data_5XRZ
# 
_entry.id   5XRZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5XRZ         
WWPDB D_1300004062 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5XRZ 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Saotome, M.'    1 ? 
'Saito, K.'      2 ? 
'Yasuda, T.'     3 ? 
'Sugiyama, S.'   4 ? 
'Kurumizaka, H.' 5 ? 
'Kagawa, W.'     6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            iScience 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2589-0042 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            3 
_citation.language                  ? 
_citation.page_first                50 
_citation.page_last                 62 
_citation.title                     'Structural Basis of Homology-Directed DNA Repair Mediated by RAD52' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.isci.2018.04.005 
_citation.pdbx_database_id_PubMed   30428330 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Saotome, M.'    1 ? 
primary 'Saito, K.'      2 ? 
primary 'Yasuda, T.'     3 ? 
primary 'Ohtomo, H.'     4 ? 
primary 'Sugiyama, S.'   5 ? 
primary 'Nishimura, Y.'  6 ? 
primary 'Kurumizaka, H.' 7 ? 
primary 'Kagawa, W.'     8 ? 
# 
_cell.entry_id           5XRZ 
_cell.length_a           67.621 
_cell.length_b           101.420 
_cell.length_c           101.710 
_cell.angle_alpha        91.89 
_cell.angle_beta         108.68 
_cell.angle_gamma        108.17 
_cell.Z_PDB              11 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5XRZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA repair protein RAD52 homolog' 23597.582 11 ? 'K102A, K133A' 'UNP residues 1-212' ? 
2 polymer     syn 'ssDNA (40-MER)'                   12077.721 1  ? ?              ?                    ? 
3 non-polymer syn 'POTASSIUM ION'                    39.098    10 ? ?              ?                    ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANE
MFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLASKALSLEKARKEAVTDGLKRALRS
FGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
;GSHMSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANE
MFGYNGWAHSITQQNVDFVDLNNGAFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLASKALSLEKARKEAVTDGLKRALRS
FGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
A,B,C,D,E,F,G,H,I,J,K ? 
2 polydeoxyribonucleotide no no 
;(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DC)(DC)
(DC)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)
;
TTTTTTTTTTTTTTTTTTCCCTTTTTTTTTTTTTTTTTTT L                     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   GLY n 
1 7   THR n 
1 8   GLU n 
1 9   GLU n 
1 10  ALA n 
1 11  ILE n 
1 12  LEU n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  ASP n 
1 17  SER n 
1 18  HIS n 
1 19  PRO n 
1 20  ALA n 
1 21  ALA n 
1 22  GLY n 
1 23  GLY n 
1 24  GLY n 
1 25  SER n 
1 26  VAL n 
1 27  LEU n 
1 28  CYS n 
1 29  PHE n 
1 30  GLY n 
1 31  GLN n 
1 32  CYS n 
1 33  GLN n 
1 34  TYR n 
1 35  THR n 
1 36  ALA n 
1 37  GLU n 
1 38  GLU n 
1 39  TYR n 
1 40  GLN n 
1 41  ALA n 
1 42  ILE n 
1 43  GLN n 
1 44  LYS n 
1 45  ALA n 
1 46  LEU n 
1 47  ARG n 
1 48  GLN n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  TYR n 
1 55  ILE n 
1 56  SER n 
1 57  SER n 
1 58  ARG n 
1 59  MET n 
1 60  ALA n 
1 61  GLY n 
1 62  GLY n 
1 63  GLY n 
1 64  GLN n 
1 65  LYS n 
1 66  VAL n 
1 67  CYS n 
1 68  TYR n 
1 69  ILE n 
1 70  GLU n 
1 71  GLY n 
1 72  HIS n 
1 73  ARG n 
1 74  VAL n 
1 75  ILE n 
1 76  ASN n 
1 77  LEU n 
1 78  ALA n 
1 79  ASN n 
1 80  GLU n 
1 81  MET n 
1 82  PHE n 
1 83  GLY n 
1 84  TYR n 
1 85  ASN n 
1 86  GLY n 
1 87  TRP n 
1 88  ALA n 
1 89  HIS n 
1 90  SER n 
1 91  ILE n 
1 92  THR n 
1 93  GLN n 
1 94  GLN n 
1 95  ASN n 
1 96  VAL n 
1 97  ASP n 
1 98  PHE n 
1 99  VAL n 
1 100 ASP n 
1 101 LEU n 
1 102 ASN n 
1 103 ASN n 
1 104 GLY n 
1 105 ALA n 
1 106 PHE n 
1 107 TYR n 
1 108 VAL n 
1 109 GLY n 
1 110 VAL n 
1 111 CYS n 
1 112 ALA n 
1 113 PHE n 
1 114 VAL n 
1 115 ARG n 
1 116 VAL n 
1 117 GLN n 
1 118 LEU n 
1 119 LYS n 
1 120 ASP n 
1 121 GLY n 
1 122 SER n 
1 123 TYR n 
1 124 HIS n 
1 125 GLU n 
1 126 ASP n 
1 127 VAL n 
1 128 GLY n 
1 129 TYR n 
1 130 GLY n 
1 131 VAL n 
1 132 SER n 
1 133 GLU n 
1 134 GLY n 
1 135 LEU n 
1 136 ALA n 
1 137 SER n 
1 138 LYS n 
1 139 ALA n 
1 140 LEU n 
1 141 SER n 
1 142 LEU n 
1 143 GLU n 
1 144 LYS n 
1 145 ALA n 
1 146 ARG n 
1 147 LYS n 
1 148 GLU n 
1 149 ALA n 
1 150 VAL n 
1 151 THR n 
1 152 ASP n 
1 153 GLY n 
1 154 LEU n 
1 155 LYS n 
1 156 ARG n 
1 157 ALA n 
1 158 LEU n 
1 159 ARG n 
1 160 SER n 
1 161 PHE n 
1 162 GLY n 
1 163 ASN n 
1 164 ALA n 
1 165 LEU n 
1 166 GLY n 
1 167 ASN n 
1 168 CYS n 
1 169 ILE n 
1 170 LEU n 
1 171 ASP n 
1 172 LYS n 
1 173 ASP n 
1 174 TYR n 
1 175 LEU n 
1 176 ARG n 
1 177 SER n 
1 178 LEU n 
1 179 ASN n 
1 180 LYS n 
1 181 LEU n 
1 182 PRO n 
1 183 ARG n 
1 184 GLN n 
1 185 LEU n 
1 186 PRO n 
1 187 LEU n 
1 188 GLU n 
1 189 VAL n 
1 190 ASP n 
1 191 LEU n 
1 192 THR n 
1 193 LYS n 
1 194 ALA n 
1 195 LYS n 
1 196 ARG n 
1 197 GLN n 
1 198 ASP n 
1 199 LEU n 
1 200 GLU n 
1 201 PRO n 
1 202 SER n 
1 203 VAL n 
1 204 GLU n 
1 205 GLU n 
1 206 ALA n 
1 207 ARG n 
1 208 TYR n 
1 209 ASN n 
1 210 SER n 
1 211 CYS n 
1 212 ARG n 
1 213 PRO n 
1 214 ASN n 
1 215 MET n 
2 1   DT  n 
2 2   DT  n 
2 3   DT  n 
2 4   DT  n 
2 5   DT  n 
2 6   DT  n 
2 7   DT  n 
2 8   DT  n 
2 9   DT  n 
2 10  DT  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DT  n 
2 17  DT  n 
2 18  DT  n 
2 19  DC  n 
2 20  DC  n 
2 21  DC  n 
2 22  DT  n 
2 23  DT  n 
2 24  DT  n 
2 25  DT  n 
2 26  DT  n 
2 27  DT  n 
2 28  DT  n 
2 29  DT  n 
2 30  DT  n 
2 31  DT  n 
2 32  DT  n 
2 33  DT  n 
2 34  DT  n 
2 35  DT  n 
2 36  DT  n 
2 37  DT  n 
2 38  DT  n 
2 39  DT  n 
2 40  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   215 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 RAD52 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'JM109(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       40 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RAD52_HUMAN P43351 ? 1 
;MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFG
YNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGN
ALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNM
;
1 
2 PDB 5XRZ        5XRZ   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5XRZ A 4 ? 215 ? P43351 1 ? 212 ? 1 212 
2  1 5XRZ B 4 ? 215 ? P43351 1 ? 212 ? 1 212 
3  1 5XRZ C 4 ? 215 ? P43351 1 ? 212 ? 1 212 
4  1 5XRZ D 4 ? 215 ? P43351 1 ? 212 ? 1 212 
5  1 5XRZ E 4 ? 215 ? P43351 1 ? 212 ? 1 212 
6  1 5XRZ F 4 ? 215 ? P43351 1 ? 212 ? 1 212 
7  1 5XRZ G 4 ? 215 ? P43351 1 ? 212 ? 1 212 
8  1 5XRZ H 4 ? 215 ? P43351 1 ? 212 ? 1 212 
9  1 5XRZ I 4 ? 215 ? P43351 1 ? 212 ? 1 212 
10 1 5XRZ J 4 ? 215 ? P43351 1 ? 212 ? 1 212 
11 1 5XRZ K 4 ? 215 ? P43351 1 ? 212 ? 1 212 
12 2 5XRZ L 1 ? 40  ? 5XRZ   1 ? 40  ? 1 40  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5XRZ GLY A 1   ? UNP P43351 ?   ?   'expression tag'      -2  1  
1  5XRZ SER A 2   ? UNP P43351 ?   ?   'expression tag'      -1  2  
1  5XRZ HIS A 3   ? UNP P43351 ?   ?   'expression tag'      0   3  
1  5XRZ ALA A 105 ? UNP P43351 LYS 102 'engineered mutation' 102 4  
1  5XRZ ALA A 136 ? UNP P43351 LYS 133 'engineered mutation' 133 5  
2  5XRZ GLY B 1   ? UNP P43351 ?   ?   'expression tag'      -2  6  
2  5XRZ SER B 2   ? UNP P43351 ?   ?   'expression tag'      -1  7  
2  5XRZ HIS B 3   ? UNP P43351 ?   ?   'expression tag'      0   8  
2  5XRZ ALA B 105 ? UNP P43351 LYS 102 'engineered mutation' 102 9  
2  5XRZ ALA B 136 ? UNP P43351 LYS 133 'engineered mutation' 133 10 
3  5XRZ GLY C 1   ? UNP P43351 ?   ?   'expression tag'      -2  11 
3  5XRZ SER C 2   ? UNP P43351 ?   ?   'expression tag'      -1  12 
3  5XRZ HIS C 3   ? UNP P43351 ?   ?   'expression tag'      0   13 
3  5XRZ ALA C 105 ? UNP P43351 LYS 102 'engineered mutation' 102 14 
3  5XRZ ALA C 136 ? UNP P43351 LYS 133 'engineered mutation' 133 15 
4  5XRZ GLY D 1   ? UNP P43351 ?   ?   'expression tag'      -2  16 
4  5XRZ SER D 2   ? UNP P43351 ?   ?   'expression tag'      -1  17 
4  5XRZ HIS D 3   ? UNP P43351 ?   ?   'expression tag'      0   18 
4  5XRZ ALA D 105 ? UNP P43351 LYS 102 'engineered mutation' 102 19 
4  5XRZ ALA D 136 ? UNP P43351 LYS 133 'engineered mutation' 133 20 
5  5XRZ GLY E 1   ? UNP P43351 ?   ?   'expression tag'      -2  21 
5  5XRZ SER E 2   ? UNP P43351 ?   ?   'expression tag'      -1  22 
5  5XRZ HIS E 3   ? UNP P43351 ?   ?   'expression tag'      0   23 
5  5XRZ ALA E 105 ? UNP P43351 LYS 102 'engineered mutation' 102 24 
5  5XRZ ALA E 136 ? UNP P43351 LYS 133 'engineered mutation' 133 25 
6  5XRZ GLY F 1   ? UNP P43351 ?   ?   'expression tag'      -2  26 
6  5XRZ SER F 2   ? UNP P43351 ?   ?   'expression tag'      -1  27 
6  5XRZ HIS F 3   ? UNP P43351 ?   ?   'expression tag'      0   28 
6  5XRZ ALA F 105 ? UNP P43351 LYS 102 'engineered mutation' 102 29 
6  5XRZ ALA F 136 ? UNP P43351 LYS 133 'engineered mutation' 133 30 
7  5XRZ GLY G 1   ? UNP P43351 ?   ?   'expression tag'      -2  31 
7  5XRZ SER G 2   ? UNP P43351 ?   ?   'expression tag'      -1  32 
7  5XRZ HIS G 3   ? UNP P43351 ?   ?   'expression tag'      0   33 
7  5XRZ ALA G 105 ? UNP P43351 LYS 102 'engineered mutation' 102 34 
7  5XRZ ALA G 136 ? UNP P43351 LYS 133 'engineered mutation' 133 35 
8  5XRZ GLY H 1   ? UNP P43351 ?   ?   'expression tag'      -2  36 
8  5XRZ SER H 2   ? UNP P43351 ?   ?   'expression tag'      -1  37 
8  5XRZ HIS H 3   ? UNP P43351 ?   ?   'expression tag'      0   38 
8  5XRZ ALA H 105 ? UNP P43351 LYS 102 'engineered mutation' 102 39 
8  5XRZ ALA H 136 ? UNP P43351 LYS 133 'engineered mutation' 133 40 
9  5XRZ GLY I 1   ? UNP P43351 ?   ?   'expression tag'      -2  41 
9  5XRZ SER I 2   ? UNP P43351 ?   ?   'expression tag'      -1  42 
9  5XRZ HIS I 3   ? UNP P43351 ?   ?   'expression tag'      0   43 
9  5XRZ ALA I 105 ? UNP P43351 LYS 102 'engineered mutation' 102 44 
9  5XRZ ALA I 136 ? UNP P43351 LYS 133 'engineered mutation' 133 45 
10 5XRZ GLY J 1   ? UNP P43351 ?   ?   'expression tag'      -2  46 
10 5XRZ SER J 2   ? UNP P43351 ?   ?   'expression tag'      -1  47 
10 5XRZ HIS J 3   ? UNP P43351 ?   ?   'expression tag'      0   48 
10 5XRZ ALA J 105 ? UNP P43351 LYS 102 'engineered mutation' 102 49 
10 5XRZ ALA J 136 ? UNP P43351 LYS 133 'engineered mutation' 133 50 
11 5XRZ GLY K 1   ? UNP P43351 ?   ?   'expression tag'      -2  51 
11 5XRZ SER K 2   ? UNP P43351 ?   ?   'expression tag'      -1  52 
11 5XRZ HIS K 3   ? UNP P43351 ?   ?   'expression tag'      0   53 
11 5XRZ ALA K 105 ? UNP P43351 LYS 102 'engineered mutation' 102 54 
11 5XRZ ALA K 136 ? UNP P43351 LYS 133 'engineered mutation' 133 55 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'    121.158 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"        ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'                     ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5XRZ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.29 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.19 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'calcium acetate, PEG 3,350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-12-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Cryo-cooled channel-cut Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.10000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-1A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.10000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL-1A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            100.2 
_reflns.entry_id                         5XRZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.6 
_reflns.d_resolution_low                 95.3 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       27023 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       0.0 
_reflns.observed_criterion_sigma_I       0.0 
_reflns.percent_possible_obs             96.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                0.103 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.103 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.145 
_reflns.pdbx_Rpim_I_all                  0.103 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.972 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.6 
_reflns_shell.d_res_low                   3.7 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.7 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4412 
_reflns_shell.percent_possible_all        97.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.400 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.4 
_reflns_shell.pdbx_Rsym_value             0.103 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.565 
_reflns_shell.pdbx_Rpim_I_all             0.400 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.597 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5XRZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     26956 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.703 
_refine.ls_d_res_high                            3.600 
_refine.ls_percent_reflns_obs                    96.67 
_refine.ls_R_factor_obs                          0.2188 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2165 
_refine.ls_R_factor_R_free                       0.2565 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.30 
_refine.ls_number_reflns_R_free                  1430 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1KN0 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.41 
_refine.pdbx_overall_phase_error                 31.20 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15862 
_refine_hist.pdbx_number_atoms_nucleic_acid   794 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16666 
_refine_hist.d_res_high                       3.600 
_refine_hist.d_res_low                        45.703 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002 ? ? 16999 'X-RAY DIFFRACTION' ? 
f_angle_d          0.480 ? ? 23049 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 8.540 ? ? 10109 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.039 ? ? 2458  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004 ? ? 2922  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.6001 3.7287  2576 0.2981 97.00 0.3198 . . 143 . . 
'X-RAY DIFFRACTION' . 3.7287 3.8780  2537 0.2628 97.00 0.3002 . . 140 . . 
'X-RAY DIFFRACTION' . 3.8780 4.0544  2622 0.2590 97.00 0.2633 . . 99  . . 
'X-RAY DIFFRACTION' . 4.0544 4.2680  2548 0.2242 96.00 0.2846 . . 136 . . 
'X-RAY DIFFRACTION' . 4.2680 4.5351  2518 0.2083 97.00 0.2422 . . 147 . . 
'X-RAY DIFFRACTION' . 4.5351 4.8849  2577 0.1919 98.00 0.2614 . . 163 . . 
'X-RAY DIFFRACTION' . 4.8849 5.3758  2548 0.2113 97.00 0.2602 . . 145 . . 
'X-RAY DIFFRACTION' . 5.3758 6.1521  2504 0.2198 96.00 0.2826 . . 172 . . 
'X-RAY DIFFRACTION' . 6.1521 7.7449  2536 0.2117 96.00 0.2297 . . 141 . . 
'X-RAY DIFFRACTION' . 7.7449 45.7072 2560 0.1871 97.00 0.2249 . . 144 . . 
# 
_struct.entry_id                     5XRZ 
_struct.title                        'Structure of a ssDNA bound to the inner DNA binding site of RAD52' 
_struct.pdbx_descriptor              'DNA repair protein RAD52 homolog/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5XRZ 
_struct_keywords.text            'Protein-DNA complex, ssDNA annealing protein, DNA repair protein, RECOMBINATION' 
_struct_keywords.pdbx_keywords   RECOMBINATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 1 ? 
J N N 1 ? 
K N N 1 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 3 ? 
V N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 35  ? ARG A 47  ? THR A 32  ARG A 44  1 ? 13 
HELX_P HELX_P2  AA2 GLU A 70  ? PHE A 82  ? GLU A 67  PHE A 79  1 ? 13 
HELX_P HELX_P3  AA3 SER A 137 ? SER A 160 ? SER A 134 SER A 157 1 ? 24 
HELX_P HELX_P4  AA4 PHE A 161 ? LEU A 170 ? PHE A 158 LEU A 167 5 ? 10 
HELX_P HELX_P5  AA5 ASP A 171 ? LYS A 180 ? ASP A 168 LYS A 177 1 ? 10 
HELX_P HELX_P6  AA6 GLU A 200 ? SER A 210 ? GLU A 197 SER A 207 1 ? 11 
HELX_P HELX_P7  AA7 THR B 35  ? ARG B 47  ? THR B 32  ARG B 44  1 ? 13 
HELX_P HELX_P8  AA8 GLU B 70  ? PHE B 82  ? GLU B 67  PHE B 79  1 ? 13 
HELX_P HELX_P9  AA9 SER B 137 ? SER B 160 ? SER B 134 SER B 157 1 ? 24 
HELX_P HELX_P10 AB1 PHE B 161 ? LEU B 170 ? PHE B 158 LEU B 167 5 ? 10 
HELX_P HELX_P11 AB2 ASP B 171 ? LYS B 180 ? ASP B 168 LYS B 177 1 ? 10 
HELX_P HELX_P12 AB3 GLU B 200 ? SER B 210 ? GLU B 197 SER B 207 1 ? 11 
HELX_P HELX_P13 AB4 THR C 35  ? ARG C 47  ? THR C 32  ARG C 44  1 ? 13 
HELX_P HELX_P14 AB5 GLU C 70  ? PHE C 82  ? GLU C 67  PHE C 79  1 ? 13 
HELX_P HELX_P15 AB6 SER C 137 ? SER C 160 ? SER C 134 SER C 157 1 ? 24 
HELX_P HELX_P16 AB7 PHE C 161 ? LEU C 170 ? PHE C 158 LEU C 167 5 ? 10 
HELX_P HELX_P17 AB8 ASP C 171 ? LYS C 180 ? ASP C 168 LYS C 177 1 ? 10 
HELX_P HELX_P18 AB9 GLU C 200 ? SER C 210 ? GLU C 197 SER C 207 1 ? 11 
HELX_P HELX_P19 AC1 THR D 35  ? ARG D 47  ? THR D 32  ARG D 44  1 ? 13 
HELX_P HELX_P20 AC2 GLU D 70  ? PHE D 82  ? GLU D 67  PHE D 79  1 ? 13 
HELX_P HELX_P21 AC3 SER D 137 ? SER D 160 ? SER D 134 SER D 157 1 ? 24 
HELX_P HELX_P22 AC4 PHE D 161 ? LEU D 170 ? PHE D 158 LEU D 167 5 ? 10 
HELX_P HELX_P23 AC5 ASP D 171 ? LYS D 180 ? ASP D 168 LYS D 177 1 ? 10 
HELX_P HELX_P24 AC6 GLU D 200 ? SER D 210 ? GLU D 197 SER D 207 1 ? 11 
HELX_P HELX_P25 AC7 THR E 35  ? ARG E 47  ? THR E 32  ARG E 44  1 ? 13 
HELX_P HELX_P26 AC8 GLU E 70  ? PHE E 82  ? GLU E 67  PHE E 79  1 ? 13 
HELX_P HELX_P27 AC9 SER E 137 ? SER E 160 ? SER E 134 SER E 157 1 ? 24 
HELX_P HELX_P28 AD1 PHE E 161 ? LEU E 170 ? PHE E 158 LEU E 167 5 ? 10 
HELX_P HELX_P29 AD2 ASP E 171 ? LYS E 180 ? ASP E 168 LYS E 177 1 ? 10 
HELX_P HELX_P30 AD3 GLU E 200 ? SER E 210 ? GLU E 197 SER E 207 1 ? 11 
HELX_P HELX_P31 AD4 THR F 35  ? ARG F 47  ? THR F 32  ARG F 44  1 ? 13 
HELX_P HELX_P32 AD5 GLU F 70  ? PHE F 82  ? GLU F 67  PHE F 79  1 ? 13 
HELX_P HELX_P33 AD6 SER F 137 ? SER F 160 ? SER F 134 SER F 157 1 ? 24 
HELX_P HELX_P34 AD7 PHE F 161 ? LEU F 170 ? PHE F 158 LEU F 167 5 ? 10 
HELX_P HELX_P35 AD8 ASP F 171 ? LYS F 180 ? ASP F 168 LYS F 177 1 ? 10 
HELX_P HELX_P36 AD9 GLU F 200 ? ASN F 209 ? GLU F 197 ASN F 206 1 ? 10 
HELX_P HELX_P37 AE1 THR G 35  ? ARG G 47  ? THR G 32  ARG G 44  1 ? 13 
HELX_P HELX_P38 AE2 GLU G 70  ? PHE G 82  ? GLU G 67  PHE G 79  1 ? 13 
HELX_P HELX_P39 AE3 SER G 137 ? SER G 160 ? SER G 134 SER G 157 1 ? 24 
HELX_P HELX_P40 AE4 PHE G 161 ? LEU G 170 ? PHE G 158 LEU G 167 5 ? 10 
HELX_P HELX_P41 AE5 ASP G 171 ? LYS G 180 ? ASP G 168 LYS G 177 1 ? 10 
HELX_P HELX_P42 AE6 GLU G 200 ? SER G 210 ? GLU G 197 SER G 207 1 ? 11 
HELX_P HELX_P43 AE7 THR H 35  ? ARG H 47  ? THR H 32  ARG H 44  1 ? 13 
HELX_P HELX_P44 AE8 GLU H 70  ? PHE H 82  ? GLU H 67  PHE H 79  1 ? 13 
HELX_P HELX_P45 AE9 SER H 137 ? SER H 160 ? SER H 134 SER H 157 1 ? 24 
HELX_P HELX_P46 AF1 PHE H 161 ? LEU H 170 ? PHE H 158 LEU H 167 5 ? 10 
HELX_P HELX_P47 AF2 ASP H 171 ? LYS H 180 ? ASP H 168 LYS H 177 1 ? 10 
HELX_P HELX_P48 AF3 GLU H 200 ? SER H 210 ? GLU H 197 SER H 207 1 ? 11 
HELX_P HELX_P49 AF4 THR I 35  ? ARG I 47  ? THR I 32  ARG I 44  1 ? 13 
HELX_P HELX_P50 AF5 GLU I 70  ? PHE I 82  ? GLU I 67  PHE I 79  1 ? 13 
HELX_P HELX_P51 AF6 SER I 137 ? SER I 160 ? SER I 134 SER I 157 1 ? 24 
HELX_P HELX_P52 AF7 PHE I 161 ? LEU I 170 ? PHE I 158 LEU I 167 5 ? 10 
HELX_P HELX_P53 AF8 ASP I 171 ? LYS I 180 ? ASP I 168 LYS I 177 1 ? 10 
HELX_P HELX_P54 AF9 GLU I 200 ? SER I 210 ? GLU I 197 SER I 207 1 ? 11 
HELX_P HELX_P55 AG1 THR J 35  ? ARG J 47  ? THR J 32  ARG J 44  1 ? 13 
HELX_P HELX_P56 AG2 GLU J 70  ? PHE J 82  ? GLU J 67  PHE J 79  1 ? 13 
HELX_P HELX_P57 AG3 SER J 137 ? SER J 160 ? SER J 134 SER J 157 1 ? 24 
HELX_P HELX_P58 AG4 PHE J 161 ? LEU J 170 ? PHE J 158 LEU J 167 5 ? 10 
HELX_P HELX_P59 AG5 ASP J 171 ? LYS J 180 ? ASP J 168 LYS J 177 1 ? 10 
HELX_P HELX_P60 AG6 GLU J 200 ? SER J 210 ? GLU J 197 SER J 207 1 ? 11 
HELX_P HELX_P61 AG7 THR K 35  ? ARG K 47  ? THR K 32  ARG K 44  1 ? 13 
HELX_P HELX_P62 AG8 GLU K 70  ? PHE K 82  ? GLU K 67  PHE K 79  1 ? 13 
HELX_P HELX_P63 AG9 SER K 137 ? SER K 160 ? SER K 134 SER K 157 1 ? 24 
HELX_P HELX_P64 AH1 PHE K 161 ? LEU K 170 ? PHE K 158 LEU K 167 5 ? 10 
HELX_P HELX_P65 AH2 ASP K 171 ? LYS K 180 ? ASP K 168 LYS K 177 1 ? 10 
HELX_P HELX_P66 AH3 GLU K 200 ? SER K 210 ? GLU K 197 SER K 207 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 143 OE2   ? ? ? 1_555 M K . K ? ? A GLU 140 A K 301 1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc2  metalc ? ? B GLU 143 OE2   ? ? ? 1_555 N K . K ? ? B GLU 140 B K 301 1_555 ? ? ? ? ? ? ? 2.978 ? 
metalc3  metalc ? ? C GLU 143 OE2   ? ? ? 1_555 O K . K ? ? C GLU 140 C K 301 1_555 ? ? ? ? ? ? ? 2.800 ? 
metalc4  metalc ? ? D GLU 143 OE2   ? ? ? 1_555 P K . K ? ? D GLU 140 D K 301 1_555 ? ? ? ? ? ? ? 2.820 ? 
metalc5  metalc ? ? E GLU 143 OE2   ? ? ? 1_555 Q K . K ? ? E GLU 140 E K 301 1_555 ? ? ? ? ? ? ? 3.093 ? 
metalc6  metalc ? ? F GLU 143 OE2   ? ? ? 1_555 R K . K ? ? F GLU 140 F K 301 1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc7  metalc ? ? G GLU 143 OE2   ? ? ? 1_555 S K . K ? ? G GLU 140 G K 301 1_555 ? ? ? ? ? ? ? 2.808 ? 
metalc8  metalc ? ? H GLU 143 OE2   ? ? ? 1_555 T K . K ? ? H GLU 140 H K 301 1_555 ? ? ? ? ? ? ? 2.928 ? 
metalc9  metalc ? ? I GLU 143 OE2   ? ? ? 1_555 U K . K ? ? I GLU 140 I K 301 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc10 metalc ? ? I GLU 148 OE2   ? ? ? 1_555 T K . K ? ? I GLU 145 H K 301 1_555 ? ? ? ? ? ? ? 3.296 ? 
metalc11 metalc ? ? K GLU 143 OE2   ? ? ? 1_555 V K . K ? ? K GLU 140 K K 301 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc12 metalc ? ? L DT  1   "O5'" ? ? ? 1_555 V K . K ? ? L DT  1   K K 301 1_555 ? ? ? ? ? ? ? 3.337 ? 
metalc13 metalc ? ? L DT  12  "O3'" ? ? ? 1_555 O K . K ? ? L DT  12  C K 301 1_555 ? ? ? ? ? ? ? 3.338 ? 
metalc14 metalc ? ? L DT  16  "O4'" ? ? ? 1_555 P K . K ? ? L DT  16  D K 301 1_555 ? ? ? ? ? ? ? 3.498 ? 
metalc15 metalc ? ? L DT  17  OP1   ? ? ? 1_555 P K . K ? ? L DT  17  D K 301 1_555 ? ? ? ? ? ? ? 3.451 ? 
metalc16 metalc ? ? L DT  25  OP1   ? ? ? 1_555 R K . K ? ? L DT  25  F K 301 1_555 ? ? ? ? ? ? ? 3.300 ? 
metalc17 metalc ? ? L DT  37  OP1   ? ? ? 1_555 U K . K ? ? L DT  37  I K 301 1_555 ? ? ? ? ? ? ? 2.866 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 3 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 3 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 55  ? MET A 59  ? ILE A 52  MET A 56  
AA1 2 LYS A 65  ? ILE A 69  ? LYS A 62  ILE A 66  
AA2 1 TRP A 87  ? ASN A 102 ? TRP A 84  ASN A 99  
AA2 2 ALA A 105 ? LEU A 118 ? ALA A 102 LEU A 115 
AA2 3 TYR A 123 ? SER A 132 ? TYR A 120 SER A 129 
AA3 1 ILE B 55  ? MET B 59  ? ILE B 52  MET B 56  
AA3 2 LYS B 65  ? ILE B 69  ? LYS B 62  ILE B 66  
AA4 1 TRP B 87  ? ASN B 102 ? TRP B 84  ASN B 99  
AA4 2 ALA B 105 ? LEU B 118 ? ALA B 102 LEU B 115 
AA4 3 TYR B 123 ? SER B 132 ? TYR B 120 SER B 129 
AA5 1 ILE C 55  ? MET C 59  ? ILE C 52  MET C 56  
AA5 2 LYS C 65  ? ILE C 69  ? LYS C 62  ILE C 66  
AA6 1 TRP C 87  ? ASN C 102 ? TRP C 84  ASN C 99  
AA6 2 ALA C 105 ? LEU C 118 ? ALA C 102 LEU C 115 
AA6 3 TYR C 123 ? SER C 132 ? TYR C 120 SER C 129 
AA7 1 ILE D 55  ? MET D 59  ? ILE D 52  MET D 56  
AA7 2 LYS D 65  ? ILE D 69  ? LYS D 62  ILE D 66  
AA8 1 TRP D 87  ? ASN D 102 ? TRP D 84  ASN D 99  
AA8 2 ALA D 105 ? LEU D 118 ? ALA D 102 LEU D 115 
AA8 3 TYR D 123 ? SER D 132 ? TYR D 120 SER D 129 
AA9 1 ILE E 55  ? MET E 59  ? ILE E 52  MET E 56  
AA9 2 LYS E 65  ? ILE E 69  ? LYS E 62  ILE E 66  
AB1 1 TRP E 87  ? ASN E 102 ? TRP E 84  ASN E 99  
AB1 2 ALA E 105 ? LEU E 118 ? ALA E 102 LEU E 115 
AB1 3 TYR E 123 ? SER E 132 ? TYR E 120 SER E 129 
AB2 1 ILE F 55  ? MET F 59  ? ILE F 52  MET F 56  
AB2 2 LYS F 65  ? ILE F 69  ? LYS F 62  ILE F 66  
AB3 1 TRP F 87  ? ASN F 102 ? TRP F 84  ASN F 99  
AB3 2 ALA F 105 ? LEU F 118 ? ALA F 102 LEU F 115 
AB3 3 TYR F 123 ? SER F 132 ? TYR F 120 SER F 129 
AB4 1 ILE G 55  ? MET G 59  ? ILE G 52  MET G 56  
AB4 2 LYS G 65  ? ILE G 69  ? LYS G 62  ILE G 66  
AB5 1 TRP G 87  ? ASN G 102 ? TRP G 84  ASN G 99  
AB5 2 ALA G 105 ? LEU G 118 ? ALA G 102 LEU G 115 
AB5 3 TYR G 123 ? SER G 132 ? TYR G 120 SER G 129 
AB6 1 ILE H 55  ? MET H 59  ? ILE H 52  MET H 56  
AB6 2 LYS H 65  ? ILE H 69  ? LYS H 62  ILE H 66  
AB7 1 TRP H 87  ? ASN H 102 ? TRP H 84  ASN H 99  
AB7 2 ALA H 105 ? LEU H 118 ? ALA H 102 LEU H 115 
AB7 3 TYR H 123 ? SER H 132 ? TYR H 120 SER H 129 
AB8 1 ILE I 55  ? MET I 59  ? ILE I 52  MET I 56  
AB8 2 LYS I 65  ? ILE I 69  ? LYS I 62  ILE I 66  
AB9 1 TRP I 87  ? ASN I 102 ? TRP I 84  ASN I 99  
AB9 2 ALA I 105 ? LEU I 118 ? ALA I 102 LEU I 115 
AB9 3 TYR I 123 ? SER I 132 ? TYR I 120 SER I 129 
AC1 1 ILE J 55  ? MET J 59  ? ILE J 52  MET J 56  
AC1 2 LYS J 65  ? ILE J 69  ? LYS J 62  ILE J 66  
AC2 1 TRP J 87  ? ASN J 102 ? TRP J 84  ASN J 99  
AC2 2 ALA J 105 ? LEU J 118 ? ALA J 102 LEU J 115 
AC2 3 TYR J 123 ? SER J 132 ? TYR J 120 SER J 129 
AC3 1 ILE K 55  ? MET K 59  ? ILE K 52  MET K 56  
AC3 2 LYS K 65  ? ILE K 69  ? LYS K 62  ILE K 66  
AC4 1 TRP K 87  ? ASN K 102 ? TRP K 84  ASN K 99  
AC4 2 ALA K 105 ? LEU K 118 ? ALA K 102 LEU K 115 
AC4 3 TYR K 123 ? SER K 132 ? TYR K 120 SER K 129 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 56  ? N SER A 53  O TYR A 68  ? O TYR A 65  
AA2 1 2 N ALA A 88  ? N ALA A 85  O GLN A 117 ? O GLN A 114 
AA2 2 3 N VAL A 116 ? N VAL A 113 O HIS A 124 ? O HIS A 121 
AA3 1 2 N SER B 56  ? N SER B 53  O TYR B 68  ? O TYR B 65  
AA4 1 2 N ALA B 88  ? N ALA B 85  O GLN B 117 ? O GLN B 114 
AA4 2 3 N VAL B 116 ? N VAL B 113 O HIS B 124 ? O HIS B 121 
AA5 1 2 N SER C 56  ? N SER C 53  O TYR C 68  ? O TYR C 65  
AA6 1 2 N ALA C 88  ? N ALA C 85  O GLN C 117 ? O GLN C 114 
AA6 2 3 N VAL C 110 ? N VAL C 107 O GLY C 130 ? O GLY C 127 
AA7 1 2 N ARG D 58  ? N ARG D 55  O VAL D 66  ? O VAL D 63  
AA8 1 2 N ALA D 88  ? N ALA D 85  O GLN D 117 ? O GLN D 114 
AA8 2 3 N VAL D 116 ? N VAL D 113 O HIS D 124 ? O HIS D 121 
AA9 1 2 N SER E 56  ? N SER E 53  O TYR E 68  ? O TYR E 65  
AB1 1 2 N ALA E 88  ? N ALA E 85  O GLN E 117 ? O GLN E 114 
AB1 2 3 N VAL E 116 ? N VAL E 113 O HIS E 124 ? O HIS E 121 
AB2 1 2 N SER F 56  ? N SER F 53  O TYR F 68  ? O TYR F 65  
AB3 1 2 N ALA F 88  ? N ALA F 85  O GLN F 117 ? O GLN F 114 
AB3 2 3 N VAL F 116 ? N VAL F 113 O HIS F 124 ? O HIS F 121 
AB4 1 2 N SER G 56  ? N SER G 53  O TYR G 68  ? O TYR G 65  
AB5 1 2 N ALA G 88  ? N ALA G 85  O GLN G 117 ? O GLN G 114 
AB5 2 3 N VAL G 116 ? N VAL G 113 O HIS G 124 ? O HIS G 121 
AB6 1 2 N SER H 56  ? N SER H 53  O TYR H 68  ? O TYR H 65  
AB7 1 2 N ALA H 88  ? N ALA H 85  O GLN H 117 ? O GLN H 114 
AB7 2 3 N VAL H 116 ? N VAL H 113 O HIS H 124 ? O HIS H 121 
AB8 1 2 N SER I 56  ? N SER I 53  O TYR I 68  ? O TYR I 65  
AB9 1 2 N ALA I 88  ? N ALA I 85  O GLN I 117 ? O GLN I 114 
AB9 2 3 N VAL I 110 ? N VAL I 107 O GLY I 130 ? O GLY I 127 
AC1 1 2 N ARG J 58  ? N ARG J 55  O VAL J 66  ? O VAL J 63  
AC2 1 2 N ALA J 88  ? N ALA J 85  O GLN J 117 ? O GLN J 114 
AC2 2 3 N VAL J 116 ? N VAL J 113 O HIS J 124 ? O HIS J 121 
AC3 1 2 N ARG K 58  ? N ARG K 55  O VAL K 66  ? O VAL K 63  
AC4 1 2 N ALA K 88  ? N ALA K 85  O GLN K 117 ? O GLN K 114 
AC4 2 3 N VAL K 116 ? N VAL K 113 O HIS K 124 ? O HIS K 121 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A K 301 ? 1 'binding site for residue K A 301' 
AC2 Software B K 301 ? 2 'binding site for residue K B 301' 
AC3 Software C K 301 ? 2 'binding site for residue K C 301' 
AC4 Software D K 301 ? 4 'binding site for residue K D 301' 
AC5 Software E K 301 ? 2 'binding site for residue K E 301' 
AC6 Software F K 301 ? 2 'binding site for residue K F 301' 
AC7 Software G K 301 ? 1 'binding site for residue K G 301' 
AC8 Software H K 301 ? 2 'binding site for residue K H 301' 
AC9 Software I K 301 ? 3 'binding site for residue K I 301' 
AD1 Software K K 301 ? 2 'binding site for residue K K 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 GLU A 143 ? GLU A 140 . ? 1_555 ? 
