU A 1 441 ? 51.860  22.097  44.881  1.00 58.91  ? 441 GLU A N     1 
ATOM   2478  C  CA    . GLU A 1 441 ? 51.707  20.929  45.727  1.00 67.87  ? 441 GLU A CA    1 
ATOM   2479  C  C     . GLU A 1 441 ? 50.812  21.208  46.917  1.00 67.86  ? 441 GLU A C     1 
ATOM   2480  O  O     . GLU A 1 441 ? 50.108  20.284  47.390  1.00 58.13  ? 441 GLU A O     1 
ATOM   2481  C  CB    . GLU A 1 441 ? 53.059  20.451  46.278  1.00 78.39  ? 441 GLU A CB    1 
ATOM   2482  C  CG    . GLU A 1 441 ? 53.015  19.113  47.044  1.00 91.78  ? 441 GLU A CG    1 
ATOM   2483  C  CD    . GLU A 1 441 ? 54.402  18.543  47.334  1.00 109.37 ? 441 GLU A CD    1 
ATOM   2484  O  OE1   . GLU A 1 441 ? 54.829  17.559  46.688  1.00 111.94 ? 441 GLU A OE1   1 
ATOM   2485  O  OE2   . GLU A 1 441 ? 55.073  19.080  48.226  1.00 119.21 ? 441 GLU A OE2   1 
ATOM   2486  N  N     . GLU A 1 442 ? 50.785  22.436  47.453  1.00 72.09  ? 442 GLU A N     1 
ATOM   2487  C  CA    . GLU A 1 442 ? 49.956  22.599  48.624  1.00 79.36  ? 442 GLU A CA    1 
ATOM   2488  C  C     . GLU A 1 442 ? 48.453  22.730  48.323  1.00 77.06  ? 442 GLU A C     1 
ATOM   2489  O  O     . GLU A 1 442 ? 47.627  22.735  49.248  1.00 86.23  ? 442 GLU A O     1 
ATOM   2490  C  CB    . GLU A 1 442 ? 50.394  23.774  49.518  1.00 85.95  ? 442 GLU A CB    1 
ATOM   2491  C  CG    . GLU A 1 442 ? 50.868  25.088  49.074  1.00 104.12 ? 442 GLU A CG    1 
ATOM   2492  C  CD    . GLU A 1 442 ? 52.219  25.414  48.547  1.00 119.23 ? 442 GLU A CD    1 
ATOM   2493  O  OE1   . GLU A 1 442 ? 52.560  24.996  47.447  1.00 128.70 ? 442 GLU A OE1   1 
ATOM   2494  O  OE2   . GLU A 1 442 ? 52.915  26.176  49.309  1.00 130.69 ? 442 GLU A OE2   1 
ATOM   2495  N  N     . GLU A 1 443 ? 48.072  22.801  47.063  1.00 75.03  ? 443 GLU A N     1 
ATOM   2496  C  CA    . GLU A 1 443 ? 46.643  22.775  46.698  1.00 77.30  ? 443 GLU A CA    1 
ATOM   2497  C  C     . GLU A 1 443 ? 46.155  21.349  46.663  1.00 70.45  ? 443 GLU A C     1 
ATOM   2498  O  O     . GLU A 1 443 ? 45.625  20.886  45.656  1.00 61.26  ? 443 GLU A O     1 
ATOM   2499  C  CB    . GLU A 1 443 ? 46.410  23.451  45.363  1.00 81.62  ? 443 GLU A CB    1 
ATOM   2500  C  CG    . GLU A 1 443 ? 46.897  24.875  45.340  1.00 85.34  ? 443 GLU A CG    1 
ATOM   2501  C  CD    . GLU A 1 443 ? 46.709  25.526  43.995  1.00 97.89  ? 443 GLU A CD    1 
ATOM   2502  O  OE1   . GLU A 1 443 ? 47.317  25.001  43.032  1.00 103.79 ? 443 GLU A OE1   1 
ATOM   2503  O  OE2   . GLU A 1 443 ? 45.984  26.548  43.892  1.00 94.93  ? 443 GLU A OE2   1 
ATOM   2504  N  N     . ARG A 1 444 ? 46.248  20.679  47.802  1.00 76.80  ? 444 ARG A N     1 
ATOM   2505  C  CA    . ARG A 1 444 ? 46.077  19.233  47.867  1.00 71.17  ? 444 ARG A CA    1 
ATOM   2506  C  C     . ARG A 1 444 ? 44.639  18.823  47.524  1.00 62.77  ? 444 ARG A C     1 
ATOM   2507  O  O     . ARG A 1 444 ? 44.447  17.768  46.930  1.00 64.62  ? 444 ARG A O     1 
ATOM   2508  C  CB    . ARG A 1 444 ? 46.483  18.757  49.248  1.00 83.27  ? 444 ARG A CB    1 
ATOM   2509  C  CG    . ARG A 1 444 ? 46.463  17.254  49.436  1.00 95.67  ? 444 ARG A CG    1 
ATOM   2510  C  CD    . ARG A 1 444 ? 46.760  16.948  50.896  1.00 101.70 ? 444 ARG A CD    1 
ATOM   2511  N  NE    . ARG A 1 444 ? 45.652  17.344  51.743  1.00 99.26  ? 444 ARG A NE    1 
ATOM   2512  C  CZ    . ARG A 1 444 ? 45.186  16.630  52.757  1.00 109.61 ? 444 ARG A CZ    1 
ATOM   2513  N  NH1   . ARG A 1 444 ? 45.793  15.503  53.098  1.00 119.51 ? 444 ARG A NH1   1 
ATOM   2514  N  NH2   . ARG A 1 444 ? 44.162  17.094  53.487  1.00 105.32 ? 444 ARG A NH2   1 
ATOM   2515  N  N     . HIS A 1 445 ? 43.638  19.589  47.968  1.00 62.68  ? 445 HIS A N     1 
ATOM   2516  C  CA    . HIS A 1 445 ? 42.237  19.212  47.702  1.00 55.95  ? 445 HIS A CA    1 
ATOM   2517  C  C     . HIS A 1 445 ? 41.890  19.128  46.230  1.00 58.98  ? 445 HIS A C     1 
ATOM   2518  O  O     . HIS A 1 445 ? 41.277  18.160  45.770  1.00 53.72  ? 445 HIS A O     1 
ATOM   2519  C  CB    . HIS A 1 445 ? 41.280  20.170  48.428  1.00 48.14  ? 445 HIS A CB    1 
ATOM   2520  C  CG    . HIS A 1 445 ? 41.607  20.349  49.879  1.00 62.85  ? 445 HIS A CG    1 
ATOM   2521  N  ND1   . HIS A 1 445 ? 41.406  21.528  50.564  1.00 67.37  ? 445 HIS A ND1   1 
ATOM   2522  C  CD2   . HIS A 1 445 ? 42.044  19.449  50.794  1.00 57.61  ? 445 HIS A CD2   1 
ATOM   2523  C  CE1   . HIS A 1 445 ? 41.730  21.349  51.834  1.00 52.69  ? 445 HIS A CE1   1 
ATOM   2524  N  NE2   . HIS A 1 445 ? 42.128  20.100  51.995  1.00 44.07  ? 445 HIS A NE2   1 
ATOM   2525  N  N     . ARG A 1 446 ? 42.260  20.167  45.505  1.00 58.92  ? 446 ARG A N     1 
ATOM   2526  C  CA    . ARG A 1 446 ? 42.033  20.221  44.082  1.00 48.06  ? 446 ARG A CA    1 
ATOM   2527  C  C     . ARG A 1 446 ? 42.696  19.063  43.346  1.00 49.90  ? 446 ARG A C     1 
ATOM   2528  O  O     . ARG A 1 446 ? 42.021  18.289  42.680  1.00 62.39  ? 446 ARG A O     1 
ATOM   2529  C  CB    . ARG A 1 446 ? 42.463  21.607  43.567  1.00 44.14  ? 446 ARG A CB    1 
ATOM   2530  C  CG    . ARG A 1 446 ? 42.184  21.898  42.095  1.00 47.55  ? 446 ARG A CG    1 
ATOM   2531  C  CD    . ARG A 1 446 ? 42.424  23.400  41.823  1.00 58.20  ? 446 ARG A CD    1 
ATOM   2532  N  NE    . ARG A 1 446 ? 43.805  23.873  41.770  1.00 66.95  ? 446 ARG A NE    1 
ATOM   2533  C  CZ    . ARG A 1 446 ? 44.575  23.916  40.699  1.00 72.22  ? 446 ARG A CZ    1 
ATOM   2534  N  NH1   . ARG A 1 446 ? 44.129  23.470  39.538  1.00 82.46  ? 446 ARG A NH1   1 
ATOM   2535  N  NH2   . ARG A 1 446 ? 45.809  24.380  40.806  1.00 80.39  ? 446 ARG A NH2   1 
ATOM   2536  N  N     . TRP A 1 447 ? 44.002  18.900  43.497  1.00 52.58  ? 447 TRP A N     1 
ATOM   2537  C  CA    . TRP A 1 447 ? 44.667  17.849  42.734  1.00 55.55  ? 447 TRP A CA    1 
ATOM   2538  C  C     . TRP A 1 447 ? 44.346  16.430  43.238  1.00 58.21  ? 447 TRP A C     1 
ATOM   2539  O  O     . TRP A 1 447 ? 44.380  15.475  42.466  1.00 55.31  ? 447 TRP A O     1 
ATOM   2540  C  CB    . TRP A 1 447 ? 46.171  18.133  42.598  1.00 59.79  ? 447 TRP A CB    1 
ATOM   2541  C  CG    . TRP A 1 447 ? 47.053  18.083  43.792  1.00 61.84  ? 447 TRP A CG    1 
ATOM   2542  C  CD1   . TRP A 1 447 ? 47.637  19.144  44.414  1.00 66.92  ? 447 TRP A CD1   1 
ATOM   2543  C  CD2   . TRP A 1 447 ? 47.572  16.912  44.428  1.00 61.61  ? 447 TRP A CD2   1 
ATOM   2544  N  NE1   . TRP A 1 447 ? 48.426  18.712  45.443  1.00 64.99  ? 447 TRP A NE1   1 
ATOM   2545  C  CE2   . TRP A 1 447 ? 48.412  17.343  45.469  1.00 56.73  ? 447 TRP A CE2   1 
ATOM   2546  C  CE3   . TRP A 1 447 ? 47.378  15.544  44.241  1.00 64.47  ? 447 TRP A CE3   1 
ATOM   2547  C  CZ2   . TRP A 1 447 ? 49.046  16.459  46.321  1.00 37.74  ? 447 TRP A CZ2   1 
ATOM   2548  C  CZ3   . TRP A 1 447 ? 48.021  14.666  45.081  1.00 57.06  ? 447 TRP A CZ3   1 
ATOM   2549  C  CH2   . TRP A 1 447 ? 48.836  15.124  46.109  1.00 48.01  ? 447 TRP A CH2   1 
ATOM   2550  N  N     . GLU A 1 448 ? 44.050  16.278  44.526  1.00 63.66  ? 448 GLU A N     1 
ATOM   2551  C  CA    . GLU A 1 448 ? 43.583  14.957  44.954  1.00 66.14  ? 448 GLU A CA    1 
ATOM   2552  C  C     . GLU A 1 448 ? 42.223  14.649  44.345  1.00 52.45  ? 448 GLU A C     1 
ATOM   2553  O  O     . GLU A 1 448 ? 41.965  13.529  43.909  1.00 55.27  ? 448 GLU A O     1 
ATOM   2554  C  CB    . GLU A 1 448 ? 43.479  14.728  46.477  1.00 64.25  ? 448 GLU A CB    1 
ATOM   2555  C  CG    . GLU A 1 448 ? 44.784  14.517  47.205  1.00 70.16  ? 448 GLU A CG    1 
ATOM   2556  C  CD    . GLU A 1 448 ? 44.597  14.403  48.710  1.00 85.33  ? 448 GLU A CD    1 
ATOM   2557  O  OE1   . GLU A 1 448 ? 45.594  14.256  49.459  1.00 96.51  ? 448 GLU A OE1   1 
ATOM   2558  O  OE2   . GLU A 1 448 ? 43.430  14.349  49.145  1.00 86.17  ? 448 GLU A OE2   1 
ATOM   2559  N  N     . ASN A 1 449 ? 41.369  15.650  44.286  1.00 42.79  ? 449 ASN A N     1 
ATOM   2560  C  CA    . ASN A 1 449 ? 40.087  15.437  43.658  1.00 43.12  ? 449 ASN A CA    1 
ATOM   2561  C  C     . ASN A 1 449 ? 40.235  15.116  42.185  1.00 44.90  ? 449 ASN A C     1 
ATOM   2562  O  O     . ASN A 1 449 ? 39.550  14.225  41.673  1.00 52.87  ? 449 ASN A O     1 
ATOM   2563  C  CB    . ASN A 1 449 ? 39.198  16.682  43.872  1.00 38.63  ? 449 ASN A CB    1 
ATOM   2564  C  CG    . ASN A 1 449 ? 38.049  16.419  44.832  1.00 45.09  ? 449 ASN A CG    1 
ATOM   2565  O  OD1   . ASN A 1 449 ? 37.978  15.353  45.475  1.00 44.91  ? 449 ASN A OD1   1 
ATOM   2566  N  ND2   . ASN A 1 449 ? 37.213  17.412  45.018  1.00 55.71  ? 449 ASN A ND2   1 
ATOM   2567  N  N     . ALA A 1 450 ? 41.189  15.759  41.528  1.00 58.22  ? 450 ALA A N     1 
ATOM   2568  C  CA    . ALA A 1 450 ? 41.465  15.448  40.133  1.00 59.57  ? 450 ALA A CA    1 
ATOM   2569  C  C     . ALA A 1 450 ? 41.957  14.008  39.963  1.00 59.01  ? 450 ALA A C     1 
ATOM   2570  O  O     . ALA A 1 450 ? 41.501  13.286  39.059  1.00 57.16  ? 450 ALA A O     1 
ATOM   2571  C  CB    . ALA A 1 450 ? 42.536  16.402  39.579  1.00 46.46  ? 450 ALA A CB    1 
ATOM   2572  N  N     . LEU A 1 451 ? 42.784  13.569  40.902  1.00 41.71  ? 451 LEU A N     1 
ATOM   2573  C  CA    . LEU A 1 451 ? 43.266  12.227  40.876  1.00 51.14  ? 451 LEU A CA    1 
ATOM   2574  C  C     . LEU A 1 451 ? 42.134  11.166  41.019  1.00 61.24  ? 451 LEU A C     1 
ATOM   2575  O  O     . LEU A 1 451 ? 42.120  10.126  40.319  1.00 63.54  ? 451 LEU A O     1 
ATOM   2576  C  CB    . LEU A 1 451 ? 44.354  12.000  41.919  1.00 69.19  ? 451 LEU A CB    1 
ATOM   2577  C  CG    . LEU A 1 451 ? 45.690  11.949  41.115  1.00 68.65  ? 451 LEU A CG    1 
ATOM   2578  C  CD1   . LEU A 1 451 ? 45.822  13.232  40.265  1.00 78.31  ? 451 LEU A CD1   1 
ATOM   2579  C  CD2   . LEU A 1 451 ? 46.942  11.804  41.958  1.00 64.26  ? 451 LEU A CD2   1 
ATOM   2580  N  N     . LEU A 1 452 ? 41.203  11.460  41.912  1.00 49.74  ? 452 LEU A N     1 
ATOM   2581  C  CA    . LEU A 1 452 ? 40.040  10.613  42.148  1.00 52.32  ? 452 LEU A CA    1 
ATOM   2582  C  C     . LEU A 1 452 ? 39.177  10.564  40.879  1.00 55.45  ? 452 LEU A C     1 
ATOM   2583  O  O     . LEU A 1 452 ? 38.647  9.505   40.495  1.00 58.67  ? 452 LEU A O     1 
ATOM   2584  C  CB    . LEU A 1 452 ? 39.245  11.128  43.343  1.00 50.93  ? 452 LEU A CB    1 
ATOM   2585  C  CG    . LEU A 1 452 ? 39.852  10.820  44.723  1.00 54.35  ? 452 LEU A CG    1 
ATOM   2586  C  CD1   . LEU A 1 452 ? 39.122  11.588  45.813  1.00 44.95  ? 452 LEU A CD1   1 
ATOM   2587  C  CD2   . LEU A 1 452 ? 39.817  9.330   45.042  1.00 58.03  ? 452 LEU A CD2   1 
ATOM   2588  N  N     . GLY A 1 453 ? 39.070  11.714  40.211  1.00 50.38  ? 453 GLY A N     1 
ATOM   2589  C  CA    . GLY A 1 453 ? 38.342  11.761  38.962  1.00 55.10  ? 453 GLY A CA    1 
ATOM   2590  C  C     . GLY A 1 453 ? 38.985  10.841  37.936  1.00 61.95  ? 453 GLY A C     1 
ATOM   2591  O  O     . GLY A 1 453 ? 38.321  9.968   37.372  1.00 61.85  ? 453 GLY A O     1 
ATOM   2592  N  N     . LEU A 1 454 ? 40.294  10.989  37.755  1.00 61.53  ? 454 LEU A N     1 
ATOM   2593  C  CA    . LEU A 1 454 ? 41.079  10.179  36.829  1.00 48.01  ? 454 LEU A CA    1 
ATOM   2594  C  C     . LEU A 1 454 ? 40.834  8.689   37.054  1.00 57.51  ? 454 LEU A C     1 
ATOM   2595  O  O     . LEU A 1 454 ? 40.665  7.898   36.106  1.00 62.20  ? 454 LEU A O     1 
ATOM   2596  C  CB    . LEU A 1 454 ? 42.552  10.496  36.988  1.00 41.70  ? 454 LEU A CB    1 
ATOM   2597  C  CG    . LEU A 1 454 ? 43.450  9.995   35.859  1.00 49.10  ? 454 LEU A CG    1 
ATOM   2598  C  CD1   . LEU A 1 454 ? 43.066  10.666  34.547  1.00 51.77  ? 454 LEU A CD1   1 
ATOM   2599  C  CD2   . LEU A 1 454 ? 44.865  10.305  36.200  1.00 49.75  ? 454 LEU A CD2   1 
ATOM   2600  N  N     . LEU A 1 455 ? 40.850  8.293   38.321  1.00 53.38  ? 455 LEU A N     1 
ATOM   2601  C  CA    . LEU A 1 455 ? 40.728  6.874   38.628  1.00 56.67  ? 455 LEU A CA    1 
ATOM   2602  C  C     . LEU A 1 455 ? 39.314  6.379   38.360  1.00 56.15  ? 455 LEU A C     1 
ATOM   2603  O  O     . LEU A 1 455 ? 39.147  5.265   37.849  1.00 65.34  ? 455 LEU A O     1 
ATOM   2604  C  CB    . LEU A 1 455 ? 41.134  6.602   40.073  1.00 61.68  ? 455 LEU A CB    1 
ATOM   2605  C  CG    . LEU A 1 455 ? 42.604  6.923   40.293  1.00 60.87  ? 455 LEU A CG    1 
ATOM   2606  C  CD1   . LEU A 1 455 ? 42.976  6.984   41.775  1.00 55.45  ? 455 LEU A CD1   1 
ATOM   2607  C  CD2   . LEU A 1 455 ? 43.402  5.846   39.560  1.00 55.51  ? 455 LEU A CD2   1 
ATOM   2608  N  N     . ALA A 1 456 ? 38.301  7.184   38.706  1.00 50.73  ? 456 ALA A N     1 
ATOM   2609  C  CA    . ALA A 1 456 ? 36.937  6.803   38.365  1.00 47.59  ? 456 ALA A CA    1 
ATOM   2610  C  C     . ALA A 1 456 ? 36.719  6.683   36.844  1.00 49.85  ? 456 ALA A C     1 
ATOM   2611  O  O     . ALA A 1 456 ? 35.991  5.803   36.351  1.00 53.34  ? 456 ALA A O     1 
ATOM   2612  C  CB    . ALA A 1 456 ? 35.968  7.812   38.949  1.00 35.53  ? 456 ALA A CB    1 
ATOM   2613  N  N     . LYS A 1 457 ? 37.388  7.554   36.106  1.00 42.25  ? 457 LYS A N     1 
ATOM   2614  C  CA    . LYS A 1 457 ? 37.305  7.553   34.655  1.00 41.97  ? 457 LYS A CA    1 
ATOM   2615  C  C     . LYS A 1 457 ? 38.082  6.400   34.032  1.00 46.45  ? 457 LYS A C     1 
ATOM   2616  O  O     . LYS A 1 457 ? 37.829  5.992   32.911  1.00 54.66  ? 457 LYS A O     1 
ATOM   2617  C  CB    . LYS A 1 457 ? 37.828  8.886   34.108  1.00 26.99  ? 457 LYS A CB    1 
ATOM   2618  C  CG    . LYS A 1 457 ? 36.961  10.081  34.441  1.00 30.68  ? 457 LYS A CG    1 
ATOM   2619  C  CD    . LYS A 1 457 ? 37.721  11.372  34.084  1.00 41.33  ? 457 LYS A CD    1 
ATOM   2620  C  CE    . LYS A 1 457 ? 36.903  12.631  34.371  1.00 46.79  ? 457 LYS A CE    1 
ATOM   2621  N  NZ    . LYS A 1 457 ? 35.479  12.306  34.369  1.00 61.16  ? 457 LYS A NZ    1 
ATOM   2622  N  N     . ALA A 1 458 ? 38.976  5.806   34.802  1.00 46.37  ? 458 ALA A N     1 
ATOM   2623  C  CA    . ALA A 1 458 ? 39.720  4.673   34.277  1.00 47.56  ? 458 ALA A CA    1 
ATOM   2624  C  C     . ALA A 1 458 ? 39.083  3.373   34.643  1.00 62.02  ? 458 ALA A C     1 
ATOM   2625  O  O     . ALA A 1 458 ? 39.607  2.317   34.270  1.00 73.42  ? 458 ALA A O     1 
ATOM   2626  C  CB    . ALA A 1 458 ? 41.119  4.694   34.778  1.00 45.05  ? 458 ALA A CB    1 
ATOM   2627  N  N     . GLY A 1 459 ? 37.956  3.455   35.354  1.00 55.90  ? 459 GLY A N     1 
ATOM   2628  C  CA    . GLY A 1 459 ? 37.187  2.282   35.693  1.00 49.01  ? 459 GLY A CA    1 
ATOM   2629  C  C     . GLY A 1 459 ? 37.513  1.636   37.023  1.00 50.33  ? 459 GLY A C     1 
ATOM   2630  O  O     . GLY A 1 459 ? 37.101  0.500   37.275  1.00 48.71  ? 459 GLY A O     1 
ATOM   2631  N  N     . LEU A 1 460 ? 38.281  2.318   37.863  1.00 58.17  ? 460 LEU A N     1 
ATOM   2632  C  CA    . LEU A 1 460 ? 38.538  1.811   39.228  1.00 57.50  ? 460 LEU A CA    1 
ATOM   2633  C  C     . LEU A 1 460 ? 37.375  1.991   40.178  1.00 54.72  ? 460 LEU A C     1 
ATOM   2634  O  O     . LEU A 1 460 ? 36.693  3.011   40.133  1.00 52.46  ? 460 LEU A O     1 
ATOM   2635  C  CB    . LEU A 1 460 ? 39.765  2.466   39.848  1.00 49.13  ? 460 LEU A CB    1 
ATOM   2636  C  CG    . LEU A 1 460 ? 41.116  1.900   39.452  1.00 66.08  ? 460 LEU A CG    1 
ATOM   2637  C  CD1   . LEU A 1 460 ? 41.660  2.565   38.223  1.00 69.37  ? 460 LEU A CD1   1 
ATOM   2638  C  CD2   . LEU A 1 460 ? 42.032  2.164   40.621  1.00 73.07  ? 460 LEU A CD2   1 
ATOM   2639  N  N     . GLN A 1 461 ? 37.248  1.057   41.123  1.00 50.24  ? 461 GLN A N     1 
ATOM   2640  C  CA    . GLN A 1 461 ? 36.305  1.221   42.238  1.00 63.47  ? 461 GLN A CA    1 
ATOM   2641  C  C     . GLN A 1 461 ? 37.085  1.720   43.425  1.00 64.78  ? 461 GLN A C     1 
ATOM   2642  O  O     . GLN A 1 461 ? 37.811  0.983   44.090  1.00 72.87  ? 461 GLN A O     1 
ATOM   2643  C  CB    . GLN A 1 461 ? 35.583  -0.093  42.589  1.00 69.73  ? 461 GLN A CB    1 
ATOM   2644  C  CG    . GLN A 1 461 ? 34.208  -0.140  41.950  1.00 82.28  ? 461 GLN A CG    1 
ATOM   2645  C  CD    . GLN A 1 461 ? 33.148  0.729   42.645  1.00 80.36  ? 461 GLN A CD    1 
ATOM   2646  O  OE1   . GLN A 1 461 ? 32.503  1.537   41.993  1.00 81.98  ? 461 GLN A OE1   1 
ATOM   2647  N  NE2   . GLN A 1 461 ? 32.864  0.453   43.902  1.00 79.34  ? 461 GLN A NE2   1 
ATOM   2648  N  N     . VAL A 1 462 ? 36.928  3.012   43.672  1.00 69.30  ? 462 VAL A N     1 
ATOM   2649  C  CA    . VAL A 1 462 ? 37.693  3.663   44.711  1.00 66.48  ? 462 VAL A CA    1 
ATOM   2650  C  C     . VAL A 1 462 ? 37.166  3.304   46.101  1.00 64.53  ? 462 VAL A C     1 
ATOM   2651  O  O     . VAL A 1 462 ? 37.924  2.895   46.983  1.00 68.79  ? 462 VAL A O     1 
ATOM   2652  C  CB    . VAL A 1 462 ? 37.652  5.216   44.495  1.00 67.56  ? 462 VAL A CB    1 
ATOM   2653  C  CG1   . VAL A 1 462 ? 38.269  5.969   45.673  1.00 58.02  ? 462 VAL A CG1   1 
ATOM   2654  C  CG2   . VAL A 1 462 ? 38.271  5.638   43.122  1.00 28.88  ? 462 VAL A CG2   1 
ATOM   2655  N  N     . VAL A 1 463 ? 35.859  3.444   46.287  1.00 53.83  ? 463 VAL A N     1 
ATOM   2656  C  CA    . VAL A 1 463 ? 35.217  3.080   47.550  1.00 59.92  ? 463 VAL A CA    1 
ATOM   2657  C  C     . VAL A 1 463 ? 33.927  2.280   47.346  1.00 64.81  ? 463 VAL A C     1 
ATOM   2658  O  O     . VAL A 1 463 ? 33.375  2.249   46.234  1.00 75.83  ? 463 VAL A O     1 
ATOM   2659  C  CB    . VAL A 1 463 ? 34.889  4.311   48.425  1.00 53.20  ? 463 VAL A CB    1 
ATOM   2660  C  CG1   . VAL A 1 463 ? 36.161  4.944   48.949  1.00 55.05  ? 463 VAL A CG1   1 
ATOM   2661  C  CG2   . VAL A 1 463 ? 34.076  5.318   47.643  1.00 50.56  ? 463 VAL A CG2   1 
ATOM   2662  N  N     . ALA A 1 464 ? 33.475  1.603   48.400  1.00 54.57  ? 464 ALA A N     1 
ATOM   2663  C  CA    . ALA A 1 464 ? 32.210  0.890   48.320  1.00 54.27  ? 464 ALA A CA    1 
ATOM   2664  C  C     . ALA A 1 464 ? 31.561  0.915   49.712  1.00 55.86  ? 464 ALA A C     1 
ATOM   2665  O  O     . ALA A 1 464 ? 32.246  1.150   50.702  1.00 55.48  ? 464 ALA A O     1 
ATOM   2666  C  CB    . ALA A 1 464 ? 32.431  -0.539  47.847  1.00 40.84  ? 464 ALA A CB    1 
ATOM   2667  N  N     . LEU A 1 465 ? 30.269  0.624   49.833  1.00 54.87  ? 465 LEU A N     1 
ATOM   2668  C  CA    . LEU A 1 465 ? 29.731  0.618   51.186  1.00 48.78  ? 465 LEU A CA    1 
ATOM   2669  C  C     . LEU A 1 465 ? 29.721  -0.727  51.846  1.00 49.67  ? 465 LEU A C     1 
ATOM   2670  O  O     . LEU A 1 465 ? 29.665  -1.768  51.201  1.00 49.93  ? 465 LEU A O     1 
ATOM   2671  C  CB    . LEU A 1 465 ? 28.286  1.131   51.181  1.00 55.37  ? 465 LEU A CB    1 
ATOM   2672  C  CG    . LEU A 1 465 ? 27.919  2.382   50.406  1.00 56.59  ? 465 LEU A CG    1 
ATOM   2673  C  CD1   . LEU A 1 465 ? 26.415  2.611   50.399  1.00 55.91  ? 465 LEU A CD1   1 
ATOM   2674  C  CD2   . LEU A 1 465 ? 28.610  3.556   51.095  1.00 75.07  ? 465 LEU A CD2   1 
ATOM   2675  N  N     . SER A 1 466 ? 29.608  -0.700  53.154  1.00 61.14  ? 466 SER A N     1 
ATOM   2676  C  CA    . SER A 1 466 ? 29.647  -1.942  53.873  1.00 62.26  ? 466 SER A CA    1 
ATOM   2677  C  C     . SER A 1 466 ? 28.362  -1.963  54.667  1.00 64.38  ? 466 SER A C     1 
ATOM   2678  O  O     . SER A 1 466 ? 28.050  -1.011  55.396  1.00 53.90  ? 466 SER A O     1 
ATOM   2679  C  CB    . SER A 1 466 ? 30.860  -2.084  54.777  1.00 59.32  ? 466 SER A CB    1 
ATOM   2680  O  OG    . SER A 1 466 ? 30.707  -3.259  55.549  1.00 68.21  ? 466 SER A OG    1 
ATOM   2681  N  N     . GLY A 1 467 ? 27.551  -2.972  54.425  1.00 54.15  ? 467 GLY A N     1 
ATOM   2682  C  CA    . GLY A 1 467 ? 26.282  -3.049  55.097  1.00 54.73  ? 467 GLY A CA    1 
ATOM   2683  C  C     . GLY A 1 467 ? 25.331  -3.914  54.351  1.00 63.22  ? 467 GLY A C     1 
ATOM   2684  O  O     . GLY A 1 467 ? 25.617  -4.348  53.244  1.00 88.51  ? 467 GLY A O     1 
ATOM   2685  N  N     . ALA A 1 468 ? 24.138  -4.006  54.886  1.00 58.18  ? 468 ALA A N     1 
ATOM   2686  C  CA    . ALA A 1 468 ? 23.071  -4.772  54.294  1.00 70.43  ? 468 ALA A CA    1 
ATOM   2687  C  C     . ALA A 1 468 ? 21.888  -3.959  53.820  1.00 74.86  ? 468 ALA A C     1 
ATOM   2688  O  O     . ALA A 1 468 ? 21.349  -3.159  54.583  1.00 73.64  ? 468 ALA A O     1 
ATOM   2689  C  CB    . ALA A 1 468 ? 22.609  -5.862  55.240  1.00 68.17  ? 468 ALA A CB    1 
ATOM   2690  N  N     . TYR A 1 469 ? 21.619  -3.991  52.530  1.00 70.62  ? 469 TYR A N     1 
ATOM   2691  C  CA    . TYR A 1 469 ? 20.554  -3.187  51.943  1.00 58.27  ? 469 TYR A CA    1 
ATOM   2692  C  C     . TYR A 1 469 ? 19.559  -4.108  51.279  1.00 56.24  ? 469 TYR A C     1 
ATOM   2693  O  O     . TYR A 1 469 ? 19.916  -5.228  50.882  1.00 59.86  ? 469 TYR A O     1 
ATOM   2694  C  CB    . TYR A 1 469 ? 21.116  -2.141  51.006  1.00 53.70  ? 469 TYR A CB    1 
ATOM   2695  C  CG    . TYR A 1 469 ? 22.233  -1.334  51.618  1.00 49.30  ? 469 TYR A CG    1 
ATOM   2696  C  CD1   . TYR A 1 469 ? 21.949  -0.423  52.648  1.00 55.29  ? 469 TYR A CD1   1 
ATOM   2697  C  CD2   . TYR A 1 469 ? 23.556  -1.552  51.287  1.00 37.02  ? 469 TYR A CD2   1 
ATOM   2698  C  CE1   . TYR A 1 469 ? 22.938  0.325   53.246  1.00 37.21  ? 469 TYR A CE1   1 
ATOM   2699  C  CE2   . TYR A 1 469 ? 24.566  -0.822  51.906  1.00 40.90  ? 469 TYR A CE2   1 
ATOM   2700  C  CZ    . TYR A 1 469 ? 24.243  0.115   52.881  1.00 32.67  ? 469 TYR A CZ    1 
ATOM   2701  O  OH    . TYR A 1 469 ? 25.225  0.839   53.485  1.00 36.35  ? 469 TYR A OH    1 
ATOM   2702  N  N     . PRO A 1 470 ? 18.279  -3.704  51.286  1.00 47.24  ? 470 PRO A N     1 
ATOM   2703  C  CA    . PRO A 1 470 ? 17.231  -4.525  50.654  1.00 50.03  ? 470 PRO A CA    1 
ATOM   2704  C  C     . PRO A 1 470 ? 17.488  -4.817  49.188  1.00 55.53  ? 470 PRO A C     1 
ATOM   2705  O  O     . PRO A 1 470 ? 17.275  -5.964  48.791  1.00 70.11  ? 470 PRO A O     1 
ATOM   2706  C  CB    . PRO A 1 470 ? 15.940  -3.695  50.883  1.00 41.39  ? 470 PRO A CB    1 
ATOM   2707  C  CG    . PRO A 1 470 ? 16.377  -2.349  51.238  1.00 39.21  ? 470 PRO A CG    1 
ATOM   2708  C  CD    . PRO A 1 470 ? 17.719  -2.510  51.943  1.00 47.29  ? 470 PRO A CD    1 
ATOM   2709  N  N     . ALA A 1 471 ? 18.094  -3.878  48.462  1.00 51.04  ? 471 ALA A N     1 
ATOM   2710  C  CA    . ALA A 1 471 ? 18.322  -4.036  47.029  1.00 44.78  ? 471 ALA A CA    1 
ATOM   2711  C  C     . ALA A 1 471 ? 19.804  -4.104  46.705  1.00 45.11  ? 471 ALA A C     1 
ATOM   2712  O  O     . ALA A 1 471 ? 20.579  -3.292  47.175  1.00 61.76  ? 471 ALA A O     1 
ATOM   2713  C  CB    . ALA A 1 471 ? 17.680  -2.884  46.263  1.00 45.64  ? 471 ALA A CB    1 
ATOM   2714  N  N     . GLU A 1 472 ? 20.192  -5.080  45.888  1.00 42.66  ? 472 GLU A N     1 
ATOM   2715  C  CA    . GLU A 1 472 ? 21.589  -5.236  45.544  1.00 54.49  ? 472 GLU A CA    1 
ATOM   2716  C  C     . GLU A 1 472 ? 21.889  -4.631  44.179  1.00 58.62  ? 472 GLU A C     1 
ATOM   2717  O  O     . GLU A 1 472 ? 22.989  -4.808  43.643  1.00 58.39  ? 472 GLU A O     1 
ATOM   2718  C  CB    . GLU A 1 472 ? 21.978  -6.717  45.551  1.00 58.39  ? 472 GLU A CB    1 
ATOM   2719  C  CG    . GLU A 1 472 ? 21.046  -7.659  44.818  1.00 63.96  ? 472 GLU A CG    1 
ATOM   2720  C  CD    . GLU A 1 472 ? 21.405  -9.114  45.070  1.00 68.18  ? 472 GLU A CD    1 
ATOM   2721  O  OE1   . GLU A 1 472 ? 20.528  -9.987  44.962  1.00 61.96  ? 472 GLU A OE1   1 
ATOM   2722  O  OE2   . GLU A 1 472 ? 22.543  -9.356  45.521  1.00 75.31  ? 472 GLU A OE2   1 
ATOM   2723  N  N     . LEU A 1 473 ? 20.899  -3.937  43.617  1.00 52.15  ? 473 LEU A N     1 
ATOM   2724  C  CA    . LEU A 1 473 ? 21.096  -3.103  42.437  1.00 54.19  ? 473 LEU A CA    1 
ATOM   2725  C  C     . LEU A 1 473 ? 20.322  -1.796  42.616  1.00 49.67  ? 473 LEU A C     1 
ATOM   2726  O  O     . LEU A 1 473 ? 19.116  -1.813  42.868  1.00 59.64  ? 473 LEU A O     1 
ATOM   2727  C  CB    . LEU A 1 473 ? 20.630  -3.864  41.179  1.00 48.53  ? 473 LEU A CB    1 
ATOM   2728  C  CG    . LEU A 1 473 ? 20.624  -3.116  39.851  1.00 45.03  ? 473 LEU A CG    1 
ATOM   2729  C  CD1   . LEU A 1 473 ? 22.066  -2.744  39.433  1.00 50.46  ? 473 LEU A CD1   1 
ATOM   2730  C  CD2   . LEU A 1 473 ? 19.890  -3.898  38.770  1.00 50.17  ? 473 LEU A CD2   1 
ATOM   2731  N  N     . ALA A 1 474 ? 20.987  -0.661  42.488  1.00 38.49  ? 474 ALA A N     1 
ATOM   2732  C  CA    . ALA A 1 474 ? 20.260  0.610   42.580  1.00 38.70  ? 474 ALA A CA    1 
ATOM   2733  C  C     . ALA A 1 474 ? 20.441  1.381   41.305  1.00 50.36  ? 474 ALA A C     1 
ATOM   2734  O  O     . ALA A 1 474 ? 21.570  1.535   40.846  1.00 56.87  ? 474 ALA A O     1 
ATOM   2735  C  CB    . ALA A 1 474 ? 20.710  1.423   43.737  1.00 47.43  ? 474 ALA A CB    1 
ATOM   2736  N  N     . VAL A 1 475 ? 19.348  1.872   40.735  1.00 50.05  ? 475 VAL A N     1 
ATOM   2737  C  CA    . VAL A 1 475 ? 19.430  2.574   39.466  1.00 52.00  ? 475 VAL A CA    1 
ATOM   2738  C  C     . VAL A 1 475 ? 18.741  3.924   39.500  1.00 48.41  ? 475 VAL A C     1 
ATOM   2739  O  O     . VAL A 1 475 ? 17.613  4.051   40.007  1.00 47.08  ? 475 VAL A O     1 
ATOM   2740  C  CB    . VAL A 1 475 ? 18.747  1.743   38.341  1.00 42.10  ? 475 VAL A CB    1 
ATOM   2741  C  CG1   . VAL A 1 475 ? 18.865  2.449   37.015  1.00 35.86  ? 475 VAL A CG1   1 
ATOM   2742  C  CG2   . VAL A 1 475 ? 19.307  0.333   38.286  1.00 44.12  ? 475 VAL A CG2   1 
ATOM   2743  N  N     . GLY A 1 476 ? 19.450  4.933   38.996  1.00 40.05  ? 476 GLY A N     1 
ATOM   2744  C  CA    . GLY A 1 476 ? 18.930  6.280   38.905  1.00 37.98  ? 476 GLY A CA    1 
ATOM   2745  C  C     . GLY A 1 476 ? 18.637  6.685   37.461  1.00 47.33  ? 476 GLY A C     1 
ATOM   2746  O  O     . GLY A 1 476 ? 19.435  6.440   36.545  1.00 38.36  ? 476 GLY A O     1 
ATOM   2747  N  N     . PHE A 1 477 ? 17.561  7.441   37.289  1.00 47.70  ? 477 PHE A N     1 
ATOM   2748  C  CA    . PHE A 1 477 ? 17.084  7.894   35.990  1.00 46.64  ? 477 PHE A CA    1 
ATOM   2749  C  C     . PHE A 1 477 ? 16.984  9.398   36.016  1.00 51.49  ? 477 PHE A C     1 
ATOM   2750  O  O     . PHE A 1 477 ? 16.495  9.945   37.008  1.00 46.33  ? 477 PHE A O     1 
ATOM   2751  C  CB    . PHE A 1 477 ? 15.720  7.302   35.639  1.00 42.27  ? 477 PHE A CB    1 
ATOM   2752  C  CG    . PHE A 1 477 ? 15.704  5.804   35.525  1.00 31.51  ? 477 PHE A CG    1 
ATOM   2753  C  CD1   . PHE A 1 477 ? 15.601  5.003   36.640  1.00 30.28  ? 477 PHE A CD1   1 
ATOM   2754  C  CD2   . PHE A 1 477 ? 15.724  5.201   34.293  1.00 40.84  ? 477 PHE A CD2   1 
ATOM   2755  C  CE1   . PHE A 1 477 ? 15.572  3.625   36.533  1.00 34.20  ? 477 PHE A CE1   1 
ATOM   2756  C  CE2   . PHE A 1 477 ? 15.678  3.813   34.179  1.00 43.09  ? 477 PHE A CE2   1 
ATOM   2757  C  CZ    . PHE A 1 477 ? 15.615  3.036   35.308  1.00 42.41  ? 477 PHE A CZ    1 
ATOM   2758  N  N     . ASP A 1 478 ? 17.456  10.066  34.956  1.00 53.96  ? 478 ASP A N     1 
ATOM   2759  C  CA    . ASP A 1 478 ? 17.316  11.522  34.852  1.00 36.41  ? 478 ASP A CA    1 
ATOM   2760  C  C     . ASP A 1 478 ? 17.188  11.902  33.390  1.00 45.97  ? 478 ASP A C     1 
ATOM   2761  O  O     . ASP A 1 478 ? 17.415  11.069  32.491  1.00 36.45  ? 478 ASP A O     1 
ATOM   2762  C  CB    . ASP A 1 478 ? 18.513  12.267  35.480  1.00 23.77  ? 478 ASP A CB    1 
ATOM   2763  C  CG    . ASP A 1 478 ? 18.201  13.771  35.771  1.00 72.45  ? 478 ASP A CG    1 
ATOM   2764  O  OD1   . ASP A 1 478 ? 16.997  14.124  35.851  1.00 80.06  ? 478 ASP A OD1   1 
ATOM   2765  O  OD2   . ASP A 1 478 ? 19.142  14.599  35.952  1.00 56.81  ? 478 ASP A OD2   1 
ATOM   2766  N  N     . ALA A 1 479 ? 16.771  13.149  33.163  1.00 46.38  ? 479 ALA A N     1 
ATOM   2767  C  CA    . ALA A 1 479 ? 16.748  13.711  31.836  1.00 42.79  ? 479 ALA A CA    1 
ATOM   2768  C  C     . ALA A 1 479 ? 17.561  15.019  31.832  1.00 47.72  ? 479 ALA A C     1 
ATOM   2769  O  O     . ALA A 1 479 ? 17.446  15.861  32.729  1.00 52.12  ? 479 ALA A O     1 
ATOM   2770  C  CB    . ALA A 1 479 ? 15.283  13.924  31.389  1.00 37.92  ? 479 ALA A CB    1 
ATOM   2771  N  N     . GLY A 1 480 ? 18.295  15.236  30.753  1.00 54.61  ? 480 GLY A N     1 
ATOM   2772  C  CA    . GLY A 1 480 ? 19.179  16.381  30.642  1.00 63.77  ? 480 GLY A CA    1 
ATOM   2773  C  C     . GLY A 1 480 ? 19.236  17.009  29.277  1.00 63.63  ? 480 GLY A C     1 
ATOM   2774  O  O     . GLY A 1 480 ? 18.660  16.482  28.311  1.00 56.72  ? 480 GLY A O     1 
ATOM   2775  N  N     . GLY A 1 481 ? 19.916  18.154  29.198  1.00 55.09  ? 481 GLY A N     1 
ATOM   2776  C  CA    . GLY A 1 481 ? 19.993  18.920  27.968  1.00 63.79  ? 481 GLY A CA    1 
ATOM   2777  C  C     . GLY A 1 481 ? 19.131  20.145  28.210  1.00 88.29  ? 481 GLY A C     1 
ATOM   2778  O  O     . GLY A 1 481 ? 18.164  20.103  28.986  1.00 96.49  ? 481 GLY A O     1 
ATOM   2779  N  N     . ARG A 1 482 ? 19.378  21.209  27.470  1.00 97.89  ? 482 ARG A N     1 
ATOM   2780  C  CA    . ARG A 1 482 ? 18.665  22.442  27.771  1.00 111.20 ? 482 ARG A CA    1 
ATOM   2781  C  C     . ARG A 1 482 ? 18.061  22.950  26.491  1.00 105.70 ? 482 ARG A C     1 
ATOM   2782  O  O     . ARG A 1 482 ? 17.399  23.995  26.454  1.00 105.52 ? 482 ARG A O     1 
ATOM   2783  C  CB    . ARG A 1 482 ? 19.636  23.495  28.379  1.00 105.43 ? 482 ARG A CB    1 
ATOM   2784  N  N     . GLU A 1 483 ? 18.197  22.127  25.466  1.00 105.36 ? 483 GLU A N     1 
ATOM   2785  C  CA    . GLU A 1 483 ? 17.590  22.442  24.204  1.00 86.40  ? 483 GLU A CA    1 
ATOM   2786  C  C     . GLU A 1 483 ? 16.155  21.957  24.087  1.00 71.81  ? 483 GLU A C     1 
ATOM   2787  O  O     . GLU A 1 483 ? 15.496  21.654  25.091  1.00 71.80  ? 483 GLU A O     1 
ATOM   2788  C  CB    . GLU A 1 483 ? 18.439  21.810  23.126  1.00 85.64  ? 483 GLU A CB    1 
ATOM   2789  C  CG    . GLU A 1 483 ? 19.713  22.505  22.857  1.00 92.67  ? 483 GLU A CG    1 
ATOM   2790  C  CD    . GLU A 1 483 ? 20.328  22.007  21.593  1.00 108.11 ? 483 GLU A CD    1 
ATOM   2791  O  OE1   . GLU A 1 483 ? 19.656  22.033  20.547  1.00 113.87 ? 483 GLU A OE1   1 
ATOM   2792  O  OE2   . GLU A 1 483 ? 21.511  21.566  21.647  1.00 117.45 ? 483 GLU A OE2   1 
ATOM   2793  N  N     . SER A 1 484 ? 15.672  21.972  22.851  1.00 58.93  ? 484 SER A N     1 
ATOM   2794  C  CA    . SER A 1 484 ? 14.314  21.594  22.546  1.00 54.55  ? 484 SER A CA    1 
ATOM   2795  C  C     . SER A 1 484 ? 14.093  20.091  22.727  1.00 61.67  ? 484 SER A C     1 
ATOM   2796  O  O     . SER A 1 484 ? 12.976  19.596  22.518  1.00 63.48  ? 484 SER A O     1 
ATOM   2797  C  CB    . SER A 1 484 ? 13.955  22.038  21.142  1.00 73.21  ? 484 SER A CB    1 
ATOM   2798  O  OG    . SER A 1 484 ? 14.764  21.390  20.181  1.00 78.35  ? 484 SER A OG    1 
ATOM   2799  N  N     . PHE A 1 485 ? 15.161  19.352  23.039  1.00 57.96  ? 485 PHE A N     1 
ATOM   2800  C  CA    . PHE A 1 485 ? 15.034  17.902  23.220  1.00 49.60  ? 485 PHE A CA    1 
ATOM   2801  C  C     . PHE A 1 485 ? 15.870  17.570  24.409  1.00 54.58  ? 485 PHE A C     1 
ATOM   2802  O  O     . PHE A 1 485 ? 16.794  18.313  24.731  1.00 60.93  ? 485 PHE A O     1 
ATOM   2803  C  CB    . PHE A 1 485 ? 15.486  17.084  21.996  1.00 43.52  ? 485 PHE A CB    1 
ATOM   2804  C  CG    . PHE A 1 485 ? 16.941  17.271  21.639  1.00 47.93  ? 485 PHE A CG    1 
ATOM   2805  C  CD1   . PHE A 1 485 ? 17.337  18.302  20.793  1.00 49.04  ? 485 PHE A CD1   1 
ATOM   2806  C  CD2   . PHE A 1 485 ? 17.899  16.416  22.133  1.00 47.18  ? 485 PHE A CD2   1 
ATOM   2807  C  CE1   . PHE A 1 485 ? 18.650  18.461  20.451  1.00 51.22  ? 485 PHE A CE1   1 
ATOM   2808  C  CE2   . PHE A 1 485 ? 19.237  16.571  21.797  1.00 58.62  ? 485 PHE A CE2   1 
ATOM   2809  C  CZ    . PHE A 1 485 ? 19.608  17.593  20.954  1.00 58.40  ? 485 PHE A CZ    1 
ATOM   2810  N  N     . ARG A 1 486 ? 15.665  16.384  24.963  1.00 51.41  ? 486 ARG A N     1 
ATOM   2811  C  CA    . ARG A 1 486 ? 16.460  15.986  26.092  1.00 52.37  ? 486 ARG A CA    1 
ATOM   2812  C  C     . ARG A 1 486 ? 17.067  14.613  25.849  1.00 47.96  ? 486 ARG A C     1 
ATOM   2813  O  O     . ARG A 1 486 ? 16.811  13.972  24.836  1.00 65.49  ? 486 ARG A O     1 
ATOM   2814  C  CB    . ARG A 1 486 ? 15.579  15.832  27.332  1.00 57.43  ? 486 ARG A CB    1 
ATOM   2815  C  CG    . ARG A 1 486 ? 14.792  16.916  28.015  1.00 63.40  ? 486 ARG A CG    1 
ATOM   2816  C  CD    . ARG A 1 486 ? 15.370  18.290  28.208  1.00 68.70  ? 486 ARG A CD    1 
ATOM   2817  N  NE    . ARG A 1 486 ? 14.306  19.180  28.683  1.00 78.86  ? 486 ARG A NE    1 
ATOM   2818  C  CZ    . ARG A 1 486 ? 13.786  19.048  29.920  1.00 83.84  ? 486 ARG A CZ    1 
ATOM   2819  N  NH1   . ARG A 1 486 ? 14.187  18.074  30.730  1.00 69.66  ? 486 ARG A NH1   1 
ATOM   2820  N  NH2   . ARG A 1 486 ? 12.836  19.852  30.356  1.00 99.91  ? 486 ARG A NH2   1 
ATOM   2821  N  N     . PHE A 1 487 ? 17.871  14.189  26.819  1.00 50.48  ? 487 PHE A N     1 
ATOM   2822  C  CA    . PHE A 1 487 ? 18.462  12.862  26.876  1.00 47.54  ? 487 PHE A CA    1 
ATOM   2823  C  C     . PHE A 1 487 ? 17.997  12.200  28.188  1.00 44.79  ? 487 PHE A C     1 
ATOM   2824  O  O     . PHE A 1 487 ? 18.177  12.757  29.268  1.00 61.64  ? 487 PHE A O     1 
ATOM   2825  C  CB    . PHE A 1 487 ? 19.991  12.875  26.793  1.00 32.34  ? 487 PHE A CB    1 
ATOM   2826  C  CG    . PHE A 1 487 ? 20.511  13.115  25.445  1.00 46.88  ? 487 PHE A CG    1 
ATOM   2827  C  CD1   . PHE A 1 487 ? 20.542  12.076  24.511  1.00 57.20  ? 487 PHE A CD1   1 
ATOM   2828  C  CD2   . PHE A 1 487 ? 20.978  14.360  25.079  1.00 49.27  ? 487 PHE A CD2   1 
ATOM   2829  C  CE1   . PHE A 1 487 ? 21.029  12.289  23.217  1.00 57.36  ? 487 PHE A CE1   1 
ATOM   2830  C  CE2   . PHE A 1 487 ? 21.462  14.571  23.780  1.00 52.77  ? 487 PHE A CE2   1 
ATOM   2831  C  CZ    . PHE A 1 487 ? 21.478  13.533  22.856  1.00 56.63  ? 487 PHE A CZ    1 
ATOM   2832  N  N     . GLY A 1 488 ? 17.356  11.047  28.076  1.00 38.12  ? 488 GLY A N     1 
ATOM   2833  C  CA    . GLY A 1 488 ? 16.941  10.278  29.224  1.00 34.41  ? 488 GLY A CA    1 
ATOM   2834  C  C     . GLY A 1 488 ? 18.024  9.239   29.412  1.00 50.00  ? 488 GLY A C     1 
ATOM   2835  O  O     . GLY A 1 488 ? 18.396  8.554   28.441  1.00 43.63  ? 488 GLY A O     1 
ATOM   2836  N  N     . GLY A 1 489 ? 18.587  9.183   30.626  1.00 53.46  ? 489 GLY A N     1 
ATOM   2837  C  CA    . GLY A 1 489 ? 19.691  8.287   30.954  1.00 32.43  ? 489 GLY A CA    1 
ATOM   2838  C  C     . GLY A 1 489 ? 19.576  7.644   32.332  1.00 47.17  ? 489 GLY A C     1 
ATOM   2839  O  O     . GLY A 1 489 ? 18.781  8.059   33.209  1.00 48.83  ? 489 GLY A O     1 
ATOM   2840  N  N     . ALA A 1 490 ? 20.430  6.653   32.543  1.00 51.13  ? 490 ALA A N     1 
ATOM   2841  C  CA    . ALA A 1 490 ? 20.446  5.871   33.770  1.00 44.85  ? 490 ALA A CA    1 
ATOM   2842  C  C     . ALA A 1 490 ? 21.862  5.577   34.185  1.00 45.77  ? 490 ALA A C     1 
ATOM   2843  O  O     . ALA A 1 490 ? 22.753  5.436   33.336  1.00 45.18  ? 490 ALA A O     1 
ATOM   2844  C  CB    . ALA A 1 490 ? 19.681  4.609   33.629  1.00 22.10  ? 490 ALA A CB    1 
ATOM   2845  N  N     . ALA A 1 491 ? 22.077  5.533   35.494  1.00 40.23  ? 491 ALA A N     1 
ATOM   2846  C  CA    . ALA A 1 491 ? 23.368  5.130   36.032  1.00 39.69  ? 491 ALA A CA    1 
ATOM   2847  C  C     . ALA A 1 491 ? 23.061  4.161   37.150  1.00 42.23  ? 491 ALA A C     1 
ATOM   2848  O  O     . ALA A 1 491 ? 21.956  4.177   37.722  1.00 40.48  ? 491 ALA A O     1 
ATOM   2849  C  CB    . ALA A 1 491 ? 24.169  6.327   36.538  1.00 39.06  ? 491 ALA A CB    1 
ATOM   2850  N  N     . CYS A 1 492 ? 23.983  3.242   37.411  1.00 35.10  ? 492 CYS A N     1 
ATOM   2851  C  CA    . CYS A 1 492 ? 23.677  2.232   38.402  1.00 41.72  ? 492 CYS A CA    1 
ATOM   2852  C  C     . CYS A 1 492 ? 24.836  1.936   39.337  1.00 43.12  ? 492 CYS A C     1 
ATOM   2853  O  O     . CYS A 1 492 ? 26.008  2.197   39.031  1.00 48.33  ? 492 CYS A O     1 
ATOM   2854  C  CB    . CYS A 1 492 ? 23.172  0.956   37.711  1.00 19.34  ? 492 CYS A CB    1 
ATOM   2855  S  SG    . CYS A 1 492 ? 24.346  0.078   36.720  1.00 82.69  ? 492 CYS A SG    1 
ATOM   2856  N  N     . ALA A 1 493 ? 24.461  1.388   40.485  1.00 45.49  ? 493 ALA A N     1 
ATOM   2857  C  CA    . ALA A 1 493 ? 25.373  0.849   41.475  1.00 46.03  ? 493 ALA A CA    1 
ATOM   2858  C  C     . ALA A 1 493 ? 25.063  -0.631  41.602  1.00 49.66  ? 493 ALA A C     1 
ATOM   2859  O  O     . ALA A 1 493 ? 23.908  -1.018  41.898  1.00 43.76  ? 493 ALA A O     1 
ATOM   2860  C  CB    . ALA A 1 493 ? 25.222  1.557   42.786  1.00 51.42  ? 493 ALA A CB    1 
ATOM   2861  N  N     . VAL A 1 494 ? 26.040  -1.458  41.243  1.00 51.85  ? 494 VAL A N     1 
ATOM   2862  C  CA    . VAL A 1 494 ? 25.817  -2.878  41.261  1.00 44.82  ? 494 VAL A CA    1 
ATOM   2863  C  C     . VAL A 1 494 ? 26.475  -3.541  42.424  1.00 49.68  ? 494 VAL A C     1 
ATOM   2864  O  O     . VAL A 1 494 ? 27.584  -3.133  42.838  1.00 57.25  ? 494 VAL A O     1 
ATOM   2865  C  CB    . VAL A 1 494 ? 26.406  -3.479  39.960  1.00 46.09  ? 494 VAL A CB    1 
ATOM   2866  C  CG1   . VAL A 1 494 ? 26.208  -4.948  39.876  1.00 49.80  ? 494 VAL A CG1   1 
ATOM   2867  C  CG2   . VAL A 1 494 ? 25.818  -2.793  38.742  1.00 32.36  ? 494 VAL A CG2   1 
ATOM   2868  N  N     . GLY A 1 495 ? 25.790  -4.586  42.927  1.00 51.02  ? 495 GLY A N     1 
ATOM   2869  C  CA    . GLY A 1 495 ? 26.237  -5.308  44.101  1.00 48.02  ? 495 GLY A CA    1 
ATOM   2870  C  C     . GLY A 1 495 ? 25.658  -4.628  45.327  1.00 65.61  ? 495 GLY A C     1 
ATOM   2871  O  O     . GLY A 1 495 ? 25.336  -3.442  45.267  1.00 58.62  ? 495 GLY A O     1 
ATOM   2872  N  N     . GLY A 1 496 ? 25.461  -5.354  46.415  1.00 76.42  ? 496 GLY A N     1 
ATOM   2873  C  CA    . GLY A 1 496 ? 24.955  -4.766  47.649  1.00 71.70  ? 496 GLY A CA    1 
ATOM   2874  C  C     . GLY A 1 496 ? 25.871  -3.705  48.285  1.00 73.54  ? 496 GLY A C     1 
ATOM   2875  O  O     . GLY A 1 496 ? 25.423  -2.892  49.083  1.00 73.56  ? 496 GLY A O     1 
ATOM   2876  N  N     . ASP A 1 497 ? 27.115  -3.613  47.819  1.00 75.21  ? 497 ASP A N     1 
ATOM   2877  C  CA    . ASP A 1 497 ? 28.117  -2.731  48.410  1.00 62.61  ? 497 ASP A CA    1 
ATOM   2878  C  C     . ASP A 1 497 ? 28.298  -1.547  47.504  1.00 64.49  ? 497 ASP A C     1 
ATOM   2879  O  O     . ASP A 1 497 ? 28.998  -0.576  47.835  1.00 50.40  ? 497 ASP A O     1 
ATOM   2880  C  CB    . ASP A 1 497 ? 29.449  -3.478  48.563  1.00 63.69  ? 497 ASP A CB    1 
ATOM   2881  C  CG    . ASP A 1 497 ? 29.829  -4.277  47.311  1.00 73.95  ? 497 ASP A CG    1 
ATOM   2882  O  OD1   . ASP A 1 497 ? 28.929  -4.615  46.512  1.00 87.90  ? 497 ASP A OD1   1 
ATOM   2883  O  OD2   . ASP A 1 497 ? 31.006  -4.689  47.194  1.00 58.44  ? 497 ASP A OD2   1 
ATOM   2884  N  N     . GLY A 1 498 ? 27.555  -1.575  46.400  1.00 66.40  ? 498 GLY A N     1 
ATOM   2885  C  CA    . GLY A 1 498 ? 27.793  -0.621  45.337  1.00 65.49  ? 498 GLY A CA    1 
ATOM   2886  C  C     . GLY A 1 498 ? 29.149  -0.865  44.710  1.00 65.29  ? 498 GLY A C     1 
ATOM   2887  O  O     . GLY A 1 498 ? 29.811  0.067   44.281  1.00 54.28  ? 498 GLY A O     1 
ATOM   2888  N  N     . GLY A 1 499 ? 29.562  -2.132  44.701  1.00 69.92  ? 499 GLY A N     1 
ATOM   2889  C  CA    . GLY A 1 499 ? 30.889  -2.471  44.278  1.00 79.29  ? 499 GLY A CA    1 
ATOM   2890  C  C     . GLY A 1 499 ? 31.170  -2.120  42.816  1.00 76.28  ? 499 GLY A C     1 
ATOM   2891  O  O     . GLY A 1 499 ? 32.343  -2.244  42.403  1.00 75.72  ? 499 GLY A O     1 
ATOM   2892  N  N     . HIS A 1 500 ? 30.145  -1.720  42.037  1.00 66.24  ? 500 HIS A N     1 
ATOM   2893  C  CA    . HIS A 1 500 ? 30.407  -1.267  40.691  1.00 56.75  ? 500 HIS A CA    1 
ATOM   2894  C  C     . HIS A 1 500 ? 29.547  -0.089  40.298  1.00 44.95  ? 500 HIS A C     1 
ATOM   2895  O  O     . HIS A 1 500 ? 28.360  -0.152  40.447  1.00 57.40  ? 500 HIS A O     1 
ATOM   2896  C  CB    . HIS A 1 500 ? 30.258  -2.380  39.638  1.00 69.73  ? 500 HIS A CB    1 
ATOM   2897  C  CG    . HIS A 1 500 ? 31.135  -3.540  39.923  1.00 91.35  ? 500 HIS A CG    1 
ATOM   2898  N  ND1   . HIS A 1 500 ? 31.650  -4.314  38.923  1.00 105.37 ? 500 HIS A ND1   1 
ATOM   2899  C  CD2   . HIS A 1 500 ? 31.252  -4.302  41.030  1.00 97.21  ? 500 HIS A CD2   1 
ATOM   2900  C  CE1   . HIS A 1 500 ? 32.355  -5.296  39.463  1.00 107.79 ? 500 HIS A CE1   1 
ATOM   2901  N  NE2   . HIS A 1 500 ? 32.088  -5.345  40.740  1.00 96.59  ? 500 HIS A NE2   1 
ATOM   2902  N  N     . LEU A 1 501 ? 30.107  0.933   39.654  1.00 49.86  ? 501 LEU A N     1 
ATOM   2903  C  CA    . LEU A 1 501 ? 29.310  2.057   39.212  1.00 39.37  ? 501 LEU A CA    1 
ATOM   2904  C  C     . LEU A 1 501 ? 29.405  2.100   37.695  1.00 45.93  ? 501 LEU A C     1 
ATOM   2905  O  O     . LEU A 1 501 ? 30.502  2.186   37.116  1.00 51.21  ? 501 LEU A O     1 
ATOM   2906  C  CB    . LEU A 1 501 ? 29.819  3.361   39.873  1.00 34.25  ? 501 LEU A CB    1 
ATOM   2907  C  CG    . LEU A 1 501 ? 29.803  3.387   41.391  1.00 30.08  ? 501 LEU A CG    1 
ATOM   2908  C  CD1   . LEU A 1 501 ? 30.439  4.664   41.929  1.00 28.84  ? 501 LEU A CD1   1 
ATOM   2909  C  CD2   . LEU A 1 501 ? 28.336  3.314   41.896  1.00 26.32  ? 501 LEU A CD2   1 
ATOM   2910  N  N     . LEU A 1 502 ? 28.233  2.135   37.066  1.00 35.26  ? 502 LEU A N     1 
ATOM   2911  C  CA    . LEU A 1 502 ? 28.123  2.025   35.609  1.00 40.13  ? 502 LEU A CA    1 
ATOM   2912  C  C     . LEU A 1 502 ? 27.191  3.065   35.034  1.00 49.27  ? 502 LEU A C     1 
ATOM   2913  O  O     . LEU A 1 502 ? 26.269  3.548   35.731  1.00 49.57  ? 502 LEU A O     1 
ATOM   2914  C  CB    . LEU A 1 502 ? 27.552  0.670   35.238  1.00 41.71  ? 502 LEU A CB    1 
ATOM   2915  C  CG    . LEU A 1 502 ? 28.520  -0.467  35.478  1.00 52.73  ? 502 LEU A CG    1 
ATOM   2916  C  CD1   . LEU A 1 502 ? 27.755  -1.620  36.052  1.00 63.41  ? 502 LEU A CD1   1 
ATOM   2917  C  CD2   . LEU A 1 502 ? 29.309  -0.824  34.262  1.00 71.57  ? 502 LEU A CD2   1 
ATOM   2918  N  N     . TRP A 1 503 ? 27.443  3.453   33.790  1.00 46.28  ? 503 TRP A N     1 
ATOM   2919  C  CA    . TRP A 1 503 ? 26.472  4.259   33.038  1.00 38.71  ? 503 TRP A CA    1 
ATOM   2920  C  C     . TRP A 1 503 ? 25.920  3.496   31.822  1.00 44.24  ? 503 TRP A C     1 
ATOM   2921  O  O     . TRP A 1 503 ? 26.459  2.435   31.450  1.00 33.80  ? 503 TRP A O     1 
ATOM   2922  C  CB    . TRP A 1 503 ? 27.120  5.542   32.562  1.00 42.49  ? 503 TRP A CB    1 
ATOM   2923  C  CG    . TRP A 1 503 ? 28.343  5.307   31.687  1.00 38.81  ? 503 TRP A CG    1 
ATOM   2924  C  CD1   . TRP A 1 503 ? 29.610  5.071   32.104  1.00 40.28  ? 503 TRP A CD1   1 
ATOM   2925  C  CD2   . TRP A 1 503 ? 28.390  5.322   30.246  1.00 49.63  ? 503 TRP A CD2   1 
ATOM   2926  N  NE1   . TRP A 1 503 ? 30.445  4.903   31.028  1.00 55.08  ? 503 TRP A NE1   1 
ATOM   2927  C  CE2   . TRP A 1 503 ? 29.730  5.060   29.871  1.00 49.82  ? 503 TRP A CE2   1 
ATOM   2928  C  CE3   . TRP A 1 503 ? 27.431  5.519   29.242  1.00 49.50  ? 503 TRP A CE3   1 
ATOM   2929  C  CZ2   . TRP A 1 503 ? 30.147  4.997   28.528  1.00 37.43  ? 503 TRP A CZ2   1 
ATOM   2930  C  CZ3   . TRP A 1 503 ? 27.844  5.455   27.905  1.00 49.52  ? 503 TRP A CZ3   1 
ATOM   2931  C  CH2   . TRP A 1 503 ? 29.191  5.195   27.567  1.00 41.00  ? 503 TRP A CH2   1 
ATOM   2932  N  N     . THR A 1 504 ? 24.766  3.901   31.309  1.00 45.66  ? 504 THR A N     1 
ATOM   2933  C  CA    . THR A 1 504 ? 24.274  3.383   30.039  1.00 45.09  ? 504 THR A CA    1 
ATOM   2934  C  C     . THR A 1 504 ? 24.045  4.500   29.048  1.00 42.59  ? 504 THR A C     1 
ATOM   2935  O  O     . THR A 1 504 ? 23.829  5.648   29.432  1.00 59.32  ? 504 THR A O     1 
ATOM   2936  C  CB    . THR A 1 504 ? 23.070  2.477   30.195  1.00 47.93  ? 504 THR A CB    1 
ATOM   2937  O  OG1   . THR A 1 504 ? 22.178  3.086   31.115  1.00 39.82  ? 504 THR A OG1   1 
ATOM   2938  C  CG2   . THR A 1 504 ? 23.455  1.218   30.931  1.00 50.64  ? 504 THR A CG2   1 
ATOM   2939  N  N     . LEU A 1 505 ? 24.228  4.181   27.777  1.00 51.38  ? 505 LEU A N     1 
ATOM   2940  C  CA    . LEU A 1 505 ? 23.958  5.095   26.677  1.00 44.98  ? 505 LEU A CA    1 
ATOM   2941  C  C     . LEU A 1 505 ? 22.575  5.714   26.775  1.00 42.87  ? 505 LEU A C     1 
ATOM   2942  O  O     . LEU A 1 505 ? 21.559  5.021   26.815  1.00 43.18  ? 505 LEU A O     1 
ATOM   2943  C  CB    . LEU A 1 505 ? 24.131  4.370   25.345  1.00 37.26  ? 505 LEU A CB    1 
ATOM   2944  C  CG    . LEU A 1 505 ? 24.453  5.247   24.142  1.00 45.35  ? 505 LEU A CG    1 
ATOM   2945  C  CD1   . LEU A 1 505 ? 25.743  6.053   24.353  1.00 37.81  ? 505 LEU A CD1   1 
ATOM   2946  C  CD2   . LEU A 1 505 ? 24.546  4.391   22.909  1.00 44.46  ? 505 LEU A CD2   1 
ATOM   2947  N  N     . PRO A 1 506 ? 22.540  7.045   26.826  1.00 46.15  ? 506 PRO A N     1 
ATOM   2948  C  CA    . PRO A 1 506 ? 21.251  7.723   26.906  1.00 45.69  ? 506 PRO A CA    1 
ATOM   2949  C  C     . PRO A 1 506 ? 20.488  7.666   25.589  1.00 47.96  ? 506 PRO A C     1 
ATOM   2950  O  O     . PRO A 1 506 ? 20.966  7.127   24.598  1.00 56.44  ? 506 PRO A O     1 
ATOM   2951  C  CB    . PRO A 1 506 ? 21.630  9.157   27.319  1.00 34.94  ? 506 PRO A CB    1 
ATOM   2952  C  CG    . PRO A 1 506 ? 23.053  9.042   27.853  1.00 33.84  ? 506 PRO A CG    1 
ATOM   2953  C  CD    . PRO A 1 506 ? 23.666  7.969   27.058  1.00 42.81  ? 506 PRO A CD    1 
ATOM   2954  N  N     . GLU A 1 507 ? 19.265  8.166   25.629  1.00 44.28  ? 507 GLU A N     1 
ATOM   2955  C  CA    . GLU A 1 507 ? 18.386  8.252   24.475  1.00 47.78  ? 507 GLU A CA    1 
ATOM   2956  C  C     . GLU A 1 507 ? 17.810  9.661   24.275  1.00 40.57  ? 507 GLU A C     1 
ATOM   2957  O  O     . GLU A 1 507 ? 17.502  10.364  25.230  1.00 45.01  ? 507 GLU A O     1 
ATOM   2958  C  CB    . GLU A 1 507 ? 17.242  7.219   24.605  1.00 49.19  ? 507 GLU A CB    1 
ATOM   2959  C  CG    . GLU A 1 507 ? 16.366  7.145   23.374  1.00 63.24  ? 507 GLU A CG    1 
ATOM   2960  C  CD    . GLU A 1 507 ? 17.107  6.761   22.126  1.00 61.17  ? 507 GLU A CD    1 
ATOM   2961  O  OE1   . GLU A 1 507 ? 17.536  5.585   22.008  1.00 51.35  ? 507 GLU A OE1   1 
ATOM   2962  O  OE2   . GLU A 1 507 ? 17.302  7.691   21.289  1.00 54.37  ? 507 GLU A OE2   1 
ATOM   2963  N  N     . ALA A 1 508 ? 17.678  10.077  23.023  1.00 38.06  ? 508 ALA A N     1 
ATOM   2964  C  CA    . ALA A 1 508 ? 17.062  11.360  22.752  1.00 42.41  ? 508 ALA A CA    1 
ATOM   2965  C  C     . ALA A 1 508 ? 15.532  11.253  22.928  1.00 48.13  ? 508 ALA A C     1 
ATOM   2966  O  O     . ALA A 1 508 ? 14.924  10.227  22.569  1.00 48.22  ? 508 ALA A O     1 
ATOM   2967  C  CB    . ALA A 1 508 ? 17.424  11.852  21.372  1.00 40.21  ? 508 ALA A CB    1 
ATOM   2968  N  N     . GLN A 1 509 ? 14.928  12.252  23.574  1.00 43.88  ? 509 GLN A N     1 
ATOM   2969  C  CA    . GLN A 1 509 ? 13.483  12.245  23.793  1.00 49.45  ? 509 GLN A CA    1 
ATOM   2970  C  C     . GLN A 1 509 ? 12.946  13.667  23.657  1.00 45.99  ? 509 GLN A C     1 
ATOM   2971  O  O     . GLN A 1 509 ? 13.740  14.598  23.744  1.00 47.66  ? 509 GLN A O     1 
ATOM   2972  C  CB    . GLN A 1 509 ? 13.163  11.665  25.176  1.00 51.11  ? 509 GLN A CB    1 
ATOM   2973  C  CG    . GLN A 1 509 ? 13.817  12.400  26.352  1.00 53.70  ? 509 GLN A CG    1 
ATOM   2974  C  CD    . GLN A 1 509 ? 13.736  11.621  27.658  1.00 49.80  ? 509 GLN A CD    1 
ATOM   2975  O  OE1   . GLN A 1 509 ? 13.983  10.415  27.702  1.00 52.17  ? 509 GLN A OE1   1 
ATOM   2976  N  NE2   . GLN A 1 509 ? 13.308  12.295  28.709  1.00 43.52  ? 509 GLN A NE2   1 
ATOM   2977  N  N     . ALA A 1 510 ? 11.630  13.844  23.446  1.00 53.22  ? 510 ALA A N     1 
ATOM   2978  C  CA    . ALA A 1 510 ? 11.040  15.193  23.242  1.00 40.87  ? 510 ALA A CA    1 
ATOM   2979  C  C     . ALA A 1 510 ? 11.111  16.086  24.460  1.00 45.62  ? 510 ALA A C     1 
ATOM   2980  O  O     . ALA A 1 510 ? 11.395  17.272  24.354  1.00 56.75  ? 510 ALA A O     1 
ATOM   2981  C  CB    . ALA A 1 510 ? 9.595   15.090  22.791  1.00 34.23  ? 510 ALA A CB    1 
ATOM   2982  N  N     . GLY A 1 511 ? 10.799  15.527  25.621  1.00 48.68  ? 511 GLY A N     1 
ATOM   2983  C  CA    . GLY A 1 511 ? 10.794  16.353  26.813  1.00 47.72  ? 511 GLY A CA    1 
ATOM   2984  C  C     . GLY A 1 511 ? 11.275  15.688  28.098  1.00 52.61  ? 511 GLY A C     1 
ATOM   2985  O  O     . GLY A 1 511 ? 12.229  14.919  28.099  1.00 48.40  ? 511 GLY A O     1 
ATOM   2986  N  N     . GLU A 1 512 ? 10.574  15.930  29.192  1.00 50.60  ? 512 GLU A N     1 
ATOM   2987  C  CA    . GLU A 1 512 ? 11.057  15.424  30.443  1.00 59.11  ? 512 GLU A CA    1 
ATOM   2988  C  C     . GLU A 1 512 ? 10.639  13.951  30.564  1.00 50.38  ? 512 GLU A C     1 
ATOM   2989  O  O     . GLU A 1 512 ? 11.319  13.163  31.206  1.00 48.51  ? 512 GLU A O     1 
ATOM   2990  C  CB    . GLU A 1 512 ? 10.532  16.234  31.634  1.00 77.18  ? 512 GLU A CB    1 
ATOM   2991  C  CG    . GLU A 1 512 ? 10.850  15.581  33.001  1.00 84.99  ? 512 GLU A CG    1 
ATOM   2992  C  CD    . GLU A 1 512 ? 12.345  15.629  33.378  1.00 94.06  ? 512 GLU A CD    1 
ATOM   2993  O  OE1   . GLU A 1 512 ? 13.130  16.386  32.785  1.00 96.90  ? 512 GLU A OE1   1 
ATOM   2994  O  OE2   . GLU A 1 512 ? 12.788  14.814  34.243  1.00 106.22 ? 512 GLU A OE2   1 
ATOM   2995  N  N     . ARG A 1 513 ? 9.477   13.605  30.008  1.00 39.01  ? 513 ARG A N     1 
ATOM   2996  C  CA    . ARG A 1 513 ? 9.047   12.220  30.095  1.00 38.31  ? 513 ARG A CA    1 
ATOM   2997  C  C     . ARG A 1 513 ? 9.948   11.240  29.340  1.00 50.26  ? 513 ARG A C     1 
ATOM   2998  O  O     . ARG A 1 513 ? 10.292  11.436  28.174  1.00 57.74  ? 513 ARG A O     1 
ATOM   2999  C  CB    . ARG A 1 513 ? 7.594   12.090  29.664  1.00 35.90  ? 513 ARG A CB    1 
ATOM   3000  C  CG    . ARG A 1 513 ? 7.105   10.678  29.698  1.00 46.75  ? 513 ARG A CG    1 
ATOM   3001  C  CD    . ARG A 1 513 ? 5.642   10.535  29.324  1.00 45.58  ? 513 ARG A CD    1 
ATOM   3002  N  NE    . ARG A 1 513 ? 5.159   9.835   30.494  1.00 60.90  ? 513 ARG A NE    1 
ATOM   3003  C  CZ    . ARG A 1 513 ? 3.912   9.709   30.893  1.00 68.13  ? 513 ARG A CZ    1 
ATOM   3004  N  NH1   . ARG A 1 513 ? 2.906   10.169  30.200  1.00 93.79  ? 513 ARG A NH1   1 
ATOM   3005  N  NH2   . ARG A 1 513 ? 3.685   9.049   32.016  1.00 68.69  ? 513 ARG A NH2   1 
ATOM   3006  N  N     . ILE A 1 514 ? 10.422  10.222  30.054  1.00 54.95  ? 514 ILE A N     1 
ATOM   3007  C  CA    . ILE A 1 514 ? 11.177  9.147   29.439  1.00 44.90  ? 514 ILE A CA    1 
ATOM   3008  C  C     . ILE A 1 514 ? 10.169  8.100   28.956  1.00 45.11  ? 514 ILE A C     1 
ATOM   3009  O  O     . ILE A 1 514 ? 9.271   7.692   29.706  1.00 56.30  ? 514 ILE A O     1 
ATOM   3010  C  CB    . ILE A 1 514 ? 12.168  8.493   30.422  1.00 51.04  ? 514 ILE A CB    1 
ATOM   3011  C  CG1   . ILE A 1 514 ? 12.984  9.543   31.158  1.00 48.64  ? 514 ILE A CG1   1 
ATOM   3012  C  CG2   . ILE A 1 514 ? 13.012  7.391   29.721  1.00 34.24  ? 514 ILE A CG2   1 
ATOM   3013  C  CD1   . ILE A 1 514 ? 13.844  8.980   32.207  1.00 57.29  ? 514 ILE A CD1   1 
ATOM   3014  N  N     . PRO A 1 515 ? 10.219  7.745   27.675  1.00 43.07  ? 515 PRO A N     1 
ATOM   3015  C  CA    . PRO A 1 515 ? 9.285   6.745   27.121  1.00 46.10  ? 515 PRO A CA    1 
ATOM   3016  C  C     . PRO A 1 515 ? 9.347   5.402   27.868  1.00 50.57  ? 515 PRO A C     1 
ATOM   3017  O  O     . PRO A 1 515 ? 10.447  5.011   28.258  1.00 56.23  ? 515 PRO A O     1 
ATOM   3018  C  CB    . PRO A 1 515 ? 9.776   6.586   25.683  1.00 34.00  ? 515 PRO A CB    1 
ATOM   3019  C  CG    . PRO A 1 515 ? 10.431  7.876   25.364  1.00 26.53  ? 515 PRO A CG    1 
ATOM   3020  C  CD    . PRO A 1 515 ? 11.085  8.327   26.640  1.00 42.38  ? 515 PRO A CD    1 
ATOM   3021  N  N     . GLN A 1 516 ? 8.210   4.704   27.993  1.00 42.99  ? 516 GLN A N     1 
ATOM   3022  C  CA    . GLN A 1 516 ? 8.137   3.457   28.776  1.00 54.17  ? 516 GLN A CA    1 
ATOM   3023  C  C     . GLN A 1 516 ? 9.185   2.421   28.333  1.00 55.81  ? 516 GLN A C     1 
ATOM   3024  O  O     . GLN A 1 516 ? 9.851   1.784   29.177  1.00 54.14  ? 516 GLN A O     1 
ATOM   3025  C  CB    . GLN A 1 516 ? 6.724   2.853   28.704  1.00 49.04  ? 516 GLN A CB    1 
ATOM   3026  C  CG    . GLN A 1 516 ? 5.639   3.790   29.179  1.00 42.26  ? 516 GLN A CG    1 
ATOM   3027  C  CD    . GLN A 1 516 ? 4.371   3.046   29.613  1.00 55.28  ? 516 GLN A CD    1 
ATOM   3028  O  OE1   . GLN A 1 516 ? 4.448   1.925   30.104  1.00 58.57  ? 516 GLN A OE1   1 
ATOM   3029  N  NE2   . GLN A 1 516 ? 3.207   3.680   29.449  1.00 57.00  ? 516 GLN A NE2   1 
ATOM   3030  N  N     . GLU A 1 517 ? 9.289   2.243   27.023  1.00 50.22  ? 517 GLU A N     1 
ATOM   3031  C  CA    . GLU A 1 517 ? 10.240  1.297   26.449  1.00 42.18  ? 517 GLU A CA    1 
ATOM   3032  C  C     . GLU A 1 517 ? 11.692  1.711   26.694  1.00 38.26  ? 517 GLU A C     1 
ATOM   3033  O  O     . GLU A 1 517 ? 12.563  0.878   26.892  1.00 39.31  ? 517 GLU A O     1 
ATOM   3034  C  CB    . GLU A 1 517 ? 10.015  1.174   24.939  1.00 35.00  ? 517 GLU A CB    1 
ATOM   3035  C  CG    . GLU A 1 517 ? 8.627   1.539   24.442  1.00 63.36  ? 517 GLU A CG    1 
ATOM   3036  C  CD    . GLU A 1 517 ? 8.413   3.025   24.247  1.00 81.50  ? 517 GLU A CD    1 
ATOM   3037  O  OE1   . GLU A 1 517 ? 9.188   3.656   23.469  1.00 92.09  ? 517 GLU A OE1   1 
ATOM   3038  O  OE2   . GLU A 1 517 ? 7.404   3.530   24.802  1.00 74.53  ? 517 GLU A OE2   1 
ATOM   3039  N  N     . VAL A 1 518 ? 11.937  3.001   26.728  1.00 34.53  ? 518 VAL A N     1 
ATOM   3040  C  CA    . VAL A 1 518 ? 13.287  3.458   27.006  1.00 40.29  ? 518 VAL A CA    1 
ATOM   3041  C  C     . VAL A 1 518 ? 13.656  3.137   28.457  1.00 46.68  ? 518 VAL A C     1 
ATOM   3042  O  O     . VAL A 1 518 ? 14.756  2.634   28.744  1.00 41.79  ? 518 VAL A O     1 
ATOM   3043  C  CB    . VAL A 1 518 ? 13.409  4.961   26.722  1.00 42.27  ? 518 VAL A CB    1 
ATOM   3044  C  CG1   . VAL A 1 518 ? 14.749  5.475   27.182  1.00 40.93  ? 518 VAL A CG1   1 
ATOM   3045  C  CG2   . VAL A 1 518 ? 13.279  5.173   25.251  1.00 45.33  ? 518 VAL A CG2   1 
ATOM   3046  N  N     . VAL A 1 519 ? 12.710  3.385   29.366  1.00 35.97  ? 519 VAL A N     1 
ATOM   3047  C  CA    . VAL A 1 519 ? 12.954  3.122   30.759  1.00 43.58  ? 519 VAL A CA    1 
ATOM   3048  C  C     . VAL A 1 519 ? 13.283  1.653   30.917  1.00 52.36  ? 519 VAL A C     1 
ATOM   3049  O  O     . VAL A 1 519 ? 14.349  1.269   31.449  1.00 41.72  ? 519 VAL A O     1 
ATOM   3050  C  CB    . VAL A 1 519 ? 11.740  3.478   31.631  1.00 48.48  ? 519 VAL A CB    1 
ATOM   3051  C  CG1   . VAL A 1 519 ? 11.920  2.978   33.102  1.00 29.72  ? 519 VAL A CG1   1 
ATOM   3052  C  CG2   . VAL A 1 519 ? 11.459  4.973   31.574  1.00 48.14  ? 519 VAL A CG2   1 
ATOM   3053  N  N     . TRP A 1 520 ? 12.465  0.830   30.296  1.00 51.98  ? 520 TRP A N     1 
ATOM   3054  C  CA    . TRP A 1 520 ? 12.730  -0.573  30.414  1.00 40.48  ? 520 TRP A CA    1 
ATOM   3055  C  C     . TRP A 1 520 ? 14.056  -0.992  29.804  1.00 43.38  ? 520 TRP A C     1 
ATOM   3056  O  O     . TRP A 1 520 ? 14.776  -1.791  30.421  1.00 47.12  ? 520 TRP A O     1 
ATOM   3057  C  CB    . TRP A 1 520 ? 11.622  -1.411  29.773  1.00 42.96  ? 520 TRP A CB    1 
ATOM   3058  C  CG    . TRP A 1 520 ? 12.085  -2.794  29.680  1.00 53.14  ? 520 TRP A CG    1 
ATOM   3059  C  CD1   . TRP A 1 520 ? 12.269  -3.525  28.555  1.00 46.85  ? 520 TRP A CD1   1 
ATOM   3060  C  CD2   . TRP A 1 520 ? 12.495  -3.627  30.781  1.00 52.77  ? 520 TRP A CD2   1 
ATOM   3061  N  NE1   . TRP A 1 520 ? 12.771  -4.764  28.872  1.00 39.59  ? 520 TRP A NE1   1 
ATOM   3062  C  CE2   . TRP A 1 520 ? 12.909  -4.863  30.230  1.00 40.43  ? 520 TRP A CE2   1 
ATOM   3063  C  CE3   . TRP A 1 520 ? 12.558  -3.441  32.176  1.00 34.92  ? 520 TRP A CE3   1 
ATOM   3064  C  CZ2   . TRP A 1 520 ? 13.374  -5.915  31.013  1.00 40.50  ? 520 TRP A CZ2   1 
ATOM   3065  C  CZ3   . TRP A 1 520 ? 13.012  -4.484  32.956  1.00 44.46  ? 520 TRP A CZ3   1 
ATOM   3066  C  CH2   . TRP A 1 520 ? 13.411  -5.718  32.370  1.00 50.29  ? 520 TRP A CH2   1 
ATOM   3067  N  N     . ASP A 1 521 ? 14.409  -0.460  28.633  1.00 39.94  ? 521 ASP A N     1 
ATOM   3068  C  CA    . ASP A 1 521 ? 15.695  -0.837  27.991  1.00 49.01  ? 521 ASP A CA    1 
ATOM   3069  C  C     . ASP A 1 521 ? 16.946  -0.454  28.802  1.00 49.59  ? 521 ASP A C     1 
ATOM   3070  O  O     . ASP A 1 521 ? 17.852  -1.282  29.014  1.00 51.61  ? 521 ASP A O     1 
ATOM   3071  C  CB    . ASP A 1 521 ? 15.784  -0.230  26.589  1.00 45.80  ? 521 ASP A CB    1 
ATOM   3072  C  CG    . ASP A 1 521 ? 14.799  -0.864  25.622  1.00 53.02  ? 521 ASP A CG    1 
ATOM   3073  O  OD1   . ASP A 1 521 ? 14.251  -1.928  25.989  1.00 56.37  ? 521 ASP A OD1   1 
ATOM   3074  O  OD2   . ASP A 1 521 ? 14.516  -0.269  24.540  1.00 42.94  ? 521 ASP A OD2   1 
ATOM   3075  N  N     . LEU A 1 522 ? 16.924  0.744   29.363  1.00 38.08  ? 522 LEU A N     1 
ATOM   3076  C  CA    . LEU A 1 522 ? 18.013  1.209   30.191  1.00 42.15  ? 522 LEU A CA    1 
ATOM   3077  C  C     . LEU A 1 522 ? 18.135  0.305   31.409  1.00 51.80  ? 522 LEU A C     1 
ATOM   3078  O  O     . LEU A 1 522 ? 19.233  -0.182  31.780  1.00 47.01  ? 522 LEU A O     1 
ATOM   3079  C  CB    . LEU A 1 522 ? 17.750  2.657   30.629  1.00 49.39  ? 522 LEU A CB    1 
ATOM   3080  C  CG    . LEU A 1 522 ? 17.634  3.674   29.502  1.00 46.90  ? 522 LEU A CG    1 
ATOM   3081  C  CD1   . LEU A 1 522 ? 17.223  5.029   30.044  1.00 46.32  ? 522 LEU A CD1   1 
ATOM   3082  C  CD2   . LEU A 1 522 ? 18.963  3.769   28.812  1.00 37.51  ? 522 LEU A CD2   1 
ATOM   3083  N  N     . LEU A 1 523 ? 16.982  0.065   32.024  1.00 57.76  ? 523 LEU A N     1 
ATOM   3084  C  CA    . LEU A 1 523 ? 16.928  -0.825  33.157  1.00 48.97  ? 523 LEU A CA    1 
ATOM   3085  C  C     . LEU A 1 523 ? 17.499  -2.198  32.785  1.00 54.10  ? 523 LEU A C     1 
ATOM   3086  O  O     . LEU A 1 523 ? 18.297  -2.769  33.543  1.00 60.34  ? 523 LEU A O     1 
ATOM   3087  C  CB    . LEU A 1 523 ? 15.503  -0.924  33.649  1.00 30.62  ? 523 LEU A CB    1 
ATOM   3088  C  CG    . LEU A 1 523 ? 15.225  -1.840  34.813  1.00 35.34  ? 523 LEU A CG    1 
ATOM   3089  C  CD1   . LEU A 1 523 ? 16.246  -1.501  35.913  1.00 36.71  ? 523 LEU A CD1   1 
ATOM   3090  C  CD2   . LEU A 1 523 ? 13.768  -1.614  35.270  1.00 38.46  ? 523 LEU A CD2   1 
ATOM   3091  N  N     . GLU A 1 524 ? 17.105  -2.728  31.631  1.00 52.65  ? 524 GLU A N     1 
ATOM   3092  C  CA    . GLU A 1 524 ? 17.568  -4.046  31.226  1.00 47.03  ? 524 GLU A CA    1 
ATOM   3093  C  C     . GLU A 1 524 ? 19.077  -4.042  31.108  1.00 42.69  ? 524 GLU A C     1 
ATOM   3094  O  O     . GLU A 1 524 ? 19.713  -5.010  31.520  1.00 39.93  ? 524 GLU A O     1 
ATOM   3095  C  CB    . GLU A 1 524 ? 16.937  -4.479  29.915  1.00 50.44  ? 524 GLU A CB    1 
ATOM   3096  C  CG    . GLU A 1 524 ? 17.513  -5.795  29.411  1.00 57.29  ? 524 GLU A CG    1 
ATOM   3097  C  CD    . GLU A 1 524 ? 16.918  -6.232  28.081  1.00 69.50  ? 524 GLU A CD    1 
ATOM   3098  O  OE1   . GLU A 1 524 ? 15.715  -6.573  28.053  1.00 75.01  ? 524 GLU A OE1   1 
ATOM   3099  O  OE2   . GLU A 1 524 ? 17.644  -6.213  27.063  1.00 71.05  ? 524 GLU A OE2   1 
ATOM   3100  N  N     . GLU A 1 525 ? 19.665  -2.957  30.576  1.00 39.90  ? 525 GLU A N     1 
ATOM   3101  C  CA    . GLU A 1 525 ? 21.122  -2.905  30.574  1.00 41.84  ? 525 GLU A CA    1 
ATOM   3102  C  C     . GLU A 1 525 ? 21.763  -2.930  31.937  1.00 45.16  ? 525 GLU A C     1 
ATOM   3103  O  O     . GLU A 1 525 ? 22.763  -3.621  32.110  1.00 46.59  ? 525 GLU A O     1 
ATOM   3104  C  CB    . GLU A 1 525 ? 21.699  -1.688  29.846  1.00 49.88  ? 525 GLU A CB    1 
ATOM   3105  C  CG    . GLU A 1 525 ? 21.619  -1.719  28.357  1.00 71.97  ? 525 GLU A CG    1 
ATOM   3106  C  CD    . GLU A 1 525 ? 22.549  -2.819  27.797  1.00 70.34  ? 525 GLU A CD    1 
ATOM   3107  O  OE1   . GLU A 1 525 ? 22.145  -3.472  26.809  1.00 78.86  ? 525 GLU A OE1   1 
ATOM   3108  O  OE2   . GLU A 1 525 ? 23.606  -3.127  28.426  1.00 46.05  ? 525 GLU A OE2   1 
ATOM   3109  N  N     . THR A 1 526 ? 21.192  -2.252  32.926  1.00 55.48  ? 526 THR A N     1 
ATOM   3110  C  CA    . THR A 1 526 ? 21.810  -2.327  34.263  1.00 47.91  ? 526 THR A CA    1 
ATOM   3111  C  C     . THR A 1 526 ? 21.629  -3.739  34.886  1.00 42.94  ? 526 THR A C     1 
ATOM   3112  O  O     . THR A 1 526 ? 22.506  -4.216  35.615  1.00 36.50  ? 526 THR A O     1 
ATOM   3113  C  CB    . THR A 1 526 ? 21.240  -1.304  35.193  1.00 32.10  ? 526 THR A CB    1 
ATOM   3114  O  OG1   . THR A 1 526 ? 19.916  -1.713  35.548  1.00 49.55  ? 526 THR A OG1   1 
ATOM   3115  C  CG2   . THR A 1 526 ? 21.196  0.027   34.508  1.00 26.51  ? 526 THR A CG2   1 
ATOM   3116  N  N     . LEU A 1 527 ? 20.479  -4.378  34.636  1.00 43.26  ? 527 LEU A N     1 
ATOM   3117  C  CA    . LEU A 1 527 ? 20.260  -5.785  35.053  1.00 47.35  ? 527 LEU A CA    1 
ATOM   3118  C  C     . LEU A 1 527 ? 21.287  -6.672  34.435  1.00 45.85  ? 527 LEU A C     1 
ATOM   3119  O  O     . LEU A 1 527 ? 21.739  -7.640  35.023  1.00 41.24  ? 527 LEU A O     1 
ATOM   3120  C  CB    . LEU A 1 527 ? 18.877  -6.319  34.650  1.00 44.70  ? 527 LEU A CB    1 
ATOM   3121  C  CG    . LEU A 1 527 ? 17.571  -5.751  35.191  1.00 45.23  ? 527 LEU A CG    1 
ATOM   3122  C  CD1   . LEU A 1 527 ? 16.418  -6.503  34.590  1.00 39.06  ? 527 LEU A CD1   1 
ATOM   3123  C  CD2   . LEU A 1 527 ? 17.576  -5.988  36.690  1.00 41.52  ? 527 LEU A CD2   1 
ATOM   3124  N  N     . TRP A 1 528 ? 21.581  -6.378  33.185  1.00 39.68  ? 528 TRP A N     1 
ATOM   3125  C  CA    . TRP A 1 528 ? 22.500  -7.194  32.439  1.00 48.60  ? 528 TRP A CA    1 
ATOM   3126  C  C     . TRP A 1 528 ? 23.931  -6.985  32.976  1.00 49.86  ? 528 TRP A C     1 
ATOM   3127  O  O     . TRP A 1 528 ? 24.769  -7.896  32.956  1.00 33.75  ? 528 TRP A O     1 
ATOM   3128  C  CB    . TRP A 1 528 ? 22.398  -6.867  30.953  1.00 51.87  ? 528 TRP A CB    1 
ATOM   3129  C  CG    . TRP A 1 528 ? 22.841  -7.972  30.109  1.00 46.45  ? 528 TRP A CG    1 
ATOM   3130  C  CD1   . TRP A 1 528 ? 23.883  -7.956  29.233  1.00 56.85  ? 528 TRP A CD1   1 
ATOM   3131  C  CD2   . TRP A 1 528 ? 22.279  -9.284  30.054  1.00 55.78  ? 528 TRP A CD2   1 
ATOM   3132  N  NE1   . TRP A 1 528 ? 24.001  -9.180  28.625  1.00 63.77  ? 528 TRP A NE1   1 
ATOM   3133  C  CE2   . TRP A 1 528 ? 23.025  -10.015 29.111  1.00 63.88  ? 528 TRP A CE2   1 
ATOM   3134  C  CE3   . TRP A 1 528 ? 21.214  -9.915  30.713  1.00 59.96  ? 528 TRP A CE3   1 
ATOM   3135  C  CZ2   . TRP A 1 528 ? 22.756  -11.346 28.819  1.00 68.49  ? 528 TRP A CZ2   1 
ATOM   3136  C  CZ3   . TRP A 1 528 ? 20.941  -11.242 30.424  1.00 60.65  ? 528 TRP A CZ3   1 
ATOM   3137  C  CH2   . TRP A 1 528 ? 21.714  -11.942 29.484  1.00 70.81  ? 528 TRP A CH2   1 
ATOM   3138  N  N     . ALA A 1 529 ? 24.229  -5.753  33.382  1.00 53.21  ? 529 ALA A N     1 
ATOM   3139  C  CA    . ALA A 1 529 ? 25.492  -5.451  34.046  1.00 45.85  ? 529 ALA A CA    1 
ATOM   3140  C  C     . ALA A 1 529 ? 25.620  -6.276  35.314  1.00 45.41  ? 529 ALA A C     1 
ATOM   3141  O  O     . ALA A 1 529 ? 26.670  -6.868  35.578  1.00 50.39  ? 529 ALA A O     1 
ATOM   3142  C  CB    . ALA A 1 529 ? 25.594  -3.957  34.358  1.00 45.81  ? 529 ALA A CB    1 
ATOM   3143  N  N     . PHE A 1 530 ? 24.563  -6.277  36.125  1.00 37.57  ? 530 PHE A N     1 
ATOM   3144  C  CA    . PHE A 1 530 ? 24.563  -7.118  37.305  1.00 43.32  ? 530 PHE A CA    1 
ATOM   3145  C  C     . PHE A 1 530 ? 24.705  -8.581  36.990  1.00 48.57  ? 530 PHE A C     1 
ATOM   3146  O  O     . PHE A 1 530 ? 25.445  -9.284  37.648  1.00 59.41  ? 530 PHE A O     1 
ATOM   3147  C  CB    . PHE A 1 530 ? 23.235  -6.910  38.058  1.00 50.60  ? 530 PHE A CB    1 
ATOM   3148  C  CG    . PHE A 1 530 ? 23.156  -7.596  39.401  1.00 53.08  ? 530 PHE A CG    1 
ATOM   3149  C  CD1   . PHE A 1 530 ? 22.837  -8.954  39.461  1.00 53.43  ? 530 PHE A CD1   1 
ATOM   3150  C  CD2   . PHE A 1 530 ? 23.322  -6.892  40.594  1.00 52.52  ? 530 PHE A CD2   1 
ATOM   3151  C  CE1   . PHE A 1 530 ? 22.732  -9.619  40.699  1.00 58.36  ? 530 PHE A CE1   1 
ATOM   3152  C  CE2   . PHE A 1 530 ? 23.206  -7.533  41.822  1.00 53.04  ? 530 PHE A CE2   1 
ATOM   3153  C  CZ    . PHE A 1 530 ? 22.913  -8.907  41.881  1.00 56.51  ? 530 PHE A CZ    1 
ATOM   3154  N  N     . ARG A 1 531 ? 24.062  -9.032  35.932  1.00 48.00  ? 531 ARG A N     1 
ATOM   3155  C  CA    . ARG A 1 531 ? 24.124  -10.429 35.550  1.00 53.98  ? 531 ARG A CA    1 
ATOM   3156  C  C     . ARG A 1 531 ? 25.607  -10.745 35.137  1.00 57.16  ? 531 ARG A C     1 
ATOM   3157  O  O     . ARG A 1 531 ? 26.128  -11.795 35.499  1.00 62.74  ? 531 ARG A O     1 
ATOM   3158  C  CB    . ARG A 1 531 ? 23.023  -10.732 34.498  1.00 49.91  ? 531 ARG A CB    1 
ATOM   3159  C  CG    . ARG A 1 531 ? 23.317  -11.650 33.291  1.00 56.77  ? 531 ARG A CG    1 
ATOM   3160  C  CD    . ARG A 1 531 ? 24.089  -12.881 33.619  1.00 66.00  ? 531 ARG A CD    1 
ATOM   3161  N  NE    . ARG A 1 531 ? 24.582  -13.612 32.467  1.00 75.83  ? 531 ARG A NE    1 
ATOM   3162  C  CZ    . ARG A 1 531 ? 25.842  -14.019 32.338  1.00 79.18  ? 531 ARG A CZ    1 
ATOM   3163  N  NH1   . ARG A 1 531 ? 26.719  -13.638 33.261  1.00 80.38  ? 531 ARG A NH1   1 
ATOM   3164  N  NH2   . ARG A 1 531 ? 26.240  -14.682 31.269  1.00 79.90  ? 531 ARG A NH2   1 
ATOM   3165  N  N     . ARG A 1 532 ? 26.260  -9.863  34.373  1.00 48.33  ? 532 ARG A N     1 
ATOM   3166  C  CA    . ARG A 1 532 ? 27.628  -10.105 33.934  1.00 54.74  ? 532 ARG A CA    1 
ATOM   3167  C  C     . ARG A 1 532 ? 28.630  -10.061 35.078  1.00 56.27  ? 532 ARG A C     1 
ATOM   3168  O  O     . ARG A 1 532 ? 29.567  -10.856 35.118  1.00 58.47  ? 532 ARG A O     1 
ATOM   3169  C  CB    . ARG A 1 532 ? 28.091  -9.092  32.874  1.00 65.44  ? 532 ARG A CB    1 
ATOM   3170  C  CG    . ARG A 1 532 ? 27.330  -9.074  31.542  1.00 75.34  ? 532 ARG A CG    1 
ATOM   3171  C  CD    . ARG A 1 532 ? 28.113  -8.232  30.515  1.00 74.30  ? 532 ARG A CD    1 
ATOM   3172  N  NE    . ARG A 1 532 ? 28.522  -6.934  31.048  1.00 74.91  ? 532 ARG A NE    1 
ATOM   3173  C  CZ    . ARG A 1 532 ? 27.787  -5.822  30.985  1.00 75.80  ? 532 ARG A CZ    1 
ATOM   3174  N  NH1   . ARG A 1 532 ? 28.259  -4.679  31.502  1.00 57.33  ? 532 ARG A NH1   1 
ATOM   3175  N  NH2   . ARG A 1 532 ? 26.590  -5.849  30.396  1.00 84.49  ? 532 ARG A NH2   1 
ATOM   3176  N  N     . LYS A 1 533 ? 28.353  -9.186  36.041  1.00 55.54  ? 533 LYS A N     1 
ATOM   3177  C  CA    . LYS A 1 533 ? 29.249  -9.023  37.177  1.00 68.02  ? 533 LYS A CA    1 
ATOM   3178  C  C     . LYS A 1 533 ? 29.129  -10.173 38.177  1.00 65.34  ? 533 LYS A C     1 
ATOM   3179  O  O     . LYS A 1 533 ? 30.114  -10.545 38.821  1.00 66.19  ? 533 LYS A O     1 
ATOM   3180  C  CB    . LYS A 1 533 ? 28.982  -7.731  37.902  1.00 71.46  ? 533 LYS A CB    1 
ATOM   3181  C  CG    . LYS A 1 533 ? 29.666  -6.525  37.315  1.00 75.17  ? 533 LYS A CG    1 
ATOM   3182  C  CD    . LYS A 1 533 ? 30.828  -6.426  36.298  1.00 105.25 ? 533 LYS A CD    1 
ATOM   3183  C  CE    . LYS A 1 533 ? 32.253  -6.575  36.677  1.00 122.46 ? 533 LYS A CE    1 
ATOM   3184  N  NZ    . LYS A 1 533 ? 33.076  -6.374  35.411  1.00 128.35 ? 533 LYS A NZ    1 
ATOM   3185  N  N     . ALA A 1 534 ? 27.884  -10.463 38.537  1.00 58.17  ? 534 ALA A N     1 
ATOM   3186  C  CA    . ALA A 1 534 ? 27.517  -11.376 39.632  1.00 58.20  ? 534 ALA A CA    1 
ATOM   3187  C  C     . ALA A 1 534 ? 27.138  -12.805 39.229  1.00 69.82  ? 534 ALA A C     1 
ATOM   3188  O  O     . ALA A 1 534 ? 27.053  -13.687 40.072  1.00 74.14  ? 534 ALA A O     1 
ATOM   3189  C  CB    . ALA A 1 534 ? 26.417  -10.779 40.428  1.00 54.45  ? 534 ALA A CB    1 
ATOM   3190  N  N     . GLY A 1 535 ? 26.833  -13.026 37.959  1.00 76.21  ? 535 GLY A N     1 
ATOM   3191  C  CA    . GLY A 1 535 ? 26.430  -14.337 37.479  1.00 62.47  ? 535 GLY A CA    1 
ATOM   3192  C  C     . GLY A 1 535 ? 25.059  -14.792 37.896  1.00 55.47  ? 535 GLY A C     1 
ATOM   3193  O  O     . GLY A 1 535 ? 24.723  -15.964 37.838  1.00 49.68  ? 535 GLY A O     1 
ATOM   3194  N  N     . ARG A 1 536 ? 24.200  -13.834 38.174  1.00 66.70  ? 536 ARG A N     1 
ATOM   3195  C  CA    . ARG A 1 536 ? 22.830  -14.147 38.545  1.00 59.04  ? 536 ARG A CA    1 
ATOM   3196  C  C     . ARG A 1 536 ? 21.999  -12.870 38.436  1.00 58.16  ? 536 ARG A C     1 
ATOM   3197  O  O     . ARG A 1 536 ? 22.529  -11.778 38.183  1.00 61.04  ? 536 ARG A O     1 
ATOM   3198  C  CB    . ARG A 1 536 ? 22.740  -14.712 39.976  1.00 50.20  ? 536 ARG A CB    1 
ATOM   3199  C  CG    . ARG A 1 536 ? 23.245  -13.730 41.042  1.00 55.91  ? 536 ARG A CG    1 
ATOM   3200  C  CD    . ARG A 1 536 ? 23.262  -14.283 42.477  1.00 59.25  ? 536 ARG A CD    1 
ATOM   3201  N  NE    . ARG A 1 536 ? 23.997  -13.361 43.335  1.00 67.26  ? 536 ARG A NE    1 
ATOM   3202  C  CZ    . ARG A 1 536 ? 23.473  -12.308 43.951  1.00 63.20  ? 536 ARG A CZ    1 
ATOM   3203  N  NH1   . ARG A 1 536 ? 22.177  -12.070 43.874  1.00 35.37  ? 536 ARG A NH1   1 
ATOM   3204  N  NH2   . ARG A 1 536 ? 24.253  -11.523 44.686  1.00 81.33  ? 536 ARG A NH2   1 
ATOM   3205  N  N     . LEU A 1 537 ? 20.688  -13.006 38.579  1.00 52.42  ? 537 LEU A N     1 
ATOM   3206  C  CA    . LEU A 1 537 ? 19.843  -11.817 38.623  1.00 53.11  ? 537 LEU A CA    1 
ATOM   3207  C  C     . LEU A 1 537 ? 19.683  -11.288 40.035  1.00 49.79  ? 537 LEU A C     1 
ATOM   3208  O  O     . LEU A 1 537 ? 19.795  -12.047 41.000  1.00 53.02  ? 537 LEU A O     1 
ATOM   3209  C  CB    . LEU A 1 537 ? 18.463  -12.060 38.037  1.00 52.39  ? 537 LEU A CB    1 
ATOM   3210  C  CG    . LEU A 1 537 ? 18.271  -12.450 36.586  1.00 57.38  ? 537 LEU A CG    1 
ATOM   3211  C  CD1   . LEU A 1 537 ? 16.785  -12.531 36.360  1.00 45.20  ? 537 LEU A CD1   1 
ATOM   3212  C  CD2   . LEU A 1 537 ? 18.909  -11.408 35.612  1.00 45.85  ? 537 LEU A CD2   1 
ATOM   3213  N  N     . PRO A 1 538 ? 19.512  -9.959  40.167  1.00 41.42  ? 538 PRO A N     1 
ATOM   3214  C  CA    . PRO A 1 538 ? 19.319  -9.403  41.502  1.00 54.04  ? 538 PRO A CA    1 
ATOM   3215  C  C     . PRO A 1 538 ? 17.928  -9.742  42.031  1.00 53.82  ? 538 PRO A C     1 
ATOM   3216  O  O     . PRO A 1 538 ? 16.931  -9.779  41.321  1.00 60.30  ? 538 PRO A O     1 
ATOM   3217  C  CB    . PRO A 1 538 ? 19.443  -7.903  41.293  1.00 51.69  ? 538 PRO A CB    1 
ATOM   3218  C  CG    . PRO A 1 538 ? 19.018  -7.713  39.904  1.00 48.71  ? 538 PRO A CG    1 
ATOM   3219  C  CD    . PRO A 1 538 ? 19.480  -8.908  39.142  1.00 43.44  ? 538 PRO A CD    1 
ATOM   3220  N  N     . SER A 1 539 ? 17.881  -9.986  43.309  1.00 46.63  ? 539 SER A N     1 
ATOM   3221  C  CA    . SER A 1 539 ? 16.664  -10.289 43.991  1.00 49.54  ? 539 SER A CA    1 
ATOM   3222  C  C     . SER A 1 539 ? 15.654  -9.153  44.088  1.00 48.48  ? 539 SER A C     1 
ATOM   3223  O  O     . SER A 1 539 ? 14.438  -9.350  43.958  1.00 60.28  ? 539 SER A O     1 
ATOM   3224  C  CB    . SER A 1 539 ? 17.178  -10.655 45.352  1.00 56.44  ? 539 SER A CB    1 
ATOM   3225  O  OG    . SER A 1 539 ? 16.313  -11.003 46.307  1.00 79.16  ? 539 SER A OG    1 
ATOM   3226  N  N     . ARG A 1 540 ? 16.176  -7.944  44.182  1.00 41.67  ? 540 ARG A N     1 
ATOM   3227  C  CA    . ARG A 1 540 ? 15.352  -6.738  44.338  1.00 57.02  ? 540 ARG A CA    1 
ATOM   3228  C  C     . ARG A 1 540 ? 16.154  -5.522  43.834  1.00 63.79  ? 540 ARG A C     1 
ATOM   3229  O  O     . ARG A 1 540 ? 17.353  -5.447  44.065  1.00 68.70  ? 540 ARG A O     1 
ATOM   3230  C  CB    . ARG A 1 540 ? 14.833  -6.576  45.775  1.00 40.94  ? 540 ARG A CB    1 
ATOM   3231  C  CG    . ARG A 1 540 ? 14.404  -5.154  46.181  1.00 50.24  ? 540 ARG A CG    1 
ATOM   3232  C  CD    . ARG A 1 540 ? 13.715  -5.062  47.571  1.00 41.08  ? 540 ARG A CD    1 
ATOM   3233  N  NE    . ARG A 1 540 ? 12.256  -5.262  47.521  1.00 47.55  ? 540 ARG A NE    1 
ATOM   3234  C  CZ    . ARG A 1 540 ? 11.622  -6.324  47.990  1.00 70.61  ? 540 ARG A CZ    1 
ATOM   3235  N  NH1   . ARG A 1 540 ? 12.323  -7.381  48.418  1.00 81.54  ? 540 ARG A NH1   1 
ATOM   3236  N  NH2   . ARG A 1 540 ? 10.308  -6.387  47.889  1.00 67.77  ? 540 ARG A NH2   1 
ATOM   3237  N  N     . VAL A 1 541 ? 15.496  -4.598  43.121  1.00 57.45  ? 541 VAL A N     1 
ATOM   3238  C  CA    . VAL A 1 541 ? 16.169  -3.386  42.665  1.00 48.86  ? 541 VAL A CA    1 
ATOM   3239  C  C     . VAL A 1 541 ? 15.576  -2.141  43.277  1.00 39.14  ? 541 VAL A C     1 
ATOM   3240  O  O     . VAL A 1 541 ? 14.375  -2.076  43.562  1.00 52.63  ? 541 VAL A O     1 
ATOM   3241  C  CB    . VAL A 1 541 ? 16.110  -3.234  41.104  1.00 49.52  ? 541 VAL A CB    1 
ATOM   3242  C  CG1   . VAL A 1 541 ? 16.916  -4.320  40.437  1.00 66.30  ? 541 VAL A CG1   1 
ATOM   3243  C  CG2   . VAL A 1 541 ? 14.707  -3.318  40.597  1.00 44.58  ? 541 VAL A CG2   1 
ATOM   3244  N  N     . LEU A 1 542 ? 16.420  -1.130  43.439  1.00 39.26  ? 542 LEU A N     1 
ATOM   3245  C  CA    . LEU A 1 542 ? 15.969  0.179   43.923  1.00 43.41  ? 542 LEU A CA    1 
ATOM   3246  C  C     . LEU A 1 542 ? 16.026  1.100   42.702  1.00 41.96  ? 542 LEU A C     1 
ATOM   3247  O  O     . LEU A 1 542 ? 17.071  1.305   42.082  1.00 48.21  ? 542 LEU A O     1 
ATOM   3248  C  CB    . LEU A 1 542 ? 16.837  0.662   45.090  1.00 47.04  ? 542 LEU A CB    1 
ATOM   3249  C  CG    . LEU A 1 542 ? 16.548  2.051   45.675  1.00 48.22  ? 542 LEU A CG    1 
ATOM   3250  C  CD1   . LEU A 1 542 ? 15.081  2.172   46.062  1.00 44.95  ? 542 LEU A CD1   1 
ATOM   3251  C  CD2   . LEU A 1 542 ? 17.425  2.281   46.902  1.00 52.28  ? 542 LEU A CD2   1 
ATOM   3252  N  N     . LEU A 1 543 ? 14.863  1.582   42.320  1.00 42.39  ? 543 LEU A N     1 
ATOM   3253  C  CA    . LEU A 1 543 ? 14.694  2.387   41.129  1.00 36.21  ? 543 LEU A CA    1 
ATOM   3254  C  C     . LEU A 1 543 ? 14.548  3.838   41.583  1.00 38.50  ? 543 LEU A C     1 
ATOM   3255  O  O     . LEU A 1 543 ? 13.541  4.168   42.201  1.00 34.87  ? 543 LEU A O     1 
ATOM   3256  C  CB    . LEU A 1 543 ? 13.438  1.882   40.474  1.00 37.19  ? 543 LEU A CB    1 
ATOM   3257  C  CG    . LEU A 1 543 ? 13.673  0.658   39.600  1.00 37.19  ? 543 LEU A CG    1 
ATOM   3258  C  CD1   . LEU A 1 543 ? 12.509  0.442   38.718  1.00 43.86  ? 543 LEU A CD1   1 
ATOM   3259  C  CD2   . LEU A 1 543 ? 14.989  0.628   38.862  1.00 57.87  ? 543 LEU A CD2   1 
ATOM   3260  N  N     . LEU A 1 544 ? 15.461  4.724   41.221  1.00 32.79  ? 544 LEU A N     1 
ATOM   3261  C  CA    . LEU A 1 544 ? 15.374  6.118   41.664  1.00 25.33  ? 544 LEU A CA    1 
ATOM   3262  C  C     . LEU A 1 544 ? 15.105  7.123   40.527  1.00 40.79  ? 544 LEU A C     1 
ATOM   3263  O  O     . LEU A 1 544 ? 15.812  7.136   39.520  1.00 52.36  ? 544 LEU A O     1 
ATOM   3264  C  CB    . LEU A 1 544 ? 16.641  6.517   42.421  1.00 22.11  ? 544 LEU A CB    1 
ATOM   3265  C  CG    . LEU A 1 544 ? 16.955  5.593   43.635  1.00 48.41  ? 544 LEU A CG    1 
ATOM   3266  C  CD1   . LEU A 1 544 ? 18.381  5.770   44.179  1.00 39.83  ? 544 LEU A CD1   1 
ATOM   3267  C  CD2   . LEU A 1 544 ? 15.911  5.637   44.759  1.00 46.61  ? 544 LEU A CD2   1 
ATOM   3268  N  N     . ARG A 1 545 ? 14.093  7.945   40.671  1.00 35.35  ? 545 ARG A N     1 
ATOM   3269  C  CA    . ARG A 1 545 ? 13.806  8.906   39.644  1.00 47.16  ? 545 ARG A CA    1 
ATOM   3270  C  C     . ARG A 1 545 ? 14.097  10.272  40.148  1.00 41.81  ? 545 ARG A C     1 
ATOM   3271  O  O     . ARG A 1 545 ? 13.714  10.607  41.214  1.00 41.10  ? 545 ARG A O     1 
ATOM   3272  C  CB    . ARG A 1 545 ? 12.354  8.819   39.225  1.00 59.64  ? 545 ARG A CB    1 
ATOM   3273  C  CG    . ARG A 1 545 ? 11.925  9.870   38.230  1.00 53.90  ? 545 ARG A CG    1 
ATOM   3274  C  CD    . ARG A 1 545 ? 12.584  9.643   36.891  1.00 83.99  ? 545 ARG A CD    1 
ATOM   3275  N  NE    . ARG A 1 545 ? 11.860  10.257  35.790  1.00 70.72  ? 545 ARG A NE    1 
ATOM   3276  C  CZ    . ARG A 1 545 ? 12.274  11.336  35.162  1.00 63.90  ? 545 ARG A CZ    1 
ATOM   3277  N  NH1   . ARG A 1 545 ? 13.384  11.906  35.530  1.00 72.64  ? 545 ARG A NH1   1 
ATOM   3278  N  NH2   . ARG A 1 545 ? 11.581  11.845  34.186  1.00 52.07  ? 545 ARG A NH2   1 
ATOM   3279  N  N     . ASN A 1 546 ? 14.786  11.062  39.356  1.00 51.30  ? 546 ASN A N     1 
ATOM   3280  C  CA    . ASN A 1 546 ? 15.128  12.414  39.724  1.00 46.62  ? 546 ASN A CA    1 
ATOM   3281  C  C     . ASN A 1 546 ? 13.984  13.303  39.345  1.00 47.06  ? 546 ASN A C     1 
ATOM   3282  O  O     . ASN A 1 546 ? 13.638  13.398  38.196  1.00 55.51  ? 546 ASN A O     1 
ATOM   3283  C  CB    . ASN A 1 546 ? 16.389  12.814  38.995  1.00 30.00  ? 546 ASN A CB    1 
ATOM   3284  C  CG    . ASN A 1 546 ? 16.840  14.204  39.320  1.00 30.00  ? 546 ASN A CG    1 
ATOM   3285  O  OD1   . ASN A 1 546 ? 16.064  15.133  39.310  1.00 30.00  ? 546 ASN A OD1   1 
ATOM   3286  N  ND2   . ASN A 1 546 ? 18.114  14.354  39.581  1.00 30.00  ? 546 ASN A ND2   1 
ATOM   3287  N  N     . GLY A 1 547 ? 13.387  13.942  40.332  1.00 49.46  ? 547 GLY A N     1 
ATOM   3288  C  CA    . GLY A 1 547 ? 12.251  14.800  40.116  1.00 50.18  ? 547 GLY A CA    1 
ATOM   3289  C  C     . GLY A 1 547 ? 11.031  13.924  40.198  1.00 62.69  ? 547 GLY A C     1 
ATOM   3290  O  O     . GLY A 1 547 ? 11.112  12.841  40.710  1.00 65.60  ? 547 GLY A O     1 
ATOM   3291  N  N     . ARG A 1 548 ? 9.895   14.383  39.700  1.00 63.68  ? 548 ARG A N     1 
ATOM   3292  C  CA    . ARG A 1 548 ? 8.682   13.568  39.723  1.00 55.92  ? 548 ARG A CA    1 
ATOM   3293  C  C     . ARG A 1 548 ? 8.662   12.445  38.722  1.00 52.86  ? 548 ARG A C     1 
ATOM   3294  O  O     . ARG A 1 548 ? 9.257   12.553  37.645  1.00 68.95  ? 548 ARG A O     1 
ATOM   3295  C  CB    . ARG A 1 548 ? 7.438   14.409  39.513  1.00 58.00  ? 548 ARG A CB    1 
ATOM   3296  C  CG    . ARG A 1 548 ? 7.439   15.563  40.439  1.00 82.35  ? 548 ARG A CG    1 
ATOM   3297  C  CD    . ARG A 1 548 ? 6.340   16.539  40.216  1.00 104.53 ? 548 ARG A CD    1 
ATOM   3298  N  NE    . ARG A 1 548 ? 5.570   16.192  39.018  1.00 123.24 ? 548 ARG A NE    1 
ATOM   3299  C  CZ    . ARG A 1 548 ? 4.373   16.697  38.718  1.00 133.74 ? 548 ARG A CZ    1 
ATOM   3300  N  NH1   . ARG A 1 548 ? 3.798   17.598  39.515  1.00 137.99 ? 548 ARG A NH1   1 
ATOM   3301  N  NH2   . ARG A 1 548 ? 3.770   16.297  37.620  1.00 132.38 ? 548 ARG A NH2   1 
ATOM   3302  N  N     . VAL A 1 549 ? 7.918   11.394  39.020  1.00 49.27  ? 549 VAL A N     1 
ATOM   3303  C  CA    . VAL A 1 549 ? 7.701   10.331  38.050  1.00 46.95  ? 549 VAL A CA    1 
ATOM   3304  C  C     . VAL A 1 549 ? 6.414   10.605  37.250  1.00 40.15  ? 549 VAL A C     1 
ATOM   3305  O  O     . VAL A 1 549 ? 5.318   10.606  37.795  1.00 34.05  ? 549 VAL A O     1 
ATOM   3306  C  CB    . VAL A 1 549 ? 7.588   8.919   38.729  1.00 48.26  ? 549 VAL A CB    1 
ATOM   3307  C  CG1   . VAL A 1 549 ? 7.265   7.857   37.701  1.00 32.50  ? 549 VAL A CG1   1 
ATOM   3308  C  CG2   . VAL A 1 549 ? 8.843   8.576   39.536  1.00 47.81  ? 549 VAL A CG2   1 
ATOM   3309  N  N     . PRO A 1 550 ? 6.547   10.886  35.952  1.00 49.00  ? 550 PRO A N     1 
ATOM   3310  C  CA    . PRO A 1 550 ? 5.311   11.091  35.184  1.00 39.03  ? 550 PRO A CA    1 
ATOM   3311  C  C     . PRO A 1 550 ? 4.438   9.861   35.157  1.00 37.01  ? 550 PRO A C     1 
ATOM   3312  O  O     . PRO A 1 550 ? 4.991   8.774   35.149  1.00 44.92  ? 550 PRO A O     1 
ATOM   3313  C  CB    . PRO A 1 550 ? 5.827   11.455  33.784  1.00 44.64  ? 550 PRO A CB    1 
ATOM   3314  C  CG    . PRO A 1 550 ? 7.246   11.909  34.023  1.00 47.85  ? 550 PRO A CG    1 
ATOM   3315  C  CD    . PRO A 1 550 ? 7.756   11.107  35.156  1.00 49.57  ? 550 PRO A CD    1 
ATOM   3316  N  N     . GLN A 1 551 ? 3.109   10.061  35.125  1.00 40.49  ? 551 GLN A N     1 
ATOM   3317  C  CA    . GLN A 1 551 ? 2.084   8.999   35.161  1.00 45.05  ? 551 GLN A CA    1 
ATOM   3318  C  C     . GLN A 1 551 ? 2.465   7.797   34.293  1.00 48.48  ? 551 GLN A C     1 
ATOM   3319  O  O     . GLN A 1 551 ? 2.524   7.930   33.096  1.00 54.65  ? 551 GLN A O     1 
ATOM   3320  C  CB    . GLN A 1 551 ? 0.737   9.553   34.799  1.00 56.19  ? 551 GLN A CB    1 
ATOM   3321  N  N     . ASP A 1 552 ? 2.580   6.610   34.876  1.00 46.94  ? 552 ASP A N     1 
ATOM   3322  C  CA    . ASP A 1 552 ? 2.852   5.351   34.153  1.00 55.14  ? 552 ASP A CA    1 
ATOM   3323  C  C     . ASP A 1 552 ? 4.146   5.310   33.364  1.00 49.06  ? 552 ASP A C     1 
ATOM   3324  O  O     . ASP A 1 552 ? 4.306   4.396   32.543  1.00 37.35  ? 552 ASP A O     1 
ATOM   3325  C  CB    . ASP A 1 552 ? 1.745   4.991   33.133  1.00 58.10  ? 552 ASP A CB    1 
ATOM   3326  C  CG    . ASP A 1 552 ? 0.367   4.863   33.746  1.00 66.46  ? 552 ASP A CG    1 
ATOM   3327  O  OD1   . ASP A 1 552 ? 0.247   4.309   34.855  1.00 76.16  ? 552 ASP A OD1   1 
ATOM   3328  O  OD2   . ASP A 1 552 ? -0.599  5.302   33.107  1.00 73.30  ? 552 ASP A OD2   1 
ATOM   3329  N  N     . GLU A 1 553 ? 5.095   6.206   33.682  1.00 49.17  ? 553 GLU A N     1 
ATOM   3330  C  CA    . GLU A 1 553 ? 6.413   6.212   33.021  1.00 36.59  ? 553 GLU A CA    1 
ATOM   3331  C  C     . GLU A 1 553 ? 7.175   4.896   33.190  1.00 40.90  ? 553 GLU A C     1 
ATOM   3332  O  O     . GLU A 1 553 ? 7.892   4.466   32.303  1.00 47.68  ? 553 GLU A O     1 
ATOM   3333  C  CB    . GLU A 1 553 ? 7.270   7.352   33.534  1.00 36.45  ? 553 GLU A CB    1 
ATOM   3334  C  CG    . GLU A 1 553 ? 8.671   7.432   32.934  1.00 38.75  ? 553 GLU A CG    1 
ATOM   3335  C  CD    . GLU A 1 553 ? 9.490   8.583   33.515  1.00 64.92  ? 553 GLU A CD    1 
ATOM   3336  O  OE1   . GLU A 1 553 ? 9.879   8.533   34.700  1.00 79.88  ? 553 GLU A OE1   1 
ATOM   3337  O  OE2   . GLU A 1 553 ? 9.728   9.572   32.785  1.00 70.71  ? 553 GLU A OE2   1 
ATOM   3338  N  N     . PHE A 1 554 ? 6.959   4.243   34.324  1.00 49.48  ? 554 PHE A N     1 
ATOM   3339  C  CA    . PHE A 1 554 ? 7.681   3.034   34.711  1.00 52.24  ? 554 PHE A CA    1 
ATOM   3340  C  C     . PHE A 1 554 ? 6.791   1.806   34.537  1.00 54.35  ? 554 PHE A C     1 
ATOM   3341  O  O     . PHE A 1 554 ? 7.193   0.695   34.887  1.00 59.01  ? 554 PHE A O     1 
ATOM   3342  C  CB    . PHE A 1 554 ? 8.198   3.157   36.143  1.00 48.43  ? 554 PHE A CB    1 
ATOM   3343  C  CG    . PHE A 1 554 ? 9.532   3.860   36.249  1.00 40.35  ? 554 PHE A CG    1 
ATOM   3344  C  CD1   . PHE A 1 554 ? 9.595   5.249   36.150  1.00 30.29  ? 554 PHE A CD1   1 
ATOM   3345  C  CD2   . PHE A 1 554 ? 10.707  3.150   36.537  1.00 44.40  ? 554 PHE A CD2   1 
ATOM   3346  C  CE1   . PHE A 1 554 ? 10.818  5.921   36.242  1.00 40.53  ? 554 PHE A CE1   1 
ATOM   3347  C  CE2   . PHE A 1 554 ? 11.932  3.803   36.660  1.00 35.29  ? 554 PHE A CE2   1 
ATOM   3348  C  CZ    . PHE A 1 554 ? 11.990  5.199   36.492  1.00 44.26  ? 554 PHE A CZ    1 
ATOM   3349  N  N     . ALA A 1 555 ? 5.555   2.004   34.077  1.00 44.16  ? 555 ALA A N     1 
ATOM   3350  C  CA    . ALA A 1 555 ? 4.608   0.880   34.020  1.00 43.19  ? 555 ALA A CA    1 
ATOM   3351  C  C     . ALA A 1 555 ? 5.128   -0.386  33.330  1.00 42.79  ? 555 ALA A C     1 
ATOM   3352  O  O     . ALA A 1 555 ? 5.084   -1.476  33.899  1.00 48.76  ? 555 ALA A O     1 
ATOM   3353  C  CB    . ALA A 1 555 ? 3.334   1.348   33.325  1.00 44.63  ? 555 ALA A CB    1 
ATOM   3354  N  N     . LEU A 1 556 ? 5.698   -0.229  32.145  1.00 45.21  ? 556 LEU A N     1 
ATOM   3355  C  CA    . LEU A 1 556 ? 6.210   -1.360  31.383  1.00 51.93  ? 556 LEU A CA    1 
ATOM   3356  C  C     . LEU A 1 556 ? 7.413   -2.041  32.039  1.00 54.08  ? 556 LEU A C     1 
ATOM   3357  O  O     . LEU A 1 556 ? 7.454   -3.266  32.139  1.00 58.79  ? 556 LEU A O     1 
ATOM   3358  C  CB    . LEU A 1 556 ? 6.466   -0.872  29.952  1.00 51.98  ? 556 LEU A CB    1 
ATOM   3359  C  CG    . LEU A 1 556 ? 6.458   -1.899  28.835  1.00 51.78  ? 556 LEU A CG    1 
ATOM   3360  C  CD1   . LEU A 1 556 ? 5.965   -1.186  27.631  1.00 53.88  ? 556 LEU A CD1   1 
ATOM   3361  C  CD2   . LEU A 1 556 ? 7.893   -2.258  28.560  1.00 48.71  ? 556 LEU A CD2   1 
ATOM   3362  N  N     . ALA A 1 557 ? 8.335   -1.234  32.549  1.00 46.28  ? 557 ALA A N     1 
ATOM   3363  C  CA    . ALA A 1 557 ? 9.507   -1.715  33.244  1.00 42.10  ? 557 ALA A CA    1 
ATOM   3364  C  C     . ALA A 1 557 ? 9.082   -2.489  34.497  1.00 49.39  ? 557 ALA A C     1 
ATOM   3365  O  O     . ALA A 1 557 ? 9.611   -3.570  34.809  1.00 53.79  ? 557 ALA A O     1 
ATOM   3366  C  CB    . ALA A 1 557 ? 10.428  -0.536  33.620  1.00 42.10  ? 557 ALA A CB    1 
ATOM   3367  N  N     . LEU A 1 558 ? 8.125   -1.916  35.211  1.00 48.78  ? 558 LEU A N     1 
ATOM   3368  C  CA    . LEU A 1 558 ? 7.614   -2.476  36.454  1.00 57.35  ? 558 LEU A CA    1 
ATOM   3369  C  C     . LEU A 1 558 ? 7.024   -3.880  36.125  1.00 52.52  ? 558 LEU A C     1 
ATOM   3370  O  O     . LEU A 1 558 ? 7.291   -4.887  36.823  1.00 48.22  ? 558 LEU A O     1 
ATOM   3371  C  CB    . LEU A 1 558 ? 6.580   -1.521  37.049  1.00 47.35  ? 558 LEU A CB    1 
ATOM   3372  C  CG    . LEU A 1 558 ? 7.200   -0.556  38.089  1.00 50.89  ? 558 LEU A CG    1 
ATOM   3373  C  CD1   . LEU A 1 558 ? 6.274   -0.036  39.143  1.00 57.46  ? 558 LEU A CD1   1 
ATOM   3374  C  CD2   . LEU A 1 558 ? 8.651   -0.848  38.597  1.00 36.80  ? 558 LEU A CD2   1 
ATOM   3375  N  N     . GLU A 1 559 ? 6.224   -3.942  35.051  1.00 42.46  ? 559 GLU A N     1 
ATOM   3376  C  CA    . GLU A 1 559 ? 5.670   -5.228  34.640  1.00 50.63  ? 559 GLU A CA    1 
ATOM   3377  C  C     . GLU A 1 559 ? 6.768   -6.242  34.232  1.00 59.29  ? 559 GLU A C     1 
ATOM   3378  O  O     . GLU A 1 559 ? 6.724   -7.419  34.626  1.00 54.97  ? 559 GLU A O     1 
ATOM   3379  C  CB    . GLU A 1 559 ? 4.707   -5.040  33.500  1.00 39.29  ? 559 GLU A CB    1 
ATOM   3380  N  N     . ALA A 1 560 ? 7.749   -5.790  33.455  1.00 47.87  ? 560 ALA A N     1 
ATOM   3381  C  CA    . ALA A 1 560 ? 8.871   -6.641  33.058  1.00 56.52  ? 560 ALA A CA    1 
ATOM   3382  C  C     . ALA A 1 560 ? 9.616   -7.262  34.214  1.00 58.32  ? 560 ALA A C     1 
ATOM   3383  O  O     . ALA A 1 560 ? 9.893   -8.471  34.199  1.00 50.02  ? 560 ALA A O     1 
ATOM   3384  C  CB    . ALA A 1 560 ? 9.876   -5.853  32.187  1.00 47.67  ? 560 ALA A CB    1 
ATOM   3385  N  N     . LEU A 1 561 ? 9.900   -6.443  35.233  1.00 51.39  ? 561 LEU A N     1 
ATOM   3386  C  CA    . LEU A 1 561 ? 10.546  -6.950  36.438  1.00 45.56  ? 561 LEU A CA    1 
ATOM   3387  C  C     . LEU A 1 561 ? 9.677   -7.989  37.111  1.00 53.36  ? 561 LEU A C     1 
ATOM   3388  O  O     . LEU A 1 561 ? 10.163  -9.056  37.495  1.00 66.66  ? 561 LEU A O     1 
ATOM   3389  C  CB    . LEU A 1 561 ? 10.836  -5.821  37.426  1.00 47.17  ? 561 LEU A CB    1 
ATOM   3390  C  CG    . LEU A 1 561 ? 11.978  -4.867  37.118  1.00 46.39  ? 561 LEU A CG    1 
ATOM   3391  C  CD1   . LEU A 1 561 ? 12.044  -3.768  38.201  1.00 30.92  ? 561 LEU A CD1   1 
ATOM   3392  C  CD2   . LEU A 1 561 ? 13.281  -5.643  37.029  1.00 44.54  ? 561 LEU A CD2   1 
ATOM   3393  N  N     . ALA A 1 562 ? 8.377   -7.712  37.201  1.00 58.46  ? 562 ALA A N     1 
ATOM   3394  C  CA    . ALA A 1 562 ? 7.540   -8.708  37.833  1.00 46.42  ? 562 ALA A CA    1 
ATOM   3395  C  C     . ALA A 1 562 ? 7.517   -10.026 37.060  1.00 59.55  ? 562 ALA A C     1 
ATOM   3396  O  O     . ALA A 1 562 ? 7.642   -11.096 37.668  1.00 67.71  ? 562 ALA A O     1 
ATOM   3397  C  CB    . ALA A 1 562 ? 6.134   -8.181  37.935  1.00 32.19  ? 562 ALA A CB    1 
ATOM   3398  N  N     . ARG A 1 563 ? 7.616   -9.945  35.735  1.00 56.78  ? 563 ARG A N     1 
ATOM   3399  C  CA    . ARG A 1 563 ? 7.614   -11.146 34.919  1.00 50.89  ? 563 ARG A CA    1 
ATOM   3400  C  C     . ARG A 1 563 ? 8.947   -11.885 35.025  1.00 59.23  ? 563 ARG A C     1 
ATOM   3401  O  O     . ARG A 1 563 ? 8.986   -13.091 34.881  1.00 70.93  ? 563 ARG A O     1 
ATOM   3402  C  CB    . ARG A 1 563 ? 7.375   -10.818 33.464  1.00 51.92  ? 563 ARG A CB    1 
ATOM   3403  C  CG    . ARG A 1 563 ? 6.032   -10.314 33.008  1.00 54.47  ? 563 ARG A CG    1 
ATOM   3404  C  CD    . ARG A 1 563 ? 6.261   -9.886  31.583  1.00 67.53  ? 563 ARG A CD    1 
ATOM   3405  N  NE    . ARG A 1 563 ? 5.182   -9.122  30.983  1.00 87.36  ? 563 ARG A NE    1 
ATOM   3406  C  CZ    . ARG A 1 563 ? 5.224   -8.663  29.731  1.00 91.85  ? 563 ARG A CZ    1 
ATOM   3407  N  NH1   . ARG A 1 563 ? 6.305   -8.865  28.985  1.00 85.69  ? 563 ARG A NH1   1 
ATOM   3408  N  NH2   . ARG A 1 563 ? 4.208   -7.970  29.231  1.00 95.11  ? 563 ARG A NH2   1 
ATOM   3409  N  N     . GLU A 1 564 ? 10.016  -11.182 35.390  1.00 54.25  ? 564 GLU A N     1 
ATOM   3410  C  CA    . GLU A 1 564 ? 11.303  -11.831 35.594  1.00 41.81  ? 564 GLU A CA    1 
ATOM   3411  C  C     . GLU A 1 564 ? 11.519  -12.285 37.001  1.00 54.68  ? 564 GLU A C     1 
ATOM   3412  O  O     . GLU A 1 564 ? 12.604  -12.791 37.298  1.00 63.30  ? 564 GLU A O     1 
ATOM   3413  C  CB    . GLU A 1 564 ? 12.562  -11.052 35.225  1.00 46.86  ? 564 GLU A CB    1 
ATOM   3414  C  CG    . GLU A 1 564 ? 12.916  -10.668 33.914  1.00 62.01  ? 564 GLU A CG    1 
ATOM   3415  C  CD    . GLU A 1 564 ? 13.138  -11.893 32.994  1.00 76.24  ? 564 GLU A CD    1 
ATOM   3416  O  OE1   . GLU A 1 564 ? 12.896  -11.721 31.789  1.00 79.70  ? 564 GLU A OE1   1 
ATOM   3417  O  OE2   . GLU A 1 564 ? 13.541  -13.002 33.447  1.00 83.48  ? 564 GLU A OE2   1 
ATOM   3418  N  N     . GLY A 1 565 ? 10.566  -12.007 37.891  1.00 52.36  ? 565 GLY A N     1 
ATOM   3419  C  CA    . GLY A 1 565 ? 10.697  -12.391 39.289  1.00 45.18  ? 565 GLY A CA    1 
ATOM   3420  C  C     . GLY A 1 565 ? 11.642  -11.547 40.109  1.00 54.18  ? 565 GLY A C     1 
ATOM   3421  O  O     . GLY A 1 565 ? 12.193  -11.970 41.128  1.00 62.71  ? 565 GLY A O     1 
ATOM   3422  N  N     . ILE A 1 566 ? 11.842  -10.335 39.644  1.00 48.08  ? 566 ILE A N     1 
ATOM   3423  C  CA    . ILE A 1 566 ? 12.687  -9.410  40.335  1.00 51.89  ? 566 ILE A CA    1 
ATOM   3424  C  C     . ILE A 1 566 ? 11.814  -8.469  41.169  1.00 49.54  ? 566 ILE A C     1 
ATOM   3425  O  O     . ILE A 1 566 ? 10.864  -7.866  40.663  1.00 51.15  ? 566 ILE A O     1 
ATOM   3426  C  CB    . ILE A 1 566 ? 13.600  -8.661  39.330  1.00 43.21  ? 566 ILE A CB    1 
ATOM   3427  C  CG1   . ILE A 1 566 ? 14.464  -9.680  38.588  1.00 61.37  ? 566 ILE A CG1   1 
ATOM   3428  C  CG2   . ILE A 1 566 ? 14.481  -7.653  40.025  1.00 40.85  ? 566 ILE A CG2   1 
ATOM   3429  C  CD1   . ILE A 1 566 ? 15.310  -9.110  37.487  1.00 75.15  ? 566 ILE A CD1   1 
ATOM   3430  N  N     . ALA A 1 567 ? 12.121  -8.349  42.460  1.00 34.89  ? 567 ALA A N     1 
ATOM   3431  C  CA    . ALA A 1 567 ? 11.330  -7.437  43.273  1.00 42.58  ? 567 ALA A CA    1 
ATOM   3432  C  C     . ALA A 1 567 ? 11.831  -6.012  43.090  1.00 54.88  ? 567 ALA A C     1 
ATOM   3433  O  O     . ALA A 1 567 ? 12.939  -5.809  42.601  1.00 59.14  ? 567 ALA A O     1 
ATOM   3434  C  CB    . ALA A 1 567 ? 11.405  -7.818  44.689  1.00 32.62  ? 567 ALA A CB    1 
ATOM   3435  N  N     . TYR A 1 568 ? 11.001  -5.014  43.400  1.00 54.74  ? 568 TYR A N     1 
ATOM   3436  C  CA    . TYR A 1 568 ? 11.421  -3.651  43.083  1.00 55.49  ? 568 TYR A CA    1 
ATOM   3437  C  C     . TYR A 1 568 ? 10.856  -2.637  44.070  1.00 54.61  ? 568 TYR A C     1 
ATOM   3438  O  O     . TYR A 1 568 ? 9.897   -2.923  44.795  1.00 57.16  ? 568 TYR A O     1 
ATOM   3439  C  CB    . TYR A 1 568 ? 10.973  -3.209  41.684  1.00 51.07  ? 568 TYR A CB    1 
ATOM   3440  C  CG    . TYR A 1 568 ? 9.498   -3.351  41.400  1.00 51.53  ? 568 TYR A CG    1 
ATOM   3441  C  CD1   . TYR A 1 568 ? 8.602   -2.395  41.877  1.00 56.37  ? 568 TYR A CD1   1 
ATOM   3442  C  CD2   . TYR A 1 568 ? 8.988   -4.428  40.679  1.00 57.50  ? 568 TYR A CD2   1 
ATOM   3443  C  CE1   . TYR A 1 568 ? 7.250   -2.502  41.634  1.00 55.80  ? 568 TYR A CE1   1 
ATOM   3444  C  CE2   . TYR A 1 568 ? 7.613   -4.550  40.432  1.00 45.16  ? 568 TYR A CE2   1 
ATOM   3445  C  CZ    . TYR A 1 568 ? 6.759   -3.580  40.912  1.00 48.19  ? 568 TYR A CZ    1 
ATOM   3446  O  OH    . TYR A 1 568 ? 5.399   -3.670  40.703  1.00 46.09  ? 568 TYR A OH    1 
ATOM   3447  N  N     . ASP A 1 569 ? 11.492  -1.470  44.110  1.00 41.33  ? 569 ASP A N     1 
ATOM   3448  C  CA    . ASP A 1 569 ? 10.942  -0.240  44.671  1.00 39.43  ? 569 ASP A CA    1 
ATOM   3449  C  C     . ASP A 1 569 ? 11.141  0.997   43.796  1.00 47.78  ? 569 ASP A C     1 
ATOM   3450  O  O     . ASP A 1 569 ? 12.222  1.206   43.287  1.00 58.63  ? 569 ASP A O     1 
ATOM   3451  C  CB    . ASP A 1 569 ? 11.542  0.053   46.038  1.00 52.27  ? 569 ASP A CB    1 
ATOM   3452  C  CG    . ASP A 1 569 ? 11.179  -0.964  47.067  1.00 55.40  ? 569 ASP A CG    1 
ATOM   3453  O  OD1   . ASP A 1 569 ? 10.052  -0.871  47.593  1.00 52.29  ? 569 ASP A OD1   1 
ATOM   3454  O  OD2   . ASP A 1 569 ? 12.008  -1.874  47.317  1.00 64.47  ? 569 ASP A OD2   1 
ATOM   3455  N  N     . LEU A 1 570 ? 10.109  1.796   43.605  1.00 41.51  ? 570 LEU A N     1 