2  AC2 2 GLU B 143 ? GLU B 140 . ? 1_555 ? 
3  AC2 2 GLU C 148 ? GLU C 145 . ? 1_555 ? 
4  AC3 2 GLU C 143 ? GLU C 140 . ? 1_555 ? 
5  AC3 2 DT  L 12  ? DT  L 12  . ? 1_555 ? 
6  AC4 4 GLU D 143 ? GLU D 140 . ? 1_555 ? 
7  AC4 4 GLU E 148 ? GLU E 145 . ? 1_555 ? 
8  AC4 4 DT  L 16  ? DT  L 16  . ? 1_555 ? 
9  AC4 4 DT  L 17  ? DT  L 17  . ? 1_555 ? 
10 AC5 2 GLU E 143 ? GLU E 140 . ? 1_555 ? 
11 AC5 2 GLU F 148 ? GLU F 145 . ? 1_555 ? 
12 AC6 2 GLU F 143 ? GLU F 140 . ? 1_555 ? 
13 AC6 2 DT  L 25  ? DT  L 25  . ? 1_555 ? 
14 AC7 1 GLU G 143 ? GLU G 140 . ? 1_555 ? 
15 AC8 2 GLU H 143 ? GLU H 140 . ? 1_555 ? 
16 AC8 2 GLU I 148 ? GLU I 145 . ? 1_555 ? 
17 AC9 3 GLU I 143 ? GLU I 140 . ? 1_555 ? 
18 AC9 3 GLU J 148 ? GLU J 145 . ? 1_555 ? 
19 AC9 3 DT  L 37  ? DT  L 37  . ? 1_555 ? 
20 AD1 2 GLU K 143 ? GLU K 140 . ? 1_555 ? 
21 AD1 2 DT  L 1   ? DT  L 1   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5XRZ 
_atom_sites.fract_transf_matrix[1][1]   0.014788 
_atom_sites.fract_transf_matrix[1][2]   0.004854 
_atom_sites.fract_transf_matrix[1][3]   0.005780 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010377 
_atom_sites.fract_transf_matrix[2][3]   0.001549 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010494 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
K  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . CYS A 1 28  ? 46.735 -47.159  -144.039 1.00 137.27 ? 25  CYS A N     1 
ATOM   2     C CA    . CYS A 1 28  ? 45.524 -46.373  -144.245 1.00 134.07 ? 25  CYS A CA    1 
ATOM   3     C C     . CYS A 1 28  ? 44.603 -46.459  -143.032 1.00 134.75 ? 25  CYS A C     1 
ATOM   4     O O     . CYS A 1 28  ? 44.995 -46.965  -141.980 1.00 142.68 ? 25  CYS A O     1 
ATOM   5     C CB    . CYS A 1 28  ? 44.787 -46.846  -145.500 1.00 142.61 ? 25  CYS A CB    1 
ATOM   6     S SG    . CYS A 1 28  ? 44.326 -48.597  -145.483 1.00 153.16 ? 25  CYS A SG    1 
ATOM   7     N N     . PHE A 1 29  ? 43.378 -45.962  -143.185 1.00 125.39 ? 26  PHE A N     1 
ATOM   8     C CA    . PHE A 1 29  ? 42.406 -46.026  -142.104 1.00 104.27 ? 26  PHE A CA    1 
ATOM   9     C C     . PHE A 1 29  ? 41.975 -47.468  -141.863 1.00 125.00 ? 26  PHE A C     1 
ATOM   10    O O     . PHE A 1 29  ? 41.800 -48.248  -142.803 1.00 141.24 ? 26  PHE A O     1 
ATOM   11    C CB    . PHE A 1 29  ? 41.191 -45.157  -142.428 1.00 94.52  ? 26  PHE A CB    1 
ATOM   12    C CG    . PHE A 1 29  ? 40.370 -44.790  -141.225 1.00 99.32  ? 26  PHE A CG    1 
ATOM   13    C CD1   . PHE A 1 29  ? 39.452 -45.682  -140.694 1.00 107.62 ? 26  PHE A CD1   1 
ATOM   14    C CD2   . PHE A 1 29  ? 40.521 -43.554  -140.621 1.00 114.69 ? 26  PHE A CD2   1 
ATOM   15    C CE1   . PHE A 1 29  ? 38.700 -45.346  -139.585 1.00 108.71 ? 26  PHE A CE1   1 
ATOM   16    C CE2   . PHE A 1 29  ? 39.770 -43.212  -139.513 1.00 120.23 ? 26  PHE A CE2   1 
ATOM   17    C CZ    . PHE A 1 29  ? 38.860 -44.111  -138.994 1.00 105.97 ? 26  PHE A CZ    1 
ATOM   18    N N     . GLY A 1 30  ? 41.805 -47.820  -140.589 1.00 122.54 ? 27  GLY A N     1 
ATOM   19    C CA    . GLY A 1 30  ? 41.519 -49.183  -140.202 1.00 120.81 ? 27  GLY A CA    1 
ATOM   20    C C     . GLY A 1 30  ? 42.726 -50.090  -140.114 1.00 119.70 ? 27  GLY A C     1 
ATOM   21    O O     . GLY A 1 30  ? 42.619 -51.181  -139.539 1.00 124.84 ? 27  GLY A O     1 
ATOM   22    N N     . GLN A 1 31  ? 43.868 -49.683  -140.665 1.00 119.18 ? 28  GLN A N     1 
ATOM   23    C CA    . GLN A 1 31  ? 45.089 -50.480  -140.648 1.00 130.96 ? 28  GLN A CA    1 
ATOM   24    C C     . GLN A 1 31  ? 46.178 -49.904  -139.758 1.00 138.22 ? 28  GLN A C     1 
ATOM   25    O O     . GLN A 1 31  ? 46.849 -50.660  -139.051 1.00 145.29 ? 28  GLN A O     1 
ATOM   26    C CB    . GLN A 1 31  ? 45.636 -50.635  -142.073 1.00 136.22 ? 28  GLN A CB    1 
ATOM   27    C CG    . GLN A 1 31  ? 44.687 -51.332  -143.043 1.00 146.62 ? 28  GLN A CG    1 
ATOM   28    C CD    . GLN A 1 31  ? 44.645 -52.841  -142.865 1.00 159.50 ? 28  GLN A CD    1 
ATOM   29    O OE1   . GLN A 1 31  ? 45.067 -53.376  -141.839 1.00 149.03 ? 28  GLN A OE1   1 
ATOM   30    N NE2   . GLN A 1 31  ? 44.131 -53.536  -143.873 1.00 184.63 ? 28  GLN A NE2   1 
ATOM   31    N N     . CYS A 1 32  ? 46.376 -48.586  -139.783 1.00 135.83 ? 29  CYS A N     1 
ATOM   32    C CA    . CYS A 1 32  ? 47.445 -47.962  -139.013 1.00 135.47 ? 29  CYS A CA    1 
ATOM   33    C C     . CYS A 1 32  ? 47.257 -48.213  -137.522 1.00 135.30 ? 29  CYS A C     1 
ATOM   34    O O     . CYS A 1 32  ? 46.161 -48.039  -136.983 1.00 131.62 ? 29  CYS A O     1 
ATOM   35    C CB    . CYS A 1 32  ? 47.489 -46.460  -139.294 1.00 133.71 ? 29  CYS A CB    1 
ATOM   36    S SG    . CYS A 1 32  ? 48.057 -46.024  -140.954 1.00 134.82 ? 29  CYS A SG    1 
ATOM   37    N N     . GLN A 1 33  ? 48.335 -48.618  -136.857 1.00 136.58 ? 30  GLN A N     1 
ATOM   38    C CA    . GLN A 1 33  ? 48.312 -48.929  -135.436 1.00 132.87 ? 30  GLN A CA    1 
ATOM   39    C C     . GLN A 1 33  ? 48.785 -47.737  -134.612 1.00 148.88 ? 30  GLN A C     1 
ATOM   40    O O     . GLN A 1 33  ? 49.635 -46.954  -135.044 1.00 155.22 ? 30  GLN A O     1 
ATOM   41    C CB    . GLN A 1 33  ? 49.185 -50.148  -135.135 1.00 136.35 ? 30  GLN A CB    1 
ATOM   42    C CG    . GLN A 1 33  ? 48.662 -51.445  -135.725 1.00 151.13 ? 30  GLN A CG    1 
ATOM   43    C CD    . GLN A 1 33  ? 49.583 -52.617  -135.457 1.00 164.85 ? 30  GLN A CD    1 
ATOM   44    O OE1   . GLN A 1 33  ? 50.026 -52.828  -134.328 1.00 164.48 ? 30  GLN A OE1   1 
ATOM   45    N NE2   . GLN A 1 33  ? 49.874 -53.392  -136.496 1.00 164.12 ? 30  GLN A NE2   1 
ATOM   46    N N     . TYR A 1 34  ? 48.220 -47.613  -133.414 1.00 150.82 ? 31  TYR A N     1 
ATOM   47    C CA    . TYR A 1 34  ? 48.554 -46.507  -132.528 1.00 148.02 ? 31  TYR A CA    1 
ATOM   48    C C     . TYR A 1 34  ? 49.930 -46.703  -131.902 1.00 155.44 ? 31  TYR A C     1 
ATOM   49    O O     . TYR A 1 34  ? 50.285 -47.804  -131.472 1.00 150.51 ? 31  TYR A O     1 
ATOM   50    C CB    . TYR A 1 34  ? 47.500 -46.372  -131.428 1.00 144.52 ? 31  TYR A CB    1 
ATOM   51    C CG    . TYR A 1 34  ? 46.295 -45.550  -131.821 1.00 138.80 ? 31  TYR A CG    1 
ATOM   52    C CD1   . TYR A 1 34  ? 46.425 -44.213  -132.167 1.00 140.76 ? 31  TYR A CD1   1 
ATOM   53    C CD2   . TYR A 1 34  ? 45.024 -46.109  -131.836 1.00 140.68 ? 31  TYR A CD2   1 
ATOM   54    C CE1   . TYR A 1 34  ? 45.325 -43.456  -132.524 1.00 146.84 ? 31  TYR A CE1   1 
ATOM   55    C CE2   . TYR A 1 34  ? 43.917 -45.360  -132.191 1.00 138.26 ? 31  TYR A CE2   1 
ATOM   56    C CZ    . TYR A 1 34  ? 44.074 -44.034  -132.534 1.00 139.48 ? 31  TYR A CZ    1 
ATOM   57    O OH    . TYR A 1 34  ? 42.975 -43.284  -132.888 1.00 129.60 ? 31  TYR A OH    1 
ATOM   58    N N     . THR A 1 35  ? 50.706 -45.623  -131.856 1.00 156.69 ? 32  THR A N     1 
ATOM   59    C CA    . THR A 1 35  ? 51.979 -45.641  -131.156 1.00 159.68 ? 32  THR A CA    1 
ATOM   60    C C     . THR A 1 35  ? 51.757 -45.522  -129.649 1.00 159.42 ? 32  THR A C     1 
ATOM   61    O O     . THR A 1 35  ? 50.672 -45.166  -129.180 1.00 154.84 ? 32  THR A O     1 
ATOM   62    C CB    . THR A 1 35  ? 52.885 -44.509  -131.646 1.00 150.80 ? 32  THR A CB    1 
ATOM   63    O OG1   . THR A 1 35  ? 52.214 -43.253  -131.488 1.00 148.57 ? 32  THR A OG1   1 
ATOM   64    C CG2   . THR A 1 35  ? 53.240 -44.708  -133.112 1.00 143.43 ? 32  THR A CG2   1 
ATOM   65    N N     . ALA A 1 36  ? 52.808 -45.839  -128.888 1.00 157.29 ? 33  ALA A N     1 
ATOM   66    C CA    . ALA A 1 36  ? 52.710 -45.826  -127.429 1.00 155.00 ? 33  ALA A CA    1 
ATOM   67    C C     . ALA A 1 36  ? 52.357 -44.438  -126.905 1.00 159.00 ? 33  ALA A C     1 
ATOM   68    O O     . ALA A 1 36  ? 51.475 -44.288  -126.050 1.00 157.82 ? 33  ALA A O     1 
ATOM   69    C CB    . ALA A 1 36  ? 54.023 -46.315  -126.815 1.00 164.11 ? 33  ALA A CB    1 
ATOM   70    N N     . GLU A 1 37  ? 53.044 -43.408  -127.406 1.00 162.72 ? 34  GLU A N     1 
ATOM   71    C CA    . GLU A 1 37  ? 52.813 -42.050  -126.924 1.00 161.50 ? 34  GLU A CA    1 
ATOM   72    C C     . GLU A 1 37  ? 51.389 -41.599  -127.225 1.00 162.41 ? 34  GLU A C     1 
ATOM   73    O O     . GLU A 1 37  ? 50.686 -41.080  -126.347 1.00 151.58 ? 34  GLU A O     1 
ATOM   74    C CB    . GLU A 1 37  ? 53.824 -41.091  -127.556 1.00 161.22 ? 34  GLU A CB    1 
ATOM   75    C CG    . GLU A 1 37  ? 55.236 -41.645  -127.692 1.00 164.12 ? 34  GLU A CG    1 
ATOM   76    C CD    . GLU A 1 37  ? 55.457 -42.356  -129.014 1.00 162.12 ? 34  GLU A CD    1 
ATOM   77    O OE1   . GLU A 1 37  ? 55.237 -41.729  -130.072 1.00 166.66 ? 34  GLU A OE1   1 
ATOM   78    O OE2   . GLU A 1 37  ? 55.848 -43.542  -128.995 1.00 151.71 ? 34  GLU A OE2   1 
ATOM   79    N N     . GLU A 1 38  ? 50.955 -41.778  -128.476 1.00 161.40 ? 35  GLU A N     1 
ATOM   80    C CA    . GLU A 1 38  ? 49.595 -41.422  -128.870 1.00 152.63 ? 35  GLU A CA    1 
ATOM   81    C C     . GLU A 1 38  ? 48.565 -42.173  -128.034 1.00 146.80 ? 35  GLU A C     1 
ATOM   82    O O     . GLU A 1 38  ? 47.587 -41.584  -127.556 1.00 135.57 ? 35  GLU A O     1 
ATOM   83    C CB    . GLU A 1 38  ? 49.406 -41.710  -130.360 1.00 158.35 ? 35  GLU A CB    1 
ATOM   84    C CG    . GLU A 1 38  ? 48.157 -41.108  -130.979 1.00 168.12 ? 35  GLU A CG    1 
ATOM   85    C CD    . GLU A 1 38  ? 48.102 -41.313  -132.483 1.00 160.23 ? 35  GLU A CD    1 
ATOM   86    O OE1   . GLU A 1 38  ? 47.114 -40.875  -133.108 1.00 157.15 ? 35  GLU A OE1   1 
ATOM   87    O OE2   . GLU A 1 38  ? 49.046 -41.913  -133.040 1.00 146.45 ? 35  GLU A OE2   1 
ATOM   88    N N     . TYR A 1 39  ? 48.774 -43.480  -127.846 1.00 153.16 ? 36  TYR A N     1 
ATOM   89    C CA    . TYR A 1 39  ? 47.870 -44.280  -127.025 1.00 146.45 ? 36  TYR A CA    1 
ATOM   90    C C     . TYR A 1 39  ? 47.740 -43.710  -125.618 1.00 141.00 ? 36  TYR A C     1 
ATOM   91    O O     . TYR A 1 39  ? 46.628 -43.480  -125.128 1.00 135.83 ? 36  TYR A O     1 
ATOM   92    C CB    . TYR A 1 39  ? 48.352 -45.731  -126.953 1.00 144.27 ? 36  TYR A CB    1 
ATOM   93    C CG    . TYR A 1 39  ? 47.855 -46.420  -125.702 1.00 141.91 ? 36  TYR A CG    1 
ATOM   94    C CD1   . TYR A 1 39  ? 46.502 -46.671  -125.511 1.00 139.77 ? 36  TYR A CD1   1 
ATOM   95    C CD2   . TYR A 1 39  ? 48.735 -46.772  -124.686 1.00 148.91 ? 36  TYR A CD2   1 
ATOM   96    C CE1   . TYR A 1 39  ? 46.044 -47.273  -124.357 1.00 144.06 ? 36  TYR A CE1   1 
ATOM   97    C CE2   . TYR A 1 39  ? 48.287 -47.376  -123.530 1.00 154.17 ? 36  TYR A CE2   1 
ATOM   98    C CZ    . TYR A 1 39  ? 46.941 -47.624  -123.371 1.00 146.84 ? 36  TYR A CZ    1 
ATOM   99    O OH    . TYR A 1 39  ? 46.491 -48.223  -122.219 1.00 138.41 ? 36  TYR A OH    1 
ATOM   100   N N     . GLN A 1 40  ? 48.873 -43.525  -124.934 1.00 141.38 ? 37  GLN A N     1 
ATOM   101   C CA    . GLN A 1 40  ? 48.826 -43.073  -123.547 1.00 147.74 ? 37  GLN A CA    1 
ATOM   102   C C     . GLN A 1 40  ? 48.190 -41.694  -123.439 1.00 143.77 ? 37  GLN A C     1 
ATOM   103   O O     . GLN A 1 40  ? 47.369 -41.445  -122.543 1.00 133.67 ? 37  GLN A O     1 
ATOM   104   C CB    . GLN A 1 40  ? 50.233 -43.069  -122.949 1.00 162.06 ? 37  GLN A CB    1 
ATOM   105   C CG    . GLN A 1 40  ? 50.265 -43.327  -121.452 1.00 165.98 ? 37  GLN A CG    1 
ATOM   106   C CD    . GLN A 1 40  ? 51.656 -43.203  -120.863 1.00 170.05 ? 37  GLN A CD    1 
ATOM   107   O OE1   . GLN A 1 40  ? 52.580 -42.717  -121.516 1.00 171.06 ? 37  GLN A OE1   1 
ATOM   108   N NE2   . GLN A 1 40  ? 51.813 -43.647  -119.621 1.00 172.01 ? 37  GLN A NE2   1 
ATOM   109   N N     . ALA A 1 41  ? 48.551 -40.788  -124.353 1.00 145.36 ? 38  ALA A N     1 
ATOM   110   C CA    . ALA A 1 41  ? 47.968 -39.451  -124.348 1.00 139.31 ? 38  ALA A CA    1 
ATOM   111   C C     . ALA A 1 41  ? 46.454 -39.511  -124.503 1.00 138.95 ? 38  ALA A C     1 
ATOM   112   O O     . ALA A 1 41  ? 45.717 -38.876  -123.739 1.00 133.12 ? 38  ALA A O     1 
ATOM   113   C CB    . ALA A 1 41  ? 48.595 -38.608  -125.458 1.00 140.20 ? 38  ALA A CB    1 
ATOM   114   N N     . ILE A 1 42  ? 45.972 -40.272  -125.492 1.00 140.30 ? 39  ILE A N     1 
ATOM   115   C CA    . ILE A 1 42  ? 44.534 -40.361  -125.732 1.00 135.96 ? 39  ILE A CA    1 
ATOM   116   C C     . ILE A 1 42  ? 43.824 -40.966  -124.530 1.00 144.10 ? 39  ILE A C     1 
ATOM   117   O O     . ILE A 1 42  ? 42.754 -40.501  -124.130 1.00 143.23 ? 39  ILE A O     1 
ATOM   118   C CB    . ILE A 1 42  ? 44.250 -41.163  -127.016 1.00 131.91 ? 39  ILE A CB    1 
ATOM   119   C CG1   . ILE A 1 42  ? 44.616 -40.337  -128.245 1.00 137.39 ? 39  ILE A CG1   1 
ATOM   120   C CG2   . ILE A 1 42  ? 42.782 -41.555  -127.084 1.00 130.68 ? 39  ILE A CG2   1 
ATOM   121   C CD1   . ILE A 1 42  ? 44.769 -41.153  -129.503 1.00 144.52 ? 39  ILE A CD1   1 
ATOM   122   N N     . GLN A 1 43  ? 44.398 -42.019  -123.944 1.00 144.25 ? 40  GLN A N     1 
ATOM   123   C CA    . GLN A 1 43  ? 43.782 -42.657  -122.783 1.00 130.01 ? 40  GLN A CA    1 
ATOM   124   C C     . GLN A 1 43  ? 43.620 -41.663  -121.637 1.00 133.20 ? 40  GLN A C     1 
ATOM   125   O O     . GLN A 1 43  ? 42.513 -41.470  -121.107 1.00 124.73 ? 40  GLN A O     1 
ATOM   126   C CB    . GLN A 1 43  ? 44.635 -43.850  -122.348 1.00 126.10 ? 40  GLN A CB    1 
ATOM   127   C CG    . GLN A 1 43  ? 44.184 -44.575  -121.086 1.00 146.62 ? 40  GLN A CG    1 
ATOM   128   C CD    . GLN A 1 43  ? 43.039 -45.542  -121.339 1.00 148.32 ? 40  GLN A CD    1 
ATOM   129   O OE1   . GLN A 1 43  ? 42.070 -45.218  -122.025 1.00 141.30 ? 40  GLN A OE1   1 
ATOM   130   N NE2   . GLN A 1 43  ? 43.162 -46.751  -120.800 1.00 154.39 ? 40  GLN A NE2   1 
ATOM   131   N N     . LYS A 1 44  ? 44.719 -41.002  -121.259 1.00 144.32 ? 41  LYS A N     1 
ATOM   132   C CA    . LYS A 1 44  ? 44.669 -40.067  -120.140 1.00 143.94 ? 41  LYS A CA    1 
ATOM   133   C C     . LYS A 1 44  ? 43.725 -38.908  -120.432 1.00 145.69 ? 41  LYS A C     1 
ATOM   134   O O     . LYS A 1 44  ? 43.005 -38.447  -119.539 1.00 144.87 ? 41  LYS A O     1 
ATOM   135   C CB    . LYS A 1 44  ? 46.073 -39.551  -119.818 1.00 148.63 ? 41  LYS A CB    1 
ATOM   136   C CG    . LYS A 1 44  ? 47.071 -40.639  -119.436 1.00 154.04 ? 41  LYS A CG    1 
ATOM   137   C CD    . LYS A 1 44  ? 48.394 -40.038  -118.977 1.00 152.04 ? 41  LYS A CD    1 
ATOM   138   C CE    . LYS A 1 44  ? 49.440 -41.112  -118.718 1.00 158.22 ? 41  LYS A CE    1 
ATOM   139   N NZ    . LYS A 1 44  ? 48.968 -42.125  -117.734 1.00 148.54 ? 41  LYS A NZ    1 
ATOM   140   N N     . ALA A 1 45  ? 43.708 -38.426  -121.678 1.00 142.42 ? 42  ALA A N     1 
ATOM   141   C CA    . ALA A 1 45  ? 42.776 -37.365  -122.039 1.00 146.40 ? 42  ALA A CA    1 
ATOM   142   C C     . ALA A 1 45  ? 41.331 -37.846  -122.011 1.00 147.09 ? 42  ALA A C     1 
ATOM   143   O O     . ALA A 1 45  ? 40.422 -37.055  -121.739 1.00 148.33 ? 42  ALA A O     1 
ATOM   144   C CB    . ALA A 1 45  ? 43.128 -36.810  -123.418 1.00 154.92 ? 42  ALA A CB    1 
ATOM   145   N N     . LEU A 1 46  ? 41.099 -39.133  -122.273 1.00 145.39 ? 43  LEU A N     1 
ATOM   146   C CA    . LEU A 1 46  ? 39.743 -39.662  -122.257 1.00 149.90 ? 43  LEU A CA    1 
ATOM   147   C C     . LEU A 1 46  ? 39.239 -39.925  -120.849 1.00 143.29 ? 43  LEU A C     1 
ATOM   148   O O     . LEU A 1 46  ? 38.023 -39.997  -120.647 1.00 129.49 ? 43  LEU A O     1 
ATOM   149   C CB    . LEU A 1 46  ? 39.654 -40.950  -123.079 1.00 148.75 ? 43  LEU A CB    1 
ATOM   150   C CG    . LEU A 1 46  ? 39.593 -40.776  -124.597 1.00 164.02 ? 43  LEU A CG    1 
ATOM   151   C CD1   . LEU A 1 46  ? 39.519 -42.121  -125.296 1.00 141.35 ? 43  LEU A CD1   1 
ATOM   152   C CD2   . LEU A 1 46  ? 38.410 -39.907  -124.982 1.00 158.42 ? 43  LEU A CD2   1 
ATOM   153   N N     . ARG A 1 47  ? 40.135 -40.062  -119.871 1.00 143.49 ? 44  ARG A N     1 
ATOM   154   C CA    . ARG A 1 47  ? 39.640 -40.143  -118.500 1.00 134.88 ? 44  ARG A CA    1 
ATOM   155   C C     . ARG A 1 47  ? 39.091 -38.816  -117.977 1.00 136.57 ? 44  ARG A C     1 
ATOM   156   O O     . ARG A 1 47  ? 38.452 -38.812  -116.920 1.00 140.61 ? 44  ARG A O     1 
ATOM   157   C CB    . ARG A 1 47  ? 40.729 -40.655  -117.559 1.00 132.70 ? 44  ARG A CB    1 
ATOM   158   C CG    . ARG A 1 47  ? 40.912 -42.156  -117.613 1.00 129.25 ? 44  ARG A CG    1 
ATOM   159   C CD    . ARG A 1 47  ? 41.916 -42.624  -116.583 1.00 122.67 ? 44  ARG A CD    1 
ATOM   160   N NE    . ARG A 1 47  ? 43.282 -42.413  -117.042 1.00 140.42 ? 44  ARG A NE    1 
ATOM   161   C CZ    . ARG A 1 47  ? 44.110 -43.395  -117.375 1.00 143.25 ? 44  ARG A CZ    1 
ATOM   162   N NH1   . ARG A 1 47  ? 43.705 -44.656  -117.304 1.00 146.87 ? 44  ARG A NH1   1 
ATOM   163   N NH2   . ARG A 1 47  ? 45.339 -43.117  -117.787 1.00 128.46 ? 44  ARG A NH2   1 
ATOM   164   N N     . GLN A 1 48  ? 39.308 -37.707  -118.685 1.00 139.08 ? 45  GLN A N     1 
ATOM   165   C CA    . GLN A 1 48  ? 38.816 -36.403  -118.250 1.00 145.23 ? 45  GLN A CA    1 
ATOM   166   C C     . GLN A 1 48  ? 37.287 -36.348  -118.205 1.00 146.44 ? 45  GLN A C     1 
ATOM   167   O O     . GLN A 1 48  ? 36.584 -37.099  -118.887 1.00 153.28 ? 45  GLN A O     1 
ATOM   168   C CB    . GLN A 1 48  ? 39.323 -35.301  -119.180 1.00 148.06 ? 45  GLN A CB    1 
ATOM   169   C CG    . GLN A 1 48  ? 40.802 -34.987  -119.051 1.00 159.03 ? 45  GLN A CG    1 
ATOM   170   C CD    . GLN A 1 48  ? 41.193 -33.746  -119.832 1.00 163.54 ? 45  GLN A CD    1 
ATOM   171   O OE1   . GLN A 1 48  ? 40.995 -33.672  -121.045 1.00 161.37 ? 45  GLN A OE1   1 
ATOM   172   N NE2   . GLN A 1 48  ? 41.752 -32.762  -119.137 1.00 161.30 ? 45  GLN A NE2   1 
ATOM   173   N N     . ARG A 1 49  ? 36.780 -35.438  -117.375 1.00 136.90 ? 46  ARG A N     1 
ATOM   174   C CA    . ARG A 1 49  ? 35.375 -35.059  -117.334 1.00 137.45 ? 46  ARG A CA    1 
ATOM   175   C C     . ARG A 1 49  ? 35.197 -33.669  -117.935 1.00 151.61 ? 46  ARG A C     1 
ATOM   176   O O     . ARG A 1 49  ? 36.149 -32.891  -118.044 1.00 162.38 ? 46  ARG A O     1 
ATOM   177   C CB    . ARG A 1 49  ? 34.834 -35.079  -115.898 1.00 141.61 ? 46  ARG A CB    1 
ATOM   178   C CG    . ARG A 1 49  ? 34.596 -36.471  -115.329 1.00 152.30 ? 46  ARG A CG    1 
ATOM   179   C CD    . ARG A 1 49  ? 34.075 -36.400  -113.898 1.00 159.60 ? 46  ARG A CD    1 
ATOM   180   N NE    . ARG A 1 49  ? 33.523 -37.672  -113.440 1.00 161.71 ? 46  ARG A NE    1 
ATOM   181   C CZ    . ARG A 1 49  ? 34.252 -38.676  -112.963 1.00 158.79 ? 46  ARG A CZ    1 
ATOM   182   N NH1   . ARG A 1 49  ? 35.570 -38.558  -112.877 1.00 141.48 ? 46  ARG A NH1   1 
ATOM   183   N NH2   . ARG A 1 49  ? 33.665 -39.798  -112.567 1.00 164.01 ? 46  ARG A NH2   1 
ATOM   184   N N     . LEU A 1 50  ? 33.963 -33.356  -118.324 1.00 155.35 ? 47  LEU A N     1 
ATOM   185   C CA    . LEU A 1 50  ? 33.675 -32.096  -118.998 1.00 165.46 ? 47  LEU A CA    1 
ATOM   186   C C     . LEU A 1 50  ? 33.260 -31.018  -118.001 1.00 154.21 ? 47  LEU A C     1 
ATOM   187   O O     . LEU A 1 50  ? 32.738 -31.306  -116.921 1.00 147.66 ? 47  LEU A O     1 
ATOM   188   C CB    . LEU A 1 50  ? 32.576 -32.272  -120.050 1.00 170.03 ? 47  LEU A CB    1 
ATOM   189   C CG    . LEU A 1 50  ? 32.885 -33.103  -121.301 1.00 149.10 ? 47  LEU A CG    1 
ATOM   190   C CD1   . LEU A 1 50  ? 34.260 -32.753  -121.861 1.00 147.88 ? 47  LEU A CD1   1 
ATOM   191   C CD2   . LEU A 1 50  ? 32.763 -34.596  -121.042 1.00 141.99 ? 47  LEU A CD2   1 
ATOM   192   N N     . GLY A 1 51  ? 33.500 -29.765  -118.382 1.00 156.54 ? 48  GLY A N     1 
ATOM   193   C CA    . GLY A 1 51  ? 33.128 -28.628  -117.574 1.00 170.35 ? 48  GLY A CA    1 
ATOM   194   C C     . GLY A 1 51  ? 31.797 -28.028  -117.984 1.00 167.11 ? 48  GLY A C     1 
ATOM   195   O O     . GLY A 1 51  ? 31.182 -28.441  -118.972 1.00 170.39 ? 48  GLY A O     1 
ATOM   196   N N     . PRO A 1 52  ? 31.319 -27.043  -117.217 1.00 159.79 ? 49  PRO A N     1 
ATOM   197   C CA    . PRO A 1 52  ? 30.053 -26.379  -117.575 1.00 151.24 ? 49  PRO A CA    1 
ATOM   198   C C     . PRO A 1 52  ? 30.062 -25.715  -118.942 1.00 161.86 ? 49  PRO A C     1 
ATOM   199   O O     . PRO A 1 52  ? 28.983 -25.443  -119.483 1.00 158.40 ? 49  PRO A O     1 
ATOM   200   C CB    . PRO A 1 52  ? 29.876 -25.343  -116.457 1.00 163.22 ? 49  PRO A CB    1 
ATOM   201   C CG    . PRO A 1 52  ? 30.614 -25.922  -115.300 1.00 178.52 ? 49  PRO A CG    1 
ATOM   202   C CD    . PRO A 1 52  ? 31.809 -26.617  -115.895 1.00 169.15 ? 49  PRO A CD    1 
ATOM   203   N N     . GLU A 1 53  ? 31.235 -25.441  -119.520 1.00 171.38 ? 50  GLU A N     1 
ATOM   204   C CA    . GLU A 1 53  ? 31.294 -24.819  -120.838 1.00 173.39 ? 50  GLU A CA    1 
ATOM   205   C C     . GLU A 1 53  ? 30.769 -25.726  -121.944 1.00 155.05 ? 50  GLU A C     1 
ATOM   206   O O     . GLU A 1 53  ? 30.565 -25.250  -123.066 1.00 142.74 ? 50  GLU A O     1 
ATOM   207   C CB    . GLU A 1 53  ? 32.729 -24.399  -121.175 1.00 179.68 ? 50  GLU A CB    1 
ATOM   208   C CG    . GLU A 1 53  ? 33.433 -23.572  -120.106 1.00 192.75 ? 50  GLU A CG    1 
ATOM   209   C CD    . GLU A 1 53  ? 34.045 -24.424  -119.009 1.00 181.21 ? 50  GLU A CD    1 
ATOM   210   O OE1   . GLU A 1 53  ? 33.284 -25.016  -118.217 1.00 163.25 ? 50  GLU A OE1   1 
ATOM   211   O OE2   . GLU A 1 53  ? 35.290 -24.499  -118.940 1.00 172.72 ? 50  GLU A OE2   1 
ATOM   212   N N     . TYR A 1 54  ? 30.548 -27.006  -121.658 1.00 153.69 ? 51  TYR A N     1 
ATOM   213   C CA    . TYR A 1 54  ? 30.049 -27.965  -122.635 1.00 149.34 ? 51  TYR A CA    1 
ATOM   214   C C     . TYR A 1 54  ? 28.633 -28.431  -122.350 1.00 142.74 ? 51  TYR A C     1 
ATOM   215   O O     . TYR A 1 54  ? 27.829 -28.552  -123.278 1.00 142.65 ? 51  TYR A O     1 
ATOM   216   C CB    . TYR A 1 54  ? 30.976 -29.184  -122.690 1.00 141.96 ? 51  TYR A CB    1 
ATOM   217   C CG    . TYR A 1 54  ? 32.334 -28.882  -123.276 1.00 147.97 ? 51  TYR A CG    1 
ATOM   218   C CD1   . TYR A 1 54  ? 32.463 -28.064  -124.389 1.00 152.05 ? 51  TYR A CD1   1 
ATOM   219   C CD2   . TYR A 1 54  ? 33.488 -29.406  -122.708 1.00 147.49 ? 51  TYR A CD2   1 
ATOM   220   C CE1   . TYR A 1 54  ? 33.702 -27.782  -124.927 1.00 154.82 ? 51  TYR A CE1   1 
ATOM   221   C CE2   . TYR A 1 54  ? 34.731 -29.130  -123.239 1.00 157.74 ? 51  TYR A CE2   1 
ATOM   222   C CZ    . TYR A 1 54  ? 34.832 -28.317  -124.348 1.00 159.66 ? 51  TYR A CZ    1 
ATOM   223   O OH    . TYR A 1 54  ? 36.068 -28.037  -124.883 1.00 153.66 ? 51  TYR A OH    1 
ATOM   224   N N     . ILE A 1 55  ? 28.312 -28.703  -121.086 1.00 134.38 ? 52  ILE A N     1 
ATOM   225   C CA    . ILE A 1 55  ? 26.988 -29.198  -120.739 1.00 132.71 ? 52  ILE A CA    1 
ATOM   226   C C     . ILE A 1 55  ? 25.943 -28.119  -121.002 1.00 138.99 ? 52  ILE A C     1 
ATOM   227   O O     . ILE A 1 55  ? 26.202 -26.915  -120.866 1.00 148.36 ? 52  ILE A O     1 
ATOM   228   C CB    . ILE A 1 55  ? 26.955 -29.653  -119.268 1.00 136.66 ? 52  ILE A CB    1 
ATOM   229   C CG1   . ILE A 1 55  ? 28.240 -30.398  -118.904 1.00 146.34 ? 52  ILE A CG1   1 
ATOM   230   C CG2   . ILE A 1 55  ? 25.745 -30.533  -119.005 1.00 128.52 ? 52  ILE A CG2   1 
ATOM   231   C CD1   . ILE A 1 55  ? 28.468 -31.664  -119.704 1.00 147.13 ? 52  ILE A CD1   1 
ATOM   232   N N     . SER A 1 56  ? 24.747 -28.556  -121.387 1.00 130.45 ? 53  SER A N     1 
ATOM   233   C CA    . SER A 1 56  ? 23.585 -27.695  -121.530 1.00 132.24 ? 53  SER A CA    1 
ATOM   234   C C     . SER A 1 56  ? 22.418 -28.366  -120.817 1.00 134.53 ? 53  SER A C     1 
ATOM   235   O O     . SER A 1 56  ? 22.547 -29.474  -120.285 1.00 136.65 ? 53  SER A O     1 
ATOM   236   C CB    . SER A 1 56  ? 23.264 -27.430  -123.007 1.00 142.93 ? 53  SER A CB    1 
ATOM   237   O OG    . SER A 1 56  ? 24.326 -26.741  -123.645 1.00 145.44 ? 53  SER A OG    1 
ATOM   238   N N     . SER A 1 57  ? 21.244 -27.746  -120.896 1.00 139.35 ? 54  SER A N     1 
ATOM   239   C CA    . SER A 1 57  ? 20.112 -28.195  -120.102 1.00 147.67 ? 54  SER A CA    1 
ATOM   240   C C     . SER A 1 57  ? 18.814 -28.060  -120.880 1.00 149.86 ? 54  SER A C     1 
ATOM   241   O O     . SER A 1 57  ? 18.631 -27.117  -121.656 1.00 140.06 ? 54  SER A O     1 
ATOM   242   C CB    . SER A 1 57  ? 20.009 -27.409  -118.790 1.00 139.68 ? 54  SER A CB    1 
ATOM   243   O OG    . SER A 1 57  ? 19.412 -26.141  -118.995 1.00 135.40 ? 54  SER A OG    1 
ATOM   244   N N     . ARG A 1 58  ? 17.924 -29.023  -120.659 1.00 155.29 ? 55  ARG A N     1 
ATOM   245   C CA    . ARG A 1 58  ? 16.588 -29.049  -121.228 1.00 161.45 ? 55  ARG A CA    1 
ATOM   246   C C     . ARG A 1 58  ? 15.576 -29.212  -120.104 1.00 168.03 ? 55  ARG A C     1 
ATOM   247   O O     . ARG A 1 58  ? 15.926 -29.522  -118.961 1.00 165.83 ? 55  ARG A O     1 
ATOM   248   C CB    . ARG A 1 58  ? 16.441 -30.195  -122.239 1.00 168.92 ? 55  ARG A CB    1 
ATOM   249   C CG    . ARG A 1 58  ? 16.369 -31.579  -121.616 1.00 169.99 ? 55  ARG A CG    1 
ATOM   250   C CD    . ARG A 1 58  ? 16.159 -32.645  -122.681 1.00 162.86 ? 55  ARG A CD    1 
ATOM   251   N NE    . ARG A 1 58  ? 14.850 -32.565  -123.322 1.00 167.26 ? 55  ARG A NE    1 
ATOM   252   C CZ    . ARG A 1 58  ? 14.443 -33.379  -124.290 1.00 179.15 ? 55  ARG A CZ    1 
ATOM   253   N NH1   . ARG A 1 58  ? 15.305 -34.203  -124.868 1.00 167.54 ? 55  ARG A NH1   1 
ATOM   254   N NH2   . ARG A 1 58  ? 13.226 -33.248  -124.799 1.00 196.80 ? 55  ARG A NH2   1 
ATOM   255   N N     . MET A 1 59  ? 14.303 -29.042  -120.449 1.00 175.31 ? 56  MET A N     1 
ATOM   256   C CA    . MET A 1 59  ? 13.196 -29.212  -119.512 1.00 177.39 ? 56  MET A CA    1 
ATOM   257   C C     . MET A 1 59  ? 12.371 -30.404  -119.983 1.00 169.94 ? 56  MET A C     1 
ATOM   258   O O     . MET A 1 59  ? 11.607 -30.298  -120.948 1.00 167.88 ? 56  MET A O     1 
ATOM   259   C CB    . MET A 1 59  ? 12.353 -27.942  -119.422 1.00 181.19 ? 56  MET A CB    1 
ATOM   260   C CG    . MET A 1 59  ? 13.027 -26.799  -118.679 1.00 183.87 ? 56  MET A CG    1 
ATOM   261   S SD    . MET A 1 59  ? 13.630 -27.270  -117.045 1.00 200.88 ? 56  MET A SD    1 
ATOM   262   C CE    . MET A 1 59  ? 12.104 -27.755  -116.242 1.00 193.32 ? 56  MET A CE    1 
ATOM   263   N N     . ALA A 1 60  ? 12.529 -31.535  -119.301 1.00 172.19 ? 57  ALA A N     1 
ATOM   264   C CA    . ALA A 1 60  ? 11.780 -32.733  -119.654 1.00 177.89 ? 57  ALA A CA    1 
ATOM   265   C C     . ALA A 1 60  ? 10.285 -32.521  -119.448 1.00 178.65 ? 57  ALA A C     1 
ATOM   266   O O     . ALA A 1 60  ? 9.855  -31.767  -118.570 1.00 163.59 ? 57  ALA A O     1 
ATOM   267   C CB    . ALA A 1 60  ? 12.259 -33.925  -118.824 1.00 172.13 ? 57  ALA A CB    1 
ATOM   268   N N     . GLY A 1 61  ? 9.489  -33.197  -120.273 1.00 193.76 ? 58  GLY A N     1 
ATOM   269   C CA    . GLY A 1 61  ? 8.047  -33.137  -120.143 1.00 196.57 ? 58  GLY A CA    1 
ATOM   270   C C     . GLY A 1 61  ? 7.581  -33.894  -118.918 1.00 197.61 ? 58  GLY A C     1 
ATOM   271   O O     . GLY A 1 61  ? 7.714  -35.120  -118.850 1.00 196.30 ? 58  GLY A O     1 
ATOM   272   N N     . GLY A 1 62  ? 7.030  -33.174  -117.941 1.00 203.63 ? 59  GLY A N     1 
ATOM   273   C CA    . GLY A 1 62  ? 6.674  -33.754  -116.666 1.00 200.04 ? 59  GLY A CA    1 
ATOM   274   C C     . GLY A 1 62  ? 7.831  -33.971  -115.716 1.00 192.15 ? 59  GLY A C     1 
ATOM   275   O O     . GLY A 1 62  ? 7.608  -34.068  -114.503 1.00 179.43 ? 59  GLY A O     1 
ATOM   276   N N     . GLY A 1 63  ? 9.060  -34.055  -116.222 1.00 189.73 ? 60  GLY A N     1 
ATOM   277   C CA    . GLY A 1 63  ? 10.221 -34.255  -115.377 1.00 179.55 ? 60  GLY A CA    1 
ATOM   278   C C     . GLY A 1 63  ? 10.852 -32.954  -114.929 1.00 184.87 ? 60  GLY A C     1 
ATOM   279   O O     . GLY A 1 63  ? 10.146 -31.985  -114.634 1.00 187.60 ? 60  GLY A O     1 
ATOM   280   N N     . GLN A 1 64  ? 12.184 -32.915  -114.877 1.00 185.81 ? 61  GLN A N     1 
ATOM   281   C CA    . GLN A 1 64  ? 12.897 -31.731  -114.412 1.00 182.54 ? 61  GLN A CA    1 
ATOM   282   C C     . GLN A 1 64  ? 14.046 -31.380  -115.349 1.00 181.49 ? 61  GLN A C     1 
ATOM   283   O O     . GLN A 1 64  ? 14.137 -31.905  -116.464 1.00 179.03 ? 61  GLN A O     1 
ATOM   284   C CB    . GLN A 1 64  ? 13.428 -31.930  -112.987 1.00 173.33 ? 61  GLN A CB    1 
ATOM   285   C CG    . GLN A 1 64  ? 12.552 -32.786  -112.089 1.00 177.90 ? 61  GLN A CG    1 
ATOM   286   C CD    . GLN A 1 64  ? 12.990 -34.237  -112.065 1.00 171.86 ? 61  GLN A CD    1 
ATOM   287   O OE1   . GLN A 1 64  ? 13.166 -34.861  -113.110 1.00 170.00 ? 61  GLN A OE1   1 
ATOM   288   N NE2   . GLN A 1 64  ? 13.170 -34.781  -110.868 1.00 161.10 ? 61  GLN A NE2   1 
ATOM   289   N N     . LYS A 1 65  ? 14.907 -30.469  -114.901 1.00 183.16 ? 62  LYS A N     1 
ATOM   290   C CA    . LYS A 1 65  ? 16.072 -30.051  -115.670 1.00 178.80 ? 62  LYS A CA    1 
ATOM   291   C C     . LYS A 1 65  ? 16.980 -31.239  -115.966 1.00 173.00 ? 62  LYS A C     1 
ATOM   292   O O     . LYS A 1 65  ? 17.499 -31.882  -115.048 1.00 166.09 ? 62  LYS A O     1 
ATOM   293   C CB    . LYS A 1 65  ? 16.826 -28.969  -114.896 1.00 177.75 ? 62  LYS A CB    1 
ATOM   294   C CG    . LYS A 1 65  ? 18.055 -28.403  -115.587 1.00 169.67 ? 62  LYS A CG    1 
ATOM   295   C CD    . LYS A 1 65  ? 18.700 -27.331  -114.714 1.00 164.37 ? 62  LYS A CD    1 
ATOM   296   C CE    . LYS A 1 65  ? 20.000 -26.814  -115.308 1.00 156.57 ? 62  LYS A CE    1 
ATOM   297   N NZ    . LYS A 1 65  ? 20.604 -25.731  -114.482 1.00 126.22 ? 62  LYS A NZ    1 
ATOM   298   N N     . VAL A 1 66  ? 17.172 -31.528  -117.251 1.00 179.38 ? 63  VAL A N     1 
ATOM   299   C CA    . VAL A 1 66  ? 18.060 -32.595  -117.698 1.00 161.93 ? 63  VAL A CA    1 
ATOM   300   C C     . VAL A 1 66  ? 19.281 -31.959  -118.347 1.00 152.40 ? 63  VAL A C     1 
ATOM   301   O O     . VAL A 1 66  ? 19.220 -30.837  -118.857 1.00 149.67 ? 63  VAL A O     1 
ATOM   302   C CB    . VAL A 1 66  ? 17.350 -33.558  -118.677 1.00 157.86 ? 63  VAL A CB    1 
ATOM   303   C CG1   . VAL A 1 66  ? 18.159 -34.837  -118.871 1.00 157.53 ? 63  VAL A CG1   1 
ATOM   304   C CG2   . VAL A 1 66  ? 15.949 -33.881  -118.189 1.00 163.14 ? 63  VAL A CG2   1 
ATOM   305   N N     . CYS A 1 67  ? 20.396 -32.683  -118.331 1.00 146.05 ? 64  CYS A N     1 
ATOM   306   C CA    . CYS A 1 67  ? 21.658 -32.189  -118.861 1.00 142.99 ? 64  CYS A CA    1 
ATOM   307   C C     . CYS A 1 67  ? 22.055 -32.990  -120.093 1.00 135.77 ? 64  CYS A C     1 
ATOM   308   O O     . CYS A 1 67  ? 21.833 -34.203  -120.156 1.00 128.04 ? 64  CYS A O     1 
ATOM   309   C CB    . CYS A 1 67  ? 22.764 -32.268  -117.806 1.00 143.50 ? 64  CYS A CB    1 
ATOM   310   S SG    . CYS A 1 67  ? 22.257 -31.727  -116.158 1.00 176.39 ? 64  CYS A SG    1 
ATOM   311   N N     . TYR A 1 68  ? 22.636 -32.301  -121.073 1.00 130.94 ? 65  TYR A N     1 
ATOM   312   C CA    . TYR A 1 68  ? 23.029 -32.939  -122.324 1.00 125.31 ? 65  TYR A CA    1 
ATOM   313   C C     . TYR A 1 68  ? 24.266 -32.246  -122.881 1.00 119.70 ? 65  TYR A C     1 
ATOM   314   O O     . TYR A 1 68  ? 24.773 -31.278  -122.311 1.00 140.77 ? 65  TYR A O     1 
ATOM   315   C CB    . TYR A 1 68  ? 21.883 -32.921  -123.342 1.00 125.82 ? 65  TYR A CB    1 
ATOM   316   C CG    . TYR A 1 68  ? 21.477 -31.538  -123.810 1.00 121.82 ? 65  TYR A CG    1 
ATOM   317   C CD1   . TYR A 1 68  ? 22.113 -30.930  -124.887 1.00 130.94 ? 65  TYR A CD1   1 
ATOM   318   C CD2   . TYR A 1 68  ? 20.442 -30.850  -123.191 1.00 124.68 ? 65  TYR A CD2   1 
ATOM   319   C CE1   . TYR A 1 68  ? 21.741 -29.673  -125.320 1.00 142.16 ? 65  TYR A CE1   1 
ATOM   320   C CE2   . TYR A 1 68  ? 20.061 -29.592  -123.621 1.00 137.67 ? 65  TYR A CE2   1 
ATOM   321   C CZ    . TYR A 1 68  ? 20.713 -29.009  -124.686 1.00 144.38 ? 65  TYR A CZ    1 
ATOM   322   O OH    . TYR A 1 68  ? 20.340 -27.757  -125.118 1.00 143.06 ? 65  TYR A OH    1 
ATOM   323   N N     . ILE A 1 69  ? 24.755 -32.763  -124.008 1.00 109.64 ? 66  ILE A N     1 
ATOM   324   C CA    . ILE A 1 69  ? 25.868 -32.175  -124.745 1.00 109.55 ? 66  ILE A CA    1 
ATOM   325   C C     . ILE A 1 69  ? 25.436 -31.993  -126.193 1.00 124.47 ? 66  ILE A C     1 
ATOM   326   O O     . ILE A 1 69  ? 24.989 -32.950  -126.836 1.00 127.66 ? 66  ILE A O     1 
ATOM   327   C CB    . ILE A 1 69  ? 27.138 -33.044  -124.666 1.00 91.93  ? 66  ILE A CB    1 
ATOM   328   C CG1   . ILE A 1 69  ? 27.506 -33.326  -123.208 1.00 98.04  ? 66  ILE A CG1   1 
ATOM   329   C CG2   . ILE A 1 69  ? 28.295 -32.359  -125.372 1.00 97.16  ? 66  ILE A CG2   1 
ATOM   330   C CD1   . ILE A 1 69  ? 28.723 -34.210  -123.049 1.00 120.21 ? 66  ILE A CD1   1 
ATOM   331   N N     . GLU A 1 70  ? 25.560 -30.768  -126.700 1.00 135.87 ? 67  GLU A N     1 
ATOM   332   C CA    . GLU A 1 70  ? 25.168 -30.479  -128.074 1.00 136.31 ? 67  GLU A CA    1 
ATOM   333   C C     . GLU A 1 70  ? 26.026 -31.265  -129.064 1.00 122.41 ? 67  GLU A C     1 
ATOM   334   O O     . GLU A 1 70  ? 27.158 -31.655  -128.769 1.00 120.22 ? 67  GLU A O     1 
ATOM   335   C CB    . GLU A 1 70  ? 25.274 -28.979  -128.355 1.00 135.73 ? 67  GLU A CB    1 
ATOM   336   C CG    . GLU A 1 70  ? 24.326 -28.132  -127.519 1.00 138.28 ? 67  GLU A CG    1 
ATOM   337   C CD    . GLU A 1 70  ? 24.350 -26.666  -127.905 1.00 144.47 ? 67  GLU A CD    1 
ATOM   338   O OE1   . GLU A 1 70  ? 24.215 -26.364  -129.109 1.00 135.98 ? 67  GLU A OE1   1 
ATOM   339   O OE2   . GLU A 1 70  ? 24.501 -25.816  -127.002 1.00 154.69 ? 67  GLU A OE2   1 
ATOM   340   N N     . GLY A 1 71  ? 25.465 -31.501  -130.249 1.00 108.22 ? 68  GLY A N     1 
ATOM   341   C CA    . GLY A 1 71  ? 26.119 -32.276  -131.288 1.00 115.93 ? 68  GLY A CA    1 
ATOM   342   C C     . GLY A 1 71  ? 27.485 -31.765  -131.703 1.00 120.87 ? 68  GLY A C     1 
ATOM   343   O O     . GLY A 1 71  ? 28.472 -32.507  -131.641 1.00 114.20 ? 68  GLY A O     1 
ATOM   344   N N     . HIS A 1 72  ? 27.543 -30.507  -132.153 1.00 130.63 ? 69  HIS A N     1 
ATOM   345   C CA    . HIS A 1 72  ? 28.809 -29.909  -132.567 1.00 128.03 ? 69  HIS A CA    1 
ATOM   346   C C     . HIS A 1 72  ? 29.871 -30.011  -131.480 1.00 130.27 ? 69  HIS A C     1 
ATOM   347   O O     . HIS A 1 72  ? 31.060 -30.154  -131.787 1.00 125.85 ? 69  HIS A O     1 
ATOM   348   C CB    . HIS A 1 72  ? 28.597 -28.445  -132.960 1.00 126.37 ? 69  HIS A CB    1 
ATOM   349   C CG    . HIS A 1 72  ? 27.918 -27.627  -131.905 1.00 127.06 ? 69  HIS A CG    1 
ATOM   350   N ND1   . HIS A 1 72  ? 28.610 -26.821  -131.027 1.00 131.89 ? 69  HIS A ND1   1 
ATOM   351   C CD2   . HIS A 1 72  ? 26.608 -27.487  -131.590 1.00 117.65 ? 69  HIS A CD2   1 
ATOM   352   C CE1   . HIS A 1 72  ? 27.757 -26.222  -130.215 1.00 139.66 ? 69  HIS A CE1   1 
ATOM   353   N NE2   . HIS A 1 72  ? 26.536 -26.609  -130.535 1.00 133.88 ? 69  HIS A NE2   1 
ATOM   354   N N     . ARG A 1 73  ? 29.464 -29.942  -130.210 1.00 130.26 ? 70  ARG A N     1 
ATOM   355   C CA    . ARG A 1 73  ? 30.408 -30.122  -129.112 1.00 130.24 ? 70  ARG A CA    1 
ATOM   356   C C     . ARG A 1 73  ? 31.094 -31.481  -129.193 1.00 127.62 ? 70  ARG A C     1 
ATOM   357   O O     . ARG A 1 73  ? 32.326 -31.570  -129.165 1.00 128.73 ? 70  ARG A O     1 
ATOM   358   C CB    . ARG A 1 73  ? 29.688 -29.965  -127.772 1.00 134.99 ? 70  ARG A CB    1 
ATOM   359   C CG    . ARG A 1 73  ? 29.025 -28.612  -127.562 1.00 140.23 ? 70  ARG A CG    1 
ATOM   360   C CD    . ARG A 1 73  ? 29.988 -27.605  -126.952 1.00 145.49 ? 70  ARG A CD    1 
ATOM   361   N NE    . ARG A 1 73  ? 29.406 -26.268  -126.862 1.00 143.82 ? 70  ARG A NE    1 
ATOM   362   C CZ    . ARG A 1 73  ? 28.481 -25.908  -125.977 1.00 145.87 ? 70  ARG A CZ    1 
ATOM   363   N NH1   . ARG A 1 73  ? 28.025 -26.785  -125.091 1.00 146.04 ? 70  ARG A NH1   1 
ATOM   364   N NH2   . ARG A 1 73  ? 28.012 -24.668  -125.974 1.00 153.94 ? 70  ARG A NH2   1 
ATOM   365   N N     . VAL A 1 74  ? 30.305 -32.555  -129.289 1.00 126.07 ? 71  VAL A N     1 
ATOM   366   C CA    . VAL A 1 74  ? 30.868 -33.902  -129.365 1.00 118.49 ? 71  VAL A CA    1 
ATOM   367   C C     . VAL A 1 74  ? 31.687 -34.074  -130.638 1.00 113.72 ? 71  VAL A C     1 
ATOM   368   O O     . VAL A 1 74  ? 32.724 -34.750  -130.642 1.00 99.24  ? 71  VAL A O     1 
ATOM   369   C CB    . VAL A 1 74  ? 29.749 -34.955  -129.270 1.00 108.30 ? 71  VAL A CB    1 
ATOM   370   C CG1   . VAL A 1 74  ? 30.332 -36.318  -128.928 1.00 96.65  ? 71  VAL A CG1   1 
ATOM   371   C CG2   . VAL A 1 74  ? 28.707 -34.537  -128.246 1.00 126.69 ? 71  VAL A CG2   1 
ATOM   372   N N     . ILE A 1 75  ? 31.226 -33.481  -131.741 1.00 117.22 ? 72  ILE A N     1 
ATOM   373   C CA    . ILE A 1 75  ? 31.951 -33.588  -133.005 1.00 117.60 ? 72  ILE A CA    1 
ATOM   374   C C     . ILE A 1 75  ? 33.341 -32.975  -132.872 1.00 125.80 ? 72  ILE A C     1 
ATOM   375   O O     . ILE A 1 75  ? 34.348 -33.576  -133.273 1.00 119.56 ? 72  ILE A O     1 
ATOM   376   C CB    . ILE A 1 75  ? 31.144 -32.934  -134.142 1.00 121.45 ? 72  ILE A CB    1 
ATOM   377   C CG1   . ILE A 1 75  ? 29.930 -33.796  -134.492 1.00 108.16 ? 72  ILE A CG1   1 
ATOM   378   C CG2   . ILE A 1 75  ? 32.018 -32.724  -135.369 1.00 124.14 ? 72  ILE A CG2   1 
ATOM   379   C CD1   . ILE A 1 75  ? 29.265 -33.426  -135.801 1.00 105.21 ? 72  ILE A CD1   1 
ATOM   380   N N     . ASN A 1 76  ? 33.415 -31.764  -132.311 1.00 129.25 ? 73  ASN A N     1 
ATOM   381   C CA    . ASN A 1 76  ? 34.706 -31.121  -132.090 1.00 128.17 ? 73  ASN A CA    1 
ATOM   382   C C     . ASN A 1 76  ? 35.560 -31.911  -131.109 1.00 126.62 ? 73  ASN A C     1 
ATOM   383   O O     . ASN A 1 76  ? 36.774 -32.043  -131.300 1.00 129.67 ? 73  ASN A O     1 
ATOM   384   C CB    . ASN A 1 76  ? 34.503 -29.692  -131.587 1.00 126.88 ? 73  ASN A CB    1 
ATOM   385   C CG    . ASN A 1 76  ? 33.997 -28.763  -132.668 1.00 132.12 ? 73  ASN A CG    1 
ATOM   386   O OD1   . ASN A 1 76  ? 34.488 -28.782  -133.796 1.00 123.20 ? 73  ASN A OD1   1 
ATOM   387   N ND2   . ASN A 1 76  ? 33.010 -27.942  -132.330 1.00 138.23 ? 73  ASN A ND2   1 
ATOM   388   N N     . LEU A 1 77  ? 34.946 -32.435  -130.044 1.00 119.96 ? 74  LEU A N     1 
ATOM   389   C CA    . LEU A 1 77  ? 35.692 -33.242  -129.085 1.00 127.40 ? 74  LEU A CA    1 
ATOM   390   C C     . LEU A 1 77  ? 36.349 -34.437  -129.762 1.00 132.29 ? 74  LEU A C     1 
ATOM   391   O O     . LEU A 1 77  ? 37.521 -34.734  -129.508 1.00 138.07 ? 74  LEU A O     1 
ATOM   392   C CB    . LEU A 1 77  ? 34.771 -33.706  -127.955 1.00 134.37 ? 74  LEU A CB    1 
ATOM   393   C CG    . LEU A 1 77  ? 34.347 -32.652  -126.930 1.00 131.36 ? 74  LEU A CG    1 
ATOM   394   C CD1   . LEU A 1 77  ? 33.160 -33.143  -126.114 1.00 121.42 ? 74  LEU A CD1   1 
ATOM   395   C CD2   . LEU A 1 77  ? 35.512 -32.289  -126.023 1.00 145.80 ? 74  LEU A CD2   1 
ATOM   396   N N     . ALA A 1 78  ? 35.614 -35.129  -130.634 1.00 125.96 ? 75  ALA A N     1 
ATOM   397   C CA    . ALA A 1 78  ? 36.181 -36.277  -131.335 1.00 125.08 ? 75  ALA A CA    1 
ATOM   398   C C     . ALA A 1 78  ? 37.270 -35.848  -132.312 1.00 118.91 ? 75  ALA A C     1 
ATOM   399   O O     . ALA A 1 78  ? 38.362 -36.433  -132.340 1.00 116.20 ? 75  ALA A O     1 
ATOM   400   C CB    . ALA A 1 78  ? 35.077 -37.046  -132.060 1.00 117.02 ? 75  ALA A CB    1 
ATOM   401   N N     . ASN A 1 79  ? 36.989 -34.822  -133.123 1.00 117.61 ? 76  ASN A N     1 
ATOM   402   C CA    . ASN A 1 79  ? 37.971 -34.330  -134.083 1.00 128.13 ? 76  ASN A CA    1 
ATOM   403   C C     . ASN A 1 79  ? 39.245 -33.832  -133.414 1.00 134.07 ? 76  ASN A C     1 
ATOM   404   O O     . ASN A 1 79  ? 40.294 -33.787  -134.064 1.00 137.47 ? 76  ASN A O     1 
ATOM   405   C CB    . ASN A 1 79  ? 37.362 -33.218  -134.938 1.00 128.64 ? 76  ASN A CB    1 
ATOM   406   C CG    . ASN A 1 79  ? 36.443 -33.753  -136.019 1.00 124.79 ? 76  ASN A CG    1 
ATOM   407   O OD1   . ASN A 1 79  ? 36.896 -34.350  -136.996 1.00 129.33 ? 76  ASN A OD1   1 
ATOM   408   N ND2   . ASN A 1 79  ? 35.144 -33.543  -135.849 1.00 118.07 ? 76  ASN A ND2   1 
ATOM   409   N N     . GLU A 1 80  ? 39.177 -33.439  -132.145 1.00 127.74 ? 77  GLU A N     1 
ATOM   410   C CA    . GLU A 1 80  ? 40.382 -33.056  -131.421 1.00 132.40 ? 77  GLU A CA    1 
ATOM   411   C C     . GLU A 1 80  ? 41.073 -34.261  -130.791 1.00 131.95 ? 77  GLU A C     1 
ATOM   412   O O     . GLU A 1 80  ? 42.294 -34.405  -130.905 1.00 134.21 ? 77  GLU A O     1 
ATOM   413   C CB    . GLU A 1 80  ? 40.053 -32.007  -130.353 1.00 143.86 ? 77  GLU A CB    1 
ATOM   414   C CG    . GLU A 1 80  ? 39.575 -30.672  -130.916 1.00 153.90 ? 77  GLU A CG    1 
ATOM   415   C CD    . GLU A 1 80  ? 40.552 -30.062  -131.907 1.00 145.43 ? 77  GLU A CD    1 
ATOM   416   O OE1   . GLU A 1 80  ? 41.778 -30.217  -131.718 1.00 146.08 ? 77  GLU A OE1   1 
ATOM   417   O OE2   . GLU A 1 80  ? 40.090 -29.430  -132.880 1.00 126.70 ? 77  GLU A OE2   1 
ATOM   418   N N     . MET A 1 81  ? 40.308 -35.128  -130.122 1.00 138.45 ? 78  MET A N     1 
ATOM   419   C CA    . MET A 1 81  ? 40.894 -36.277  -129.438 1.00 144.15 ? 78  MET A CA    1 
ATOM   420   C C     . MET A 1 81  ? 41.624 -37.194  -130.412 1.00 140.71 ? 78  MET A C     1 
ATOM   421   O O     . MET A 1 81  ? 42.757 -37.615  -130.153 1.00 138.08 ? 78  MET A O     1 
ATOM   422   C CB    . MET A 1 81  ? 39.808 -37.048  -128.684 1.00 141.36 ? 78  MET A CB    1 
ATOM   423   C CG    . MET A 1 81  ? 39.343 -36.380  -127.401 1.00 148.49 ? 78  MET A CG    1 
ATOM   424   S SD    . MET A 1 81  ? 40.589 -36.405  -126.097 1.00 183.03 ? 78  MET A SD    1 
ATOM   425   C CE    . MET A 1 81  ? 41.329 -38.018  -126.350 1.00 146.76 ? 78  MET A CE    1 
ATOM   426   N N     . PHE A 1 82  ? 40.992 -37.518  -131.541 1.00 136.59 ? 79  PHE A N     1 
ATOM   427   C CA    . PHE A 1 82  ? 41.589 -38.447  -132.493 1.00 127.49 ? 79  PHE A CA    1 
ATOM   428   C C     . PHE A 1 82  ? 42.105 -37.788  -133.761 1.00 131.42 ? 79  PHE A C     1 
ATOM   429   O O     . PHE A 1 82  ? 43.043 -38.307  -134.370 1.00 131.96 ? 79  PHE A O     1 
ATOM   430   C CB    . PHE A 1 82  ? 40.592 -39.549  -132.876 1.00 118.63 ? 79  PHE A CB    1 
ATOM   431   C CG    . PHE A 1 82  ? 39.921 -40.198  -131.698 1.00 113.68 ? 79  PHE A CG    1 
ATOM   432   C CD1   . PHE A 1 82  ? 38.772 -39.655  -131.148 1.00 120.87 ? 79  PHE A CD1   1 
ATOM   433   C CD2   . PHE A 1 82  ? 40.448 -41.349  -131.136 1.00 114.25 ? 79  PHE A CD2   1 
ATOM   434   C CE1   . PHE A 1 82  ? 38.159 -40.250  -130.064 1.00 125.00 ? 79  PHE A CE1   1 
ATOM   435   C CE2   . PHE A 1 82  ? 39.839 -41.949  -130.050 1.00 119.84 ? 79  PHE A CE2   1 
ATOM   436   C CZ    . PHE A 1 82  ? 38.692 -41.399  -129.514 1.00 119.27 ? 79  PHE A CZ    1 
ATOM   437   N N     . GLY A 1 83  ? 41.523 -36.675  -134.175 1.00 127.23 ? 80  GLY A N     1 
ATOM   438   C CA    . GLY A 1 83  ? 41.893 -36.045  -135.421 1.00 116.60 ? 80  GLY A CA    1 
ATOM   439   C C     . GLY A 1 83  ? 40.763 -36.095  -136.437 1.00 115.04 ? 80  GLY A C     1 
ATOM   440   O O     . GLY A 1 83  ? 39.791 -36.843  -136.300 1.00 111.93 ? 80  GLY A O     1 
ATOM   441   N N     . TYR A 1 84  ? 40.902 -35.269  -137.475 1.00 123.86 ? 81  TYR A N     1 
ATOM   442   C CA    . TYR A 1 84  ? 39.932 -35.290  -138.563 1.00 123.08 ? 81  TYR A CA    1 
ATOM   443   C C     . TYR A 1 84  ? 39.960 -36.608  -139.324 1.00 123.47 ? 81  TYR A C     1 
ATOM   444   O O     . TYR A 1 84  ? 38.952 -36.979  -139.935 1.00 121.23 ? 81  TYR A O     1 
ATOM   445   C CB    . TYR A 1 84  ? 40.187 -34.127  -139.523 1.00 113.19 ? 81  TYR A CB    1 
ATOM   446   C CG    . TYR A 1 84  ? 41.358 -34.346  -140.453 1.00 106.18 ? 81  TYR A CG    1 
ATOM   447   C CD1   . TYR A 1 84  ? 42.663 -34.173  -140.012 1.00 114.64 ? 81  TYR A CD1   1 
ATOM   448   C CD2   . TYR A 1 84  ? 41.158 -34.728  -141.773 1.00 122.94 ? 81  TYR A CD2   1 
ATOM   449   C CE1   . TYR A 1 84  ? 43.737 -34.374  -140.861 1.00 119.60 ? 81  TYR A CE1   1 
ATOM   450   C CE2   . TYR A 1 84  ? 42.224 -34.933  -142.628 1.00 128.15 ? 81  TYR A CE2   1 
ATOM   451   C CZ    . TYR A 1 84  ? 43.511 -34.754  -142.167 1.00 120.25 ? 81  TYR A CZ    1 
ATOM   452   O OH    . TYR A 1 84  ? 44.574 -34.955  -143.018 1.00 111.76 ? 81  TYR A OH    1 
ATOM   453   N N     . ASN A 1 85  ? 41.089 -37.319  -139.298 1.00 119.75 ? 82  ASN A N     1 
ATOM   454   C CA    . ASN A 1 85  ? 41.225 -38.606  -139.970 1.00 117.24 ? 82  ASN A CA    1 
ATOM   455   C C     . ASN A 1 85  ? 41.565 -39.724  -138.991 1.00 112.30 ? 82  ASN A C     1 
ATOM   456   O O     . ASN A 1 85  ? 42.025 -40.791  -139.408 1.00 115.87 ? 82  ASN A O     1 
ATOM   457   C CB    . ASN A 1 85  ? 42.287 -38.522  -141.067 1.00 123.06 ? 82  ASN A CB    1 
ATOM   458   C CG    . ASN A 1 85  ? 43.686 -38.349  -140.509 1.00 125.77 ? 82  ASN A CG    1 
ATOM   459   O OD1   . ASN A 1 85  ? 43.908 -37.553  -139.596 1.00 117.53 ? 82  ASN A OD1   1 
ATOM   460   N ND2   . ASN A 1 85  ? 44.639 -39.097  -141.055 1.00 128.82 ? 82  ASN A ND2   1 
ATOM   461   N N     . GLY A 1 86  ? 41.350 -39.500  -137.697 1.00 108.25 ? 83  GLY A N     1 
ATOM   462   C CA    . GLY A 1 86  ? 41.609 -40.522  -136.704 1.00 111.47 ? 83  GLY A CA    1 
ATOM   463   C C     . GLY A 1 86  ? 40.350 -41.270  -136.320 1.00 106.54 ? 83  GLY A C     1 
ATOM   464   O O     . GLY A 1 86  ? 40.412 -42.390  -135.803 1.00 107.11 ? 83  GLY A O     1 
ATOM   465   N N     . TRP A 1 87  ? 39.197 -40.653  -136.566 1.00 91.87  ? 84  TRP A N     1 
ATOM   466   C CA    . TRP A 1 87  ? 37.907 -41.271  -136.306 1.00 96.44  ? 84  TRP A CA    1 