ATOM   3456  C  CA    . LEU A 1 570 ? 10.193  3.061   42.856  1.00 46.49  ? 570 LEU A CA    1 
ATOM   3457  C  C     . LEU A 1 570 ? 10.191  4.269   43.758  1.00 50.93  ? 570 LEU A C     1 
ATOM   3458  O  O     . LEU A 1 570 ? 9.285   4.452   44.564  1.00 49.48  ? 570 LEU A O     1 
ATOM   3459  C  CB    . LEU A 1 570 ? 9.016   3.263   41.902  1.00 44.84  ? 570 LEU A CB    1 
ATOM   3460  C  CG    . LEU A 1 570 ? 9.198   4.118   40.652  1.00 39.02  ? 570 LEU A CG    1 
ATOM   3461  C  CD1   . LEU A 1 570 ? 10.612  4.186   40.157  1.00 44.67  ? 570 LEU A CD1   1 
ATOM   3462  C  CD2   . LEU A 1 570 ? 8.172   3.766   39.559  1.00 49.67  ? 570 LEU A CD2   1 
ATOM   3463  N  N     . VAL A 1 571 ? 11.232  5.071   43.691  1.00 50.27  ? 571 VAL A N     1 
ATOM   3464  C  CA    . VAL A 1 571 ? 11.251  6.195   44.573  1.00 43.99  ? 571 VAL A CA    1 
ATOM   3465  C  C     . VAL A 1 571 ? 11.481  7.503   43.793  1.00 41.40  ? 571 VAL A C     1 
ATOM   3466  O  O     . VAL A 1 571 ? 12.503  7.666   43.101  1.00 38.76  ? 571 VAL A O     1 
ATOM   3467  C  CB    . VAL A 1 571 ? 12.331  6.050   45.628  1.00 47.54  ? 571 VAL A CB    1 
ATOM   3468  C  CG1   . VAL A 1 571 ? 12.232  7.265   46.564  1.00 42.00  ? 571 VAL A CG1   1 
ATOM   3469  C  CG2   . VAL A 1 571 ? 12.083  4.832   46.436  1.00 38.06  ? 571 VAL A CG2   1 
ATOM   3470  N  N     . SER A 1 572 ? 10.536  8.417   43.885  1.00 38.44  ? 572 SER A N     1 
ATOM   3471  C  CA    . SER A 1 572 ? 10.687  9.758   43.344  1.00 34.91  ? 572 SER A CA    1 
ATOM   3472  C  C     . SER A 1 572 ? 11.551  10.629  44.256  1.00 41.10  ? 572 SER A C     1 
ATOM   3473  O  O     . SER A 1 572 ? 11.261  10.724  45.438  1.00 50.88  ? 572 SER A O     1 
ATOM   3474  C  CB    . SER A 1 572 ? 9.328   10.414  43.179  1.00 43.92  ? 572 SER A CB    1 
ATOM   3475  O  OG    . SER A 1 572 ? 9.495   11.728  42.672  1.00 61.27  ? 572 SER A OG    1 
ATOM   3476  N  N     . VAL A 1 573 ? 12.649  11.181  43.759  1.00 36.73  ? 573 VAL A N     1 
ATOM   3477  C  CA    . VAL A 1 573 ? 13.522  12.042  44.576  1.00 45.33  ? 573 VAL A CA    1 
ATOM   3478  C  C     . VAL A 1 573 ? 13.510  13.520  44.139  1.00 51.88  ? 573 VAL A C     1 
ATOM   3479  O  O     . VAL A 1 573 ? 14.048  13.856  43.103  1.00 59.34  ? 573 VAL A O     1 
ATOM   3480  C  CB    . VAL A 1 573 ? 14.996  11.557  44.618  1.00 40.85  ? 573 VAL A CB    1 
ATOM   3481  C  CG1   . VAL A 1 573 ? 15.795  12.440  45.577  1.00 23.37  ? 573 VAL A CG1   1 
ATOM   3482  C  CG2   . VAL A 1 573 ? 15.087  10.089  45.018  1.00 44.78  ? 573 VAL A CG2   1 
ATOM   3483  N  N     . ARG A 1 574 ? 12.839  14.387  44.881  1.00 56.71  ? 574 ARG A N     1 
ATOM   3484  C  CA    . ARG A 1 574 ? 12.692  15.799  44.519  1.00 42.63  ? 574 ARG A CA    1 
ATOM   3485  C  C     . ARG A 1 574 ? 13.641  16.712  45.301  1.00 49.42  ? 574 ARG A C     1 
ATOM   3486  O  O     . ARG A 1 574 ? 13.643  16.705  46.539  1.00 67.47  ? 574 ARG A O     1 
ATOM   3487  C  CB    . ARG A 1 574 ? 11.273  16.228  44.742  1.00 39.69  ? 574 ARG A CB    1 
ATOM   3488  C  CG    . ARG A 1 574 ? 10.350  15.457  43.852  1.00 37.32  ? 574 ARG A CG    1 
ATOM   3489  C  CD    . ARG A 1 574 ? 9.081   15.320  44.519  1.00 36.79  ? 574 ARG A CD    1 
ATOM   3490  N  NE    . ARG A 1 574 ? 8.152   14.352  43.978  1.00 43.08  ? 574 ARG A NE    1 
ATOM   3491  C  CZ    . ARG A 1 574 ? 6.860   14.505  44.215  1.00 53.75  ? 574 ARG A CZ    1 
ATOM   3492  N  NH1   . ARG A 1 574 ? 6.490   15.589  44.895  1.00 68.99  ? 574 ARG A NH1   1 
ATOM   3493  N  NH2   . ARG A 1 574 ? 5.953   13.665  43.752  1.00 51.52  ? 574 ARG A NH2   1 
ATOM   3494  N  N     . LYS A 1 575 ? 14.483  17.449  44.592  1.00 44.87  ? 575 LYS A N     1 
ATOM   3495  C  CA    . LYS A 1 575 ? 15.492  18.292  45.225  1.00 45.66  ? 575 LYS A CA    1 
ATOM   3496  C  C     . LYS A 1 575 ? 14.862  19.542  45.834  1.00 57.67  ? 575 LYS A C     1 
ATOM   3497  O  O     . LYS A 1 575 ? 15.497  20.274  46.583  1.00 65.68  ? 575 LYS A O     1 
ATOM   3498  C  CB    . LYS A 1 575 ? 16.587  18.713  44.221  1.00 43.63  ? 575 LYS A CB    1 
ATOM   3499  C  CG    . LYS A 1 575 ? 17.330  17.556  43.579  1.00 54.18  ? 575 LYS A CG    1 
ATOM   3500  C  CD    . LYS A 1 575 ? 18.480  18.055  42.696  1.00 62.95  ? 575 LYS A CD    1 
ATOM   3501  C  CE    . LYS A 1 575 ? 17.910  18.904  41.554  1.00 83.71  ? 575 LYS A CE    1 
ATOM   3502  N  NZ    . LYS A 1 575 ? 17.108  18.129  40.565  1.00 94.81  ? 575 LYS A NZ    1 
ATOM   3503  N  N     . SER A 1 576 ? 13.680  19.884  45.380  1.00 55.42  ? 576 SER A N     1 
ATOM   3504  C  CA    . SER A 1 576 ? 12.960  20.994  45.988  1.00 63.70  ? 576 SER A CA    1 
ATOM   3505  C  C     . SER A 1 576 ? 11.512  20.613  46.278  1.00 57.25  ? 576 SER A C     1 
ATOM   3506  O  O     . SER A 1 576 ? 10.946  19.704  45.668  1.00 60.23  ? 576 SER A O     1 
ATOM   3507  C  CB    . SER A 1 576 ? 13.161  22.293  45.186  1.00 70.14  ? 576 SER A CB    1 
ATOM   3508  O  OG    . SER A 1 576 ? 12.619  22.475  43.940  1.00 82.35  ? 576 SER A OG    1 
ATOM   3509  N  N     . GLY A 1 577 ? 10.944  21.253  47.299  1.00 53.17  ? 577 GLY A N     1 
ATOM   3510  C  CA    . GLY A 1 577 ? 9.579   20.988  47.696  1.00 55.92  ? 577 GLY A CA    1 
ATOM   3511  C  C     . GLY A 1 577 ? 9.500   20.356  49.055  1.00 62.64  ? 577 GLY A C     1 
ATOM   3512  O  O     . GLY A 1 577 ? 8.404   20.163  49.589  1.00 73.91  ? 577 GLY A O     1 
ATOM   3513  N  N     . GLY A 1 578 ? 10.664  20.037  49.614  1.00 66.84  ? 578 GLY A N     1 
ATOM   3514  C  CA    . GLY A 1 578 ? 10.760  19.319  50.867  1.00 66.33  ? 578 GLY A CA    1 
ATOM   3515  C  C     . GLY A 1 578 ? 10.732  20.281  52.031  1.00 68.94  ? 578 GLY A C     1 
ATOM   3516  O  O     . GLY A 1 578 ? 10.508  19.899  53.190  1.00 80.45  ? 578 GLY A O     1 
ATOM   3517  N  N     . GLY A 1 579 ? 10.960  21.550  51.727  1.00 65.51  ? 579 GLY A N     1 
ATOM   3518  C  CA    . GLY A 1 579 ? 10.879  22.577  52.750  1.00 65.25  ? 579 GLY A CA    1 
ATOM   3519  C  C     . GLY A 1 579 ? 12.113  22.578  53.618  1.00 63.20  ? 579 GLY A C     1 
ATOM   3520  O  O     . GLY A 1 579 ? 13.221  22.314  53.145  1.00 68.37  ? 579 GLY A O     1 
ATOM   3521  N  N     . ARG A 1 580 ? 11.929  22.862  54.899  1.00 67.02  ? 580 ARG A N     1 
ATOM   3522  C  CA    . ARG A 1 580 ? 13.110  22.937  55.722  1.00 61.43  ? 580 ARG A CA    1 
ATOM   3523  C  C     . ARG A 1 580 ? 12.948  22.203  57.079  1.00 68.51  ? 580 ARG A C     1 
ATOM   3524  O  O     . ARG A 1 580 ? 11.827  22.034  57.550  1.00 83.44  ? 580 ARG A O     1 
ATOM   3525  C  CB    . ARG A 1 580 ? 13.427  24.395  55.830  1.00 51.42  ? 580 ARG A CB    1 
ATOM   3526  C  CG    . ARG A 1 580 ? 14.824  24.636  55.397  1.00 64.26  ? 580 ARG A CG    1 
ATOM   3527  C  CD    . ARG A 1 580 ? 15.010  26.083  55.014  1.00 70.54  ? 580 ARG A CD    1 
ATOM   3528  N  NE    . ARG A 1 580 ? 16.316  26.262  54.404  1.00 58.07  ? 580 ARG A NE    1 
ATOM   3529  C  CZ    . ARG A 1 580 ? 16.508  26.650  53.155  1.00 61.84  ? 580 ARG A CZ    1 
ATOM   3530  N  NH1   . ARG A 1 580 ? 15.503  26.923  52.367  1.00 76.32  ? 580 ARG A NH1   1 
ATOM   3531  N  NH2   . ARG A 1 580 ? 17.763  26.809  52.746  1.00 63.96  ? 580 ARG A NH2   1 
ATOM   3532  N  N     . VAL A 1 581 ? 14.036  21.680  57.642  1.00 56.88  ? 581 VAL A N     1 
ATOM   3533  C  CA    . VAL A 1 581 ? 13.987  20.973  58.946  1.00 56.75  ? 581 VAL A CA    1 
ATOM   3534  C  C     . VAL A 1 581 ? 14.991  21.478  60.005  1.00 57.77  ? 581 VAL A C     1 
ATOM   3535  O  O     . VAL A 1 581 ? 16.163  21.682  59.738  1.00 43.86  ? 581 VAL A O     1 
ATOM   3536  C  CB    . VAL A 1 581 ? 14.153  19.427  58.831  1.00 42.10  ? 581 VAL A CB    1 
ATOM   3537  C  CG1   . VAL A 1 581 ? 13.106  18.824  57.893  1.00 45.04  ? 581 VAL A CG1   1 
ATOM   3538  C  CG2   . VAL A 1 581 ? 15.560  19.044  58.449  1.00 39.78  ? 581 VAL A CG2   1 
ATOM   3539  N  N     . TYR A 1 582 ? 14.482  21.840  61.166  1.00 63.39  ? 582 TYR A N     1 
ATOM   3540  C  CA    . TYR A 1 582 ? 15.312  22.365  62.245  1.00 55.01  ? 582 TYR A CA    1 
ATOM   3541  C  C     . TYR A 1 582 ? 15.139  21.513  63.494  1.00 59.01  ? 582 TYR A C     1 
ATOM   3542  O  O     . TYR A 1 582 ? 14.059  21.021  63.762  1.00 46.51  ? 582 TYR A O     1 
ATOM   3543  C  CB    . TYR A 1 582 ? 14.942  23.798  62.553  1.00 63.28  ? 582 TYR A CB    1 
ATOM   3544  C  CG    . TYR A 1 582 ? 15.011  24.754  61.396  1.00 67.55  ? 582 TYR A CG    1 
ATOM   3545  C  CD1   . TYR A 1 582 ? 16.229  25.127  60.860  1.00 65.65  ? 582 TYR A CD1   1 
ATOM   3546  C  CD2   . TYR A 1 582 ? 13.862  25.202  60.775  1.00 65.86  ? 582 TYR A CD2   1 
ATOM   3547  C  CE1   . TYR A 1 582 ? 16.298  26.022  59.809  1.00 63.81  ? 582 TYR A CE1   1 
ATOM   3548  C  CE2   . TYR A 1 582 ? 13.927  26.068  59.717  1.00 66.68  ? 582 TYR A CE2   1 
ATOM   3549  C  CZ    . TYR A 1 582 ? 15.143  26.472  59.237  1.00 58.43  ? 582 TYR A CZ    1 
ATOM   3550  O  OH    . TYR A 1 582 ? 15.199  27.331  58.178  1.00 61.53  ? 582 TYR A OH    1 
ATOM   3551  N  N     . PRO A 1 583 ? 16.235  21.271  64.221  1.00 66.07  ? 583 PRO A N     1 
ATOM   3552  C  CA    . PRO A 1 583 ? 16.103  20.482  65.442  1.00 76.48  ? 583 PRO A CA    1 
ATOM   3553  C  C     . PRO A 1 583 ? 15.365  21.270  66.520  1.00 80.81  ? 583 PRO A C     1 
ATOM   3554  O  O     . PRO A 1 583 ? 15.498  22.491  66.584  1.00 78.77  ? 583 PRO A O     1 
ATOM   3555  C  CB    . PRO A 1 583 ? 17.558  20.169  65.813  1.00 72.84  ? 583 PRO A CB    1 
ATOM   3556  C  CG    . PRO A 1 583 ? 18.366  21.245  65.200  1.00 57.98  ? 583 PRO A CG    1 
ATOM   3557  C  CD    . PRO A 1 583 ? 17.637  21.642  63.940  1.00 61.64  ? 583 PRO A CD    1 
ATOM   3558  N  N     . VAL A 1 584 ? 14.555  20.570  67.313  1.00 81.35  ? 584 VAL A N     1 
ATOM   3559  C  CA    . VAL A 1 584 ? 13.876  21.175  68.448  1.00 81.73  ? 584 VAL A CA    1 
ATOM   3560  C  C     . VAL A 1 584 ? 14.938  21.548  69.466  1.00 86.18  ? 584 VAL A C     1 
ATOM   3561  O  O     . VAL A 1 584 ? 14.851  22.607  70.093  1.00 92.00  ? 584 VAL A O     1 
ATOM   3562  C  CB    . VAL A 1 584 ? 12.844  20.237  69.086  1.00 87.10  ? 584 VAL A CB    1 
ATOM   3563  C  CG1   . VAL A 1 584 ? 12.189  20.905  70.280  1.00 97.18  ? 584 VAL A CG1   1 
ATOM   3564  C  CG2   . VAL A 1 584 ? 11.806  19.813  68.071  1.00 85.39  ? 584 VAL A CG2   1 
ATOM   3565  N  N     . GLN A 1 585 ? 15.927  20.671  69.641  1.00 81.12  ? 585 GLN A N     1 
ATOM   3566  C  CA    . GLN A 1 585 ? 17.053  20.936  70.539  1.00 85.55  ? 585 GLN A CA    1 
ATOM   3567  C  C     . GLN A 1 585 ? 18.367  20.485  69.917  1.00 85.51  ? 585 GLN A C     1 
ATOM   3568  O  O     . GLN A 1 585 ? 18.408  19.586  69.088  1.00 90.20  ? 585 GLN A O     1 
ATOM   3569  C  CB    . GLN A 1 585 ? 16.853  20.266  71.894  1.00 85.98  ? 585 GLN A CB    1 
ATOM   3570  N  N     . GLY A 1 586 ? 19.429  21.183  70.282  1.00 76.80  ? 586 GLY A N     1 
ATOM   3571  C  CA    . GLY A 1 586 ? 20.807  20.867  69.941  1.00 64.88  ? 586 GLY A CA    1 
ATOM   3572  C  C     . GLY A 1 586 ? 21.282  21.235  68.543  1.00 70.34  ? 586 GLY A C     1 
ATOM   3573  O  O     . GLY A 1 586 ? 20.678  22.079  67.878  1.00 84.25  ? 586 GLY A O     1 
ATOM   3574  N  N     . ARG A 1 587 ? 22.330  20.572  68.062  1.00 59.17  ? 587 ARG A N     1 
ATOM   3575  C  CA    . ARG A 1 587 ? 22.932  20.956  66.781  1.00 53.59  ? 587 ARG A CA    1 
ATOM   3576  C  C     . ARG A 1 587 ? 22.216  20.210  65.682  1.00 61.12  ? 587 ARG A C     1 
ATOM   3577  O  O     . ARG A 1 587 ? 21.658  19.160  65.926  1.00 78.52  ? 587 ARG A O     1 
ATOM   3578  C  CB    . ARG A 1 587 ? 24.430  20.702  66.752  1.00 50.07  ? 587 ARG A CB    1 
ATOM   3579  N  N     . LEU A 1 588 ? 22.202  20.746  64.475  1.00 66.90  ? 588 LEU A N     1 
ATOM   3580  C  CA    . LEU A 1 588 ? 21.669  19.990  63.353  1.00 73.09  ? 588 LEU A CA    1 
ATOM   3581  C  C     . LEU A 1 588 ? 22.576  18.996  62.641  1.00 70.75  ? 588 LEU A C     1 
ATOM   3582  O  O     . LEU A 1 588 ? 23.589  19.390  62.076  1.00 82.98  ? 588 LEU A O     1 
ATOM   3583  C  CB    . LEU A 1 588 ? 21.192  21.013  62.317  1.00 74.19  ? 588 LEU A CB    1 
ATOM   3584  C  CG    . LEU A 1 588 ? 20.464  20.513  61.085  1.00 67.93  ? 588 LEU A CG    1 
ATOM   3585  C  CD1   . LEU A 1 588 ? 19.365  19.575  61.533  1.00 62.77  ? 588 LEU A CD1   1 
ATOM   3586  C  CD2   . LEU A 1 588 ? 19.893  21.689  60.337  1.00 64.83  ? 588 LEU A CD2   1 
ATOM   3587  N  N     . ALA A 1 589 ? 22.227  17.712  62.647  1.00 63.81  ? 589 ALA A N     1 
ATOM   3588  C  CA    . ALA A 1 589 ? 23.108  16.772  61.963  1.00 62.82  ? 589 ALA A CA    1 
ATOM   3589  C  C     . ALA A 1 589 ? 22.359  16.144  60.774  1.00 57.36  ? 589 ALA A C     1 
ATOM   3590  O  O     . ALA A 1 589 ? 21.138  16.025  60.764  1.00 62.20  ? 589 ALA A O     1 
ATOM   3591  C  CB    . ALA A 1 589 ? 23.604  15.690  62.916  1.00 57.46  ? 589 ALA A CB    1 
ATOM   3592  N  N     . ASP A 1 590 ? 23.120  15.636  59.835  1.00 50.09  ? 590 ASP A N     1 
ATOM   3593  C  CA    . ASP A 1 590 ? 22.629  14.994  58.631  1.00 42.47  ? 590 ASP A CA    1 
ATOM   3594  C  C     . ASP A 1 590 ? 22.207  13.556  58.978  1.00 53.66  ? 590 ASP A C     1 
ATOM   3595  O  O     . ASP A 1 590 ? 22.478  13.056  60.077  1.00 41.16  ? 590 ASP A O     1 
ATOM   3596  C  CB    . ASP A 1 590 ? 23.562  15.226  57.438  1.00 41.75  ? 590 ASP A CB    1 
ATOM   3597  C  CG    . ASP A 1 590 ? 24.817  14.465  57.473  1.00 64.14  ? 590 ASP A CG    1 
ATOM   3598  O  OD1   . ASP A 1 590 ? 25.010  13.553  58.293  1.00 82.69  ? 590 ASP A OD1   1 
ATOM   3599  O  OD2   . ASP A 1 590 ? 25.705  14.925  56.728  1.00 67.39  ? 590 ASP A OD2   1 
ATOM   3600  N  N     . GLY A 1 591 ? 21.478  12.967  58.042  1.00 58.78  ? 591 GLY A N     1 
ATOM   3601  C  CA    . GLY A 1 591 ? 20.969  11.610  58.022  1.00 44.58  ? 591 GLY A CA    1 
ATOM   3602  C  C     . GLY A 1 591 ? 19.761  11.493  58.890  1.00 54.69  ? 591 GLY A C     1 
ATOM   3603  O  O     . GLY A 1 591 ? 19.526  10.599  59.718  1.00 63.85  ? 591 GLY A O     1 
ATOM   3604  N  N     . LEU A 1 592 ? 18.945  12.505  58.630  1.00 60.99  ? 592 LEU A N     1 
ATOM   3605  C  CA    . LEU A 1 592 ? 17.655  12.651  59.272  1.00 56.36  ? 592 LEU A CA    1 
ATOM   3606  C  C     . LEU A 1 592 ? 16.565  12.130  58.338  1.00 45.40  ? 592 LEU A C     1 
ATOM   3607  O  O     . LEU A 1 592 ? 16.563  12.436  57.161  1.00 55.63  ? 592 LEU A O     1 
ATOM   3608  C  CB    . LEU A 1 592 ? 17.395  14.105  59.644  1.00 65.75  ? 592 LEU A CB    1 
ATOM   3609  C  CG    . LEU A 1 592 ? 17.622  14.445  61.123  1.00 62.52  ? 592 LEU A CG    1 
ATOM   3610  C  CD1   . LEU A 1 592 ? 17.472  15.944  61.344  1.00 54.72  ? 592 LEU A CD1   1 
ATOM   3611  C  CD2   . LEU A 1 592 ? 16.758  13.631  62.072  1.00 62.62  ? 592 LEU A CD2   1 
ATOM   3612  N  N     . TYR A 1 593 ? 15.742  11.242  58.821  1.00 53.73  ? 593 TYR A N     1 
ATOM   3613  C  CA    . TYR A 1 593 ? 14.592  10.708  58.105  1.00 57.96  ? 593 TYR A CA    1 
ATOM   3614  C  C     . TYR A 1 593 ? 13.271  11.221  58.707  1.00 56.73  ? 593 TYR A C     1 
ATOM   3615  O  O     . TYR A 1 593 ? 13.001  10.997  59.880  1.00 66.40  ? 593 TYR A O     1 
ATOM   3616  C  CB    . TYR A 1 593 ? 14.693  9.181   58.063  1.00 59.55  ? 593 TYR A CB    1 
ATOM   3617  C  CG    . TYR A 1 593 ? 13.385  8.463   57.875  1.00 52.99  ? 593 TYR A CG    1 
ATOM   3618  C  CD1   . TYR A 1 593 ? 12.610  8.651   56.759  1.00 47.78  ? 593 TYR A CD1   1 
ATOM   3619  C  CD2   . TYR A 1 593 ? 13.012  7.482   58.771  1.00 56.19  ? 593 TYR A CD2   1 
ATOM   3620  C  CE1   . TYR A 1 593 ? 11.451  7.965   56.599  1.00 54.19  ? 593 TYR A CE1   1 
ATOM   3621  C  CE2   . TYR A 1 593 ? 11.869  6.789   58.611  1.00 58.06  ? 593 TYR A CE2   1 
ATOM   3622  C  CZ    . TYR A 1 593 ? 11.082  7.035   57.522  1.00 55.43  ? 593 TYR A CZ    1 
ATOM   3623  O  OH    . TYR A 1 593 ? 9.909   6.338   57.346  1.00 65.63  ? 593 TYR A OH    1 
ATOM   3624  N  N     . VAL A 1 594 ? 12.457  11.936  57.958  1.00 54.64  ? 594 VAL A N     1 
ATOM   3625  C  CA    . VAL A 1 594 ? 11.242  12.463  58.578  1.00 50.42  ? 594 VAL A CA    1 
ATOM   3626  C  C     . VAL A 1 594 ? 10.000  11.996  57.829  1.00 61.98  ? 594 VAL A C     1 
ATOM   3627  O  O     . VAL A 1 594 ? 9.636   12.615  56.829  1.00 59.37  ? 594 VAL A O     1 
ATOM   3628  C  CB    . VAL A 1 594 ? 11.172  14.014  58.542  1.00 36.80  ? 594 VAL A CB    1 
ATOM   3629  C  CG1   . VAL A 1 594 ? 9.903   14.487  59.238  1.00 46.77  ? 594 VAL A CG1   1 
ATOM   3630  C  CG2   . VAL A 1 594 ? 12.385  14.671  59.157  1.00 40.81  ? 594 VAL A CG2   1 
ATOM   3631  N  N     . PRO A 1 595 ? 9.310   10.951  58.321  1.00 64.18  ? 595 PRO A N     1 
ATOM   3632  C  CA    . PRO A 1 595 ? 8.132   10.553  57.542  1.00 64.41  ? 595 PRO A CA    1 
ATOM   3633  C  C     . PRO A 1 595 ? 7.083   11.615  57.745  1.00 63.32  ? 595 PRO A C     1 
ATOM   3634  O  O     . PRO A 1 595 ? 6.963   12.145  58.833  1.00 65.93  ? 595 PRO A O     1 
ATOM   3635  C  CB    . PRO A 1 595 ? 7.764   9.192   58.122  1.00 65.52  ? 595 PRO A CB    1 
ATOM   3636  C  CG    . PRO A 1 595 ? 8.336   9.185   59.480  1.00 63.84  ? 595 PRO A CG    1 
ATOM   3637  C  CD    . PRO A 1 595 ? 9.580   10.042  59.447  1.00 62.18  ? 595 PRO A CD    1 
ATOM   3638  N  N     . LEU A 1 596 ? 6.305   11.873  56.710  1.00 64.76  ? 596 LEU A N     1 
ATOM   3639  C  CA    . LEU A 1 596 ? 5.218   12.821  56.746  1.00 61.65  ? 596 LEU A CA    1 
ATOM   3640  C  C     . LEU A 1 596 ? 4.015   11.938  56.527  1.00 73.18  ? 596 LEU A C     1 
ATOM   3641  O  O     . LEU A 1 596 ? 3.815   11.019  57.294  1.00 95.59  ? 596 LEU A O     1 
ATOM   3642  C  CB    . LEU A 1 596 ? 5.368   13.841  55.647  1.00 60.78  ? 596 LEU A CB    1 
ATOM   3643  C  CG    . LEU A 1 596 ? 6.484   14.818  55.926  1.00 69.58  ? 596 LEU A CG    1 
ATOM   3644  C  CD1   . LEU A 1 596 ? 6.685   15.786  54.785  1.00 52.39  ? 596 LEU A CD1   1 
ATOM   3645  C  CD2   . LEU A 1 596 ? 6.153   15.557  57.196  1.00 77.19  ? 596 LEU A CD2   1 
ATOM   3646  N  N     . GLU A 1 597 ? 3.233   12.214  55.491  1.00 69.50  ? 597 GLU A N     1 
ATOM   3647  C  CA    . GLU A 1 597 ? 2.067   11.399  55.200  1.00 79.07  ? 597 GLU A CA    1 
ATOM   3648  C  C     . GLU A 1 597 ? 2.544   9.984   54.905  1.00 85.30  ? 597 GLU A C     1 
ATOM   3649  O  O     . GLU A 1 597 ? 3.708   9.655   55.134  1.00 87.39  ? 597 GLU A O     1 
ATOM   3650  C  CB    . GLU A 1 597 ? 1.300   11.961  54.003  1.00 30.00  ? 597 GLU A CB    1 
ATOM   3651  C  CG    . GLU A 1 597 ? 0.571   13.263  54.289  1.00 30.00  ? 597 GLU A CG    1 
ATOM   3652  C  CD    . GLU A 1 597 ? 0.545   14.192  53.091  1.00 30.00  ? 597 GLU A CD    1 
ATOM   3653  O  OE1   . GLU A 1 597 ? 0.200   13.728  51.984  1.00 30.00  ? 597 GLU A OE1   1 
ATOM   3654  O  OE2   . GLU A 1 597 ? 0.870   15.387  53.256  1.00 30.00  ? 597 GLU A OE2   1 
ATOM   3655  N  N     . ASP A 1 598 ? 1.647   9.149   54.397  1.00 88.33  ? 598 ASP A N     1 
ATOM   3656  C  CA    . ASP A 1 598 ? 1.988   7.793   54.075  1.00 97.84  ? 598 ASP A CA    1 
ATOM   3657  C  C     . ASP A 1 598 ? 2.644   7.724   52.731  1.00 92.96  ? 598 ASP A C     1 
ATOM   3658  O  O     . ASP A 1 598 ? 2.076   8.111   51.726  1.00 95.71  ? 598 ASP A O     1 
ATOM   3659  C  CB    . ASP A 1 598 ? 0.754   6.903   54.093  1.00 106.98 ? 598 ASP A CB    1 
ATOM   3660  C  CG    . ASP A 1 598 ? 1.057   5.523   54.596  1.00 117.17 ? 598 ASP A CG    1 
ATOM   3661  O  OD1   . ASP A 1 598 ? 2.093   5.363   55.258  1.00 122.30 ? 598 ASP A OD1   1 
ATOM   3662  O  OD2   . ASP A 1 598 ? 0.267   4.600   54.340  1.00 124.61 ? 598 ASP A OD2   1 
ATOM   3663  N  N     . LYS A 1 599 ? 3.849   7.209   52.723  1.00 74.83  ? 599 LYS A N     1 
ATOM   3664  C  CA    . LYS A 1 599 ? 4.597   7.075   51.481  1.00 60.02  ? 599 LYS A CA    1 
ATOM   3665  C  C     . LYS A 1 599 ? 5.390   8.316   51.061  1.00 58.02  ? 599 LYS A C     1 
ATOM   3666  O  O     . LYS A 1 599 ? 6.032   8.291   50.019  1.00 53.23  ? 599 LYS A O     1 
ATOM   3667  C  CB    . LYS A 1 599 ? 3.670   6.680   50.336  1.00 48.74  ? 599 LYS A CB    1 
ATOM   3668  C  CG    . LYS A 1 599 ? 2.957   5.335   50.430  1.00 64.55  ? 599 LYS A CG    1 
ATOM   3669  C  CD    . LYS A 1 599 ? 3.957   4.186   50.442  1.00 81.05  ? 599 LYS A CD    1 
ATOM   3670  C  CE    . LYS A 1 599 ? 3.267   2.857   50.147  1.00 92.04  ? 599 LYS A CE    1 
ATOM   3671  N  NZ    . LYS A 1 599 ? 4.236   1.718   50.085  1.00 92.44  ? 599 LYS A NZ    1 
ATOM   3672  N  N     . THR A 1 600 ? 5.268   9.420   51.800  1.00 53.27  ? 600 THR A N     1 
ATOM   3673  C  CA    . THR A 1 600 ? 6.074   10.569  51.442  1.00 52.60  ? 600 THR A CA    1 
ATOM   3674  C  C     . THR A 1 600 ? 7.021   10.807  52.629  1.00 55.46  ? 600 THR A C     1 
ATOM   3675  O  O     . THR A 1 600 ? 6.557   10.711  53.759  1.00 55.38  ? 600 THR A O     1 
ATOM   3676  C  CB    . THR A 1 600 ? 5.208   11.807  51.189  1.00 69.81  ? 600 THR A CB    1 
ATOM   3677  O  OG1   . THR A 1 600 ? 4.154   11.478  50.279  1.00 78.81  ? 600 THR A OG1   1 
ATOM   3678  C  CG2   . THR A 1 600 ? 6.029   13.014  50.714  1.00 57.94  ? 600 THR A CG2   1 
ATOM   3679  N  N     . PHE A 1 601 ? 8.231   11.337  52.415  1.00 63.20  ? 601 PHE A N     1 
ATOM   3680  C  CA    . PHE A 1 601 ? 9.110   11.635  53.558  1.00 60.73  ? 601 PHE A CA    1 
ATOM   3681  C  C     . PHE A 1 601 ? 10.237  12.591  53.208  1.00 57.47  ? 601 PHE A C     1 
ATOM   3682  O  O     . PHE A 1 601 ? 10.615  12.721  52.043  1.00 56.93  ? 601 PHE A O     1 
ATOM   3683  C  CB    . PHE A 1 601 ? 9.733   10.374  54.229  1.00 55.67  ? 601 PHE A CB    1 
ATOM   3684  C  CG    . PHE A 1 601 ? 10.690  9.558   53.365  1.00 52.64  ? 601 PHE A CG    1 
ATOM   3685  C  CD1   . PHE A 1 601 ? 10.219  8.561   52.508  1.00 46.45  ? 601 PHE A CD1   1 
ATOM   3686  C  CD2   . PHE A 1 601 ? 12.079  9.754   53.474  1.00 52.11  ? 601 PHE A CD2   1 
ATOM   3687  C  CE1   . PHE A 1 601 ? 11.140  7.767   51.737  1.00 55.61  ? 601 PHE A CE1   1 
ATOM   3688  C  CE2   . PHE A 1 601 ? 13.003  9.009   52.706  1.00 51.67  ? 601 PHE A CE2   1 
ATOM   3689  C  CZ    . PHE A 1 601 ? 12.534  8.003   51.824  1.00 55.96  ? 601 PHE A CZ    1 
ATOM   3690  N  N     . LEU A 1 602 ? 10.802  13.245  54.222  1.00 56.45  ? 602 LEU A N     1 
ATOM   3691  C  CA    . LEU A 1 602 ? 11.948  14.104  53.961  1.00 54.53  ? 602 LEU A CA    1 
ATOM   3692  C  C     . LEU A 1 602 ? 13.182  13.339  54.326  1.00 40.98  ? 602 LEU A C     1 
ATOM   3693  O  O     . LEU A 1 602 ? 13.133  12.483  55.188  1.00 44.78  ? 602 LEU A O     1 
ATOM   3694  C  CB    . LEU A 1 602 ? 11.875  15.402  54.750  1.00 52.95  ? 602 LEU A CB    1 
ATOM   3695  C  CG    . LEU A 1 602 ? 10.579  16.149  54.524  1.00 50.63  ? 602 LEU A CG    1 
ATOM   3696  C  CD1   . LEU A 1 602 ? 10.577  17.402  55.321  1.00 58.57  ? 602 LEU A CD1   1 
ATOM   3697  C  CD2   . LEU A 1 602 ? 10.439  16.449  53.058  1.00 48.80  ? 602 LEU A CD2   1 
ATOM   3698  N  N     . LEU A 1 603 ? 14.297  13.673  53.696  1.00 40.27  ? 603 LEU A N     1 
ATOM   3699  C  CA    . LEU A 1 603 ? 15.537  13.010  54.028  1.00 44.46  ? 603 LEU A CA    1 
ATOM   3700  C  C     . LEU A 1 603 ? 16.646  14.046  53.963  1.00 56.24  ? 603 LEU A C     1 
ATOM   3701  O  O     . LEU A 1 603 ? 16.984  14.525  52.883  1.00 67.60  ? 603 LEU A O     1 
ATOM   3702  C  CB    . LEU A 1 603 ? 15.821  11.891  53.049  1.00 38.27  ? 603 LEU A CB    1 
ATOM   3703  C  CG    . LEU A 1 603 ? 17.019  11.019  53.382  1.00 37.18  ? 603 LEU A CG    1 
ATOM   3704  C  CD1   . LEU A 1 603 ? 16.708  10.343  54.708  1.00 39.59  ? 603 LEU A CD1   1 
ATOM   3705  C  CD2   . LEU A 1 603 ? 17.301  9.998   52.271  1.00 34.09  ? 603 LEU A CD2   1 
ATOM   3706  N  N     . LEU A 1 604 ? 17.183  14.415  55.124  1.00 50.46  ? 604 LEU A N     1 
ATOM   3707  C  CA    . LEU A 1 604 ? 18.363  15.268  55.193  1.00 56.62  ? 604 LEU A CA    1 
ATOM   3708  C  C     . LEU A 1 604 ? 19.590  14.362  55.073  1.00 61.12  ? 604 LEU A C     1 
ATOM   3709  O  O     . LEU A 1 604 ? 19.880  13.580  56.001  1.00 63.83  ? 604 LEU A O     1 
ATOM   3710  C  CB    . LEU A 1 604 ? 18.386  16.033  56.501  1.00 57.76  ? 604 LEU A CB    1 
ATOM   3711  C  CG    . LEU A 1 604 ? 19.161  17.331  56.526  1.00 61.85  ? 604 LEU A CG    1 
ATOM   3712  C  CD1   . LEU A 1 604 ? 18.702  18.195  55.394  1.00 60.58  ? 604 LEU A CD1   1 
ATOM   3713  C  CD2   . LEU A 1 604 ? 18.847  17.989  57.857  1.00 72.70  ? 604 LEU A CD2   1 
ATOM   3714  N  N     . THR A 1 605 ? 20.276  14.460  53.938  1.00 48.68  ? 605 THR A N     1 
ATOM   3715  C  CA    . THR A 1 605 ? 21.371  13.567  53.628  1.00 48.88  ? 605 THR A CA    1 
ATOM   3716  C  C     . THR A 1 605 ? 22.765  14.106  53.877  1.00 43.00  ? 605 THR A C     1 
ATOM   3717  O  O     . THR A 1 605 ? 23.706  13.352  54.134  1.00 64.16  ? 605 THR A O     1 
ATOM   3718  C  CB    . THR A 1 605 ? 21.319  13.176  52.144  1.00 48.36  ? 605 THR A CB    1 
ATOM   3719  O  OG1   . THR A 1 605 ? 21.345  14.364  51.346  1.00 40.33  ? 605 THR A OG1   1 
ATOM   3720  C  CG2   . THR A 1 605 ? 20.064  12.384  51.853  1.00 46.71  ? 605 THR A CG2   1 
ATOM   3721  N  N     . VAL A 1 606 ? 22.896  15.389  53.601  1.00 35.69  ? 606 VAL A N     1 
ATOM   3722  C  CA    . VAL A 1 606 ? 24.111  16.200  53.719  1.00 46.00  ? 606 VAL A CA    1 
ATOM   3723  C  C     . VAL A 1 606 ? 23.915  17.534  54.457  1.00 59.22  ? 606 VAL A C     1 
ATOM   3724  O  O     . VAL A 1 606 ? 22.906  18.235  54.275  1.00 47.24  ? 606 VAL A O     1 
ATOM   3725  C  CB    . VAL A 1 606 ? 24.773  16.465  52.410  1.00 51.32  ? 606 VAL A CB    1 
ATOM   3726  C  CG1   . VAL A 1 606 ? 25.302  15.135  51.864  1.00 58.92  ? 606 VAL A CG1   1 
ATOM   3727  C  CG2   . VAL A 1 606 ? 23.812  17.106  51.459  1.00 38.47  ? 606 VAL A CG2   1 
ATOM   3728  N  N     . HIS A 1 607 ? 24.871  17.852  55.304  1.00 70.87  ? 607 HIS A N     1 
ATOM   3729  C  CA    . HIS A 1 607 ? 24.930  19.163  55.936  1.00 61.11  ? 607 HIS A CA    1 
ATOM   3730  C  C     . HIS A 1 607 ? 26.302  19.523  56.451  1.00 60.94  ? 607 HIS A C     1 
ATOM   3731  O  O     . HIS A 1 607 ? 27.032  18.704  57.039  1.00 76.96  ? 607 HIS A O     1 
ATOM   3732  C  CB    . HIS A 1 607 ? 23.929  19.271  57.102  1.00 59.49  ? 607 HIS A CB    1 
ATOM   3733  C  CG    . HIS A 1 607 ? 24.113  20.509  57.920  1.00 61.43  ? 607 HIS A CG    1 
ATOM   3734  N  ND1   . HIS A 1 607 ? 23.875  21.770  57.427  1.00 72.23  ? 607 HIS A ND1   1 
ATOM   3735  C  CD2   . HIS A 1 607 ? 24.485  20.676  59.213  1.00 58.38  ? 607 HIS A CD2   1 
ATOM   3736  C  CE1   . HIS A 1 607 ? 24.122  22.664  58.368  1.00 69.78  ? 607 HIS A CE1   1 
ATOM   3737  N  NE2   . HIS A 1 607 ? 24.493  22.027  59.463  1.00 60.59  ? 607 HIS A NE2   1 
ATOM   3738  N  N     . ARG A 1 608 ? 26.600  20.810  56.263  1.00 56.28  ? 608 ARG A N     1 
ATOM   3739  C  CA    . ARG A 1 608 ? 27.761  21.359  56.904  1.00 74.79  ? 608 ARG A CA    1 
ATOM   3740  C  C     . ARG A 1 608 ? 27.308  22.727  57.381  1.00 82.40  ? 608 ARG A C     1 
ATOM   3741  O  O     . ARG A 1 608 ? 26.538  23.412  56.718  1.00 82.90  ? 608 ARG A O     1 
ATOM   3742  C  CB    . ARG A 1 608 ? 28.878  21.601  55.851  1.00 69.20  ? 608 ARG A CB    1 
ATOM   3743  C  CG    . ARG A 1 608 ? 29.308  20.475  54.933  1.00 55.34  ? 608 ARG A CG    1 
ATOM   3744  C  CD    . ARG A 1 608 ? 30.273  19.510  55.552  1.00 54.26  ? 608 ARG A CD    1 
ATOM   3745  N  NE    . ARG A 1 608 ? 29.632  18.641  56.542  1.00 65.09  ? 608 ARG A NE    1 
ATOM   3746  C  CZ    . ARG A 1 608 ? 30.285  17.970  57.486  1.00 63.16  ? 608 ARG A CZ    1 
ATOM   3747  N  NH1   . ARG A 1 608 ? 31.614  18.000  57.517  1.00 60.92  ? 608 ARG A NH1   1 
ATOM   3748  N  NH2   . ARG A 1 608 ? 29.614  17.196  58.334  1.00 54.36  ? 608 ARG A NH2   1 
ATOM   3749  N  N     . ASP A 1 609 ? 27.910  23.193  58.463  1.00 75.59  ? 609 ASP A N     1 
ATOM   3750  C  CA    . ASP A 1 609 ? 27.651  24.525  58.995  1.00 72.53  ? 609 ASP A CA    1 
ATOM   3751  C  C     . ASP A 1 609 ? 27.971  25.680  58.133  1.00 72.48  ? 609 ASP A C     1 
ATOM   3752  O  O     . ASP A 1 609 ? 27.200  26.625  57.994  1.00 79.20  ? 609 ASP A O     1 
ATOM   3753  C  CB    . ASP A 1 609 ? 28.290  24.662  60.362  1.00 76.26  ? 609 ASP A CB    1 
ATOM   3754  C  CG    . ASP A 1 609 ? 27.439  24.031  61.433  1.00 80.87  ? 609 ASP A CG    1 
ATOM   3755  O  OD1   . ASP A 1 609 ? 26.600  23.165  61.101  1.00 86.94  ? 609 ASP A OD1   1 
ATOM   3756  O  OD2   . ASP A 1 609 ? 27.631  24.377  62.610  1.00 88.10  ? 609 ASP A OD2   1 
ATOM   3757  N  N     . PHE A 1 610 ? 29.139  25.599  57.546  1.00 73.61  ? 610 PHE A N     1 
ATOM   3758  C  CA    . PHE A 1 610 ? 29.544  26.684  56.715  1.00 73.02  ? 610 PHE A CA    1 
ATOM   3759  C  C     . PHE A 1 610 ? 28.988  26.728  55.322  1.00 77.79  ? 610 PHE A C     1 
ATOM   3760  O  O     . PHE A 1 610 ? 29.268  27.685  54.618  1.00 94.57  ? 610 PHE A O     1 
ATOM   3761  C  CB    . PHE A 1 610 ? 31.064  26.580  56.553  1.00 75.71  ? 610 PHE A CB    1 
ATOM   3762  C  CG    . PHE A 1 610 ? 31.499  25.370  55.734  1.00 76.52  ? 610 PHE A CG    1 
ATOM   3763  C  CD1   . PHE A 1 610 ? 31.605  25.451  54.342  1.00 69.92  ? 610 PHE A CD1   1 
ATOM   3764  C  CD2   . PHE A 1 610 ? 31.772  24.151  56.355  1.00 72.50  ? 610 PHE A CD2   1 
ATOM   3765  C  CE1   . PHE A 1 610 ? 31.974  24.358  53.599  1.00 62.03  ? 610 PHE A CE1   1 
ATOM   3766  C  CE2   . PHE A 1 610 ? 32.147  23.047  55.619  1.00 62.47  ? 610 PHE A CE2   1 
ATOM   3767  C  CZ    . PHE A 1 610 ? 32.246  23.149  54.245  1.00 63.04  ? 610 PHE A CZ    1 
ATOM   3768  N  N     . ARG A 1 611 ? 28.087  25.836  54.950  1.00 73.95  ? 611 ARG A N     1 
ATOM   3769  C  CA    . ARG A 1 611 ? 27.395  25.981  53.661  1.00 76.79  ? 611 ARG A CA    1 
ATOM   3770  C  C     . ARG A 1 611 ? 26.096  26.676  53.622  1.00 73.45  ? 611 ARG A C     1 
ATOM   3771  O  O     . ARG A 1 611 ? 25.684  27.129  52.557  1.00 91.43  ? 611 ARG A O     1 
ATOM   3772  C  CB    . ARG A 1 611 ? 27.065  24.630  53.087  1.00 77.14  ? 611 ARG A CB    1 
ATOM   3773  C  CG    . ARG A 1 611 ? 28.108  23.733  52.749  1.00 72.95  ? 611 ARG A CG    1 
ATOM   3774  C  CD    . ARG A 1 611 ? 27.460  22.657  52.055  1.00 58.31  ? 611 ARG A CD    1 
ATOM   3775  N  NE    . ARG A 1 611 ? 28.341  21.670  51.614  1.00 55.57  ? 611 ARG A NE    1 
ATOM   3776  C  CZ    . ARG A 1 611 ? 28.156  20.365  51.705  1.00 62.94  ? 611 ARG A CZ    1 
ATOM   3777  N  NH1   . ARG A 1 611 ? 27.051  19.813  52.190  1.00 55.20  ? 611 ARG A NH1   1 
ATOM   3778  N  NH2   . ARG A 1 611 ? 29.124  19.611  51.227  1.00 83.54  ? 611 ARG A NH2   1 
ATOM   3779  N  N     . GLY A 1 612 ? 25.433  26.748  54.763  1.00 57.07  ? 612 GLY A N     1 
ATOM   3780  C  CA    . GLY A 1 612 ? 24.234  27.537  54.829  1.00 55.25  ? 612 GLY A CA    1 
ATOM   3781  C  C     . GLY A 1 612 ? 23.274  26.504  55.383  1.00 66.41  ? 612 GLY A C     1 
ATOM   3782  O  O     . GLY A 1 612 ? 23.715  25.491  55.937  1.00 76.36  ? 612 GLY A O     1 
ATOM   3783  N  N     . THR A 1 613 ? 22.011  26.865  55.475  1.00 63.22  ? 613 THR A N     1 
ATOM   3784  C  CA    . THR A 1 613 ? 20.983  25.956  55.942  1.00 62.73  ? 613 THR A CA    1 
ATOM   3785  C  C     . THR A 1 613 ? 20.691  24.836  54.928  1.00 64.76  ? 613 THR A C     1 
ATOM   3786  O  O     . THR A 1 613 ? 20.502  25.132  53.752  1.00 67.37  ? 613 THR A O     1 
ATOM   3787  C  CB    . THR A 1 613 ? 19.723  26.721  56.233  1.00 53.53  ? 613 THR A CB    1 
ATOM   3788  O  OG1   . THR A 1 613 ? 20.052  27.919  56.946  1.00 53.91  ? 613 THR A OG1   1 
ATOM   3789  C  CG2   . THR A 1 613 ? 18.720  25.834  56.987  1.00 59.05  ? 613 THR A CG2   1 
ATOM   3790  N  N     . PRO A 1 614 ? 20.700  23.558  55.365  1.00 60.32  ? 614 PRO A N     1 
ATOM   3791  C  CA    . PRO A 1 614 ? 20.390  22.407  54.500  1.00 42.41  ? 614 PRO A CA    1 
ATOM   3792  C  C     . PRO A 1 614 ? 18.966  22.431  53.932  1.00 41.62  ? 614 PRO A C     1 
ATOM   3793  O  O     . PRO A 1 614 ? 18.069  23.042  54.496  1.00 42.31  ? 614 PRO A O     1 
ATOM   3794  C  CB    . PRO A 1 614 ? 20.603  21.203  55.430  1.00 44.50  ? 614 PRO A CB    1 
ATOM   3795  C  CG    . PRO A 1 614 ? 20.626  21.746  56.779  1.00 43.30  ? 614 PRO A CG    1 
ATOM   3796  C  CD    . PRO A 1 614 ? 21.124  23.130  56.708  1.00 51.49  ? 614 PRO A CD    1 
ATOM   3797  N  N     . ARG A 1 615 ? 18.782  21.704  52.839  1.00 51.19  ? 615 ARG A N     1 
ATOM   3798  C  CA    . ARG A 1 615 ? 17.520  21.528  52.097  1.00 55.28  ? 615 ARG A CA    1 
ATOM   3799  C  C     . ARG A 1 615 ? 17.178  20.047  51.977  1.00 51.96  ? 615 ARG A C     1 
ATOM   3800  O  O     . ARG A 1 615 ? 17.716  19.368  51.106  1.00 59.97  ? 615 ARG A O     1 
ATOM   3801  C  CB    . ARG A 1 615 ? 17.606  22.173  50.711  1.00 58.70  ? 615 ARG A CB    1 
ATOM   3802  C  CG    . ARG A 1 615 ? 18.191  23.574  50.707  1.00 60.37  ? 615 ARG A CG    1 
ATOM   3803  C  CD    . ARG A 1 615 ? 18.085  24.223  49.327  1.00 77.19  ? 615 ARG A CD    1 
ATOM   3804  N  NE    . ARG A 1 615 ? 16.938  25.106  49.154  1.00 94.34  ? 615 ARG A NE    1 
ATOM   3805  C  CZ    . ARG A 1 615 ? 17.031  26.430  49.037  1.00 106.06 ? 615 ARG A CZ    1 
ATOM   3806  N  NH1   . ARG A 1 615 ? 18.222  27.020  49.072  1.00 110.03 ? 615 ARG A NH1   1 
ATOM   3807  N  NH2   . ARG A 1 615 ? 15.938  27.170  48.880  1.00 108.27 ? 615 ARG A NH2   1 
ATOM   3808  N  N     . PRO A 1 616 ? 16.395  19.512  52.916  1.00 35.92  ? 616 PRO A N     1 
ATOM   3809  C  CA    . PRO A 1 616 ? 16.036  18.091  52.857  1.00 52.39  ? 616 PRO A CA    1 
ATOM   3810  C  C     . PRO A 1 616 ? 15.472  17.699  51.473  1.00 51.39  ? 616 PRO A C     1 
ATOM   3811  O  O     . PRO A 1 616 ? 14.724  18.476  50.870  1.00 42.53  ? 616 PRO A O     1 
ATOM   3812  C  CB    . PRO A 1 616 ? 14.985  17.926  53.973  1.00 60.64  ? 616 PRO A CB    1 
ATOM   3813  C  CG    . PRO A 1 616 ? 14.547  19.329  54.294  1.00 65.13  ? 616 PRO A CG    1 
ATOM   3814  C  CD    . PRO A 1 616 ? 15.752  20.178  54.055  1.00 59.15  ? 616 PRO A CD    1 
ATOM   3815  N  N     . LEU A 1 617 ? 15.799  16.492  51.017  1.00 50.52  ? 617 LEU A N     1 
ATOM   3816  C  CA    . LEU A 1 617 ? 15.207  15.929  49.808  1.00 41.75  ? 617 LEU A CA    1 
ATOM   3817  C  C     . LEU A 1 617 ? 13.801  15.576  50.186  1.00 41.92  ? 617 LEU A C     1 
ATOM   3818  O  O     . LEU A 1 617 ? 13.533  15.244  51.342  1.00 40.68  ? 617 LEU A O     1 
ATOM   3819  C  CB    . LEU A 1 617 ? 15.952  14.676  49.341  1.00 36.30  ? 617 LEU A CB    1 
ATOM   3820  C  CG    . LEU A 1 617 ? 17.388  14.887  48.888  1.00 38.99  ? 617 LEU A CG    1 
ATOM   3821  C  CD1   . LEU A 1 617 ? 18.022  13.543  48.556  1.00 44.14  ? 617 LEU A CD1   1 
ATOM   3822  C  CD2   . LEU A 1 617 ? 17.446  15.855  47.729  1.00 36.50  ? 617 LEU A CD2   1 
ATOM   3823  N  N     . LYS A 1 618 ? 12.907  15.623  49.215  1.00 38.34  ? 618 LYS A N     1 
ATOM   3824  C  CA    . LYS A 1 618 ? 11.573  15.113  49.441  1.00 41.03  ? 618 LYS A CA    1 
ATOM   3825  C  C     . LYS A 1 618 ? 11.331  13.880  48.595  1.00 47.98  ? 618 LYS A C     1 
ATOM   3826  O  O     . LYS A 1 618 ? 11.481  13.934  47.382  1.00 55.32  ? 618 LYS A O     1 
ATOM   3827  C  CB    . LYS A 1 618 ? 10.532  16.193  49.104  1.00 46.55  ? 618 LYS A CB    1 
ATOM   3828  C  CG    . LYS A 1 618 ? 9.100   15.703  49.226  1.00 53.32  ? 618 LYS A CG    1 
ATOM   3829  C  CD    . LYS A 1 618 ? 8.089   16.754  48.835  1.00 64.56  ? 618 LYS A CD    1 
ATOM   3830  C  CE    . LYS A 1 618 ? 6.735   16.098  48.669  1.00 73.89  ? 618 LYS A CE    1 
ATOM   3831  N  NZ    . LYS A 1 618 ? 5.668   16.978  48.120  1.00 73.35  ? 618 LYS A NZ    1 
ATOM   3832  N  N     . LEU A 1 619 ? 10.950  12.774  49.228  1.00 35.92  ? 619 LEU A N     1 
ATOM   3833  C  CA    . LEU A 1 619 ? 10.873  11.485  48.546  1.00 37.28  ? 619 LEU A CA    1 
ATOM   3834  C  C     . LEU A 1 619 ? 9.492   10.853  48.566  1.00 54.97  ? 619 LEU A C     1 
ATOM   3835  O  O     . LEU A 1 619 ? 8.808   10.867  49.580  1.00 82.85  ? 619 LEU A O     1 
ATOM   3836  C  CB    . LEU A 1 619 ? 11.902  10.500  49.098  1.00 22.86  ? 619 LEU A CB    1 
ATOM   3837  C  CG    . LEU A 1 619 ? 13.377  10.905  48.900  1.00 53.89  ? 619 LEU A CG    1 
ATOM   3838  C  CD1   . LEU A 1 619 ? 13.923  11.773  50.022  1.00 57.04  ? 619 LEU A CD1   1 
ATOM   3839  C  CD2   . LEU A 1 619 ? 14.249  9.641   48.757  1.00 47.89  ? 619 LEU A CD2   1 
ATOM   3840  N  N     . VAL A 1 620 ? 9.084   10.287  47.433  1.00 53.32  ? 620 VAL A N     1 
ATOM   3841  C  CA    . VAL A 1 620 ? 7.786   9.630   47.376  1.00 43.91  ? 620 VAL A CA    1 
ATOM   3842  C  C     . VAL A 1 620 ? 7.917   8.194   46.943  1.00 43.84  ? 620 VAL A C     1 
ATOM   3843  O  O     . VAL A 1 620 ? 8.451   7.906   45.890  1.00 58.20  ? 620 VAL A O     1 
ATOM   3844  C  CB    . VAL A 1 620 ? 6.821   10.305  46.391  1.00 41.82  ? 620 VAL A CB    1 
ATOM   3845  C  CG1   . VAL A 1 620 ? 5.512   9.585   46.398  1.00 48.84  ? 620 VAL A CG1   1 
ATOM   3846  C  CG2   . VAL A 1 620 ? 6.670   11.788  46.708  1.00 50.12  ? 620 VAL A CG2   1 
ATOM   3847  N  N     . HIS A 1 621 ? 7.414   7.291   47.781  1.00 48.79  ? 621 HIS A N     1 
ATOM   3848  C  CA    . HIS A 1 621 ? 7.483   5.875   47.491  1.00 50.63  ? 621 HIS A CA    1 
ATOM   3849  C  C     . HIS A 1 621 ? 6.326   5.485   46.555  1.00 53.51  ? 621 HIS A C     1 
ATOM   3850  O  O     . HIS A 1 621 ? 5.195   5.243   46.966  1.00 57.65  ? 621 HIS A O     1 
ATOM   3851  C  CB    . HIS A 1 621 ? 7.477   5.050   48.797  1.00 38.85  ? 621 HIS A CB    1 
ATOM   3852  C  CG    . HIS A 1 621 ? 7.870   3.612   48.592  1.00 49.04  ? 621 HIS A CG    1 
ATOM   3853  N  ND1   . HIS A 1 621 ? 7.614   2.625   49.517  1.00 57.14  ? 621 HIS A ND1   1 
ATOM   3854  C  CD2   . HIS A 1 621 ? 8.404   2.980   47.520  1.00 58.74  ? 621 HIS A CD2   1 
ATOM   3855  C  CE1   . HIS A 1 621 ? 8.029   1.459   49.053  1.00 61.52  ? 621 HIS A CE1   1 
ATOM   3856  N  NE2   . HIS A 1 621 ? 8.511   1.647   47.840  1.00 66.10  ? 621 HIS A NE2   1 
ATOM   3857  N  N     . GLU A 1 622 ? 6.652   5.439   45.279  1.00 46.35  ? 622 GLU A N     1 
ATOM   3858  C  CA    . GLU A 1 622 ? 5.710   5.249   44.204  1.00 38.02  ? 622 GLU A CA    1 
ATOM   3859  C  C     . GLU A 1 622 ? 5.235   3.825   43.965  1.00 50.36  ? 622 GLU A C     1 
ATOM   3860  O  O     . GLU A 1 622 ? 4.078   3.609   43.639  1.00 60.12  ? 622 GLU A O     1 
ATOM   3861  C  CB    . GLU A 1 622 ? 6.334   5.764   42.935  1.00 35.68  ? 622 GLU A CB    1 
ATOM   3862  C  CG    . GLU A 1 622 ? 5.391   6.601   42.159  1.00 75.88  ? 622 GLU A CG    1 
ATOM   3863  C  CD    . GLU A 1 622 ? 5.363   8.012   42.648  1.00 78.56  ? 622 GLU A CD    1 
ATOM   3864  O  OE1   . GLU A 1 622 ? 4.256   8.589   42.708  1.00 80.25  ? 622 GLU A OE1   1 
ATOM   3865  O  OE2   . GLU A 1 622 ? 6.440   8.498   43.046  1.00 77.26  ? 622 GLU A OE2   1 
ATOM   3866  N  N     . ALA A 1 623 ? 6.120   2.852   44.141  1.00 50.34  ? 623 ALA A N     1 
ATOM   3867  C  CA    . ALA A 1 623 ? 5.747   1.474   43.964  1.00 49.26  ? 623 ALA A CA    1 
ATOM   3868  C  C     . ALA A 1 623 ? 6.703   0.603   44.766  1.00 53.66  ? 623 ALA A C     1 
ATOM   3869  O  O     . ALA A 1 623 ? 7.828   1.022   45.029  1.00 47.78  ? 623 ALA A O     1 
ATOM   3870  C  CB    . ALA A 1 623 ? 5.780   1.110   42.455  1.00 25.46  ? 623 ALA A CB    1 
ATOM   3871  N  N     . GLY A 1 624 ? 6.209   -0.538  45.256  1.00 53.12  ? 624 GLY A N     1 
ATOM   3872  C  CA    . GLY A 1 624 ? 7.014   -1.453  46.048  1.00 49.57  ? 624 GLY A CA    1 
ATOM   3873  C  C     . GLY A 1 624 ? 6.535   -1.507  47.479  1.00 64.67  ? 624 GLY A C     1 
ATOM   3874  O  O     . GLY A 1 624 ? 5.799   -0.615  47.917  1.00 68.43  ? 624 GLY A O     1 
ATOM   3875  N  N     . ASP A 1 625 ? 6.974   -2.511  48.235  1.00 72.10  ? 625 ASP A N     1 
ATOM   3876  C  CA    . ASP A 1 625 ? 6.457   -2.673  49.585  1.00 64.70  ? 625 ASP A CA    1 
ATOM   3877  C  C     . ASP A 1 625 ? 7.586   -2.668  50.606  1.00 61.65  ? 625 ASP A C     1 
ATOM   3878  O  O     . ASP A 1 625 ? 7.376   -3.059  51.743  1.00 69.96  ? 625 ASP A O     1 
ATOM   3879  C  CB    . ASP A 1 625 ? 5.701   -3.986  49.731  1.00 69.37  ? 625 ASP A CB    1 
ATOM   3880  C  CG    . ASP A 1 625 ? 6.511   -5.186  49.246  1.00 85.67  ? 625 ASP A CG    1 
ATOM   3881  O  OD1   . ASP A 1 625 ? 7.765   -5.154  49.335  1.00 81.42  ? 625 ASP A OD1   1 
ATOM   3882  O  OD2   . ASP A 1 625 ? 5.892   -6.191  48.831  1.00 100.15 ? 625 ASP A OD2   1 
ATOM   3883  N  N     . THR A 1 626 ? 8.778   -2.215  50.224  1.00 61.84  ? 626 THR A N     1 
ATOM   3884  C  CA    . THR A 1 626 ? 9.838   -2.078  51.220  1.00 63.00  ? 626 THR A CA    1 
ATOM   3885  C  C     . THR A 1 626 ? 9.405   -0.997  52.214  1.00 60.16  ? 626 THR A C     1 
ATOM   3886  O  O     . THR A 1 626 ? 8.917   0.068   51.814  1.00 54.07  ? 626 THR A O     1 
ATOM   3887  C  CB    . THR A 1 626 ? 11.172  -1.729  50.550  1.00 62.47  ? 626 THR A CB    1 
ATOM   3888  O  OG1   . THR A 1 626 ? 11.565  -2.811  49.702  1.00 74.89  ? 626 THR A OG1   1 
ATOM   3889  C  CG2   . THR A 1 626 ? 12.252  -1.421  51.576  1.00 48.19  ? 626 THR A CG2   1 
ATOM   3890  N  N     . PRO A 1 627 ? 9.599   -1.258  53.506  1.00 61.23  ? 627 PRO A N     1 
ATOM   3891  C  CA    . PRO A 1 627 ? 9.257   -0.225  54.487  1.00 59.92  ? 627 PRO A CA    1 
ATOM   3892  C  C     . PRO A 1 627 ? 10.002  1.089   54.221  1.00 57.90  ? 627 PRO A C     1 
ATOM   3893  O  O     . PRO A 1 627 ? 11.195  1.013   53.946  1.00 58.24  ? 627 PRO A O     1 
ATOM   3894  C  CB    . PRO A 1 627 ? 9.685   -0.861  55.808  1.00 55.76  ? 627 PRO A CB    1 
ATOM   3895  C  CG    . PRO A 1 627 ? 9.546   -2.324  55.553  1.00 56.34  ? 627 PRO A CG    1 
ATOM   3896  C  CD    . PRO A 1 627 ? 9.942   -2.548  54.130  1.00 60.13  ? 627 PRO A CD    1 
ATOM   3897  N  N     . LEU A 1 628 ? 9.328   2.236   54.423  1.00 46.09  ? 628 LEU A N     1 
ATOM   3898  C  CA    . LEU A 1 628 ? 9.977   3.509   54.164  1.00 43.54  ? 628 LEU A CA    1 
ATOM   3899  C  C     . LEU A 1 628 ? 11.308  3.716   54.842  1.00 62.88  ? 628 LEU A C     1 
ATOM   3900  O  O     . LEU A 1 628 ? 12.217  4.292   54.227  1.00 67.41  ? 628 LEU A O     1 
ATOM   3901  C  CB    . LEU A 1 628 ? 9.106   4.762   54.446  1.00 62.15  ? 628 LEU A CB    1 
ATOM   3902  C  CG    . LEU A 1 628 ? 8.147   4.735   53.250  1.00 75.81  ? 628 LEU A CG    1 
ATOM   3903  C  CD1   . LEU A 1 628 ? 6.765   4.543   53.891  1.00 88.83  ? 628 LEU A CD1   1 
ATOM   3904  C  CD2   . LEU A 1 628 ? 8.146   5.896   52.325  1.00 84.29  ? 628 LEU A CD2   1 
ATOM   3905  N  N     . GLU A 1 629 ? 11.437  3.264   56.080  1.00 65.28  ? 629 GLU A N     1 
ATOM   3906  C  CA    . GLU A 1 629 ? 12.666  3.506   56.814  1.00 67.35  ? 629 GLU A CA    1 
ATOM   3907  C  C     . GLU A 1 629 ? 13.800  2.766   56.112  1.00 57.49  ? 629 GLU A C     1 
ATOM   3908  O  O     . GLU A 1 629 ? 14.926  3.280   56.034  1.00 46.57  ? 629 GLU A O     1 
ATOM   3909  C  CB    . GLU A 1 629 ? 12.510  3.086   58.295  1.00 80.06  ? 629 GLU A CB    1 
ATOM   3910  C  CG    . GLU A 1 629 ? 13.689  3.510   59.148  1.00 92.03  ? 629 GLU A CG    1 
ATOM   3911  C  CD    . GLU A 1 629 ? 13.751  2.799   60.494  1.00 116.91 ? 629 GLU A CD    1 
ATOM   3912  O  OE1   . GLU A 1 629 ? 13.882  1.566   60.489  1.00 130.98 ? 629 GLU A OE1   1 
ATOM   3913  O  OE2   . GLU A 1 629 ? 13.846  3.457   61.563  1.00 121.38 ? 629 GLU A OE2   1 
ATOM   3914  N  N     . ALA A 1 630 ? 13.546  1.561   55.587  1.00 52.05  ? 630 ALA A N     1 
ATOM   3915  C  CA    . ALA A 1 630 ? 14.619  0.837   54.902  1.00 46.20  ? 630 ALA A CA    1 
ATOM   3916  C  C     . ALA A 1 630 ? 15.069  1.519   53.589  1.00 47.12  ? 630 ALA A C     1 
ATOM   3917  O  O     . ALA A 1 630 ? 16.282  1.574   53.305  1.00 47.78  ? 630 ALA A O     1 
ATOM   3918  C  CB    . ALA A 1 630 ? 14.171  -0.594  54.621  1.00 52.79  ? 630 ALA A CB    1 
ATOM   3919  N  N     . LEU A 1 631 ? 14.106  2.085   52.848  1.00 46.47  ? 631 LEU A N     1 
ATOM   3920  C  CA    . LEU A 1 631 ? 14.375  2.869   51.631  1.00 55.33  ? 631 LEU A CA    1 
ATOM   3921  C  C     . LEU A 1 631 ? 15.267  4.032   52.014  1.00 55.78  ? 631 LEU A C     1 
ATOM   3922  O  O     . LEU A 1 631 ? 16.249  4.321   51.306  1.00 42.19  ? 631 LEU A O     1 
ATOM   3923  C  CB    . LEU A 1 631 ? 13.102  3.369   50.982  1.00 52.19  ? 631 LEU A CB    1 
ATOM   3924  C  CG    . LEU A 1 631 ? 12.292  2.272   50.321  1.00 50.66  ? 631 LEU A CG    1 
ATOM   3925  C  CD1   . LEU A 1 631 ? 10.960  2.865   49.850  1.00 46.48  ? 631 LEU A CD1   1 
ATOM   3926  C  CD2   . LEU A 1 631 ? 13.046  1.527   49.263  1.00 58.05  ? 631 LEU A CD2   1 
ATOM   3927  N  N     . ALA A 1 632 ? 14.846  4.762   53.053  1.00 52.30  ? 632 ALA A N     1 
ATOM   3928  C  CA    . ALA A 1 632 ? 15.583  5.927   53.539  1.00 47.28  ? 632 ALA A CA    1 
ATOM   3929  C  C     . ALA A 1 632 ? 17.018  5.517   53.901  1.00 42.75  ? 632 ALA A C     1 
ATOM   3930  O  O     . ALA A 1 632 ? 17.965  6.242   53.629  1.00 39.14  ? 632 ALA A O     1 
ATOM   3931  C  CB    . ALA A 1 632 ? 14.903  6.538   54.750  1.00 54.61  ? 632 ALA A CB    1 
ATOM   3932  N  N     . HIS A 1 633 ? 17.159  4.412   54.621  1.00 43.52  ? 633 HIS A N     1 
ATOM   3933  C  CA    . HIS A 1 633 ? 18.486  3.876   54.938  1.00 53.47  ? 633 HIS A CA    1 
ATOM   3934  C  C     . HIS A 1 633 ? 19.403  3.652   53.742  1.00 53.45  ? 633 HIS A C     1 
ATOM   3935  O  O     . HIS A 1 633 ? 20.526  4.191   53.677  1.00 38.72  ? 633 HIS A O     1 
ATOM   3936  C  CB    . HIS A 1 633 ? 18.346  2.581   55.760  1.00 41.60  ? 633 HIS A CB    1 
ATOM   3937  C  CG    . HIS A 1 633 ? 19.652  1.982   56.170  1.00 45.04  ? 633 HIS A CG    1 
ATOM   3938  N  ND1   . HIS A 1 633 ? 20.207  0.895   55.531  1.00 59.12  ? 633 HIS A ND1   1 
ATOM   3939  C  CD2   . HIS A 1 633 ? 20.553  2.367   57.105  1.00 52.32  ? 633 HIS A CD2   1 
ATOM   3940  C  CE1   . HIS A 1 633 ? 21.360  0.592   56.099  1.00 56.83  ? 633 HIS A CE1   1 
ATOM   3941  N  NE2   . HIS A 1 633 ? 21.602  1.484   57.043  1.00 54.73  ? 633 HIS A NE2   1 
ATOM   3942  N  N     . GLN A 1 634 ? 18.933  2.853   52.795  1.00 52.47  ? 634 GLN A N     1 
ATOM   3943  C  CA    . GLN A 1 634 ? 19.755  2.603   51.619  1.00 49.89  ? 634 GLN A CA    1 
ATOM   3944  C  C     . GLN A 1 634 ? 20.038  3.895   50.835  1.00 49.34  ? 634 GLN A C     1 
ATOM   3945  O  O     . GLN A 1 634 ? 21.142  4.076   50.366  1.00 41.15  ? 634 GLN A O     1 
ATOM   3946  C  CB    . GLN A 1 634 ? 19.120  1.528   50.747  1.00 46.36  ? 634 GLN A CB    1 
ATOM   3947  C  CG    . GLN A 1 634 ? 19.874  1.233   49.471  1.00 49.43  ? 634 GLN A CG    1 
ATOM   3948  C  CD    . GLN A 1 634 ? 19.568  -0.145  48.908  1.00 53.54  ? 634 GLN A CD    1 
ATOM   3949  O  OE1   . GLN A 1 634 ? 18.477  -0.691  49.102  1.00 53.35  ? 634 GLN A OE1   1 
ATOM   3950  N  NE2   . GLN A 1 634 ? 20.474  -0.647  48.090  1.00 45.41  ? 634 GLN A NE2   1 
ATOM   3951  N  N     . ILE A 1 635 ? 19.044  4.758   50.645  1.00 43.61  ? 635 ILE A N     1 
ATOM   3952  C  CA    . ILE A 1 635 ? 19.267  6.008   49.927  1.00 47.05  ? 635 ILE A CA    1 
ATOM   3953  C  C     . ILE A 1 635 ? 20.272  6.962   50.617  1.00 46.67  ? 635 ILE A C     1 
ATOM   3954  O  O     . ILE A 1 635 ? 21.261  7.476   50.023  1.00 49.82  ? 635 ILE A O     1 
ATOM   3955  C  CB    . ILE A 1 635 ? 17.931  6.752   49.696  1.00 45.74  ? 635 ILE A CB    1 
ATOM   3956  C  CG1   . ILE A 1 635 ? 17.083  5.971   48.677  1.00 39.31  ? 635 ILE A CG1   1 
ATOM   3957  C  CG2   . ILE A 1 635 ? 18.199  8.170   49.164  1.00 41.77  ? 635 ILE A CG2   1 
ATOM   3958  C  CD1   . ILE A 1 635 ? 15.605  6.309   48.659  1.00 24.67  ? 635 ILE A CD1   1 
ATOM   3959  N  N     . PHE A 1 636 ? 20.064  7.143   51.900  1.00 46.04  ? 636 PHE A N     1 
ATOM   3960  C  CA    . PHE A 1 636 ? 21.003  7.931   52.682  1.00 56.04  ? 636 PHE A CA    1 
ATOM   3961  C  C     . PHE A 1 636 ? 22.418  7.384   52.540  1.00 52.31  ? 636 PHE A C     1 
ATOM   3962  O  O     . PHE A 1 636 ? 23.349  8.133   52.275  1.00 49.87  ? 636 PHE A O     1 
ATOM   3963  C  CB    . PHE A 1 636 ? 20.585  7.975   54.149  1.00 61.20  ? 636 PHE A CB    1 
ATOM   3964  C  CG    . PHE A 1 636 ? 21.574  8.659   55.029  1.00 51.17  ? 636 PHE A CG    1 
ATOM   3965  C  CD1   . PHE A 1 636 ? 22.066  9.910   54.687  1.00 40.94  ? 636 PHE A CD1   1 
ATOM   3966  C  CD2   . PHE A 1 636 ? 22.009  8.054   56.194  1.00 56.28  ? 636 PHE A CD2   1 
ATOM   3967  C  CE1   . PHE A 1 636 ? 22.966  10.546  55.511  1.00 39.97  ? 636 PHE A CE1   1 
ATOM   3968  C  CE2   . PHE A 1 636 ? 22.913  8.674   57.003  1.00 57.26  ? 636 PHE A CE2   1 
ATOM   3969  C  CZ    . PHE A 1 636 ? 23.399  9.918   56.664  1.00 43.89  ? 636 PHE A CZ    1 
ATOM   3970  N  N     . HIS A 1 637 ? 22.569  6.081   52.717  1.00 36.77  ? 637 HIS A N     1 
ATOM   3971  C  CA    . HIS A 1 637 ? 23.876  5.447   52.589  1.00 36.20  ? 637 HIS A CA    1 
ATOM   3972  C  C     . HIS A 1 637 ? 24.426  5.690   51.147  1.00 50.40  ? 637 HIS A C     1 
ATOM   3973  O  O     . HIS A 1 637 ? 25.608  6.050   50.963  1.00 31.70  ? 637 HIS A O     1 
ATOM   3974  C  CB    . HIS A 1 637 ? 23.776  3.979   52.965  1.00 33.12  ? 637 HIS A CB    1 
ATOM   3975  C  CG    . HIS A 1 637 ? 23.792  3.760   54.450  1.00 58.38  ? 637 HIS A CG    1 
ATOM   3976  N  ND1   . HIS A 1 637 ? 24.271  2.609   55.044  1.00 58.26  ? 637 HIS A ND1   1 
ATOM   3977  C  CD2   . HIS A 1 637 ? 23.421  4.579   55.469  1.00 52.23  ? 637 HIS A CD2   1 
ATOM   3978  C  CE1   . HIS A 1 637 ? 24.139  2.707   56.356  1.00 46.22  ? 637 HIS A CE1   1 
ATOM   3979  N  NE2   . HIS A 1 637 ? 23.630  3.893   56.643  1.00 39.92  ? 637 HIS A NE2   1 
ATOM   3980  N  N     . LEU A 1 638 ? 23.565  5.526   50.133  1.00 39.31  ? 638 LEU A N     1 
ATOM   3981  C  CA    . LEU A 1 638 ? 24.016  5.722   48.753  1.00 40.98  ? 638 LEU A CA    1 
ATOM   3982  C  C     . LEU A 1 638 ? 24.588  7.112   48.485  1.00 47.59  ? 638 LEU A C     1 
ATOM   3983  O  O     . LEU A 1 638 ? 25.377  7.282   47.564  1.00 37.19  ? 638 LEU A O     1 
ATOM   3984  C  CB    . LEU A 1 638 ? 22.891  5.404   47.745  1.00 32.65  ? 638 LEU A CB    1 
ATOM   3985  C  CG    . LEU A 1 638 ? 22.565  3.905   47.585  1.00 34.67  ? 638 LEU A CG    1 
ATOM   3986  C  CD1   . LEU A 1 638 ? 21.233  3.562   46.962  1.00 44.38  ? 638 LEU A CD1   1 
ATOM   3987  C  CD2   . LEU A 1 638 ? 23.617  3.344   46.732  1.00 25.28  ? 638 LEU A CD2   1 
ATOM   3988  N  N     . THR A 1 639 ? 24.221  8.108   49.266  1.00 48.06  ? 639 THR A N     1 
ATOM   3989  C  CA    . THR A 1 639 ? 24.909  9.381   49.063  1.00 33.80  ? 639 THR A CA    1 
ATOM   3990  C  C     . THR A 1 639 ? 26.442  9.300   49.295  1.00 48.47  ? 639 THR A C     1 
ATOM   3991  O  O     . THR A 1 639 ? 27.156  10.228  48.917  1.00 52.19  ? 639 THR A O     1 
ATOM   3992  C  CB    . THR A 1 639 ? 24.412  10.529  49.914  1.00 29.44  ? 639 THR A CB    1 
ATOM   3993  O  OG1   . THR A 1 639 ? 24.809  10.299  51.274  1.00 49.01  ? 639 THR A OG1   1 
ATOM   3994  C  CG2   . THR A 1 639 ? 22.902  10.704  49.788  1.00 31.37  ? 639 THR A CG2   1 
ATOM   3995  N  N     . ARG A 1 640 ? 26.956  8.291   49.984  1.00 44.77  ? 640 ARG A N     1 
ATOM   3996  C  CA    . ARG A 1 640 ? 28.390  8.309   50.264  1.00 47.28  ? 640 ARG A CA    1 
ATOM   3997  C  C     . ARG A 1 640 ? 29.260  7.527   49.256  1.00 38.36  ? 640 ARG A C     1 
ATOM   3998  O  O     . ARG A 1 640 ? 30.474  7.384   49.465  1.00 48.98  ? 640 ARG A O     1 
ATOM   3999  C  CB    . ARG A 1 640 ? 28.672  7.942   51.728  1.00 42.87  ? 640 ARG A CB    1 
ATOM   4000  C  CG    . ARG A 1 640 ? 27.590  8.601   52.480  1.00 47.54  ? 640 ARG A CG    1 
ATOM   4001  C  CD    . ARG A 1 640 ? 28.011  9.566   53.530  1.00 45.64  ? 640 ARG A CD    1 
ATOM   4002  N  NE    . ARG A 1 640 ? 26.807  10.214  54.080  1.00 60.56  ? 640 ARG A NE    1 
ATOM   4003  C  CZ    . ARG A 1 640 ? 26.742  11.405  54.694  1.00 62.63  ? 640 ARG A CZ    1 
ATOM   4004  N  NH1   . ARG A 1 640 ? 27.806  12.145  54.891  1.00 87.37  ? 640 ARG A NH1   1 
ATOM   4005  N  NH2   . ARG A 1 640 ? 25.585  11.882  55.151  1.00 59.55  ? 640 ARG A NH2   1 
ATOM   4006  N  N     . LEU A 1 641 ? 28.612  6.908   48.274  1.00 39.01  ? 641 LEU A N     1 
ATOM   4007  C  CA    . LEU A 1 641 ? 29.330  6.063   47.327  1.00 44.99  ? 641 LEU A CA    1 
ATOM   4008  C  C     . LEU A 1 641 ? 30.089  6.803   46.234  1.00 47.83  ? 641 LEU A C     1 
ATOM   4009  O  O     . LEU A 1 641 ? 30.956  6.237   45.550  1.00 56.81  ? 641 LEU A O     1 
ATOM   4010  C  CB    . LEU A 1 641 ? 28.387  5.148   46.570  1.00 37.12  ? 641 LEU A CB    1 
ATOM   4011  C  CG    . LEU A 1 641 ? 29.004  3.793   46.471  1.00 42.36  ? 641 LEU A CG    1 
ATOM   4012  C  CD1   . LEU A 1 641 ? 29.053  2.725   47.335  1.00 83.74  ? 641 LEU A CD1   1 
ATOM   4013  C  CD2   . LEU A 1 641 ? 28.814  3.297   45.263  1.00 47.68  ? 641 LEU A CD2   1 
ATOM   4014  N  N     . TYR A 1 642 ? 29.779  8.068   46.046  1.00 44.73  ? 642 TYR A N     1 
ATOM   4015  C  CA    . TYR A 1 642 ? 30.338  8.819   44.946  1.00 53.11  ? 642 TYR A CA    1 
ATOM   4016  C  C     . TYR A 1 642 ? 31.835  8.973   45.077  1.00 58.79  ? 642 TYR A C     1 
ATOM   4017  O  O     . TYR A 1 642 ? 32.316  9.472   46.098  1.00 67.98  ? 642 TYR A O     1 
ATOM   4018  C  CB    . TYR A 1 642 ? 29.671  10.182  44.882  1.00 53.50  ? 642 TYR A CB    1 
ATOM   4019  C  CG    . TYR A 1 642 ? 29.978  10.945  43.606  1.00 49.85  ? 642 TYR A CG    1 
ATOM   4020  C  CD1   . TYR A 1 642 ? 29.439  10.582  42.391  1.00 55.05  ? 642 TYR A CD1   1 
ATOM   4021  C  CD2   . TYR A 1 642 ? 30.765  12.096  43.654  1.00 45.17  ? 642 TYR A CD2   1 
ATOM   4022  C  CE1   . TYR A 1 642 ? 29.710  11.316  41.238  1.00 61.58  ? 642 TYR A CE1   1 
ATOM   4023  C  CE2   . TYR A 1 642 ? 31.039  12.829  42.526  1.00 52.12  ? 642 TYR A CE2   1 
ATOM   4024  C  CZ    . TYR A 1 642 ? 30.523  12.438  41.304  1.00 58.72  ? 642 TYR A CZ    1 
ATOM   4025  O  OH    . TYR A 1 642 ? 30.794  13.177  40.147  1.00 50.50  ? 642 TYR A OH    1 
ATOM   4026  N  N     . PRO A 1 643 ? 32.605  8.472   44.088  1.00 56.77  ? 643 PRO A N     1 
ATOM   4027  C  CA    . PRO A 1 643 ? 34.079  8.357   44.165  1.00 52.61  ? 643 PRO A CA    1 
ATOM   4028  C  C     . PRO A 1 643 ? 34.824  9.646   43.796  1.00 48.91  ? 643 PRO A C     1 
ATOM   4029  O  O     . PRO A 1 643 ? 35.978  9.752   44.169  1.00 58.63  ? 643 PRO A O     1 
ATOM   4030  C  CB    . PRO A 1 643 ? 34.397  7.253   43.165  1.00 44.91  ? 643 PRO A CB    1 
ATOM   4031  C  CG    . PRO A 1 643 ? 33.376  7.421   42.135  1.00 40.41  ? 643 PRO A CG    1 
ATOM   4032  C  CD    . PRO A 1 643 ? 32.102  7.869   42.845  1.00 39.32  ? 643 PRO A CD    1 
ATOM   4033  N  N     . ALA A 1 644 ? 34.222  10.585  43.072  1.00 50.33  ? 644 ALA A N     1 
ATOM   4034  C  CA    . ALA A 1 644 ? 34.987  11.704  42.509  1.00 53.70  ? 644 ALA A CA    1 
ATOM   4035  C  C     . ALA A 1 644 ? 34.976  12.930  43.422  1.00 62.06  ? 644 ALA A C     1 
ATOM   4036  O  O     . ALA A 1 644 ? 35.564  13.968  43.070  1.00 68.73  ? 644 ALA A O     1 
ATOM   4037  C  CB    . ALA A 1 644 ? 34.478  12.071  41.136  1.00 55.76  ? 644 ALA A CB    1 
ATOM   4038  N  N     . SER A 1 645 ? 34.189  12.889  44.499  1.00 53.39  ? 645 SER A N     1 
ATOM   4039  C  CA    . SER A 1 645 ? 34.252  13.965  45.494  1.00 51.00  ? 645 SER A CA    1 
ATOM   4040  C  C     . SER A 1 645 ? 34.929  13.524  46.782  1.00 57.57  ? 645 SER A C     1 
ATOM   4041  O  O     . SER A 1 645 ? 34.330  12.797  47.581  1.00 65.49  ? 645 SER A O     1 
ATOM   4042  C  CB    . SER A 1 645 ? 32.865  14.489  45.825  1.00 54.47  ? 645 SER A CB    1 
ATOM   4043  O  OG    . SER A 1 645 ? 32.952  15.562  46.738  1.00 50.82  ? 645 SER A OG    1 
ATOM   4044  N  N     . GLY A 1 646 ? 36.171  13.950  46.966  1.00 56.06  ? 646 GLY A N     1 
ATOM   4045  C  CA    . GLY A 1 646 ? 37.005  13.490  48.060  1.00 59.42  ? 646 GLY A CA    1 
ATOM   4046  C  C     . GLY A 1 646 ? 36.627  13.917  49.470  1.00 55.43  ? 646 GLY A C     1 
ATOM   4047  O  O     . GLY A 1 646 ? 36.959  13.238  50.440  1.00 52.35  ? 646 GLY A O     1 
ATOM   4048  N  N     . PHE A 1 647 ? 36.022  15.096  49.587  1.00 54.22  ? 647 PHE A N     1 
ATOM   4049  C  CA    . PHE A 1 647 ? 35.879  15.738  50.894  1.00 58.03  ? 647 PHE A CA    1 
ATOM   4050  C  C     . PHE A 1 647 ? 34.456  16.162  51.215  1.00 57.61  ? 647 PHE A C     1 
ATOM   4051  O  O     . PHE A 1 647 ? 34.197  16.736  52.267  1.00 63.96  ? 647 PHE A O     1 
ATOM   4052  C  CB    . PHE A 1 647 ? 36.833  16.920  50.992  1.00 49.26  ? 647 PHE A CB    1 
ATOM   4053  C  CG    . PHE A 1 647 ? 38.214  16.580  50.566  1.00 51.64  ? 647 PHE A CG    1 
ATOM   4054  C  CD1   . PHE A 1 647 ? 39.124  16.070  51.465  1.00 50.74  ? 647 PHE A CD1   1 
ATOM   4055  C  CD2   . PHE A 1 647 ? 38.594  16.728  49.233  1.00 53.95  ? 647 PHE A CD2   1 
ATOM   4056  C  CE1   . PHE A 1 647 ? 40.410  15.739  51.043  1.00 54.48  ? 647 PHE A CE1   1 
ATOM   4057  C  CE2   . PHE A 1 647 ? 39.863  16.400  48.814  1.00 51.22  ? 647 PHE A CE2   1 
ATOM   4058  C  CZ    . PHE A 1 647 ? 40.775  15.909  49.725  1.00 54.84  ? 647 PHE A CZ    1 
ATOM   4059  N  N     . ALA A 1 648 ? 33.547  15.960  50.277  1.00 48.56  ? 648 ALA A N     1 
ATOM   4060  C  CA    . ALA A 1 648 ? 32.170  16.330  50.534  1.00 51.93  ? 648 ALA A CA    1 
ATOM   4061  C  C     . ALA A 1 648 ? 31.211  15.433  49.761  1.00 51.58  ? 648 ALA A C     1 
ATOM   4062  O  O     . ALA A 1 648 ? 31.311  15.295  48.545  1.00 48.59  ? 648 ALA A O     1 
ATOM   4063  C  CB    . ALA A 1 648 ? 31.928  17.768  50.189  1.00 41.28  ? 648 ALA A CB    1 
ATOM   4064  N  N     . PHE A 1 649 ? 30.315  14.787  50.499  1.00 50.42  ? 649 PHE A N     1 
ATOM   4065  C  CA    . PHE A 1 649 ? 29.322  13.916  49.894  1.00 55.61  ? 649 PHE A CA    1 
ATOM   4066  C  C     . PHE A 1 649 ? 28.236  14.679  49.156  1.00 57.62  ? 649 PHE A C     1 
ATOM   4067  O  O     . PHE A 1 649 ? 27.814  15.766  49.575  1.00 51.82  ? 649 PHE A O     1 
ATOM   4068  C  CB    . PHE A 1 649 ? 28.662  13.014  50.954  1.00 56.14  ? 649 PHE A CB    1 
ATOM   4069  C  CG    . PHE A 1 649 ? 29.629  12.233  51.777  1.00 47.36  ? 649 PHE A CG    1 
ATOM   4070  C  CD1   . PHE A 1 649 ? 30.457  11.298  51.174  1.00 48.12  ? 649 PHE A CD1   1 
ATOM   4071  C  CD2   . PHE A 1 649 ? 29.783  12.485  53.122  1.00 44.95  ? 649 PHE A CD2   1 
ATOM   4072  C  CE1   . PHE A 1 649 ? 31.363  10.569  51.918  1.00 52.33  ? 649 PHE A CE1   1 
ATOM   4073  C  CE2   . PHE A 1 649 ? 30.685  11.765  53.877  1.00 39.93  ? 649 PHE A CE2   1 
ATOM   4074  C  CZ    . PHE A 1 649 ? 31.493  10.809  53.263  1.00 40.53  ? 649 PHE A CZ    1 
ATOM   4075  N  N     . PRO A 1 650 ? 27.779  14.108  48.036  1.00 57.96  ? 650 PRO A N     1 
ATOM   4076  C  CA    . PRO A 1 650 ? 26.709  14.787  47.306  1.00 44.10  ? 650 PRO A CA    1 
ATOM   4077  C  C     . PRO A 1 650 ? 25.392  14.595  48.025  1.00 48.98  ? 650 PRO A C     1 
ATOM   4078  O  O     . PRO A 1 650 ? 25.239  13.601  48.747  1.00 48.17  ? 650 PRO A O     1 
ATOM   4079  C  CB    . PRO A 1 650 ? 26.744  14.121  45.931  1.00 32.19  ? 650 PRO A CB    1 
ATOM   4080  C  CG    . PRO A 1 650 ? 28.016  13.304  45.925  1.00 43.39  ? 650 PRO A CG    1 
ATOM   4081  C  CD    . PRO A 1 650 ? 28.274  12.928  47.313  1.00 49.74  ? 650 PRO A CD    1 
ATOM   4082  N  N     . ARG A 1 651 ? 24.462  15.522  47.792  1.00 51.88  ? 651 ARG A N     1 
ATOM   4083  C  CA    . ARG A 1 651 ? 23.130  15.492  48.384  1.00 44.72  ? 651 ARG A CA    1 
ATOM   4084  C  C     . ARG A 1 651 ? 22.335  14.319  47.854  1.00 42.22  ? 651 ARG A C     1 
ATOM   4085  O  O     . ARG A 1 651 ? 21.641  13.646  48.594  1.00 45.45  ? 651 ARG A O     1 
ATOM   4086  C  CB    . ARG A 1 651 ? 22.391  16.836  48.089  1.00 37.09  ? 651 ARG A CB    1 
ATOM   4087  C  CG    . ARG A 1 651 ? 21.084  16.950  48.829  1.00 33.76  ? 651 ARG A CG    1 
ATOM   4088  C  CD    . ARG A 1 651 ? 20.450  18.316  48.922  1.00 43.41  ? 651 ARG A CD    1 
ATOM   4089  N  NE    . ARG A 1 651 ? 20.064  19.012  47.713  1.00 54.00  ? 651 ARG A NE    1 
ATOM   4090  C  CZ    . ARG A 1 651 ? 18.800  19.413  47.519  1.00 56.99  ? 651 ARG A CZ    1 
ATOM   4091  N  NH1   . ARG A 1 651 ? 17.890  19.176  48.461  1.00 48.98  ? 651 ARG A NH1   1 
ATOM   4092  N  NH2   . ARG A 1 651 ? 18.433  20.049  46.419  1.00 64.37  ? 651 ARG A NH2   1 
ATOM   4093  N  N     . LEU A 1 652 ? 22.446  14.069  46.557  1.00 53.85  ? 652 LEU A N     1 
ATOM   4094  C  CA    . LEU A 1 652 ? 21.731  12.966  45.926  1.00 46.34  ? 652 LEU A CA    1 
ATOM   4095  C  C     . LEU A 1 652 ? 22.470  11.639  46.099  1.00 47.20  ? 652 LEU A C     1 
ATOM   4096  O  O     . LEU A 1 652 ? 23.699  11.634  46.236  1.00 54.85  ? 652 LEU A O     1 
ATOM   4097  C  CB    . LEU A 1 652 ? 21.531  13.190  44.440  1.00 39.97  ? 652 LEU A CB    1 
ATOM   4098  C  CG    . LEU A 1 652 ? 20.597  14.297  43.935  1.00 35.78  ? 652 LEU A CG    1 
ATOM   4099  C  CD1   . LEU A 1 652 ? 20.823  14.501  42.428  1.00 30.82  ? 652 LEU A CD1   1 
ATOM   4100  C  CD2   . LEU A 1 652 ? 19.168  14.109  44.301  1.00 47.48  ? 652 LEU A CD2   1 
ATOM   4101  N  N     . PRO A 1 653 ? 21.733  10.522  46.196  1.00 45.01  ? 653 PRO A N     1 
ATOM   4102  C  CA    . PRO A 1 653 ? 22.424  9.229   46.250  1.00 44.21  ? 653 PRO A CA    1 
ATOM   4103  C  C     . PRO A 1 653 ? 23.231  9.011   44.948  1.00 52.41  ? 653 PRO A C     1 
ATOM   4104  O  O     . PRO A 1 653 ? 22.861  9.547   43.900  1.00 69.23  ? 653 PRO A O     1 
ATOM   4105  C  CB    . PRO A 1 653 ? 21.262  8.219   46.330  1.00 35.40  ? 653 PRO A CB    1 
ATOM   4106  C  CG    . PRO A 1 653 ? 20.052  8.972   45.832  1.00 31.70  ? 653 PRO A CG    1 
ATOM   4107  C  CD    . PRO A 1 653 ? 20.272  10.376  46.280  1.00 33.77  ? 653 PRO A CD    1 
ATOM   4108  N  N     . ALA A 1 654 ? 24.314  8.250   45.004  1.00 38.59  ? 654 ALA A N     1 
ATOM   4109  C  CA    . ALA A 1 654 ? 25.241  8.145   43.879  1.00 39.62  ? 654 ALA A CA    1 
ATOM   4110  C  C     . ALA A 1 654 ? 24.582  7.796   42.550  1.00 46.14  ? 654 ALA A C     1 
ATOM   4111  O  O     . ALA A 1 654 ? 24.901  8.419   41.551  1.00 62.71  ? 654 ALA A O     1 
ATOM   4112  C  CB    . ALA A 1 654 ? 26.366  7.144   44.191  1.00 44.26  ? 654 ALA A CB    1 
ATOM   4113  N  N     . PRO A 1 655 ? 23.634  6.838   42.519  1.00 42.78  ? 655 PRO A N     1 
ATOM   4114  C  CA    . PRO A 1 655 ? 23.082  6.575   41.181  1.00 45.13  ? 655 PRO A CA    1 
ATOM   4115  C  C     . PRO A 1 655 ? 22.399  7.781   40.547  1.00 57.94  ? 655 PRO A C     1 
ATOM   4116  O  O     . PRO A 1 655 ? 22.574  7.976   39.331  1.00 74.90  ? 655 PRO A O     1 
ATOM   4117  C  CB    . PRO A 1 655 ? 22.049  5.468   41.439  1.00 41.42  ? 655 PRO A CB    1 
ATOM   4118  C  CG    . PRO A 1 655 ? 22.589  4.766   42.618  1.00 55.21  ? 655 PRO A CG    1 
ATOM   4119  C  CD    . PRO A 1 655 ? 23.183  5.831   43.495  1.00 51.76  ? 655 PRO A CD    1 
ATOM   4120  N  N     . LEU A 1 656 ? 21.697  8.593   41.329  1.00 43.94  ? 656 LEU A N     1 
ATOM   4121  C  CA    . LEU A 1 656 ? 21.082  9.790   40.775  1.00 35.84  ? 656 LEU A CA    1 
ATOM   4122  C  C     . LEU A 1 656 ? 22.085  10.897  40.483  1.00 39.66  ? 656 LEU A C     1 
ATOM   4123  O  O     . LEU A 1 656 ? 21.932  11.596  39.504  1.00 48.39  ? 656 LEU A O     1 
ATOM   4124  C  CB    . LEU A 1 656 ? 19.989  10.334  41.690  1.00 34.00  ? 656 LEU A CB    1 
ATOM   4125  C  CG    . LEU A 1 656 ? 18.663  9.600   41.452  1.00 46.60  ? 656 LEU A CG    1 
ATOM   4126  C  CD1   . LEU A 1 656 ? 17.525  10.154  42.377  1.00 40.04  ? 656 LEU A CD1   1 
ATOM   4127  C  CD2   . LEU A 1 656 ? 18.289  9.622   39.979  1.00 51.18  ? 656 LEU A CD2   1 
ATOM   4128  N  N     . HIS A 1 657 ? 23.092  11.073  41.341  1.00 44.45  ? 657 HIS A N     1 
ATOM   4129  C  CA    . HIS A 1 657 ? 24.145  12.065  41.090  1.00 35.59  ? 657 HIS A CA    1 
ATOM   4130  C  C     . HIS A 1 657 ? 24.940  11.778  39.842  1.00 47.90  ? 657 HIS A C     1 
ATOM   4131  O  O     . HIS A 1 657 ? 25.126  12.670  39.008  1.00 54.73  ? 657 HIS A O     1 
ATOM   4132  C  CB    . HIS A 1 657 ? 25.057  12.113  42.312  1.00 31.20  ? 657 HIS A CB    1 
ATOM   4133  C  CG    . HIS A 1 657 ? 25.933  13.316  42.369  1.00 45.89  ? 657 HIS A CG    1 
ATOM   4134  N  ND1   . HIS A 1 657 ? 25.475  14.558  42.748  1.00 52.82  ? 657 HIS A ND1   1 
ATOM   4135  C  CD2   . HIS A 1 657 ? 27.270  13.447  42.197  1.00 48.23  ? 657 HIS A CD2   1 
ATOM   4136  C  CE1   . HIS A 1 657 ? 26.474  15.422  42.727  1.00 39.03  ? 657 HIS A CE1   1 
ATOM   4137  N  NE2   . HIS A 1 657 ? 27.573  14.774  42.390  1.00 41.51  ? 657 HIS A NE2   1 
ATOM   4138  N  N     . LEU A 1 658 ? 25.282  10.509  39.650  1.00 51.89  ? 658 LEU A N     1 
ATOM   4139  C  CA    . LEU A 1 658 ? 25.979  10.051  38.451  1.00 47.09  ? 658 LEU A CA    1 
ATOM   4140  C  C     . LEU A 1 658 ? 25.076  10.233  37.260  1.00 55.32  ? 658 LEU A C     1 
ATOM   4141  O  O     . LEU A 1 658 ? 25.492  10.756  36.254  1.00 63.61  ? 658 LEU A O     1 
ATOM   4142  C  CB    . LEU A 1 658 ? 26.403  8.600   38.585  1.00 39.92  ? 658 LEU A CB    1 
ATOM   4143  C  CG    . LEU A 1 658 ? 27.517  8.347   39.599  1.00 34.97  ? 658 LEU A CG    1 
ATOM   4144  C  CD1   . LEU A 1 658 ? 27.749  6.862   39.816  1.00 31.53  ? 658 LEU A CD1   1 
ATOM   4145  C  CD2   . LEU A 1 658 ? 28.820  8.977   39.030  1.00 51.49  ? 658 LEU A CD2   1 
ATOM   4146  N  N     . ALA A 1 659 ? 23.824  9.818   37.379  1.00 49.01  ? 659 ALA A N     1 
ATOM   4147  C  CA    . ALA A 1 659 ? 22.926  9.932   36.260  1.00 29.39  ? 659 ALA A CA    1 
ATOM   4148  C  C     . ALA A 1 659 ? 22.699  11.410  35.828  1.00 49.53  ? 659 ALA A C     1 
ATOM   4149  O  O     . ALA A 1 659 ? 22.708  11.753  34.643  1.00 50.61  ? 659 ALA A O     1 
ATOM   4150  C  CB    . ALA A 1 659 ? 21.630  9.276   36.612  1.00 27.49  ? 659 ALA A CB    1 
ATOM   4151  N  N     . ASP A 1 660 ? 22.509  12.287  36.802  1.00 41.84  ? 660 ASP A N     1 
ATOM   4152  C  CA    . ASP A 1 660 ? 22.331  13.711  36.551  1.00 44.30  ? 660 ASP A CA    1 
ATOM   4153  C  C     . ASP A 1 660 ? 23.600  14.170  35.768  1.00 47.65  ? 660 ASP A C     1 
ATOM   4154  O  O     . ASP A 1 660 ? 23.501  14.864  34.733  1.00 53.73  ? 660 ASP A O     1 
ATOM   4155  C  CB    . ASP A 1 660 ? 22.174  14.506  37.842  1.00 49.92  ? 660 ASP A CB    1 
ATOM   4156  C  CG    . ASP A 1 660 ? 22.261  16.002  37.631  1.00 61.44  ? 660 ASP A CG    1 
ATOM   4157  O  OD1   . ASP A 1 660 ? 21.498  16.509  36.785  1.00 78.59  ? 660 ASP A OD1   1 
ATOM   4158  O  OD2   . ASP A 1 660 ? 23.187  16.653  38.129  1.00 63.47  ? 660 ASP A OD2   1 
ATOM   4159  N  N     . ARG A 1 661 ? 24.796  13.821  36.269  1.00 44.52  ? 661 ARG A N     1 
ATOM   4160  C  CA    . ARG A 1 661 ? 26.015  14.245  35.560  1.00 33.02  ? 661 ARG A CA    1 
ATOM   4161  C  C     . ARG A 1 661 ? 26.182  13.615  34.150  1.00 51.75  ? 661 ARG A C     1 
ATOM   4162  O  O     . ARG A 1 661 ? 26.631  14.281  33.207  1.00 51.75  ? 661 ARG A O     1 
ATOM   4163  C  CB    . ARG A 1 661 ? 27.266  13.970  36.400  1.00 26.44  ? 661 ARG A CB    1 
ATOM   4164  C  CG    . ARG A 1 661 ? 27.504  15.058  37.443  1.00 34.08  ? 661 ARG A CG    1 
ATOM   4165  C  CD    . ARG A 1 661 ? 28.799  14.869  38.189  1.00 55.04  ? 661 ARG A CD    1 
ATOM   4166  N  NE    . ARG A 1 661 ? 29.769  15.832  37.669  1.00 69.37  ? 661 ARG A NE    1 
ATOM   4167  C  CZ    . ARG A 1 661 ? 30.259  16.854  38.368  1.00 78.97  ? 661 ARG A CZ    1 
ATOM   4168  N  NH1   . ARG A 1 661 ? 31.126  17.703  37.820  1.00 79.02  ? 661 ARG A NH1   1 
ATOM   4169  N  NH2   . ARG A 1 661 ? 29.870  17.037  39.618  1.00 93.30  ? 661 ARG A NH2   1 
ATOM   4170  N  N     . LEU A 1 662 ? 25.732  12.377  33.988  1.00 53.49  ? 662 LEU A N     1 
ATOM   4171  C  CA    . LEU A 1 662 ? 25.780  11.643  32.718  1.00 48.04  ? 662 LEU A CA    1 
ATOM   4172  C  C     . LEU A 1 662 ? 24.943  12.407  31.674  1.00 44.34  ? 662 LEU A C     1 
ATOM   4173  O  O     . LEU A 1 662 ? 25.483  12.820  30.631  1.00 36.56  ? 662 LEU A O     1 
ATOM   4174  C  CB    . LEU A 1 662 ? 25.195  10.252  32.887  1.00 42.80  ? 662 LEU A CB    1 
ATOM   4175  C  CG    . LEU A 1 662 ? 24.848  9.463   31.624  1.00 43.65  ? 662 LEU A CG    1 
ATOM   4176  C  CD1   . LEU A 1 662 ? 26.110  9.201   30.821  1.00 39.92  ? 662 LEU A CD1   1 
ATOM   4177  C  CD2   . LEU A 1 662 ? 24.088  8.164   31.934  1.00 41.54  ? 662 LEU A CD2   1 
ATOM   4178  N  N     . VAL A 1 663 ? 23.648  12.642  31.962  1.00 45.74  ? 663 VAL A N     1 
ATOM   4179  C  CA    . VAL A 1 663 ? 22.815  13.362  30.976  1.00 52.49  ? 663 VAL A CA    1 
ATOM   4180  C  C     . VAL A 1 663 ? 23.335  14.805  30.763  1.00 40.39  ? 663 VAL A C     1 
ATOM   4181  O  O     . VAL A 1 663 ? 23.171  15.358  29.688  1.00 30.22  ? 663 VAL A O     1 
ATOM   4182  C  CB    . VAL A 1 663 ? 21.319  13.374  31.317  1.00 46.39  ? 663 VAL A CB    1 
ATOM   4183  C  CG1   . VAL A 1 663 ? 20.754  11.969  31.263  1.00 38.16  ? 663 VAL A CG1   1 
ATOM   4184  C  CG2   . VAL A 1 663 ? 21.050  14.107  32.648  1.00 59.33  ? 663 VAL A CG2   1 
ATOM   4185  N  N     . LYS A 1 664 ? 23.938  15.421  31.769  1.00 39.50  ? 664 LYS A N     1 
ATOM   4186  C  CA    . LYS A 1 664 ? 24.511  16.741  31.542  1.00 42.24  ? 664 LYS A CA    1 
ATOM   4187  C  C     . LYS A 1 664 ? 25.659  16.728  30.526  1.00 41.53  ? 664 LYS A C     1 
ATOM   4188  O  O     . LYS A 1 664 ? 25.657  17.517  29.552  1.00 45.57  ? 664 LYS A O     1 
ATOM   4189  C  CB    . LYS A 1 664 ? 24.926  17.369  32.867  1.00 52.06  ? 664 LYS A CB    1 
ATOM   4190  C  CG    . LYS A 1 664 ? 24.986  18.875  32.807  1.00 59.92  ? 664 LYS A CG    1 
ATOM   4191  C  CD    . LYS A 1 664 ? 25.491  19.510  34.087  1.00 67.68  ? 664 LYS A CD    1 
ATOM   4192  C  CE    . LYS A 1 664 ? 24.516  19.139  35.213  1.00 71.78  ? 664 LYS A CE    1 
ATOM   4193  N  NZ    . LYS A 1 664 ? 24.603  20.126  36.314  1.00 70.56  ? 664 LYS A NZ    1 
ATOM   4194  N  N     . GLU A 1 665 ? 26.598  15.801  30.705  1.00 38.38  ? 665 GLU A N     1 
ATOM   4195  C  CA    . GLU A 1 665 ? 27.754  15.720  29.800  1.00 42.53  ? 665 GLU A CA    1 
ATOM   4196  C  C     . GLU A 1 665 ? 27.374  15.328  28.403  1.00 45.28  ? 665 GLU A C     1 
ATOM   4197  O  O     . GLU A 1 665 ? 27.988  15.813  27.446  1.00 40.77  ? 665 GLU A O     1 
ATOM   4198  C  CB    . GLU A 1 665 ? 28.784  14.719  30.283  1.00 39.16  ? 665 GLU A CB    1 
ATOM   4199  C  CG    . GLU A 1 665 ? 29.851  15.368  31.119  1.00 64.51  ? 665 GLU A CG    1 
ATOM   4200  C  CD    . GLU A 1 665 ? 30.779  16.263  30.356  1.00 75.00  ? 665 GLU A CD    1 
ATOM   4201  O  OE1   . GLU A 1 665 ? 30.517  17.475  30.325  1.00 74.06  ? 665 GLU A OE1   1 
ATOM   4202  O  OE2   . GLU A 1 665 ? 31.797  15.775  29.834  1.00 90.14  ? 665 GLU A OE2   1 
ATOM   4203  N  N     . VAL A 1 666 ? 26.409  14.420  28.275  1.00 54.91  ? 666 VAL A N     1 
ATOM   4204  C  CA    . VAL A 1 666 ? 25.940  14.024  26.954  1.00 48.89  ? 666 VAL A CA    1 
ATOM   4205  C  C     . VAL A 1 666 ? 25.218  15.197  26.311  1.00 49.48  ? 666 VAL A C     1 
ATOM   4206  O  O     . VAL A 1 666 ? 25.363  15.424  25.105  1.00 64.73  ? 666 VAL A O     1 
ATOM   4207  C  CB    . VAL A 1 666 ? 25.089  12.765  27.011  1.00 48.05  ? 666 VAL A CB    1 
ATOM   4208  C  CG1   . VAL A 1 666 ? 24.458  12.445  25.651  1.00 49.02  ? 666 VAL A CG1   1 
ATOM   4209  C  CG2   . VAL A 1 666 ? 25.949  11.611  27.552  1.00 39.80  ? 666 VAL A CG2   1 
ATOM   4210  N  N     . GLY A 1 667 ? 24.447  15.949  27.106  1.00 41.18  ? 667 GLY A N     1 
ATOM   4211  C  CA    . GLY A 1 667 ? 23.817  17.148  26.577  1.00 50.62  ? 667 GLY A CA    1 
ATOM   4212  C  C     . GLY A 1 667 ? 24.848  18.180  26.096  1.00 60.04  ? 667 GLY A C     1 
ATOM   4213  O  O     . GLY A 1 667 ? 24.597  18.918  25.162  1.00 60.58  ? 667 GLY A O     1 
ATOM   4214  N  N     . ARG A 1 668 ? 26.041  18.155  26.672  1.00 61.97  ? 668 ARG A N     1 
ATOM   4215  C  CA    . ARG A 1 668 ? 27.130  19.058  26.294  1.00 56.91  ? 668 ARG A CA    1 
ATOM   4216  C  C     . ARG A 1 668 ? 27.944  18.639  25.067  1.00 53.91  ? 668 ARG A C     1 
ATOM   4217  O  O     . ARG A 1 668 ? 28.243  19.467  24.209  1.00 53.15  ? 668 ARG A O     1 
ATOM   4218  C  CB    . ARG A 1 668 ? 28.095  19.249  27.473  1.00 47.27  ? 668 ARG A CB    1 
ATOM   4219  C  CG    . ARG A 1 668 ? 28.117  20.622  28.023  1.00 49.83  ? 668 ARG A CG    1 
ATOM   4220  C  CD    . ARG A 1 668 ? 27.976  20.752  29.503  1.00 58.19  ? 668 ARG A CD    1 
ATOM   4221  N  NE    . ARG A 1 668 ? 28.982  20.043  30.268  1.00 62.80  ? 668 ARG A NE    1 
ATOM   4222  C  CZ    . ARG A 1 668 ? 28.988  20.012  31.595  1.00 65.84  ? 668 ARG A CZ    1 
ATOM   4223  N  NH1   . ARG A 1 668 ? 28.104  20.749  32.275  1.00 62.54  ? 668 ARG A NH1   1 
ATOM   4224  N  NH2   . ARG A 1 668 ? 29.930  19.334  32.241  1.00 72.40  ? 668 ARG A NH2   1 
ATOM   4225  N  N     . LEU A 1 669 ? 28.362  17.385  25.022  1.00 49.38  ? 669 LEU A N     1 
ATOM   4226  C  CA    . LEU A 1 669 ? 29.283  16.902  24.005  1.00 44.08  ? 669 LEU A CA    1 
ATOM   4227  C  C     . LEU A 1 669 ? 28.497  16.341  22.844  1.00 49.97  ? 669 LEU A C     1 
ATOM   4228  O  O     . LEU A 1 669 ? 28.914  16.461  21.700  1.00 69.21  ? 669 LEU A O     1 
ATOM   4229  C  CB    . LEU A 1 669 ? 30.273  15.870  24.561  1.00 36.24  ? 669 LEU A CB    1 
ATOM   4230  C  CG    . LEU A 1 669 ? 30.882  16.265  25.894  1.00 37.89  ? 669 LEU A CG    1 
ATOM   4231  C  CD1   . LEU A 1 669 ? 31.768  15.198  26.366  1.00 40.57  ? 669 LEU A CD1   1 
ATOM   4232  C  CD2   . LEU A 1 669 ? 31.663  17.584  25.702  1.00 45.68  ? 669 LEU A CD2   1 
ATOM   4233  N  N     . GLY A 1 670 ? 27.510  15.528  23.148  1.00 43.46  ? 670 GLY A N     1 
ATOM   4234  C  CA    . GLY A 1 670 ? 26.770  14.879  22.102  1.00 45.65  ? 670 GLY A CA    1 
ATOM   4235  C  C     . GLY A 1 670 ? 26.889  13.435  22.448  1.00 51.76  ? 670 GLY A C     1 
ATOM   4236  O  O     . GLY A 1 670 ? 27.843  13.055  23.117  1.00 55.95  ? 670 GLY A O     1 
ATOM   4237  N  N     . ILE A 1 671 ? 26.050  12.608  21.858  1.00 51.23  ? 671 ILE A N     1 
ATOM   4238  C  CA    . ILE A 1 671 ? 26.019  11.206  22.188  1.00 26.31  ? 671 ILE A CA    1 
ATOM   4239  C  C     . ILE A 1 671 ? 26.893  10.471  21.178  1.00 36.24  ? 671 ILE A C     1 
ATOM   4240  O  O     . ILE A 1 671 ? 27.355  9.338   21.423  1.00 31.92  ? 671 ILE A O     1 
ATOM   4241  C  CB    . ILE A 1 671 ? 24.573  10.729  22.163  1.00 24.60  ? 671 ILE A CB    1 
ATOM   4242  C  CG1   . ILE A 1 671 ? 24.437  9.407   22.893  1.00 30.59  ? 671 ILE A CG1   1 
ATOM   4243  C  CG2   . ILE A 1 671 ? 24.084  10.506  20.730  1.00 34.35  ? 671 ILE A CG2   1 
ATOM   4244  C  CD1   . ILE A 1 671 ? 22.999  8.982   23.039  1.00 50.71  ? 671 ILE A CD1   1 
ATOM   4245  N  N     . ARG A 1 672 ? 27.315  11.196  20.139  1.00 45.69  ? 672 ARG A N     1 
ATOM   4246  C  CA    . ARG A 1 672 ? 28.009  10.559  19.008  1.00 44.14  ? 672 ARG A CA    1 
ATOM   4247  C  C     . ARG A 1 672 ? 29.420  10.096  19.336  1.00 56.02  ? 672 ARG A C     1 
ATOM   4248  O  O     . ARG A 1 672 ? 30.005  9.358   18.548  1.00 56.64  ? 672 ARG A O     1 
ATOM   4249  C  CB    . ARG A 1 672 ? 28.098  11.510  17.814  1.00 31.53  ? 672 ARG A CB    1 
ATOM   4250  C  CG    . ARG A 1 672 ? 28.994  12.743  18.046  1.00 31.11  ? 672 ARG A CG    1 
ATOM   4251  C  CD    . ARG A 1 672 ? 28.700  13.850  17.046  1.00 41.74  ? 672 ARG A CD    1 
ATOM   4252  N  NE    . ARG A 1 672 ? 29.426  15.100  17.310  1.00 48.51  ? 672 ARG A NE    1 
ATOM   4253  C  CZ    . ARG A 1 672 ? 28.947  16.085  18.077  1.00 55.74  ? 672 ARG A CZ    1 
ATOM   4254  N  NH1   . ARG A 1 672 ? 27.732  15.994  18.614  1.00 59.45  ? 672 ARG A NH1   1 
ATOM   4255  N  NH2   . ARG A 1 672 ? 29.648  17.194  18.261  1.00 55.46  ? 672 ARG A NH2   1 
ATOM   4256  N  N     . HIS A 1 673 ? 29.948  10.499  20.499  1.00 51.96  ? 673 HIS A N     1 
ATOM   4257  C  CA    . HIS A 1 673 ? 31.345  10.214  20.825  1.00 50.61  ? 673 HIS A CA    1 
ATOM   4258  C  C     . HIS A 1 673 ? 31.524  8.960   21.708  1.00 53.87  ? 673 HIS A C     1 
ATOM   4259  O  O     . HIS A 1 673 ? 32.660  8.512   21.920  1.00 55.94  ? 673 HIS A O     1 
ATOM   4260  C  CB    . HIS A 1 673 ? 31.976  11.388  21.553  1.00 45.53  ? 673 HIS A CB    1 
ATOM   4261  C  CG    . HIS A 1 673 ? 31.670  12.724  20.963  1.00 49.63  ? 673 HIS A CG    1 
ATOM   4262  N  ND1   . HIS A 1 673 ? 32.236  13.171  19.790  1.00 52.61  ? 673 HIS A ND1   1 
ATOM   4263  C  CD2   . HIS A 1 673 ? 30.845  13.710  21.384  1.00 56.73  ? 673 HIS A CD2   1 
ATOM   4264  C  CE1   . HIS A 1 673 ? 31.789  14.385  19.523  1.00 60.63  ? 673 HIS A CE1   1 
ATOM   4265  N  NE2   . HIS A 1 673 ? 30.938  14.731  20.471  1.00 64.82  ? 673 HIS A NE2   1 
ATOM   4266  N  N     . LEU A 1 674 ? 30.418  8.365   22.170  1.00 41.33  ? 674 LEU A N     1 
ATOM   4267  C  CA    . LEU A 1 674 ? 30.497  7.402   23.280  1.00 39.72  ? 674 LEU A CA    1 
ATOM   4268  C  C     . LEU A 1 674 ? 30.586  5.928   22.881  1.00 51.72  ? 674 LEU A C     1 
ATOM   4269  O  O     . LEU A 1 674 ? 30.660  5.052   23.751  1.00 40.97  ? 674 LEU A O     1 
ATOM   4270  C  CB    . LEU A 1 674 ? 29.276  7.563   24.169  1.00 46.67  ? 674 LEU A CB    1 
ATOM   4271  C  CG    . LEU A 1 674 ? 28.985  8.911   24.801  1.00 43.25  ? 674 LEU A CG    1 
ATOM   4272  C  CD1   . LEU A 1 674 ? 27.772  8.738   25.683  1.00 37.91  ? 674 LEU A CD1   1 
ATOM   4273  C  CD2   . LEU A 1 674 ? 30.204  9.385   25.572  1.00 45.95  ? 674 LEU A CD2   1 
ATOM   4274  N  N     . LYS A 1 675 ? 30.595  5.655   21.577  1.00 55.48  ? 675 LYS A N     1 
ATOM   4275  C  CA    . LYS A 1 675 ? 30.451  4.278   21.143  1.00 45.52  ? 675 LYS A CA    1 
ATOM   4276  C  C     . LYS A 1 675 ? 31.568  3.346   21.616  1.00 44.56  ? 675 LYS A C     1 
ATOM   4277  O  O     . LYS A 1 675 ? 31.302  2.182   21.944  1.00 43.79  ? 675 LYS A O     1 
ATOM   4278  C  CB    . LYS A 1 675 ? 30.325  4.244   19.616  1.00 43.57  ? 675 LYS A CB    1 
ATOM   4279  C  CG    . LYS A 1 675 ? 29.904  2.913   19.072  1.00 44.81  ? 675 LYS A CG    1 
ATOM   4280  C  CD    . LYS A 1 675 ? 29.302  3.057   17.694  1.00 60.47  ? 675 LYS A CD    1 
ATOM   4281  C  CE    . LYS A 1 675 ? 29.321  1.739   16.961  1.00 54.49  ? 675 LYS A CE    1 
ATOM   4282  N  NZ    . LYS A 1 675 ? 28.947  0.536   17.749  1.00 38.42  ? 675 LYS A NZ    1 
ATOM   4283  N  N     . GLU A 1 676 ? 32.777  3.866   21.774  1.00 47.16  ? 676 GLU A N     1 
ATOM   4284  C  CA    . GLU A 1 676 ? 33.914  3.027   22.168  1.00 53.29  ? 676 GLU A CA    1 
ATOM   4285  C  C     . GLU A 1 676 ? 34.332  3.267   23.600  1.00 49.54  ? 676 GLU A C     1 
ATOM   4286  O  O     . GLU A 1 676 ? 35.454  2.940   23.955  1.00 59.94  ? 676 GLU A O     1 
ATOM   4287  C  CB    . GLU A 1 676 ? 35.109  3.202   21.236  1.00 69.88  ? 676 GLU A CB    1 
ATOM   4288  C  CG    . GLU A 1 676 ? 34.704  3.284   19.817  1.00 90.45  ? 676 GLU A CG    1 
ATOM   4289  C  CD    . GLU A 1 676 ? 35.642  2.737   18.790  1.00 110.87 ? 676 GLU A CD    1 
ATOM   4290  O  OE1   . GLU A 1 676 ? 36.857  3.037   18.814  1.00 120.66 ? 676 GLU A OE1   1 
ATOM   4291  O  OE2   . GLU A 1 676 ? 35.084  2.234   17.788  1.00 116.00 ? 676 GLU A OE2   1 
ATOM   4292  N  N     . VAL A 1 677 ? 33.468  3.898   24.401  1.00 42.93  ? 677 VAL A N     1 
ATOM   4293  C  CA    . VAL A 1 677 ? 33.792  4.218   25.787  1.00 39.04  ? 677 VAL A CA    1 
ATOM   4294  C  C     . VAL A 1 677 ? 33.178  3.194   26.760  1.00 46.56  ? 677 VAL A C     1 
ATOM   4295  O  O     . VAL A 1 677 ? 31.958  3.024   26.769  1.00 48.78  ? 677 VAL A O     1 
ATOM   4296  C  CB    . VAL A 1 677 ? 33.289  5.616   26.150  1.00 37.53  ? 677 VAL A CB    1 
ATOM   4297  C  CG1   . VAL A 1 677 ? 33.757  6.023   27.552  1.00 43.07  ? 677 VAL A CG1   1 
ATOM   4298  C  CG2   . VAL A 1 677 ? 33.788  6.605   25.162  1.00 41.02  ? 677 VAL A CG2   1 
ATOM   4299  N  N     . ASP A 1 678 ? 34.010  2.497   27.554  1.00 44.88  ? 678 ASP A N     1 
ATOM   4300  C  CA    . ASP A 1 678 ? 33.514  1.439   28.481  1.00 42.14  ? 678 ASP A CA    1 
ATOM   4301  C  C     . ASP A 1 678 ? 32.516  1.982   29.485  1.00 42.79  ? 678 ASP A C     1 
ATOM   4302  O  O     . ASP A 1 678 ? 32.719  3.049   30.075  1.00 45.72  ? 678 ASP A O     1 
ATOM   4303  C  CB    . ASP A 1 678 ? 34.648  0.776   29.266  1.00 51.29  ? 678 ASP A CB    1 
ATOM   4304  C  CG    . ASP A 1 678 ? 35.679  0.109   28.380  1.00 92.88  ? 678 ASP A CG    1 
ATOM   4305  O  OD1   . ASP A 1 678 ? 35.336  -0.288  27.251  1.00 106.80 ? 678 ASP A OD1   1 
ATOM   4306  O  OD2   . ASP A 1 678 ? 36.859  0.035   28.791  1.00 108.10 ? 678 ASP A OD2   1 
ATOM   4307  N  N     . ARG A 1 679 ? 31.453  1.216   29.707  1.00 32.98  ? 679 ARG A N     1 
ATOM   4308  C  CA    . ARG A 1 679 ? 30.389  1.666   30.596  1.00 38.63  ? 679 ARG A CA    1 
ATOM   4309  C  C     . ARG A 1 679 ? 30.752  1.691   32.113  1.00 55.56  ? 679 ARG A C     1 
ATOM   4310  O  O     . ARG A 1 679 ? 29.936  2.128   32.954  1.00 40.30  ? 679 ARG A O     1 
ATOM   4311  C  CB    . ARG A 1 679 ? 29.201  0.711   30.462  1.00 35.07  ? 679 ARG A CB    1 
ATOM   4312  C  CG    . ARG A 1 679 ? 28.420  0.794   29.177  1.00 44.10  ? 679 ARG A CG    1 
ATOM   4313  C  CD    . ARG A 1 679 ? 27.457  -0.355  29.150  1.00 47.96  ? 679 ARG A CD    1 
ATOM   4314  N  NE    . ARG A 1 679 ? 26.253  0.011   28.424  1.00 72.36  ? 679 ARG A NE    1 
ATOM   4315  C  CZ    . ARG A 1 679 ? 25.849  -0.614  27.330  1.00 86.39  ? 679 ARG A CZ    1 
ATOM   4316  N  NH1   . ARG A 1 679 ? 26.564  -1.641  26.864  1.00 84.08  ? 679 ARG A NH1   1 
ATOM   4317  N  NH2   . ARG A 1 679 ? 24.732  -0.219  26.723  1.00 84.40  ? 679 ARG A NH2   1 
ATOM   4318  N  N     . GLU A 1 680 ? 31.937  1.173   32.453  1.00 36.90  ? 680 GLU A N     1 
ATOM   4319  C  CA    . GLU A 1 680 ? 32.504  1.239   33.798  1.00 38.79  ? 680 GLU A CA    1 
ATOM   4320  C  C     . GLU A 1 680 ? 33.327  2.491   34.042  1.00 47.73  ? 680 GLU A C     1 
ATOM   4321  O  O     . GLU A 1 680 ? 33.651  2.812   35.180  1.00 55.69  ? 680 GLU A O     1 
ATOM   4322  C  CB    . GLU A 1 680 ? 33.362  0.013   34.037  1.00 56.32  ? 680 GLU A CB    1 
ATOM   4323  C  CG    . GLU A 1 680 ? 32.582  -1.243  33.883  1.00 84.44  ? 680 GLU A CG    1 
ATOM   4324  C  CD    . GLU A 1 680 ? 32.906  -1.938  32.579  1.00 115.61 ? 680 GLU A CD    1 
ATOM   4325  O  OE1   . GLU A 1 680 ? 33.664  -1.343  31.774  1.00 122.72 ? 680 GLU A OE1   1 
ATOM   4326  O  OE2   . GLU A 1 680 ? 32.363  -3.041  32.333  1.00 125.63 ? 680 GLU A OE2   1 
ATOM   4327  N  N     . LYS A 1 681 ? 33.694  3.170   32.960  1.00 49.58  ? 681 LYS A N     1 
ATOM   4328  C  CA    . LYS A 1 681 ? 34.506  4.375   33.033  1.00 42.73  ? 681 LYS A CA    1 
ATOM   4329  C  C     . LYS A 1 681 ? 33.633  5.553   33.175  1.00 41.92  ? 681 LYS A C     1 
ATOM   4330  O  O     . LYS A 1 681 ? 32.916  5.882   32.252  1.00 48.25  ? 681 LYS A O     1 
ATOM   4331  C  CB    . LYS A 1 681 ? 35.376  4.487   31.777  1.00 53.01  ? 681 LYS A CB    1 
ATOM   4332  C  CG    . LYS A 1 681 ? 36.420  3.349   31.616  1.00 40.38  ? 681 LYS A CG    1 
ATOM   4333  C  CD    . LYS A 1 681 ? 37.307  3.651   30.432  1.00 52.94  ? 681 LYS A CD    1 
ATOM   4334  C  CE    . LYS A 1 681 ? 38.302  2.564   30.107  1.00 48.67  ? 681 LYS A CE    1 
ATOM   4335  N  NZ    . LYS A 1 681 ? 39.076  2.979   28.879  1.00 62.94  ? 681 LYS A NZ    1 
ATOM   4336  N  N     . LEU A 1 682 ? 33.688  6.195   34.339  1.00 51.10  ? 682 LEU A N     1 
ATOM   4337  C  CA    . LEU A 1 682 ? 32.818  7.343   34.639  1.00 52.58  ? 682 LEU A CA    1 
ATOM   4338  C  C     . LEU A 1 682 ? 33.354  8.653   34.035  1.00 58.85  ? 682 LEU A C     1 
ATOM   4339  O  O     . LEU A 1 682 ? 33.834  9.559   34.772  1.00 52.43  ? 682 LEU A O     1 
ATOM   4340  C  CB    . LEU A 1 682 ? 32.683  7.448   36.149  1.00 48.23  ? 682 LEU A CB    1 
ATOM   4341  C  CG    . LEU A 1 682 ? 32.213  6.145   36.786  1.00 47.19  ? 682 LEU A CG    1 
ATOM   4342  C  CD1   . LEU A 1 682 ? 31.926  6.313   38.273  1.00 61.82  ? 682 LEU A CD1   1 
ATOM   4343  C  CD2   . LEU A 1 682 ? 30.961  5.675   36.072  1.00 39.78  ? 682 LEU A CD2   1 
ATOM   4344  N  N     . PHE A 1 683 ? 33.206  8.774   32.711  1.00 60.07  ? 683 PHE A N     1 
ATOM   4345  C  CA    . PHE A 1 683 ? 33.806  9.888   31.969  1.00 60.27  ? 683 PHE A CA    1 
ATOM   4346  C  C     . PHE A 1 683 ? 33.238  11.279  32.324  1.00 59.11  ? 683 PHE A C     1 
ATOM   4347  O  O     . PHE A 1 683 ? 33.831  12.310  31.979  1.00 59.72  ? 683 PHE A O     1 
ATOM   4348  C  CB    . PHE A 1 683 ? 33.701  9.654   30.447  1.00 54.83  ? 683 PHE A CB    1 
ATOM   4349  C  CG    . PHE A 1 683 ? 32.288  9.674   29.907  1.00 51.98  ? 683 PHE A CG    1 
ATOM   4350  C  CD1   . PHE A 1 683 ? 31.496  8.524   29.897  1.00 50.00  ? 683 PHE A CD1   1 
ATOM   4351  C  CD2   . PHE A 1 683 ? 31.751  10.869  29.414  1.00 30.93  ? 683 PHE A CD2   1 
ATOM   4352  C  CE1   . PHE A 1 683 ? 30.187  8.574   29.390  1.00 38.75  ? 683 PHE A CE1   1 
ATOM   4353  C  CE2   . PHE A 1 683 ? 30.462  10.935  28.936  1.00 28.63  ? 683 PHE A CE2   1 
ATOM   4354  C  CZ    . PHE A 1 683 ? 29.671  9.789   28.921  1.00 31.96  ? 683 PHE A CZ    1 
ATOM   4355  N  N     . PHE A 1 684 ? 32.065  11.308  32.945  1.00 47.41  ? 684 PHE A N     1 
ATOM   4356  C  CA    . PHE A 1 684 ? 31.375  12.563  33.193  1.00 51.67  ? 684 PHE A CA    1 
ATOM   4357  C  C     . PHE A 1 684 ? 31.610  13.272  34.545  1.00 57.58  ? 684 PHE A C     1 
ATOM   4358  O  O     . PHE A 1 684 ? 31.032  14.343  34.805  1.00 56.47  ? 684 PHE A O     1 
ATOM   4359  C  CB    . PHE A 1 684 ? 29.904  12.325  32.982  1.00 47.76  ? 684 PHE A CB    1 
ATOM   4360  C  CG    . PHE A 1 684 ? 29.416  11.068  33.592  1.00 50.55  ? 684 PHE A CG    1 
ATOM   4361  C  CD1   . PHE A 1 684 ? 29.087  11.029  34.929  1.00 46.07  ? 684 PHE A CD1   1 
ATOM   4362  C  CD2   . PHE A 1 684 ? 29.338  9.904   32.845  1.00 49.52  ? 684 PHE A CD2   1 
ATOM   4363  C  CE1   . PHE A 1 684 ? 28.619  9.860   35.506  1.00 54.58  ? 684 PHE A CE1   1 
ATOM   4364  C  CE2   . PHE A 1 684 ? 28.867  8.730   33.414  1.00 55.94  ? 684 PHE A CE2   1 
ATOM   4365  C  CZ    . PHE A 1 684 ? 28.509  8.707   34.749  1.00 52.21  ? 684 PHE A CZ    1 
ATOM   4366  N  N     . VAL A 1 685 ? 32.361  12.641  35.435  1.00 45.95  ? 685 VAL A N     1 
ATOM   4367  C  CA    . VAL A 1 685 ? 32.557  13.196  36.766  1.00 42.42  ? 685 VAL A CA    1 
ATOM   4368  C  C     . VAL A 1 685 ? 33.529  14.405  36.694  1.00 63.47  ? 685 VAL A C     1 
ATOM   4369  O  O     . VAL A 1 685 ? 33.344  15.445  37.309  1.00 73.73  ? 685 VAL A O     1 
ATOM   4370  C  CB    . VAL A 1 685 ? 33.072  12.102  37.756  1.00 60.93  ? 685 VAL A CB    1 
ATOM   4371  C  CG1   . VAL A 1 685 ? 32.075  10.923  37.815  1.00 18.61  ? 685 VAL A CG1   1 
ATOM   4372  C  CG2   . VAL A 1 685 ? 34.478  11.599  37.380  1.00 46.41  ? 685 VAL A CG2   1 
ATOM   4373  O  OXT   . VAL A 1 685 ? 34.535  14.440  35.988  1.00 65.66  ? 685 VAL A OXT   1 
ATOM   4374  N  N     . LEU B 1 4   ? 28.743  7.170   -23.796 1.00 50.07  ? 4   LEU B N     1 
ATOM   4375  C  CA    . LEU B 1 4   ? 29.137  8.569   -24.002 1.00 71.00  ? 4   LEU B CA    1 
ATOM   4376  C  C     . LEU B 1 4   ? 28.310  9.272   -25.105 1.00 93.68  ? 4   LEU B C     1 
ATOM   4377  O  O     . LEU B 1 4   ? 27.671  8.597   -25.928 1.00 80.24  ? 4   LEU B O     1 
ATOM   4378  C  CB    . LEU B 1 4   ? 30.608  8.640   -24.337 1.00 63.80  ? 4   LEU B CB    1 
ATOM   4379  N  N     . GLY B 1 5   ? 28.309  10.618  -25.106 1.00 96.10  ? 5   GLY B N     1 
ATOM   4380  C  CA    . GLY B 1 5   ? 27.725  11.364  -26.216 1.00 74.02  ? 5   GLY B CA    1 
ATOM   4381  C  C     . GLY B 1 5   ? 26.727  12.484  -25.916 1.00 71.33  ? 5   GLY B C     1 
ATOM   4382  O  O     . GLY B 1 5   ? 25.852  12.332  -25.072 1.00 73.58  ? 5   GLY B O     1 
ATOM   4383  N  N     . LYS B 1 6   ? 26.794  13.511  -26.736 1.00 75.50  ? 6   LYS B N     1 
ATOM   4384  C  CA    . LYS B 1 6   ? 25.893  14.624  -26.663 1.00 75.04  ? 6   LYS B CA    1 
ATOM   4385  C  C     . LYS B 1 6   ? 24.554  14.171  -27.186 1.00 77.05  ? 6   LYS B C     1 
ATOM   4386  O  O     . LYS B 1 6   ? 24.458  13.308  -28.042 1.00 83.80  ? 6   LYS B O     1 
ATOM   4387  C  CB    . LYS B 1 6   ? 26.414  15.768  -27.528 1.00 76.91  ? 6   LYS B CB    1 
ATOM   4388  C  CG    . LYS B 1 6   ? 25.675  17.083  -27.356 1.00 88.05  ? 6   LYS B CG    1 
ATOM   4389  C  CD    . LYS B 1 6   ? 25.948  18.063  -28.485 1.00 97.75  ? 6   LYS B CD    1 
ATOM   4390  C  CE    . LYS B 1 6   ? 24.721  18.278  -29.359 1.00 119.87 ? 6   LYS B CE    1 
ATOM   4391  N  NZ    . LYS B 1 6   ? 25.036  18.342  -30.815 1.00 123.43 ? 6   LYS B NZ    1 
ATOM   4392  N  N     . THR B 1 7   ? 23.515  14.764  -26.642 1.00 75.29  ? 7   THR B N     1 
ATOM   4393  C  CA    . THR B 1 7   ? 22.144  14.501  -27.039 1.00 80.35  ? 7   THR B CA    1 
ATOM   4394  C  C     . THR B 1 7   ? 21.242  15.629  -26.569 1.00 91.55  ? 7   THR B C     1 
ATOM   4395  O  O     . THR B 1 7   ? 21.681  16.560  -25.899 1.00 104.23 ? 7   THR B O     1 
ATOM   4396  C  CB    . THR B 1 7   ? 21.632  13.159  -26.520 1.00 30.00  ? 7   THR B CB    1 
ATOM   4397  O  OG1   . THR B 1 7   ? 20.257  13.011  -26.847 1.00 30.00  ? 7   THR B OG1   1 
ATOM   4398  C  CG2   . THR B 1 7   ? 21.793  13.086  -25.040 1.00 30.00  ? 7   THR B CG2   1 
ATOM   4399  N  N     . GLU B 1 8   ? 19.970  15.559  -26.912 1.00 78.50  ? 8   GLU B N     1 
ATOM   4400  C  CA    . GLU B 1 8   ? 19.067  16.622  -26.528 1.00 84.85  ? 8   GLU B CA    1 
ATOM   4401  C  C     . GLU B 1 8   ? 17.847  16.118  -25.822 1.00 84.92  ? 8   GLU B C     1 
ATOM   4402  O  O     . GLU B 1 8   ? 17.346  15.056  -26.118 1.00 86.94  ? 8   GLU B O     1 
ATOM   4403  C  CB    . GLU B 1 8   ? 18.653  17.432  -27.754 1.00 91.57  ? 8   GLU B CB    1 
ATOM   4404  C  CG    . GLU B 1 8   ? 19.474  18.691  -27.971 1.00 104.33 ? 8   GLU B CG    1 
ATOM   4405  C  CD    . GLU B 1 8   ? 18.842  19.675  -28.943 1.00 111.71 ? 8   GLU B CD    1 
ATOM   4406  O  OE1   . GLU B 1 8   ? 17.775  19.371  -29.504 1.00 105.09 ? 8   GLU B OE1   1 
ATOM   4407  O  OE2   . GLU B 1 8   ? 19.422  20.760  -29.152 1.00 129.30 ? 8   GLU B OE2   1 
ATOM   4408  N  N     . VAL B 1 9   ? 17.386  16.870  -24.844 1.00 81.73  ? 9   VAL B N     1 
ATOM   4409  C  CA    . VAL B 1 9   ? 16.160  16.485  -24.184 1.00 73.35  ? 9   VAL B CA    1 
ATOM   4410  C  C     . VAL B 1 9   ? 15.218  17.700  -24.098 1.00 65.46  ? 9   VAL B C     1 
ATOM   4411  O  O     . VAL B 1 9   ? 15.629  18.857  -24.252 1.00 53.97  ? 9   VAL B O     1 
ATOM   4412  C  CB    . VAL B 1 9   ? 16.438  15.928  -22.764 1.00 86.79  ? 9   VAL B CB    1 
ATOM   4413  C  CG1   . VAL B 1 9   ? 17.368  14.734  -22.839 1.00 82.60  ? 9   VAL B CG1   1 
ATOM   4414  C  CG2   . VAL B 1 9   ? 17.068  16.981  -21.890 1.00 90.51  ? 9   VAL B CG2   1 
ATOM   4415  N  N     . PHE B 1 10  ? 13.945  17.408  -23.894 1.00 67.86  ? 10  PHE B N     1 
ATOM   4416  C  CA    . PHE B 1 10  ? 12.944  18.409  -23.543 1.00 73.01  ? 10  PHE B CA    1 
ATOM   4417  C  C     . PHE B 1 10  ? 12.831  18.377  -22.029 1.00 69.82  ? 10  PHE B C     1 
ATOM   4418  O  O     . PHE B 1 10  ? 12.963  17.317  -21.407 1.00 67.36  ? 10  PHE B O     1 
ATOM   4419  C  CB    . PHE B 1 10  ? 11.541  18.121  -24.143 1.00 71.16  ? 10  PHE B CB    1 
ATOM   4420  C  CG    . PHE B 1 10  ? 11.470  18.197  -25.633 1.00 86.68  ? 10  PHE B CG    1 
ATOM   4421  C  CD1   . PHE B 1 10  ? 11.686  19.407  -26.283 1.00 95.17  ? 10  PHE B CD1   1 
ATOM   4422  C  CD2   . PHE B 1 10  ? 11.136  17.078  -26.390 1.00 85.69  ? 10  PHE B CD2   1 
ATOM   4423  C  CE1   . PHE B 1 10  ? 11.610  19.498  -27.676 1.00 91.63  ? 10  PHE B CE1   1 
ATOM   4424  C  CE2   . PHE B 1 10  ? 11.054  17.169  -27.784 1.00 86.94  ? 10  PHE B CE2   1 
ATOM   4425  C  CZ    . PHE B 1 10  ? 11.294  18.382  -28.423 1.00 81.92  ? 10  PHE B CZ    1 
ATOM   4426  N  N     . LEU B 1 11  ? 12.645  19.549  -21.443 1.00 70.39  ? 11  LEU B N     1 
ATOM   4427  C  CA    . LEU B 1 11  ? 12.251  19.625  -20.051 1.00 60.38  ? 11  LEU B CA    1 
ATOM   4428  C  C     . LEU B 1 11  ? 10.751  19.888  -20.057 1.00 55.26  ? 11  LEU B C     1 
ATOM   4429  O  O     . LEU B 1 11  ? 10.209  20.328  -21.068 1.00 57.61  ? 11  LEU B O     1 
ATOM   4430  C  CB    . LEU B 1 11  ? 13.017  20.718  -19.302 1.00 52.93  ? 11  LEU B CB    1 
ATOM   4431  C  CG    . LEU B 1 11  ? 14.528  20.807  -19.523 1.00 49.87  ? 11  LEU B CG    1 
ATOM   4432  C  CD1   . LEU B 1 11  ? 15.093  21.982  -18.760 1.00 50.50  ? 11  LEU B CD1   1 
ATOM   4433  C  CD2   . LEU B 1 11  ? 15.234  19.517  -19.099 1.00 49.72  ? 11  LEU B CD2   1 