ATOM   467   C C     . TRP A 1 87  ? 37.057 -41.202  -137.566 1.00 103.57 ? 84  TRP A C     1 
ATOM   468   O O     . TRP A 1 87  ? 37.305 -40.398  -138.469 1.00 102.90 ? 84  TRP A O     1 
ATOM   469   C CB    . TRP A 1 87  ? 37.165 -40.598  -135.145 1.00 89.45  ? 84  TRP A CB    1 
ATOM   470   C CG    . TRP A 1 87  ? 36.534 -39.297  -135.521 1.00 96.01  ? 84  TRP A CG    1 
ATOM   471   C CD1   . TRP A 1 87  ? 37.174 -38.140  -135.849 1.00 107.15 ? 84  TRP A CD1   1 
ATOM   472   C CD2   . TRP A 1 87  ? 35.132 -39.022  -135.618 1.00 86.42  ? 84  TRP A CD2   1 
ATOM   473   N NE1   . TRP A 1 87  ? 36.259 -37.158  -136.140 1.00 107.97 ? 84  TRP A NE1   1 
ATOM   474   C CE2   . TRP A 1 87  ? 34.997 -37.674  -136.005 1.00 98.08  ? 84  TRP A CE2   1 
ATOM   475   C CE3   . TRP A 1 87  ? 33.978 -39.783  -135.411 1.00 99.77  ? 84  TRP A CE3   1 
ATOM   476   C CZ2   . TRP A 1 87  ? 33.755 -37.072  -136.191 1.00 108.12 ? 84  TRP A CZ2   1 
ATOM   477   C CZ3   . TRP A 1 87  ? 32.746 -39.183  -135.596 1.00 106.36 ? 84  TRP A CZ3   1 
ATOM   478   C CH2   . TRP A 1 87  ? 32.644 -37.841  -135.982 1.00 102.56 ? 84  TRP A CH2   1 
ATOM   479   N N     . ALA A 1 88  ? 36.043 -42.061  -137.614 1.00 105.04 ? 85  ALA A N     1 
ATOM   480   C CA    . ALA A 1 88  ? 35.127 -42.116  -138.741 1.00 86.93  ? 85  ALA A CA    1 
ATOM   481   C C     . ALA A 1 88  ? 33.800 -42.661  -138.242 1.00 83.14  ? 85  ALA A C     1 
ATOM   482   O O     . ALA A 1 88  ? 33.767 -43.474  -137.322 1.00 74.84  ? 85  ALA A O     1 
ATOM   483   C CB    . ALA A 1 88  ? 35.680 -42.994  -139.870 1.00 87.70  ? 85  ALA A CB    1 
ATOM   484   N N     . HIS A 1 89  ? 32.702 -42.189  -138.818 1.00 88.28  ? 86  HIS A N     1 
ATOM   485   C CA    . HIS A 1 89  ? 31.398 -42.708  -138.437 1.00 90.86  ? 86  HIS A CA    1 
ATOM   486   C C     . HIS A 1 89  ? 30.614 -43.103  -139.679 1.00 101.36 ? 86  HIS A C     1 
ATOM   487   O O     . HIS A 1 89  ? 30.886 -42.640  -140.791 1.00 99.54  ? 86  HIS A O     1 
ATOM   488   C CB    . HIS A 1 89  ? 30.603 -41.703  -137.582 1.00 83.47  ? 86  HIS A CB    1 
ATOM   489   C CG    . HIS A 1 89  ? 29.893 -40.647  -138.371 1.00 88.43  ? 86  HIS A CG    1 
ATOM   490   N ND1   . HIS A 1 89  ? 28.671 -40.135  -137.990 1.00 93.06  ? 86  HIS A ND1   1 
ATOM   491   C CD2   . HIS A 1 89  ? 30.241 -39.987  -139.501 1.00 90.30  ? 86  HIS A CD2   1 
ATOM   492   C CE1   . HIS A 1 89  ? 28.290 -39.217  -138.860 1.00 100.37 ? 86  HIS A CE1   1 
ATOM   493   N NE2   . HIS A 1 89  ? 29.225 -39.108  -139.787 1.00 100.08 ? 86  HIS A NE2   1 
ATOM   494   N N     . SER A 1 90  ? 29.640 -43.985  -139.473 1.00 97.09  ? 87  SER A N     1 
ATOM   495   C CA    . SER A 1 90  ? 28.826 -44.481  -140.571 1.00 87.52  ? 87  SER A CA    1 
ATOM   496   C C     . SER A 1 90  ? 27.453 -44.867  -140.048 1.00 85.01  ? 87  SER A C     1 
ATOM   497   O O     . SER A 1 90  ? 27.291 -45.220  -138.876 1.00 90.02  ? 87  SER A O     1 
ATOM   498   C CB    . SER A 1 90  ? 29.483 -45.682  -141.262 1.00 99.71  ? 87  SER A CB    1 
ATOM   499   O OG    . SER A 1 90  ? 29.930 -46.633  -140.311 1.00 89.18  ? 87  SER A OG    1 
ATOM   500   N N     . ILE A 1 91  ? 26.463 -44.785  -140.930 1.00 79.75  ? 88  ILE A N     1 
ATOM   501   C CA    . ILE A 1 91  ? 25.087 -45.142  -140.613 1.00 68.13  ? 88  ILE A CA    1 
ATOM   502   C C     . ILE A 1 91  ? 24.899 -46.586  -141.059 1.00 73.31  ? 88  ILE A C     1 
ATOM   503   O O     . ILE A 1 91  ? 24.770 -46.867  -142.253 1.00 80.72  ? 88  ILE A O     1 
ATOM   504   C CB    . ILE A 1 91  ? 24.089 -44.201  -141.289 1.00 76.38  ? 88  ILE A CB    1 
ATOM   505   C CG1   . ILE A 1 91  ? 24.474 -42.744  -141.029 1.00 71.72  ? 88  ILE A CG1   1 
ATOM   506   C CG2   . ILE A 1 91  ? 22.678 -44.479  -140.795 1.00 66.65  ? 88  ILE A CG2   1 
ATOM   507   C CD1   . ILE A 1 91  ? 23.586 -41.746  -141.732 1.00 81.02  ? 88  ILE A CD1   1 
ATOM   508   N N     . THR A 1 92  ? 24.891 -47.514  -140.098 1.00 88.85  ? 89  THR A N     1 
ATOM   509   C CA    . THR A 1 92  ? 24.685 -48.917  -140.438 1.00 74.83  ? 89  THR A CA    1 
ATOM   510   C C     . THR A 1 92  ? 23.277 -49.149  -140.972 1.00 70.63  ? 89  THR A C     1 
ATOM   511   O O     . THR A 1 92  ? 23.094 -49.856  -141.971 1.00 88.04  ? 89  THR A O     1 
ATOM   512   C CB    . THR A 1 92  ? 24.953 -49.798  -139.217 1.00 63.89  ? 89  THR A CB    1 
ATOM   513   O OG1   . THR A 1 92  ? 26.353 -49.780  -138.916 1.00 83.08  ? 89  THR A OG1   1 
ATOM   514   C CG2   . THR A 1 92  ? 24.518 -51.231  -139.479 1.00 73.13  ? 89  THR A CG2   1 
ATOM   515   N N     . GLN A 1 93  ? 22.275 -48.549  -140.333 1.00 63.69  ? 90  GLN A N     1 
ATOM   516   C CA    . GLN A 1 93  ? 20.896 -48.662  -140.782 1.00 78.47  ? 90  GLN A CA    1 
ATOM   517   C C     . GLN A 1 93  ? 20.061 -47.604  -140.079 1.00 87.07  ? 90  GLN A C     1 
ATOM   518   O O     . GLN A 1 93  ? 20.241 -47.359  -138.883 1.00 87.04  ? 90  GLN A O     1 
ATOM   519   C CB    . GLN A 1 93  ? 20.324 -50.058  -140.498 1.00 72.21  ? 90  GLN A CB    1 
ATOM   520   C CG    . GLN A 1 93  ? 18.887 -50.240  -140.955 1.00 82.06  ? 90  GLN A CG    1 
ATOM   521   C CD    . GLN A 1 93  ? 18.382 -51.651  -140.747 1.00 122.67 ? 90  GLN A CD    1 
ATOM   522   O OE1   . GLN A 1 93  ? 18.366 -52.158  -139.626 1.00 144.52 ? 90  GLN A OE1   1 
ATOM   523   N NE2   . GLN A 1 93  ? 17.968 -52.297  -141.831 1.00 140.56 ? 90  GLN A NE2   1 
ATOM   524   N N     . GLN A 1 94  ? 19.153 -46.985  -140.829 1.00 85.29  ? 91  GLN A N     1 
ATOM   525   C CA    . GLN A 1 94  ? 18.171 -46.057  -140.287 1.00 71.97  ? 91  GLN A CA    1 
ATOM   526   C C     . GLN A 1 94  ? 16.787 -46.503  -140.727 1.00 85.15  ? 91  GLN A C     1 
ATOM   527   O O     . GLN A 1 94  ? 16.553 -46.722  -141.920 1.00 102.30 ? 91  GLN A O     1 
ATOM   528   C CB    . GLN A 1 94  ? 18.438 -44.622  -140.750 1.00 87.32  ? 91  GLN A CB    1 
ATOM   529   C CG    . GLN A 1 94  ? 17.224 -43.716  -140.646 1.00 90.13  ? 91  GLN A CG    1 
ATOM   530   C CD    . GLN A 1 94  ? 17.568 -42.256  -140.831 1.00 79.08  ? 91  GLN A CD    1 
ATOM   531   O OE1   . GLN A 1 94  ? 16.972 -41.568  -141.658 1.00 83.52  ? 91  GLN A OE1   1 
ATOM   532   N NE2   . GLN A 1 94  ? 18.528 -41.771  -140.055 1.00 72.14  ? 91  GLN A NE2   1 
ATOM   533   N N     . ASN A 1 95  ? 15.874 -46.630  -139.768 1.00 70.73  ? 92  ASN A N     1 
ATOM   534   C CA    . ASN A 1 95  ? 14.531 -47.130  -140.025 1.00 83.46  ? 92  ASN A CA    1 
ATOM   535   C C     . ASN A 1 95  ? 13.521 -46.223  -139.340 1.00 84.27  ? 92  ASN A C     1 
ATOM   536   O O     . ASN A 1 95  ? 13.644 -45.943  -138.143 1.00 92.31  ? 92  ASN A O     1 
ATOM   537   C CB    . ASN A 1 95  ? 14.374 -48.573  -139.533 1.00 92.43  ? 92  ASN A CB    1 
ATOM   538   C CG    . ASN A 1 95  ? 12.991 -49.132  -139.798 1.00 115.64 ? 92  ASN A CG    1 
ATOM   539   O OD1   . ASN A 1 95  ? 12.640 -49.440  -140.937 1.00 116.58 ? 92  ASN A OD1   1 
ATOM   540   N ND2   . ASN A 1 95  ? 12.197 -49.270  -138.742 1.00 111.86 ? 92  ASN A ND2   1 
ATOM   541   N N     . VAL A 1 96  ? 12.525 -45.773  -140.098 1.00 83.34  ? 93  VAL A N     1 
ATOM   542   C CA    . VAL A 1 96  ? 11.461 -44.934  -139.558 1.00 85.13  ? 93  VAL A CA    1 
ATOM   543   C C     . VAL A 1 96  ? 10.502 -45.813  -138.765 1.00 98.33  ? 93  VAL A C     1 
ATOM   544   O O     . VAL A 1 96  ? 9.882  -46.728  -139.317 1.00 102.38 ? 93  VAL A O     1 
ATOM   545   C CB    . VAL A 1 96  ? 10.725 -44.187  -140.679 1.00 71.69  ? 93  VAL A CB    1 
ATOM   546   C CG1   . VAL A 1 96  ? 9.600  -43.341  -140.107 1.00 77.57  ? 93  VAL A CG1   1 
ATOM   547   C CG2   . VAL A 1 96  ? 11.699 -43.326  -141.471 1.00 86.81  ? 93  VAL A CG2   1 
ATOM   548   N N     . ASP A 1 97  ? 10.380 -45.537  -137.464 1.00 95.92  ? 94  ASP A N     1 
ATOM   549   C CA    . ASP A 1 97  ? 9.534  -46.368  -136.614 1.00 82.26  ? 94  ASP A CA    1 
ATOM   550   C C     . ASP A 1 97  ? 8.056  -46.119  -136.888 1.00 86.62  ? 94  ASP A C     1 
ATOM   551   O O     . ASP A 1 97  ? 7.289  -47.068  -137.088 1.00 91.48  ? 94  ASP A O     1 
ATOM   552   C CB    . ASP A 1 97  ? 9.863  -46.129  -135.141 1.00 92.92  ? 94  ASP A CB    1 
ATOM   553   C CG    . ASP A 1 97  ? 11.096 -46.887  -134.693 1.00 99.26  ? 94  ASP A CG    1 
ATOM   554   O OD1   . ASP A 1 97  ? 11.165 -48.109  -134.943 1.00 93.65  ? 94  ASP A OD1   1 
ATOM   555   O OD2   . ASP A 1 97  ? 11.996 -46.266  -134.095 1.00 108.87 ? 94  ASP A OD2   1 
ATOM   556   N N     . PHE A 1 98  ? 7.630  -44.856  -136.903 1.00 94.68  ? 95  PHE A N     1 
ATOM   557   C CA    . PHE A 1 98  ? 6.211  -44.604  -137.128 1.00 95.86  ? 95  PHE A CA    1 
ATOM   558   C C     . PHE A 1 98  ? 5.999  -43.179  -137.616 1.00 98.26  ? 95  PHE A C     1 
ATOM   559   O O     . PHE A 1 98  ? 6.808  -42.283  -137.356 1.00 97.55  ? 95  PHE A O     1 
ATOM   560   C CB    . PHE A 1 98  ? 5.386  -44.863  -135.859 1.00 93.32  ? 95  PHE A CB    1 
ATOM   561   C CG    . PHE A 1 98  ? 5.736  -43.962  -134.707 1.00 104.25 ? 95  PHE A CG    1 
ATOM   562   C CD1   . PHE A 1 98  ? 5.127  -42.724  -134.564 1.00 101.91 ? 95  PHE A CD1   1 
ATOM   563   C CD2   . PHE A 1 98  ? 6.676  -44.351  -133.768 1.00 108.29 ? 95  PHE A CD2   1 
ATOM   564   C CE1   . PHE A 1 98  ? 5.448  -41.895  -133.508 1.00 102.50 ? 95  PHE A CE1   1 
ATOM   565   C CE2   . PHE A 1 98  ? 7.001  -43.525  -132.709 1.00 111.30 ? 95  PHE A CE2   1 
ATOM   566   C CZ    . PHE A 1 98  ? 6.386  -42.296  -132.580 1.00 105.58 ? 95  PHE A CZ    1 
ATOM   567   N N     . VAL A 1 99  ? 4.866  -42.983  -138.296 1.00 93.61  ? 96  VAL A N     1 
ATOM   568   C CA    . VAL A 1 99  ? 4.385  -41.672  -138.727 1.00 94.41  ? 96  VAL A CA    1 
ATOM   569   C C     . VAL A 1 99  ? 2.867  -41.681  -138.575 1.00 100.82 ? 96  VAL A C     1 
ATOM   570   O O     . VAL A 1 99  ? 2.171  -42.379  -139.322 1.00 93.84  ? 96  VAL A O     1 
ATOM   571   C CB    . VAL A 1 99  ? 4.777  -41.343  -140.176 1.00 86.50  ? 96  VAL A CB    1 
ATOM   572   C CG1   . VAL A 1 99  ? 3.974  -40.153  -140.687 1.00 93.96  ? 96  VAL A CG1   1 
ATOM   573   C CG2   . VAL A 1 99  ? 6.270  -41.070  -140.288 1.00 94.29  ? 96  VAL A CG2   1 
ATOM   574   N N     . ASP A 1 100 ? 2.354  -40.921  -137.610 1.00 112.64 ? 97  ASP A N     1 
ATOM   575   C CA    . ASP A 1 100 ? 0.930  -40.849  -137.324 1.00 105.59 ? 97  ASP A CA    1 
ATOM   576   C C     . ASP A 1 100 ? 0.442  -39.412  -137.460 1.00 111.57 ? 97  ASP A C     1 
ATOM   577   O O     . ASP A 1 100 ? 1.225  -38.459  -137.401 1.00 125.39 ? 97  ASP A O     1 
ATOM   578   C CB    . ASP A 1 100 ? 0.619  -41.380  -135.918 1.00 114.25 ? 97  ASP A CB    1 
ATOM   579   C CG    . ASP A 1 100 ? 1.200  -42.759  -135.676 1.00 117.00 ? 97  ASP A CG    1 
ATOM   580   O OD1   . ASP A 1 100 ? 0.999  -43.650  -136.528 1.00 120.57 ? 97  ASP A OD1   1 
ATOM   581   O OD2   . ASP A 1 100 ? 1.862  -42.952  -134.635 1.00 113.55 ? 97  ASP A OD2   1 
ATOM   582   N N     . LEU A 1 101 ? -0.873 -39.263  -137.615 1.00 113.49 ? 98  LEU A N     1 
ATOM   583   C CA    . LEU A 1 101 ? -1.492 -37.959  -137.832 1.00 121.02 ? 98  LEU A CA    1 
ATOM   584   C C     . LEU A 1 101 ? -2.725 -37.836  -136.951 1.00 130.20 ? 98  LEU A C     1 
ATOM   585   O O     . LEU A 1 101 ? -3.689 -38.588  -137.122 1.00 136.15 ? 98  LEU A O     1 
ATOM   586   C CB    . LEU A 1 101 ? -1.866 -37.766  -139.305 1.00 125.15 ? 98  LEU A CB    1 
ATOM   587   C CG    . LEU A 1 101 ? -2.596 -36.472  -139.674 1.00 135.03 ? 98  LEU A CG    1 
ATOM   588   C CD1   . LEU A 1 101 ? -1.840 -35.254  -139.168 1.00 133.03 ? 98  LEU A CD1   1 
ATOM   589   C CD2   . LEU A 1 101 ? -2.809 -36.388  -141.178 1.00 143.62 ? 98  LEU A CD2   1 
ATOM   590   N N     . ASN A 1 102 ? -2.692 -36.890  -136.013 1.00 139.21 ? 99  ASN A N     1 
ATOM   591   C CA    . ASN A 1 102 ? -3.806 -36.621  -135.108 1.00 138.04 ? 99  ASN A CA    1 
ATOM   592   C C     . ASN A 1 102 ? -4.250 -35.176  -135.296 1.00 141.16 ? 99  ASN A C     1 
ATOM   593   O O     . ASN A 1 102 ? -3.554 -34.250  -134.864 1.00 134.78 ? 99  ASN A O     1 
ATOM   594   C CB    . ASN A 1 102 ? -3.417 -36.890  -133.655 1.00 131.33 ? 99  ASN A CB    1 
ATOM   595   C CG    . ASN A 1 102 ? -2.987 -38.325  -133.420 1.00 127.51 ? 99  ASN A CG    1 
ATOM   596   O OD1   . ASN A 1 102 ? -3.538 -39.255  -134.010 1.00 127.80 ? 99  ASN A OD1   1 
ATOM   597   N ND2   . ASN A 1 102 ? -2.003 -38.513  -132.549 1.00 122.80 ? 99  ASN A ND2   1 
ATOM   598   N N     . ASN A 1 103 ? -5.403 -34.998  -135.940 1.00 148.37 ? 100 ASN A N     1 
ATOM   599   C CA    . ASN A 1 103 ? -6.058 -33.703  -136.162 1.00 152.54 ? 100 ASN A CA    1 
ATOM   600   C C     . ASN A 1 103 ? -5.052 -32.611  -136.522 1.00 144.80 ? 100 ASN A C     1 
ATOM   601   O O     . ASN A 1 103 ? -4.953 -31.569  -135.873 1.00 144.15 ? 100 ASN A O     1 
ATOM   602   C CB    . ASN A 1 103 ? -6.911 -33.285  -134.958 1.00 139.35 ? 100 ASN A CB    1 
ATOM   603   C CG    . ASN A 1 103 ? -6.191 -33.445  -133.633 1.00 141.14 ? 100 ASN A CG    1 
ATOM   604   O OD1   . ASN A 1 103 ? -6.229 -34.510  -133.017 1.00 136.25 ? 100 ASN A OD1   1 
ATOM   605   N ND2   . ASN A 1 103 ? -5.530 -32.382  -133.187 1.00 146.71 ? 100 ASN A ND2   1 
ATOM   606   N N     . GLY A 1 104 ? -4.294 -32.875  -137.585 1.00 141.79 ? 101 GLY A N     1 
ATOM   607   C CA    . GLY A 1 104 ? -3.384 -31.896  -138.137 1.00 141.25 ? 101 GLY A CA    1 
ATOM   608   C C     . GLY A 1 104 ? -1.978 -31.934  -137.581 1.00 141.01 ? 101 GLY A C     1 
ATOM   609   O O     . GLY A 1 104 ? -1.107 -31.225  -138.102 1.00 123.91 ? 101 GLY A O     1 
ATOM   610   N N     . ALA A 1 105 ? -1.725 -32.731  -136.546 1.00 141.64 ? 102 ALA A N     1 
ATOM   611   C CA    . ALA A 1 105 ? -0.405 -32.824  -135.937 1.00 139.59 ? 102 ALA A CA    1 
ATOM   612   C C     . ALA A 1 105 ? 0.259  -34.128  -136.356 1.00 137.43 ? 102 ALA A C     1 
ATOM   613   O O     . ALA A 1 105 ? -0.349 -35.199  -136.262 1.00 139.66 ? 102 ALA A O     1 
ATOM   614   C CB    . ALA A 1 105 ? -0.499 -32.740  -134.413 1.00 135.72 ? 102 ALA A CB    1 
ATOM   615   N N     . PHE A 1 106 ? 1.508  -34.034  -136.804 1.00 129.26 ? 103 PHE A N     1 
ATOM   616   C CA    . PHE A 1 106 ? 2.268  -35.187  -137.270 1.00 118.75 ? 103 PHE A CA    1 
ATOM   617   C C     . PHE A 1 106 ? 3.202  -35.657  -136.162 1.00 112.10 ? 103 PHE A C     1 
ATOM   618   O O     . PHE A 1 106 ? 4.031  -34.882  -135.673 1.00 105.22 ? 103 PHE A O     1 
ATOM   619   C CB    . PHE A 1 106 ? 3.062  -34.844  -138.531 1.00 123.11 ? 103 PHE A CB    1 
ATOM   620   C CG    . PHE A 1 106 ? 2.292  -35.042  -139.807 1.00 126.10 ? 103 PHE A CG    1 
ATOM   621   C CD1   . PHE A 1 106 ? 1.591  -36.214  -140.034 1.00 117.64 ? 103 PHE A CD1   1 
ATOM   622   C CD2   . PHE A 1 106 ? 2.272  -34.056  -140.780 1.00 134.64 ? 103 PHE A CD2   1 
ATOM   623   C CE1   . PHE A 1 106 ? 0.884  -36.401  -141.208 1.00 104.39 ? 103 PHE A CE1   1 
ATOM   624   C CE2   . PHE A 1 106 ? 1.566  -34.236  -141.955 1.00 130.13 ? 103 PHE A CE2   1 
ATOM   625   C CZ    . PHE A 1 106 ? 0.871  -35.411  -142.169 1.00 113.89 ? 103 PHE A CZ    1 
ATOM   626   N N     . TYR A 1 107 ? 3.064  -36.922  -135.770 1.00 107.69 ? 104 TYR A N     1 
ATOM   627   C CA    . TYR A 1 107 ? 3.905  -37.538  -134.749 1.00 112.74 ? 104 TYR A CA    1 
ATOM   628   C C     . TYR A 1 107 ? 4.774  -38.582  -135.440 1.00 96.61  ? 104 TYR A C     1 
ATOM   629   O O     . TYR A 1 107 ? 4.268  -39.602  -135.918 1.00 97.14  ? 104 TYR A O     1 
ATOM   630   C CB    . TYR A 1 107 ? 3.061  -38.165  -133.639 1.00 121.57 ? 104 TYR A CB    1 
ATOM   631   C CG    . TYR A 1 107 ? 2.062  -37.223  -132.999 1.00 129.01 ? 104 TYR A CG    1 
ATOM   632   C CD1   . TYR A 1 107 ? 0.867  -36.906  -133.633 1.00 130.81 ? 104 TYR A CD1   1 
ATOM   633   C CD2   . TYR A 1 107 ? 2.316  -36.650  -131.760 1.00 129.85 ? 104 TYR A CD2   1 
ATOM   634   C CE1   . TYR A 1 107 ? -0.044 -36.045  -133.052 1.00 134.22 ? 104 TYR A CE1   1 
ATOM   635   C CE2   . TYR A 1 107 ? 1.409  -35.789  -131.170 1.00 138.08 ? 104 TYR A CE2   1 
ATOM   636   C CZ    . TYR A 1 107 ? 0.231  -35.490  -131.821 1.00 141.09 ? 104 TYR A CZ    1 
ATOM   637   O OH    . TYR A 1 107 ? -0.676 -34.634  -131.240 1.00 146.24 ? 104 TYR A OH    1 
ATOM   638   N N     . VAL A 1 108 ? 6.077  -38.328  -135.488 1.00 90.55  ? 105 VAL A N     1 
ATOM   639   C CA    . VAL A 1 108 ? 7.024  -39.151  -136.226 1.00 90.76  ? 105 VAL A CA    1 
ATOM   640   C C     . VAL A 1 108 ? 8.107  -39.625  -135.269 1.00 101.45 ? 105 VAL A C     1 
ATOM   641   O O     . VAL A 1 108 ? 8.723  -38.811  -134.567 1.00 107.89 ? 105 VAL A O     1 
ATOM   642   C CB    . VAL A 1 108 ? 7.644  -38.378  -137.405 1.00 95.77  ? 105 VAL A CB    1 
ATOM   643   C CG1   . VAL A 1 108 ? 8.699  -39.225  -138.094 1.00 99.60  ? 105 VAL A CG1   1 
ATOM   644   C CG2   . VAL A 1 108 ? 6.564  -37.950  -138.388 1.00 100.44 ? 105 VAL A CG2   1 
ATOM   645   N N     . GLY A 1 109 ? 8.337  -40.937  -135.253 1.00 97.57  ? 106 GLY A N     1 
ATOM   646   C CA    . GLY A 1 109 ? 9.453  -41.530  -134.542 1.00 93.80  ? 106 GLY A CA    1 
ATOM   647   C C     . GLY A 1 109 ? 10.387 -42.254  -135.489 1.00 94.23  ? 106 GLY A C     1 
ATOM   648   O O     . GLY A 1 109 ? 9.931  -43.064  -136.308 1.00 100.42 ? 106 GLY A O     1 
ATOM   649   N N     . VAL A 1 110 ? 11.692 -41.999  -135.367 1.00 82.36  ? 107 VAL A N     1 
ATOM   650   C CA    . VAL A 1 110 ? 12.699 -42.541  -136.276 1.00 87.45  ? 107 VAL A CA    1 
ATOM   651   C C     . VAL A 1 110 ? 13.916 -42.950  -135.456 1.00 85.08  ? 107 VAL A C     1 
ATOM   652   O O     . VAL A 1 110 ? 14.248 -42.303  -134.460 1.00 89.58  ? 107 VAL A O     1 
ATOM   653   C CB    . VAL A 1 110 ? 13.087 -41.515  -137.368 1.00 92.35  ? 107 VAL A CB    1 
ATOM   654   C CG1   . VAL A 1 110 ? 14.291 -41.994  -138.173 1.00 77.63  ? 107 VAL A CG1   1 
ATOM   655   C CG2   . VAL A 1 110 ? 11.913 -41.249  -138.295 1.00 92.48  ? 107 VAL A CG2   1 
ATOM   656   N N     . CYS A 1 111 ? 14.560 -44.048  -135.847 1.00 89.42  ? 108 CYS A N     1 
ATOM   657   C CA    . CYS A 1 111 ? 15.752 -44.525  -135.161 1.00 91.80  ? 108 CYS A CA    1 
ATOM   658   C C     . CYS A 1 111 ? 16.886 -44.715  -136.157 1.00 80.39  ? 108 CYS A C     1 
ATOM   659   O O     . CYS A 1 111 ? 16.658 -44.950  -137.348 1.00 89.84  ? 108 CYS A O     1 
ATOM   660   C CB    . CYS A 1 111 ? 15.488 -45.843  -134.423 1.00 105.54 ? 108 CYS A CB    1 
ATOM   661   S SG    . CYS A 1 111 ? 15.506 -47.303  -135.488 1.00 90.09  ? 108 CYS A SG    1 
ATOM   662   N N     . ALA A 1 112 ? 18.114 -44.608  -135.655 1.00 69.87  ? 109 ALA A N     1 
ATOM   663   C CA    . ALA A 1 112 ? 19.306 -44.781  -136.470 1.00 79.12  ? 109 ALA A CA    1 
ATOM   664   C C     . ALA A 1 112 ? 20.352 -45.542  -135.669 1.00 80.78  ? 109 ALA A C     1 
ATOM   665   O O     . ALA A 1 112 ? 20.344 -45.536  -134.437 1.00 92.98  ? 109 ALA A O     1 
ATOM   666   C CB    . ALA A 1 112 ? 19.874 -43.436  -136.943 1.00 88.84  ? 109 ALA A CB    1 
ATOM   667   N N     . PHE A 1 113 ? 21.269 -46.185  -136.389 1.00 76.27  ? 110 PHE A N     1 
ATOM   668   C CA    . PHE A 1 113 ? 22.340 -46.982  -135.796 1.00 74.76  ? 110 PHE A CA    1 
ATOM   669   C C     . PHE A 1 113 ? 23.665 -46.454  -136.326 1.00 75.56  ? 110 PHE A C     1 
ATOM   670   O O     . PHE A 1 113 ? 23.966 -46.611  -137.514 1.00 87.98  ? 110 PHE A O     1 
ATOM   671   C CB    . PHE A 1 113 ? 22.174 -48.469  -136.118 1.00 84.92  ? 110 PHE A CB    1 
ATOM   672   C CG    . PHE A 1 113 ? 20.968 -49.101  -135.478 1.00 86.94  ? 110 PHE A CG    1 
ATOM   673   C CD1   . PHE A 1 113 ? 19.693 -48.833  -135.950 1.00 74.80  ? 110 PHE A CD1   1 
ATOM   674   C CD2   . PHE A 1 113 ? 21.110 -49.968  -134.407 1.00 82.95  ? 110 PHE A CD2   1 
ATOM   675   C CE1   . PHE A 1 113 ? 18.584 -49.413  -135.364 1.00 82.95  ? 110 PHE A CE1   1 
ATOM   676   C CE2   . PHE A 1 113 ? 20.005 -50.553  -133.818 1.00 84.31  ? 110 PHE A CE2   1 
ATOM   677   C CZ    . PHE A 1 113 ? 18.740 -50.274  -134.297 1.00 89.01  ? 110 PHE A CZ    1 
ATOM   678   N N     . VAL A 1 114 ? 24.430 -45.777  -135.473 1.00 72.66  ? 111 VAL A N     1 
ATOM   679   C CA    . VAL A 1 114 ? 25.698 -45.180  -135.876 1.00 71.98  ? 111 VAL A CA    1 
ATOM   680   C C     . VAL A 1 114 ? 26.850 -46.029  -135.361 1.00 76.78  ? 111 VAL A C     1 
ATOM   681   O O     . VAL A 1 114 ? 26.849 -46.474  -134.203 1.00 76.69  ? 111 VAL A O     1 
ATOM   682   C CB    . VAL A 1 114 ? 25.812 -43.727  -135.379 1.00 74.50  ? 111 VAL A CB    1 
ATOM   683   C CG1   . VAL A 1 114 ? 27.019 -43.048  -136.007 1.00 76.18  ? 111 VAL A CG1   1 
ATOM   684   C CG2   . VAL A 1 114 ? 24.543 -42.964  -135.712 1.00 69.16  ? 111 VAL A CG2   1 
ATOM   685   N N     . ARG A 1 115 ? 27.841 -46.247  -136.225 1.00 76.35  ? 112 ARG A N     1 
ATOM   686   C CA    . ARG A 1 115 ? 29.049 -46.998  -135.904 1.00 85.46  ? 112 ARG A CA    1 
ATOM   687   C C     . ARG A 1 115 ? 30.259 -46.095  -136.098 1.00 95.46  ? 112 ARG A C     1 
ATOM   688   O O     . ARG A 1 115 ? 30.505 -45.616  -137.211 1.00 103.94 ? 112 ARG A O     1 
ATOM   689   C CB    . ARG A 1 115 ? 29.180 -48.247  -136.779 1.00 89.71  ? 112 ARG A CB    1 
ATOM   690   C CG    . ARG A 1 115 ? 30.553 -48.899  -136.689 1.00 93.07  ? 112 ARG A CG    1 
ATOM   691   C CD    . ARG A 1 115 ? 30.751 -49.965  -137.751 1.00 101.15 ? 112 ARG A CD    1 
ATOM   692   N NE    . ARG A 1 115 ? 32.164 -50.149  -138.069 1.00 100.63 ? 112 ARG A NE    1 
ATOM   693   C CZ    . ARG A 1 115 ? 32.873 -51.222  -137.736 1.00 107.75 ? 112 ARG A CZ    1 
ATOM   694   N NH1   . ARG A 1 115 ? 32.301 -52.218  -137.073 1.00 105.43 ? 112 ARG A NH1   1 
ATOM   695   N NH2   . ARG A 1 115 ? 34.155 -51.301  -138.069 1.00 105.95 ? 112 ARG A NH2   1 
ATOM   696   N N     . VAL A 1 116 ? 30.983 -45.834  -135.010 1.00 87.65  ? 113 VAL A N     1 
ATOM   697   C CA    . VAL A 1 116 ? 32.221 -45.064  -135.023 1.00 88.66  ? 113 VAL A CA    1 
ATOM   698   C C     . VAL A 1 116 ? 33.392 -46.037  -135.020 1.00 84.56  ? 113 VAL A C     1 
ATOM   699   O O     . VAL A 1 116 ? 33.354 -47.068  -134.340 1.00 82.63  ? 113 VAL A O     1 
ATOM   700   C CB    . VAL A 1 116 ? 32.294 -44.105  -133.820 1.00 94.92  ? 113 VAL A CB    1 
ATOM   701   C CG1   . VAL A 1 116 ? 33.469 -43.154  -133.967 1.00 110.85 ? 113 VAL A CG1   1 
ATOM   702   C CG2   . VAL A 1 116 ? 30.991 -43.335  -133.678 1.00 91.16  ? 113 VAL A CG2   1 
ATOM   703   N N     . GLN A 1 117 ? 34.427 -45.718  -135.789 1.00 69.66  ? 114 GLN A N     1 
ATOM   704   C CA    . GLN A 1 117 ? 35.592 -46.572  -135.951 1.00 87.54  ? 114 GLN A CA    1 
ATOM   705   C C     . GLN A 1 117 ? 36.841 -45.707  -135.942 1.00 91.01  ? 114 GLN A C     1 
ATOM   706   O O     . GLN A 1 117 ? 36.881 -44.657  -136.589 1.00 81.92  ? 114 GLN A O     1 