ATOM   4434  N  N     . ASN B 1 12  ? 10.076  19.567  -18.958 1.00 55.39  ? 12  ASN B N     1 
ATOM   4435  C  CA    . ASN B 1 12  ? 8.649   19.880  -18.850 1.00 50.78  ? 12  ASN B CA    1 
ATOM   4436  C  C     . ASN B 1 12  ? 8.405   21.336  -18.543 1.00 48.93  ? 12  ASN B C     1 
ATOM   4437  O  O     . ASN B 1 12  ? 7.519   21.699  -17.765 1.00 61.97  ? 12  ASN B O     1 
ATOM   4438  C  CB    . ASN B 1 12  ? 7.991   18.964  -17.831 1.00 68.15  ? 12  ASN B CB    1 
ATOM   4439  C  CG    . ASN B 1 12  ? 8.550   19.159  -16.410 1.00 74.74  ? 12  ASN B CG    1 
ATOM   4440  O  OD1   . ASN B 1 12  ? 9.735   19.478  -16.229 1.00 66.05  ? 12  ASN B OD1   1 
ATOM   4441  N  ND2   . ASN B 1 12  ? 7.693   18.989  -15.406 1.00 72.11  ? 12  ASN B ND2   1 
ATOM   4442  N  N     . ARG B 1 13  ? 9.160   22.175  -19.234 1.00 46.81  ? 13  ARG B N     1 
ATOM   4443  C  CA    . ARG B 1 13  ? 8.994   23.607  -19.198 1.00 58.76  ? 13  ARG B CA    1 
ATOM   4444  C  C     . ARG B 1 13  ? 8.753   24.167  -20.598 1.00 62.47  ? 13  ARG B C     1 
ATOM   4445  O  O     . ARG B 1 13  ? 9.241   23.620  -21.582 1.00 74.90  ? 13  ARG B O     1 
ATOM   4446  C  CB    . ARG B 1 13  ? 10.173  24.282  -18.558 1.00 66.38  ? 13  ARG B CB    1 
ATOM   4447  C  CG    . ARG B 1 13  ? 10.715  23.735  -17.204 1.00 103.86 ? 13  ARG B CG    1 
ATOM   4448  C  CD    . ARG B 1 13  ? 11.836  24.653  -17.262 1.00 100.08 ? 13  ARG B CD    1 
ATOM   4449  N  NE    . ARG B 1 13  ? 13.068  25.011  -16.579 1.00 92.95  ? 13  ARG B NE    1 
ATOM   4450  C  CZ    . ARG B 1 13  ? 13.856  24.381  -15.739 1.00 86.87  ? 13  ARG B CZ    1 
ATOM   4451  N  NH1   . ARG B 1 13  ? 13.582  23.187  -15.268 1.00 84.61  ? 13  ARG B NH1   1 
ATOM   4452  N  NH2   . ARG B 1 13  ? 14.918  25.048  -15.317 1.00 83.93  ? 13  ARG B NH2   1 
ATOM   4453  N  N     . PHE B 1 14  ? 7.990   25.253  -20.687 1.00 70.80  ? 14  PHE B N     1 
ATOM   4454  C  CA    . PHE B 1 14  ? 7.597   25.818  -21.972 1.00 66.44  ? 14  PHE B CA    1 
ATOM   4455  C  C     . PHE B 1 14  ? 7.754   27.330  -22.012 1.00 63.23  ? 14  PHE B C     1 
ATOM   4456  O  O     . PHE B 1 14  ? 7.238   28.020  -21.145 1.00 58.72  ? 14  PHE B O     1 
ATOM   4457  C  CB    . PHE B 1 14  ? 6.143   25.470  -22.274 1.00 58.21  ? 14  PHE B CB    1 
ATOM   4458  C  CG    . PHE B 1 14  ? 5.881   24.005  -22.378 1.00 63.94  ? 14  PHE B CG    1 
ATOM   4459  C  CD1   . PHE B 1 14  ? 5.665   23.251  -21.222 1.00 69.70  ? 14  PHE B CD1   1 
ATOM   4460  C  CD2   . PHE B 1 14  ? 5.915   23.365  -23.595 1.00 71.35  ? 14  PHE B CD2   1 
ATOM   4461  C  CE1   . PHE B 1 14  ? 5.433   21.889  -21.302 1.00 73.08  ? 14  PHE B CE1   1 
ATOM   4462  C  CE2   . PHE B 1 14  ? 5.683   21.995  -23.680 1.00 73.09  ? 14  PHE B CE2   1 
ATOM   4463  C  CZ    . PHE B 1 14  ? 5.439   21.260  -22.523 1.00 74.40  ? 14  PHE B CZ    1 
ATOM   4464  N  N     . ALA B 1 15  ? 8.540   27.836  -22.960 1.00 68.79  ? 15  ALA B N     1 
ATOM   4465  C  CA    . ALA B 1 15  ? 8.652   29.277  -23.092 1.00 72.03  ? 15  ALA B CA    1 
ATOM   4466  C  C     . ALA B 1 15  ? 7.342   29.857  -23.633 1.00 85.59  ? 15  ALA B C     1 
ATOM   4467  O  O     . ALA B 1 15  ? 6.780   29.370  -24.625 1.00 86.04  ? 15  ALA B O     1 
ATOM   4468  C  CB    . ALA B 1 15  ? 9.810   29.627  -23.985 1.00 71.84  ? 15  ALA B CB    1 
ATOM   4469  N  N     . LEU B 1 16  ? 6.856   30.897  -22.974 1.00 88.41  ? 16  LEU B N     1 
ATOM   4470  C  CA    . LEU B 1 16  ? 5.718   31.684  -23.399 1.00 79.75  ? 16  LEU B CA    1 
ATOM   4471  C  C     . LEU B 1 16  ? 6.201   33.093  -23.743 1.00 91.91  ? 16  LEU B C     1 
ATOM   4472  O  O     . LEU B 1 16  ? 7.407   33.313  -23.939 1.00 97.52  ? 16  LEU B O     1 
ATOM   4473  C  CB    . LEU B 1 16  ? 4.677   31.701  -22.298 1.00 85.19  ? 16  LEU B CB    1 
ATOM   4474  C  CG    . LEU B 1 16  ? 4.124   30.304  -22.005 1.00 86.21  ? 16  LEU B CG    1 
ATOM   4475  C  CD1   . LEU B 1 16  ? 3.225   30.312  -20.762 1.00 85.01  ? 16  LEU B CD1   1 
ATOM   4476  C  CD2   . LEU B 1 16  ? 3.374   29.799  -23.214 1.00 79.22  ? 16  LEU B CD2   1 
ATOM   4477  N  N     . ARG B 1 17  ? 5.260   34.038  -23.816 1.00 94.32  ? 17  ARG B N     1 
ATOM   4478  C  CA    . ARG B 1 17  ? 5.534   35.384  -24.329 1.00 90.25  ? 17  ARG B CA    1 
ATOM   4479  C  C     . ARG B 1 17  ? 6.501   36.166  -23.467 1.00 92.89  ? 17  ARG B C     1 
ATOM   4480  O  O     . ARG B 1 17  ? 6.648   35.897  -22.248 1.00 90.89  ? 17  ARG B O     1 
ATOM   4481  C  CB    . ARG B 1 17  ? 4.250   36.193  -24.465 1.00 89.93  ? 17  ARG B CB    1 
ATOM   4482  C  CG    . ARG B 1 17  ? 3.578   36.581  -23.154 1.00 96.01  ? 17  ARG B CG    1 
ATOM   4483  C  CD    . ARG B 1 17  ? 2.568   37.690  -23.453 1.00 91.12  ? 17  ARG B CD    1 
ATOM   4484  N  NE    . ARG B 1 17  ? 1.740   38.123  -22.327 1.00 79.52  ? 17  ARG B NE    1 
ATOM   4485  C  CZ    . ARG B 1 17  ? 2.198   38.962  -21.397 1.00 83.65  ? 17  ARG B CZ    1 
ATOM   4486  N  NH1   . ARG B 1 17  ? 3.445   39.426  -21.490 1.00 98.44  ? 17  ARG B NH1   1 
ATOM   4487  N  NH2   . ARG B 1 17  ? 1.429   39.331  -20.380 1.00 64.89  ? 17  ARG B NH2   1 
ATOM   4488  N  N     . PRO B 1 18  ? 7.233   37.105  -24.076 1.00 104.01 ? 18  PRO B N     1 
ATOM   4489  C  CA    . PRO B 1 18  ? 8.058   38.067  -23.351 1.00 109.74 ? 18  PRO B CA    1 
ATOM   4490  C  C     . PRO B 1 18  ? 7.207   38.906  -22.422 1.00 106.88 ? 18  PRO B C     1 
ATOM   4491  O  O     . PRO B 1 18  ? 6.063   39.199  -22.770 1.00 81.99  ? 18  PRO B O     1 
ATOM   4492  C  CB    . PRO B 1 18  ? 8.670   38.937  -24.442 1.00 111.83 ? 18  PRO B CB    1 
ATOM   4493  C  CG    . PRO B 1 18  ? 8.643   38.068  -25.665 1.00 110.45 ? 18  PRO B CG    1 
ATOM   4494  C  CD    . PRO B 1 18  ? 7.388   37.251  -25.513 1.00 103.73 ? 18  PRO B CD    1 
ATOM   4495  N  N     . LEU B 1 19  ? 7.727   39.281  -21.246 1.00 108.16 ? 19  LEU B N     1 
ATOM   4496  C  CA    . LEU B 1 19  ? 7.021   40.230  -20.380 1.00 111.18 ? 19  LEU B CA    1 
ATOM   4497  C  C     . LEU B 1 19  ? 6.885   41.526  -21.171 1.00 112.39 ? 19  LEU B C     1 
ATOM   4498  O  O     . LEU B 1 19  ? 7.842   42.020  -21.740 1.00 121.82 ? 19  LEU B O     1 
ATOM   4499  C  CB    . LEU B 1 19  ? 7.719   40.449  -19.058 1.00 112.12 ? 19  LEU B CB    1 
ATOM   4500  C  CG    . LEU B 1 19  ? 7.354   39.473  -17.933 1.00 107.79 ? 19  LEU B CG    1 
ATOM   4501  C  CD1   . LEU B 1 19  ? 7.660   38.015  -18.310 1.00 103.84 ? 19  LEU B CD1   1 
ATOM   4502  C  CD2   . LEU B 1 19  ? 8.041   39.858  -16.623 1.00 108.91 ? 19  LEU B CD2   1 
ATOM   4503  N  N     . ASN B 1 20  ? 5.705   42.144  -21.108 1.00 112.54 ? 20  ASN B N     1 
ATOM   4504  C  CA    . ASN B 1 20  ? 5.529   43.367  -21.839 1.00 113.63 ? 20  ASN B CA    1 
ATOM   4505  C  C     . ASN B 1 20  ? 6.133   44.558  -21.034 1.00 148.99 ? 20  ASN B C     1 
ATOM   4506  O  O     . ASN B 1 20  ? 6.563   44.343  -19.900 1.00 143.82 ? 20  ASN B O     1 
ATOM   4507  C  CB    . ASN B 1 20  ? 4.063   43.597  -22.273 1.00 105.21 ? 20  ASN B CB    1 
ATOM   4508  C  CG    . ASN B 1 20  ? 3.043   43.635  -21.137 1.00 96.52  ? 20  ASN B CG    1 
ATOM   4509  O  OD1   . ASN B 1 20  ? 3.215   44.332  -20.110 1.00 99.33  ? 20  ASN B OD1   1 
ATOM   4510  N  ND2   . ASN B 1 20  ? 1.974   42.871  -21.304 1.00 85.23  ? 20  ASN B ND2   1 
ATOM   4511  N  N     . PRO B 1 21  ? 6.280   45.769  -21.640 1.00 136.02 ? 21  PRO B N     1 
ATOM   4512  C  CA    . PRO B 1 21  ? 6.970   46.891  -20.990 1.00 139.91 ? 21  PRO B CA    1 
ATOM   4513  C  C     . PRO B 1 21  ? 6.453   47.302  -19.651 1.00 137.61 ? 21  PRO B C     1 
ATOM   4514  O  O     . PRO B 1 21  ? 7.249   47.839  -18.814 1.00 142.37 ? 21  PRO B O     1 
ATOM   4515  C  CB    . PRO B 1 21  ? 6.644   48.038  -21.886 1.00 137.74 ? 21  PRO B CB    1 
ATOM   4516  C  CG    . PRO B 1 21  ? 6.418   47.533  -23.060 1.00 134.41 ? 21  PRO B CG    1 
ATOM   4517  C  CD    . PRO B 1 21  ? 5.768   46.210  -22.966 1.00 132.63 ? 21  PRO B CD    1 
ATOM   4518  N  N     . GLU B 1 22  ? 5.199   47.130  -19.513 1.00 139.53 ? 22  GLU B N     1 
ATOM   4519  C  CA    . GLU B 1 22  ? 4.344   47.379  -18.398 1.00 125.80 ? 22  GLU B CA    1 
ATOM   4520  C  C     . GLU B 1 22  ? 4.714   46.486  -17.216 1.00 110.50 ? 22  GLU B C     1 
ATOM   4521  O  O     . GLU B 1 22  ? 4.861   46.931  -16.095 1.00 95.46  ? 22  GLU B O     1 
ATOM   4522  C  CB    . GLU B 1 22  ? 2.944   47.076  -18.874 1.00 124.05 ? 22  GLU B CB    1 
ATOM   4523  C  CG    . GLU B 1 22  ? 2.374   47.934  -19.928 1.00 125.63 ? 22  GLU B CG    1 
ATOM   4524  C  CD    . GLU B 1 22  ? 1.654   49.227  -19.563 1.00 126.19 ? 22  GLU B CD    1 
ATOM   4525  O  OE1   . GLU B 1 22  ? 1.476   49.607  -18.400 1.00 128.72 ? 22  GLU B OE1   1 
ATOM   4526  O  OE2   . GLU B 1 22  ? 1.287   49.858  -20.541 1.00 123.95 ? 22  GLU B OE2   1 
ATOM   4527  N  N     . GLU B 1 23  ? 4.731   45.190  -17.515 1.00 110.00 ? 23  GLU B N     1 
ATOM   4528  C  CA    . GLU B 1 23  ? 5.080   44.215  -16.532 1.00 92.63  ? 23  GLU B CA    1 
ATOM   4529  C  C     . GLU B 1 23  ? 6.545   44.365  -15.985 1.00 93.82  ? 23  GLU B C     1 
ATOM   4530  O  O     . GLU B 1 23  ? 6.859   43.908  -14.910 1.00 102.32 ? 23  GLU B O     1 
ATOM   4531  C  CB    . GLU B 1 23  ? 4.897   42.742  -17.002 1.00 77.64  ? 23  GLU B CB    1 
ATOM   4532  C  CG    . GLU B 1 23  ? 3.440   42.469  -17.428 1.00 71.33  ? 23  GLU B CG    1 
ATOM   4533  C  CD    . GLU B 1 23  ? 3.264   41.310  -18.457 1.00 109.76 ? 23  GLU B CD    1 
ATOM   4534  O  OE1   . GLU B 1 23  ? 3.518   41.150  -19.596 1.00 112.87 ? 23  GLU B OE1   1 
ATOM   4535  O  OE2   . GLU B 1 23  ? 2.618   40.395  -18.139 1.00 108.88 ? 23  GLU B OE2   1 
ATOM   4536  N  N     . LEU B 1 24  ? 7.409   44.816  -16.873 1.00 93.68  ? 24  LEU B N     1 
ATOM   4537  C  CA    . LEU B 1 24  ? 8.798   45.064  -16.446 1.00 103.62 ? 24  LEU B CA    1 
ATOM   4538  C  C     . LEU B 1 24  ? 8.971   46.264  -15.450 1.00 134.67 ? 24  LEU B C     1 
ATOM   4539  O  O     . LEU B 1 24  ? 10.030  46.409  -14.867 1.00 139.57 ? 24  LEU B O     1 
ATOM   4540  C  CB    . LEU B 1 24  ? 9.629   45.256  -17.675 1.00 100.94 ? 24  LEU B CB    1 
ATOM   4541  C  CG    . LEU B 1 24  ? 9.920   44.049  -18.538 1.00 101.26 ? 24  LEU B CG    1 
ATOM   4542  C  CD1   . LEU B 1 24  ? 10.813  44.443  -19.704 1.00 110.27 ? 24  LEU B CD1   1 
ATOM   4543  C  CD2   . LEU B 1 24  ? 10.661  43.025  -17.696 1.00 95.02  ? 24  LEU B CD2   1 
ATOM   4544  N  N     . ARG B 1 25  ? 7.899   47.053  -15.343 1.00 109.75 ? 25  ARG B N     1 
ATOM   4545  C  CA    . ARG B 1 25  ? 7.909   48.159  -14.405 1.00 108.69 ? 25  ARG B CA    1 
ATOM   4546  C  C     . ARG B 1 25  ? 6.662   48.042  -13.546 1.00 106.79 ? 25  ARG B C     1 
ATOM   4547  O  O     . ARG B 1 25  ? 5.604   48.702  -13.766 1.00 114.53 ? 25  ARG B O     1 
ATOM   4548  C  CB    . ARG B 1 25  ? 8.120   49.500  -15.140 1.00 116.79 ? 25  ARG B CB    1 
ATOM   4549  C  CG    . ARG B 1 25  ? 6.947   49.766  -15.952 1.00 123.35 ? 25  ARG B CG    1 
ATOM   4550  C  CD    . ARG B 1 25  ? 6.880   50.975  -16.724 1.00 130.87 ? 25  ARG B CD    1 
ATOM   4551  N  NE    . ARG B 1 25  ? 5.794   50.597  -17.614 1.00 136.91 ? 25  ARG B NE    1 
ATOM   4552  C  CZ    . ARG B 1 25  ? 4.750   51.333  -17.981 1.00 137.56 ? 25  ARG B CZ    1 
ATOM   4553  N  NH1   . ARG B 1 25  ? 3.838   50.726  -18.708 1.00 140.51 ? 25  ARG B NH1   1 
ATOM   4554  N  NH2   . ARG B 1 25  ? 4.559   52.560  -17.580 1.00 138.60 ? 25  ARG B NH2   1 
ATOM   4555  N  N     . PRO B 1 26  ? 6.673   47.087  -12.656 1.00 107.95 ? 26  PRO B N     1 
ATOM   4556  C  CA    . PRO B 1 26  ? 5.518   46.909  -11.785 1.00 86.68  ? 26  PRO B CA    1 
ATOM   4557  C  C     . PRO B 1 26  ? 5.329   48.109  -10.843 1.00 81.96  ? 26  PRO B C     1 
ATOM   4558  O  O     . PRO B 1 26  ? 6.271   48.861  -10.623 1.00 90.36  ? 26  PRO B O     1 
ATOM   4559  C  CB    . PRO B 1 26  ? 5.907   45.662  -10.975 1.00 75.24  ? 26  PRO B CB    1 
ATOM   4560  C  CG    . PRO B 1 26  ? 7.368   45.643  -10.989 1.00 87.26  ? 26  PRO B CG    1 
ATOM   4561  C  CD    . PRO B 1 26  ? 7.777   46.164  -12.312 1.00 102.77 ? 26  PRO B CD    1 
ATOM   4562  N  N     . TRP B 1 27  ? 4.099   48.315  -10.397 1.00 76.79  ? 27  TRP B N     1 
ATOM   4563  C  CA    . TRP B 1 27  ? 3.720   49.311  -9.407  1.00 74.65  ? 27  TRP B CA    1 
ATOM   4564  C  C     . TRP B 1 27  ? 4.244   48.994  -8.019  1.00 85.02  ? 27  TRP B C     1 
ATOM   4565  O  O     . TRP B 1 27  ? 4.184   47.851  -7.567  1.00 91.67  ? 27  TRP B O     1 
ATOM   4566  C  CB    . TRP B 1 27  ? 2.212   49.438  -9.264  1.00 67.53  ? 27  TRP B CB    1 
ATOM   4567  C  CG    . TRP B 1 27  ? 1.490   50.278  -10.274 1.00 67.91  ? 27  TRP B CG    1 
ATOM   4568  C  CD1   . TRP B 1 27  ? 1.351   51.640  -10.264 1.00 71.82  ? 27  TRP B CD1   1 
ATOM   4569  C  CD2   . TRP B 1 27  ? 0.844   49.811  -11.450 1.00 71.94  ? 27  TRP B CD2   1 
ATOM   4570  N  NE1   . TRP B 1 27  ? 0.614   52.038  -11.357 1.00 72.20  ? 27  TRP B NE1   1 
ATOM   4571  C  CE2   . TRP B 1 27  ? 0.304   50.932  -12.105 1.00 71.63  ? 27  TRP B CE2   1 
ATOM   4572  C  CE3   . TRP B 1 27  ? 0.663   48.543  -12.019 1.00 81.29  ? 27  TRP B CE3   1 
ATOM   4573  C  CZ2   . TRP B 1 27  ? -0.407  50.830  -13.305 1.00 72.95  ? 27  TRP B CZ2   1 
ATOM   4574  C  CZ3   . TRP B 1 27  ? -0.063  48.445  -13.225 1.00 75.36  ? 27  TRP B CZ3   1 
ATOM   4575  C  CH2   . TRP B 1 27  ? -0.584  49.581  -13.844 1.00 71.89  ? 27  TRP B CH2   1 
ATOM   4576  N  N     . ARG B 1 28  ? 4.840   49.997  -7.382  1.00 77.54  ? 28  ARG B N     1 
ATOM   4577  C  CA    . ARG B 1 28  ? 5.416   49.837  -6.092  1.00 81.41  ? 28  ARG B CA    1 
ATOM   4578  C  C     . ARG B 1 28  ? 4.462   50.418  -5.071  1.00 78.54  ? 28  ARG B C     1 
ATOM   4579  O  O     . ARG B 1 28  ? 3.923   51.492  -5.302  1.00 75.22  ? 28  ARG B O     1 
ATOM   4580  C  CB    . ARG B 1 28  ? 6.699   50.608  -5.904  1.00 89.78  ? 28  ARG B CB    1 
ATOM   4581  C  CG    . ARG B 1 28  ? 7.434   50.228  -4.746  1.00 103.96 ? 28  ARG B CG    1 
ATOM   4582  C  CD    . ARG B 1 28  ? 8.908   50.617  -4.716  1.00 115.42 ? 28  ARG B CD    1 
ATOM   4583  N  NE    . ARG B 1 28  ? 9.146   51.948  -4.242  1.00 124.60 ? 28  ARG B NE    1 
ATOM   4584  C  CZ    . ARG B 1 28  ? 9.210   52.218  -2.921  1.00 124.94 ? 28  ARG B CZ    1 
ATOM   4585  N  NH1   . ARG B 1 28  ? 9.489   53.427  -2.468  1.00 122.07 ? 28  ARG B NH1   1 
ATOM   4586  N  NH2   . ARG B 1 28  ? 8.943   51.252  -2.059  1.00 127.74 ? 28  ARG B NH2   1 
ATOM   4587  N  N     . LEU B 1 29  ? 4.157   49.703  -3.999  1.00 75.29  ? 29  LEU B N     1 
ATOM   4588  C  CA    . LEU B 1 29  ? 3.243   50.241  -3.031  1.00 73.58  ? 29  LEU B CA    1 
ATOM   4589  C  C     . LEU B 1 29  ? 3.835   50.057  -1.648  1.00 87.70  ? 29  LEU B C     1 
ATOM   4590  O  O     . LEU B 1 29  ? 4.329   48.970  -1.326  1.00 78.96  ? 29  LEU B O     1 
ATOM   4591  C  CB    . LEU B 1 29  ? 1.891   49.543  -2.979  1.00 66.91  ? 29  LEU B CB    1 
ATOM   4592  C  CG    . LEU B 1 29  ? 0.827   49.374  -4.068  1.00 69.94  ? 29  LEU B CG    1 
ATOM   4593  C  CD1   . LEU B 1 29  ? 0.216   50.666  -4.545  1.00 74.79  ? 29  LEU B CD1   1 
ATOM   4594  C  CD2   . LEU B 1 29  ? 1.437   48.605  -5.217  1.00 76.54  ? 29  LEU B CD2   1 
ATOM   4595  N  N     . GLU B 1 30  ? 3.827   51.108  -0.833  1.00 87.21  ? 30  GLU B N     1 
ATOM   4596  C  CA    . GLU B 1 30  ? 4.161   50.948  0.603   1.00 95.63  ? 30  GLU B CA    1 
ATOM   4597  C  C     . GLU B 1 30  ? 3.045   50.590  1.460   1.00 91.69  ? 30  GLU B C     1 
ATOM   4598  O  O     . GLU B 1 30  ? 1.968   51.163  1.350   1.00 98.04  ? 30  GLU B O     1 
ATOM   4599  C  CB    . GLU B 1 30  ? 4.838   51.986  1.408   1.00 112.05 ? 30  GLU B CB    1 
ATOM   4600  C  CG    . GLU B 1 30  ? 4.884   53.343  1.417   1.00 123.44 ? 30  GLU B CG    1 
ATOM   4601  C  CD    . GLU B 1 30  ? 6.043   53.461  2.430   1.00 133.74 ? 30  GLU B CD    1 
ATOM   4602  O  OE1   . GLU B 1 30  ? 5.717   53.635  3.635   1.00 139.39 ? 30  GLU B OE1   1 
ATOM   4603  O  OE2   . GLU B 1 30  ? 7.197   53.076  2.059   1.00 140.87 ? 30  GLU B OE2   1 
ATOM   4604  N  N     . VAL B 1 31  ? 3.317   49.672  2.373   1.00 97.65  ? 31  VAL B N     1 
ATOM   4605  C  CA    . VAL B 1 31  ? 2.316   49.231  3.317   1.00 89.71  ? 31  VAL B CA    1 
ATOM   4606  C  C     . VAL B 1 31  ? 2.384   49.843  4.748   1.00 85.97  ? 31  VAL B C     1 
ATOM   4607  O  O     . VAL B 1 31  ? 3.400   49.787  5.411   1.00 95.02  ? 31  VAL B O     1 
ATOM   4608  C  CB    . VAL B 1 31  ? 2.473   47.762  3.527   1.00 88.97  ? 31  VAL B CB    1 
ATOM   4609  C  CG1   . VAL B 1 31  ? 1.416   47.300  4.513   1.00 89.48  ? 31  VAL B CG1   1 
ATOM   4610  C  CG2   . VAL B 1 31  ? 2.325   47.045  2.214   1.00 85.65  ? 31  VAL B CG2   1 
ATOM   4611  N  N     . VAL B 1 32  ? 1.301   50.485  5.195   1.00 87.02  ? 32  VAL B N     1 
ATOM   4612  C  CA    . VAL B 1 32  ? 1.205   50.910  6.586   1.00 78.82  ? 32  VAL B CA    1 
ATOM   4613  C  C     . VAL B 1 32  ? 0.203   50.043  7.351   1.00 90.26  ? 32  VAL B C     1 
ATOM   4614  O  O     . VAL B 1 32  ? -0.989  49.998  7.036   1.00 92.74  ? 32  VAL B O     1 
ATOM   4615  C  CB    . VAL B 1 32  ? 0.780   52.354  6.671   1.00 70.45  ? 32  VAL B CB    1 
ATOM   4616  C  CG1   . VAL B 1 32  ? 0.605   52.774  8.099   1.00 67.70  ? 32  VAL B CG1   1 
ATOM   4617  C  CG2   . VAL B 1 32  ? 1.778   53.214  5.937   1.00 73.63  ? 32  VAL B CG2   1 
ATOM   4618  N  N     . LEU B 1 33  ? 0.690   49.479  8.450   1.00 97.83  ? 33  LEU B N     1 
ATOM   4619  C  CA    . LEU B 1 33  ? -0.069  48.595  9.338   1.00 98.26  ? 33  LEU B CA    1 
ATOM   4620  C  C     . LEU B 1 33  ? -0.296  49.180  10.732  1.00 98.69  ? 33  LEU B C     1 
ATOM   4621  O  O     . LEU B 1 33  ? 0.596   49.815  11.263  1.00 82.29  ? 33  LEU B O     1 
ATOM   4622  C  CB    . LEU B 1 33  ? 0.693   47.272  9.448   1.00 86.77  ? 33  LEU B CB    1 
ATOM   4623  C  CG    . LEU B 1 33  ? 0.636   46.307  8.265   1.00 74.68  ? 33  LEU B CG    1 
ATOM   4624  C  CD1   . LEU B 1 33  ? 1.732   45.319  8.420   1.00 61.09  ? 33  LEU B CD1   1 
ATOM   4625  C  CD2   . LEU B 1 33  ? -0.705  45.576  8.226   1.00 84.46  ? 33  LEU B CD2   1 
ATOM   4626  N  N     . ASP B 1 34  ? -1.527  49.096  11.248  1.00 105.76 ? 34  ASP B N     1 
ATOM   4627  C  CA    . ASP B 1 34  ? -1.822  49.566  12.605  1.00 116.28 ? 34  ASP B CA    1 
ATOM   4628  C  C     . ASP B 1 34  ? -2.561  48.466  13.420  1.00 115.89 ? 34  ASP B C     1 
ATOM   4629  O  O     . ASP B 1 34  ? -3.728  48.137  13.090  1.00 119.95 ? 34  ASP B O     1 
ATOM   4630  C  CB    . ASP B 1 34  ? -2.633  50.863  12.553  1.00 128.36 ? 34  ASP B CB    1 
ATOM   4631  C  CG    . ASP B 1 34  ? -3.092  51.327  13.941  1.00 134.79 ? 34  ASP B CG    1 
ATOM   4632  O  OD1   . ASP B 1 34  ? -2.897  50.641  14.958  1.00 138.56 ? 34  ASP B OD1   1 
ATOM   4633  O  OD2   . ASP B 1 34  ? -3.761  52.390  13.999  1.00 137.48 ? 34  ASP B OD2   1 
ATOM   4634  N  N     . PRO B 1 35  ? -1.939  47.928  14.481  1.00 125.88 ? 35  PRO B N     1 
ATOM   4635  C  CA    . PRO B 1 35  ? -0.607  48.296  14.973  1.00 106.38 ? 35  PRO B CA    1 
ATOM   4636  C  C     . PRO B 1 35  ? 0.584   47.713  14.200  1.00 104.97 ? 35  PRO B C     1 
ATOM   4637  O  O     . PRO B 1 35  ? 0.413   46.762  13.448  1.00 113.27 ? 35  PRO B O     1 
ATOM   4638  C  CB    . PRO B 1 35  ? -0.655  47.806  16.420  1.00 100.90 ? 35  PRO B CB    1 
ATOM   4639  C  CG    . PRO B 1 35  ? -1.521  46.618  16.377  1.00 110.04 ? 35  PRO B CG    1 
ATOM   4640  C  CD    . PRO B 1 35  ? -2.587  46.949  15.354  1.00 120.23 ? 35  PRO B CD    1 
ATOM   4641  N  N     . PRO B 1 36  ? 1.780   48.315  14.361  1.00 101.15 ? 36  PRO B N     1 
ATOM   4642  C  CA    . PRO B 1 36  ? 3.032   47.760  13.810  1.00 99.03  ? 36  PRO B CA    1 
ATOM   4643  C  C     . PRO B 1 36  ? 3.459   46.416  14.435  1.00 108.83 ? 36  PRO B C     1 
ATOM   4644  O  O     . PRO B 1 36  ? 3.553   46.355  15.612  1.00 108.37 ? 36  PRO B O     1 
ATOM   4645  C  CB    . PRO B 1 36  ? 4.067   48.819  14.139  1.00 94.99  ? 36  PRO B CB    1 
ATOM   4646  C  CG    . PRO B 1 36  ? 3.280   50.083  14.328  1.00 99.42  ? 36  PRO B CG    1 
ATOM   4647  C  CD    . PRO B 1 36  ? 1.994   49.650  14.958  1.00 101.56 ? 36  PRO B CD    1 
ATOM   4648  N  N     . PRO B 1 37  ? 3.692   45.380  13.623  1.00 115.97 ? 37  PRO B N     1 
ATOM   4649  C  CA    . PRO B 1 37  ? 4.038   44.008  14.018  1.00 125.00 ? 37  PRO B CA    1 
ATOM   4650  C  C     . PRO B 1 37  ? 5.447   43.907  14.627  1.00 124.33 ? 37  PRO B C     1 
ATOM   4651  O  O     . PRO B 1 37  ? 6.251   44.796  14.346  1.00 121.18 ? 37  PRO B O     1 
ATOM   4652  C  CB    . PRO B 1 37  ? 3.972   43.247  12.705  1.00 125.60 ? 37  PRO B CB    1 
ATOM   4653  C  CG    . PRO B 1 37  ? 4.320   44.244  11.698  1.00 122.65 ? 37  PRO B CG    1 
ATOM   4654  C  CD    . PRO B 1 37  ? 3.721   45.530  12.157  1.00 118.38 ? 37  PRO B CD    1 
ATOM   4655  N  N     . GLY B 1 38  ? 5.794   42.869  15.390  1.00 129.63 ? 38  GLY B N     1 
ATOM   4656  C  CA    . GLY B 1 38  ? 7.181   42.802  15.818  1.00 131.51 ? 38  GLY B CA    1 
ATOM   4657  C  C     . GLY B 1 38  ? 8.101   42.435  14.666  1.00 131.03 ? 38  GLY B C     1 
ATOM   4658  O  O     . GLY B 1 38  ? 7.637   42.104  13.579  1.00 124.58 ? 38  GLY B O     1 
ATOM   4659  N  N     . ARG B 1 39  ? 9.405   42.499  14.923  1.00 135.14 ? 39  ARG B N     1 
ATOM   4660  C  CA    . ARG B 1 39  ? 10.394  42.243  13.895  1.00 129.57 ? 39  ARG B CA    1 
ATOM   4661  C  C     . ARG B 1 39  ? 10.272  40.855  13.256  1.00 127.83 ? 39  ARG B C     1 
ATOM   4662  O  O     . ARG B 1 39  ? 10.637  40.660  12.098  1.00 132.47 ? 39  ARG B O     1 
ATOM   4663  C  CB    . ARG B 1 39  ? 11.785  42.415  14.502  1.00 124.56 ? 39  ARG B CB    1 
ATOM   4664  N  N     . GLU B 1 40  ? 9.762   39.883  14.014  1.00 122.39 ? 40  GLU B N     1 
ATOM   4665  C  CA    . GLU B 1 40  ? 9.665   38.502  13.513  1.00 123.03 ? 40  GLU B CA    1 
ATOM   4666  C  C     . GLU B 1 40  ? 8.359   38.122  12.801  1.00 124.24 ? 40  GLU B C     1 
ATOM   4667  O  O     . GLU B 1 40  ? 8.309   37.079  12.151  1.00 124.18 ? 40  GLU B O     1 
ATOM   4668  C  CB    . GLU B 1 40  ? 9.899   37.535  14.666  1.00 116.59 ? 40  GLU B CB    1 
ATOM   4669  N  N     . GLU B 1 41  ? 7.327   38.960  12.906  1.00 120.79 ? 41  GLU B N     1 
ATOM   4670  C  CA    . GLU B 1 41  ? 6.010   38.563  12.391  1.00 122.94 ? 41  GLU B CA    1 
ATOM   4671  C  C     . GLU B 1 41  ? 5.544   39.257  11.098  1.00 132.61 ? 41  GLU B C     1 
ATOM   4672  O  O     . GLU B 1 41  ? 4.630   38.783  10.431  1.00 127.93 ? 41  GLU B O     1 
ATOM   4673  C  CB    . GLU B 1 41  ? 4.955   38.669  13.490  1.00 114.02 ? 41  GLU B CB    1 
ATOM   4674  C  CG    . GLU B 1 41  ? 5.074   39.827  14.436  1.00 118.56 ? 41  GLU B CG    1 
ATOM   4675  C  CD    . GLU B 1 41  ? 3.710   40.380  14.798  1.00 126.94 ? 41  GLU B CD    1 
ATOM   4676  O  OE1   . GLU B 1 41  ? 2.709   39.672  14.602  1.00 128.28 ? 41  GLU B OE1   1 
ATOM   4677  O  OE2   . GLU B 1 41  ? 3.652   41.470  15.414  1.00 131.88 ? 41  GLU B OE2   1 
ATOM   4678  N  N     . VAL B 1 42  ? 6.161   40.389  10.784  1.00 132.72 ? 42  VAL B N     1 
ATOM   4679  C  CA    . VAL B 1 42  ? 5.883   41.275  9.634   1.00 130.74 ? 42  VAL B CA    1 
ATOM   4680  C  C     . VAL B 1 42  ? 5.895   40.577  8.280   1.00 122.21 ? 42  VAL B C     1 
ATOM   4681  O  O     . VAL B 1 42  ? 4.938   40.764  7.535   1.00 131.04 ? 42  VAL B O     1 
ATOM   4682  C  CB    . VAL B 1 42  ? 6.780   42.562  9.552   1.00 116.74 ? 42  VAL B CB    1 
ATOM   4683  C  CG1   . VAL B 1 42  ? 7.908   42.665  10.465  1.00 116.96 ? 42  VAL B CG1   1 
ATOM   4684  C  CG2   . VAL B 1 42  ? 6.782   43.238  8.092   1.00 118.23 ? 42  VAL B CG2   1 
ATOM   4685  N  N     . TYR B 1 43  ? 6.873   39.744  7.942   1.00 122.23 ? 43  TYR B N     1 
ATOM   4686  C  CA    . TYR B 1 43  ? 6.892   39.180  6.577   1.00 110.56 ? 43  TYR B CA    1 
ATOM   4687  C  C     . TYR B 1 43  ? 5.650   38.350  6.265   1.00 106.93 ? 43  TYR B C     1 
ATOM   4688  O  O     . TYR B 1 43  ? 5.046   38.535  5.176   1.00 114.83 ? 43  TYR B O     1 
ATOM   4689  C  CB    . TYR B 1 43  ? 8.107   38.274  6.253   1.00 111.83 ? 43  TYR B CB    1 
ATOM   4690  C  CG    . TYR B 1 43  ? 9.461   38.931  6.153   1.00 119.77 ? 43  TYR B CG    1 
ATOM   4691  C  CD1   . TYR B 1 43  ? 9.732   39.776  5.089   1.00 118.27 ? 43  TYR B CD1   1 
ATOM   4692  C  CD2   . TYR B 1 43  ? 10.537  38.515  6.937   1.00 128.29 ? 43  TYR B CD2   1 
ATOM   4693  C  CE1   . TYR B 1 43  ? 10.971  40.345  4.914   1.00 118.34 ? 43  TYR B CE1   1 
ATOM   4694  C  CE2   . TYR B 1 43  ? 11.815  39.071  6.755   1.00 128.08 ? 43  TYR B CE2   1 
ATOM   4695  C  CZ    . TYR B 1 43  ? 12.017  39.983  5.739   1.00 122.06 ? 43  TYR B CZ    1 
ATOM   4696  O  OH    . TYR B 1 43  ? 13.255  40.554  5.545   1.00 119.77 ? 43  TYR B OH    1 
ATOM   4697  N  N     . PRO B 1 44  ? 5.263   37.418  7.141   1.00 107.39 ? 44  PRO B N     1 
ATOM   4698  C  CA    . PRO B 1 44  ? 4.008   36.756  6.772   1.00 107.81 ? 44  PRO B CA    1 
ATOM   4699  C  C     . PRO B 1 44  ? 2.855   37.756  6.665   1.00 104.28 ? 44  PRO B C     1 
ATOM   4700  O  O     . PRO B 1 44  ? 1.957   37.570  5.845   1.00 107.51 ? 44  PRO B O     1 
ATOM   4701  C  CB    . PRO B 1 44  ? 3.750   35.770  7.913   1.00 107.18 ? 44  PRO B CB    1 
ATOM   4702  C  CG    . PRO B 1 44  ? 4.566   36.241  9.027   1.00 100.57 ? 44  PRO B CG    1 
ATOM   4703  C  CD    . PRO B 1 44  ? 5.783   36.889  8.414   1.00 99.27  ? 44  PRO B CD    1 
ATOM   4704  N  N     . LEU B 1 45  ? 2.894   38.811  7.474   1.00 99.59  ? 45  LEU B N     1 
ATOM   4705  C  CA    . LEU B 1 45  ? 1.808   39.746  7.450   1.00 100.69 ? 45  LEU B CA    1 
ATOM   4706  C  C     . LEU B 1 45  ? 1.709   40.560  6.174   1.00 103.34 ? 45  LEU B C     1 
ATOM   4707  O  O     . LEU B 1 45  ? 0.606   40.797  5.637   1.00 110.61 ? 45  LEU B O     1 
ATOM   4708  C  CB    . LEU B 1 45  ? 2.007   40.713  8.591   1.00 97.26  ? 45  LEU B CB    1 
ATOM   4709  C  CG    . LEU B 1 45  ? 0.855   41.209  9.400   1.00 97.17  ? 45  LEU B CG    1 
ATOM   4710  C  CD1   . LEU B 1 45  ? -0.117  40.067  9.781   1.00 106.55 ? 45  LEU B CD1   1 
ATOM   4711  C  CD2   . LEU B 1 45  ? 1.556   41.850  10.535  1.00 82.25  ? 45  LEU B CD2   1 
ATOM   4712  N  N     . LEU B 1 46  ? 2.870   40.926  5.641   1.00 89.24  ? 46  LEU B N     1 
ATOM   4713  C  CA    . LEU B 1 46  ? 2.968   41.599  4.361   1.00 95.70  ? 46  LEU B CA    1 
ATOM   4714  C  C     . LEU B 1 46  ? 2.413   40.705  3.287   1.00 98.18  ? 46  LEU B C     1 
ATOM   4715  O  O     . LEU B 1 46  ? 1.650   41.174  2.450   1.00 104.55 ? 46  LEU B O     1 
ATOM   4716  C  CB    . LEU B 1 46  ? 4.389   42.015  4.029   1.00 88.29  ? 46  LEU B CB    1 
ATOM   4717  C  CG    . LEU B 1 46  ? 4.882   43.069  5.008   1.00 88.34  ? 46  LEU B CG    1 
ATOM   4718  C  CD1   . LEU B 1 46  ? 6.151   43.726  4.464   1.00 89.93  ? 46  LEU B CD1   1 
ATOM   4719  C  CD2   . LEU B 1 46  ? 3.785   44.081  5.411   1.00 98.87  ? 46  LEU B CD2   1 
ATOM   4720  N  N     . ALA B 1 47  ? 2.752   39.417  3.350   1.00 85.22  ? 47  ALA B N     1 
ATOM   4721  C  CA    . ALA B 1 47  ? 2.218   38.469  2.375   1.00 94.43  ? 47  ALA B CA    1 
ATOM   4722  C  C     . ALA B 1 47  ? 0.694   38.405  2.457   1.00 106.89 ? 47  ALA B C     1 
ATOM   4723  O  O     . ALA B 1 47  ? -0.020  38.426  1.419   1.00 126.70 ? 47  ALA B O     1 
ATOM   4724  C  CB    . ALA B 1 47  ? 2.807   37.108  2.598   1.00 90.06  ? 47  ALA B CB    1 
ATOM   4725  N  N     . GLN B 1 48  ? 0.176   38.391  3.682   1.00 96.25  ? 48  GLN B N     1 
ATOM   4726  C  CA    . GLN B 1 48  ? -1.263  38.360  3.805   1.00 91.63  ? 48  GLN B CA    1 
ATOM   4727  C  C     . GLN B 1 48  ? -1.895  39.628  3.207   1.00 91.72  ? 48  GLN B C     1 
ATOM   4728  O  O     . GLN B 1 48  ? -2.894  39.563  2.458   1.00 111.84 ? 48  GLN B O     1 
ATOM   4729  C  CB    . GLN B 1 48  ? -1.675  38.181  5.254   1.00 81.47  ? 48  GLN B CB    1 
ATOM   4730  C  CG    . GLN B 1 48  ? -3.135  37.838  5.330   1.00 91.66  ? 48  GLN B CG    1 
ATOM   4731  C  CD    . GLN B 1 48  ? -3.631  37.643  6.726   1.00 104.86 ? 48  GLN B CD    1 
ATOM   4732  O  OE1   . GLN B 1 48  ? -2.947  37.037  7.565   1.00 93.45  ? 48  GLN B OE1   1 
ATOM   4733  N  NE2   . GLN B 1 48  ? -4.818  38.183  7.006   1.00 117.03 ? 48  GLN B NE2   1 
ATOM   4734  N  N     . VAL B 1 49  ? -1.264  40.771  3.451   1.00 73.72  ? 49  VAL B N     1 
ATOM   4735  C  CA    . VAL B 1 49  ? -1.720  42.044  2.888   1.00 88.43  ? 49  VAL B CA    1 
ATOM   4736  C  C     . VAL B 1 49  ? -1.718  41.984  1.355   1.00 96.09  ? 49  VAL B C     1 
ATOM   4737  O  O     . VAL B 1 49  ? -2.701  42.408  0.697   1.00 104.64 ? 49  VAL B O     1 
ATOM   4738  C  CB    . VAL B 1 49  ? -0.829  43.210  3.349   1.00 80.56  ? 49  VAL B CB    1 
ATOM   4739  C  CG1   . VAL B 1 49  ? -1.162  44.484  2.561   1.00 87.64  ? 49  VAL B CG1   1 
ATOM   4740  C  CG2   . VAL B 1 49  ? -1.011  43.441  4.809   1.00 77.39  ? 49  VAL B CG2   1 
ATOM   4741  N  N     . ALA B 1 50  ? -0.643  41.411  0.807   1.00 81.94  ? 50  ALA B N     1 
ATOM   4742  C  CA    . ALA B 1 50  ? -0.540  41.210  -0.622  1.00 82.81  ? 50  ALA B CA    1 
ATOM   4743  C  C     . ALA B 1 50  ? -1.748  40.458  -1.136  1.00 97.81  ? 50  ALA B C     1 
ATOM   4744  O  O     . ALA B 1 50  ? -2.310  40.877  -2.159  1.00 114.32 ? 50  ALA B O     1 
ATOM   4745  C  CB    . ALA B 1 50  ? 0.733   40.443  -0.942  1.00 65.03  ? 50  ALA B CB    1 
ATOM   4746  N  N     . ARG B 1 51  ? -2.218  39.424  -0.434  1.00 77.74  ? 51  ARG B N     1 
ATOM   4747  C  CA    . ARG B 1 51  ? -3.456  38.788  -0.919  1.00 86.57  ? 51  ARG B CA    1 
ATOM   4748  C  C     . ARG B 1 51  ? -4.714  39.655  -0.823  1.00 91.33  ? 51  ARG B C     1 
ATOM   4749  O  O     . ARG B 1 51  ? -5.481  39.709  -1.791  1.00 106.61 ? 51  ARG B O     1 
ATOM   4750  C  CB    . ARG B 1 51  ? -3.866  37.509  -0.237  1.00 96.18  ? 51  ARG B CB    1 
ATOM   4751  C  CG    . ARG B 1 51  ? -3.233  36.291  -0.440  1.00 112.37 ? 51  ARG B CG    1 
ATOM   4752  C  CD    . ARG B 1 51  ? -4.080  35.205  0.191   1.00 126.34 ? 51  ARG B CD    1 
ATOM   4753  N  NE    . ARG B 1 51  ? -4.470  35.590  1.551   1.00 139.26 ? 51  ARG B NE    1 
ATOM   4754  C  CZ    . ARG B 1 51  ? -4.268  34.839  2.627   1.00 145.77 ? 51  ARG B CZ    1 
ATOM   4755  N  NH1   . ARG B 1 51  ? -3.585  33.713  2.498   1.00 134.69 ? 51  ARG B NH1   1 
ATOM   4756  N  NH2   . ARG B 1 51  ? -4.662  35.262  3.831   1.00 146.25 ? 51  ARG B NH2   1 
ATOM   4757  N  N     . ARG B 1 52  ? -4.915  40.287  0.349   1.00 68.61  ? 52  ARG B N     1 
ATOM   4758  C  CA    . ARG B 1 52  ? -6.168  40.993  0.485   1.00 77.43  ? 52  ARG B CA    1 
ATOM   4759  C  C     . ARG B 1 52  ? -6.259  42.168  -0.411  1.00 79.39  ? 52  ARG B C     1 
ATOM   4760  O  O     . ARG B 1 52  ? -7.339  42.579  -0.745  1.00 92.92  ? 52  ARG B O     1 
ATOM   4761  C  CB    . ARG B 1 52  ? -6.431  41.577  1.897   1.00 101.56 ? 52  ARG B CB    1 
ATOM   4762  C  CG    . ARG B 1 52  ? -6.487  40.711  2.940   1.00 91.16  ? 52  ARG B CG    1 
ATOM   4763  C  CD    . ARG B 1 52  ? -7.749  40.103  3.501   1.00 103.76 ? 52  ARG B CD    1 
ATOM   4764  N  NE    . ARG B 1 52  ? -8.977  40.428  4.213   1.00 123.72 ? 52  ARG B NE    1 
ATOM   4765  C  CZ    . ARG B 1 52  ? -10.209 40.254  3.711   1.00 132.06 ? 52  ARG B CZ    1 
ATOM   4766  N  NH1   . ARG B 1 52  ? -10.359 40.106  2.432   1.00 143.67 ? 52  ARG B NH1   1 
ATOM   4767  N  NH2   . ARG B 1 52  ? -11.308 40.503  4.428   1.00 124.25 ? 52  ARG B NH2   1 
ATOM   4768  N  N     . ALA B 1 53  ? -5.134  42.661  -0.907  1.00 72.58  ? 53  ALA B N     1 
ATOM   4769  C  CA    . ALA B 1 53  ? -5.201  43.799  -1.797  1.00 73.87  ? 53  ALA B CA    1 
ATOM   4770  C  C     . ALA B 1 53  ? -5.833  43.294  -3.117  1.00 71.79  ? 53  ALA B C     1 
ATOM   4771  O  O     . ALA B 1 53  ? -6.520  44.073  -3.822  1.00 75.76  ? 53  ALA B O     1 
ATOM   4772  C  CB    . ALA B 1 53  ? -3.822  44.391  -2.023  1.00 75.74  ? 53  ALA B CB    1 
ATOM   4773  N  N     . GLY B 1 54  ? -5.548  42.035  -3.498  1.00 57.04  ? 54  GLY B N     1 
ATOM   4774  C  CA    . GLY B 1 54  ? -6.222  41.553  -4.683  1.00 65.48  ? 54  GLY B CA    1 
ATOM   4775  C  C     . GLY B 1 54  ? -5.378  41.744  -5.896  1.00 81.20  ? 54  GLY B C     1 
ATOM   4776  O  O     . GLY B 1 54  ? -4.230  42.156  -5.756  1.00 89.43  ? 54  GLY B O     1 
ATOM   4777  N  N     . GLY B 1 55  ? -5.870  41.287  -7.047  1.00 86.62  ? 55  GLY B N     1 
ATOM   4778  C  CA    . GLY B 1 55  ? -5.143  41.443  -8.297  1.00 93.14  ? 55  GLY B CA    1 
ATOM   4779  C  C     . GLY B 1 55  ? -3.809  40.764  -8.199  1.00 95.75  ? 55  GLY B C     1 
ATOM   4780  O  O     . GLY B 1 55  ? -3.634  39.964  -7.321  1.00 95.69  ? 55  GLY B O     1 
ATOM   4781  N  N     . VAL B 1 56  ? -2.929  40.941  -9.159  1.00 94.50  ? 56  VAL B N     1 
ATOM   4782  C  CA    . VAL B 1 56  ? -1.606  40.362  -9.066  1.00 83.24  ? 56  VAL B CA    1 
ATOM   4783  C  C     . VAL B 1 56  ? -0.578  41.140  -8.224  1.00 82.80  ? 56  VAL B C     1 
ATOM   4784  O  O     . VAL B 1 56  ? 0.186   41.967  -8.762  1.00 86.49  ? 56  VAL B O     1 
ATOM   4785  C  CB    . VAL B 1 56  ? -1.110  40.127  -10.485 1.00 88.31  ? 56  VAL B CB    1 
ATOM   4786  C  CG1   . VAL B 1 56  ? 0.198   39.407  -10.502 1.00 92.57  ? 56  VAL B CG1   1 
ATOM   4787  C  CG2   . VAL B 1 56  ? -2.184  39.341  -11.226 1.00 87.96  ? 56  VAL B CG2   1 
ATOM   4788  N  N     . THR B 1 57  ? -0.527  40.865  -6.927  1.00 85.44  ? 57  THR B N     1 
ATOM   4789  C  CA    . THR B 1 57  ? 0.309   41.637  -5.999  1.00 88.19  ? 57  THR B CA    1 
ATOM   4790  C  C     . THR B 1 57  ? 1.138   40.741  -5.062  1.00 91.12  ? 57  THR B C     1 
ATOM   4791  O  O     . THR B 1 57  ? 0.597   39.818  -4.478  1.00 100.07 ? 57  THR B O     1 
ATOM   4792  C  CB    . THR B 1 57  ? -0.518  42.605  -5.120  1.00 76.42  ? 57  THR B CB    1 
ATOM   4793  O  OG1   . THR B 1 57  ? -1.443  43.334  -5.935  1.00 82.40  ? 57  THR B OG1   1 
ATOM   4794  C  CG2   . THR B 1 57  ? 0.414   43.574  -4.419  1.00 76.04  ? 57  THR B CG2   1 
ATOM   4795  N  N     . VAL B 1 58  ? 2.438   40.985  -4.941  1.00 85.82  ? 58  VAL B N     1 
ATOM   4796  C  CA    . VAL B 1 58  ? 3.328   40.201  -4.076  1.00 84.61  ? 58  VAL B CA    1 
ATOM   4797  C  C     . VAL B 1 58  ? 4.175   41.071  -3.146  1.00 91.95  ? 58  VAL B C     1 
ATOM   4798  O  O     . VAL B 1 58  ? 4.254   42.274  -3.334  1.00 89.34  ? 58  VAL B O     1 
ATOM   4799  C  CB    . VAL B 1 58  ? 4.248   39.317  -4.932  1.00 77.30  ? 58  VAL B CB    1 
ATOM   4800  C  CG1   . VAL B 1 58  ? 3.429   38.383  -5.783  1.00 71.82  ? 58  VAL B CG1   1 
ATOM   4801  C  CG2   . VAL B 1 58  ? 5.148   40.187  -5.813  1.00 75.47  ? 58  VAL B CG2   1 
ATOM   4802  N  N     . ARG B 1 59  ? 4.818   40.476  -2.142  1.00 96.83  ? 59  ARG B N     1 
ATOM   4803  C  CA    . ARG B 1 59  ? 5.744   41.269  -1.333  1.00 92.83  ? 59  ARG B CA    1 
ATOM   4804  C  C     . ARG B 1 59  ? 7.016   41.516  -2.135  1.00 82.95  ? 59  ARG B C     1 
ATOM   4805  O  O     . ARG B 1 59  ? 7.580   40.618  -2.761  1.00 80.35  ? 59  ARG B O     1 
ATOM   4806  C  CB    . ARG B 1 59  ? 6.039   40.610  0.026   1.00 94.76  ? 59  ARG B CB    1 
ATOM   4807  C  CG    . ARG B 1 59  ? 7.059   41.392  0.845   1.00 106.34 ? 59  ARG B CG    1 
ATOM   4808  C  CD    . ARG B 1 59  ? 7.544   40.733  2.160   1.00 113.58 ? 59  ARG B CD    1 
ATOM   4809  N  NE    . ARG B 1 59  ? 7.640   39.289  2.206   1.00 116.32 ? 59  ARG B NE    1 
ATOM   4810  C  CZ    . ARG B 1 59  ? 8.682   38.569  1.818   1.00 116.60 ? 59  ARG B CZ    1 
ATOM   4811  N  NH1   . ARG B 1 59  ? 9.747   39.160  1.300   1.00 109.59 ? 59  ARG B NH1   1 
ATOM   4812  N  NH2   . ARG B 1 59  ? 8.638   37.242  1.932   1.00 126.80 ? 59  ARG B NH2   1 
ATOM   4813  N  N     . MET B 1 60  ? 7.457   42.768  -2.117  1.00 76.21  ? 60  MET B N     1 
ATOM   4814  C  CA    . MET B 1 60  ? 8.736   43.152  -2.676  1.00 82.38  ? 60  MET B CA    1 
ATOM   4815  C  C     . MET B 1 60  ? 9.492   43.955  -1.633  1.00 90.45  ? 60  MET B C     1 
ATOM   4816  O  O     . MET B 1 60  ? 9.094   45.073  -1.295  1.00 93.70  ? 60  MET B O     1 
ATOM   4817  C  CB    . MET B 1 60  ? 8.556   44.000  -3.920  1.00 87.58  ? 60  MET B CB    1 
ATOM   4818  C  CG    . MET B 1 60  ? 9.858   44.572  -4.443  1.00 102.68 ? 60  MET B CG    1 
ATOM   4819  S  SD    . MET B 1 60  ? 9.698   45.613  -5.921  1.00 104.05 ? 60  MET B SD    1 
ATOM   4820  C  CE    . MET B 1 60  ? 8.420   46.756  -5.381  1.00 77.92  ? 60  MET B CE    1 
ATOM   4821  N  N     . GLY B 1 61  ? 10.568  43.381  -1.120  1.00 91.45  ? 61  GLY B N     1 
ATOM   4822  C  CA    . GLY B 1 61  ? 11.315  43.981  -0.046  1.00 91.63  ? 61  GLY B CA    1 
ATOM   4823  C  C     . GLY B 1 61  ? 10.404  44.104  1.145   1.00 97.78  ? 61  GLY B C     1 
ATOM   4824  O  O     . GLY B 1 61  ? 9.769   43.130  1.563   1.00 100.09 ? 61  GLY B O     1 
ATOM   4825  N  N     . ASP B 1 62  ? 10.347  45.309  1.691   1.00 96.14  ? 62  ASP B N     1 
ATOM   4826  C  CA    . ASP B 1 62  ? 9.510   45.626  2.840   1.00 100.55 ? 62  ASP B CA    1 
ATOM   4827  C  C     . ASP B 1 62  ? 8.105   46.096  2.439   1.00 97.98  ? 62  ASP B C     1 
ATOM   4828  O  O     . ASP B 1 62  ? 7.287   46.442  3.293   1.00 99.24  ? 62  ASP B O     1 
ATOM   4829  C  CB    . ASP B 1 62  ? 10.262  46.662  3.670   1.00 104.61 ? 62  ASP B CB    1 
ATOM   4830  C  CG    . ASP B 1 62  ? 10.491  47.958  2.910   1.00 100.61 ? 62  ASP B CG    1 
ATOM   4831  O  OD1   . ASP B 1 62  ? 10.860  47.895  1.713   1.00 94.17  ? 62  ASP B OD1   1 
ATOM   4832  O  OD2   . ASP B 1 62  ? 10.445  49.034  3.555   1.00 97.73  ? 62  ASP B OD2   1 
ATOM   4833  N  N     . GLY B 1 63  ? 7.845   46.146  1.133   1.00 92.09  ? 63  GLY B N     1 
ATOM   4834  C  CA    . GLY B 1 63  ? 6.570   46.634  0.643   1.00 90.00  ? 63  GLY B CA    1 
ATOM   4835  C  C     . GLY B 1 63  ? 5.894   45.696  -0.338  1.00 95.51  ? 63  GLY B C     1 
ATOM   4836  O  O     . GLY B 1 63  ? 6.006   44.472  -0.229  1.00 101.88 ? 63  GLY B O     1 
ATOM   4837  N  N     . LEU B 1 64  ? 5.240   46.264  -1.346  1.00 95.97  ? 64  LEU B N     1 
ATOM   4838  C  CA    . LEU B 1 64  ? 4.427   45.464  -2.246  1.00 82.43  ? 64  LEU B CA    1 
ATOM   4839  C  C     . LEU B 1 64  ? 4.753   45.834  -3.680  1.00 82.51  ? 64  LEU B C     1 
ATOM   4840  O  O     . LEU B 1 64  ? 5.060   46.979  -3.975  1.00 83.46  ? 64  LEU B O     1 
ATOM   4841  C  CB    . LEU B 1 64  ? 2.939   45.691  -1.943  1.00 70.53  ? 64  LEU B CB    1 
ATOM   4842  C  CG    . LEU B 1 64  ? 2.194   44.634  -1.118  1.00 71.27  ? 64  LEU B CG    1 
ATOM   4843  C  CD1   . LEU B 1 64  ? 2.969   44.241  0.120   1.00 45.63  ? 64  LEU B CD1   1 
ATOM   4844  C  CD2   . LEU B 1 64  ? 0.833   45.173  -0.698  1.00 72.10  ? 64  LEU B CD2   1 
ATOM   4845  N  N     . ALA B 1 65  ? 4.572   44.881  -4.582  1.00 81.80  ? 65  ALA B N     1 
ATOM   4846  C  CA    . ALA B 1 65  ? 4.648   45.138  -6.013  1.00 84.48  ? 65  ALA B CA    1 
ATOM   4847  C  C     . ALA B 1 65  ? 3.410   44.571  -6.664  1.00 86.20  ? 65  ALA B C     1 
ATOM   4848  O  O     . ALA B 1 65  ? 2.974   43.472  -6.339  1.00 75.77  ? 65  ALA B O     1 
ATOM   4849  C  CB    . ALA B 1 65  ? 5.887   44.522  -6.625  1.00 84.46  ? 65  ALA B CB    1 
ATOM   4850  N  N     . SER B 1 66  ? 2.859   45.311  -7.614  1.00 89.45  ? 66  SER B N     1 
ATOM   4851  C  CA    . SER B 1 66  ? 1.647   44.872  -8.268  1.00 86.43  ? 66  SER B CA    1 
ATOM   4852  C  C     . SER B 1 66  ? 1.725   45.133  -9.747  1.00 77.47  ? 66  SER B C     1 
ATOM   4853  O  O     . SER B 1 66  ? 2.242   46.164  -10.181 1.00 78.09  ? 66  SER B O     1 
ATOM   4854  C  CB    . SER B 1 66  ? 0.447   45.615  -7.680  1.00 90.74  ? 66  SER B CB    1 
ATOM   4855  O  OG    . SER B 1 66  ? -0.760  45.140  -8.235  1.00 93.74  ? 66  SER B OG    1 
ATOM   4856  N  N     . TRP B 1 67  ? 1.166   44.203  -10.514 1.00 67.79  ? 67  TRP B N     1 
ATOM   4857  C  CA    . TRP B 1 67  ? 1.001   44.391  -11.938 1.00 75.80  ? 67  TRP B CA    1 
ATOM   4858  C  C     . TRP B 1 67  ? -0.367  44.935  -12.237 1.00 83.03  ? 67  TRP B C     1 
ATOM   4859  O  O     . TRP B 1 67  ? -0.740  45.130  -13.398 1.00 89.29  ? 67  TRP B O     1 
ATOM   4860  C  CB    . TRP B 1 67  ? 1.208   43.098  -12.694 1.00 73.25  ? 67  TRP B CB    1 
ATOM   4861  C  CG    . TRP B 1 67  ? 2.616   42.762  -12.974 1.00 70.29  ? 67  TRP B CG    1 
ATOM   4862  C  CD1   . TRP B 1 67  ? 3.708   43.597  -12.934 1.00 70.40  ? 67  TRP B CD1   1 
ATOM   4863  C  CD2   . TRP B 1 67  ? 3.091   41.495  -13.401 1.00 79.06  ? 67  TRP B CD2   1 
ATOM   4864  N  NE1   . TRP B 1 67  ? 4.836   42.901  -13.279 1.00 81.90  ? 67  TRP B NE1   1 
ATOM   4865  C  CE2   . TRP B 1 67  ? 4.483   41.608  -13.577 1.00 86.86  ? 67  TRP B CE2   1 
ATOM   4866  C  CE3   . TRP B 1 67  ? 2.474   40.264  -13.636 1.00 78.47  ? 67  TRP B CE3   1 
ATOM   4867  C  CZ2   . TRP B 1 67  ? 5.263   40.538  -13.985 1.00 89.92  ? 67  TRP B CZ2   1 
ATOM   4868  C  CZ3   . TRP B 1 67  ? 3.251   39.203  -14.034 1.00 86.95  ? 67  TRP B CZ3   1 
ATOM   4869  C  CH2   . TRP B 1 67  ? 4.628   39.344  -14.206 1.00 94.20  ? 67  TRP B CH2   1 
ATOM   4870  N  N     . SER B 1 68  ? -1.092  45.212  -11.166 1.00 67.55  ? 68  SER B N     1 
ATOM   4871  C  CA    . SER B 1 68  ? -2.401  45.792  -11.270 1.00 72.38  ? 68  SER B CA    1 
ATOM   4872  C  C     . SER B 1 68  ? -2.339  47.193  -10.698 1.00 87.55  ? 68  SER B C     1 
ATOM   4873  O  O     . SER B 1 68  ? -1.688  47.400  -9.676  1.00 100.19 ? 68  SER B O     1 
ATOM   4874  C  CB    . SER B 1 68  ? -3.397  44.944  -10.512 1.00 76.27  ? 68  SER B CB    1 
ATOM   4875  O  OG    . SER B 1 68  ? -4.668  45.514  -10.638 1.00 96.58  ? 68  SER B OG    1 
ATOM   4876  N  N     . PRO B 1 69  ? -2.928  48.181  -11.392 1.00 85.08  ? 69  PRO B N     1 
ATOM   4877  C  CA    . PRO B 1 69  ? -2.783  49.533  -10.840 1.00 90.25  ? 69  PRO B CA    1 
ATOM   4878  C  C     . PRO B 1 69  ? -3.408  49.614  -9.452  1.00 75.59  ? 69  PRO B C     1 
ATOM   4879  O  O     . PRO B 1 69  ? -4.342  48.865  -9.148  1.00 56.95  ? 69  PRO B O     1 
ATOM   4880  C  CB    . PRO B 1 69  ? -3.507  50.412  -11.865 1.00 103.13 ? 69  PRO B CB    1 
ATOM   4881  C  CG    . PRO B 1 69  ? -4.436  49.473  -12.562 1.00 86.83  ? 69  PRO B CG    1 
ATOM   4882  C  CD    . PRO B 1 69  ? -3.725  48.164  -12.624 1.00 74.83  ? 69  PRO B CD    1 
ATOM   4883  N  N     . PRO B 1 70  ? -2.915  50.530  -8.618  1.00 75.95  ? 70  PRO B N     1 
ATOM   4884  C  CA    . PRO B 1 70  ? -3.457  50.708  -7.265  1.00 69.80  ? 70  PRO B CA    1 
ATOM   4885  C  C     . PRO B 1 70  ? -4.973  51.041  -7.177  1.00 73.67  ? 70  PRO B C     1 
ATOM   4886  O  O     . PRO B 1 70  ? -5.570  50.778  -6.143  1.00 64.99  ? 70  PRO B O     1 
ATOM   4887  C  CB    . PRO B 1 70  ? -2.616  51.874  -6.711  1.00 70.42  ? 70  PRO B CB    1 
ATOM   4888  C  CG    . PRO B 1 70  ? -1.923  52.490  -7.915  1.00 81.89  ? 70  PRO B CG    1 
ATOM   4889  C  CD    . PRO B 1 70  ? -1.725  51.361  -8.863  1.00 84.34  ? 70  PRO B CD    1 
ATOM   4890  N  N     . GLU B 1 71  ? -5.641  51.396  -8.267  1.00 76.10  ? 71  GLU B N     1 
ATOM   4891  C  CA    . GLU B 1 71  ? -7.054  51.776  -8.177  1.00 65.57  ? 71  GLU B CA    1 
ATOM   4892  C  C     . GLU B 1 71  ? -7.896  50.566  -8.159  1.00 61.77  ? 71  GLU B C     1 
ATOM   4893  O  O     . GLU B 1 71  ? -8.921  50.462  -7.514  1.00 43.63  ? 71  GLU B O     1 
ATOM   4894  C  CB    . GLU B 1 71  ? -7.464  52.604  -9.387  1.00 58.63  ? 71  GLU B CB    1 
ATOM   4895  C  CG    . GLU B 1 71  ? -7.117  54.041  -9.269  1.00 69.35  ? 71  GLU B CG    1 
ATOM   4896  C  CD    . GLU B 1 71  ? -5.622  54.245  -9.592  1.00 79.73  ? 71  GLU B CD    1 
ATOM   4897  O  OE1   . GLU B 1 71  ? -5.157  55.403  -9.554  1.00 90.69  ? 71  GLU B OE1   1 
ATOM   4898  O  OE2   . GLU B 1 71  ? -4.915  53.243  -9.895  1.00 67.51  ? 71  GLU B OE2   1 
ATOM   4899  N  N     . VAL B 1 72  ? -7.352  49.532  -8.701  1.00 60.70  ? 72  VAL B N     1 
ATOM   4900  C  CA    . VAL B 1 72  ? -8.159  48.340  -8.696  1.00 71.56  ? 72  VAL B CA    1 
ATOM   4901  C  C     . VAL B 1 72  ? -7.753  47.405  -7.556  1.00 73.23  ? 72  VAL B C     1 
ATOM   4902  O  O     . VAL B 1 72  ? -8.238  46.284  -7.439  1.00 56.74  ? 72  VAL B O     1 
ATOM   4903  C  CB    . VAL B 1 72  ? -8.217  47.753  -10.122 1.00 79.97  ? 72  VAL B CB    1 
ATOM   4904  C  CG1   . VAL B 1 72  ? -8.981  48.715  -11.035 1.00 86.15  ? 72  VAL B CG1   1 
ATOM   4905  C  CG2   . VAL B 1 72  ? -6.847  47.469  -10.652 1.00 94.36  ? 72  VAL B CG2   1 
ATOM   4906  N  N     . LEU B 1 73  ? -6.753  47.813  -6.791  1.00 86.59  ? 73  LEU B N     1 
ATOM   4907  C  CA    . LEU B 1 73  ? -6.378  47.060  -5.591  1.00 66.66  ? 73  LEU B CA    1 
ATOM   4908  C  C     . LEU B 1 73  ? -7.302  47.503  -4.451  1.00 58.32  ? 73  LEU B C     1 
ATOM   4909  O  O     . LEU B 1 73  ? -7.851  48.603  -4.506  1.00 73.08  ? 73  LEU B O     1 
ATOM   4910  C  CB    . LEU B 1 73  ? -4.925  47.323  -5.226  1.00 64.95  ? 73  LEU B CB    1 
ATOM   4911  C  CG    . LEU B 1 73  ? -3.952  46.598  -6.157  1.00 62.10  ? 73  LEU B CG    1 
ATOM   4912  C  CD1   . LEU B 1 73  ? -2.476  46.694  -5.723  1.00 55.50  ? 73  LEU B CD1   1 
ATOM   4913  C  CD2   . LEU B 1 73  ? -4.398  45.191  -6.244  1.00 51.47  ? 73  LEU B CD2   1 
ATOM   4914  N  N     . VAL B 1 74  ? -7.445  46.702  -3.400  1.00 57.31  ? 74  VAL B N     1 
ATOM   4915  C  CA    . VAL B 1 74  ? -8.094  47.171  -2.174  1.00 61.23  ? 74  VAL B CA    1 
ATOM   4916  C  C     . VAL B 1 74  ? -7.072  47.862  -1.277  1.00 64.30  ? 74  VAL B C     1 
ATOM   4917  O  O     . VAL B 1 74  ? -6.508  47.189  -0.441  1.00 50.71  ? 74  VAL B O     1 
ATOM   4918  C  CB    . VAL B 1 74  ? -8.665  46.029  -1.250  1.00 78.71  ? 74  VAL B CB    1 
ATOM   4919  C  CG1   . VAL B 1 74  ? -10.025 46.341  -0.768  1.00 109.61 ? 74  VAL B CG1   1 
ATOM   4920  C  CG2   . VAL B 1 74  ? -8.617  44.718  -1.845  1.00 69.33  ? 74  VAL B CG2   1 
ATOM   4921  N  N     . LEU B 1 75  ? -6.845  49.164  -1.439  1.00 75.44  ? 75  LEU B N     1 
ATOM   4922  C  CA    . LEU B 1 75  ? -5.762  49.864  -0.785  1.00 70.93  ? 75  LEU B CA    1 
ATOM   4923  C  C     . LEU B 1 75  ? -5.996  49.978  0.702   1.00 70.43  ? 75  LEU B C     1 
ATOM   4924  O  O     . LEU B 1 75  ? -5.042  49.973  1.482   1.00 76.70  ? 75  LEU B O     1 
ATOM   4925  C  CB    . LEU B 1 75  ? -5.589  51.251  -1.380  1.00 78.07  ? 75  LEU B CB    1 
ATOM   4926  C  CG    . LEU B 1 75  ? -5.347  51.272  -2.890  1.00 73.76  ? 75  LEU B CG    1 
ATOM   4927  C  CD1   . LEU B 1 75  ? -5.104  52.714  -3.335  1.00 77.88  ? 75  LEU B CD1   1 
ATOM   4928  C  CD2   . LEU B 1 75  ? -4.191  50.321  -3.300  1.00 40.50  ? 75  LEU B CD2   1 
ATOM   4929  N  N     . GLU B 1 76  ? -7.246  50.070  1.129   1.00 70.25  ? 76  GLU B N     1 
ATOM   4930  C  CA    . GLU B 1 76  ? -7.462  50.095  2.570   1.00 65.87  ? 76  GLU B CA    1 
ATOM   4931  C  C     . GLU B 1 76  ? -8.301  48.933  3.067   1.00 66.70  ? 76  GLU B C     1 
ATOM   4932  O  O     . GLU B 1 76  ? -9.327  48.606  2.456   1.00 87.74  ? 76  GLU B O     1 
ATOM   4933  C  CB    . GLU B 1 76  ? -8.154  51.429  2.977   1.00 57.46  ? 76  GLU B CB    1 
ATOM   4934  C  CG    . GLU B 1 76  ? -7.556  52.658  2.353   1.00 72.95  ? 76  GLU B CG    1 
ATOM   4935  C  CD    . GLU B 1 76  ? -8.283  53.919  2.736   1.00 96.41  ? 76  GLU B CD    1 
ATOM   4936  O  OE1   . GLU B 1 76  ? -9.196  53.845  3.585   1.00 105.07 ? 76  GLU B OE1   1 
ATOM   4937  O  OE2   . GLU B 1 76  ? -7.961  54.980  2.151   1.00 109.14 ? 76  GLU B OE2   1 
ATOM   4938  N  N     . GLY B 1 77  ? -7.888  48.328  4.175   1.00 58.66  ? 77  GLY B N     1 
ATOM   4939  C  CA    . GLY B 1 77  ? -8.644  47.221  4.749   1.00 80.26  ? 77  GLY B CA    1 
ATOM   4940  C  C     . GLY B 1 77  ? -8.187  46.671  6.125   1.00 89.16  ? 77  GLY B C     1 
ATOM   4941  O  O     . GLY B 1 77  ? -7.406  47.313  6.789   1.00 63.65  ? 77  GLY B O     1 
ATOM   4942  N  N     . THR B 1 78  ? -8.604  45.443  6.471   1.00 93.85  ? 78  THR B N     1 
ATOM   4943  C  CA    . THR B 1 78  ? -8.235  44.757  7.726   1.00 94.33  ? 78  THR B CA    1 
ATOM   4944  C  C     . THR B 1 78  ? -7.824  43.296  7.590   1.00 92.86  ? 78  THR B C     1 
ATOM   4945  O  O     . THR B 1 78  ? -8.288  42.584  6.688   1.00 97.73  ? 78  THR B O     1 
ATOM   4946  C  CB    . THR B 1 78  ? -9.392  44.819  8.753   1.00 103.54 ? 78  THR B CB    1 
ATOM   4947  O  OG1   . THR B 1 78  ? -9.482  43.557  9.484   1.00 114.05 ? 78  THR B OG1   1 
ATOM   4948  C  CG2   . THR B 1 78  ? -10.750 45.278  8.094   1.00 115.43 ? 78  THR B CG2   1 
ATOM   4949  N  N     . LEU B 1 79  ? -6.862  42.921  8.451   1.00 86.36  ? 79  LEU B N     1 
ATOM   4950  C  CA    . LEU B 1 79  ? -6.334  41.550  8.656   1.00 95.03  ? 79  LEU B CA    1 
ATOM   4951  C  C     . LEU B 1 79  ? -6.433  40.925  10.073  1.00 103.28 ? 79  LEU B C     1 
ATOM   4952  O  O     . LEU B 1 79  ? -6.407  41.650  11.060  1.00 111.03 ? 79  LEU B O     1 
ATOM   4953  C  CB    . LEU B 1 79  ? -4.861  41.414  8.278   1.00 101.34 ? 79  LEU B CB    1 
ATOM   4954  C  CG    . LEU B 1 79  ? -4.284  41.828  6.938   1.00 120.79 ? 79  LEU B CG    1 
ATOM   4955  C  CD1   . LEU B 1 79  ? -4.882  41.787  5.720   1.00 132.17 ? 79  LEU B CD1   1 
ATOM   4956  C  CD2   . LEU B 1 79  ? -3.485  42.803  6.936   1.00 121.45 ? 79  LEU B CD2   1 
ATOM   4957  N  N     . ALA B 1 80  ? -6.360  39.593  10.193  1.00 102.23 ? 80  ALA B N     1 
ATOM   4958  C  CA    . ALA B 1 80  ? -6.251  38.904  11.508  1.00 77.85  ? 80  ALA B CA    1 
ATOM   4959  C  C     . ALA B 1 80  ? -5.132  37.839  11.678  1.00 121.08 ? 80  ALA B C     1 
ATOM   4960  O  O     . ALA B 1 80  ? -5.174  36.802  11.016  1.00 124.02 ? 80  ALA B O     1 
ATOM   4961  C  CB    . ALA B 1 80  ? -7.572  38.259  11.852  1.00 68.75  ? 80  ALA B CB    1 
ATOM   4962  N  N     . ARG B 1 81  ? -4.130  38.105  12.526  1.00 113.67 ? 81  ARG B N     1 
ATOM   4963  C  CA    . ARG B 1 81  ? -3.073  37.109  12.816  1.00 112.91 ? 81  ARG B CA    1 
ATOM   4964  C  C     . ARG B 1 81  ? -2.808  36.843  14.315  1.00 126.51 ? 81  ARG B C     1 
ATOM   4965  O  O     . ARG B 1 81  ? -2.635  37.770  15.117  1.00 129.98 ? 81  ARG B O     1 
ATOM   4966  C  CB    . ARG B 1 81  ? -1.767  37.516  12.146  1.00 94.45  ? 81  ARG B CB    1 
ATOM   4967  N  N     . MET B 1 82  ? -2.794  35.554  14.668  1.00 136.51 ? 82  MET B N     1 
ATOM   4968  C  CA    . MET B 1 82  ? -2.573  35.081  16.046  1.00 131.23 ? 82  MET B CA    1 
ATOM   4969  C  C     . MET B 1 82  ? -3.356  35.845  17.113  1.00 124.84 ? 82  MET B C     1 
ATOM   4970  O  O     . MET B 1 82  ? -2.806  36.225  18.146  1.00 131.13 ? 82  MET B O     1 
ATOM   4971  C  CB    . MET B 1 82  ? -1.069  35.118  16.375  1.00 131.82 ? 82  MET B CB    1 
ATOM   4972  N  N     . GLY B 1 83  ? -4.632  36.089  16.838  1.00 123.64 ? 83  GLY B N     1 
ATOM   4973  C  CA    . GLY B 1 83  ? -5.508  36.781  17.768  1.00 111.75 ? 83  GLY B CA    1 
ATOM   4974  C  C     . GLY B 1 83  ? -5.518  38.274  17.516  1.00 109.26 ? 83  GLY B C     1 
ATOM   4975  O  O     . GLY B 1 83  ? -6.576  38.914  17.561  1.00 108.84 ? 83  GLY B O     1 
ATOM   4976  N  N     . GLN B 1 84  ? -4.345  38.829  17.227  1.00 98.07  ? 84  GLN B N     1 
ATOM   4977  C  CA    . GLN B 1 84  ? -4.214  40.268  17.005  1.00 99.42  ? 84  GLN B CA    1 
ATOM   4978  C  C     . GLN B 1 84  ? -4.799  40.709  15.627  1.00 115.82 ? 84  GLN B C     1 
ATOM   4979  O  O     . GLN B 1 84  ? -4.499  40.095  14.606  1.00 128.61 ? 84  GLN B O     1 
ATOM   4980  C  CB    . GLN B 1 84  ? -2.738  40.672  17.132  1.00 89.83  ? 84  GLN B CB    1 
ATOM   4981  N  N     . THR B 1 85  ? -5.609  41.775  15.622  1.00 102.41 ? 85  THR B N     1 
ATOM   4982  C  CA    . THR B 1 85  ? -6.195  42.385  14.421  1.00 100.70 ? 85  THR B CA    1 
ATOM   4983  C  C     . THR B 1 85  ? -5.470  43.644  13.902  1.00 107.49 ? 85  THR B C     1 
ATOM   4984  O  O     . THR B 1 85  ? -5.244  44.597  14.653  1.00 91.80  ? 85  THR B O     1 
ATOM   4985  C  CB    . THR B 1 85  ? -7.688  42.790  14.657  1.00 84.22  ? 85  THR B CB    1 
ATOM   4986  O  OG1   . THR B 1 85  ? -8.491  41.614  14.833  1.00 90.36  ? 85  THR B OG1   1 
ATOM   4987  C  CG2   . THR B 1 85  ? -8.221  43.689  13.525  1.00 87.28  ? 85  THR B CG2   1 
ATOM   4988  N  N     . TYR B 1 86  ? -5.124  43.647  12.610  1.00 105.61 ? 86  TYR B N     1 
ATOM   4989  C  CA    . TYR B 1 86  ? -4.466  44.806  12.017  1.00 106.39 ? 86  TYR B CA    1 
ATOM   4990  C  C     . TYR B 1 86  ? -5.300  45.519  10.955  1.00 102.95 ? 86  TYR B C     1 
ATOM   4991  O  O     . TYR B 1 86  ? -6.115  44.921  10.257  1.00 115.45 ? 86  TYR B O     1 
ATOM   4992  C  CB    . TYR B 1 86  ? -3.101  44.445  11.392  1.00 115.87 ? 86  TYR B CB    1 
ATOM   4993  C  CG    . TYR B 1 86  ? -2.173  43.831  12.381  1.00 122.74 ? 86  TYR B CG    1 
ATOM   4994  C  CD1   . TYR B 1 86  ? -2.014  44.449  13.590  1.00 131.86 ? 86  TYR B CD1   1 
ATOM   4995  C  CD2   . TYR B 1 86  ? -1.312  42.803  12.070  1.00 123.24 ? 86  TYR B CD2   1 
ATOM   4996  C  CE1   . TYR B 1 86  ? -1.145  43.972  14.563  1.00 131.72 ? 86  TYR B CE1   1 
ATOM   4997  C  CE2   . TYR B 1 86  ? -0.428  42.315  13.018  1.00 119.50 ? 86  TYR B CE2   1 
ATOM   4998  C  CZ    . TYR B 1 86  ? -0.336  42.911  14.259  1.00 120.12 ? 86  TYR B CZ    1 
ATOM   4999  O  OH    . TYR B 1 86  ? 0.575   42.363  15.162  1.00 110.66 ? 86  TYR B OH    1 
ATOM   5000  N  N     . ALA B 1 87  ? -5.054  46.820  10.834  1.00 98.54  ? 87  ALA B N     1 
ATOM   5001  C  CA    . ALA B 1 87  ? -5.666  47.629  9.791   1.00 88.98  ? 87  ALA B CA    1 
ATOM   5002  C  C     . ALA B 1 87  ? -4.558  48.064  8.846   1.00 96.16  ? 87  ALA B C     1 
ATOM   5003  O  O     . ALA B 1 87  ? -3.569  48.642  9.276   1.00 95.25  ? 87  ALA B O     1 
ATOM   5004  C  CB    . ALA B 1 87  ? -6.394  48.820  10.357  1.00 68.83  ? 87  ALA B CB    1 
ATOM   5005  N  N     . TYR B 1 88  ? -4.702  47.752  7.564   1.00 92.03  ? 88  TYR B N     1 
ATOM   5006  C  CA    . TYR B 1 88  ? -3.728  48.110  6.541   1.00 70.67  ? 88  TYR B CA    1 
ATOM   5007  C  C     . TYR B 1 88  ? -4.186  49.236  5.589   1.00 71.78  ? 88  TYR B C     1 
ATOM   5008  O  O     . TYR B 1 88  ? -5.402  49.439  5.370   1.00 76.41  ? 88  TYR B O     1 
ATOM   5009  C  CB    . TYR B 1 88  ? -3.323  46.891  5.694   1.00 60.41  ? 88  TYR B CB    1 
ATOM   5010  C  CG    . TYR B 1 88  ? -4.339  46.491  4.630   1.00 74.58  ? 88  TYR B CG    1 
ATOM   5011  C  CD1   . TYR B 1 88  ? -4.361  47.118  3.387   1.00 88.93  ? 88  TYR B CD1   1 
ATOM   5012  C  CD2   . TYR B 1 88  ? -5.228  45.453  4.835   1.00 71.25  ? 88  TYR B CD2   1 
ATOM   5013  C  CE1   . TYR B 1 88  ? -5.289  46.775  2.424   1.00 90.98  ? 88  TYR B CE1   1 
ATOM   5014  C  CE2   . TYR B 1 88  ? -6.150  45.085  3.848   1.00 73.35  ? 88  TYR B CE2   1 
ATOM   5015  C  CZ    . TYR B 1 88  ? -6.167  45.752  2.657   1.00 83.95  ? 88  TYR B CZ    1 
ATOM   5016  O  OH    . TYR B 1 88  ? -7.059  45.417  1.674   1.00 98.07  ? 88  TYR B OH    1 
ATOM   5017  N  N     . ARG B 1 89  ? -3.225  50.072  5.209   1.00 58.97  ? 89  ARG B N     1 
ATOM   5018  C  CA    . ARG B 1 89  ? -3.431  51.064  4.155   1.00 67.55  ? 89  ARG B CA    1 
ATOM   5019  C  C     . ARG B 1 89  ? -2.248  51.027  3.200   1.00 74.56  ? 89  ARG B C     1 
ATOM   5020  O  O     . ARG B 1 89  ? -1.108  51.029  3.637   1.00 86.56  ? 89  ARG B O     1 
ATOM   5021  C  CB    . ARG B 1 89  ? -3.623  52.485  4.663   1.00 67.03  ? 89  ARG B CB    1 
ATOM   5022  C  CG    . ARG B 1 89  ? -3.725  53.473  3.493   1.00 66.43  ? 89  ARG B CG    1 
ATOM   5023  C  CD    . ARG B 1 89  ? -4.269  54.821  3.886   1.00 75.23  ? 89  ARG B CD    1 
ATOM   5024  N  NE    . ARG B 1 89  ? -4.529  55.670  2.729   1.00 81.35  ? 89  ARG B NE    1 
ATOM   5025  C  CZ    . ARG B 1 89  ? -5.065  56.882  2.800   1.00 100.40 ? 89  ARG B CZ    1 
ATOM   5026  N  NH1   . ARG B 1 89  ? -5.329  57.424  3.984   1.00 121.20 ? 89  ARG B NH1   1 
ATOM   5027  N  NH2   . ARG B 1 89  ? -5.260  57.588  1.697   1.00 99.61  ? 89  ARG B NH2   1 
ATOM   5028  N  N     . LEU B 1 90  ? -2.523  50.964  1.905   1.00 67.33  ? 90  LEU B N     1 
ATOM   5029  C  CA    . LEU B 1 90  ? -1.480  50.878  0.881   1.00 66.57  ? 90  LEU B CA    1 
ATOM   5030  C  C     . LEU B 1 90  ? -1.376  52.198  0.134   1.00 78.10  ? 90  LEU B C     1 
ATOM   5031  O  O     . LEU B 1 90  ? -2.365  52.696  -0.396  1.00 78.70  ? 90  LEU B O     1 
ATOM   5032  C  CB    . LEU B 1 90  ? -1.699  49.748  -0.107  1.00 60.28  ? 90  LEU B CB    1 
ATOM   5033  C  CG    . LEU B 1 90  ? -1.990  48.404  0.536   1.00 63.55  ? 90  LEU B CG    1 
ATOM   5034  C  CD1   . LEU B 1 90  ? -2.183  47.302  -0.495  1.00 56.31  ? 90  LEU B CD1   1 
ATOM   5035  C  CD2   . LEU B 1 90  ? -0.902  48.065  1.508   1.00 75.63  ? 90  LEU B CD2   1 
ATOM   5036  N  N     . TYR B 1 91  ? -0.226  52.839  0.250   1.00 80.62  ? 91  TYR B N     1 
ATOM   5037  C  CA    . TYR B 1 91  ? 0.090   54.081  -0.467  1.00 78.08  ? 91  TYR B CA    1 
ATOM   5038  C  C     . TYR B 1 91  ? 0.913   53.798  -1.706  1.00 74.39  ? 91  TYR B C     1 
ATOM   5039  O  O     . TYR B 1 91  ? 2.004   53.246  -1.585  1.00 73.09  ? 91  TYR B O     1 
ATOM   5040  C  CB    . TYR B 1 91  ? 0.810   55.057  0.459   1.00 70.94  ? 91  TYR B CB    1 
ATOM   5041  C  CG    . TYR B 1 91  ? 0.040   55.547  1.672   1.00 63.77  ? 91  TYR B CG    1 
ATOM   5042  C  CD1   . TYR B 1 91  ? -0.950  56.509  1.544   1.00 71.55  ? 91  TYR B CD1   1 
ATOM   5043  C  CD2   . TYR B 1 91  ? 0.185   54.931  2.904   1.00 66.85  ? 91  TYR B CD2   1 
ATOM   5044  C  CE1   . TYR B 1 91  ? -1.657  56.964  2.638   1.00 76.24  ? 91  TYR B CE1   1 
ATOM   5045  C  CE2   . TYR B 1 91  ? -0.538  55.352  4.000   1.00 77.43  ? 91  TYR B CE2   1 
ATOM   5046  C  CZ    . TYR B 1 91  ? -1.459  56.371  3.865   1.00 81.89  ? 91  TYR B CZ    1 
ATOM   5047  O  OH    . TYR B 1 91  ? -2.192  56.807  4.954   1.00 88.36  ? 91  TYR B OH    1 
ATOM   5048  N  N     . PRO B 1 92  ? 0.356   54.101  -2.904  1.00 67.09  ? 92  PRO B N     1 
ATOM   5049  C  CA    . PRO B 1 92  ? 1.156   53.884  -4.114  1.00 75.16  ? 92  PRO B CA    1 
ATOM   5050  C  C     . PRO B 1 92  ? 2.383   54.779  -4.084  1.00 100.13 ? 92  PRO B C     1 
ATOM   5051  O  O     . PRO B 1 92  ? 2.280   55.971  -3.769  1.00 118.40 ? 92  PRO B O     1 
ATOM   5052  C  CB    . PRO B 1 92  ? 0.229   54.371  -5.227  1.00 69.84  ? 92  PRO B CB    1 
ATOM   5053  C  CG    . PRO B 1 92  ? -1.087  54.307  -4.679  1.00 61.34  ? 92  PRO B CG    1 
ATOM   5054  C  CD    . PRO B 1 92  ? -0.974  54.637  -3.227  1.00 60.45  ? 92  PRO B CD    1 
ATOM   5055  N  N     . LYS B 1 93  ? 3.507   54.254  -4.545  1.00 98.19  ? 93  LYS B N     1 
ATOM   5056  C  CA    . LYS B 1 93  ? 4.735   55.019  -4.547  1.00 92.60  ? 93  LYS B CA    1 
ATOM   5057  C  C     . LYS B 1 93  ? 5.480   54.887  -5.875  1.00 93.94  ? 93  LYS B C     1 
ATOM   5058  O  O     . LYS B 1 93  ? 6.680   54.635  -5.903  1.00 107.97 ? 93  LYS B O     1 
ATOM   5059  C  CB    . LYS B 1 93  ? 5.589   54.500  -3.356  1.00 91.29  ? 93  LYS B CB    1 
ATOM   5060  C  CG    . LYS B 1 93  ? 5.123   54.978  -1.960  1.00 94.63  ? 93  LYS B CG    1 
ATOM   5061  C  CD    . LYS B 1 93  ? 5.202   56.487  -2.016  1.00 97.37  ? 93  LYS B CD    1 
ATOM   5062  C  CE    . LYS B 1 93  ? 4.603   57.365  -0.950  1.00 102.53 ? 93  LYS B CE    1 
ATOM   5063  N  NZ    . LYS B 1 93  ? 5.098   57.472  0.432   1.00 111.12 ? 93  LYS B NZ    1 
ATOM   5064  N  N     . GLY B 1 94  ? 4.742   55.049  -6.962  1.00 82.14  ? 94  GLY B N     1 
ATOM   5065  C  CA    . GLY B 1 94  ? 5.262   55.054  -8.303  1.00 87.58  ? 94  GLY B CA    1 
ATOM   5066  C  C     . GLY B 1 94  ? 5.523   53.605  -8.722  1.00 104.86 ? 94  GLY B C     1 
ATOM   5067  O  O     . GLY B 1 94  ? 5.153   52.705  -7.990  1.00 101.83 ? 94  GLY B O     1 
ATOM   5068  N  N     . ARG B 1 95  ? 6.301   53.418  -9.800  1.00 110.78 ? 95  ARG B N     1 
ATOM   5069  C  CA    . ARG B 1 95  ? 6.640   52.115  -10.300 1.00 110.86 ? 95  ARG B CA    1 
ATOM   5070  C  C     . ARG B 1 95  ? 8.163   51.869  -10.495 1.00 117.43 ? 95  ARG B C     1 
ATOM   5071  O  O     . ARG B 1 95  ? 8.901   52.785  -10.809 1.00 125.27 ? 95  ARG B O     1 
ATOM   5072  C  CB    . ARG B 1 95  ? 5.956   51.753  -11.586 1.00 103.60 ? 95  ARG B CB    1 
ATOM   5073  C  CG    . ARG B 1 95  ? 4.509   51.841  -11.562 1.00 96.91  ? 95  ARG B CG    1 
ATOM   5074  C  CD    . ARG B 1 95  ? 4.208   51.290  -12.909 1.00 95.90  ? 95  ARG B CD    1 
ATOM   5075  N  NE    . ARG B 1 95  ? 2.875   51.439  -13.389 1.00 96.21  ? 95  ARG B NE    1 
ATOM   5076  C  CZ    . ARG B 1 95  ? 2.627   51.549  -14.698 1.00 100.34 ? 95  ARG B CZ    1 
ATOM   5077  N  NH1   . ARG B 1 95  ? 1.399   51.636  -15.265 1.00 102.13 ? 95  ARG B NH1   1 
ATOM   5078  N  NH2   . ARG B 1 95  ? 3.649   51.493  -15.471 1.00 101.92 ? 95  ARG B NH2   1 
ATOM   5079  N  N     . ARG B 1 96  ? 8.626   50.692  -10.110 1.00 116.75 ? 96  ARG B N     1 
ATOM   5080  C  CA    . ARG B 1 96  ? 10.048  50.366  -10.117 1.00 108.81 ? 96  ARG B CA    1 
ATOM   5081  C  C     . ARG B 1 96  ? 10.410  49.453  -11.282 1.00 120.24 ? 96  ARG B C     1 
ATOM   5082  O  O     . ARG B 1 96  ? 9.840   48.365  -11.412 1.00 126.65 ? 96  ARG B O     1 
ATOM   5083  C  CB    . ARG B 1 96  ? 10.522  49.833  -8.772  1.00 93.37  ? 96  ARG B CB    1 
ATOM   5084  C  CG    . ARG B 1 96  ? 10.921  48.409  -8.747  1.00 97.56  ? 96  ARG B CG    1 
ATOM   5085  C  CD    . ARG B 1 96  ? 11.446  48.125  -7.377  1.00 112.16 ? 96  ARG B CD    1 
ATOM   5086  N  NE    . ARG B 1 96  ? 12.493  49.084  -7.040  1.00 117.16 ? 96  ARG B NE    1 
ATOM   5087  C  CZ    . ARG B 1 96  ? 13.568  48.817  -6.304  1.00 120.12 ? 96  ARG B CZ    1 
ATOM   5088  N  NH1   . ARG B 1 96  ? 13.771  47.601  -5.825  1.00 124.22 ? 96  ARG B NH1   1 
ATOM   5089  N  NH2   . ARG B 1 96  ? 14.456  49.771  -6.061  1.00 123.72 ? 96  ARG B NH2   1 
ATOM   5090  N  N     . PRO B 1 97  ? 11.200  49.944  -12.239 1.00 124.16 ? 97  PRO B N     1 
ATOM   5091  C  CA    . PRO B 1 97  ? 11.705  49.163  -13.377 1.00 121.59 ? 97  PRO B CA    1 
ATOM   5092  C  C     . PRO B 1 97  ? 12.496  47.902  -12.962 1.00 115.55 ? 97  PRO B C     1 
ATOM   5093  O  O     . PRO B 1 97  ? 13.510  48.009  -12.252 1.00 119.93 ? 97  PRO B O     1 
ATOM   5094  C  CB    . PRO B 1 97  ? 12.643  50.134  -14.080 1.00 119.57 ? 97  PRO B CB    1 
ATOM   5095  C  CG    . PRO B 1 97  ? 12.149  51.482  -13.700 1.00 115.73 ? 97  PRO B CG    1 
ATOM   5096  C  CD    . PRO B 1 97  ? 11.685  51.341  -12.284 1.00 120.38 ? 97  PRO B CD    1 
ATOM   5097  N  N     . LEU B 1 98  ? 11.898  46.739  -13.192 1.00 110.99 ? 98  LEU B N     1 
ATOM   5098  C  CA    . LEU B 1 98  ? 12.494  45.482  -12.754 1.00 119.69 ? 98  LEU B CA    1 
ATOM   5099  C  C     . LEU B 1 98  ? 13.222  44.759  -13.873 1.00 134.39 ? 98  LEU B C     1 
ATOM   5100  O  O     . LEU B 1 98  ? 12.716  44.624  -14.987 1.00 126.79 ? 98  LEU B O     1 
ATOM   5101  C  CB    . LEU B 1 98  ? 11.385  44.636  -12.262 1.00 100.37 ? 98  LEU B CB    1 
ATOM   5102  C  CG    . LEU B 1 98  ? 11.226  44.704  -10.761 1.00 87.30  ? 98  LEU B CG    1 
ATOM   5103  C  CD1   . LEU B 1 98  ? 10.483  43.858  -10.266 1.00 83.95  ? 98  LEU B CD1   1 
ATOM   5104  C  CD2   . LEU B 1 98  ? 12.185  44.461  -9.980  1.00 81.30  ? 98  LEU B CD2   1 
ATOM   5105  N  N     . ASP B 1 99  ? 14.481  44.519  -13.739 1.00 123.04 ? 99  ASP B N     1 
ATOM   5106  C  CA    . ASP B 1 99  ? 15.208  43.876  -14.822 1.00 125.86 ? 99  ASP B CA    1 
ATOM   5107  C  C     . ASP B 1 99  ? 15.344  42.326  -14.746 1.00 109.60 ? 99  ASP B C     1 
ATOM   5108  O  O     . ASP B 1 99  ? 15.973  41.851  -13.752 1.00 122.65 ? 99  ASP B O     1 
ATOM   5109  C  CB    . ASP B 1 99  ? 16.448  44.544  -15.027 1.00 134.17 ? 99  ASP B CB    1 
ATOM   5110  C  CG    . ASP B 1 99  ? 17.193  43.949  -16.168 1.00 139.71 ? 99  ASP B CG    1 
ATOM   5111  O  OD1   . ASP B 1 99  ? 16.991  42.875  -16.761 1.00 141.80 ? 99  ASP B OD1   1 
ATOM   5112  O  OD2   . ASP B 1 99  ? 17.899  44.732  -16.695 1.00 139.65 ? 99  ASP B OD2   1 
ATOM   5113  N  N     . PRO B 1 100 ? 14.959  41.532  -15.758 1.00 114.13 ? 100 PRO B N     1 
ATOM   5114  C  CA    . PRO B 1 100 ? 15.072  40.082  -15.533 1.00 115.02 ? 100 PRO B CA    1 
ATOM   5115  C  C     . PRO B 1 100 ? 16.538  39.528  -15.293 1.00 125.46 ? 100 PRO B C     1 
ATOM   5116  O  O     . PRO B 1 100 ? 16.655  38.358  -14.843 1.00 127.88 ? 100 PRO B O     1 
ATOM   5117  C  CB    . PRO B 1 100 ? 14.497  39.497  -16.762 1.00 118.42 ? 100 PRO B CB    1 
ATOM   5118  C  CG    . PRO B 1 100 ? 13.637  40.594  -17.458 1.00 65.87  ? 100 PRO B CG    1 
ATOM   5119  C  CD    . PRO B 1 100 ? 14.423  41.853  -17.063 1.00 88.20  ? 100 PRO B CD    1 
ATOM   5120  N  N     . LYS B 1 101 ? 17.603  40.277  -15.621 1.00 117.37 ? 101 LYS B N     1 
ATOM   5121  C  CA    . LYS B 1 101 ? 19.005  39.781  -15.364 1.00 123.80 ? 101 LYS B CA    1 
ATOM   5122  C  C     . LYS B 1 101 ? 19.477  39.770  -13.915 1.00 128.48 ? 101 LYS B C     1 
ATOM   5123  O  O     . LYS B 1 101 ? 20.257  38.905  -13.503 1.00 124.71 ? 101 LYS B O     1 
ATOM   5124  C  CB    . LYS B 1 101 ? 20.030  40.617  -16.085 1.00 128.89 ? 101 LYS B CB    1 
ATOM   5125  C  CG    . LYS B 1 101 ? 19.608  41.830  -16.841 1.00 134.35 ? 101 LYS B CG    1 
ATOM   5126  C  CD    . LYS B 1 101 ? 20.753  42.675  -17.268 1.00 139.22 ? 101 LYS B CD    1 
ATOM   5127  C  CE    . LYS B 1 101 ? 20.497  44.177  -17.484 1.00 150.12 ? 101 LYS B CE    1 
ATOM   5128  N  NZ    . LYS B 1 101 ? 19.720  44.778  -18.670 1.00 146.70 ? 101 LYS B NZ    1 
ATOM   5129  N  N     . ASP B 1 102 ? 19.056  40.807  -13.199 1.00 117.82 ? 102 ASP B N     1 
ATOM   5130  C  CA    . ASP B 1 102 ? 19.408  40.985  -11.811 1.00 128.09 ? 102 ASP B CA    1 
ATOM   5131  C  C     . ASP B 1 102 ? 18.556  39.953  -11.146 1.00 137.57 ? 102 ASP B C     1 
ATOM   5132  O  O     . ASP B 1 102 ? 17.378  40.161  -10.918 1.00 144.39 ? 102 ASP B O     1 
ATOM   5133  C  CB    . ASP B 1 102 ? 19.070  42.399  -11.347 1.00 126.29 ? 102 ASP B CB    1 
ATOM   5134  C  CG    . ASP B 1 102 ? 19.034  42.537  -9.840  1.00 130.75 ? 102 ASP B CG    1 
ATOM   5135  O  OD1   . ASP B 1 102 ? 18.237  41.828  -9.191  1.00 140.03 ? 102 ASP B OD1   1 
ATOM   5136  O  OD2   . ASP B 1 102 ? 19.784  43.372  -9.302  1.00 125.94 ? 102 ASP B OD2   1 
ATOM   5137  N  N     . PRO B 1 103 ? 19.212  38.771  -10.855 1.00 134.85 ? 103 PRO B N     1 
ATOM   5138  C  CA    . PRO B 1 103 ? 18.363  37.731  -10.260 1.00 136.48 ? 103 PRO B CA    1 
ATOM   5139  C  C     . PRO B 1 103 ? 17.484  38.182  -9.099  1.00 135.50 ? 103 PRO B C     1 
ATOM   5140  O  O     . PRO B 1 103 ? 16.530  37.496  -8.750  1.00 133.05 ? 103 PRO B O     1 
ATOM   5141  C  CB    . PRO B 1 103 ? 19.368  36.679  -9.803  1.00 137.41 ? 103 PRO B CB    1 
ATOM   5142  C  CG    . PRO B 1 103 ? 20.436  36.748  -10.818 1.00 133.45 ? 103 PRO B CG    1 
ATOM   5143  C  CD    . PRO B 1 103 ? 20.638  38.215  -10.929 1.00 129.59 ? 103 PRO B CD    1 
ATOM   5144  N  N     . GLY B 1 104 ? 17.792  39.328  -8.516  1.00 144.92 ? 104 GLY B N     1 
ATOM   5145  C  CA    . GLY B 1 104 ? 16.979  39.811  -7.426  1.00 133.84 ? 104 GLY B CA    1 
ATOM   5146  C  C     . GLY B 1 104 ? 15.636  40.167  -8.011  1.00 116.16 ? 104 GLY B C     1 
ATOM   5147  O  O     . GLY B 1 104 ? 14.585  39.678  -7.604  1.00 106.67 ? 104 GLY B O     1 
ATOM   5148  N  N     . GLU B 1 105 ? 15.693  41.032  -9.002  1.00 120.59 ? 105 GLU B N     1 
ATOM   5149  C  CA    . GLU B 1 105 ? 14.505  41.481  -9.674  1.00 106.51 ? 105 GLU B CA    1 
ATOM   5150  C  C     . GLU B 1 105 ? 13.735  40.300  -10.252 1.00 100.68 ? 105 GLU B C     1 
ATOM   5151  O  O     . GLU B 1 105 ? 12.559  40.168  -10.008 1.00 109.58 ? 105 GLU B O     1 
ATOM   5152  C  CB    . GLU B 1 105 ? 14.861  42.552  -10.703 1.00 30.00  ? 105 GLU B CB    1 
ATOM   5153  C  CG    . GLU B 1 105 ? 16.036  43.415  -10.264 1.00 30.00  ? 105 GLU B CG    1 
ATOM   5154  C  CD    . GLU B 1 105 ? 15.838  44.898  -10.468 1.00 30.00  ? 105 GLU B CD    1 
ATOM   5155  O  OE1   . GLU B 1 105 ? 16.352  45.680  -9.653  1.00 30.00  ? 105 GLU B OE1   1 
ATOM   5156  O  OE2   . GLU B 1 105 ? 15.198  45.291  -11.452 1.00 30.00  ? 105 GLU B OE2   1 
ATOM   5157  N  N     . ARG B 1 106 ? 14.390  39.429  -10.993 1.00 95.46  ? 106 ARG B N     1 
ATOM   5158  C  CA    . ARG B 1 106 ? 13.706  38.278  -11.558 1.00 94.01  ? 106 ARG B CA    1 
ATOM   5159  C  C     . ARG B 1 106 ? 12.876  37.538  -10.516 1.00 97.40  ? 106 ARG B C     1 
ATOM   5160  O  O     . ARG B 1 106 ? 11.768  37.133  -10.792 1.00 102.47 ? 106 ARG B O     1 
ATOM   5161  C  CB    . ARG B 1 106 ? 14.705  37.314  -12.198 1.00 97.17  ? 106 ARG B CB    1 
ATOM   5162  C  CG    . ARG B 1 106 ? 14.540  37.128  -13.693 1.00 92.78  ? 106 ARG B CG    1 
ATOM   5163  C  CD    . ARG B 1 106 ? 14.485  35.670  -14.076 1.00 99.42  ? 106 ARG B CD    1 
ATOM   5164  N  NE    . ARG B 1 106 ? 15.330  34.860  -13.217 1.00 114.17 ? 106 ARG B NE    1 
ATOM   5165  C  CZ    . ARG B 1 106 ? 15.561  33.569  -13.419 1.00 127.87 ? 106 ARG B CZ    1 
ATOM   5166  N  NH1   . ARG B 1 106 ? 15.010  32.955  -14.455 1.00 128.62 ? 106 ARG B NH1   1 
ATOM   5167  N  NH2   . ARG B 1 106 ? 16.343  32.893  -12.594 1.00 139.12 ? 106 ARG B NH2   1 
ATOM   5168  N  N     . SER B 1 107 ? 13.410  37.351  -9.319  1.00 96.01  ? 107 SER B N     1 
ATOM   5169  C  CA    . SER B 1 107 ? 12.677  36.649  -8.272  1.00 100.56 ? 107 SER B CA    1 
ATOM   5170  C  C     . SER B 1 107 ? 11.359  37.336  -7.976  1.00 107.73 ? 107 SER B C     1 
ATOM   5171  O  O     . SER B 1 107 ? 10.326  36.671  -7.806  1.00 107.02 ? 107 SER B O     1 
ATOM   5172  C  CB    . SER B 1 107 ? 13.532  36.550  -7.002  1.00 94.12  ? 107 SER B CB    1 
ATOM   5173  N  N     . VAL B 1 108 ? 11.377  38.668  -7.989  1.00 107.73 ? 108 VAL B N     1 
ATOM   5174  C  CA    . VAL B 1 108 ? 10.140  39.413  -7.750  1.00 99.49  ? 108 VAL B CA    1 
ATOM   5175  C  C     . VAL B 1 108 ? 9.183   39.221  -8.936  1.00 95.84  ? 108 VAL B C     1 
ATOM   5176  O  O     . VAL B 1 108 ? 7.978   38.989  -8.750  1.00 102.59 ? 108 VAL B O     1 
ATOM   5177  C  CB    . VAL B 1 108 ? 10.397  40.916  -7.520  1.00 96.86  ? 108 VAL B CB    1 
ATOM   5178  C  CG1   . VAL B 1 108 ? 9.092   41.652  -7.251  1.00 102.67 ? 108 VAL B CG1   1 
ATOM   5179  C  CG2   . VAL B 1 108 ? 11.393  41.128  -6.397  1.00 95.32  ? 108 VAL B CG2   1 
ATOM   5180  N  N     . LEU B 1 109 ? 9.732   39.269  -10.151 1.00 94.37  ? 109 LEU B N     1 
ATOM   5181  C  CA    . LEU B 1 109 ? 8.945   39.008  -11.362 1.00 85.43  ? 109 LEU B CA    1 
ATOM   5182  C  C     . LEU B 1 109 ? 8.352   37.599  -11.401 1.00 85.23  ? 109 LEU B C     1 
ATOM   5183  O  O     . LEU B 1 109 ? 7.270   37.397  -11.940 1.00 84.28  ? 109 LEU B O     1 
ATOM   5184  C  CB    . LEU B 1 109 ? 9.759   39.267  -12.627 1.00 91.32  ? 109 LEU B CB    1 
ATOM   5185  C  CG    . LEU B 1 109 ? 10.312  40.680  -12.840 1.00 99.34  ? 109 LEU B CG    1 
ATOM   5186  C  CD1   . LEU B 1 109 ? 11.325  40.687  -13.972 1.00 109.69 ? 109 LEU B CD1   1 
ATOM   5187  C  CD2   . LEU B 1 109 ? 9.188   41.649  -13.153 1.00 87.76  ? 109 LEU B CD2   1 
ATOM   5188  N  N     . SER B 1 110 ? 9.093   36.617  -10.917 1.00 84.62  ? 110 SER B N     1 
ATOM   5189  C  CA    . SER B 1 110 ? 8.632   35.241  -10.894 1.00 83.64  ? 110 SER B CA    1 
ATOM   5190  C  C     . SER B 1 110 ? 7.531   35.110  -9.870  1.00 84.98  ? 110 SER B C     1 
ATOM   5191  O  O     . SER B 1 110 ? 6.574   34.358  -10.074 1.00 91.28  ? 110 SER B O     1 
ATOM   5192  C  CB    . SER B 1 110 ? 9.760   34.269  -10.598 1.00 84.27  ? 110 SER B CB    1 
ATOM   5193  O  OG    . SER B 1 110 ? 10.642  34.219  -11.701 1.00 79.37  ? 110 SER B OG    1 
ATOM   5194  N  N     . ALA B 1 111 ? 7.657   35.845  -8.765  1.00 83.78  ? 111 ALA B N     1 
ATOM   5195  C  CA    . ALA B 1 111 ? 6.595   35.809  -7.764  1.00 82.15  ? 111 ALA B CA    1 
ATOM   5196  C  C     . ALA B 1 111 ? 5.313   36.418  -8.317  1.00 72.42  ? 111 ALA B C     1 
ATOM   5197  O  O     . ALA B 1 111 ? 4.226   35.840  -8.163  1.00 65.96  ? 111 ALA B O     1 
ATOM   5198  C  CB    . ALA B 1 111 ? 7.034   36.548  -6.525  1.00 80.87  ? 111 ALA B CB    1 
ATOM   5199  N  N     . LEU B 1 112 ? 5.458   37.531  -9.034  1.00 71.66  ? 112 LEU B N     1 
ATOM   5200  C  CA    . LEU B 1 112 ? 4.341   38.116  -9.757  1.00 76.12  ? 112 LEU B CA    1 
ATOM   5201  C  C     . LEU B 1 112 ? 3.777   37.132  -10.770 1.00 75.01  ? 112 LEU B C     1 
ATOM   5202  O  O     . LEU B 1 112 ? 2.561   37.041  -10.938 1.00 75.88  ? 112 LEU B O     1 
ATOM   5203  C  CB    . LEU B 1 112 ? 4.746   39.403  -10.474 1.00 79.34  ? 112 LEU B CB    1 
ATOM   5204  C  CG    . LEU B 1 112 ? 4.970   40.609  -9.558  1.00 88.48  ? 112 LEU B CG    1 
ATOM   5205  C  CD1   . LEU B 1 112 ? 5.924   41.608  -10.226 1.00 91.40  ? 112 LEU B CD1   1 
ATOM   5206  C  CD2   . LEU B 1 112 ? 3.693   41.269  -9.083  1.00 94.14  ? 112 LEU B CD2   1 
ATOM   5207  N  N     . ALA B 1 113 ? 4.658   36.421  -11.468 1.00 73.65  ? 113 ALA B N     1 
ATOM   5208  C  CA    . ALA B 1 113 ? 4.211   35.457  -12.463 1.00 73.28  ? 113 ALA B CA    1 
ATOM   5209  C  C     . ALA B 1 113 ? 3.385   34.328  -11.856 1.00 76.97  ? 113 ALA B C     1 
ATOM   5210  O  O     . ALA B 1 113 ? 2.364   33.938  -12.427 1.00 77.31  ? 113 ALA B O     1 
ATOM   5211  C  CB    . ALA B 1 113 ? 5.391   34.890  -13.193 1.00 62.75  ? 113 ALA B CB    1 
ATOM   5212  N  N     . ARG B 1 114 ? 3.829   33.794  -10.717 1.00 74.12  ? 114 ARG B N     1 
ATOM   5213  C  CA    . ARG B 1 114 ? 3.052   32.728  -10.092 1.00 71.74  ? 114 ARG B CA    1 
ATOM   5214  C  C     . ARG B 1 114 ? 1.725   33.252  -9.643  1.00 72.70  ? 114 ARG B C     1 
ATOM   5215  O  O     . ARG B 1 114 ? 0.717   32.571  -9.774  1.00 78.11  ? 114 ARG B O     1 
ATOM   5216  C  CB    . ARG B 1 114 ? 3.712   32.077  -8.880  1.00 73.17  ? 114 ARG B CB    1 
ATOM   5217  C  CG    . ARG B 1 114 ? 5.013   31.399  -9.159  1.00 90.75  ? 114 ARG B CG    1 
ATOM   5218  C  CD    . ARG B 1 114 ? 5.763   31.146  -7.870  1.00 99.63  ? 114 ARG B CD    1 
ATOM   5219  N  NE    . ARG B 1 114 ? 5.148   30.016  -7.176  1.00 104.04 ? 114 ARG B NE    1 
ATOM   5220  C  CZ    . ARG B 1 114 ? 5.615   28.773  -7.227  1.00 115.64 ? 114 ARG B CZ    1 
ATOM   5221  N  NH1   . ARG B 1 114 ? 6.713   28.514  -7.921  1.00 121.70 ? 114 ARG B NH1   1 
ATOM   5222  N  NH2   . ARG B 1 114 ? 4.998   27.792  -6.574  1.00 119.96 ? 114 ARG B NH2   1 
ATOM   5223  N  N     . ARG B 1 115 ? 1.743   34.467  -9.091  1.00 76.17  ? 115 ARG B N     1 
ATOM   5224  C  CA    . ARG B 1 115 ? 0.465   34.960  -8.674  1.00 82.21  ? 115 ARG B CA    1 
ATOM   5225  C  C     . ARG B 1 115 ? -0.467  35.179  -9.869  1.00 82.30  ? 115 ARG B C     1 
ATOM   5226  O  O     . ARG B 1 115 ? -1.579  34.640  -9.863  1.00 71.13  ? 115 ARG B O     1 
ATOM   5227  C  CB    . ARG B 1 115 ? 0.605   36.192  -7.787  1.00 93.87  ? 115 ARG B CB    1 
ATOM   5228  C  CG    . ARG B 1 115 ? -0.731  36.430  -7.240  1.00 102.81 ? 115 ARG B CG    1 
ATOM   5229  C  CD    . ARG B 1 115 ? -0.969  36.501  -5.794  1.00 100.99 ? 115 ARG B CD    1 
ATOM   5230  N  NE    . ARG B 1 115 ? 0.178   36.777  -4.939  1.00 106.35 ? 115 ARG B NE    1 
ATOM   5231  C  CZ    . ARG B 1 115 ? 0.027   37.242  -3.702  1.00 117.87 ? 115 ARG B CZ    1 
ATOM   5232  N  NH1   . ARG B 1 115 ? -1.184  37.471  -3.250  1.00 125.67 ? 115 ARG B NH1   1 
ATOM   5233  N  NH2   . ARG B 1 115 ? 1.095   37.518  -2.980  1.00 122.38 ? 115 ARG B NH2   1 
ATOM   5234  N  N     . LEU B 1 116 ? 0.041   35.741  -10.964 1.00 78.14  ? 116 LEU B N     1 
ATOM   5235  C  CA    . LEU B 1 116 ? -0.765  35.842  -12.166 1.00 69.30  ? 116 LEU B CA    1 
ATOM   5236  C  C     . LEU B 1 116 ? -1.331  34.511  -12.554 1.00 72.50  ? 116 LEU B C     1 
ATOM   5237  O  O     . LEU B 1 116 ? -2.518  34.402  -12.815 1.00 67.55  ? 116 LEU B O     1 
ATOM   5238  C  CB    . LEU B 1 116 ? 0.093   36.348  -13.359 1.00 79.82  ? 116 LEU B CB    1 
ATOM   5239  C  CG    . LEU B 1 116 ? -0.479  36.741  -14.733 1.00 68.38  ? 116 LEU B CG    1 
ATOM   5240  C  CD1   . LEU B 1 116 ? 0.542   37.560  -15.480 1.00 69.97  ? 116 LEU B CD1   1 
ATOM   5241  C  CD2   . LEU B 1 116 ? -0.763  35.445  -15.518 1.00 54.88  ? 116 LEU B CD2   1 
ATOM   5242  N  N     . LEU B 1 117 ? -0.500  33.481  -12.605 1.00 80.50  ? 117 LEU B N     1 
ATOM   5243  C  CA    . LEU B 1 117 ? -1.016  32.169  -12.973 1.00 78.42  ? 117 LEU B CA    1 
ATOM   5244  C  C     . LEU B 1 117 ? -2.110  31.584  -12.086 1.00 82.35  ? 117 LEU B C     1 
ATOM   5245  O  O     . LEU B 1 117 ? -3.158  31.147  -12.577 1.00 94.13  ? 117 LEU B O     1 
ATOM   5246  C  CB    . LEU B 1 117 ? 0.155   31.205  -13.019 1.00 62.19  ? 117 LEU B CB    1 
ATOM   5247  C  CG    . LEU B 1 117 ? -0.268  29.786  -13.324 1.00 62.86  ? 117 LEU B CG    1 
ATOM   5248  C  CD1   . LEU B 1 117 ? -0.733  29.706  -14.751 1.00 62.78  ? 117 LEU B CD1   1 
ATOM   5249  C  CD2   . LEU B 1 117 ? 0.922   28.841  -13.089 1.00 65.42  ? 117 LEU B CD2   1 
ATOM   5250  N  N     . GLN B 1 118 ? -1.902  31.639  -10.784 1.00 78.47  ? 118 GLN B N     1 
ATOM   5251  C  CA    . GLN B 1 118 ? -2.861  31.149  -9.839  1.00 77.30  ? 118 GLN B CA    1 
ATOM   5252  C  C     . GLN B 1 118 ? -4.198  31.879  -10.013 1.00 81.62  ? 118 GLN B C     1 
ATOM   5253  O  O     . GLN B 1 118 ? -5.273  31.267  -10.151 1.00 85.60  ? 118 GLN B O     1 
ATOM   5254  C  CB    . GLN B 1 118 ? -2.373  31.484  -8.440  1.00 79.20  ? 118 GLN B CB    1 
ATOM   5255  C  CG    . GLN B 1 118 ? -3.103  30.909  -7.273  1.00 100.42 ? 118 GLN B CG    1 
ATOM   5256  C  CD    . GLN B 1 118 ? -2.355  31.225  -5.993  1.00 113.91 ? 118 GLN B CD    1 
ATOM   5257  O  OE1   . GLN B 1 118 ? -1.626  32.232  -5.940  1.00 120.24 ? 118 GLN B OE1   1 
ATOM   5258  N  NE2   . GLN B 1 118 ? -2.572  30.446  -4.955  1.00 115.99 ? 118 GLN B NE2   1 
ATOM   5259  N  N     . GLU B 1 119 ? -4.073  33.226  -10.048 1.00 81.75  ? 119 GLU B N     1 
ATOM   5260  C  CA    . GLU B 1 119 ? -5.192  34.171  -10.218 1.00 80.91  ? 119 GLU B CA    1 
ATOM   5261  C  C     . GLU B 1 119 ? -6.006  33.996  -11.522 1.00 86.70  ? 119 GLU B C     1 
ATOM   5262  O  O     . GLU B 1 119 ? -7.263  33.905  -11.520 1.00 91.59  ? 119 GLU B O     1 
ATOM   5263  C  CB    . GLU B 1 119 ? -4.665  35.649  -10.064 1.00 105.82 ? 119 GLU B CB    1 
ATOM   5264  C  CG    . GLU B 1 119 ? -4.223  35.538  -8.690  1.00 115.32 ? 119 GLU B CG    1 
ATOM   5265  C  CD    . GLU B 1 119 ? -4.068  36.561  -7.609  1.00 124.00 ? 119 GLU B CD    1 
ATOM   5266  O  OE1   . GLU B 1 119 ? -3.270  37.546  -7.682  1.00 137.86 ? 119 GLU B OE1   1 
ATOM   5267  O  OE2   . GLU B 1 119 ? -4.678  36.138  -6.594  1.00 121.93 ? 119 GLU B OE2   1 
ATOM   5268  N  N     . ARG B 1 120 ? -5.261  33.857  -12.624 1.00 82.54  ? 120 ARG B N     1 
ATOM   5269  C  CA    . ARG B 1 120 ? -5.880  33.697  -13.941 1.00 80.91  ? 120 ARG B CA    1 
ATOM   5270  C  C     . ARG B 1 120 ? -6.619  32.361  -13.949 1.00 90.60  ? 120 ARG B C     1 
ATOM   5271  O  O     . ARG B 1 120 ? -7.703  32.262  -14.515 1.00 93.69  ? 120 ARG B O     1 
ATOM   5272  C  CB    . ARG B 1 120 ? -4.868  33.881  -15.042 1.00 78.41  ? 120 ARG B CB    1 
ATOM   5273  C  CG    . ARG B 1 120 ? -4.382  35.336  -15.157 1.00 71.48  ? 120 ARG B CG    1 
ATOM   5274  C  CD    . ARG B 1 120 ? -4.050  35.689  -16.573 1.00 78.91  ? 120 ARG B CD    1 
ATOM   5275  N  NE    . ARG B 1 120 ? -3.513  37.037  -16.647 1.00 79.29  ? 120 ARG B NE    1 
ATOM   5276  C  CZ    . ARG B 1 120 ? -3.157  37.612  -17.783 1.00 86.05  ? 120 ARG B CZ    1 
ATOM   5277  N  NH1   . ARG B 1 120 ? -3.321  36.951  -18.919 1.00 87.48  ? 120 ARG B NH1   1 
ATOM   5278  N  NH2   . ARG B 1 120 ? -2.676  38.846  -17.790 1.00 87.71  ? 120 ARG B NH2   1 
ATOM   5279  N  N     . LEU B 1 121 ? -6.034  31.342  -13.296 1.00 98.69  ? 121 LEU B N     1 
ATOM   5280  C  CA    . LEU B 1 121 ? -6.629  30.015  -13.262 1.00 97.62  ? 121 LEU B CA    1 
ATOM   5281  C  C     . LEU B 1 121 ? -7.905  30.028  -12.430 1.00 113.31 ? 121 LEU B C     1 
ATOM   5282  O  O     . LEU B 1 121 ? -8.824  29.263  -12.722 1.00 116.80 ? 121 LEU B O     1 
ATOM   5283  C  CB    . LEU B 1 121 ? -5.659  28.983  -12.639 1.00 84.04  ? 121 LEU B CB    1 
ATOM   5284  C  CG    . LEU B 1 121 ? -4.340  28.537  -13.303 1.00 79.46  ? 121 LEU B CG    1 
ATOM   5285  C  CD1   . LEU B 1 121 ? -3.743  27.347  -12.586 1.00 74.84  ? 121 LEU B CD1   1 
ATOM   5286  C  CD2   . LEU B 1 121 ? -4.595  28.156  -14.771 1.00 85.15  ? 121 LEU B CD2   1 
ATOM   5287  N  N     . ARG B 1 122 ? -7.985  30.887  -11.416 1.00 99.65  ? 122 ARG B N     1 
ATOM   5288  C  CA    . ARG B 1 122 ? -9.208  30.912  -10.617 1.00 95.46  ? 122 ARG B CA    1 
ATOM   5289  C  C     . ARG B 1 122 ? -10.355 31.393  -11.449 1.00 103.64 ? 122 ARG B C     1 
ATOM   5290  O  O     . ARG B 1 122 ? -11.522 31.165  -11.135 1.00 101.47 ? 122 ARG B O     1 
ATOM   5291  C  CB    . ARG B 1 122 ? -9.358  32.025  -9.692  1.00 97.61  ? 122 ARG B CB    1 
ATOM   5292  C  CG    . ARG B 1 122 ? -8.564  32.275  -8.700  1.00 105.22 ? 122 ARG B CG    1 
ATOM   5293  C  CD    . ARG B 1 122 ? -9.123  33.565  -8.129  1.00 124.48 ? 122 ARG B CD    1 
ATOM   5294  N  NE    . ARG B 1 122 ? -7.922  34.295  -7.701  1.00 126.88 ? 122 ARG B NE    1 
ATOM   5295  C  CZ    . ARG B 1 122 ? -7.811  35.516  -7.156  1.00 126.91 ? 122 ARG B CZ    1 
ATOM   5296  N  NH1   . ARG B 1 122 ? -8.855  36.186  -6.702  1.00 131.46 ? 122 ARG B NH1   1 
ATOM   5297  N  NH2   . ARG B 1 122 ? -6.610  35.982  -6.873  1.00 129.79 ? 122 ARG B NH2   1 
ATOM   5298  N  N     . ARG B 1 123 ? -10.001 32.181  -12.470 1.00 111.30 ? 123 ARG B N     1 
ATOM   5299  C  CA    . ARG B 1 123 ? -11.111 32.745  -13.281 1.00 93.02  ? 123 ARG B CA    1 
ATOM   5300  C  C     . ARG B 1 123 ? -11.491 31.955  -14.479 1.00 88.98  ? 123 ARG B C     1 
ATOM   5301  O  O     . ARG B 1 123 ? -12.247 32.446  -15.336 1.00 100.42 ? 123 ARG B O     1 
ATOM   5302  C  CB    . ARG B 1 123 ? -10.668 34.080  -13.825 1.00 92.89  ? 123 ARG B CB    1 
ATOM   5303  C  CG    . ARG B 1 123 ? -10.641 35.146  -12.938 1.00 103.02 ? 123 ARG B CG    1 
ATOM   5304  C  CD    . ARG B 1 123 ? -10.130 36.378  -13.522 1.00 114.39 ? 123 ARG B CD    1 
ATOM   5305  N  NE    . ARG B 1 123 ? -9.178  36.925  -12.522 1.00 118.72 ? 123 ARG B NE    1 
ATOM   5306  C  CZ    . ARG B 1 123 ? -9.515  37.824  -11.622 1.00 122.34 ? 123 ARG B CZ    1 
ATOM   5307  N  NH1   . ARG B 1 123 ? -10.742 38.264  -11.583 1.00 122.38 ? 123 ARG B NH1   1 
ATOM   5308  N  NH2   . ARG B 1 123 ? -8.601  38.250  -10.766 1.00 124.23 ? 123 ARG B NH2   1 
ATOM   5309  N  N     . LEU B 1 124 ? -10.886 30.776  -14.597 1.00 107.73 ? 124 LEU B N     1 
ATOM   5310  C  CA    . LEU B 1 124 ? -11.134 29.794  -15.648 1.00 98.53  ? 124 LEU B CA    1 
ATOM   5311  C  C     . LEU B 1 124 ? -12.471 29.101  -15.394 1.00 115.11 ? 124 LEU B C     1 
ATOM   5312  O  O     . LEU B 1 124 ? -12.707 28.598  -14.300 1.00 110.75 ? 124 LEU B O     1 
ATOM   5313  C  CB    . LEU B 1 124 ? -9.979  28.785  -15.764 1.00 79.47  ? 124 LEU B CB    1 
ATOM   5314  N  N     . GLU B 1 125 ? -13.346 29.103  -16.396 1.00 130.22 ? 125 GLU B N     1 
ATOM   5315  C  CA    . GLU B 1 125 ? -14.677 28.507  -16.261 1.00 129.29 ? 125 GLU B CA    1 
ATOM   5316  C  C     . GLU B 1 125 ? -14.735 27.030  -16.723 1.00 126.68 ? 125 GLU B C     1 
ATOM   5317  O  O     . GLU B 1 125 ? -14.174 26.611  -17.741 1.00 130.75 ? 125 GLU B O     1 
ATOM   5318  C  CB    . GLU B 1 125 ? -15.713 29.341  -17.007 1.00 130.11 ? 125 GLU B CB    1 
ATOM   5319  N  N     . GLY B 1 126 ? -15.446 26.284  -15.895 1.00 124.46 ? 126 GLY B N     1 
ATOM   5320  C  CA    . GLY B 1 126 ? -15.807 24.894  -15.932 1.00 119.04 ? 126 GLY B CA    1 
ATOM   5321  C  C     . GLY B 1 126 ? -14.672 23.916  -15.792 1.00 115.26 ? 126 GLY B C     1 
ATOM   5322  O  O     . GLY B 1 126 ? -14.688 22.858  -16.407 1.00 105.74 ? 126 GLY B O     1 
ATOM   5323  N  N     . VAL B 1 127 ? -13.714 24.243  -14.938 1.00 119.32 ? 127 VAL B N     1 
ATOM   5324  C  CA    . VAL B 1 127 ? -12.482 23.470  -14.704 1.00 116.93 ? 127 VAL B CA    1 
ATOM   5325  C  C     . VAL B 1 127 ? -12.160 23.457  -13.210 1.00 118.67 ? 127 VAL B C     1 
ATOM   5326  O  O     . VAL B 1 127 ? -12.478 24.401  -12.489 1.00 118.79 ? 127 VAL B O     1 
ATOM   5327  C  CB    . VAL B 1 127 ? -11.305 24.011  -15.509 1.00 109.01 ? 127 VAL B CB    1 
ATOM   5328  N  N     . TRP B 1 128 ? -11.640 22.346  -12.731 1.00 112.49 ? 128 TRP B N     1 
ATOM   5329  C  CA    . TRP B 1 128 ? -11.244 22.258  -11.323 1.00 111.08 ? 128 TRP B CA    1 
ATOM   5330  C  C     . TRP B 1 128 ? -9.909  22.785  -10.829 1.00 103.41 ? 128 TRP B C     1 
ATOM   5331  O  O     . TRP B 1 128 ? -8.854  22.207  -10.989 1.00 109.89 ? 128 TRP B O     1 
ATOM   5332  C  CB    . TRP B 1 128 ? -11.343 20.785  -10.933 1.00 117.79 ? 128 TRP B CB    1 
ATOM   5333  C  CG    . TRP B 1 128 ? -11.025 20.503  -9.506  1.00 124.52 ? 128 TRP B CG    1 
ATOM   5334  C  CD1   . TRP B 1 128 ? -9.832  20.049  -9.149  1.00 128.37 ? 128 TRP B CD1   1 
ATOM   5335  C  CD2   . TRP B 1 128 ? -11.721 20.850  -8.306  1.00 128.08 ? 128 TRP B CD2   1 
ATOM   5336  N  NE1   . TRP B 1 128 ? -9.721  19.939  -7.800  1.00 130.68 ? 128 TRP B NE1   1 
ATOM   5337  C  CE2   . TRP B 1 128 ? -10.867 20.422  -7.241  1.00 127.74 ? 128 TRP B CE2   1 
ATOM   5338  C  CE3   . TRP B 1 128 ? -12.982 21.382  -8.019  1.00 130.83 ? 128 TRP B CE3   1 
ATOM   5339  C  CZ2   . TRP B 1 128 ? -11.188 20.546  -5.915  1.00 127.96 ? 128 TRP B CZ2   1 
ATOM   5340  C  CZ3   . TRP B 1 128 ? -13.318 21.497  -6.677  1.00 125.78 ? 128 TRP B CZ3   1 
ATOM   5341  C  CH2   . TRP B 1 128 ? -12.412 21.084  -5.645  1.00 124.82 ? 128 TRP B CH2   1 
ATOM   5342  N  N     . VAL B 1 129 ? -9.999  23.891  -10.103 1.00 99.49  ? 129 VAL B N     1 
ATOM   5343  C  CA    . VAL B 1 129 ? -8.780  24.545  -9.623  1.00 78.33  ? 129 VAL B CA    1 
ATOM   5344  C  C     . VAL B 1 129 ? -8.527  24.464  -8.131  1.00 89.81  ? 129 VAL B C     1 
ATOM   5345  O  O     . VAL B 1 129 ? -9.413  24.757  -7.301  1.00 103.94 ? 129 VAL B O     1 
ATOM   5346  C  CB    . VAL B 1 129 ? -8.769  26.040  -10.053 1.00 102.23 ? 129 VAL B CB    1 
ATOM   5347  C  CG1   . VAL B 1 129 ? -7.543  26.759  -9.485  1.00 97.08  ? 129 VAL B CG1   1 
ATOM   5348  C  CG2   . VAL B 1 129 ? -8.788  26.149  -11.556 1.00 97.29  ? 129 VAL B CG2   1 
ATOM   5349  N  N     . GLU B 1 130 ? -7.309  24.024  -7.804  1.00 91.76  ? 130 GLU B N     1 
ATOM   5350  C  CA    . GLU B 1 130 ? -6.847  24.049  -6.431  1.00 94.23  ? 130 GLU B CA    1 
ATOM   5351  C  C     . GLU B 1 130 ? -5.468  24.687  -6.340  1.00 81.30  ? 130 GLU B C     1 
ATOM   5352  O  O     . GLU B 1 130 ? -4.474  24.015  -6.542  1.00 68.45  ? 130 GLU B O     1 
ATOM   5353  C  CB    . GLU B 1 130 ? -6.780  22.634  -5.805  1.00 104.02 ? 130 GLU B CB    1 
ATOM   5354  C  CG    . GLU B 1 130 ? -8.061  21.858  -5.523  1.00 113.16 ? 130 GLU B CG    1 
ATOM   5355  C  CD    . GLU B 1 130 ? -7.778  20.482  -4.951  1.00 122.32 ? 130 GLU B CD    1 
ATOM   5356  O  OE1   . GLU B 1 130 ? -6.589  20.206  -4.810  1.00 127.29 ? 130 GLU B OE1   1 
ATOM   5357  O  OE2   . GLU B 1 130 ? -8.699  19.688  -4.626  1.00 129.08 ? 130 GLU B OE2   1 
ATOM   5358  N  N     . GLY B 1 131 ? -5.392  25.960  -5.947  1.00 87.22  ? 131 GLY B N     1 
ATOM   5359  C  CA    . GLY B 1 131 ? -4.095  26.608  -5.963  1.00 90.20  ? 131 GLY B CA    1 
ATOM   5360  C  C     . GLY B 1 131 ? -3.653  26.605  -7.412  1.00 87.25  ? 131 GLY B C     1 
ATOM   5361  O  O     . GLY B 1 131 ? -4.305  27.185  -8.298  1.00 81.27  ? 131 GLY B O     1 
ATOM   5362  N  N     . LEU B 1 132 ? -2.479  26.022  -7.626  1.00 74.92  ? 132 LEU B N     1 
ATOM   5363  C  CA    . LEU B 1 132 ? -1.857  25.900  -8.926  1.00 64.72  ? 132 LEU B CA    1 
ATOM   5364  C  C     . LEU B 1 132 ? -2.143  24.565  -9.630  1.00 73.64  ? 132 LEU B C     1 
ATOM   5365  O  O     . LEU B 1 132 ? -1.434  24.218  -10.587 1.00 79.88  ? 132 LEU B O     1 
ATOM   5366  C  CB    . LEU B 1 132 ? -0.349  26.057  -8.798  1.00 61.87  ? 132 LEU B CB    1 
ATOM   5367  C  CG    . LEU B 1 132 ? 0.047   27.358  -8.142  1.00 73.06  ? 132 LEU B CG    1 
ATOM   5368  C  CD1   . LEU B 1 132 ? 1.545   27.438  -7.890  1.00 63.52  ? 132 LEU B CD1   1 
ATOM   5369  C  CD2   . LEU B 1 132 ? -0.372  28.478  -9.119  1.00 88.99  ? 132 LEU B CD2   1 
ATOM   5370  N  N     . ALA B 1 133 ? -3.115  23.784  -9.146  1.00 73.30  ? 133 ALA B N     1 
ATOM   5371  C  CA    . ALA B 1 133 ? -3.551  22.572  -9.874  1.00 78.83  ? 133 ALA B CA    1 
ATOM   5372  C  C     . ALA B 1 133 ? -4.870  22.742  -10.644 1.00 83.73  ? 133 ALA B C     1 
ATOM   5373  O  O     . ALA B 1 133 ? -5.780  23.399  -10.165 1.00 98.15  ? 133 ALA B O     1 
ATOM   5374  C  CB    . ALA B 1 133 ? -3.664  21.405  -8.935  1.00 83.40  ? 133 ALA B CB    1 
ATOM   5375  N  N     . VAL B 1 134 ? -4.957  22.186  -11.845 1.00 83.47  ? 134 VAL B N     1 
ATOM   5376  C  CA    . VAL B 1 134 ? -6.180  22.225  -12.653 1.00 96.48  ? 134 VAL B CA    1 
ATOM   5377  C  C     . VAL B 1 134 ? -6.580  20.817  -13.099 1.00 100.36 ? 134 VAL B C     1 
ATOM   5378  O  O     . VAL B 1 134 ? -5.713  20.027  -13.465 1.00 96.01  ? 134 VAL B O     1 
ATOM   5379  C  CB    . VAL B 1 134 ? -6.089  23.150  -13.878 1.00 96.69  ? 134 VAL B CB    1 
ATOM   5380  C  CG1   . VAL B 1 134 ? -6.092  24.614  -13.449 1.00 101.54 ? 134 VAL B CG1   1 
ATOM   5381  C  CG2   . VAL B 1 134 ? -4.883  22.807  -14.707 1.00 90.34  ? 134 VAL B CG2   1 
ATOM   5382  N  N     . TYR B 1 135 ? -7.839  20.443  -12.912 1.00 108.59 ? 135 TYR B N     1 
ATOM   5383  C  CA    . TYR B 1 135 ? -8.339  19.145  -13.366 1.00 113.49 ? 135 TYR B CA    1 
ATOM   5384  C  C     . TYR B 1 135 ? -9.477  19.268  -14.399 1.00 116.40 ? 135 TYR B C     1 
ATOM   5385  O  O     . TYR B 1 135 ? -10.395 20.106  -14.277 1.00 122.63 ? 135 TYR B O     1 
ATOM   5386  C  CB    . TYR B 1 135 ? -8.747  18.305  -12.173 1.00 112.56 ? 135 TYR B CB    1 
ATOM   5387  C  CG    . TYR B 1 135 ? -7.619  18.120  -11.183 1.00 103.04 ? 135 TYR B CG    1 
ATOM   5388  C  CD1   . TYR B 1 135 ? -6.622  17.179  -11.380 1.00 101.08 ? 135 TYR B CD1   1 
ATOM   5389  C  CD2   . TYR B 1 135 ? -7.483  18.972  -10.123 1.00 98.09  ? 135 TYR B CD2   1 
ATOM   5390  C  CE1   . TYR B 1 135 ? -5.593  17.057  -10.466 1.00 95.27  ? 135 TYR B CE1   1 
ATOM   5391  C  CE2   . TYR B 1 135 ? -6.488  18.860  -9.217  1.00 92.09  ? 135 TYR B CE2   1 
ATOM   5392  C  CZ    . TYR B 1 135 ? -5.543  17.913  -9.392  1.00 87.63  ? 135 TYR B CZ    1 
ATOM   5393  O  OH    . TYR B 1 135 ? -4.552  17.832  -8.464  1.00 95.56  ? 135 TYR B OH    1 
ATOM   5394  N  N     . ARG B 1 136 ? -9.374  18.413  -15.414 1.00 100.50 ? 136 ARG B N     1 
ATOM   5395  C  CA    . ARG B 1 136 ? -10.045 18.557  -16.705 1.00 102.88 ? 136 ARG B CA    1 
ATOM   5396  C  C     . ARG B 1 136 ? -10.765 17.332  -17.264 1.00 104.43 ? 136 ARG B C     1 
ATOM   5397  O  O     . ARG B 1 136 ? -11.857 17.444  -17.832 1.00 114.40 ? 136 ARG B O     1 
ATOM   5398  C  CB    . ARG B 1 136 ? -9.017  18.945  -17.733 1.00 103.69 ? 136 ARG B CB    1 
ATOM   5399  C  CG    . ARG B 1 136 ? -8.144  20.006  -17.303 1.00 107.87 ? 136 ARG B CG    1 
ATOM   5400  C  CD    . ARG B 1 136 ? -6.987  19.883  -18.164 1.00 112.33 ? 136 ARG B CD    1 
ATOM   5401  N  NE    . ARG B 1 136 ? -6.096  20.986  -17.948 1.00 123.31 ? 136 ARG B NE    1 
ATOM   5402  C  CZ    . ARG B 1 136 ? -5.415  21.560  -18.921 1.00 131.20 ? 136 ARG B CZ    1 
ATOM   5403  N  NH1   . ARG B 1 136 ? -5.513  21.119  -20.171 1.00 136.75 ? 136 ARG B NH1   1 
ATOM   5404  N  NH2   . ARG B 1 136 ? -4.630  22.570  -18.642 1.00 129.87 ? 136 ARG B NH2   1 
ATOM   5405  N  N     . ARG B 1 137 ? -10.137 16.169  -17.102 1.00 102.94 ? 137 ARG B N     1 
ATOM   5406  C  CA    . ARG B 1 137 ? -10.638 14.938  -17.696 1.00 97.51  ? 137 ARG B CA    1 
ATOM   5407  C  C     . ARG B 1 137 ? -10.865 13.785  -16.729 1.00 110.37 ? 137 ARG B C     1 
ATOM   5408  O  O     . ARG B 1 137 ? -10.073 13.542  -15.820 1.00 121.29 ? 137 ARG B O     1 
ATOM   5409  C  CB    . ARG B 1 137 ? -9.677  14.488  -18.817 1.00 82.34  ? 137 ARG B CB    1 
ATOM   5410  N  N     . GLU B 1 138 ? -12.002 13.117  -16.906 1.00 115.15 ? 138 GLU B N     1 
ATOM   5411  C  CA    . GLU B 1 138 ? -12.343 11.930  -16.133 1.00 114.55 ? 138 GLU B CA    1 
ATOM   5412  C  C     . GLU B 1 138 ? -11.401 10.771  -16.451 1.00 114.14 ? 138 GLU B C     1 