ATOM   707   C CB    . GLN A 1 117 ? 35.529 -47.368  -137.259 1.00 104.21 ? 114 GLN A CB    1 
ATOM   708   C CG    . GLN A 1 117 ? 36.685 -48.336  -137.456 1.00 103.75 ? 114 GLN A CG    1 
ATOM   709   C CD    . GLN A 1 117 ? 36.728 -48.909  -138.860 1.00 115.17 ? 114 GLN A CD    1 
ATOM   710   O OE1   . GLN A 1 117 ? 35.923 -48.544  -139.717 1.00 124.18 ? 114 GLN A OE1   1 
ATOM   711   N NE2   . GLN A 1 117 ? 37.645 -49.841  -139.091 1.00 127.39 ? 114 GLN A NE2   1 
ATOM   712   N N     . LEU A 1 118 ? 37.855 -46.153  -135.210 1.00 101.46 ? 115 LEU A N     1 
ATOM   713   C CA    . LEU A 1 118 ? 39.136 -45.468  -135.167 1.00 102.13 ? 115 LEU A CA    1 
ATOM   714   C C     . LEU A 1 118 ? 40.078 -46.047  -136.216 1.00 98.05  ? 115 LEU A C     1 
ATOM   715   O O     . LEU A 1 118 ? 39.896 -47.168  -136.698 1.00 117.08 ? 115 LEU A O     1 
ATOM   716   C CB    . LEU A 1 118 ? 39.759 -45.582  -133.777 1.00 114.41 ? 115 LEU A CB    1 
ATOM   717   C CG    . LEU A 1 118 ? 38.840 -45.247  -132.602 1.00 105.36 ? 115 LEU A CG    1 
ATOM   718   C CD1   . LEU A 1 118 ? 39.575 -45.417  -131.280 1.00 99.46  ? 115 LEU A CD1   1 
ATOM   719   C CD2   . LEU A 1 118 ? 38.292 -43.834  -132.739 1.00 107.51 ? 115 LEU A CD2   1 
ATOM   720   N N     . LYS A 1 119 ? 41.096 -45.258  -136.572 1.00 93.79  ? 116 LYS A N     1 
ATOM   721   C CA    . LYS A 1 119 ? 42.032 -45.664  -137.616 1.00 108.49 ? 116 LYS A CA    1 
ATOM   722   C C     . LYS A 1 119 ? 42.760 -46.962  -137.285 1.00 116.41 ? 116 LYS A C     1 
ATOM   723   O O     . LYS A 1 119 ? 43.352 -47.571  -138.183 1.00 122.50 ? 116 LYS A O     1 
ATOM   724   C CB    . LYS A 1 119 ? 43.041 -44.545  -137.886 1.00 118.45 ? 116 LYS A CB    1 
ATOM   725   C CG    . LYS A 1 119 ? 43.744 -44.004  -136.656 1.00 123.84 ? 116 LYS A CG    1 
ATOM   726   C CD    . LYS A 1 119 ? 44.631 -42.826  -137.026 1.00 129.38 ? 116 LYS A CD    1 
ATOM   727   C CE    . LYS A 1 119 ? 45.135 -42.095  -135.795 1.00 145.09 ? 116 LYS A CE    1 
ATOM   728   N NZ    . LYS A 1 119 ? 45.833 -40.829  -136.152 1.00 153.23 ? 116 LYS A NZ    1 
ATOM   729   N N     . ASP A 1 120 ? 42.751 -47.391  -136.023 1.00 107.63 ? 117 ASP A N     1 
ATOM   730   C CA    . ASP A 1 120 ? 43.357 -48.666  -135.665 1.00 122.64 ? 117 ASP A CA    1 
ATOM   731   C C     . ASP A 1 120 ? 42.425 -49.847  -135.902 1.00 116.93 ? 117 ASP A C     1 
ATOM   732   O O     . ASP A 1 120 ? 42.882 -50.994  -135.855 1.00 114.01 ? 117 ASP A O     1 
ATOM   733   C CB    . ASP A 1 120 ? 43.801 -48.655  -134.200 1.00 126.67 ? 117 ASP A CB    1 
ATOM   734   C CG    . ASP A 1 120 ? 42.641 -48.816  -133.239 1.00 127.34 ? 117 ASP A CG    1 
ATOM   735   O OD1   . ASP A 1 120 ? 41.593 -48.172  -133.456 1.00 120.87 ? 117 ASP A OD1   1 
ATOM   736   O OD2   . ASP A 1 120 ? 42.776 -49.591  -132.269 1.00 118.54 ? 117 ASP A OD2   1 
ATOM   737   N N     . GLY A 1 121 ? 41.140 -49.597  -136.149 1.00 110.22 ? 118 GLY A N     1 
ATOM   738   C CA    . GLY A 1 121 ? 40.157 -50.638  -136.354 1.00 109.31 ? 118 GLY A CA    1 
ATOM   739   C C     . GLY A 1 121 ? 39.141 -50.764  -135.239 1.00 113.24 ? 118 GLY A C     1 
ATOM   740   O O     . GLY A 1 121 ? 38.084 -51.374  -135.450 1.00 109.31 ? 118 GLY A O     1 
ATOM   741   N N     . SER A 1 122 ? 39.433 -50.218  -134.059 1.00 114.95 ? 119 SER A N     1 
ATOM   742   C CA    . SER A 1 122 ? 38.479 -50.242  -132.959 1.00 104.79 ? 119 SER A CA    1 
ATOM   743   C C     . SER A 1 122 ? 37.193 -49.526  -133.354 1.00 96.09  ? 119 SER A C     1 
ATOM   744   O O     . SER A 1 122 ? 37.202 -48.565  -134.126 1.00 82.20  ? 119 SER A O     1 
ATOM   745   C CB    . SER A 1 122 ? 39.083 -49.590  -131.715 1.00 110.89 ? 119 SER A CB    1 
ATOM   746   O OG    . SER A 1 122 ? 38.146 -49.552  -130.653 1.00 120.22 ? 119 SER A OG    1 
ATOM   747   N N     . TYR A 1 123 ? 36.074 -50.005  -132.813 1.00 91.98  ? 120 TYR A N     1 
ATOM   748   C CA    . TYR A 1 123 ? 34.770 -49.520  -133.233 1.00 77.60  ? 120 TYR A CA    1 
ATOM   749   C C     . TYR A 1 123 ? 33.766 -49.657  -132.097 1.00 81.91  ? 120 TYR A C     1 
ATOM   750   O O     . TYR A 1 123 ? 33.845 -50.577  -131.280 1.00 92.17  ? 120 TYR A O     1 
ATOM   751   C CB    . TYR A 1 123 ? 34.274 -50.274  -134.474 1.00 97.41  ? 120 TYR A CB    1 
ATOM   752   C CG    . TYR A 1 123 ? 34.128 -51.765  -134.266 1.00 99.66  ? 120 TYR A CG    1 
ATOM   753   C CD1   . TYR A 1 123 ? 32.936 -52.310  -133.808 1.00 96.15  ? 120 TYR A CD1   1 
ATOM   754   C CD2   . TYR A 1 123 ? 35.184 -52.628  -134.528 1.00 89.90  ? 120 TYR A CD2   1 
ATOM   755   C CE1   . TYR A 1 123 ? 32.801 -53.670  -133.614 1.00 79.82  ? 120 TYR A CE1   1 
ATOM   756   C CE2   . TYR A 1 123 ? 35.057 -53.990  -134.339 1.00 89.78  ? 120 TYR A CE2   1 
ATOM   757   C CZ    . TYR A 1 123 ? 33.863 -54.506  -133.882 1.00 87.66  ? 120 TYR A CZ    1 
ATOM   758   O OH    . TYR A 1 123 ? 33.729 -55.861  -133.691 1.00 83.91  ? 120 TYR A OH    1 
ATOM   759   N N     . HIS A 1 124 ? 32.821 -48.724  -132.061 1.00 75.71  ? 121 HIS A N     1 
ATOM   760   C CA    . HIS A 1 124 ? 31.695 -48.767  -131.142 1.00 94.23  ? 121 HIS A CA    1 
ATOM   761   C C     . HIS A 1 124 ? 30.444 -48.346  -131.896 1.00 90.75  ? 121 HIS A C     1 
ATOM   762   O O     . HIS A 1 124 ? 30.469 -47.376  -132.656 1.00 98.50  ? 121 HIS A O     1 
ATOM   763   C CB    . HIS A 1 124 ? 31.919 -47.856  -129.927 1.00 101.54 ? 121 HIS A CB    1 
ATOM   764   C CG    . HIS A 1 124 ? 32.982 -48.344  -128.992 1.00 104.39 ? 121 HIS A CG    1 
ATOM   765   N ND1   . HIS A 1 124 ? 34.003 -47.536  -128.539 1.00 106.02 ? 121 HIS A ND1   1 
ATOM   766   C CD2   . HIS A 1 124 ? 33.187 -49.559  -128.429 1.00 105.17 ? 121 HIS A CD2   1 
ATOM   767   C CE1   . HIS A 1 124 ? 34.789 -48.230  -127.736 1.00 109.27 ? 121 HIS A CE1   1 
ATOM   768   N NE2   . HIS A 1 124 ? 34.315 -49.461  -127.651 1.00 113.65 ? 121 HIS A NE2   1 
ATOM   769   N N     . GLU A 1 125 ? 29.346 -49.060  -131.671 1.00 79.11  ? 122 GLU A N     1 
ATOM   770   C CA    . GLU A 1 125 ? 28.110 -48.824  -132.403 1.00 90.01  ? 122 GLU A CA    1 
ATOM   771   C C     . GLU A 1 125 ? 26.950 -48.701  -131.428 1.00 94.06  ? 122 GLU A C     1 
ATOM   772   O O     . GLU A 1 125 ? 26.855 -49.468  -130.465 1.00 98.16  ? 122 GLU A O     1 
ATOM   773   C CB    . GLU A 1 125 ? 27.842 -49.955  -133.407 1.00 105.08 ? 122 GLU A CB    1 
ATOM   774   C CG    . GLU A 1 125 ? 26.507 -49.860  -134.126 1.00 96.83  ? 122 GLU A CG    1 
ATOM   775   C CD    . GLU A 1 125 ? 26.275 -51.022  -135.071 1.00 81.65  ? 122 GLU A CD    1 
ATOM   776   O OE1   . GLU A 1 125 ? 26.633 -52.163  -134.709 1.00 81.53  ? 122 GLU A OE1   1 
ATOM   777   O OE2   . GLU A 1 125 ? 25.732 -50.798  -136.172 1.00 89.87  ? 122 GLU A OE2   1 
ATOM   778   N N     . ASP A 1 126 ? 26.074 -47.730  -131.676 1.00 86.24  ? 123 ASP A N     1 
ATOM   779   C CA    . ASP A 1 126 ? 24.960 -47.490  -130.769 1.00 92.98  ? 123 ASP A CA    1 
ATOM   780   C C     . ASP A 1 126 ? 23.814 -46.824  -131.520 1.00 92.78  ? 123 ASP A C     1 
ATOM   781   O O     . ASP A 1 126 ? 23.977 -46.309  -132.631 1.00 93.89  ? 123 ASP A O     1 
ATOM   782   C CB    . ASP A 1 126 ? 25.392 -46.639  -129.571 1.00 113.85 ? 123 ASP A CB    1 
ATOM   783   C CG    . ASP A 1 126 ? 24.619 -46.976  -128.311 1.00 103.19 ? 123 ASP A CG    1 
ATOM   784   O OD1   . ASP A 1 126 ? 23.371 -46.923  -128.347 1.00 99.90  ? 123 ASP A OD1   1 
ATOM   785   O OD2   . ASP A 1 126 ? 25.258 -47.296  -127.286 1.00 111.14 ? 123 ASP A OD2   1 
ATOM   786   N N     . VAL A 1 127 ? 22.646 -46.835  -130.877 1.00 85.12  ? 124 VAL A N     1 
ATOM   787   C CA    . VAL A 1 127 ? 21.415 -46.324  -131.461 1.00 85.83  ? 124 VAL A CA    1 
ATOM   788   C C     . VAL A 1 127 ? 21.250 -44.849  -131.113 1.00 89.37  ? 124 VAL A C     1 
ATOM   789   O O     . VAL A 1 127 ? 21.858 -44.325  -130.177 1.00 101.42 ? 124 VAL A O     1 
ATOM   790   C CB    . VAL A 1 127 ? 20.199 -47.150  -130.987 1.00 68.94  ? 124 VAL A CB    1 
ATOM   791   C CG1   . VAL A 1 127 ? 18.985 -46.917  -131.877 1.00 79.42  ? 124 VAL A CG1   1 
ATOM   792   C CG2   . VAL A 1 127 ? 20.551 -48.613  -130.967 1.00 97.41  ? 124 VAL A CG2   1 
ATOM   793   N N     . GLY A 1 128 ? 20.418 -44.177  -131.893 1.00 77.72  ? 125 GLY A N     1 
ATOM   794   C CA    . GLY A 1 128 ? 19.974 -42.830  -131.581 1.00 85.70  ? 125 GLY A CA    1 
ATOM   795   C C     . GLY A 1 128 ? 18.573 -42.642  -132.111 1.00 89.64  ? 125 GLY A C     1 
ATOM   796   O O     . GLY A 1 128 ? 18.161 -43.308  -133.066 1.00 92.35  ? 125 GLY A O     1 
ATOM   797   N N     . TYR A 1 129 ? 17.825 -41.746  -131.476 1.00 80.73  ? 126 TYR A N     1 
ATOM   798   C CA    . TYR A 1 129 ? 16.422 -41.571  -131.811 1.00 81.93  ? 126 TYR A CA    1 
ATOM   799   C C     . TYR A 1 129 ? 16.116 -40.131  -132.201 1.00 92.82  ? 126 TYR A C     1 
ATOM   800   O O     . TYR A 1 129 ? 16.762 -39.186  -131.737 1.00 96.69  ? 126 TYR A O     1 
ATOM   801   C CB    . TYR A 1 129 ? 15.521 -41.988  -130.646 1.00 84.74  ? 126 TYR A CB    1 
ATOM   802   C CG    . TYR A 1 129 ? 14.265 -42.679  -131.106 1.00 83.67  ? 126 TYR A CG    1 
ATOM   803   C CD1   . TYR A 1 129 ? 14.244 -44.049  -131.316 1.00 89.74  ? 126 TYR A CD1   1 
ATOM   804   C CD2   . TYR A 1 129 ? 13.106 -41.958  -131.354 1.00 96.62  ? 126 TYR A CD2   1 
ATOM   805   C CE1   . TYR A 1 129 ? 13.101 -44.686  -131.743 1.00 95.75  ? 126 TYR A CE1   1 
ATOM   806   C CE2   . TYR A 1 129 ? 11.956 -42.585  -131.784 1.00 100.30 ? 126 TYR A CE2   1 
ATOM   807   C CZ    . TYR A 1 129 ? 11.959 -43.950  -131.977 1.00 96.56  ? 126 TYR A CZ    1 
ATOM   808   O OH    . TYR A 1 129 ? 10.815 -44.579  -132.406 1.00 87.14  ? 126 TYR A OH    1 
ATOM   809   N N     . GLY A 1 130 ? 15.123 -39.988  -133.063 1.00 100.38 ? 127 GLY A N     1 
ATOM   810   C CA    . GLY A 1 130 ? 14.616 -38.680  -133.442 1.00 108.63 ? 127 GLY A CA    1 
ATOM   811   C C     . GLY A 1 130 ? 13.107 -38.670  -133.361 1.00 113.64 ? 127 GLY A C     1 
ATOM   812   O O     . GLY A 1 130 ? 12.443 -39.649  -133.715 1.00 110.29 ? 127 GLY A O     1 
ATOM   813   N N     . VAL A 1 131 ? 12.570 -37.537  -132.916 1.00 107.40 ? 128 VAL A N     1 
ATOM   814   C CA    . VAL A 1 131 ? 11.168 -37.403  -132.539 1.00 109.20 ? 128 VAL A CA    1 
ATOM   815   C C     . VAL A 1 131 ? 10.657 -36.064  -133.046 1.00 107.95 ? 128 VAL A C     1 
ATOM   816   O O     . VAL A 1 131 ? 11.291 -35.028  -132.817 1.00 119.85 ? 128 VAL A O     1 
ATOM   817   C CB    . VAL A 1 131 ? 10.972 -37.497  -131.011 1.00 112.53 ? 128 VAL A CB    1 
ATOM   818   C CG1   . VAL A 1 131 ? 9.505  -37.399  -130.662 1.00 115.31 ? 128 VAL A CG1   1 
ATOM   819   C CG2   . VAL A 1 131 ? 11.561 -38.792  -130.461 1.00 101.72 ? 128 VAL A CG2   1 
ATOM   820   N N     . SER A 1 132 ? 9.524  -36.079  -133.748 1.00 97.19  ? 129 SER A N     1 
ATOM   821   C CA    . SER A 1 132 ? 8.867  -34.837  -134.167 1.00 124.12 ? 129 SER A CA    1 
ATOM   822   C C     . SER A 1 132 ? 7.368  -34.999  -133.935 1.00 119.93 ? 129 SER A C     1 
ATOM   823   O O     . SER A 1 132 ? 6.686  -35.659  -134.720 1.00 117.49 ? 129 SER A O     1 
ATOM   824   C CB    . SER A 1 132 ? 9.171  -34.511  -135.623 1.00 133.52 ? 129 SER A CB    1 
ATOM   825   O OG    . SER A 1 132 ? 8.535  -33.306  -136.011 1.00 131.67 ? 129 SER A OG    1 
ATOM   826   N N     . GLU A 1 133 ? 6.857  -34.389  -132.867 1.00 134.18 ? 130 GLU A N     1 
ATOM   827   C CA    . GLU A 1 133 ? 5.456  -34.545  -132.495 1.00 137.86 ? 130 GLU A CA    1 
ATOM   828   C C     . GLU A 1 133 ? 4.599  -33.327  -132.809 1.00 139.20 ? 130 GLU A C     1 
ATOM   829   O O     . GLU A 1 133 ? 3.409  -33.482  -133.100 1.00 136.49 ? 130 GLU A O     1 
ATOM   830   C CB    . GLU A 1 133 ? 5.340  -34.859  -130.998 1.00 136.68 ? 130 GLU A CB    1 
ATOM   831   C CG    . GLU A 1 133 ? 6.284  -35.948  -130.520 1.00 145.11 ? 130 GLU A CG    1 
ATOM   832   C CD    . GLU A 1 133 ? 5.850  -36.572  -129.208 1.00 144.08 ? 130 GLU A CD    1 
ATOM   833   O OE1   . GLU A 1 133 ? 4.815  -37.271  -129.192 1.00 157.51 ? 130 GLU A OE1   1 
ATOM   834   O OE2   . GLU A 1 133 ? 6.546  -36.364  -128.192 1.00 136.49 ? 130 GLU A OE2   1 
ATOM   835   N N     . GLY A 1 134 ? 5.168  -32.127  -132.758 1.00 139.74 ? 131 GLY A N     1 
ATOM   836   C CA    . GLY A 1 134 ? 4.385  -30.910  -132.852 1.00 141.92 ? 131 GLY A CA    1 
ATOM   837   C C     . GLY A 1 134 ? 4.031  -30.461  -134.256 1.00 140.81 ? 131 GLY A C     1 
ATOM   838   O O     . GLY A 1 134 ? 2.899  -30.038  -134.508 1.00 144.12 ? 131 GLY A O     1 
ATOM   839   N N     . LEU A 1 135 ? 4.992  -30.547  -135.173 1.00 131.76 ? 132 LEU A N     1 
ATOM   840   C CA    . LEU A 1 135 ? 4.853  -29.931  -136.486 1.00 114.53 ? 132 LEU A CA    1 
ATOM   841   C C     . LEU A 1 135 ? 3.679  -30.524  -137.263 1.00 123.88 ? 132 LEU A C     1 
ATOM   842   O O     . LEU A 1 135 ? 3.205  -31.631  -136.992 1.00 126.80 ? 132 LEU A O     1 
ATOM   843   C CB    . LEU A 1 135 ? 6.144  -30.096  -137.288 1.00 115.23 ? 132 LEU A CB    1 
ATOM   844   C CG    . LEU A 1 135 ? 7.308  -29.196  -136.870 1.00 126.05 ? 132 LEU A CG    1 
ATOM   845   C CD1   . LEU A 1 135 ? 8.639  -29.859  -137.187 1.00 134.07 ? 132 LEU A CD1   1 
ATOM   846   C CD2   . LEU A 1 135 ? 7.206  -27.837  -137.544 1.00 135.30 ? 132 LEU A CD2   1 
ATOM   847   N N     . ALA A 1 136 ? 3.209  -29.754  -138.245 1.00 130.49 ? 133 ALA A N     1 
ATOM   848   C CA    . ALA A 1 136 ? 2.103  -30.148  -139.106 1.00 132.37 ? 133 ALA A CA    1 
ATOM   849   C C     . ALA A 1 136 ? 2.543  -30.502  -140.519 1.00 122.38 ? 133 ALA A C     1 
ATOM   850   O O     . ALA A 1 136 ? 1.700  -30.890  -141.336 1.00 96.26  ? 133 ALA A O     1 
ATOM   851   C CB    . ALA A 1 136 ? 1.052  -29.032  -139.159 1.00 135.63 ? 133 ALA A CB    1 
ATOM   852   N N     . SER A 1 137 ? 3.830  -30.375  -140.833 1.00 132.23 ? 134 SER A N     1 
ATOM   853   C CA    . SER A 1 137 ? 4.361  -30.730  -142.143 1.00 131.06 ? 134 SER A CA    1 
ATOM   854   C C     . SER A 1 137 ? 5.068  -32.076  -142.046 1.00 119.99 ? 134 SER A C     1 
ATOM   855   O O     . SER A 1 137 ? 5.983  -32.245  -141.232 1.00 122.52 ? 134 SER A O     1 
ATOM   856   C CB    . SER A 1 137 ? 5.320  -29.655  -142.653 1.00 128.64 ? 134 SER A CB    1 
ATOM   857   O OG    . SER A 1 137 ? 5.922  -30.049  -143.874 1.00 116.83 ? 134 SER A OG    1 
ATOM   858   N N     . LYS A 1 138 ? 4.637  -33.031  -142.874 1.00 115.56 ? 135 LYS A N     1 
ATOM   859   C CA    . LYS A 1 138 ? 5.233  -34.364  -142.857 1.00 117.69 ? 135 LYS A CA    1 
ATOM   860   C C     . LYS A 1 138 ? 6.716  -34.314  -143.207 1.00 115.38 ? 135 LYS A C     1 
ATOM   861   O O     . LYS A 1 138 ? 7.546  -34.937  -142.534 1.00 104.25 ? 135 LYS A O     1 
ATOM   862   C CB    . LYS A 1 138 ? 4.482  -35.279  -143.825 1.00 110.30 ? 135 LYS A CB    1 
ATOM   863   C CG    . LYS A 1 138 ? 4.745  -36.760  -143.616 1.00 88.81  ? 135 LYS A CG    1 
ATOM   864   C CD    . LYS A 1 138 ? 3.491  -37.577  -143.871 1.00 87.58  ? 135 LYS A CD    1 
ATOM   865   C CE    . LYS A 1 138 ? 3.237  -37.741  -145.360 1.00 88.70  ? 135 LYS A CE    1 
ATOM   866   N NZ    . LYS A 1 138 ? 2.110  -38.673  -145.638 1.00 87.17  ? 135 LYS A NZ    1 
ATOM   867   N N     . ALA A 1 139 ? 7.064  -33.586  -144.272 1.00 114.99 ? 136 ALA A N     1 
ATOM   868   C CA    . ALA A 1 139 ? 8.458  -33.504  -144.698 1.00 111.08 ? 136 ALA A CA    1 
ATOM   869   C C     . ALA A 1 139 ? 9.343  -32.906  -143.612 1.00 112.11 ? 136 ALA A C     1 
ATOM   870   O O     . ALA A 1 139 ? 10.444 -33.407  -143.354 1.00 111.52 ? 136 ALA A O     1 
ATOM   871   C CB    . ALA A 1 139 ? 8.564  -32.688  -145.985 1.00 97.76  ? 136 ALA A CB    1 
ATOM   872   N N     . LEU A 1 140 ? 8.881  -31.831  -142.968 1.00 111.77 ? 137 LEU A N     1 
ATOM   873   C CA    . LEU A 1 140 ? 9.661  -31.213  -141.900 1.00 117.40 ? 137 LEU A CA    1 
ATOM   874   C C     . LEU A 1 140 ? 9.838  -32.169  -140.727 1.00 116.71 ? 137 LEU A C     1 
ATOM   875   O O     . LEU A 1 140 ? 10.939 -32.293  -140.172 1.00 110.83 ? 137 LEU A O     1 
ATOM   876   C CB    . LEU A 1 140 ? 8.990  -29.918  -141.437 1.00 118.47 ? 137 LEU A CB    1 
ATOM   877   C CG    . LEU A 1 140 ? 9.330  -28.605  -142.150 1.00 123.01 ? 137 LEU A CG    1 
ATOM   878   C CD1   . LEU A 1 140 ? 9.225  -28.728  -143.664 1.00 117.88 ? 137 LEU A CD1   1 
ATOM   879   C CD2   . LEU A 1 140 ? 8.434  -27.485  -141.639 1.00 121.74 ? 137 LEU A CD2   1 
ATOM   880   N N     . SER A 1 141 ? 8.758  -32.849  -140.334 1.00 117.66 ? 138 SER A N     1 
ATOM   881   C CA    . SER A 1 141 ? 8.836  -33.793  -139.225 1.00 112.62 ? 138 SER A CA    1 
ATOM   882   C C     . SER A 1 141 ? 9.817  -34.916  -139.529 1.00 109.24 ? 138 SER A C     1 
ATOM   883   O O     . SER A 1 141 ? 10.616 -35.301  -138.668 1.00 98.31  ? 138 SER A O     1 
ATOM   884   C CB    . SER A 1 141 ? 7.449  -34.361  -138.921 1.00 110.77 ? 138 SER A CB    1 
ATOM   885   O OG    . SER A 1 141 ? 6.619  -33.389  -138.310 1.00 114.87 ? 138 SER A OG    1 
ATOM   886   N N     . LEU A 1 142 ? 9.787  -35.442  -140.756 1.00 109.40 ? 139 LEU A N     1 
ATOM   887   C CA    . LEU A 1 142 ? 10.698 -36.525  -141.112 1.00 100.89 ? 139 LEU A CA    1 
ATOM   888   C C     . LEU A 1 142 ? 12.142 -36.042  -141.165 1.00 99.44  ? 139 LEU A C     1 
ATOM   889   O O     . LEU A 1 142 ? 13.043 -36.725  -140.670 1.00 93.75  ? 139 LEU A O     1 
ATOM   890   C CB    . LEU A 1 142 ? 10.283 -37.141  -142.447 1.00 92.03  ? 139 LEU A CB    1 
ATOM   891   C CG    . LEU A 1 142 ? 9.019  -38.001  -142.409 1.00 89.96  ? 139 LEU A CG    1 
ATOM   892   C CD1   . LEU A 1 142 ? 8.534  -38.307  -143.813 1.00 110.40 ? 139 LEU A CD1   1 
ATOM   893   C CD2   . LEU A 1 142 ? 9.284  -39.285  -141.647 1.00 86.15  ? 139 LEU A CD2   1 
ATOM   894   N N     . GLU A 1 143 ? 12.384 -34.883  -141.783 1.00 105.78 ? 140 GLU A N     1 
ATOM   895   C CA    . GLU A 1 143 ? 13.721 -34.295  -141.787 1.00 99.64  ? 140 GLU A CA    1 
ATOM   896   C C     . GLU A 1 143 ? 14.273 -34.178  -140.372 1.00 101.75 ? 140 GLU A C     1 
ATOM   897   O O     . GLU A 1 143 ? 15.388 -34.641  -140.076 1.00 93.70  ? 140 GLU A O     1 
ATOM   898   C CB    . GLU A 1 143 ? 13.666 -32.921  -142.459 1.00 94.99  ? 140 GLU A CB    1 
ATOM   899   C CG    . GLU A 1 143 ? 14.988 -32.182  -142.515 1.00 106.46 ? 140 GLU A CG    1 
ATOM   900   C CD    . GLU A 1 143 ? 14.896 -30.893  -143.310 1.00 137.18 ? 140 GLU A CD    1 
ATOM   901   O OE1   . GLU A 1 143 ? 13.764 -30.421  -143.544 1.00 141.61 ? 140 GLU A OE1   1 
ATOM   902   O OE2   . GLU A 1 143 ? 15.953 -30.349  -143.697 1.00 123.32 ? 140 GLU A OE2   1 
ATOM   903   N N     . LYS A 1 144 ? 13.472 -33.601  -139.469 1.00 108.57 ? 141 LYS A N     1 
ATOM   904   C CA    . LYS A 1 144 ? 13.899 -33.442  -138.084 1.00 102.66 ? 141 LYS A CA    1 
ATOM   905   C C     . LYS A 1 144 ? 14.189 -34.792  -137.450 1.00 95.99  ? 141 LYS A C     1 
ATOM   906   O O     . LYS A 1 144 ? 15.247 -34.988  -136.843 1.00 94.91  ? 141 LYS A O     1 
ATOM   907   C CB    . LYS A 1 144 ? 12.831 -32.692  -137.286 1.00 96.48  ? 141 LYS A CB    1 
ATOM   908   C CG    . LYS A 1 144 ? 13.184 -32.491  -135.817 1.00 103.37 ? 141 LYS A CG    1 
ATOM   909   C CD    . LYS A 1 144 ? 12.013 -31.910  -135.041 1.00 108.61 ? 141 LYS A CD    1 
ATOM   910   C CE    . LYS A 1 144 ? 12.326 -31.821  -133.555 1.00 132.81 ? 141 LYS A CE    1 
ATOM   911   N NZ    . LYS A 1 144 ? 11.150 -31.364  -132.763 1.00 149.41 ? 141 LYS A NZ    1 
ATOM   912   N N     . ALA A 1 145 ? 13.259 -35.739  -137.584 1.00 93.36  ? 142 ALA A N     1 
ATOM   913   C CA    . ALA A 1 145 ? 13.403 -37.016  -136.899 1.00 97.25  ? 142 ALA A CA    1 
ATOM   914   C C     . ALA A 1 145 ? 14.652 -37.748  -137.370 1.00 87.35  ? 142 ALA A C     1 
ATOM   915   O O     . ALA A 1 145 ? 15.437 -38.241  -136.556 1.00 88.79  ? 142 ALA A O     1 
ATOM   916   C CB    . ALA A 1 145 ? 12.153 -37.868  -137.119 1.00 110.28 ? 142 ALA A CB    1 
ATOM   917   N N     . ARG A 1 146 ? 14.876 -37.793  -138.686 1.00 90.03  ? 143 ARG A N     1 
ATOM   918   C CA    . ARG A 1 146 ? 15.999 -38.558  -139.219 1.00 92.18  ? 143 ARG A CA    1 
ATOM   919   C C     . ARG A 1 146 ? 17.335 -37.919  -138.852 1.00 91.19  ? 143 ARG A C     1 
ATOM   920   O O     . ARG A 1 146 ? 18.261 -38.608  -138.394 1.00 102.68 ? 143 ARG A O     1 
ATOM   921   C CB    . ARG A 1 146 ? 15.862 -38.708  -140.736 1.00 67.05  ? 143 ARG A CB    1 
ATOM   922   C CG    . ARG A 1 146 ? 14.516 -39.271  -141.172 1.00 90.47  ? 143 ARG A CG    1 
ATOM   923   C CD    . ARG A 1 146 ? 14.529 -39.774  -142.606 1.00 91.48  ? 143 ARG A CD    1 
ATOM   924   N NE    . ARG A 1 146 ? 14.780 -41.210  -142.677 1.00 95.76  ? 143 ARG A NE    1 
ATOM   925   C CZ    . ARG A 1 146 ? 14.413 -41.979  -143.696 1.00 95.79  ? 143 ARG A CZ    1 
ATOM   926   N NH1   . ARG A 1 146 ? 13.771 -41.451  -144.730 1.00 87.86  ? 143 ARG A NH1   1 
ATOM   927   N NH2   . ARG A 1 146 ? 14.682 -43.278  -143.679 1.00 92.70  ? 143 ARG A NH2   1 
ATOM   928   N N     . LYS A 1 147 ? 17.466 -36.601  -139.052 1.00 88.81  ? 144 LYS A N     1 
ATOM   929   C CA    . LYS A 1 147 ? 18.726 -35.951  -138.703 1.00 87.92  ? 144 LYS A CA    1 
ATOM   930   C C     . LYS A 1 147 ? 19.000 -36.025  -137.202 1.00 84.47  ? 144 LYS A C     1 
ATOM   931   O O     . LYS A 1 147 ? 20.138 -36.289  -136.782 1.00 86.65  ? 144 LYS A O     1 
ATOM   932   C CB    . LYS A 1 147 ? 18.728 -34.507  -139.202 1.00 84.07  ? 144 LYS A CB    1 
ATOM   933   C CG    . LYS A 1 147 ? 18.624 -34.388  -140.715 1.00 87.36  ? 144 LYS A CG    1 
ATOM   934   C CD    . LYS A 1 147 ? 18.516 -32.943  -141.164 1.00 82.89  ? 144 LYS A CD    1 
ATOM   935   C CE    . LYS A 1 147 ? 18.447 -32.853  -142.679 1.00 80.63  ? 144 LYS A CE    1 
ATOM   936   N NZ    . LYS A 1 147 ? 18.290 -31.449  -143.148 1.00 108.97 ? 144 LYS A NZ    1 
ATOM   937   N N     . GLU A 1 148 ? 17.973 -35.797  -136.377 1.00 73.16  ? 145 GLU A N     1 
ATOM   938   C CA    . GLU A 1 148 ? 18.132 -35.924  -134.934 1.00 89.56  ? 145 GLU A CA    1 
ATOM   939   C C     . GLU A 1 148 ? 18.534 -37.339  -134.544 1.00 89.03  ? 145 GLU A C     1 
ATOM   940   O O     . GLU A 1 148 ? 19.372 -37.529  -133.656 1.00 96.33  ? 145 GLU A O     1 
ATOM   941   C CB    . GLU A 1 148 ? 16.835 -35.523  -134.231 1.00 107.09 ? 145 GLU A CB    1 
ATOM   942   C CG    . GLU A 1 148 ? 16.897 -35.581  -132.714 1.00 121.61 ? 145 GLU A CG    1 
ATOM   943   C CD    . GLU A 1 148 ? 15.600 -35.139  -132.064 1.00 131.70 ? 145 GLU A CD    1 
ATOM   944   O OE1   . GLU A 1 148 ? 14.819 -34.419  -132.722 1.00 130.69 ? 145 GLU A OE1   1 
ATOM   945   O OE2   . GLU A 1 148 ? 15.361 -35.515  -130.897 1.00 138.97 ? 145 GLU A OE2   1 
ATOM   946   N N     . ALA A 1 149 ? 17.950 -38.346  -135.198 1.00 89.44  ? 146 ALA A N     1 
ATOM   947   C CA    . ALA A 1 149 ? 18.291 -39.729  -134.890 1.00 74.91  ? 146 ALA A CA    1 
ATOM   948   C C     . ALA A 1 149 ? 19.756 -40.003  -135.189 1.00 66.28  ? 146 ALA A C     1 
ATOM   949   O O     . ALA A 1 149 ? 20.461 -40.614  -134.380 1.00 69.22  ? 146 ALA A O     1 
ATOM   950   C CB    . ALA A 1 149 ? 17.391 -40.680  -135.678 1.00 69.60  ? 146 ALA A CB    1 
ATOM   951   N N     . VAL A 1 150 ? 20.234 -39.552  -136.349 1.00 73.95  ? 147 VAL A N     1 
ATOM   952   C CA    . VAL A 1 150 ? 21.629 -39.805  -136.703 1.00 86.60  ? 147 VAL A CA    1 
ATOM   953   C C     . VAL A 1 150 ? 22.572 -39.095  -135.735 1.00 96.62  ? 147 VAL A C     1 
ATOM   954   O O     . VAL A 1 150 ? 23.562 -39.679  -135.272 1.00 94.57  ? 147 VAL A O     1 
ATOM   955   C CB    . VAL A 1 150 ? 21.895 -39.402  -138.164 1.00 77.00  ? 147 VAL A CB    1 
ATOM   956   C CG1   . VAL A 1 150 ? 23.383 -39.202  -138.405 1.00 66.73  ? 147 VAL A CG1   1 
ATOM   957   C CG2   . VAL A 1 150 ? 21.365 -40.472  -139.084 1.00 75.89  ? 147 VAL A CG2   1 
ATOM   958   N N     . THR A 1 151 ? 22.278 -37.835  -135.402 1.00 97.76  ? 148 THR A N     1 
ATOM   959   C CA    . THR A 1 151 ? 23.149 -37.100  -134.485 1.00 91.91  ? 148 THR A CA    1 
ATOM   960   C C     . THR A 1 151 ? 23.157 -37.733  -133.094 1.00 94.28  ? 148 THR A C     1 
ATOM   961   O O     . THR A 1 151 ? 24.218 -37.896  -132.474 1.00 99.31  ? 148 THR A O     1 
ATOM   962   C CB    . THR A 1 151 ? 22.714 -35.635  -134.414 1.00 87.52  ? 148 THR A CB    1 
ATOM   963   O OG1   . THR A 1 151 ? 22.800 -35.049  -135.719 1.00 87.97  ? 148 THR A OG1   1 
ATOM   964   C CG2   . THR A 1 151 ? 23.613 -34.861  -133.462 1.00 94.86  ? 148 THR A CG2   1 
ATOM   965   N N     . ASP A 1 152 ? 21.975 -38.091  -132.584 1.00 85.51  ? 149 ASP A N     1 
ATOM   966   C CA    . ASP A 1 152 ? 21.882 -38.737  -131.280 1.00 89.48  ? 149 ASP A CA    1 
ATOM   967   C C     . ASP A 1 152 ? 22.609 -40.075  -131.270 1.00 92.02  ? 149 ASP A C     1 
ATOM   968   O O     . ASP A 1 152 ? 23.252 -40.433  -130.276 1.00 94.74  ? 149 ASP A O     1 
ATOM   969   C CB    . ASP A 1 152 ? 20.415 -38.914  -130.893 1.00 88.55  ? 149 ASP A CB    1 
ATOM   970   C CG    . ASP A 1 152 ? 20.227 -39.139  -129.406 1.00 113.19 ? 149 ASP A CG    1 
ATOM   971   O OD1   . ASP A 1 152 ? 20.238 -38.143  -128.651 1.00 112.33 ? 149 ASP A OD1   1 
ATOM   972   O OD2   . ASP A 1 152 ? 20.069 -40.307  -128.994 1.00 113.57 ? 149 ASP A OD2   1 
ATOM   973   N N     . GLY A 1 153 ? 22.503 -40.839  -132.360 1.00 95.72  ? 150 GLY A N     1 
ATOM   974   C CA    . GLY A 1 153 ? 23.233 -42.091  -132.444 1.00 91.70  ? 150 GLY A CA    1 
ATOM   975   C C     . GLY A 1 153 ? 24.732 -41.886  -132.452 1.00 92.66  ? 150 GLY A C     1 
ATOM   976   O O     . GLY A 1 153 ? 25.476 -42.655  -131.841 1.00 84.37  ? 150 GLY A O     1 
ATOM   977   N N     . LEU A 1 154 ? 25.196 -40.837  -133.137 1.00 89.52  ? 151 LEU A N     1 
ATOM   978   C CA    . LEU A 1 154 ? 26.622 -40.527  -133.117 1.00 83.63  ? 151 LEU A CA    1 
ATOM   979   C C     . LEU A 1 154 ? 27.081 -40.189  -131.704 1.00 87.20  ? 151 LEU A C     1 
ATOM   980   O O     . LEU A 1 154 ? 28.147 -40.639  -131.263 1.00 89.05  ? 151 LEU A O     1 
ATOM   981   C CB    . LEU A 1 154 ? 26.925 -39.374  -134.074 1.00 76.61  ? 151 LEU A CB    1 
ATOM   982   C CG    . LEU A 1 154 ? 28.392 -38.954  -134.176 1.00 77.15  ? 151 LEU A CG    1 
ATOM   983   C CD1   . LEU A 1 154 ? 29.276 -40.150  -134.487 1.00 86.15  ? 151 LEU A CD1   1 
ATOM   984   C CD2   . LEU A 1 154 ? 28.568 -37.868  -135.226 1.00 66.78  ? 151 LEU A CD2   1 
ATOM   985   N N     . LYS A 1 155 ? 26.277 -39.412  -130.974 1.00 78.07  ? 152 LYS A N     1 
ATOM   986   C CA    . LYS A 1 155 ? 26.609 -39.106  -129.584 1.00 83.84  ? 152 LYS A CA    1 
ATOM   987   C C     . LYS A 1 155 ? 26.675 -40.375  -128.738 1.00 98.11  ? 152 LYS A C     1 
ATOM   988   O O     . LYS A 1 155 ? 27.653 -40.605  -128.015 1.00 99.36  ? 152 LYS A O     1 
ATOM   989   C CB    . LYS A 1 155 ? 25.590 -38.131  -128.994 1.00 92.60  ? 152 LYS A CB    1 
ATOM   990   C CG    . LYS A 1 155 ? 25.589 -36.743  -129.610 1.00 101.35 ? 152 LYS A CG    1 
ATOM   991   C CD    . LYS A 1 155 ? 24.738 -35.791  -128.779 1.00 102.50 ? 152 LYS A CD    1 
ATOM   992   C CE    . LYS A 1 155 ? 23.311 -36.304  -128.627 1.00 100.51 ? 152 LYS A CE    1 
ATOM   993   N NZ    . LYS A 1 155 ? 22.509 -35.471  -127.686 1.00 93.79  ? 152 LYS A NZ    1 
ATOM   994   N N     . ARG A 1 156 ? 25.631 -41.206  -128.809 1.00 95.35  ? 153 ARG A N     1 
ATOM   995   C CA    . ARG A 1 156 ? 25.583 -42.416  -127.993 1.00 89.70  ? 153 ARG A CA    1 
ATOM   996   C C     . ARG A 1 156 ? 26.676 -43.408  -128.371 1.00 84.93  ? 153 ARG A C     1 
ATOM   997   O O     . ARG A 1 156 ? 27.095 -44.214  -127.533 1.00 98.80  ? 153 ARG A O     1 
ATOM   998   C CB    . ARG A 1 156 ? 24.205 -43.069  -128.102 1.00 90.44  ? 153 ARG A CB    1 
ATOM   999   C CG    . ARG A 1 156 ? 23.176 -42.481  -127.148 1.00 94.78  ? 153 ARG A CG    1 
ATOM   1000  C CD    . ARG A 1 156 ? 21.878 -43.269  -127.175 1.00 87.82  ? 153 ARG A CD    1 
ATOM   1001  N NE    . ARG A 1 156 ? 22.082 -44.684  -126.880 1.00 89.61  ? 153 ARG A NE    1 
ATOM   1002  C CZ    . ARG A 1 156 ? 22.185 -45.186  -125.654 1.00 97.49  ? 153 ARG A CZ    1 
ATOM   1003  N NH1   . ARG A 1 156 ? 22.101 -44.390  -124.596 1.00 126.32 ? 153 ARG A NH1   1 
ATOM   1004  N NH2   . ARG A 1 156 ? 22.370 -46.489  -125.485 1.00 86.84  ? 153 ARG A NH2   1 
ATOM   1005  N N     . ALA A 1 157 ? 27.144 -43.373  -129.619 1.00 91.15  ? 154 ALA A N     1 
ATOM   1006  C CA    . ALA A 1 157 ? 28.205 -44.283  -130.033 1.00 100.44 ? 154 ALA A CA    1 
ATOM   1007  C C     . ALA A 1 157 ? 29.571 -43.771  -129.599 1.00 104.14 ? 154 ALA A C     1 
ATOM   1008  O O     . ALA A 1 157 ? 30.447 -44.563  -129.233 1.00 96.13  ? 154 ALA A O     1 
ATOM   1009  C CB    . ALA A 1 157 ? 28.164 -44.486  -131.547 1.00 95.67  ? 154 ALA A CB    1 
ATOM   1010  N N     . LEU A 1 158 ? 29.770 -42.450  -129.631 1.00 104.71 ? 155 LEU A N     1 
ATOM   1011  C CA    . LEU A 1 158 ? 31.008 -41.877  -129.120 1.00 104.09 ? 155 LEU A CA    1 
ATOM   1012  C C     . LEU A 1 158 ? 31.079 -41.936  -127.600 1.00 109.09 ? 155 LEU A C     1 
ATOM   1013  O O     . LEU A 1 158 ? 32.175 -41.827  -127.040 1.00 115.10 ? 155 LEU A O     1 
ATOM   1014  C CB    . LEU A 1 158 ? 31.159 -40.434  -129.602 1.00 102.06 ? 155 LEU A CB    1 
ATOM   1015  C CG    . LEU A 1 158 ? 31.559 -40.270  -131.070 1.00 90.12  ? 155 LEU A CG    1 
ATOM   1016  C CD1   . LEU A 1 158 ? 31.233 -38.871  -131.561 1.00 83.22  ? 155 LEU A CD1   1 
ATOM   1017  C CD2   . LEU A 1 158 ? 33.038 -40.577  -131.256 1.00 88.36  ? 155 LEU A CD2   1 
ATOM   1018  N N     . ARG A 1 159 ? 29.934 -42.088  -126.927 1.00 105.14 ? 156 ARG A N     1 
ATOM   1019  C CA    . ARG A 1 159 ? 29.926 -42.213  -125.470 1.00 108.24 ? 156 ARG A CA    1 
ATOM   1020  C C     . ARG A 1 159 ? 30.864 -43.318  -124.996 1.00 102.77 ? 156 ARG A C     1 
ATOM   1021  O O     . ARG A 1 159 ? 31.628 -43.134  -124.042 1.00 114.49 ? 156 ARG A O     1 
ATOM   1022  C CB    . ARG A 1 159 ? 28.503 -42.485  -124.977 1.00 117.36 ? 156 ARG A CB    1 
ATOM   1023  C CG    . ARG A 1 159 ? 27.624 -41.254  -124.839 1.00 120.63 ? 156 ARG A CG    1 
ATOM   1024  C CD    . ARG A 1 159 ? 26.331 -41.600  -124.115 1.00 123.24 ? 156 ARG A CD    1 
ATOM   1025  N NE    . ARG A 1 159 ? 25.465 -40.438  -123.933 1.00 120.59 ? 156 ARG A NE    1 
ATOM   1026  C CZ    . ARG A 1 159 ? 24.201 -40.507  -123.525 1.00 123.56 ? 156 ARG A CZ    1 
ATOM   1027  N NH1   . ARG A 1 159 ? 23.653 -41.685  -123.257 1.00 124.96 ? 156 ARG A NH1   1 
ATOM   1028  N NH2   . ARG A 1 159 ? 23.485 -39.401  -123.386 1.00 115.00 ? 156 ARG A NH2   1 
ATOM   1029  N N     . SER A 1 160 ? 30.820 -44.476  -125.654 1.00 115.00 ? 157 SER A N     1 
ATOM   1030  C CA    . SER A 1 160 ? 31.552 -45.673  -125.232 1.00 117.49 ? 157 SER A CA    1 
ATOM   1031  C C     . SER A 1 160 ? 33.078 -45.530  -125.322 1.00 113.74 ? 157 SER A C     1 
ATOM   1032  O O     . SER A 1 160 ? 33.765 -46.541  -125.119 1.00 103.73 ? 157 SER A O     1 
ATOM   1033  C CB    . SER A 1 160 ? 31.096 -46.875  -126.060 1.00 133.57 ? 157 SER A CB    1 
ATOM   1034  O OG    . SER A 1 160 ? 29.682 -46.923  -126.149 1.00 145.52 ? 157 SER A OG    1 
ATOM   1035  N N     . PHE A 1 161 ? 33.643 -44.357  -125.607 1.00 109.71 ? 158 PHE A N     1 
ATOM   1036  C CA    . PHE A 1 161 ? 35.090 -44.198  -125.670 1.00 121.05 ? 158 PHE A CA    1 
ATOM   1037  C C     . PHE A 1 161 ? 35.703 -43.689  -124.374 1.00 136.89 ? 158 PHE A C     1 
ATOM   1038  O O     . PHE A 1 161 ? 36.887 -43.941  -124.127 1.00 147.35 ? 158 PHE A O     1 
ATOM   1039  C CB    . PHE A 1 161 ? 35.470 -43.241  -126.807 1.00 119.61 ? 158 PHE A CB    1 
ATOM   1040  C CG    . PHE A 1 161 ? 35.545 -43.896  -128.157 1.00 123.65 ? 158 PHE A CG    1 
ATOM   1041  C CD1   . PHE A 1 161 ? 36.253 -45.074  -128.333 1.00 132.42 ? 158 PHE A CD1   1 
ATOM   1042  C CD2   . PHE A 1 161 ? 34.906 -43.334  -129.250 1.00 117.65 ? 158 PHE A CD2   1 
ATOM   1043  C CE1   . PHE A 1 161 ? 36.327 -45.676  -129.577 1.00 119.72 ? 158 PHE A CE1   1 
ATOM   1044  C CE2   . PHE A 1 161 ? 34.973 -43.933  -130.495 1.00 115.60 ? 158 PHE A CE2   1 
ATOM   1045  C CZ    . PHE A 1 161 ? 35.684 -45.106  -130.658 1.00 111.49 ? 158 PHE A CZ    1 
ATOM   1046  N N     . GLY A 1 162 ? 34.939 -42.990  -123.548 1.00 144.15 ? 159 GLY A N     1 
ATOM   1047  C CA    . GLY A 1 162 ? 35.465 -42.452  -122.311 1.00 134.88 ? 159 GLY A CA    1 
ATOM   1048  C C     . GLY A 1 162 ? 34.609 -41.318  -121.804 1.00 127.46 ? 159 GLY A C     1 
ATOM   1049  O O     . GLY A 1 162 ? 33.735 -40.801  -122.501 1.00 126.49 ? 159 GLY A O     1 
ATOM   1050  N N     . ASN A 1 163 ? 34.877 -40.938  -120.551 1.00 130.98 ? 160 ASN A N     1 
ATOM   1051  C CA    . ASN A 1 163 ? 34.135 -39.847  -119.925 1.00 137.97 ? 160 ASN A CA    1 
ATOM   1052  C C     . ASN A 1 163 ? 34.269 -38.553  -120.718 1.00 142.15 ? 160 ASN A C     1 
ATOM   1053  O O     . ASN A 1 163 ? 33.314 -37.773  -120.810 1.00 141.20 ? 160 ASN A O     1 
ATOM   1054  C CB    . ASN A 1 163 ? 34.614 -39.644  -118.487 1.00 134.92 ? 160 ASN A CB    1 
ATOM   1055  C CG    . ASN A 1 163 ? 34.519 -40.907  -117.655 1.00 128.70 ? 160 ASN A CG    1 
ATOM   1056  O OD1   . ASN A 1 163 ? 33.477 -41.560  -117.614 1.00 128.20 ? 160 ASN A OD1   1 
ATOM   1057  N ND2   . ASN A 1 163 ? 35.610 -41.257  -116.984 1.00 123.69 ? 160 ASN A ND2   1 
ATOM   1058  N N     . ALA A 1 164 ? 35.450 -38.307  -121.292 1.00 139.53 ? 161 ALA A N     1 
ATOM   1059  C CA    . ALA A 1 164 ? 35.695 -37.055  -122.002 1.00 135.78 ? 161 ALA A CA    1 
ATOM   1060  C C     . ALA A 1 164 ? 34.773 -36.880  -123.203 1.00 138.95 ? 161 ALA A C     1 
ATOM   1061  O O     . ALA A 1 164 ? 34.505 -35.746  -123.616 1.00 155.40 ? 161 ALA A O     1 
ATOM   1062  C CB    . ALA A 1 164 ? 37.156 -36.981  -122.444 1.00 131.88 ? 161 ALA A CB    1 
ATOM   1063  N N     . LEU A 1 165 ? 34.283 -37.977  -123.780 1.00 130.26 ? 162 LEU A N     1 
ATOM   1064  C CA    . LEU A 1 165 ? 33.444 -37.918  -124.970 1.00 124.98 ? 162 LEU A CA    1 
ATOM   1065  C C     . LEU A 1 165 ? 31.960 -38.074  -124.655 1.00 124.54 ? 162 LEU A C     1 
ATOM   1066  O O     . LEU A 1 165 ? 31.171 -38.376  -125.557 1.00 118.16 ? 162 LEU A O     1 
ATOM   1067  C CB    . LEU A 1 165 ? 33.887 -38.975  -125.982 1.00 121.10 ? 162 LEU A CB    1 
ATOM   1068  C CG    . LEU A 1 165 ? 35.138 -38.614  -126.785 1.00 127.75 ? 162 LEU A CG    1 
ATOM   1069  C CD1   . LEU A 1 165 ? 35.563 -39.766  -127.677 1.00 134.14 ? 162 LEU A CD1   1 
ATOM   1070  C CD2   . LEU A 1 165 ? 34.901 -37.359  -127.607 1.00 123.93 ? 162 LEU A CD2   1 
ATOM   1071  N N     . GLY A 1 166 ? 31.564 -37.879  -123.398 1.00 119.96 ? 163 GLY A N     1 
ATOM   1072  C CA    . GLY A 1 166 ? 30.163 -37.872  -123.025 1.00 115.67 ? 163 GLY A CA    1 
ATOM   1073  C C     . GLY A 1 166 ? 29.715 -39.020  -122.149 1.00 130.95 ? 163 GLY A C     1 
ATOM   1074  O O     . GLY A 1 166 ? 28.514 -39.129  -121.876 1.00 148.43 ? 163 GLY A O     1 
ATOM   1075  N N     . ASN A 1 167 ? 30.628 -39.884  -121.699 1.00 121.96 ? 164 ASN A N     1 
ATOM   1076  C CA    . ASN A 1 167 ? 30.229 -40.997  -120.846 1.00 115.25 ? 164 ASN A CA    1 
ATOM   1077  C C     . ASN A 1 167 ? 29.888 -40.548  -119.431 1.00 134.19 ? 164 ASN A C     1 
ATOM   1078  O O     . ASN A 1 167 ? 29.203 -41.281  -118.709 1.00 138.83 ? 164 ASN A O     1 
ATOM   1079  C CB    . ASN A 1 167 ? 31.333 -42.055  -120.808 1.00 112.75 ? 164 ASN A CB    1 
ATOM   1080  C CG    . ASN A 1 167 ? 30.896 -43.331  -120.115 1.00 121.67 ? 164 ASN A CG    1 
ATOM   1081  O OD1   . ASN A 1 167 ? 29.731 -43.721  -120.185 1.00 117.54 ? 164 ASN A OD1   1 
ATOM   1082  N ND2   . ASN A 1 167 ? 31.833 -43.991  -119.445 1.00 121.96 ? 164 ASN A ND2   1 
ATOM   1083  N N     . CYS A 1 168 ? 30.338 -39.362  -119.022 1.00 135.45 ? 165 CYS A N     1 
ATOM   1084  C CA    . CYS A 1 168 ? 30.098 -38.884  -117.667 1.00 135.37 ? 165 CYS A CA    1 
ATOM   1085  C C     . CYS A 1 168 ? 28.742 -38.213  -117.500 1.00 136.76 ? 165 CYS A C     1 
ATOM   1086  O O     . CYS A 1 168 ? 28.306 -38.019  -116.361 1.00 138.38 ? 165 CYS A O     1 
ATOM   1087  C CB    . CYS A 1 168 ? 31.204 -37.912  -117.249 1.00 137.33 ? 165 CYS A CB    1 
ATOM   1088  S SG    . CYS A 1 168 ? 31.415 -36.507  -118.361 1.00 166.38 ? 165 CYS A SG    1 
ATOM   1089  N N     . ILE A 1 169 ? 28.066 -37.863  -118.599 1.00 136.77 ? 166 ILE A N     1 
ATOM   1090  C CA    . ILE A 1 169 ? 26.768 -37.202  -118.512 1.00 139.64 ? 166 ILE A CA    1 
ATOM   1091  C C     . ILE A 1 169 ? 25.733 -38.086  -117.829 1.00 126.41 ? 166 ILE A C     1 
ATOM   1092  O O     . ILE A 1 169 ? 24.679 -37.596  -117.409 1.00 115.52 ? 166 ILE A O     1 
ATOM   1093  C CB    . ILE A 1 169 ? 26.291 -36.775  -119.917 1.00 136.73 ? 166 ILE A CB    1 
ATOM   1094  C CG1   . ILE A 1 169 ? 25.227 -35.679  -119.817 1.00 131.62 ? 166 ILE A CG1   1 
ATOM   1095  C CG2   . ILE A 1 169 ? 25.745 -37.970  -120.686 1.00 129.76 ? 166 ILE A CG2   1 
ATOM   1096  C CD1   . ILE A 1 169 ? 25.790 -34.301  -119.554 1.00 131.59 ? 166 ILE A CD1   1 
ATOM   1097  N N     . LEU A 1 170 ? 26.009 -39.382  -117.702 1.00 124.83 ? 167 LEU A N     1 
ATOM   1098  C CA    . LEU A 1 170 ? 25.113 -40.317  -117.037 1.00 139.96 ? 167 LEU A CA    1 
ATOM   1099  C C     . LEU A 1 170 ? 25.531 -40.611  -115.602 1.00 152.37 ? 167 LEU A C     1 
ATOM   1100  O O     . LEU A 1 170 ? 24.857 -41.392  -114.923 1.00 154.69 ? 167 LEU A O     1 
ATOM   1101  C CB    . LEU A 1 170 ? 25.033 -41.624  -117.832 1.00 141.02 ? 167 LEU A CB    1 
ATOM   1102  C CG    . LEU A 1 170 ? 24.367 -41.536  -119.207 1.00 127.97 ? 167 LEU A CG    1 
ATOM   1103  C CD1   . LEU A 1 170 ? 24.768 -42.716  -120.081 1.00 144.17 ? 167 LEU A CD1   1 
ATOM   1104  C CD2   . LEU A 1 170 ? 22.855 -41.458  -119.065 1.00 109.85 ? 167 LEU A CD2   1 
ATOM   1105  N N     . ASP A 1 171 ? 26.621 -40.010  -115.129 1.00 150.48 ? 168 ASP A N     1 
ATOM   1106  C CA    . ASP A 1 171 ? 27.066 -40.184  -113.750 1.00 156.10 ? 168 ASP A CA    1 
ATOM   1107  C C     . ASP A 1 171 ? 26.310 -39.198  -112.867 1.00 168.27 ? 168 ASP A C     1 
ATOM   1108  O O     . ASP A 1 171 ? 26.518 -37.984  -112.960 1.00 168.23 ? 168 ASP A O     1 
ATOM   1109  C CB    . ASP A 1 171 ? 28.575 -39.981  -113.647 1.00 145.93 ? 168 ASP A CB    1 
ATOM   1110  C CG    . ASP A 1 171 ? 29.136 -40.439  -112.314 1.00 160.01 ? 168 ASP A CG    1 
ATOM   1111  O OD1   . ASP A 1 171 ? 28.416 -41.140  -111.571 1.00 160.07 ? 168 ASP A OD1   1 
ATOM   1112  O OD2   . ASP A 1 171 ? 30.299 -40.098  -112.008 1.00 165.27 ? 168 ASP A OD2   1 
ATOM   1113  N N     . LYS A 1 172 ? 25.422 -39.722  -112.018 1.00 167.44 ? 169 LYS A N     1 
ATOM   1114  C CA    . LYS A 1 172 ? 24.576 -38.864  -111.192 1.00 164.44 ? 169 LYS A CA    1 
ATOM   1115  C C     . LYS A 1 172 ? 25.403 -38.021  -110.226 1.00 156.84 ? 169 LYS A C     1 
ATOM   1116  O O     . LYS A 1 172 ? 25.085 -36.851  -109.983 1.00 154.10 ? 169 LYS A O     1 
ATOM   1117  C CB    . LYS A 1 172 ? 23.559 -39.720  -110.439 1.00 154.70 ? 169 LYS A CB    1 
ATOM   1118  C CG    . LYS A 1 172 ? 22.694 -40.567  -111.362 1.00 149.21 ? 169 LYS A CG    1 
ATOM   1119  C CD    . LYS A 1 172 ? 22.123 -41.782  -110.652 1.00 172.79 ? 169 LYS A CD    1 
ATOM   1120  C CE    . LYS A 1 172 ? 21.441 -42.720  -111.637 1.00 177.36 ? 169 LYS A CE    1 
ATOM   1121  N NZ    . LYS A 1 172 ? 21.014 -43.994  -110.995 1.00 172.22 ? 169 LYS A NZ    1 
ATOM   1122  N N     . ASP A 1 173 ? 26.462 -38.603  -109.657 1.00 146.68 ? 170 ASP A N     1 
ATOM   1123  C CA    . ASP A 1 173 ? 27.347 -37.839  -108.782 1.00 155.94 ? 170 ASP A CA    1 
ATOM   1124  C C     . ASP A 1 173 ? 28.018 -36.701  -109.542 1.00 158.73 ? 170 ASP A C     1 
ATOM   1125  O O     . ASP A 1 173 ? 28.186 -35.596  -109.007 1.00 174.22 ? 170 ASP A O     1 
ATOM   1126  C CB    . ASP A 1 173 ? 28.392 -38.763  -108.158 1.00 169.72 ? 170 ASP A CB    1 
ATOM   1127  C CG    . ASP A 1 173 ? 27.770 -39.901  -107.370 1.00 177.01 ? 170 ASP A CG    1 
ATOM   1128  O OD1   . ASP A 1 173 ? 26.715 -39.682  -106.738 1.00 175.64 ? 170 ASP A OD1   1 
ATOM   1129  O OD2   . ASP A 1 173 ? 28.337 -41.015  -107.384 1.00 175.29 ? 170 ASP A OD2   1 
ATOM   1130  N N     . TYR A 1 174 ? 28.430 -36.963  -110.784 1.00 144.20 ? 171 TYR A N     1 
ATOM   1131  C CA    . TYR A 1 174 ? 28.990 -35.910  -111.625 1.00 154.73 ? 171 TYR A CA    1 
ATOM   1132  C C     . TYR A 1 174 ? 27.990 -34.778  -111.833 1.00 159.37 ? 171 TYR A C     1 
ATOM   1133  O O     . TYR A 1 174 ? 28.361 -33.601  -111.801 1.00 162.83 ? 171 TYR A O     1 
ATOM   1134  C CB    . TYR A 1 174 ? 29.438 -36.501  -112.961 1.00 154.61 ? 171 TYR A CB    1 
ATOM   1135  C CG    . TYR A 1 174 ? 29.827 -35.479  -114.002 1.00 151.55 ? 171 TYR A CG    1 
ATOM   1136  C CD1   . TYR A 1 174 ? 30.987 -34.729  -113.869 1.00 150.65 ? 171 TYR A CD1   1 
ATOM   1137  C CD2   . TYR A 1 174 ? 29.043 -35.277  -115.129 1.00 148.19 ? 171 TYR A CD2   1 
ATOM   1138  C CE1   . TYR A 1 174 ? 31.348 -33.797  -114.823 1.00 143.30 ? 171 TYR A CE1   1 
ATOM   1139  C CE2   . TYR A 1 174 ? 29.397 -34.352  -116.089 1.00 151.56 ? 171 TYR A CE2   1 
ATOM   1140  C CZ    . TYR A 1 174 ? 30.549 -33.613  -115.930 1.00 148.50 ? 171 TYR A CZ    1 
ATOM   1141  O OH    . TYR A 1 174 ? 30.901 -32.688  -116.886 1.00 150.41 ? 171 TYR A OH    1 
ATOM   1142  N N     . LEU A 1 175 ? 26.714 -35.114  -112.038 1.00 157.47 ? 172 LEU A N     1 
ATOM   1143  C CA    . LEU A 1 175 ? 25.690 -34.081  -112.184 1.00 160.05 ? 172 LEU A CA    1 
ATOM   1144  C C     . LEU A 1 175 ? 25.523 -33.282  -110.895 1.00 162.20 ? 172 LEU A C     1 
ATOM   1145  O O     . LEU A 1 175 ? 25.397 -32.048  -110.928 1.00 162.46 ? 172 LEU A O     1 
ATOM   1146  C CB    . LEU A 1 175 ? 24.363 -34.713  -112.601 1.00 153.40 ? 172 LEU A CB    1 
ATOM   1147  C CG    . LEU A 1 175 ? 24.287 -35.241  -114.035 1.00 145.20 ? 172 LEU A CG    1 
ATOM   1148  C CD1   . LEU A 1 175 ? 22.864 -35.647  -114.385 1.00 129.31 ? 172 LEU A CD1   1 
ATOM   1149  C CD2   . LEU A 1 175 ? 24.811 -34.208  -115.022 1.00 157.94 ? 172 LEU A CD2   1 
ATOM   1150  N N     . ARG A 1 176 ? 25.493 -33.972  -109.751 1.00 165.06 ? 173 ARG A N     1 
ATOM   1151  C CA    . ARG A 1 176 ? 25.397 -33.279  -108.470 1.00 171.58 ? 173 ARG A CA    1 
ATOM   1152  C C     . ARG A 1 176 ? 26.552 -32.303  -108.288 1.00 174.49 ? 173 ARG A C     1 
ATOM   1153  O O     . ARG A 1 176 ? 26.355 -31.176  -107.820 1.00 184.81 ? 173 ARG A O     1 
ATOM   1154  C CB    . ARG A 1 176 ? 25.367 -34.288  -107.321 1.00 172.77 ? 173 ARG A CB    1 
ATOM   1155  C CG    . ARG A 1 176 ? 24.157 -35.208  -107.315 1.00 171.50 ? 173 ARG A CG    1 
ATOM   1156  C CD    . ARG A 1 176 ? 23.996 -35.932  -105.980 1.00 156.03 ? 173 ARG A CD    1 
ATOM   1157  N NE    . ARG A 1 176 ? 25.165 -36.735  -105.623 1.00 159.65 ? 173 ARG A NE    1 
ATOM   1158  C CZ    . ARG A 1 176 ? 26.108 -36.347  -104.770 1.00 166.46 ? 173 ARG A CZ    1 
ATOM   1159  N NH1   . ARG A 1 176 ? 26.023 -35.164  -104.176 1.00 161.74 ? 173 ARG A NH1   1 
ATOM   1160  N NH2   . ARG A 1 176 ? 27.136 -37.143  -104.506 1.00 168.91 ? 173 ARG A NH2   1 
ATOM   1161  N N     . SER A 1 177 ? 27.766 -32.721  -108.652 1.00 165.04 ? 174 SER A N     1 
ATOM   1162  C CA    . SER A 1 177 ? 28.909 -31.818  -108.583 1.00 162.57 ? 174 SER A CA    1 
ATOM   1163  C C     . SER A 1 177 ? 28.837 -30.715  -109.632 1.00 170.11 ? 174 SER A C     1 
ATOM   1164  O O     . SER A 1 177 ? 29.430 -29.649  -109.436 1.00 174.87 ? 174 SER A O     1 
ATOM   1165  C CB    . SER A 1 177 ? 30.212 -32.603  -108.743 1.00 145.88 ? 174 SER A CB    1 
ATOM   1166  O OG    . SER A 1 177 ? 30.421 -33.473  -107.645 1.00 167.46 ? 174 SER A OG    1 
ATOM   1167  N N     . LEU A 1 178 ? 28.126 -30.948  -110.737 1.00 169.32 ? 175 LEU A N     1 
ATOM   1168  C CA    . LEU A 1 178 ? 27.953 -29.905  -111.743 1.00 171.15 ? 175 LEU A CA    1 
ATOM   1169  C C     . LEU A 1 178 ? 27.023 -28.809  -111.244 1.00 171.18 ? 175 LEU A C     1 
ATOM   1170  O O     . LEU A 1 178 ? 27.233 -27.626  -111.539 1.00 171.88 ? 175 LEU A O     1 
ATOM   1171  C CB    . LEU A 1 178 ? 27.408 -30.505  -113.039 1.00 172.76 ? 175 LEU A CB    1 
ATOM   1172  C CG    . LEU A 1 178 ? 28.399 -30.933  -114.120 1.00 169.41 ? 175 LEU A CG    1 
ATOM   1173  C CD1   . LEU A 1 178 ? 27.647 -31.482  -115.321 1.00 158.69 ? 175 LEU A CD1   1 
ATOM   1174  C CD2   . LEU A 1 178 ? 29.290 -29.771  -114.524 1.00 170.96 ? 175 LEU A CD2   1 
ATOM   1175  N N     . ASN A 1 179 ? 25.984 -29.182  -110.492 1.00 169.85 ? 176 ASN A N     1 
ATOM   1176  C CA    . ASN A 1 179 ? 25.099 -28.172  -109.918 1.00 174.49 ? 176 ASN A CA    1 
ATOM   1177  C C     . ASN A 1 179 ? 25.831 -27.271  -108.932 1.00 181.32 ? 176 ASN A C     1 
ATOM   1178  O O     . ASN A 1 179 ? 25.420 -26.126  -108.714 1.00 184.95 ? 176 ASN A O     1 
ATOM   1179  C CB    . ASN A 1 179 ? 23.904 -28.839  -109.236 1.00 175.02 ? 176 ASN A CB    1 
ATOM   1180  C CG    . ASN A 1 179 ? 23.037 -29.616  -110.207 1.00 184.24 ? 176 ASN A CG    1 
ATOM   1181  O OD1   . ASN A 1 179 ? 22.661 -29.107  -111.262 1.00 195.87 ? 176 ASN A OD1   1 
ATOM   1182  N ND2   . ASN A 1 179 ? 22.709 -30.853  -109.851 1.00 179.01 ? 176 ASN A ND2   1 
ATOM   1183  N N     . LYS A 1 180 ? 26.917 -27.765  -108.332 1.00 184.66 ? 177 LYS A N     1 
ATOM   1184  C CA    . LYS A 1 180 ? 27.670 -27.032  -107.320 1.00 189.12 ? 177 LYS A CA    1 
ATOM   1185  C C     . LYS A 1 180 ? 28.748 -26.132  -107.915 1.00 182.60 ? 177 LYS A C     1 
ATOM   1186  O O     . LYS A 1 180 ? 29.743 -25.837  -107.240 1.00 179.20 ? 177 LYS A O     1 
ATOM   1187  C CB    . LYS A 1 180 ? 28.285 -28.016  -106.324 1.00 177.95 ? 177 LYS A CB    1 