ATOM   5413  O  O     . GLU B 1 138 ? -10.960 10.054  -15.549 1.00 107.96 ? 138 GLU B O     1 
ATOM   5414  C  CB    . GLU B 1 138 ? -13.758 11.518  -16.431 1.00 115.40 ? 138 GLU B CB    1 
ATOM   5415  N  N     . GLY B 1 144 ? -19.694 9.691   -9.045  1.00 115.85 ? 144 GLY B N     1 
ATOM   5416  C  CA    . GLY B 1 144 ? -19.846 9.618   -7.599  1.00 118.72 ? 144 GLY B CA    1 
ATOM   5417  C  C     . GLY B 1 144 ? -18.608 8.996   -6.970  1.00 136.36 ? 144 GLY B C     1 
ATOM   5418  O  O     . GLY B 1 144 ? -18.627 8.559   -5.805  1.00 143.63 ? 144 GLY B O     1 
ATOM   5419  N  N     . TRP B 1 145 ? -17.519 8.981   -7.739  1.00 136.20 ? 145 TRP B N     1 
ATOM   5420  C  CA    . TRP B 1 145 ? -16.226 8.427   -7.310  1.00 132.24 ? 145 TRP B CA    1 
ATOM   5421  C  C     . TRP B 1 145 ? -15.105 9.128   -8.063  1.00 138.95 ? 145 TRP B C     1 
ATOM   5422  O  O     . TRP B 1 145 ? -14.237 9.774   -7.468  1.00 142.15 ? 145 TRP B O     1 
ATOM   5423  C  CB    . TRP B 1 145 ? -16.158 6.906   -7.561  1.00 121.99 ? 145 TRP B CB    1 
ATOM   5424  N  N     . ARG B 1 146 ? -15.124 8.982   -9.380  1.00 138.97 ? 146 ARG B N     1 
ATOM   5425  C  CA    . ARG B 1 146 ? -14.268 9.689   -10.280 1.00 132.56 ? 146 ARG B CA    1 
ATOM   5426  C  C     . ARG B 1 146 ? -12.730 9.649   -10.182 1.00 125.15 ? 146 ARG B C     1 
ATOM   5427  O  O     . ARG B 1 146 ? -12.155 9.505   -9.120  1.00 127.85 ? 146 ARG B O     1 
ATOM   5428  C  CB    . ARG B 1 146 ? -14.531 11.195  -9.962  1.00 124.21 ? 146 ARG B CB    1 
ATOM   5429  C  CG    . ARG B 1 146 ? -15.619 11.955  -10.551 1.00 128.95 ? 146 ARG B CG    1 
ATOM   5430  C  CD    . ARG B 1 146 ? -15.816 11.532  -11.936 1.00 131.90 ? 146 ARG B CD    1 
ATOM   5431  N  NE    . ARG B 1 146 ? -16.913 12.227  -12.572 1.00 134.04 ? 146 ARG B NE    1 
ATOM   5432  C  CZ    . ARG B 1 146 ? -16.987 12.368  -13.893 1.00 130.86 ? 146 ARG B CZ    1 
ATOM   5433  N  NH1   . ARG B 1 146 ? -16.071 11.805  -14.653 1.00 131.42 ? 146 ARG B NH1   1 
ATOM   5434  N  NH2   . ARG B 1 146 ? -17.988 13.021  -14.479 1.00 129.64 ? 146 ARG B NH2   1 
ATOM   5435  N  N     . VAL B 1 147 ? -12.090 9.736   -11.350 1.00 123.69 ? 147 VAL B N     1 
ATOM   5436  C  CA    . VAL B 1 147 ? -10.638 9.905   -11.423 1.00 108.45 ? 147 VAL B CA    1 
ATOM   5437  C  C     . VAL B 1 147 ? -10.423 11.301  -11.999 1.00 113.08 ? 147 VAL B C     1 
ATOM   5438  O  O     . VAL B 1 147 ? -10.887 11.505  -13.141 1.00 109.17 ? 147 VAL B O     1 
ATOM   5439  C  CB    . VAL B 1 147 ? -10.006 8.831   -12.293 1.00 103.11 ? 147 VAL B CB    1 
ATOM   5440  N  N     . LEU B 1 148 ? -9.751  12.272  -11.385 1.00 109.63 ? 148 LEU B N     1 
ATOM   5441  C  CA    . LEU B 1 148 ? -9.619  13.532  -12.171 1.00 114.28 ? 148 LEU B CA    1 
ATOM   5442  C  C     . LEU B 1 148 ? -8.216  13.687  -12.790 1.00 110.11 ? 148 LEU B C     1 
ATOM   5443  O  O     . LEU B 1 148 ? -7.226  13.403  -12.135 1.00 117.06 ? 148 LEU B O     1 
ATOM   5444  C  CB    . LEU B 1 148 ? -9.959  14.755  -11.296 1.00 115.79 ? 148 LEU B CB    1 
ATOM   5445  N  N     . GLY B 1 149 ? -8.128  14.123  -14.043 1.00 103.94 ? 149 GLY B N     1 
ATOM   5446  C  CA    . GLY B 1 149 ? -6.816  14.312  -14.695 1.00 94.71  ? 149 GLY B CA    1 
ATOM   5447  C  C     . GLY B 1 149 ? -6.416  15.773  -14.790 1.00 93.45  ? 149 GLY B C     1 
ATOM   5448  O  O     . GLY B 1 149 ? -7.271  16.631  -14.953 1.00 103.73 ? 149 GLY B O     1 
ATOM   5449  N  N     . GLY B 1 150 ? -5.137  16.088  -14.698 1.00 89.28  ? 150 GLY B N     1 
ATOM   5450  C  CA    . GLY B 1 150 ? -4.747  17.475  -14.803 1.00 83.19  ? 150 GLY B CA    1 
ATOM   5451  C  C     . GLY B 1 150 ? -3.263  17.692  -14.742 1.00 76.68  ? 150 GLY B C     1 
ATOM   5452  O  O     . GLY B 1 150 ? -2.509  16.877  -15.244 1.00 79.96  ? 150 GLY B O     1 
ATOM   5453  N  N     . ALA B 1 151 ? -2.842  18.764  -14.084 1.00 75.29  ? 151 ALA B N     1 
ATOM   5454  C  CA    . ALA B 1 151 ? -1.418  19.031  -13.889 1.00 74.51  ? 151 ALA B CA    1 
ATOM   5455  C  C     . ALA B 1 151 ? -1.153  19.984  -12.738 1.00 72.79  ? 151 ALA B C     1 
ATOM   5456  O  O     . ALA B 1 151 ? -1.999  20.781  -12.363 1.00 79.77  ? 151 ALA B O     1 
ATOM   5457  C  CB    . ALA B 1 151 ? -0.785  19.569  -15.162 1.00 71.85  ? 151 ALA B CB    1 
ATOM   5458  N  N     . VAL B 1 152 ? 0.022   19.864  -12.157 1.00 70.69  ? 152 VAL B N     1 
ATOM   5459  C  CA    . VAL B 1 152 ? 0.554   20.873  -11.278 1.00 66.55  ? 152 VAL B CA    1 
ATOM   5460  C  C     . VAL B 1 152 ? 1.328   21.878  -12.128 1.00 60.67  ? 152 VAL B C     1 
ATOM   5461  O  O     . VAL B 1 152 ? 2.114   21.476  -12.996 1.00 67.51  ? 152 VAL B O     1 
ATOM   5462  C  CB    . VAL B 1 152 ? 1.452   20.279  -10.237 1.00 56.71  ? 152 VAL B CB    1 
ATOM   5463  C  CG1   . VAL B 1 152 ? 2.063   21.403  -9.414  1.00 43.70  ? 152 VAL B CG1   1 
ATOM   5464  C  CG2   . VAL B 1 152 ? 0.650   19.321  -9.383  1.00 64.90  ? 152 VAL B CG2   1 
ATOM   5465  N  N     . LEU B 1 153 ? 1.070   23.166  -11.923 1.00 52.11  ? 153 LEU B N     1 
ATOM   5466  C  CA    . LEU B 1 153 ? 1.647   24.207  -12.773 1.00 61.52  ? 153 LEU B CA    1 
ATOM   5467  C  C     . LEU B 1 153 ? 2.593   25.155  -12.063 1.00 71.49  ? 153 LEU B C     1 
ATOM   5468  O  O     . LEU B 1 153 ? 2.488   25.385  -10.853 1.00 75.81  ? 153 LEU B O     1 
ATOM   5469  C  CB    . LEU B 1 153 ? 0.552   25.041  -13.414 1.00 64.20  ? 153 LEU B CB    1 
ATOM   5470  C  CG    . LEU B 1 153 ? -0.549  24.273  -14.117 1.00 70.27  ? 153 LEU B CG    1 
ATOM   5471  C  CD1   . LEU B 1 153 ? -1.545  25.294  -14.591 1.00 82.28  ? 153 LEU B CD1   1 
ATOM   5472  C  CD2   . LEU B 1 153 ? 0.010   23.446  -15.270 1.00 58.67  ? 153 LEU B CD2   1 
ATOM   5473  N  N     . ASP B 1 154 ? 3.448   25.794  -12.845 1.00 69.74  ? 154 ASP B N     1 
ATOM   5474  C  CA    . ASP B 1 154 ? 4.226   26.884  -12.293 1.00 70.80  ? 154 ASP B CA    1 
ATOM   5475  C  C     . ASP B 1 154 ? 4.576   27.922  -13.381 1.00 66.12  ? 154 ASP B C     1 
ATOM   5476  O  O     . ASP B 1 154 ? 4.561   27.623  -14.585 1.00 61.46  ? 154 ASP B O     1 
ATOM   5477  C  CB    . ASP B 1 154 ? 5.484   26.300  -11.649 1.00 74.83  ? 154 ASP B CB    1 
ATOM   5478  C  CG    . ASP B 1 154 ? 6.131   27.236  -10.648 1.00 85.10  ? 154 ASP B CG    1 
ATOM   5479  O  OD1   . ASP B 1 154 ? 5.527   28.285  -10.347 1.00 88.08  ? 154 ASP B OD1   1 
ATOM   5480  O  OD2   . ASP B 1 154 ? 7.234   26.898  -10.135 1.00 86.59  ? 154 ASP B OD2   1 
ATOM   5481  N  N     . LEU B 1 155 ? 4.846   29.152  -12.944 1.00 59.35  ? 155 LEU B N     1 
ATOM   5482  C  CA    . LEU B 1 155 ? 5.180   30.248  -13.852 1.00 72.92  ? 155 LEU B CA    1 
ATOM   5483  C  C     . LEU B 1 155 ? 6.296   31.137  -13.344 1.00 77.49  ? 155 LEU B C     1 
ATOM   5484  O  O     . LEU B 1 155 ? 6.206   31.665  -12.235 1.00 81.30  ? 155 LEU B O     1 
ATOM   5485  C  CB    . LEU B 1 155 ? 3.952   31.123  -14.103 1.00 76.32  ? 155 LEU B CB    1 
ATOM   5486  C  CG    . LEU B 1 155 ? 3.701   31.536  -15.547 1.00 82.28  ? 155 LEU B CG    1 
ATOM   5487  C  CD1   . LEU B 1 155 ? 3.904   30.363  -16.495 1.00 78.46  ? 155 LEU B CD1   1 
ATOM   5488  C  CD2   . LEU B 1 155 ? 2.314   32.167  -15.710 1.00 84.64  ? 155 LEU B CD2   1 
ATOM   5489  N  N     . TRP B 1 156 ? 7.368   31.283  -14.120 1.00 73.17  ? 156 TRP B N     1 
ATOM   5490  C  CA    . TRP B 1 156 ? 8.357   32.280  -13.744 1.00 69.90  ? 156 TRP B CA    1 
ATOM   5491  C  C     . TRP B 1 156 ? 8.833   33.041  -14.966 1.00 78.80  ? 156 TRP B C     1 
ATOM   5492  O  O     . TRP B 1 156 ? 8.268   32.897  -16.034 1.00 86.18  ? 156 TRP B O     1 
ATOM   5493  C  CB    . TRP B 1 156 ? 9.480   31.608  -12.948 1.00 77.40  ? 156 TRP B CB    1 
ATOM   5494  C  CG    . TRP B 1 156 ? 10.299  30.586  -13.645 1.00 77.61  ? 156 TRP B CG    1 
ATOM   5495  C  CD1   . TRP B 1 156 ? 11.444  30.794  -14.354 1.00 79.80  ? 156 TRP B CD1   1 
ATOM   5496  C  CD2   . TRP B 1 156 ? 9.971   29.202  -13.801 1.00 75.97  ? 156 TRP B CD2   1 
ATOM   5497  N  NE1   . TRP B 1 156 ? 11.899  29.603  -14.878 1.00 79.87  ? 156 TRP B NE1   1 
ATOM   5498  C  CE2   . TRP B 1 156 ? 11.001  28.613  -14.569 1.00 73.78  ? 156 TRP B CE2   1 
ATOM   5499  C  CE3   . TRP B 1 156 ? 8.915   28.396  -13.354 1.00 71.06  ? 156 TRP B CE3   1 
ATOM   5500  C  CZ2   . TRP B 1 156 ? 11.010  27.251  -14.894 1.00 57.37  ? 156 TRP B CZ2   1 
ATOM   5501  C  CZ3   . TRP B 1 156 ? 8.921   27.037  -13.685 1.00 68.75  ? 156 TRP B CZ3   1 
ATOM   5502  C  CH2   . TRP B 1 156 ? 9.963   26.483  -14.447 1.00 63.73  ? 156 TRP B CH2   1 
ATOM   5503  N  N     . VAL B 1 157 ? 9.849   33.875  -14.800 1.00 83.49  ? 157 VAL B N     1 
ATOM   5504  C  CA    . VAL B 1 157 ? 10.387  34.692  -15.892 1.00 92.77  ? 157 VAL B CA    1 
ATOM   5505  C  C     . VAL B 1 157 ? 11.839  34.389  -16.325 1.00 98.03  ? 157 VAL B C     1 
ATOM   5506  O  O     . VAL B 1 157 ? 12.729  34.246  -15.475 1.00 98.03  ? 157 VAL B O     1 
ATOM   5507  C  CB    . VAL B 1 157 ? 10.250  36.172  -15.541 1.00 90.91  ? 157 VAL B CB    1 
ATOM   5508  C  CG1   . VAL B 1 157 ? 8.793   36.503  -15.389 1.00 90.38  ? 157 VAL B CG1   1 
ATOM   5509  C  CG2   . VAL B 1 157 ? 10.931  36.448  -14.246 1.00 97.98  ? 157 VAL B CG2   1 
ATOM   5510  N  N     . SER B 1 158 ? 12.085  34.235  -17.626 1.00 96.49  ? 158 SER B N     1 
ATOM   5511  C  CA    . SER B 1 158 ? 13.455  33.955  -18.043 1.00 88.08  ? 158 SER B CA    1 
ATOM   5512  C  C     . SER B 1 158 ? 14.175  35.276  -17.971 1.00 105.72 ? 158 SER B C     1 
ATOM   5513  O  O     . SER B 1 158 ? 13.557  36.339  -18.006 1.00 112.50 ? 158 SER B O     1 
ATOM   5514  C  CB    . SER B 1 158 ? 13.578  33.374  -19.458 1.00 76.56  ? 158 SER B CB    1 
ATOM   5515  O  OG    . SER B 1 158 ? 13.085  34.233  -20.463 1.00 65.65  ? 158 SER B OG    1 
ATOM   5516  N  N     . ASP B 1 159 ? 15.493  35.198  -17.905 1.00 100.19 ? 159 ASP B N     1 
ATOM   5517  C  CA    . ASP B 1 159 ? 16.329  36.380  -17.848 1.00 114.35 ? 159 ASP B CA    1 
ATOM   5518  C  C     . ASP B 1 159 ? 16.301  37.221  -19.113 1.00 116.06 ? 159 ASP B C     1 
ATOM   5519  O  O     . ASP B 1 159 ? 16.750  38.362  -19.101 1.00 127.42 ? 159 ASP B O     1 
ATOM   5520  C  CB    . ASP B 1 159 ? 17.752  35.940  -17.535 1.00 124.65 ? 159 ASP B CB    1 
ATOM   5521  C  CG    . ASP B 1 159 ? 18.371  35.173  -18.675 1.00 130.00 ? 159 ASP B CG    1 
ATOM   5522  O  OD1   . ASP B 1 159 ? 17.608  34.517  -19.421 1.00 128.02 ? 159 ASP B OD1   1 
ATOM   5523  O  OD2   . ASP B 1 159 ? 19.608  35.215  -18.820 1.00 140.33 ? 159 ASP B OD2   1 
ATOM   5524  N  N     . SER B 1 160 ? 15.768  36.660  -20.195 1.00 105.69 ? 160 SER B N     1 
ATOM   5525  C  CA    . SER B 1 160 ? 15.528  37.414  -21.428 1.00 91.15  ? 160 SER B CA    1 
ATOM   5526  C  C     . SER B 1 160 ? 14.146  38.044  -21.333 1.00 94.68  ? 160 SER B C     1 
ATOM   5527  O  O     . SER B 1 160 ? 13.676  38.659  -22.278 1.00 96.09  ? 160 SER B O     1 
ATOM   5528  C  CB    . SER B 1 160 ? 15.629  36.550  -22.680 1.00 83.76  ? 160 SER B CB    1 
ATOM   5529  O  OG    . SER B 1 160 ? 14.746  35.445  -22.619 1.00 88.51  ? 160 SER B OG    1 
ATOM   5530  N  N     . GLY B 1 161 ? 13.502  37.897  -20.178 1.00 102.14 ? 161 GLY B N     1 
ATOM   5531  C  CA    . GLY B 1 161 ? 12.223  38.536  -19.956 1.00 102.03 ? 161 GLY B CA    1 
ATOM   5532  C  C     . GLY B 1 161 ? 10.963  37.926  -20.544 1.00 95.76  ? 161 GLY B C     1 
ATOM   5533  O  O     . GLY B 1 161 ? 10.091  38.650  -21.015 1.00 100.50 ? 161 GLY B O     1 
ATOM   5534  N  N     . ALA B 1 162 ? 10.880  36.598  -20.553 1.00 93.40  ? 162 ALA B N     1 
ATOM   5535  C  CA    . ALA B 1 162 ? 9.694   35.905  -21.066 1.00 91.59  ? 162 ALA B CA    1 
ATOM   5536  C  C     . ALA B 1 162 ? 9.111   34.894  -20.044 1.00 91.95  ? 162 ALA B C     1 
ATOM   5537  O  O     . ALA B 1 162 ? 9.827   34.385  -19.184 1.00 90.70  ? 162 ALA B O     1 
ATOM   5538  C  CB    . ALA B 1 162 ? 10.022  35.206  -22.364 1.00 88.59  ? 162 ALA B CB    1 
ATOM   5539  N  N     . PHE B 1 163 ? 7.804   34.638  -20.126 1.00 84.23  ? 163 PHE B N     1 
ATOM   5540  C  CA    . PHE B 1 163 ? 7.138   33.639  -19.274 1.00 90.14  ? 163 PHE B CA    1 
ATOM   5541  C  C     . PHE B 1 163 ? 7.562   32.195  -19.524 1.00 87.33  ? 163 PHE B C     1 
ATOM   5542  O  O     . PHE B 1 163 ? 7.616   31.731  -20.659 1.00 85.33  ? 163 PHE B O     1 
ATOM   5543  C  CB    . PHE B 1 163 ? 5.603   33.734  -19.411 1.00 92.47  ? 163 PHE B CB    1 
ATOM   5544  C  CG    . PHE B 1 163 ? 4.997   34.949  -18.753 1.00 92.12  ? 163 PHE B CG    1 
ATOM   5545  C  CD1   . PHE B 1 163 ? 4.818   34.983  -17.383 1.00 87.21  ? 163 PHE B CD1   1 
ATOM   5546  C  CD2   . PHE B 1 163 ? 4.659   36.077  -19.497 1.00 92.15  ? 163 PHE B CD2   1 
ATOM   5547  C  CE1   . PHE B 1 163 ? 4.272   36.099  -16.762 1.00 89.58  ? 163 PHE B CE1   1 
ATOM   5548  C  CE2   . PHE B 1 163 ? 4.124   37.197  -18.886 1.00 89.71  ? 163 PHE B CE2   1 
ATOM   5549  C  CZ    . PHE B 1 163 ? 3.928   37.208  -17.516 1.00 91.66  ? 163 PHE B CZ    1 
ATOM   5550  N  N     . LEU B 1 164 ? 7.883   31.512  -18.430 1.00 87.07  ? 164 LEU B N     1 
ATOM   5551  C  CA    . LEU B 1 164 ? 8.193   30.086  -18.404 1.00 82.57  ? 164 LEU B CA    1 
ATOM   5552  C  C     . LEU B 1 164 ? 7.175   29.249  -17.646 1.00 71.81  ? 164 LEU B C     1 
ATOM   5553  O  O     . LEU B 1 164 ? 6.954   29.476  -16.449 1.00 74.71  ? 164 LEU B O     1 
ATOM   5554  C  CB    . LEU B 1 164 ? 9.573   29.817  -17.775 1.00 78.23  ? 164 LEU B CB    1 
ATOM   5555  C  CG    . LEU B 1 164 ? 10.811  29.978  -18.643 1.00 73.30  ? 164 LEU B CG    1 
ATOM   5556  C  CD1   . LEU B 1 164 ? 10.668  29.134  -19.904 1.00 73.46  ? 164 LEU B CD1   1 
ATOM   5557  C  CD2   . LEU B 1 164 ? 10.954  31.425  -18.981 1.00 73.29  ? 164 LEU B CD2   1 
ATOM   5558  N  N     . LEU B 1 165 ? 6.558   28.306  -18.353 1.00 62.64  ? 165 LEU B N     1 
ATOM   5559  C  CA    . LEU B 1 165 ? 5.583   27.379  -17.783 1.00 74.10  ? 165 LEU B CA    1 
ATOM   5560  C  C     . LEU B 1 165 ? 6.098   26.015  -17.424 1.00 80.29  ? 165 LEU B C     1 
ATOM   5561  O  O     . LEU B 1 165 ? 6.557   25.280  -18.296 1.00 66.44  ? 165 LEU B O     1 
ATOM   5562  C  CB    . LEU B 1 165 ? 4.433   27.113  -18.743 1.00 69.51  ? 165 LEU B CB    1 
ATOM   5563  C  CG    . LEU B 1 165 ? 3.096   26.626  -18.174 1.00 59.41  ? 165 LEU B CG    1 
ATOM   5564  C  CD1   . LEU B 1 165 ? 2.564   27.363  -16.970 1.00 55.09  ? 165 LEU B CD1   1 
ATOM   5565  C  CD2   . LEU B 1 165 ? 2.061   26.558  -19.334 1.00 63.45  ? 165 LEU B CD2   1 
ATOM   5566  N  N     . GLU B 1 166 ? 5.966   25.629  -16.159 1.00 75.03  ? 166 GLU B N     1 
ATOM   5567  C  CA    . GLU B 1 166 ? 6.334   24.262  -15.852 1.00 77.10  ? 166 GLU B CA    1 
ATOM   5568  C  C     . GLU B 1 166 ? 5.001   23.561  -15.716 1.00 66.82  ? 166 GLU B C     1 
ATOM   5569  O  O     . GLU B 1 166 ? 4.069   24.062  -15.063 1.00 64.46  ? 166 GLU B O     1 
ATOM   5570  C  CB    . GLU B 1 166 ? 7.194   24.094  -14.604 1.00 80.89  ? 166 GLU B CB    1 
ATOM   5571  C  CG    . GLU B 1 166 ? 7.783   22.696  -14.600 1.00 107.01 ? 166 GLU B CG    1 
ATOM   5572  C  CD    . GLU B 1 166 ? 8.671   22.407  -13.426 1.00 107.90 ? 166 GLU B CD    1 
ATOM   5573  O  OE1   . GLU B 1 166 ? 8.594   21.276  -12.878 1.00 103.97 ? 166 GLU B OE1   1 
ATOM   5574  O  OE2   . GLU B 1 166 ? 9.454   23.304  -13.068 1.00 114.30 ? 166 GLU B OE2   1 
ATOM   5575  N  N     . VAL B 1 167 ? 4.921   22.393  -16.327 1.00 61.64  ? 167 VAL B N     1 
ATOM   5576  C  CA    . VAL B 1 167 ? 3.691   21.638  -16.336 1.00 64.69  ? 167 VAL B CA    1 
ATOM   5577  C  C     . VAL B 1 167 ? 4.064   20.246  -15.986 1.00 65.25  ? 167 VAL B C     1 
ATOM   5578  O  O     . VAL B 1 167 ? 4.995   19.707  -16.564 1.00 72.28  ? 167 VAL B O     1 
ATOM   5579  C  CB    . VAL B 1 167 ? 2.928   21.683  -17.694 1.00 63.89  ? 167 VAL B CB    1 
ATOM   5580  C  CG1   . VAL B 1 167 ? 1.651   20.840  -17.633 1.00 50.33  ? 167 VAL B CG1   1 
ATOM   5581  C  CG2   . VAL B 1 167 ? 2.608   23.126  -18.089 1.00 61.10  ? 167 VAL B CG2   1 
ATOM   5582  N  N     . ASP B 1 168 ? 3.355   19.679  -15.016 1.00 62.91  ? 168 ASP B N     1 
ATOM   5583  C  CA    . ASP B 1 168 ? 3.490   18.253  -14.748 1.00 71.37  ? 168 ASP B CA    1 
ATOM   5584  C  C     . ASP B 1 168 ? 2.114   17.597  -14.465 1.00 80.04  ? 168 ASP B C     1 
ATOM   5585  O  O     . ASP B 1 168 ? 1.458   17.885  -13.478 1.00 79.56  ? 168 ASP B O     1 
ATOM   5586  C  CB    . ASP B 1 168 ? 4.469   18.041  -13.590 1.00 81.14  ? 168 ASP B CB    1 
ATOM   5587  C  CG    . ASP B 1 168 ? 5.207   16.725  -13.696 1.00 88.08  ? 168 ASP B CG    1 
ATOM   5588  O  OD1   . ASP B 1 168 ? 4.986   16.010  -14.694 1.00 95.52  ? 168 ASP B OD1   1 
ATOM   5589  O  OD2   . ASP B 1 168 ? 6.041   16.425  -12.822 1.00 83.93  ? 168 ASP B OD2   1 
ATOM   5590  N  N     . PRO B 1 169 ? 1.697   16.666  -15.336 1.00 78.09  ? 169 PRO B N     1 
ATOM   5591  C  CA    . PRO B 1 169 ? 0.395   16.000  -15.236 1.00 78.82  ? 169 PRO B CA    1 
ATOM   5592  C  C     . PRO B 1 169 ? 0.152   15.350  -13.897 1.00 77.21  ? 169 PRO B C     1 
ATOM   5593  O  O     . PRO B 1 169 ? 1.074   14.804  -13.306 1.00 83.23  ? 169 PRO B O     1 
ATOM   5594  C  CB    . PRO B 1 169 ? 0.462   14.926  -16.326 1.00 87.64  ? 169 PRO B CB    1 
ATOM   5595  C  CG    . PRO B 1 169 ? 1.457   15.430  -17.290 1.00 93.32  ? 169 PRO B CG    1 
ATOM   5596  C  CD    . PRO B 1 169 ? 2.481   16.160  -16.473 1.00 86.83  ? 169 PRO B CD    1 
ATOM   5597  N  N     . ALA B 1 170 ? -1.088  15.401  -13.429 1.00 81.89  ? 170 ALA B N     1 
ATOM   5598  C  CA    . ALA B 1 170 ? -1.417  14.806  -12.144 1.00 84.05  ? 170 ALA B CA    1 
ATOM   5599  C  C     . ALA B 1 170 ? -2.876  14.400  -12.067 1.00 96.64  ? 170 ALA B C     1 
ATOM   5600  O  O     . ALA B 1 170 ? -3.734  14.922  -12.781 1.00 105.06 ? 170 ALA B O     1 
ATOM   5601  C  CB    . ALA B 1 170 ? -1.094  15.783  -11.010 1.00 68.15  ? 170 ALA B CB    1 
ATOM   5602  N  N     . TYR B 1 171 ? -3.142  13.449  -11.186 1.00 95.70  ? 171 TYR B N     1 
ATOM   5603  C  CA    . TYR B 1 171 ? -4.489  12.995  -10.950 1.00 91.24  ? 171 TYR B CA    1 
ATOM   5604  C  C     . TYR B 1 171 ? -4.964  13.441  -9.602  1.00 92.78  ? 171 TYR B C     1 
ATOM   5605  O  O     . TYR B 1 171 ? -4.162  13.807  -8.736  1.00 94.39  ? 171 TYR B O     1 
ATOM   5606  C  CB    . TYR B 1 171 ? -4.605  11.484  -11.090 1.00 92.75  ? 171 TYR B CB    1 
ATOM   5607  C  CG    . TYR B 1 171 ? -4.332  10.985  -12.493 1.00 106.00 ? 171 TYR B CG    1 
ATOM   5608  C  CD1   . TYR B 1 171 ? -3.034  10.790  -12.942 1.00 112.08 ? 171 TYR B CD1   1 
ATOM   5609  C  CD2   . TYR B 1 171 ? -5.379  10.720  -13.373 1.00 109.83 ? 171 TYR B CD2   1 
ATOM   5610  C  CE1   . TYR B 1 171 ? -2.782  10.328  -14.221 1.00 113.77 ? 171 TYR B CE1   1 
ATOM   5611  C  CE2   . TYR B 1 171 ? -5.137  10.256  -14.652 1.00 110.98 ? 171 TYR B CE2   1 
ATOM   5612  C  CZ    . TYR B 1 171 ? -3.833  10.064  -15.064 1.00 115.67 ? 171 TYR B CZ    1 
ATOM   5613  O  OH    . TYR B 1 171 ? -3.565  9.606   -16.326 1.00 116.28 ? 171 TYR B OH    1 
ATOM   5614  N  N     . ARG B 1 172 ? -6.288  13.438  -9.464  1.00 99.19  ? 172 ARG B N     1 
ATOM   5615  C  CA    . ARG B 1 172 ? -6.985  13.873  -8.267  1.00 95.75  ? 172 ARG B CA    1 
ATOM   5616  C  C     . ARG B 1 172 ? -8.074  12.862  -7.949  1.00 106.60 ? 172 ARG B C     1 
ATOM   5617  O  O     . ARG B 1 172 ? -8.928  12.554  -8.786  1.00 112.19 ? 172 ARG B O     1 
ATOM   5618  C  CB    . ARG B 1 172 ? -7.576  15.252  -8.457  1.00 89.11  ? 172 ARG B CB    1 
ATOM   5619  N  N     . ILE B 1 173 ? -8.038  12.381  -6.712  1.00 106.22 ? 173 ILE B N     1 
ATOM   5620  C  CA    . ILE B 1 173 ? -8.996  11.432  -6.160  1.00 110.70 ? 173 ILE B CA    1 
ATOM   5621  C  C     . ILE B 1 173 ? -10.096 12.206  -5.439  1.00 121.79 ? 173 ILE B C     1 
ATOM   5622  O  O     . ILE B 1 173 ? -9.813  12.967  -4.510  1.00 134.95 ? 173 ILE B O     1 
ATOM   5623  C  CB    . ILE B 1 173 ? -8.307  10.450  -5.223  1.00 105.04 ? 173 ILE B CB    1 
ATOM   5624  N  N     . LEU B 1 174 ? -11.350 12.014  -5.854  1.00 119.58 ? 174 LEU B N     1 
ATOM   5625  C  CA    . LEU B 1 174 ? -12.437 12.812  -5.303  1.00 102.61 ? 174 LEU B CA    1 
ATOM   5626  C  C     . LEU B 1 174 ? -13.504 11.940  -4.625  1.00 113.94 ? 174 LEU B C     1 
ATOM   5627  O  O     . LEU B 1 174 ? -14.059 12.350  -3.596  1.00 115.76 ? 174 LEU B O     1 
ATOM   5628  C  CB    . LEU B 1 174 ? -13.065 13.662  -6.412  1.00 72.99  ? 174 LEU B CB    1 
ATOM   5629  N  N     . CYS B 1 175 ? -13.737 10.737  -5.154  1.00 120.21 ? 175 CYS B N     1 
ATOM   5630  C  CA    . CYS B 1 175 ? -14.624 9.721   -4.545  1.00 121.89 ? 175 CYS B CA    1 
ATOM   5631  C  C     . CYS B 1 175 ? -15.844 10.258  -3.782  1.00 117.05 ? 175 CYS B C     1 
ATOM   5632  O  O     . CYS B 1 175 ? -16.096 9.871   -2.637  1.00 105.40 ? 175 CYS B O     1 
ATOM   5633  C  CB    . CYS B 1 175 ? -13.802 8.810   -3.635  1.00 119.63 ? 175 CYS B CB    1 
ATOM   5634  N  N     . LEU B 1 279 ? -1.661  4.378   -11.245 1.00 90.52  ? 279 LEU B N     1 
ATOM   5635  C  CA    . LEU B 1 279 ? -1.779  5.832   -11.326 1.00 92.11  ? 279 LEU B CA    1 
ATOM   5636  C  C     . LEU B 1 279 ? -0.475  6.441   -11.822 1.00 111.82 ? 279 LEU B C     1 
ATOM   5637  O  O     . LEU B 1 279 ? -0.359  7.658   -11.970 1.00 112.93 ? 279 LEU B O     1 
ATOM   5638  C  CB    . LEU B 1 279 ? -2.153  6.420   -9.973  1.00 82.48  ? 279 LEU B CB    1 
ATOM   5639  N  N     . SER B 1 280 ? 0.512   5.588   -12.072 1.00 114.84 ? 280 SER B N     1 
ATOM   5640  C  CA    . SER B 1 280 ? 1.727   6.018   -12.744 1.00 112.49 ? 280 SER B CA    1 
ATOM   5641  C  C     . SER B 1 280 ? 1.406   6.081   -14.229 1.00 102.37 ? 280 SER B C     1 
ATOM   5642  O  O     . SER B 1 280 ? 0.473   5.420   -14.698 1.00 106.65 ? 280 SER B O     1 
ATOM   5643  C  CB    . SER B 1 280 ? 2.893   5.064   -12.464 1.00 114.17 ? 280 SER B CB    1 
ATOM   5644  N  N     . LEU B 1 281 ? 2.206   6.827   -14.977 1.00 106.97 ? 281 LEU B N     1 
ATOM   5645  C  CA    . LEU B 1 281 ? 1.963   7.020   -16.406 1.00 98.14  ? 281 LEU B CA    1 
ATOM   5646  C  C     . LEU B 1 281 ? 3.187   6.550   -17.165 1.00 92.76  ? 281 LEU B C     1 
ATOM   5647  O  O     . LEU B 1 281 ? 4.313   6.776   -16.721 1.00 82.45  ? 281 LEU B O     1 
ATOM   5648  C  CB    . LEU B 1 281 ? 1.697   8.487   -16.770 1.00 89.58  ? 281 LEU B CB    1 
ATOM   5649  C  CG    . LEU B 1 281 ? 0.368   9.159   -16.409 1.00 84.66  ? 281 LEU B CG    1 
ATOM   5650  C  CD1   . LEU B 1 281 ? 0.420   10.671  -16.655 1.00 85.12  ? 281 LEU B CD1   1 
ATOM   5651  C  CD2   . LEU B 1 281 ? -0.804  8.509   -17.087 1.00 74.95  ? 281 LEU B CD2   1 
ATOM   5652  N  N     . PRO B 1 282 ? 2.984   5.828   -18.276 1.00 104.33 ? 282 PRO B N     1 
ATOM   5653  C  CA    . PRO B 1 282 ? 4.164   5.591   -19.111 1.00 102.73 ? 282 PRO B CA    1 
ATOM   5654  C  C     . PRO B 1 282 ? 4.747   6.948   -19.487 1.00 90.55  ? 282 PRO B C     1 
ATOM   5655  O  O     . PRO B 1 282 ? 3.977   7.891   -19.683 1.00 81.39  ? 282 PRO B O     1 
ATOM   5656  C  CB    . PRO B 1 282 ? 3.595   4.878   -20.334 1.00 107.42 ? 282 PRO B CB    1 
ATOM   5657  C  CG    . PRO B 1 282 ? 2.357   4.209   -19.822 1.00 110.64 ? 282 PRO B CG    1 
ATOM   5658  C  CD    . PRO B 1 282 ? 1.779   5.176   -18.816 1.00 112.05 ? 282 PRO B CD    1 
ATOM   5659  N  N     . TRP B 1 283 ? 6.068   7.037   -19.609 1.00 87.35  ? 283 TRP B N     1 
ATOM   5660  C  CA    . TRP B 1 283 ? 6.749   8.324   -19.797 1.00 81.92  ? 283 TRP B CA    1 
ATOM   5661  C  C     . TRP B 1 283 ? 6.251   9.071   -21.016 1.00 90.21  ? 283 TRP B C     1 
ATOM   5662  O  O     . TRP B 1 283 ? 6.076   10.298  -21.009 1.00 85.34  ? 283 TRP B O     1 
ATOM   5663  C  CB    . TRP B 1 283 ? 8.266   8.165   -19.836 1.00 76.00  ? 283 TRP B CB    1 
ATOM   5664  C  CG    . TRP B 1 283 ? 8.849   7.491   -21.040 1.00 85.14  ? 283 TRP B CG    1 
ATOM   5665  C  CD1   . TRP B 1 283 ? 9.160   6.176   -21.163 1.00 89.35  ? 283 TRP B CD1   1 
ATOM   5666  C  CD2   . TRP B 1 283 ? 9.206   8.107   -22.298 1.00 82.30  ? 283 TRP B CD2   1 
ATOM   5667  N  NE1   . TRP B 1 283 ? 9.700   5.932   -22.406 1.00 88.13  ? 283 TRP B NE1   1 
ATOM   5668  C  CE2   . TRP B 1 283 ? 9.731   7.100   -23.121 1.00 80.30  ? 283 TRP B CE2   1 
ATOM   5669  C  CE3   . TRP B 1 283 ? 9.129   9.414   -22.801 1.00 84.86  ? 283 TRP B CE3   1 
ATOM   5670  C  CZ2   . TRP B 1 283 ? 10.175  7.349   -24.424 1.00 82.70  ? 283 TRP B CZ2   1 
ATOM   5671  C  CZ3   . TRP B 1 283 ? 9.584   9.662   -24.102 1.00 81.28  ? 283 TRP B CZ3   1 
ATOM   5672  C  CH2   . TRP B 1 283 ? 10.098  8.635   -24.891 1.00 74.07  ? 283 TRP B CH2   1 
ATOM   5673  N  N     . GLU B 1 284 ? 6.040   8.320   -22.076 1.00 97.00  ? 284 GLU B N     1 
ATOM   5674  C  CA    . GLU B 1 284 ? 5.582   8.877   -23.322 1.00 98.58  ? 284 GLU B CA    1 
ATOM   5675  C  C     . GLU B 1 284 ? 4.191   9.504   -23.239 1.00 89.48  ? 284 GLU B C     1 
ATOM   5676  O  O     . GLU B 1 284 ? 3.928   10.591  -23.790 1.00 88.30  ? 284 GLU B O     1 
ATOM   5677  C  CB    . GLU B 1 284 ? 5.615   7.740   -24.376 1.00 80.59  ? 284 GLU B CB    1 
ATOM   5678  C  CG    . GLU B 1 284 ? 5.966   6.399   -23.728 1.00 100.67 ? 284 GLU B CG    1 
ATOM   5679  C  CD    . GLU B 1 284 ? 5.927   5.175   -24.626 1.00 115.48 ? 284 GLU B CD    1 
ATOM   5680  O  OE1   . GLU B 1 284 ? 6.043   5.321   -25.867 1.00 117.80 ? 284 GLU B OE1   1 
ATOM   5681  O  OE2   . GLU B 1 284 ? 5.939   4.059   -24.073 1.00 122.65 ? 284 GLU B OE2   1 
ATOM   5682  N  N     . GLU B 1 285 ? 3.331   8.856   -22.499 1.00 91.59  ? 285 GLU B N     1 
ATOM   5683  C  CA    . GLU B 1 285 ? 1.991   9.344   -22.264 1.00 91.88  ? 285 GLU B CA    1 
ATOM   5684  C  C     . GLU B 1 285 ? 1.984   10.625  -21.462 1.00 82.89  ? 285 GLU B C     1 
ATOM   5685  O  O     . GLU B 1 285 ? 1.195   11.554  -21.728 1.00 96.22  ? 285 GLU B O     1 
ATOM   5686  C  CB    . GLU B 1 285 ? 1.234   8.143   -21.813 1.00 107.56 ? 285 GLU B CB    1 
ATOM   5687  C  CG    . GLU B 1 285 ? -0.182  8.258   -21.857 1.00 120.43 ? 285 GLU B CG    1 
ATOM   5688  C  CD    . GLU B 1 285 ? -0.601  6.817   -21.911 1.00 140.64 ? 285 GLU B CD    1 
ATOM   5689  O  OE1   . GLU B 1 285 ? 0.307   5.967   -22.082 1.00 144.63 ? 285 GLU B OE1   1 
ATOM   5690  O  OE2   . GLU B 1 285 ? -1.693  6.581   -22.442 1.00 150.59 ? 285 GLU B OE2   1 
ATOM   5691  N  N     . ARG B 1 286 ? 2.795   10.612  -20.419 1.00 75.32  ? 286 ARG B N     1 
ATOM   5692  C  CA    . ARG B 1 286 ? 2.944   11.774  -19.576 1.00 81.06  ? 286 ARG B CA    1 
ATOM   5693  C  C     . ARG B 1 286 ? 3.474   12.917  -20.446 1.00 76.10  ? 286 ARG B C     1 
ATOM   5694  O  O     . ARG B 1 286 ? 3.021   14.050  -20.326 1.00 69.91  ? 286 ARG B O     1 
ATOM   5695  C  CB    . ARG B 1 286 ? 3.895   11.497  -18.415 1.00 79.38  ? 286 ARG B CB    1 
ATOM   5696  C  CG    . ARG B 1 286 ? 4.098   12.707  -17.507 1.00 76.58  ? 286 ARG B CG    1 
ATOM   5697  C  CD    . ARG B 1 286 ? 4.902   12.361  -16.259 1.00 70.19  ? 286 ARG B CD    1 
ATOM   5698  N  NE    . ARG B 1 286 ? 4.184   11.432  -15.382 1.00 78.76  ? 286 ARG B NE    1 
ATOM   5699  C  CZ    . ARG B 1 286 ? 3.310   11.808  -14.455 1.00 82.10  ? 286 ARG B CZ    1 
ATOM   5700  N  NH1   . ARG B 1 286 ? 3.050   13.096  -14.276 1.00 67.14  ? 286 ARG B NH1   1 
ATOM   5701  N  NH2   . ARG B 1 286 ? 2.694   10.893  -13.723 1.00 92.85  ? 286 ARG B NH2   1 
ATOM   5702  N  N     . ARG B 1 287 ? 4.413   12.618  -21.344 1.00 74.23  ? 287 ARG B N     1 
ATOM   5703  C  CA    . ARG B 1 287 ? 4.940   13.655  -22.228 1.00 83.75  ? 287 ARG B CA    1 
ATOM   5704  C  C     . ARG B 1 287 ? 3.844   14.246  -23.126 1.00 87.79  ? 287 ARG B C     1 
ATOM   5705  O  O     . ARG B 1 287 ? 3.715   15.476  -23.232 1.00 92.84  ? 287 ARG B O     1 
ATOM   5706  C  CB    . ARG B 1 287 ? 6.074   13.114  -23.101 1.00 80.45  ? 287 ARG B CB    1 
ATOM   5707  C  CG    . ARG B 1 287 ? 6.372   14.020  -24.289 1.00 76.03  ? 287 ARG B CG    1 
ATOM   5708  C  CD    . ARG B 1 287 ? 7.642   13.633  -25.053 1.00 94.14  ? 287 ARG B CD    1 
ATOM   5709  N  NE    . ARG B 1 287 ? 7.591   12.288  -25.619 1.00 97.98  ? 287 ARG B NE    1 
ATOM   5710  C  CZ    . ARG B 1 287 ? 8.456   11.832  -26.518 1.00 92.17  ? 287 ARG B CZ    1 
ATOM   5711  N  NH1   . ARG B 1 287 ? 9.401   12.634  -26.978 1.00 84.49  ? 287 ARG B NH1   1 
ATOM   5712  N  NH2   . ARG B 1 287 ? 8.349   10.592  -26.988 1.00 97.08  ? 287 ARG B NH2   1 
ATOM   5713  N  N     . ARG B 1 288 ? 3.030   13.397  -23.744 1.00 75.71  ? 288 ARG B N     1 
ATOM   5714  C  CA    . ARG B 1 288 ? 1.947   13.942  -24.551 1.00 98.04  ? 288 ARG B CA    1 
ATOM   5715  C  C     . ARG B 1 288 ? 0.972   14.808  -23.829 1.00 98.45  ? 288 ARG B C     1 
ATOM   5716  O  O     . ARG B 1 288 ? 0.628   15.905  -24.289 1.00 104.86 ? 288 ARG B O     1 
ATOM   5717  C  CB    . ARG B 1 288 ? 1.003   12.923  -25.140 1.00 108.48 ? 288 ARG B CB    1 
ATOM   5718  C  CG    . ARG B 1 288 ? 1.322   12.384  -26.413 1.00 120.30 ? 288 ARG B CG    1 
ATOM   5719  C  CD    . ARG B 1 288 ? 0.276   11.409  -26.811 1.00 126.75 ? 288 ARG B CD    1 
ATOM   5720  N  NE    . ARG B 1 288 ? 0.185   10.266  -25.897 1.00 132.54 ? 288 ARG B NE    1 
ATOM   5721  C  CZ    . ARG B 1 288 ? -0.775  9.350   -25.911 1.00 134.27 ? 288 ARG B CZ    1 
ATOM   5722  N  NH1   . ARG B 1 288 ? -1.593  9.258   -26.957 1.00 139.82 ? 288 ARG B NH1   1 
ATOM   5723  N  NH2   . ARG B 1 288 ? -0.744  8.376   -25.014 1.00 128.30 ? 288 ARG B NH2   1 
ATOM   5724  N  N     . ARG B 1 289 ? 0.507   14.281  -22.700 1.00 95.86  ? 289 ARG B N     1 
ATOM   5725  C  CA    . ARG B 1 289 ? -0.475  14.989  -21.919 1.00 91.31  ? 289 ARG B CA    1 
ATOM   5726  C  C     . ARG B 1 289 ? 0.147   16.300  -21.439 1.00 91.75  ? 289 ARG B C     1 
ATOM   5727  O  O     . ARG B 1 289 ? -0.553  17.323  -21.297 1.00 93.01  ? 289 ARG B O     1 
ATOM   5728  C  CB    . ARG B 1 289 ? -0.993  14.100  -20.790 1.00 91.99  ? 289 ARG B CB    1 
ATOM   5729  C  CG    . ARG B 1 289 ? -2.177  13.269  -21.291 1.00 97.49  ? 289 ARG B CG    1 
ATOM   5730  C  CD    . ARG B 1 289 ? -2.542  12.075  -20.437 1.00 102.33 ? 289 ARG B CD    1 
ATOM   5731  N  NE    . ARG B 1 289 ? -3.297  12.478  -19.258 1.00 106.95 ? 289 ARG B NE    1 
ATOM   5732  C  CZ    . ARG B 1 289 ? -3.715  11.637  -18.319 1.00 103.21 ? 289 ARG B CZ    1 
ATOM   5733  N  NH1   . ARG B 1 289 ? -3.450  10.335  -18.425 1.00 100.35 ? 289 ARG B NH1   1 
ATOM   5734  N  NH2   . ARG B 1 289 ? -4.400  12.096  -17.278 1.00 95.46  ? 289 ARG B NH2   1 
ATOM   5735  N  N     . THR B 1 290 ? 1.463   16.277  -21.237 1.00 91.17  ? 290 THR B N     1 
ATOM   5736  C  CA    . THR B 1 290 ? 2.190   17.469  -20.802 1.00 90.04  ? 290 THR B CA    1 
ATOM   5737  C  C     . THR B 1 290 ? 2.069   18.536  -21.905 1.00 84.46  ? 290 THR B C     1 
ATOM   5738  O  O     . THR B 1 290 ? 1.765   19.699  -21.604 1.00 67.98  ? 290 THR B O     1 
ATOM   5739  C  CB    . THR B 1 290 ? 3.675   17.201  -20.502 1.00 87.18  ? 290 THR B CB    1 
ATOM   5740  O  OG1   . THR B 1 290 ? 3.786   16.324  -19.383 1.00 90.82  ? 290 THR B OG1   1 
ATOM   5741  C  CG2   . THR B 1 290 ? 4.409   18.518  -20.201 1.00 79.15  ? 290 THR B CG2   1 
ATOM   5742  N  N     . ARG B 1 291 ? 2.342   18.144  -23.163 1.00 90.38  ? 291 ARG B N     1 
ATOM   5743  C  CA    . ARG B 1 291 ? 2.193   19.111  -24.275 1.00 87.88  ? 291 ARG B CA    1 
ATOM   5744  C  C     . ARG B 1 291 ? 0.763   19.629  -24.538 1.00 81.90  ? 291 ARG B C     1 
ATOM   5745  O  O     . ARG B 1 291 ? 0.544   20.852  -24.716 1.00 89.39  ? 291 ARG B O     1 
ATOM   5746  C  CB    . ARG B 1 291 ? 2.620   18.574  -25.640 1.00 96.91  ? 291 ARG B CB    1 
ATOM   5747  C  CG    . ARG B 1 291 ? 4.005   18.169  -25.921 1.00 102.88 ? 291 ARG B CG    1 
ATOM   5748  C  CD    . ARG B 1 291 ? 4.084   17.818  -27.278 1.00 112.74 ? 291 ARG B CD    1 
ATOM   5749  N  NE    . ARG B 1 291 ? 5.346   17.550  -27.987 1.00 128.96 ? 291 ARG B NE    1 
ATOM   5750  C  CZ    . ARG B 1 291 ? 6.533   18.142  -27.865 1.00 143.53 ? 291 ARG B CZ    1 
ATOM   5751  N  NH1   . ARG B 1 291 ? 6.836   18.894  -26.822 1.00 144.47 ? 291 ARG B NH1   1 
ATOM   5752  N  NH2   . ARG B 1 291 ? 7.508   17.740  -28.662 1.00 151.13 ? 291 ARG B NH2   1 
ATOM   5753  N  N     . GLU B 1 292 ? -0.189  18.699  -24.514 1.00 80.90  ? 292 GLU B N     1 
ATOM   5754  C  CA    . GLU B 1 292 ? -1.574  19.062  -24.734 1.00 84.63  ? 292 GLU B CA    1 
ATOM   5755  C  C     . GLU B 1 292 ? -2.000  20.107  -23.705 1.00 96.37  ? 292 GLU B C     1 
ATOM   5756  O  O     . GLU B 1 292 ? -2.486  21.209  -24.043 1.00 100.94 ? 292 GLU B O     1 
ATOM   5757  C  CB    . GLU B 1 292 ? -2.479  17.836  -24.624 1.00 72.81  ? 292 GLU B CB    1 
ATOM   5758  C  CG    . GLU B 1 292 ? -2.265  16.820  -25.707 1.00 83.08  ? 292 GLU B CG    1 
ATOM   5759  C  CD    . GLU B 1 292 ? -2.984  15.523  -25.433 1.00 93.55  ? 292 GLU B CD    1 
ATOM   5760  O  OE1   . GLU B 1 292 ? -3.569  15.385  -24.343 1.00 99.51  ? 292 GLU B OE1   1 
ATOM   5761  O  OE2   . GLU B 1 292 ? -2.923  14.614  -26.287 1.00 100.19 ? 292 GLU B OE2   1 
ATOM   5762  N  N     . ILE B 1 293 ? -1.688  19.804  -22.447 1.00 99.84  ? 293 ILE B N     1 
ATOM   5763  C  CA    . ILE B 1 293 ? -2.048  20.725  -21.399 1.00 94.98  ? 293 ILE B CA    1 
ATOM   5764  C  C     . ILE B 1 293 ? -1.252  22.026  -21.434 1.00 83.55  ? 293 ILE B C     1 
ATOM   5765  O  O     . ILE B 1 293 ? -1.804  23.085  -21.173 1.00 82.31  ? 293 ILE B O     1 
ATOM   5766  C  CB    . ILE B 1 293 ? -1.879  20.043  -19.995 1.00 72.95  ? 293 ILE B CB    1 
ATOM   5767  C  CG1   . ILE B 1 293 ? -2.965  18.978  -19.789 1.00 81.52  ? 293 ILE B CG1   1 
ATOM   5768  C  CG2   . ILE B 1 293 ? -1.984  21.055  -18.873 1.00 56.35  ? 293 ILE B CG2   1 
ATOM   5769  C  CD1   . ILE B 1 293 ? -2.687  18.020  -18.672 1.00 84.95  ? 293 ILE B CD1   1 
ATOM   5770  N  N     . ALA B 1 294 ? 0.014   21.982  -21.826 1.00 80.24  ? 294 ALA B N     1 
ATOM   5771  C  CA    . ALA B 1 294 ? 0.751   23.242  -21.976 1.00 81.81  ? 294 ALA B CA    1 
ATOM   5772  C  C     . ALA B 1 294 ? 0.158   24.225  -22.992 1.00 98.94  ? 294 ALA B C     1 
ATOM   5773  O  O     . ALA B 1 294 ? 0.063   25.424  -22.704 1.00 93.38  ? 294 ALA B O     1 
ATOM   5774  C  CB    . ALA B 1 294 ? 2.222   22.951  -22.365 1.00 57.16  ? 294 ALA B CB    1 
ATOM   5775  N  N     . SER B 1 295 ? -0.290  23.724  -24.149 1.00 99.43  ? 295 SER B N     1 
ATOM   5776  C  CA    . SER B 1 295 ? -0.912  24.601  -25.164 1.00 95.28  ? 295 SER B CA    1 
ATOM   5777  C  C     . SER B 1 295 ? -2.315  25.058  -24.803 1.00 91.78  ? 295 SER B C     1 
ATOM   5778  O  O     . SER B 1 295 ? -2.654  26.248  -24.888 1.00 94.60  ? 295 SER B O     1 
ATOM   5779  C  CB    . SER B 1 295 ? -0.834  24.001  -26.573 1.00 96.41  ? 295 SER B CB    1 
ATOM   5780  O  OG    . SER B 1 295 ? -0.740  22.608  -26.625 1.00 101.91 ? 295 SER B OG    1 
ATOM   5781  N  N     . TRP B 1 296 ? -3.083  24.114  -24.295 1.00 95.48  ? 296 TRP B N     1 
ATOM   5782  C  CA    . TRP B 1 296 ? -4.444  24.378  -23.872 1.00 96.59  ? 296 TRP B CA    1 
ATOM   5783  C  C     . TRP B 1 296 ? -4.364  25.513  -22.864 1.00 91.04  ? 296 TRP B C     1 
ATOM   5784  O  O     . TRP B 1 296 ? -5.108  26.496  -22.953 1.00 102.77 ? 296 TRP B O     1 
ATOM   5785  C  CB    . TRP B 1 296 ? -5.069  23.102  -23.273 1.00 104.84 ? 296 TRP B CB    1 
ATOM   5786  C  CG    . TRP B 1 296 ? -6.566  23.120  -22.904 1.00 114.82 ? 296 TRP B CG    1 
ATOM   5787  C  CD1   . TRP B 1 296 ? -7.596  22.732  -23.740 1.00 127.17 ? 296 TRP B CD1   1 
ATOM   5788  C  CD2   . TRP B 1 296 ? -7.186  23.422  -21.639 1.00 112.28 ? 296 TRP B CD2   1 
ATOM   5789  N  NE1   . TRP B 1 296 ? -8.800  22.824  -23.088 1.00 132.11 ? 296 TRP B NE1   1 
ATOM   5790  C  CE2   . TRP B 1 296 ? -8.579  23.237  -21.800 1.00 120.91 ? 296 TRP B CE2   1 
ATOM   5791  C  CE3   . TRP B 1 296 ? -6.709  23.866  -20.408 1.00 116.46 ? 296 TRP B CE3   1 
ATOM   5792  C  CZ2   . TRP B 1 296 ? -9.487  23.472  -20.770 1.00 121.36 ? 296 TRP B CZ2   1 
ATOM   5793  C  CZ3   . TRP B 1 296 ? -7.608  24.071  -19.378 1.00 113.17 ? 296 TRP B CZ3   1 
ATOM   5794  C  CH2   . TRP B 1 296 ? -8.979  23.886  -19.570 1.00 124.38 ? 296 TRP B CH2   1 
ATOM   5795  N  N     . ILE B 1 297 ? -3.472  25.407  -21.888 1.00 87.51  ? 297 ILE B N     1 
ATOM   5796  C  CA    . ILE B 1 297 ? -3.419  26.504  -20.935 1.00 94.31  ? 297 ILE B CA    1 
ATOM   5797  C  C     . ILE B 1 297 ? -2.780  27.797  -21.477 1.00 89.15  ? 297 ILE B C     1 
ATOM   5798  O  O     . ILE B 1 297 ? -3.242  28.887  -21.178 1.00 90.87  ? 297 ILE B O     1 
ATOM   5799  C  CB    . ILE B 1 297 ? -2.645  26.084  -19.655 1.00 93.99  ? 297 ILE B CB    1 
ATOM   5800  C  CG1   . ILE B 1 297 ? -3.631  25.795  -18.546 1.00 91.35  ? 297 ILE B CG1   1 
ATOM   5801  C  CG2   . ILE B 1 297 ? -1.505  27.022  -19.287 1.00 84.55  ? 297 ILE B CG2   1 
ATOM   5802  C  CD1   . ILE B 1 297 ? -3.182  24.788  -17.701 1.00 88.11  ? 297 ILE B CD1   1 
ATOM   5803  N  N     . GLY B 1 298 ? -1.738  27.694  -22.282 1.00 86.44  ? 298 GLY B N     1 
ATOM   5804  C  CA    . GLY B 1 298 ? -1.153  28.906  -22.830 1.00 95.19  ? 298 GLY B CA    1 
ATOM   5805  C  C     . GLY B 1 298 ? -2.061  29.780  -23.731 1.00 102.73 ? 298 GLY B C     1 
ATOM   5806  O  O     . GLY B 1 298 ? -1.966  31.030  -23.715 1.00 81.62  ? 298 GLY B O     1 
ATOM   5807  N  N     . ARG B 1 299 ? -2.935  29.094  -24.492 1.00 108.78 ? 299 ARG B N     1 
ATOM   5808  C  CA    . ARG B 1 299 ? -3.946  29.664  -25.410 1.00 102.28 ? 299 ARG B CA    1 
ATOM   5809  C  C     . ARG B 1 299 ? -5.115  30.301  -24.724 1.00 98.53  ? 299 ARG B C     1 
ATOM   5810  O  O     . ARG B 1 299 ? -5.920  31.053  -25.277 1.00 108.35 ? 299 ARG B O     1 
ATOM   5811  C  CB    . ARG B 1 299 ? -4.467  28.552  -26.325 1.00 99.78  ? 299 ARG B CB    1 
ATOM   5812  N  N     . ARG B 1 300 ? -5.223  29.950  -23.475 1.00 96.91  ? 300 ARG B N     1 
ATOM   5813  C  CA    . ARG B 1 300 ? -6.334  30.352  -22.664 1.00 96.54  ? 300 ARG B CA    1 
ATOM   5814  C  C     . ARG B 1 300 ? -6.098  31.382  -21.663 1.00 96.61  ? 300 ARG B C     1 
ATOM   5815  O  O     . ARG B 1 300 ? -7.007  32.074  -21.158 1.00 84.28  ? 300 ARG B O     1 
ATOM   5816  C  CB    . ARG B 1 300 ? -6.536  29.142  -21.825 1.00 97.92  ? 300 ARG B CB    1 
ATOM   5817  C  CG    . ARG B 1 300 ? -7.437  29.204  -20.633 1.00 96.73  ? 300 ARG B CG    1 
ATOM   5818  C  CD    . ARG B 1 300 ? -8.191  28.214  -21.303 1.00 112.50 ? 300 ARG B CD    1 
ATOM   5819  N  NE    . ARG B 1 300 ? -9.397  27.446  -21.087 1.00 121.47 ? 300 ARG B NE    1 
ATOM   5820  C  CZ    . ARG B 1 300 ? -10.568 27.921  -21.314 1.00 125.46 ? 300 ARG B CZ    1 
ATOM   5821  N  NH1   . ARG B 1 300 ? -10.536 29.148  -21.322 1.00 119.97 ? 300 ARG B NH1   1 
ATOM   5822  N  NH2   . ARG B 1 300 ? -11.720 27.306  -21.159 1.00 135.41 ? 300 ARG B NH2   1 
ATOM   5823  N  N     . LEU B 1 301 ? -4.841  31.427  -21.329 1.00 97.82  ? 301 LEU B N     1 
ATOM   5824  C  CA    . LEU B 1 301 ? -4.247  32.199  -20.351 1.00 100.90 ? 301 LEU B CA    1 
ATOM   5825  C  C     . LEU B 1 301 ? -3.893  33.531  -20.983 1.00 89.37  ? 301 LEU B C     1 
ATOM   5826  O  O     . LEU B 1 301 ? -3.644  34.498  -20.309 1.00 92.08  ? 301 LEU B O     1 
ATOM   5827  C  CB    . LEU B 1 301 ? -3.096  31.472  -19.629 1.00 106.75 ? 301 LEU B CB    1 
ATOM   5828  C  CG    . LEU B 1 301 ? -3.880  31.205  -18.298 1.00 102.40 ? 301 LEU B CG    1 
ATOM   5829  C  CD1   . LEU B 1 301 ? -3.092  30.521  -17.173 1.00 101.94 ? 301 LEU B CD1   1 
ATOM   5830  C  CD2   . LEU B 1 301 ? -4.881  32.284  -17.800 1.00 92.89  ? 301 LEU B CD2   1 
ATOM   5831  N  N     . GLY B 1 302 ? -3.675  33.476  -22.293 1.00 90.11  ? 302 GLY B N     1 
ATOM   5832  C  CA    . GLY B 1 302 ? -3.280  34.683  -22.973 1.00 81.11  ? 302 GLY B CA    1 
ATOM   5833  C  C     . GLY B 1 302 ? -1.794  34.930  -22.892 1.00 83.38  ? 302 GLY B C     1 
ATOM   5834  O  O     . GLY B 1 302 ? -1.332  36.060  -22.775 1.00 87.41  ? 302 GLY B O     1 
ATOM   5835  N  N     . LEU B 1 303 ? -1.025  33.837  -22.815 1.00 92.08  ? 303 LEU B N     1 
ATOM   5836  C  CA    . LEU B 1 303 ? 0.415   34.011  -22.664 1.00 93.00  ? 303 LEU B CA    1 
ATOM   5837  C  C     . LEU B 1 303 ? 1.171   33.490  -23.884 1.00 85.94  ? 303 LEU B C     1 
ATOM   5838  O  O     . LEU B 1 303 ? 2.394   33.484  -23.916 1.00 75.32  ? 303 LEU B O     1 
ATOM   5839  C  CB    . LEU B 1 303 ? 0.883   33.177  -21.443 1.00 77.75  ? 303 LEU B CB    1 
ATOM   5840  C  CG    . LEU B 1 303 ? 0.252   33.592  -20.123 1.00 70.62  ? 303 LEU B CG    1 
ATOM   5841  C  CD1   . LEU B 1 303 ? 0.874   32.846  -18.969 1.00 76.57  ? 303 LEU B CD1   1 
ATOM   5842  C  CD2   . LEU B 1 303 ? 0.525   35.074  -19.961 1.00 69.86  ? 303 LEU B CD2   1 
ATOM   5843  N  N     . GLY B 1 304 ? 0.449   33.323  -24.979 1.00 93.84  ? 304 GLY B N     1 
ATOM   5844  C  CA    . GLY B 1 304 ? 1.037   32.913  -26.231 1.00 94.82  ? 304 GLY B CA    1 
ATOM   5845  C  C     . GLY B 1 304 ? 1.060   31.442  -26.508 1.00 91.08  ? 304 GLY B C     1 
ATOM   5846  O  O     . GLY B 1 304 ? 0.343   30.669  -25.884 1.00 76.76  ? 304 GLY B O     1 
ATOM   5847  N  N     . THR B 1 305 ? 1.785   31.068  -27.552 1.00 91.90  ? 305 THR B N     1 
ATOM   5848  C  CA    . THR B 1 305 ? 1.793   29.674  -27.925 1.00 91.02  ? 305 THR B CA    1 
ATOM   5849  C  C     . THR B 1 305 ? 3.072   29.178  -27.199 1.00 116.41 ? 305 THR B C     1 
ATOM   5850  O  O     . THR B 1 305 ? 4.131   29.781  -27.367 1.00 111.61 ? 305 THR B O     1 
ATOM   5851  C  CB    . THR B 1 305 ? 1.752   29.496  -29.462 1.00 84.45  ? 305 THR B CB    1 
ATOM   5852  O  OG1   . THR B 1 305 ? 1.666   28.103  -29.799 1.00 77.62  ? 305 THR B OG1   1 
ATOM   5853  C  CG2   . THR B 1 305 ? 2.941   30.154  -30.150 1.00 89.82  ? 305 THR B CG2   1 
ATOM   5854  N  N     . PRO B 1 306 ? 2.981   28.079  -26.413 1.00 105.71 ? 306 PRO B N     1 
ATOM   5855  C  CA    . PRO B 1 306 ? 4.070   27.468  -25.613 1.00 101.97 ? 306 PRO B CA    1 
ATOM   5856  C  C     . PRO B 1 306 ? 5.078   26.774  -26.467 1.00 99.66  ? 306 PRO B C     1 
ATOM   5857  O  O     . PRO B 1 306 ? 4.681   25.943  -27.296 1.00 104.64 ? 306 PRO B O     1 
ATOM   5858  C  CB    . PRO B 1 306 ? 3.327   26.476  -24.731 1.00 109.02 ? 306 PRO B CB    1 
ATOM   5859  C  CG    . PRO B 1 306 ? 2.115   26.141  -25.466 1.00 110.82 ? 306 PRO B CG    1 
ATOM   5860  C  CD    . PRO B 1 306 ? 1.711   27.365  -26.235 1.00 109.05 ? 306 PRO B CD    1 
ATOM   5861  N  N     . GLU B 1 307 ? 6.334   27.033  -26.315 1.00 103.79 ? 307 GLU B N     1 
ATOM   5862  C  CA    . GLU B 1 307 ? 7.297   26.259  -27.026 1.00 111.60 ? 307 GLU B CA    1 
ATOM   5863  C  C     . GLU B 1 307 ? 8.234   25.474  -26.092 1.00 96.51  ? 307 GLU B C     1 
ATOM   5864  O  O     . GLU B 1 307 ? 8.975   26.096  -25.326 1.00 87.02  ? 307 GLU B O     1 
ATOM   5865  C  CB    . GLU B 1 307 ? 7.929   27.159  -28.065 1.00 128.19 ? 307 GLU B CB    1 
ATOM   5866  C  CG    . GLU B 1 307 ? 8.992   26.485  -28.878 1.00 138.49 ? 307 GLU B CG    1 
ATOM   5867  C  CD    . GLU B 1 307 ? 9.635   27.459  -29.809 1.00 152.40 ? 307 GLU B CD    1 
ATOM   5868  O  OE1   . GLU B 1 307 ? 9.925   28.528  -29.307 1.00 158.85 ? 307 GLU B OE1   1 
ATOM   5869  O  OE2   . GLU B 1 307 ? 9.871   27.259  -31.021 1.00 158.87 ? 307 GLU B OE2   1 
ATOM   5870  N  N     . ALA B 1 308 ? 8.271   24.132  -26.189 1.00 99.01  ? 308 ALA B N     1 
ATOM   5871  C  CA    . ALA B 1 308 ? 8.999   23.283  -25.250 1.00 90.22  ? 308 ALA B CA    1 
ATOM   5872  C  C     . ALA B 1 308 ? 10.486  23.583  -25.267 1.00 77.83  ? 308 ALA B C     1 
ATOM   5873  O  O     . ALA B 1 308 ? 11.082  23.776  -26.313 1.00 65.49  ? 308 ALA B O     1 
ATOM   5874  C  CB    . ALA B 1 308 ? 8.752   21.809  -25.565 1.00 83.69  ? 308 ALA B CB    1 
ATOM   5875  N  N     . VAL B 1 309 ? 11.067  23.603  -24.072 1.00 71.26  ? 309 VAL B N     1 
ATOM   5876  C  CA    . VAL B 1 309 ? 12.458  23.921  -23.911 1.00 80.34  ? 309 VAL B CA    1 
ATOM   5877  C  C     . VAL B 1 309 ? 13.357  22.697  -24.035 1.00 89.38  ? 309 VAL B C     1 
ATOM   5878  O  O     . VAL B 1 309 ? 13.110  21.606  -23.488 1.00 90.74  ? 309 VAL B O     1 
ATOM   5879  C  CB    . VAL B 1 309 ? 12.654  24.450  -22.445 1.00 62.16  ? 309 VAL B CB    1 
ATOM   5880  C  CG1   . VAL B 1 309 ? 13.862  25.011  -22.178 1.00 55.73  ? 309 VAL B CG1   1 
ATOM   5881  C  CG2   . VAL B 1 309 ? 11.787  25.366  -22.067 1.00 61.56  ? 309 VAL B CG2   1 
ATOM   5882  N  N     . ARG B 1 310 ? 14.422  22.910  -24.775 1.00 90.81  ? 310 ARG B N     1 
ATOM   5883  C  CA    . ARG B 1 310 ? 15.374  21.882  -25.011 1.00 79.64  ? 310 ARG B CA    1 
ATOM   5884  C  C     . ARG B 1 310 ? 16.568  22.168  -24.128 1.00 73.61  ? 310 ARG B C     1 
ATOM   5885  O  O     . ARG B 1 310 ? 16.857  23.335  -23.802 1.00 70.27  ? 310 ARG B O     1 
ATOM   5886  C  CB    . ARG B 1 310 ? 15.803  21.781  -26.473 1.00 80.59  ? 310 ARG B CB    1 
ATOM   5887  C  CG    . ARG B 1 310 ? 14.783  21.234  -27.442 1.00 81.21  ? 310 ARG B CG    1 
ATOM   5888  C  CD    . ARG B 1 310 ? 14.969  21.762  -28.854 1.00 78.24  ? 310 ARG B CD    1 
ATOM   5889  N  NE    . ARG B 1 310 ? 13.881  21.323  -29.711 1.00 81.20  ? 310 ARG B NE    1 
ATOM   5890  C  CZ    . ARG B 1 310 ? 14.021  20.302  -30.549 1.00 95.15  ? 310 ARG B CZ    1 
ATOM   5891  N  NH1   . ARG B 1 310 ? 15.151  19.592  -30.523 1.00 100.39 ? 310 ARG B NH1   1 
ATOM   5892  N  NH2   . ARG B 1 310 ? 13.010  19.910  -31.316 1.00 108.65 ? 310 ARG B NH2   1 
ATOM   5893  N  N     . ALA B 1 311 ? 17.365  21.132  -23.899 1.00 77.33  ? 311 ALA B N     1 
ATOM   5894  C  CA    . ALA B 1 311 ? 18.608  21.264  -23.157 1.00 70.36  ? 311 ALA B CA    1 
ATOM   5895  C  C     . ALA B 1 311 ? 19.560  20.228  -23.681 1.00 71.67  ? 311 ALA B C     1 
ATOM   5896  O  O     . ALA B 1 311 ? 19.151  19.145  -24.162 1.00 58.10  ? 311 ALA B O     1 
ATOM   5897  C  CB    . ALA B 1 311 ? 18.384  21.102  -21.680 1.00 65.60  ? 311 ALA B CB    1 
ATOM   5898  N  N     . GLN B 1 312 ? 20.844  20.521  -23.486 1.00 65.49  ? 312 GLN B N     1 
ATOM   5899  C  CA    . GLN B 1 312 ? 21.859  19.617  -23.945 1.00 75.42  ? 312 GLN B CA    1 
ATOM   5900  C  C     . GLN B 1 312 ? 22.003  18.604  -22.827 1.00 73.55  ? 312 GLN B C     1 
ATOM   5901  O  O     . GLN B 1 312 ? 22.119  18.955  -21.650 1.00 87.15  ? 312 GLN B O     1 
ATOM   5902  C  CB    . GLN B 1 312 ? 23.232  20.328  -24.171 1.00 94.63  ? 312 GLN B CB    1 
ATOM   5903  C  CG    . GLN B 1 312 ? 23.769  19.815  -25.436 1.00 108.07 ? 312 GLN B CG    1 
ATOM   5904  C  CD    . GLN B 1 312 ? 23.962  20.814  -26.515 1.00 125.27 ? 312 GLN B CD    1 
ATOM   5905  O  OE1   . GLN B 1 312 ? 24.406  21.889  -26.332 1.00 138.50 ? 312 GLN B OE1   1 
ATOM   5906  N  NE2   . GLN B 1 312 ? 23.091  20.626  -27.487 1.00 125.03 ? 312 GLN B NE2   1 
ATOM   5907  N  N     . ALA B 1 313 ? 22.042  17.337  -23.205 1.00 67.07  ? 313 ALA B N     1 
ATOM   5908  C  CA    . ALA B 1 313 ? 22.175  16.271  -22.248 1.00 58.85  ? 313 ALA B CA    1 
ATOM   5909  C  C     . ALA B 1 313 ? 23.371  15.432  -22.627 1.00 72.22  ? 313 ALA B C     1 
ATOM   5910  O  O     . ALA B 1 313 ? 23.749  15.420  -23.773 1.00 85.51  ? 313 ALA B O     1 
ATOM   5911  C  CB    . ALA B 1 313 ? 20.913  15.445  -22.229 1.00 63.06  ? 313 ALA B CB    1 
ATOM   5912  N  N     . TYR B 1 314 ? 23.933  14.696  -21.678 1.00 70.07  ? 314 TYR B N     1 
ATOM   5913  C  CA    . TYR B 1 314 ? 25.101  13.870  -21.982 1.00 63.59  ? 314 TYR B CA    1 
ATOM   5914  C  C     . TYR B 1 314 ? 24.861  12.504  -21.423 1.00 66.13  ? 314 TYR B C     1 
ATOM   5915  O  O     . TYR B 1 314 ? 24.279  12.371  -20.355 1.00 74.31  ? 314 TYR B O     1 
ATOM   5916  C  CB    . TYR B 1 314 ? 26.363  14.501  -21.420 1.00 60.91  ? 314 TYR B CB    1 
ATOM   5917  C  CG    . TYR B 1 314 ? 26.573  15.855  -22.015 1.00 65.55  ? 314 TYR B CG    1 
ATOM   5918  C  CD1   . TYR B 1 314 ? 26.006  16.988  -21.409 1.00 65.64  ? 314 TYR B CD1   1 
ATOM   5919  C  CD2   . TYR B 1 314 ? 27.360  16.031  -23.138 1.00 62.31  ? 314 TYR B CD2   1 
ATOM   5920  C  CE1   . TYR B 1 314 ? 26.179  18.249  -21.940 1.00 66.20  ? 314 TYR B CE1   1 
ATOM   5921  C  CE2   . TYR B 1 314 ? 27.558  17.301  -23.674 1.00 59.25  ? 314 TYR B CE2   1 
ATOM   5922  C  CZ    . TYR B 1 314 ? 26.970  18.407  -23.070 1.00 68.16  ? 314 TYR B CZ    1 
ATOM   5923  O  OH    . TYR B 1 314 ? 27.146  19.672  -23.600 1.00 76.14  ? 314 TYR B OH    1 
ATOM   5924  N  N     . ARG B 1 315 ? 25.306  11.492  -22.145 1.00 63.72  ? 315 ARG B N     1 
ATOM   5925  C  CA    . ARG B 1 315 ? 25.098  10.118  -21.736 1.00 70.47  ? 315 ARG B CA    1 
ATOM   5926  C  C     . ARG B 1 315 ? 26.339  9.666   -21.024 1.00 74.37  ? 315 ARG B C     1 
ATOM   5927  O  O     . ARG B 1 315 ? 27.426  9.623   -21.620 1.00 70.04  ? 315 ARG B O     1 
ATOM   5928  C  CB    . ARG B 1 315 ? 24.805  9.243   -22.925 1.00 90.65  ? 315 ARG B CB    1 
ATOM   5929  C  CG    . ARG B 1 315 ? 23.796  9.930   -23.711 1.00 111.16 ? 315 ARG B CG    1 
ATOM   5930  C  CD    . ARG B 1 315 ? 23.349  9.349   -24.978 1.00 126.50 ? 315 ARG B CD    1 
ATOM   5931  N  NE    . ARG B 1 315 ? 22.231  8.416   -24.978 1.00 127.88 ? 315 ARG B NE    1 
ATOM   5932  C  CZ    . ARG B 1 315 ? 21.716  8.023   -26.130 1.00 134.20 ? 315 ARG B CZ    1 
ATOM   5933  N  NH1   . ARG B 1 315 ? 22.209  8.542   -27.254 1.00 138.25 ? 315 ARG B NH1   1 
ATOM   5934  N  NH2   . ARG B 1 315 ? 20.696  7.182   -26.156 1.00 132.26 ? 315 ARG B NH2   1 
ATOM   5935  N  N     . LEU B 1 316 ? 26.161  9.348   -19.750 1.00 70.37  ? 316 LEU B N     1 
ATOM   5936  C  CA    . LEU B 1 316 ? 27.243  8.925   -18.889 1.00 59.44  ? 316 LEU B CA    1 
ATOM   5937  C  C     . LEU B 1 316 ? 27.631  7.474   -19.181 1.00 48.94  ? 316 LEU B C     1 
ATOM   5938  O  O     . LEU B 1 316 ? 26.804  6.681   -19.601 1.00 49.08  ? 316 LEU B O     1 
ATOM   5939  C  CB    . LEU B 1 316 ? 26.777  9.093   -17.437 1.00 61.96  ? 316 LEU B CB    1 
ATOM   5940  C  CG    . LEU B 1 316 ? 26.528  10.559  -17.042 1.00 63.31  ? 316 LEU B CG    1 
ATOM   5941  C  CD1   . LEU B 1 316 ? 25.906  10.648  -15.686 1.00 73.37  ? 316 LEU B CD1   1 
ATOM   5942  C  CD2   . LEU B 1 316 ? 27.777  11.461  -17.101 1.00 69.64  ? 316 LEU B CD2   1 
ATOM   5943  N  N     . SER B 1 317 ? 28.872  7.108   -18.890 1.00 65.49  ? 317 SER B N     1 
ATOM   5944  C  CA    . SER B 1 317 ? 29.404  5.752   -19.141 1.00 60.87  ? 317 SER B CA    1 
ATOM   5945  C  C     . SER B 1 317 ? 28.689  4.801   -18.206 1.00 69.69  ? 317 SER B C     1 
ATOM   5946  O  O     . SER B 1 317 ? 28.270  5.202   -17.113 1.00 64.13  ? 317 SER B O     1 
ATOM   5947  C  CB    . SER B 1 317 ? 30.897  5.625   -18.924 1.00 52.27  ? 317 SER B CB    1 
ATOM   5948  O  OG    . SER B 1 317 ? 31.227  5.773   -17.554 1.00 60.49  ? 317 SER B OG    1 
ATOM   5949  N  N     . ILE B 1 318 ? 28.327  3.639   -18.729 1.00 82.41  ? 318 ILE B N     1 
ATOM   5950  C  CA    . ILE B 1 318 ? 27.701  2.600   -17.923 1.00 82.09  ? 318 ILE B CA    1 
ATOM   5951  C  C     . ILE B 1 318 ? 28.684  2.155   -16.836 1.00 66.05  ? 318 ILE B C     1 
ATOM   5952  O  O     . ILE B 1 318 ? 29.838  1.833   -17.113 1.00 54.17  ? 318 ILE B O     1 
ATOM   5953  C  CB    . ILE B 1 318 ? 27.298  1.389   -18.823 1.00 53.80  ? 318 ILE B CB    1 
ATOM   5954  C  CG1   . ILE B 1 318 ? 26.153  1.784   -19.768 1.00 58.53  ? 318 ILE B CG1   1 
ATOM   5955  C  CG2   . ILE B 1 318 ? 26.962  0.150   -18.019 1.00 55.89  ? 318 ILE B CG2   1 
ATOM   5956  C  CD1   . ILE B 1 318 ? 26.633  2.471   -21.074 1.00 58.42  ? 318 ILE B CD1   1 
ATOM   5957  N  N     . PRO B 1 319 ? 28.225  2.134   -15.579 1.00 53.16  ? 319 PRO B N     1 
ATOM   5958  C  CA    . PRO B 1 319 ? 29.158  1.765   -14.511 1.00 56.84  ? 319 PRO B CA    1 
ATOM   5959  C  C     . PRO B 1 319 ? 29.495  0.271   -14.492 1.00 59.74  ? 319 PRO B C     1 
ATOM   5960  O  O     . PRO B 1 319 ? 28.636  -0.516  -14.898 1.00 59.36  ? 319 PRO B O     1 
ATOM   5961  C  CB    . PRO B 1 319 ? 28.369  2.129   -13.244 1.00 46.38  ? 319 PRO B CB    1 
ATOM   5962  C  CG    . PRO B 1 319 ? 26.957  2.054   -13.631 1.00 45.36  ? 319 PRO B CG    1 
ATOM   5963  C  CD    . PRO B 1 319 ? 26.887  2.468   -15.086 1.00 48.53  ? 319 PRO B CD    1 
ATOM   5964  N  N     . LYS B 1 320 ? 30.683  -0.097  -13.995 1.00 54.57  ? 320 LYS B N     1 
ATOM   5965  C  CA    . LYS B 1 320 ? 31.053  -1.519  -13.964 1.00 60.04  ? 320 LYS B CA    1 
ATOM   5966  C  C     . LYS B 1 320 ? 30.926  -2.191  -12.568 1.00 51.03  ? 320 LYS B C     1 
ATOM   5967  O  O     . LYS B 1 320 ? 31.748  -1.996  -11.679 1.00 39.56  ? 320 LYS B O     1 
ATOM   5968  C  CB    . LYS B 1 320 ? 32.491  -1.747  -14.500 1.00 75.50  ? 320 LYS B CB    1 
ATOM   5969  C  CG    . LYS B 1 320 ? 32.820  -1.290  -15.938 1.00 84.83  ? 320 LYS B CG    1 
ATOM   5970  C  CD    . LYS B 1 320 ? 32.770  0.187   -16.252 1.00 91.80  ? 320 LYS B CD    1 
ATOM   5971  C  CE    . LYS B 1 320 ? 32.892  0.382   -17.769 1.00 84.79  ? 320 LYS B CE    1 
ATOM   5972  N  NZ    . LYS B 1 320 ? 32.824  1.808   -18.217 1.00 79.90  ? 320 LYS B NZ    1 
ATOM   5973  N  N     . LEU B 1 321 ? 29.949  -3.079  -12.458 1.00 57.31  ? 321 LEU B N     1 
ATOM   5974  C  CA    . LEU B 1 321 ? 29.704  -3.694  -11.178 1.00 45.85  ? 321 LEU B CA    1 
ATOM   5975  C  C     . LEU B 1 321 ? 30.449  -5.021  -11.043 1.00 59.14  ? 321 LEU B C     1 
ATOM   5976  O  O     . LEU B 1 321 ? 30.401  -5.835  -11.945 1.00 77.87  ? 321 LEU B O     1 
ATOM   5977  C  CB    . LEU B 1 321 ? 28.197  -3.898  -10.989 1.00 29.24  ? 321 LEU B CB    1 
ATOM   5978  C  CG    . LEU B 1 321 ? 27.503  -3.296  -9.770  1.00 41.84  ? 321 LEU B CG    1 
ATOM   5979  C  CD1   . LEU B 1 321 ? 26.176  -4.020  -9.501  1.00 33.10  ? 321 LEU B CD1   1 
ATOM   5980  C  CD2   . LEU B 1 321 ? 28.387  -3.166  -8.515  1.00 29.42  ? 321 LEU B CD2   1 
ATOM   5981  N  N     . MET B 1 322 ? 31.130  -5.215  -9.907  1.00 53.80  ? 322 MET B N     1 
ATOM   5982  C  CA    . MET B 1 322 ? 31.919  -6.440  -9.614  1.00 55.02  ? 322 MET B CA    1 
ATOM   5983  C  C     . MET B 1 322 ? 31.473  -7.219  -8.401  1.00 59.95  ? 322 MET B C     1 
ATOM   5984  O  O     . MET B 1 322 ? 31.403  -6.665  -7.306  1.00 55.55  ? 322 MET B O     1 
ATOM   5985  C  CB    . MET B 1 322 ? 33.416  -6.146  -9.454  1.00 48.68  ? 322 MET B CB    1 
ATOM   5986  C  CG    . MET B 1 322 ? 34.062  -5.566  -10.661 1.00 58.09  ? 322 MET B CG    1 
ATOM   5987  S  SD    . MET B 1 322 ? 35.798  -5.281  -10.366 1.00 105.86 ? 322 MET B SD    1 
ATOM   5988  C  CE    . MET B 1 322 ? 36.217  -6.667  -9.309  1.00 95.97  ? 322 MET B CE    1 
ATOM   5989  N  N     . GLY B 1 323 ? 31.130  -8.473  -8.596  1.00 61.21  ? 323 GLY B N     1 
ATOM   5990  C  CA    . GLY B 1 323 ? 31.093  -9.391  -7.461  1.00 57.97  ? 323 GLY B CA    1 
ATOM   5991  C  C     . GLY B 1 323 ? 32.492  -9.973  -7.395  1.00 57.14  ? 323 GLY B C     1 
ATOM   5992  O  O     . GLY B 1 323 ? 33.452  -9.209  -7.547  1.00 51.57  ? 323 GLY B O     1 
ATOM   5993  N  N     . ARG B 1 324 ? 32.641  -11.294 -7.257  1.00 61.76  ? 324 ARG B N     1 
ATOM   5994  C  CA    . ARG B 1 324 ? 33.955  -11.953 -7.413  1.00 59.60  ? 324 ARG B CA    1 
ATOM   5995  C  C     . ARG B 1 324 ? 34.339  -11.675 -8.867  1.00 63.17  ? 324 ARG B C     1 
ATOM   5996  O  O     . ARG B 1 324 ? 35.514  -11.572 -9.196  1.00 67.18  ? 324 ARG B O     1 
ATOM   5997  C  CB    . ARG B 1 324 ? 33.984  -13.422 -7.021  1.00 61.04  ? 324 ARG B CB    1 
ATOM   5998  C  CG    . ARG B 1 324 ? 35.255  -14.107 -7.457  1.00 72.75  ? 324 ARG B CG    1 
ATOM   5999  C  CD    . ARG B 1 324 ? 35.168  -15.575 -7.177  1.00 95.86  ? 324 ARG B CD    1 
ATOM   6000  N  NE    . ARG B 1 324 ? 36.434  -16.330 -7.194  1.00 104.40 ? 324 ARG B NE    1 
ATOM   6001  C  CZ    . ARG B 1 324 ? 37.308  -16.362 -6.180  1.00 111.24 ? 324 ARG B CZ    1 
ATOM   6002  N  NH1   . ARG B 1 324 ? 38.417  -17.076 -6.267  1.00 116.63 ? 324 ARG B NH1   1 
ATOM   6003  N  NH2   . ARG B 1 324 ? 37.051  -15.691 -5.008  1.00 96.91  ? 324 ARG B NH2   1 
ATOM   6004  N  N     . ARG B 1 325 ? 33.322  -11.631 -9.727  1.00 56.71  ? 325 ARG B N     1 
ATOM   6005  C  CA    . ARG B 1 325 ? 33.475  -11.199 -11.126 1.00 55.55  ? 325 ARG B CA    1 
ATOM   6006  C  C     . ARG B 1 325 ? 32.363  -10.220 -11.506 1.00 64.29  ? 325 ARG B C     1 
ATOM   6007  O  O     . ARG B 1 325 ? 31.473  -9.886  -10.709 1.00 62.92  ? 325 ARG B O     1 
ATOM   6008  C  CB    . ARG B 1 325 ? 33.456  -12.357 -12.124 1.00 54.02  ? 325 ARG B CB    1 
ATOM   6009  C  CG    . ARG B 1 325 ? 32.176  -13.153 -12.409 1.00 72.88  ? 325 ARG B CG    1 
ATOM   6010  C  CD    . ARG B 1 325 ? 32.561  -14.432 -13.219 1.00 78.55  ? 325 ARG B CD    1 
ATOM   6011  N  NE    . ARG B 1 325 ? 31.427  -15.278 -13.591 1.00 74.33  ? 325 ARG B NE    1 
ATOM   6012  C  CZ    . ARG B 1 325 ? 30.551  -14.968 -14.537 1.00 86.44  ? 325 ARG B CZ    1 
ATOM   6013  N  NH1   . ARG B 1 325 ? 30.732  -13.870 -15.258 1.00 102.69 ? 325 ARG B NH1   1 
ATOM   6014  N  NH2   . ARG B 1 325 ? 29.548  -15.787 -14.813 1.00 88.42  ? 325 ARG B NH2   1 
ATOM   6015  N  N     . ALA B 1 326 ? 32.435  -9.756  -12.741 1.00 63.68  ? 326 ALA B N     1 
ATOM   6016  C  CA    . ALA B 1 326 ? 31.459  -8.797  -13.235 1.00 58.14  ? 326 ALA B CA    1 
ATOM   6017  C  C     . ALA B 1 326 ? 30.048  -9.331  -13.121 1.00 56.22  ? 326 ALA B C     1 
ATOM   6018  O  O     . ALA B 1 326 ? 29.797  -10.519 -13.370 1.00 51.29  ? 326 ALA B O     1 
ATOM   6019  C  CB    . ALA B 1 326 ? 31.745  -8.461  -14.645 1.00 49.28  ? 326 ALA B CB    1 
ATOM   6020  N  N     . VAL B 1 327 ? 29.143  -8.444  -12.718 1.00 49.11  ? 327 VAL B N     1 
ATOM   6021  C  CA    . VAL B 1 327 ? 27.742  -8.765  -12.586 1.00 48.28  ? 327 VAL B CA    1 
ATOM   6022  C  C     . VAL B 1 327 ? 26.964  -7.606  -13.227 1.00 55.34  ? 327 VAL B C     1 
ATOM   6023  O  O     . VAL B 1 327 ? 27.532  -6.541  -13.495 1.00 53.57  ? 327 VAL B O     1 
ATOM   6024  C  CB    . VAL B 1 327 ? 27.338  -8.880  -11.107 1.00 63.17  ? 327 VAL B CB    1 
ATOM   6025  C  CG1   . VAL B 1 327 ? 28.090  -10.048 -10.446 1.00 61.93  ? 327 VAL B CG1   1 
ATOM   6026  C  CG2   . VAL B 1 327 ? 27.708  -7.596  -10.358 1.00 63.10  ? 327 VAL B CG2   1 
ATOM   6027  N  N     . SER B 1 328 ? 25.673  -7.806  -13.481 1.00 62.46  ? 328 SER B N     1 
ATOM   6028  C  CA    . SER B 1 328 ? 24.802  -6.747  -13.994 1.00 71.26  ? 328 SER B CA    1 
ATOM   6029  C  C     . SER B 1 328 ? 23.895  -6.243  -12.901 1.00 69.76  ? 328 SER B C     1 
ATOM   6030  O  O     . SER B 1 328 ? 23.339  -5.139  -12.980 1.00 73.64  ? 328 SER B O     1 
ATOM   6031  C  CB    . SER B 1 328 ? 23.983  -7.236  -15.191 1.00 90.97  ? 328 SER B CB    1 
ATOM   6032  O  OG    . SER B 1 328 ? 23.334  -8.461  -14.901 1.00 100.20 ? 328 SER B OG    1 
ATOM   6033  N  N     . LYS B 1 329 ? 23.816  -7.037  -11.842 1.00 61.96  ? 329 LYS B N     1 
ATOM   6034  C  CA    . LYS B 1 329 ? 22.979  -6.725  -10.697 1.00 52.63  ? 329 LYS B CA    1 
ATOM   6035  C  C     . LYS B 1 329 ? 23.610  -7.389  -9.502  1.00 63.40  ? 329 LYS B C     1 
ATOM   6036  O  O     . LYS B 1 329 ? 24.349  -8.356  -9.664  1.00 83.20  ? 329 LYS B O     1 
ATOM   6037  C  CB    . LYS B 1 329 ? 21.548  -7.186  -11.002 1.00 49.68  ? 329 LYS B CB    1 
ATOM   6038  C  CG    . LYS B 1 329 ? 21.398  -8.668  -11.436 1.00 69.21  ? 329 LYS B CG    1 
ATOM   6039  C  CD    . LYS B 1 329 ? 19.938  -8.953  -11.826 1.00 65.08  ? 329 LYS B CD    1 
ATOM   6040  C  CE    . LYS B 1 329 ? 19.647  -10.374 -12.336 1.00 57.05  ? 329 LYS B CE    1 
ATOM   6041  N  NZ    . LYS B 1 329 ? 20.290  -11.509 -11.621 1.00 56.68  ? 329 LYS B NZ    1 
ATOM   6042  N  N     . PRO B 1 330 ? 23.385  -6.826  -8.299  1.00 60.19  ? 330 PRO B N     1 
ATOM   6043  C  CA    . PRO B 1 330 ? 23.952  -7.397  -7.067  1.00 48.56  ? 330 PRO B CA    1 
ATOM   6044  C  C     . PRO B 1 330 ? 23.566  -8.817  -6.744  1.00 54.86  ? 330 PRO B C     1 
ATOM   6045  O  O     . PRO B 1 330 ? 24.433  -9.558  -6.271  1.00 55.01  ? 330 PRO B O     1 
ATOM   6046  C  CB    . PRO B 1 330 ? 23.410  -6.467  -5.988  1.00 39.66  ? 330 PRO B CB    1 
ATOM   6047  C  CG    . PRO B 1 330 ? 23.206  -5.139  -6.708  1.00 39.25  ? 330 PRO B CG    1 
ATOM   6048  C  CD    . PRO B 1 330 ? 22.726  -5.524  -8.058  1.00 48.30  ? 330 PRO B CD    1 
ATOM   6049  N  N     . ALA B 1 331 ? 22.385  -9.242  -7.185  1.00 56.90  ? 331 ALA B N     1 
ATOM   6050  C  CA    . ALA B 1 331 ? 21.944  -10.610 -6.951  1.00 57.29  ? 331 ALA B CA    1 
ATOM   6051  C  C     . ALA B 1 331 ? 22.837  -11.678 -7.583  1.00 56.29  ? 331 ALA B C     1 
ATOM   6052  O  O     . ALA B 1 331 ? 23.010  -12.782 -7.045  1.00 60.75  ? 331 ALA B O     1 
ATOM   6053  C  CB    . ALA B 1 331 ? 20.527  -10.747 -7.461  1.00 58.06  ? 331 ALA B CB    1 
ATOM   6054  N  N     . ASP B 1 332 ? 23.537  -11.280 -8.626  1.00 53.88  ? 332 ASP B N     1 
ATOM   6055  C  CA    . ASP B 1 332 ? 24.445  -12.171 -9.325  1.00 59.70  ? 332 ASP B CA    1 
ATOM   6056  C  C     . ASP B 1 332 ? 25.632  -12.583 -8.463  1.00 61.16  ? 332 ASP B C     1 
ATOM   6057  O  O     . ASP B 1 332 ? 26.267  -13.614 -8.709  1.00 52.03  ? 332 ASP B O     1 
ATOM   6058  C  CB    . ASP B 1 332 ? 24.879  -11.525 -10.626 1.00 57.93  ? 332 ASP B CB    1 
ATOM   6059  C  CG    . ASP B 1 332 ? 23.776  -11.523 -11.645 1.00 70.65  ? 332 ASP B CG    1 
ATOM   6060  O  OD1   . ASP B 1 332 ? 22.887  -12.412 -11.564 1.00 75.30  ? 332 ASP B OD1   1 
ATOM   6061  O  OD2   . ASP B 1 332 ? 23.763  -10.603 -12.485 1.00 83.81  ? 332 ASP B OD2   1 
ATOM   6062  N  N     . ALA B 1 333 ? 25.938  -11.779 -7.456  1.00 61.45  ? 333 ALA B N     1 
ATOM   6063  C  CA    . ALA B 1 333 ? 27.069  -12.093 -6.589  1.00 62.38  ? 333 ALA B CA    1 
ATOM   6064  C  C     . ALA B 1 333 ? 26.763  -13.411 -5.841  1.00 71.72  ? 333 ALA B C     1 
ATOM   6065  O  O     . ALA B 1 333 ? 27.678  -14.101 -5.393  1.00 74.64  ? 333 ALA B O     1 
ATOM   6066  C  CB    . ALA B 1 333 ? 27.364  -10.964 -5.640  1.00 55.54  ? 333 ALA B CB    1 
ATOM   6067  N  N     . LEU B 1 334 ? 25.479  -13.752 -5.700  1.00 65.64  ? 334 LEU B N     1 
ATOM   6068  C  CA    . LEU B 1 334 ? 25.098  -15.044 -5.114  1.00 68.74  ? 334 LEU B CA    1 
ATOM   6069  C  C     . LEU B 1 334 ? 25.506  -16.278 -5.928  1.00 76.16  ? 334 LEU B C     1 
ATOM   6070  O  O     . LEU B 1 334 ? 25.628  -17.375 -5.375  1.00 75.87  ? 334 LEU B O     1 
ATOM   6071  C  CB    . LEU B 1 334 ? 23.601  -15.109 -4.869  1.00 66.61  ? 334 LEU B CB    1 
ATOM   6072  C  CG    . LEU B 1 334 ? 22.998  -14.129 -3.902  1.00 60.64  ? 334 LEU B CG    1 
ATOM   6073  C  CD1   . LEU B 1 334 ? 21.506  -14.356 -3.871  1.00 55.41  ? 334 LEU B CD1   1 
ATOM   6074  C  CD2   . LEU B 1 334 ? 23.644  -14.410 -2.556  1.00 63.81  ? 334 LEU B CD2   1 
ATOM   6075  N  N     . ARG B 1 335 ? 25.783  -16.098 -7.213  1.00 71.06  ? 335 ARG B N     1 
ATOM   6076  C  CA    . ARG B 1 335 ? 26.142  -17.198 -8.117  1.00 63.67  ? 335 ARG B CA    1 
ATOM   6077  C  C     . ARG B 1 335 ? 27.616  -17.122 -8.474  1.00 68.22  ? 335 ARG B C     1 
ATOM   6078  O  O     . ARG B 1 335 ? 28.292  -18.149 -8.512  1.00 77.87  ? 335 ARG B O     1 
ATOM   6079  C  CB    . ARG B 1 335 ? 25.316  -17.028 -9.388  1.00 59.82  ? 335 ARG B CB    1 
ATOM   6080  C  CG    . ARG B 1 335 ? 23.862  -17.371 -9.406  1.00 76.28  ? 335 ARG B CG    1 
ATOM   6081  C  CD    . ARG B 1 335 ? 23.244  -16.332 -10.323 1.00 87.25  ? 335 ARG B CD    1 
ATOM   6082  N  NE    . ARG B 1 335 ? 21.778  -16.319 -10.260 1.00 95.64  ? 335 ARG B NE    1 
ATOM   6083  C  CZ    . ARG B 1 335 ? 21.034  -15.536 -9.543  1.00 93.08  ? 335 ARG B CZ    1 
ATOM   6084  N  NH1   . ARG B 1 335 ? 21.623  -15.177 -8.532  1.00 93.81  ? 335 ARG B NH1   1 
ATOM   6085  N  NH2   . ARG B 1 335 ? 19.727  -15.507 -9.482  1.00 97.46  ? 335 ARG B NH2   1 
ATOM   6086  N  N     . VAL B 1 336 ? 28.119  -15.922 -8.736  1.00 63.86  ? 336 VAL B N     1 
ATOM   6087  C  CA    . VAL B 1 336 ? 29.523  -15.777 -9.108  1.00 58.05  ? 336 VAL B CA    1 
ATOM   6088  C  C     . VAL B 1 336 ? 30.452  -15.609 -7.900  1.00 70.31  ? 336 VAL B C     1 
ATOM   6089  O  O     . VAL B 1 336 ? 31.659  -15.766 -8.010  1.00 74.71  ? 336 VAL B O     1 
ATOM   6090  C  CB    . VAL B 1 336 ? 29.743  -14.660 -10.118 1.00 49.40  ? 336 VAL B CB    1 
ATOM   6091  C  CG1   . VAL B 1 336 ? 28.664  -14.745 -11.186 1.00 32.24  ? 336 VAL B CG1   1 
ATOM   6092  C  CG2   . VAL B 1 336 ? 29.785  -13.298 -9.445  1.00 54.58  ? 336 VAL B CG2   1 
ATOM   6093  N  N     . GLY B 1 337 ? 29.901  -15.177 -6.774  1.00 74.59  ? 337 GLY B N     1 
ATOM   6094  C  CA    . GLY B 1 337 ? 30.673  -14.929 -5.563  1.00 74.68  ? 337 GLY B CA    1 
ATOM   6095  C  C     . GLY B 1 337 ? 30.747  -13.445 -5.227  1.00 74.96  ? 337 GLY B C     1 
ATOM   6096  O  O     . GLY B 1 337 ? 30.521  -12.587 -6.102  1.00 74.37  ? 337 GLY B O     1 
ATOM   6097  N  N     . PHE B 1 338 ? 31.117  -13.139 -3.977  1.00 69.01  ? 338 PHE B N     1 
ATOM   6098  C  CA    . PHE B 1 338 ? 31.155  -11.750 -3.503  1.00 60.44  ? 338 PHE B CA    1 
ATOM   6099  C  C     . PHE B 1 338 ? 32.433  -11.057 -3.839  1.00 66.63  ? 338 PHE B C     1 
ATOM   6100  O  O     . PHE B 1 338 ? 33.467  -11.691 -4.001  1.00 68.47  ? 338 PHE B O     1 
ATOM   6101  C  CB    . PHE B 1 338 ? 30.942  -11.678 -2.005  1.00 64.44  ? 338 PHE B CB    1 
ATOM   6102  C  CG    . PHE B 1 338 ? 29.831  -12.531 -1.529  1.00 74.16  ? 338 PHE B CG    1 
ATOM   6103  C  CD1   . PHE B 1 338 ? 28.547  -12.338 -2.013  1.00 70.58  ? 338 PHE B CD1   1 
ATOM   6104  C  CD2   . PHE B 1 338 ? 30.076  -13.574 -0.654  1.00 77.94  ? 338 PHE B CD2   1 
ATOM   6105  C  CE1   . PHE B 1 338 ? 27.524  -13.139 -1.596  1.00 76.04  ? 338 PHE B CE1   1 
ATOM   6106  C  CE2   . PHE B 1 338 ? 29.061  -14.383 -0.238  1.00 79.52  ? 338 PHE B CE2   1 
ATOM   6107  C  CZ    . PHE B 1 338 ? 27.783  -14.172 -0.711  1.00 82.91  ? 338 PHE B CZ    1 
ATOM   6108  N  N     . TYR B 1 339 ? 32.373  -9.733  -3.840  1.00 72.98  ? 339 TYR B N     1 
ATOM   6109  C  CA    . TYR B 1 339 ? 33.533  -8.920  -4.134  1.00 56.78  ? 339 TYR B CA    1 
ATOM   6110  C  C     . TYR B 1 339 ? 34.629  -9.169  -3.135  1.00 55.05  ? 339 TYR B C     1 
ATOM   6111  O  O     . TYR B 1 339 ? 35.785  -9.261  -3.504  1.00 60.29  ? 339 TYR B O     1 
ATOM   6112  C  CB    . TYR B 1 339 ? 33.162  -7.473  -4.098  1.00 56.34  ? 339 TYR B CB    1 
ATOM   6113  C  CG    . TYR B 1 339 ? 34.329  -6.594  -4.339  1.00 54.30  ? 339 TYR B CG    1 
ATOM   6114  C  CD1   . TYR B 1 339 ? 34.828  -6.461  -5.625  1.00 51.87  ? 339 TYR B CD1   1 
ATOM   6115  C  CD2   . TYR B 1 339 ? 34.951  -5.907  -3.296  1.00 47.49  ? 339 TYR B CD2   1 
ATOM   6116  C  CE1   . TYR B 1 339 ? 35.896  -5.654  -5.887  1.00 54.26  ? 339 TYR B CE1   1 
ATOM   6117  C  CE2   . TYR B 1 339 ? 36.030  -5.097  -3.552  1.00 58.61  ? 339 TYR B CE2   1 
ATOM   6118  C  CZ    . TYR B 1 339 ? 36.497  -4.976  -4.859  1.00 61.16  ? 339 TYR B CZ    1 
ATOM   6119  O  OH    . TYR B 1 339 ? 37.564  -4.168  -5.135  1.00 75.93  ? 339 TYR B OH    1 
ATOM   6120  N  N     . ARG B 1 340 ? 34.259  -9.288  -1.868  1.00 61.24  ? 340 ARG B N     1 
ATOM   6121  C  CA    . ARG B 1 340 ? 35.222  -9.648  -0.827  1.00 75.79  ? 340 ARG B CA    1 
ATOM   6122  C  C     . ARG B 1 340 ? 34.597  -10.455 0.274   1.00 84.87  ? 340 ARG B C     1 
ATOM   6123  O  O     . ARG B 1 340 ? 33.827  -9.954  1.095   1.00 85.19  ? 340 ARG B O     1 
ATOM   6124  C  CB    . ARG B 1 340 ? 35.865  -8.424  -0.192  1.00 75.25  ? 340 ARG B CB    1 
ATOM   6125  C  CG    . ARG B 1 340 ? 37.026  -8.769  0.741   1.00 71.37  ? 340 ARG B CG    1 
ATOM   6126  C  CD    . ARG B 1 340 ? 37.617  -7.518  1.354   1.00 77.43  ? 340 ARG B CD    1 
ATOM   6127  N  NE    . ARG B 1 340 ? 36.594  -6.806  2.115   1.00 92.58  ? 340 ARG B NE    1 
ATOM   6128  C  CZ    . ARG B 1 340 ? 35.962  -5.708  1.704   1.00 88.51  ? 340 ARG B CZ    1 
ATOM   6129  N  NH1   . ARG B 1 340 ? 36.240  -5.140  0.529   1.00 78.83  ? 340 ARG B NH1   1 
ATOM   6130  N  NH2   . ARG B 1 340 ? 35.056  -5.178  2.501   1.00 93.80  ? 340 ARG B NH2   1 
ATOM   6131  N  N     . ALA B 1 341 ? 34.771  -11.756 0.135   1.00 90.72  ? 341 ALA B N     1 
ATOM   6132  C  CA    . ALA B 1 341 ? 34.297  -12.669 1.130   1.00 90.26  ? 341 ALA B CA    1 
ATOM   6133  C  C     . ALA B 1 341 ? 35.335  -12.964 2.187   1.00 84.97  ? 341 ALA B C     1 
ATOM   6134  O  O     . ALA B 1 341 ? 36.544  -12.827 1.970   1.00 96.90  ? 341 ALA B O     1 
ATOM   6135  C  CB    . ALA B 1 341 ? 33.838  -13.959 0.504   1.00 101.89 ? 341 ALA B CB    1 
ATOM   6136  N  N     . GLN B 1 342 ? 34.834  -13.241 3.358   1.00 80.28  ? 342 GLN B N     1 
ATOM   6137  C  CA    . GLN B 1 342 ? 35.583  -13.624 4.531   1.00 86.78  ? 342 GLN B CA    1 
ATOM   6138  C  C     . GLN B 1 342 ? 34.791  -14.589 5.377   1.00 84.08  ? 342 GLN B C     1 
ATOM   6139  O  O     . GLN B 1 342 ? 33.571  -14.741 5.207   1.00 91.26  ? 342 GLN B O     1 
ATOM   6140  C  CB    . GLN B 1 342 ? 36.270  -12.405 5.164   1.00 93.71  ? 342 GLN B CB    1 
ATOM   6141  C  CG    . GLN B 1 342 ? 35.433  -11.196 5.220   1.00 105.71 ? 342 GLN B CG    1 
ATOM   6142  C  CD    . GLN B 1 342 ? 35.474  -10.383 6.448   1.00 121.38 ? 342 GLN B CD    1 
ATOM   6143  O  OE1   . GLN B 1 342 ? 35.623  -10.901 7.560   1.00 134.02 ? 342 GLN B OE1   1 
ATOM   6144  N  NE2   . GLN B 1 342 ? 35.380  -9.058  6.260   1.00 117.93 ? 342 GLN B NE2   1 
ATOM   6145  N  N     . GLU B 1 343 ? 35.479  -15.301 6.250   1.00 79.71  ? 343 GLU B N     1 
ATOM   6146  C  CA    . GLU B 1 343 ? 34.861  -16.245 7.143   1.00 70.60  ? 343 GLU B CA    1 
ATOM   6147  C  C     . GLU B 1 343 ? 33.714  -15.603 7.917   1.00 70.45  ? 343 GLU B C     1 
ATOM   6148  O  O     . GLU B 1 343 ? 33.833  -14.584 8.594   1.00 74.29  ? 343 GLU B O     1 
ATOM   6149  C  CB    . GLU B 1 343 ? 36.092  -16.750 7.965   1.00 84.10  ? 343 GLU B CB    1 
ATOM   6150  C  CG    . GLU B 1 343 ? 35.969  -17.693 8.997   1.00 98.77  ? 343 GLU B CG    1 
ATOM   6151  C  CD    . GLU B 1 343 ? 37.244  -17.926 9.768   1.00 116.27 ? 343 GLU B CD    1 
ATOM   6152  O  OE1   . GLU B 1 343 ? 38.073  -18.736 9.221   1.00 115.44 ? 343 GLU B OE1   1 
ATOM   6153  O  OE2   . GLU B 1 343 ? 37.489  -17.310 10.801  1.00 129.68 ? 343 GLU B OE2   1 
ATOM   6154  N  N     . THR B 1 344 ? 32.580  -16.284 7.755   1.00 66.76  ? 344 THR B N     1 
ATOM   6155  C  CA    . THR B 1 344 ? 31.302  -15.857 8.311   1.00 62.31  ? 344 THR B CA    1 
ATOM   6156  C  C     . THR B 1 344 ? 30.537  -16.940 9.048   1.00 68.60  ? 344 THR B C     1 
ATOM   6157  O  O     . THR B 1 344 ? 30.601  -18.117 8.713   1.00 81.49  ? 344 THR B O     1 
ATOM   6158  C  CB    . THR B 1 344 ? 30.379  -15.368 7.135   1.00 62.35  ? 344 THR B CB    1 
ATOM   6159  O  OG1   . THR B 1 344 ? 31.039  -14.360 6.364   1.00 74.73  ? 344 THR B OG1   1 
ATOM   6160  C  CG2   . THR B 1 344 ? 29.028  -14.841 7.605   1.00 55.94  ? 344 THR B CG2   1 
ATOM   6161  N  N     . ALA B 1 345 ? 29.713  -16.511 9.984   1.00 68.71  ? 345 ALA B N     1 
ATOM   6162  C  CA    . ALA B 1 345 ? 28.867  -17.395 10.762  1.00 66.99  ? 345 ALA B CA    1 
ATOM   6163  C  C     . ALA B 1 345 ? 27.537  -16.663 10.799  1.00 73.89  ? 345 ALA B C     1 
ATOM   6164  O  O     . ALA B 1 345 ? 27.454  -15.479 11.154  1.00 82.14  ? 345 ALA B O     1 
ATOM   6165  C  CB    . ALA B 1 345 ? 29.408  -17.631 12.158  1.00 56.80  ? 345 ALA B CB    1 
ATOM   6166  N  N     . LEU B 1 346 ? 26.488  -17.368 10.420  1.00 59.80  ? 346 LEU B N     1 
ATOM   6167  C  CA    . LEU B 1 346 ? 25.233  -16.717 10.376  1.00 56.14  ? 346 LEU B CA    1 
ATOM   6168  C  C     . LEU B 1 346 ? 24.351  -17.524 11.331  1.00 67.24  ? 346 LEU B C     1 
ATOM   6169  O  O     . LEU B 1 346 ? 24.526  -18.743 11.417  1.00 76.35  ? 346 LEU B O     1 
ATOM   6170  C  CB    . LEU B 1 346 ? 24.814  -16.857 8.929   1.00 63.24  ? 346 LEU B CB    1 
ATOM   6171  C  CG    . LEU B 1 346 ? 25.230  -15.804 7.894   1.00 62.60  ? 346 LEU B CG    1 
ATOM   6172  C  CD1   . LEU B 1 346 ? 24.584  -16.151 6.561   1.00 51.80  ? 346 LEU B CD1   1 
ATOM   6173  C  CD2   . LEU B 1 346 ? 25.094  -14.329 8.277   1.00 68.70  ? 346 LEU B CD2   1 
ATOM   6174  N  N     . ALA B 1 347 ? 23.369  -16.934 11.999  1.00 63.94  ? 347 ALA B N     1 
ATOM   6175  C  CA    . ALA B 1 347 ? 22.470  -17.784 12.794  1.00 54.00  ? 347 ALA B CA    1 
ATOM   6176  C  C     . ALA B 1 347 ? 21.012  -17.678 12.317  1.00 62.48  ? 347 ALA B C     1 
ATOM   6177  O  O     . ALA B 1 347 ? 20.563  -16.602 11.855  1.00 47.38  ? 347 ALA B O     1 
ATOM   6178  C  CB    . ALA B 1 347 ? 22.589  -17.461 14.283  1.00 48.53  ? 347 ALA B CB    1 
ATOM   6179  N  N     . LEU B 1 348 ? 20.252  -18.758 12.502  1.00 61.56  ? 348 LEU B N     1 
ATOM   6180  C  CA    . LEU B 1 348 ? 18.829  -18.750 12.167  1.00 57.56  ? 348 LEU B CA    1 
ATOM   6181  C  C     . LEU B 1 348 ? 17.937  -18.769 13.412  1.00 53.68  ? 348 LEU B C     1 
ATOM   6182  O  O     . LEU B 1 348 ? 18.160  -19.542 14.346  1.00 61.39  ? 348 LEU B O     1 
ATOM   6183  C  CB    . LEU B 1 348 ? 18.480  -19.909 11.236  1.00 70.11  ? 348 LEU B CB    1 
ATOM   6184  C  CG    . LEU B 1 348 ? 17.012  -20.129 10.842  1.00 67.77  ? 348 LEU B CG    1 
ATOM   6185  C  CD1   . LEU B 1 348 ? 16.542  -19.036 9.898   1.00 60.64  ? 348 LEU B CD1   1 
ATOM   6186  C  CD2   . LEU B 1 348 ? 16.831  -21.479 10.169  1.00 71.45  ? 348 LEU B CD2   1 
ATOM   6187  N  N     . LEU B 1 349 ? 16.979  -17.854 13.444  1.00 52.43  ? 349 LEU B N     1 
ATOM   6188  C  CA    . LEU B 1 349 ? 15.970  -17.803 14.500  1.00 55.32  ? 349 LEU B CA    1 
ATOM   6189  C  C     . LEU B 1 349 ? 14.616  -17.977 13.832  1.00 59.24  ? 349 LEU B C     1 
ATOM   6190  O  O     . LEU B 1 349 ? 14.221  -17.189 12.965  1.00 53.25  ? 349 LEU B O     1 
ATOM   6191  C  CB    . LEU B 1 349 ? 16.011  -16.493 15.298  1.00 62.42  ? 349 LEU B CB    1 
ATOM   6192  C  CG    . LEU B 1 349 ? 14.820  -16.233 16.240  1.00 57.22  ? 349 LEU B CG    1 
ATOM   6193  C  CD1   . LEU B 1 349 ? 14.760  -17.207 17.390  1.00 54.25  ? 349 LEU B CD1   1 
ATOM   6194  C  CD2   . LEU B 1 349 ? 14.894  -14.813 16.777  1.00 53.62  ? 349 LEU B CD2   1 
ATOM   6195  N  N     . ARG B 1 350 ? 13.901  -19.007 14.280  1.00 55.93  ? 350 ARG B N     1 
ATOM   6196  C  CA    . ARG B 1 350 ? 12.611  -19.355 13.733  1.00 46.18  ? 350 ARG B CA    1 
ATOM   6197  C  C     . ARG B 1 350 ? 11.542  -18.980 14.719  1.00 54.45  ? 350 ARG B C     1 
ATOM   6198  O  O     . ARG B 1 350 ? 11.529  -19.443 15.842  1.00 72.38  ? 350 ARG B O     1 
ATOM   6199  C  CB    . ARG B 1 350 ? 12.550  -20.855 13.476  1.00 57.09  ? 350 ARG B CB    1 
ATOM   6200  C  CG    . ARG B 1 350 ? 13.355  -21.356 12.318  1.00 52.99  ? 350 ARG B CG    1 
ATOM   6201  C  CD    . ARG B 1 350 ? 12.412  -21.544 11.203  1.00 49.85  ? 350 ARG B CD    1 
ATOM   6202  N  NE    . ARG B 1 350 ? 12.683  -22.700 10.373  1.00 54.69  ? 350 ARG B NE    1 
ATOM   6203  C  CZ    . ARG B 1 350 ? 11.883  -23.059 9.377   1.00 55.05  ? 350 ARG B CZ    1 
ATOM   6204  N  NH1   . ARG B 1 350 ? 12.183  -24.094 8.600   1.00 66.59  ? 350 ARG B NH1   1 
ATOM   6205  N  NH2   . ARG B 1 350 ? 10.789  -22.348 9.144   1.00 45.54  ? 350 ARG B NH2   1 
ATOM   6206  N  N     . LEU B 1 351 ? 10.625  -18.136 14.296  1.00 55.58  ? 351 LEU B N     1 
ATOM   6207  C  CA    . LEU B 1 351 ? 9.535   -17.766 15.167  1.00 52.74  ? 351 LEU B CA    1 
ATOM   6208  C  C     . LEU B 1 351 ? 8.298   -18.573 14.816  1.00 70.29  ? 351 LEU B C     1 
ATOM   6209  O  O     . LEU B 1 351 ? 7.216   -18.303 15.314  1.00 86.55  ? 351 LEU B O     1 
ATOM   6210  C  CB    . LEU B 1 351 ? 9.235   -16.277 15.049  1.00 37.93  ? 351 LEU B CB    1 
ATOM   6211  C  CG    . LEU B 1 351 ? 10.405  -15.422 15.507  1.00 40.92  ? 351 LEU B CG    1 
ATOM   6212  C  CD1   . LEU B 1 351 ? 10.029  -13.947 15.506  1.00 46.61  ? 351 LEU B CD1   1 
ATOM   6213  C  CD2   . LEU B 1 351 ? 10.969  -15.906 16.803  1.00 36.24  ? 351 LEU B CD2   1 
ATOM   6214  N  N     . ASP B 1 352 ? 8.425   -19.453 13.838  1.00 65.23  ? 352 ASP B N     1 
ATOM   6215  C  CA    . ASP B 1 352 ? 7.263   -20.161 13.344  1.00 58.11  ? 352 ASP B CA    1 
ATOM   6216  C  C     . ASP B 1 352 ? 7.159   -21.605 13.835  1.00 67.55  ? 352 ASP B C     1 
ATOM   6217  O  O     . ASP B 1 352 ? 6.247   -22.332 13.425  1.00 61.67  ? 352 ASP B O     1 
ATOM   6218  C  CB    . ASP B 1 352 ? 7.283   -20.112 11.803  1.00 61.09  ? 352 ASP B CB    1 
ATOM   6219  C  CG    . ASP B 1 352 ? 8.430   -20.945 11.176  1.00 68.49  ? 352 ASP B CG    1 
ATOM   6220  O  OD1   . ASP B 1 352 ? 9.480   -21.178 11.841  1.00 70.67  ? 352 ASP B OD1   1 
ATOM   6221  O  OD2   . ASP B 1 352 ? 8.301   -21.293 9.974   1.00 59.70  ? 352 ASP B OD2   1 
ATOM   6222  N  N     . GLY B 1 353 ? 8.013   -22.010 14.779  1.00 76.23  ? 353 GLY B N     1 
ATOM   6223  C  CA    . GLY B 1 353 ? 7.873   -23.343 15.346  1.00 63.28  ? 353 GLY B CA    1 
ATOM   6224  C  C     . GLY B 1 353 ? 8.412   -24.430 14.443  1.00 64.02  ? 353 GLY B C     1 
ATOM   6225  O  O     . GLY B 1 353 ? 8.343   -25.604 14.766  1.00 76.04  ? 353 GLY B O     1 
ATOM   6226  N  N     . ALA B 1 354 ? 8.996   -24.045 13.326  1.00 57.98  ? 354 ALA B N     1 
ATOM   6227  C  CA    . ALA B 1 354 ? 9.519   -24.994 12.361  1.00 60.89  ? 354 ALA B CA    1 
ATOM   6228  C  C     . ALA B 1 354 ? 10.923  -25.580 12.513  1.00 82.53  ? 354 ALA B C     1 
ATOM   6229  O  O     . ALA B 1 354 ? 11.642  -25.305 13.450  1.00 84.74  ? 354 ALA B O     1 
ATOM   6230  C  CB    . ALA B 1 354 ? 9.336   -24.450 10.968  1.00 49.42  ? 354 ALA B CB    1 
ATOM   6231  N  N     . GLN B 1 355 ? 11.261  -26.413 11.529  1.00 93.28  ? 355 GLN B N     1 
ATOM   6232  C  CA    . GLN B 1 355 ? 12.506  -27.187 11.395  1.00 96.81  ? 355 GLN B CA    1 
ATOM   6233  C  C     . GLN B 1 355 ? 13.825  -26.469 11.649  1.00 77.08  ? 355 GLN B C     1 
ATOM   6234  O  O     . GLN B 1 355 ? 14.018  -25.929 12.711  1.00 89.44  ? 355 GLN B O     1 
ATOM   6235  C  CB    . GLN B 1 355 ? 12.527  -27.939 10.036  1.00 109.23 ? 355 GLN B CB    1 
ATOM   6236  C  CG    . GLN B 1 355 ? 11.502  -27.492 9.003   1.00 119.96 ? 355 GLN B CG    1 
ATOM   6237  C  CD    . GLN B 1 355 ? 11.929  -27.763 7.561   1.00 126.37 ? 355 GLN B CD    1 
ATOM   6238  O  OE1   . GLN B 1 355 ? 12.211  -26.836 6.796   1.00 131.08 ? 355 GLN B OE1   1 
ATOM   6239  N  NE2   . GLN B 1 355 ? 11.956  -29.033 7.180   1.00 129.40 ? 355 GLN B NE2   1 
ATOM   6240  N  N     . GLY B 1 356 ? 14.727  -26.491 10.675  1.00 73.18  ? 356 GLY B N     1 
ATOM   6241  C  CA    . GLY B 1 356 ? 16.013  -25.841 10.763  1.00 71.61  ? 356 GLY B CA    1 
ATOM   6242  C  C     . GLY B 1 356 ? 16.111  -24.945 9.558   1.00 70.92  ? 356 GLY B C     1 
ATOM   6243  O  O     . GLY B 1 356 ? 15.144  -24.329 9.187   1.00 71.74  ? 356 GLY B O     1 
ATOM   6244  N  N     . TRP B 1 357 ? 17.260  -24.860 8.925   1.00 62.46  ? 357 TRP B N     1 
ATOM   6245  C  CA    . TRP B 1 357 ? 17.335  -24.018 7.741   1.00 61.51  ? 357 TRP B CA    1 
ATOM   6246  C  C     . TRP B 1 357 ? 16.484  -24.625 6.644   1.00 55.32  ? 357 TRP B C     1 
ATOM   6247  O  O     . TRP B 1 357 ? 16.539  -25.826 6.413   1.00 60.49  ? 357 TRP B O     1 
ATOM   6248  C  CB    . TRP B 1 357 ? 18.774  -23.873 7.251   1.00 68.52  ? 357 TRP B CB    1 
ATOM   6249  C  CG    . TRP B 1 357 ? 19.586  -22.948 8.059   1.00 72.08  ? 357 TRP B CG    1 
ATOM   6250  C  CD1   . TRP B 1 357 ? 20.251  -23.222 9.214   1.00 76.56  ? 357 TRP B CD1   1 
ATOM   6251  C  CD2   . TRP B 1 357 ? 19.864  -21.588 7.745   1.00 69.43  ? 357 TRP B CD2   1 
ATOM   6252  N  NE1   . TRP B 1 357 ? 20.906  -22.095 9.659   1.00 76.48  ? 357 TRP B NE1   1 
ATOM   6253  C  CE2   . TRP B 1 357 ? 20.686  -21.082 8.766   1.00 73.42  ? 357 TRP B CE2   1 
ATOM   6254  C  CE3   . TRP B 1 357 ? 19.486  -20.745 6.704   1.00 66.33  ? 357 TRP B CE3   1 
ATOM   6255  C  CZ2   . TRP B 1 357 ? 21.133  -19.771 8.775   1.00 77.68  ? 357 TRP B CZ2   1 
ATOM   6256  C  CZ3   . TRP B 1 357 ? 19.933  -19.449 6.712   1.00 70.80  ? 357 TRP B CZ3   1 
ATOM   6257  C  CH2   . TRP B 1 357 ? 20.743  -18.969 7.740   1.00 76.59  ? 357 TRP B CH2   1 
ATOM   6258  N  N     . PRO B 1 358 ? 15.656  -23.812 5.993   1.00 56.82  ? 358 PRO B N     1 
ATOM   6259  C  CA    . PRO B 1 358 ? 15.134  -24.350 4.732   1.00 66.04  ? 358 PRO B CA    1 
ATOM   6260  C  C     . PRO B 1 358 ? 16.257  -24.725 3.755   1.00 72.94  ? 358 PRO B C     1 
ATOM   6261  O  O     . PRO B 1 358 ? 17.180  -23.918 3.607   1.00 79.83  ? 358 PRO B O     1 
ATOM   6262  C  CB    . PRO B 1 358 ? 14.306  -23.192 4.171   1.00 55.14  ? 358 PRO B CB    1 
ATOM   6263  C  CG    . PRO B 1 358 ? 13.870  -22.438 5.372   1.00 52.56  ? 358 PRO B CG    1 
ATOM   6264  C  CD    . PRO B 1 358 ? 15.027  -22.525 6.351   1.00 43.29  ? 358 PRO B CD    1 
ATOM   6265  N  N     . GLU B 1 359 ? 16.232  -25.935 3.183   1.00 75.00  ? 359 GLU B N     1 
ATOM   6266  C  CA    . GLU B 1 359 ? 17.360  -26.495 2.427   1.00 76.07  ? 359 GLU B CA    1 
ATOM   6267  C  C     . GLU B 1 359 ? 17.774  -25.564 1.289   1.00 77.45  ? 359 GLU B C     1 
ATOM   6268  O  O     . GLU B 1 359 ? 18.965  -25.426 1.009   1.00 78.70  ? 359 GLU B O     1 
ATOM   6269  C  CB    . GLU B 1 359 ? 17.051  -27.887 1.862   1.00 81.12  ? 359 GLU B CB    1 
ATOM   6270  C  CG    . GLU B 1 359 ? 18.259  -28.651 1.201   1.00 92.56  ? 359 GLU B CG    1 
ATOM   6271  C  CD    . GLU B 1 359 ? 19.508  -28.854 2.076   1.00 99.63  ? 359 GLU B CD    1 
ATOM   6272  O  OE1   . GLU B 1 359 ? 19.635  -28.327 3.195   1.00 98.89  ? 359 GLU B OE1   1 
ATOM   6273  O  OE2   . GLU B 1 359 ? 20.457  -29.525 1.556   1.00 108.97 ? 359 GLU B OE2   1 
ATOM   6274  N  N     . PHE B 1 360 ? 16.807  -24.947 0.607   1.00 71.30  ? 360 PHE B N     1 
ATOM   6275  C  CA    . PHE B 1 360 ? 17.194  -24.123 -0.537  1.00 64.74  ? 360 PHE B CA    1 
ATOM   6276  C  C     . PHE B 1 360 ? 17.984  -22.861 -0.127  1.00 69.18  ? 360 PHE B C     1 
ATOM   6277  O  O     . PHE B 1 360 ? 18.887  -22.426 -0.859  1.00 75.85  ? 360 PHE B O     1 
ATOM   6278  C  CB    . PHE B 1 360 ? 15.964  -23.763 -1.374  1.00 59.59  ? 360 PHE B CB    1 
ATOM   6279  C  CG    . PHE B 1 360 ? 14.913  -22.944 -0.689  1.00 65.69  ? 360 PHE B CG    1 
ATOM   6280  C  CD1   . PHE B 1 360 ? 14.989  -21.552 -0.700  1.00 67.46  ? 360 PHE B CD1   1 
ATOM   6281  C  CD2   . PHE B 1 360 ? 13.827  -23.555 -0.062  1.00 76.24  ? 360 PHE B CD2   1 
ATOM   6282  C  CE1   . PHE B 1 360 ? 13.983  -20.778 -0.096  1.00 78.06  ? 360 PHE B CE1   1 
ATOM   6283  C  CE2   . PHE B 1 360 ? 12.826  -22.790 0.553   1.00 77.61  ? 360 PHE B CE2   1 
ATOM   6284  C  CZ    . PHE B 1 360 ? 12.900  -21.408 0.542   1.00 79.62  ? 360 PHE B CZ    1 
ATOM   6285  N  N     . LEU B 1 361 ? 17.703  -22.327 1.062   1.00 66.52  ? 361 LEU B N     1 
ATOM   6286  C  CA    . LEU B 1 361 ? 18.478  -21.214 1.624   1.00 61.59  ? 361 LEU B CA    1 
ATOM   6287  C  C     . LEU B 1 361 ? 19.910  -21.666 1.935   1.00 66.18  ? 361 LEU B C     1 
ATOM   6288  O  O     . LEU B 1 361 ? 20.886  -21.009 1.561   1.00 67.65  ? 361 LEU B O     1 
ATOM   6289  C  CB    . LEU B 1 361 ? 17.830  -20.680 2.895   1.00 57.66  ? 361 LEU B CB    1 
ATOM   6290  C  CG    . LEU B 1 361 ? 16.548  -19.886 2.703   1.00 56.97  ? 361 LEU B CG    1 
ATOM   6291  C  CD1   . LEU B 1 361 ? 16.017  -19.348 4.038   1.00 58.74  ? 361 LEU B CD1   1 
ATOM   6292  C  CD2   . LEU B 1 361 ? 16.805  -18.774 1.705   1.00 46.31  ? 361 LEU B CD2   1 
ATOM   6293  N  N     . ARG B 1 362 ? 20.022  -22.811 2.600   1.00 62.11  ? 362 ARG B N     1 
ATOM   6294  C  CA    . ARG B 1 362 ? 21.324  -23.351 2.858   1.00 65.99  ? 362 ARG B CA    1 
ATOM   6295  C  C     . ARG B 1 362 ? 22.154  -23.568 1.627   1.00 78.31  ? 362 ARG B C     1 
ATOM   6296  O  O     . ARG B 1 362 ? 23.347  -23.240 1.568   1.00 87.68  ? 362 ARG B O     1 
ATOM   6297  C  CB    . ARG B 1 362 ? 21.217  -24.755 3.483   1.00 63.05  ? 362 ARG B CB    1 
ATOM   6298  C  CG    . ARG B 1 362 ? 22.475  -25.244 4.170   1.00 61.46  ? 362 ARG B CG    1 
ATOM   6299  C  CD    . ARG B 1 362 ? 22.244  -26.567 4.868   1.00 72.98  ? 362 ARG B CD    1 
ATOM   6300  N  NE    . ARG B 1 362 ? 22.293  -26.403 6.305   1.00 93.60  ? 362 ARG B NE    1 
ATOM   6301  C  CZ    . ARG B 1 362 ? 23.420  -26.350 7.010   1.00 100.58 ? 362 ARG B CZ    1 
ATOM   6302  N  NH1   . ARG B 1 362 ? 24.605  -26.460 6.401   1.00 96.93  ? 362 ARG B NH1   1 
ATOM   6303  N  NH2   . ARG B 1 362 ? 23.357  -26.197 8.331   1.00 102.15 ? 362 ARG B NH2   1 
ATOM   6304  N  N     . ARG B 1 363 ? 21.534  -24.214 0.665   1.00 69.62  ? 363 ARG B N     1 
ATOM   6305  C  CA    . ARG B 1 363 ? 22.241  -24.583 -0.521  1.00 72.41  ? 363 ARG B CA    1 
ATOM   6306  C  C     . ARG B 1 363 ? 22.704  -23.282 -1.219  1.00 64.74  ? 363 ARG B C     1 
ATOM   6307  O  O     . ARG B 1 363 ? 23.845  -23.170 -1.641  1.00 56.36  ? 363 ARG B O     1 
ATOM   6308  C  CB    . ARG B 1 363 ? 21.316  -25.438 -1.349  1.00 79.58  ? 363 ARG B CB    1 
ATOM   6309  C  CG    . ARG B 1 363 ? 21.855  -26.342 -2.360  1.00 86.08  ? 363 ARG B CG    1 
ATOM   6310  C  CD    . ARG B 1 363 ? 20.767  -26.721 -3.237  1.00 99.60  ? 363 ARG B CD    1 
ATOM   6311  N  NE    . ARG B 1 363 ? 19.493  -26.874 -2.584  1.00 106.09 ? 363 ARG B NE    1 
ATOM   6312  C  CZ    . ARG B 1 363 ? 18.369  -26.504 -3.189  1.00 112.62 ? 363 ARG B CZ    1 
ATOM   6313  N  NH1   . ARG B 1 363 ? 18.417  -26.243 -4.399  1.00 117.03 ? 363 ARG B NH1   1 
ATOM   6314  N  NH2   . ARG B 1 363 ? 17.173  -26.553 -2.740  1.00 109.23 ? 363 ARG B NH2   1 
ATOM   6315  N  N     . ALA B 1 364 ? 21.847  -22.257 -1.223  1.00 69.95  ? 364 ALA B N     1 
ATOM   6316  C  CA    . ALA B 1 364 ? 22.198  -21.011 -1.912  1.00 58.66  ? 364 ALA B CA    1 
ATOM   6317  C  C     . ALA B 1 364 ? 23.342  -20.259 -1.235  1.00 72.75  ? 364 ALA B C     1 
ATOM   6318  O  O     . ALA B 1 364 ? 24.252  -19.796 -1.935  1.00 82.58  ? 364 ALA B O     1 
ATOM   6319  C  CB    . ALA B 1 364 ? 20.977  -20.119 -1.993  1.00 40.00  ? 364 ALA B CB    1 
ATOM   6320  N  N     . LEU B 1 365 ? 23.336  -20.208 0.103   1.00 69.76  ? 365 LEU B N     1 
ATOM   6321  C  CA    . LEU B 1 365 ? 24.415  -19.587 0.863   1.00 67.81  ? 365 LEU B CA    1 
ATOM   6322  C  C     . LEU B 1 365 ? 25.713  -20.343 0.613   1.00 82.01  ? 365 LEU B C     1 
ATOM   6323  O  O     . LEU B 1 365 ? 26.751  -19.725 0.325   1.00 86.31  ? 365 LEU B O     1 
ATOM   6324  C  CB    . LEU B 1 365 ? 24.092  -19.537 2.361   1.00 59.57  ? 365 LEU B CB    1 
ATOM   6325  C  CG    . LEU B 1 365 ? 23.056  -18.490 2.784   1.00 54.69  ? 365 LEU B CG    1 
ATOM   6326  C  CD1   . LEU B 1 365 ? 22.593  -18.651 4.235   1.00 46.78  ? 365 LEU B CD1   1 
ATOM   6327  C  CD2   . LEU B 1 365 ? 23.635  -17.096 2.567   1.00 54.35  ? 365 LEU B CD2   1 
ATOM   6328  N  N     . LEU B 1 366 ? 25.663  -21.671 0.737   1.00 81.05  ? 366 LEU B N     1 
ATOM   6329  C  CA    . LEU B 1 366 ? 26.870  -22.496 0.501   1.00 82.69  ? 366 LEU B CA    1 
ATOM   6330  C  C     . LEU B 1 366 ? 27.443  -22.274 -0.870  1.00 72.74  ? 366 LEU B C     1 
ATOM   6331  O  O     . LEU B 1 366 ? 28.647  -22.198 -1.051  1.00 64.11  ? 366 LEU B O     1 
ATOM   6332  C  CB    . LEU B 1 366 ? 26.600  -23.965 0.694   1.00 80.81  ? 366 LEU B CB    1 
ATOM   6333  C  CG    . LEU B 1 366 ? 26.329  -24.380 2.121   1.00 68.14  ? 366 LEU B CG    1 
ATOM   6334  C  CD1   . LEU B 1 366 ? 26.130  -25.851 2.269   1.00 71.57  ? 366 LEU B CD1   1 
ATOM   6335  C  CD2   . LEU B 1 366 ? 27.649  -24.040 2.792   1.00 58.59  ? 366 LEU B CD2   1 
ATOM   6336  N  N     . ARG B 1 367 ? 26.557  -22.188 -1.835  1.00 66.16  ? 367 ARG B N     1 
ATOM   6337  C  CA    . ARG B 1 367 ? 26.947  -21.939 -3.208  1.00 63.53  ? 367 ARG B CA    1 
ATOM   6338  C  C     . ARG B 1 367 ? 27.651  -20.565 -3.330  1.00 68.04  ? 367 ARG B C     1 
ATOM   6339  O  O     . ARG B 1 367 ? 28.729  -20.479 -3.960  1.00 65.08  ? 367 ARG B O     1 
ATOM   6340  C  CB    . ARG B 1 367 ? 25.719  -22.013 -4.097  1.00 72.73  ? 367 ARG B CB    1 
ATOM   6341  C  CG    . ARG B 1 367 ? 25.929  -22.254 -5.542  1.00 87.15  ? 367 ARG B CG    1 
ATOM   6342  C  CD    . ARG B 1 367 ? 24.614  -22.594 -6.144  1.00 98.34  ? 367 ARG B CD    1 
ATOM   6343  N  NE    . ARG B 1 367 ? 23.947  -21.517 -6.873  1.00 107.39 ? 367 ARG B NE    1 
ATOM   6344  C  CZ    . ARG B 1 367 ? 22.620  -21.366 -6.935  1.00 125.93 ? 367 ARG B CZ    1 
ATOM   6345  N  NH1   . ARG B 1 367 ? 21.824  -22.143 -6.192  1.00 133.59 ? 367 ARG B NH1   1 
ATOM   6346  N  NH2   . ARG B 1 367 ? 22.097  -20.347 -7.635  1.00 131.76 ? 367 ARG B NH2   1 
ATOM   6347  N  N     . ALA B 1 368 ? 27.066  -19.516 -2.736  1.00 68.17  ? 368 ALA B N     1 
ATOM   6348  C  CA    . ALA B 1 368 ? 27.656  -18.184 -2.790  1.00 66.35  ? 368 ALA B CA    1 
ATOM   6349  C  C     . ALA B 1 368 ? 29.074  -18.216 -2.148  1.00 63.57  ? 368 ALA B C     1 
ATOM   6350  O  O     . ALA B 1 368 ? 30.023  -17.645 -2.674  1.00 66.99  ? 368 ALA B O     1 
ATOM   6351  C  CB    . ALA B 1 368 ? 26.753  -17.192 -2.064  1.00 59.69  ? 368 ALA B CB    1 
ATOM   6352  N  N     . PHE B 1 369 ? 29.210  -18.841 -0.981  1.00 61.53  ? 369 PHE B N     1 
ATOM   6353  C  CA    . PHE B 1 369 ? 30.504  -18.859 -0.287  1.00 68.66  ? 369 PHE B CA    1 
ATOM   6354  C  C     . PHE B 1 369 ? 31.534  -19.729 -1.003  1.00 82.31  ? 369 PHE B C     1 
ATOM   6355  O  O     . PHE B 1 369 ? 32.733  -19.453 -0.964  1.00 87.19  ? 369 PHE B O     1 
ATOM   6356  C  CB    . PHE B 1 369 ? 30.326  -19.291 1.171   1.00 56.67  ? 369 PHE B CB    1 
ATOM   6357  C  CG    . PHE B 1 369 ? 29.927  -18.156 2.047   1.00 58.92  ? 369 PHE B CG    1 
ATOM   6358  C  CD1   . PHE B 1 369 ? 28.604  -17.777 2.115   1.00 66.87  ? 369 PHE B CD1   1 
ATOM   6359  C  CD2   . PHE B 1 369 ? 30.871  -17.394 2.704   1.00 61.82  ? 369 PHE B CD2   1 
ATOM   6360  C  CE1   . PHE B 1 369 ? 28.226  -16.700 2.879   1.00 74.58  ? 369 PHE B CE1   1 
ATOM   6361  C  CE2   . PHE B 1 369 ? 30.501  -16.310 3.468   1.00 61.78  ? 369 PHE B CE2   1 
ATOM   6362  C  CZ    . PHE B 1 369 ? 29.177  -15.964 3.559   1.00 74.38  ? 369 PHE B CZ    1 
ATOM   6363  N  N     . GLY B 1 370 ? 31.080  -20.819 -1.604  1.00 85.09  ? 370 GLY B N     1 
ATOM   6364  C  CA    . GLY B 1 370 ? 31.985  -21.622 -2.391  1.00 83.50  ? 370 GLY B CA    1 
ATOM   6365  C  C     . GLY B 1 370 ? 32.512  -20.856 -3.584  1.00 78.74  ? 370 GLY B C     1 
ATOM   6366  O  O     . GLY B 1 370 ? 33.720  -20.846 -3.817  1.00 85.44  ? 370 GLY B O     1 
ATOM   6367  N  N     . ALA B 1 371 ? 31.637  -20.120 -4.266  1.00 77.56  ? 371 ALA B N     1 
ATOM   6368  C  CA    . ALA B 1 371 ? 32.111  -19.298 -5.369  1.00 77.73  ? 371 ALA B CA    1 
ATOM   6369  C  C     . ALA B 1 371 ? 33.041  -18.216 -4.887  1.00 70.89  ? 371 ALA B C     1 
ATOM   6370  O  O     . ALA B 1 371 ? 33.958  -17.848 -5.592  1.00 68.27  ? 371 ALA B O     1 
ATOM   6371  C  CB    . ALA B 1 371 ? 30.927  -18.668 -6.112  1.00 85.09  ? 371 ALA B CB    1 
ATOM   6372  N  N     . SER B 1 372 ? 32.842  -17.750 -3.662  1.00 79.77  ? 372 SER B N     1 
ATOM   6373  C  CA    . SER B 1 372 ? 33.694  -16.683 -3.129  1.00 78.69  ? 372 SER B CA    1 
ATOM   6374  C  C     . SER B 1 372 ? 34.994  -17.199 -2.548  1.00 72.83  ? 372 SER B C     1 
ATOM   6375  O  O     . SER B 1 372 ? 35.885  -16.421 -2.234  1.00 68.53  ? 372 SER B O     1 
ATOM   6376  C  CB    . SER B 1 372 ? 32.960  -15.834 -2.091  1.00 80.62  ? 372 SER B CB    1 
ATOM   6377  O  OG    . SER B 1 372 ? 31.798  -15.233 -2.631  1.00 86.61  ? 372 SER B OG    1 
ATOM   6378  N  N     . GLY B 1 373 ? 35.077  -18.503 -2.339  1.00 70.68  ? 373 GLY B N     1 
ATOM   6379  C  CA    . GLY B 1 373 ? 36.248  -19.054 -1.703  1.00 71.94  ? 373 GLY B CA    1 
ATOM   6380  C  C     . GLY B 1 373 ? 36.371  -18.723 -0.224  1.00 67.84  ? 373 GLY B C     1 
ATOM   6381  O  O     . GLY B 1 373 ? 37.479  -18.573 0.292   1.00 80.57  ? 373 GLY B O     1 
ATOM   6382  N  N     . ALA B 1 374 ? 35.248  -18.626 0.476   1.00 55.36  ? 374 ALA B N     1 
ATOM   6383  C  CA    . ALA B 1 374 ? 35.320  -18.334 1.902   1.00 67.65  ? 374 ALA B CA    1 
ATOM   6384  C  C     . ALA B 1 374 ? 34.462  -19.353 2.625   1.00 70.84  ? 374 ALA B C     1 
ATOM   6385  O  O     . ALA B 1 374 ? 33.501  -19.874 2.066   1.00 74.26  ? 374 ALA B O     1 
ATOM   6386  C  CB    . ALA B 1 374 ? 34.827  -16.929 2.209   1.00 72.91  ? 374 ALA B CB    1 
ATOM   6387  N  N     . SER B 1 375 ? 34.754  -19.564 3.898   1.00 66.53  ? 375 SER B N     1 
ATOM   6388  C  CA    . SER B 1 375 ? 34.091  -20.610 4.662   1.00 72.99  ? 375 SER B CA    1 
ATOM   6389  C  C     . SER B 1 375 ? 32.869  -20.048 5.419   1.00 82.11  ? 375 SER B C     1 
ATOM   6390  O  O     . SER B 1 375 ? 32.909  -18.925 5.934   1.00 87.25  ? 375 SER B O     1 
ATOM   6391  C  CB    . SER B 1 375 ? 35.115  -21.292 5.555   1.00 68.67  ? 375 SER B CB    1 
ATOM   6392  O  OG    . SER B 1 375 ? 35.498  -20.420 6.583   1.00 69.53  ? 375 SER B OG    1 
ATOM   6393  N  N     . LEU B 1 376 ? 31.789  -20.833 5.461   1.00 67.45  ? 376 LEU B N     1 
ATOM   6394  C  CA    . LEU B 1 376 ? 30.577  -20.474 6.162   1.00 55.79  ? 376 LEU B CA    1 
ATOM   6395  C  C     . LEU B 1 376 ? 30.200  -21.431 7.306   1.00 83.62  ? 376 LEU B C     1 
ATOM   6396  O  O     . LEU B 1 376 ? 30.233  -22.645 7.157   1.00 97.98  ? 376 LEU B O     1 
ATOM   6397  C  CB    . LEU B 1 376 ? 29.443  -20.449 5.148   1.00 53.15  ? 376 LEU B CB    1 
ATOM   6398  C  CG    . LEU B 1 376 ? 28.008  -20.121 5.507   1.00 55.79  ? 376 LEU B CG    1 
ATOM   6399  C  CD1   . LEU B 1 376 ? 27.958  -18.719 6.051   1.00 62.76  ? 376 LEU B CD1   1 
ATOM   6400  C  CD2   . LEU B 1 376 ? 27.078  -20.297 4.291   1.00 58.48  ? 376 LEU B CD2   1 
ATOM   6401  N  N     . ARG B 1 377 ? 29.829  -20.891 8.463   1.00 82.23  ? 377 ARG B N     1 
ATOM   6402  C  CA    . ARG B 1 377 ? 29.282  -21.680 9.561   1.00 73.94  ? 377 ARG B CA    1 
ATOM   6403  C  C     . ARG B 1 377 ? 27.856  -21.229 9.805   1.00 67.63  ? 377 ARG B C     1 
ATOM   6404  O  O     . ARG B 1 377 ? 27.620  -20.041 10.017  1.00 62.44  ? 377 ARG B O     1 
ATOM   6405  C  CB    . ARG B 1 377 ? 30.110  -21.529 10.828  1.00 73.24  ? 377 ARG B CB    1 
ATOM   6406  C  CG    . ARG B 1 377 ? 30.515  -22.814 11.516  1.00 79.62  ? 377 ARG B CG    1 
ATOM   6407  C  CD    . ARG B 1 377 ? 31.640  -22.553 12.513  1.00 97.99  ? 377 ARG B CD    1 
ATOM   6408  N  NE    . ARG B 1 377 ? 31.864  -21.119 12.794  1.00 102.98 ? 377 ARG B NE    1 
ATOM   6409  C  CZ    . ARG B 1 377 ? 31.446  -20.441 13.864  1.00 100.47 ? 377 ARG B CZ    1 
ATOM   6410  N  NH1   . ARG B 1 377 ? 31.680  -19.151 14.002  1.00 92.74  ? 377 ARG B NH1   1 
ATOM   6411  N  NH2   . ARG B 1 377 ? 30.785  -21.074 14.799  1.00 109.53 ? 377 ARG B NH2   1 
ATOM   6412  N  N     . LEU B 1 378 ? 26.922  -22.182 9.806   1.00 67.85  ? 378 LEU B N     1 
ATOM   6413  C  CA    . LEU B 1 378 ? 25.522  -21.851 10.025  1.00 58.42  ? 378 LEU B CA    1 
ATOM   6414  C  C     . LEU B 1 378 ? 25.080  -22.361 11.389  1.00 62.65  ? 378 LEU B C     1 
ATOM   6415  O  O     . LEU B 1 378 ? 25.272  -23.512 11.719  1.00 79.76  ? 378 LEU B O     1 
ATOM   6416  C  CB    . LEU B 1 378 ? 24.638  -22.426 8.908   1.00 47.34  ? 378 LEU B CB    1 
ATOM   6417  C  CG    . LEU B 1 378 ? 24.778  -21.834 7.481   1.00 58.24  ? 378 LEU B CG    1 
ATOM   6418  C  CD1   . LEU B 1 378 ? 23.775  -22.425 6.503   1.00 56.18  ? 378 LEU B CD1   1 
ATOM   6419  C  CD2   . LEU B 1 378 ? 24.747  -20.329 7.428   1.00 58.93  ? 378 LEU B CD2   1 
ATOM   6420  N  N     . HIS B 1 379 ? 24.461  -21.487 12.175  1.00 60.60  ? 379 HIS B N     1 
ATOM   6421  C  CA    . HIS B 1 379 ? 24.031  -21.809 13.520  1.00 55.68  ? 379 HIS B CA    1 
ATOM   6422  C  C     . HIS B 1 379 ? 22.513  -21.752 13.636  1.00 71.94  ? 379 HIS B C     1 
ATOM   6423  O  O     . HIS B 1 379 ? 21.833  -21.164 12.778  1.00 75.61  ? 379 HIS B O     1 
ATOM   6424  C  CB    . HIS B 1 379 ? 24.639  -20.854 14.546  1.00 47.65  ? 379 HIS B CB    1 
ATOM   6425  C  CG    . HIS B 1 379 ? 26.135  -20.883 14.624  1.00 58.47  ? 379 HIS B CG    1 
ATOM   6426  N  ND1   . HIS B 1 379 ? 26.806  -21.105 15.815  1.00 70.27  ? 379 HIS B ND1   1 
ATOM   6427  C  CD2   . HIS B 1 379 ? 27.088  -20.651 13.691  1.00 60.12  ? 379 HIS B CD2   1 
ATOM   6428  C  CE1   . HIS B 1 379 ? 28.103  -21.042 15.605  1.00 61.72  ? 379 HIS B CE1   1 
ATOM   6429  N  NE2   . HIS B 1 379 ? 28.300  -20.762 14.327  1.00 66.91  ? 379 HIS B NE2   1 
ATOM   6430  N  N     . THR B 1 380 ? 21.969  -22.400 14.661  1.00 74.03  ? 380 THR B N     1 
ATOM   6431  C  CA    . THR B 1 380 ? 20.539  -22.245 14.891  1.00 77.34  ? 380 THR B CA    1 
ATOM   6432  C  C     . THR B 1 380 ? 20.367  -21.734 16.349  1.00 66.76  ? 380 THR B C     1 
ATOM   6433  O  O     . THR B 1 380 ? 20.947  -22.294 17.305  1.00 65.86  ? 380 THR B O     1 
ATOM   6434  C  CB    . THR B 1 380 ? 19.771  -23.525 14.672  1.00 67.46  ? 380 THR B CB    1 
ATOM   6435  O  OG1   . THR B 1 380 ? 19.760  -23.850 13.282  1.00 78.25  ? 380 THR B OG1   1 
ATOM   6436  C  CG2   . THR B 1 380 ? 18.368  -23.395 15.233  1.00 52.69  ? 380 THR B CG2   1 
ATOM   6437  N  N     . LEU B 1 381 ? 19.529  -20.714 16.525  1.00 59.78  ? 381 LEU B N     1 
ATOM   6438  C  CA    . LEU B 1 381 ? 19.206  -20.253 17.873  1.00 61.95  ? 381 LEU B CA    1 
ATOM   6439  C  C     . LEU B 1 381 ? 17.984  -20.979 18.383  1.00 69.39  ? 381 LEU B C     1 
ATOM   6440  O  O     . LEU B 1 381 ? 16.852  -20.757 17.960  1.00 60.53  ? 381 LEU B O     1 
ATOM   6441  C  CB    . LEU B 1 381 ? 18.933  -18.766 17.901  1.00 51.71  ? 381 LEU B CB    1 
ATOM   6442  C  CG    . LEU B 1 381 ? 20.132  -17.859 17.721  1.00 59.74  ? 381 LEU B CG    1 
ATOM   6443  C  CD1   . LEU B 1 381 ? 19.630  -16.465 17.454  1.00 61.59  ? 381 LEU B CD1   1 
ATOM   6444  C  CD2   . LEU B 1 381 ? 21.008  -17.901 18.942  1.00 75.07  ? 381 LEU B CD2   1 
ATOM   6445  N  N     . HIS B 1 382 ? 18.234  -21.882 19.309  1.00 74.18  ? 382 HIS B N     1 
ATOM   6446  C  CA    . HIS B 1 382 ? 17.153  -22.553 19.976  1.00 72.52  ? 382 HIS B CA    1 
ATOM   6447  C  C     . HIS B 1 382 ? 16.666  -21.745 21.196  1.00 71.41  ? 382 HIS B C     1 
ATOM   6448  O  O     . HIS B 1 382 ? 16.778  -22.149 22.362  1.00 80.46  ? 382 HIS B O     1 
ATOM   6449  C  CB    . HIS B 1 382 ? 17.613  -23.922 20.355  1.00 76.11  ? 382 HIS B CB    1 
ATOM   6450  C  CG    . HIS B 1 382 ? 18.090  -24.752 19.207  1.00 84.93  ? 382 HIS B CG    1 
ATOM   6451  N  ND1   . HIS B 1 382 ? 19.412  -25.122 19.076  1.00 91.61  ? 382 HIS B ND1   1 
ATOM   6452  C  CD2   . HIS B 1 382 ? 17.444  -25.270 18.136  1.00 76.24  ? 382 HIS B CD2   1 
ATOM   6453  C  CE1   . HIS B 1 382 ? 19.560  -25.837 17.976  1.00 86.43  ? 382 HIS B CE1   1 
ATOM   6454  N  NE2   . HIS B 1 382 ? 18.379  -25.949 17.393  1.00 80.97  ? 382 HIS B NE2   1 
ATOM   6455  N  N     . ALA B 1 383 ? 16.173  -20.557 20.913  1.00 59.88  ? 383 ALA B N     1 
ATOM   6456  C  CA    . ALA B 1 383 ? 15.634  -19.726 21.946  1.00 46.06  ? 383 ALA B CA    1 
ATOM   6457  C  C     . ALA B 1 383 ? 14.524  -18.942 21.308  1.00 51.04  ? 383 ALA B C     1 
ATOM   6458  O  O     . ALA B 1 383 ? 14.498  -18.730 20.102  1.00 46.85  ? 383 ALA B O     1 
ATOM   6459  C  CB    . ALA B 1 383 ? 16.662  -18.820 22.513  1.00 48.53  ? 383 ALA B CB    1 
ATOM   6460  N  N     . HIS B 1 384 ? 13.624  -18.434 22.130  1.00 55.77  ? 384 HIS B N     1 
ATOM   6461  C  CA    . HIS B 1 384 ? 12.509  -17.622 21.666  1.00 59.79  ? 384 HIS B CA    1 
ATOM   6462  C  C     . HIS B 1 384 ? 12.414  -16.359 22.484  1.00 62.68  ? 384 HIS B C     1 
ATOM   6463  O  O     . HIS B 1 384 ? 12.678  -16.405 23.662  1.00 66.93  ? 384 HIS B O     1 
ATOM   6464  C  CB    . HIS B 1 384 ? 11.229  -18.397 21.840  1.00 64.31  ? 384 HIS B CB    1 
ATOM   6465  C  CG    . HIS B 1 384 ? 10.046  -17.748 21.222  1.00 59.74  ? 384 HIS B CG    1 
ATOM   6466  N  ND1   . HIS B 1 384 ? 9.371   -16.720 21.822  1.00 45.92  ? 384 HIS B ND1   1 
ATOM   6467  C  CD2   . HIS B 1 384 ? 9.413   -17.988 20.059  1.00 72.96  ? 384 HIS B CD2   1 
ATOM   6468  C  CE1   . HIS B 1 384 ? 8.370   -16.352 21.054  1.00 47.63  ? 384 HIS B CE1   1 
ATOM   6469  N  NE2   . HIS B 1 384 ? 8.377   -17.103 19.975  1.00 68.34  ? 384 HIS B NE2   1 
ATOM   6470  N  N     . PRO B 1 385 ? 12.037  -15.196 21.828  1.00 56.13  ? 385 PRO B N     1 
ATOM   6471  C  CA    . PRO B 1 385 ? 11.988  -14.007 22.679  1.00 51.83  ? 385 PRO B CA    1 
ATOM   6472  C  C     . PRO B 1 385 ? 10.976  -14.042 23.779  1.00 67.79  ? 385 PRO B C     1 
ATOM   6473  O  O     . PRO B 1 385 ? 11.065  -13.225 24.663  1.00 67.54  ? 385 PRO B O     1 
ATOM   6474  C  CB    . PRO B 1 385 ? 11.661  -12.882 21.721  1.00 30.00  ? 385 PRO B CB    1 
ATOM   6475  C  CG    . PRO B 1 385 ? 10.948  -13.502 20.638  1.00 30.00  ? 385 PRO B CG    1 
ATOM   6476  C  CD    . PRO B 1 385 ? 11.781  -14.702 20.415  1.00 30.00  ? 385 PRO B CD    1 
ATOM   6477  N  N     . SER B 1 386 ? 10.034  -14.960 23.739  1.00 75.13  ? 386 SER B N     1 
ATOM   6478  C  CA    . SER B 1 386 ? 9.057   -15.022 24.796  1.00 69.67  ? 386 SER B CA    1 
ATOM   6479  C  C     . SER B 1 386 ? 9.722   -15.604 26.020  1.00 64.13  ? 386 SER B C     1 
ATOM   6480  O  O     . SER B 1 386 ? 9.113   -15.678 27.052  1.00 53.64  ? 386 SER B O     1 
ATOM   6481  C  CB    . SER B 1 386 ? 7.845   -15.817 24.378  1.00 36.10  ? 386 SER B CB    1 
ATOM   6482  N  N     . GLN B 1 387 ? 10.985  -16.009 25.910  1.00 63.88  ? 387 GLN B N     1 
ATOM   6483  C  CA    . GLN B 1 387 ? 11.665  -16.508 27.088  1.00 59.85  ? 387 GLN B CA    1 
ATOM   6484  C  C     . GLN B 1 387 ? 12.191  -15.350 27.933  1.00 57.05  ? 387 GLN B C     1 
ATOM   6485  O  O     . GLN B 1 387 ? 12.751  -15.550 29.007  1.00 68.95  ? 387 GLN B O     1 
ATOM   6486  C  CB    . GLN B 1 387 ? 12.833  -17.361 26.653  1.00 52.94  ? 387 GLN B CB    1 
ATOM   6487  C  CG    . GLN B 1 387 ? 12.505  -18.699 26.152  1.00 39.74  ? 387 GLN B CG    1 
ATOM   6488  C  CD    . GLN B 1 387 ? 13.750  -19.351 25.676  1.00 47.46  ? 387 GLN B CD    1 
ATOM   6489  O  OE1   . GLN B 1 387 ? 14.117  -19.208 24.519  1.00 62.36  ? 387 GLN B OE1   1 
ATOM   6490  N  NE2   . GLN B 1 387 ? 14.427  -20.068 26.562  1.00 50.12  ? 387 GLN B NE2   1 
ATOM   6491  N  N     . GLY B 1 388 ? 12.025  -14.130 27.441  1.00 51.19  ? 388 GLY B N     1 
ATOM   6492  C  CA    . GLY B 1 388 ? 12.533  -13.001 28.197  1.00 47.92  ? 388 GLY B CA    1 
ATOM   6493  C  C     . GLY B 1 388 ? 14.055  -12.916 28.206  1.00 53.49  ? 388 GLY B C     1 
ATOM   6494  O  O     . GLY B 1 388 ? 14.719  -13.096 27.166  1.00 59.80  ? 388 GLY B O     1 
ATOM   6495  N  N     . LEU B 1 389 ? 14.619  -12.733 29.399  1.00 61.29  ? 389 LEU B N     1 
ATOM   6496  C  CA    . LEU B 1 389 ? 16.057  -12.523 29.520  1.00 59.53  ? 389 LEU B CA    1 
ATOM   6497  C  C     . LEU B 1 389 ? 16.908  -13.721 29.168  1.00 56.48  ? 389 LEU B C     1 
ATOM   6498  O  O     . LEU B 1 389 ? 18.058  -13.557 28.736  1.00 68.35  ? 389 LEU B O     1 
ATOM   6499  C  CB    . LEU B 1 389 ? 16.408  -12.117 30.946  1.00 60.19  ? 389 LEU B CB    1 
ATOM   6500  C  CG    . LEU B 1 389 ? 16.038  -10.723 31.458  1.00 57.79  ? 389 LEU B CG    1 
ATOM   6501  C  CD1   . LEU B 1 389 ? 16.427  -10.544 32.922  1.00 64.24  ? 389 LEU B CD1   1 
ATOM   6502  C  CD2   . LEU B 1 389 ? 16.534  -9.617  30.603  1.00 59.28  ? 389 LEU B CD2   1 
ATOM   6503  N  N     . ALA B 1 390 ? 16.315  -14.907 29.256  1.00 51.24  ? 390 ALA B N     1 
ATOM   6504  C  CA    . ALA B 1 390 ? 17.001  -16.123 28.858  1.00 57.72  ? 390 ALA B CA    1 
ATOM   6505  C  C     . ALA B 1 390 ? 17.325  -16.020 27.378  1.00 67.52  ? 390 ALA B C     1 
ATOM   6506  O  O     . ALA B 1 390 ? 18.433  -16.367 26.928  1.00 64.47  ? 390 ALA B O     1 
ATOM   6507  C  CB    . ALA B 1 390 ? 16.152  -17.319 29.133  1.00 55.02  ? 390 ALA B CB    1 
ATOM   6508  N  N     . PHE B 1 391 ? 16.386  -15.417 26.651  1.00 61.07  ? 391 PHE B N     1 
ATOM   6509  C  CA    . PHE B 1 391 ? 16.567  -15.202 25.229  1.00 62.30  ? 391 PHE B CA    1 
ATOM   6510  C  C     . PHE B 1 391 ? 17.827  -14.344 25.016  1.00 64.22  ? 391 PHE B C     1 
ATOM   6511  O  O     . PHE B 1 391 ? 18.700  -14.713 24.211  1.00 73.34  ? 391 PHE B O     1 
ATOM   6512  C  CB    . PHE B 1 391 ? 15.326  -14.600 24.579  1.00 61.17  ? 391 PHE B CB    1 
ATOM   6513  C  CG    . PHE B 1 391 ? 15.468  -14.428 23.101  1.00 53.95  ? 391 PHE B CG    1 
ATOM   6514  C  CD1   . PHE B 1 391 ? 15.634  -15.543 22.279  1.00 52.50  ? 391 PHE B CD1   1 
ATOM   6515  C  CD2   . PHE B 1 391 ? 15.448  -13.157 22.525  1.00 47.62  ? 391 PHE B CD2   1 
ATOM   6516  C  CE1   . PHE B 1 391 ? 15.791  -15.389 20.904  1.00 49.70  ? 391 PHE B CE1   1 
ATOM   6517  C  CE2   . PHE B 1 391 ? 15.612  -12.993 21.146  1.00 35.99  ? 391 PHE B CE2   1 
ATOM   6518  C  CZ    . PHE B 1 391 ? 15.779  -14.111 20.336  1.00 33.27  ? 391 PHE B CZ    1 
ATOM   6519  N  N     . ARG B 1 392 ? 17.971  -13.249 25.758  1.00 62.00  ? 392 ARG B N     1 
ATOM   6520  C  CA    . ARG B 1 392 ? 19.167  -12.434 25.563  1.00 54.84  ? 392 ARG B CA    1 
ATOM   6521  C  C     . ARG B 1 392 ? 20.449  -13.176 25.860  1.00 53.11  ? 392 ARG B C     1 
ATOM   6522  O  O     . ARG B 1 392 ? 21.420  -13.045 25.087  1.00 67.60  ? 392 ARG B O     1 
ATOM   6523  C  CB    . ARG B 1 392 ? 19.149  -11.193 26.459  1.00 48.21  ? 392 ARG B CB    1 
ATOM   6524  C  CG    . ARG B 1 392 ? 20.062  -10.127 25.935  1.00 55.25  ? 392 ARG B CG    1 
ATOM   6525  C  CD    . ARG B 1 392 ? 19.934  -8.748  26.532  1.00 56.01  ? 392 ARG B CD    1 
ATOM   6526  N  NE    . ARG B 1 392 ? 21.229  -8.092  26.357  1.00 59.46  ? 392 ARG B NE    1 
ATOM   6527  C  CZ    . ARG B 1 392 ? 21.495  -6.826  26.639  1.00 51.26  ? 392 ARG B CZ    1 
ATOM   6528  N  NH1   . ARG B 1 392 ? 22.720  -6.369  26.438  1.00 56.16  ? 392 ARG B NH1   1 
ATOM   6529  N  NH2   . ARG B 1 392 ? 20.550  -6.028  27.124  1.00 52.20  ? 392 ARG B NH2   1 
ATOM   6530  N  N     . GLU B 1 393 ? 20.398  -14.086 26.825  1.00 41.55  ? 393 GLU B N     1 
ATOM   6531  C  CA    . GLU B 1 393 ? 21.569  -14.882 27.120  1.00 55.67  ? 393 GLU B CA    1 
ATOM   6532  C  C     . GLU B 1 393 ? 21.978  -15.744 25.921  1.00 62.64  ? 393 GLU B C     1 
ATOM   6533  O  O     . GLU B 1 393 ? 23.164  -15.758 25.542  1.00 71.25  ? 393 GLU B O     1 
ATOM   6534  C  CB    . GLU B 1 393 ? 21.320  -15.761 28.350  1.00 51.91  ? 393 GLU B CB    1 
ATOM   6535  C  CG    . GLU B 1 393 ? 22.491  -16.658 28.773  1.00 52.40  ? 393 GLU B CG    1 
ATOM   6536  C  CD    . GLU B 1 393 ? 23.734  -15.880 29.164  1.00 61.76  ? 393 GLU B CD    1 
ATOM   6537  O  OE1   . GLU B 1 393 ? 23.651  -14.663 29.438  1.00 78.80  ? 393 GLU B OE1   1 
ATOM   6538  O  OE2   . GLU B 1 393 ? 24.767  -16.523 29.358  1.00 60.04  ? 393 GLU B OE2   1 
ATOM   6539  N  N     . ALA B 1 394 ? 20.992  -16.373 25.270  1.00 55.64  ? 394 ALA B N     1 
ATOM   6540  C  CA    . ALA B 1 394 ? 21.280  -17.134 24.059  1.00 56.73  ? 394 ALA B CA    1 
ATOM   6541  C  C     . ALA B 1 394 ? 21.923  -16.288 22.976  1.00 62.90  ? 394 ALA B C     1 
ATOM   6542  O  O     . ALA B 1 394 ? 22.969  -16.669 22.388  1.00 70.14  ? 394 ALA B O     1 
ATOM   6543  C  CB    . ALA B 1 394 ? 20.011  -17.765 23.547  1.00 39.84  ? 394 ALA B CB    1 
ATOM   6544  N  N     . LEU B 1 395 ? 21.417  -15.071 22.834  1.00 56.53  ? 395 LEU B N     1 
ATOM   6545  C  CA    . LEU B 1 395 ? 22.036  -14.173 21.895  1.00 53.89  ? 395 LEU B CA    1 
ATOM   6546  C  C     . LEU B 1 395 ? 23.474  -13.915 22.244  1.00 52.69  ? 395 LEU B C     1 
ATOM   6547  O  O     . LEU B 1 395 ? 24.350  -14.094 21.399  1.00 58.77  ? 395 LEU B O     1 
ATOM   6548  C  CB    . LEU B 1 395 ? 21.288  -12.855 21.800  1.00 55.35  ? 395 LEU B CB    1 
ATOM   6549  C  CG    . LEU B 1 395 ? 19.868  -12.975 21.263  1.00 59.88  ? 395 LEU B CG    1 
ATOM   6550  C  CD1   . LEU B 1 395 ? 19.145  -11.627 21.299  1.00 54.69  ? 395 LEU B CD1   1 
ATOM   6551  C  CD2   . LEU B 1 395 ? 20.009  -13.461 19.838  1.00 67.29  ? 395 LEU B CD2   1 
ATOM   6552  N  N     . ARG B 1 396 ? 23.720  -13.612 23.511  1.00 46.28  ? 396 ARG B N     1 
ATOM   6553  C  CA    . ARG B 1 396 ? 25.069  -13.316 23.951  1.00 55.46  ? 396 ARG B CA    1 
ATOM   6554  C  C     . ARG B 1 396 ? 25.962  -14.502 23.605  1.00 60.69  ? 396 ARG B C     1 
ATOM   6555  O  O     . ARG B 1 396 ? 26.994  -14.326 22.914  1.00 75.73  ? 396 ARG B O     1 
ATOM   6556  C  CB    . ARG B 1 396 ? 25.082  -13.022 25.447  1.00 49.52  ? 396 ARG B CB    1 
ATOM   6557  C  CG    . ARG B 1 396 ? 26.417  -12.600 25.998  1.00 54.46  ? 396 ARG B CG    1 
ATOM   6558  C  CD    . ARG B 1 396 ? 26.409  -12.714 27.518  1.00 59.20  ? 396 ARG B CD    1 
ATOM   6559  N  NE    . ARG B 1 396 ? 26.375  -14.129 27.885  1.00 51.85  ? 396 ARG B NE    1 
ATOM   6560  C  CZ    . ARG B 1 396 ? 27.448  -14.916 27.852  1.00 65.10  ? 396 ARG B CZ    1 
ATOM   6561  N  NH1   . ARG B 1 396 ? 28.628  -14.416 27.497  1.00 81.99  ? 396 ARG B NH1   1 
ATOM   6562  N  NH2   . ARG B 1 396 ? 27.363  -16.192 28.194  1.00 70.46  ? 396 ARG B NH2   1 
ATOM   6563  N  N     . LYS B 1 397 ? 25.533  -15.691 23.963  1.00 52.50  ? 397 LYS B N     1 
ATOM   6564  C  CA    . LYS B 1 397 ? 26.275  -16.881 23.634  1.00 60.14  ? 397 LYS B CA    1 
ATOM   6565  C  C     . LYS B 1 397 ? 26.485  -17.026 22.145  1.00 57.59  ? 397 LYS B C     1 
ATOM   6566  O  O     . LYS B 1 397 ? 27.545  -17.367 21.712  1.00 60.50  ? 397 LYS B O     1 
ATOM   6567  C  CB    . LYS B 1 397 ? 25.533  -18.107 24.145  1.00 63.53  ? 397 LYS B CB    1 
ATOM   6568  C  CG    . LYS B 1 397 ? 25.735  -18.407 25.614  1.00 65.13  ? 397 LYS B CG    1 
ATOM   6569  C  CD    . LYS B 1 397 ? 24.687  -19.376 26.097  1.00 65.91  ? 397 LYS B CD    1 
ATOM   6570  C  CE    . LYS B 1 397 ? 24.990  -19.876 27.486  1.00 70.47  ? 397 LYS B CE    1 
ATOM   6571  N  NZ    . LYS B 1 397 ? 24.071  -20.977 27.836  1.00 72.33  ? 397 LYS B NZ    1 
ATOM   6572  N  N     . ALA B 1 398 ? 25.461  -16.774 21.358  1.00 56.95  ? 398 ALA B N     1 
ATOM   6573  C  CA    . ALA B 1 398 ? 25.571  -16.907 19.926  1.00 54.58  ? 398 ALA B CA    1 
ATOM   6574  C  C     . ALA B 1 398 ? 26.639  -16.020 19.383  1.00 65.36  ? 398 ALA B C     1 
ATOM   6575  O  O     . ALA B 1 398 ? 27.362  -16.368 18.483  1.00 66.16  ? 398 ALA B O     1 
ATOM   6576  C  CB    . ALA B 1 398 ? 24.264  -16.552 19.289  1.00 44.60  ? 398 ALA B CB    1 
ATOM   6577  N  N     . LYS B 1 399 ? 26.710  -14.842 19.949  1.00 63.24  ? 399 LYS B N     1 
ATOM   6578  C  CA    . LYS B 1 399 ? 27.643  -13.844 19.547  1.00 49.10  ? 399 LYS B CA    1 
ATOM   6579  C  C     . LYS B 1 399 ? 29.031  -14.211 19.924  1.00 59.43  ? 399 LYS B C     1 
ATOM   6580  O  O     . LYS B 1 399 ? 29.946  -13.954 19.185  1.00 57.31  ? 399 LYS B O     1 
ATOM   6581  C  CB    . LYS B 1 399 ? 27.304  -12.574 20.272  1.00 30.00  ? 399 LYS B CB    1 
ATOM   6582  C  CG    . LYS B 1 399 ? 27.189  -11.382 19.376  1.00 30.00  ? 399 LYS B CG    1 
ATOM   6583  C  CD    . LYS B 1 399 ? 28.313  -10.422 19.628  1.00 30.00  ? 399 LYS B CD    1 
ATOM   6584  C  CE    . LYS B 1 399 ? 28.551  -9.607  18.383  1.00 30.00  ? 399 LYS B CE    1 
ATOM   6585  N  NZ    . LYS B 1 399 ? 29.385  -10.377 17.434  1.00 30.00  ? 399 LYS B NZ    1 
ATOM   6586  N  N     . GLU B 1 400 ? 29.181  -14.798 21.099  1.00 69.41  ? 400 GLU B N     1 
ATOM   6587  C  CA    . GLU B 1 400 ? 30.478  -15.193 21.626  1.00 77.81  ? 400 GLU B CA    1 
ATOM   6588  C  C     . GLU B 1 400 ? 31.047  -16.285 20.774  1.00 70.08  ? 400 GLU B C     1 
ATOM   6589  O  O     . GLU B 1 400 ? 32.241  -16.451 20.664  1.00 68.33  ? 400 GLU B O     1 
ATOM   6590  C  CB    . GLU B 1 400 ? 30.316  -15.722 23.048  1.00 98.67  ? 400 GLU B CB    1 
ATOM   6591  C  CG    . GLU B 1 400 ? 31.303  -15.199 24.075  1.00 116.14 ? 400 GLU B CG    1 
ATOM   6592  C  CD    . GLU B 1 400 ? 31.322  -16.036 25.354  1.00 124.35 ? 400 GLU B CD    1 
ATOM   6593  O  OE1   . GLU B 1 400 ? 30.522  -16.987 25.459  1.00 122.20 ? 400 GLU B OE1   1 
ATOM   6594  O  OE2   . GLU B 1 400 ? 32.135  -15.746 26.262  1.00 129.17 ? 400 GLU B OE2   1 
ATOM   6595  N  N     . GLU B 1 401 ? 30.158  -17.035 20.166  1.00 71.24  ? 401 GLU B N     1 
ATOM   6596  C  CA    . GLU B 1 401 ? 30.554  -18.161 19.326  1.00 64.65  ? 401 GLU B CA    1 
ATOM   6597  C  C     . GLU B 1 401 ? 30.828  -17.767 17.876  1.00 62.62  ? 401 GLU B C     1 
ATOM   6598  O  O     . GLU B 1 401 ? 31.111  -18.627 17.013  1.00 56.40  ? 401 GLU B O     1 
ATOM   6599  C  CB    . GLU B 1 401 ? 29.431  -19.209 19.335  1.00 62.88  ? 401 GLU B CB    1 
ATOM   6600  C  CG    . GLU B 1 401 ? 29.275  -19.938 20.632  1.00 76.61  ? 401 GLU B CG    1 
ATOM   6601  C  CD    . GLU B 1 401 ? 28.192  -20.979 20.574  1.00 96.31  ? 401 GLU B CD    1 
ATOM   6602  O  OE1   . GLU B 1 401 ? 27.704  -21.272 19.454  1.00 110.77 ? 401 GLU B OE1   1 
ATOM   6603  O  OE2   . GLU B 1 401 ? 27.811  -21.504 21.636  1.00 97.44  ? 401 GLU B OE2   1 
ATOM   6604  N  N     . GLY B 1 402 ? 30.711  -16.482 17.577  1.00 60.32  ? 402 GLY B N     1 
ATOM   6605  C  CA    . GLY B 1 402 ? 31.079  -15.988 16.273  1.00 57.05  ? 402 GLY B CA    1 
ATOM   6606  C  C     . GLY B 1 402 ? 29.955  -15.531 15.380  1.00 57.55  ? 402 GLY B C     1 
ATOM   6607  O  O     . GLY B 1 402 ? 30.223  -15.050 14.286  1.00 62.84  ? 402 GLY B O     1 
ATOM   6608  N  N     . VAL B 1 403 ? 28.700  -15.709 15.790  1.00 52.47  ? 403 VAL B N     1 
ATOM   6609  C  CA    . VAL B 1 403 ? 27.610  -15.301 14.903  1.00 55.58  ? 403 VAL B CA    1 
ATOM   6610  C  C     . VAL B 1 403 ? 27.683  -13.797 14.604  1.00 49.99  ? 403 VAL B C     1 
ATOM   6611  O  O     . VAL B 1 403 ? 27.841  -12.982 15.500  1.00 47.16  ? 403 VAL B O     1 
ATOM   6612  C  CB    . VAL B 1 403 ? 26.247  -15.669 15.508  1.00 52.16  ? 403 VAL B CB    1 
ATOM   6613  C  CG1   . VAL B 1 403 ? 25.149  -15.173 14.648  1.00 50.41  ? 403 VAL B CG1   1 
ATOM   6614  C  CG2   . VAL B 1 403 ? 26.141  -17.152 15.646  1.00 61.59  ? 403 VAL B CG2   1 
ATOM   6615  N  N     . GLN B 1 404 ? 27.477  -13.429 13.349  1.00 45.11  ? 404 GLN B N     1 
ATOM   6616  C  CA    . GLN B 1 404 ? 27.663  -12.035 12.913  1.00 55.36  ? 404 GLN B CA    1 
ATOM   6617  C  C     . GLN B 1 404 ? 26.335  -11.370 12.583  1.00 58.70  ? 404 GLN B C     1 
ATOM   6618  O  O     . GLN B 1 404 ? 26.200  -10.141 12.696  1.00 54.90  ? 404 GLN B O     1 
ATOM   6619  C  CB    . GLN B 1 404 ? 28.599  -11.946 11.718  1.00 57.11  ? 404 GLN B CB    1 
ATOM   6620  C  CG    . GLN B 1 404 ? 29.986  -12.368 12.054  1.00 63.41  ? 404 GLN B CG    1 
ATOM   6621  C  CD    . GLN B 1 404 ? 30.872  -12.374 10.858  1.00 85.17  ? 404 GLN B CD    1 
ATOM   6622  O  OE1   . GLN B 1 404 ? 30.700  -13.211 9.977   1.00 83.39  ? 404 GLN B OE1   1 
ATOM   6623  N  NE2   . GLN B 1 404 ? 31.893  -11.521 10.855  1.00 103.74 ? 404 GLN B NE2   1 
ATOM   6624  N  N     . ALA B 1 405 ? 25.348  -12.185 12.213  1.00 50.57  ? 405 ALA B N     1 
ATOM   6625  C  CA    . ALA B 1 405 ? 24.035  -11.672 11.859  1.00 47.02  ? 405 ALA B CA    1 
ATOM   6626  C  C     . ALA B 1 405 ? 23.003  -12.800 11.975  1.00 47.37  ? 405 ALA B C     1 
ATOM   6627  O  O     . ALA B 1 405 ? 23.341  -13.987 11.983  1.00 50.93  ? 405 ALA B O     1 
ATOM   6628  C  CB    . ALA B 1 405 ? 24.043  -11.043 10.451  1.00 33.84  ? 405 ALA B CB    1 
ATOM   6629  N  N     . VAL B 1 406 ? 21.735  -12.430 12.065  1.00 37.53  ? 406 VAL B N     1 
ATOM   6630  C  CA    . VAL B 1 406 ? 20.710  -13.446 12.223  1.00 48.23  ? 406 VAL B CA    1 
ATOM   6631  C  C     . VAL B 1 406 ? 19.591  -13.368 11.186  1.00 53.49  ? 406 VAL B C     1 
ATOM   6632  O  O     . VAL B 1 406 ? 19.063  -12.296 10.862  1.00 40.49  ? 406 VAL B O     1 
ATOM   6633  C  CB    . VAL B 1 406 ? 20.071  -13.275 13.677  1.00 45.36  ? 406 VAL B CB    1 
ATOM   6634  C  CG1   . VAL B 1 406 ? 18.776  -14.046 13.858  1.00 37.00  ? 406 VAL B CG1   1 
ATOM   6635  C  CG2   . VAL B 1 406 ? 21.081  -13.601 14.770  1.00 42.29  ? 406 VAL B CG2   1 
ATOM   6636  N  N     . LEU B 1 407 ? 19.213  -14.534 10.674  1.00 53.54  ? 407 LEU B N     1 
ATOM   6637  C  CA    . LEU B 1 407 ? 18.085  -14.598 9.768   1.00 54.70  ? 407 LEU B CA    1 
ATOM   6638  C  C     . LEU B 1 407 ? 16.836  -14.971 10.559  1.00 62.41  ? 407 LEU B C     1 
ATOM   6639  O  O     . LEU B 1 407 ? 16.796  -16.024 11.207  1.00 72.72  ? 407 LEU B O     1 
ATOM   6640  C  CB    . LEU B 1 407 ? 18.379  -15.594 8.645   1.00 47.23  ? 407 LEU B CB    1 
ATOM   6641  C  CG    . LEU B 1 407 ? 17.286  -15.779 7.591   1.00 44.04  ? 407 LEU B CG    1 
ATOM   6642  C  CD1   . LEU B 1 407 ? 16.968  -14.487 6.899   1.00 48.26  ? 407 LEU B CD1   1 
ATOM   6643  C  CD2   . LEU B 1 407 ? 17.673  -16.860 6.572   1.00 34.24  ? 407 LEU B CD2   1 
ATOM   6644  N  N     . VAL B 1 408 ? 15.818  -14.122 10.508  1.00 49.41  ? 408 VAL B N     1 
ATOM   6645  C  CA    . VAL B 1 408 ? 14.608  -14.378 11.274  1.00 45.85  ? 408 VAL B CA    1 
ATOM   6646  C  C     . VAL B 1 408 ? 13.451  -14.777 10.387  1.00 48.43  ? 408 VAL B C     1 
ATOM   6647  O  O     . VAL B 1 408 ? 12.958  -13.943 9.625   1.00 38.98  ? 408 VAL B O     1 
ATOM   6648  C  CB    . VAL B 1 408 ? 14.239  -13.130 12.145  1.00 59.22  ? 408 VAL B CB    1 
ATOM   6649  C  CG1   . VAL B 1 408 ? 13.079  -13.378 13.038  1.00 55.71  ? 408 VAL B CG1   1 
ATOM   6650  C  CG2   . VAL B 1 408 ? 15.441  -12.678 12.951  1.00 60.03  ? 408 VAL B CG2   1 
ATOM   6651  N  N     . LEU B 1 409 ? 13.031  -16.045 10.497  1.00 57.88  ? 409 LEU B N     1 
ATOM   6652  C  CA    . LEU B 1 409 ? 11.896  -16.610 9.746   1.00 60.81  ? 409 LEU B CA    1 
ATOM   6653  C  C     . LEU B 1 409 ? 10.682  -16.453 10.617  1.00 59.42  ? 409 LEU B C     1 
ATOM   6654  O  O     . LEU B 1 409 ? 10.594  -17.083 11.678  1.00 63.09  ? 409 LEU B O     1 
ATOM   6655  C  CB    . LEU B 1 409 ? 12.096  -18.075 9.382   1.00 60.21  ? 409 LEU B CB    1 
ATOM   6656  C  CG    . LEU B 1 409 ? 13.103  -18.377 8.278   1.00 53.62  ? 409 LEU B CG    1 
ATOM   6657  C  CD1   . LEU B 1 409 ? 13.095  -19.861 7.939   1.00 50.28  ? 409 LEU B CD1   1 
ATOM   6658  C  CD2   . LEU B 1 409 ? 12.815  -17.548 7.072   1.00 44.76  ? 409 LEU B CD2   1 
ATOM   6659  N  N     . THR B 1 410 ? 9.738   -15.640 10.181  1.00 56.07  ? 410 THR B N     1 
ATOM   6660  C  CA    . THR B 1 410 ? 8.602   -15.337 11.038  1.00 55.42  ? 410 THR B CA    1 
ATOM   6661  C  C     . THR B 1 410 ? 7.391   -15.000 10.220  1.00 60.89  ? 410 THR B C     1 
ATOM   6662  O  O     . THR B 1 410 ? 7.507   -14.547 9.074   1.00 69.21  ? 410 THR B O     1 
ATOM   6663  C  CB    . THR B 1 410 ? 8.876   -14.124 11.942  1.00 51.34  ? 410 THR B CB    1 
ATOM   6664  O  OG1   . THR B 1 410 ? 7.668   -13.727 12.581  1.00 62.00  ? 410 THR B OG1   1 
ATOM   6665  C  CG2   . THR B 1 410 ? 9.419   -12.950 11.117  1.00 55.62  ? 410 THR B CG2   1 
ATOM   6666  N  N     . PRO B 1 411 ? 6.212   -15.323 10.736  1.00 63.21  ? 411 PRO B N     1 
ATOM   6667  C  CA    . PRO B 1 411 ? 4.998   -14.790 10.120  1.00 59.42  ? 411 PRO B CA    1 
ATOM   6668  C  C     . PRO B 1 411 ? 5.053   -13.287 10.192  1.00 55.07  ? 411 PRO B C     1 
ATOM   6669  O  O     . PRO B 1 411 ? 5.818   -12.770 11.014  1.00 64.93  ? 411 PRO B O     1 
ATOM   6670  C  CB    . PRO B 1 411 ? 3.881   -15.345 10.994  1.00 55.03  ? 411 PRO B CB    1 
ATOM   6671  C  CG    . PRO B 1 411 ? 4.486   -16.479 11.671  1.00 56.60  ? 411 PRO B CG    1 
ATOM   6672  C  CD    . PRO B 1 411 ? 5.907   -16.168 11.888  1.00 57.19  ? 411 PRO B CD    1 
ATOM   6673  N  N     . PRO B 1 412 ? 4.346   -12.588 9.300   1.00 58.08  ? 412 PRO B N     1 
ATOM   6674  C  CA    . PRO B 1 412 ? 4.464   -11.121 9.275   1.00 56.79  ? 412 PRO B CA    1 
ATOM   6675  C  C     . PRO B 1 412 ? 4.236   -10.520 10.676  1.00 62.08  ? 412 PRO B C     1 
ATOM   6676  O  O     . PRO B 1 412 ? 3.259   -10.858 11.381  1.00 57.17  ? 412 PRO B O     1 
ATOM   6677  C  CB    . PRO B 1 412 ? 3.371   -10.698 8.280   1.00 37.04  ? 412 PRO B CB    1 
ATOM   6678  C  CG    . PRO B 1 412 ? 3.287   -11.867 7.357   1.00 45.68  ? 412 PRO B CG    1 
ATOM   6679  C  CD    . PRO B 1 412 ? 3.472   -13.090 8.234   1.00 57.30  ? 412 PRO B CD    1 
ATOM   6680  N  N     . MET B 1 413 ? 5.146   -9.630  11.065  1.00 52.85  ? 413 MET B N     1 
ATOM   6681  C  CA    . MET B 1 413 ? 5.101   -9.035  12.386  1.00 51.85  ? 413 MET B CA    1 
ATOM   6682  C  C     . MET B 1 413 ? 4.511   -7.621  12.328  1.00 47.80  ? 413 MET B C     1 
ATOM   6683  O  O     . MET B 1 413 ? 4.639   -6.945  11.325  1.00 43.81  ? 413 MET B O     1 
ATOM   6684  C  CB    . MET B 1 413 ? 6.506   -9.005  13.002  1.00 48.51  ? 413 MET B CB    1 
ATOM   6685  C  CG    . MET B 1 413 ? 7.276   -10.317 12.950  1.00 33.17  ? 413 MET B CG    1 
ATOM   6686  S  SD    . MET B 1 413 ? 8.933   -10.079 13.647  1.00 63.31  ? 413 MET B SD    1 
ATOM   6687  C  CE    . MET B 1 413 ? 8.533   -9.918  15.395  1.00 50.73  ? 413 MET B CE    1 
ATOM   6688  N  N     . ALA B 1 414 ? 3.805   -7.214  13.381  1.00 57.95  ? 414 ALA B N     1 
ATOM   6689  C  CA    . ALA B 1 414 ? 3.395   -5.815  13.575  1.00 52.46  ? 414 ALA B CA    1 
ATOM   6690  C  C     . ALA B 1 414 ? 4.621   -4.923  13.748  1.00 57.89  ? 414 ALA B C     1 
ATOM   6691  O  O     . ALA B 1 414 ? 5.680   -5.400  14.205  1.00 51.60  ? 414 ALA B O     1 
ATOM   6692  C  CB    . ALA B 1 414 ? 2.502   -5.684  14.785  1.00 46.91  ? 414 ALA B CB    1 
ATOM   6693  N  N     . TRP B 1 415 ? 4.491   -3.640  13.405  1.00 51.59  ? 415 TRP B N     1 
ATOM   6694  C  CA    . TRP B 1 415 ? 5.651   -2.733  13.437  1.00 53.25  ? 415 TRP B CA    1 
ATOM   6695  C  C     . TRP B 1 415 ? 6.336   -2.706  14.785  1.00 64.00  ? 415 TRP B C     1 
ATOM   6696  O  O     . TRP B 1 415 ? 7.569   -2.696  14.849  1.00 69.42  ? 415 TRP B O     1 
ATOM   6697  C  CB    . TRP B 1 415 ? 5.214   -1.310  13.055  1.00 49.52  ? 415 TRP B CB    1 
ATOM   6698  C  CG    . TRP B 1 415 ? 5.381   -0.967  11.581  1.00 70.18  ? 415 TRP B CG    1 
ATOM   6699  C  CD1   . TRP B 1 415 ? 4.391   -0.911  10.635  1.00 81.40  ? 415 TRP B CD1   1 
ATOM   6700  C  CD2   . TRP B 1 415 ? 6.577   -0.494  10.928  1.00 76.24  ? 415 TRP B CD2   1 
ATOM   6701  N  NE1   . TRP B 1 415 ? 4.915   -0.521  9.420   1.00 80.64  ? 415 TRP B NE1   1 
ATOM   6702  C  CE2   . TRP B 1 415 ? 6.249   -0.246  9.574   1.00 72.65  ? 415 TRP B CE2   1 
ATOM   6703  C  CE3   . TRP B 1 415 ? 7.895   -0.289  11.348  1.00 81.56  ? 415 TRP B CE3   1 
ATOM   6704  C  CZ2   . TRP B 1 415 ? 7.194   0.196   8.637   1.00 58.54  ? 415 TRP B CZ2   1 
ATOM   6705  C  CZ3   . TRP B 1 415 ? 8.838   0.148   10.414  1.00 76.96  ? 415 TRP B CZ3   1 
ATOM   6706  C  CH2   . TRP B 1 415 ? 8.480   0.382   9.075   1.00 65.42  ? 415 TRP B CH2   1 
ATOM   6707  N  N     . GLU B 1 416 ? 5.549   -2.680  15.866  1.00 59.38  ? 416 GLU B N     1 
ATOM   6708  C  CA    . GLU B 1 416 ? 6.129   -2.582  17.211  1.00 52.77  ? 416 GLU B CA    1 
ATOM   6709  C  C     . GLU B 1 416 ? 6.949   -3.846  17.551  1.00 55.33  ? 416 GLU B C     1 
ATOM   6710  O  O     . GLU B 1 416 ? 8.077   -3.758  18.016  1.00 68.83  ? 416 GLU B O     1 
ATOM   6711  C  CB    . GLU B 1 416 ? 5.074   -2.186  18.244  1.00 64.48  ? 416 GLU B CB    1 
ATOM   6712  C  CG    . GLU B 1 416 ? 3.822   -2.969  18.387  1.00 95.08  ? 416 GLU B CG    1 
ATOM   6713  C  CD    . GLU B 1 416 ? 2.936   -2.304  19.426  1.00 117.25 ? 416 GLU B CD    1 
ATOM   6714  O  OE1   . GLU B 1 416 ? 3.491   -1.587  20.297  1.00 130.69 ? 416 GLU B OE1   1 
ATOM   6715  O  OE2   . GLU B 1 416 ? 1.704   -2.460  19.387  1.00 124.90 ? 416 GLU B OE2   1 
ATOM   6716  N  N     . ASP B 1 417 ? 6.420   -5.016  17.231  1.00 50.86  ? 417 ASP B N     1 
ATOM   6717  C  CA    . ASP B 1 417 ? 7.107   -6.274  17.495  1.00 63.56  ? 417 ASP B CA    1 
ATOM   6718  C  C     . ASP B 1 417 ? 8.388   -6.377  16.679  1.00 60.17  ? 417 ASP B C     1 
ATOM   6719  O  O     . ASP B 1 417 ? 9.431   -6.860  17.159  1.00 65.38  ? 417 ASP B O     1 
ATOM   6720  C  CB    . ASP B 1 417 ? 6.149   -7.423  17.201  1.00 72.58  ? 417 ASP B CB    1 
ATOM   6721  C  CG    . ASP B 1 417 ? 4.895   -7.302  18.025  1.00 70.86  ? 417 ASP B CG    1 
ATOM   6722  O  OD1   . ASP B 1 417 ? 5.059   -6.981  19.218  1.00 65.99  ? 417 ASP B OD1   1 
ATOM   6723  O  OD2   . ASP B 1 417 ? 3.773   -7.486  17.518  1.00 75.19  ? 417 ASP B OD2   1 
ATOM   6724  N  N     . ARG B 1 418 ? 8.272   -5.999  15.420  1.00 54.71  ? 418 ARG B N     1 
ATOM   6725  C  CA    . ARG B 1 418 ? 9.404   -5.950  14.530  1.00 55.27  ? 418 ARG B CA    1 
ATOM   6726  C  C     . ARG B 1 418 ? 10.492  -5.031  15.137  1.00 46.62  ? 418 ARG B C     1 
ATOM   6727  O  O     . ARG B 1 418 ? 11.661  -5.419  15.268  1.00 59.81  ? 418 ARG B O     1 
ATOM   6728  C  CB    . ARG B 1 418 ? 8.980   -5.449  13.158  1.00 59.08  ? 418 ARG B CB    1 
ATOM   6729  C  CG    . ARG B 1 418 ? 10.144  -5.285  12.209  1.00 63.26  ? 418 ARG B CG    1 
ATOM   6730  C  CD    . ARG B 1 418 ? 10.697  -4.002  12.019  1.00 59.73  ? 418 ARG B CD    1 
ATOM   6731  N  NE    . ARG B 1 418 ? 11.778  -3.803  11.060  1.00 58.72  ? 418 ARG B NE    1 
ATOM   6732  C  CZ    . ARG B 1 418 ? 12.587  -2.749  11.149  1.00 50.79  ? 418 ARG B CZ    1 
ATOM   6733  N  NH1   . ARG B 1 418 ? 12.413  -1.872  12.125  1.00 49.14  ? 418 ARG B NH1   1 
ATOM   6734  N  NH2   . ARG B 1 418 ? 13.554  -2.552  10.284  1.00 57.37  ? 418 ARG B NH2   1 
ATOM   6735  N  N     . ASN B 1 419 ? 10.097  -3.818  15.524  1.00 31.68  ? 419 ASN B N     1 
ATOM   6736  C  CA    . ASN B 1 419 ? 11.051  -2.880  16.137  1.00 47.12  ? 419 ASN B CA    1 
ATOM   6737  C  C     . ASN B 1 419 ? 11.699  -3.393  17.445  1.00 59.70  ? 419 ASN B C     1 
ATOM   6738  O  O     . ASN B 1 419 ? 12.922  -3.304  17.651  1.00 61.03  ? 419 ASN B O     1 
ATOM   6739  C  CB    . ASN B 1 419 ? 10.367  -1.537  16.389  1.00 40.55  ? 419 ASN B CB    1 
ATOM   6740  C  CG    . ASN B 1 419 ? 10.029  -0.798  15.110  1.00 42.33  ? 419 ASN B CG    1 
ATOM   6741  O  OD1   . ASN B 1 419 ? 10.483  -1.159  14.035  1.00 37.32  ? 419 ASN B OD1   1 
ATOM   6742  N  ND2   . ASN B 1 419 ? 9.198   0.214   15.219  1.00 55.99  ? 419 ASN B ND2   1 
ATOM   6743  N  N     . ARG B 1 420 ? 10.882  -3.957  18.316  1.00 57.15  ? 420 ARG B N     1 
ATOM   6744  C  CA    . ARG B 1 420 ? 11.365  -4.479  19.584  1.00 50.29  ? 420 ARG B CA    1 
ATOM   6745  C  C     . ARG B 1 420 ? 12.384  -5.600  19.364  1.00 44.24  ? 420 ARG B C     1 
ATOM   6746  O  O     . ARG B 1 420 ? 13.415  -5.663  20.028  1.00 48.71  ? 420 ARG B O     1 
ATOM   6747  C  CB    . ARG B 1 420 ? 10.268  -5.173  20.336  1.00 62.60  ? 420 ARG B CB    1 
ATOM   6748  C  CG    . ARG B 1 420 ? 10.576  -5.530  21.757  1.00 81.87  ? 420 ARG B CG    1 
ATOM   6749  C  CD    . ARG B 1 420 ? 9.462   -6.473  22.116  1.00 99.68  ? 420 ARG B CD    1 
ATOM   6750  N  NE    . ARG B 1 420 ? 10.089  -7.807  22.219  1.00 111.99 ? 420 ARG B NE    1 
ATOM   6751  C  CZ    . ARG B 1 420 ? 10.199  -8.583  23.288  1.00 111.04 ? 420 ARG B CZ    1 
ATOM   6752  N  NH1   . ARG B 1 420 ? 9.351   -8.415  24.306  1.00 116.53 ? 420 ARG B NH1   1 
ATOM   6753  N  NH2   . ARG B 1 420 ? 10.825  -9.714  23.185  1.00 107.66 ? 420 ARG B NH2   1 
ATOM   6754  N  N     . LEU B 1 421 ? 12.063  -6.486  18.424  1.00 40.90  ? 421 LEU B N     1 
ATOM   6755  C  CA    . LEU B 1 421 ? 12.887  -7.641  18.117  1.00 39.65  ? 421 LEU B CA    1 
ATOM   6756  C  C     . LEU B 1 421 ? 14.242  -7.175  17.581  1.00 43.54  ? 421 LEU B C     1 
ATOM   6757  O  O     . LEU B 1 421 ? 15.325  -7.589  18.067  1.00 40.97  ? 421 LEU B O     1 
ATOM   6758  C  CB    . LEU B 1 421 ? 12.190  -8.491  17.055  1.00 30.29  ? 421 LEU B CB    1 
ATOM   6759  C  CG    . LEU B 1 421 ? 12.853  -9.820  16.713  1.00 49.19  ? 421 LEU B CG    1 
ATOM   6760  C  CD1   . LEU B 1 421 ? 13.138  -10.632 17.963  1.00 28.69  ? 421 LEU B CD1   1 
ATOM   6761  C  CD2   . LEU B 1 421 ? 12.044  -10.607 15.728  1.00 59.08  ? 421 LEU B CD2   1 
ATOM   6762  N  N     . LYS B 1 422 ? 14.168  -6.245  16.620  1.00 31.04  ? 422 LYS B N     1 
ATOM   6763  C  CA    . LYS B 1 422 ? 15.393  -5.740  16.004  1.00 43.46  ? 422 LYS B CA    1 
ATOM   6764  C  C     . LYS B 1 422 ? 16.283  -5.087  17.021  1.00 53.83  ? 422 LYS B C     1 
ATOM   6765  O  O     . LYS B 1 422 ? 17.479  -5.385  17.094  1.00 66.85  ? 422 LYS B O     1 
ATOM   6766  C  CB    . LYS B 1 422 ? 15.119  -4.712  14.911  1.00 36.34  ? 422 LYS B CB    1 
ATOM   6767  C  CG    . LYS B 1 422 ? 14.265  -5.146  13.738  1.00 45.04  ? 422 LYS B CG    1 
ATOM   6768  C  CD    . LYS B 1 422 ? 15.155  -5.810  12.777  1.00 58.14  ? 422 LYS B CD    1 
ATOM   6769  C  CE    . LYS B 1 422 ? 14.646  -5.881  11.377  1.00 60.10  ? 422 LYS B CE    1 
ATOM   6770  N  NZ    . LYS B 1 422 ? 15.848  -5.673  10.475  1.00 62.30  ? 422 LYS B NZ    1 
ATOM   6771  N  N     . ALA B 1 423 ? 15.662  -4.277  17.870  1.00 48.67  ? 423 ALA B N     1 
ATOM   6772  C  CA    . ALA B 1 423 ? 16.390  -3.563  18.908  1.00 53.48  ? 423 ALA B CA    1 
ATOM   6773  C  C     . ALA B 1 423 ? 17.014  -4.531  19.916  1.00 61.98  ? 423 ALA B C     1 
ATOM   6774  O  O     . ALA B 1 423 ? 18.180  -4.378  20.306  1.00 69.45  ? 423 ALA B O     1 
ATOM   6775  C  CB    . ALA B 1 423 ? 15.464  -2.610  19.614  1.00 49.44  ? 423 ALA B CB    1 
ATOM   6776  N  N     . LEU B 1 424 ? 16.248  -5.532  20.329  1.00 44.84  ? 424 LEU B N     1 
ATOM   6777  C  CA    . LEU B 1 424 ? 16.794  -6.537  21.217  1.00 46.08  ? 424 LEU B CA    1 
ATOM   6778  C  C     . LEU B 1 424 ? 18.046  -7.238  20.645  1.00 49.57  ? 424 LEU B C     1 
ATOM   6779  O  O     . LEU B 1 424 ? 19.065  -7.312  21.323  1.00 62.63  ? 424 LEU B O     1 
ATOM   6780  C  CB    . LEU B 1 424 ? 15.710  -7.536  21.578  1.00 50.09  ? 424 LEU B CB    1 
ATOM   6781  C  CG    . LEU B 1 424 ? 16.189  -8.682  22.436  1.00 56.49  ? 424 LEU B CG    1 
ATOM   6782  C  CD1   . LEU B 1 424 ? 16.852  -8.162  23.711  1.00 41.43  ? 424 LEU B CD1   1 
ATOM   6783  C  CD2   . LEU B 1 424 ? 14.917  -9.433  22.756  1.00 62.58  ? 424 LEU B CD2   1 
ATOM   6784  N  N     . LEU B 1 425 ? 17.992  -7.750  19.418  1.00 39.97  ? 425 LEU B N     1 
ATOM   6785  C  CA    . LEU B 1 425 ? 19.201  -8.368  18.887  1.00 50.65  ? 425 LEU B CA    1 
ATOM   6786  C  C     . LEU B 1 425 ? 20.366  -7.402  18.759  1.00 53.97  ? 425 LEU B C     1 
ATOM   6787  O  O     . LEU B 1 425 ? 21.536  -7.740  18.974  1.00 43.93  ? 425 LEU B O     1 
ATOM   6788  C  CB    . LEU B 1 425 ? 18.963  -9.131  17.578  1.00 52.48  ? 425 LEU B CB    1 
ATOM   6789  C  CG    . LEU B 1 425 ? 18.074  -10.382 17.539  1.00 41.13  ? 425 LEU B CG    1 
ATOM   6790  C  CD1   . LEU B 1 425 ? 16.703  -10.305 18.121  1.00 47.93  ? 425 LEU B CD1   1 
ATOM   6791  C  CD2   . LEU B 1 425 ? 18.046  -10.957 16.110  1.00 40.54  ? 425 LEU B CD2   1 
ATOM   6792  N  N     . LEU B 1 426 ? 20.029  -6.220  18.322  1.00 53.24  ? 426 LEU B N     1 
ATOM   6793  C  CA    . LEU B 1 426 ? 20.995  -5.169  18.120  1.00 39.52  ? 426 LEU B CA    1 
ATOM   6794  C  C     . LEU B 1 426 ? 21.765  -4.859  19.421  1.00 43.82  ? 426 LEU B C     1 
ATOM   6795  O  O     . LEU B 1 426 ? 22.970  -4.670  19.432  1.00 52.50  ? 426 LEU B O     1 
ATOM   6796  C  CB    . LEU B 1 426 ? 20.180  -3.970  17.682  1.00 25.16  ? 426 LEU B CB    1 
ATOM   6797  C  CG    . LEU B 1 426 ? 20.274  -3.531  16.241  1.00 26.29  ? 426 LEU B CG    1 
ATOM   6798  C  CD1   . LEU B 1 426 ? 19.454  -2.243  16.041  1.00 30.16  ? 426 LEU B CD1   1 
ATOM   6799  C  CD2   . LEU B 1 426 ? 21.655  -3.553  15.592  1.00 35.16  ? 426 LEU B CD2   1 
ATOM   6800  N  N     . ARG B 1 427 ? 21.066  -4.959  20.540  1.00 40.77  ? 427 ARG B N     1 
ATOM   6801  C  CA    . ARG B 1 427 ? 21.633  -4.625  21.844  1.00 43.23  ? 427 ARG B CA    1 
ATOM   6802  C  C     . ARG B 1 427 ? 22.699  -5.641  22.217  1.00 60.37  ? 427 ARG B C     1 
ATOM   6803  O  O     . ARG B 1 427 ? 23.535  -5.404  23.120  1.00 61.57  ? 427 ARG B O     1 
ATOM   6804  C  CB    . ARG B 1 427 ? 20.506  -4.464  22.849  1.00 38.65  ? 427 ARG B CB    1 
ATOM   6805  C  CG    . ARG B 1 427 ? 20.421  -2.983  23.152  1.00 61.76  ? 427 ARG B CG    1 
ATOM   6806  C  CD    . ARG B 1 427 ? 19.618  -2.478  24.368  1.00 78.44  ? 427 ARG B CD    1 
ATOM   6807  N  NE    . ARG B 1 427 ? 18.165  -2.674  24.492  1.00 81.23  ? 427 ARG B NE    1 
ATOM   6808  C  CZ    . ARG B 1 427 ? 17.567  -3.844  24.653  1.00 89.95  ? 427 ARG B CZ    1 
ATOM   6809  N  NH1   . ARG B 1 427 ? 18.221  -4.899  24.453  1.00 103.34 ? 427 ARG B NH1   1 
ATOM   6810  N  NH2   . ARG B 1 427 ? 16.238  -4.017  24.774  1.00 84.07  ? 427 ARG B NH2   1 
ATOM   6811  N  N     . GLU B 1 428 ? 22.580  -6.838  21.660  1.00 52.09  ? 428 GLU B N     1 
ATOM   6812  C  CA    . GLU B 1 428 ? 23.619  -7.835  21.766  1.00 41.33  ? 428 GLU B CA    1 
ATOM   6813  C  C     . GLU B 1 428 ? 24.570  -7.819  20.581  1.00 38.43  ? 428 GLU B C     1 
ATOM   6814  O  O     . GLU B 1 428 ? 25.305  -8.774  20.405  1.00 55.51  ? 428 GLU B O     1 
ATOM   6815  C  CB    . GLU B 1 428 ? 23.014  -9.227  21.928  1.00 40.19  ? 428 GLU B CB    1 
ATOM   6816  C  CG    . GLU B 1 428 ? 22.666  -9.529  23.366  1.00 48.89  ? 428 GLU B CG    1 
ATOM   6817  C  CD    . GLU B 1 428 ? 23.923  -9.493  24.231  1.00 63.55  ? 428 GLU B CD    1 
ATOM   6818  O  OE1   . GLU B 1 428 ? 23.869  -8.895  25.330  1.00 60.07  ? 428 GLU B OE1   1 
ATOM   6819  O  OE2   . GLU B 1 428 ? 24.968  -10.040 23.788  1.00 67.63  ? 428 GLU B OE2   1 
ATOM   6820  N  N     . GLY B 1 429 ? 24.548  -6.768  19.763  1.00 47.90  ? 429 GLY B N     1 
ATOM   6821  C  CA    . GLY B 1 429 ? 25.489  -6.602  18.651  1.00 53.10  ? 429 GLY B CA    1 
ATOM   6822  C  C     . GLY B 1 429 ? 25.181  -7.426  17.388  1.00 47.56  ? 429 GLY B C     1 
ATOM   6823  O  O     . GLY B 1 429 ? 26.035  -7.622  16.530  1.00 52.48  ? 429 GLY B O     1 
ATOM   6824  N  N     . LEU B 1 430 ? 23.964  -7.932  17.288  1.00 40.32  ? 430 LEU B N     1 
ATOM   6825  C  CA    . LEU B 1 430 ? 23.565  -8.800  16.197  1.00 39.43  ? 430 LEU B CA    1 
ATOM   6826  C  C     . LEU B 1 430 ? 22.581  -8.115  15.258  1.00 46.44  ? 430 LEU B C     1 
ATOM   6827  O  O     . LEU B 1 430 ? 21.428  -7.913  15.608  1.00 49.75  ? 430 LEU B O     1 
ATOM   6828  C  CB    . LEU B 1 430 ? 22.979  -10.091 16.773  1.00 39.33  ? 430 LEU B CB    1 
ATOM   6829  C  CG    . LEU B 1 430 ? 24.075  -10.840 17.542  1.00 53.66  ? 430 LEU B CG    1 
ATOM   6830  C  CD1   . LEU B 1 430 ? 23.550  -12.081 18.250  1.00 63.11  ? 430 LEU B CD1   1 
ATOM   6831  C  CD2   . LEU B 1 430 ? 25.168  -11.249 16.545  1.00 57.87  ? 430 LEU B CD2   1 
ATOM   6832  N  N     . PRO B 1 431 ? 23.037  -7.717  14.065  1.00 49.41  ? 431 PRO B N     1 
ATOM   6833  C  CA    . PRO B 1 431 ? 22.074  -7.275  13.052  1.00 43.49  ? 431 PRO B CA    1 
ATOM   6834  C  C     . PRO B 1 431 ? 21.164  -8.417  12.628  1.00 39.42  ? 431 PRO B C     1 
ATOM   6835  O  O     . PRO B 1 431 ? 21.565  -9.570  12.789  1.00 47.50  ? 431 PRO B O     1 
ATOM   6836  C  CB    . PRO B 1 431 ? 22.959  -6.836  11.890  1.00 43.21  ? 431 PRO B CB    1 
ATOM   6837  C  CG    . PRO B 1 431 ? 24.281  -6.504  12.496  1.00 45.25  ? 431 PRO B CG    1 
ATOM   6838  C  CD    . PRO B 1 431 ? 24.428  -7.525  13.614  1.00 49.06  ? 431 PRO B CD    1 
ATOM   6839  N  N     . SER B 1 432 ? 19.945  -8.138  12.190  1.00 38.55  ? 432 SER B N     1 
ATOM   6840  C  CA    . SER B 1 432 ? 19.019  -9.214  11.810  1.00 37.34  ? 432 SER B CA    1 
ATOM   6841  C  C     . SER B 1 432 ? 18.351  -8.915  10.468  1.00 37.93  ? 432 SER B C     1 
ATOM   6842  O  O     . SER B 1 432 ? 18.079  -7.770  10.142  1.00 41.83  ? 432 SER B O     1 
ATOM   6843  C  CB    . SER B 1 432 ? 17.935  -9.390  12.846  1.00 41.10  ? 432 SER B CB    1 
ATOM   6844  O  OG    . SER B 1 432 ? 17.214  -8.171  12.984  1.00 41.42  ? 432 SER B OG    1 
ATOM   6845  N  N     . GLN B 1 433 ? 18.003  -9.959  9.728   1.00 43.32  ? 433 GLN B N     1 
ATOM   6846  C  CA    . GLN B 1 433 ? 17.248  -9.811  8.477   1.00 38.12  ? 433 GLN B CA    1 
ATOM   6847  C  C     . GLN B 1 433 ? 15.967  -10.580 8.633   1.00 42.81  ? 433 GLN B C     1 
ATOM   6848  O  O     . GLN B 1 433 ? 15.998  -11.770 8.944   1.00 55.82  ? 433 GLN B O     1 
ATOM   6849  C  CB    . GLN B 1 433 ? 18.026  -10.339 7.290   1.00 50.40  ? 433 GLN B CB    1 
ATOM   6850  C  CG    . GLN B 1 433 ? 17.177  -10.424 6.022   1.00 57.80  ? 433 GLN B CG    1 
ATOM   6851  C  CD    . GLN B 1 433 ? 16.713  -9.062  5.532   1.00 62.54  ? 433 GLN B CD    1 
ATOM   6852  O  OE1   . GLN B 1 433 ? 17.508  -8.129  5.352   1.00 69.82  ? 433 GLN B OE1   1 
ATOM   6853  N  NE2   . GLN B 1 433 ? 15.413  -8.946  5.303   1.00 59.51  ? 433 GLN B NE2   1 
ATOM   6854  N  N     . ILE B 1 434 ? 14.830  -9.914  8.463   1.00 49.77  ? 434 ILE B N     1 
ATOM   6855  C  CA    . ILE B 1 434 ? 13.574  -10.660 8.526   1.00 57.00  ? 434 ILE B CA    1 
ATOM   6856  C  C     . ILE B 1 434 ? 13.146  -11.212 7.179   1.00 55.84  ? 434 ILE B C     1 
ATOM   6857  O  O     . ILE B 1 434 ? 13.246  -10.540 6.163   1.00 55.70  ? 434 ILE B O     1 
ATOM   6858  C  CB    . ILE B 1 434 ? 12.484  -9.762  9.144   1.00 49.73  ? 434 ILE B CB    1 
ATOM   6859  C  CG1   . ILE B 1 434 ? 12.860  -9.455  10.594  1.00 44.03  ? 434 ILE B CG1   1 
ATOM   6860  C  CG2   . ILE B 1 434 ? 11.113  -10.407 9.078   1.00 53.10  ? 434 ILE B CG2   1 
ATOM   6861  C  CD1   . ILE B 1 434 ? 12.062  -8.347  11.155  1.00 44.69  ? 434 ILE B CD1   1 
ATOM   6862  N  N     . LEU B 1 435 ? 12.585  -12.413 7.192   1.00 58.77  ? 435 LEU B N     1 
ATOM   6863  C  CA    . LEU B 1 435 ? 12.024  -13.015 5.986   1.00 55.69  ? 435 LEU B CA    1 
ATOM   6864  C  C     . LEU B 1 435 ? 10.734  -13.698 6.384   1.00 57.37  ? 435 LEU B C     1 
ATOM   6865  O  O     . LEU B 1 435 ? 10.729  -14.687 7.113   1.00 59.10  ? 435 LEU B O     1 
ATOM   6866  C  CB    . LEU B 1 435 ? 13.010  -14.020 5.391   1.00 49.16  ? 435 LEU B CB    1 
ATOM   6867  C  CG    . LEU B 1 435 ? 12.675  -14.775 4.107   1.00 51.12  ? 435 LEU B CG    1 
ATOM   6868  C  CD1   . LEU B 1 435 ? 12.360  -13.842 2.917   1.00 43.71  ? 435 LEU B CD1   1 
ATOM   6869  C  CD2   . LEU B 1 435 ? 13.849  -15.682 3.816   1.00 36.51  ? 435 LEU B CD2   1 
ATOM   6870  N  N     . ASN B 1 436 ? 9.634   -13.234 5.828   1.00 55.86  ? 436 ASN B N     1 
ATOM   6871  C  CA    . ASN B 1 436 ? 8.359   -13.768 6.243   1.00 51.98  ? 436 ASN B CA    1 
ATOM   6872  C  C     . ASN B 1 436 ? 8.025   -15.113 5.685   1.00 57.73  ? 436 ASN B C     1 
ATOM   6873  O  O     . ASN B 1 436 ? 8.495   -15.488 4.617   1.00 62.05  ? 436 ASN B O     1 
ATOM   6874  C  CB    . ASN B 1 436 ? 7.212   -12.813 5.874   1.00 56.77  ? 436 ASN B CB    1 
ATOM   6875  C  CG    . ASN B 1 436 ? 7.170   -11.571 6.740   1.00 54.90  ? 436 ASN B CG    1 
ATOM   6876  O  OD1   . ASN B 1 436 ? 7.584   -11.605 7.892   1.00 63.47  ? 436 ASN B OD1   1 
ATOM   6877  N  ND2   . ASN B 1 436 ? 6.628   -10.477 6.199   1.00 45.48  ? 436 ASN B ND2   1 
ATOM   6878  N  N     . VAL B 1 437 ? 7.207   -15.839 6.441   1.00 62.10  ? 437 VAL B N     1 
ATOM   6879  C  CA    . VAL B 1 437 ? 6.780   -17.188 6.086   1.00 54.06  ? 437 VAL B CA    1 
ATOM   6880  C  C     . VAL B 1 437 ? 5.279   -16.967 6.072   1.00 55.89  ? 437 VAL B C     1 
ATOM   6881  O  O     . VAL B 1 437 ? 4.761   -16.105 6.791   1.00 68.82  ? 437 VAL B O     1 
ATOM   6882  C  CB    . VAL B 1 437 ? 7.134   -18.305 7.091   1.00 57.08  ? 437 VAL B CB    1 
ATOM   6883  C  CG1   . VAL B 1 437 ? 8.542   -18.820 6.872   1.00 64.80  ? 437 VAL B CG1   1 
ATOM   6884  C  CG2   . VAL B 1 437 ? 6.914   -17.838 8.547   1.00 64.73  ? 437 VAL B CG2   1 
ATOM   6885  N  N     . PRO B 1 438 ? 4.566   -17.671 5.206   1.00 56.41  ? 438 PRO B N     1 
ATOM   6886  C  CA    . PRO B 1 438 ? 5.036   -18.789 4.389   1.00 65.12  ? 438 PRO B CA    1 
ATOM   6887  C  C     . PRO B 1 438 ? 6.016   -18.365 3.279   1.00 72.41  ? 438 PRO B C     1 
ATOM   6888  O  O     . PRO B 1 438 ? 5.969   -17.250 2.774   1.00 67.83  ? 438 PRO B O     1 
ATOM   6889  C  CB    . PRO B 1 438 ? 3.716   -19.393 3.869   1.00 58.46  ? 438 PRO B CB    1 
ATOM   6890  C  CG    . PRO B 1 438 ? 2.784   -18.289 3.852   1.00 55.15  ? 438 PRO B CG    1 
ATOM   6891  C  CD    . PRO B 1 438 ? 3.125   -17.421 5.027   1.00 55.70  ? 438 PRO B CD    1 
ATOM   6892  N  N     . LEU B 1 439 ? 6.911   -19.274 2.928   1.00 74.73  ? 439 LEU B N     1 
ATOM   6893  C  CA    . LEU B 1 439 ? 7.963   -18.982 1.992   1.00 64.63  ? 439 LEU B CA    1 
ATOM   6894  C  C     . LEU B 1 439 ? 8.115   -20.141 1.037   1.00 69.15  ? 439 LEU B C     1 
ATOM   6895  O  O     . LEU B 1 439 ? 8.387   -21.276 1.467   1.00 76.17  ? 439 LEU B O     1 
ATOM   6896  C  CB    . LEU B 1 439 ? 9.287   -18.727 2.720   1.00 65.92  ? 439 LEU B CB    1 
ATOM   6897  C  CG    . LEU B 1 439 ? 10.484  -18.530 1.794   1.00 59.61  ? 439 LEU B CG    1 
ATOM   6898  C  CD1   . LEU B 1 439 ? 10.302  -17.240 0.995   1.00 55.90  ? 439 LEU B CD1   1 
ATOM   6899  C  CD2   . LEU B 1 439 ? 11.760  -18.475 2.590   1.00 59.65  ? 439 LEU B CD2   1 
ATOM   6900  N  N     . ARG B 1 440 ? 7.947   -19.876 -0.254  1.00 65.72  ? 440 ARG B N     1 
ATOM   6901  C  CA    . ARG B 1 440 ? 8.143   -20.921 -1.257  1.00 75.36  ? 440 ARG B CA    1 
ATOM   6902  C  C     . ARG B 1 440 ? 9.427   -20.711 -2.051  1.00 71.57  ? 440 ARG B C     1 
ATOM   6903  O  O     . ARG B 1 440 ? 9.818   -19.571 -2.312  1.00 62.26  ? 440 ARG B O     1 
ATOM   6904  C  CB    . ARG B 1 440 ? 6.941   -21.037 -2.183  1.00 71.63  ? 440 ARG B CB    1 
ATOM   6905  C  CG    . ARG B 1 440 ? 5.568   -20.997 -1.506  1.00 80.80  ? 440 ARG B CG    1 
ATOM   6906  C  CD    . ARG B 1 440 ? 4.602   -20.879 -2.615  1.00 90.61  ? 440 ARG B CD    1 
ATOM   6907  N  NE    . ARG B 1 440 ? 4.850   -19.594 -3.271  1.00 103.09 ? 440 ARG B NE    1 
ATOM   6908  C  CZ    . ARG B 1 440 ? 4.336   -19.190 -4.426  1.00 117.71 ? 440 ARG B CZ    1 
ATOM   6909  N  NH1   . ARG B 1 440 ? 3.660   -20.041 -5.188  1.00 125.54 ? 440 ARG B NH1   1 
ATOM   6910  N  NH2   . ARG B 1 440 ? 4.637   -17.979 -4.874  1.00 114.86 ? 440 ARG B NH2   1 
ATOM   6911  N  N     . GLU B 1 441 ? 10.026  -21.803 -2.528  1.00 77.39  ? 441 GLU B N     1 
ATOM   6912  C  CA    . GLU B 1 441 ? 11.298  -21.715 -3.253  1.00 79.04  ? 441 GLU B CA    1 
ATOM   6913  C  C     . GLU B 1 441 ? 11.164  -20.858 -4.522  1.00 78.22  ? 441 GLU B C     1 
ATOM   6914  O  O     . GLU B 1 441 ? 12.134  -20.245 -4.946  1.00 61.82  ? 441 GLU B O     1 
ATOM   6915  C  CB    . GLU B 1 441 ? 11.800  -23.111 -3.611  1.00 69.60  ? 441 GLU B CB    1 
ATOM   6916  C  CG    . GLU B 1 441 ? 13.134  -23.154 -4.335  1.00 80.07  ? 441 GLU B CG    1 
ATOM   6917  C  CD    . GLU B 1 441 ? 13.671  -24.579 -4.499  1.00 101.00 ? 441 GLU B CD    1 
ATOM   6918  O  OE1   . GLU B 1 441 ? 14.582  -24.988 -3.753  1.00 104.50 ? 441 GLU B OE1   1 
ATOM   6919  O  OE2   . GLU B 1 441 ? 13.176  -25.304 -5.392  1.00 111.47 ? 441 GLU B OE2   1 
ATOM   6920  N  N     . GLU B 1 442 ? 9.988   -20.838 -5.147  1.00 78.61  ? 442 GLU B N     1 
ATOM   6921  C  CA    . GLU B 1 442 ? 9.762   -20.051 -6.365  1.00 81.53  ? 442 GLU B CA    1 
ATOM   6922  C  C     . GLU B 1 442 ? 9.766   -18.541 -6.150  1.00 76.70  ? 442 GLU B C     1 
ATOM   6923  O  O     . GLU B 1 442 ? 9.881   -17.781 -7.101  1.00 81.17  ? 442 GLU B O     1 
ATOM   6924  C  CB    . GLU B 1 442 ? 8.424   -20.421 -6.964  1.00 94.30  ? 442 GLU B CB    1 
ATOM   6925  C  CG    . GLU B 1 442 ? 8.235   -21.807 -6.888  1.00 109.98 ? 442 GLU B CG    1 
ATOM   6926  C  CD    . GLU B 1 442 ? 6.965   -22.353 -6.379  1.00 123.20 ? 442 GLU B CD    1 
ATOM   6927  O  OE1   . GLU B 1 442 ? 6.825   -22.225 -5.139  1.00 133.71 ? 442 GLU B OE1   1 
ATOM   6928  O  OE2   . GLU B 1 442 ? 6.218   -23.028 -7.145  1.00 122.10 ? 442 GLU B OE2   1 
ATOM   6929  N  N     . GLU B 1 443 ? 9.630   -18.104 -4.902  1.00 76.26  ? 443 GLU B N     1 
ATOM   6930  C  CA    . GLU B 1 443 ? 9.684   -16.664 -4.615  1.00 78.75  ? 443 GLU B CA    1 
ATOM   6931  C  C     . GLU B 1 443 ? 11.115  -16.197 -4.491  1.00 86.81  ? 443 GLU B C     1 
ATOM   6932  O  O     . GLU B 1 443 ? 11.507  -15.580 -3.499  1.00 90.19  ? 443 GLU B O     1 
ATOM   6933  C  CB    . GLU B 1 443 ? 8.903   -16.298 -3.353  1.00 66.92  ? 443 GLU B CB    1 
ATOM   6934  C  CG    . GLU B 1 443 ? 7.435   -16.573 -3.462  1.00 67.81  ? 443 GLU B CG    1 
ATOM   6935  C  CD    . GLU B 1 443 ? 6.737   -16.546 -2.122  1.00 77.11  ? 443 GLU B CD    1 
ATOM   6936  O  OE1   . GLU B 1 443 ? 7.214   -17.141 -1.143  1.00 79.51  ? 443 GLU B OE1   1 
ATOM   6937  O  OE2   . GLU B 1 443 ? 5.704   -15.807 -2.056  1.00 84.63  ? 443 GLU B OE2   1 
ATOM   6938  N  N     . ARG B 1 444 ? 11.852  -16.478 -5.551  1.00 78.91  ? 444 ARG B N     1 
ATOM   6939  C  CA    . ARG B 1 444 ? 13.290  -16.302 -5.582  1.00 76.43  ? 444 ARG B CA    1 
ATOM   6940  C  C     . ARG B 1 444 ? 13.746  -14.864 -5.329  1.00 74.53  ? 444 ARG B C     1 
ATOM   6941  O  O     . ARG B 1 444 ? 14.773  -14.644 -4.705  1.00 83.37  ? 444 ARG B O     1 
ATOM   6942  C  CB    . ARG B 1 444 ? 13.829  -16.779 -6.918  1.00 85.65  ? 444 ARG B CB    1 
ATOM   6943  C  CG    . ARG B 1 444 ? 15.334  -16.712 -7.017  1.00 91.21  ? 444 ARG B CG    1 
ATOM   6944  C  CD    . ARG B 1 444 ? 15.838  -17.189 -8.347  1.00 97.76  ? 444 ARG B CD    1 
ATOM   6945  N  NE    . ARG B 1 444 ? 15.462  -16.118 -9.332  1.00 107.38 ? 444 ARG B NE    1 
ATOM   6946  C  CZ    . ARG B 1 444 ? 16.184  -15.795 -10.405 1.00 110.42 ? 444 ARG B CZ    1 
ATOM   6947  N  NH1   . ARG B 1 444 ? 17.324  -16.429 -10.643 1.00 107.64 ? 444 ARG B NH1   1 
ATOM   6948  N  NH2   . ARG B 1 444 ? 15.778  -14.829 -11.174 1.00 115.49 ? 444 ARG B NH2   1 
ATOM   6949  N  N     . HIS B 1 445 ? 13.016  -13.870 -5.818  1.00 72.51  ? 445 HIS B N     1 
ATOM   6950  C  CA    . HIS B 1 445 ? 13.414  -12.475 -5.677  1.00 57.83  ? 445 HIS B CA    1 
ATOM   6951  C  C     . HIS B 1 445 ? 13.403  -11.987 -4.238  1.00 68.50  ? 445 HIS B C     1 
ATOM   6952  O  O     . HIS B 1 445 ? 14.351  -11.335 -3.765  1.00 67.96  ? 445 HIS B O     1 
ATOM   6953  C  CB    . HIS B 1 445 ? 12.463  -11.592 -6.479  1.00 64.71  ? 445 HIS B CB    1 
ATOM   6954  C  CG    . HIS B 1 445 ? 12.465  -11.893 -7.947  1.00 76.09  ? 445 HIS B CG    1 
ATOM   6955  N  ND1   . HIS B 1 445 ? 11.333  -11.759 -8.728  1.00 68.90  ? 445 HIS B ND1   1 
ATOM   6956  C  CD2   . HIS B 1 445 ? 13.431  -12.388 -8.762  1.00 74.69  ? 445 HIS B CD2   1 
ATOM   6957  C  CE1   . HIS B 1 445 ? 11.611  -12.118 -9.965  1.00 65.05  ? 445 HIS B CE1   1 
ATOM   6958  N  NE2   . HIS B 1 445 ? 12.876  -12.505 -10.014 1.00 66.47  ? 445 HIS B NE2   1 
ATOM   6959  N  N     . ARG B 1 446 ? 12.296  -12.299 -3.558  1.00 75.94  ? 446 ARG B N     1 
ATOM   6960  C  CA    . ARG B 1 446 ? 12.132  -11.966 -2.150  1.00 71.35  ? 446 ARG B CA    1 
ATOM   6961  C  C     . ARG B 1 446 ? 13.225  -12.596 -1.276  1.00 65.35  ? 446 ARG B C     1 
ATOM   6962  O  O     . ARG B 1 446 ? 13.970  -11.896 -0.575  1.00 60.79  ? 446 ARG B O     1 
ATOM   6963  C  CB    . ARG B 1 446 ? 10.744  -12.423 -1.676  1.00 65.25  ? 446 ARG B CB    1 
ATOM   6964  C  CG    . ARG B 1 446 ? 10.403  -12.105 -0.230  1.00 58.27  ? 446 ARG B CG    1 
ATOM   6965  C  CD    . ARG B 1 446 ? 8.884   -12.093 0.048   1.00 56.10  ? 446 ARG B CD    1 
ATOM   6966  N  NE    . ARG B 1 446 ? 8.340   -13.451 0.025   1.00 55.61  ? 446 ARG B NE    1 
ATOM   6967  C  CZ    . ARG B 1 446 ? 8.163   -14.180 1.122   1.00 60.22  ? 446 ARG B CZ    1 
ATOM   6968  N  NH1   . ARG B 1 446 ? 8.549   -13.706 2.296   1.00 79.93  ? 446 ARG B NH1   1 
ATOM   6969  N  NH2   . ARG B 1 446 ? 7.672   -15.400 1.053   1.00 63.92  ? 446 ARG B NH2   1 
ATOM   6970  N  N     . TRP B 1 447 ? 13.403  -13.905 -1.382  1.00 63.17  ? 447 TRP B N     1 
ATOM   6971  C  CA    . TRP B 1 447 ? 14.365  -14.535 -0.488  1.00 56.72  ? 447 TRP B CA    1 
ATOM   6972  C  C     . TRP B 1 447 ? 15.815  -14.259 -0.897  1.00 57.16  ? 447 TRP B C     1 
ATOM   6973  O  O     . TRP B 1 447 ? 16.698  -14.215 -0.019  1.00 59.93  ? 447 TRP B O     1 
ATOM   6974  C  CB    . TRP B 1 447 ? 14.053  -16.027 -0.268  1.00 48.97  ? 447 TRP B CB    1 
ATOM   6975  C  CG    . TRP B 1 447 ? 14.157  -16.980 -1.410  1.00 65.17  ? 447 TRP B CG    1 
ATOM   6976  C  CD1   . TRP B 1 447 ? 13.118  -17.543 -2.101  1.00 79.61  ? 447 TRP B CD1   1 
ATOM   6977  C  CD2   . TRP B 1 447 ? 15.350  -17.559 -1.942  1.00 74.59  ? 447 TRP B CD2   1 
ATOM   6978  N  NE1   . TRP B 1 447 ? 13.597  -18.416 -3.048  1.00 87.28  ? 447 TRP B NE1   1 
ATOM   6979  C  CE2   . TRP B 1 447 ? 14.965  -18.442 -2.970  1.00 76.26  ? 447 TRP B CE2   1 
ATOM   6980  C  CE3   . TRP B 1 447 ? 16.712  -17.404 -1.662  1.00 76.67  ? 447 TRP B CE3   1 
ATOM   6981  C  CZ2   . TRP B 1 447 ? 15.892  -19.158 -3.718  1.00 64.51  ? 447 TRP B CZ2   1 
ATOM   6982  C  CZ3   . TRP B 1 447 ? 17.635  -18.127 -2.412  1.00 60.86  ? 447 TRP B CZ3   1 
ATOM   6983  C  CH2   . TRP B 1 447 ? 17.220  -18.987 -3.417  1.00 52.39  ? 447 TRP B CH2   1 
ATOM   6984  N  N     . GLU B 1 448 ? 16.088  -14.073 -2.190  1.00 57.67  ? 448 GLU B N     1 
ATOM   6985  C  CA    . GLU B 1 448 ? 17.451  -13.669 -2.566  1.00 63.05  ? 448 GLU B CA    1 
ATOM   6986  C  C     . GLU B 1 448 ? 17.764  -12.272 -2.044  1.00 64.83  ? 448 GLU B C     1 
ATOM   6987  O  O     . GLU B 1 448 ? 18.880  -12.024 -1.532  1.00 51.87  ? 448 GLU B O     1 
ATOM   6988  C  CB    . GLU B 1 448 ? 17.694  -13.691 -4.075  1.00 48.34  ? 448 GLU B CB    1 
ATOM   6989  C  CG    . GLU B 1 448 ? 17.863  -15.070 -4.689  1.00 66.07  ? 448 GLU B CG    1 
ATOM   6990  C  CD    . GLU B 1 448 ? 18.260  -14.999 -6.169  1.00 84.39  ? 448 GLU B CD    1 
ATOM   6991  O  OE1   . GLU B 1 448 ? 18.436  -16.067 -6.804  1.00 79.93  ? 448 GLU B OE1   1 
ATOM   6992  O  OE2   . GLU B 1 448 ? 18.392  -13.869 -6.697  1.00 90.01  ? 448 GLU B OE2   1 
ATOM   6993  N  N     . ASN B 1 449 ? 16.781  -11.381 -2.097  1.00 59.28  ? 449 ASN B N     1 
ATOM   6994  C  CA    . ASN B 1 449 ? 16.987  -10.088 -1.472  1.00 53.60  ? 449 ASN B CA    1 
ATOM   6995  C  C     . ASN B 1 449 ? 17.190  -10.156 0.018   1.00 58.78  ? 449 ASN B C     1 
ATOM   6996  O  O     . ASN B 1 449 ? 18.078  -9.452  0.551   1.00 57.89  ? 449 ASN B O     1 
ATOM   6997  C  CB    . ASN B 1 449 ? 15.827  -9.149  -1.779  1.00 50.70  ? 449 ASN B CB    1 
ATOM   6998  C  CG    . ASN B 1 449 ? 16.151  -8.179  -2.869  1.00 58.47  ? 449 ASN B CG    1 
ATOM   6999  O  OD1   . ASN B 1 449 ? 17.245  -8.205  -3.450  1.00 54.65  ? 449 ASN B OD1   1 
ATOM   7000  N  ND2   . ASN B 1 449 ? 15.209  -7.296  -3.151  1.00 69.01  ? 449 ASN B ND2   1 
ATOM   7001  N  N     . ALA B 1 450 ? 16.452  -11.049 0.674   1.00 61.34  ? 450 ALA B N     1 
ATOM   7002  C  CA    . ALA B 1 450 ? 16.680  -11.295 2.095   1.00 64.79  ? 450 ALA B CA    1 
ATOM   7003  C  C     . ALA B 1 450 ? 18.129  -11.734 2.362   1.00 58.87  ? 450 ALA B C     1 
ATOM   7004  O  O     . ALA B 1 450 ? 18.802  -11.209 3.255   1.00 58.09  ? 450 ALA B O     1 
ATOM   7005  C  CB    . ALA B 1 450 ? 15.694  -12.363 2.639   1.00 20.16  ? 450 ALA B CB    1 
ATOM   7006  N  N     . LEU B 1 451 ? 18.596  -12.671 1.535   1.00 51.81  ? 451 LEU B N     1 
ATOM   7007  C  CA    . LEU B 1 451 ? 19.949  -13.207 1.681   1.00 57.92  ? 451 LEU B CA    1 
ATOM   7008  C  C     . LEU B 1 451 ? 21.031  -12.118 1.528   1.00 57.11  ? 451 LEU B C     1 
ATOM   7009  O  O     . LEU B 1 451 ? 22.038  -12.063 2.269   1.00 56.45  ? 451 LEU B O     1 
ATOM   7010  C  CB    . LEU B 1 451 ? 20.154  -14.376 0.717   1.00 60.00  ? 451 LEU B CB    1 
ATOM   7011  C  CG    . LEU B 1 451 ? 20.165  -15.638 1.576   1.00 55.86  ? 451 LEU B CG    1 
ATOM   7012  C  CD1   . LEU B 1 451 ? 18.839  -15.713 2.343   1.00 64.16  ? 451 LEU B CD1   1 
ATOM   7013  C  CD2   . LEU B 1 451 ? 20.368  -16.918 0.778   1.00 55.22  ? 451 LEU B CD2   1 
ATOM   7014  N  N     . LEU B 1 452 ? 20.813  -11.236 0.558   1.00 59.19  ? 452 LEU B N     1 
ATOM   7015  C  CA    . LEU B 1 452 ? 21.730  -10.131 0.332   1.00 52.66  ? 452 LEU B CA    1 
ATOM   7016  C  C     . LEU B 1 452 ? 21.719  -9.199  1.532   1.00 52.70  ? 452 LEU B C     1 
ATOM   7017  O  O     . LEU B 1 452 ? 22.784  -8.680  1.926   1.00 50.20  ? 452 LEU B O     1 
ATOM   7018  C  CB    . LEU B 1 452 ? 21.429  -9.363  -0.961  1.00 60.17  ? 452 LEU B CB    1 
ATOM   7019  C  CG    . LEU B 1 452 ? 21.691  -10.072 -2.284  1.00 55.54  ? 452 LEU B CG    1 
ATOM   7020  C  CD1   . LEU B 1 452 ? 20.917  -9.412  -3.420  1.00 52.85  ? 452 LEU B CD1   1 
ATOM   7021  C  CD2   . LEU B 1 452 ? 23.194  -10.063 -2.580  1.00 35.92  ? 452 LEU B CD2   1 
ATOM   7022  N  N     . GLY B 1 453 ? 20.523  -8.974  2.084   1.00 42.81  ? 453 GLY B N     1 
ATOM   7023  C  CA    . GLY B 1 453 ? 20.376  -8.182  3.303   1.00 41.54  ? 453 GLY B CA    1 
ATOM   7024  C  C     . GLY B 1 453 ? 21.201  -8.775  4.428   1.00 45.16  ? 453 GLY B C     1 
ATOM   7025  O  O     . GLY B 1 453 ? 21.951  -8.063  5.107   1.00 40.04  ? 453 GLY B O     1 
ATOM   7026  N  N     . LEU B 1 454 ? 21.039  -10.077 4.642   1.00 40.65  ? 454 LEU B N     1 
ATOM   7027  C  CA    . LEU B 1 454 ? 21.786  -10.753 5.691   1.00 43.46  ? 454 LEU B CA    1 
ATOM   7028  C  C     . LEU B 1 454 ? 23.272  -10.589 5.563   1.00 52.27  ? 454 LEU B C     1 
ATOM   7029  O  O     . LEU B 1 454 ? 23.977  -10.280 6.542   1.00 60.87  ? 454 LEU B O     1 
ATOM   7030  C  CB    . LEU B 1 454 ? 21.523  -12.258 5.635   1.00 48.25  ? 454 LEU B CB    1 
ATOM   7031  C  CG    . LEU B 1 454 ? 21.741  -13.102 6.880   1.00 48.37  ? 454 LEU B CG    1 
ATOM   7032  C  CD1   . LEU B 1 454 ? 21.000  -12.577 8.077   1.00 53.43  ? 454 LEU B CD1   1 
ATOM   7033  C  CD2   . LEU B 1 454 ? 21.398  -14.555 6.547   1.00 47.15  ? 454 LEU B CD2   1 
ATOM   7034  N  N     . LEU B 1 455 ? 23.744  -10.726 4.327   1.00 45.41  ? 455 LEU B N     1 
ATOM   7035  C  CA    . LEU B 1 455 ? 25.172  -10.627 4.079   1.00 50.31  ? 455 LEU B CA    1 
ATOM   7036  C  C     . LEU B 1 455 ? 25.711  -9.229  4.323   1.00 56.26  ? 455 LEU B C     1 
ATOM   7037  O  O     . LEU B 1 455 ? 26.806  -9.078  4.894   1.00 50.25  ? 455 LEU B O     1 
ATOM   7038  C  CB    . LEU B 1 455 ? 25.458  -11.115 2.660   1.00 53.47  ? 455 LEU B CB    1 
ATOM   7039  C  CG    . LEU B 1 455 ? 25.136  -12.606 2.555   1.00 57.17  ? 455 LEU B CG    1 
ATOM   7040  C  CD1   . LEU B 1 455 ? 25.205  -13.101 1.124   1.00 61.70  ? 455 LEU B CD1   1 
ATOM   7041  C  CD2   . LEU B 1 455 ? 26.120  -13.394 3.436   1.00 59.91  ? 455 LEU B CD2   1 
ATOM   7042  N  N     . ALA B 1 456 ? 24.974  -8.212  3.873   1.00 54.53  ? 456 ALA B N     1 
ATOM   7043  C  CA    . ALA B 1 456 ? 25.399  -6.841  4.129   1.00 47.25  ? 456 ALA B CA    1 
ATOM   7044  C  C     . ALA B 1 456 ? 25.386  -6.526  5.641   1.00 57.03  ? 456 ALA B C     1 
ATOM   7045  O  O     . ALA B 1 456 ? 26.233  -5.761  6.148   1.00 54.79  ? 456 ALA B O     1 
ATOM   7046  C  CB    . ALA B 1 456 ? 24.518  -5.885  3.388   1.00 43.03  ? 456 ALA B CB    1 
ATOM   7047  N  N     . LYS B 1 457 ? 24.412  -7.096  6.352   1.00 62.43  ? 457 LYS B N     1 
ATOM   7048  C  CA    . LYS B 1 457 ? 24.299  -6.912  7.804   1.00 55.94  ? 457 LYS B CA    1 
ATOM   7049  C  C     . LYS B 1 457 ? 25.380  -7.680  8.555   1.00 48.05  ? 457 LYS B C     1 
ATOM   7050  O  O     . LYS B 1 457 ? 25.657  -7.381  9.713   1.00 46.22  ? 457 LYS B O     1 
ATOM   7051  C  CB    . LYS B 1 457 ? 22.923  -7.393  8.271   1.00 58.82  ? 457 LYS B CB    1 
ATOM   7052  C  CG    . LYS B 1 457 ? 21.764  -6.519  7.829   1.00 52.71  ? 457 LYS B CG    1 
ATOM   7053  C  CD    . LYS B 1 457 ? 20.448  -7.243  8.129   1.00 55.00  ? 457 LYS B CD    1 
ATOM   7054  C  CE    . LYS B 1 457 ? 19.240  -6.396  7.831   1.00 36.06  ? 457 LYS B CE    1 
ATOM   7055  N  NZ    . LYS B 1 457 ? 19.700  -5.025  7.760   1.00 47.30  ? 457 LYS B NZ    1 
ATOM   7056  N  N     . ALA B 1 458 ? 26.043  -8.612  7.869   1.00 42.40  ? 458 ALA B N     1 
ATOM   7057  C  CA    . ALA B 1 458 ? 27.109  -9.410  8.497   1.00 47.33  ? 458 ALA B CA    1 
ATOM   7058  C  C     . ALA B 1 458 ? 28.443  -8.793  8.258   1.00 51.23  ? 458 ALA B C     1 
ATOM   7059  O  O     . ALA B 1 458 ? 29.458  -9.314  8.708   1.00 69.74  ? 458 ALA B O     1 
ATOM   7060  C  CB    . ALA B 1 458 ? 27.113  -10.851 8.008   1.00 55.72  ? 458 ALA B CB    1 
ATOM   7061  N  N     . GLY B 1 459 ? 28.457  -7.739  7.461   1.00 42.29  ? 459 GLY B N     1 
ATOM   7062  C  CA    . GLY B 1 459 ? 29.690  -7.019  7.193   1.00 37.46  ? 459 GLY B CA    1 
ATOM   7063  C  C     . GLY B 1 459 ? 30.405  -7.427  5.918   1.00 46.86  ? 459 GLY B C     1 
ATOM   7064  O  O     . GLY B 1 459 ? 31.564  -7.059  5.736   1.00 46.94  ? 459 GLY B O     1 
ATOM   7065  N  N     . LEU B 1 460 ? 29.723  -8.199  5.063   1.00 43.02  ? 460 LEU B N     1 
ATOM   7066  C  CA    . LEU B 1 460 ? 30.257  -8.671  3.776   1.00 50.32  ? 460 LEU B CA    1 
ATOM   7067  C  C     . LEU B 1 460 ? 30.159  -7.590  2.688   1.00 53.08  ? 460 LEU B C     1 
ATOM   7068  O  O     . LEU B 1 460 ? 29.165  -6.864  2.640   1.00 67.24  ? 460 LEU B O     1 
ATOM   7069  C  CB    . LEU B 1 460 ? 29.508  -9.896  3.293   1.00 52.66  ? 460 LEU B CB    1 
ATOM   7070  C  CG    . LEU B 1 460 ? 30.165  -11.222 3.586   1.00 57.62  ? 460 LEU B CG    1 
ATOM   7071  C  CD1   . LEU B 1 460 ? 29.575  -11.677 4.892   1.00 65.73  ? 460 LEU B CD1   1 
ATOM   7072  C  CD2   . LEU B 1 460 ? 29.823  -12.191 2.513   1.00 71.82  ? 460 LEU B CD2   1 
ATOM   7073  N  N     . GLN B 1 461 ? 31.207  -7.423  1.891   1.00 41.02  ? 461 GLN B N     1 
ATOM   7074  C  CA    . GLN B 1 461 ? 31.186  -6.566  0.688   1.00 43.86  ? 461 GLN B CA    1 
ATOM   7075  C  C     . GLN B 1 461 ? 30.712  -7.420  -0.511  1.00 49.09  ? 461 GLN B C     1 
ATOM   7076  O  O     . GLN B 1 461 ? 31.463  -8.230  -1.076  1.00 46.20  ? 461 GLN B O     1 
ATOM   7077  C  CB    . GLN B 1 461 ? 32.536  -5.963  0.410   1.00 51.92  ? 461 GLN B CB    1 
ATOM   7078  C  CG    . GLN B 1 461 ? 32.731  -4.486  0.737   1.00 73.60  ? 461 GLN B CG    1 
ATOM   7079  C  CD    . GLN B 1 461 ? 31.842  -3.438  0.031   1.00 86.62  ? 461 GLN B CD    1 
ATOM   7080  O  OE1   . GLN B 1 461 ? 30.820  -2.982  0.548   1.00 97.24  ? 461 GLN B OE1   1 
ATOM   7081  N  NE2   . GLN B 1 461 ? 32.225  -3.100  -1.186  1.00 89.08  ? 461 GLN B NE2   1 
ATOM   7082  N  N     . VAL B 1 462 ? 29.460  -7.236  -0.889  1.00 48.92  ? 462 VAL B N     1 
ATOM   7083  C  CA    . VAL B 1 462 ? 28.905  -8.090  -1.895  1.00 67.27  ? 462 VAL B CA    1 
ATOM   7084  C  C     . VAL B 1 462 ? 29.339  -7.665  -3.297  1.00 69.99  ? 462 VAL B C     1 
ATOM   7085  O  O     . VAL B 1 462 ? 29.837  -8.486  -4.076  1.00 73.25  ? 462 VAL B O     1 
ATOM   7086  C  CB    . VAL B 1 462 ? 27.329  -8.017  -1.825  1.00 61.12  ? 462 VAL B CB    1 
ATOM   7087  C  CG1   . VAL B 1 462 ? 26.676  -8.646  -3.051  1.00 51.24  ? 462 VAL B CG1   1 
ATOM   7088  C  CG2   . VAL B 1 462 ? 26.773  -8.495  -0.458  1.00 62.07  ? 462 VAL B CG2   1 
ATOM   7089  N  N     . VAL B 1 463 ? 29.209  -6.379  -3.594  1.00 61.10  ? 463 VAL B N     1 
ATOM   7090  C  CA    . VAL B 1 463 ? 29.685  -5.808  -4.848  1.00 56.76  ? 463 VAL B CA    1 
ATOM   7091  C  C     . VAL B 1 463 ? 30.529  -4.557  -4.677  1.00 59.64  ? 463 VAL B C     1 
ATOM   7092  O  O     . VAL B 1 463 ? 30.485  -3.938  -3.618  1.00 59.63  ? 463 VAL B O     1 
ATOM   7093  C  CB    . VAL B 1 463 ? 28.504  -5.523  -5.820  1.00 53.08  ? 463 VAL B CB    1 
ATOM   7094  C  CG1   . VAL B 1 463 ? 27.878  -6.816  -6.293  1.00 47.69  ? 463 VAL B CG1   1 
ATOM   7095  C  CG2   . VAL B 1 463 ? 27.439  -4.692  -5.175  1.00 60.70  ? 463 VAL B CG2   1 
ATOM   7096  N  N     . ALA B 1 464 ? 31.360  -4.242  -5.673  1.00 61.40  ? 464 ALA B N     1 
ATOM   7097  C  CA    . ALA B 1 464 ? 32.071  -2.958  -5.676  1.00 56.56  ? 464 ALA B CA    1 
ATOM   7098  C  C     . ALA B 1 464 ? 32.157  -2.376  -7.090  1.00 48.71  ? 464 ALA B C     1 
ATOM   7099  O  O     . ALA B 1 464 ? 31.871  -3.071  -8.057  1.00 54.64  ? 464 ALA B O     1 
ATOM   7100  C  CB    . ALA B 1 464 ? 33.462  -3.143  -5.112  1.00 45.47  ? 464 ALA B CB    1 
ATOM   7101  N  N     . LEU B 1 465 ? 32.497  -1.096  -7.240  1.00 57.03  ? 465 LEU B N     1 
ATOM   7102  C  CA    . LEU B 1 465 ? 32.553  -0.613  -8.607  1.00 55.22  ? 465 LEU B CA    1 
ATOM   7103  C  C     . LEU B 1 465 ? 33.948  -0.768  -9.205  1.00 61.46  ? 465 LEU B C     1 
ATOM   7104  O  O     . LEU B 1 465 ? 34.951  -0.741  -8.500  1.00 53.04  ? 465 LEU B O     1 
ATOM   7105  C  CB    . LEU B 1 465 ? 32.166  0.866   -8.655  1.00 45.66  ? 465 LEU B CB    1 
ATOM   7106  C  CG    . LEU B 1 465 ? 30.768  1.237   -8.175  1.00 46.23  ? 465 LEU B CG    1 
ATOM   7107  C  CD1   . LEU B 1 465 ? 30.614  2.771   -8.134  1.00 54.14  ? 465 LEU B CD1   1 
ATOM   7108  C  CD2   . LEU B 1 465 ? 29.665  0.516   -8.936  1.00 41.70  ? 465 LEU B CD2   1 
ATOM   7109  N  N     . SER B 1 466 ? 34.032  -0.871  -10.516 1.00 67.32  ? 466 SER B N     1 
ATOM   7110  C  CA    . SER B 1 466 ? 35.314  -0.851  -11.159 1.00 66.34  ? 466 SER B CA    1 
ATOM   7111  C  C     . SER B 1 466 ? 35.395  0.483   -11.914 1.00 61.49  ? 466 SER B C     1 
ATOM   7112  O  O     . SER B 1 466 ? 34.434  0.853   -12.635 1.00 57.25  ? 466 SER B O     1 
ATOM   7113  C  CB    . SER B 1 466 ? 35.519  -2.076  -12.031 1.00 66.94  ? 466 SER B CB    1 
ATOM   7114  O  OG    . SER B 1 466 ? 36.697  -1.934  -12.788 1.00 62.90  ? 466 SER B OG    1 
ATOM   7115  N  N     . GLY B 1 467 ? 36.512  1.188   -11.817 1.00 56.81  ? 467 GLY B N     1 
ATOM   7116  C  CA    . GLY B 1 467 ? 36.609  2.420   -12.569 1.00 71.10  ? 467 GLY B CA    1 
ATOM   7117  C  C     . GLY B 1 467 ? 37.320  3.489   -11.807 1.00 76.10  ? 467 GLY B C     1 
ATOM   7118  O  O     . GLY B 1 467 ? 37.684  3.255   -10.656 1.00 86.87  ? 467 GLY B O     1 
ATOM   7119  N  N     . ALA B 1 468 ? 37.645  4.611   -12.447 1.00 76.18  ? 468 ALA B N     1 
ATOM   7120  C  CA    . ALA B 1 468 ? 38.377  5.560   -11.650 1.00 74.33  ? 468 ALA B CA    1 
ATOM   7121  C  C     . ALA B 1 468 ? 37.450  6.726   -11.338 1.00 79.23  ? 468 ALA B C     1 
ATOM   7122  O  O     . ALA B 1 468 ? 36.708  7.220   -12.214 1.00 78.84  ? 468 ALA B O     1 
ATOM   7123  C  CB    . ALA B 1 468 ? 39.593  6.034   -12.432 1.00 67.19  ? 468 ALA B CB    1 
ATOM   7124  N  N     . TYR B 1 469 ? 37.614  7.279   -10.141 1.00 81.13  ? 469 TYR B N     1 
ATOM   7125  C  CA    . TYR B 1 469 ? 36.747  8.369   -9.775  1.00 76.22  ? 469 TYR B CA    1 
ATOM   7126  C  C     . TYR B 1 469 ? 37.610  9.419   -9.119  1.00 68.10  ? 469 TYR B C     1 
ATOM   7127  O  O     . TYR B 1 469 ? 38.651  9.072   -8.558  1.00 69.67  ? 469 TYR B O     1 
ATOM   7128  C  CB    . TYR B 1 469 ? 35.624  7.874   -8.888  1.00 68.19  ? 469 TYR B CB    1 
ATOM   7129  C  CG    . TYR B 1 469 ? 34.858  6.764   -9.560  1.00 58.51  ? 469 TYR B CG    1 
ATOM   7130  C  CD1   . TYR B 1 469 ? 33.903  7.034   -10.533 1.00 56.65  ? 469 TYR B CD1   1 
ATOM   7131  C  CD2   . TYR B 1 469 ? 35.038  5.438   -9.157  1.00 52.72  ? 469 TYR B CD2   1 
ATOM   7132  C  CE1   . TYR B 1 469 ? 33.191  6.004   -11.143 1.00 54.87  ? 469 TYR B CE1   1 
ATOM   7133  C  CE2   . TYR B 1 469 ? 34.304  4.402   -9.738  1.00 50.01  ? 469 TYR B CE2   1 
ATOM   7134  C  CZ    . TYR B 1 469 ? 33.384  4.698   -10.723 1.00 53.25  ? 469 TYR B CZ    1 
ATOM   7135  O  OH    . TYR B 1 469 ? 32.666  3.694   -11.312 1.00 62.26  ? 469 TYR B OH    1 
ATOM   7136  N  N     . PRO B 1 470 ? 37.216  10.698  -9.218  1.00 60.53  ? 470 PRO B N     1 
ATOM   7137  C  CA    . PRO B 1 470 ? 37.951  11.800  -8.583  1.00 64.78  ? 470 PRO B CA    1 
ATOM   7138  C  C     . PRO B 1 470 ? 38.243  11.519  -7.082  1.00 76.89  ? 470 PRO B C     1 
ATOM   7139  O  O     . PRO B 1 470 ? 39.369  11.660  -6.601  1.00 78.99  ? 470 PRO B O     1 
ATOM   7140  C  CB    . PRO B 1 470 ? 36.966  12.954  -8.643  1.00 61.78  ? 470 PRO B CB    1 
ATOM   7141  C  CG    . PRO B 1 470 ? 36.175  12.723  -9.771  1.00 69.42  ? 470 PRO B CG    1 
ATOM   7142  C  CD    . PRO B 1 470 ? 36.017  11.199  -9.907  1.00 60.91  ? 470 PRO B CD    1 
ATOM   7143  N  N     . ALA B 1 471 ? 37.166  11.183  -6.348  1.00 60.17  ? 471 ALA B N     1 
ATOM   7144  C  CA    . ALA B 1 471 ? 37.232  10.925  -4.906  1.00 57.10  ? 471 ALA B CA    1 
ATOM   7145  C  C     . ALA B 1 471 ? 37.240  9.452   -4.479  1.00 56.61  ? 471 ALA B C     1 
ATOM   7146  O  O     . ALA B 1 471 ? 36.388  8.684   -4.913  1.00 64.48  ? 471 ALA B O     1 
ATOM   7147  C  CB    . ALA B 1 471 ? 36.091  11.641  -4.235  1.00 58.28  ? 471 ALA B CB    1 
ATOM   7148  N  N     . GLU B 1 472 ? 38.183  9.075   -3.619  1.00 53.21  ? 472 GLU B N     1 
ATOM   7149  C  CA    . GLU B 1 472 ? 38.281  7.702   -3.086  1.00 50.97  ? 472 GLU B CA    1 
ATOM   7150  C  C     . GLU B 1 472 ? 37.473  7.479   -1.825  1.00 51.29  ? 472 GLU B C     1 
ATOM   7151  O  O     . GLU B 1 472 ? 37.545  6.400   -1.227  1.00 44.06  ? 472 GLU B O     1 
ATOM   7152  C  CB    . GLU B 1 472 ? 39.724  7.241   -2.865  1.00 42.31  ? 472 GLU B CB    1 
ATOM   7153  C  CG    . GLU B 1 472 ? 40.673  8.285   -2.420  1.00 49.70  ? 472 GLU B CG    1 
ATOM   7154  C  CD    . GLU B 1 472 ? 42.128  7.816   -2.577  1.00 62.34  ? 472 GLU B CD    1 
ATOM   7155  O  OE1   . GLU B 1 472 ? 43.042  8.502   -2.070  1.00 75.86  ? 472 GLU B OE1   1 
ATOM   7156  O  OE2   . GLU B 1 472 ? 42.338  6.651   -3.009  1.00 52.20  ? 472 GLU B OE2   1 
ATOM   7157  N  N     . LEU B 1 473 ? 36.784  8.524   -1.376  1.00 43.88  ? 473 LEU B N     1 
ATOM   7158  C  CA    . LEU B 1 473 ? 35.938  8.398   -0.216  1.00 36.22  ? 473 LEU B CA    1 
ATOM   7159  C  C     . LEU B 1 473 ? 34.688  9.219   -0.547  1.00 50.68  ? 473 LEU B C     1 
ATOM   7160  O  O     . LEU B 1 473 ? 34.780  10.408  -0.893  1.00 66.94  ? 473 LEU B O     1 
ATOM   7161  C  CB    . LEU B 1 473 ? 36.641  8.940   1.034   1.00 35.77  ? 473 LEU B CB    1 
ATOM   7162  C  CG    . LEU B 1 473 ? 35.798  9.067   2.333   1.00 50.74  ? 473 LEU B CG    1 
ATOM   7163  C  CD1   . LEU B 1 473 ? 35.286  7.717   2.757   1.00 60.63  ? 473 LEU B CD1   1 
ATOM   7164  C  CD2   . LEU B 1 473 ? 36.493  9.763   3.495   1.00 45.78  ? 473 LEU B CD2   1 
ATOM   7165  N  N     . ALA B 1 474 ? 33.513  8.617   -0.398  1.00 29.44  ? 474 ALA B N     1 
ATOM   7166  C  CA    . ALA B 1 474 ? 32.291  9.366   -0.660  1.00 33.08  ? 474 ALA B CA    1 
ATOM   7167  C  C     . ALA B 1 474 ? 31.470  9.328   0.559   1.00 44.21  ? 474 ALA B C     1 
ATOM   7168  O  O     . ALA B 1 474 ? 31.229  8.229   1.077   1.00 53.00  ? 474 ALA B O     1 
ATOM   7169  C  CB    . ALA B 1 474 ? 31.526  8.806   -1.820  1.00 40.91  ? 474 ALA B CB    1 
ATOM   7170  N  N     . VAL B 1 475 ? 30.955  10.480  0.993   1.00 37.85  ? 475 VAL B N     1 
ATOM   7171  C  CA    . VAL B 1 475 ? 30.138  10.442  2.186   1.00 45.23  ? 475 VAL B CA    1 
ATOM   7172  C  C     . VAL B 1 475 ? 28.818  11.181  2.023   1.00 51.41  ? 475 VAL B C     1 
ATOM   7173  O  O     . VAL B 1 475 ? 28.746  12.251  1.412   1.00 57.62  ? 475 VAL B O     1 
ATOM   7174  C  CB    . VAL B 1 475 ? 30.917  11.139  3.365   1.00 37.94  ? 475 VAL B CB    1 
ATOM   7175  C  CG1   . VAL B 1 475 ? 30.135  11.076  4.672   1.00 35.84  ? 475 VAL B CG1   1 
ATOM   7176  C  CG2   . VAL B 1 475 ? 32.297  10.553  3.544   1.00 38.83  ? 475 VAL B CG2   1 
ATOM   7177  N  N     . GLY B 1 476 ? 27.774  10.576  2.584   1.00 37.96  ? 476 GLY B N     1 
ATOM   7178  C  CA    . GLY B 1 476 ? 26.428  11.104  2.503   1.00 36.97  ? 476 GLY B CA    1 
ATOM   7179  C  C     . GLY B 1 476 ? 25.932  11.480  3.904   1.00 42.87  ? 476 GLY B C     1 
ATOM   7180  O  O     . GLY B 1 476 ? 26.206  10.776  4.886   1.00 45.04  ? 476 GLY B O     1 
ATOM   7181  N  N     . PHE B 1 477 ? 25.177  12.571  3.972   1.00 33.72  ? 477 PHE B N     1 
ATOM   7182  C  CA    . PHE B 1 477 ? 24.659  13.178  5.199   1.00 46.68  ? 477 PHE B CA    1 
ATOM   7183  C  C     . PHE B 1 477 ? 23.164  13.306  5.093   1.00 45.00  ? 477 PHE B C     1 
ATOM   7184  O  O     . PHE B 1 477 ? 22.696  13.800  4.075   1.00 55.95  ? 477 PHE B O     1 
ATOM   7185  C  CB    . PHE B 1 477 ? 25.280  14.572  5.433   1.00 48.79  ? 477 PHE B CB    1 
ATOM   7186  C  CG    . PHE B 1 477 ? 26.745  14.538  5.684   1.00 47.16  ? 477 PHE B CG    1 
ATOM   7187  C  CD1   . PHE B 1 477 ? 27.639  14.548  4.617   1.00 48.12  ? 477 PHE B CD1   1 
ATOM   7188  C  CD2   . PHE B 1 477 ? 27.244  14.572  6.975   1.00 38.34  ? 477 PHE B CD2   1 
ATOM   7189  C  CE1   . PHE B 1 477 ? 29.019  14.503  4.824   1.00 31.63  ? 477 PHE B CE1   1 
ATOM   7190  C  CE2   . PHE B 1 477 ? 28.619  14.547  7.198   1.00 35.72  ? 477 PHE B CE2   1 
ATOM   7191  C  CZ    . PHE B 1 477 ? 29.508  14.512  6.115   1.00 35.22  ? 477 PHE B CZ    1 
ATOM   7192  N  N     . ASP B 1 478 ? 22.412  12.886  6.108   1.00 43.27  ? 478 ASP B N     1 
ATOM   7193  C  CA    . ASP B 1 478 ? 20.960  13.095  6.074   1.00 41.08  ? 478 ASP B CA    1 
ATOM   7194  C  C     . ASP B 1 478 ? 20.488  13.335  7.498   1.00 49.46  ? 478 ASP B C     1 
ATOM   7195  O  O     . ASP B 1 478 ? 21.273  13.180  8.469   1.00 29.07  ? 478 ASP B O     1 
ATOM   7196  C  CB    . ASP B 1 478 ? 20.216  11.895  5.443   1.00 28.80  ? 478 ASP B CB    1 
ATOM   7197  C  CG    . ASP B 1 478 ? 18.742  12.225  5.068   1.00 74.54  ? 478 ASP B CG    1 
ATOM   7198  O  OD1   . ASP B 1 478 ? 18.430  13.426  4.907   1.00 77.82  ? 478 ASP B OD1   1 
ATOM   7199  O  OD2   . ASP B 1 478 ? 17.904  11.306  4.863   1.00 71.47  ? 478 ASP B OD2   1 
ATOM   7200  N  N     . ALA B 1 479 ? 19.221  13.744  7.612   1.00 46.58  ? 479 ALA B N     1 
ATOM   7201  C  CA    . ALA B 1 479 ? 18.588  13.889  8.911   1.00 52.11  ? 479 ALA B CA    1 
ATOM   7202  C  C     . ALA B 1 479 ? 17.256  13.118  8.885   1.00 63.75  ? 479 ALA B C     1 
ATOM   7203  O  O     . ALA B 1 479 ? 16.481  13.213  7.944   1.00 72.49  ? 479 ALA B O     1 
ATOM   7204  C  CB    . ALA B 1 479 ? 18.378  15.368  9.241   1.00 49.52  ? 479 ALA B CB    1 
ATOM   7205  N  N     . GLY B 1 480 ? 16.974  12.411  9.971   1.00 58.87  ? 480 GLY B N     1 
ATOM   7206  C  CA    . GLY B 1 480 ? 15.790  11.578  10.085  1.00 58.64  ? 480 GLY B CA    1 
ATOM   7207  C  C     . GLY B 1 480 ? 15.055  11.644  11.399  1.00 64.22  ? 480 GLY B C     1 
ATOM   7208  O  O     . GLY B 1 480 ? 15.519  12.279  12.361  1.00 72.14  ? 480 GLY B O     1 
ATOM   7209  N  N     . GLY B 1 481 ? 13.880  11.031  11.434  1.00 64.06  ? 481 GLY B N     1 
ATOM   7210  C  CA    . GLY B 1 481 ? 13.070  11.096  12.631  1.00 71.34  ? 481 GLY B CA    1 
ATOM   7211  C  C     . GLY B 1 481 ? 11.874  11.962  12.298  1.00 85.26  ? 481 GLY B C     1 
ATOM   7212  O  O     . GLY B 1 481 ? 11.971  12.897  11.491  1.00 89.41  ? 481 GLY B O     1 
ATOM   7213  N  N     . ARG B 1 482 ? 10.724  11.642  12.869  1.00 87.68  ? 482 ARG B N     1 
ATOM   7214  C  CA    . ARG B 1 482 ? 9.518   12.349  12.491  1.00 83.70  ? 482 ARG B CA    1 
ATOM   7215  C  C     . ARG B 1 482 ? 9.025   13.182  13.677  1.00 91.62  ? 482 ARG B C     1 
ATOM   7216  O  O     . ARG B 1 482 ? 8.027   13.906  13.597  1.00 79.87  ? 482 ARG B O     1 
ATOM   7217  C  CB    . ARG B 1 482 ? 8.448   11.340  12.003  1.00 76.87  ? 482 ARG B CB    1 
ATOM   7218  N  N     . GLU B 1 483 ? 9.712   13.025  14.797  1.00 93.67  ? 483 GLU B N     1 
ATOM   7219  C  CA    . GLU B 1 483 ? 9.337   13.756  15.988  1.00 96.26  ? 483 GLU B CA    1 
ATOM   7220  C  C     . GLU B 1 483 ? 9.835   15.193  16.048  1.00 82.40  ? 483 GLU B C     1 
ATOM   7221  O  O     . GLU B 1 483 ? 10.203  15.811  15.045  1.00 92.92  ? 483 GLU B O     1 
ATOM   7222  C  CB    . GLU B 1 483 ? 9.789   13.041  17.262  1.00 105.68 ? 483 GLU B CB    1 
ATOM   7223  C  CG    . GLU B 1 483 ? 9.213   11.676  17.430  1.00 111.30 ? 483 GLU B CG    1 
ATOM   7224  C  CD    . GLU B 1 483 ? 9.561   11.096  18.764  1.00 114.03 ? 483 GLU B CD    1 
ATOM   7225  O  OE1   . GLU B 1 483 ? 9.463   11.832  19.782  1.00 115.66 ? 483 GLU B OE1   1 
ATOM   7226  O  OE2   . GLU B 1 483 ? 10.035  9.940   18.794  1.00 113.32 ? 483 GLU B OE2   1 
ATOM   7227  N  N     . SER B 1 484 ? 9.810   15.737  17.255  1.00 71.13  ? 484 SER B N     1 
ATOM   7228  C  CA    . SER B 1 484 ? 10.216  17.085  17.440  1.00 67.35  ? 484 SER B CA    1 
ATOM   7229  C  C     . SER B 1 484 ? 11.729  17.241  17.485  1.00 72.09  ? 484 SER B C     1 
ATOM   7230  O  O     . SER B 1 484 ? 12.235  18.346  17.694  1.00 72.94  ? 484 SER B O     1 
ATOM   7231  C  CB    . SER B 1 484 ? 9.608   17.549  18.747  1.00 88.95  ? 484 SER B CB    1 
ATOM   7232  O  OG    . SER B 1 484 ? 10.273  16.923  19.826  1.00 108.71 ? 484 SER B OG    1 
ATOM   7233  N  N     . PHE B 1 485 ? 12.455  16.177  17.144  1.00 71.98  ? 485 PHE B N     1 
ATOM   7234  C  CA    . PHE B 1 485 ? 13.914  16.222  17.097  1.00 67.37  ? 485 PHE B CA    1 
ATOM   7235  C  C     . PHE B 1 485 ? 14.355  15.242  16.029  1.00 67.24  ? 485 PHE B C     1 
ATOM   7236  O  O     . PHE B 1 485 ? 13.640  14.294  15.729  1.00 74.84  ? 485 PHE B O     1 
ATOM   7237  C  CB    . PHE B 1 485 ? 14.600  15.842  18.406  1.00 68.83  ? 485 PHE B CB    1 
ATOM   7238  C  CG    . PHE B 1 485 ? 14.343  14.432  18.857  1.00 58.03  ? 485 PHE B CG    1 
ATOM   7239  C  CD1   . PHE B 1 485 ? 13.265  14.114  19.649  1.00 47.12  ? 485 PHE B CD1   1 
ATOM   7240  C  CD2   . PHE B 1 485 ? 15.219  13.424  18.494  1.00 60.79  ? 485 PHE B CD2   1 
ATOM   7241  C  CE1   . PHE B 1 485 ? 13.061  12.833  20.071  1.00 35.58  ? 485 PHE B CE1   1 
ATOM   7242  C  CE2   . PHE B 1 485 ? 15.007  12.129  18.902  1.00 54.97  ? 485 PHE B CE2   1 
ATOM   7243  C  CZ    . PHE B 1 485 ? 13.926  11.835  19.699  1.00 41.31  ? 485 PHE B CZ    1 
ATOM   7244  N  N     . ARG B 1 486 ? 15.475  15.518  15.388  1.00 60.29  ? 486 ARG B N     1 
ATOM   7245  C  CA    . ARG B 1 486 ? 15.985  14.626  14.366  1.00 60.79  ? 486 ARG B CA    1 
ATOM   7246  C  C     . ARG B 1 486 ? 17.292  14.009  14.821  1.00 58.48  ? 486 ARG B C     1 
ATOM   7247  O  O     . ARG B 1 486 ? 17.858  14.389  15.869  1.00 41.95  ? 486 ARG B O     1 
ATOM   7248  C  CB    . ARG B 1 486 ? 16.194  15.353  13.026  1.00 66.34  ? 486 ARG B CB    1 
ATOM   7249  C  CG    . ARG B 1 486 ? 15.102  16.338  12.712  1.00 75.41  ? 486 ARG B CG    1 
ATOM   7250  C  CD    . ARG B 1 486 ? 13.783  15.704  12.273  1.00 87.98  ? 486 ARG B CD    1 
ATOM   7251  N  NE    . ARG B 1 486 ? 13.001  16.663  11.497  1.00 95.03  ? 486 ARG B NE    1 
ATOM   7252  C  CZ    . ARG B 1 486 ? 13.272  17.059  10.257  1.00 98.23  ? 486 ARG B CZ    1 
ATOM   7253  N  NH1   . ARG B 1 486 ? 14.319  16.575  9.610   1.00 95.79  ? 486 ARG B NH1   1 
ATOM   7254  N  NH2   . ARG B 1 486 ? 12.483  17.943  9.657   1.00 103.20 ? 486 ARG B NH2   1 
ATOM   7255  N  N     . PHE B 1 487 ? 17.753  13.076  13.987  1.00 50.61  ? 487 PHE B N     1 
ATOM   7256  C  CA    . PHE B 1 487 ? 19.090  12.501  14.016  1.00 43.63  ? 487 PHE B CA    1 
ATOM   7257  C  C     . PHE B 1 487 ? 19.801  12.862  12.734  1.00 46.19  ? 487 PHE B C     1 
ATOM   7258  O  O     . PHE B 1 487 ? 19.300  12.620  11.639  1.00 57.63  ? 487 PHE B O     1 
ATOM   7259  C  CB    . PHE B 1 487 ? 19.071  10.989  14.199  1.00 43.16  ? 487 PHE B CB    1 
ATOM   7260  C  CG    . PHE B 1 487 ? 18.705  10.562  15.564  1.00 50.28  ? 487 PHE B CG    1 
ATOM   7261  C  CD1   . PHE B 1 487 ? 19.655  10.609  16.575  1.00 61.93  ? 487 PHE B CD1   1 
ATOM   7262  C  CD2   . PHE B 1 487 ? 17.422  10.126  15.859  1.00 46.18  ? 487 PHE B CD2   1 
ATOM   7263  C  CE1   . PHE B 1 487 ? 19.340  10.223  17.883  1.00 63.14  ? 487 PHE B CE1   1 
ATOM   7264  C  CE2   . PHE B 1 487 ? 17.100  9.741   17.150  1.00 57.14  ? 487 PHE B CE2   1 
ATOM   7265  C  CZ    . PHE B 1 487 ? 18.064  9.781   18.172  1.00 50.89  ? 487 PHE B CZ    1 
ATOM   7266  N  N     . GLY B 1 488 ? 20.962  13.482  12.890  1.00 45.26  ? 488 GLY B N     1 
ATOM   7267  C  CA    . GLY B 1 488 ? 21.835  13.787  11.787  1.00 42.22  ? 488 GLY B CA    1 
ATOM   7268  C  C     . GLY B 1 488 ? 22.844  12.667  11.716  1.00 55.76  ? 488 GLY B C     1 
ATOM   7269  O  O     . GLY B 1 488 ? 23.343  12.230  12.775  1.00 55.06  ? 488 GLY B O     1 
ATOM   7270  N  N     . GLY B 1 489 ? 23.039  12.121  10.501  1.00 48.04  ? 489 GLY B N     1 
ATOM   7271  C  CA    . GLY B 1 489 ? 23.873  10.944  10.325  1.00 38.39  ? 489 GLY B CA    1 
ATOM   7272  C  C     . GLY B 1 489 ? 24.590  10.877  8.983   1.00 39.03  ? 489 GLY B C     1 
ATOM   7273  O  O     . GLY B 1 489 ? 24.307  11.598  8.011   1.00 42.28  ? 489 GLY B O     1 
ATOM   7274  N  N     . ALA B 1 490 ? 25.557  9.980   8.935   1.00 40.20  ? 490 ALA B N     1 
ATOM   7275  C  CA    . ALA B 1 490 ? 26.401  9.865   7.776   1.00 42.11  ? 490 ALA B CA    1 
ATOM   7276  C  C     . ALA B 1 490 ? 26.660  8.433   7.439   1.00 45.98  ? 490 ALA B C     1 
ATOM   7277  O  O     . ALA B 1 490 ? 26.733  7.600   8.358   1.00 47.66  ? 490 ALA B O     1 
ATOM   7278  C  CB    . ALA B 1 490 ? 27.718  10.594  7.996   1.00 42.00  ? 490 ALA B CB    1 
ATOM   7279  N  N     . ALA B 1 491 ? 26.829  8.151   6.142   1.00 38.80  ? 491 ALA B N     1 
ATOM   7280  C  CA    . ALA B 1 491 ? 27.245  6.826   5.727   1.00 44.44  ? 491 ALA B CA    1 
ATOM   7281  C  C     . ALA B 1 491 ? 28.303  7.035   4.663   1.00 47.29  ? 491 ALA B C     1 
ATOM   7282  O  O     . ALA B 1 491 ? 28.383  8.099   4.040   1.00 46.80  ? 491 ALA B O     1 
ATOM   7283  C  CB    . ALA B 1 491 ? 26.053  5.973   5.217   1.00 24.06  ? 491 ALA B CB    1 
ATOM   7284  N  N     . CYS B 1 492 ? 29.190  6.066   4.515   1.00 45.19  ? 492 CYS B N     1 
ATOM   7285  C  CA    . CYS B 1 492 ? 30.274  6.294   3.591   1.00 45.10  ? 492 CYS B CA    1 
ATOM   7286  C  C     . CYS B 1 492 ? 30.605  5.053   2.771   1.00 49.21  ? 492 CYS B C     1 
ATOM   7287  O  O     . CYS B 1 492 ? 30.313  3.901   3.154   1.00 36.70  ? 492 CYS B O     1 
ATOM   7288  C  CB    . CYS B 1 492 ? 31.521  6.819   4.335   1.00 40.78  ? 492 CYS B CB    1 
ATOM   7289  S  SG    . CYS B 1 492 ? 32.365  5.686   5.449   1.00 60.03  ? 492 CYS B SG    1 
ATOM   7290  N  N     . ALA B 1 493 ? 31.195  5.340   1.616   1.00 46.14  ? 493 ALA B N     1 
ATOM   7291  C  CA    . ALA B 1 493 ? 31.812  4.358   0.757   1.00 39.62  ? 493 ALA B CA    1 
ATOM   7292  C  C     . ALA B 1 493 ? 33.322  4.619   0.730   1.00 46.25  ? 493 ALA B C     1 
ATOM   7293  O  O     . ALA B 1 493 ? 33.773  5.742   0.400   1.00 53.10  ? 493 ALA B O     1 
ATOM   7294  C  CB    . ALA B 1 493 ? 31.239  4.419   -0.590  1.00 22.76  ? 493 ALA B CB    1 
ATOM   7295  N  N     . VAL B 1 494 ? 34.094  3.592   1.090   1.00 33.26  ? 494 VAL B N     1 
ATOM   7296  C  CA    . VAL B 1 494 ? 35.518  3.746   1.264   1.00 36.47  ? 494 VAL B CA    1 
ATOM   7297  C  C     . VAL B 1 494 ? 36.154  3.067   0.022   1.00 60.06  ? 494 VAL B C     1 
ATOM   7298  O  O     . VAL B 1 494 ? 35.772  1.957   -0.384  1.00 57.12  ? 494 VAL B O     1 
ATOM   7299  C  CB    . VAL B 1 494 ? 35.974  3.182   2.595   1.00 37.28  ? 494 VAL B CB    1 
ATOM   7300  C  CG1   . VAL B 1 494 ? 37.486  3.385   2.797   1.00 51.31  ? 494 VAL B CG1   1 
ATOM   7301  C  CG2   . VAL B 1 494 ? 35.209  3.851   3.695   1.00 40.54  ? 494 VAL B CG2   1 
ATOM   7302  N  N     . GLY B 1 495 ? 37.321  3.598   -0.291  1.00 54.08  ? 495 GLY B N     1 
ATOM   7303  C  CA    . GLY B 1 495 ? 38.256  3.290   -1.363  1.00 75.06  ? 495 GLY B CA    1 
ATOM   7304  C  C     . GLY B 1 495 ? 37.594  3.791   -2.662  1.00 72.34  ? 495 GLY B C     1 
ATOM   7305  O  O     . GLY B 1 495 ? 36.387  4.079   -2.685  1.00 52.56  ? 495 GLY B O     1 
ATOM   7306  N  N     . GLY B 1 496 ? 38.330  3.734   -3.775  1.00 79.63  ? 496 GLY B N     1 
ATOM   7307  C  CA    . GLY B 1 496 ? 37.809  4.066   -5.101  1.00 86.41  ? 496 GLY B CA    1 
ATOM   7308  C  C     . GLY B 1 496 ? 36.698  3.253   -5.713  1.00 92.52  ? 496 GLY B C     1 
ATOM   7309  O  O     . GLY B 1 496 ? 35.911  3.734   -6.531  1.00 92.50  ? 496 GLY B O     1 
ATOM   7310  N  N     . ASP B 1 497 ? 36.662  2.005   -5.294  1.00 88.61  ? 497 ASP B N     1 
ATOM   7311  C  CA    . ASP B 1 497 ? 35.775  0.974   -5.777  1.00 80.98  ? 497 ASP B CA    1 
ATOM   7312  C  C     . ASP B 1 497 ? 34.489  0.951   -4.965  1.00 80.47  ? 497 ASP B C     1 
ATOM   7313  O  O     . ASP B 1 497 ? 33.532  0.264   -5.302  1.00 81.47  ? 497 ASP B O     1 
ATOM   7314  C  CB    . ASP B 1 497 ? 36.467  -0.376  -5.749  1.00 84.11  ? 497 ASP B CB    1 
ATOM   7315  C  CG    . ASP B 1 497 ? 37.184  -0.645  -4.437  1.00 92.89  ? 497 ASP B CG    1 
ATOM   7316  O  OD1   . ASP B 1 497 ? 37.289  0.272   -3.597  1.00 107.72 ? 497 ASP B OD1   1 
ATOM   7317  O  OD2   . ASP B 1 497 ? 37.628  -1.794  -4.226  1.00 88.66  ? 497 ASP B OD2   1 
ATOM   7318  N  N     . GLY B 1 498 ? 34.511  1.697   -3.869  1.00 84.57  ? 498 GLY B N     1 
ATOM   7319  C  CA    . GLY B 1 498 ? 33.533  1.662   -2.803  1.00 78.51  ? 498 GLY B CA    1 
ATOM   7320  C  C     . GLY B 1 498 ? 33.640  0.333   -2.100  1.00 78.18  ? 498 GLY B C     1 
ATOM   7321  O  O     . GLY B 1 498 ? 32.662  -0.319  -1.710  1.00 68.13  ? 498 GLY B O     1 
ATOM   7322  N  N     . GLY B 1 499 ? 34.906  -0.065  -1.968  1.00 87.76  ? 499 GLY B N     1 
ATOM   7323  C  CA    . GLY B 1 499 ? 35.279  -1.366  -1.476  1.00 89.20  ? 499 GLY B CA    1 
ATOM   7324  C  C     . GLY B 1 499 ? 34.750  -1.589  -0.066  1.00 83.83  ? 499 GLY B C     1 
ATOM   7325  O  O     . GLY B 1 499 ? 34.819  -2.709  0.405   1.00 88.16  ? 499 GLY B O     1 
ATOM   7326  N  N     . HIS B 1 500 ? 34.274  -0.541  0.626   1.00 71.47  ? 500 HIS B N     1 
ATOM   7327  C  CA    . HIS B 1 500 ? 33.681  -0.749  1.952   1.00 58.75  ? 500 HIS B CA    1 
ATOM   7328  C  C     . HIS B 1 500 ? 32.519  0.197   2.189   1.00 58.23  ? 500 HIS B C     1 
ATOM   7329  O  O     . HIS B 1 500 ? 32.602  1.368   1.865   1.00 61.86  ? 500 HIS B O     1 
ATOM   7330  C  CB    . HIS B 1 500 ? 34.691  -0.546  3.090   1.00 67.19  ? 500 HIS B CB    1 
ATOM   7331  C  CG    . HIS B 1 500 ? 35.912  -1.388  3.005   1.00 79.41  ? 500 HIS B CG    1 
ATOM   7332  N  ND1   . HIS B 1 500 ? 37.163  -0.961  3.320   1.00 91.17  ? 500 HIS B ND1   1 
ATOM   7333  C  CD2   . HIS B 1 500 ? 36.069  -2.658  2.627   1.00 89.13  ? 500 HIS B CD2   1 
ATOM   7334  C  CE1   . HIS B 1 500 ? 38.034  -1.942  3.151   1.00 95.19  ? 500 HIS B CE1   1 
ATOM   7335  N  NE2   . HIS B 1 500 ? 37.392  -2.988  2.719   1.00 96.51  ? 500 HIS B NE2   1 
ATOM   7336  N  N     . LEU B 1 501 ? 31.476  -0.310  2.836   1.00 49.31  ? 501 LEU B N     1 
ATOM   7337  C  CA    . LEU B 1 501 ? 30.350  0.512   3.160   1.00 40.55  ? 501 LEU B CA    1 
ATOM   7338  C  C     . LEU B 1 501 ? 30.186  0.524   4.664   1.00 43.36  ? 501 LEU B C     1 
ATOM   7339  O  O     . LEU B 1 501 ? 29.966  -0.534  5.274   1.00 56.17  ? 501 LEU B O     1 
ATOM   7340  C  CB    . LEU B 1 501 ? 29.093  -0.005  2.480   1.00 48.58  ? 501 LEU B CB    1 
ATOM   7341  C  CG    . LEU B 1 501 ? 29.127  0.077   0.948   1.00 47.71  ? 501 LEU B CG    1 
ATOM   7342  C  CD1   . LEU B 1 501 ? 27.959  -0.719  0.326   1.00 54.87  ? 501 LEU B CD1   1 
ATOM   7343  C  CD2   . LEU B 1 501 ? 29.301  1.477   0.400   1.00 35.84  ? 501 LEU B CD2   1 
ATOM   7344  N  N     . LEU B 1 502 ? 30.171  1.719   5.237   1.00 39.97  ? 502 LEU B N     1 
ATOM   7345  C  CA    . LEU B 1 502 ? 30.127  1.983   6.697   1.00 37.19  ? 502 LEU B CA    1 
ATOM   7346  C  C     . LEU B 1 502 ? 29.061  2.958   7.082   1.00 52.98  ? 502 LEU B C     1 
ATOM   7347  O  O     . LEU B 1 502 ? 28.612  3.784   6.256   1.00 64.83  ? 502 LEU B O     1 
ATOM   7348  C  CB    . LEU B 1 502 ? 31.496  2.531   7.107   1.00 49.72  ? 502 LEU B CB    1 
ATOM   7349  C  CG    . LEU B 1 502 ? 32.634  1.678   6.622   1.00 58.67  ? 502 LEU B CG    1 
ATOM   7350  C  CD1   . LEU B 1 502 ? 33.908  2.277   6.823   1.00 68.95  ? 502 LEU B CD1   1 
ATOM   7351  C  CD2   . LEU B 1 502 ? 32.645  0.840   7.949   1.00 76.07  ? 502 LEU B CD2   1 
ATOM   7352  N  N     . TRP B 1 503 ? 28.710  2.924   8.364   1.00 49.03  ? 503 TRP B N     1 
ATOM   7353  C  CA    . TRP B 1 503 ? 27.816  3.951   8.938   1.00 33.49  ? 503 TRP B CA    1 
ATOM   7354  C  C     . TRP B 1 503 ? 28.526  4.568   10.151  1.00 31.13  ? 503 TRP B C     1 
ATOM   7355  O  O     . TRP B 1 503 ? 29.530  3.985   10.631  1.00 27.12  ? 503 TRP B O     1 
ATOM   7356  C  CB    . TRP B 1 503 ? 26.480  3.326   9.358   1.00 20.57  ? 503 TRP B CB    1 
ATOM   7357  C  CG    . TRP B 1 503 ? 26.634  2.139   10.358  1.00 51.49  ? 503 TRP B CG    1 
ATOM   7358  C  CD1   . TRP B 1 503 ? 26.856  0.826   10.041  1.00 51.81  ? 503 TRP B CD1   1 
ATOM   7359  C  CD2   . TRP B 1 503 ? 26.507  2.180   11.792  1.00 54.39  ? 503 TRP B CD2   1 
ATOM   7360  N  NE1   . TRP B 1 503 ? 26.897  0.057   11.175  1.00 53.83  ? 503 TRP B NE1   1 
ATOM   7361  C  CE2   . TRP B 1 503 ? 26.692  0.857   12.268  1.00 59.76  ? 503 TRP B CE2   1 
ATOM   7362  C  CE3   . TRP B 1 503 ? 26.265  3.203   12.721  1.00 49.82  ? 503 TRP B CE3   1 
ATOM   7363  C  CZ2   . TRP B 1 503 ? 26.649  0.525   13.640  1.00 50.52  ? 503 TRP B CZ2   1 
ATOM   7364  C  CZ3   . TRP B 1 503 ? 26.227  2.871   14.085  1.00 51.76  ? 503 TRP B CZ3   1 
ATOM   7365  C  CH2   . TRP B 1 503 ? 26.420  1.537   14.521  1.00 50.62  ? 503 TRP B CH2   1 
ATOM   7366  N  N     . THR B 1 504 ? 28.001  5.681   10.691  1.00 30.10  ? 504 THR B N     1 
ATOM   7367  C  CA    . THR B 1 504 ? 28.617  6.098   11.913  1.00 42.67  ? 504 THR B CA    1 
ATOM   7368  C  C     . THR B 1 504 ? 27.402  6.481   12.803  1.00 55.80  ? 504 THR B C     1 
ATOM   7369  O  O     . THR B 1 504 ? 26.261  6.714   12.306  1.00 57.65  ? 504 THR B O     1 