ATOM   1188  C CG    . LYS A 1 180 ? 27.261 -28.922  -105.656 1.00 174.71 ? 177 LYS A CG    1 
ATOM   1189  C CD    . LYS A 1 180 ? 27.925 -30.032  -104.859 1.00 176.57 ? 177 LYS A CD    1 
ATOM   1190  C CE    . LYS A 1 180 ? 26.892 -30.995  -104.294 1.00 177.48 ? 177 LYS A CE    1 
ATOM   1191  N NZ    . LYS A 1 180 ? 27.522 -32.121  -103.550 1.00 178.16 ? 177 LYS A NZ    1 
ATOM   1192  N N     . LEU A 1 181 ? 28.585 -25.689  -109.159 1.00 178.87 ? 178 LEU A N     1 
ATOM   1193  C CA    . LEU A 1 181 ? 29.556 -24.811  -109.790 1.00 182.28 ? 178 LEU A CA    1 
ATOM   1194  C C     . LEU A 1 181 ? 28.902 -23.499  -110.210 1.00 183.08 ? 178 LEU A C     1 
ATOM   1195  O O     . LEU A 1 181 ? 27.687 -23.449  -110.428 1.00 180.74 ? 178 LEU A O     1 
ATOM   1196  C CB    . LEU A 1 181 ? 30.192 -25.479  -111.016 1.00 182.69 ? 178 LEU A CB    1 
ATOM   1197  C CG    . LEU A 1 181 ? 31.337 -26.456  -110.738 1.00 177.60 ? 178 LEU A CG    1 
ATOM   1198  C CD1   . LEU A 1 181 ? 31.867 -27.045  -112.035 1.00 176.71 ? 178 LEU A CD1   1 
ATOM   1199  C CD2   . LEU A 1 181 ? 32.452 -25.772  -109.960 1.00 166.58 ? 178 LEU A CD2   1 
ATOM   1200  N N     . PRO A 1 182 ? 29.677 -22.420  -110.322 1.00 182.78 ? 179 PRO A N     1 
ATOM   1201  C CA    . PRO A 1 182 ? 29.107 -21.145  -110.777 1.00 181.12 ? 179 PRO A CA    1 
ATOM   1202  C C     . PRO A 1 182 ? 28.578 -21.249  -112.200 1.00 187.83 ? 179 PRO A C     1 
ATOM   1203  O O     . PRO A 1 182 ? 29.290 -21.660  -113.119 1.00 199.22 ? 179 PRO A O     1 
ATOM   1204  C CB    . PRO A 1 182 ? 30.291 -20.175  -110.683 1.00 172.04 ? 179 PRO A CB    1 
ATOM   1205  C CG    . PRO A 1 182 ? 31.198 -20.790  -109.668 1.00 166.04 ? 179 PRO A CG    1 
ATOM   1206  C CD    . PRO A 1 182 ? 31.074 -22.269  -109.880 1.00 173.48 ? 179 PRO A CD    1 
ATOM   1207  N N     . ARG A 1 183 ? 27.313 -20.870  -112.375 1.00 183.96 ? 180 ARG A N     1 
ATOM   1208  C CA    . ARG A 1 183 ? 26.663 -20.900  -113.684 1.00 195.77 ? 180 ARG A CA    1 
ATOM   1209  C C     . ARG A 1 183 ? 27.189 -19.728  -114.504 1.00 191.95 ? 180 ARG A C     1 
ATOM   1210  O O     . ARG A 1 183 ? 26.692 -18.604  -114.418 1.00 182.61 ? 180 ARG A O     1 
ATOM   1211  C CB    . ARG A 1 183 ? 25.148 -20.847  -113.537 1.00 189.80 ? 180 ARG A CB    1 
ATOM   1212  C CG    . ARG A 1 183 ? 24.409 -21.912  -114.330 1.00 181.18 ? 180 ARG A CG    1 
ATOM   1213  C CD    . ARG A 1 183 ? 24.438 -21.607  -115.819 1.00 188.91 ? 180 ARG A CD    1 
ATOM   1214  N NE    . ARG A 1 183 ? 23.983 -20.250  -116.109 1.00 193.91 ? 180 ARG A NE    1 
ATOM   1215  C CZ    . ARG A 1 183 ? 24.078 -19.669  -117.300 1.00 196.44 ? 180 ARG A CZ    1 
ATOM   1216  N NH1   . ARG A 1 183 ? 24.614 -20.326  -118.320 1.00 193.22 ? 180 ARG A NH1   1 
ATOM   1217  N NH2   . ARG A 1 183 ? 23.638 -18.430  -117.472 1.00 191.79 ? 180 ARG A NH2   1 
ATOM   1218  N N     . GLN A 1 184 ? 28.210 -19.998  -115.312 1.00 192.83 ? 181 GLN A N     1 
ATOM   1219  C CA    . GLN A 1 184 ? 28.877 -18.953  -116.070 1.00 193.68 ? 181 GLN A CA    1 
ATOM   1220  C C     . GLN A 1 184 ? 28.045 -18.541  -117.281 1.00 199.77 ? 181 GLN A C     1 
ATOM   1221  O O     . GLN A 1 184 ? 27.220 -19.302  -117.795 1.00 202.49 ? 181 GLN A O     1 
ATOM   1222  C CB    . GLN A 1 184 ? 30.261 -19.419  -116.523 1.00 195.25 ? 181 GLN A CB    1 
ATOM   1223  C CG    . GLN A 1 184 ? 30.260 -20.767  -117.227 1.00 197.59 ? 181 GLN A CG    1 
ATOM   1224  C CD    . GLN A 1 184 ? 31.610 -21.116  -117.820 1.00 188.05 ? 181 GLN A CD    1 
ATOM   1225  O OE1   . GLN A 1 184 ? 32.091 -20.446  -118.733 1.00 190.62 ? 181 GLN A OE1   1 
ATOM   1226  N NE2   . GLN A 1 184 ? 32.230 -22.168  -117.299 1.00 177.28 ? 181 GLN A NE2   1 
ATOM   1227  N N     . LEU A 1 185 ? 28.276 -17.311  -117.735 1.00 198.69 ? 182 LEU A N     1 
ATOM   1228  C CA    . LEU A 1 185 ? 27.589 -16.775  -118.897 1.00 198.38 ? 182 LEU A CA    1 
ATOM   1229  C C     . LEU A 1 185 ? 28.201 -17.350  -120.175 1.00 200.94 ? 182 LEU A C     1 
ATOM   1230  O O     . LEU A 1 185 ? 29.371 -17.742  -120.183 1.00 195.80 ? 182 LEU A O     1 
ATOM   1231  C CB    . LEU A 1 185 ? 27.684 -15.251  -118.906 1.00 190.04 ? 182 LEU A CB    1 
ATOM   1232  C CG    . LEU A 1 185 ? 26.441 -14.453  -119.309 1.00 185.82 ? 182 LEU A CG    1 
ATOM   1233  C CD1   . LEU A 1 185 ? 25.253 -14.836  -118.436 1.00 174.61 ? 182 LEU A CD1   1 
ATOM   1234  C CD2   . LEU A 1 185 ? 26.707 -12.958  -119.228 1.00 172.77 ? 182 LEU A CD2   1 
ATOM   1235  N N     . PRO A 1 186 ? 27.419 -17.444  -121.253 1.00 199.58 ? 183 PRO A N     1 
ATOM   1236  C CA    . PRO A 1 186 ? 27.954 -17.974  -122.514 1.00 195.14 ? 183 PRO A CA    1 
ATOM   1237  C C     . PRO A 1 186 ? 29.253 -17.296  -122.929 1.00 192.16 ? 183 PRO A C     1 
ATOM   1238  O O     . PRO A 1 186 ? 29.402 -16.076  -122.833 1.00 189.83 ? 183 PRO A O     1 
ATOM   1239  C CB    . PRO A 1 186 ? 26.830 -17.690  -123.514 1.00 188.30 ? 183 PRO A CB    1 
ATOM   1240  C CG    . PRO A 1 186 ? 25.589 -17.755  -122.693 1.00 190.78 ? 183 PRO A CG    1 
ATOM   1241  C CD    . PRO A 1 186 ? 25.953 -17.296  -121.299 1.00 190.83 ? 183 PRO A CD    1 
ATOM   1242  N N     . LEU A 1 187 ? 30.199 -18.108  -123.395 1.00 194.27 ? 184 LEU A N     1 
ATOM   1243  C CA    . LEU A 1 187 ? 31.490 -17.600  -123.835 1.00 196.78 ? 184 LEU A CA    1 
ATOM   1244  C C     . LEU A 1 187 ? 31.338 -16.755  -125.095 1.00 192.50 ? 184 LEU A C     1 
ATOM   1245  O O     . LEU A 1 187 ? 30.434 -16.963  -125.908 1.00 194.23 ? 184 LEU A O     1 
ATOM   1246  C CB    . LEU A 1 187 ? 32.465 -18.751  -124.097 1.00 193.01 ? 184 LEU A CB    1 
ATOM   1247  C CG    . LEU A 1 187 ? 32.798 -19.718  -122.954 1.00 195.49 ? 184 LEU A CG    1 
ATOM   1248  C CD1   . LEU A 1 187 ? 32.977 -18.971  -121.636 1.00 193.64 ? 184 LEU A CD1   1 
ATOM   1249  C CD2   . LEU A 1 187 ? 31.766 -20.837  -122.823 1.00 188.05 ? 184 LEU A CD2   1 
ATOM   1250  N N     . GLU A 1 188 ? 32.240 -15.789  -125.249 1.00 187.39 ? 185 GLU A N     1 
ATOM   1251  C CA    . GLU A 1 188 ? 32.250 -14.917  -126.415 1.00 193.03 ? 185 GLU A CA    1 
ATOM   1252  C C     . GLU A 1 188 ? 33.188 -15.486  -127.472 1.00 189.38 ? 185 GLU A C     1 
ATOM   1253  O O     . GLU A 1 188 ? 34.318 -15.879  -127.162 1.00 190.90 ? 185 GLU A O     1 
ATOM   1254  C CB    . GLU A 1 188 ? 32.679 -13.502  -126.025 1.00 199.29 ? 185 GLU A CB    1 
ATOM   1255  C CG    . GLU A 1 188 ? 32.614 -12.492  -127.158 1.00 188.71 ? 185 GLU A CG    1 
ATOM   1256  C CD    . GLU A 1 188 ? 32.933 -11.082  -126.698 1.00 187.36 ? 185 GLU A CD    1 
ATOM   1257  O OE1   . GLU A 1 188 ? 33.910 -10.910  -125.939 1.00 185.79 ? 185 GLU A OE1   1 
ATOM   1258  O OE2   . GLU A 1 188 ? 32.206 -10.147  -127.094 1.00 191.26 ? 185 GLU A OE2   1 
ATOM   1259  N N     . VAL A 1 189 ? 32.715 -15.533  -128.715 1.00 178.45 ? 186 VAL A N     1 
ATOM   1260  C CA    . VAL A 1 189 ? 33.468 -16.104  -129.827 1.00 172.51 ? 186 VAL A CA    1 
ATOM   1261  C C     . VAL A 1 189 ? 34.135 -14.973  -130.596 1.00 168.58 ? 186 VAL A C     1 
ATOM   1262  O O     . VAL A 1 189 ? 33.472 -14.009  -131.001 1.00 176.70 ? 186 VAL A O     1 
ATOM   1263  C CB    . VAL A 1 189 ? 32.560 -16.936  -130.748 1.00 176.28 ? 186 VAL A CB    1 
ATOM   1264  C CG1   . VAL A 1 189 ? 33.361 -17.505  -131.907 1.00 164.01 ? 186 VAL A CG1   1 
ATOM   1265  C CG2   . VAL A 1 189 ? 31.896 -18.054  -129.964 1.00 167.29 ? 186 VAL A CG2   1 
ATOM   1266  N N     . ASP A 1 190 ? 35.444 -15.090  -130.798 1.00 163.23 ? 187 ASP A N     1 
ATOM   1267  C CA    . ASP A 1 190 ? 36.224 -14.079  -131.502 1.00 171.96 ? 187 ASP A CA    1 
ATOM   1268  C C     . ASP A 1 190 ? 36.266 -14.434  -132.984 1.00 169.95 ? 187 ASP A C     1 
ATOM   1269  O O     . ASP A 1 190 ? 36.846 -15.455  -133.368 1.00 181.89 ? 187 ASP A O     1 
ATOM   1270  C CB    . ASP A 1 190 ? 37.631 -13.987  -130.917 1.00 166.00 ? 187 ASP A CB    1 
ATOM   1271  C CG    . ASP A 1 190 ? 38.483 -12.947  -131.611 1.00 176.08 ? 187 ASP A CG    1 
ATOM   1272  O OD1   . ASP A 1 190 ? 38.246 -11.741  -131.387 1.00 186.99 ? 187 ASP A OD1   1 
ATOM   1273  O OD2   . ASP A 1 190 ? 39.388 -13.334  -132.381 1.00 171.52 ? 187 ASP A OD2   1 
ATOM   1274  N N     . LEU A 1 191 ? 35.653 -13.593  -133.819 1.00 152.87 ? 188 LEU A N     1 
ATOM   1275  C CA    . LEU A 1 191 ? 35.611 -13.812  -135.260 1.00 164.04 ? 188 LEU A CA    1 
ATOM   1276  C C     . LEU A 1 191 ? 36.602 -12.929  -136.011 1.00 172.12 ? 188 LEU A C     1 
ATOM   1277  O O     . LEU A 1 191 ? 36.361 -12.569  -137.169 1.00 171.01 ? 188 LEU A O     1 
ATOM   1278  C CB    . LEU A 1 191 ? 34.196 -13.593  -135.791 1.00 163.55 ? 188 LEU A CB    1 
ATOM   1279  C CG    . LEU A 1 191 ? 33.114 -14.455  -135.146 1.00 151.11 ? 188 LEU A CG    1 
ATOM   1280  C CD1   . LEU A 1 191 ? 31.791 -14.249  -135.851 1.00 146.32 ? 188 LEU A CD1   1 
ATOM   1281  C CD2   . LEU A 1 191 ? 33.518 -15.918  -135.180 1.00 160.51 ? 188 LEU A CD2   1 
ATOM   1282  N N     . THR A 1 192 ? 37.714 -12.572  -135.371 1.00 173.87 ? 189 THR A N     1 
ATOM   1283  C CA    . THR A 1 192 ? 38.752 -11.798  -136.044 1.00 172.12 ? 189 THR A CA    1 
ATOM   1284  C C     . THR A 1 192 ? 39.582 -12.691  -136.960 1.00 165.35 ? 189 THR A C     1 
ATOM   1285  O O     . THR A 1 192 ? 39.675 -12.448  -138.168 1.00 153.82 ? 189 THR A O     1 
ATOM   1286  C CB    . THR A 1 192 ? 39.645 -11.098  -135.015 1.00 174.69 ? 189 THR A CB    1 
ATOM   1287  O OG1   . THR A 1 192 ? 40.282 -12.077  -134.185 1.00 175.36 ? 189 THR A OG1   1 
ATOM   1288  C CG2   . THR A 1 192 ? 38.823 -10.153  -134.151 1.00 156.15 ? 189 THR A CG2   1 
ATOM   1289  N N     . LYS A 1 193 ? 40.190 -13.734  -136.395 1.00 170.98 ? 190 LYS A N     1 
ATOM   1290  C CA    . LYS A 1 193 ? 41.021 -14.671  -137.139 1.00 179.43 ? 190 LYS A CA    1 
ATOM   1291  C C     . LYS A 1 193 ? 40.210 -15.747  -137.856 1.00 177.01 ? 190 LYS A C     1 
ATOM   1292  O O     . LYS A 1 193 ? 40.770 -16.791  -138.212 1.00 164.94 ? 190 LYS A O     1 
ATOM   1293  C CB    . LYS A 1 193 ? 42.030 -15.329  -136.195 1.00 178.01 ? 190 LYS A CB    1 
ATOM   1294  C CG    . LYS A 1 193 ? 42.883 -14.346  -135.413 1.00 172.25 ? 190 LYS A CG    1 
ATOM   1295  C CD    . LYS A 1 193 ? 43.821 -15.070  -134.463 1.00 159.51 ? 190 LYS A CD    1 
ATOM   1296  C CE    . LYS A 1 193 ? 44.636 -14.089  -133.635 1.00 151.99 ? 190 LYS A CE    1 
ATOM   1297  N NZ    . LYS A 1 193 ? 45.539 -14.787  -132.678 1.00 143.64 ? 190 LYS A NZ    1 
ATOM   1298  N N     . ALA A 1 194 ? 38.915 -15.524  -138.068 1.00 172.49 ? 191 ALA A N     1 
ATOM   1299  C CA    . ALA A 1 194 ? 38.082 -16.499  -138.755 1.00 163.60 ? 191 ALA A CA    1 
ATOM   1300  C C     . ALA A 1 194 ? 38.514 -16.660  -140.209 1.00 164.07 ? 191 ALA A C     1 
ATOM   1301  O O     . ALA A 1 194 ? 39.108 -15.760  -140.809 1.00 162.95 ? 191 ALA A O     1 
ATOM   1302  C CB    . ALA A 1 194 ? 36.612 -16.087  -138.688 1.00 155.38 ? 191 ALA A CB    1 
ATOM   1303  N N     . LYS A 1 195 ? 38.212 -17.829  -140.772 1.00 159.10 ? 192 LYS A N     1 
ATOM   1304  C CA    . LYS A 1 195 ? 38.531 -18.095  -142.169 1.00 158.74 ? 192 LYS A CA    1 
ATOM   1305  C C     . LYS A 1 195 ? 37.734 -17.167  -143.075 1.00 149.11 ? 192 LYS A C     1 
ATOM   1306  O O     . LYS A 1 195 ? 36.517 -17.021  -142.920 1.00 129.14 ? 192 LYS A O     1 
ATOM   1307  C CB    . LYS A 1 195 ? 38.239 -19.557  -142.509 1.00 155.19 ? 192 LYS A CB    1 
ATOM   1308  C CG    . LYS A 1 195 ? 38.605 -19.949  -143.928 1.00 153.21 ? 192 LYS A CG    1 
ATOM   1309  C CD    . LYS A 1 195 ? 38.677 -21.458  -144.080 1.00 148.54 ? 192 LYS A CD    1 
ATOM   1310  C CE    . LYS A 1 195 ? 39.179 -21.843  -145.461 1.00 158.87 ? 192 LYS A CE    1 
ATOM   1311  N NZ    . LYS A 1 195 ? 40.429 -21.116  -145.814 1.00 154.48 ? 192 LYS A NZ    1 
ATOM   1312  N N     . ARG A 1 196 ? 38.425 -16.533  -144.024 1.00 146.42 ? 193 ARG A N     1 
ATOM   1313  C CA    . ARG A 1 196 ? 37.808 -15.520  -144.868 1.00 148.79 ? 193 ARG A CA    1 
ATOM   1314  C C     . ARG A 1 196 ? 37.999 -15.737  -146.363 1.00 136.75 ? 193 ARG A C     1 
ATOM   1315  O O     . ARG A 1 196 ? 37.399 -14.996  -147.150 1.00 117.67 ? 193 ARG A O     1 
ATOM   1316  C CB    . ARG A 1 196 ? 38.330 -14.126  -144.488 1.00 162.36 ? 193 ARG A CB    1 
ATOM   1317  C CG    . ARG A 1 196 ? 37.925 -13.709  -143.079 1.00 161.98 ? 193 ARG A CG    1 
ATOM   1318  C CD    . ARG A 1 196 ? 37.905 -12.202  -142.897 1.00 149.67 ? 193 ARG A CD    1 
ATOM   1319  N NE    . ARG A 1 196 ? 36.867 -11.791  -141.954 1.00 156.75 ? 193 ARG A NE    1 
ATOM   1320  C CZ    . ARG A 1 196 ? 36.967 -11.893  -140.632 1.00 160.82 ? 193 ARG A CZ    1 
ATOM   1321  N NH1   . ARG A 1 196 ? 38.065 -12.395  -140.083 1.00 158.26 ? 193 ARG A NH1   1 
ATOM   1322  N NH2   . ARG A 1 196 ? 35.968 -11.493  -139.857 1.00 162.37 ? 193 ARG A NH2   1 
ATOM   1323  N N     . GLN A 1 197 ? 38.801 -16.714  -146.783 1.00 144.73 ? 194 GLN A N     1 
ATOM   1324  C CA    . GLN A 1 197 ? 38.974 -17.019  -148.196 1.00 148.08 ? 194 GLN A CA    1 
ATOM   1325  C C     . GLN A 1 197 ? 39.110 -18.526  -148.365 1.00 154.08 ? 194 GLN A C     1 
ATOM   1326  O O     . GLN A 1 197 ? 39.280 -19.271  -147.397 1.00 155.62 ? 194 GLN A O     1 
ATOM   1327  C CB    . GLN A 1 197 ? 40.184 -16.283  -148.792 1.00 142.77 ? 194 GLN A CB    1 
ATOM   1328  C CG    . GLN A 1 197 ? 41.516 -17.008  -148.645 1.00 138.76 ? 194 GLN A CG    1 
ATOM   1329  C CD    . GLN A 1 197 ? 42.005 -17.070  -147.209 1.00 153.79 ? 194 GLN A CD    1 
ATOM   1330  O OE1   . GLN A 1 197 ? 41.437 -16.441  -146.316 1.00 158.17 ? 194 GLN A OE1   1 
ATOM   1331  N NE2   . GLN A 1 197 ? 43.070 -17.830  -146.982 1.00 154.57 ? 194 GLN A NE2   1 
ATOM   1332  N N     . ASP A 1 198 ? 39.031 -18.974  -149.620 1.00 151.92 ? 195 ASP A N     1 
ATOM   1333  C CA    . ASP A 1 198 ? 39.031 -20.405  -149.912 1.00 145.39 ? 195 ASP A CA    1 
ATOM   1334  C C     . ASP A 1 198 ? 40.424 -21.014  -149.788 1.00 142.59 ? 195 ASP A C     1 
ATOM   1335  O O     . ASP A 1 198 ? 40.632 -21.968  -149.029 1.00 134.05 ? 195 ASP A O     1 
ATOM   1336  C CB    . ASP A 1 198 ? 38.468 -20.653  -151.315 1.00 139.70 ? 195 ASP A CB    1 
ATOM   1337  C CG    . ASP A 1 198 ? 37.015 -20.238  -151.444 1.00 143.18 ? 195 ASP A CG    1 
ATOM   1338  O OD1   . ASP A 1 198 ? 36.381 -19.953  -150.407 1.00 149.27 ? 195 ASP A OD1   1 
ATOM   1339  O OD2   . ASP A 1 198 ? 36.507 -20.199  -152.584 1.00 135.21 ? 195 ASP A OD2   1 
ATOM   1340  N N     . LEU A 1 199 ? 41.387 -20.475  -150.534 1.00 147.80 ? 196 LEU A N     1 
ATOM   1341  C CA    . LEU A 1 199 ? 42.701 -21.098  -150.644 1.00 148.49 ? 196 LEU A CA    1 
ATOM   1342  C C     . LEU A 1 199 ? 43.406 -21.167  -149.294 1.00 157.14 ? 196 LEU A C     1 
ATOM   1343  O O     . LEU A 1 199 ? 43.346 -20.231  -148.491 1.00 162.32 ? 196 LEU A O     1 
ATOM   1344  C CB    . LEU A 1 199 ? 43.562 -20.329  -151.647 1.00 138.71 ? 196 LEU A CB    1 
ATOM   1345  C CG    . LEU A 1 199 ? 44.987 -20.838  -151.874 1.00 147.80 ? 196 LEU A CG    1 
ATOM   1346  C CD1   . LEU A 1 199 ? 44.975 -22.295  -152.313 1.00 148.56 ? 196 LEU A CD1   1 
ATOM   1347  C CD2   . LEU A 1 199 ? 45.711 -19.973  -152.894 1.00 156.29 ? 196 LEU A CD2   1 
ATOM   1348  N N     . GLU A 1 200 ? 44.079 -22.292  -149.051 1.00 163.22 ? 197 GLU A N     1 
ATOM   1349  C CA    . GLU A 1 200 ? 44.887 -22.507  -147.850 1.00 166.01 ? 197 GLU A CA    1 
ATOM   1350  C C     . GLU A 1 200 ? 46.292 -22.906  -148.283 1.00 170.06 ? 197 GLU A C     1 
ATOM   1351  O O     . GLU A 1 200 ? 46.617 -24.099  -148.355 1.00 166.48 ? 197 GLU A O     1 
ATOM   1352  C CB    . GLU A 1 200 ? 44.265 -23.570  -146.944 1.00 159.13 ? 197 GLU A CB    1 
ATOM   1353  C CG    . GLU A 1 200 ? 43.025 -23.108  -146.201 1.00 157.96 ? 197 GLU A CG    1 
ATOM   1354  C CD    . GLU A 1 200 ? 43.354 -22.227  -145.012 1.00 165.47 ? 197 GLU A CD    1 
ATOM   1355  O OE1   . GLU A 1 200 ? 44.285 -22.573  -144.254 1.00 173.65 ? 197 GLU A OE1   1 
ATOM   1356  O OE2   . GLU A 1 200 ? 42.682 -21.189  -144.835 1.00 167.37 ? 197 GLU A OE2   1 
ATOM   1357  N N     . PRO A 1 201 ? 47.148 -21.928  -148.595 1.00 169.22 ? 198 PRO A N     1 
ATOM   1358  C CA    . PRO A 1 201 ? 48.515 -22.259  -149.034 1.00 163.96 ? 198 PRO A CA    1 
ATOM   1359  C C     . PRO A 1 201 ? 49.301 -23.070  -148.022 1.00 161.70 ? 198 PRO A C     1 
ATOM   1360  O O     . PRO A 1 201 ? 50.172 -23.854  -148.419 1.00 163.54 ? 198 PRO A O     1 
ATOM   1361  C CB    . PRO A 1 201 ? 49.146 -20.880  -149.272 1.00 171.31 ? 198 PRO A CB    1 
ATOM   1362  C CG    . PRO A 1 201 ? 47.987 -19.999  -149.573 1.00 182.43 ? 198 PRO A CG    1 
ATOM   1363  C CD    . PRO A 1 201 ? 46.886 -20.482  -148.673 1.00 175.81 ? 198 PRO A CD    1 
ATOM   1364  N N     . SER A 1 202 ? 49.039 -22.888  -146.724 1.00 153.72 ? 199 SER A N     1 
ATOM   1365  C CA    . SER A 1 202 ? 49.685 -23.717  -145.711 1.00 160.07 ? 199 SER A CA    1 
ATOM   1366  C C     . SER A 1 202 ? 49.465 -25.198  -145.993 1.00 169.44 ? 199 SER A C     1 
ATOM   1367  O O     . SER A 1 202 ? 50.381 -26.014  -145.838 1.00 166.86 ? 199 SER A O     1 
ATOM   1368  C CB    . SER A 1 202 ? 49.158 -23.353  -144.322 1.00 155.09 ? 199 SER A CB    1 
ATOM   1369  O OG    . SER A 1 202 ? 49.850 -24.062  -143.308 1.00 133.37 ? 199 SER A OG    1 
ATOM   1370  N N     . VAL A 1 203 ? 48.254 -25.560  -146.411 1.00 175.63 ? 200 VAL A N     1 
ATOM   1371  C CA    . VAL A 1 203 ? 47.947 -26.948  -146.739 1.00 177.51 ? 200 VAL A CA    1 
ATOM   1372  C C     . VAL A 1 203 ? 48.462 -27.303  -148.129 1.00 167.50 ? 200 VAL A C     1 
ATOM   1373  O O     . VAL A 1 203 ? 49.010 -28.393  -148.340 1.00 166.83 ? 200 VAL A O     1 
ATOM   1374  C CB    . VAL A 1 203 ? 46.432 -27.200  -146.619 1.00 177.39 ? 200 VAL A CB    1 
ATOM   1375  C CG1   . VAL A 1 203 ? 46.121 -28.661  -146.890 1.00 174.84 ? 200 VAL A CG1   1 
ATOM   1376  C CG2   . VAL A 1 203 ? 45.924 -26.776  -145.250 1.00 164.65 ? 200 VAL A CG2   1 
ATOM   1377  N N     . GLU A 1 204 ? 48.234 -26.411  -149.100 1.00 156.07 ? 201 GLU A N     1 
ATOM   1378  C CA    . GLU A 1 204 ? 48.664 -26.642  -150.477 1.00 161.38 ? 201 GLU A CA    1 
ATOM   1379  C C     . GLU A 1 204 ? 50.153 -26.961  -150.570 1.00 166.03 ? 201 GLU A C     1 
ATOM   1380  O O     . GLU A 1 204 ? 50.558 -27.838  -151.339 1.00 150.36 ? 201 GLU A O     1 
ATOM   1381  C CB    . GLU A 1 204 ? 48.326 -25.420  -151.333 1.00 171.54 ? 201 GLU A CB    1 
ATOM   1382  C CG    . GLU A 1 204 ? 48.950 -25.424  -152.718 1.00 173.21 ? 201 GLU A CG    1 
ATOM   1383  C CD    . GLU A 1 204 ? 48.380 -26.504  -153.612 1.00 154.27 ? 201 GLU A CD    1 
ATOM   1384  O OE1   . GLU A 1 204 ? 47.157 -26.482  -153.864 1.00 149.80 ? 201 GLU A OE1   1 
ATOM   1385  O OE2   . GLU A 1 204 ? 49.155 -27.372  -154.066 1.00 153.03 ? 201 GLU A OE2   1 
ATOM   1386  N N     . GLU A 1 205 ? 50.980 -26.260  -149.792 1.00 186.11 ? 202 GLU A N     1 
ATOM   1387  C CA    . GLU A 1 205 ? 52.421 -26.501  -149.807 1.00 194.53 ? 202 GLU A CA    1 
ATOM   1388  C C     . GLU A 1 205 ? 52.740 -27.938  -149.413 1.00 178.40 ? 202 GLU A C     1 
ATOM   1389  O O     . GLU A 1 205 ? 53.412 -28.672  -150.151 1.00 164.38 ? 202 GLU A O     1 
ATOM   1390  C CB    . GLU A 1 205 ? 53.116 -25.515  -148.866 1.00 197.25 ? 202 GLU A CB    1 
ATOM   1391  C CG    . GLU A 1 205 ? 54.632 -25.514  -148.948 1.00 196.09 ? 202 GLU A CG    1 
ATOM   1392  C CD    . GLU A 1 205 ? 55.253 -24.423  -148.097 1.00 195.47 ? 202 GLU A CD    1 
ATOM   1393  O OE1   . GLU A 1 205 ? 55.088 -24.470  -146.859 1.00 189.29 ? 202 GLU A OE1   1 
ATOM   1394  O OE2   . GLU A 1 205 ? 55.902 -23.519  -148.664 1.00 199.54 ? 202 GLU A OE2   1 
ATOM   1395  N N     . ALA A 1 206 ? 52.273 -28.346  -148.231 1.00 177.71 ? 203 ALA A N     1 
ATOM   1396  C CA    . ALA A 1 206 ? 52.548 -29.690  -147.739 1.00 182.78 ? 203 ALA A CA    1 
ATOM   1397  C C     . ALA A 1 206 ? 51.981 -30.753  -148.671 1.00 177.59 ? 203 ALA A C     1 
ATOM   1398  O O     . ALA A 1 206 ? 52.592 -31.810  -148.859 1.00 168.62 ? 203 ALA A O     1 
ATOM   1399  C CB    . ALA A 1 206 ? 51.980 -29.854  -146.331 1.00 167.95 ? 203 ALA A CB    1 
ATOM   1400  N N     . ARG A 1 207 ? 50.816 -30.492  -149.271 1.00 175.83 ? 204 ARG A N     1 
ATOM   1401  C CA    . ARG A 1 207 ? 50.211 -31.508  -150.128 1.00 166.95 ? 204 ARG A CA    1 
ATOM   1402  C C     . ARG A 1 207 ? 50.952 -31.632  -151.454 1.00 169.45 ? 204 ARG A C     1 
ATOM   1403  O O     . ARG A 1 207 ? 51.122 -32.742  -151.972 1.00 168.27 ? 204 ARG A O     1 
ATOM   1404  C CB    . ARG A 1 207 ? 48.735 -31.200  -150.365 1.00 158.22 ? 204 ARG A CB    1 
ATOM   1405  C CG    . ARG A 1 207 ? 47.977 -32.364  -150.984 1.00 155.37 ? 204 ARG A CG    1 
ATOM   1406  C CD    . ARG A 1 207 ? 46.573 -31.970  -151.381 1.00 149.75 ? 204 ARG A CD    1 
ATOM   1407  N NE    . ARG A 1 207 ? 45.902 -31.202  -150.338 1.00 154.49 ? 204 ARG A NE    1 
ATOM   1408  C CZ    . ARG A 1 207 ? 45.063 -30.200  -150.578 1.00 153.56 ? 204 ARG A CZ    1 
ATOM   1409  N NH1   . ARG A 1 207 ? 44.798 -29.842  -151.827 1.00 148.74 ? 204 ARG A NH1   1 
ATOM   1410  N NH2   . ARG A 1 207 ? 44.495 -29.551  -149.573 1.00 142.04 ? 204 ARG A NH2   1 
ATOM   1411  N N     . TYR A 1 208 ? 51.390 -30.507  -152.026 1.00 169.65 ? 205 TYR A N     1 
ATOM   1412  C CA    . TYR A 1 208 ? 52.200 -30.568  -153.236 1.00 164.32 ? 205 TYR A CA    1 
ATOM   1413  C C     . TYR A 1 208 ? 53.542 -31.233  -152.966 1.00 167.96 ? 205 TYR A C     1 
ATOM   1414  O O     . TYR A 1 208 ? 54.086 -31.907  -153.848 1.00 172.24 ? 205 TYR A O     1 
ATOM   1415  C CB    . TYR A 1 208 ? 52.402 -29.167  -153.811 1.00 157.57 ? 205 TYR A CB    1 
ATOM   1416  C CG    . TYR A 1 208 ? 53.322 -29.132  -155.011 1.00 154.02 ? 205 TYR A CG    1 
ATOM   1417  C CD1   . TYR A 1 208 ? 52.953 -29.732  -156.208 1.00 149.15 ? 205 TYR A CD1   1 
ATOM   1418  C CD2   . TYR A 1 208 ? 54.559 -28.504  -154.947 1.00 164.10 ? 205 TYR A CD2   1 
ATOM   1419  C CE1   . TYR A 1 208 ? 53.788 -29.707  -157.308 1.00 148.61 ? 205 TYR A CE1   1 
ATOM   1420  C CE2   . TYR A 1 208 ? 55.402 -28.474  -156.043 1.00 162.01 ? 205 TYR A CE2   1 
ATOM   1421  C CZ    . TYR A 1 208 ? 55.011 -29.076  -157.221 1.00 150.06 ? 205 TYR A CZ    1 
ATOM   1422  O OH    . TYR A 1 208 ? 55.846 -29.048  -158.314 1.00 131.78 ? 205 TYR A OH    1 
ATOM   1423  N N     . ASN A 1 209 ? 54.088 -31.058  -151.762 1.00 168.18 ? 206 ASN A N     1 
ATOM   1424  C CA    . ASN A 1 209 ? 55.310 -31.762  -151.395 1.00 172.22 ? 206 ASN A CA    1 
ATOM   1425  C C     . ASN A 1 209 ? 55.055 -33.196  -150.948 1.00 175.68 ? 206 ASN A C     1 
ATOM   1426  O O     . ASN A 1 209 ? 56.017 -33.948  -150.757 1.00 179.25 ? 206 ASN A O     1 
ATOM   1427  C CB    . ASN A 1 209 ? 56.046 -31.001  -150.289 1.00 173.58 ? 206 ASN A CB    1 