ATOM   7370  C  CB    . THR B 1 504 ? 29.492  7.356   11.722  1.00 63.46  ? 504 THR B CB    1 
ATOM   7371  O  OG1   . THR B 1 504 ? 29.062  8.156   10.594  1.00 74.81  ? 504 THR B OG1   1 
ATOM   7372  C  CG2   . THR B 1 504 ? 30.895  6.907   11.423  1.00 75.41  ? 504 THR B CG2   1 
ATOM   7373  N  N     . LEU B 1 505 ? 27.661  6.570   14.113  1.00 40.44  ? 505 LEU B N     1 
ATOM   7374  C  CA    . LEU B 1 505 ? 26.640  6.851   15.104  1.00 48.72  ? 505 LEU B CA    1 
ATOM   7375  C  C     . LEU B 1 505 ? 26.048  8.227   14.808  1.00 48.67  ? 505 LEU B C     1 
ATOM   7376  O  O     . LEU B 1 505 ? 26.759  9.252   14.745  1.00 51.97  ? 505 LEU B O     1 
ATOM   7377  C  CB    . LEU B 1 505 ? 27.261  6.784   16.489  1.00 57.51  ? 505 LEU B CB    1 
ATOM   7378  C  CG    . LEU B 1 505 ? 26.278  6.565   17.618  1.00 49.08  ? 505 LEU B CG    1 
ATOM   7379  C  CD1   . LEU B 1 505 ? 25.498  5.281   17.364  1.00 49.40  ? 505 LEU B CD1   1 
ATOM   7380  C  CD2   . LEU B 1 505 ? 27.049  6.496   18.898  1.00 47.76  ? 505 LEU B CD2   1 
ATOM   7381  N  N     . PRO B 1 506 ? 24.727  8.277   14.719  1.00 45.19  ? 506 PRO B N     1 
ATOM   7382  C  CA    . PRO B 1 506 ? 24.059  9.561   14.554  1.00 36.32  ? 506 PRO B CA    1 
ATOM   7383  C  C     . PRO B 1 506 ? 24.079  10.437  15.791  1.00 45.78  ? 506 PRO B C     1 
ATOM   7384  O  O     . PRO B 1 506 ? 24.541  10.027  16.844  1.00 69.27  ? 506 PRO B O     1 
ATOM   7385  C  CB    . PRO B 1 506 ? 22.650  9.155   14.174  1.00 31.18  ? 506 PRO B CB    1 
ATOM   7386  C  CG    . PRO B 1 506 ? 22.784  7.793   13.565  1.00 42.39  ? 506 PRO B CG    1 
ATOM   7387  C  CD    . PRO B 1 506 ? 23.844  7.142   14.411  1.00 48.94  ? 506 PRO B CD    1 
ATOM   7388  N  N     . GLU B 1 507 ? 23.629  11.669  15.620  1.00 31.34  ? 507 GLU B N     1 
ATOM   7389  C  CA    . GLU B 1 507 ? 23.515  12.620  16.707  1.00 38.92  ? 507 GLU B CA    1 
ATOM   7390  C  C     . GLU B 1 507 ? 22.137  13.253  16.762  1.00 46.31  ? 507 GLU B C     1 
ATOM   7391  O  O     . GLU B 1 507 ? 21.528  13.559  15.726  1.00 46.37  ? 507 GLU B O     1 
ATOM   7392  C  CB    . GLU B 1 507 ? 24.558  13.718  16.573  1.00 49.38  ? 507 GLU B CB    1 
ATOM   7393  C  CG    . GLU B 1 507 ? 24.593  14.677  17.748  1.00 56.56  ? 507 GLU B CG    1 
ATOM   7394  C  CD    . GLU B 1 507 ? 24.856  13.976  19.058  1.00 66.45  ? 507 GLU B CD    1 
ATOM   7395  O  OE1   . GLU B 1 507 ? 26.022  13.588  19.297  1.00 63.89  ? 507 GLU B OE1   1 
ATOM   7396  O  OE2   . GLU B 1 507 ? 23.904  13.848  19.860  1.00 72.62  ? 507 GLU B OE2   1 
ATOM   7397  N  N     . ALA B 1 508 ? 21.643  13.470  17.974  1.00 41.56  ? 508 ALA B N     1 
ATOM   7398  C  CA    . ALA B 1 508 ? 20.356  14.120  18.148  1.00 42.24  ? 508 ALA B CA    1 
ATOM   7399  C  C     . ALA B 1 508 ? 20.482  15.619  17.906  1.00 36.55  ? 508 ALA B C     1 
ATOM   7400  O  O     . ALA B 1 508 ? 21.484  16.214  18.279  1.00 46.54  ? 508 ALA B O     1 
ATOM   7401  C  CB    . ALA B 1 508 ? 19.810  13.842  19.505  1.00 44.14  ? 508 ALA B CB    1 
ATOM   7402  N  N     . GLN B 1 509 ? 19.595  16.179  17.096  1.00 42.68  ? 509 GLN B N     1 
ATOM   7403  C  CA    . GLN B 1 509 ? 19.612  17.616  16.818  1.00 45.66  ? 509 GLN B CA    1 
ATOM   7404  C  C     . GLN B 1 509 ? 18.183  18.194  16.824  1.00 49.28  ? 509 GLN B C     1 
ATOM   7405  O  O     . GLN B 1 509 ? 17.219  17.454  16.635  1.00 49.41  ? 509 GLN B O     1 
ATOM   7406  C  CB    . GLN B 1 509 ? 20.293  17.856  15.461  1.00 47.67  ? 509 GLN B CB    1 
ATOM   7407  C  CG    . GLN B 1 509 ? 19.642  17.114  14.279  1.00 47.13  ? 509 GLN B CG    1 
ATOM   7408  C  CD    . GLN B 1 509 ? 20.519  17.129  13.019  1.00 51.26  ? 509 GLN B CD    1 
ATOM   7409  O  OE1   . GLN B 1 509 ? 21.719  16.866  13.078  1.00 66.73  ? 509 GLN B OE1   1 
ATOM   7410  N  NE2   . GLN B 1 509 ? 19.933  17.493  11.896  1.00 40.55  ? 509 GLN B NE2   1 
ATOM   7411  N  N     . ALA B 1 510 ? 18.058  19.521  16.901  1.00 49.64  ? 510 ALA B N     1 
ATOM   7412  C  CA    . ALA B 1 510 ? 16.741  20.187  17.024  1.00 36.94  ? 510 ALA B CA    1 
ATOM   7413  C  C     . ALA B 1 510 ? 15.925  20.061  15.767  1.00 47.81  ? 510 ALA B C     1 
ATOM   7414  O  O     . ALA B 1 510 ? 14.721  19.870  15.820  1.00 53.16  ? 510 ALA B O     1 
ATOM   7415  C  CB    . ALA B 1 510 ? 16.891  21.631  17.405  1.00 33.25  ? 510 ALA B CB    1 
ATOM   7416  N  N     . GLY B 1 511 ? 16.586  20.227  14.622  1.00 60.52  ? 511 GLY B N     1 
ATOM   7417  C  CA    . GLY B 1 511 ? 15.857  20.217  13.378  1.00 65.67  ? 511 GLY B CA    1 
ATOM   7418  C  C     . GLY B 1 511 ? 16.581  19.675  12.159  1.00 62.84  ? 511 GLY B C     1 
ATOM   7419  O  O     . GLY B 1 511 ? 17.316  18.687  12.259  1.00 62.21  ? 511 GLY B O     1 
ATOM   7420  N  N     . GLU B 1 512 ? 16.461  20.343  11.016  1.00 62.73  ? 512 GLU B N     1 
ATOM   7421  C  CA    . GLU B 1 512 ? 17.036  19.730  9.835   1.00 60.15  ? 512 GLU B CA    1 
ATOM   7422  C  C     . GLU B 1 512 ? 18.497  20.074  9.739   1.00 53.68  ? 512 GLU B C     1 
ATOM   7423  O  O     . GLU B 1 512 ? 19.306  19.264  9.304   1.00 54.72  ? 512 GLU B O     1 
ATOM   7424  C  CB    . GLU B 1 512 ? 16.292  20.131  8.570   1.00 62.95  ? 512 GLU B CB    1 
ATOM   7425  C  CG    . GLU B 1 512 ? 16.971  19.731  7.233   1.00 52.34  ? 512 GLU B CG    1 
ATOM   7426  C  CD    . GLU B 1 512 ? 16.974  18.192  7.021   1.00 91.30  ? 512 GLU B CD    1 
ATOM   7427  O  OE1   . GLU B 1 512 ? 16.023  17.487  7.458   1.00 95.03  ? 512 GLU B OE1   1 
ATOM   7428  O  OE2   . GLU B 1 512 ? 17.857  17.685  6.305   1.00 80.11  ? 512 GLU B OE2   1 
ATOM   7429  N  N     . ARG B 1 513 ? 18.851  21.289  10.123  1.00 53.28  ? 513 ARG B N     1 
ATOM   7430  C  CA    . ARG B 1 513 ? 20.262  21.617  10.152  1.00 42.06  ? 513 ARG B CA    1 
ATOM   7431  C  C     . ARG B 1 513 ? 21.083  20.734  11.105  1.00 44.87  ? 513 ARG B C     1 
ATOM   7432  O  O     . ARG B 1 513 ? 20.828  20.615  12.291  1.00 58.69  ? 513 ARG B O     1 
ATOM   7433  C  CB    . ARG B 1 513 ? 20.413  23.109  10.449  1.00 40.38  ? 513 ARG B CB    1 
ATOM   7434  C  CG    . ARG B 1 513 ? 21.827  23.527  10.591  1.00 54.41  ? 513 ARG B CG    1 
ATOM   7435  C  CD    . ARG B 1 513 ? 21.974  24.977  10.926  1.00 62.74  ? 513 ARG B CD    1 
ATOM   7436  N  NE    . ARG B 1 513 ? 22.691  25.405  9.757   1.00 71.97  ? 513 ARG B NE    1 
ATOM   7437  C  CZ    . ARG B 1 513 ? 22.888  26.630  9.335   1.00 65.05  ? 513 ARG B CZ    1 
ATOM   7438  N  NH1   . ARG B 1 513 ? 22.378  27.651  9.966   1.00 84.16  ? 513 ARG B NH1   1 
ATOM   7439  N  NH2   . ARG B 1 513 ? 23.580  26.811  8.225   1.00 50.39  ? 513 ARG B NH2   1 
ATOM   7440  N  N     . ILE B 1 514 ? 22.163  20.223  10.545  1.00 45.93  ? 514 ILE B N     1 
ATOM   7441  C  CA    . ILE B 1 514 ? 23.185  19.529  11.289  1.00 48.67  ? 514 ILE B CA    1 
ATOM   7442  C  C     . ILE B 1 514 ? 24.213  20.540  11.741  1.00 52.38  ? 514 ILE B C     1 
ATOM   7443  O  O     . ILE B 1 514 ? 24.693  21.374  10.964  1.00 48.83  ? 514 ILE B O     1 
ATOM   7444  C  CB    . ILE B 1 514 ? 23.883  18.480  10.412  1.00 51.18  ? 514 ILE B CB    1 
ATOM   7445  C  CG1   . ILE B 1 514 ? 22.846  17.652  9.641   1.00 61.37  ? 514 ILE B CG1   1 
ATOM   7446  C  CG2   . ILE B 1 514 ? 24.791  17.600  11.254  1.00 48.95  ? 514 ILE B CG2   1 
ATOM   7447  C  CD1   . ILE B 1 514 ? 23.446  16.598  8.733   1.00 45.60  ? 514 ILE B CD1   1 
ATOM   7448  N  N     . PRO B 1 515 ? 24.503  20.521  13.035  1.00 47.64  ? 515 PRO B N     1 
ATOM   7449  C  CA    . PRO B 1 515 ? 25.477  21.478  13.582  1.00 37.55  ? 515 PRO B CA    1 
ATOM   7450  C  C     . PRO B 1 515 ? 26.864  21.304  12.946  1.00 45.21  ? 515 PRO B C     1 
ATOM   7451  O  O     . PRO B 1 515 ? 27.238  20.174  12.592  1.00 50.44  ? 515 PRO B O     1 
ATOM   7452  C  CB    . PRO B 1 515 ? 25.491  21.145  15.068  1.00 28.28  ? 515 PRO B CB    1 
ATOM   7453  C  CG    . PRO B 1 515 ? 24.141  20.497  15.320  1.00 37.05  ? 515 PRO B CG    1 
ATOM   7454  C  CD    . PRO B 1 515 ? 23.848  19.701  14.071  1.00 36.05  ? 515 PRO B CD    1 
ATOM   7455  N  N     . GLN B 1 516 ? 27.590  22.408  12.765  1.00 39.40  ? 516 GLN B N     1 
ATOM   7456  C  CA    . GLN B 1 516 ? 28.887  22.409  12.064  1.00 39.66  ? 516 GLN B CA    1 
ATOM   7457  C  C     . GLN B 1 516 ? 29.860  21.373  12.658  1.00 47.92  ? 516 GLN B C     1 
ATOM   7458  O  O     . GLN B 1 516 ? 30.505  20.597  11.933  1.00 54.03  ? 516 GLN B O     1 
ATOM   7459  C  CB    . GLN B 1 516 ? 29.502  23.801  12.147  1.00 48.71  ? 516 GLN B CB    1 
ATOM   7460  C  CG    . GLN B 1 516 ? 28.629  24.891  11.566  1.00 57.66  ? 516 GLN B CG    1 
ATOM   7461  C  CD    . GLN B 1 516 ? 29.413  26.073  11.084  1.00 60.90  ? 516 GLN B CD    1 
ATOM   7462  O  OE1   . GLN B 1 516 ? 30.556  25.951  10.648  1.00 78.02  ? 516 GLN B OE1   1 
ATOM   7463  N  NE2   . GLN B 1 516 ? 28.796  27.234  11.146  1.00 60.95  ? 516 GLN B NE2   1 
ATOM   7464  N  N     . GLU B 1 517 ? 29.898  21.328  13.989  1.00 48.54  ? 517 GLU B N     1 
ATOM   7465  C  CA    . GLU B 1 517 ? 30.798  20.409  14.698  1.00 49.05  ? 517 GLU B CA    1 
ATOM   7466  C  C     . GLU B 1 517 ? 30.382  18.958  14.510  1.00 43.97  ? 517 GLU B C     1 
ATOM   7467  O  O     . GLU B 1 517 ? 31.219  18.075  14.433  1.00 40.40  ? 517 GLU B O     1 
ATOM   7468  C  CB    . GLU B 1 517 ? 30.845  20.740  16.199  1.00 63.08  ? 517 GLU B CB    1 
ATOM   7469  C  CG    . GLU B 1 517 ? 30.494  22.169  16.547  1.00 84.94  ? 517 GLU B CG    1 
ATOM   7470  C  CD    . GLU B 1 517 ? 29.011  22.442  16.667  1.00 92.61  ? 517 GLU B CD    1 
ATOM   7471  O  OE1   . GLU B 1 517 ? 28.325  21.673  17.390  1.00 100.99 ? 517 GLU B OE1   1 
ATOM   7472  O  OE2   . GLU B 1 517 ? 28.545  23.418  16.027  1.00 81.77  ? 517 GLU B OE2   1 
ATOM   7473  N  N     . VAL B 1 518 ? 29.081  18.730  14.427  1.00 46.41  ? 518 VAL B N     1 
ATOM   7474  C  CA    . VAL B 1 518 ? 28.610  17.385  14.208  1.00 45.03  ? 518 VAL B CA    1 
ATOM   7475  C  C     . VAL B 1 518 ? 28.991  16.905  12.799  1.00 46.84  ? 518 VAL B C     1 
ATOM   7476  O  O     . VAL B 1 518 ? 29.532  15.808  12.634  1.00 36.51  ? 518 VAL B O     1 
ATOM   7477  C  CB    . VAL B 1 518 ? 27.074  17.326  14.419  1.00 36.22  ? 518 VAL B CB    1 
ATOM   7478  C  CG1   . VAL B 1 518 ? 26.538  15.944  14.059  1.00 54.41  ? 518 VAL B CG1   1 
ATOM   7479  C  CG2   . VAL B 1 518 ? 26.772  17.617  15.825  1.00 44.90  ? 518 VAL B CG2   1 
ATOM   7480  N  N     . VAL B 1 519 ? 28.757  17.760  11.802  1.00 45.76  ? 519 VAL B N     1 
ATOM   7481  C  CA    . VAL B 1 519 ? 29.124  17.457  10.427  1.00 39.89  ? 519 VAL B CA    1 
ATOM   7482  C  C     . VAL B 1 519 ? 30.601  17.074  10.385  1.00 30.63  ? 519 VAL B C     1 
ATOM   7483  O  O     . VAL B 1 519 ? 30.975  16.010  9.876   1.00 40.69  ? 519 VAL B O     1 
ATOM   7484  C  CB    . VAL B 1 519 ? 28.880  18.649  9.490   1.00 48.74  ? 519 VAL B CB    1 
ATOM   7485  C  CG1   . VAL B 1 519 ? 29.513  18.393  8.112   1.00 52.31  ? 519 VAL B CG1   1 
ATOM   7486  C  CG2   . VAL B 1 519 ? 27.407  18.869  9.315   1.00 47.53  ? 519 VAL B CG2   1 
ATOM   7487  N  N     . TRP B 1 520 ? 31.437  17.923  10.962  1.00 29.76  ? 520 TRP B N     1 
ATOM   7488  C  CA    . TRP B 1 520 ? 32.863  17.621  11.000  1.00 35.81  ? 520 TRP B CA    1 
ATOM   7489  C  C     . TRP B 1 520 ? 33.177  16.280  11.710  1.00 39.61  ? 520 TRP B C     1 
ATOM   7490  O  O     . TRP B 1 520 ? 34.055  15.539  11.263  1.00 41.79  ? 520 TRP B O     1 
ATOM   7491  C  CB    . TRP B 1 520 ? 33.677  18.744  11.657  1.00 45.84  ? 520 TRP B CB    1 
ATOM   7492  C  CG    . TRP B 1 520 ? 35.057  18.280  11.861  1.00 53.99  ? 520 TRP B CG    1 
ATOM   7493  C  CD1   . TRP B 1 520 ? 35.716  18.197  13.025  1.00 59.71  ? 520 TRP B CD1   1 
ATOM   7494  C  CD2   . TRP B 1 520 ? 35.940  17.762  10.856  1.00 62.01  ? 520 TRP B CD2   1 
ATOM   7495  N  NE1   . TRP B 1 520 ? 36.966  17.663  12.828  1.00 65.11  ? 520 TRP B NE1   1 
ATOM   7496  C  CE2   . TRP B 1 520 ? 37.129  17.397  11.499  1.00 60.54  ? 520 TRP B CE2   1 
ATOM   7497  C  CE3   . TRP B 1 520 ? 35.839  17.574  9.477   1.00 61.08  ? 520 TRP B CE3   1 
ATOM   7498  C  CZ2   . TRP B 1 520 ? 38.206  16.860  10.820  1.00 55.24  ? 520 TRP B CZ2   1 
ATOM   7499  C  CZ3   . TRP B 1 520 ? 36.915  17.041  8.808   1.00 58.13  ? 520 TRP B CZ3   1 
ATOM   7500  C  CH2   . TRP B 1 520 ? 38.082  16.699  9.475   1.00 50.37  ? 520 TRP B CH2   1 
ATOM   7501  N  N     . ASP B 1 521 ? 32.578  16.040  12.875  1.00 33.14  ? 521 ASP B N     1 
ATOM   7502  C  CA    . ASP B 1 521 ? 32.851  14.821  13.636  1.00 41.34  ? 521 ASP B CA    1 
ATOM   7503  C  C     . ASP B 1 521 ? 32.505  13.554  12.867  1.00 42.24  ? 521 ASP B C     1 
ATOM   7504  O  O     . ASP B 1 521 ? 33.286  12.580  12.811  1.00 52.22  ? 521 ASP B O     1 
ATOM   7505  C  CB    . ASP B 1 521 ? 32.114  14.855  14.988  1.00 53.84  ? 521 ASP B CB    1 
ATOM   7506  C  CG    . ASP B 1 521 ? 32.761  15.823  15.974  1.00 64.81  ? 521 ASP B CG    1 
ATOM   7507  O  OD1   . ASP B 1 521 ? 33.903  16.277  15.700  1.00 63.35  ? 521 ASP B OD1   1 
ATOM   7508  O  OD2   . ASP B 1 521 ? 32.125  16.144  17.007  1.00 78.59  ? 521 ASP B OD2   1 
ATOM   7509  N  N     . LEU B 1 522 ? 31.351  13.596  12.218  1.00 36.64  ? 522 LEU B N     1 
ATOM   7510  C  CA    . LEU B 1 522 ? 30.915  12.467  11.435  1.00 38.44  ? 522 LEU B CA    1 
ATOM   7511  C  C     . LEU B 1 522 ? 31.895  12.216  10.316  1.00 52.54  ? 522 LEU B C     1 
ATOM   7512  O  O     . LEU B 1 522 ? 32.418  11.076  10.106  1.00 52.93  ? 522 LEU B O     1 
ATOM   7513  C  CB    . LEU B 1 522 ? 29.512  12.747  10.890  1.00 26.90  ? 522 LEU B CB    1 
ATOM   7514  C  CG    . LEU B 1 522 ? 28.437  12.961  11.956  1.00 37.29  ? 522 LEU B CG    1 
ATOM   7515  C  CD1   . LEU B 1 522 ? 27.176  13.442  11.305  1.00 56.77  ? 522 LEU B CD1   1 
ATOM   7516  C  CD2   . LEU B 1 522 ? 28.152  11.673  12.678  1.00 35.32  ? 522 LEU B CD2   1 
ATOM   7517  N  N     . LEU B 1 523 ? 32.238  13.321  9.671   1.00 43.53  ? 523 LEU B N     1 
ATOM   7518  C  CA    . LEU B 1 523 ? 33.186  13.284  8.595   1.00 36.82  ? 523 LEU B CA    1 
ATOM   7519  C  C     . LEU B 1 523 ? 34.528  12.700  9.063   1.00 50.70  ? 523 LEU B C     1 
ATOM   7520  O  O     . LEU B 1 523 ? 35.116  11.833  8.387   1.00 55.26  ? 523 LEU B O     1 
ATOM   7521  C  CB    . LEU B 1 523 ? 33.371  14.692  8.068   1.00 36.93  ? 523 LEU B CB    1 
ATOM   7522  C  CG    . LEU B 1 523 ? 34.288  14.839  6.870   1.00 43.94  ? 523 LEU B CG    1 
ATOM   7523  C  CD1   . LEU B 1 523 ? 33.931  13.773  5.824   1.00 42.11  ? 523 LEU B CD1   1 
ATOM   7524  C  CD2   . LEU B 1 523 ? 34.162  16.239  6.329   1.00 47.89  ? 523 LEU B CD2   1 
ATOM   7525  N  N     . GLU B 1 524 ? 35.000  13.160  10.228  1.00 41.59  ? 524 GLU B N     1 
ATOM   7526  C  CA    . GLU B 1 524 ? 36.265  12.678  10.751  1.00 52.30  ? 524 GLU B CA    1 
ATOM   7527  C  C     . GLU B 1 524 ? 36.207  11.159  10.998  1.00 49.23  ? 524 GLU B C     1 
ATOM   7528  O  O     . GLU B 1 524 ? 37.171  10.462  10.725  1.00 39.02  ? 524 GLU B O     1 
ATOM   7529  C  CB    . GLU B 1 524 ? 36.645  13.391  12.038  1.00 65.99  ? 524 GLU B CB    1 
ATOM   7530  C  CG    . GLU B 1 524 ? 37.797  12.711  12.745  1.00 69.50  ? 524 GLU B CG    1 
ATOM   7531  C  CD    . GLU B 1 524 ? 38.228  13.433  13.981  1.00 72.55  ? 524 GLU B CD    1 
ATOM   7532  O  OE1   . GLU B 1 524 ? 38.661  14.603  13.886  1.00 67.30  ? 524 GLU B OE1   1 
ATOM   7533  O  OE2   . GLU B 1 524 ? 38.158  12.793  15.055  1.00 90.88  ? 524 GLU B OE2   1 
ATOM   7534  N  N     . GLU B 1 525 ? 35.101  10.653  11.546  1.00 36.96  ? 525 GLU B N     1 
ATOM   7535  C  CA    . GLU B 1 525 ? 34.949  9.206   11.640  1.00 40.23  ? 525 GLU B CA    1 
ATOM   7536  C  C     . GLU B 1 525 ? 35.092  8.497   10.290  1.00 46.90  ? 525 GLU B C     1 
ATOM   7537  O  O     . GLU B 1 525 ? 35.758  7.465   10.224  1.00 46.05  ? 525 GLU B O     1 
ATOM   7538  C  CB    . GLU B 1 525 ? 33.618  8.782   12.265  1.00 52.05  ? 525 GLU B CB    1 
ATOM   7539  C  CG    . GLU B 1 525 ? 33.544  8.809   13.779  1.00 60.02  ? 525 GLU B CG    1 
ATOM   7540  C  CD    . GLU B 1 525 ? 34.591  7.906   14.434  1.00 75.93  ? 525 GLU B CD    1 
ATOM   7541  O  OE1   . GLU B 1 525 ? 35.212  8.365   15.415  1.00 84.88  ? 525 GLU B OE1   1 
ATOM   7542  O  OE2   . GLU B 1 525 ? 34.859  6.784   13.930  1.00 75.78  ? 525 GLU B OE2   1 
ATOM   7543  N  N     . THR B 1 526 ? 34.436  8.989   9.233   1.00 51.09  ? 526 THR B N     1 
ATOM   7544  C  CA    . THR B 1 526 ? 34.604  8.297   7.944   1.00 48.83  ? 526 THR B CA    1 
ATOM   7545  C  C     . THR B 1 526 ? 36.030  8.369   7.402   1.00 47.11  ? 526 THR B C     1 
ATOM   7546  O  O     . THR B 1 526 ? 36.556  7.361   6.858   1.00 48.81  ? 526 THR B O     1 
ATOM   7547  C  CB    . THR B 1 526 ? 33.627  8.827   6.888   1.00 40.20  ? 526 THR B CB    1 
ATOM   7548  O  OG1   . THR B 1 526 ? 34.049  10.120  6.459   1.00 56.27  ? 526 THR B OG1   1 
ATOM   7549  C  CG2   . THR B 1 526 ? 32.298  8.985   7.509   1.00 30.22  ? 526 THR B CG2   1 
ATOM   7550  N  N     . LEU B 1 527 ? 36.694  9.498   7.652   1.00 39.94  ? 527 LEU B N     1 
ATOM   7551  C  CA    . LEU B 1 527 ? 38.079  9.655   7.229   1.00 40.09  ? 527 LEU B CA    1 
ATOM   7552  C  C     . LEU B 1 527 ? 38.941  8.675   7.962   1.00 46.57  ? 527 LEU B C     1 
ATOM   7553  O  O     . LEU B 1 527 ? 39.888  8.119   7.412   1.00 40.15  ? 527 LEU B O     1 
ATOM   7554  C  CB    . LEU B 1 527 ? 38.642  11.042  7.549   1.00 47.95  ? 527 LEU B CB    1 
ATOM   7555  C  CG    . LEU B 1 527 ? 38.233  12.331  6.856   1.00 62.86  ? 527 LEU B CG    1 
ATOM   7556  C  CD1   . LEU B 1 527 ? 38.811  13.526  7.577   1.00 56.43  ? 527 LEU B CD1   1 
ATOM   7557  C  CD2   . LEU B 1 527 ? 38.731  12.293  5.423   1.00 60.36  ? 527 LEU B CD2   1 
ATOM   7558  N  N     . TRP B 1 528 ? 38.611  8.502   9.235   1.00 54.53  ? 528 TRP B N     1 
ATOM   7559  C  CA    . TRP B 1 528 ? 39.346  7.622   10.113  1.00 53.18  ? 528 TRP B CA    1 
ATOM   7560  C  C     . TRP B 1 528 ? 39.102  6.144   9.650   1.00 58.44  ? 528 TRP B C     1 
ATOM   7561  O  O     . TRP B 1 528 ? 39.957  5.273   9.794   1.00 48.25  ? 528 TRP B O     1 
ATOM   7562  C  CB    . TRP B 1 528 ? 38.957  7.939   11.543  1.00 54.16  ? 528 TRP B CB    1 
ATOM   7563  C  CG    . TRP B 1 528 ? 39.902  7.371   12.479  1.00 56.74  ? 528 TRP B CG    1 
ATOM   7564  C  CD1   . TRP B 1 528 ? 39.779  6.368   13.394  1.00 52.77  ? 528 TRP B CD1   1 
ATOM   7565  C  CD2   . TRP B 1 528 ? 41.240  7.870   12.580  1.00 61.38  ? 528 TRP B CD2   1 
ATOM   7566  N  NE1   . TRP B 1 528 ? 40.989  6.220   14.071  1.00 54.88  ? 528 TRP B NE1   1 
ATOM   7567  C  CE2   . TRP B 1 528 ? 41.894  7.131   13.584  1.00 62.36  ? 528 TRP B CE2   1 
ATOM   7568  C  CE3   . TRP B 1 528 ? 41.950  8.889   11.899  1.00 54.83  ? 528 TRP B CE3   1 
ATOM   7569  C  CZ2   . TRP B 1 528 ? 43.236  7.370   13.932  1.00 66.70  ? 528 TRP B CZ2   1 
ATOM   7570  C  CZ3   . TRP B 1 528 ? 43.287  9.141   12.255  1.00 50.30  ? 528 TRP B CZ3   1 
ATOM   7571  C  CH2   . TRP B 1 528 ? 43.908  8.382   13.260  1.00 61.03  ? 528 TRP B CH2   1 
ATOM   7572  N  N     . ALA B 1 529 ? 37.894  5.856   9.173   1.00 57.64  ? 529 ALA B N     1 
ATOM   7573  C  CA    . ALA B 1 529 ? 37.582  4.539   8.603   1.00 50.53  ? 529 ALA B CA    1 
ATOM   7574  C  C     . ALA B 1 529 ? 38.430  4.264   7.354   1.00 59.82  ? 529 ALA B C     1 
ATOM   7575  O  O     . ALA B 1 529 ? 38.995  3.169   7.209   1.00 52.46  ? 529 ALA B O     1 
ATOM   7576  C  CB    . ALA B 1 529 ? 36.124  4.449   8.239   1.00 49.80  ? 529 ALA B CB    1 
ATOM   7577  N  N     . PHE B 1 530 ? 38.573  5.280   6.499   1.00 55.83  ? 530 PHE B N     1 
ATOM   7578  C  CA    . PHE B 1 530 ? 39.432  5.169   5.320   1.00 45.42  ? 530 PHE B CA    1 
ATOM   7579  C  C     . PHE B 1 530 ? 40.854  4.938   5.822   1.00 52.79  ? 530 PHE B C     1 
ATOM   7580  O  O     . PHE B 1 530 ? 41.583  4.114   5.277   1.00 60.97  ? 530 PHE B O     1 
ATOM   7581  C  CB    . PHE B 1 530 ? 39.362  6.435   4.485   1.00 48.48  ? 530 PHE B CB    1 
ATOM   7582  C  CG    . PHE B 1 530 ? 40.176  6.391   3.225   1.00 51.30  ? 530 PHE B CG    1 
ATOM   7583  C  CD1   . PHE B 1 530 ? 41.519  6.736   3.225   1.00 46.62  ? 530 PHE B CD1   1 
ATOM   7584  C  CD2   . PHE B 1 530 ? 39.549  6.106   2.004   1.00 54.68  ? 530 PHE B CD2   1 
ATOM   7585  C  CE1   . PHE B 1 530 ? 42.245  6.723   2.054   1.00 60.32  ? 530 PHE B CE1   1 
ATOM   7586  C  CE2   . PHE B 1 530 ? 40.257  6.087   0.825   1.00 51.92  ? 530 PHE B CE2   1 
ATOM   7587  C  CZ    . PHE B 1 530 ? 41.613  6.398   0.843   1.00 66.89  ? 530 PHE B CZ    1 
ATOM   7588  N  N     . ARG B 1 531 ? 41.288  5.708   6.820   1.00 59.19  ? 531 ARG B N     1 
ATOM   7589  C  CA    . ARG B 1 531 ? 42.659  5.569   7.292   1.00 63.40  ? 531 ARG B CA    1 
ATOM   7590  C  C     . ARG B 1 531 ? 42.905  4.191   7.939   1.00 58.03  ? 531 ARG B C     1 
ATOM   7591  O  O     . ARG B 1 531 ? 43.950  3.601   7.724   1.00 46.90  ? 531 ARG B O     1 
ATOM   7592  C  CB    . ARG B 1 531 ? 42.931  6.715   8.303   1.00 59.17  ? 531 ARG B CB    1 
ATOM   7593  C  CG    . ARG B 1 531 ? 43.725  6.413   9.606   1.00 63.35  ? 531 ARG B CG    1 
ATOM   7594  C  CD    . ARG B 1 531 ? 45.096  5.845   9.382   1.00 85.03  ? 531 ARG B CD    1 
ATOM   7595  N  NE    . ARG B 1 531 ? 45.728  5.336   10.608  1.00 92.58  ? 531 ARG B NE    1 
ATOM   7596  C  CZ    . ARG B 1 531 ? 45.915  4.057   10.916  1.00 80.64  ? 531 ARG B CZ    1 
ATOM   7597  N  NH1   . ARG B 1 531 ? 45.563  3.100   10.074  1.00 70.80  ? 531 ARG B NH1   1 
ATOM   7598  N  NH2   . ARG B 1 531 ? 46.504  3.751   12.051  1.00 74.62  ? 531 ARG B NH2   1 
ATOM   7599  N  N     . ARG B 1 532 ? 41.889  3.593   8.565   1.00 69.83  ? 532 ARG B N     1 
ATOM   7600  C  CA    . ARG B 1 532 ? 42.028  2.237   9.137   1.00 64.78  ? 532 ARG B CA    1 
ATOM   7601  C  C     . ARG B 1 532 ? 42.042  1.186   8.067   1.00 55.72  ? 532 ARG B C     1 
ATOM   7602  O  O     . ARG B 1 532 ? 42.641  0.141   8.215   1.00 56.86  ? 532 ARG B O     1 
ATOM   7603  C  CB    . ARG B 1 532 ? 40.912  1.931   10.110  1.00 57.90  ? 532 ARG B CB    1 
ATOM   7604  C  CG    . ARG B 1 532 ? 40.965  2.734   11.393  1.00 57.85  ? 532 ARG B CG    1 
ATOM   7605  C  CD    . ARG B 1 532 ? 40.065  2.083   12.416  1.00 62.30  ? 532 ARG B CD    1 
ATOM   7606  N  NE    . ARG B 1 532 ? 38.803  1.708   11.794  1.00 48.82  ? 532 ARG B NE    1 
ATOM   7607  C  CZ    . ARG B 1 532 ? 37.697  2.438   11.837  1.00 66.45  ? 532 ARG B CZ    1 
ATOM   7608  N  NH1   . ARG B 1 532 ? 36.580  2.001   11.243  1.00 69.57  ? 532 ARG B NH1   1 
ATOM   7609  N  NH2   . ARG B 1 532 ? 37.705  3.602   12.483  1.00 77.51  ? 532 ARG B NH2   1 
ATOM   7610  N  N     . LYS B 1 533 ? 41.385  1.497   6.966   1.00 59.88  ? 533 LYS B N     1 
ATOM   7611  C  CA    . LYS B 1 533 ? 41.306  0.571   5.876   1.00 42.17  ? 533 LYS B CA    1 
ATOM   7612  C  C     . LYS B 1 533 ? 42.214  0.673   4.746   1.00 54.55  ? 533 LYS B C     1 
ATOM   7613  O  O     . LYS B 1 533 ? 42.475  -0.384  4.187   1.00 60.06  ? 533 LYS B O     1 
ATOM   7614  C  CB    . LYS B 1 533 ? 39.890  0.665   5.232   1.00 72.19  ? 533 LYS B CB    1 
ATOM   7615  C  CG    . LYS B 1 533 ? 39.277  -0.527  5.549   1.00 75.28  ? 533 LYS B CG    1 
ATOM   7616  C  CD    . LYS B 1 533 ? 38.998  -0.988  6.864   1.00 95.11  ? 533 LYS B CD    1 
ATOM   7617  C  CE    . LYS B 1 533 ? 38.217  -2.251  6.607   1.00 107.27 ? 533 LYS B CE    1 
ATOM   7618  N  NZ    . LYS B 1 533 ? 38.328  -3.173  7.815   1.00 99.79  ? 533 LYS B NZ    1 
ATOM   7619  N  N     . ALA B 1 534 ? 43.092  1.631   4.763   1.00 56.32  ? 534 ALA B N     1 
ATOM   7620  C  CA    . ALA B 1 534 ? 43.909  1.830   3.610   1.00 51.31  ? 534 ALA B CA    1 
ATOM   7621  C  C     . ALA B 1 534 ? 45.263  2.297   4.072   1.00 55.09  ? 534 ALA B C     1 
ATOM   7622  O  O     . ALA B 1 534 ? 46.216  2.244   3.311   1.00 67.42  ? 534 ALA B O     1 
ATOM   7623  C  CB    . ALA B 1 534 ? 43.222  2.868   2.649   1.00 41.25  ? 534 ALA B CB    1 
ATOM   7624  N  N     . GLY B 1 535 ? 45.372  2.737   5.320   1.00 60.19  ? 535 GLY B N     1 
ATOM   7625  C  CA    . GLY B 1 535 ? 46.682  3.113   5.802   1.00 51.46  ? 535 GLY B CA    1 
ATOM   7626  C  C     . GLY B 1 535 ? 47.129  4.478   5.379   1.00 47.18  ? 535 GLY B C     1 
ATOM   7627  O  O     . GLY B 1 535 ? 48.316  4.751   5.418   1.00 54.23  ? 535 GLY B O     1 
ATOM   7628  N  N     . ARG B 1 536 ? 46.242  5.243   4.764   1.00 54.51  ? 536 ARG B N     1 
ATOM   7629  C  CA    . ARG B 1 536 ? 46.583  6.612   4.407   1.00 59.58  ? 536 ARG B CA    1 
ATOM   7630  C  C     . ARG B 1 536 ? 45.336  7.470   4.401   1.00 67.66  ? 536 ARG B C     1 
ATOM   7631  O  O     . ARG B 1 536 ? 44.255  6.956   4.656   1.00 53.27  ? 536 ARG B O     1 
ATOM   7632  C  CB    . ARG B 1 536 ? 47.291  6.567   3.064   1.00 51.59  ? 536 ARG B CB    1 
ATOM   7633  C  CG    . ARG B 1 536 ? 46.456  5.821   2.024   1.00 65.08  ? 536 ARG B CG    1 
ATOM   7634  C  CD    . ARG B 1 536 ? 46.984  5.938   0.610   1.00 76.80  ? 536 ARG B CD    1 
ATOM   7635  N  NE    . ARG B 1 536 ? 46.123  5.200   -0.304  1.00 73.06  ? 536 ARG B NE    1 
ATOM   7636  C  CZ    . ARG B 1 536 ? 45.035  5.674   -0.889  1.00 60.64  ? 536 ARG B CZ    1 
ATOM   7637  N  NH1   . ARG B 1 536 ? 44.805  6.978   -0.881  1.00 71.00  ? 536 ARG B NH1   1 
ATOM   7638  N  NH2   . ARG B 1 536 ? 44.329  4.880   -1.681  1.00 36.53  ? 536 ARG B NH2   1 
ATOM   7639  N  N     . LEU B 1 537 ? 45.490  8.776   4.235   1.00 75.41  ? 537 LEU B N     1 
ATOM   7640  C  CA    . LEU B 1 537 ? 44.325  9.642   4.125   1.00 66.99  ? 537 LEU B CA    1 
ATOM   7641  C  C     . LEU B 1 537 ? 43.918  9.695   2.661   1.00 55.16  ? 537 LEU B C     1 
ATOM   7642  O  O     . LEU B 1 537 ? 44.697  9.336   1.798   1.00 61.06  ? 537 LEU B O     1 
ATOM   7643  C  CB    . LEU B 1 537 ? 44.599  11.061  4.632   1.00 68.92  ? 537 LEU B CB    1 
ATOM   7644  C  CG    . LEU B 1 537 ? 44.981  11.312  6.086   1.00 71.01  ? 537 LEU B CG    1 
ATOM   7645  C  CD1   . LEU B 1 537 ? 45.146  12.813  6.224   1.00 79.55  ? 537 LEU B CD1   1 
ATOM   7646  C  CD2   . LEU B 1 537 ? 43.880  10.782  7.020   1.00 57.01  ? 537 LEU B CD2   1 
ATOM   7647  N  N     . PRO B 1 538 ? 42.640  9.931   2.389   1.00 51.04  ? 538 PRO B N     1 
ATOM   7648  C  CA    . PRO B 1 538 ? 42.213  10.020  0.987   1.00 44.83  ? 538 PRO B CA    1 
ATOM   7649  C  C     . PRO B 1 538 ? 42.676  11.345  0.392   1.00 48.27  ? 538 PRO B C     1 
ATOM   7650  O  O     . PRO B 1 538 ? 42.750  12.338  1.126   1.00 60.50  ? 538 PRO B O     1 
ATOM   7651  C  CB    . PRO B 1 538 ? 40.686  9.941   1.085   1.00 53.83  ? 538 PRO B CB    1 
ATOM   7652  C  CG    . PRO B 1 538 ? 40.369  10.538  2.423   1.00 57.65  ? 538 PRO B CG    1 
ATOM   7653  C  CD    . PRO B 1 538 ? 41.523  10.127  3.334   1.00 59.64  ? 538 PRO B CD    1 
ATOM   7654  N  N     . SER B 1 539 ? 42.952  11.399  -0.902  1.00 58.53  ? 539 SER B N     1 
ATOM   7655  C  CA    . SER B 1 539 ? 43.401  12.685  -1.427  1.00 53.06  ? 539 SER B CA    1 
ATOM   7656  C  C     . SER B 1 539 ? 42.239  13.670  -1.666  1.00 49.87  ? 539 SER B C     1 
ATOM   7657  O  O     . SER B 1 539 ? 42.426  14.878  -1.598  1.00 66.01  ? 539 SER B O     1 
ATOM   7658  C  CB    . SER B 1 539 ? 44.265  12.534  -2.674  1.00 47.30  ? 539 SER B CB    1 
ATOM   7659  O  OG    . SER B 1 539 ? 43.709  11.970  -3.782  1.00 69.68  ? 539 SER B OG    1 
ATOM   7660  N  N     . ARG B 1 540 ? 41.060  13.135  -1.965  1.00 47.71  ? 540 ARG B N     1 
ATOM   7661  C  CA    . ARG B 1 540 ? 39.880  13.949  -2.278  1.00 50.63  ? 540 ARG B CA    1 
ATOM   7662  C  C     . ARG B 1 540 ? 38.604  13.243  -1.771  1.00 50.56  ? 540 ARG B C     1 
ATOM   7663  O  O     . ARG B 1 540 ? 38.517  12.009  -1.898  1.00 54.66  ? 540 ARG B O     1 
ATOM   7664  C  CB    . ARG B 1 540 ? 39.712  14.163  -3.776  1.00 59.82  ? 540 ARG B CB    1 
ATOM   7665  C  CG    . ARG B 1 540 ? 38.562  15.071  -4.188  1.00 57.16  ? 540 ARG B CG    1 
ATOM   7666  C  CD    . ARG B 1 540 ? 38.575  15.408  -5.680  1.00 60.39  ? 540 ARG B CD    1 
ATOM   7667  N  NE    . ARG B 1 540 ? 38.628  16.841  -5.831  1.00 67.97  ? 540 ARG B NE    1 
ATOM   7668  C  CZ    . ARG B 1 540 ? 39.767  17.485  -6.076  1.00 75.88  ? 540 ARG B CZ    1 
ATOM   7669  N  NH1   . ARG B 1 540 ? 40.878  16.767  -6.342  1.00 82.23  ? 540 ARG B NH1   1 
ATOM   7670  N  NH2   . ARG B 1 540 ? 39.827  18.797  -6.204  1.00 74.27  ? 540 ARG B NH2   1 
ATOM   7671  N  N     . VAL B 1 541 ? 37.645  13.967  -1.191  1.00 46.54  ? 541 VAL B N     1 
ATOM   7672  C  CA    . VAL B 1 541 ? 36.399  13.334  -0.739  1.00 55.39  ? 541 VAL B CA    1 
ATOM   7673  C  C     . VAL B 1 541 ? 35.180  13.919  -1.450  1.00 53.11  ? 541 VAL B C     1 
ATOM   7674  O  O     . VAL B 1 541 ? 35.137  15.111  -1.790  1.00 55.93  ? 541 VAL B O     1 
ATOM   7675  C  CB    . VAL B 1 541 ? 36.137  13.462  0.819   1.00 68.78  ? 541 VAL B CB    1 
ATOM   7676  C  CG1   . VAL B 1 541 ? 37.135  12.666  1.638   1.00 58.12  ? 541 VAL B CG1   1 
ATOM   7677  C  CG2   . VAL B 1 541 ? 36.117  14.917  1.258   1.00 64.73  ? 541 VAL B CG2   1 
ATOM   7678  N  N     . LEU B 1 542 ? 34.184  13.066  -1.659  1.00 52.41  ? 542 LEU B N     1 
ATOM   7679  C  CA    . LEU B 1 542 ? 32.937  13.523  -2.239  1.00 54.45  ? 542 LEU B CA    1 
ATOM   7680  C  C     . LEU B 1 542 ? 31.956  13.531  -1.094  1.00 55.70  ? 542 LEU B C     1 
ATOM   7681  O  O     . LEU B 1 542 ? 31.666  12.493  -0.474  1.00 52.75  ? 542 LEU B O     1 
ATOM   7682  C  CB    . LEU B 1 542 ? 32.519  12.628  -3.414  1.00 42.18  ? 542 LEU B CB    1 
ATOM   7683  C  CG    . LEU B 1 542 ? 31.164  12.950  -4.051  1.00 38.26  ? 542 LEU B CG    1 
ATOM   7684  C  CD1   . LEU B 1 542 ? 31.094  14.377  -4.583  1.00 39.12  ? 542 LEU B CD1   1 
ATOM   7685  C  CD2   . LEU B 1 542 ? 31.030  11.993  -5.263  1.00 52.77  ? 542 LEU B CD2   1 
ATOM   7686  N  N     . LEU B 1 543 ? 31.513  14.749  -0.788  1.00 53.70  ? 543 LEU B N     1 
ATOM   7687  C  CA    . LEU B 1 543 ? 30.550  15.013  0.270   1.00 48.08  ? 543 LEU B CA    1 
ATOM   7688  C  C     . LEU B 1 543 ? 29.174  15.184  -0.338  1.00 46.14  ? 543 LEU B C     1 
ATOM   7689  O  O     . LEU B 1 543 ? 28.959  16.166  -1.044  1.00 48.57  ? 543 LEU B O     1 
ATOM   7690  C  CB    . LEU B 1 543 ? 30.975  16.297  0.975   1.00 40.51  ? 543 LEU B CB    1 
ATOM   7691  C  CG    . LEU B 1 543 ? 32.230  16.125  1.819   1.00 45.52  ? 543 LEU B CG    1 
ATOM   7692  C  CD1   . LEU B 1 543 ? 32.449  17.358  2.669   1.00 56.20  ? 543 LEU B CD1   1 
ATOM   7693  C  CD2   . LEU B 1 543 ? 32.205  14.865  2.613   1.00 50.95  ? 543 LEU B CD2   1 
ATOM   7694  N  N     . LEU B 1 544 ? 28.220  14.361  0.058   1.00 39.08  ? 544 LEU B N     1 
ATOM   7695  C  CA    . LEU B 1 544 ? 26.863  14.471  -0.433  1.00 43.69  ? 544 LEU B CA    1 
ATOM   7696  C  C     . LEU B 1 544 ? 25.833  14.798  0.638   1.00 41.52  ? 544 LEU B C     1 
ATOM   7697  O  O     . LEU B 1 544 ? 25.830  14.243  1.687   1.00 41.44  ? 544 LEU B O     1 
ATOM   7698  C  CB    . LEU B 1 544 ? 26.476  13.203  -1.153  1.00 34.92  ? 544 LEU B CB    1 
ATOM   7699  C  CG    . LEU B 1 544 ? 27.479  12.764  -2.179  1.00 36.60  ? 544 LEU B CG    1 
ATOM   7700  C  CD1   . LEU B 1 544 ? 27.141  11.368  -2.608  1.00 46.44  ? 544 LEU B CD1   1 
ATOM   7701  C  CD2   . LEU B 1 544 ? 27.468  13.688  -3.361  1.00 40.17  ? 544 LEU B CD2   1 
ATOM   7702  N  N     . ARG B 1 545 ? 24.939  15.708  0.337   1.00 44.97  ? 545 ARG B N     1 
ATOM   7703  C  CA    . ARG B 1 545 ? 23.924  16.104  1.271   1.00 45.90  ? 545 ARG B CA    1 
ATOM   7704  C  C     . ARG B 1 545 ? 22.561  15.841  0.720   1.00 46.80  ? 545 ARG B C     1 
ATOM   7705  O  O     . ARG B 1 545 ? 22.246  16.300  -0.327  1.00 50.88  ? 545 ARG B O     1 
ATOM   7706  C  CB    . ARG B 1 545 ? 24.061  17.587  1.544   1.00 40.84  ? 545 ARG B CB    1 
ATOM   7707  C  CG    . ARG B 1 545 ? 23.046  18.148  2.500   1.00 49.14  ? 545 ARG B CG    1 
ATOM   7708  C  CD    . ARG B 1 545 ? 23.146  17.465  3.832   1.00 49.77  ? 545 ARG B CD    1 
ATOM   7709  N  NE    . ARG B 1 545 ? 22.597  18.282  4.891   1.00 61.15  ? 545 ARG B NE    1 
ATOM   7710  C  CZ    . ARG B 1 545 ? 21.407  18.090  5.419   1.00 72.64  ? 545 ARG B CZ    1 
ATOM   7711  N  NH1   . ARG B 1 545 ? 20.645  17.123  4.976   1.00 78.21  ? 545 ARG B NH1   1 
ATOM   7712  N  NH2   . ARG B 1 545 ? 20.980  18.870  6.377   1.00 72.99  ? 545 ARG B NH2   1 
ATOM   7713  N  N     . ASN B 1 546 ? 21.741  15.113  1.439   1.00 43.18  ? 546 ASN B N     1 
ATOM   7714  C  CA    . ASN B 1 546 ? 20.401  14.850  0.998   1.00 45.91  ? 546 ASN B CA    1 
ATOM   7715  C  C     . ASN B 1 546 ? 19.580  16.113  1.136   1.00 47.00  ? 546 ASN B C     1 
ATOM   7716  O  O     . ASN B 1 546 ? 19.455  16.623  2.210   1.00 62.80  ? 546 ASN B O     1 
ATOM   7717  C  CB    . ASN B 1 546 ? 19.839  13.757  1.864   1.00 30.00  ? 546 ASN B CB    1 
ATOM   7718  C  CG    . ASN B 1 546 ? 18.449  13.381  1.500   1.00 30.00  ? 546 ASN B CG    1 
ATOM   7719  O  OD1   . ASN B 1 546 ? 17.686  14.189  1.043   1.00 30.00  ? 546 ASN B OD1   1 
ATOM   7720  N  ND2   . ASN B 1 546 ? 18.112  12.140  1.715   1.00 30.00  ? 546 ASN B ND2   1 
ATOM   7721  N  N     . GLY B 1 547 ? 19.018  16.618  0.053   1.00 38.58  ? 547 GLY B N     1 
ATOM   7722  C  CA    . GLY B 1 547 ? 18.242  17.831  0.123   1.00 48.43  ? 547 GLY B CA    1 
ATOM   7723  C  C     . GLY B 1 547 ? 19.107  19.064  0.106   1.00 55.87  ? 547 GLY B C     1 
ATOM   7724  O  O     . GLY B 1 547 ? 20.212  19.016  -0.352  1.00 55.34  ? 547 GLY B O     1 
ATOM   7725  N  N     . ARG B 1 548 ? 18.623  20.181  0.616   1.00 48.82  ? 548 ARG B N     1 
ATOM   7726  C  CA    . ARG B 1 548 ? 19.456  21.364  0.595   1.00 45.17  ? 548 ARG B CA    1 
ATOM   7727  C  C     . ARG B 1 548 ? 20.544  21.435  1.638   1.00 56.26  ? 548 ARG B C     1 
ATOM   7728  O  O     . ARG B 1 548 ? 20.376  20.873  2.729   1.00 71.86  ? 548 ARG B O     1 
ATOM   7729  C  CB    . ARG B 1 548 ? 18.676  22.656  0.732   1.00 52.42  ? 548 ARG B CB    1 
ATOM   7730  C  CG    . ARG B 1 548 ? 17.876  22.928  -0.475  1.00 77.77  ? 548 ARG B CG    1 
ATOM   7731  C  CD    . ARG B 1 548 ? 16.677  23.780  -0.360  1.00 94.22  ? 548 ARG B CD    1 
ATOM   7732  N  NE    . ARG B 1 548 ? 17.080  24.777  0.638   1.00 103.07 ? 548 ARG B NE    1 
ATOM   7733  C  CZ    . ARG B 1 548 ? 16.357  25.770  1.116   1.00 107.42 ? 548 ARG B CZ    1 
ATOM   7734  N  NH1   . ARG B 1 548 ? 15.404  26.275  0.339   1.00 104.38 ? 548 ARG B NH1   1 
ATOM   7735  N  NH2   . ARG B 1 548 ? 16.892  26.549  2.040   1.00 112.91 ? 548 ARG B NH2   1 
ATOM   7736  N  N     . VAL B 1 549 ? 21.663  22.093  1.316   1.00 49.84  ? 549 VAL B N     1 
ATOM   7737  C  CA    . VAL B 1 549 ? 22.663  22.411  2.358   1.00 67.86  ? 549 VAL B CA    1 
ATOM   7738  C  C     . VAL B 1 549 ? 22.369  23.762  3.054   1.00 65.02  ? 549 VAL B C     1 
ATOM   7739  O  O     . VAL B 1 549 ? 22.500  24.818  2.433   1.00 85.97  ? 549 VAL B O     1 
ATOM   7740  C  CB    . VAL B 1 549 ? 24.122  22.434  1.790   1.00 33.58  ? 549 VAL B CB    1 
ATOM   7741  C  CG1   . VAL B 1 549 ? 25.075  22.776  2.850   1.00 40.33  ? 549 VAL B CG1   1 
ATOM   7742  C  CG2   . VAL B 1 549 ? 24.506  21.102  1.246   1.00 32.71  ? 549 VAL B CG2   1 
ATOM   7743  N  N     . PRO B 1 550 ? 21.936  23.746  4.328   1.00 49.46  ? 550 PRO B N     1 
ATOM   7744  C  CA    . PRO B 1 550 ? 21.748  25.004  5.068   1.00 43.12  ? 550 PRO B CA    1 
ATOM   7745  C  C     . PRO B 1 550 ? 23.011  25.883  5.073   1.00 56.63  ? 550 PRO B C     1 
ATOM   7746  O  O     . PRO B 1 550 ? 24.106  25.296  5.154   1.00 58.56  ? 550 PRO B O     1 
ATOM   7747  C  CB    . PRO B 1 550 ? 21.403  24.526  6.472   1.00 52.17  ? 550 PRO B CB    1 
ATOM   7748  C  CG    . PRO B 1 550 ? 20.708  23.217  6.250   1.00 58.21  ? 550 PRO B CG    1 
ATOM   7749  C  CD    . PRO B 1 550 ? 21.493  22.576  5.114   1.00 48.22  ? 550 PRO B CD    1 
ATOM   7750  N  N     . GLN B 1 551 ? 22.856  27.225  5.026   1.00 55.90  ? 551 GLN B N     1 
ATOM   7751  C  CA    . GLN B 1 551 ? 23.975  28.175  4.969   1.00 63.76  ? 551 GLN B CA    1 
ATOM   7752  C  C     . GLN B 1 551 ? 25.078  27.883  5.991   1.00 66.39  ? 551 GLN B C     1 
ATOM   7753  O  O     . GLN B 1 551 ? 24.857  27.977  7.178   1.00 72.62  ? 551 GLN B O     1 
ATOM   7754  C  CB    . GLN B 1 551 ? 23.483  29.613  5.222   1.00 74.63  ? 551 GLN B CB    1 
ATOM   7755  C  CG    . GLN B 1 551 ? 22.265  30.103  4.471   1.00 94.46  ? 551 GLN B CG    1 
ATOM   7756  C  CD    . GLN B 1 551 ? 22.575  30.574  3.066   1.00 116.95 ? 551 GLN B CD    1 
ATOM   7757  O  OE1   . GLN B 1 551 ? 23.748  30.902  2.775   1.00 121.68 ? 551 GLN B OE1   1 
ATOM   7758  N  NE2   . GLN B 1 551 ? 21.578  30.621  2.208   1.00 122.62 ? 551 GLN B NE2   1 
ATOM   7759  N  N     . ASP B 1 552 ? 26.287  27.613  5.513   1.00 61.33  ? 552 ASP B N     1 
ATOM   7760  C  CA    . ASP B 1 552 ? 27.485  27.424  6.343   1.00 57.36  ? 552 ASP B CA    1 
ATOM   7761  C  C     . ASP B 1 552 ? 27.470  26.120  7.137   1.00 56.93  ? 552 ASP B C     1 
ATOM   7762  O  O     . ASP B 1 552 ? 28.315  25.945  7.998   1.00 53.59  ? 552 ASP B O     1 
ATOM   7763  C  CB    . ASP B 1 552 ? 27.737  28.570  7.306   1.00 69.49  ? 552 ASP B CB    1 
ATOM   7764  C  CG    . ASP B 1 552 ? 28.027  29.894  6.610   1.00 83.04  ? 552 ASP B CG    1 
ATOM   7765  O  OD1   . ASP B 1 552 ? 28.755  29.925  5.583   1.00 88.09  ? 552 ASP B OD1   1 
ATOM   7766  O  OD2   . ASP B 1 552 ? 27.572  30.927  7.126   1.00 84.83  ? 552 ASP B OD2   1 
ATOM   7767  N  N     . GLU B 1 553 ? 26.557  25.194  6.830   1.00 62.73  ? 553 GLU B N     1 
ATOM   7768  C  CA    . GLU B 1 553 ? 26.472  23.939  7.567   1.00 49.00  ? 553 GLU B CA    1 
ATOM   7769  C  C     . GLU B 1 553 ? 27.779  23.165  7.537   1.00 58.66  ? 553 GLU B C     1 
ATOM   7770  O  O     . GLU B 1 553 ? 28.177  22.550  8.531   1.00 73.02  ? 553 GLU B O     1 
ATOM   7771  C  CB    . GLU B 1 553 ? 25.388  23.040  6.950   1.00 48.31  ? 553 GLU B CB    1 
ATOM   7772  C  CG    . GLU B 1 553 ? 25.056  21.804  7.754   1.00 64.82  ? 553 GLU B CG    1 
ATOM   7773  C  CD    . GLU B 1 553 ? 23.956  20.948  7.122   1.00 78.86  ? 553 GLU B CD    1 
ATOM   7774  O  OE1   . GLU B 1 553 ? 24.144  20.454  5.976   1.00 74.33  ? 553 GLU B OE1   1 
ATOM   7775  O  OE2   . GLU B 1 553 ? 22.902  20.757  7.767   1.00 87.74  ? 553 GLU B OE2   1 
ATOM   7776  N  N     . PHE B 1 554 ? 28.454  23.228  6.396   1.00 55.81  ? 554 PHE B N     1 
ATOM   7777  C  CA    . PHE B 1 554 ? 29.708  22.491  6.172   1.00 47.99  ? 554 PHE B CA    1 
ATOM   7778  C  C     . PHE B 1 554 ? 30.937  23.353  6.346   1.00 39.73  ? 554 PHE B C     1 
ATOM   7779  O  O     . PHE B 1 554 ? 32.026  22.878  6.145   1.00 44.31  ? 554 PHE B O     1 
ATOM   7780  C  CB    . PHE B 1 554 ? 29.716  21.840  4.775   1.00 43.07  ? 554 PHE B CB    1 
ATOM   7781  C  CG    . PHE B 1 554 ? 28.920  20.570  4.679   1.00 41.42  ? 554 PHE B CG    1 
ATOM   7782  C  CD1   . PHE B 1 554 ? 27.529  20.574  4.649   1.00 41.93  ? 554 PHE B CD1   1 
ATOM   7783  C  CD2   . PHE B 1 554 ? 29.594  19.360  4.519   1.00 33.24  ? 554 PHE B CD2   1 
ATOM   7784  C  CE1   . PHE B 1 554 ? 26.809  19.379  4.552   1.00 37.65  ? 554 PHE B CE1   1 
ATOM   7785  C  CE2   . PHE B 1 554 ? 28.903  18.155  4.423   1.00 25.19  ? 554 PHE B CE2   1 
ATOM   7786  C  CZ    . PHE B 1 554 ? 27.496  18.168  4.443   1.00 36.07  ? 554 PHE B CZ    1 
ATOM   7787  N  N     . ALA B 1 555 ? 30.771  24.576  6.826   1.00 46.49  ? 555 ALA B N     1 
ATOM   7788  C  CA    . ALA B 1 555 ? 31.871  25.531  6.881   1.00 56.35  ? 555 ALA B CA    1 
ATOM   7789  C  C     . ALA B 1 555 ? 33.083  25.037  7.670   1.00 58.53  ? 555 ALA B C     1 
ATOM   7790  O  O     . ALA B 1 555 ? 34.215  25.007  7.149   1.00 59.49  ? 555 ALA B O     1 
ATOM   7791  C  CB    . ALA B 1 555 ? 31.372  26.825  7.481   1.00 28.41  ? 555 ALA B CB    1 
ATOM   7792  N  N     . LEU B 1 556 ? 32.850  24.616  8.902   1.00 63.79  ? 556 LEU B N     1 
ATOM   7793  C  CA    . LEU B 1 556 ? 33.895  24.038  9.751   1.00 56.57  ? 556 LEU B CA    1 
ATOM   7794  C  C     . LEU B 1 556 ? 34.593  22.832  9.118   1.00 58.02  ? 556 LEU B C     1 
ATOM   7795  O  O     . LEU B 1 556 ? 35.814  22.745  9.083   1.00 55.99  ? 556 LEU B O     1 
ATOM   7796  C  CB    . LEU B 1 556 ? 33.357  23.591  11.099  1.00 54.63  ? 556 LEU B CB    1 
ATOM   7797  C  CG    . LEU B 1 556 ? 34.208  23.895  12.312  1.00 63.79  ? 556 LEU B CG    1 
ATOM   7798  C  CD1   . LEU B 1 556 ? 33.526  24.780  13.287  1.00 68.15  ? 556 LEU B CD1   1 
ATOM   7799  C  CD2   . LEU B 1 556 ? 34.536  22.545  12.875  1.00 62.20  ? 556 LEU B CD2   1 
ATOM   7800  N  N     . ALA B 1 557 ? 33.791  21.851  8.723   1.00 63.01  ? 557 ALA B N     1 
ATOM   7801  C  CA    . ALA B 1 557 ? 34.271  20.656  8.073   1.00 53.52  ? 557 ALA B CA    1 
ATOM   7802  C  C     . ALA B 1 557 ? 35.148  20.936  6.876   1.00 52.39  ? 557 ALA B C     1 
ATOM   7803  O  O     . ALA B 1 557 ? 36.201  20.316  6.673   1.00 56.10  ? 557 ALA B O     1 
ATOM   7804  C  CB    . ALA B 1 557 ? 33.091  19.797  7.629   1.00 38.66  ? 557 ALA B CB    1 
ATOM   7805  N  N     . LEU B 1 558 ? 34.672  21.865  6.063   1.00 47.17  ? 558 LEU B N     1 
ATOM   7806  C  CA    . LEU B 1 558 ? 35.340  22.254  4.849   1.00 42.44  ? 558 LEU B CA    1 
ATOM   7807  C  C     . LEU B 1 558 ? 36.732  22.845  5.236   1.00 65.48  ? 558 LEU B C     1 
ATOM   7808  O  O     . LEU B 1 558 ? 37.795  22.476  4.669   1.00 52.76  ? 558 LEU B O     1 
ATOM   7809  C  CB    . LEU B 1 558 ? 34.429  23.266  4.154   1.00 44.73  ? 558 LEU B CB    1 
ATOM   7810  C  CG    . LEU B 1 558 ? 33.514  22.632  3.087   1.00 42.39  ? 558 LEU B CG    1 
ATOM   7811  C  CD1   . LEU B 1 558 ? 33.050  23.547  1.988   1.00 49.16  ? 558 LEU B CD1   1 
ATOM   7812  C  CD2   . LEU B 1 558 ? 33.836  21.178  2.641   1.00 42.24  ? 558 LEU B CD2   1 
ATOM   7813  N  N     . GLU B 1 559 ? 36.728  23.716  6.256   1.00 54.07  ? 559 GLU B N     1 
ATOM   7814  C  CA    . GLU B 1 559 ? 37.968  24.287  6.783   1.00 46.36  ? 559 GLU B CA    1 
ATOM   7815  C  C     . GLU B 1 559 ? 38.950  23.210  7.315   1.00 65.78  ? 559 GLU B C     1 
ATOM   7816  O  O     . GLU B 1 559 ? 40.177  23.283  7.081   1.00 57.07  ? 559 GLU B O     1 
ATOM   7817  C  CB    . GLU B 1 559 ? 37.681  25.328  7.858   1.00 55.96  ? 559 GLU B CB    1 
ATOM   7818  C  CG    . GLU B 1 559 ? 38.520  26.603  7.698   1.00 86.12  ? 559 GLU B CG    1 
ATOM   7819  C  CD    . GLU B 1 559 ? 38.071  27.457  6.496   1.00 113.54 ? 559 GLU B CD    1 
ATOM   7820  O  OE1   . GLU B 1 559 ? 36.903  27.908  6.485   1.00 123.27 ? 559 GLU B OE1   1 
ATOM   7821  O  OE2   . GLU B 1 559 ? 38.875  27.678  5.560   1.00 111.47 ? 559 GLU B OE2   1 
ATOM   7822  N  N     . ALA B 1 560 ? 38.417  22.242  8.063   1.00 54.96  ? 560 ALA B N     1 
ATOM   7823  C  CA    . ALA B 1 560 ? 39.248  21.182  8.612   1.00 49.00  ? 560 ALA B CA    1 
ATOM   7824  C  C     . ALA B 1 560 ? 39.866  20.319  7.512   1.00 61.67  ? 560 ALA B C     1 
ATOM   7825  O  O     . ALA B 1 560 ? 41.038  19.940  7.621   1.00 62.07  ? 560 ALA B O     1 
ATOM   7826  C  CB    . ALA B 1 560 ? 38.447  20.311  9.560   1.00 30.14  ? 560 ALA B CB    1 
ATOM   7827  N  N     . LEU B 1 561 ? 39.096  19.997  6.469   1.00 54.47  ? 561 LEU B N     1 
ATOM   7828  C  CA    . LEU B 1 561 ? 39.663  19.261  5.345   1.00 59.60  ? 561 LEU B CA    1 
ATOM   7829  C  C     . LEU B 1 561 ? 40.786  20.039  4.687   1.00 68.59  ? 561 LEU B C     1 
ATOM   7830  O  O     . LEU B 1 561 ? 41.857  19.500  4.417   1.00 82.11  ? 561 LEU B O     1 
ATOM   7831  C  CB    . LEU B 1 561 ? 38.586  18.938  4.308   1.00 60.55  ? 561 LEU B CB    1 
ATOM   7832  C  CG    . LEU B 1 561 ? 37.599  17.832  4.670   1.00 53.38  ? 561 LEU B CG    1 
ATOM   7833  C  CD1   . LEU B 1 561 ? 36.508  17.680  3.598   1.00 48.21  ? 561 LEU B CD1   1 
ATOM   7834  C  CD2   . LEU B 1 561 ? 38.370  16.563  4.814   1.00 43.60  ? 561 LEU B CD2   1 
ATOM   7835  N  N     . ALA B 1 562 ? 40.561  21.328  4.477   1.00 64.74  ? 562 ALA B N     1 
ATOM   7836  C  CA    . ALA B 1 562 ? 41.614  22.152  3.903   1.00 55.07  ? 562 ALA B CA    1 
ATOM   7837  C  C     . ALA B 1 562 ? 42.878  22.030  4.730   1.00 57.74  ? 562 ALA B C     1 
ATOM   7838  O  O     . ALA B 1 562 ? 43.945  21.713  4.223   1.00 62.43  ? 562 ALA B O     1 
ATOM   7839  C  CB    . ALA B 1 562 ? 41.169  23.596  3.779   1.00 42.83  ? 562 ALA B CB    1 
ATOM   7840  N  N     . ARG B 1 563 ? 42.744  22.319  6.009   1.00 69.58  ? 563 ARG B N     1 
ATOM   7841  C  CA    . ARG B 1 563 ? 43.830  22.199  6.972   1.00 70.40  ? 563 ARG B CA    1 
ATOM   7842  C  C     . ARG B 1 563 ? 44.575  20.876  6.875   1.00 64.66  ? 563 ARG B C     1 
ATOM   7843  O  O     . ARG B 1 563 ? 45.740  20.767  7.216   1.00 73.46  ? 563 ARG B O     1 
ATOM   7844  C  CB    . ARG B 1 563 ? 43.252  22.390  8.352   1.00 57.22  ? 563 ARG B CB    1 
ATOM   7845  C  CG    . ARG B 1 563 ? 42.824  23.776  8.677   1.00 47.70  ? 563 ARG B CG    1 
ATOM   7846  C  CD    . ARG B 1 563 ? 42.551  23.757  10.156  1.00 60.44  ? 563 ARG B CD    1 
ATOM   7847  N  NE    . ARG B 1 563 ? 41.713  24.864  10.588  1.00 85.85  ? 563 ARG B NE    1 
ATOM   7848  C  CZ    . ARG B 1 563 ? 41.090  24.882  11.755  1.00 105.37 ? 563 ARG B CZ    1 
ATOM   7849  N  NH1   . ARG B 1 563 ? 41.194  23.831  12.560  1.00 106.04 ? 563 ARG B NH1   1 
ATOM   7850  N  NH2   . ARG B 1 563 ? 40.348  25.930  12.101  1.00 123.63 ? 563 ARG B NH2   1 
ATOM   7851  N  N     . GLU B 1 564 ? 43.825  19.832  6.634   1.00 61.99  ? 564 GLU B N     1 
ATOM   7852  C  CA    . GLU B 1 564 ? 44.382  18.514  6.704   1.00 63.37  ? 564 GLU B CA    1 
ATOM   7853  C  C     . GLU B 1 564 ? 44.941  18.098  5.328   1.00 56.10  ? 564 GLU B C     1 
ATOM   7854  O  O     . GLU B 1 564 ? 45.414  16.962  5.187   1.00 62.06  ? 564 GLU B O     1 
ATOM   7855  C  CB    . GLU B 1 564 ? 43.262  17.637  7.242   1.00 72.62  ? 564 GLU B CB    1 
ATOM   7856  C  CG    . GLU B 1 564 ? 43.574  16.414  7.918   1.00 82.16  ? 564 GLU B CG    1 
ATOM   7857  C  CD    . GLU B 1 564 ? 44.471  16.636  9.152   1.00 88.28  ? 564 GLU B CD    1 
ATOM   7858  O  OE1   . GLU B 1 564 ? 44.058  17.156  10.226  1.00 84.51  ? 564 GLU B OE1   1 
ATOM   7859  O  OE2   . GLU B 1 564 ? 45.643  16.263  9.009   1.00 96.92  ? 564 GLU B OE2   1 
ATOM   7860  N  N     . GLY B 1 565 ? 44.870  19.009  4.329   1.00 44.75  ? 565 GLY B N     1 
ATOM   7861  C  CA    . GLY B 1 565 ? 45.390  18.731  2.990   1.00 44.18  ? 565 GLY B CA    1 
ATOM   7862  C  C     . GLY B 1 565 ? 44.546  17.798  2.122   1.00 66.15  ? 565 GLY B C     1 
ATOM   7863  O  O     . GLY B 1 565 ? 45.037  17.176  1.178   1.00 73.26  ? 565 GLY B O     1 
ATOM   7864  N  N     . ILE B 1 566 ? 43.289  17.642  2.505   1.00 73.15  ? 566 ILE B N     1 
ATOM   7865  C  CA    . ILE B 1 566 ? 42.330  16.803  1.810   1.00 59.03  ? 566 ILE B CA    1 
ATOM   7866  C  C     . ILE B 1 566 ? 41.432  17.633  0.872   1.00 58.38  ? 566 ILE B C     1 
ATOM   7867  O  O     . ILE B 1 566 ? 40.825  18.626  1.286   1.00 58.99  ? 566 ILE B O     1 
ATOM   7868  C  CB    . ILE B 1 566 ? 41.505  16.030  2.806   1.00 47.00  ? 566 ILE B CB    1 
ATOM   7869  C  CG1   . ILE B 1 566 ? 42.447  15.257  3.721   1.00 52.35  ? 566 ILE B CG1   1 
ATOM   7870  C  CG2   . ILE B 1 566 ? 40.527  15.113  2.083   1.00 46.03  ? 566 ILE B CG2   1 
ATOM   7871  C  CD1   . ILE B 1 566 ? 41.762  14.282  4.663   1.00 57.14  ? 566 ILE B CD1   1 
ATOM   7872  N  N     . ALA B 1 567 ? 41.481  17.330  -0.414  1.00 48.71  ? 567 ALA B N     1 
ATOM   7873  C  CA    . ALA B 1 567 ? 40.631  18.017  -1.371  1.00 54.02  ? 567 ALA B CA    1 
ATOM   7874  C  C     . ALA B 1 567 ? 39.193  17.528  -1.191  1.00 59.34  ? 567 ALA B C     1 
ATOM   7875  O  O     . ALA B 1 567 ? 38.980  16.453  -0.597  1.00 46.56  ? 567 ALA B O     1 
ATOM   7876  C  CB    . ALA B 1 567 ? 41.110  17.794  -2.781  1.00 48.75  ? 567 ALA B CB    1 
ATOM   7877  N  N     . TYR B 1 568 ? 38.219  18.319  -1.654  1.00 54.29  ? 568 TYR B N     1 
ATOM   7878  C  CA    . TYR B 1 568 ? 36.816  17.995  -1.439  1.00 45.18  ? 568 TYR B CA    1 
ATOM   7879  C  C     . TYR B 1 568 ? 35.898  18.546  -2.517  1.00 44.83  ? 568 TYR B C     1 
ATOM   7880  O  O     . TYR B 1 568 ? 36.253  19.462  -3.244  1.00 53.37  ? 568 TYR B O     1 
ATOM   7881  C  CB    . TYR B 1 568 ? 36.314  18.547  -0.089  1.00 45.28  ? 568 TYR B CB    1 
ATOM   7882  C  CG    . TYR B 1 568 ? 36.473  20.048  0.059   1.00 49.13  ? 568 TYR B CG    1 
ATOM   7883  C  CD1   . TYR B 1 568 ? 35.513  20.931  -0.442  1.00 49.70  ? 568 TYR B CD1   1 
ATOM   7884  C  CD2   . TYR B 1 568 ? 37.521  20.579  0.794   1.00 49.55  ? 568 TYR B CD2   1 
ATOM   7885  C  CE1   . TYR B 1 568 ? 35.651  22.305  -0.307  1.00 43.77  ? 568 TYR B CE1   1 
ATOM   7886  C  CE2   . TYR B 1 568 ? 37.656  21.965  0.959   1.00 53.07  ? 568 TYR B CE2   1 
ATOM   7887  C  CZ    . TYR B 1 568 ? 36.716  22.819  0.401   1.00 54.90  ? 568 TYR B CZ    1 
ATOM   7888  O  OH    . TYR B 1 568 ? 36.845  24.192  0.546   1.00 63.22  ? 568 TYR B OH    1 
ATOM   7889  N  N     . ASP B 1 569 ? 34.699  17.965  -2.581  1.00 49.86  ? 569 ASP B N     1 
ATOM   7890  C  CA    . ASP B 1 569 ? 33.558  18.560  -3.264  1.00 53.32  ? 569 ASP B CA    1 
ATOM   7891  C  C     . ASP B 1 569 ? 32.289  18.436  -2.441  1.00 48.54  ? 569 ASP B C     1 
ATOM   7892  O  O     . ASP B 1 569 ? 32.012  17.346  -1.936  1.00 53.34  ? 569 ASP B O     1 
ATOM   7893  C  CB    . ASP B 1 569 ? 33.318  17.869  -4.607  1.00 60.83  ? 569 ASP B CB    1 
ATOM   7894  C  CG    . ASP B 1 569 ? 34.433  18.103  -5.583  1.00 61.53  ? 569 ASP B CG    1 
ATOM   7895  O  OD1   . ASP B 1 569 ? 34.449  19.189  -6.217  1.00 58.89  ? 569 ASP B OD1   1 
ATOM   7896  O  OD2   . ASP B 1 569 ? 35.289  17.188  -5.693  1.00 62.87  ? 569 ASP B OD2   1 
ATOM   7897  N  N     . LEU B 1 570 ? 31.459  19.484  -2.418  1.00 50.62  ? 570 LEU B N     1 
ATOM   7898  C  CA    . LEU B 1 570 ? 30.155  19.409  -1.739  1.00 40.93  ? 570 LEU B CA    1 
ATOM   7899  C  C     . LEU B 1 570 ? 29.025  19.396  -2.734  1.00 41.67  ? 570 LEU B C     1 
ATOM   7900  O  O     . LEU B 1 570 ? 28.886  20.276  -3.553  1.00 41.72  ? 570 LEU B O     1 
ATOM   7901  C  CB    . LEU B 1 570 ? 29.949  20.628  -0.852  1.00 39.97  ? 570 LEU B CB    1 
ATOM   7902  C  CG    . LEU B 1 570 ? 28.940  20.579  0.281   1.00 46.14  ? 570 LEU B CG    1 
ATOM   7903  C  CD1   . LEU B 1 570 ? 28.823  19.166  0.867   1.00 39.65  ? 570 LEU B CD1   1 
ATOM   7904  C  CD2   . LEU B 1 570 ? 29.266  21.692  1.305   1.00 49.75  ? 570 LEU B CD2   1 
ATOM   7905  N  N     . VAL B 1 571 ? 28.143  18.434  -2.618  1.00 49.80  ? 571 VAL B N     1 
ATOM   7906  C  CA    . VAL B 1 571 ? 27.055  18.402  -3.571  1.00 55.48  ? 571 VAL B CA    1 
ATOM   7907  C  C     . VAL B 1 571 ? 25.720  18.223  -2.868  1.00 46.84  ? 571 VAL B C     1 
ATOM   7908  O  O     . VAL B 1 571 ? 25.495  17.244  -2.132  1.00 44.88  ? 571 VAL B O     1 
ATOM   7909  C  CB    . VAL B 1 571 ? 27.255  17.276  -4.632  1.00 36.00  ? 571 VAL B CB    1 
ATOM   7910  C  CG1   . VAL B 1 571 ? 26.152  17.345  -5.656  1.00 33.19  ? 571 VAL B CG1   1 
ATOM   7911  C  CG2   . VAL B 1 571 ? 28.612  17.382  -5.287  1.00 30.53  ? 571 VAL B CG2   1 
ATOM   7912  N  N     . SER B 1 572 ? 24.834  19.163  -3.120  1.00 37.65  ? 572 SER B N     1 
ATOM   7913  C  CA    . SER B 1 572 ? 23.461  19.082  -2.654  1.00 42.04  ? 572 SER B CA    1 
ATOM   7914  C  C     . SER B 1 572 ? 22.645  18.182  -3.570  1.00 42.40  ? 572 SER B C     1 
ATOM   7915  O  O     . SER B 1 572 ? 22.667  18.372  -4.753  1.00 44.50  ? 572 SER B O     1 
ATOM   7916  C  CB    . SER B 1 572 ? 22.832  20.464  -2.610  1.00 43.26  ? 572 SER B CB    1 
ATOM   7917  O  OG    . SER B 1 572 ? 21.475  20.351  -2.271  1.00 65.67  ? 572 SER B OG    1 
ATOM   7918  N  N     . VAL B 1 573 ? 22.022  17.143  -3.051  1.00 40.34  ? 573 VAL B N     1 
ATOM   7919  C  CA    . VAL B 1 573 ? 21.214  16.262  -3.879  1.00 38.63  ? 573 VAL B CA    1 
ATOM   7920  C  C     . VAL B 1 573 ? 19.711  16.351  -3.550  1.00 47.20  ? 573 VAL B C     1 
ATOM   7921  O  O     . VAL B 1 573 ? 19.271  15.886  -2.484  1.00 49.38  ? 573 VAL B O     1 
ATOM   7922  C  CB    . VAL B 1 573 ? 21.673  14.801  -3.769  1.00 39.38  ? 573 VAL B CB    1 
ATOM   7923  C  CG1   . VAL B 1 573 ? 20.868  13.899  -4.708  1.00 31.36  ? 573 VAL B CG1   1 
ATOM   7924  C  CG2   . VAL B 1 573 ? 23.146  14.713  -4.099  1.00 43.26  ? 573 VAL B CG2   1 
ATOM   7925  N  N     . ARG B 1 574 ? 18.943  17.035  -4.399  1.00 38.43  ? 574 ARG B N     1 
ATOM   7926  C  CA    . ARG B 1 574 ? 17.505  17.199  -4.141  1.00 45.69  ? 574 ARG B CA    1 
ATOM   7927  C  C     . ARG B 1 574 ? 16.659  16.190  -4.899  1.00 52.94  ? 574 ARG B C     1 
ATOM   7928  O  O     . ARG B 1 574 ? 16.806  16.085  -6.114  1.00 56.62  ? 574 ARG B O     1 
ATOM   7929  C  CB    . ARG B 1 574 ? 17.001  18.588  -4.482  1.00 38.60  ? 574 ARG B CB    1 
ATOM   7930  C  CG    . ARG B 1 574 ? 17.557  19.739  -3.634  1.00 53.95  ? 574 ARG B CG    1 
ATOM   7931  C  CD    . ARG B 1 574 ? 18.490  20.480  -4.447  1.00 52.06  ? 574 ARG B CD    1 
ATOM   7932  N  NE    . ARG B 1 574 ? 19.196  21.644  -3.912  1.00 56.44  ? 574 ARG B NE    1 
ATOM   7933  C  CZ    . ARG B 1 574 ? 18.823  22.909  -4.021  1.00 60.40  ? 574 ARG B CZ    1 
ATOM   7934  N  NH1   . ARG B 1 574 ? 17.750  23.235  -4.726  1.00 69.25  ? 574 ARG B NH1   1 
ATOM   7935  N  NH2   . ARG B 1 574 ? 19.594  23.848  -3.487  1.00 63.32  ? 574 ARG B NH2   1 
ATOM   7936  N  N     . LYS B 1 575 ? 15.709  15.534  -4.216  1.00 51.62  ? 575 LYS B N     1 
ATOM   7937  C  CA    . LYS B 1 575 ? 14.909  14.446  -4.799  1.00 55.43  ? 575 LYS B CA    1 
ATOM   7938  C  C     . LYS B 1 575 ? 13.657  15.034  -5.455  1.00 64.82  ? 575 LYS B C     1 
ATOM   7939  O  O     . LYS B 1 575 ? 12.966  14.359  -6.205  1.00 82.96  ? 575 LYS B O     1 
ATOM   7940  C  CB    . LYS B 1 575 ? 14.464  13.403  -3.757  1.00 56.63  ? 575 LYS B CB    1 
ATOM   7941  C  CG    . LYS B 1 575 ? 15.557  12.721  -2.948  1.00 68.20  ? 575 LYS B CG    1 
ATOM   7942  C  CD    . LYS B 1 575 ? 14.969  11.606  -2.053  1.00 73.26  ? 575 LYS B CD    1 
ATOM   7943  C  CE    . LYS B 1 575 ? 14.025  12.236  -1.040  1.00 74.97  ? 575 LYS B CE    1 
ATOM   7944  N  NZ    . LYS B 1 575 ? 14.768  13.070  -0.050  1.00 77.31  ? 575 LYS B NZ    1 
ATOM   7945  N  N     . SER B 1 576 ? 13.413  16.310  -5.199  1.00 67.06  ? 576 SER B N     1 
ATOM   7946  C  CA    . SER B 1 576 ? 12.311  17.043  -5.801  1.00 76.62  ? 576 SER B CA    1 
ATOM   7947  C  C     . SER B 1 576 ? 12.877  18.348  -6.284  1.00 67.88  ? 576 SER B C     1 
ATOM   7948  O  O     . SER B 1 576 ? 13.710  18.940  -5.604  1.00 74.88  ? 576 SER B O     1 
ATOM   7949  C  CB    . SER B 1 576 ? 11.232  17.512  -4.837  1.00 76.37  ? 576 SER B CB    1 
ATOM   7950  O  OG    . SER B 1 576 ? 10.564  16.641  -4.020  1.00 88.00  ? 576 SER B OG    1 
ATOM   7951  N  N     . GLY B 1 577 ? 12.363  18.839  -7.407  1.00 58.86  ? 577 GLY B N     1 
ATOM   7952  C  CA    . GLY B 1 577 ? 12.651  20.191  -7.839  1.00 56.78  ? 577 GLY B CA    1 
ATOM   7953  C  C     . GLY B 1 577 ? 13.375  20.169  -9.162  1.00 55.54  ? 577 GLY B C     1 
ATOM   7954  O  O     . GLY B 1 577 ? 13.661  21.206  -9.780  1.00 51.13  ? 577 GLY B O     1 
ATOM   7955  N  N     . GLY B 1 578 ? 13.693  18.955  -9.586  1.00 56.59  ? 578 GLY B N     1 
ATOM   7956  C  CA    . GLY B 1 578 ? 14.433  18.761  -10.817 1.00 64.26  ? 578 GLY B CA    1 
ATOM   7957  C  C     . GLY B 1 578 ? 13.543  18.772  -12.035 1.00 67.05  ? 578 GLY B C     1 
ATOM   7958  O  O     . GLY B 1 578 ? 13.990  18.948  -13.166 1.00 71.37  ? 578 GLY B O     1 
ATOM   7959  N  N     . GLY B 1 579 ? 12.256  18.587  -11.802 1.00 63.25  ? 579 GLY B N     1 
ATOM   7960  C  CA    . GLY B 1 579 ? 11.316  18.633  -12.895 1.00 54.79  ? 579 GLY B CA    1 
ATOM   7961  C  C     . GLY B 1 579 ? 11.376  17.335  -13.665 1.00 58.06  ? 579 GLY B C     1 
ATOM   7962  O  O     . GLY B 1 579 ? 11.625  16.268  -13.105 1.00 63.82  ? 579 GLY B O     1 
ATOM   7963  N  N     . ARG B 1 580 ? 11.115  17.429  -14.956 1.00 62.74  ? 580 ARG B N     1 
ATOM   7964  C  CA    . ARG B 1 580 ? 11.102  16.208  -15.703 1.00 54.60  ? 580 ARG B CA    1 
ATOM   7965  C  C     . ARG B 1 580 ? 11.947  16.284  -17.009 1.00 71.82  ? 580 ARG B C     1 
ATOM   7966  O  O     . ARG B 1 580 ? 12.157  17.375  -17.541 1.00 66.00  ? 580 ARG B O     1 
ATOM   7967  C  CB    . ARG B 1 580 ? 9.660   15.854  -15.950 1.00 62.43  ? 580 ARG B CB    1 
ATOM   7968  C  CG    . ARG B 1 580 ? 9.302   14.608  -15.207 1.00 67.55  ? 580 ARG B CG    1 
ATOM   7969  C  CD    . ARG B 1 580 ? 7.863   14.388  -15.154 1.00 87.47  ? 580 ARG B CD    1 
ATOM   7970  N  NE    . ARG B 1 580 ? 7.590   13.130  -14.472 1.00 80.22  ? 580 ARG B NE    1 
ATOM   7971  C  CZ    . ARG B 1 580 ? 7.204   13.024  -13.223 1.00 60.64  ? 580 ARG B CZ    1 
ATOM   7972  N  NH1   . ARG B 1 580 ? 6.903   14.091  -12.522 1.00 72.97  ? 580 ARG B NH1   1 
ATOM   7973  N  NH2   . ARG B 1 580 ? 6.978   11.812  -12.757 1.00 50.71  ? 580 ARG B NH2   1 
ATOM   7974  N  N     . VAL B 1 581 ? 12.411  15.138  -17.525 1.00 58.66  ? 581 VAL B N     1 
ATOM   7975  C  CA    . VAL B 1 581 ? 13.199  15.135  -18.774 1.00 58.76  ? 581 VAL B CA    1 
ATOM   7976  C  C     . VAL B 1 581 ? 12.712  14.066  -19.767 1.00 59.19  ? 581 VAL B C     1 
ATOM   7977  O  O     . VAL B 1 581 ? 12.495  12.902  -19.411 1.00 73.28  ? 581 VAL B O     1 
ATOM   7978  C  CB    . VAL B 1 581 ? 14.744  14.955  -18.540 1.00 60.20  ? 581 VAL B CB    1 
ATOM   7979  C  CG1   . VAL B 1 581 ? 15.319  16.096  -17.675 1.00 46.81  ? 581 VAL B CG1   1 
ATOM   7980  C  CG2   . VAL B 1 581 ? 15.104  13.578  -17.960 1.00 64.67  ? 581 VAL B CG2   1 
ATOM   7981  N  N     . TYR B 1 582 ? 12.514  14.479  -21.018 1.00 53.92  ? 582 TYR B N     1 
ATOM   7982  C  CA    . TYR B 1 582 ? 11.993  13.587  -22.053 1.00 53.75  ? 582 TYR B CA    1 
ATOM   7983  C  C     . TYR B 1 582 ? 12.943  13.641  -23.237 1.00 52.03  ? 582 TYR B C     1 
ATOM   7984  O  O     . TYR B 1 582 ? 13.482  14.680  -23.545 1.00 46.78  ? 582 TYR B O     1 
ATOM   7985  C  CB    . TYR B 1 582 ? 10.600  13.999  -22.472 1.00 53.90  ? 582 TYR B CB    1 
ATOM   7986  C  CG    . TYR B 1 582 ? 9.583   14.011  -21.357 1.00 56.14  ? 582 TYR B CG    1 
ATOM   7987  C  CD1   . TYR B 1 582 ? 9.109   12.827  -20.800 1.00 56.55  ? 582 TYR B CD1   1 
ATOM   7988  C  CD2   . TYR B 1 582 ? 9.101   15.216  -20.854 1.00 59.86  ? 582 TYR B CD2   1 
ATOM   7989  C  CE1   . TYR B 1 582 ? 8.163   12.850  -19.781 1.00 72.92  ? 582 TYR B CE1   1 
ATOM   7990  C  CE2   . TYR B 1 582 ? 8.169   15.254  -19.839 1.00 67.54  ? 582 TYR B CE2   1 
ATOM   7991  C  CZ    . TYR B 1 582 ? 7.700   14.072  -19.294 1.00 81.55  ? 582 TYR B CZ    1 
ATOM   7992  O  OH    . TYR B 1 582 ? 6.767   14.129  -18.268 1.00 85.26  ? 582 TYR B OH    1 
ATOM   7993  N  N     . PRO B 1 583 ? 13.199  12.493  -23.880 1.00 58.33  ? 583 PRO B N     1 
ATOM   7994  C  CA    . PRO B 1 583 ? 14.047  12.520  -25.075 1.00 69.08  ? 583 PRO B CA    1 
ATOM   7995  C  C     . PRO B 1 583 ? 13.362  13.250  -26.227 1.00 82.26  ? 583 PRO B C     1 
ATOM   7996  O  O     . PRO B 1 583 ? 12.152  13.131  -26.384 1.00 98.43  ? 583 PRO B O     1 
ATOM   7997  C  CB    . PRO B 1 583 ? 14.238  11.044  -25.413 1.00 74.85  ? 583 PRO B CB    1 
ATOM   7998  C  CG    . PRO B 1 583 ? 13.152  10.340  -24.702 1.00 70.78  ? 583 PRO B CG    1 
ATOM   7999  C  CD    . PRO B 1 583 ? 12.843  11.119  -23.490 1.00 62.20  ? 583 PRO B CD    1 
ATOM   8000  N  N     . VAL B 1 584 ? 14.135  13.978  -27.024 1.00 75.64  ? 584 VAL B N     1 
ATOM   8001  C  CA    . VAL B 1 584 ? 13.641  14.631  -28.234 1.00 72.92  ? 584 VAL B CA    1 
ATOM   8002  C  C     . VAL B 1 584 ? 13.276  13.507  -29.198 1.00 86.98  ? 584 VAL B C     1 
ATOM   8003  O  O     . VAL B 1 584 ? 12.269  13.598  -29.903 1.00 87.87  ? 584 VAL B O     1 
ATOM   8004  C  CB    . VAL B 1 584 ? 14.654  15.571  -28.868 1.00 70.07  ? 584 VAL B CB    1 
ATOM   8005  C  CG1   . VAL B 1 584 ? 14.093  16.145  -30.157 1.00 64.47  ? 584 VAL B CG1   1 
ATOM   8006  C  CG2   . VAL B 1 584 ? 14.961  16.707  -27.924 1.00 72.93  ? 584 VAL B CG2   1 
ATOM   8007  N  N     . GLN B 1 585 ? 14.117  12.468  -29.249 1.00 92.32  ? 585 GLN B N     1 
ATOM   8008  C  CA    . GLN B 1 585 ? 13.833  11.305  -30.088 1.00 92.26  ? 585 GLN B CA    1 
ATOM   8009  C  C     . GLN B 1 585 ? 14.244  10.009  -29.388 1.00 91.20  ? 585 GLN B C     1 
ATOM   8010  O  O     . GLN B 1 585 ? 15.109  10.008  -28.518 1.00 101.97 ? 585 GLN B O     1 
ATOM   8011  C  CB    . GLN B 1 585 ? 14.565  11.421  -31.406 1.00 96.24  ? 585 GLN B CB    1 
ATOM   8012  N  N     . GLY B 1 586 ? 13.589  8.908   -29.750 1.00 90.25  ? 586 GLY B N     1 
ATOM   8013  C  CA    . GLY B 1 586 ? 13.978  7.616   -29.211 1.00 87.57  ? 586 GLY B CA    1 
ATOM   8014  C  C     . GLY B 1 586 ? 13.441  7.269   -27.846 1.00 88.72  ? 586 GLY B C     1 
ATOM   8015  O  O     . GLY B 1 586 ? 12.528  7.923   -27.344 1.00 85.75  ? 586 GLY B O     1 
ATOM   8016  N  N     . ARG B 1 587 ? 13.985  6.198   -27.268 1.00 91.00  ? 587 ARG B N     1 
ATOM   8017  C  CA    . ARG B 1 587 ? 13.484  5.664   -25.999 1.00 102.43 ? 587 ARG B CA    1 
ATOM   8018  C  C     . ARG B 1 587 ? 14.205  6.409   -24.882 1.00 90.82  ? 587 ARG B C     1 
ATOM   8019  O  O     . ARG B 1 587 ? 15.266  6.993   -25.106 1.00 88.83  ? 587 ARG B O     1 
ATOM   8020  C  CB    . ARG B 1 587 ? 13.719  4.168   -25.883 1.00 114.54 ? 587 ARG B CB    1 
ATOM   8021  N  N     . LEU B 1 588 ? 13.615  6.430   -23.694 1.00 83.47  ? 588 LEU B N     1 
ATOM   8022  C  CA    . LEU B 1 588 ? 14.236  7.126   -22.564 1.00 85.62  ? 588 LEU B CA    1 
ATOM   8023  C  C     . LEU B 1 588 ? 15.153  6.186   -21.744 1.00 79.20  ? 588 LEU B C     1 
ATOM   8024  O  O     . LEU B 1 588 ? 14.689  5.199   -21.158 1.00 83.80  ? 588 LEU B O     1 
ATOM   8025  C  CB    . LEU B 1 588 ? 13.157  7.782   -21.699 1.00 78.42  ? 588 LEU B CB    1 
ATOM   8026  C  CG    . LEU B 1 588 ? 13.621  8.408   -20.405 1.00 68.79  ? 588 LEU B CG    1 
ATOM   8027  C  CD1   . LEU B 1 588 ? 14.629  9.445   -20.838 1.00 65.28  ? 588 LEU B CD1   1 
ATOM   8028  C  CD2   . LEU B 1 588 ? 12.436  9.096   -19.777 1.00 66.11  ? 588 LEU B CD2   1 
ATOM   8029  N  N     . ALA B 1 589 ? 16.440  6.506   -21.665 1.00 68.07  ? 589 ALA B N     1 
ATOM   8030  C  CA    . ALA B 1 589 ? 17.378  5.666   -20.903 1.00 61.28  ? 589 ALA B CA    1 
ATOM   8031  C  C     . ALA B 1 589 ? 17.946  6.438   -19.716 1.00 64.22  ? 589 ALA B C     1 
ATOM   8032  O  O     . ALA B 1 589 ? 18.077  7.668   -19.756 1.00 62.17  ? 589 ALA B O     1 
ATOM   8033  C  CB    . ALA B 1 589 ? 18.507  5.137   -21.793 1.00 32.09  ? 589 ALA B CB    1 
ATOM   8034  N  N     . ASP B 1 590 ? 18.293  5.716   -18.654 1.00 61.95  ? 590 ASP B N     1 
ATOM   8035  C  CA    . ASP B 1 590 ? 18.881  6.411   -17.514 1.00 63.14  ? 590 ASP B CA    1 
ATOM   8036  C  C     . ASP B 1 590 ? 20.360  6.672   -17.754 1.00 61.52  ? 590 ASP B C     1 
ATOM   8037  O  O     . ASP B 1 590 ? 20.885  6.327   -18.810 1.00 39.30  ? 590 ASP B O     1 
ATOM   8038  C  CB    . ASP B 1 590 ? 18.688  5.650   -16.177 1.00 54.19  ? 590 ASP B CB    1 
ATOM   8039  C  CG    . ASP B 1 590 ? 19.230  4.229   -16.185 1.00 60.75  ? 590 ASP B CG    1 
ATOM   8040  O  OD1   . ASP B 1 590 ? 20.331  3.997   -16.698 1.00 69.90  ? 590 ASP B OD1   1 
ATOM   8041  O  OD2   . ASP B 1 590 ? 18.634  3.373   -15.498 1.00 67.65  ? 590 ASP B OD2   1 
ATOM   8042  N  N     . GLY B 1 591 ? 21.017  7.276   -16.763 1.00 69.06  ? 591 GLY B N     1 
ATOM   8043  C  CA    . GLY B 1 591 ? 22.383  7.755   -16.900 1.00 54.27  ? 591 GLY B CA    1 
ATOM   8044  C  C     . GLY B 1 591 ? 22.498  9.025   -17.715 1.00 53.00  ? 591 GLY B C     1 
ATOM   8045  O  O     . GLY B 1 591 ? 23.465  9.227   -18.441 1.00 51.39  ? 591 GLY B O     1 
ATOM   8046  N  N     . LEU B 1 592 ? 21.494  9.886   -17.573 1.00 57.16  ? 592 LEU B N     1 
ATOM   8047  C  CA    . LEU B 1 592 ? 21.474  11.181  -18.250 1.00 57.31  ? 592 LEU B CA    1 
ATOM   8048  C  C     . LEU B 1 592 ? 21.951  12.332  -17.353 1.00 60.28  ? 592 LEU B C     1 
ATOM   8049  O  O     . LEU B 1 592 ? 21.580  12.446  -16.185 1.00 64.05  ? 592 LEU B O     1 
ATOM   8050  C  CB    . LEU B 1 592 ? 20.065  11.506  -18.757 1.00 57.91  ? 592 LEU B CB    1 
ATOM   8051  C  CG    . LEU B 1 592 ? 19.779  11.111  -20.206 1.00 63.16  ? 592 LEU B CG    1 
ATOM   8052  C  CD1   . LEU B 1 592 ? 18.297  11.306  -20.537 1.00 61.87  ? 592 LEU B CD1   1 
ATOM   8053  C  CD2   . LEU B 1 592 ? 20.667  11.927  -21.143 1.00 60.21  ? 592 LEU B CD2   1 
ATOM   8054  N  N     . TYR B 1 593 ? 22.881  13.107  -17.865 1.00 49.67  ? 593 TYR B N     1 
ATOM   8055  C  CA    . TYR B 1 593 ? 23.362  14.278  -17.168 1.00 44.89  ? 593 TYR B CA    1 
ATOM   8056  C  C     . TYR B 1 593 ? 22.935  15.559  -17.913 1.00 46.11  ? 593 TYR B C     1 
ATOM   8057  O  O     . TYR B 1 593 ? 23.223  15.726  -19.098 1.00 45.95  ? 593 TYR B O     1 
ATOM   8058  C  CB    . TYR B 1 593 ? 24.878  14.134  -16.950 1.00 45.99  ? 593 TYR B CB    1 
ATOM   8059  C  CG    . TYR B 1 593 ? 25.643  15.425  -16.834 1.00 48.28  ? 593 TYR B CG    1 
ATOM   8060  C  CD1   . TYR B 1 593 ? 25.455  16.260  -15.776 1.00 56.22  ? 593 TYR B CD1   1 
ATOM   8061  C  CD2   . TYR B 1 593 ? 26.704  15.688  -17.677 1.00 54.51  ? 593 TYR B CD2   1 
ATOM   8062  C  CE1   . TYR B 1 593 ? 26.179  17.413  -15.653 1.00 63.71  ? 593 TYR B CE1   1 
ATOM   8063  C  CE2   . TYR B 1 593 ? 27.445  16.827  -17.551 1.00 63.86  ? 593 TYR B CE2   1 
ATOM   8064  C  CZ    . TYR B 1 593 ? 27.181  17.681  -16.539 1.00 68.44  ? 593 TYR B CZ    1 
ATOM   8065  O  OH    . TYR B 1 593 ? 27.919  18.830  -16.418 1.00 80.08  ? 593 TYR B OH    1 
ATOM   8066  N  N     . VAL B 1 594 ? 22.286  16.492  -17.232 1.00 44.95  ? 594 VAL B N     1 
ATOM   8067  C  CA    . VAL B 1 594 ? 21.795  17.680  -17.937 1.00 44.75  ? 594 VAL B CA    1 
ATOM   8068  C  C     . VAL B 1 594 ? 22.201  18.930  -17.253 1.00 43.97  ? 594 VAL B C     1 
ATOM   8069  O  O     . VAL B 1 594 ? 21.541  19.350  -16.333 1.00 60.24  ? 594 VAL B O     1 
ATOM   8070  C  CB    . VAL B 1 594 ? 20.274  17.743  -18.056 1.00 50.83  ? 594 VAL B CB    1 
ATOM   8071  C  CG1   . VAL B 1 594 ? 19.883  18.992  -18.847 1.00 47.07  ? 594 VAL B CG1   1 
ATOM   8072  C  CG2   . VAL B 1 594 ? 19.693  16.466  -18.663 1.00 43.32  ? 594 VAL B CG2   1 
ATOM   8073  N  N     . PRO B 1 595 ? 23.319  19.514  -17.649 1.00 52.94  ? 595 PRO B N     1 
ATOM   8074  C  CA    . PRO B 1 595 ? 23.722  20.762  -17.003 1.00 54.41  ? 595 PRO B CA    1 
ATOM   8075  C  C     . PRO B 1 595 ? 22.746  21.878  -17.315 1.00 60.43  ? 595 PRO B C     1 
ATOM   8076  O  O     . PRO B 1 595 ? 22.272  21.951  -18.428 1.00 68.80  ? 595 PRO B O     1 
ATOM   8077  C  CB    . PRO B 1 595 ? 25.142  21.012  -17.542 1.00 50.69  ? 595 PRO B CB    1 
ATOM   8078  C  CG    . PRO B 1 595 ? 25.201  20.288  -18.757 1.00 64.01  ? 595 PRO B CG    1 
ATOM   8079  C  CD    . PRO B 1 595 ? 24.329  19.064  -18.612 1.00 65.67  ? 595 PRO B CD    1 
ATOM   8080  N  N     . LEU B 1 596 ? 22.284  22.568  -16.289 1.00 63.02  ? 596 LEU B N     1 
ATOM   8081  C  CA    . LEU B 1 596 ? 21.396  23.681  -16.511 1.00 68.62  ? 596 LEU B CA    1 
ATOM   8082  C  C     . LEU B 1 596 ? 22.169  24.963  -16.310 1.00 83.18  ? 596 LEU B C     1 
ATOM   8083  O  O     . LEU B 1 596 ? 23.080  25.228  -17.082 1.00 99.90  ? 596 LEU B O     1 
ATOM   8084  C  CB    . LEU B 1 596 ? 20.210  23.617  -15.550 1.00 66.88  ? 596 LEU B CB    1 
ATOM   8085  C  CG    . LEU B 1 596 ? 19.350  22.374  -15.731 1.00 69.45  ? 596 LEU B CG    1 
ATOM   8086  C  CD1   . LEU B 1 596 ? 18.191  22.421  -14.754 1.00 73.73  ? 596 LEU B CD1   1 
ATOM   8087  C  CD2   . LEU B 1 596 ? 18.831  22.304  -17.187 1.00 66.23  ? 596 LEU B CD2   1 
ATOM   8088  N  N     . GLU B 1 597 ? 21.936  25.676  -15.225 1.00 92.59  ? 597 GLU B N     1 
ATOM   8089  C  CA    . GLU B 1 597 ? 22.738  26.847  -15.079 1.00 95.85  ? 597 GLU B CA    1 
ATOM   8090  C  C     . GLU B 1 597 ? 24.125  26.427  -14.703 1.00 89.58  ? 597 GLU B C     1 
ATOM   8091  O  O     . GLU B 1 597 ? 24.460  25.227  -14.797 1.00 74.46  ? 597 GLU B O     1 
ATOM   8092  C  CB    . GLU B 1 597 ? 22.141  27.782  -14.017 1.00 97.90  ? 597 GLU B CB    1 
ATOM   8093  N  N     . ASP B 1 598 ? 24.989  27.367  -14.324 1.00 90.40  ? 598 ASP B N     1 
ATOM   8094  C  CA    . ASP B 1 598 ? 26.281  26.941  -13.835 1.00 100.44 ? 598 ASP B CA    1 
ATOM   8095  C  C     . ASP B 1 598 ? 26.081  26.373  -12.422 1.00 104.57 ? 598 ASP B C     1 
ATOM   8096  O  O     . ASP B 1 598 ? 25.346  26.928  -11.584 1.00 94.77  ? 598 ASP B O     1 
ATOM   8097  C  CB    . ASP B 1 598 ? 27.379  27.996  -13.914 1.00 126.46 ? 598 ASP B CB    1 
ATOM   8098  C  CG    . ASP B 1 598 ? 28.686  27.359  -14.335 1.00 127.77 ? 598 ASP B CG    1 
ATOM   8099  O  OD1   . ASP B 1 598 ? 28.788  26.135  -14.043 1.00 127.24 ? 598 ASP B OD1   1 
ATOM   8100  O  OD2   . ASP B 1 598 ? 29.584  27.993  -14.911 1.00 130.80 ? 598 ASP B OD2   1 
ATOM   8101  N  N     . LYS B 1 599 ? 26.828  25.306  -12.184 1.00 116.37 ? 599 LYS B N     1 
ATOM   8102  C  CA    . LYS B 1 599 ? 26.903  24.577  -10.937 1.00 94.89  ? 599 LYS B CA    1 
ATOM   8103  C  C     . LYS B 1 599 ? 25.592  23.858  -10.540 1.00 66.20  ? 599 LYS B C     1 
ATOM   8104  O  O     . LYS B 1 599 ? 25.512  23.343  -9.443  1.00 75.77  ? 599 LYS B O     1 
ATOM   8105  C  CB    . LYS B 1 599 ? 27.264  25.491  -9.745  1.00 84.14  ? 599 LYS B CB    1 
ATOM   8106  C  CG    . LYS B 1 599 ? 28.591  26.160  -9.972  1.00 78.35  ? 599 LYS B CG    1 
ATOM   8107  C  CD    . LYS B 1 599 ? 29.787  25.248  -9.977  1.00 74.54  ? 599 LYS B CD    1 
ATOM   8108  C  CE    . LYS B 1 599 ? 31.062  25.904  -9.480  1.00 80.68  ? 599 LYS B CE    1 
ATOM   8109  N  NZ    . LYS B 1 599 ? 32.063  24.945  -8.967  1.00 86.76  ? 599 LYS B NZ    1 
ATOM   8110  N  N     . THR B 1 600 ? 24.632  23.757  -11.453 1.00 66.95  ? 600 THR B N     1 
ATOM   8111  C  CA    . THR B 1 600 ? 23.361  23.146  -11.116 1.00 64.39  ? 600 THR B CA    1 
ATOM   8112  C  C     . THR B 1 600 ? 23.075  22.177  -12.262 1.00 60.61  ? 600 THR B C     1 
ATOM   8113  O  O     . THR B 1 600 ? 23.201  22.536  -13.437 1.00 67.20  ? 600 THR B O     1 
ATOM   8114  C  CB    . THR B 1 600 ? 22.158  24.137  -11.008 1.00 52.23  ? 600 THR B CB    1 
ATOM   8115  O  OG1   . THR B 1 600 ? 22.435  25.176  -10.064 1.00 69.40  ? 600 THR B OG1   1 
ATOM   8116  C  CG2   . THR B 1 600 ? 20.869  23.407  -10.633 1.00 48.79  ? 600 THR B CG2   1 
ATOM   8117  N  N     . PHE B 1 601 ? 22.670  20.941  -11.945 1.00 44.48  ? 601 PHE B N     1 
ATOM   8118  C  CA    . PHE B 1 601 ? 22.366  20.021  -13.047 1.00 52.45  ? 601 PHE B CA    1 
ATOM   8119  C  C     . PHE B 1 601 ? 21.390  18.929  -12.677 1.00 54.65  ? 601 PHE B C     1 
ATOM   8120  O  O     . PHE B 1 601 ? 21.257  18.592  -11.508 1.00 59.83  ? 601 PHE B O     1 
ATOM   8121  C  CB    . PHE B 1 601 ? 23.643  19.368  -13.616 1.00 51.35  ? 601 PHE B CB    1 
ATOM   8122  C  CG    . PHE B 1 601 ? 24.369  18.431  -12.674 1.00 51.87  ? 601 PHE B CG    1 
ATOM   8123  C  CD1   . PHE B 1 601 ? 25.374  18.908  -11.818 1.00 58.88  ? 601 PHE B CD1   1 
ATOM   8124  C  CD2   . PHE B 1 601 ? 24.098  17.059  -12.678 1.00 57.29  ? 601 PHE B CD2   1 
ATOM   8125  C  CE1   . PHE B 1 601 ? 26.081  18.026  -10.959 1.00 56.83  ? 601 PHE B CE1   1 
ATOM   8126  C  CE2   . PHE B 1 601 ? 24.790  16.168  -11.822 1.00 59.11  ? 601 PHE B CE2   1 
ATOM   8127  C  CZ    . PHE B 1 601 ? 25.782  16.653  -10.965 1.00 55.31  ? 601 PHE B CZ    1 
ATOM   8128  N  N     . LEU B 1 602 ? 20.710  18.374  -13.678 1.00 41.74  ? 602 LEU B N     1 
ATOM   8129  C  CA    . LEU B 1 602 ? 19.824  17.235  -13.439 1.00 39.32  ? 602 LEU B CA    1 
ATOM   8130  C  C     . LEU B 1 602 ? 20.558  15.942  -13.727 1.00 52.22  ? 602 LEU B C     1 
ATOM   8131  O  O     . LEU B 1 602 ? 21.508  15.903  -14.497 1.00 51.67  ? 602 LEU B O     1 
ATOM   8132  C  CB    . LEU B 1 602 ? 18.561  17.320  -14.302 1.00 48.78  ? 602 LEU B CB    1 
ATOM   8133  C  CG    . LEU B 1 602 ? 17.878  18.687  -14.285 1.00 56.71  ? 602 LEU B CG    1 
ATOM   8134  C  CD1   . LEU B 1 602 ? 16.618  18.701  -15.125 1.00 55.78  ? 602 LEU B CD1   1 
ATOM   8135  C  CD2   . LEU B 1 602 ? 17.504  18.990  -12.828 1.00 49.02  ? 602 LEU B CD2   1 
ATOM   8136  N  N     . LEU B 1 603 ? 20.145  14.885  -13.049 1.00 54.17  ? 603 LEU B N     1 
ATOM   8137  C  CA    . LEU B 1 603 ? 20.794  13.602  -13.232 1.00 41.29  ? 603 LEU B CA    1 
ATOM   8138  C  C     . LEU B 1 603 ? 19.721  12.530  -13.145 1.00 44.56  ? 603 LEU B C     1 
ATOM   8139  O  O     . LEU B 1 603 ? 19.159  12.273  -12.090 1.00 58.83  ? 603 LEU B O     1 
ATOM   8140  C  CB    . LEU B 1 603 ? 21.878  13.408  -12.182 1.00 49.80  ? 603 LEU B CB    1 
ATOM   8141  C  CG    . LEU B 1 603 ? 22.741  12.178  -12.374 1.00 54.27  ? 603 LEU B CG    1 
ATOM   8142  C  CD1   . LEU B 1 603 ? 23.566  12.392  -13.646 1.00 49.10  ? 603 LEU B CD1   1 
ATOM   8143  C  CD2   . LEU B 1 603 ? 23.665  11.934  -11.171 1.00 43.16  ? 603 LEU B CD2   1 
ATOM   8144  N  N     . LEU B 1 604 ? 19.440  11.908  -14.267 1.00 46.30  ? 604 LEU B N     1 
ATOM   8145  C  CA    . LEU B 1 604 ? 18.563  10.760  -14.329 1.00 46.14  ? 604 LEU B CA    1 
ATOM   8146  C  C     . LEU B 1 604 ? 19.405  9.533   -14.080 1.00 53.93  ? 604 LEU B C     1 
ATOM   8147  O  O     . LEU B 1 604 ? 20.227  9.135   -14.927 1.00 62.55  ? 604 LEU B O     1 
ATOM   8148  C  CB    . LEU B 1 604 ? 17.884  10.655  -15.699 1.00 55.71  ? 604 LEU B CB    1 
ATOM   8149  C  CG    . LEU B 1 604 ? 16.482  10.058  -15.775 1.00 57.80  ? 604 LEU B CG    1 
ATOM   8150  C  CD1   . LEU B 1 604 ? 15.578  10.633  -14.724 1.00 61.49  ? 604 LEU B CD1   1 
ATOM   8151  C  CD2   . LEU B 1 604 ? 15.922  10.252  -17.158 1.00 62.83  ? 604 LEU B CD2   1 
ATOM   8152  N  N     . THR B 1 605 ? 19.222  8.955   -12.905 1.00 44.48  ? 605 THR B N     1 
ATOM   8153  C  CA    . THR B 1 605 ? 20.048  7.837   -12.481 1.00 50.22  ? 605 THR B CA    1 
ATOM   8154  C  C     . THR B 1 605 ? 19.445  6.472   -12.705 1.00 50.47  ? 605 THR B C     1 
ATOM   8155  O  O     . THR B 1 605 ? 20.153  5.490   -12.925 1.00 71.99  ? 605 THR B O     1 
ATOM   8156  C  CB    . THR B 1 605 ? 20.381  7.966   -10.976 1.00 44.99  ? 605 THR B CB    1 
ATOM   8157  O  OG1   . THR B 1 605 ? 19.148  8.083   -10.232 1.00 53.75  ? 605 THR B OG1   1 
ATOM   8158  C  CG2   . THR B 1 605 ? 21.235  9.193   -10.746 1.00 42.40  ? 605 THR B CG2   1 
ATOM   8159  N  N     . VAL B 1 606 ? 18.128  6.421   -12.599 1.00 51.44  ? 606 VAL B N     1 
ATOM   8160  C  CA    . VAL B 1 606 ? 17.393  5.176   -12.712 1.00 56.16  ? 606 VAL B CA    1 
ATOM   8161  C  C     . VAL B 1 606 ? 16.137  5.392   -13.526 1.00 60.59  ? 606 VAL B C     1 
ATOM   8162  O  O     . VAL B 1 606 ? 15.492  6.446   -13.445 1.00 82.17  ? 606 VAL B O     1 
ATOM   8163  C  CB    . VAL B 1 606 ? 17.047  4.611   -11.318 1.00 59.60  ? 606 VAL B CB    1 
ATOM   8164  C  CG1   . VAL B 1 606 ? 18.307  4.154   -10.597 1.00 58.15  ? 606 VAL B CG1   1 
ATOM   8165  C  CG2   . VAL B 1 606 ? 16.227  5.618   -10.513 1.00 38.66  ? 606 VAL B CG2   1 
ATOM   8166  N  N     . HIS B 1 607 ? 15.784  4.368   -14.295 1.00 55.50  ? 607 HIS B N     1 
ATOM   8167  C  CA    . HIS B 1 607 ? 14.538  4.345   -15.057 1.00 60.40  ? 607 HIS B CA    1 
ATOM   8168  C  C     . HIS B 1 607 ? 14.150  2.944   -15.444 1.00 59.36  ? 607 HIS B C     1 
ATOM   8169  O  O     . HIS B 1 607 ? 14.976  2.160   -15.887 1.00 64.10  ? 607 HIS B O     1 
ATOM   8170  C  CB    . HIS B 1 607 ? 14.554  5.211   -16.289 1.00 70.89  ? 607 HIS B CB    1 
ATOM   8171  C  CG    . HIS B 1 607 ? 13.335  5.015   -17.139 1.00 73.08  ? 607 HIS B CG    1 
ATOM   8172  N  ND1   . HIS B 1 607 ? 12.054  5.248   -16.673 1.00 64.36  ? 607 HIS B ND1   1 
ATOM   8173  C  CD2   . HIS B 1 607 ? 13.201  4.611   -18.427 1.00 63.39  ? 607 HIS B CD2   1 
ATOM   8174  C  CE1   . HIS B 1 607 ? 11.188  4.998   -17.638 1.00 63.86  ? 607 HIS B CE1   1 
ATOM   8175  N  NE2   . HIS B 1 607 ? 11.858  4.602   -18.709 1.00 60.66  ? 607 HIS B NE2   1 
ATOM   8176  N  N     . ARG B 1 608 ? 12.886  2.633   -15.209 1.00 65.90  ? 608 ARG B N     1 
ATOM   8177  C  CA    . ARG B 1 608 ? 12.267  1.420   -15.685 1.00 72.85  ? 608 ARG B CA    1 
ATOM   8178  C  C     . ARG B 1 608 ? 10.955  1.702   -16.425 1.00 88.51  ? 608 ARG B C     1 
ATOM   8179  O  O     . ARG B 1 608 ? 10.168  2.552   -15.962 1.00 95.20  ? 608 ARG B O     1 
ATOM   8180  C  CB    . ARG B 1 608 ? 11.921  0.545   -14.496 1.00 72.85  ? 608 ARG B CB    1 
ATOM   8181  C  CG    . ARG B 1 608 ? 13.087  0.020   -13.707 1.00 66.63  ? 608 ARG B CG    1 
ATOM   8182  C  CD    . ARG B 1 608 ? 13.858  -1.016  -14.400 1.00 64.76  ? 608 ARG B CD    1 
ATOM   8183  N  NE    . ARG B 1 608 ? 14.833  -0.438  -15.300 1.00 50.29  ? 608 ARG B NE    1 
ATOM   8184  C  CZ    . ARG B 1 608 ? 15.699  -1.175  -15.982 1.00 61.82  ? 608 ARG B CZ    1 
ATOM   8185  N  NH1   . ARG B 1 608 ? 15.663  -2.510  -15.883 1.00 56.15  ? 608 ARG B NH1   1 
ATOM   8186  N  NH2   . ARG B 1 608 ? 16.566  -0.589  -16.795 1.00 63.79  ? 608 ARG B NH2   1 
ATOM   8187  N  N     . ASP B 1 609 ? 10.774  1.101   -17.605 1.00 79.84  ? 609 ASP B N     1 
ATOM   8188  C  CA    . ASP B 1 609 ? 9.609   1.397   -18.434 1.00 73.29  ? 609 ASP B CA    1 
ATOM   8189  C  C     . ASP B 1 609 ? 8.258   1.148   -17.691 1.00 95.87  ? 609 ASP B C     1 
ATOM   8190  O  O     . ASP B 1 609 ? 7.271   1.821   -17.975 1.00 109.15 ? 609 ASP B O     1 
ATOM   8191  C  CB    . ASP B 1 609 ? 9.672   0.577   -19.712 1.00 68.77  ? 609 ASP B CB    1 
ATOM   8192  N  N     . PHE B 1 610 ? 8.226   0.216   -16.734 1.00 82.68  ? 610 PHE B N     1 
ATOM   8193  C  CA    . PHE B 1 610 ? 7.011   -0.171  -16.004 1.00 78.64  ? 610 PHE B CA    1 
ATOM   8194  C  C     . PHE B 1 610 ? 6.739   0.622   -14.728 1.00 85.52  ? 610 PHE B C     1 
ATOM   8195  O  O     . PHE B 1 610 ? 5.741   0.361   -14.050 1.00 90.76  ? 610 PHE B O     1 
ATOM   8196  C  CB    . PHE B 1 610 ? 7.038   -1.658  -15.669 1.00 83.02  ? 610 PHE B CB    1 
ATOM   8197  C  CG    . PHE B 1 610 ? 8.148   -2.052  -14.749 1.00 83.05  ? 610 PHE B CG    1 
ATOM   8198  C  CD1   . PHE B 1 610 ? 9.389   -2.405  -15.259 1.00 79.97  ? 610 PHE B CD1   1 
ATOM   8199  C  CD2   . PHE B 1 610 ? 7.958   -2.067  -13.376 1.00 85.42  ? 610 PHE B CD2   1 
ATOM   8200  C  CE1   . PHE B 1 610 ? 10.421  -2.769  -14.419 1.00 78.01  ? 610 PHE B CE1   1 
ATOM   8201  C  CE2   . PHE B 1 610 ? 8.985   -2.434  -12.528 1.00 86.40  ? 610 PHE B CE2   1 
ATOM   8202  C  CZ    . PHE B 1 610 ? 10.220  -2.784  -13.057 1.00 80.87  ? 610 PHE B CZ    1 
ATOM   8203  N  N     . ARG B 1 611 ? 7.677   1.469   -14.318 1.00 89.36  ? 611 ARG B N     1 
ATOM   8204  C  CA    . ARG B 1 611 ? 7.625   2.083   -12.989 1.00 94.47  ? 611 ARG B CA    1 
ATOM   8205  C  C     . ARG B 1 611 ? 6.820   3.388   -13.032 1.00 95.97  ? 611 ARG B C     1 
ATOM   8206  O  O     . ARG B 1 611 ? 6.279   3.851   -12.014 1.00 94.70  ? 611 ARG B O     1 
ATOM   8207  C  CB    . ARG B 1 611 ? 9.031   2.350   -12.495 1.00 87.48  ? 611 ARG B CB    1 
ATOM   8208  C  CG    . ARG B 1 611 ? 9.318   1.866   -11.107 1.00 75.72  ? 611 ARG B CG    1 
ATOM   8209  C  CD    . ARG B 1 611 ? 10.534  1.075   -11.082 1.00 80.53  ? 611 ARG B CD    1 
ATOM   8210  N  NE    . ARG B 1 611 ? 11.761  1.784   -11.211 1.00 77.71  ? 611 ARG B NE    1 
ATOM   8211  C  CZ    . ARG B 1 611 ? 12.943  1.520   -10.691 1.00 69.74  ? 611 ARG B CZ    1 
ATOM   8212  N  NH1   . ARG B 1 611 ? 13.888  2.389   -10.992 1.00 66.60  ? 611 ARG B NH1   1 
ATOM   8213  N  NH2   . ARG B 1 611 ? 13.244  0.377   -10.072 1.00 69.79  ? 611 ARG B NH2   1 
ATOM   8214  N  N     . GLY B 1 612 ? 6.801   3.993   -14.216 1.00 94.07  ? 612 GLY B N     1 
ATOM   8215  C  CA    . GLY B 1 612 ? 6.175   5.282   -14.422 1.00 82.41  ? 612 GLY B CA    1 
ATOM   8216  C  C     . GLY B 1 612 ? 7.179   6.144   -15.135 1.00 65.42  ? 612 GLY B C     1 
ATOM   8217  O  O     . GLY B 1 612 ? 8.142   5.651   -15.672 1.00 55.54  ? 612 GLY B O     1 
ATOM   8218  N  N     . THR B 1 613 ? 7.027   7.444   -15.016 1.00 69.92  ? 613 THR B N     1 
ATOM   8219  C  CA    . THR B 1 613 ? 7.917   8.387   -15.653 1.00 57.79  ? 613 THR B CA    1 
ATOM   8220  C  C     . THR B 1 613 ? 8.931   8.766   -14.584 1.00 60.53  ? 613 THR B C     1 
ATOM   8221  O  O     . THR B 1 613 ? 8.553   9.113   -13.462 1.00 54.49  ? 613 THR B O     1 
ATOM   8222  C  CB    . THR B 1 613 ? 7.175   9.653   -16.103 1.00 64.29  ? 613 THR B CB    1 
ATOM   8223  O  OG1   . THR B 1 613 ? 5.974   9.318   -16.809 1.00 62.56  ? 613 THR B OG1   1 
ATOM   8224  C  CG2   . THR B 1 613 ? 8.080   10.558  -16.909 1.00 62.34  ? 613 THR B CG2   1 
ATOM   8225  N  N     . PRO B 1 614 ? 10.227  8.678   -14.917 1.00 65.14  ? 614 PRO B N     1 
ATOM   8226  C  CA    . PRO B 1 614 ? 11.389  9.034   -14.084 1.00 60.49  ? 614 PRO B CA    1 
ATOM   8227  C  C     . PRO B 1 614 ? 11.351  10.450  -13.540 1.00 66.55  ? 614 PRO B C     1 
ATOM   8228  O  O     . PRO B 1 614 ? 10.803  11.340  -14.198 1.00 69.31  ? 614 PRO B O     1 
ATOM   8229  C  CB    . PRO B 1 614 ? 12.561  8.943   -15.050 1.00 54.68  ? 614 PRO B CB    1 
ATOM   8230  C  CG    . PRO B 1 614 ? 12.159  8.090   -16.049 1.00 40.61  ? 614 PRO B CG    1 
ATOM   8231  C  CD    . PRO B 1 614 ? 10.675  8.256   -16.253 1.00 52.50  ? 614 PRO B CD    1 
ATOM   8232  N  N     . ARG B 1 615 ? 11.912  10.629  -12.345 1.00 71.53  ? 615 ARG B N     1 
ATOM   8233  C  CA    . ARG B 1 615 ? 12.121  11.944  -11.762 1.00 68.81  ? 615 ARG B CA    1 
ATOM   8234  C  C     . ARG B 1 615 ? 13.600  12.253  -11.556 1.00 65.88  ? 615 ARG B C     1 
ATOM   8235  O  O     . ARG B 1 615 ? 14.217  11.745  -10.621 1.00 63.38  ? 615 ARG B O     1 
ATOM   8236  C  CB    . ARG B 1 615 ? 11.396  12.059  -10.415 1.00 57.85  ? 615 ARG B CB    1 
ATOM   8237  C  CG    . ARG B 1 615 ? 9.908   11.764  -10.494 1.00 53.75  ? 615 ARG B CG    1 
ATOM   8238  C  CD    . ARG B 1 615 ? 9.241   11.660  -9.145  1.00 66.99  ? 615 ARG B CD    1 
ATOM   8239  N  NE    . ARG B 1 615 ? 8.375   12.835  -9.031  1.00 82.75  ? 615 ARG B NE    1 
ATOM   8240  C  CZ    . ARG B 1 615 ? 7.043   12.793  -9.050  1.00 93.16  ? 615 ARG B CZ    1 
ATOM   8241  N  NH1   . ARG B 1 615 ? 6.412   11.618  -9.130  1.00 88.24  ? 615 ARG B NH1   1 
ATOM   8242  N  NH2   . ARG B 1 615 ? 6.343   13.922  -8.951  1.00 93.93  ? 615 ARG B NH2   1 
ATOM   8243  N  N     . PRO B 1 616 ? 14.190  13.056  -12.443 1.00 58.91  ? 616 PRO B N     1 
ATOM   8244  C  CA    . PRO B 1 616 ? 15.626  13.295  -12.320 1.00 53.13  ? 616 PRO B CA    1 
ATOM   8245  C  C     . PRO B 1 616 ? 15.951  13.967  -10.975 1.00 48.78  ? 616 PRO B C     1 
ATOM   8246  O  O     . PRO B 1 616 ? 15.164  14.740  -10.440 1.00 60.94  ? 616 PRO B O     1 
ATOM   8247  C  CB    . PRO B 1 616 ? 15.934  14.228  -13.504 1.00 53.32  ? 616 PRO B CB    1 
ATOM   8248  C  CG    . PRO B 1 616 ? 14.597  14.772  -13.913 1.00 58.72  ? 616 PRO B CG    1 
ATOM   8249  C  CD    . PRO B 1 616 ? 13.629  13.669  -13.646 1.00 60.86  ? 616 PRO B CD    1 
ATOM   8250  N  N     . LEU B 1 617 ? 17.124  13.656  -10.445 1.00 44.96  ? 617 LEU B N     1 
ATOM   8251  C  CA    . LEU B 1 617 ? 17.652  14.324  -9.260  1.00 46.64  ? 617 LEU B CA    1 
ATOM   8252  C  C     . LEU B 1 617 ? 18.112  15.683  -9.664  1.00 45.78  ? 617 LEU B C     1 
ATOM   8253  O  O     . LEU B 1 617 ? 18.538  15.864  -10.798 1.00 56.80  ? 617 LEU B O     1 
ATOM   8254  C  CB    . LEU B 1 617 ? 18.823  13.559  -8.651  1.00 43.77  ? 617 LEU B CB    1 
ATOM   8255  C  CG    . LEU B 1 617 ? 18.536  12.184  -8.104  1.00 46.03  ? 617 LEU B CG    1 
ATOM   8256  C  CD1   . LEU B 1 617 ? 19.800  11.617  -7.560  1.00 53.93  ? 617 LEU B CD1   1 
ATOM   8257  C  CD2   . LEU B 1 617 ? 17.486  12.286  -7.023  1.00 53.78  ? 617 LEU B CD2   1 
ATOM   8258  N  N     . LYS B 1 618 ? 17.974  16.647  -8.767  1.00 52.79  ? 618 LYS B N     1 
ATOM   8259  C  CA    . LYS B 1 618 ? 18.536  17.970  -8.992  1.00 45.80  ? 618 LYS B CA    1 
ATOM   8260  C  C     . LYS B 1 618 ? 19.746  18.232  -8.079  1.00 41.10  ? 618 LYS B C     1 
ATOM   8261  O  O     . LYS B 1 618 ? 19.647  18.256  -6.856  1.00 45.73  ? 618 LYS B O     1 
ATOM   8262  C  CB    . LYS B 1 618 ? 17.464  19.045  -8.772  1.00 41.66  ? 618 LYS B CB    1 
ATOM   8263  C  CG    . LYS B 1 618 ? 17.990  20.465  -9.018  1.00 40.52  ? 618 LYS B CG    1 
ATOM   8264  C  CD    . LYS B 1 618 ? 16.918  21.513  -8.838  1.00 55.34  ? 618 LYS B CD    1 
ATOM   8265  C  CE    . LYS B 1 618 ? 17.525  22.904  -8.841  1.00 72.20  ? 618 LYS B CE    1 
ATOM   8266  N  NZ    . LYS B 1 618 ? 16.795  23.895  -8.009  1.00 77.12  ? 618 LYS B NZ    1 
ATOM   8267  N  N     . LEU B 1 619 ? 20.898  18.441  -8.673  1.00 47.53  ? 619 LEU B N     1 
ATOM   8268  C  CA    . LEU B 1 619 ? 22.138  18.575  -7.911  1.00 42.13  ? 619 LEU B CA    1 
ATOM   8269  C  C     . LEU B 1 619 ? 22.757  19.962  -7.965  1.00 63.19  ? 619 LEU B C     1 
ATOM   8270  O  O     . LEU B 1 619 ? 22.800  20.608  -9.015  1.00 67.83  ? 619 LEU B O     1 
ATOM   8271  C  CB    . LEU B 1 619 ? 23.149  17.527  -8.378  1.00 28.74  ? 619 LEU B CB    1 
ATOM   8272  C  CG    . LEU B 1 619 ? 22.675  16.086  -8.108  1.00 35.34  ? 619 LEU B CG    1 
ATOM   8273  C  CD1   . LEU B 1 619 ? 21.803  15.513  -9.217  1.00 37.26  ? 619 LEU B CD1   1 
ATOM   8274  C  CD2   . LEU B 1 619 ? 23.901  15.176  -7.849  1.00 34.38  ? 619 LEU B CD2   1 
ATOM   8275  N  N     . VAL B 1 620 ? 23.276  20.417  -6.836  1.00 69.12  ? 620 VAL B N     1 
ATOM   8276  C  CA    . VAL B 1 620 ? 23.952  21.707  -6.856  1.00 67.67  ? 620 VAL B CA    1 
ATOM   8277  C  C     . VAL B 1 620 ? 25.362  21.568  -6.314  1.00 59.37  ? 620 VAL B C     1 
ATOM   8278  O  O     . VAL B 1 620 ? 25.564  21.064  -5.213  1.00 66.00  ? 620 VAL B O     1 
ATOM   8279  C  CB    . VAL B 1 620 ? 23.225  22.753  -6.017  1.00 61.15  ? 620 VAL B CB    1 
ATOM   8280  C  CG1   . VAL B 1 620 ? 23.992  24.061  -6.108  1.00 61.77  ? 620 VAL B CG1   1 
ATOM   8281  C  CG2   . VAL B 1 620 ? 21.776  22.931  -6.499  1.00 48.64  ? 620 VAL B CG2   1 
ATOM   8282  N  N     . HIS B 1 621 ? 26.342  21.943  -7.133  1.00 55.40  ? 621 HIS B N     1 
ATOM   8283  C  CA    . HIS B 1 621 ? 27.736  21.866  -6.711  1.00 46.00  ? 621 HIS B CA    1 
ATOM   8284  C  C     . HIS B 1 621 ? 28.065  23.058  -5.806  1.00 52.72  ? 621 HIS B C     1 
ATOM   8285  O  O     . HIS B 1 621 ? 28.337  24.156  -6.279  1.00 60.52  ? 621 HIS B O     1 
ATOM   8286  C  CB    . HIS B 1 621 ? 28.656  21.818  -7.918  1.00 39.69  ? 621 HIS B CB    1 
ATOM   8287  C  CG    . HIS B 1 621 ? 30.068  21.488  -7.577  1.00 49.22  ? 621 HIS B CG    1 
ATOM   8288  N  ND1   . HIS B 1 621 ? 31.100  21.577  -8.486  1.00 63.89  ? 621 HIS B ND1   1 
ATOM   8289  C  CD2   . HIS B 1 621 ? 30.608  20.984  -6.445  1.00 56.84  ? 621 HIS B CD2   1 
ATOM   8290  C  CE1   . HIS B 1 621 ? 32.227  21.193  -7.913  1.00 66.60  ? 621 HIS B CE1   1 
ATOM   8291  N  NE2   . HIS B 1 621 ? 31.954  20.823  -6.675  1.00 70.41  ? 621 HIS B NE2   1 
ATOM   8292  N  N     . GLU B 1 622 ? 28.112  22.806  -4.508  1.00 55.19  ? 622 GLU B N     1 
ATOM   8293  C  CA    . GLU B 1 622 ? 28.210  23.841  -3.502  1.00 42.11  ? 622 GLU B CA    1 
ATOM   8294  C  C     . GLU B 1 622 ? 29.629  24.305  -3.209  1.00 39.94  ? 622 GLU B C     1 
ATOM   8295  O  O     . GLU B 1 622 ? 29.875  25.482  -2.955  1.00 50.93  ? 622 GLU B O     1 
ATOM   8296  C  CB    . GLU B 1 622 ? 27.589  23.361  -2.226  1.00 42.87  ? 622 GLU B CB    1 
ATOM   8297  C  CG    . GLU B 1 622 ? 26.732  24.436  -1.646  1.00 68.49  ? 622 GLU B CG    1 
ATOM   8298  C  CD    . GLU B 1 622 ? 25.402  24.458  -2.298  1.00 77.03  ? 622 GLU B CD    1 
ATOM   8299  O  OE1   . GLU B 1 622 ? 24.796  25.538  -2.341  1.00 68.52  ? 622 GLU B OE1   1 
ATOM   8300  O  OE2   . GLU B 1 622 ? 24.950  23.367  -2.713  1.00 85.99  ? 622 GLU B OE2   1 
ATOM   8301  N  N     . ALA B 1 623 ? 30.573  23.380  -3.201  1.00 40.76  ? 623 ALA B N     1 
ATOM   8302  C  CA    . ALA B 1 623 ? 31.966  23.752  -2.998  1.00 44.36  ? 623 ALA B CA    1 
ATOM   8303  C  C     . ALA B 1 623 ? 32.851  22.727  -3.656  1.00 49.70  ? 623 ALA B C     1 
ATOM   8304  O  O     . ALA B 1 623 ? 32.450  21.576  -3.796  1.00 65.79  ? 623 ALA B O     1 
ATOM   8305  C  CB    . ALA B 1 623 ? 32.285  23.866  -1.517  1.00 51.11  ? 623 ALA B CB    1 
ATOM   8306  N  N     . GLY B 1 624 ? 34.033  23.158  -4.090  1.00 53.30  ? 624 GLY B N     1 
ATOM   8307  C  CA    . GLY B 1 624 ? 34.982  22.304  -4.802  1.00 71.13  ? 624 GLY B CA    1 
ATOM   8308  C  C     . GLY B 1 624 ? 35.168  22.719  -6.257  1.00 72.36  ? 624 GLY B C     1 
ATOM   8309  O  O     . GLY B 1 624 ? 34.306  23.438  -6.811  1.00 69.51  ? 624 GLY B O     1 
ATOM   8310  N  N     . ASP B 1 625 ? 36.187  22.168  -6.927  1.00 60.58  ? 625 ASP B N     1 
ATOM   8311  C  CA    . ASP B 1 625 ? 36.422  22.576  -8.311  1.00 58.06  ? 625 ASP B CA    1 
ATOM   8312  C  C     . ASP B 1 625 ? 36.458  21.385  -9.245  1.00 62.31  ? 625 ASP B C     1 
ATOM   8313  O  O     . ASP B 1 625 ? 36.996  21.502  -10.339 1.00 72.65  ? 625 ASP B O     1 
ATOM   8314  C  CB    . ASP B 1 625 ? 37.775  23.245  -8.509  1.00 65.54  ? 625 ASP B CB    1 
ATOM   8315  C  CG    . ASP B 1 625 ? 38.897  22.508  -7.804  1.00 78.83  ? 625 ASP B CG    1 
ATOM   8316  O  OD1   . ASP B 1 625 ? 38.832  21.261  -7.770  1.00 95.17  ? 625 ASP B OD1   1 
ATOM   8317  O  OD2   . ASP B 1 625 ? 39.878  23.138  -7.364  1.00 77.76  ? 625 ASP B OD2   1 
ATOM   8318  N  N     . THR B 1 626 ? 35.894  20.254  -8.841  1.00 57.44  ? 626 THR B N     1 
ATOM   8319  C  CA    . THR B 1 626 ? 35.754  19.131  -9.750  1.00 54.75  ? 626 THR B CA    1 
ATOM   8320  C  C     . THR B 1 626 ? 34.746  19.457  -10.832 1.00 52.76  ? 626 THR B C     1 
ATOM   8321  O  O     . THR B 1 626 ? 33.676  20.063  -10.582 1.00 51.14  ? 626 THR B O     1 
ATOM   8322  C  CB    . THR B 1 626 ? 35.342  17.833  -9.017  1.00 50.63  ? 626 THR B CB    1 
ATOM   8323  O  OG1   . THR B 1 626 ? 36.368  17.472  -8.087  1.00 52.10  ? 626 THR B OG1   1 
ATOM   8324  C  CG2   . THR B 1 626 ? 35.155  16.690  -9.980  1.00 51.30  ? 626 THR B CG2   1 
ATOM   8325  N  N     . PRO B 1 627 ? 35.153  19.241  -12.091 1.00 50.04  ? 627 PRO B N     1 
ATOM   8326  C  CA    . PRO B 1 627 ? 34.214  19.533  -13.161 1.00 49.43  ? 627 PRO B CA    1 
ATOM   8327  C  C     . PRO B 1 627 ? 32.904  18.827  -12.950 1.00 55.17  ? 627 PRO B C     1 
ATOM   8328  O  O     . PRO B 1 627 ? 32.914  17.618  -12.607 1.00 57.58  ? 627 PRO B O     1 
ATOM   8329  C  CB    . PRO B 1 627 ? 34.916  18.989  -14.375 1.00 42.20  ? 627 PRO B CB    1 
ATOM   8330  C  CG    . PRO B 1 627 ? 36.371  19.071  -14.048 1.00 41.64  ? 627 PRO B CG    1 
ATOM   8331  C  CD    . PRO B 1 627 ? 36.466  18.807  -12.590 1.00 51.06  ? 627 PRO B CD    1 
ATOM   8332  N  N     . LEU B 1 628 ? 31.789  19.486  -13.242 1.00 55.51  ? 628 LEU B N     1 
ATOM   8333  C  CA    . LEU B 1 628 ? 30.442  18.957  -13.061 1.00 48.05  ? 628 LEU B CA    1 
ATOM   8334  C  C     . LEU B 1 628 ? 30.217  17.592  -13.655 1.00 48.77  ? 628 LEU B C     1 
ATOM   8335  O  O     . LEU B 1 628 ? 29.565  16.745  -13.005 1.00 41.58  ? 628 LEU B O     1 
ATOM   8336  C  CB    . LEU B 1 628 ? 29.532  20.035  -13.589 1.00 44.60  ? 628 LEU B CB    1 
ATOM   8337  C  CG    . LEU B 1 628 ? 28.579  20.750  -12.643 1.00 57.91  ? 628 LEU B CG    1 
ATOM   8338  C  CD1   . LEU B 1 628 ? 28.705  21.106  -11.265 1.00 72.98  ? 628 LEU B CD1   1 
ATOM   8339  C  CD2   . LEU B 1 628 ? 29.157  22.095  -13.155 1.00 83.84  ? 628 LEU B CD2   1 
ATOM   8340  N  N     . GLU B 1 629 ? 30.719  17.379  -14.864 1.00 59.96  ? 629 GLU B N     1 
ATOM   8341  C  CA    . GLU B 1 629 ? 30.548  16.088  -15.521 1.00 60.90  ? 629 GLU B CA    1 
ATOM   8342  C  C     . GLU B 1 629 ? 31.198  14.979  -14.713 1.00 57.58  ? 629 GLU B C     1 
ATOM   8343  O  O     . GLU B 1 629 ? 30.657  13.869  -14.637 1.00 64.98  ? 629 GLU B O     1 
ATOM   8344  C  CB    . GLU B 1 629 ? 31.185  16.095  -16.903 1.00 62.82  ? 629 GLU B CB    1 
ATOM   8345  C  CG    . GLU B 1 629 ? 30.474  15.223  -17.917 1.00 86.69  ? 629 GLU B CG    1 
ATOM   8346  C  CD    . GLU B 1 629 ? 31.375  14.732  -19.065 1.00 103.85 ? 629 GLU B CD    1 
ATOM   8347  O  OE1   . GLU B 1 629 ? 32.622  14.697  -18.959 1.00 109.70 ? 629 GLU B OE1   1 
ATOM   8348  O  OE2   . GLU B 1 629 ? 30.835  14.566  -20.179 1.00 115.29 ? 629 GLU B OE2   1 
ATOM   8349  N  N     . ALA B 1 630 ? 32.332  15.268  -14.075 1.00 52.48  ? 630 ALA B N     1 
ATOM   8350  C  CA    . ALA B 1 630 ? 33.000  14.248  -13.250 1.00 56.17  ? 630 ALA B CA    1 
ATOM   8351  C  C     . ALA B 1 630 ? 32.210  13.874  -12.015 1.00 57.79  ? 630 ALA B C     1 
ATOM   8352  O  O     . ALA B 1 630 ? 32.133  12.683  -11.656 1.00 64.01  ? 630 ALA B O     1 
ATOM   8353  C  CB    . ALA B 1 630 ? 34.411  14.685  -12.855 1.00 56.20  ? 630 ALA B CB    1 
ATOM   8354  N  N     . LEU B 1 631 ? 31.646  14.894  -11.373 1.00 58.30  ? 631 LEU B N     1 
ATOM   8355  C  CA    . LEU B 1 631 ? 30.776  14.701  -10.224 1.00 66.11  ? 631 LEU B CA    1 
ATOM   8356  C  C     . LEU B 1 631 ? 29.586  13.852  -10.638 1.00 69.30  ? 631 LEU B C     1 
ATOM   8357  O  O     . LEU B 1 631 ? 29.230  12.897  -9.921  1.00 63.95  ? 631 LEU B O     1 
ATOM   8358  C  CB    . LEU B 1 631 ? 30.313  16.042  -9.664  1.00 70.14  ? 631 LEU B CB    1 
ATOM   8359  C  CG    . LEU B 1 631 ? 31.429  16.914  -9.055  1.00 55.79  ? 631 LEU B CG    1 
ATOM   8360  C  CD1   . LEU B 1 631 ? 30.876  18.298  -8.656  1.00 44.40  ? 631 LEU B CD1   1 
ATOM   8361  C  CD2   . LEU B 1 631 ? 32.136  16.210  -7.882  1.00 28.73  ? 631 LEU B CD2   1 
ATOM   8362  N  N     . ALA B 1 632 ? 29.003  14.180  -11.801 1.00 60.31  ? 632 ALA B N     1 
ATOM   8363  C  CA    . ALA B 1 632 ? 27.844  13.449  -12.302 1.00 51.99  ? 632 ALA B CA    1 
ATOM   8364  C  C     . ALA B 1 632 ? 28.206  11.986  -12.589 1.00 53.24  ? 632 ALA B C     1 
ATOM   8365  O  O     . ALA B 1 632 ? 27.441  11.064  -12.309 1.00 62.16  ? 632 ALA B O     1 
ATOM   8366  C  CB    . ALA B 1 632 ? 27.323  14.098  -13.525 1.00 50.16  ? 632 ALA B CB    1 
ATOM   8367  N  N     . HIS B 1 633 ? 29.411  11.768  -13.081 1.00 51.99  ? 633 HIS B N     1 
ATOM   8368  C  CA    . HIS B 1 633 ? 29.894  10.415  -13.340 1.00 46.39  ? 633 HIS B CA    1 
ATOM   8369  C  C     . HIS B 1 633 ? 30.010  9.592   -12.068 1.00 46.17  ? 633 HIS B C     1 
ATOM   8370  O  O     . HIS B 1 633 ? 29.523  8.451   -11.999 1.00 53.31  ? 633 HIS B O     1 
ATOM   8371  C  CB    . HIS B 1 633 ? 31.231  10.482  -14.061 1.00 45.74  ? 633 HIS B CB    1 
ATOM   8372  C  CG    . HIS B 1 633 ? 31.816  9.145   -14.376 1.00 64.84  ? 633 HIS B CG    1 
ATOM   8373  N  ND1   . HIS B 1 633 ? 32.839  8.594   -13.629 1.00 77.75  ? 633 HIS B ND1   1 
ATOM   8374  C  CD2   . HIS B 1 633 ? 31.519  8.240   -15.336 1.00 71.87  ? 633 HIS B CD2   1 
ATOM   8375  C  CE1   . HIS B 1 633 ? 33.169  7.422   -14.137 1.00 83.56  ? 633 HIS B CE1   1 
ATOM   8376  N  NE2   . HIS B 1 633 ? 32.378  7.180   -15.169 1.00 80.11  ? 633 HIS B NE2   1 
ATOM   8377  N  N     . GLN B 1 634 ? 30.728  10.126  -11.085 1.00 52.54  ? 634 GLN B N     1 
ATOM   8378  C  CA    . GLN B 1 634 ? 30.893  9.361   -9.854  1.00 52.42  ? 634 GLN B CA    1 
ATOM   8379  C  C     . GLN B 1 634 ? 29.564  9.164   -9.104  1.00 51.22  ? 634 GLN B C     1 
ATOM   8380  O  O     . GLN B 1 634 ? 29.314  8.079   -8.613  1.00 52.53  ? 634 GLN B O     1 
ATOM   8381  C  CB    . GLN B 1 634 ? 31.942  9.995   -8.957  1.00 48.13  ? 634 GLN B CB    1 
ATOM   8382  C  CG    . GLN B 1 634 ? 32.319  9.093   -7.818  1.00 47.25  ? 634 GLN B CG    1 
ATOM   8383  C  CD    . GLN B 1 634 ? 33.445  9.631   -6.950  1.00 50.32  ? 634 GLN B CD    1 
ATOM   8384  O  OE1   . GLN B 1 634 ? 34.051  10.661  -7.242  1.00 53.42  ? 634 GLN B OE1   1 
ATOM   8385  N  NE2   . GLN B 1 634 ? 33.900  8.781   -6.048  1.00 52.75  ? 634 GLN B NE2   1 
ATOM   8386  N  N     . ILE B 1 635 ? 28.697  10.180  -9.057  1.00 46.70  ? 635 ILE B N     1 
ATOM   8387  C  CA    . ILE B 1 635 ? 27.405  10.024  -8.379  1.00 49.07  ? 635 ILE B CA    1 
ATOM   8388  C  C     . ILE B 1 635 ? 26.470  9.001   -9.085  1.00 56.69  ? 635 ILE B C     1 
ATOM   8389  O  O     . ILE B 1 635 ? 25.849  8.086   -8.442  1.00 42.17  ? 635 ILE B O     1 
ATOM   8390  C  CB    . ILE B 1 635 ? 26.681  11.395  -8.249  1.00 48.17  ? 635 ILE B CB    1 
ATOM   8391  C  CG1   . ILE B 1 635 ? 27.391  12.277  -7.219  1.00 38.03  ? 635 ILE B CG1   1 
ATOM   8392  C  CG2   . ILE B 1 635 ? 25.235  11.200  -7.833  1.00 42.96  ? 635 ILE B CG2   1 
ATOM   8393  C  CD1   . ILE B 1 635 ? 27.139  13.731  -7.345  1.00 35.62  ? 635 ILE B CD1   1 
ATOM   8394  N  N     . PHE B 1 636 ? 26.400  9.130   -10.411 1.00 57.38  ? 636 PHE B N     1 
ATOM   8395  C  CA    . PHE B 1 636 ? 25.629  8.168   -11.195 1.00 58.27  ? 636 PHE B CA    1 
ATOM   8396  C  C     . PHE B 1 636 ? 26.121  6.747   -10.917 1.00 46.79  ? 636 PHE B C     1 
ATOM   8397  O  O     . PHE B 1 636 ? 25.320  5.852   -10.611 1.00 43.14  ? 636 PHE B O     1 
ATOM   8398  C  CB    . PHE B 1 636 ? 25.677  8.491   -12.696 1.00 48.83  ? 636 PHE B CB    1 
ATOM   8399  C  CG    . PHE B 1 636 ? 25.046  7.436   -13.539 1.00 59.30  ? 636 PHE B CG    1 
ATOM   8400  C  CD1   . PHE B 1 636 ? 23.760  6.980   -13.247 1.00 64.55  ? 636 PHE B CD1   1 
ATOM   8401  C  CD2   . PHE B 1 636 ? 25.722  6.897   -14.627 1.00 60.25  ? 636 PHE B CD2   1 
ATOM   8402  C  CE1   . PHE B 1 636 ? 23.171  5.995   -14.014 1.00 63.68  ? 636 PHE B CE1   1 
ATOM   8403  C  CE2   . PHE B 1 636 ? 25.140  5.926   -15.404 1.00 50.04  ? 636 PHE B CE2   1 
ATOM   8404  C  CZ    . PHE B 1 636 ? 23.864  5.454   -15.085 1.00 51.63  ? 636 PHE B CZ    1 
ATOM   8405  N  N     . HIS B 1 637 ? 27.435  6.552   -10.997 1.00 46.82  ? 637 HIS B N     1 
ATOM   8406  C  CA    . HIS B 1 637 ? 28.006  5.238   -10.703 1.00 52.84  ? 637 HIS B CA    1 
ATOM   8407  C  C     . HIS B 1 637 ? 27.708  4.766   -9.257  1.00 64.51  ? 637 HIS B C     1 
ATOM   8408  O  O     . HIS B 1 637 ? 27.386  3.588   -9.023  1.00 54.27  ? 637 HIS B O     1 
ATOM   8409  C  CB    . HIS B 1 637 ? 29.506  5.241   -10.996 1.00 54.60  ? 637 HIS B CB    1 
ATOM   8410  C  CG    . HIS B 1 637 ? 29.826  5.180   -12.460 1.00 56.02  ? 637 HIS B CG    1 
ATOM   8411  N  ND1   . HIS B 1 637 ? 30.998  4.641   -12.941 1.00 48.94  ? 637 HIS B ND1   1 
ATOM   8412  C  CD2   . HIS B 1 637 ? 29.108  5.553   -13.549 1.00 58.47  ? 637 HIS B CD2   1 
ATOM   8413  C  CE1   . HIS B 1 637 ? 30.987  4.681   -14.263 1.00 52.61  ? 637 HIS B CE1   1 
ATOM   8414  N  NE2   . HIS B 1 637 ? 29.859  5.241   -14.657 1.00 49.58  ? 637 HIS B NE2   1 
ATOM   8415  N  N     . LEU B 1 638 ? 27.779  5.692   -8.299  1.00 64.21  ? 638 LEU B N     1 
ATOM   8416  C  CA    . LEU B 1 638 ? 27.494  5.367   -6.908  1.00 55.16  ? 638 LEU B CA    1 
ATOM   8417  C  C     . LEU B 1 638 ? 26.097  4.807   -6.699  1.00 54.51  ? 638 LEU B C     1 
ATOM   8418  O  O     . LEU B 1 638 ? 25.867  4.088   -5.705  1.00 41.63  ? 638 LEU B O     1 
ATOM   8419  C  CB    . LEU B 1 638 ? 27.747  6.584   -6.029  1.00 57.78  ? 638 LEU B CB    1 
ATOM   8420  C  CG    . LEU B 1 638 ? 29.235  6.836   -5.793  1.00 43.39  ? 638 LEU B CG    1 
ATOM   8421  C  CD1   . LEU B 1 638 ? 29.494  8.172   -5.104  1.00 55.36  ? 638 LEU B CD1   1 
ATOM   8422  C  CD2   . LEU B 1 638 ? 29.741  5.745   -4.872  1.00 25.64  ? 638 LEU B CD2   1 
ATOM   8423  N  N     . THR B 1 639 ? 25.160  5.087   -7.604  1.00 57.99  ? 639 THR B N     1 
ATOM   8424  C  CA    . THR B 1 639 ? 23.835  4.493   -7.376  1.00 52.62  ? 639 THR B CA    1 
ATOM   8425  C  C     . THR B 1 639 ? 23.863  2.949   -7.507  1.00 49.51  ? 639 THR B C     1 
ATOM   8426  O  O     . THR B 1 639 ? 22.934  2.291   -7.108  1.00 53.94  ? 639 THR B O     1 
ATOM   8427  C  CB    . THR B 1 639 ? 22.761  5.011   -8.331  1.00 48.51  ? 639 THR B CB    1 
ATOM   8428  O  OG1   . THR B 1 639 ? 23.077  4.561   -9.673  1.00 54.58  ? 639 THR B OG1   1 
ATOM   8429  C  CG2   . THR B 1 639 ? 22.683  6.514   -8.262  1.00 30.78  ? 639 THR B CG2   1 
ATOM   8430  N  N     . ARG B 1 640 ? 24.840  2.384   -8.190  1.00 52.52  ? 640 ARG B N     1 
ATOM   8431  C  CA    . ARG B 1 640 ? 24.896  0.928   -8.405  1.00 54.85  ? 640 ARG B CA    1 
ATOM   8432  C  C     . ARG B 1 640 ? 25.589  0.088   -7.299  1.00 58.49  ? 640 ARG B C     1 
ATOM   8433  O  O     . ARG B 1 640 ? 25.654  -1.127  -7.411  1.00 64.17  ? 640 ARG B O     1 
ATOM   8434  C  CB    . ARG B 1 640 ? 25.514  0.655   -9.771  1.00 47.62  ? 640 ARG B CB    1 
ATOM   8435  C  CG    . ARG B 1 640 ? 24.951  1.648   -10.796 1.00 38.63  ? 640 ARG B CG    1 
ATOM   8436  C  CD    . ARG B 1 640 ? 23.735  1.214   -11.560 1.00 40.97  ? 640 ARG B CD    1 
ATOM   8437  N  NE    . ARG B 1 640 ? 23.298  2.273   -12.496 1.00 60.48  ? 640 ARG B NE    1 
ATOM   8438  C  CZ    . ARG B 1 640 ? 22.060  2.485   -12.958 1.00 70.81  ? 640 ARG B CZ    1 
ATOM   8439  N  NH1   . ARG B 1 640 ? 21.128  1.601   -12.755 1.00 81.28  ? 640 ARG B NH1   1 
ATOM   8440  N  NH2   . ARG B 1 640 ? 21.810  3.477   -13.813 1.00 70.12  ? 640 ARG B NH2   1 
ATOM   8441  N  N     . LEU B 1 641 ? 26.154  0.760   -6.299  1.00 53.68  ? 641 LEU B N     1 
ATOM   8442  C  CA    . LEU B 1 641 ? 26.917  0.119   -5.211  1.00 44.40  ? 641 LEU B CA    1 
ATOM   8443  C  C     . LEU B 1 641 ? 26.080  -0.539  -4.123  1.00 53.86  ? 641 LEU B C     1 
ATOM   8444  O  O     . LEU B 1 641 ? 26.554  -1.468  -3.411  1.00 62.59  ? 641 LEU B O     1 
ATOM   8445  C  CB    . LEU B 1 641 ? 27.874  1.168   -4.667  1.00 45.61  ? 641 LEU B CB    1 
ATOM   8446  C  CG    . LEU B 1 641 ? 29.283  0.549   -4.653  1.00 60.22  ? 641 LEU B CG    1 
ATOM   8447  C  CD1   . LEU B 1 641 ? 30.255  1.175   -3.985  1.00 60.92  ? 641 LEU B CD1   1 
ATOM   8448  C  CD2   . LEU B 1 641 ? 29.166  -0.178  -3.428  1.00 70.62  ? 641 LEU B CD2   1 
ATOM   8449  N  N     . TYR B 1 642 ? 24.835  -0.113  -3.986  1.00 36.52  ? 642 TYR B N     1 
ATOM   8450  C  CA    . TYR B 1 642 ? 23.972  -0.607  -2.916  1.00 46.60  ? 642 TYR B CA    1 
ATOM   8451  C  C     . TYR B 1 642 ? 23.789  -2.133  -3.001  1.00 54.60  ? 642 TYR B C     1 
ATOM   8452  O  O     . TYR B 1 642 ? 23.329  -2.647  -4.001  1.00 43.38  ? 642 TYR B O     1 
ATOM   8453  C  CB    . TYR B 1 642 ? 22.612  0.046   -2.981  1.00 41.24  ? 642 TYR B CB    1 
ATOM   8454  C  CG    . TYR B 1 642 ? 21.742  -0.121  -1.784  1.00 52.31  ? 642 TYR B CG    1 
ATOM   8455  C  CD1   . TYR B 1 642 ? 22.061  0.451   -0.569  1.00 68.09  ? 642 TYR B CD1   1 
ATOM   8456  C  CD2   . TYR B 1 642 ? 20.601  -0.901  -1.860  1.00 60.10  ? 642 TYR B CD2   1 
ATOM   8457  C  CE1   . TYR B 1 642 ? 21.222  0.289   0.555   1.00 63.52  ? 642 TYR B CE1   1 
ATOM   8458  C  CE2   . TYR B 1 642 ? 19.768  -1.062  -0.763  1.00 69.61  ? 642 TYR B CE2   1 
ATOM   8459  C  CZ    . TYR B 1 642 ? 20.090  -0.475  0.441   1.00 64.35  ? 642 TYR B CZ    1 
ATOM   8460  O  OH    . TYR B 1 642 ? 19.266  -0.657  1.515   1.00 73.36  ? 642 TYR B OH    1 
ATOM   8461  N  N     . PRO B 1 643 ? 24.187  -2.864  -1.954  1.00 62.20  ? 643 PRO B N     1 
ATOM   8462  C  CA    . PRO B 1 643 ? 24.223  -4.337  -1.945  1.00 56.84  ? 643 PRO B CA    1 
ATOM   8463  C  C     . PRO B 1 643 ? 22.881  -5.013  -1.624  1.00 62.75  ? 643 PRO B C     1 
ATOM   8464  O  O     . PRO B 1 643 ? 22.738  -6.172  -1.992  1.00 65.59  ? 643 PRO B O     1 
ATOM   8465  C  CB    . PRO B 1 643 ? 25.230  -4.649  -0.843  1.00 51.44  ? 643 PRO B CB    1 
ATOM   8466  C  CG    . PRO B 1 643 ? 25.027  -3.544  0.147   1.00 51.45  ? 643 PRO B CG    1 
ATOM   8467  C  CD    . PRO B 1 643 ? 24.739  -2.301  -0.703  1.00 59.20  ? 643 PRO B CD    1 
ATOM   8468  N  N     . ALA B 1 644 ? 21.943  -4.350  -0.942  1.00 62.03  ? 644 ALA B N     1 
ATOM   8469  C  CA    . ALA B 1 644 ? 20.759  -5.065  -0.453  1.00 52.34  ? 644 ALA B CA    1 
ATOM   8470  C  C     . ALA B 1 644 ? 19.557  -4.966  -1.398  1.00 48.49  ? 644 ALA B C     1 
ATOM   8471  O  O     . ALA B 1 644 ? 18.459  -5.432  -1.094  1.00 38.90  ? 644 ALA B O     1 
ATOM   8472  C  CB    . ALA B 1 644 ? 20.365  -4.520  0.964   1.00 32.24  ? 644 ALA B CB    1 
ATOM   8473  N  N     . SER B 1 645 ? 19.762  -4.392  -2.571  1.00 55.31  ? 645 SER B N     1 
ATOM   8474  C  CA    . SER B 1 645 ? 18.728  -4.462  -3.608  1.00 65.55  ? 645 SER B CA    1 
ATOM   8475  C  C     . SER B 1 645 ? 19.267  -5.233  -4.806  1.00 62.23  ? 645 SER B C     1 
ATOM   8476  O  O     . SER B 1 645 ? 20.071  -4.692  -5.572  1.00 58.07  ? 645 SER B O     1 
ATOM   8477  C  CB    . SER B 1 645 ? 18.265  -3.082  -4.054  1.00 64.89  ? 645 SER B CB    1 
ATOM   8478  O  OG    . SER B 1 645 ? 17.248  -3.204  -5.030  1.00 53.43  ? 645 SER B OG    1 
ATOM   8479  N  N     . GLY B 1 646 ? 18.847  -6.492  -4.934  1.00 62.36  ? 646 GLY B N     1 
ATOM   8480  C  CA    . GLY B 1 646 ? 19.295  -7.393  -5.988  1.00 60.25  ? 646 GLY B CA    1 
ATOM   8481  C  C     . GLY B 1 646 ? 18.994  -7.032  -7.449  1.00 52.87  ? 646 GLY B C     1 
ATOM   8482  O  O     . GLY B 1 646 ? 19.747  -7.379  -8.358  1.00 46.64  ? 646 GLY B O     1 
ATOM   8483  N  N     . PHE B 1 647 ? 17.824  -6.450  -7.690  1.00 49.42  ? 647 PHE B N     1 
ATOM   8484  C  CA    . PHE B 1 647 ? 17.329  -6.393  -9.051  1.00 36.88  ? 647 PHE B CA    1 
ATOM   8485  C  C     . PHE B 1 647 ? 16.951  -4.992  -9.501  1.00 44.28  ? 647 PHE B C     1 
ATOM   8486  O  O     . PHE B 1 647 ? 16.464  -4.800  -10.616 1.00 45.04  ? 647 PHE B O     1 
ATOM   8487  C  CB    . PHE B 1 647 ? 16.133  -7.330  -9.168  1.00 36.54  ? 647 PHE B CB    1 
ATOM   8488  C  CG    . PHE B 1 647 ? 16.415  -8.672  -8.614  1.00 47.00  ? 647 PHE B CG    1 
ATOM   8489  C  CD1   . PHE B 1 647 ? 16.910  -9.674  -9.417  1.00 46.95  ? 647 PHE B CD1   1 
ATOM   8490  C  CD2   . PHE B 1 647 ? 16.129  -8.951  -7.285  1.00 52.64  ? 647 PHE B CD2   1 
ATOM   8491  C  CE1   . PHE B 1 647 ? 17.194  -10.915 -8.892  1.00 52.27  ? 647 PHE B CE1   1 
ATOM   8492  C  CE2   . PHE B 1 647 ? 16.390  -10.189 -6.764  1.00 60.15  ? 647 PHE B CE2   1 
ATOM   8493  C  CZ    . PHE B 1 647 ? 16.918  -11.180 -7.578  1.00 62.24  ? 647 PHE B CZ    1 
ATOM   8494  N  N     . ALA B 1 648 ? 17.094  -4.023  -8.602  1.00 40.42  ? 648 ALA B N     1 
ATOM   8495  C  CA    . ALA B 1 648 ? 16.787  -2.642  -8.954  1.00 44.22  ? 648 ALA B CA    1 
ATOM   8496  C  C     . ALA B 1 648 ? 17.730  -1.736  -8.182  1.00 61.47  ? 648 ALA B C     1 
ATOM   8497  O  O     . ALA B 1 648 ? 17.827  -1.818  -6.957  1.00 60.57  ? 648 ALA B O     1 
ATOM   8498  C  CB    . ALA B 1 648 ? 15.353  -2.298  -8.657  1.00 42.02  ? 648 ALA B CB    1 
ATOM   8499  N  N     . PHE B 1 649 ? 18.298  -0.775  -8.891  1.00 65.80  ? 649 PHE B N     1 
ATOM   8500  C  CA    . PHE B 1 649 ? 19.193  0.196   -8.294  1.00 55.16  ? 649 PHE B CA    1 
ATOM   8501  C  C     . PHE B 1 649 ? 18.448  1.354   -7.675  1.00 47.61  ? 649 PHE B C     1 
ATOM   8502  O  O     . PHE B 1 649 ? 17.405  1.780   -8.164  1.00 53.77  ? 649 PHE B O     1 
ATOM   8503  C  CB    . PHE B 1 649 ? 20.144  0.728   -9.351  1.00 55.57  ? 649 PHE B CB    1 
ATOM   8504  C  CG    . PHE B 1 649 ? 20.989  -0.323  -10.014 1.00 56.24  ? 649 PHE B CG    1 
ATOM   8505  C  CD1   . PHE B 1 649 ? 21.858  -1.105  -9.281  1.00 42.59  ? 649 PHE B CD1   1 
ATOM   8506  C  CD2   . PHE B 1 649 ? 20.830  -0.600  -11.362 1.00 67.53  ? 649 PHE B CD2   1 
ATOM   8507  C  CE1   . PHE B 1 649 ? 22.645  -2.049  -9.916  1.00 49.57  ? 649 PHE B CE1   1 
ATOM   8508  C  CE2   . PHE B 1 649 ? 21.606  -1.519  -12.016 1.00 56.72  ? 649 PHE B CE2   1 
ATOM   8509  C  CZ    . PHE B 1 649 ? 22.499  -2.266  -11.288 1.00 56.64  ? 649 PHE B CZ    1 
ATOM   8510  N  N     . PRO B 1 650 ? 18.957  1.842   -6.548  1.00 53.76  ? 650 PRO B N     1 
ATOM   8511  C  CA    . PRO B 1 650 ? 18.300  3.004   -5.954  1.00 41.34  ? 650 PRO B CA    1 
ATOM   8512  C  C     . PRO B 1 650 ? 18.565  4.233   -6.777  1.00 44.94  ? 650 PRO B C     1 
ATOM   8513  O  O     . PRO B 1 650 ? 19.586  4.282   -7.475  1.00 45.61  ? 650 PRO B O     1 
ATOM   8514  C  CB    . PRO B 1 650 ? 18.952  3.118   -4.585  1.00 34.83  ? 650 PRO B CB    1 
ATOM   8515  C  CG    . PRO B 1 650 ? 19.635  1.747   -4.353  1.00 46.71  ? 650 PRO B CG    1 
ATOM   8516  C  CD    . PRO B 1 650 ? 20.040  1.307   -5.700  1.00 52.47  ? 650 PRO B CD    1 
ATOM   8517  N  N     . ARG B 1 651 ? 17.660  5.201   -6.683  1.00 40.41  ? 651 ARG B N     1 
ATOM   8518  C  CA    . ARG B 1 651 ? 17.759  6.471   -7.376  1.00 36.15  ? 651 ARG B CA    1 
ATOM   8519  C  C     . ARG B 1 651 ? 18.924  7.276   -6.756  1.00 57.80  ? 651 ARG B C     1 
ATOM   8520  O  O     . ARG B 1 651 ? 19.667  7.926   -7.470  1.00 73.07  ? 651 ARG B O     1 
ATOM   8521  C  CB    . ARG B 1 651 ? 16.406  7.228   -7.304  1.00 40.54  ? 651 ARG B CB    1 
ATOM   8522  C  CG    . ARG B 1 651 ? 16.439  8.631   -7.918  1.00 42.67  ? 651 ARG B CG    1 
ATOM   8523  C  CD    . ARG B 1 651 ? 15.059  9.214   -8.182  1.00 50.21  ? 651 ARG B CD    1 
ATOM   8524  N  NE    . ARG B 1 651 ? 14.301  9.720   -7.059  1.00 55.61  ? 651 ARG B NE    1 
ATOM   8525  C  CZ    . ARG B 1 651 ? 13.916  10.986  -6.957  1.00 52.39  ? 651 ARG B CZ    1 
ATOM   8526  N  NH1   . ARG B 1 651 ? 14.250  11.841  -7.895  1.00 38.20  ? 651 ARG B NH1   1 
ATOM   8527  N  NH2   . ARG B 1 651 ? 13.232  11.409  -5.907  1.00 68.82  ? 651 ARG B NH2   1 
ATOM   8528  N  N     . LEU B 1 652 ? 19.072  7.250   -5.436  1.00 49.66  ? 652 LEU B N     1 
ATOM   8529  C  CA    . LEU B 1 652 ? 20.141  7.981   -4.771  1.00 42.42  ? 652 LEU B CA    1 
ATOM   8530  C  C     . LEU B 1 652 ? 21.420  7.175   -4.774  1.00 51.17  ? 652 LEU B C     1 
ATOM   8531  O  O     . LEU B 1 652 ? 21.374  5.934   -4.720  1.00 58.73  ? 652 LEU B O     1 
ATOM   8532  C  CB    . LEU B 1 652 ? 19.782  8.313   -3.309  1.00 43.12  ? 652 LEU B CB    1 
ATOM   8533  C  CG    . LEU B 1 652 ? 18.625  9.240   -2.937  1.00 46.00  ? 652 LEU B CG    1 
ATOM   8534  C  CD1   . LEU B 1 652 ? 18.421  9.284   -1.433  1.00 54.74  ? 652 LEU B CD1   1 
ATOM   8535  C  CD2   . LEU B 1 652 ? 18.957  10.652  -3.405  1.00 43.60  ? 652 LEU B CD2   1 
ATOM   8536  N  N     . PRO B 1 653 ? 22.572  7.862   -4.882  1.00 44.05  ? 653 PRO B N     1 
ATOM   8537  C  CA    . PRO B 1 653 ? 23.888  7.210   -4.746  1.00 50.65  ? 653 PRO B CA    1 
ATOM   8538  C  C     . PRO B 1 653 ? 23.985  6.497   -3.393  1.00 47.14  ? 653 PRO B C     1 
ATOM   8539  O  O     . PRO B 1 653 ? 23.368  6.963   -2.428  1.00 49.22  ? 653 PRO B O     1 
ATOM   8540  C  CB    . PRO B 1 653 ? 24.888  8.366   -4.845  1.00 51.04  ? 653 PRO B CB    1 
ATOM   8541  C  CG    . PRO B 1 653 ? 24.082  9.588   -4.550  1.00 41.40  ? 653 PRO B CG    1 
ATOM   8542  C  CD    . PRO B 1 653 ? 22.704  9.311   -5.080  1.00 26.23  ? 653 PRO B CD    1 
ATOM   8543  N  N     . ALA B 1 654 ? 24.618  5.335   -3.355  1.00 46.67  ? 654 ALA B N     1 
ATOM   8544  C  CA    . ALA B 1 654 ? 24.644  4.504   -2.150  1.00 35.20  ? 654 ALA B CA    1 
ATOM   8545  C  C     . ALA B 1 654 ? 24.970  5.206   -0.820  1.00 54.56  ? 654 ALA B C     1 
ATOM   8546  O  O     . ALA B 1 654 ? 24.292  4.952   0.166   1.00 54.92  ? 654 ALA B O     1 
ATOM   8547  C  CB    . ALA B 1 654 ? 25.623  3.330   -2.361  1.00 39.27  ? 654 ALA B CB    1 
ATOM   8548  N  N     . PRO B 1 655 ? 25.982  6.111   -0.777  1.00 52.07  ? 655 PRO B N     1 
ATOM   8549  C  CA    . PRO B 1 655 ? 26.163  6.830   0.498   1.00 53.42  ? 655 PRO B CA    1 
ATOM   8550  C  C     . PRO B 1 655 ? 24.907  7.532   1.030   1.00 53.59  ? 655 PRO B C     1 
ATOM   8551  O  O     . PRO B 1 655 ? 24.647  7.497   2.242   1.00 53.33  ? 655 PRO B O     1 
ATOM   8552  C  CB    . PRO B 1 655 ? 27.216  7.868   0.148   1.00 45.76  ? 655 PRO B CB    1 
ATOM   8553  C  CG    . PRO B 1 655 ? 28.070  7.174   -0.842  1.00 44.44  ? 655 PRO B CG    1 
ATOM   8554  C  CD    . PRO B 1 655 ? 27.087  6.411   -1.712  1.00 41.79  ? 655 PRO B CD    1 
ATOM   8555  N  N     . LEU B 1 656 ? 24.149  8.174   0.139   1.00 47.30  ? 656 LEU B N     1 
ATOM   8556  C  CA    . LEU B 1 656 ? 22.941  8.877   0.559   1.00 50.14  ? 656 LEU B CA    1 
ATOM   8557  C  C     . LEU B 1 656 ? 21.795  7.910   0.849   1.00 54.21  ? 656 LEU B C     1 
ATOM   8558  O  O     . LEU B 1 656 ? 20.980  8.163   1.729   1.00 66.19  ? 656 LEU B O     1 
ATOM   8559  C  CB    . LEU B 1 656 ? 22.518  9.925   -0.468  1.00 45.25  ? 656 LEU B CB    1 
ATOM   8560  C  CG    . LEU B 1 656 ? 23.279  11.227  -0.286  1.00 46.28  ? 656 LEU B CG    1 
ATOM   8561  C  CD1   . LEU B 1 656 ? 22.825  12.316  -1.285  1.00 41.61  ? 656 LEU B CD1   1 
ATOM   8562  C  CD2   . LEU B 1 656 ? 23.136  11.680  1.159   1.00 46.13  ? 656 LEU B CD2   1 
ATOM   8563  N  N     . HIS B 1 657 ? 21.657  6.883   0.025   1.00 39.61  ? 657 HIS B N     1 
ATOM   8564  C  CA    . HIS B 1 657 ? 20.631  5.902   0.241   1.00 37.83  ? 657 HIS B CA    1 
ATOM   8565  C  C     . HIS B 1 657 ? 20.821  5.200   1.596   1.00 42.57  ? 657 HIS B C     1 
ATOM   8566  O  O     . HIS B 1 657 ? 19.885  5.082   2.415   1.00 59.24  ? 657 HIS B O     1 
ATOM   8567  C  CB    . HIS B 1 657 ? 20.653  4.909   -0.901  1.00 28.61  ? 657 HIS B CB    1 
ATOM   8568  C  CG    . HIS B 1 657 ? 19.444  4.043   -0.976  1.00 40.90  ? 657 HIS B CG    1 
ATOM   8569  N  ND1   . HIS B 1 657 ? 18.204  4.540   -1.329  1.00 40.28  ? 657 HIS B ND1   1 
ATOM   8570  C  CD2   . HIS B 1 657 ? 19.289  2.703   -0.815  1.00 44.00  ? 657 HIS B CD2   1 
ATOM   8571  C  CE1   . HIS B 1 657 ? 17.333  3.540   -1.358  1.00 47.65  ? 657 HIS B CE1   1 
ATOM   8572  N  NE2   . HIS B 1 657 ? 17.962  2.419   -1.040  1.00 49.26  ? 657 HIS B NE2   1 
ATOM   8573  N  N     . LEU B 1 658 ? 22.063  4.814   1.865   1.00 35.88  ? 658 LEU B N     1 
ATOM   8574  C  CA    . LEU B 1 658 ? 22.408  4.196   3.146   1.00 47.36  ? 658 LEU B CA    1 
ATOM   8575  C  C     . LEU B 1 658 ? 22.161  5.187   4.274   1.00 48.87  ? 658 LEU B C     1 
ATOM   8576  O  O     . LEU B 1 658 ? 21.491  4.875   5.239   1.00 38.10  ? 658 LEU B O     1 
ATOM   8577  C  CB    . LEU B 1 658 ? 23.861  3.701   3.172   1.00 29.01  ? 658 LEU B CB    1 
ATOM   8578  C  CG    . LEU B 1 658 ? 24.124  2.487   2.315   1.00 35.25  ? 658 LEU B CG    1 
ATOM   8579  C  CD1   . LEU B 1 658 ? 25.615  2.209   2.258   1.00 36.71  ? 658 LEU B CD1   1 
ATOM   8580  C  CD2   . LEU B 1 658 ? 23.335  1.267   2.831   1.00 27.51  ? 658 LEU B CD2   1 
ATOM   8581  N  N     . ALA B 1 659 ? 22.621  6.415   4.095   1.00 41.11  ? 659 ALA B N     1 
ATOM   8582  C  CA    . ALA B 1 659 ? 22.466  7.388   5.143   1.00 48.54  ? 659 ALA B CA    1 
ATOM   8583  C  C     . ALA B 1 659 ? 20.982  7.640   5.456   1.00 47.04  ? 659 ALA B C     1 
ATOM   8584  O  O     . ALA B 1 659 ? 20.578  7.667   6.631   1.00 53.81  ? 659 ALA B O     1 
ATOM   8585  C  CB    . ALA B 1 659 ? 23.146  8.673   4.739   1.00 50.78  ? 659 ALA B CB    1 
ATOM   8586  N  N     . ASP B 1 660 ? 20.167  7.789   4.420   1.00 43.12  ? 660 ASP B N     1 
ATOM   8587  C  CA    . ASP B 1 660 ? 18.747  7.969   4.618   1.00 43.94  ? 660 ASP B CA    1 
ATOM   8588  C  C     . ASP B 1 660 ? 18.149  6.786   5.382   1.00 47.48  ? 660 ASP B C     1 
ATOM   8589  O  O     . ASP B 1 660 ? 17.429  6.991   6.374   1.00 48.10  ? 660 ASP B O     1 
ATOM   8590  C  CB    . ASP B 1 660 ? 18.046  8.178   3.286   1.00 55.23  ? 660 ASP B CB    1 
ATOM   8591  C  CG    . ASP B 1 660 ? 16.560  8.072   3.414   1.00 61.15  ? 660 ASP B CG    1 
ATOM   8592  O  OD1   . ASP B 1 660 ? 15.976  9.080   3.851   1.00 76.33  ? 660 ASP B OD1   1 
ATOM   8593  O  OD2   . ASP B 1 660 ? 15.976  7.029   3.047   1.00 59.81  ? 660 ASP B OD2   1 
ATOM   8594  N  N     . ARG B 1 661 ? 18.498  5.556   4.979   1.00 35.88  ? 661 ARG B N     1 
ATOM   8595  C  CA    . ARG B 1 661 ? 18.021  4.389   5.733   1.00 40.52  ? 661 ARG B CA    1 
ATOM   8596  C  C     . ARG B 1 661 ? 18.520  4.390   7.206   1.00 55.21  ? 661 ARG B C     1 
ATOM   8597  O  O     . ARG B 1 661 ? 17.736  4.064   8.109   1.00 46.68  ? 661 ARG B O     1 
ATOM   8598  C  CB    . ARG B 1 661 ? 18.348  3.077   5.027   1.00 43.87  ? 661 ARG B CB    1 
ATOM   8599  C  CG    . ARG B 1 661 ? 17.502  2.891   3.784   1.00 53.45  ? 661 ARG B CG    1 
ATOM   8600  C  CD    . ARG B 1 661 ? 17.534  1.470   3.236   1.00 69.04  ? 661 ARG B CD    1 
ATOM   8601  N  NE    . ARG B 1 661 ? 16.503  0.587   3.795   1.00 86.20  ? 661 ARG B NE    1 
ATOM   8602  C  CZ    . ARG B 1 661 ? 15.519  0.043   3.077   1.00 93.18  ? 661 ARG B CZ    1 
ATOM   8603  N  NH1   . ARG B 1 661 ? 14.626  -0.748  3.659   1.00 101.09 ? 661 ARG B NH1   1 
ATOM   8604  N  NH2   . ARG B 1 661 ? 15.422  0.298   1.776   1.00 88.45  ? 661 ARG B NH2   1 
ATOM   8605  N  N     . LEU B 1 662 ? 19.795  4.729   7.431   1.00 53.15  ? 662 LEU B N     1 
ATOM   8606  C  CA    . LEU B 1 662 ? 20.397  4.815   8.753   1.00 31.96  ? 662 LEU B CA    1 
ATOM   8607  C  C     . LEU B 1 662 ? 19.596  5.730   9.664   1.00 39.20  ? 662 LEU B C     1 
ATOM   8608  O  O     . LEU B 1 662 ? 19.117  5.299   10.728  1.00 46.91  ? 662 LEU B O     1 
ATOM   8609  C  CB    . LEU B 1 662 ? 21.838  5.322   8.668   1.00 23.39  ? 662 LEU B CB    1 
ATOM   8610  C  CG    . LEU B 1 662 ? 22.546  5.735   9.990   1.00 33.46  ? 662 LEU B CG    1 
ATOM   8611  C  CD1   . LEU B 1 662 ? 22.805  4.593   10.935  1.00 25.98  ? 662 LEU B CD1   1 
ATOM   8612  C  CD2   . LEU B 1 662 ? 23.869  6.400   9.683   1.00 48.33  ? 662 LEU B CD2   1 
ATOM   8613  N  N     . VAL B 1 663 ? 19.405  6.979   9.265   1.00 38.50  ? 663 VAL B N     1 
ATOM   8614  C  CA    . VAL B 1 663 ? 18.691  7.892   10.165  1.00 51.84  ? 663 VAL B CA    1 
ATOM   8615  C  C     . VAL B 1 663 ? 17.225  7.461   10.308  1.00 57.41  ? 663 VAL B C     1 
ATOM   8616  O  O     . VAL B 1 663 ? 16.626  7.703   11.338  1.00 54.65  ? 663 VAL B O     1 
ATOM   8617  C  CB    . VAL B 1 663 ? 18.774  9.353   9.708   1.00 52.85  ? 663 VAL B CB    1 
ATOM   8618  C  CG1   . VAL B 1 663 ? 20.202  9.887   9.806   1.00 43.72  ? 663 VAL B CG1   1 
ATOM   8619  C  CG2   . VAL B 1 663 ? 18.073  9.548   8.305   1.00 29.82  ? 663 VAL B CG2   1 
ATOM   8620  N  N     . LYS B 1 664 ? 16.647  6.824   9.293   1.00 53.84  ? 664 LYS B N     1 
ATOM   8621  C  CA    . LYS B 1 664 ? 15.297  6.312   9.461   1.00 33.05  ? 664 LYS B CA    1 
ATOM   8622  C  C     . LYS B 1 664 ? 15.202  5.199   10.571  1.00 48.87  ? 664 LYS B C     1 
ATOM   8623  O  O     . LYS B 1 664 ? 14.316  5.229   11.447  1.00 43.95  ? 664 LYS B O     1 
ATOM   8624  C  CB    . LYS B 1 664 ? 14.788  5.711   8.158   1.00 41.10  ? 664 LYS B CB    1 
ATOM   8625  C  CG    . LYS B 1 664 ? 13.297  5.502   8.146   1.00 46.02  ? 664 LYS B CG    1 
ATOM   8626  C  CD    . LYS B 1 664 ? 12.689  5.330   6.786   1.00 67.55  ? 664 LYS B CD    1 
ATOM   8627  C  CE    . LYS B 1 664 ? 13.204  6.224   5.694   1.00 85.61  ? 664 LYS B CE    1 
ATOM   8628  N  NZ    . LYS B 1 664 ? 12.352  5.976   4.481   1.00 95.64  ? 664 LYS B NZ    1 
ATOM   8629  N  N     . GLU B 1 665 ? 16.116  4.221   10.524  1.00 45.16  ? 665 GLU B N     1 
ATOM   8630  C  CA    . GLU B 1 665 ? 16.111  3.113   11.497  1.00 45.85  ? 665 GLU B CA    1 
ATOM   8631  C  C     . GLU B 1 665 ? 16.415  3.590   12.911  1.00 60.80  ? 665 GLU B C     1 
ATOM   8632  O  O     . GLU B 1 665 ? 15.823  3.106   13.883  1.00 57.90  ? 665 GLU B O     1 
ATOM   8633  C  CB    . GLU B 1 665 ? 17.133  2.043   11.134  1.00 35.95  ? 665 GLU B CB    1 
ATOM   8634  C  CG    . GLU B 1 665 ? 16.583  0.888   10.323  1.00 57.23  ? 665 GLU B CG    1 
ATOM   8635  C  CD    . GLU B 1 665 ? 15.570  0.040   11.047  1.00 60.64  ? 665 GLU B CD    1 
ATOM   8636  O  OE1   . GLU B 1 665 ? 14.359  0.384   11.031  1.00 59.15  ? 665 GLU B OE1   1 
ATOM   8637  O  OE2   . GLU B 1 665 ? 16.007  -0.974  11.644  1.00 69.81  ? 665 GLU B OE2   1 
ATOM   8638  N  N     . VAL B 1 666 ? 17.366  4.503   13.036  1.00 53.62  ? 666 VAL B N     1 
ATOM   8639  C  CA    . VAL B 1 666 ? 17.655  5.055   14.336  1.00 47.31  ? 666 VAL B CA    1 
ATOM   8640  C  C     . VAL B 1 666 ? 16.465  5.869   14.860  1.00 49.39  ? 666 VAL B C     1 
ATOM   8641  O  O     . VAL B 1 666 ? 16.105  5.810   16.047  1.00 56.86  ? 666 VAL B O     1 
ATOM   8642  C  CB    . VAL B 1 666 ? 18.957  5.874   14.269  1.00 53.51  ? 666 VAL B CB    1 
ATOM   8643  C  CG1   . VAL B 1 666 ? 19.218  6.677   15.549  1.00 58.40  ? 666 VAL B CG1   1 
ATOM   8644  C  CG2   . VAL B 1 666 ? 20.124  4.935   13.848  1.00 31.35  ? 666 VAL B CG2   1 
ATOM   8645  N  N     . GLY B 1 667 ? 15.809  6.589   13.968  1.00 43.54  ? 667 GLY B N     1 
ATOM   8646  C  CA    . GLY B 1 667 ? 14.561  7.264   14.312  1.00 40.23  ? 667 GLY B CA    1 
ATOM   8647  C  C     . GLY B 1 667 ? 13.512  6.298   14.838  1.00 47.78  ? 667 GLY B C     1 
ATOM   8648  O  O     . GLY B 1 667 ? 12.716  6.635   15.685  1.00 57.38  ? 667 GLY B O     1 
ATOM   8649  N  N     . ARG B 1 668 ? 13.482  5.097   14.284  1.00 52.91  ? 668 ARG B N     1 
ATOM   8650  C  CA    . ARG B 1 668 ? 12.536  4.077   14.702  1.00 46.15  ? 668 ARG B CA    1 
ATOM   8651  C  C     . ARG B 1 668 ? 12.865  3.302   15.985  1.00 43.69  ? 668 ARG B C     1 
ATOM   8652  O  O     . ARG B 1 668 ? 11.981  3.036   16.768  1.00 58.62  ? 668 ARG B O     1 
ATOM   8653  C  CB    . ARG B 1 668 ? 12.410  3.080   13.564  1.00 52.65  ? 668 ARG B CB    1 
ATOM   8654  C  CG    . ARG B 1 668 ? 11.049  2.907   13.008  1.00 46.60  ? 668 ARG B CG    1 
ATOM   8655  C  CD    . ARG B 1 668 ? 11.070  2.998   11.506  1.00 42.94  ? 668 ARG B CD    1 
ATOM   8656  N  NE    . ARG B 1 668 ? 11.828  1.951   10.853  1.00 50.31  ? 668 ARG B NE    1 
ATOM   8657  C  CZ    . ARG B 1 668 ? 11.962  1.872   9.530   1.00 72.29  ? 668 ARG B CZ    1 
ATOM   8658  N  NH1   . ARG B 1 668 ? 11.346  2.755   8.757   1.00 68.84  ? 668 ARG B NH1   1 
ATOM   8659  N  NH2   . ARG B 1 668 ? 12.674  0.894   8.973   1.00 86.05  ? 668 ARG B NH2   1 
ATOM   8660  N  N     . LEU B 1 669 ? 14.125  2.944   16.198  1.00 37.66  ? 669 LEU B N     1 
ATOM   8661  C  CA    . LEU B 1 669 ? 14.507  2.000   17.262  1.00 42.69  ? 669 LEU B CA    1 
ATOM   8662  C  C     . LEU B 1 669 ? 15.080  2.753   18.460  1.00 45.43  ? 669 LEU B C     1 
ATOM   8663  O  O     . LEU B 1 669 ? 14.955  2.333   19.613  1.00 45.17  ? 669 LEU B O     1 
ATOM   8664  C  CB    . LEU B 1 669 ? 15.567  1.029   16.727  1.00 42.33  ? 669 LEU B CB    1 
ATOM   8665  C  CG    . LEU B 1 669 ? 15.210  0.260   15.460  1.00 43.96  ? 669 LEU B CG    1 
ATOM   8666  C  CD1   . LEU B 1 669 ? 16.198  -0.853  15.251  1.00 45.35  ? 669 LEU B CD1   1 
ATOM   8667  C  CD2   . LEU B 1 669 ? 13.805  -0.325  15.598  1.00 46.81  ? 669 LEU B CD2   1 
ATOM   8668  N  N     . GLY B 1 670 ? 15.695  3.889   18.152  1.00 45.86  ? 670 GLY B N     1 
ATOM   8669  C  CA    . GLY B 1 670 ? 16.437  4.655   19.122  1.00 43.97  ? 670 GLY B CA    1 
ATOM   8670  C  C     . GLY B 1 670 ? 17.921  4.403   18.890  1.00 43.99  ? 670 GLY B C     1 
ATOM   8671  O  O     . GLY B 1 670 ? 18.316  3.411   18.292  1.00 50.81  ? 670 GLY B O     1 
ATOM   8672  N  N     . ILE B 1 671 ? 18.745  5.264   19.455  1.00 45.99  ? 671 ILE B N     1 
ATOM   8673  C  CA    . ILE B 1 671 ? 20.171  5.184   19.260  1.00 43.66  ? 671 ILE B CA    1 
ATOM   8674  C  C     . ILE B 1 671 ? 20.817  4.341   20.361  1.00 42.71  ? 671 ILE B C     1 
ATOM   8675  O  O     . ILE B 1 671 ? 21.958  3.924   20.247  1.00 53.23  ? 671 ILE B O     1 
ATOM   8676  C  CB    . ILE B 1 671 ? 20.746  6.630   19.252  1.00 55.74  ? 671 ILE B CB    1 
ATOM   8677  C  CG1   . ILE B 1 671 ? 22.096  6.719   18.581  1.00 47.37  ? 671 ILE B CG1   1 
ATOM   8678  C  CG2   . ILE B 1 671 ? 20.775  7.259   20.650  1.00 62.86  ? 671 ILE B CG2   1 
ATOM   8679  C  CD1   . ILE B 1 671 ? 22.490  8.149   18.358  1.00 48.56  ? 671 ILE B CD1   1 
ATOM   8680  N  N     . ARG B 1 672 ? 20.053  4.030   21.404  1.00 58.34  ? 672 ARG B N     1 
ATOM   8681  C  CA    . ARG B 1 672 ? 20.612  3.381   22.592  1.00 54.83  ? 672 ARG B CA    1 
ATOM   8682  C  C     . ARG B 1 672 ? 21.051  1.932   22.357  1.00 60.69  ? 672 ARG B C     1 
ATOM   8683  O  O     . ARG B 1 672 ? 21.817  1.379   23.139  1.00 74.92  ? 672 ARG B O     1 
ATOM   8684  C  CB    . ARG B 1 672 ? 19.551  3.425   23.733  1.00 42.14  ? 672 ARG B CB    1 
ATOM   8685  C  CG    . ARG B 1 672 ? 18.280  2.569   23.466  1.00 31.78  ? 672 ARG B CG    1 
ATOM   8686  C  CD    . ARG B 1 672 ? 17.132  2.871   24.459  1.00 34.40  ? 672 ARG B CD    1 
ATOM   8687  N  NE    . ARG B 1 672 ? 15.875  2.209   24.103  1.00 40.23  ? 672 ARG B NE    1 
ATOM   8688  C  CZ    . ARG B 1 672 ? 14.972  2.669   23.226  1.00 50.06  ? 672 ARG B CZ    1 
ATOM   8689  N  NH1   . ARG B 1 672 ? 15.112  3.857   22.632  1.00 43.59  ? 672 ARG B NH1   1 
ATOM   8690  N  NH2   . ARG B 1 672 ? 13.875  1.959   22.984  1.00 51.02  ? 672 ARG B NH2   1 
ATOM   8691  N  N     . HIS B 1 673 ? 20.632  1.341   21.245  1.00 52.03  ? 673 HIS B N     1 
ATOM   8692  C  CA    . HIS B 1 673 ? 20.941  -0.068  20.995  1.00 50.11  ? 673 HIS B CA    1 
ATOM   8693  C  C     . HIS B 1 673 ? 22.235  -0.332  20.186  1.00 53.26  ? 673 HIS B C     1 
ATOM   8694  O  O     . HIS B 1 673 ? 22.634  -1.488  20.020  1.00 67.15  ? 673 HIS B O     1 
ATOM   8695  C  CB    . HIS B 1 673 ? 19.778  -0.740  20.272  1.00 49.42  ? 673 HIS B CB    1 
ATOM   8696  C  CG    . HIS B 1 673 ? 18.430  -0.309  20.757  1.00 59.03  ? 673 HIS B CG    1 
ATOM   8697  N  ND1   . HIS B 1 673 ? 17.880  -0.780  21.929  1.00 52.50  ? 673 HIS B ND1   1 
ATOM   8698  C  CD2   . HIS B 1 673 ? 17.507  0.521   20.209  1.00 57.31  ? 673 HIS B CD2   1 
ATOM   8699  C  CE1   . HIS B 1 673 ? 16.682  -0.250  22.091  1.00 52.13  ? 673 HIS B CE1   1 
ATOM   8700  N  NE2   . HIS B 1 673 ? 16.431  0.543   21.060  1.00 44.98  ? 673 HIS B NE2   1 
ATOM   8701  N  N     . LEU B 1 674 ? 22.898  0.722   19.718  1.00 36.69  ? 674 LEU B N     1 
ATOM   8702  C  CA    . LEU B 1 674 ? 23.940  0.575   18.715  1.00 44.66  ? 674 LEU B CA    1 
ATOM   8703  C  C     . LEU B 1 674 ? 25.380  0.512   19.238  1.00 53.17  ? 674 LEU B C     1 
ATOM   8704  O  O     . LEU B 1 674 ? 26.314  0.333   18.453  1.00 49.08  ? 674 LEU B O     1 
ATOM   8705  C  CB    . LEU B 1 674 ? 23.845  1.757   17.746  1.00 36.13  ? 674 LEU B CB    1 
ATOM   8706  C  CG    . LEU B 1 674 ? 22.507  2.044   17.056  1.00 36.99  ? 674 LEU B CG    1 
ATOM   8707  C  CD1   . LEU B 1 674 ? 22.711  3.131   16.066  1.00 47.30  ? 674 LEU B CD1   1 
ATOM   8708  C  CD2   . LEU B 1 674 ? 22.051  0.770   16.274  1.00 32.94  ? 674 LEU B CD2   1 
ATOM   8709  N  N     . LYS B 1 675 ? 25.554  0.558   20.555  1.00 40.19  ? 675 LYS B N     1 
ATOM   8710  C  CA    . LYS B 1 675 ? 26.901  0.663   21.095  1.00 43.16  ? 675 LYS B CA    1 
ATOM   8711  C  C     . LYS B 1 675 ? 27.828  -0.478  20.667  1.00 51.70  ? 675 LYS B C     1 
ATOM   8712  O  O     . LYS B 1 675 ? 28.999  -0.241  20.368  1.00 50.86  ? 675 LYS B O     1 
ATOM   8713  C  CB    . LYS B 1 675 ? 26.890  0.740   22.618  1.00 45.47  ? 675 LYS B CB    1 
ATOM   8714  C  CG    . LYS B 1 675 ? 28.039  1.545   23.160  1.00 53.51  ? 675 LYS B CG    1 
ATOM   8715  C  CD    . LYS B 1 675 ? 27.945  1.698   24.657  1.00 51.45  ? 675 LYS B CD    1 
ATOM   8716  C  CE    . LYS B 1 675 ? 29.121  2.469   25.191  1.00 45.57  ? 675 LYS B CE    1 
ATOM   8717  N  NZ    . LYS B 1 675 ? 30.467  1.988   24.823  1.00 54.49  ? 675 LYS B NZ    1 
ATOM   8718  N  N     . GLU B 1 676 ? 27.297  -1.693  20.632  1.00 59.14  ? 676 GLU B N     1 
ATOM   8719  C  CA    . GLU B 1 676 ? 28.091  -2.875  20.314  1.00 55.22  ? 676 GLU B CA    1 
ATOM   8720  C  C     . GLU B 1 676 ? 27.884  -3.411  18.917  1.00 41.91  ? 676 GLU B C     1 
ATOM   8721  O  O     . GLU B 1 676 ? 28.232  -4.538  18.638  1.00 67.58  ? 676 GLU B O     1 
ATOM   8722  C  CB    . GLU B 1 676 ? 27.738  -3.960  21.356  1.00 60.33  ? 676 GLU B CB    1 
ATOM   8723  C  CG    . GLU B 1 676 ? 28.388  -3.609  22.615  1.00 71.45  ? 676 GLU B CG    1 
ATOM   8724  C  CD    . GLU B 1 676 ? 28.074  -4.392  23.826  1.00 94.13  ? 676 GLU B CD    1 
ATOM   8725  O  OE1   . GLU B 1 676 ? 27.871  -5.627  23.781  1.00 103.00 ? 676 GLU B OE1   1 
ATOM   8726  O  OE2   . GLU B 1 676 ? 28.269  -3.761  24.889  1.00 114.48 ? 676 GLU B OE2   1 
ATOM   8727  N  N     . VAL B 1 677 ? 27.356  -2.592  18.020  1.00 50.18  ? 677 VAL B N     1 
ATOM   8728  C  CA    . VAL B 1 677 ? 27.134  -2.983  16.610  1.00 49.86  ? 677 VAL B CA    1 
ATOM   8729  C  C     . VAL B 1 677 ? 28.242  -2.480  15.684  1.00 47.98  ? 677 VAL B C     1 
ATOM   8730  O  O     . VAL B 1 677 ? 28.501  -1.276  15.658  1.00 30.79  ? 677 VAL B O     1 
ATOM   8731  C  CB    . VAL B 1 677 ? 25.786  -2.481  16.113  1.00 54.11  ? 677 VAL B CB    1 
ATOM   8732  C  CG1   . VAL B 1 677 ? 25.463  -3.058  14.746  1.00 38.11  ? 677 VAL B CG1   1 
ATOM   8733  C  CG2   . VAL B 1 677 ? 24.715  -2.845  17.124  1.00 52.50  ? 677 VAL B CG2   1 
ATOM   8734  N  N     . ASP B 1 678 ? 28.898  -3.373  14.930  1.00 46.41  ? 678 ASP B N     1 
ATOM   8735  C  CA    . ASP B 1 678 ? 30.052  -2.929  14.160  1.00 44.80  ? 678 ASP B CA    1 
ATOM   8736  C  C     . ASP B 1 678 ? 29.589  -1.993  13.043  1.00 44.19  ? 678 ASP B C     1 
ATOM   8737  O  O     . ASP B 1 678 ? 28.558  -2.234  12.399  1.00 48.07  ? 678 ASP B O     1 
ATOM   8738  C  CB    . ASP B 1 678 ? 30.774  -4.107  13.465  1.00 57.73  ? 678 ASP B CB    1 
ATOM   8739  C  CG    . ASP B 1 678 ? 31.374  -5.117  14.442  1.00 81.05  ? 678 ASP B CG    1 
ATOM   8740  O  OD1   . ASP B 1 678 ? 31.940  -4.711  15.480  1.00 100.67 ? 678 ASP B OD1   1 
ATOM   8741  O  OD2   . ASP B 1 678 ? 31.387  -6.325  14.095  1.00 73.54  ? 678 ASP B OD2   1 
ATOM   8742  N  N     . ARG B 1 679 ? 30.411  -0.991  12.743  1.00 34.13  ? 679 ARG B N     1 
ATOM   8743  C  CA    . ARG B 1 679 ? 30.083  0.075   11.798  1.00 36.10  ? 679 ARG B CA    1 
ATOM   8744  C  C     . ARG B 1 679 ? 30.120  -0.467  10.357  1.00 53.89  ? 679 ARG B C     1 
ATOM   8745  O  O     . ARG B 1 679 ? 29.716  0.236   9.409   1.00 55.00  ? 679 ARG B O     1 
ATOM   8746  C  CB    . ARG B 1 679 ? 31.069  1.224   11.942  1.00 43.35  ? 679 ARG B CB    1 
ATOM   8747  C  CG    . ARG B 1 679 ? 31.237  1.877   13.300  1.00 53.83  ? 679 ARG B CG    1 
ATOM   8748  C  CD    . ARG B 1 679 ? 32.035  3.141   13.053  1.00 67.15  ? 679 ARG B CD    1 
ATOM   8749  N  NE    . ARG B 1 679 ? 31.710  4.330   13.811  1.00 78.88  ? 679 ARG B NE    1 
ATOM   8750  C  CZ    . ARG B 1 679 ? 32.318  4.686   14.931  1.00 84.64  ? 679 ARG B CZ    1 
ATOM   8751  N  NH1   . ARG B 1 679 ? 33.276  3.905   15.444  1.00 50.04  ? 679 ARG B NH1   1 
ATOM   8752  N  NH2   . ARG B 1 679 ? 31.934  5.806   15.543  1.00 100.32 ? 679 ARG B NH2   1 
ATOM   8753  N  N     . GLU B 1 680 ? 30.660  -1.681  10.172  1.00 54.36  ? 680 GLU B N     1 
ATOM   8754  C  CA    . GLU B 1 680 ? 30.675  -2.287  8.825   1.00 52.99  ? 680 GLU B CA    1 
ATOM   8755  C  C     . GLU B 1 680 ? 29.476  -3.147  8.543   1.00 46.34  ? 680 GLU B C     1 
ATOM   8756  O  O     . GLU B 1 680 ? 29.228  -3.513  7.398   1.00 60.96  ? 680 GLU B O     1 
ATOM   8757  C  CB    . GLU B 1 680 ? 31.918  -3.177  8.622   1.00 50.97  ? 680 GLU B CB    1 
ATOM   8758  C  CG    . GLU B 1 680 ? 33.243  -2.498  8.827   1.00 73.52  ? 680 GLU B CG    1 
ATOM   8759  C  CD    . GLU B 1 680 ? 33.787  -2.689  10.238  1.00 95.54  ? 680 GLU B CD    1 
ATOM   8760  O  OE1   . GLU B 1 680 ? 33.087  -3.339  11.060  1.00 99.73  ? 680 GLU B OE1   1 
ATOM   8761  O  OE2   . GLU B 1 680 ? 34.905  -2.177  10.515  1.00 104.57 ? 680 GLU B OE2   1 
ATOM   8762  N  N     . LYS B 1 681 ? 28.712  -3.425  9.582   1.00 51.05  ? 681 LYS B N     1 
ATOM   8763  C  CA    . LYS B 1 681 ? 27.462  -4.168  9.464   1.00 48.75  ? 681 LYS B CA    1 
ATOM   8764  C  C     . LYS B 1 681 ? 26.310  -3.234  9.158   1.00 40.29  ? 681 LYS B C     1 
ATOM   8765  O  O     . LYS B 1 681 ? 25.914  -2.442  10.010  1.00 38.55  ? 681 LYS B O     1 
ATOM   8766  C  CB    . LYS B 1 681 ? 27.230  -4.929  10.770  1.00 53.08  ? 681 LYS B CB    1 
ATOM   8767  C  CG    . LYS B 1 681 ? 28.319  -5.965  11.097  1.00 44.21  ? 681 LYS B CG    1 
ATOM   8768  C  CD    . LYS B 1 681 ? 27.942  -6.721  12.360  1.00 53.63  ? 681 LYS B CD    1 
ATOM   8769  C  CE    . LYS B 1 681 ? 28.914  -7.821  12.746  1.00 59.33  ? 681 LYS B CE    1 
ATOM   8770  N  NZ    . LYS B 1 681 ? 28.347  -8.512  13.953  1.00 67.82  ? 681 LYS B NZ    1 
ATOM   8771  N  N     . LEU B 1 682 ? 25.687  -3.406  8.001   1.00 46.13  ? 682 LEU B N     1 
ATOM   8772  C  CA    . LEU B 1 682 ? 24.639  -2.471  7.590   1.00 50.97  ? 682 LEU B CA    1 
ATOM   8773  C  C     . LEU B 1 682 ? 23.279  -2.914  8.089   1.00 58.00  ? 682 LEU B C     1 
ATOM   8774  O  O     . LEU B 1 682 ? 22.441  -3.401  7.322   1.00 54.83  ? 682 LEU B O     1 
ATOM   8775  C  CB    . LEU B 1 682 ? 24.627  -2.308  6.060   1.00 45.81  ? 682 LEU B CB    1 
ATOM   8776  C  CG    . LEU B 1 682 ? 25.990  -2.070  5.418   1.00 38.53  ? 682 LEU B CG    1 
ATOM   8777  C  CD1   . LEU B 1 682 ? 25.889  -1.857  3.930   1.00 32.61  ? 682 LEU B CD1   1 
ATOM   8778  C  CD2   . LEU B 1 682 ? 26.498  -0.785  6.069   1.00 41.21  ? 682 LEU B CD2   1 
ATOM   8779  N  N     . PHE B 1 683 ? 23.073  -2.686  9.394   1.00 57.91  ? 683 PHE B N     1 
ATOM   8780  C  CA    . PHE B 1 683 ? 21.913  -3.229  10.111  1.00 55.08  ? 683 PHE B CA    1 
ATOM   8781  C  C     . PHE B 1 683 ? 20.563  -2.666  9.635   1.00 49.92  ? 683 PHE B C     1 
ATOM   8782  O  O     . PHE B 1 683 ? 19.515  -3.220  9.938   1.00 66.90  ? 683 PHE B O     1 
ATOM   8783  C  CB    . PHE B 1 683 ? 22.058  -3.010  11.629  1.00 48.69  ? 683 PHE B CB    1 
ATOM   8784  C  CG    . PHE B 1 683 ? 22.019  -1.569  12.042  1.00 52.69  ? 683 PHE B CG    1 
ATOM   8785  C  CD1   . PHE B 1 683 ? 23.183  -0.793  12.071  1.00 50.65  ? 683 PHE B CD1   1 
ATOM   8786  C  CD2   . PHE B 1 683 ? 20.811  -0.984  12.419  1.00 52.26  ? 683 PHE B CD2   1 
ATOM   8787  C  CE1   . PHE B 1 683 ? 23.135  0.563   12.470  1.00 40.03  ? 683 PHE B CE1   1 
ATOM   8788  C  CE2   . PHE B 1 683 ? 20.749  0.341   12.800  1.00 49.21  ? 683 PHE B CE2   1 
ATOM   8789  C  CZ    . PHE B 1 683 ? 21.900  1.119   12.827  1.00 40.14  ? 683 PHE B CZ    1 
ATOM   8790  N  N     . PHE B 1 684 ? 20.598  -1.574  8.884   1.00 45.11  ? 684 PHE B N     1 
ATOM   8791  C  CA    . PHE B 1 684 ? 19.379  -0.855  8.540   1.00 49.87  ? 684 PHE B CA    1 
ATOM   8792  C  C     . PHE B 1 684 ? 18.809  -1.104  7.162   1.00 55.99  ? 684 PHE B C     1 
ATOM   8793  O  O     . PHE B 1 684 ? 17.781  -0.524  6.809   1.00 76.52  ? 684 PHE B O     1 
ATOM   8794  C  CB    . PHE B 1 684 ? 19.638  0.652   8.709   1.00 52.34  ? 684 PHE B CB    1 
ATOM   8795  C  CG    . PHE B 1 684 ? 20.936  1.094   8.113   1.00 56.91  ? 684 PHE B CG    1 
ATOM   8796  C  CD1   . PHE B 1 684 ? 21.045  1.403   6.768   1.00 42.09  ? 684 PHE B CD1   1 
ATOM   8797  C  CD2   . PHE B 1 684 ? 22.071  1.180   8.927   1.00 62.43  ? 684 PHE B CD2   1 
ATOM   8798  C  CE1   . PHE B 1 684 ? 22.259  1.780   6.247   1.00 52.76  ? 684 PHE B CE1   1 
ATOM   8799  C  CE2   . PHE B 1 684 ? 23.295  1.566   8.412   1.00 62.05  ? 684 PHE B CE2   1 
ATOM   8800  C  CZ    . PHE B 1 684 ? 23.397  1.865   7.078   1.00 63.96  ? 684 PHE B CZ    1 
ATOM   8801  N  N     . VAL B 1 685 ? 19.495  -1.908  6.362   1.00 51.03  ? 685 VAL B N     1 
ATOM   8802  C  CA    . VAL B 1 685 ? 18.999  -2.241  5.032   1.00 56.94  ? 685 VAL B CA    1 
ATOM   8803  C  C     . VAL B 1 685 ? 17.736  -3.134  5.117   1.00 68.92  ? 685 VAL B C     1 
ATOM   8804  O  O     . VAL B 1 685 ? 16.778  -2.963  4.371   1.00 83.15  ? 685 VAL B O     1 
ATOM   8805  C  CB    . VAL B 1 685 ? 20.109  -2.897  4.164   1.00 29.00  ? 685 VAL B CB    1 
ATOM   8806  C  CG1   . VAL B 1 685 ? 21.328  -1.988  4.118   1.00 39.33  ? 685 VAL B CG1   1 
ATOM   8807  C  CG2   . VAL B 1 685 ? 20.534  -4.229  4.711   1.00 34.32  ? 685 VAL B CG2   1 
ATOM   8808  O  OXT   . VAL B 1 685 ? 17.589  -4.059  5.926   1.00 65.39  ? 685 VAL B OXT   1 
ATOM   8809  O  OP3   . DT  C 2 1   ? 36.179  18.169  33.511  1.00 59.10  ? 1   DT  C OP3   1 
ATOM   8810  P  P     . DT  C 2 1   ? 36.944  17.382  34.533  1.00 57.10  ? 1   DT  C P     1 
ATOM   8811  O  OP1   . DT  C 2 1   ? 37.802  16.417  33.827  1.00 45.75  ? 1   DT  C OP1   1 
ATOM   8812  O  OP2   . DT  C 2 1   ? 36.022  16.896  35.592  1.00 64.91  ? 1   DT  C OP2   1 
ATOM   8813  O  "O5'" . DT  C 2 1   ? 37.930  18.391  35.263  1.00 53.96  ? 1   DT  C "O5'" 1 
ATOM   8814  C  "C5'" . DT  C 2 1   ? 37.519  19.704  35.547  1.00 49.40  ? 1   DT  C "C5'" 1 
ATOM   8815  C  "C4'" . DT  C 2 1   ? 38.636  20.679  35.253  1.00 46.90  ? 1   DT  C "C4'" 1 
ATOM   8816  O  "O4'" . DT  C 2 1   ? 38.333  21.361  34.028  1.00 58.36  ? 1   DT  C "O4'" 1 
ATOM   8817  C  "C3'" . DT  C 2 1   ? 38.861  21.768  36.315  1.00 54.36  ? 1   DT  C "C3'" 1 
ATOM   8818  O  "O3'" . DT  C 2 1   ? 40.229  21.794  36.731  1.00 58.60  ? 1   DT  C "O3'" 1 
ATOM   8819  C  "C2'" . DT  C 2 1   ? 38.461  23.068  35.614  1.00 59.14  ? 1   DT  C "C2'" 1 
ATOM   8820  C  "C1'" . DT  C 2 1   ? 38.650  22.725  34.152  1.00 60.45  ? 1   DT  C "C1'" 1 
ATOM   8821  N  N1    . DT  C 2 1   ? 37.743  23.465  33.270  1.00 58.39  ? 1   DT  C N1    1 
ATOM   8822  C  C2    . DT  C 2 1   ? 38.260  24.309  32.318  1.00 51.83  ? 1   DT  C C2    1 
ATOM   8823  O  O2    . DT  C 2 1   ? 39.453  24.492  32.161  1.00 44.99  ? 1   DT  C O2    1 
ATOM   8824  N  N3    . DT  C 2 1   ? 37.323  24.933  31.549  1.00 50.09  ? 1   DT  C N3    1 
ATOM   8825  C  C4    . DT  C 2 1   ? 35.948  24.796  31.626  1.00 59.50  ? 1   DT  C C4    1 
ATOM   8826  O  O4    . DT  C 2 1   ? 35.182  25.393  30.885  1.00 73.74  ? 1   DT  C O4    1 
ATOM   8827  C  C5    . DT  C 2 1   ? 35.472  23.898  32.638  1.00 71.22  ? 1   DT  C C5    1 
ATOM   8828  C  C7    . DT  C 2 1   ? 33.993  23.677  32.807  1.00 70.85  ? 1   DT  C C7    1 
ATOM   8829  C  C6    . DT  C 2 1   ? 36.383  23.278  33.407  1.00 69.93  ? 1   DT  C C6    1 
ATOM   8830  P  P     . DG  C 2 2   ? 40.647  22.396  38.172  1.00 64.19  ? 2   DG  C P     1 
ATOM   8831  O  OP1   . DG  C 2 2   ? 39.922  23.659  38.482  1.00 58.24  ? 2   DG  C OP1   1 
ATOM   8832  O  OP2   . DG  C 2 2   ? 42.124  22.354  38.147  1.00 62.79  ? 2   DG  C OP2   1 
ATOM   8833  O  "O5'" . DG  C 2 2   ? 40.111  21.334  39.236  1.00 45.63  ? 2   DG  C "O5'" 1 
ATOM   8834  C  "C5'" . DG  C 2 2   ? 40.313  19.909  39.038  1.00 50.98  ? 2   DG  C "C5'" 1 
ATOM   8835  C  "C4'" . DG  C 2 2   ? 39.232  19.145  39.754  1.00 54.02  ? 2   DG  C "C4'" 1 
ATOM   8836  O  "O4'" . DG  C 2 2   ? 39.322  19.432  41.183  1.00 70.32  ? 2   DG  C "O4'" 1 
ATOM   8837  C  "C3'" . DG  C 2 2   ? 37.817  19.550  39.335  1.00 51.11  ? 2   DG  C "C3'" 1 
ATOM   8838  O  "O3'" . DG  C 2 2   ? 36.961  18.432  39.411  1.00 47.66  ? 2   DG  C "O3'" 1 
ATOM   8839  C  "C2'" . DG  C 2 2   ? 37.441  20.624  40.363  1.00 58.03  ? 2   DG  C "C2'" 1 
ATOM   8840  C  "C1'" . DG  C 2 2   ? 38.163  20.144  41.614  1.00 73.68  ? 2   DG  C "C1'" 1 
ATOM   8841  N  N9    . DG  C 2 2   ? 38.530  21.249  42.529  1.00 75.71  ? 2   DG  C N9    1 
ATOM   8842  C  C8    . DG  C 2 2   ? 38.909  22.527  42.188  1.00 66.89  ? 2   DG  C C8    1 
ATOM   8843  N  N7    . DG  C 2 2   ? 39.125  23.314  43.220  1.00 54.58  ? 2   DG  C N7    1 
ATOM   8844  C  C5    . DG  C 2 2   ? 38.865  22.505  44.316  1.00 61.00  ? 2   DG  C C5    1 
ATOM   8845  C  C6    . DG  C 2 2   ? 38.923  22.794  45.698  1.00 50.41  ? 2   DG  C C6    1 
ATOM   8846  O  O6    . DG  C 2 2   ? 39.256  23.850  46.247  1.00 51.66  ? 2   DG  C O6    1 
ATOM   8847  N  N1    . DG  C 2 2   ? 38.554  21.700  46.470  1.00 53.20  ? 2   DG  C N1    1 
ATOM   8848  C  C2    . DG  C 2 2   ? 38.204  20.475  45.970  1.00 61.77  ? 2   DG  C C2    1 
ATOM   8849  N  N2    . DG  C 2 2   ? 37.896  19.543  46.860  1.00 68.97  ? 2   DG  C N2    1 
ATOM   8850  N  N3    . DG  C 2 2   ? 38.146  20.182  44.687  1.00 78.77  ? 2   DG  C N3    1 
ATOM   8851  C  C4    . DG  C 2 2   ? 38.488  21.238  43.913  1.00 78.97  ? 2   DG  C C4    1 
ATOM   8852  P  P     . DA  C 2 3   ? 35.385  18.597  39.219  1.00 57.35  ? 3   DA  C P     1 
ATOM   8853  O  OP1   . DA  C 2 3   ? 34.964  17.460  38.370  1.00 62.31  ? 3   DA  C OP1   1 
ATOM   8854  O  OP2   . DA  C 2 3   ? 35.016  20.000  38.902  1.00 58.88  ? 3   DA  C OP2   1 
ATOM   8855  O  "O5'" . DA  C 2 3   ? 34.801  18.422  40.660  1.00 62.52  ? 3   DA  C "O5'" 1 
ATOM   8856  C  "C5'" . DA  C 2 3   ? 35.046  17.259  41.424  1.00 69.70  ? 3   DA  C "C5'" 1 
ATOM   8857  C  "C4'" . DA  C 2 3   ? 34.532  17.488  42.827  1.00 60.01  ? 3   DA  C "C4'" 1 
ATOM   8858  O  "O4'" . DA  C 2 3   ? 35.339  18.528  43.414  1.00 60.64  ? 3   DA  C "O4'" 1 
ATOM   8859  C  "C3'" . DA  C 2 3   ? 33.123  18.061  42.866  1.00 52.23  ? 3   DA  C "C3'" 1 
ATOM   8860  O  "O3'" . DA  C 2 3   ? 32.172  17.038  42.895  1.00 42.55  ? 3   DA  C "O3'" 1 
ATOM   8861  C  "C2'" . DA  C 2 3   ? 33.101  18.866  44.158  1.00 58.58  ? 3   DA  C "C2'" 1 
ATOM   8862  C  "C1'" . DA  C 2 3   ? 34.578  19.197  44.393  1.00 63.56  ? 3   DA  C "C1'" 1 
ATOM   8863  N  N9    . DA  C 2 3   ? 34.888  20.613  44.336  1.00 61.78  ? 3   DA  C N9    1 
ATOM   8864  C  C8    . DA  C 2 3   ? 35.023  21.395  43.226  1.00 61.30  ? 3   DA  C C8    1 
ATOM   8865  N  N7    . DA  C 2 3   ? 35.322  22.650  43.498  1.00 60.74  ? 3   DA  C N7    1 
ATOM   8866  C  C5    . DA  C 2 3   ? 35.405  22.677  44.875  1.00 60.00  ? 3   DA  C C5    1 
ATOM   8867  C  C6    . DA  C 2 3   ? 35.700  23.705  45.788  1.00 61.14  ? 3   DA  C C6    1 
ATOM   8868  N  N6    . DA  C 2 3   ? 35.969  24.962  45.422  1.00 57.03  ? 3   DA  C N6    1 
ATOM   8869  N  N1    . DA  C 2 3   ? 35.700  23.391  47.095  1.00 68.56  ? 3   DA  C N1    1 
ATOM   8870  C  C2    . DA  C 2 3   ? 35.435  22.127  47.459  1.00 78.82  ? 3   DA  C C2    1 
ATOM   8871  N  N3    . DA  C 2 3   ? 35.140  21.076  46.700  1.00 70.88  ? 3   DA  C N3    1 
ATOM   8872  C  C4    . DA  C 2 3   ? 35.138  21.426  45.405  1.00 67.00  ? 3   DA  C C4    1 
ATOM   8873  P  P     . DG  C 2 4   ? 30.624  17.395  42.659  1.00 46.93  ? 4   DG  C P     1 
ATOM   8874  O  OP1   . DG  C 2 4   ? 29.976  16.105  42.416  1.00 41.87  ? 4   DG  C OP1   1 
ATOM   8875  O  OP2   . DG  C 2 4   ? 30.485  18.588  41.796  1.00 53.31  ? 4   DG  C OP2   1 
ATOM   8876  O  "O5'" . DG  C 2 4   ? 30.112  17.943  44.052  1.00 52.24  ? 4   DG  C "O5'" 1 
ATOM   8877  C  "C5'" . DG  C 2 4   ? 29.971  17.096  45.127  1.00 51.03  ? 4   DG  C "C5'" 1 
ATOM   8878  C  "C4'" . DG  C 2 4   ? 29.802  17.942  46.318  1.00 49.04  ? 4   DG  C "C4'" 1 
ATOM   8879  O  "O4'" . DG  C 2 4   ? 30.898  18.848  46.383  1.00 49.25  ? 4   DG  C "O4'" 1 
ATOM   8880  C  "C3'" . DG  C 2 4   ? 28.638  18.876  46.208  1.00 52.24  ? 4   DG  C "C3'" 1 
ATOM   8881  O  "O3'" . DG  C 2 4   ? 27.462  18.183  46.454  1.00 50.69  ? 4   DG  C "O3'" 1 
ATOM   8882  C  "C2'" . DG  C 2 4   ? 28.970  19.871  47.311  1.00 52.89  ? 4   DG  C "C2'" 1 
ATOM   8883  C  "C1'" . DG  C 2 4   ? 30.484  19.991  47.115  1.00 58.59  ? 4   DG  C "C1'" 1 
ATOM   8884  N  N9    . DG  C 2 4   ? 30.887  21.155  46.365  1.00 55.05  ? 4   DG  C N9    1 
ATOM   8885  C  C8    . DG  C 2 4   ? 30.875  21.289  45.023  1.00 76.30  ? 4   DG  C C8    1 
ATOM   8886  N  N7    . DG  C 2 4   ? 31.320  22.442  44.613  1.00 92.94  ? 4   DG  C N7    1 
ATOM   8887  C  C5    . DG  C 2 4   ? 31.654  23.108  45.782  1.00 82.98  ? 4   DG  C C5    1 
ATOM   8888  C  C6    . DG  C 2 4   ? 32.191  24.414  45.981  1.00 76.35  ? 4   DG  C C6    1 
ATOM   8889  O  O6    . DG  C 2 4   ? 32.485  25.272  45.129  1.00 65.11  ? 4   DG  C O6    1 
ATOM   8890  N  N1    . DG  C 2 4   ? 32.376  24.682  47.325  1.00 74.94  ? 4   DG  C N1    1 
ATOM   8891  C  C2    . DG  C 2 4   ? 32.079  23.807  48.345  1.00 80.88  ? 4   DG  C C2    1 
ATOM   8892  N  N2    . DG  C 2 4   ? 32.328  24.232  49.593  1.00 86.62  ? 4   DG  C N2    1 
ATOM   8893  N  N3    . DG  C 2 4   ? 31.584  22.596  48.165  1.00 82.64  ? 4   DG  C N3    1 
ATOM   8894  C  C4    . DG  C 2 4   ? 31.396  22.318  46.865  1.00 67.95  ? 4   DG  C C4    1 
ATOM   8895  P  P     . DG  C 2 5   ? 26.099  18.741  45.863  1.00 51.45  ? 5   DG  C P     1 
ATOM   8896  O  OP1   . DG  C 2 5   ? 25.146  17.632  45.850  1.00 48.86  ? 5   DG  C OP1   1 
ATOM   8897  O  OP2   . DG  C 2 5   ? 26.392  19.508  44.669  1.00 65.45  ? 5   DG  C OP2   1 
ATOM   8898  O  "O5'" . DG  C 2 5   ? 25.647  19.779  46.937  1.00 59.47  ? 5   DG  C "O5'" 1 
ATOM   8899  C  "C5'" . DG  C 2 5   ? 25.504  19.341  48.290  1.00 64.57  ? 5   DG  C "C5'" 1 
ATOM   8900  C  "C4'" . DG  C 2 5   ? 25.116  20.489  49.187  1.00 57.57  ? 5   DG  C "C4'" 1 
ATOM   8901  O  "O4'" . DG  C 2 5   ? 26.117  21.533  49.092  1.00 64.94  ? 5   DG  C "O4'" 1 
ATOM   8902  C  "C3'" . DG  C 2 5   ? 23.779  21.140  48.861  1.00 49.91  ? 5   DG  C "C3'" 1 
ATOM   8903  O  "O3'" . DG  C 2 5   ? 23.190  21.575  50.063  1.00 51.68  ? 5   DG  C "O3'" 1 
ATOM   8904  C  "C2'" . DG  C 2 5   ? 24.166  22.318  47.974  1.00 50.39  ? 5   DG  C "C2'" 1 
ATOM   8905  C  "C1'" . DG  C 2 5   ? 25.586  22.670  48.442  1.00 61.14  ? 5   DG  C "C1'" 1 
ATOM   8906  N  N9    . DG  C 2 5   ? 26.500  23.063  47.343  1.00 63.16  ? 5   DG  C N9    1 
ATOM   8907  C  C8    . DG  C 2 5   ? 26.741  22.380  46.181  1.00 66.85  ? 5   DG  C C8    1 
ATOM   8908  N  N7    . DG  C 2 5   ? 27.598  22.971  45.400  1.00 63.49  ? 5   DG  C N7    1 
ATOM   8909  C  C5    . DG  C 2 5   ? 27.941  24.124  46.073  1.00 52.56  ? 5   DG  C C5    1 
ATOM   8910  C  C6    . DG  C 2 5   ? 28.825  25.160  45.706  1.00 60.40  ? 5   DG  C C6    1 
ATOM   8911  O  O6    . DG  C 2 5   ? 29.498  25.271  44.663  1.00 59.82  ? 5   DG  C O6    1 
ATOM   8912  N  N1    . DG  C 2 5   ? 28.896  26.147  46.684  1.00 64.86  ? 5   DG  C N1    1 
ATOM   8913  C  C2    . DG  C 2 5   ? 28.201  26.137  47.857  1.00 55.61  ? 5   DG  C C2    1 
ATOM   8914  N  N2    . DG  C 2 5   ? 28.391  27.183  48.659  1.00 56.48  ? 5   DG  C N2    1 
ATOM   8915  N  N3    . DG  C 2 5   ? 27.362  25.180  48.212  1.00 61.02  ? 5   DG  C N3    1 
ATOM   8916  C  C4    . DG  C 2 5   ? 27.281  24.204  47.271  1.00 58.41  ? 5   DG  C C4    1 
ATOM   8917  P  P     . DT  C 2 6   ? 21.687  22.135  50.106  1.00 71.22  ? 6   DT  C P     1 
ATOM   8918  O  OP1   . DT  C 2 6   ? 21.165  21.485  51.326  1.00 73.55  ? 6   DT  C OP1   1 
ATOM   8919  O  OP2   . DT  C 2 6   ? 20.928  22.055  48.829  1.00 76.79  ? 6   DT  C OP2   1 
ATOM   8920  O  "O5'" . DT  C 2 6   ? 21.936  23.678  50.318  1.00 58.28  ? 6   DT  C "O5'" 1 
ATOM   8921  C  "C5'" . DT  C 2 6   ? 23.044  24.062  51.067  1.00 62.84  ? 6   DT  C "C5'" 1 
ATOM   8922  C  "C4'" . DT  C 2 6   ? 23.160  25.561  51.117  1.00 62.58  ? 6   DT  C "C4'" 1 
ATOM   8923  O  "O4'" . DT  C 2 6   ? 24.098  26.004  50.125  1.00 65.19  ? 6   DT  C "O4'" 1 
ATOM   8924  C  "C3'" . DT  C 2 6   ? 21.871  26.340  50.891  1.00 53.78  ? 6   DT  C "C3'" 1 
ATOM   8925  O  "O3'" . DT  C 2 6   ? 21.821  27.367  51.872  1.00 52.94  ? 6   DT  C "O3'" 1 
ATOM   8926  C  "C2'" . DT  C 2 6   ? 22.009  26.867  49.453  1.00 53.34  ? 6   DT  C "C2'" 1 
ATOM   8927  C  "C1'" . DT  C 2 6   ? 23.524  26.991  49.301  1.00 70.60  ? 6   DT  C "C1'" 1 
ATOM   8928  N  N1    . DT  C 2 6   ? 24.075  26.753  47.919  1.00 75.12  ? 6   DT  C N1    1 
ATOM   8929  C  C2    . DT  C 2 6   ? 25.092  27.573  47.453  1.00 73.96  ? 6   DT  C C2    1 
ATOM   8930  O  O2    . DT  C 2 6   ? 25.535  28.525  48.079  1.00 76.53  ? 6   DT  C O2    1 
ATOM   8931  N  N3    . DT  C 2 6   ? 25.565  27.245  46.213  1.00 70.41  ? 6   DT  C N3    1 
ATOM   8932  C  C4    . DT  C 2 6   ? 25.168  26.187  45.423  1.00 65.53  ? 6   DT  C C4    1 
ATOM   8933  O  O4    . DT  C 2 6   ? 25.655  25.975  44.330  1.00 74.11  ? 6   DT  C O4    1 
ATOM   8934  C  C5    . DT  C 2 6   ? 24.134  25.355  45.964  1.00 62.44  ? 6   DT  C C5    1 
ATOM   8935  C  C7    . DT  C 2 6   ? 23.636  24.206  45.163  1.00 65.43  ? 6   DT  C C7    1 
ATOM   8936  C  C6    . DT  C 2 6   ? 23.645  25.655  47.184  1.00 70.83  ? 6   DT  C C6    1 
ATOM   8937  P  P     . DA  C 2 7   ? 20.692  28.508  51.890  1.00 82.46  ? 7   DA  C P     1 
ATOM   8938  O  OP1   . DA  C 2 7   ? 20.795  29.110  53.242  1.00 88.18  ? 7   DA  C OP1   1 
ATOM   8939  O  OP2   . DA  C 2 7   ? 19.379  28.010  51.423  1.00 76.26  ? 7   DA  C OP2   1 
ATOM   8940  O  "O5'" . DA  C 2 7   ? 21.231  29.573  50.836  1.00 63.74  ? 7   DA  C "O5'" 1 
ATOM   8941  C  "C5'" . DA  C 2 7   ? 20.406  30.627  50.458  1.00 81.39  ? 7   DA  C "C5'" 1 
ATOM   8942  C  "C4'" . DA  C 2 7   ? 21.083  31.448  49.398  1.00 91.16  ? 7   DA  C "C4'" 1 
ATOM   8943  O  "O4'" . DA  C 2 7   ? 22.018  30.622  48.682  1.00 96.96  ? 7   DA  C "O4'" 1 
ATOM   8944  C  "C3'" . DA  C 2 7   ? 20.162  31.981  48.329  1.00 82.25  ? 7   DA  C "C3'" 1 
ATOM   8945  O  "O3'" . DA  C 2 7   ? 19.539  33.160  48.792  1.00 81.75  ? 7   DA  C "O3'" 1 
ATOM   8946  C  "C2'" . DA  C 2 7   ? 21.130  32.255  47.179  1.00 83.67  ? 7   DA  C "C2'" 1 
ATOM   8947  C  "C1'" . DA  C 2 7   ? 22.238  31.197  47.405  1.00 95.21  ? 7   DA  C "C1'" 1 
ATOM   8948  N  N9    . DA  C 2 7   ? 22.261  30.136  46.386  1.00 95.85  ? 7   DA  C N9    1 
ATOM   8949  C  C8    . DA  C 2 7   ? 21.532  28.973  46.372  1.00 89.53  ? 7   DA  C C8    1 
ATOM   8950  N  N7    . DA  C 2 7   ? 21.754  28.220  45.322  1.00 83.46  ? 7   DA  C N7    1 
ATOM   8951  C  C5    . DA  C 2 7   ? 22.691  28.935  44.592  1.00 91.15  ? 7   DA  C C5    1 
ATOM   8952  C  C6    . DA  C 2 7   ? 23.338  28.679  43.363  1.00 98.56  ? 7   DA  C C6    1 
ATOM   8953  N  N6    . DA  C 2 7   ? 23.122  27.575  42.633  1.00 104.97 ? 7   DA  C N6    1 
ATOM   8954  N  N1    . DA  C 2 7   ? 24.220  29.606  42.911  1.00 92.19  ? 7   DA  C N1    1 
ATOM   8955  C  C2    . DA  C 2 7   ? 24.433  30.712  43.644  1.00 88.44  ? 7   DA  C C2    1 
ATOM   8956  N  N3    . DA  C 2 7   ? 23.889  31.062  44.810  1.00 88.19  ? 7   DA  C N3    1 
ATOM   8957  C  C4    . DA  C 2 7   ? 23.015  30.120  45.233  1.00 94.39  ? 7   DA  C C4    1 
ATOM   8958  P  P     . DT  C 2 8   ? 18.153  33.645  48.139  1.00 101.46 ? 8   DT  C P     1 
ATOM   8959  O  OP1   . DT  C 2 8   ? 17.633  34.753  48.977  1.00 102.88 ? 8   DT  C OP1   1 
ATOM   8960  O  OP2   . DT  C 2 8   ? 17.282  32.458  47.943  1.00 100.77 ? 8   DT  C OP2   1 
ATOM   8961  O  "O5'" . DT  C 2 8   ? 18.601  34.201  46.697  1.00 135.00 ? 8   DT  C "O5'" 1 
ATOM   8962  C  "C5'" . DT  C 2 8   ? 19.422  35.384  46.593  1.00 123.28 ? 8   DT  C "C5'" 1 
ATOM   8963  C  "C4'" . DT  C 2 8   ? 19.555  35.841  45.144  1.00 109.21 ? 8   DT  C "C4'" 1 
ATOM   8964  O  "O4'" . DT  C 2 8   ? 20.320  34.856  44.406  1.00 107.55 ? 8   DT  C "O4'" 1 
ATOM   8965  C  "C3'" . DT  C 2 8   ? 18.229  36.018  44.391  1.00 103.76 ? 8   DT  C "C3'" 1 
ATOM   8966  O  "O3'" . DT  C 2 8   ? 18.234  37.223  43.601  1.00 99.76  ? 8   DT  C "O3'" 1 
ATOM   8967  C  "C2'" . DT  C 2 8   ? 18.141  34.766  43.525  1.00 107.38 ? 8   DT  C "C2'" 1 
ATOM   8968  C  "C1'" . DT  C 2 8   ? 19.610  34.444  43.265  1.00 111.69 ? 8   DT  C "C1'" 1 
ATOM   8969  N  N1    . DT  C 2 8   ? 19.861  32.971  43.031  1.00 128.43 ? 8   DT  C N1    1 
ATOM   8970  C  C2    . DT  C 2 8   ? 20.805  32.573  42.094  1.00 126.07 ? 8   DT  C C2    1 
ATOM   8971  O  O2    . DT  C 2 8   ? 21.481  33.358  41.447  1.00 124.28 ? 8   DT  C O2    1 
ATOM   8972  N  N3    . DT  C 2 8   ? 20.931  31.206  41.951  1.00 122.27 ? 8   DT  C N3    1 
ATOM   8973  C  C4    . DT  C 2 8   ? 20.215  30.219  42.630  1.00 117.61 ? 8   DT  C C4    1 
ATOM   8974  O  O4    . DT  C 2 8   ? 20.390  29.020  42.432  1.00 108.22 ? 8   DT  C O4    1 
ATOM   8975  C  C5    . DT  C 2 8   ? 19.244  30.703  43.589  1.00 127.85 ? 8   DT  C C5    1 
ATOM   8976  C  C7    . DT  C 2 8   ? 18.415  29.725  44.380  1.00 130.49 ? 8   DT  C C7    1 
ATOM   8977  C  C6    . DT  C 2 8   ? 19.110  32.039  43.738  1.00 131.17 ? 8   DT  C C6    1 
ATOM   8978  P  P     . DG  C 2 12  ? 13.946  34.788  30.190  1.00 112.28 ? 12  DG  C P     1 
ATOM   8979  O  OP1   . DG  C 2 12  ? 15.343  34.750  30.702  1.00 105.96 ? 12  DG  C OP1   1 
ATOM   8980  O  OP2   . DG  C 2 12  ? 13.494  35.884  29.303  1.00 115.89 ? 12  DG  C OP2   1 
ATOM   8981  O  "O5'" . DG  C 2 12  ? 13.630  33.427  29.421  1.00 119.99 ? 12  DG  C "O5'" 1 
ATOM   8982  C  "C5'" . DG  C 2 12  ? 14.683  32.516  29.129  1.00 114.56 ? 12  DG  C "C5'" 1 
ATOM   8983  C  "C4'" . DG  C 2 12  ? 14.195  31.080  29.237  1.00 105.94 ? 12  DG  C "C4'" 1 
ATOM   8984  O  "O4'" . DG  C 2 12  ? 14.376  30.597  30.602  1.00 96.35  ? 12  DG  C "O4'" 1 
ATOM   8985  C  "C3'" . DG  C 2 12  ? 12.697  30.871  28.908  1.00 101.48 ? 12  DG  C "C3'" 1 
ATOM   8986  O  "O3'" . DG  C 2 12  ? 12.530  29.779  27.979  1.00 94.45  ? 12  DG  C "O3'" 1 
ATOM   8987  C  "C2'" . DG  C 2 12  ? 12.098  30.553  30.268  1.00 96.02  ? 12  DG  C "C2'" 1 
ATOM   8988  C  "C1'" . DG  C 2 12  ? 13.255  29.822  30.910  1.00 92.90  ? 12  DG  C "C1'" 1 
ATOM   8989  N  N9    . DG  C 2 12  ? 13.085  29.676  32.340  1.00 95.97  ? 12  DG  C N9    1 
ATOM   8990  C  C8    . DG  C 2 12  ? 12.696  30.642  33.237  1.00 99.22  ? 12  DG  C C8    1 
ATOM   8991  N  N7    . DG  C 2 12  ? 12.557  30.191  34.455  1.00 103.14 ? 12  DG  C N7    1 
ATOM   8992  C  C5    . DG  C 2 12  ? 12.844  28.834  34.349  1.00 103.47 ? 12  DG  C C5    1 
ATOM   8993  C  C6    . DG  C 2 12  ? 12.849  27.820  35.336  1.00 102.68 ? 12  DG  C C6    1 
ATOM   8994  O  O6    . DG  C 2 12  ? 12.606  27.923  36.543  1.00 98.08  ? 12  DG  C O6    1 
ATOM   8995  N  N1    . DG  C 2 12  ? 13.190  26.577  34.798  1.00 106.84 ? 12  DG  C N1    1 
ATOM   8996  C  C2    . DG  C 2 12  ? 13.489  26.345  33.472  1.00 104.42 ? 12  DG  C C2    1 
ATOM   8997  N  N2    . DG  C 2 12  ? 13.794  25.082  33.140  1.00 100.56 ? 12  DG  C N2    1 
ATOM   8998  N  N3    . DG  C 2 12  ? 13.489  27.286  32.539  1.00 104.61 ? 12  DG  C N3    1 
ATOM   8999  C  C4    . DG  C 2 12  ? 13.157  28.502  33.049  1.00 102.48 ? 12  DG  C C4    1 
ATOM   9000  P  P     . DG  C 2 13  ? 11.117  29.012  27.809  1.00 111.01 ? 13  DG  C P     1 
ATOM   9001  O  OP1   . DG  C 2 13  ? 11.025  28.644  26.383  1.00 117.72 ? 13  DG  C OP1   1 
ATOM   9002  O  OP2   . DG  C 2 13  ? 9.985   29.746  28.425  1.00 96.61  ? 13  DG  C OP2   1 
ATOM   9003  O  "O5'" . DG  C 2 13  ? 11.360  27.630  28.583  1.00 108.20 ? 13  DG  C "O5'" 1 
ATOM   9004  C  "C5'" . DG  C 2 13  ? 12.448  26.770  28.201  1.00 81.15  ? 13  DG  C "C5'" 1 
ATOM   9005  C  "C4'" . DG  C 2 13  ? 12.118  25.320  28.508  1.00 60.00  ? 13  DG  C "C4'" 1 
ATOM   9006  O  "O4'" . DG  C 2 13  ? 12.181  25.120  29.938  1.00 58.71  ? 13  DG  C "O4'" 1 
ATOM   9007  C  "C3'" . DG  C 2 13  ? 10.721  24.874  28.059  1.00 62.58  ? 13  DG  C "C3'" 1 
ATOM   9008  O  "O3'" . DG  C 2 13  ? 10.741  23.587  27.455  1.00 55.92  ? 13  DG  C "O3'" 1 
ATOM   9009  C  "C2'" . DG  C 2 13  ? 9.905   24.860  29.340  1.00 72.73  ? 13  DG  C "C2'" 1 
ATOM   9010  C  "C1'" . DG  C 2 13  ? 10.937  24.655  30.439  1.00 70.17  ? 13  DG  C "C1'" 1 
ATOM   9011  N  N9    . DG  C 2 13  ? 10.587  25.410  31.644  1.00 71.55  ? 13  DG  C N9    1 
ATOM   9012  C  C8    . DG  C 2 13  ? 10.471  26.774  31.755  1.00 79.25  ? 13  DG  C C8    1 
ATOM   9013  N  N7    . DG  C 2 13  ? 10.116  27.175  32.948  1.00 80.64  ? 13  DG  C N7    1 
ATOM   9014  C  C5    . DG  C 2 13  ? 9.963   25.999  33.671  1.00 82.09  ? 13  DG  C C5    1 
ATOM   9015  C  C6    . DG  C 2 13  ? 9.578   25.795  35.029  1.00 80.33  ? 13  DG  C C6    1 
ATOM   9016  O  O6    . DG  C 2 13  ? 9.290   26.652  35.889  1.00 79.87  ? 13  DG  C O6    1 
ATOM   9017  N  N1    . DG  C 2 13  ? 9.541   24.433  35.356  1.00 73.88  ? 13  DG  C N1    1 
ATOM   9018  C  C2    . DG  C 2 13  ? 9.840   23.407  34.485  1.00 69.74  ? 13  DG  C C2    1 
ATOM   9019  N  N2    . DG  C 2 13  ? 9.762   22.165  34.979  1.00 66.20  ? 13  DG  C N2    1 
ATOM   9020  N  N3    . DG  C 2 13  ? 10.200  23.587  33.215  1.00 79.89  ? 13  DG  C N3    1 
ATOM   9021  C  C4    . DG  C 2 13  ? 10.243  24.901  32.878  1.00 80.85  ? 13  DG  C C4    1 
ATOM   9022  P  P     . DT  C 2 14  ? 9.360   22.861  27.047  1.00 89.97  ? 14  DT  C P     1 
ATOM   9023  O  OP1   . DT  C 2 14  ? 9.675   22.010  25.877  1.00 91.62  ? 14  DT  C OP1   1 
ATOM   9024  O  OP2   . DT  C 2 14  ? 8.279   23.862  26.967  1.00 97.18  ? 14  DT  C OP2   1 
ATOM   9025  O  "O5'" . DT  C 2 14  ? 8.991   21.944  28.306  1.00 67.40  ? 14  DT  C "O5'" 1 
ATOM   9026  C  "C5'" . DT  C 2 14  ? 10.017  21.227  28.955  1.00 68.42  ? 14  DT  C "C5'" 1 
ATOM   9027  C  "C4'" . DT  C 2 14  ? 9.462   20.036  29.681  1.00 67.33  ? 14  DT  C "C4'" 1 
ATOM   9028  O  "O4'" . DT  C 2 14  ? 9.139   20.387  31.054  1.00 82.92  ? 14  DT  C "O4'" 1 
ATOM   9029  C  "C3'" . DT  C 2 14  ? 8.211   19.430  29.082  1.00 60.17  ? 14  DT  C "C3'" 1 
ATOM   9030  O  "O3'" . DT  C 2 14  ? 8.336   18.002  29.191  1.00 50.01  ? 14  DT  C "O3'" 1 
ATOM   9031  C  "C2'" . DT  C 2 14  ? 7.073   20.030  29.940  1.00 67.38  ? 14  DT  C "C2'" 1 
ATOM   9032  C  "C1'" . DT  C 2 14  ? 7.741   20.260  31.301  1.00 77.00  ? 14  DT  C "C1'" 1 
ATOM   9033  N  N1    . DT  C 2 14  ? 7.288   21.520  32.036  1.00 73.67  ? 14  DT  C N1    1 
ATOM   9034  C  C2    . DT  C 2 14  ? 6.786   21.444  33.336  1.00 71.07  ? 14  DT  C C2    1 
ATOM   9035  O  O2    . DT  C 2 14  ? 6.633   20.403  33.947  1.00 59.94  ? 14  DT  C O2    1 
ATOM   9036  N  N3    . DT  C 2 14  ? 6.443   22.658  33.888  1.00 72.36  ? 14  DT  C N3    1 
ATOM   9037  C  C4    . DT  C 2 14  ? 6.561   23.910  33.300  1.00 66.03  ? 14  DT  C C4    1 
ATOM   9038  O  O4    . DT  C 2 14  ? 6.231   24.939  33.863  1.00 69.51  ? 14  DT  C O4    1 
ATOM   9039  C  C5    . DT  C 2 14  ? 7.097   23.923  31.972  1.00 63.50  ? 14  DT  C C5    1 
ATOM   9040  C  C7    . DT  C 2 14  ? 7.249   25.231  31.251  1.00 48.04  ? 14  DT  C C7    1 
ATOM   9041  C  C6    . DT  C 2 14  ? 7.439   22.745  31.410  1.00 68.97  ? 14  DT  C C6    1 
ATOM   9042  P  P     . DT  C 2 15  ? 7.078   17.004  29.148  1.00 53.12  ? 15  DT  C P     1 
ATOM   9043  O  OP1   . DT  C 2 15  ? 7.608   15.683  28.721  1.00 52.23  ? 15  DT  C OP1   1 
ATOM   9044  O  OP2   . DT  C 2 15  ? 6.012   17.620  28.336  1.00 68.25  ? 15  DT  C OP2   1 
ATOM   9045  O  "O5'" . DT  C 2 15  ? 6.597   16.938  30.686  1.00 64.31  ? 15  DT  C "O5'" 1 
ATOM   9046  C  "C5'" . DT  C 2 15  ? 5.882   15.815  31.153  1.00 59.52  ? 15  DT  C "C5'" 1 
ATOM   9047  C  "C4'" . DT  C 2 15  ? 5.066   16.136  32.398  1.00 49.64  ? 15  DT  C "C4'" 1 
ATOM   9048  O  "O4'" . DT  C 2 15  ? 5.065   17.562  32.684  1.00 45.83  ? 15  DT  C "O4'" 1 
ATOM   9049  C  "C3'" . DT  C 2 15  ? 3.596   15.717  32.323  1.00 45.64  ? 15  DT  C "C3'" 1 
ATOM   9050  O  "O3'" . DT  C 2 15  ? 3.347   14.788  33.354  1.00 52.82  ? 15  DT  C "O3'" 1 
ATOM   9051  C  "C2'" . DT  C 2 15  ? 2.810   17.040  32.517  1.00 46.24  ? 15  DT  C "C2'" 1 
ATOM   9052  C  "C1'" . DT  C 2 15  ? 3.818   17.884  33.269  1.00 53.24  ? 15  DT  C "C1'" 1 
ATOM   9053  N  N1    . DT  C 2 15  ? 3.589   19.396  33.200  1.00 70.11  ? 15  DT  C N1    1 
ATOM   9054  C  C2    . DT  C 2 15  ? 3.122   20.060  34.315  1.00 74.69  ? 15  DT  C C2    1 
ATOM   9055  O  O2    . DT  C 2 15  ? 2.854   19.497  35.368  1.00 77.00  ? 15  DT  C O2    1 
ATOM   9056  N  N3    . DT  C 2 15  ? 2.971   21.416  34.155  1.00 73.37  ? 15  DT  C N3    1 
ATOM   9057  C  C4    . DT  C 2 15  ? 3.247   22.175  33.024  1.00 75.02  ? 15  DT  C C4    1 
ATOM   9058  O  O4    . DT  C 2 15  ? 3.079   23.400  32.979  1.00 72.30  ? 15  DT  C O4    1 
ATOM   9059  C  C5    . DT  C 2 15  ? 3.732   21.429  31.897  1.00 68.99  ? 15  DT  C C5    1 
ATOM   9060  C  C7    . DT  C 2 15  ? 4.054   22.141  30.621  1.00 52.88  ? 15  DT  C C7    1 
ATOM   9061  C  C6    . DT  C 2 15  ? 3.885   20.090  32.036  1.00 79.10  ? 15  DT  C C6    1 
ATOM   9062  P  P     . DG  C 2 16  ? 2.149   13.713  33.252  1.00 68.62  ? 16  DG  C P     1 
ATOM   9063  O  OP1   . DG  C 2 16  ? 2.490   12.626  34.229  1.00 65.87  ? 16  DG  C OP1   1 
ATOM   9064  O  OP2   . DG  C 2 16  ? 1.847   13.456  31.822  1.00 67.76  ? 16  DG  C OP2   1 
ATOM   9065  O  "O5'" . DG  C 2 16  ? 0.851   14.526  33.736  1.00 91.53  ? 16  DG  C "O5'" 1 
ATOM   9066  C  "C5'" . DG  C 2 16  ? 0.783   15.048  35.043  1.00 84.42  ? 16  DG  C "C5'" 1 
ATOM   9067  C  "C4'" . DG  C 2 16  ? -0.327  16.063  35.147  1.00 73.96  ? 16  DG  C "C4'" 1 
ATOM   9068  O  "O4'" . DG  C 2 16  ? 0.148   17.336  34.721  1.00 72.57  ? 16  DG  C "O4'" 1 
ATOM   9069  C  "C3'" . DG  C 2 16  ? -1.547  15.793  34.275  1.00 81.11  ? 16  DG  C "C3'" 1 
ATOM   9070  O  "O3'" . DG  C 2 16  ? -2.547  15.167  35.058  1.00 97.94  ? 16  DG  C "O3'" 1 
ATOM   9071  C  "C2'" . DG  C 2 16  ? -1.989  17.192  33.802  1.00 75.81  ? 16  DG  C "C2'" 1 
ATOM   9072  C  "C1'" . DG  C 2 16  ? -0.978  18.121  34.474  1.00 79.12  ? 16  DG  C "C1'" 1 
ATOM   9073  N  N9    . DG  C 2 16  ? -0.571  19.250  33.655  1.00 77.42  ? 16  DG  C N9    1 
ATOM   9074  C  C8    . DG  C 2 16  ? -0.104  19.209  32.373  1.00 63.29  ? 16  DG  C C8    1 
ATOM   9075  N  N7    . DG  C 2 16  ? 0.195   20.376  31.898  1.00 60.86  ? 16  DG  C N7    1 
ATOM   9076  C  C5    . DG  C 2 16  ? -0.076  21.249  32.928  1.00 71.03  ? 16  DG  C C5    1 
ATOM   9077  C  C6    . DG  C 2 16  ? 0.052   22.653  32.982  1.00 79.04  ? 16  DG  C C6    1 
ATOM   9078  O  O6    . DG  C 2 16  ? 0.451   23.418  32.094  1.00 82.03  ? 16  DG  C O6    1 
ATOM   9079  N  N1    . DG  C 2 16  ? -0.335  23.159  34.223  1.00 82.04  ? 16  DG  C N1    1 
ATOM   9080  C  C2    . DG  C 2 16  ? -0.801  22.400  35.268  1.00 84.46  ? 16  DG  C C2    1 
ATOM   9081  N  N2    . DG  C 2 16  ? -1.121  23.065  36.381  1.00 84.55  ? 16  DG  C N2    1 
ATOM   9082  N  N3    . DG  C 2 16  ? -0.934  21.078  35.227  1.00 85.46  ? 16  DG  C N3    1 
ATOM   9083  C  C4    . DG  C 2 16  ? -0.550  20.573  34.024  1.00 80.70  ? 16  DG  C C4    1 
ATOM   9084  P  P     . DT  C 2 17  ? -4.036  14.957  34.488  1.00 103.53 ? 17  DT  C P     1 
ATOM   9085  O  OP1   . DT  C 2 17  ? -4.597  13.819  35.258  1.00 100.76 ? 17  DT  C OP1   1 
ATOM   9086  O  OP2   . DT  C 2 17  ? -4.025  14.939  33.003  1.00 97.67  ? 17  DT  C OP2   1 
ATOM   9087  O  "O5'" . DT  C 2 17  ? -4.810  16.277  34.958  1.00 136.48 ? 17  DT  C "O5'" 1 
ATOM   9088  C  "C5'" . DT  C 2 17  ? -5.063  16.502  36.349  1.00 129.93 ? 17  DT  C "C5'" 1 
ATOM   9089  C  "C4'" . DT  C 2 17  ? -5.601  17.903  36.576  1.00 122.15 ? 17  DT  C "C4'" 1 
ATOM   9090  O  "O4'" . DT  C 2 17  ? -4.729  18.862  35.926  1.00 117.73 ? 17  DT  C "O4'" 1 
ATOM   9091  C  "C3'" . DT  C 2 17  ? -7.011  18.161  36.017  1.00 120.74 ? 17  DT  C "C3'" 1 
ATOM   9092  O  "O3'" . DT  C 2 17  ? -7.880  18.650  37.053  1.00 126.20 ? 17  DT  C "O3'" 1 
ATOM   9093  C  "C2'" . DT  C 2 17  ? -6.790  19.211  34.921  1.00 110.17 ? 17  DT  C "C2'" 1 
ATOM   9094  C  "C1'" . DT  C 2 17  ? -5.520  19.897  35.399  1.00 109.33 ? 17  DT  C "C1'" 1 
ATOM   9095  N  N1    . DT  C 2 17  ? -4.760  20.582  34.305  1.00 93.32  ? 17  DT  C N1    1 
ATOM   9096  C  C2    . DT  C 2 17  ? -4.495  21.934  34.400  1.00 79.90  ? 17  DT  C C2    1 
ATOM   9097  O  O2    . DT  C 2 17  ? -4.833  22.619  35.343  1.00 83.66  ? 17  DT  C O2    1 
ATOM   9098  N  N3    . DT  C 2 17  ? -3.810  22.455  33.350  1.00 69.86  ? 17  DT  C N3    1 
ATOM   9099  C  C4    . DT  C 2 17  ? -3.380  21.789  32.222  1.00 73.25  ? 17  DT  C C4    1 
ATOM   9100  O  O4    . DT  C 2 17  ? -2.768  22.364  31.324  1.00 76.98  ? 17  DT  C O4    1 
ATOM   9101  C  C5    . DT  C 2 17  ? -3.694  20.370  32.180  1.00 76.73  ? 17  DT  C C5    1 
ATOM   9102  C  C7    . DT  C 2 17  ? -3.282  19.525  31.010  1.00 70.39  ? 17  DT  C C7    1 
ATOM   9103  C  C6    . DT  C 2 17  ? -4.360  19.849  33.211  1.00 86.80  ? 17  DT  C C6    1 
ATOM   9104  O  "O5'" . DA  D 3 4   ? -1.705  32.582  32.120  1.00 113.79 ? 4   DA  D "O5'" 1 
ATOM   9105  C  "C5'" . DA  D 3 4   ? -2.907  33.148  32.621  1.00 108.60 ? 4   DA  D "C5'" 1 
ATOM   9106  C  "C4'" . DA  D 3 4   ? -3.393  32.402  33.856  1.00 112.38 ? 4   DA  D "C4'" 1 
ATOM   9107  O  "O4'" . DA  D 3 4   ? -3.756  31.034  33.524  1.00 112.55 ? 4   DA  D "O4'" 1 
ATOM   9108  C  "C3'" . DA  D 3 4   ? -2.399  32.286  34.996  1.00 111.09 ? 4   DA  D "C3'" 1 
ATOM   9109  O  "O3'" . DA  D 3 4   ? -3.121  32.303  36.210  1.00 123.38 ? 4   DA  D "O3'" 1 
ATOM   9110  C  "C2'" . DA  D 3 4   ? -1.748  30.919  34.741  1.00 99.53  ? 4   DA  D "C2'" 1 
ATOM   9111  C  "C1'" . DA  D 3 4   ? -2.936  30.116  34.237  1.00 97.72  ? 4   DA  D "C1'" 1 
ATOM   9112  N  N9    . DA  D 3 4   ? -2.616  29.030  33.310  1.00 82.77  ? 4   DA  D N9    1 
ATOM   9113  C  C8    . DA  D 3 4   ? -1.933  29.128  32.123  1.00 78.11  ? 4   DA  D C8    1 
ATOM   9114  N  N7    . DA  D 3 4   ? -1.852  27.990  31.456  1.00 72.67  ? 4   DA  D N7    1 
ATOM   9115  C  C5    . DA  D 3 4   ? -2.546  27.092  32.244  1.00 77.46  ? 4   DA  D C5    1 
ATOM   9116  C  C6    . DA  D 3 4   ? -2.824  25.721  32.096  1.00 75.85  ? 4   DA  D C6    1 
ATOM   9117  N  N6    . DA  D 3 4   ? -2.409  25.003  31.062  1.00 67.23  ? 4   DA  D N6    1 
ATOM   9118  N  N1    . DA  D 3 4   ? -3.537  25.114  33.073  1.00 94.26  ? 4   DA  D N1    1 
ATOM   9119  C  C2    . DA  D 3 4   ? -3.946  25.843  34.130  1.00 93.82  ? 4   DA  D C2    1 
ATOM   9120  N  N3    . DA  D 3 4   ? -3.754  27.142  34.379  1.00 91.26  ? 4   DA  D N3    1 
ATOM   9121  C  C4    . DA  D 3 4   ? -3.035  27.716  33.391  1.00 86.37  ? 4   DA  D C4    1 
ATOM   9122  P  P     . DC  D 3 5   ? -2.403  32.720  37.582  0.94 116.45 ? 5   DC  D P     1 
ATOM   9123  O  OP1   . DC  D 3 5   ? -3.393  33.403  38.445  0.94 91.00  ? 5   DC  D OP1   1 
ATOM   9124  O  OP2   . DC  D 3 5   ? -1.144  33.414  37.231  0.94 125.82 ? 5   DC  D OP2   1 
ATOM   9125  O  "O5'" . DC  D 3 5   ? -2.012  31.308  38.210  0.94 105.43 ? 5   DC  D "O5'" 1 
ATOM   9126  C  "C5'" . DC  D 3 5   ? -2.953  30.239  38.245  0.94 95.99  ? 5   DC  D "C5'" 1 
ATOM   9127  C  "C4'" . DC  D 3 5   ? -2.289  29.020  38.833  0.94 98.61  ? 5   DC  D "C4'" 1 
ATOM   9128  O  "O4'" . DC  D 3 5   ? -2.121  28.008  37.795  0.94 101.11 ? 5   DC  D "O4'" 1 
ATOM   9129  C  "C3'" . DC  D 3 5   ? -0.875  29.286  39.352  0.94 97.50  ? 5   DC  D "C3'" 1 
ATOM   9130  O  "O3'" . DC  D 3 5   ? -0.526  28.324  40.331  0.94 105.78 ? 5   DC  D "O3'" 1 
ATOM   9131  C  "C2'" . DC  D 3 5   ? -0.069  29.024  38.096  0.94 97.84  ? 5   DC  D "C2'" 1 
ATOM   9132  C  "C1'" . DC  D 3 5   ? -0.743  27.730  37.687  0.94 94.03  ? 5   DC  D "C1'" 1 
ATOM   9133  N  N1    . DC  D 3 5   ? -0.429  27.275  36.328  0.94 81.56  ? 5   DC  D N1    1 
ATOM   9134  C  C2    . DC  D 3 5   ? -0.944  26.061  35.894  0.94 79.47  ? 5   DC  D C2    1 
ATOM   9135  O  O2    . DC  D 3 5   ? -1.668  25.413  36.656  0.94 81.76  ? 5   DC  D O2    1 
ATOM   9136  N  N3    . DC  D 3 5   ? -0.644  25.633  34.650  0.94 85.44  ? 5   DC  D N3    1 
ATOM   9137  C  C4    . DC  D 3 5   ? 0.139   26.374  33.863  0.94 83.79  ? 5   DC  D C4    1 
ATOM   9138  N  N4    . DC  D 3 5   ? 0.410   25.912  32.645  0.94 83.44  ? 5   DC  D N4    1 
ATOM   9139  C  C5    . DC  D 3 5   ? 0.680   27.621  34.291  0.94 81.21  ? 5   DC  D C5    1 
ATOM   9140  C  C6    . DC  D 3 5   ? 0.377   28.026  35.524  0.94 78.18  ? 5   DC  D C6    1 
ATOM   9141  P  P     . DA  D 3 6   ? -1.020  28.420  41.857  1.00 113.09 ? 6   DA  D P     1 
ATOM   9142  O  OP1   . DA  D 3 6   ? -2.483  28.627  41.864  1.00 103.23 ? 6   DA  D OP1   1 
ATOM   9143  O  OP2   . DA  D 3 6   ? -0.095  29.313  42.607  1.00 107.93 ? 6   DA  D OP2   1 
ATOM   9144  O  "O5'" . DA  D 3 6   ? -0.770  26.938  42.389  1.00 91.59  ? 6   DA  D "O5'" 1 
ATOM   9145  C  "C5'" . DA  D 3 6   ? -1.482  25.867  41.807  1.00 77.09  ? 6   DA  D "C5'" 1 
ATOM   9146  C  "C4'" . DA  D 3 6   ? -0.715  24.577  41.950  1.00 72.06  ? 6   DA  D "C4'" 1 
ATOM   9147  O  "O4'" . DA  D 3 6   ? -0.130  24.207  40.680  1.00 69.48  ? 6   DA  D "O4'" 1 
ATOM   9148  C  "C3'" . DA  D 3 6   ? 0.432   24.614  42.954  1.00 80.39  ? 6   DA  D "C3'" 1 
ATOM   9149  O  "O3'" . DA  D 3 6   ? 0.515   23.359  43.571  1.00 88.07  ? 6   DA  D "O3'" 1 
ATOM   9150  C  "C2'" . DA  D 3 6   ? 1.659   24.907  42.084  1.00 74.69  ? 6   DA  D "C2'" 1 
ATOM   9151  C  "C1'" . DA  D 3 6   ? 1.294   24.192  40.781  1.00 81.14  ? 6   DA  D "C1'" 1 
ATOM   9152  N  N9    . DA  D 3 6   ? 1.822   24.830  39.578  1.00 88.27  ? 6   DA  D N9    1 
ATOM   9153  C  C8    . DA  D 3 6   ? 2.191   26.142  39.424  1.00 92.78  ? 6   DA  D C8    1 
ATOM   9154  N  N7    . DA  D 3 6   ? 2.595   26.445  38.210  1.00 89.43  ? 6   DA  D N7    1 
ATOM   9155  C  C5    . DA  D 3 6   ? 2.477   25.253  37.520  1.00 82.83  ? 6   DA  D C5    1 
ATOM   9156  C  C6    . DA  D 3 6   ? 2.752   24.903  36.187  1.00 76.20  ? 6   DA  D C6    1 
ATOM   9157  N  N6    . DA  D 3 6   ? 3.220   25.773  35.277  1.00 69.58  ? 6   DA  D N6    1 
ATOM   9158  N  N1    . DA  D 3 6   ? 2.522   23.624  35.826  1.00 71.55  ? 6   DA  D N1    1 
ATOM   9159  C  C2    . DA  D 3 6   ? 2.059   22.758  36.741  1.00 63.78  ? 6   DA  D C2    1 
ATOM   9160  N  N3    . DA  D 3 6   ? 1.760   22.964  38.018  1.00 62.76  ? 6   DA  D N3    1 
ATOM   9161  C  C4    . DA  D 3 6   ? 1.993   24.246  38.350  1.00 80.31  ? 6   DA  D C4    1 
ATOM   9162  P  P     . DA  D 3 7   ? 1.546   23.092  44.763  1.00 88.68  ? 7   DA  D P     1 
ATOM   9163  O  OP1   . DA  D 3 7   ? 0.934   22.023  45.584  1.00 91.26  ? 7   DA  D OP1   1 
ATOM   9164  O  OP2   . DA  D 3 7   ? 2.064   24.350  45.358  1.00 82.17  ? 7   DA  D OP2   1 
ATOM   9165  O  "O5'" . DA  D 3 7   ? 2.731   22.400  44.017  1.00 78.04  ? 7   DA  D "O5'" 1 
ATOM   9166  C  "C5'" . DA  D 3 7   ? 2.506   21.181  43.394  1.00 67.82  ? 7   DA  D "C5'" 1 
ATOM   9167  C  "C4'" . DA  D 3 7   ? 3.783   20.723  42.766  1.00 70.27  ? 7   DA  D "C4'" 1 
ATOM   9168  O  "O4'" . DA  D 3 7   ? 3.970   21.404  41.479  1.00 74.33  ? 7   DA  D "O4'" 1 
ATOM   9169  C  "C3'" . DA  D 3 7   ? 5.032   21.025  43.612  1.00 54.71  ? 7   DA  D "C3'" 1 
ATOM   9170  O  "O3'" . DA  D 3 7   ? 5.896   19.904  43.572  1.00 65.10  ? 7   DA  D "O3'" 1 
ATOM   9171  C  "C2'" . DA  D 3 7   ? 5.636   22.228  42.885  1.00 57.39  ? 7   DA  D "C2'" 1 
ATOM   9172  C  "C1'" . DA  D 3 7   ? 5.293   21.881  41.434  1.00 73.51  ? 7   DA  D "C1'" 1 
ATOM   9173  N  N9    . DA  D 3 7   ? 5.392   23.009  40.504  1.00 72.31  ? 7   DA  D N9    1 
ATOM   9174  C  C8    . DA  D 3 7   ? 5.388   24.332  40.820  1.00 73.49  ? 7   DA  D C8    1 
ATOM   9175  N  N7    . DA  D 3 7   ? 5.528   25.125  39.788  1.00 71.79  ? 7   DA  D N7    1 
ATOM   9176  C  C5    . DA  D 3 7   ? 5.644   24.261  38.724  1.00 73.39  ? 7   DA  D C5    1 
ATOM   9177  C  C6    . DA  D 3 7   ? 5.820   24.482  37.346  1.00 79.67  ? 7   DA  D C6    1 
ATOM   9178  N  N6    . DA  D 3 7   ? 5.901   25.703  36.803  1.00 89.13  ? 7   DA  D N6    1 
ATOM   9179  N  N1    . DA  D 3 7   ? 5.898   23.401  36.547  1.00 75.30  ? 7   DA  D N1    1 
ATOM   9180  C  C2    . DA  D 3 7   ? 5.813   22.188  37.103  1.00 74.08  ? 7   DA  D C2    1 
ATOM   9181  N  N3    . DA  D 3 7   ? 5.662   21.857  38.388  1.00 71.40  ? 7   DA  D N3    1 
ATOM   9182  C  C4    . DA  D 3 7   ? 5.575   22.951  39.148  1.00 69.03  ? 7   DA  D C4    1 
ATOM   9183  P  P     . DC  D 3 8   ? 6.894   19.597  44.782  1.00 81.21  ? 8   DC  D P     1 
ATOM   9184  O  OP1   . DC  D 3 8   ? 6.284   18.540  45.611  1.00 97.56  ? 8   DC  D OP1   1 
ATOM   9185  O  OP2   . DC  D 3 8   ? 7.302   20.908  45.324  1.00 69.70  ? 8   DC  D OP2   1 
ATOM   9186  O  "O5'" . DC  D 3 8   ? 8.150   18.907  44.073  1.00 76.73  ? 8   DC  D "O5'" 1 
ATOM   9187  C  "C5'" . DC  D 3 8   ? 9.076   19.695  43.324  1.00 73.23  ? 8   DC  D "C5'" 1 
ATOM   9188  C  "C4'" . DC  D 3 8   ? 9.155   19.214  41.900  1.00 74.26  ? 8   DC  D "C4'" 1 
ATOM   9189  O  "O4'" . DC  D 3 8   ? 8.174   19.929  41.102  1.00 78.50  ? 8   DC  D "O4'" 1 
ATOM   9190  C  "C3'" . DC  D 3 8   ? 10.479  19.477  41.214  1.00 64.07  ? 8   DC  D "C3'" 1 
ATOM   9191  O  "O3'" . DC  D 3 8   ? 11.369  18.430  41.473  1.00 64.84  ? 8   DC  D "O3'" 1 
ATOM   9192  C  "C2'" . DC  D 3 8   ? 10.064  19.478  39.749  1.00 67.02  ? 8   DC  D "C2'" 1 
ATOM   9193  C  "C1'" . DC  D 3 8   ? 8.690   20.151  39.800  1.00 64.65  ? 8   DC  D "C1'" 1 
ATOM   9194  N  N1    . DC  D 3 8   ? 8.730   21.623  39.548  1.00 59.26  ? 8   DC  D N1    1 
ATOM   9195  C  C2    . DC  D 3 8   ? 8.952   22.094  38.253  1.00 56.08  ? 8   DC  D C2    1 
ATOM   9196  O  O2    . DC  D 3 8   ? 9.128   21.282  37.350  1.00 64.23  ? 8   DC  D O2    1 
ATOM   9197  N  N3    . DC  D 3 8   ? 8.980   23.434  38.030  1.00 58.13  ? 8   DC  D N3    1 
ATOM   9198  C  C4    . DC  D 3 8   ? 8.822   24.274  39.053  1.00 65.15  ? 8   DC  D C4    1 
ATOM   9199  N  N4    . DC  D 3 8   ? 8.862   25.580  38.795  1.00 68.01  ? 8   DC  D N4    1 
ATOM   9200  C  C5    . DC  D 3 8   ? 8.606   23.812  40.381  1.00 54.62  ? 8   DC  D C5    1 
ATOM   9201  C  C6    . DC  D 3 8   ? 8.575   22.495  40.585  1.00 54.70  ? 8   DC  D C6    1 
ATOM   9202  P  P     . DC  D 3 9   ? 12.944  18.720  41.541  1.00 65.60  ? 9   DC  D P     1 
ATOM   9203  O  OP1   . DC  D 3 9   ? 13.614  17.441  41.818  1.00 66.86  ? 9   DC  D OP1   1 
ATOM   9204  O  OP2   . DC  D 3 9   ? 13.175  19.890  42.406  1.00 59.09  ? 9   DC  D OP2   1 
ATOM   9205  O  "O5'" . DC  D 3 9   ? 13.335  19.123  40.059  1.00 58.69  ? 9   DC  D "O5'" 1 
ATOM   9206  C  "C5'" . DC  D 3 9   ? 13.126  18.205  39.005  1.00 61.49  ? 9   DC  D "C5'" 1 
ATOM   9207  C  "C4'" . DC  D 3 9   ? 13.408  18.858  37.661  1.00 58.34  ? 9   DC  D "C4'" 1 
ATOM   9208  O  "O4'" . DC  D 3 9   ? 12.434  19.899  37.388  1.00 58.16  ? 9   DC  D "O4'" 1 
ATOM   9209  C  "C3'" . DC  D 3 9   ? 14.761  19.522  37.568  1.00 61.88  ? 9   DC  D "C3'" 1 
ATOM   9210  O  "O3'" . DC  D 3 9   ? 15.704  18.565  37.077  1.00 60.17  ? 9   DC  D "O3'" 1 
ATOM   9211  C  "C2'" . DC  D 3 9   ? 14.530  20.675  36.574  1.00 58.87  ? 9   DC  D "C2'" 1 
ATOM   9212  C  "C1'" . DC  D 3 9   ? 13.038  20.967  36.680  1.00 61.36  ? 9   DC  D "C1'" 1 
ATOM   9213  N  N1    . DC  D 3 9   ? 12.732  22.250  37.401  1.00 76.38  ? 9   DC  D N1    1 
ATOM   9214  C  C2    . DC  D 3 9   ? 12.835  23.483  36.724  1.00 73.50  ? 9   DC  D C2    1 
ATOM   9215  O  O2    . DC  D 3 9   ? 13.189  23.492  35.539  1.00 70.12  ? 9   DC  D O2    1 
ATOM   9216  N  N3    . DC  D 3 9   ? 12.554  24.633  37.399  1.00 67.45  ? 9   DC  D N3    1 
ATOM   9217  C  C4    . DC  D 3 9   ? 12.179  24.574  38.685  1.00 80.64  ? 9   DC  D C4    1 
ATOM   9218  N  N4    . DC  D 3 9   ? 11.910  25.722  39.315  1.00 86.67  ? 9   DC  D N4    1 
ATOM   9219  C  C5    . DC  D 3 9   ? 12.065  23.332  39.385  1.00 82.04  ? 9   DC  D C5    1 
ATOM   9220  C  C6    . DC  D 3 9   ? 12.347  22.209  38.714  1.00 82.16  ? 9   DC  D C6    1 
ATOM   9221  P  P     . DT  D 3 10  ? 17.263  18.942  36.963  1.00 73.85  ? 10  DT  D P     1 
ATOM   9222  O  OP1   . DT  D 3 10  ? 18.023  17.667  36.767  1.00 78.05  ? 10  DT  D OP1   1 
ATOM   9223  O  OP2   . DT  D 3 10  ? 17.547  19.872  38.090  1.00 71.36  ? 10  DT  D OP2   1 
ATOM   9224  O  "O5'" . DT  D 3 10  ? 17.385  19.878  35.674  1.00 91.40  ? 10  DT  D "O5'" 1 
ATOM   9225  C  "C5'" . DT  D 3 10  ? 16.894  19.470  34.396  1.00 93.13  ? 10  DT  D "C5'" 1 
ATOM   9226  C  "C4'" . DT  D 3 10  ? 17.325  20.490  33.370  1.00 93.89  ? 10  DT  D "C4'" 1 
ATOM   9227  O  "O4'" . DT  D 3 10  ? 16.616  21.725  33.615  1.00 95.36  ? 10  DT  D "O4'" 1 
ATOM   9228  C  "C3'" . DT  D 3 10  ? 18.807  20.814  33.459  1.00 95.00  ? 10  DT  D "C3'" 1 
ATOM   9229  O  "O3'" . DT  D 3 10  ? 19.476  20.366  32.302  1.00 91.76  ? 10  DT  D "O3'" 1 
ATOM   9230  C  "C2'" . DT  D 3 10  ? 18.914  22.339  33.648  1.00 94.81  ? 10  DT  D "C2'" 1 
ATOM   9231  C  "C1'" . DT  D 3 10  ? 17.486  22.840  33.551  1.00 94.40  ? 10  DT  D "C1'" 1 
ATOM   9232  N  N1    . DT  D 3 10  ? 17.110  23.805  34.648  1.00 91.54  ? 10  DT  D N1    1 
ATOM   9233  C  C2    . DT  D 3 10  ? 17.112  25.159  34.379  1.00 93.34  ? 10  DT  D C2    1 
ATOM   9234  O  O2    . DT  D 3 10  ? 17.424  25.616  33.290  1.00 96.14  ? 10  DT  D O2    1 
ATOM   9235  N  N3    . DT  D 3 10  ? 16.734  25.964  35.430  1.00 85.47  ? 10  DT  D N3    1 
ATOM   9236  C  C4    . DT  D 3 10  ? 16.356  25.549  36.695  1.00 93.09  ? 10  DT  D C4    1 
ATOM   9237  O  O4    . DT  D 3 10  ? 16.033  26.339  37.580  1.00 96.42  ? 10  DT  D O4    1 
ATOM   9238  C  C5    . DT  D 3 10  ? 16.372  24.115  36.910  1.00 91.35  ? 10  DT  D C5    1 
ATOM   9239  C  C7    . DT  D 3 10  ? 15.989  23.554  38.252  1.00 81.31  ? 10  DT  D C7    1 
ATOM   9240  C  C6    . DT  D 3 10  ? 16.742  23.323  35.884  1.00 91.70  ? 10  DT  D C6    1 
ATOM   9241  P  P     . DA  D 3 11  ? 21.027  19.945  32.397  1.00 72.98  ? 11  DA  D P     1 
ATOM   9242  O  OP1   . DA  D 3 11  ? 21.402  19.391  31.072  1.00 72.43  ? 11  DA  D OP1   1 
ATOM   9243  O  OP2   . DA  D 3 11  ? 21.236  19.098  33.603  1.00 80.22  ? 11  DA  D OP2   1 
ATOM   9244  O  "O5'" . DA  D 3 11  ? 21.785  21.351  32.631  1.00 115.29 ? 11  DA  D "O5'" 1 
ATOM   9245  C  "C5'" . DA  D 3 11  ? 21.834  22.331  31.575  1.00 111.19 ? 11  DA  D "C5'" 1 
ATOM   9246  C  "C4'" . DA  D 3 11  ? 22.395  23.664  32.061  1.00 108.12 ? 11  DA  D "C4'" 1 
ATOM   9247  O  "O4'" . DA  D 3 11  ? 21.424  24.343  32.875  1.00 108.35 ? 11  DA  D "O4'" 1 
ATOM   9248  C  "C3'" . DA  D 3 11  ? 23.677  23.593  32.903  1.00 114.51 ? 11  DA  D "C3'" 1 
ATOM   9249  O  "O3'" . DA  D 3 11  ? 24.749  24.204  32.175  1.00 127.83 ? 11  DA  D "O3'" 1 
ATOM   9250  C  "C2'" . DA  D 3 11  ? 23.334  24.380  34.186  1.00 109.35 ? 11  DA  D "C2'" 1 
ATOM   9251  C  "C1'" . DA  D 3 11  ? 22.105  25.175  33.770  1.00 108.78 ? 11  DA  D "C1'" 1 
ATOM   9252  N  N9    . DA  D 3 11  ? 21.191  25.523  34.877  1.00 112.48 ? 11  DA  D N9    1 
ATOM   9253  C  C8    . DA  D 3 11  ? 20.565  24.662  35.741  1.00 111.29 ? 11  DA  D C8    1 
ATOM   9254  N  N7    . DA  D 3 11  ? 19.788  25.259  36.622  1.00 109.68 ? 11  DA  D N7    1 
ATOM   9255  C  C5    . DA  D 3 11  ? 19.901  26.605  36.311  1.00 109.49 ? 11  DA  D C5    1 
ATOM   9256  C  C6    . DA  D 3 11  ? 19.320  27.767  36.875  1.00 108.93 ? 11  DA  D C6    1 
ATOM   9257  N  N6    . DA  D 3 11  ? 18.486  27.747  37.921  1.00 103.00 ? 11  DA  D N6    1 
ATOM   9258  N  N1    . DA  D 3 11  ? 19.637  28.953  36.323  1.00 111.42 ? 11  DA  D N1    1 
ATOM   9259  C  C2    . DA  D 3 11  ? 20.479  28.973  35.279  1.00 115.16 ? 11  DA  D C2    1 
ATOM   9260  N  N3    . DA  D 3 11  ? 21.088  27.956  34.664  1.00 114.74 ? 11  DA  D N3    1 
ATOM   9261  C  C4    . DA  D 3 11  ? 20.754  26.788  35.234  1.00 112.24 ? 11  DA  D C4    1 
ATOM   9262  P  P     . DC  D 3 12  ? 26.290  23.963  32.579  1.00 121.16 ? 12  DC  D P     1 
ATOM   9263  O  OP1   . DC  D 3 12  ? 27.020  23.696  31.319  1.00 113.94 ? 12  DC  D OP1   1 
ATOM   9264  O  OP2   . DC  D 3 12  ? 26.344  22.964  33.670  1.00 121.93 ? 12  DC  D OP2   1 
ATOM   9265  O  "O5'" . DC  D 3 12  ? 26.746  25.399  33.174  1.00 132.13 ? 12  DC  D "O5'" 1 
ATOM   9266  C  "C5'" . DC  D 3 12  ? 26.961  26.525  32.288  1.00 119.53 ? 12  DC  D "C5'" 1 
ATOM   9267  C  "C4'" . DC  D 3 12  ? 26.590  27.859  32.945  1.00 111.60 ? 12  DC  D "C4'" 1 
ATOM   9268  O  "O4'" . DC  D 3 12  ? 25.289  27.788  33.573  1.00 111.41 ? 12  DC  D "O4'" 1 
ATOM   9269  C  "C3'" . DC  D 3 12  ? 27.475  28.320  34.084  1.00 112.88 ? 12  DC  D "C3'" 1 
ATOM   9270  O  "O3'" . DC  D 3 12  ? 28.671  28.905  33.592  1.00 118.73 ? 12  DC  D "O3'" 1 
ATOM   9271  C  "C2'" . DC  D 3 12  ? 26.589  29.371  34.765  1.00 111.67 ? 12  DC  D "C2'" 1 
ATOM   9272  C  "C1'" . DC  D 3 12  ? 25.166  28.928  34.406  1.00 112.01 ? 12  DC  D "C1'" 1 
ATOM   9273  N  N1    . DC  D 3 12  ? 24.323  28.609  35.610  1.00 116.57 ? 12  DC  D N1    1 
ATOM   9274  C  C2    . DC  D 3 12  ? 23.652  29.647  36.274  1.00 116.87 ? 12  DC  D C2    1 
ATOM   9275  O  O2    . DC  D 3 12  ? 23.753  30.805  35.848  1.00 116.91 ? 12  DC  D O2    1 
ATOM   9276  N  N3    . DC  D 3 12  ? 22.900  29.355  37.364  1.00 118.34 ? 12  DC  D N3    1 
ATOM   9277  C  C4    . DC  D 3 12  ? 22.807  28.102  37.798  1.00 116.84 ? 12  DC  D C4    1 
ATOM   9278  N  N4    . DC  D 3 12  ? 22.052  27.872  38.882  1.00 117.65 ? 12  DC  D N4    1 
ATOM   9279  C  C5    . DC  D 3 12  ? 23.490  27.030  37.146  1.00 117.91 ? 12  DC  D C5    1 
ATOM   9280  C  C6    . DC  D 3 12  ? 24.230  27.327  36.065  1.00 118.49 ? 12  DC  D C6    1 
ATOM   9281  P  P     . DT  D 3 13  ? 29.949  29.044  34.563  1.00 129.09 ? 13  DT  D P     1 
ATOM   9282  O  OP1   . DT  D 3 13  ? 31.054  29.654  33.784  1.00 133.91 ? 13  DT  D OP1   1 
ATOM   9283  O  OP2   . DT  D 3 13  ? 30.134  27.725  35.210  1.00 121.21 ? 13  DT  D OP2   1 
ATOM   9284  O  "O5'" . DT  D 3 13  ? 29.494  30.107  35.686  1.00 124.37 ? 13  DT  D "O5'" 1 
ATOM   9285  C  "C5'" . DT  D 3 13  ? 29.320  31.497  35.353  1.00 117.50 ? 13  DT  D "C5'" 1 
ATOM   9286  C  "C4'" . DT  D 3 13  ? 28.650  32.263  36.492  1.00 111.42 ? 13  DT  D "C4'" 1 
ATOM   9287  O  "O4'" . DT  D 3 13  ? 27.401  31.625  36.856  1.00 111.63 ? 13  DT  D "O4'" 1 
ATOM   9288  C  "C3'" . DT  D 3 13  ? 29.439  32.332  37.792  1.00 105.17 ? 13  DT  D "C3'" 1 
ATOM   9289  O  "O3'" . DT  D 3 13  ? 30.356  33.428  37.745  1.00 101.87 ? 13  DT  D "O3'" 1 
ATOM   9290  C  "C2'" . DT  D 3 13  ? 28.339  32.573  38.836  1.00 103.56 ? 13  DT  D "C2'" 1 
ATOM   9291  C  "C1'" . DT  D 3 13  ? 27.100  31.915  38.212  1.00 106.00 ? 13  DT  D "C1'" 1 
ATOM   9292  N  N1    . DT  D 3 13  ? 26.689  30.656  38.903  1.00 106.93 ? 13  DT  D N1    1 
ATOM   9293  C  C2    . DT  D 3 13  ? 26.066  30.740  40.122  1.00 110.15 ? 13  DT  D C2    1 
ATOM   9294  O  O2    . DT  D 3 13  ? 25.827  31.799  40.674  1.00 114.06 ? 13  DT  D O2    1 
ATOM   9295  N  N3    . DT  D 3 13  ? 25.726  29.531  40.682  1.00 109.70 ? 13  DT  D N3    1 
ATOM   9296  C  C4    . DT  D 3 13  ? 25.943  28.268  40.150  1.00 101.17 ? 13  DT  D C4    1 
ATOM   9297  O  O4    . DT  D 3 13  ? 25.596  27.234  40.735  1.00 89.96  ? 13  DT  D O4    1 
ATOM   9298  C  C5    . DT  D 3 13  ? 26.610  28.252  38.866  1.00 100.91 ? 13  DT  D C5    1 
ATOM   9299  C  C7    . DT  D 3 13  ? 26.909  26.949  38.191  1.00 104.60 ? 13  DT  D C7    1 
ATOM   9300  C  C6    . DT  D 3 13  ? 26.947  29.432  38.312  1.00 105.92 ? 13  DT  D C6    1 
ATOM   9301  P  P     . DA  D 3 14  ? 31.548  33.551  38.822  1.00 131.01 ? 14  DA  D P     1 
ATOM   9302  O  OP1   . DA  D 3 14  ? 32.299  34.796  38.528  1.00 126.15 ? 14  DA  D OP1   1 
ATOM   9303  O  OP2   . DA  D 3 14  ? 32.290  32.266  38.801  1.00 132.27 ? 14  DA  D OP2   1 
ATOM   9304  O  "O5'" . DA  D 3 14  ? 30.790  33.722  40.234  1.00 91.56  ? 14  DA  D "O5'" 1 
ATOM   9305  C  "C5'" . DA  D 3 14  ? 30.425  35.021  40.707  1.00 95.36  ? 14  DA  D "C5'" 1 
ATOM   9306  C  "C4'" . DA  D 3 14  ? 30.339  35.055  42.233  1.00 96.82  ? 14  DA  D "C4'" 1 
ATOM   9307  O  "O4'" . DA  D 3 14  ? 29.387  34.057  42.692  1.00 100.15 ? 14  DA  D "O4'" 1 
ATOM   9308  C  "C3'" . DA  D 3 14  ? 31.638  34.748  42.970  1.00 87.76  ? 14  DA  D "C3'" 1 
ATOM   9309  O  "O3'" . DA  D 3 14  ? 31.699  35.467  44.197  1.00 76.05  ? 14  DA  D "O3'" 1 
ATOM   9310  C  "C2'" . DA  D 3 14  ? 31.528  33.252  43.218  1.00 95.20  ? 14  DA  D "C2'" 1 
ATOM   9311  C  "C1'" . DA  D 3 14  ? 30.043  33.112  43.514  1.00 97.70  ? 14  DA  D "C1'" 1 
ATOM   9312  N  N9    . DA  D 3 14  ? 29.518  31.789  43.202  1.00 93.86  ? 14  DA  D N9    1 
ATOM   9313  C  C8    . DA  D 3 14  ? 29.766  31.052  42.080  1.00 94.05  ? 14  DA  D C8    1 
ATOM   9314  N  N7    . DA  D 3 14  ? 29.158  29.890  42.065  1.00 94.86  ? 14  DA  D N7    1 
ATOM   9315  C  C5    . DA  D 3 14  ? 28.462  29.867  43.260  1.00 94.23  ? 14  DA  D C5    1 
ATOM   9316  C  C6    . DA  D 3 14  ? 27.614  28.908  43.840  1.00 97.40  ? 14  DA  D C6    1 
ATOM   9317  N  N6    . DA  D 3 14  ? 27.323  27.739  43.259  1.00 89.24  ? 14  DA  D N6    1 
ATOM   9318  N  N1    . DA  D 3 14  ? 27.073  29.197  45.046  1.00 104.92 ? 14  DA  D N1    1 
ATOM   9319  C  C2    . DA  D 3 14  ? 27.367  30.370  45.620  1.00 107.20 ? 14  DA  D C2    1 
ATOM   9320  N  N3    . DA  D 3 14  ? 28.155  31.348  45.169  1.00 103.31 ? 14  DA  D N3    1 
ATOM   9321  C  C4    . DA  D 3 14  ? 28.673  31.030  43.973  1.00 96.01  ? 14  DA  D C4    1 
ATOM   9322  P  P     . DC  D 3 15  ? 33.115  35.593  44.960  1.00 134.64 ? 15  DC  D P     1 
ATOM   9323  O  OP1   . DC  D 3 15  ? 33.457  37.025  45.066  1.00 141.32 ? 15  DC  D OP1   1 
ATOM   9324  O  OP2   . DC  D 3 15  ? 34.063  34.639  44.339  1.00 125.68 ? 15  DC  D OP2   1 
ATOM   9325  O  "O5'" . DC  D 3 15  ? 32.828  35.054  46.433  1.00 100.58 ? 15  DC  D "O5'" 1 
ATOM   9326  C  "C5'" . DC  D 3 15  ? 31.605  35.373  47.081  1.00 101.67 ? 15  DC  D "C5'" 1 
ATOM   9327  C  "C4'" . DC  D 3 15  ? 31.263  34.288  48.075  1.00 99.24  ? 15  DC  D "C4'" 1 
ATOM   9328  O  "O4'" . DC  D 3 15  ? 30.596  33.202  47.391  1.00 98.81  ? 15  DC  D "O4'" 1 
ATOM   9329  C  "C3'" . DC  D 3 15  ? 32.484  33.674  48.714  1.00 99.54  ? 15  DC  D "C3'" 1 
ATOM   9330  O  "O3'" . DC  D 3 15  ? 32.741  34.307  49.942  1.00 100.25 ? 15  DC  D "O3'" 1 
ATOM   9331  C  "C2'" . DC  D 3 15  ? 32.125  32.199  48.905  1.00 100.16 ? 15  DC  D "C2'" 1 
ATOM   9332  C  "C1'" . DC  D 3 15  ? 30.895  31.983  48.025  1.00 94.41  ? 15  DC  D "C1'" 1 
ATOM   9333  N  N1    . DC  D 3 15  ? 31.088  30.947  46.983  1.00 85.41  ? 15  DC  D N1    1 
ATOM   9334  C  C2    . DC  D 3 15  ? 30.305  29.784  47.017  1.00 85.46  ? 15  DC  D C2    1 
ATOM   9335  O  O2    . DC  D 3 15  ? 29.467  29.645  47.917  1.00 77.65  ? 15  DC  D O2    1 
ATOM   9336  N  N3    . DC  D 3 15  ? 30.483  28.846  46.058  1.00 84.95  ? 15  DC  D N3    1 
ATOM   9337  C  C4    . DC  D 3 15  ? 31.391  29.034  45.107  1.00 81.17  ? 15  DC  D C4    1 
ATOM   9338  N  N4    . DC  D 3 15  ? 31.524  28.083  44.186  1.00 81.51  ? 15  DC  D N4    1 
ATOM   9339  C  C5    . DC  D 3 15  ? 32.209  30.207  45.060  1.00 77.98  ? 15  DC  D C5    1 
ATOM   9340  C  C6    . DC  D 3 15  ? 32.027  31.128  46.013  1.00 76.48  ? 15  DC  D C6    1 
ATOM   9341  P  P     . DC  D 3 16  ? 34.232  34.291  50.536  1.00 115.85 ? 16  DC  D P     1 
ATOM   9342  O  OP1   . DC  D 3 16  ? 34.369  35.508  51.368  1.00 130.42 ? 16  DC  D OP1   1 
ATOM   9343  O  OP2   . DC  D 3 16  ? 35.182  33.991  49.434  1.00 101.24 ? 16  DC  D OP2   1 
ATOM   9344  O  "O5'" . DC  D 3 16  ? 34.233  33.022  51.500  1.00 87.54  ? 16  DC  D "O5'" 1 
ATOM   9345  C  "C5'" . DC  D 3 16  ? 33.050  32.678  52.196  1.00 86.70  ? 16  DC  D "C5'" 1 
ATOM   9346  C  "C4'" . DC  D 3 16  ? 33.057  31.201  52.524  1.00 85.47  ? 16  DC  D "C4'" 1 
ATOM   9347  O  "O4'" . DC  D 3 16  ? 32.759  30.417  51.333  1.00 82.40  ? 16  DC  D "O4'" 1 
ATOM   9348  C  "C3'" . DC  D 3 16  ? 34.399  30.691  53.051  1.00 84.18  ? 16  DC  D "C3'" 1 
ATOM   9349  O  "O3'" . DC  D 3 16  ? 34.202  29.994  54.255  1.00 87.95  ? 16  DC  D "O3'" 1 
ATOM   9350  C  "C2'" . DC  D 3 16  ? 34.901  29.770  51.940  1.00 81.32  ? 16  DC  D "C2'" 1 
ATOM   9351  C  "C1'" . DC  D 3 16  ? 33.592  29.288  51.335  1.00 85.15  ? 16  DC  D "C1'" 1 
ATOM   9352  N  N1    . DC  D 3 16  ? 33.741  28.782  49.946  1.00 91.34  ? 16  DC  D N1    1 
ATOM   9353  C  C2    . DC  D 3 16  ? 33.300  27.494  49.626  1.00 88.84  ? 16  DC  D C2    1 
ATOM   9354  O  O2    . DC  D 3 16  ? 32.766  26.805  50.507  1.00 93.07  ? 16  DC  D O2    1 
ATOM   9355  N  N3    . DC  D 3 16  ? 33.459  27.044  48.353  1.00 87.26  ? 16  DC  D N3    1 
ATOM   9356  C  C4    . DC  D 3 16  ? 34.036  27.822  47.439  1.00 85.49  ? 16  DC  D C4    1 
ATOM   9357  N  N4    . DC  D 3 16  ? 34.178  27.343  46.204  1.00 71.35  ? 16  DC  D N4    1 
ATOM   9358  C  C5    . DC  D 3 16  ? 34.505  29.128  47.755  1.00 95.85  ? 16  DC  D C5    1 
ATOM   9359  C  C6    . DC  D 3 16  ? 34.345  29.562  49.009  1.00 96.78  ? 16  DC  D C6    1 
ATOM   9360  P  P     . DT  D 3 17  ? 35.405  29.841  55.305  1.00 94.80  ? 17  DT  D P     1 
ATOM   9361  O  OP1   . DT  D 3 17  ? 34.736  30.063  56.611  1.00 94.07  ? 17  DT  D OP1   1 
ATOM   9362  O  OP2   . DT  D 3 17  ? 36.576  30.647  54.884  1.00 91.66  ? 17  DT  D OP2   1 
ATOM   9363  O  "O5'" . DT  D 3 17  ? 35.832  28.305  55.159  1.00 61.75  ? 17  DT  D "O5'" 1 
ATOM   9364  C  "C5'" . DT  D 3 17  ? 34.870  27.306  55.495  1.00 65.52  ? 17  DT  D "C5'" 1 
ATOM   9365  C  "C4'" . DT  D 3 17  ? 35.223  25.987  54.870  1.00 67.28  ? 17  DT  D "C4'" 1 
ATOM   9366  O  "O4'" . DT  D 3 17  ? 35.186  26.116  53.449  1.00 55.88  ? 17  DT  D "O4'" 1 
ATOM   9367  C  "C3'" . DT  D 3 17  ? 36.620  25.476  55.200  1.00 61.08  ? 17  DT  D "C3'" 1 
ATOM   9368  O  "O3'" . DT  D 3 17  ? 36.497  24.388  56.116  1.00 65.33  ? 17  DT  D "O3'" 1 
ATOM   9369  C  "C2'" . DT  D 3 17  ? 37.202  25.044  53.836  1.00 56.62  ? 17  DT  D "C2'" 1 
ATOM   9370  C  "C1'" . DT  D 3 17  ? 35.998  25.125  52.909  1.00 71.01  ? 17  DT  D "C1'" 1 
ATOM   9371  N  N1    . DT  D 3 17  ? 36.301  25.531  51.513  1.00 77.75  ? 17  DT  D N1    1 
ATOM   9372  C  C2    . DT  D 3 17  ? 35.862  24.744  50.465  1.00 76.31  ? 17  DT  D C2    1 
ATOM   9373  O  O2    . DT  D 3 17  ? 35.271  23.685  50.619  1.00 76.00  ? 17  DT  D O2    1 
ATOM   9374  N  N3    . DT  D 3 17  ? 36.167  25.236  49.222  1.00 78.03  ? 17  DT  D N3    1 
ATOM   9375  C  C4    . DT  D 3 17  ? 36.839  26.417  48.927  1.00 78.19  ? 17  DT  D C4    1 
ATOM   9376  O  O4    . DT  D 3 17  ? 37.068  26.781  47.772  1.00 82.85  ? 17  DT  D O4    1 
ATOM   9377  C  C5    . DT  D 3 17  ? 37.251  27.193  50.068  1.00 73.93  ? 17  DT  D C5    1 
ATOM   9378  C  C7    . DT  D 3 17  ? 37.983  28.480  49.870  1.00 65.58  ? 17  DT  D C7    1 
ATOM   9379  C  C6    . DT  D 3 17  ? 36.962  26.723  51.290  1.00 77.64  ? 17  DT  D C6    1 
ATOM   9380  P  P     . DC  D 3 18  ? 37.784  23.574  56.616  1.00 82.91  ? 18  DC  D P     1 
ATOM   9381  O  OP1   . DC  D 3 18  ? 37.537  23.136  58.004  1.00 88.31  ? 18  DC  D OP1   1 
ATOM   9382  O  OP2   . DC  D 3 18  ? 38.996  24.364  56.276  1.00 91.29  ? 18  DC  D OP2   1 
ATOM   9383  O  "O5'" . DC  D 3 18  ? 37.738  22.269  55.721  1.00 80.03  ? 18  DC  D "O5'" 1 
ATOM   9384  C  "C5'" . DC  D 3 18  ? 36.519  21.569  55.576  1.00 74.97  ? 18  DC  D "C5'" 1 
ATOM   9385  C  "C4'" . DC  D 3 18  ? 36.657  20.532  54.494  1.00 65.99  ? 18  DC  D "C4'" 1 
ATOM   9386  O  "O4'" . DC  D 3 18  ? 36.738  21.188  53.211  1.00 64.25  ? 18  DC  D "O4'" 1 
ATOM   9387  C  "C3'" . DC  D 3 18  ? 37.908  19.676  54.609  1.00 66.39  ? 18  DC  D "C3'" 1 
ATOM   9388  O  "O3'" . DC  D 3 18  ? 37.555  18.369  54.384  1.00 68.23  ? 18  DC  D "O3'" 1 
ATOM   9389  C  "C2'" . DC  D 3 18  ? 38.827  20.208  53.498  1.00 67.29  ? 18  DC  D "C2'" 1 
ATOM   9390  C  "C1'" . DC  D 3 18  ? 37.808  20.638  52.473  1.00 67.66  ? 18  DC  D "C1'" 1 
ATOM   9391  N  N1    . DC  D 3 18  ? 38.282  21.660  51.553  1.00 62.60  ? 18  DC  D N1    1 
ATOM   9392  C  C2    . DC  D 3 18  ? 38.120  21.468  50.189  1.00 63.20  ? 18  DC  D C2    1 
ATOM   9393  O  O2    . DC  D 3 18  ? 37.609  20.421  49.792  1.00 62.85  ? 18  DC  D O2    1 
ATOM   9394  N  N3    . DC  D 3 18  ? 38.537  22.431  49.339  1.00 74.74  ? 18  DC  D N3    1 
ATOM   9395  C  C4    . DC  D 3 18  ? 39.088  23.550  49.816  1.00 72.98  ? 18  DC  D C4    1 
ATOM   9396  N  N4    . DC  D 3 18  ? 39.488  24.474  48.936  1.00 79.59  ? 18  DC  D N4    1 
ATOM   9397  C  C5    . DC  D 3 18  ? 39.248  23.772  51.215  1.00 62.60  ? 18  DC  D C5    1 
ATOM   9398  C  C6    . DC  D 3 18  ? 38.831  22.806  52.039  1.00 58.80  ? 18  DC  D C6    1 
ATOM   9399  P  P     . DG  D 3 19  ? 37.931  17.262  55.463  1.00 69.01  ? 19  DG  D P     1 
ATOM   9400  O  OP1   . DG  D 3 19  ? 37.440  17.783  56.766  1.00 68.94  ? 19  DG  D OP1   1 
ATOM   9401  O  OP2   . DG  D 3 19  ? 39.374  16.952  55.250  1.00 65.43  ? 19  DG  D OP2   1 
ATOM   9402  O  "O5'" . DG  D 3 19  ? 37.038  16.000  55.007  1.00 71.55  ? 19  DG  D "O5'" 1 
ATOM   9403  C  "C5'" . DG  D 3 19  ? 35.606  16.080  55.078  1.00 67.62  ? 19  DG  D "C5'" 1 
ATOM   9404  C  "C4'" . DG  D 3 19  ? 35.071  15.197  56.196  1.00 67.83  ? 19  DG  D "C4'" 1 
ATOM   9405  O  "O4'" . DG  D 3 19  ? 33.687  15.539  56.465  1.00 60.91  ? 19  DG  D "O4'" 1 
ATOM   9406  C  "C3'" . DG  D 3 19  ? 35.073  13.697  55.898  1.00 67.93  ? 19  DG  D "C3'" 1 
ATOM   9407  O  "O3'" . DG  D 3 19  ? 35.307  12.962  57.107  1.00 63.69  ? 19  DG  D "O3'" 1 
ATOM   9408  C  "C2'" . DG  D 3 19  ? 33.665  13.460  55.338  1.00 61.43  ? 19  DG  D "C2'" 1 
ATOM   9409  C  "C1'" . DG  D 3 19  ? 32.846  14.434  56.177  1.00 61.21  ? 19  DG  D "C1'" 1 
ATOM   9410  N  N9    . DG  D 3 19  ? 31.675  14.972  55.517  1.00 60.68  ? 19  DG  D N9    1 
ATOM   9411  C  C8    . DG  D 3 19  ? 31.642  15.667  54.341  1.00 60.21  ? 19  DG  D C8    1 
ATOM   9412  N  N7    . DG  D 3 19  ? 30.445  16.070  54.011  1.00 73.10  ? 19  DG  D N7    1 
ATOM   9413  C  C5    . DG  D 3 19  ? 29.635  15.630  55.057  1.00 67.86  ? 19  DG  D C5    1 
ATOM   9414  C  C6    . DG  D 3 19  ? 28.233  15.777  55.272  1.00 67.29  ? 19  DG  D C6    1 
ATOM   9415  O  O6    . DG  D 3 19  ? 27.386  16.338  54.548  1.00 59.66  ? 19  DG  D O6    1 
ATOM   9416  N  N1    . DG  D 3 19  ? 27.832  15.165  56.462  1.00 69.78  ? 19  DG  D N1    1 
ATOM   9417  C  C2    . DG  D 3 19  ? 28.667  14.501  57.326  1.00 66.71  ? 19  DG  D C2    1 
ATOM   9418  N  N2    . DG  D 3 19  ? 28.098  13.974  58.414  1.00 71.23  ? 19  DG  D N2    1 
ATOM   9419  N  N3    . DG  D 3 19  ? 29.967  14.369  57.143  1.00 72.02  ? 19  DG  D N3    1 
ATOM   9420  C  C4    . DG  D 3 19  ? 30.382  14.955  55.993  1.00 65.95  ? 19  DG  D C4    1 
ATOM   9421  O  OP3   . DT  E 2 1   ? 13.818  -5.013  7.863   1.00 46.28  ? 1   DT  E OP3   1 
ATOM   9422  P  P     . DT  E 2 1   ? 14.470  -6.172  7.164   1.00 45.09  ? 1   DT  E P     1 
ATOM   9423  O  OP1   . DT  E 2 1   ? 15.417  -6.849  8.067   1.00 48.28  ? 1   DT  E OP1   1 
ATOM   9424  O  OP2   . DT  E 2 1   ? 14.938  -5.690  5.847   1.00 47.46  ? 1   DT  E OP2   1 
ATOM   9425  O  "O5'" . DT  E 2 1   ? 13.331  -7.264  6.880   1.00 55.05  ? 1   DT  E "O5'" 1 
ATOM   9426  C  "C5'" . DT  E 2 1   ? 12.227  -6.966  6.021   1.00 58.86  ? 1   DT  E "C5'" 1 
ATOM   9427  C  "C4'" . DT  E 2 1   ? 11.098  -7.942  6.288   1.00 64.95  ? 1   DT  E "C4'" 1 
ATOM   9428  O  "O4'" . DT  E 2 1   ? 10.342  -7.492  7.423   1.00 61.25  ? 1   DT  E "O4'" 1 
ATOM   9429  C  "C3'" . DT  E 2 1   ? 10.087  -8.165  5.143   1.00 65.88  ? 1   DT  E "C3'" 1 
ATOM   9430  O  "O3'" . DT  E 2 1   ? 10.143  -9.543  4.739   1.00 68.84  ? 1   DT  E "O3'" 1 
ATOM   9431  C  "C2'" . DT  E 2 1   ? 8.716   -7.804  5.763   1.00 52.33  ? 1   DT  E "C2'" 1 
ATOM   9432  C  "C1'" . DT  E 2 1   ? 8.987   -7.879  7.256   1.00 52.78  ? 1   DT  E "C1'" 1 
ATOM   9433  N  N1    . DT  E 2 1   ? 8.181   -6.962  8.089   1.00 49.79  ? 1   DT  E N1    1 
ATOM   9434  C  C2    . DT  E 2 1   ? 7.427   -7.476  9.115   1.00 56.75  ? 1   DT  E C2    1 
ATOM   9435  O  O2    . DT  E 2 1   ? 7.321   -8.662  9.322   1.00 72.34  ? 1   DT  E O2    1 
ATOM   9436  N  N3    . DT  E 2 1   ? 6.778   -6.545  9.879   1.00 48.53  ? 1   DT  E N3    1 
ATOM   9437  C  C4    . DT  E 2 1   ? 6.834   -5.163  9.731   1.00 62.49  ? 1   DT  E C4    1 
ATOM   9438  O  O4    . DT  E 2 1   ? 6.211   -4.389  10.453  1.00 59.85  ? 1   DT  E O4    1 
ATOM   9439  C  C5    . DT  E 2 1   ? 7.677   -4.691  8.660   1.00 68.47  ? 1   DT  E C5    1 
ATOM   9440  C  C7    . DT  E 2 1   ? 7.812   -3.218  8.406   1.00 66.23  ? 1   DT  E C7    1 
ATOM   9441  C  C6    . DT  E 2 1   ? 8.315   -5.606  7.909   1.00 62.56  ? 1   DT  E C6    1 
ATOM   9442  P  P     . DG  E 2 2   ? 9.567   -10.041 3.324   1.00 55.90  ? 2   DG  E P     1 
ATOM   9443  O  OP1   . DG  E 2 2   ? 8.634   -9.010  2.823   1.00 55.25  ? 2   DG  E OP1   1 
ATOM   9444  O  OP2   . DG  E 2 2   ? 9.228   -11.467 3.518   1.00 62.64  ? 2   DG  E OP2   1 
ATOM   9445  O  "O5'" . DG  E 2 2   ? 10.814  -10.053 2.349   1.00 52.93  ? 2   DG  E "O5'" 1 
ATOM   9446  C  "C5'" . DG  E 2 2   ? 12.113  -9.929  2.876   1.00 62.55  ? 2   DG  E "C5'" 1 
ATOM   9447  C  "C4'" . DG  E 2 2   ? 12.901  -8.967  2.036   1.00 53.07  ? 2   DG  E "C4'" 1 
ATOM   9448  O  "O4'" . DG  E 2 2   ? 12.623  -9.260  0.640   1.00 53.68  ? 2   DG  E "O4'" 1 
ATOM   9449  C  "C3'" . DG  E 2 2   ? 12.539  -7.493  2.262   1.00 51.82  ? 2   DG  E "C3'" 1 
ATOM   9450  O  "O3'" . DG  E 2 2   ? 13.731  -6.710  2.325   1.00 51.51  ? 2   DG  E "O3'" 1 
ATOM   9451  C  "C2'" . DG  E 2 2   ? 11.672  -7.133  1.049   1.00 51.41  ? 2   DG  E "C2'" 1 
ATOM   9452  C  "C1'" . DG  E 2 2   ? 12.175  -8.082  -0.022  1.00 64.87  ? 2   DG  E "C1'" 1 
ATOM   9453  N  N9    . DG  E 2 2   ? 11.129  -8.439  -0.979  1.00 71.76  ? 2   DG  E N9    1 
ATOM   9454  C  C8    . DG  E 2 2   ? 9.876   -8.863  -0.681  1.00 65.95  ? 2   DG  E C8    1 
ATOM   9455  N  N7    . DG  E 2 2   ? 9.145   -9.096  -1.736  1.00 64.72  ? 2   DG  E N7    1 
ATOM   9456  C  C5    . DG  E 2 2   ? 9.970   -8.803  -2.801  1.00 59.05  ? 2   DG  E C5    1 
ATOM   9457  C  C6    . DG  E 2 2   ? 9.717   -8.862  -4.177  1.00 68.40  ? 2   DG  E C6    1 
ATOM   9458  O  O6    . DG  E 2 2   ? 8.679   -9.200  -4.750  1.00 83.86  ? 2   DG  E O6    1 
ATOM   9459  N  N1    . DG  E 2 2   ? 10.810  -8.467  -4.918  1.00 68.85  ? 2   DG  E N1    1 
ATOM   9460  C  C2    . DG  E 2 2   ? 12.000  -8.069  -4.404  1.00 61.63  ? 2   DG  E C2    1 
ATOM   9461  N  N2    . DG  E 2 2   ? 12.935  -7.731  -5.290  1.00 66.88  ? 2   DG  E N2    1 
ATOM   9462  N  N3    . DG  E 2 2   ? 12.261  -8.012  -3.119  1.00 69.43  ? 2   DG  E N3    1 
ATOM   9463  C  C4    . DG  E 2 2   ? 11.192  -8.391  -2.369  1.00 68.55  ? 2   DG  E C4    1 
ATOM   9464  P  P     . DA  E 2 3   ? 13.686  -5.095  2.322   1.00 45.90  ? 3   DA  E P     1 
ATOM   9465  O  OP1   . DA  E 2 3   ? 14.713  -4.611  3.271   1.00 37.84  ? 3   DA  E OP1   1 
ATOM   9466  O  OP2   . DA  E 2 3   ? 12.286  -4.611  2.497   1.00 58.91  ? 3   DA  E OP2   1 
ATOM   9467  O  "O5'" . DA  E 2 3   ? 13.952  -4.729  0.804   1.00 49.99  ? 3   DA  E "O5'" 1 
ATOM   9468  C  "C5'" . DA  E 2 3   ? 15.139  -5.045  0.163   1.00 46.50  ? 3   DA  E "C5'" 1 
ATOM   9469  C  "C4'" . DA  E 2 3   ? 15.071  -4.511  -1.265  1.00 61.57  ? 3   DA  E "C4'" 1 
ATOM   9470  O  "O4'" . DA  E 2 3   ? 14.209  -5.367  -2.060  1.00 67.94  ? 3   DA  E "O4'" 1 
ATOM   9471  C  "C3'" . DA  E 2 3   ? 14.481  -3.102  -1.404  1.00 50.74  ? 3   DA  E "C3'" 1 
ATOM   9472  O  "O3'" . DA  E 2 3   ? 15.498  -2.187  -1.396  1.00 46.53  ? 3   DA  E "O3'" 1 
ATOM   9473  C  "C2'" . DA  E 2 3   ? 13.846  -3.117  -2.776  1.00 61.81  ? 3   DA  E "C2'" 1 
ATOM   9474  C  "C1'" . DA  E 2 3   ? 13.509  -4.585  -3.012  1.00 68.10  ? 3   DA  E "C1'" 1 
ATOM   9475  N  N9    . DA  E 2 3   ? 12.080  -4.877  -2.917  1.00 77.17  ? 3   DA  E N9    1 
ATOM   9476  C  C8    . DA  E 2 3   ? 11.338  -5.083  -1.789  1.00 73.02  ? 3   DA  E C8    1 
ATOM   9477  N  N7    . DA  E 2 3   ? 10.077  -5.337  -2.038  1.00 73.65  ? 3   DA  E N7    1 
ATOM   9478  C  C5    . DA  E 2 3   ? 9.995   -5.287  -3.413  1.00 69.09  ? 3   DA  E C5    1 
ATOM   9479  C  C6    . DA  E 2 3   ? 8.932   -5.467  -4.304  1.00 67.98  ? 3   DA  E C6    1 
ATOM   9480  N  N6    . DA  E 2 3   ? 7.695   -5.752  -3.925  1.00 72.50  ? 3   DA  E N6    1 
ATOM   9481  N  N1    . DA  E 2 3   ? 9.190   -5.340  -5.610  1.00 73.93  ? 3   DA  E N1    1 
ATOM   9482  C  C2    . DA  E 2 3   ? 10.434  -5.061  -5.998  1.00 70.30  ? 3   DA  E C2    1 
ATOM   9483  N  N3    . DA  E 2 3   ? 11.513  -4.876  -5.253  1.00 65.40  ? 3   DA  E N3    1 
ATOM   9484  C  C4    . DA  E 2 3   ? 11.218  -5.000  -3.962  1.00 69.98  ? 3   DA  E C4    1 
ATOM   9485  P  P     . DG  E 2 4   ? 15.181  -0.618  -1.293  1.00 36.26  ? 4   DG  E P     1 
ATOM   9486  O  OP1   . DG  E 2 4   ? 16.501  0.022   -1.002  1.00 55.14  ? 4   DG  E OP1   1 
ATOM   9487  O  OP2   . DG  E 2 4   ? 14.022  -0.412  -0.392  1.00 40.19  ? 4   DG  E OP2   1 
ATOM   9488  O  "O5'" . DG  E 2 4   ? 14.770  -0.194  -2.779  1.00 71.09  ? 4   DG  E "O5'" 1 
ATOM   9489  C  "C5'" . DG  E 2 4   ? 15.737  -0.216  -3.806  1.00 74.16  ? 4   DG  E "C5'" 1 
ATOM   9490  C  "C4'" . DG  E 2 4   ? 15.084  0.106   -5.118  1.00 68.17  ? 4   DG  E "C4'" 1 
ATOM   9491  O  "O4'" . DG  E 2 4   ? 14.173  -0.955  -5.477  1.00 73.94  ? 4   DG  E "O4'" 1 
ATOM   9492  C  "C3'" . DG  E 2 4   ? 14.226  1.342   -5.056  1.00 64.23  ? 4   DG  E "C3'" 1 
ATOM   9493  O  "O3'" . DG  E 2 4   ? 15.025  2.462   -5.250  1.00 41.12  ? 4   DG  E "O3'" 1 
ATOM   9494  C  "C2'" . DG  E 2 4   ? 13.244  1.115   -6.203  1.00 73.54  ? 4   DG  E "C2'" 1 
ATOM   9495  C  "C1'" . DG  E 2 4   ? 13.035  -0.399  -6.138  1.00 80.95  ? 4   DG  E "C1'" 1 
ATOM   9496  N  N9    . DG  E 2 4   ? 11.833  -0.809  -5.412  1.00 83.61  ? 4   DG  E N9    1 
ATOM   9497  C  C8    . DG  E 2 4   ? 11.661  -0.834  -4.056  1.00 81.52  ? 4   DG  E C8    1 
ATOM   9498  N  N7    . DG  E 2 4   ? 10.494  -1.267  -3.685  1.00 76.53  ? 4   DG  E N7    1 
ATOM   9499  C  C5    . DG  E 2 4   ? 9.854   -1.555  -4.862  1.00 80.23  ? 4   DG  E C5    1 
ATOM   9500  C  C6    . DG  E 2 4   ? 8.567   -2.061  -5.071  1.00 83.05  ? 4   DG  E C6    1 
ATOM   9501  O  O6    . DG  E 2 4   ? 7.720   -2.358  -4.215  1.00 72.10  ? 4   DG  E O6    1 
ATOM   9502  N  N1    . DG  E 2 4   ? 8.292   -2.214  -6.436  1.00 93.64  ? 4   DG  E N1    1 
ATOM   9503  C  C2    . DG  E 2 4   ? 9.171   -1.913  -7.458  1.00 93.23  ? 4   DG  E C2    1 
ATOM   9504  N  N2    . DG  E 2 4   ? 8.731   -2.125  -8.705  1.00 97.78  ? 4   DG  E N2    1 
ATOM   9505  N  N3    . DG  E 2 4   ? 10.392  -1.438  -7.267  1.00 87.48  ? 4   DG  E N3    1 
ATOM   9506  C  C4    . DG  E 2 4   ? 10.664  -1.285  -5.944  1.00 85.02  ? 4   DG  E C4    1 
ATOM   9507  P  P     . DG  E 2 5   ? 14.423  3.912   -4.965  1.00 49.82  ? 5   DG  E P     1 
ATOM   9508  O  OP1   . DG  E 2 5   ? 15.506  4.915   -5.034  1.00 53.63  ? 5   DG  E OP1   1 
ATOM   9509  O  OP2   . DG  E 2 5   ? 13.522  3.772   -3.814  1.00 68.07  ? 5   DG  E OP2   1 
ATOM   9510  O  "O5'" . DG  E 2 5   ? 13.447  4.179   -6.186  1.00 81.00  ? 5   DG  E "O5'" 1 
ATOM   9511  C  "C5'" . DG  E 2 5   ? 13.965  4.293   -7.498  1.00 77.94  ? 5   DG  E "C5'" 1 
ATOM   9512  C  "C4'" . DG  E 2 5   ? 12.831  4.459   -8.473  1.00 64.01  ? 5   DG  E "C4'" 1 
ATOM   9513  O  "O4'" . DG  E 2 5   ? 11.882  3.382   -8.261  1.00 58.59  ? 5   DG  E "O4'" 1 
ATOM   9514  C  "C3'" . DG  E 2 5   ? 12.048  5.761   -8.279  1.00 59.59  ? 5   DG  E "C3'" 1 
ATOM   9515  O  "O3'" . DG  E 2 5   ? 11.564  6.240   -9.489  1.00 49.68  ? 5   DG  E "O3'" 1 
ATOM   9516  C  "C2'" . DG  E 2 5   ? 10.913  5.342   -7.383  1.00 69.50  ? 5   DG  E "C2'" 1 
ATOM   9517  C  "C1'" . DG  E 2 5   ? 10.644  3.925   -7.853  1.00 71.13  ? 5   DG  E "C1'" 1 
ATOM   9518  N  N9    . DG  E 2 5   ? 10.059  3.117   -6.794  1.00 68.69  ? 5   DG  E N9    1 
ATOM   9519  C  C8    . DG  E 2 5   ? 10.547  2.924   -5.529  1.00 57.82  ? 5   DG  E C8    1 
ATOM   9520  N  N7    . DG  E 2 5   ? 9.776   2.167   -4.796  1.00 51.22  ? 5   DG  E N7    1 
ATOM   9521  C  C5    . DG  E 2 5   ? 8.698   1.885   -5.604  1.00 53.37  ? 5   DG  E C5    1 
ATOM   9522  C  C6    . DG  E 2 5   ? 7.546   1.125   -5.348  1.00 59.25  ? 5   DG  E C6    1 
ATOM   9523  O  O6    . DG  E 2 5   ? 7.227   0.546   -4.304  1.00 51.88  ? 5   DG  E O6    1 
ATOM   9524  N  N1    . DG  E 2 5   ? 6.712   1.061   -6.475  1.00 71.23  ? 5   DG  E N1    1 
ATOM   9525  C  C2    . DG  E 2 5   ? 6.964   1.681   -7.677  1.00 66.25  ? 5   DG  E C2    1 
ATOM   9526  N  N2    . DG  E 2 5   ? 6.039   1.537   -8.639  1.00 76.76  ? 5   DG  E N2    1 
ATOM   9527  N  N3    . DG  E 2 5   ? 8.032   2.409   -7.913  1.00 60.21  ? 5   DG  E N3    1 
ATOM   9528  C  C4    . DG  E 2 5   ? 8.854   2.463   -6.841  1.00 62.36  ? 5   DG  E C4    1 
ATOM   9529  P  P     . DT  E 2 6   ? 11.253  7.803   -9.654  1.00 76.80  ? 6   DT  E P     1 
ATOM   9530  O  OP1   . DT  E 2 6   ? 12.071  8.251   -10.793 1.00 78.10  ? 6   DT  E OP1   1 
ATOM   9531  O  OP2   . DT  E 2 6   ? 11.458  8.436   -8.326  1.00 74.76  ? 6   DT  E OP2   1 
ATOM   9532  O  "O5'" . DT  E 2 6   ? 9.691   7.851   -10.053 1.00 66.08  ? 6   DT  E "O5'" 1 
ATOM   9533  C  "C5'" . DT  E 2 6   ? 9.195   6.946   -11.044 1.00 67.45  ? 6   DT  E "C5'" 1 
ATOM   9534  C  "C4'" . DT  E 2 6   ? 7.743   6.545   -10.798 1.00 65.52  ? 6   DT  E "C4'" 1 
ATOM   9535  O  "O4'" . DT  E 2 6   ? 7.639   5.655   -9.660  1.00 57.94  ? 6   DT  E "O4'" 1 
ATOM   9536  C  "C3'" . DT  E 2 6   ? 6.777   7.690   -10.539 1.00 71.09  ? 6   DT  E "C3'" 1 
ATOM   9537  O  "O3'" . DT  E 2 6   ? 5.707   7.636   -11.482 1.00 74.98  ? 6   DT  E "O3'" 1 
ATOM   9538  C  "C2'" . DT  E 2 6   ? 6.285   7.448   -9.105  1.00 69.90  ? 6   DT  E "C2'" 1 
ATOM   9539  C  "C1'" . DT  E 2 6   ? 6.460   5.951   -8.965  1.00 64.88  ? 6   DT  E "C1'" 1 
ATOM   9540  N  N1    . DT  E 2 6   ? 6.624   5.490   -7.558  1.00 79.44  ? 6   DT  E N1    1 
ATOM   9541  C  C2    . DT  E 2 6   ? 5.816   4.490   -7.087  1.00 80.55  ? 6   DT  E C2    1 
ATOM   9542  O  O2    . DT  E 2 6   ? 4.970   3.952   -7.759  1.00 82.40  ? 6   DT  E O2    1 
ATOM   9543  N  N3    . DT  E 2 6   ? 6.048   4.126   -5.797  1.00 75.90  ? 6   DT  E N3    1 
ATOM   9544  C  C4    . DT  E 2 6   ? 6.983   4.653   -4.942  1.00 73.12  ? 6   DT  E C4    1 
ATOM   9545  O  O4    . DT  E 2 6   ? 7.117   4.255   -3.802  1.00 67.77  ? 6   DT  E O4    1 
ATOM   9546  C  C5    . DT  E 2 6   ? 7.795   5.699   -5.482  1.00 72.49  ? 6   DT  E C5    1 
ATOM   9547  C  C7    . DT  E 2 6   ? 8.836   6.345   -4.626  1.00 79.60  ? 6   DT  E C7    1 
ATOM   9548  C  C6    . DT  E 2 6   ? 7.589   6.066   -6.755  1.00 78.75  ? 6   DT  E C6    1 
ATOM   9549  P  P     . DA  E 2 7   ? 5.250   8.990   -12.212 1.00 70.98  ? 7   DA  E P     1 
ATOM   9550  O  OP1   . DA  E 2 7   ? 5.039   8.747   -13.665 1.00 80.42  ? 7   DA  E OP1   1 
ATOM   9551  O  OP2   . DA  E 2 7   ? 6.186   10.016  -11.711 1.00 63.55  ? 7   DA  E OP2   1 
ATOM   9552  O  "O5'" . DA  E 2 7   ? 3.819   9.321   -11.605 1.00 75.98  ? 7   DA  E "O5'" 1 
ATOM   9553  C  "C5'" . DA  E 2 7   ? 3.674   9.677   -10.270 1.00 69.62  ? 7   DA  E "C5'" 1 
ATOM   9554  C  "C4'" . DA  E 2 7   ? 2.451   8.995   -9.728  1.00 82.31  ? 7   DA  E "C4'" 1 
ATOM   9555  O  "O4'" . DA  E 2 7   ? 2.819   7.707   -9.173  1.00 89.71  ? 7   DA  E "O4'" 1 
ATOM   9556  C  "C3'" . DA  E 2 7   ? 1.718   9.731   -8.621  1.00 85.45  ? 7   DA  E "C3'" 1 
ATOM   9557  O  "O3'" . DA  E 2 7   ? 0.770   10.635  -9.195  1.00 93.09  ? 7   DA  E "O3'" 1 
ATOM   9558  C  "C2'" . DA  E 2 7   ? 1.031   8.573   -7.906  1.00 84.52  ? 7   DA  E "C2'" 1 
ATOM   9559  C  "C1'" . DA  E 2 7   ? 2.118   7.504   -7.954  1.00 91.88  ? 7   DA  E "C1'" 1 
ATOM   9560  N  N9    . DA  E 2 7   ? 3.069   7.594   -6.842  1.00 97.00  ? 7   DA  E N9    1 
ATOM   9561  C  C8    . DA  E 2 7   ? 4.214   8.347   -6.786  1.00 100.52 ? 7   DA  E C8    1 
ATOM   9562  N  N7    . DA  E 2 7   ? 4.874   8.233   -5.657  1.00 95.25  ? 7   DA  E N7    1 
ATOM   9563  C  C5    . DA  E 2 7   ? 4.111   7.348   -4.919  1.00 97.84  ? 7   DA  E C5    1 
ATOM   9564  C  C6    . DA  E 2 7   ? 4.263   6.820   -3.619  1.00 98.47  ? 7   DA  E C6    1 
ATOM   9565  N  N6    . DA  E 2 7   ? 5.290   7.121   -2.814  1.00 96.03  ? 7   DA  E N6    1 
ATOM   9566  N  N1    . DA  E 2 7   ? 3.316   5.967   -3.182  1.00 101.34 ? 7   DA  E N1    1 
ATOM   9567  C  C2    . DA  E 2 7   ? 2.283   5.675   -3.997  1.00 99.04  ? 7   DA  E C2    1 
ATOM   9568  N  N3    . DA  E 2 7   ? 2.036   6.106   -5.237  1.00 89.66  ? 7   DA  E N3    1 
ATOM   9569  C  C4    . DA  E 2 7   ? 2.990   6.948   -5.637  1.00 93.51  ? 7   DA  E C4    1 
ATOM   9570  P  P     . DT  E 2 8   ? 0.153   11.847  -8.335  1.00 92.72  ? 8   DT  E P     1 
ATOM   9571  O  OP1   . DT  E 2 8   ? -0.738  12.600  -9.245  1.00 95.93  ? 8   DT  E OP1   1 
ATOM   9572  O  OP2   . DT  E 2 8   ? 1.233   12.564  -7.609  1.00 92.29  ? 8   DT  E OP2   1 
ATOM   9573  O  "O5'" . DT  E 2 8   ? -0.723  11.102  -7.235  1.00 137.86 ? 8   DT  E "O5'" 1 
ATOM   9574  C  "C5'" . DT  E 2 8   ? -1.907  10.402  -7.600  1.00 131.38 ? 8   DT  E "C5'" 1 
ATOM   9575  C  "C4'" . DT  E 2 8   ? -2.852  10.338  -6.416  1.00 117.55 ? 8   DT  E "C4'" 1 
ATOM   9576  O  "O4'" . DT  E 2 8   ? -2.334  9.409   -5.425  1.00 108.25 ? 8   DT  E "O4'" 1 
ATOM   9577  C  "C3'" . DT  E 2 8   ? -3.034  11.664  -5.694  1.00 109.45 ? 8   DT  E "C3'" 1 
ATOM   9578  O  "O3'" . DT  E 2 8   ? -4.372  11.807  -5.305  1.00 114.41 ? 8   DT  E "O3'" 1 
ATOM   9579  C  "C2'" . DT  E 2 8   ? -2.108  11.537  -4.487  1.00 103.53 ? 8   DT  E "C2'" 1 
ATOM   9580  C  "C1'" . DT  E 2 8   ? -2.209  10.054  -4.181  1.00 102.27 ? 8   DT  E "C1'" 1 
ATOM   9581  N  N1    . DT  E 2 8   ? -1.004  9.523   -3.496  1.00 107.29 ? 8   DT  E N1    1 
ATOM   9582  C  C2    . DT  E 2 8   ? -1.144  8.536   -2.540  1.00 115.59 ? 8   DT  E C2    1 
ATOM   9583  O  O2    . DT  E 2 8   ? -2.221  8.055   -2.222  1.00 125.59 ? 8   DT  E O2    1 
ATOM   9584  N  N3    . DT  E 2 8   ? 0.031   8.130   -1.966  1.00 104.21 ? 8   DT  E N3    1 
ATOM   9585  C  C4    . DT  E 2 8   ? 1.301   8.601   -2.243  1.00 97.66  ? 8   DT  E C4    1 
ATOM   9586  O  O4    . DT  E 2 8   ? 2.294   8.176   -1.668  1.00 106.83 ? 8   DT  E O4    1 
ATOM   9587  C  C5    . DT  E 2 8   ? 1.376   9.636   -3.246  1.00 82.35  ? 8   DT  E C5    1 
ATOM   9588  C  C7    . DT  E 2 8   ? 2.697   10.229  -3.621  1.00 69.82  ? 8   DT  E C7    1 
ATOM   9589  C  C6    . DT  E 2 8   ? 0.234   10.043  -3.816  1.00 96.29  ? 8   DT  E C6    1 
ATOM   9590  P  P     . DG  E 2 9   ? -4.832  13.131  -4.529  1.00 120.90 ? 9   DG  E P     1 
ATOM   9591  O  OP1   . DG  E 2 9   ? -6.235  13.411  -4.918  1.00 121.86 ? 9   DG  E OP1   1 
ATOM   9592  O  OP2   . DG  E 2 9   ? -3.789  14.171  -4.724  1.00 119.36 ? 9   DG  E OP2   1 
ATOM   9593  O  "O5'" . DG  E 2 9   ? -4.758  12.701  -2.993  1.00 133.35 ? 9   DG  E "O5'" 1 
ATOM   9594  C  "C5'" . DG  E 2 9   ? -5.287  11.444  -2.567  1.00 130.28 ? 9   DG  E "C5'" 1 
ATOM   9595  C  "C4'" . DG  E 2 9   ? -5.122  11.270  -1.064  1.00 122.98 ? 9   DG  E "C4'" 1 
ATOM   9596  O  "O4'" . DG  E 2 9   ? -3.800  10.737  -0.779  1.00 125.11 ? 9   DG  E "O4'" 1 
ATOM   9597  C  "C3'" . DG  E 2 9   ? -5.216  12.562  -0.250  1.00 116.05 ? 9   DG  E "C3'" 1 
ATOM   9598  O  "O3'" . DG  E 2 9   ? -5.708  12.271  1.042   1.00 111.11 ? 9   DG  E "O3'" 1 
ATOM   9599  C  "C2'" . DG  E 2 9   ? -3.761  12.985  -0.183  1.00 119.21 ? 9   DG  E "C2'" 1 
ATOM   9600  C  "C1'" . DG  E 2 9   ? -3.134  11.635  0.081   1.00 121.90 ? 9   DG  E "C1'" 1 
ATOM   9601  N  N9    . DG  E 2 9   ? -1.706  11.591  -0.169  1.00 117.29 ? 9   DG  E N9    1 
ATOM   9602  C  C8    . DG  E 2 9   ? -0.979  12.392  -1.013  1.00 118.10 ? 9   DG  E C8    1 
ATOM   9603  N  N7    . DG  E 2 9   ? 0.300   12.126  -0.998  1.00 115.23 ? 9   DG  E N7    1 
ATOM   9604  C  C5    . DG  E 2 9   ? 0.419   11.091  -0.078  1.00 112.82 ? 9   DG  E C5    1 
ATOM   9605  C  C6    . DG  E 2 9   ? 1.563   10.384  0.364   1.00 114.01 ? 9   DG  E C6    1 
ATOM   9606  O  O6    . DG  E 2 9   ? 2.746   10.532  0.016   1.00 111.73 ? 9   DG  E O6    1 
ATOM   9607  N  N1    . DG  E 2 9   ? 1.230   9.406   1.301   1.00 113.06 ? 9   DG  E N1    1 
ATOM   9608  C  C2    . DG  E 2 9   ? -0.044  9.155   1.760   1.00 111.58 ? 9   DG  E C2    1 
ATOM   9609  N  N2    . DG  E 2 9   ? -0.174  8.180   2.673   1.00 102.35 ? 9   DG  E N2    1 
ATOM   9610  N  N3    . DG  E 2 9   ? -1.116  9.813   1.353   1.00 116.21 ? 9   DG  E N3    1 
ATOM   9611  C  C4    . DG  E 2 9   ? -0.809  10.759  0.438   1.00 114.45 ? 9   DG  E C4    1 
ATOM   9612  P  P     . DT  E 2 10  ? -6.745  13.264  1.775   1.00 162.51 ? 10  DT  E P     1 
ATOM   9613  O  OP1   . DT  E 2 10  ? -7.548  12.444  2.716   1.00 164.68 ? 10  DT  E OP1   1 
ATOM   9614  O  OP2   . DT  E 2 10  ? -7.438  14.065  0.739   1.00 163.72 ? 10  DT  E OP2   1 
ATOM   9615  O  "O5'" . DT  E 2 10  ? -5.822  14.287  2.608   1.00 128.90 ? 10  DT  E "O5'" 1 
ATOM   9616  C  "C5'" . DT  E 2 10  ? -4.472  13.960  2.937   1.00 129.91 ? 10  DT  E "C5'" 1 
ATOM   9617  C  "C4'" . DT  E 2 10  ? -4.397  12.810  3.927   1.00 128.21 ? 10  DT  E "C4'" 1 
ATOM   9618  O  "O4'" . DT  E 2 10  ? -3.301  11.929  3.560   1.00 123.17 ? 10  DT  E "O4'" 1 
ATOM   9619  C  "C3'" . DT  E 2 10  ? -4.149  13.232  5.370   1.00 131.00 ? 10  DT  E "C3'" 1 
ATOM   9620  O  "O3'" . DT  E 2 10  ? -4.912  12.423  6.288   1.00 134.40 ? 10  DT  E "O3'" 1 
ATOM   9621  C  "C2'" . DT  E 2 10  ? -2.634  13.063  5.557   1.00 128.14 ? 10  DT  E "C2'" 1 
ATOM   9622  C  "C1'" . DT  E 2 10  ? -2.207  12.099  4.442   1.00 125.38 ? 10  DT  E "C1'" 1 
ATOM   9623  N  N1    . DT  E 2 10  ? -1.004  12.589  3.658   1.00 125.19 ? 10  DT  E N1    1 
ATOM   9624  C  C2    . DT  E 2 10  ? 0.234   12.013  3.881   1.00 118.04 ? 10  DT  E C2    1 
ATOM   9625  O  O2    . DT  E 2 10  ? 0.422   11.103  4.677   1.00 108.30 ? 10  DT  E O2    1 
ATOM   9626  N  N3    . DT  E 2 10  ? 1.251   12.540  3.126   1.00 122.78 ? 10  DT  E N3    1 
ATOM   9627  C  C4    . DT  E 2 10  ? 1.167   13.562  2.192   1.00 126.53 ? 10  DT  E C4    1 
ATOM   9628  O  O4    . DT  E 2 10  ? 2.145   13.965  1.567   1.00 131.26 ? 10  DT  E O4    1 
ATOM   9629  C  C5    . DT  E 2 10  ? -0.148  14.128  2.010   1.00 123.06 ? 10  DT  E C5    1 
ATOM   9630  C  C7    . DT  E 2 10  ? -0.357  15.244  1.024   1.00 112.83 ? 10  DT  E C7    1 
ATOM   9631  C  C6    . DT  E 2 10  ? -1.157  13.623  2.745   1.00 126.91 ? 10  DT  E C6    1 
ATOM   9632  P  P     . DA  E 2 11  ? -5.669  13.107  7.537   1.00 134.28 ? 11  DA  E P     1 
ATOM   9633  O  OP1   . DA  E 2 11  ? -6.223  12.052  8.420   1.00 130.15 ? 11  DA  E OP1   1 
ATOM   9634  O  OP2   . DA  E 2 11  ? -6.593  14.109  6.958   1.00 135.85 ? 11  DA  E OP2   1 
ATOM   9635  O  "O5'" . DA  E 2 11  ? -4.494  13.884  8.323   1.00 138.05 ? 11  DA  E "O5'" 1 
ATOM   9636  C  "C5'" . DA  E 2 11  ? -3.452  13.148  8.997   1.00 129.88 ? 11  DA  E "C5'" 1 
ATOM   9637  C  "C4'" . DA  E 2 11  ? -2.249  14.035  9.307   1.00 124.22 ? 11  DA  E "C4'" 1 
ATOM   9638  O  "O4'" . DA  E 2 11  ? -1.217  13.876  8.283   1.00 127.22 ? 11  DA  E "O4'" 1 
ATOM   9639  C  "C3'" . DA  E 2 11  ? -2.542  15.543  9.387   1.00 124.55 ? 11  DA  E "C3'" 1 
ATOM   9640  O  "O3'" . DA  E 2 11  ? -2.037  16.064  10.621  1.00 131.63 ? 11  DA  E "O3'" 1 
ATOM   9641  C  "C2'" . DA  E 2 11  ? -1.790  16.117  8.183   1.00 126.61 ? 11  DA  E "C2'" 1 
ATOM   9642  C  "C1'" . DA  E 2 11  ? -0.633  15.136  8.070   1.00 127.46 ? 11  DA  E "C1'" 1 
ATOM   9643  N  N9    . DA  E 2 11  ? 0.092   15.200  6.781   1.00 122.04 ? 11  DA  E N9    1 
ATOM   9644  C  C8    . DA  E 2 11  ? -0.393  15.647  5.581   1.00 118.74 ? 11  DA  E C8    1 
ATOM   9645  N  N7    . DA  E 2 11  ? 0.496   15.652  4.616   1.00 118.35 ? 11  DA  E N7    1 
ATOM   9646  C  C5    . DA  E 2 11  ? 1.653   15.188  5.221   1.00 117.80 ? 11  DA  E C5    1 
ATOM   9647  C  C6    . DA  E 2 11  ? 2.965   14.953  4.732   1.00 120.34 ? 11  DA  E C6    1 
ATOM   9648  N  N6    . DA  E 2 11  ? 3.339   15.164  3.457   1.00 116.97 ? 11  DA  E N6    1 
ATOM   9649  N  N1    . DA  E 2 11  ? 3.880   14.492  5.608   1.00 117.64 ? 11  DA  E N1    1 
ATOM   9650  C  C2    . DA  E 2 11  ? 3.513   14.284  6.875   1.00 114.15 ? 11  DA  E C2    1 
ATOM   9651  N  N3    . DA  E 2 11  ? 2.323   14.464  7.446   1.00 116.27 ? 11  DA  E N3    1 
ATOM   9652  C  C4    . DA  E 2 11  ? 1.428   14.919  6.558   1.00 117.47 ? 11  DA  E C4    1 
ATOM   9653  P  P     . DG  E 2 12  ? -1.860  17.651  10.849  1.00 123.84 ? 12  DG  E P     1 
ATOM   9654  O  OP1   . DG  E 2 12  ? -1.795  17.888  12.314  1.00 113.02 ? 12  DG  E OP1   1 
ATOM   9655  O  OP2   . DG  E 2 12  ? -2.839  18.363  9.994   1.00 134.96 ? 12  DG  E OP2   1 
ATOM   9656  O  "O5'" . DG  E 2 12  ? -0.415  17.957  10.258  1.00 132.45 ? 12  DG  E "O5'" 1 
ATOM   9657  C  "C5'" . DG  E 2 12  ? 0.631   17.070  10.561  1.00 128.65 ? 12  DG  E "C5'" 1 
ATOM   9658  C  "C4'" . DG  E 2 12  ? 1.947   17.584  10.049  1.00 118.50 ? 12  DG  E "C4'" 1 
ATOM   9659  O  "O4'" . DG  E 2 12  ? 2.024   17.472  8.617   1.00 119.44 ? 12  DG  E "O4'" 1 
ATOM   9660  C  "C3'" . DG  E 2 12  ? 2.240   19.057  10.343  1.00 107.35 ? 12  DG  E "C3'" 1 
ATOM   9661  O  "O3'" . DG  E 2 12  ? 3.090   19.146  11.472  1.00 98.43  ? 12  DG  E "O3'" 1 
ATOM   9662  C  "C2'" . DG  E 2 12  ? 2.942   19.543  9.059   1.00 113.33 ? 12  DG  E "C2'" 1 
ATOM   9663  C  "C1'" . DG  E 2 12  ? 3.134   18.242  8.286   1.00 115.34 ? 12  DG  E "C1'" 1 
ATOM   9664  N  N9    . DG  E 2 12  ? 3.263   18.415  6.849   1.00 109.66 ? 12  DG  E N9    1 
ATOM   9665  C  C8    . DG  E 2 12  ? 2.318   18.859  5.956   1.00 105.31 ? 12  DG  E C8    1 
ATOM   9666  N  N7    . DG  E 2 12  ? 2.770   18.944  4.733   1.00 105.57 ? 12  DG  E N7    1 
ATOM   9667  C  C5    . DG  E 2 12  ? 4.097   18.534  4.833   1.00 110.36 ? 12  DG  E C5    1 
ATOM   9668  C  C6    . DG  E 2 12  ? 5.099   18.415  3.842   1.00 121.11 ? 12  DG  E C6    1 
ATOM   9669  O  O6    . DG  E 2 12  ? 5.014   18.651  2.630   1.00 130.89 ? 12  DG  E O6    1 
ATOM   9670  N  N1    . DG  E 2 12  ? 6.305   17.967  4.379   1.00 118.35 ? 12  DG  E N1    1 
ATOM   9671  C  C2    . DG  E 2 12  ? 6.515   17.673  5.703   1.00 110.68 ? 12  DG  E C2    1 
ATOM   9672  N  N2    . DG  E 2 12  ? 7.744   17.252  6.034   1.00 108.00 ? 12  DG  E N2    1 
ATOM   9673  N  N3    . DG  E 2 12  ? 5.586   17.779  6.637   1.00 106.29 ? 12  DG  E N3    1 
ATOM   9674  C  C4    . DG  E 2 12  ? 4.408   18.213  6.129   1.00 107.84 ? 12  DG  E C4    1 
ATOM   9675  P  P     . DG  E 2 13  ? 3.589   20.570  12.026  1.00 129.93 ? 13  DG  E P     1 
ATOM   9676  O  OP1   . DG  E 2 13  ? 3.435   20.568  13.497  1.00 131.11 ? 13  DG  E OP1   1 
ATOM   9677  O  OP2   . DG  E 2 13  ? 2.971   21.648  11.230  1.00 133.87 ? 13  DG  E OP2   1 
ATOM   9678  O  "O5'" . DG  E 2 13  ? 5.148   20.558  11.720  1.00 105.08 ? 13  DG  E "O5'" 1 
ATOM   9679  C  "C5'" . DG  E 2 13  ? 5.949   19.452  12.132  1.00 92.58  ? 13  DG  E "C5'" 1 
ATOM   9680  C  "C4'" . DG  E 2 13  ? 7.198   19.395  11.291  1.00 75.36  ? 13  DG  E "C4'" 1 
ATOM   9681  O  "O4'" . DG  E 2 13  ? 6.817   19.223  9.926   1.00 74.81  ? 13  DG  E "O4'" 1 
ATOM   9682  C  "C3'" . DG  E 2 13  ? 7.988   20.681  11.284  1.00 73.64  ? 13  DG  E "C3'" 1 
ATOM   9683  O  "O3'" . DG  E 2 13  ? 8.940   20.648  12.300  1.00 70.35  ? 13  DG  E "O3'" 1 
ATOM   9684  C  "C2'" . DG  E 2 13  ? 8.658   20.698  9.908   1.00 73.68  ? 13  DG  E "C2'" 1 
ATOM   9685  C  "C1'" . DG  E 2 13  ? 7.840   19.718  9.098   1.00 74.36  ? 13  DG  E "C1'" 1 
ATOM   9686  N  N9    . DG  E 2 13  ? 7.228   20.314  7.932   1.00 82.91  ? 13  DG  E N9    1 
ATOM   9687  C  C8    . DG  E 2 13  ? 5.896   20.558  7.737   1.00 87.13  ? 13  DG  E C8    1 
ATOM   9688  N  N7    . DG  E 2 13  ? 5.636   21.085  6.576   1.00 93.13  ? 13  DG  E N7    1 
ATOM   9689  C  C5    . DG  E 2 13  ? 6.875   21.191  5.968   1.00 89.84  ? 13  DG  E C5    1 
ATOM   9690  C  C6    . DG  E 2 13  ? 7.219   21.682  4.700   1.00 91.17  ? 13  DG  E C6    1 
ATOM   9691  O  O6    . DG  E 2 13  ? 6.474   22.142  3.828   1.00 103.17 ? 13  DG  E O6    1 
ATOM   9692  N  N1    . DG  E 2 13  ? 8.580   21.610  4.479   1.00 81.70  ? 13  DG  E N1    1 
ATOM   9693  C  C2    . DG  E 2 13  ? 9.496   21.122  5.370   1.00 74.79  ? 13  DG  E C2    1 
ATOM   9694  N  N2    . DG  E 2 13  ? 10.773  21.125  4.971   1.00 72.57  ? 13  DG  E N2    1 
ATOM   9695  N  N3    . DG  E 2 13  ? 9.187   20.657  6.559   1.00 82.14  ? 13  DG  E N3    1 
ATOM   9696  C  C4    . DG  E 2 13  ? 7.863   20.722  6.790   1.00 85.44  ? 13  DG  E C4    1 
ATOM   9697  P  P     . DT  E 2 14  ? 9.699   21.996  12.710  1.00 83.03  ? 14  DT  E P     1 
ATOM   9698  O  OP1   . DT  E 2 14  ? 10.370  21.705  13.998  1.00 92.05  ? 14  DT  E OP1   1 
ATOM   9699  O  OP2   . DT  E 2 14  ? 8.764   23.136  12.532  1.00 79.29  ? 14  DT  E OP2   1 
ATOM   9700  O  "O5'" . DT  E 2 14  ? 10.795  22.190  11.581  1.00 70.06  ? 14  DT  E "O5'" 1 
ATOM   9701  C  "C5'" . DT  E 2 14  ? 11.776  21.222  11.388  1.00 66.96  ? 14  DT  E "C5'" 1 
ATOM   9702  C  "C4'" . DT  E 2 14  ? 12.757  21.713  10.372  1.00 64.18  ? 14  DT  E "C4'" 1 
ATOM   9703  O  "O4'" . DT  E 2 14  ? 12.083  21.912  9.104   1.00 64.52  ? 14  DT  E "O4'" 1 
ATOM   9704  C  "C3'" . DT  E 2 14  ? 13.413  23.039  10.718  1.00 64.48  ? 14  DT  E "C3'" 1 
ATOM   9705  O  "O3'" . DT  E 2 14  ? 14.770  22.930  10.453  1.00 64.82  ? 14  DT  E "O3'" 1 
ATOM   9706  C  "C2'" . DT  E 2 14  ? 12.729  24.052  9.781   1.00 70.62  ? 14  DT  E "C2'" 1 
ATOM   9707  C  "C1'" . DT  E 2 14  ? 12.403  23.191  8.575   1.00 70.98  ? 14  DT  E "C1'" 1 
ATOM   9708  N  N1    . DT  E 2 14  ? 11.210  23.660  7.747   1.00 77.16  ? 14  DT  E N1    1 
ATOM   9709  C  C2    . DT  E 2 14  ? 11.372  24.011  6.398   1.00 74.66  ? 14  DT  E C2    1 
ATOM   9710  O  O2    . DT  E 2 14  ? 12.449  24.030  5.817   1.00 66.26  ? 14  DT  E O2    1 
ATOM   9711  N  N3    . DT  E 2 14  ? 10.212  24.363  5.760   1.00 69.62  ? 14  DT  E N3    1 
ATOM   9712  C  C4    . DT  E 2 14  ? 8.942   24.388  6.298   1.00 71.01  ? 14  DT  E C4    1 
ATOM   9713  O  O4    . DT  E 2 14  ? 7.970   24.721  5.644   1.00 74.50  ? 14  DT  E O4    1 
ATOM   9714  C  C5    . DT  E 2 14  ? 8.841   23.999  7.691   1.00 69.64  ? 14  DT  E C5    1 
ATOM   9715  C  C7    . DT  E 2 14  ? 7.514   23.991  8.375   1.00 64.62  ? 14  DT  E C7    1 
ATOM   9716  C  C6    . DT  E 2 14  ? 9.959   23.649  8.332   1.00 64.85  ? 14  DT  E C6    1 
ATOM   9717  P  P     . DT  E 2 15  ? 15.740  24.170  10.718  1.00 65.23  ? 15  DT  E P     1 
ATOM   9718  O  OP1   . DT  E 2 15  ? 17.100  23.592  10.868  1.00 65.36  ? 15  DT  E OP1   1 
ATOM   9719  O  OP2   . DT  E 2 15  ? 15.146  25.021  11.769  1.00 64.99  ? 15  DT  E OP2   1 
ATOM   9720  O  "O5'" . DT  E 2 15  ? 15.743  24.957  9.328   1.00 66.65  ? 15  DT  E "O5'" 1 
ATOM   9721  C  "C5'" . DT  E 2 15  ? 16.671  24.587  8.336   1.00 66.31  ? 15  DT  E "C5'" 1 
ATOM   9722  C  "C4'" . DT  E 2 15  ? 16.603  25.523  7.163   1.00 72.59  ? 15  DT  E "C4'" 1 
ATOM   9723  O  "O4'" . DT  E 2 15  ? 15.226  25.661  6.726   1.00 78.26  ? 15  DT  E "O4'" 1 
ATOM   9724  C  "C3'" . DT  E 2 15  ? 17.092  26.937  7.440   1.00 68.76  ? 15  DT  E "C3'" 1 
ATOM   9725  O  "O3'" . DT  E 2 15  ? 17.874  27.365  6.344   1.00 70.30  ? 15  DT  E "O3'" 1 
ATOM   9726  C  "C2'" . DT  E 2 15  ? 15.790  27.744  7.546   1.00 71.13  ? 15  DT  E "C2'" 1 
ATOM   9727  C  "C1'" . DT  E 2 15  ? 14.958  27.027  6.509   1.00 75.94  ? 15  DT  E "C1'" 1 
ATOM   9728  N  N1    . DT  E 2 15  ? 13.470  27.242  6.589   1.00 74.29  ? 15  DT  E N1    1 
ATOM   9729  C  C2    . DT  E 2 15  ? 12.783  27.446  5.418   1.00 72.89  ? 15  DT  E C2    1 
ATOM   9730  O  O2    . DT  E 2 15  ? 13.327  27.488  4.330   1.00 81.83  ? 15  DT  E O2    1 
ATOM   9731  N  N3    . DT  E 2 15  ? 11.438  27.603  5.555   1.00 75.45  ? 15  DT  E N3    1 
ATOM   9732  C  C4    . DT  E 2 15  ? 10.712  27.583  6.721   1.00 77.42  ? 15  DT  E C4    1 
ATOM   9733  O  O4    . DT  E 2 15  ? 9.487   27.740  6.725   1.00 72.73  ? 15  DT  E O4    1 
ATOM   9734  C  C5    . DT  E 2 15  ? 11.493  27.366  7.935   1.00 73.22  ? 15  DT  E C5    1 
ATOM   9735  C  C7    . DT  E 2 15  ? 10.821  27.327  9.263   1.00 78.65  ? 15  DT  E C7    1 
ATOM   9736  C  C6    . DT  E 2 15  ? 12.817  27.197  7.812   1.00 70.79  ? 15  DT  E C6    1 
ATOM   9737  P  P     . DG  E 2 16  ? 19.031  28.445  6.579   1.00 78.71  ? 16  DG  E P     1 
ATOM   9738  O  OP1   . DG  E 2 16  ? 20.202  28.043  5.768   1.00 94.06  ? 16  DG  E OP1   1 
ATOM   9739  O  OP2   . DG  E 2 16  ? 19.157  28.579  8.060   1.00 83.21  ? 16  DG  E OP2   1 
ATOM   9740  O  "O5'" . DG  E 2 16  ? 18.419  29.790  5.958   1.00 106.79 ? 16  DG  E "O5'" 1 
ATOM   9741  C  "C5'" . DG  E 2 16  ? 18.006  29.828  4.595   1.00 103.38 ? 16  DG  E "C5'" 1 
ATOM   9742  C  "C4'" . DG  E 2 16  ? 17.102  31.021  4.351   1.00 95.13  ? 16  DG  E "C4'" 1 
ATOM   9743  O  "O4'" . DG  E 2 16  ? 15.730  30.668  4.688   1.00 93.14  ? 16  DG  E "O4'" 1 
ATOM   9744  C  "C3'" . DG  E 2 16  ? 17.443  32.272  5.191   1.00 90.31  ? 16  DG  E "C3'" 1 
ATOM   9745  O  "O3'" . DG  E 2 16  ? 17.625  33.438  4.340   1.00 79.08  ? 16  DG  E "O3'" 1 
ATOM   9746  C  "C2'" . DG  E 2 16  ? 16.233  32.412  6.127   1.00 84.69  ? 16  DG  E "C2'" 1 
ATOM   9747  C  "C1'" . DG  E 2 16  ? 15.130  31.788  5.283   1.00 84.59  ? 16  DG  E "C1'" 1 
ATOM   9748  N  N9    . DG  E 2 16  ? 13.940  31.397  6.051   1.00 75.04  ? 16  DG  E N9    1 
ATOM   9749  C  C8    . DG  E 2 16  ? 13.892  31.060  7.386   1.00 68.90  ? 16  DG  E C8    1 
ATOM   9750  N  N7    . DG  E 2 16  ? 12.683  30.803  7.817   1.00 71.43  ? 16  DG  E N7    1 
ATOM   9751  C  C5    . DG  E 2 16  ? 11.875  30.990  6.700   1.00 79.33  ? 16  DG  E C5    1 
ATOM   9752  C  C6    . DG  E 2 16  ? 10.461  30.865  6.557   1.00 85.97  ? 16  DG  E C6    1 
ATOM   9753  O  O6    . DG  E 2 16  ? 9.626   30.544  7.409   1.00 80.55  ? 16  DG  E O6    1 
ATOM   9754  N  N1    . DG  E 2 16  ? 10.044  31.157  5.265   1.00 96.02  ? 16  DG  E N1    1 
ATOM   9755  C  C2    . DG  E 2 16  ? 10.878  31.529  4.239   1.00 102.49 ? 16  DG  E C2    1 
ATOM   9756  N  N2    . DG  E 2 16  ? 10.281  31.767  3.057   1.00 113.55 ? 16  DG  E N2    1 
ATOM   9757  N  N3    . DG  E 2 16  ? 12.206  31.661  4.359   1.00 95.01  ? 16  DG  E N3    1 
ATOM   9758  C  C4    . DG  E 2 16  ? 12.631  31.370  5.608   1.00 81.26  ? 16  DG  E C4    1 
ATOM   9759  O  "O5'" . DA  F 3 4   ? 1.300   32.113  6.515   1.00 115.44 ? 4   DA  F "O5'" 1 
ATOM   9760  C  "C5'" . DA  F 3 4   ? 0.493   33.251  6.221   1.00 112.61 ? 4   DA  F "C5'" 1 
ATOM   9761  C  "C4'" . DA  F 3 4   ? 0.992   33.965  4.975   1.00 116.24 ? 4   DA  F "C4'" 1 
ATOM   9762  O  "O4'" . DA  F 3 4   ? 2.262   34.609  5.257   1.00 106.36 ? 4   DA  F "O4'" 1 
ATOM   9763  C  "C3'" . DA  F 3 4   ? 1.221   33.069  3.754   1.00 121.55 ? 4   DA  F "C3'" 1 
ATOM   9764  O  "O3'" . DA  F 3 4   ? 0.854   33.755  2.541   1.00 125.75 ? 4   DA  F "O3'" 1 
ATOM   9765  C  "C2'" . DA  F 3 4   ? 2.716   32.774  3.808   1.00 115.30 ? 4   DA  F "C2'" 1 
ATOM   9766  C  "C1'" . DA  F 3 4   ? 3.303   33.994  4.527   1.00 106.58 ? 4   DA  F "C1'" 1 
ATOM   9767  N  N9    . DA  F 3 4   ? 4.359   33.631  5.461   1.00 98.58  ? 4   DA  F N9    1 
ATOM   9768  C  C8    . DA  F 3 4   ? 4.238   32.822  6.563   1.00 98.01  ? 4   DA  F C8    1 
ATOM   9769  N  N7    . DA  F 3 4   ? 5.360   32.652  7.221   1.00 97.61  ? 4   DA  F N7    1 
ATOM   9770  C  C5    . DA  F 3 4   ? 6.285   33.389  6.496   1.00 100.06 ? 4   DA  F C5    1 
ATOM   9771  C  C6    . DA  F 3 4   ? 7.668   33.609  6.668   1.00 102.13 ? 4   DA  F C6    1 
ATOM   9772  N  N6    . DA  F 3 4   ? 8.378   33.084  7.680   1.00 95.72  ? 4   DA  F N6    1 
ATOM   9773  N  N1    . DA  F 3 4   ? 8.296   34.390  5.756   1.00 100.11 ? 4   DA  F N1    1 
ATOM   9774  C  C2    . DA  F 3 4   ? 7.579   34.911  4.747   1.00 102.33 ? 4   DA  F C2    1 
ATOM   9775  N  N3    . DA  F 3 4   ? 6.278   34.771  4.479   1.00 100.58 ? 4   DA  F N3    1 
ATOM   9776  C  C4    . DA  F 3 4   ? 5.684   33.990  5.399   1.00 98.30  ? 4   DA  F C4    1 
ATOM   9777  P  P     . DC  F 3 5   ? 0.508   32.939  1.192   1.00 135.42 ? 5   DC  F P     1 
ATOM   9778  O  OP1   . DC  F 3 5   ? -0.109  33.867  0.202   1.00 150.37 ? 5   DC  F OP1   1 
ATOM   9779  O  OP2   . DC  F 3 5   ? -0.233  31.714  1.533   1.00 130.12 ? 5   DC  F OP2   1 
ATOM   9780  O  "O5'" . DC  F 3 5   ? 1.933   32.484  0.665   1.00 122.37 ? 5   DC  F "O5'" 1 
ATOM   9781  C  "C5'" . DC  F 3 5   ? 2.990   33.421  0.514   1.00 123.21 ? 5   DC  F "C5'" 1 
ATOM   9782  C  "C4'" . DC  F 3 5   ? 4.231   32.699  0.044   1.00 128.87 ? 5   DC  F "C4'" 1 
ATOM   9783  O  "O4'" . DC  F 3 5   ? 5.167   32.576  1.151   1.00 127.51 ? 5   DC  F "O4'" 1 
ATOM   9784  C  "C3'" . DC  F 3 5   ? 3.972   31.255  -0.414  1.00 134.38 ? 5   DC  F "C3'" 1 
ATOM   9785  O  "O3'" . DC  F 3 5   ? 4.978   30.846  -1.310  1.00 132.73 ? 5   DC  F "O3'" 1 
ATOM   9786  C  "C2'" . DC  F 3 5   ? 4.155   30.507  0.898   1.00 133.21 ? 5   DC  F "C2'" 1 
ATOM   9787  C  "C1'" . DC  F 3 5   ? 5.429   31.196  1.339   1.00 125.57 ? 5   DC  F "C1'" 1 
ATOM   9788  N  N1    . DC  F 3 5   ? 5.817   30.945  2.735   1.00 109.20 ? 5   DC  F N1    1 
ATOM   9789  C  C2    . DC  F 3 5   ? 7.017   31.480  3.209   1.00 96.55  ? 5   DC  F C2    1 
ATOM   9790  O  O2    . DC  F 3 5   ? 7.717   32.167  2.443   1.00 92.38  ? 5   DC  F O2    1 
ATOM   9791  N  N3    . DC  F 3 5   ? 7.376   31.237  4.491   1.00 89.60  ? 5   DC  F N3    1 
ATOM   9792  C  C4    . DC  F 3 5   ? 6.589   30.498  5.276   1.00 89.36  ? 5   DC  F C4    1 
ATOM   9793  N  N4    . DC  F 3 5   ? 6.985   30.296  6.537   1.00 86.85  ? 5   DC  F N4    1 
ATOM   9794  C  C5    . DC  F 3 5   ? 5.360   29.940  4.806   1.00 87.02  ? 5   DC  F C5    1 
ATOM   9795  C  C6    . DC  F 3 5   ? 5.023   30.180  3.537   1.00 100.74 ? 5   DC  F C6    1 
ATOM   9796  P  P     . DA  F 3 6   ? 4.952   31.227  -2.860  1.00 131.77 ? 6   DA  F P     1 
ATOM   9797  O  OP1   . DA  F 3 6   ? 4.751   32.690  -2.975  1.00 151.44 ? 6   DA  F OP1   1 
ATOM   9798  O  OP2   . DA  F 3 6   ? 4.083   30.264  -3.573  1.00 130.78 ? 6   DA  F OP2   1 
ATOM   9799  O  "O5'" . DA  F 3 6   ? 6.455   30.947  -3.294  1.00 110.34 ? 6   DA  F "O5'" 1 
ATOM   9800  C  "C5'" . DA  F 3 6   ? 7.508   31.679  -2.680  1.00 111.60 ? 6   DA  F "C5'" 1 
ATOM   9801  C  "C4'" . DA  F 3 6   ? 8.803   30.893  -2.728  1.00 115.81 ? 6   DA  F "C4'" 1 
ATOM   9802  O  "O4'" . DA  F 3 6   ? 9.101   30.356  -1.413  1.00 115.00 ? 6   DA  F "O4'" 1 
ATOM   9803  C  "C3'" . DA  F 3 6   ? 8.799   29.708  -3.680  1.00 116.58 ? 6   DA  F "C3'" 1 
ATOM   9804  O  "O3'" . DA  F 3 6   ? 10.082  29.577  -4.241  1.00 121.19 ? 6   DA  F "O3'" 1 
ATOM   9805  C  "C2'" . DA  F 3 6   ? 8.437   28.530  -2.768  1.00 110.93 ? 6   DA  F "C2'" 1 
ATOM   9806  C  "C1'" . DA  F 3 6   ? 9.092   28.940  -1.445  1.00 113.49 ? 6   DA  F "C1'" 1 
ATOM   9807  N  N9    . DA  F 3 6   ? 8.377   28.480  -0.253  1.00 106.69 ? 6   DA  F N9    1 
ATOM   9808  C  C8    . DA  F 3 6   ? 7.055   28.117  -0.160  1.00 102.88 ? 6   DA  F C8    1 
ATOM   9809  N  N7    . DA  F 3 6   ? 6.680   27.776  1.051   1.00 92.06  ? 6   DA  F N7    1 
ATOM   9810  C  C5    . DA  F 3 6   ? 7.831   27.937  1.808   1.00 95.21  ? 6   DA  F C5    1 
ATOM   9811  C  C6    . DA  F 3 6   ? 8.102   27.743  3.175   1.00 96.06  ? 6   DA  F C6    1 
ATOM   9812  N  N6    . DA  F 3 6   ? 7.187   27.318  4.054   1.00 99.55  ? 6   DA  F N6    1 
ATOM   9813  N  N1    . DA  F 3 6   ? 9.358   28.000  3.604   1.00 93.78  ? 6   DA  F N1    1 
ATOM   9814  C  C2    . DA  F 3 6   ? 10.274  28.424  2.722   1.00 82.04  ? 6   DA  F C2    1 
ATOM   9815  N  N3    . DA  F 3 6   ? 10.139  28.641  1.418   1.00 87.18  ? 6   DA  F N3    1 
ATOM   9816  C  C4    . DA  F 3 6   ? 8.884   28.376  1.019   1.00 97.13  ? 6   DA  F C4    1 
ATOM   9817  P  P     . DA  F 3 7   ? 10.396  28.445  -5.333  1.00 93.28  ? 7   DA  F P     1 
ATOM   9818  O  OP1   . DA  F 3 7   ? 11.533  28.975  -6.127  1.00 91.19  ? 7   DA  F OP1   1 
ATOM   9819  O  OP2   . DA  F 3 7   ? 9.139   27.958  -5.965  1.00 86.08  ? 7   DA  F OP2   1 
ATOM   9820  O  "O5'" . DA  F 3 7   ? 11.002  27.289  -4.458  1.00 95.98  ? 7   DA  F "O5'" 1 
ATOM   9821  C  "C5'" . DA  F 3 7   ? 12.201  27.522  -3.808  1.00 82.84  ? 7   DA  F "C5'" 1 
ATOM   9822  C  "C4'" . DA  F 3 7   ? 12.609  26.292  -3.076  1.00 78.50  ? 7   DA  F "C4'" 1 
ATOM   9823  O  "O4'" . DA  F 3 7   ? 11.829  26.199  -1.861  1.00 82.43  ? 7   DA  F "O4'" 1 
ATOM   9824  C  "C3'" . DA  F 3 7   ? 12.353  24.987  -3.849  1.00 79.82  ? 7   DA  F "C3'" 1 
ATOM   9825  O  "O3'" . DA  F 3 7   ? 13.473  24.113  -3.711  1.00 88.67  ? 7   DA  F "O3'" 1 
ATOM   9826  C  "C2'" . DA  F 3 7   ? 11.117  24.412  -3.155  1.00 74.57  ? 7   DA  F "C2'" 1 
ATOM   9827  C  "C1'" . DA  F 3 7   ? 11.369  24.878  -1.736  1.00 88.79  ? 7   DA  F "C1'" 1 
ATOM   9828  N  N9    . DA  F 3 7   ? 10.185  24.845  -0.883  1.00 104.79 ? 7   DA  F N9    1 
ATOM   9829  C  C8    . DA  F 3 7   ? 8.876   24.852  -1.281  1.00 111.30 ? 7   DA  F C8    1 
ATOM   9830  N  N7    . DA  F 3 7   ? 8.022   24.781  -0.285  1.00 108.02 ? 7   DA  F N7    1 
ATOM   9831  C  C5    . DA  F 3 7   ? 8.828   24.719  0.837   1.00 100.46 ? 7   DA  F C5    1 
ATOM   9832  C  C6    . DA  F 3 7   ? 8.533   24.633  2.200   1.00 100.89 ? 7   DA  F C6    1 
ATOM   9833  N  N6    . DA  F 3 7   ? 7.286   24.601  2.675   1.00 112.15 ? 7   DA  F N6    1 
ATOM   9834  N  N1    . DA  F 3 7   ? 9.568   24.595  3.065   1.00 97.82  ? 7   DA  F N1    1 
ATOM   9835  C  C2    . DA  F 3 7   ? 10.810  24.633  2.584   1.00 92.69  ? 7   DA  F C2    1 
ATOM   9836  N  N3    . DA  F 3 7   ? 11.211  24.710  1.323   1.00 89.87  ? 7   DA  F N3    1 
ATOM   9837  C  C4    . DA  F 3 7   ? 10.160  24.750  0.490   1.00 97.77  ? 7   DA  F C4    1 
ATOM   9838  P  P     . DC  F 3 8   ? 13.836  23.061  -4.872  1.00 83.86  ? 8   DC  F P     1 
ATOM   9839  O  OP1   . DC  F 3 8   ? 14.939  23.652  -5.662  1.00 93.46  ? 8   DC  F OP1   1 
ATOM   9840  O  OP2   . DC  F 3 8   ? 12.549  22.622  -5.495  1.00 62.07  ? 8   DC  F OP2   1 
ATOM   9841  O  "O5'" . DC  F 3 8   ? 14.463  21.826  -4.081  1.00 80.93  ? 8   DC  F "O5'" 1 
ATOM   9842  C  "C5'" . DC  F 3 8   ? 13.613  20.990  -3.308  1.00 80.72  ? 8   DC  F "C5'" 1 
ATOM   9843  C  "C4'" . DC  F 3 8   ? 14.018  20.986  -1.847  1.00 63.89  ? 8   DC  F "C4'" 1 
ATOM   9844  O  "O4'" . DC  F 3 8   ? 13.267  21.995  -1.138  1.00 59.32  ? 8   DC  F "O4'" 1 
ATOM   9845  C  "C3'" . DC  F 3 8   ? 13.693  19.701  -1.135  1.00 74.01  ? 8   DC  F "C3'" 1 
ATOM   9846  O  "O3'" . DC  F 3 8   ? 14.735  18.771  -1.330  1.00 57.26  ? 8   DC  F "O3'" 1 
ATOM   9847  C  "C2'" . DC  F 3 8   ? 13.583  20.154  0.311   1.00 73.76  ? 8   DC  F "C2'" 1 
ATOM   9848  C  "C1'" . DC  F 3 8   ? 12.943  21.533  0.156   1.00 65.91  ? 8   DC  F "C1'" 1 
ATOM   9849  N  N1    . DC  F 3 8   ? 11.461  21.535  0.317   1.00 68.70  ? 8   DC  F N1    1 
ATOM   9850  C  C2    . DC  F 3 8   ? 10.905  21.394  1.596   1.00 81.01  ? 8   DC  F C2    1 
ATOM   9851  O  O2    . DC  F 3 8   ? 11.657  21.263  2.580   1.00 80.54  ? 8   DC  F O2    1 
ATOM   9852  N  N3    . DC  F 3 8   ? 9.554   21.401  1.722   1.00 92.96  ? 8   DC  F N3    1 
ATOM   9853  C  C4    . DC  F 3 8   ? 8.780   21.539  0.641   1.00 92.19  ? 8   DC  F C4    1 
ATOM   9854  N  N4    . DC  F 3 8   ? 7.455   21.541  0.813   1.00 96.43  ? 8   DC  F N4    1 
ATOM   9855  C  C5    . DC  F 3 8   ? 9.331   21.677  -0.662  1.00 83.05  ? 8   DC  F C5    1 
ATOM   9856  C  C6    . DC  F 3 8   ? 10.661  21.669  -0.776  1.00 71.95  ? 8   DC  F C6    1 
ATOM   9857  P  P     . DC  F 3 9   ? 14.406  17.201  -1.281  1.00 78.29  ? 9   DC  F P     1 
ATOM   9858  O  OP1   . DC  F 3 9   ? 15.680  16.459  -1.457  1.00 92.64  ? 9   DC  F OP1   1 
ATOM   9859  O  OP2   . DC  F 3 9   ? 13.246  16.939  -2.140  1.00 69.95  ? 9   DC  F OP2   1 
ATOM   9860  O  "O5'" . DC  F 3 9   ? 13.923  16.930  0.215   1.00 89.46  ? 9   DC  F "O5'" 1 
ATOM   9861  C  "C5'" . DC  F 3 9   ? 14.789  17.157  1.294   1.00 87.24  ? 9   DC  F "C5'" 1 
ATOM   9862  C  "C4'" . DC  F 3 9   ? 14.048  16.970  2.604   1.00 82.49  ? 9   DC  F "C4'" 1 
ATOM   9863  O  "O4'" . DC  F 3 9   ? 13.002  17.976  2.743   1.00 77.81  ? 9   DC  F "O4'" 1 
ATOM   9864  C  "C3'" . DC  F 3 9   ? 13.365  15.631  2.728   1.00 76.26  ? 9   DC  F "C3'" 1 
ATOM   9865  O  "O3'" . DC  F 3 9   ? 14.268  14.717  3.354   1.00 80.39  ? 9   DC  F "O3'" 1 
ATOM   9866  C  "C2'" . DC  F 3 9   ? 12.152  15.933  3.620   1.00 82.20  ? 9   DC  F "C2'" 1 
ATOM   9867  C  "C1'" . DC  F 3 9   ? 11.891  17.432  3.425   1.00 77.81  ? 9   DC  F "C1'" 1 
ATOM   9868  N  N1    . DC  F 3 9   ? 10.669  17.707  2.634   1.00 76.25  ? 9   DC  F N1    1 
ATOM   9869  C  C2    . DC  F 3 9   ? 9.408   17.641  3.245   1.00 76.14  ? 9   DC  F C2    1 
ATOM   9870  O  O2    . DC  F 3 9   ? 9.331   17.372  4.450   1.00 73.90  ? 9   DC  F O2    1 
ATOM   9871  N  N3    . DC  F 3 9   ? 8.301   17.885  2.491   1.00 80.51  ? 9   DC  F N3    1 
ATOM   9872  C  C4    . DC  F 3 9   ? 8.429   18.181  1.192   1.00 85.26  ? 9   DC  F C4    1 
ATOM   9873  N  N4    . DC  F 3 9   ? 7.318   18.419  0.491   1.00 89.36  ? 9   DC  F N4    1 
ATOM   9874  C  C5    . DC  F 3 9   ? 9.705   18.247  0.554   1.00 75.29  ? 9   DC  F C5    1 
ATOM   9875  C  C6    . DC  F 3 9   ? 10.784  18.005  1.302   1.00 73.76  ? 9   DC  F C6    1 
ATOM   9876  P  P     . DT  F 3 10  ? 13.874  13.168  3.519   1.00 70.71  ? 10  DT  F P     1 
ATOM   9877  O  OP1   . DT  F 3 10  ? 15.110  12.392  3.856   1.00 74.11  ? 10  DT  F OP1   1 
ATOM   9878  O  OP2   . DT  F 3 10  ? 13.044  12.876  2.337   1.00 72.43  ? 10  DT  F OP2   1 
ATOM   9879  O  "O5'" . DT  F 3 10  ? 12.844  13.138  4.736   1.00 95.51  ? 10  DT  F "O5'" 1 
ATOM   9880  C  "C5'" . DT  F 3 10  ? 13.182  13.671  6.004   1.00 98.46  ? 10  DT  F "C5'" 1 
ATOM   9881  C  "C4'" . DT  F 3 10  ? 12.096  13.295  6.994   1.00 100.08 ? 10  DT  F "C4'" 1 
ATOM   9882  O  "O4'" . DT  F 3 10  ? 10.886  14.013  6.646   1.00 102.38 ? 10  DT  F "O4'" 1 
ATOM   9883  C  "C3'" . DT  F 3 10  ? 11.751  11.809  6.977   1.00 83.62  ? 10  DT  F "C3'" 1 
ATOM   9884  O  "O3'" . DT  F 3 10  ? 12.121  11.203  8.189   1.00 81.62  ? 10  DT  F "O3'" 1 
ATOM   9885  C  "C2'" . DT  F 3 10  ? 10.238  11.722  6.715   1.00 85.83  ? 10  DT  F "C2'" 1 
ATOM   9886  C  "C1'" . DT  F 3 10  ? 9.758   13.172  6.710   1.00 94.77  ? 10  DT  F "C1'" 1 
ATOM   9887  N  N1    . DT  F 3 10  ? 8.875   13.511  5.557   1.00 94.45  ? 10  DT  F N1    1 
ATOM   9888  C  C2    . DT  F 3 10  ? 7.514   13.554  5.746   1.00 105.69 ? 10  DT  F C2    1 
ATOM   9889  O  O2    . DT  F 3 10  ? 6.982   13.313  6.813   1.00 106.88 ? 10  DT  F O2    1 
ATOM   9890  N  N3    . DT  F 3 10  ? 6.789   13.893  4.630   1.00 110.22 ? 10  DT  F N3    1 
ATOM   9891  C  C4    . DT  F 3 10  ? 7.277   14.194  3.371   1.00 100.09 ? 10  DT  F C4    1 
ATOM   9892  O  O4    . DT  F 3 10  ? 6.538   14.489  2.435   1.00 100.27 ? 10  DT  F O4    1 
ATOM   9893  C  C5    . DT  F 3 10  ? 8.720   14.133  3.240   1.00 92.67  ? 10  DT  F C5    1 
ATOM   9894  C  C7    . DT  F 3 10  ? 9.375   14.434  1.922   1.00 91.26  ? 10  DT  F C7    1 
ATOM   9895  C  C6    . DT  F 3 10  ? 9.440   13.801  4.328   1.00 89.58  ? 10  DT  F C6    1 
ATOM   9896  P  P     . DA  F 3 11  ? 12.489  9.635   8.203   1.00 96.85  ? 11  DA  F P     1 
ATOM   9897  O  OP1   . DA  F 3 11  ? 12.978  9.293   9.561   1.00 94.55  ? 11  DA  F OP1   1 
ATOM   9898  O  OP2   . DA  F 3 11  ? 13.284  9.322   6.988   1.00 104.10 ? 11  DA  F OP2   1 
ATOM   9899  O  "O5'" . DA  F 3 11  ? 11.098  8.901   7.952   1.00 79.53  ? 11  DA  F "O5'" 1 
ATOM   9900  C  "C5'" . DA  F 3 11  ? 10.089  8.912   8.963   1.00 78.48  ? 11  DA  F "C5'" 1 
ATOM   9901  C  "C4'" . DA  F 3 11  ? 8.779   8.353   8.433   1.00 79.90  ? 11  DA  F "C4'" 1 
ATOM   9902  O  "O4'" . DA  F 3 11  ? 8.167   9.296   7.525   1.00 72.12  ? 11  DA  F "O4'" 1 
ATOM   9903  C  "C3'" . DA  F 3 11  ? 8.883   7.028   7.663   1.00 101.95 ? 11  DA  F "C3'" 1 
ATOM   9904  O  "O3'" . DA  F 3 11  ? 8.193   6.002   8.408   1.00 109.50 ? 11  DA  F "O3'" 1 
ATOM   9905  C  "C2'" . DA  F 3 11  ? 8.211   7.324   6.296   1.00 67.17  ? 11  DA  F "C2'" 1 
ATOM   9906  C  "C1'" . DA  F 3 11  ? 7.393   8.577   6.606   1.00 73.85  ? 11  DA  F "C1'" 1 
ATOM   9907  N  N9    . DA  F 3 11  ? 7.116   9.441   5.450   1.00 89.75  ? 11  DA  F N9    1 
ATOM   9908  C  C8    . DA  F 3 11  ? 8.028   10.007  4.609   1.00 105.56 ? 11  DA  F C8    1 
ATOM   9909  N  N7    . DA  F 3 11  ? 7.490   10.744  3.660   1.00 116.19 ? 11  DA  F N7    1 
ATOM   9910  C  C5    . DA  F 3 11  ? 6.129   10.667  3.899   1.00 102.14 ? 11  DA  F C5    1 
ATOM   9911  C  C6    . DA  F 3 11  ? 5.010   11.230  3.242   1.00 99.12  ? 11  DA  F C6    1 
ATOM   9912  N  N6    . DA  F 3 11  ? 5.099   12.017  2.163   1.00 103.89 ? 11  DA  F N6    1 
ATOM   9913  N  N1    . DA  F 3 11  ? 3.796   10.952  3.740   1.00 94.43  ? 11  DA  F N1    1 
ATOM   9914  C  C2    . DA  F 3 11  ? 3.702   10.165  4.818   1.00 93.58  ? 11  DA  F C2    1 
ATOM   9915  N  N3    . DA  F 3 11  ? 4.669   9.577   5.515   1.00 92.38  ? 11  DA  F N3    1 
ATOM   9916  C  C4    . DA  F 3 11  ? 5.875   9.873   5.001   1.00 95.40  ? 11  DA  F C4    1 
ATOM   9917  P  P     . DC  F 3 12  ? 8.422   4.437   8.102   1.00 123.67 ? 12  DC  F P     1 
ATOM   9918  O  OP1   . DC  F 3 12  ? 8.591   3.782   9.419   1.00 111.94 ? 12  DC  F OP1   1 
ATOM   9919  O  OP2   . DC  F 3 12  ? 9.479   4.303   7.069   1.00 130.79 ? 12  DC  F OP2   1 
ATOM   9920  O  "O5'" . DC  F 3 12  ? 7.036   3.976   7.432   1.00 131.92 ? 12  DC  F "O5'" 1 
ATOM   9921  C  "C5'" . DC  F 3 12  ? 5.871   3.822   8.248   1.00 127.25 ? 12  DC  F "C5'" 1 
ATOM   9922  C  "C4'" . DC  F 3 12  ? 4.578   4.176   7.500   1.00 120.50 ? 12  DC  F "C4'" 1 
ATOM   9923  O  "O4'" . DC  F 3 12  ? 4.704   5.441   6.815   1.00 115.87 ? 12  DC  F "O4'" 1 
ATOM   9924  C  "C3'" . DC  F 3 12  ? 4.152   3.234   6.389   1.00 110.41 ? 12  DC  F "C3'" 1 
ATOM   9925  O  "O3'" . DC  F 3 12  ? 3.503   2.073   6.919   1.00 112.64 ? 12  DC  F "O3'" 1 
ATOM   9926  C  "C2'" . DC  F 3 12  ? 3.166   4.105   5.603   1.00 103.36 ? 12  DC  F "C2'" 1 
ATOM   9927  C  "C1'" . DC  F 3 12  ? 3.617   5.540   5.916   1.00 103.86 ? 12  DC  F "C1'" 1 
ATOM   9928  N  N1    . DC  F 3 12  ? 4.021   6.308   4.691   1.00 101.74 ? 12  DC  F N1    1 
ATOM   9929  C  C2    . DC  F 3 12  ? 3.037   6.971   3.944   1.00 105.82 ? 12  DC  F C2    1 
ATOM   9930  O  O2    . DC  F 3 12  ? 1.860   6.929   4.325   1.00 112.97 ? 12  DC  F O2    1 
ATOM   9931  N  N3    . DC  F 3 12  ? 3.399   7.645   2.824   1.00 101.19 ? 12  DC  F N3    1 
ATOM   9932  C  C4    . DC  F 3 12  ? 4.672   7.674   2.443   1.00 91.28  ? 12  DC  F C4    1 
ATOM   9933  N  N4    . DC  F 3 12  ? 4.970   8.354   1.331   1.00 80.10  ? 12  DC  F N4    1 
ATOM   9934  C  C5    . DC  F 3 12  ? 5.694   6.999   3.181   1.00 94.65  ? 12  DC  F C5    1 
ATOM   9935  C  C6    . DC  F 3 12  ? 5.326   6.332   4.289   1.00 98.12  ? 12  DC  F C6    1 
ATOM   9936  P  P     . DT  F 3 13  ? 3.397   0.741   6.020   1.00 106.33 ? 13  DT  F P     1 
ATOM   9937  O  OP1   . DT  F 3 13  ? 2.716   -0.313  6.813   1.00 104.69 ? 13  DT  F OP1   1 
ATOM   9938  O  OP2   . DT  F 3 13  ? 4.749   0.509   5.452   1.00 109.19 ? 13  DT  F OP2   1 
ATOM   9939  O  "O5'" . DT  F 3 13  ? 2.425   1.152   4.809   1.00 120.09 ? 13  DT  F "O5'" 1 
ATOM   9940  C  "C5'" . DT  F 3 13  ? 1.027   1.356   5.038   1.00 114.73 ? 13  DT  F "C5'" 1 
ATOM   9941  C  "C4'" . DT  F 3 13  ? 0.347   1.981   3.820   1.00 110.07 ? 13  DT  F "C4'" 1 
ATOM   9942  O  "O4'" . DT  F 3 13  ? 1.031   3.194   3.432   1.00 104.41 ? 13  DT  F "O4'" 1 
ATOM   9943  C  "C3'" . DT  F 3 13  ? 0.336   1.132   2.556   1.00 105.71 ? 13  DT  F "C3'" 1 
ATOM   9944  O  "O3'" . DT  F 3 13  ? -0.772  0.230   2.587   1.00 110.19 ? 13  DT  F "O3'" 1 
ATOM   9945  C  "C2'" . DT  F 3 13  ? 0.161   2.184   1.457   1.00 97.32  ? 13  DT  F "C2'" 1 
ATOM   9946  C  "C1'" . DT  F 3 13  ? 0.815   3.437   2.056   1.00 98.88  ? 13  DT  F "C1'" 1 
ATOM   9947  N  N1    . DT  F 3 13  ? 2.121   3.794   1.418   1.00 110.07 ? 13  DT  F N1    1 
ATOM   9948  C  C2    . DT  F 3 13  ? 2.121   4.348   0.154   1.00 121.28 ? 13  DT  F C2    1 
ATOM   9949  O  O2    . DT  F 3 13  ? 1.102   4.568   -0.478  1.00 130.63 ? 13  DT  F O2    1 
ATOM   9950  N  N3    . DT  F 3 13  ? 3.366   4.637   -0.350  1.00 117.09 ? 13  DT  F N3    1 
ATOM   9951  C  C4    . DT  F 3 13  ? 4.583   4.432   0.269   1.00 112.59 ? 13  DT  F C4    1 
ATOM   9952  O  O4    . DT  F 3 13  ? 5.646   4.726   -0.264  1.00 110.41 ? 13  DT  F O4    1 
ATOM   9953  C  C5    . DT  F 3 13  ? 4.516   3.845   1.590   1.00 114.69 ? 13  DT  F C5    1 
ATOM   9954  C  C7    . DT  F 3 13  ? 5.777   3.569   2.354   1.00 118.01 ? 13  DT  F C7    1 
ATOM   9955  C  C6    . DT  F 3 13  ? 3.301   3.556   2.096   1.00 112.71 ? 13  DT  F C6    1 
ATOM   9956  P  P     . DA  F 3 14  ? -0.830  -1.022  1.582   1.00 126.46 ? 14  DA  F P     1 
ATOM   9957  O  OP1   . DA  F 3 14  ? -2.096  -1.749  1.830   1.00 132.61 ? 14  DA  F OP1   1 
ATOM   9958  O  OP2   . DA  F 3 14  ? 0.450   -1.755  1.717   1.00 119.52 ? 14  DA  F OP2   1 
ATOM   9959  O  "O5'" . DA  F 3 14  ? -0.926  -0.345  0.132   1.00 90.71  ? 14  DA  F "O5'" 1 
ATOM   9960  C  "C5'" . DA  F 3 14  ? -2.191  0.007   -0.431  1.00 98.30  ? 14  DA  F "C5'" 1 
ATOM   9961  C  "C4'" . DA  F 3 14  ? -2.136  0.009   -1.967  1.00 105.78 ? 14  DA  F "C4'" 1 
ATOM   9962  O  "O4'" . DA  F 3 14  ? -1.115  0.935   -2.422  1.00 102.45 ? 14  DA  F "O4'" 1 
ATOM   9963  C  "C3'" . DA  F 3 14  ? -1.790  -1.334  -2.624  1.00 102.07 ? 14  DA  F "C3'" 1 
ATOM   9964  O  "O3'" . DA  F 3 14  ? -2.420  -1.448  -3.884  1.00 97.20  ? 14  DA  F "O3'" 1 
ATOM   9965  C  "C2'" . DA  F 3 14  ? -0.288  -1.245  -2.791  1.00 102.97 ? 14  DA  F "C2'" 1 
ATOM   9966  C  "C1'" . DA  F 3 14  ? -0.118  0.228   -3.145  1.00 106.24 ? 14  DA  F "C1'" 1 
ATOM   9967  N  N9    . DA  F 3 14  ? 1.197   0.761   -2.778  1.00 104.73 ? 14  DA  F N9    1 
ATOM   9968  C  C8    . DA  F 3 14  ? 1.860   0.588   -1.591  1.00 94.41  ? 14  DA  F C8    1 
ATOM   9969  N  N7    . DA  F 3 14  ? 3.024   1.186   -1.544  1.00 83.14  ? 14  DA  F N7    1 
ATOM   9970  C  C5    . DA  F 3 14  ? 3.138   1.785   -2.787  1.00 88.08  ? 14  DA  F C5    1 
ATOM   9971  C  C6    . DA  F 3 14  ? 4.146   2.567   -3.368  1.00 87.38  ? 14  DA  F C6    1 
ATOM   9972  N  N6    . DA  F 3 14  ? 5.275   2.883   -2.738  1.00 92.54  ? 14  DA  F N6    1 
ATOM   9973  N  N1    . DA  F 3 14  ? 3.946   3.019   -4.624  1.00 84.39  ? 14  DA  F N1    1 
ATOM   9974  C  C2    . DA  F 3 14  ? 2.807   2.703   -5.252  1.00 87.82  ? 14  DA  F C2    1 
ATOM   9975  N  N3    . DA  F 3 14  ? 1.788   1.970   -4.814  1.00 94.03  ? 14  DA  F N3    1 
ATOM   9976  C  C4    . DA  F 3 14  ? 2.021   1.535   -3.560  1.00 98.52  ? 14  DA  F C4    1 
ATOM   9977  P  P     . DC  F 3 15  ? -2.548  -2.894  -4.575  1.00 121.75 ? 15  DC  F P     1 
ATOM   9978  O  OP1   . DC  F 3 15  ? -3.988  -3.216  -4.739  1.00 123.72 ? 15  DC  F OP1   1 
ATOM   9979  O  OP2   . DC  F 3 15  ? -1.638  -3.812  -3.845  1.00 113.82 ? 15  DC  F OP2   1 
ATOM   9980  O  "O5'" . DC  F 3 15  ? -1.930  -2.686  -6.024  1.00 111.20 ? 15  DC  F "O5'" 1 
ATOM   9981  C  "C5'" . DC  F 3 15  ? -2.183  -1.496  -6.745  1.00 110.26 ? 15  DC  F "C5'" 1 
ATOM   9982  C  "C4'" . DC  F 3 15  ? -1.045  -1.244  -7.707  1.00 107.81 ? 15  DC  F "C4'" 1 
ATOM   9983  O  "O4'" . DC  F 3 15  ? 0.012   -0.558  -7.011  1.00 111.55 ? 15  DC  F "O4'" 1 
ATOM   9984  C  "C3'" . DC  F 3 15  ? -0.420  -2.516  -8.232  1.00 102.75 ? 15  DC  F "C3'" 1 
ATOM   9985  O  "O3'" . DC  F 3 15  ? -0.987  -2.838  -9.474  1.00 103.28 ? 15  DC  F "O3'" 1 
ATOM   9986  C  "C2'" . DC  F 3 15  ? 1.071   -2.192  -8.366  1.00 104.31 ? 15  DC  F "C2'" 1 
ATOM   9987  C  "C1'" . DC  F 3 15  ? 1.264   -0.920  -7.554  1.00 104.90 ? 15  DC  F "C1'" 1 
ATOM   9988  N  N1    . DC  F 3 15  ? 2.244   -1.064  -6.432  1.00 95.84  ? 15  DC  F N1    1 
ATOM   9989  C  C2    . DC  F 3 15  ? 3.425   -0.324  -6.454  1.00 83.36  ? 15  DC  F C2    1 
ATOM   9990  O  O2    . DC  F 3 15  ? 3.638   0.431   -7.404  1.00 88.23  ? 15  DC  F O2    1 
ATOM   9991  N  N3    . DC  F 3 15  ? 4.296   -0.445  -5.430  1.00 77.57  ? 15  DC  F N3    1 
ATOM   9992  C  C4    . DC  F 3 15  ? 4.023   -1.261  -4.414  1.00 77.46  ? 15  DC  F C4    1 
ATOM   9993  N  N4    . DC  F 3 15  ? 4.916   -1.343  -3.421  1.00 64.79  ? 15  DC  F N4    1 
ATOM   9994  C  C5    . DC  F 3 15  ? 2.825   -2.030  -4.373  1.00 93.37  ? 15  DC  F C5    1 
ATOM   9995  C  C6    . DC  F 3 15  ? 1.970   -1.900  -5.395  1.00 102.08 ? 15  DC  F C6    1 
ATOM   9996  P  P     . DC  F 3 16  ? -0.938  -4.349  -10.009 1.00 112.88 ? 16  DC  F P     1 
ATOM   9997  O  OP1   . DC  F 3 16  ? -2.073  -4.520  -10.944 1.00 126.59 ? 16  DC  F OP1   1 
ATOM   9998  O  OP2   . DC  F 3 16  ? -0.760  -5.241  -8.842  1.00 103.47 ? 16  DC  F OP2   1 
ATOM   9999  O  "O5'" . DC  F 3 16  ? 0.386   -4.404  -10.872 1.00 91.45  ? 16  DC  F "O5'" 1 
ATOM   10000 C  "C5'" . DC  F 3 16  ? 0.778   -3.278  -11.623 1.00 96.28  ? 16  DC  F "C5'" 1 
ATOM   10001 C  "C4'" . DC  F 3 16  ? 2.275   -3.313  -11.864 1.00 94.25  ? 16  DC  F "C4'" 1 
ATOM   10002 O  "O4'" . DC  F 3 16  ? 2.990   -2.972  -10.642 1.00 89.47  ? 16  DC  F "O4'" 1 
ATOM   10003 C  "C3'" . DC  F 3 16  ? 2.811   -4.681  -12.301 1.00 94.09  ? 16  DC  F "C3'" 1 
ATOM   10004 O  "O3'" . DC  F 3 16  ? 3.585   -4.549  -13.465 1.00 86.88  ? 16  DC  F "O3'" 1 
ATOM   10005 C  "C2'" . DC  F 3 16  ? 3.666   -5.136  -11.118 1.00 96.78  ? 16  DC  F "C2'" 1 
ATOM   10006 C  "C1'" . DC  F 3 16  ? 4.114   -3.809  -10.541 1.00 92.23  ? 16  DC  F "C1'" 1 
ATOM   10007 N  N1    . DC  F 3 16  ? 4.527   -3.896  -9.122  1.00 85.01  ? 16  DC  F N1    1 
ATOM   10008 C  C2    . DC  F 3 16  ? 5.798   -3.464  -8.751  1.00 75.70  ? 16  DC  F C2    1 
ATOM   10009 O  O2    . DC  F 3 16  ? 6.553   -2.996  -9.618  1.00 77.27  ? 16  DC  F O2    1 
ATOM   10010 N  N3    . DC  F 3 16  ? 6.162   -3.553  -7.450  1.00 65.88  ? 16  DC  F N3    1 
ATOM   10011 C  C4    . DC  F 3 16  ? 5.315   -4.051  -6.549  1.00 68.69  ? 16  DC  F C4    1 
ATOM   10012 N  N4    . DC  F 3 16  ? 5.715   -4.121  -5.271  1.00 65.24  ? 16  DC  F N4    1 
ATOM   10013 C  C5    . DC  F 3 16  ? 4.021   -4.512  -6.919  1.00 78.82  ? 16  DC  F C5    1 
ATOM   10014 C  C6    . DC  F 3 16  ? 3.675   -4.421  -8.203  1.00 82.60  ? 16  DC  F C6    1 
ATOM   10015 P  P     . DT  F 3 17  ? 3.774   -5.801  -14.447 1.00 89.85  ? 17  DT  F P     1 
ATOM   10016 O  OP1   . DT  F 3 17  ? 3.673   -5.238  -15.813 1.00 87.08  ? 17  DT  F OP1   1 
ATOM   10017 O  OP2   . DT  F 3 17  ? 2.895   -6.910  -13.984 1.00 95.29  ? 17  DT  F OP2   1 
ATOM   10018 O  "O5'" . DT  F 3 17  ? 5.284   -6.242  -14.213 1.00 81.95  ? 17  DT  F "O5'" 1 
ATOM   10019 C  "C5'" . DT  F 3 17  ? 6.307   -5.326  -14.534 1.00 80.73  ? 17  DT  F "C5'" 1 
ATOM   10020 C  "C4'" . DT  F 3 17  ? 7.579   -5.660  -13.811 1.00 72.30  ? 17  DT  F "C4'" 1 
ATOM   10021 O  "O4'" . DT  F 3 17  ? 7.379   -5.519  -12.401 1.00 68.31  ? 17  DT  F "O4'" 1 
ATOM   10022 C  "C3'" . DT  F 3 17  ? 8.060   -7.079  -14.019 1.00 74.71  ? 17  DT  F "C3'" 1 
ATOM   10023 O  "O3'" . DT  F 3 17  ? 9.156   -7.026  -14.874 1.00 77.96  ? 17  DT  F "O3'" 1 
ATOM   10024 C  "C2'" . DT  F 3 17  ? 8.436   -7.576  -12.602 1.00 72.55  ? 17  DT  F "C2'" 1 
ATOM   10025 C  "C1'" . DT  F 3 17  ? 8.314   -6.321  -11.747 1.00 75.13  ? 17  DT  F "C1'" 1 
ATOM   10026 N  N1    . DT  F 3 17  ? 7.803   -6.549  -10.356 1.00 85.07  ? 17  DT  F N1    1 
ATOM   10027 C  C2    . DT  F 3 17  ? 8.528   -6.074  -9.284  1.00 81.55  ? 17  DT  F C2    1 
ATOM   10028 O  O2    . DT  F 3 17  ? 9.605   -5.505  -9.401  1.00 77.99  ? 17  DT  F O2    1 
ATOM   10029 N  N3    . DT  F 3 17  ? 7.950   -6.304  -8.058  1.00 79.17  ? 17  DT  F N3    1 
ATOM   10030 C  C4    . DT  F 3 17  ? 6.733   -6.935  -7.805  1.00 74.74  ? 17  DT  F C4    1 
ATOM   10031 O  O4    . DT  F 3 17  ? 6.291   -7.105  -6.667  1.00 66.84  ? 17  DT  F O4    1 
ATOM   10032 C  C5    . DT  F 3 17  ? 6.026   -7.388  -8.972  1.00 76.16  ? 17  DT  F C5    1 
ATOM   10033 C  C7    . DT  F 3 17  ? 4.718   -8.082  -8.824  1.00 68.57  ? 17  DT  F C7    1 
ATOM   10034 C  C6    . DT  F 3 17  ? 6.581   -7.172  -10.175 1.00 85.62  ? 17  DT  F C6    1 
ATOM   10035 P  P     . DC  F 3 18  ? 10.000  -8.341  -15.221 1.00 92.61  ? 18  DC  F P     1 
ATOM   10036 O  OP1   . DC  F 3 18  ? 10.568  -8.181  -16.590 1.00 92.01  ? 18  DC  F OP1   1 
ATOM   10037 O  OP2   . DC  F 3 18  ? 9.146   -9.509  -14.879 1.00 87.34  ? 18  DC  F OP2   1 
ATOM   10038 O  "O5'" . DC  F 3 18  ? 11.227  -8.247  -14.207 1.00 82.45  ? 18  DC  F "O5'" 1 
ATOM   10039 C  "C5'" . DC  F 3 18  ? 12.004  -7.074  -14.152 1.00 66.91  ? 18  DC  F "C5'" 1 
ATOM   10040 C  "C4'" . DC  F 3 18  ? 12.988  -7.178  -13.012 1.00 69.42  ? 18  DC  F "C4'" 1 
ATOM   10041 O  "O4'" . DC  F 3 18  ? 12.256  -7.183  -11.770 1.00 77.18  ? 18  DC  F "O4'" 1 
ATOM   10042 C  "C3'" . DC  F 3 18  ? 13.819  -8.456  -12.996 1.00 63.98  ? 18  DC  F "C3'" 1 
ATOM   10043 O  "O3'" . DC  F 3 18  ? 15.156  -8.165  -12.738 1.00 61.66  ? 18  DC  F "O3'" 1 
ATOM   10044 C  "C2'" . DC  F 3 18  ? 13.202  -9.292  -11.874 1.00 63.07  ? 18  DC  F "C2'" 1 
ATOM   10045 C  "C1'" . DC  F 3 18  ? 12.736  -8.209  -10.944 1.00 70.74  ? 18  DC  F "C1'" 1 
ATOM   10046 N  N1    . DC  F 3 18  ? 11.639  -8.606  -10.059 1.00 73.88  ? 18  DC  F N1    1 
ATOM   10047 C  C2    . DC  F 3 18  ? 11.752  -8.362  -8.689  1.00 75.70  ? 18  DC  F C2    1 
ATOM   10048 O  O2    . DC  F 3 18  ? 12.797  -7.843  -8.244  1.00 74.50  ? 18  DC  F O2    1 
ATOM   10049 N  N3    . DC  F 3 18  ? 10.724  -8.706  -7.885  1.00 70.88  ? 18  DC  F N3    1 
ATOM   10050 C  C4    . DC  F 3 18  ? 9.632   -9.255  -8.400  1.00 64.28  ? 18  DC  F C4    1 
ATOM   10051 N  N4    . DC  F 3 18  ? 8.655   -9.587  -7.560  1.00 66.07  ? 18  DC  F N4    1 
ATOM   10052 C  C5    . DC  F 3 18  ? 9.498   -9.502  -9.796  1.00 65.18  ? 18  DC  F C5    1 
ATOM   10053 C  C6    . DC  F 3 18  ? 10.516  -9.165  -10.582 1.00 64.66  ? 18  DC  F C6    1 
ATOM   10054 P  P     . DG  F 3 19  ? 16.259  -8.805  -13.712 1.00 67.57  ? 19  DG  F P     1 
ATOM   10055 O  OP1   . DG  F 3 19  ? 15.784  -8.307  -15.028 1.00 57.53  ? 19  DG  F OP1   1 
ATOM   10056 O  OP2   . DG  F 3 19  ? 16.494  -10.229 -13.337 1.00 65.88  ? 19  DG  F OP2   1 
ATOM   10057 O  "O5'" . DG  F 3 19  ? 17.619  -8.031  -13.415 1.00 56.72  ? 19  DG  F "O5'" 1 
ATOM   10058 C  "C5'" . DG  F 3 19  ? 17.609  -6.659  -13.384 1.00 49.91  ? 19  DG  F "C5'" 1 
ATOM   10059 C  "C4'" . DG  F 3 19  ? 18.406  -6.121  -14.523 1.00 46.03  ? 19  DG  F "C4'" 1 
ATOM   10060 O  "O4'" . DG  F 3 19  ? 17.981  -4.762  -14.785 1.00 56.00  ? 19  DG  F "O4'" 1 
ATOM   10061 C  "C3'" . DG  F 3 19  ? 19.894  -6.062  -14.247 1.00 57.90  ? 19  DG  F "C3'" 1 
ATOM   10062 O  "O3'" . DG  F 3 19  ? 20.611  -6.340  -15.414 1.00 69.12  ? 19  DG  F "O3'" 1 
ATOM   10063 C  "C2'" . DG  F 3 19  ? 20.108  -4.620  -13.770 1.00 61.89  ? 19  DG  F "C2'" 1 
ATOM   10064 C  "C1'" . DG  F 3 19  ? 19.050  -3.860  -14.552 1.00 61.38  ? 19  DG  F "C1'" 1 
ATOM   10065 N  N9    . DG  F 3 19  ? 18.525  -2.702  -13.843 1.00 59.42  ? 19  DG  F N9    1 
ATOM   10066 C  C8    . DG  F 3 19  ? 17.860  -2.704  -12.644 1.00 62.17  ? 19  DG  F C8    1 
ATOM   10067 N  N7    . DG  F 3 19  ? 17.489  -1.511  -12.258 1.00 71.93  ? 19  DG  F N7    1 
ATOM   10068 C  C5    . DG  F 3 19  ? 17.947  -0.661  -13.266 1.00 69.30  ? 19  DG  F C5    1 
ATOM   10069 C  C6    . DG  F 3 19  ? 17.850  0.758   -13.392 1.00 70.33  ? 19  DG  F C6    1 
ATOM   10070 O  O6    . DG  F 3 19  ? 17.322  1.569   -12.614 1.00 78.07  ? 19  DG  F O6    1 
ATOM   10071 N  N1    . DG  F 3 19  ? 18.443  1.212   -14.560 1.00 62.70  ? 19  DG  F N1    1 
ATOM   10072 C  C2    . DG  F 3 19  ? 19.069  0.406   -15.484 1.00 56.43  ? 19  DG  F C2    1 
ATOM   10073 N  N2    . DG  F 3 19  ? 19.592  1.029   -16.550 1.00 63.97  ? 19  DG  F N2    1 
ATOM   10074 N  N3    . DG  F 3 19  ? 19.157  -0.923  -15.384 1.00 39.67  ? 19  DG  F N3    1 
ATOM   10075 C  C4    . DG  F 3 19  ? 18.579  -1.382  -14.252 1.00 56.41  ? 19  DG  F C4    1 
HETATM 10076 MG MG    . MG  G 4 .   ? 35.739  15.724  37.461  1.00 63.40  ? 701 MG  A MG    1 
HETATM 10077 MG MG    . MG  H 4 .   ? 14.844  -3.724  5.247   1.00 57.05  ? 701 MG  B MG    1 
HETATM 10078 O  O     . HOH I 5 .   ? 3.184   10.945  59.814  1.00 66.87  ? 801 HOH A O     1 
HETATM 10079 O  O     . HOH I 5 .   ? 25.347  12.286  60.589  1.00 45.71  ? 802 HOH A O     1 
HETATM 10080 O  O     . HOH I 5 .   ? 25.781  17.921  19.428  1.00 62.94  ? 803 HOH A O     1 
HETATM 10081 O  O     . HOH I 5 .   ? 23.416  10.025  61.338  1.00 52.83  ? 804 HOH A O     1 
HETATM 10082 O  O     . HOH I 5 .   ? 5.492   7.548   61.909  1.00 49.40  ? 805 HOH A O     1 
HETATM 10083 O  O     . HOH J 5 .   ? 24.446  -3.731  24.112  1.00 65.22  ? 801 HOH B O     1 
HETATM 10084 O  O     . HOH J 5 .   ? 30.723  7.651   15.029  1.00 59.98  ? 802 HOH B O     1 
HETATM 10085 O  O     . HOH J 5 .   ? 12.391  -2.124  3.700   1.00 60.20  ? 803 HOH B O     1 
HETATM 10086 O  O     . HOH J 5 .   ? 11.812  3.366   21.196  1.00 35.84  ? 804 HOH B O     1 
HETATM 10087 O  O     . HOH J 5 .   ? 18.527  25.423  -22.140 1.00 69.02  ? 805 HOH B O     1 
HETATM 10088 O  O     . HOH J 5 .   ? 13.268  5.913   21.005  1.00 51.65  ? 806 HOH B O     1 
HETATM 10089 O  O     . HOH J 5 .   ? 11.755  5.451   19.256  1.00 54.12  ? 807 HOH B O     1 
HETATM 10090 O  O     . HOH J 5 .   ? 12.031  -1.542  6.087   1.00 55.36  ? 808 HOH B O     1 
HETATM 10091 O  O     . HOH J 5 .   ? 19.873  25.494  -19.237 1.00 69.28  ? 809 HOH B O     1 
HETATM 10092 O  O     . HOH J 5 .   ? 18.778  26.779  -24.732 1.00 59.45  ? 810 HOH B O     1 
HETATM 10093 O  O     . HOH J 5 .   ? 20.154  24.102  -26.630 1.00 57.39  ? 811 HOH B O     1 
HETATM 10094 O  O     . HOH K 5 .   ? 16.562  -5.556  4.266   1.00 44.13  ? 801 HOH E O     1 
HETATM 10095 O  O     . HOH K 5 .   ? 8.994   0.102   -1.085  1.00 61.47  ? 802 HOH E O     1 
HETATM 10096 O  O     . HOH L 5 .   ? 3.763   -2.230  -1.009  1.00 49.53  ? 101 HOH F O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1     N N     . LEU A 4   ? 1.0584 0.8393 0.8340 0.3005  0.1391  0.1158  4   LEU A N     
2     C CA    . LEU A 4   ? 1.1095 0.8902 0.8766 0.2997  0.1285  0.1070  4   LEU A CA    
3     C C     . LEU A 4   ? 1.2588 1.0574 1.0173 0.3077  0.1321  0.1135  4   LEU A C     
4     O O     . LEU A 4   ? 1.3896 1.2020 1.1523 0.3139  0.1433  0.1254  4   LEU A O     
5     C CB    . LEU A 4   ? 1.0575 0.8277 0.8389 0.2943  0.1219  0.0985  4   LEU A CB    
6     N N     . GLY A 5   ? 1.1443 0.9429 0.8903 0.3074  0.1226  0.1056  5   GLY A N     
7     C CA    . GLY A 5   ? 1.2749 1.0861 1.0157 0.3129  0.1215  0.1065  5   GLY A CA    
8     C C     . GLY A 5   ? 1.2318 1.0327 0.9725 0.3078  0.1094  0.0939  5   GLY A C     
9     O O     . GLY A 5   ? 1.1656 0.9561 0.8973 0.3028  0.1001  0.0845  5   GLY A O     
10    N N     . LYS A 6   ? 1.2521 1.0554 1.0037 0.3085  0.1096  0.0937  6   LYS A N     
11    C CA    . LYS A 6   ? 1.1759 0.9705 0.9290 0.3038  0.0988  0.0822  6   LYS A CA    
12    C C     . LYS A 6   ? 1.1296 0.9315 0.8631 0.3075  0.0929  0.0785  6   LYS A C     
13    O O     . LYS A 6   ? 1.3299 1.1469 1.0539 0.3151  0.0986  0.0861  6   LYS A O     
14    C CB    . LYS A 6   ? 1.1742 0.9715 0.9430 0.3046  0.1012  0.0835  6   LYS A CB    
15    C CG    . LYS A 6   ? 1.3474 1.1513 1.1088 0.3074  0.0958  0.0792  6   LYS A CG    
16    C CD    . LYS A 6   ? 1.5369 1.3427 1.3137 0.3077  0.0971  0.0793  6   LYS A CD    
17    C CE    . LYS A 6   ? 1.5034 1.3154 1.2697 0.3106  0.0908  0.0742  6   LYS A CE    
18    N NZ    . LYS A 6   ? 1.3361 1.1491 1.1156 0.3103  0.0900  0.0720  6   LYS A NZ    
19    N N     . THR A 7   ? 0.9625 0.7547 0.6908 0.3023  0.0818  0.0670  7   THR A N     
20    C CA    . THR A 7   ? 0.9697 0.7672 0.6807 0.3052  0.0751  0.0619  7   THR A CA    
21    C C     . THR A 7   ? 1.1559 0.9416 0.8686 0.2984  0.0640  0.0497  7   THR A C     
22    O O     . THR A 7   ? 1.2701 1.0457 0.9978 0.2921  0.0622  0.0460  7   THR A O     
26    N N     . GLU A 8   ? 1.0076 0.7955 0.7059 0.2996  0.0567  0.0435  8   GLU A N     
27    C CA    . GLU A 8   ? 1.0503 0.8279 0.7507 0.2930  0.0467  0.0327  8   GLU A CA    
28    C C     . GLU A 8   ? 1.0537 0.8264 0.7370 0.2905  0.0381  0.0255  8   GLU A C     
29    O O     . GLU A 8   ? 1.0949 0.8759 0.7630 0.2963  0.0388  0.0276  8   GLU A O     
30    C CB    . GLU A 8   ? 1.1994 0.9840 0.9031 0.2962  0.0454  0.0310  8   GLU A CB    
31    C CG    . GLU A 8   ? 1.3345 1.1245 1.0555 0.2986  0.0527  0.0370  8   GLU A CG    
32    C CD    . GLU A 8   ? 1.4699 1.2665 1.1903 0.3017  0.0497  0.0337  8   GLU A CD    
33    O OE1   . GLU A 8   ? 1.5665 1.3537 1.2919 0.2954  0.0420  0.0247  8   GLU A OE1   
34    O OE2   . GLU A 8   ? 1.5277 1.3393 1.2440 0.3102  0.0554  0.0404  8   GLU A OE2   
35    N N     . VAL A 9   ? 1.0915 0.8514 0.7784 0.2819  0.0300  0.0168  9   VAL A N     
36    C CA    . VAL A 9   ? 1.0170 0.7709 0.6901 0.2781  0.0212  0.0096  9   VAL A CA    
37    C C     . VAL A 9   ? 1.0064 0.7553 0.6831 0.2729  0.0126  0.0008  9   VAL A C     
38    O O     . VAL A 9   ? 1.0007 0.7475 0.6926 0.2701  0.0132  -0.0004 9   VAL A O     
39    C CB    . VAL A 9   ? 0.9248 0.6685 0.5979 0.2720  0.0203  0.0089  9   VAL A CB    
40    C CG1   . VAL A 9   ? 0.7881 0.5369 0.4591 0.2771  0.0298  0.0182  9   VAL A CG1   
41    C CG2   . VAL A 9   ? 0.7281 0.4625 0.4182 0.2644  0.0188  0.0055  9   VAL A CG2   
42    N N     . PHE A 10  ? 1.0544 0.8017 0.7177 0.2715  0.0047  -0.0052 10  PHE A N     
43    C CA    . PHE A 10  ? 1.1347 0.8759 0.8004 0.2650  -0.0043 -0.0137 10  PHE A CA    
44    C C     . PHE A 10  ? 1.2725 1.0028 0.9406 0.2565  -0.0086 -0.0171 10  PHE A C     
45    O O     . PHE A 10  ? 1.4546 1.1826 1.1139 0.2565  -0.0078 -0.0150 10  PHE A O     
46    C CB    . PHE A 10  ? 1.1837 0.9293 0.8346 0.2679  -0.0108 -0.0178 10  PHE A CB    
47    C CG    . PHE A 10  ? 1.3186 1.0759 0.9671 0.2763  -0.0079 -0.0158 10  PHE A CG    
48    C CD1   . PHE A 10  ? 1.2972 1.0566 0.9574 0.2761  -0.0071 -0.0171 10  PHE A CD1   
49    C CD2   . PHE A 10  ? 1.3357 1.1031 0.9700 0.2846  -0.0061 -0.0126 10  PHE A CD2   
50    C CE1   . PHE A 10  ? 1.1758 0.9471 0.8333 0.2843  -0.0041 -0.0149 10  PHE A CE1   
51    C CE2   . PHE A 10  ? 1.2696 1.0498 0.9012 0.2929  -0.0034 -0.0106 10  PHE A CE2   
52    C CZ    . PHE A 10  ? 1.1078 0.8899 0.7508 0.2927  -0.0023 -0.0116 10  PHE A CZ    
53    N N     . LEU A 11  ? 1.2832 1.0076 0.9627 0.2496  -0.0130 -0.0222 11  LEU A N     
54    C CA    . LEU A 11  ? 1.0329 0.7490 0.7126 0.2419  -0.0186 -0.0264 11  LEU A CA    
55    C C     . LEU A 11  ? 0.9931 0.7092 0.6641 0.2396  -0.0273 -0.0321 11  LEU A C     
56    O O     . LEU A 11  ? 1.1758 0.8972 0.8455 0.2427  -0.0287 -0.0337 11  LEU A O     
57    C CB    . LEU A 11  ? 0.8771 0.5880 0.5750 0.2361  -0.0179 -0.0282 11  LEU A CB    
58    C CG    . LEU A 11  ? 0.9134 0.6248 0.6239 0.2384  -0.0092 -0.0227 11  LEU A CG    
59    C CD1   . LEU A 11  ? 0.8877 0.5928 0.6149 0.2328  -0.0099 -0.0257 11  LEU A CD1   
60    C CD2   . LEU A 11  ? 0.9120 0.6226 0.6158 0.2407  -0.0043 -0.0173 11  LEU A CD2   
61    N N     . ASN A 12  ? 0.9431 0.6538 0.6095 0.2341  -0.0330 -0.0351 12  ASN A N     
62    C CA    . ASN A 12  ? 1.0068 0.7176 0.6680 0.2313  -0.0411 -0.0401 12  ASN A CA    
63    C C     . ASN A 12  ? 0.8902 0.5990 0.5646 0.2256  -0.0447 -0.0447 12  ASN A C     
64    O O     . ASN A 12  ? 0.8318 0.5360 0.5029 0.2217  -0.0515 -0.0484 12  ASN A O     
65    C CB    . ASN A 12  ? 1.0748 0.7816 0.7262 0.2283  -0.0454 -0.0406 12  ASN A CB    
66    C CG    . ASN A 12  ? 1.1132 0.8121 0.7686 0.2234  -0.0458 -0.0409 12  ASN A CG    
67    O OD1   . ASN A 12  ? 1.1226 0.8188 0.7859 0.2237  -0.0410 -0.0392 12  ASN A OD1   
68    N ND2   . ASN A 12  ? 1.0729 0.7664 0.7198 0.2207  -0.0523 -0.0431 12  ASN A ND2   
69    N N     . ARG A 13  ? 0.9299 0.6410 0.6150 0.2274  -0.0406 -0.0442 13  ARG A N     
70    C CA    . ARG A 13  ? 1.0696 0.7787 0.7659 0.2239  -0.0434 -0.0482 13  ARG A CA    
71    C C     . ARG A 13  ? 1.2323 0.9484 0.9318 0.2276  -0.0419 -0.0487 13  ARG A C     
72    O O     . ARG A 13  ? 1.2351 0.9562 0.9299 0.2345  -0.0370 -0.0449 13  ARG A O     
73    C CB    . ARG A 13  ? 1.1485 0.8518 0.8558 0.2230  -0.0397 -0.0473 13  ARG A CB    
74    C CG    . ARG A 13  ? 1.1995 0.8954 0.9007 0.2212  -0.0407 -0.0466 13  ARG A CG    
75    C CD    . ARG A 13  ? 1.1761 0.8659 0.8855 0.2205  -0.0367 -0.0451 13  ARG A CD    
76    N NE    . ARG A 13  ? 1.1163 0.8034 0.8412 0.2202  -0.0328 -0.0450 13  ARG A NE    
77    C CZ    . ARG A 13  ? 1.0536 0.7353 0.7812 0.2200  -0.0293 -0.0430 13  ARG A CZ    
78    N NH1   . ARG A 13  ? 1.1493 0.8290 0.8647 0.2202  -0.0298 -0.0411 13  ARG A NH1   
79    N NH2   . ARG A 13  ? 0.9369 0.6154 0.6793 0.2197  -0.0253 -0.0427 13  ARG A NH2   
80    N N     . PHE A 14  ? 1.2950 1.0111 1.0012 0.2241  -0.0462 -0.0532 14  PHE A N     
81    C CA    . PHE A 14  ? 1.1938 0.9154 0.9006 0.2278  -0.0462 -0.0546 14  PHE A CA    
82    C C     . PHE A 14  ? 1.1733 0.8936 0.8958 0.2240  -0.0463 -0.0573 14  PHE A C     
83    O O     . PHE A 14  ? 1.1938 0.9073 0.9158 0.2200  -0.0521 -0.0610 14  PHE A O     
84    C CB    . PHE A 14  ? 1.1443 0.8684 0.8399 0.2281  -0.0525 -0.0577 14  PHE A CB    
85    C CG    . PHE A 14  ? 1.0796 0.8056 0.7602 0.2323  -0.0527 -0.0552 14  PHE A CG    
86    C CD1   . PHE A 14  ? 1.1052 0.8266 0.7802 0.2288  -0.0552 -0.0546 14  PHE A CD1   
87    C CD2   . PHE A 14  ? 1.2273 0.9603 0.8994 0.2401  -0.0503 -0.0534 14  PHE A CD2   
88    C CE1   . PHE A 14  ? 1.1693 0.8923 0.8311 0.2326  -0.0554 -0.0522 14  PHE A CE1   
89    C CE2   . PHE A 14  ? 1.2954 1.0307 0.9541 0.2443  -0.0506 -0.0511 14  PHE A CE2   
90    C CZ    . PHE A 14  ? 1.2482 0.9781 0.9020 0.2403  -0.0532 -0.0505 14  PHE A CZ    
91    N N     . ALA A 15  ? 1.1200 0.8439 0.8502 0.2281  -0.0410 -0.0554 15  ALA A N     
92    C CA    . ALA A 15  ? 1.0384 0.7616 0.7838 0.2253  -0.0407 -0.0578 15  ALA A CA    
93    C C     . ALA A 15  ? 1.1124 0.8383 0.8553 0.2245  -0.0457 -0.0623 15  ALA A C     
94    O O     . ALA A 15  ? 1.2397 0.9708 0.9726 0.2296  -0.0462 -0.0623 15  ALA A O     
95    C CB    . ALA A 15  ? 0.9744 0.7010 0.7301 0.2302  -0.0330 -0.0536 15  ALA A CB    
96    N N     . LEU A 16  ? 1.0498 0.7697 0.7960 0.2203  -0.0510 -0.0665 16  LEU A N     
97    C CA    . LEU A 16  ? 1.1048 0.8270 0.8510 0.2191  -0.0554 -0.0706 16  LEU A CA    
98    C C     . LEU A 16  ? 1.1296 0.8508 0.8899 0.2186  -0.0535 -0.0719 16  LEU A C     
99    O O     . LEU A 16  ? 1.2168 0.9376 0.9873 0.2202  -0.0476 -0.0689 16  LEU A O     
100   C CB    . LEU A 16  ? 1.2229 0.9401 0.9605 0.2153  -0.0638 -0.0742 16  LEU A CB    
101   C CG    . LEU A 16  ? 1.2393 0.9568 0.9639 0.2156  -0.0660 -0.0728 16  LEU A CG    
102   C CD1   . LEU A 16  ? 1.1549 0.8660 0.8728 0.2119  -0.0736 -0.0753 16  LEU A CD1   
103   C CD2   . LEU A 16  ? 1.3169 1.0428 1.0378 0.2181  -0.0653 -0.0733 16  LEU A CD2   
104   N N     . ARG A 17  ? 1.0268 0.7466 0.7886 0.2162  -0.0584 -0.0761 17  ARG A N     
105   C CA    . ARG A 17  ? 1.0833 0.8033 0.8586 0.2162  -0.0562 -0.0772 17  ARG A CA    
106   C C     . ARG A 17  ? 1.1906 0.9039 0.9764 0.2143  -0.0551 -0.0769 17  ARG A C     
107   O O     . ARG A 17  ? 1.3206 1.0280 1.1020 0.2121  -0.0582 -0.0773 17  ARG A O     
108   C CB    . ARG A 17  ? 0.9811 0.7012 0.7554 0.2140  -0.0618 -0.0818 17  ARG A CB    
109   C CG    . ARG A 17  ? 0.8870 0.6004 0.6577 0.2098  -0.0694 -0.0851 17  ARG A CG    
110   C CD    . ARG A 17  ? 1.0990 0.8132 0.8729 0.2084  -0.0730 -0.0889 17  ARG A CD    
111   N NE    . ARG A 17  ? 1.2515 0.9603 1.0222 0.2049  -0.0805 -0.0918 17  ARG A NE    
112   C CZ    . ARG A 17  ? 1.1462 0.8493 0.9228 0.2028  -0.0826 -0.0928 17  ARG A CZ    
113   N NH1   . ARG A 17  ? 1.0226 0.7240 0.8091 0.2035  -0.0777 -0.0912 17  ARG A NH1   
114   N NH2   . ARG A 17  ? 1.1010 0.8003 0.8741 0.2002  -0.0895 -0.0953 17  ARG A NH2   
115   N N     . PRO A 18  ? 1.0426 0.7571 0.8428 0.2157  -0.0499 -0.0757 18  PRO A N     
116   C CA    . PRO A 18  ? 0.9641 0.6724 0.7766 0.2136  -0.0492 -0.0762 18  PRO A CA    
117   C C     . PRO A 18  ? 1.1486 0.8514 0.9589 0.2095  -0.0572 -0.0813 18  PRO A C     
118   O O     . PRO A 18  ? 1.3689 1.0741 1.1742 0.2088  -0.0613 -0.0840 18  PRO A O     
119   C CB    . PRO A 18  ? 0.8919 0.6040 0.7200 0.2161  -0.0428 -0.0742 18  PRO A CB    
120   C CG    . PRO A 18  ? 1.1251 0.8457 0.9489 0.2204  -0.0384 -0.0709 18  PRO A CG    
121   C CD    . PRO A 18  ? 1.1627 0.8850 0.9693 0.2196  -0.0442 -0.0735 18  PRO A CD    
122   N N     . LEU A 19  ? 1.0440 0.7401 0.8581 0.2070  -0.0594 -0.0826 19  LEU A N     
123   C CA    . LEU A 19  ? 1.1395 0.8312 0.9532 0.2037  -0.0666 -0.0871 19  LEU A CA    
124   C C     . LEU A 19  ? 1.1579 0.8512 0.9839 0.2037  -0.0653 -0.0886 19  LEU A C     
125   O O     . LEU A 19  ? 1.0308 0.7245 0.8708 0.2051  -0.0590 -0.0866 19  LEU A O     
126   C CB    . LEU A 19  ? 0.9597 0.6443 0.7759 0.2015  -0.0688 -0.0882 19  LEU A CB    
127   C CG    . LEU A 19  ? 0.8561 0.5376 0.6575 0.2003  -0.0740 -0.0886 19  LEU A CG    
128   C CD1   . LEU A 19  ? 0.9499 0.6340 0.7433 0.2025  -0.0698 -0.0847 19  LEU A CD1   
129   C CD2   . LEU A 19  ? 0.8808 0.5555 0.6856 0.1983  -0.0764 -0.0904 19  LEU A CD2   
130   N N     . ASN A 20  ? 1.1574 0.8515 0.9790 0.2022  -0.0710 -0.0918 20  ASN A N     
131   C CA    . ASN A 20  ? 1.2433 0.9386 1.0761 0.2021  -0.0701 -0.0934 20  ASN A CA    
132   C C     . ASN A 20  ? 1.1097 0.7993 0.9543 0.2001  -0.0711 -0.0952 20  ASN A C     
133   O O     . ASN A 20  ? 0.9848 0.6697 0.8271 0.1985  -0.0737 -0.0958 20  ASN A O     
134   C CB    . ASN A 20  ? 1.2271 0.9256 1.0521 0.2015  -0.0749 -0.0960 20  ASN A CB    
135   C CG    . ASN A 20  ? 1.1048 0.7999 0.9203 0.1987  -0.0836 -0.0990 20  ASN A CG    
136   O OD1   . ASN A 20  ? 1.0372 0.7275 0.8560 0.1967  -0.0874 -0.1008 20  ASN A OD1   
137   N ND2   . ASN A 20  ? 1.2397 0.9377 1.0437 0.1989  -0.0868 -0.0995 20  ASN A ND2   
138   N N     . PRO A 21  ? 1.1440 0.8342 1.0023 0.2003  -0.0683 -0.0956 21  PRO A N     
139   C CA    . PRO A 21  ? 0.9845 0.6696 0.8554 0.1987  -0.0684 -0.0971 21  PRO A CA    
140   C C     . PRO A 21  ? 1.2617 0.9423 1.1272 0.1957  -0.0772 -0.1012 21  PRO A C     
141   O O     . PRO A 21  ? 1.3505 1.0264 1.2234 0.1944  -0.0782 -0.1027 21  PRO A O     
142   C CB    . PRO A 21  ? 0.8146 0.5023 0.6988 0.1999  -0.0642 -0.0966 21  PRO A CB    
143   C CG    . PRO A 21  ? 0.9921 0.6851 0.8683 0.2011  -0.0649 -0.0966 21  PRO A CG    
144   C CD    . PRO A 21  ? 1.1584 0.8541 1.0218 0.2025  -0.0643 -0.0947 21  PRO A CD    
145   N N     . GLU A 22  ? 1.2879 0.9703 1.1404 0.1950  -0.0832 -0.1028 22  GLU A N     
146   C CA    . GLU A 22  ? 1.4104 1.0900 1.2556 0.1929  -0.0917 -0.1059 22  GLU A CA    
147   C C     . GLU A 22  ? 1.1858 0.8621 1.0208 0.1923  -0.0948 -0.1056 22  GLU A C     
148   O O     . GLU A 22  ? 1.1510 0.8233 0.9860 0.1908  -0.0999 -0.1079 22  GLU A O     
149   C CB    . GLU A 22  ? 1.6072 1.2898 1.4442 0.1925  -0.0966 -0.1075 22  GLU A CB    
150   C CG    . GLU A 22  ? 1.7107 1.3971 1.5557 0.1936  -0.0924 -0.1073 22  GLU A CG    
151   C CD    . GLU A 22  ? 1.7837 1.4697 1.6300 0.1921  -0.0980 -0.1103 22  GLU A CD    
152   O OE1   . GLU A 22  ? 1.7228 1.4057 1.5642 0.1905  -0.1048 -0.1122 22  GLU A OE1   
153   O OE2   . GLU A 22  ? 1.8978 1.5865 1.7508 0.1927  -0.0955 -0.1107 22  GLU A OE2   
154   N N     . GLU A 23  ? 1.2655 0.9436 1.0925 0.1936  -0.0917 -0.1028 23  GLU A N     
155   C CA    . GLU A 23  ? 1.2897 0.9647 1.1067 0.1932  -0.0941 -0.1022 23  GLU A CA    
156   C C     . GLU A 23  ? 1.4120 1.0827 1.2383 0.1931  -0.0902 -0.1017 23  GLU A C     
157   O O     . GLU A 23  ? 1.2778 0.9443 1.0995 0.1922  -0.0933 -0.1025 23  GLU A O     
158   C CB    . GLU A 23  ? 1.0405 0.7190 0.8463 0.1948  -0.0918 -0.0992 23  GLU A CB    
159   C CG    . GLU A 23  ? 0.9421 0.6244 0.7398 0.1948  -0.0957 -0.1001 23  GLU A CG    
160   C CD    . GLU A 23  ? 1.0573 0.7446 0.8482 0.1968  -0.0916 -0.0974 23  GLU A CD    
161   O OE1   . GLU A 23  ? 1.2177 0.9076 0.9992 0.1971  -0.0940 -0.0973 23  GLU A OE1   
162   O OE2   . GLU A 23  ? 0.9889 0.6777 0.7831 0.1986  -0.0853 -0.0948 23  GLU A OE2   
163   N N     . LEU A 24  ? 1.3966 1.0682 1.2377 0.1940  -0.0836 -0.1007 24  LEU A N     
164   C CA    . LEU A 24  ? 1.4404 1.1079 1.2928 0.1939  -0.0790 -0.1002 24  LEU A CA    
165   C C     . LEU A 24  ? 1.5825 1.2454 1.4419 0.1918  -0.0839 -0.1042 24  LEU A C     
166   O O     . LEU A 24  ? 1.2315 0.8900 1.0987 0.1913  -0.0817 -0.1048 24  LEU A O     
167   C CB    . LEU A 24  ? 1.3840 1.0542 1.2508 0.1960  -0.0693 -0.0968 24  LEU A CB    
168   C CG    . LEU A 24  ? 1.3625 1.0371 1.2255 0.1987  -0.0629 -0.0921 24  LEU A CG    
169   C CD1   . LEU A 24  ? 1.3783 1.0567 1.2568 0.2014  -0.0539 -0.0886 24  LEU A CD1   
170   C CD2   . LEU A 24  ? 1.2207 0.8922 1.0786 0.1988  -0.0615 -0.0905 24  LEU A CD2   
171   N N     . ARG A 25  ? 1.5114 1.1751 1.3690 0.1907  -0.0902 -0.1071 25  ARG A N     
172   C CA    . ARG A 25  ? 1.5316 1.1913 1.3950 0.1890  -0.0955 -0.1110 25  ARG A CA    
173   C C     . ARG A 25  ? 1.4366 1.0963 1.2855 0.1881  -0.1054 -0.1133 25  ARG A C     
174   O O     . ARG A 25  ? 1.7072 1.3693 1.5544 0.1877  -0.1098 -0.1148 25  ARG A O     
175   C CB    . ARG A 25  ? 1.6189 1.2794 1.4971 0.1888  -0.0937 -0.1123 25  ARG A CB    
176   C CG    . ARG A 25  ? 1.7551 1.4205 1.6301 0.1894  -0.0943 -0.1116 25  ARG A CG    
177   C CD    . ARG A 25  ? 1.8801 1.5468 1.7651 0.1891  -0.0944 -0.1129 25  ARG A CD    
178   N NE    . ARG A 25  ? 1.9076 1.5788 1.7817 0.1897  -0.0963 -0.1121 25  ARG A NE    
179   C CZ    . ARG A 25  ? 1.8642 1.5380 1.7373 0.1895  -0.0993 -0.1134 25  ARG A CZ    
180   N NH1   . ARG A 25  ? 1.7969 1.4743 1.6588 0.1901  -0.1004 -0.1125 25  ARG A NH1   
181   N NH2   . ARG A 25  ? 1.9178 1.5906 1.8004 0.1887  -0.1014 -0.1156 25  ARG A NH2   
182   N N     . PRO A 26  ? 1.5022 1.1595 1.3404 0.1880  -0.1082 -0.1131 26  PRO A N     
183   C CA    . PRO A 26  ? 1.3170 0.9744 1.1419 0.1876  -0.1170 -0.1145 26  PRO A CA    
184   C C     . PRO A 26  ? 1.2545 0.9093 1.0837 0.1867  -0.1237 -0.1184 26  PRO A C     
185   O O     . PRO A 26  ? 1.0316 0.6835 0.8723 0.1861  -0.1217 -0.1202 26  PRO A O     
186   C CB    . PRO A 26  ? 1.1226 0.7776 0.9362 0.1881  -0.1173 -0.1129 26  PRO A CB    
187   C CG    . PRO A 26  ? 1.1411 0.7930 0.9651 0.1881  -0.1105 -0.1124 26  PRO A CG    
188   C CD    . PRO A 26  ? 1.2498 0.9043 1.0876 0.1885  -0.1035 -0.1113 26  PRO A CD    
189   N N     . TRP A 27  ? 1.3004 0.9561 1.1213 0.1866  -0.1312 -0.1197 27  TRP A N     
190   C CA    . TRP A 27  ? 1.2994 0.9531 1.1233 0.1861  -0.1383 -0.1233 27  TRP A CA    
191   C C     . TRP A 27  ? 1.2950 0.9442 1.1137 0.1863  -0.1421 -0.1247 27  TRP A C     
192   O O     . TRP A 27  ? 1.2560 0.9043 1.0629 0.1870  -0.1428 -0.1228 27  TRP A O     
193   C CB    . TRP A 27  ? 1.2796 0.9356 1.0958 0.1864  -0.1447 -0.1237 27  TRP A CB    
194   C CG    . TRP A 27  ? 1.3261 0.9858 1.1488 0.1861  -0.1433 -0.1238 27  TRP A CG    
195   C CD1   . TRP A 27  ? 1.2640 0.9237 1.0965 0.1856  -0.1458 -0.1265 27  TRP A CD1   
196   C CD2   . TRP A 27  ? 1.5112 1.1748 1.3304 0.1864  -0.1395 -0.1215 27  TRP A CD2   
197   N NE1   . TRP A 27  ? 1.4430 1.1063 1.2787 0.1855  -0.1435 -0.1257 27  TRP A NE1   
198   C CE2   . TRP A 27  ? 1.5816 1.2474 1.4092 0.1860  -0.1397 -0.1228 27  TRP A CE2   
199   C CE3   . TRP A 27  ? 1.5896 1.2553 1.3997 0.1871  -0.1361 -0.1185 27  TRP A CE3   
200   C CZ2   . TRP A 27  ? 1.6674 1.3372 1.4946 0.1863  -0.1364 -0.1214 27  TRP A CZ2   
201   C CZ3   . TRP A 27  ? 1.6768 1.3467 1.4866 0.1873  -0.1330 -0.1173 27  TRP A CZ3   
202   C CH2   . TRP A 27  ? 1.7106 1.3824 1.5289 0.1870  -0.1331 -0.1188 27  TRP A CH2   
203   N N     . ARG A 28  ? 1.3797 1.0261 1.2073 0.1858  -0.1447 -0.1282 28  ARG A N     
204   C CA    . ARG A 28  ? 1.3406 0.9829 1.1624 0.1862  -0.1491 -0.1299 28  ARG A CA    
205   C C     . ARG A 28  ? 1.2151 0.8571 1.0325 0.1869  -0.1587 -0.1326 28  ARG A C     
206   O O     . ARG A 28  ? 1.1064 0.7502 0.9313 0.1866  -0.1615 -0.1346 28  ARG A O     
207   C CB    . ARG A 28  ? 1.4019 1.0403 1.2340 0.1855  -0.1445 -0.1316 28  ARG A CB    
208   C CG    . ARG A 28  ? 1.5479 1.1827 1.3845 0.1854  -0.1495 -0.1359 28  ARG A CG    
209   C CD    . ARG A 28  ? 1.6749 1.3066 1.5258 0.1843  -0.1425 -0.1372 28  ARG A CD    
210   N NE    . ARG A 28  ? 1.7080 1.3373 1.5687 0.1838  -0.1468 -0.1422 28  ARG A NE    
211   C CZ    . ARG A 28  ? 1.7277 1.3538 1.5843 0.1842  -0.1535 -0.1459 28  ARG A CZ    
212   N NH1   . ARG A 28  ? 1.8121 1.4368 1.6790 0.1837  -0.1573 -0.1506 28  ARG A NH1   
213   N NH2   . ARG A 28  ? 1.6184 1.2431 1.4605 0.1854  -0.1569 -0.1449 28  ARG A NH2   
214   N N     . LEU A 29  ? 1.2536 0.8932 1.0591 0.1881  -0.1635 -0.1325 29  LEU A N     
215   C CA    . LEU A 29  ? 1.1978 0.8369 0.9977 0.1893  -0.1724 -0.1346 29  LEU A CA    
216   C C     . LEU A 29  ? 1.2550 0.8895 1.0510 0.1903  -0.1762 -0.1368 29  LEU A C     
217   O O     . LEU A 29  ? 1.1470 0.7790 0.9369 0.1905  -0.1731 -0.1352 29  LEU A O     
218   C CB    . LEU A 29  ? 1.2305 0.8715 1.0165 0.1906  -0.1751 -0.1314 29  LEU A CB    
219   C CG    . LEU A 29  ? 1.2874 0.9327 1.0715 0.1902  -0.1733 -0.1289 29  LEU A CG    
220   C CD1   . LEU A 29  ? 1.3222 0.9700 1.1154 0.1898  -0.1756 -0.1310 29  LEU A CD1   
221   C CD2   . LEU A 29  ? 1.3749 1.0222 1.1612 0.1892  -0.1648 -0.1261 29  LEU A CD2   
222   N N     . GLU A 30  ? 1.3254 0.9590 1.1247 0.1911  -0.1832 -0.1406 30  GLU A N     
223   C CA    . GLU A 30  ? 1.3964 1.0258 1.1914 0.1926  -0.1885 -0.1435 30  GLU A C