ATOM   1428  C CG    . ASN A 1 209 ? 56.608 -29.676  -150.767 1.00 173.77 ? 206 ASN A CG    1 
ATOM   1429  O OD1   . ASN A 1 209 ? 56.246 -28.615  -150.258 1.00 168.83 ? 206 ASN A OD1   1 
ATOM   1430  N ND2   . ASN A 1 209 ? 57.498 -29.732  -151.751 1.00 172.96 ? 206 ASN A ND2   1 
ATOM   1431  N N     . SER A 1 210 ? 53.793 -33.592  -150.782 1.00 172.64 ? 207 SER A N     1 
ATOM   1432  C CA    . SER A 1 210 ? 53.441 -34.928  -150.319 1.00 170.87 ? 207 SER A CA    1 
ATOM   1433  C C     . SER A 1 210 ? 53.559 -35.995  -151.401 1.00 158.19 ? 207 SER A C     1 
ATOM   1434  O O     . SER A 1 210 ? 53.373 -37.178  -151.098 1.00 161.95 ? 207 SER A O     1 
ATOM   1435  C CB    . SER A 1 210 ? 52.016 -34.927  -149.758 1.00 174.96 ? 207 SER A CB    1 
ATOM   1436  O OG    . SER A 1 210 ? 51.761 -36.095  -148.998 1.00 182.96 ? 207 SER A OG    1 
ATOM   1437  N N     . CYS A 1 211 ? 53.854 -35.618  -152.640 1.00 159.33 ? 208 CYS A N     1 
ATOM   1438  C CA    . CYS A 1 211 ? 53.982 -36.593  -153.717 1.00 166.60 ? 208 CYS A CA    1 
ATOM   1439  C C     . CYS A 1 211 ? 55.415 -37.101  -153.829 1.00 144.94 ? 208 CYS A C     1 
ATOM   1440  O O     . CYS A 1 211 ? 55.841 -37.560  -154.889 1.00 112.91 ? 208 CYS A O     1 
ATOM   1441  C CB    . CYS A 1 211 ? 53.532 -35.989  -155.048 1.00 166.22 ? 208 CYS A CB    1 
ATOM   1442  S SG    . CYS A 1 211 ? 51.785 -35.524  -155.108 1.00 170.35 ? 208 CYS A SG    1 
ATOM   1443  N N     . CYS B 1 28  ? 46.789 -45.391  -154.319 1.00 155.98 ? 25  CYS B N     1 
ATOM   1444  C CA    . CYS B 1 28  ? 45.577 -44.831  -154.905 1.00 145.82 ? 25  CYS B CA    1 
ATOM   1445  C C     . CYS B 1 28  ? 44.663 -44.263  -153.825 1.00 128.15 ? 25  CYS B C     1 
ATOM   1446  O O     . CYS B 1 28  ? 45.062 -44.135  -152.667 1.00 130.84 ? 25  CYS B O     1 
ATOM   1447  C CB    . CYS B 1 28  ? 44.836 -45.895  -155.719 1.00 149.01 ? 25  CYS B CB    1 
ATOM   1448  S SG    . CYS B 1 28  ? 44.376 -47.375  -154.783 1.00 128.87 ? 25  CYS B SG    1 
ATOM   1449  N N     . PHE B 1 29  ? 43.436 -43.923  -154.210 1.00 112.10 ? 26  PHE B N     1 
ATOM   1450  C CA    . PHE B 1 29  ? 42.470 -43.406  -153.251 1.00 99.28  ? 26  PHE B CA    1 
ATOM   1451  C C     . PHE B 1 29  ? 42.048 -44.504  -152.283 1.00 114.11 ? 26  PHE B C     1 
ATOM   1452  O O     . PHE B 1 29  ? 41.876 -45.664  -152.669 1.00 131.72 ? 26  PHE B O     1 
ATOM   1453  C CB    . PHE B 1 29  ? 41.251 -42.840  -153.977 1.00 98.68  ? 26  PHE B CB    1 
ATOM   1454  C CG    . PHE B 1 29  ? 40.441 -41.886  -153.149 1.00 101.42 ? 26  PHE B CG    1 
ATOM   1455  C CD1   . PHE B 1 29  ? 39.530 -42.354  -152.216 1.00 98.30  ? 26  PHE B CD1   1 
ATOM   1456  C CD2   . PHE B 1 29  ? 40.594 -40.518  -153.300 1.00 102.30 ? 26  PHE B CD2   1 
ATOM   1457  C CE1   . PHE B 1 29  ? 38.788 -41.476  -151.453 1.00 103.07 ? 26  PHE B CE1   1 
ATOM   1458  C CE2   . PHE B 1 29  ? 39.854 -39.636  -152.540 1.00 99.92  ? 26  PHE B CE2   1 
ATOM   1459  C CZ    . PHE B 1 29  ? 38.951 -40.116  -151.614 1.00 99.67  ? 26  PHE B CZ    1 
ATOM   1460  N N     . GLY B 1 30  ? 41.883 -44.131  -151.014 1.00 109.39 ? 27  GLY B N     1 
ATOM   1461  C CA    . GLY B 1 30  ? 41.621 -45.089  -149.963 1.00 116.09 ? 27  GLY B CA    1 
ATOM   1462  C C     . GLY B 1 30  ? 42.849 -45.784  -149.420 1.00 122.29 ? 27  GLY B C     1 
ATOM   1463  O O     . GLY B 1 30  ? 42.766 -46.408  -148.353 1.00 123.24 ? 27  GLY B O     1 
ATOM   1464  N N     . GLN B 1 31  ? 43.982 -45.703  -150.114 1.00 123.62 ? 28  GLN B N     1 
ATOM   1465  C CA    . GLN B 1 31  ? 45.228 -46.335  -149.699 1.00 126.70 ? 28  GLN B CA    1 
ATOM   1466  C C     . GLN B 1 31  ? 46.296 -45.343  -149.268 1.00 135.29 ? 28  GLN B C     1 
ATOM   1467  O O     . GLN B 1 31  ? 46.997 -45.592  -148.285 1.00 149.66 ? 28  GLN B O     1 
ATOM   1468  C CB    . GLN B 1 31  ? 45.782 -47.202  -150.837 1.00 125.15 ? 28  GLN B CB    1 
ATOM   1469  C CG    . GLN B 1 31  ? 44.862 -48.338  -151.274 1.00 133.71 ? 28  GLN B CG    1 
ATOM   1470  C CD    . GLN B 1 31  ? 44.880 -49.525  -150.325 1.00 139.23 ? 28  GLN B CD    1 
ATOM   1471  O OE1   . GLN B 1 31  ? 45.321 -49.421  -149.180 1.00 139.20 ? 28  GLN B OE1   1 
ATOM   1472  N NE2   . GLN B 1 31  ? 44.397 -50.665  -150.804 1.00 146.29 ? 28  GLN B NE2   1 
ATOM   1473  N N     . CYS B 1 32  ? 46.443 -44.230  -149.987 1.00 131.74 ? 29  CYS B N     1 
ATOM   1474  C CA    . CYS B 1 32  ? 47.492 -43.261  -149.689 1.00 135.76 ? 29  CYS B CA    1 
ATOM   1475  C C     . CYS B 1 32  ? 47.326 -42.692  -148.285 1.00 137.40 ? 29  CYS B C     1 
ATOM   1476  O O     . CYS B 1 32  ? 46.231 -42.283  -147.891 1.00 125.19 ? 29  CYS B O     1 
ATOM   1477  C CB    . CYS B 1 32  ? 47.469 -42.133  -150.720 1.00 150.07 ? 29  CYS B CB    1 
ATOM   1478  S SG    . CYS B 1 32  ? 47.996 -42.621  -152.378 1.00 160.47 ? 29  CYS B SG    1 
ATOM   1479  N N     . GLN B 1 33  ? 48.422 -42.665  -147.532 1.00 147.06 ? 30  GLN B N     1 
ATOM   1480  C CA    . GLN B 1 33  ? 48.426 -42.171  -146.164 1.00 144.28 ? 30  GLN B CA    1 
ATOM   1481  C C     . GLN B 1 33  ? 48.900 -40.722  -146.114 1.00 158.42 ? 30  GLN B C     1 
ATOM   1482  O O     . GLN B 1 33  ? 49.737 -40.292  -146.911 1.00 166.57 ? 30  GLN B O     1 
ATOM   1483  C CB    . GLN B 1 33  ? 49.315 -43.044  -145.276 1.00 144.39 ? 30  GLN B CB    1 
ATOM   1484  C CG    . GLN B 1 33  ? 48.792 -44.459  -145.085 1.00 153.66 ? 30  GLN B CG    1 
ATOM   1485  C CD    . GLN B 1 33  ? 49.718 -45.317  -144.246 1.00 167.06 ? 30  GLN B CD    1 
ATOM   1486  O OE1   . GLN B 1 33  ? 50.165 -44.906  -143.176 1.00 175.08 ? 30  GLN B OE1   1 
ATOM   1487  N NE2   . GLN B 1 33  ? 50.006 -46.521  -144.729 1.00 152.72 ? 30  GLN B NE2   1 
ATOM   1488  N N     . TYR B 1 34  ? 48.350 -39.974  -145.160 1.00 155.74 ? 31  TYR B N     1 
ATOM   1489  C CA    . TYR B 1 34  ? 48.689 -38.566  -145.010 1.00 158.12 ? 31  TYR B CA    1 
ATOM   1490  C C     . TYR B 1 34  ? 50.071 -38.393  -144.392 1.00 169.61 ? 31  TYR B C     1 
ATOM   1491  O O     . TYR B 1 34  ? 50.438 -39.090  -143.441 1.00 167.26 ? 31  TYR B O     1 
ATOM   1492  C CB    . TYR B 1 34  ? 47.647 -37.859  -144.144 1.00 149.14 ? 31  TYR B CB    1 
ATOM   1493  C CG    . TYR B 1 34  ? 46.441 -37.362  -144.906 1.00 134.88 ? 31  TYR B CG    1 
ATOM   1494  C CD1   . TYR B 1 34  ? 46.574 -36.416  -145.912 1.00 136.11 ? 31  TYR B CD1   1 
ATOM   1495  C CD2   . TYR B 1 34  ? 45.168 -37.832  -144.613 1.00 136.75 ? 31  TYR B CD2   1 
ATOM   1496  C CE1   . TYR B 1 34  ? 45.475 -35.956  -146.610 1.00 143.17 ? 31  TYR B CE1   1 
ATOM   1497  C CE2   . TYR B 1 34  ? 44.062 -37.378  -145.306 1.00 135.36 ? 31  TYR B CE2   1 
ATOM   1498  C CZ    . TYR B 1 34  ? 44.221 -36.439  -146.304 1.00 136.64 ? 31  TYR B CZ    1 
ATOM   1499  O OH    . TYR B 1 34  ? 43.124 -35.983  -146.997 1.00 131.99 ? 31  TYR B OH    1 
ATOM   1500  N N     . THR B 1 35  ? 50.841 -37.457  -144.942 1.00 163.32 ? 32  THR B N     1 
ATOM   1501  C CA    . THR B 1 35  ? 52.115 -37.091  -144.347 1.00 159.20 ? 32  THR B CA    1 
ATOM   1502  C C     . THR B 1 35  ? 51.893 -36.176  -143.143 1.00 158.59 ? 32  THR B C     1 
ATOM   1503  O O     . THR B 1 35  ? 50.810 -35.621  -142.942 1.00 158.14 ? 32  THR B O     1 
ATOM   1504  C CB    . THR B 1 35  ? 53.019 -36.404  -145.372 1.00 145.54 ? 32  THR B CB    1 
ATOM   1505  O OG1   . THR B 1 35  ? 52.344 -35.266  -145.923 1.00 145.61 ? 32  THR B OG1   1 
ATOM   1506  C CG2   . THR B 1 35  ? 53.382 -37.367  -146.493 1.00 147.55 ? 32  THR B CG2   1 
ATOM   1507  N N     . ALA B 1 36  ? 52.945 -36.032  -142.333 1.00 157.84 ? 33  ALA B N     1 
ATOM   1508  C CA    . ALA B 1 36  ? 52.849 -35.236  -141.111 1.00 158.17 ? 33  ALA B CA    1 
ATOM   1509  C C     . ALA B 1 36  ? 52.499 -33.782  -141.415 1.00 158.69 ? 33  ALA B C     1 
ATOM   1510  O O     . ALA B 1 36  ? 51.618 -33.195  -140.772 1.00 153.37 ? 33  ALA B O     1 
ATOM   1511  C CB    . ALA B 1 36  ? 54.161 -35.321  -140.329 1.00 166.87 ? 33  ALA B CB    1 
ATOM   1512  N N     . GLU B 1 37  ? 53.185 -33.184  -142.391 1.00 162.25 ? 34  GLU B N     1 
ATOM   1513  C CA    . GLU B 1 37  ? 52.958 -31.777  -142.710 1.00 165.35 ? 34  GLU B CA    1 
ATOM   1514  C C     . GLU B 1 37  ? 51.534 -31.552  -143.205 1.00 162.63 ? 34  GLU B C     1 
ATOM   1515  O O     . GLU B 1 37  ? 50.838 -30.639  -142.742 1.00 157.65 ? 34  GLU B O     1 
ATOM   1516  C CB    . GLU B 1 37  ? 53.971 -31.307  -143.756 1.00 172.74 ? 34  GLU B CB    1 
ATOM   1517  C CG    . GLU B 1 37  ? 55.381 -31.851  -143.573 1.00 172.11 ? 34  GLU B CG    1 
ATOM   1518  C CD    . GLU B 1 37  ? 55.600 -33.159  -144.312 1.00 169.37 ? 34  GLU B CD    1 
ATOM   1519  O OE1   . GLU B 1 37  ? 55.380 -33.191  -145.541 1.00 166.88 ? 34  GLU B OE1   1 
ATOM   1520  O OE2   . GLU B 1 37  ? 55.987 -34.153  -143.663 1.00 165.98 ? 34  GLU B OE2   1 
ATOM   1521  N N     . GLU B 1 38  ? 51.096 -32.371  -144.165 1.00 159.47 ? 35  GLU B N     1 
ATOM   1522  C CA    . GLU B 1 38  ? 49.733 -32.276  -144.679 1.00 155.39 ? 35  GLU B CA    1 
ATOM   1523  C C     . GLU B 1 38  ? 48.708 -32.463  -143.567 1.00 148.68 ? 35  GLU B C     1 
ATOM   1524  O O     . GLU B 1 38  ? 47.726 -31.714  -143.485 1.00 144.01 ? 35  GLU B O     1 
ATOM   1525  C CB    . GLU B 1 38  ? 49.528 -33.314  -145.783 1.00 165.59 ? 35  GLU B CB    1 
ATOM   1526  C CG    . GLU B 1 38  ? 48.265 -33.131  -146.603 1.00 167.72 ? 35  GLU B CG    1 
ATOM   1527  C CD    . GLU B 1 38  ? 48.181 -34.111  -147.757 1.00 170.69 ? 35  GLU B CD    1 
ATOM   1528  O OE1   . GLU B 1 38  ? 47.173 -34.078  -148.493 1.00 167.57 ? 35  GLU B OE1   1 
ATOM   1529  O OE2   . GLU B 1 38  ? 49.122 -34.916  -147.928 1.00 164.76 ? 35  GLU B OE2   1 
ATOM   1530  N N     . TYR B 1 39  ? 48.919 -33.464  -142.707 1.00 149.18 ? 36  TYR B N     1 
ATOM   1531  C CA    . TYR B 1 39  ? 48.017 -33.695  -141.582 1.00 141.88 ? 36  TYR B CA    1 
ATOM   1532  C C     . TYR B 1 39  ? 47.898 -32.457  -140.702 1.00 145.13 ? 36  TYR B C     1 
ATOM   1533  O O     . TYR B 1 39  ? 46.787 -32.006  -140.395 1.00 140.17 ? 36  TYR B O     1 
ATOM   1534  C CB    . TYR B 1 39  ? 48.495 -34.882  -140.746 1.00 130.94 ? 36  TYR B CB    1 
ATOM   1535  C CG    . TYR B 1 39  ? 47.973 -34.821  -139.329 1.00 127.25 ? 36  TYR B CG    1 
ATOM   1536  C CD1   . TYR B 1 39  ? 46.615 -34.952  -139.062 1.00 117.99 ? 36  TYR B CD1   1 
ATOM   1537  C CD2   . TYR B 1 39  ? 48.830 -34.589  -138.262 1.00 138.63 ? 36  TYR B CD2   1 
ATOM   1538  C CE1   . TYR B 1 39  ? 46.131 -34.875  -137.772 1.00 123.64 ? 36  TYR B CE1   1 
ATOM   1539  C CE2   . TYR B 1 39  ? 48.355 -34.512  -136.969 1.00 143.02 ? 36  TYR B CE2   1 
ATOM   1540  C CZ    . TYR B 1 39  ? 47.005 -34.656  -136.730 1.00 136.21 ? 36  TYR B CZ    1 
ATOM   1541  O OH    . TYR B 1 39  ? 46.529 -34.576  -135.443 1.00 130.69 ? 36  TYR B OH    1 
ATOM   1542  N N     . GLN B 1 40  ? 49.034 -31.927  -140.241 1.00 153.39 ? 37  GLN B N     1 
ATOM   1543  C CA    . GLN B 1 40  ? 48.999 -30.791  -139.325 1.00 155.09 ? 37  GLN B CA    1 
ATOM   1544  C C     . GLN B 1 40  ? 48.348 -29.580  -139.979 1.00 152.71 ? 37  GLN B C     1 
ATOM   1545  O O     . GLN B 1 40  ? 47.539 -28.882  -139.351 1.00 151.98 ? 37  GLN B O     1 
ATOM   1546  C CB    . GLN B 1 40  ? 50.413 -30.448  -138.859 1.00 165.03 ? 37  GLN B CB    1 
ATOM   1547  C CG    . GLN B 1 40  ? 50.477 -29.831  -137.474 1.00 162.88 ? 37  GLN B CG    1 
ATOM   1548  C CD    . GLN B 1 40  ? 51.873 -29.373  -137.106 1.00 164.61 ? 37  GLN B CD    1 
ATOM   1549  O OE1   . GLN B 1 40  ? 52.763 -29.311  -137.954 1.00 164.60 ? 37  GLN B OE1   1 
ATOM   1550  N NE2   . GLN B 1 40  ? 52.074 -29.052  -135.833 1.00 164.03 ? 37  GLN B NE2   1 
ATOM   1551  N N     . ALA B 1 41  ? 48.690 -29.318  -141.243 1.00 149.88 ? 38  ALA B N     1 
ATOM   1552  C CA    . ALA B 1 41  ? 48.093 -28.200  -141.962 1.00 150.87 ? 38  ALA B CA    1 
ATOM   1553  C C     . ALA B 1 41  ? 46.579 -28.343  -142.042 1.00 151.53 ? 38  ALA B C     1 
ATOM   1554  O O     . ALA B 1 41  ? 45.839 -27.398  -141.738 1.00 151.22 ? 38  ALA B O     1 
ATOM   1555  C CB    . ALA B 1 41  ? 48.705 -28.094  -143.359 1.00 139.83 ? 38  ALA B CB    1 
ATOM   1556  N N     . ILE B 1 42  ? 46.099 -29.522  -142.449 1.00 148.46 ? 39  ILE B N     1 
ATOM   1557  C CA    . ILE B 1 42  ? 44.660 -29.735  -142.584 1.00 141.66 ? 39  ILE B CA    1 
ATOM   1558  C C     . ILE B 1 42  ? 43.967 -29.591  -141.235 1.00 144.19 ? 39  ILE B C     1 
ATOM   1559  O O     . ILE B 1 42  ? 42.905 -28.968  -141.135 1.00 143.12 ? 39  ILE B O     1 
ATOM   1560  C CB    . ILE B 1 42  ? 44.375 -31.108  -143.221 1.00 135.45 ? 39  ILE B CB    1 
ATOM   1561  C CG1   . ILE B 1 42  ? 44.729 -31.090  -144.707 1.00 146.46 ? 39  ILE B CG1   1 
ATOM   1562  C CG2   . ILE B 1 42  ? 42.912 -31.479  -143.053 1.00 132.28 ? 39  ILE B CG2   1 
ATOM   1563  C CD1   . ILE B 1 42  ? 44.897 -32.463  -145.312 1.00 149.71 ? 39  ILE B CD1   1 
ATOM   1564  N N     . GLN B 1 43  ? 44.552 -30.162  -140.180 1.00 141.87 ? 40  GLN B N     1 
ATOM   1565  C CA    . GLN B 1 43  ? 43.953 -30.075  -138.850 1.00 128.64 ? 40  GLN B CA    1 
ATOM   1566  C C     . GLN B 1 43  ? 43.800 -28.623  -138.406 1.00 142.13 ? 40  GLN B C     1 
ATOM   1567  O O     . GLN B 1 43  ? 42.702 -28.180  -138.029 1.00 137.89 ? 40  GLN B O     1 
ATOM   1568  C CB    . GLN B 1 43  ? 44.811 -30.860  -137.854 1.00 118.43 ? 40  GLN B CB    1 
ATOM   1569  C CG    . GLN B 1 43  ? 44.380 -30.763  -136.395 1.00 136.17 ? 40  GLN B CG    1 
ATOM   1570  C CD    . GLN B 1 43  ? 43.200 -31.660  -136.062 1.00 139.17 ? 40  GLN B CD    1 
ATOM   1571  O OE1   . GLN B 1 43  ? 42.226 -31.734  -136.809 1.00 151.78 ? 40  GLN B OE1   1 
ATOM   1572  N NE2   . GLN B 1 43  ? 43.289 -32.352  -134.932 1.00 141.69 ? 40  GLN B NE2   1 
ATOM   1573  N N     . LYS B 1 44  ? 44.898 -27.862  -138.451 1.00 148.05 ? 41  LYS B N     1 
ATOM   1574  C CA    . LYS B 1 44  ? 44.849 -26.475  -138.002 1.00 148.75 ? 41  LYS B CA    1 
ATOM   1575  C C     . LYS B 1 44  ? 43.910 -25.642  -138.866 1.00 152.42 ? 41  LYS B C     1 
ATOM   1576  O O     . LYS B 1 44  ? 43.202 -24.766  -138.354 1.00 153.84 ? 41  LYS B O     1 
ATOM   1577  C CB    . LYS B 1 44  ? 46.255 -25.875  -137.982 1.00 158.78 ? 41  LYS B CB    1 
ATOM   1578  C CG    . LYS B 1 44  ? 47.213 -26.603  -137.049 1.00 154.56 ? 41  LYS B CG    1 
ATOM   1579  C CD    . LYS B 1 44  ? 48.527 -25.855  -136.898 1.00 157.10 ? 41  LYS B CD    1 
ATOM   1580  C CE    . LYS B 1 44  ? 49.518 -26.646  -136.059 1.00 161.67 ? 41  LYS B CE    1 
ATOM   1581  N NZ    . LYS B 1 44  ? 48.959 -27.017  -134.728 1.00 138.39 ? 41  LYS B NZ    1 
ATOM   1582  N N     . ALA B 1 45  ? 43.886 -25.895  -140.178 1.00 144.50 ? 42  ALA B N     1 
ATOM   1583  C CA    . ALA B 1 45  ? 42.954 -25.178  -141.042 1.00 147.43 ? 42  ALA B CA    1 
ATOM   1584  C C     . ALA B 1 45  ? 41.507 -25.559  -140.754 1.00 147.85 ? 42  ALA B C     1 
ATOM   1585  O O     . ALA B 1 45  ? 40.601 -24.742  -140.957 1.00 141.92 ? 42  ALA B O     1 
ATOM   1586  C CB    . ALA B 1 45  ? 43.293 -25.438  -142.509 1.00 149.20 ? 42  ALA B CB    1 
ATOM   1587  N N     . LEU B 1 46  ? 41.267 -26.786  -140.286 1.00 151.70 ? 43  LEU B N     1 
ATOM   1588  C CA    . LEU B 1 46  ? 39.913 -27.226  -139.981 1.00 149.37 ? 43  LEU B CA    1 
ATOM   1589  C C     . LEU B 1 46  ? 39.417 -26.715  -138.640 1.00 141.08 ? 43  LEU B C     1 
ATOM   1590  O O     . LEU B 1 46  ? 38.201 -26.669  -138.424 1.00 129.96 ? 43  LEU B O     1 
ATOM   1591  C CB    . LEU B 1 46  ? 39.830 -28.754  -140.000 1.00 142.83 ? 43  LEU B CB    1 
ATOM   1592  C CG    . LEU B 1 46  ? 39.762 -29.429  -141.370 1.00 142.79 ? 43  LEU B CG    1 
ATOM   1593  C CD1   . LEU B 1 46  ? 39.700 -30.938  -141.216 1.00 137.38 ? 43  LEU B CD1   1 
ATOM   1594  C CD2   . LEU B 1 46  ? 38.566 -28.920  -142.156 1.00 140.07 ? 43  LEU B CD2   1 
ATOM   1595  N N     . ARG B 1 47  ? 40.318 -26.333  -137.734 1.00 141.92 ? 44  ARG B N     1 
ATOM   1596  C CA    . ARG B 1 47  ? 39.841 -25.682  -136.516 1.00 139.34 ? 44  ARG B CA    1 
ATOM   1597  C C     . ARG B 1 47  ? 39.323 -24.264  -136.751 1.00 142.43 ? 44  ARG B C     1 
ATOM   1598  O O     . ARG B 1 47  ? 38.698 -23.700  -135.846 1.00 138.10 ? 44  ARG B O     1 
ATOM   1599  C CB    . ARG B 1 47  ? 40.937 -25.654  -135.450 1.00 135.34 ? 44  ARG B CB    1 
ATOM   1600  C CG    . ARG B 1 47  ? 41.122 -26.974  -134.727 1.00 134.37 ? 44  ARG B CG    1 
ATOM   1601  C CD    . ARG B 1 47  ? 42.143 -26.852  -133.611 1.00 139.45 ? 44  ARG B CD    1 
ATOM   1602  N NE    . ARG B 1 47  ? 43.512 -26.933  -134.104 1.00 146.77 ? 44  ARG B NE    1 
ATOM   1603  C CZ    . ARG B 1 47  ? 44.332 -27.947  -133.851 1.00 151.61 ? 44  ARG B CZ    1 
ATOM   1604  N NH1   . ARG B 1 47  ? 43.918 -28.967  -133.111 1.00 148.77 ? 44  ARG B NH1   1 
ATOM   1605  N NH2   . ARG B 1 47  ? 45.566 -27.944  -134.338 1.00 147.99 ? 44  ARG B NH2   1 
ATOM   1606  N N     . GLN B 1 48  ? 39.560 -23.679  -137.925 1.00 140.77 ? 45  GLN B N     1 
ATOM   1607  C CA    . GLN B 1 48  ? 39.090 -22.330  -138.221 1.00 136.80 ? 45  GLN B CA    1 
ATOM   1608  C C     . GLN B 1 48  ? 37.563 -22.250  -138.231 1.00 136.66 ? 45  GLN B C     1 
ATOM   1609  O O     . GLN B 1 48  ? 36.858 -23.240  -138.444 1.00 145.45 ? 45  GLN B O     1 
ATOM   1610  C CB    . GLN B 1 48  ? 39.627 -21.857  -139.572 1.00 133.39 ? 45  GLN B CB    1 
ATOM   1611  C CG    . GLN B 1 48  ? 41.112 -21.541  -139.586 1.00 144.68 ? 45  GLN B CG    1 
ATOM   1612  C CD    . GLN B 1 48  ? 41.545 -20.868  -140.876 1.00 151.79 ? 45  GLN B CD    1 
ATOM   1613  O OE1   . GLN B 1 48  ? 41.375 -21.418  -141.964 1.00 154.00 ? 45  GLN B OE1   1 
ATOM   1614  N NE2   . GLN B 1 48  ? 42.106 -19.670  -140.760 1.00 151.49 ? 45  GLN B NE2   1 
ATOM   1615  N N     . ARG B 1 49  ? 37.058 -21.041  -137.992 1.00 130.16 ? 46  ARG B N     1 
ATOM   1616  C CA    . ARG B 1 49  ? 35.654 -20.700  -138.167 1.00 130.62 ? 46  ARG B CA    1 
ATOM   1617  C C     . ARG B 1 49  ? 35.484 -19.837  -139.411 1.00 141.12 ? 46  ARG B C     1 
ATOM   1618  O O     . ARG B 1 49  ? 36.435 -19.223  -139.902 1.00 149.12 ? 46  ARG B O     1 
ATOM   1619  C CB    . ARG B 1 49  ? 35.101 -19.959  -136.945 1.00 137.81 ? 46  ARG B CB    1 
ATOM   1620  C CG    . ARG B 1 49  ? 34.837 -20.833  -135.731 1.00 145.03 ? 46  ARG B CG    1 
ATOM   1621  C CD    . ARG B 1 49  ? 34.308 -19.999  -134.573 1.00 148.22 ? 46  ARG B CD    1 
ATOM   1622  N NE    . ARG B 1 49  ? 33.705 -20.816  -133.523 1.00 159.44 ? 46  ARG B NE    1 
ATOM   1623  C CZ    . ARG B 1 49  ? 34.390 -21.433  -132.565 1.00 160.94 ? 46  ARG B CZ    1 
ATOM   1624  N NH1   . ARG B 1 49  ? 35.711 -21.328  -132.518 1.00 163.56 ? 46  ARG B NH1   1 
ATOM   1625  N NH2   . ARG B 1 49  ? 33.753 -22.153  -131.652 1.00 147.23 ? 46  ARG B NH2   1 
ATOM   1626  N N     . LEU B 1 50  ? 34.254 -19.786  -139.915 1.00 143.91 ? 47  LEU B N     1 
ATOM   1627  C CA    . LEU B 1 50  ? 33.965 -19.086  -141.158 1.00 149.79 ? 47  LEU B CA    1 
ATOM   1628  C C     . LEU B 1 50  ? 33.540 -17.646  -140.895 1.00 132.24 ? 47  LEU B C     1 
ATOM   1629  O O     . LEU B 1 50  ? 33.020 -17.313  -139.827 1.00 128.87 ? 47  LEU B O     1 
ATOM   1630  C CB    . LEU B 1 50  ? 32.872 -19.805  -141.953 1.00 158.24 ? 47  LEU B CB    1 
ATOM   1631  C CG    . LEU B 1 50  ? 33.189 -21.183  -142.545 1.00 143.88 ? 47  LEU B CG    1 
ATOM   1632  C CD1   . LEU B 1 50  ? 34.569 -21.197  -143.195 1.00 139.16 ? 47  LEU B CD1   1 
ATOM   1633  C CD2   . LEU B 1 50  ? 33.056 -22.291  -141.510 1.00 131.71 ? 47  LEU B CD2   1 
ATOM   1634  N N     . GLY B 1 51  ? 33.772 -16.791  -141.889 1.00 138.71 ? 48  GLY B N     1 
ATOM   1635  C CA    . GLY B 1 51  ? 33.384 -15.402  -141.820 1.00 160.48 ? 48  GLY B CA    1 
ATOM   1636  C C     . GLY B 1 51  ? 32.051 -15.138  -142.491 1.00 162.04 ? 48  GLY B C     1 
ATOM   1637  O O     . GLY B 1 51  ? 31.445 -16.030  -143.094 1.00 168.12 ? 48  GLY B O     1 
ATOM   1638  N N     . PRO B 1 52  ? 31.560 -13.900  -142.384 1.00 153.61 ? 49  PRO B N     1 
ATOM   1639  C CA    . PRO B 1 52  ? 30.290 -13.548  -143.045 1.00 150.49 ? 49  PRO B CA    1 
ATOM   1640  C C     . PRO B 1 52  ? 30.294 -13.748  -144.554 1.00 153.94 ? 49  PRO B C     1 
ATOM   1641  O O     . PRO B 1 52  ? 29.213 -13.792  -145.155 1.00 151.69 ? 49  PRO B O     1 
ATOM   1642  C CB    . PRO B 1 52  ? 30.108 -12.069  -142.680 1.00 154.37 ? 49  PRO B CB    1 
ATOM   1643  C CG    . PRO B 1 52  ? 30.845 -11.915  -141.392 1.00 159.50 ? 49  PRO B CG    1 
ATOM   1644  C CD    . PRO B 1 52  ? 32.043 -12.818  -141.508 1.00 154.04 ? 49  PRO B CD    1 
ATOM   1645  N N     . GLU B 1 53  ? 31.464 -13.867  -145.187 1.00 158.53 ? 50  GLU B N     1 
ATOM   1646  C CA    . GLU B 1 53  ? 31.531 -14.060  -146.632 1.00 164.88 ? 50  GLU B CA    1 
ATOM   1647  C C     . GLU B 1 53  ? 30.944 -15.389  -147.089 1.00 149.47 ? 50  GLU B C     1 
ATOM   1648  O O     . GLU B 1 53  ? 30.745 -15.575  -148.294 1.00 149.70 ? 50  GLU B O     1 
ATOM   1649  C CB    . GLU B 1 53  ? 32.982 -13.971  -147.117 1.00 169.11 ? 50  GLU B CB    1 
ATOM   1650  C CG    . GLU B 1 53  ? 33.742 -12.731  -146.672 1.00 181.93 ? 50  GLU B CG    1 
ATOM   1651  C CD    . GLU B 1 53  ? 34.300 -12.843  -145.269 1.00 172.21 ? 50  GLU B CD    1 
ATOM   1652  O OE1   . GLU B 1 53  ? 33.504 -12.844  -144.309 1.00 159.74 ? 50  GLU B OE1   1 
ATOM   1653  O OE2   . GLU B 1 53  ? 35.536 -12.920  -145.127 1.00 169.96 ? 50  GLU B OE2   1 
ATOM   1654  N N     . TYR B 1 54  ? 30.662 -16.308  -146.170 1.00 144.61 ? 51  TYR B N     1 
ATOM   1655  C CA    . TYR B 1 54  ? 30.108 -17.615  -146.502 1.00 142.29 ? 51  TYR B CA    1 
ATOM   1656  C C     . TYR B 1 54  ? 28.674 -17.801  -146.037 1.00 135.75 ? 51  TYR B C     1 
ATOM   1657  O O     . TYR B 1 54  ? 27.860 -18.366  -146.772 1.00 127.87 ? 51  TYR B O     1 
ATOM   1658  C CB    . TYR B 1 54  ? 30.978 -18.721  -145.898 1.00 136.89 ? 51  TYR B CB    1 
ATOM   1659  C CG    . TYR B 1 54  ? 32.339 -18.841  -146.545 1.00 134.72 ? 51  TYR B CG    1 
ATOM   1660  C CD1   . TYR B 1 54  ? 32.486 -18.741  -147.922 1.00 131.32 ? 51  TYR B CD1   1 
ATOM   1661  C CD2   . TYR B 1 54  ? 33.478 -19.047  -145.777 1.00 126.30 ? 51  TYR B CD2   1 
ATOM   1662  C CE1   . TYR B 1 54  ? 33.728 -18.846  -148.517 1.00 132.96 ? 51  TYR B CE1   1 
ATOM   1663  C CE2   . TYR B 1 54  ? 34.723 -19.154  -146.362 1.00 122.37 ? 51  TYR B CE2   1 
ATOM   1664  C CZ    . TYR B 1 54  ? 34.843 -19.053  -147.731 1.00 133.45 ? 51  TYR B CZ    1 
ATOM   1665  O OH    . TYR B 1 54  ? 36.082 -19.160  -148.318 1.00 138.39 ? 51  TYR B OH    1 
ATOM   1666  N N     . ILE B 1 55  ? 28.350 -17.338  -144.830 1.00 133.19 ? 52  ILE B N     1 
ATOM   1667  C CA    . ILE B 1 55  ? 27.018 -17.531  -144.275 1.00 121.28 ? 52  ILE B CA    1 
ATOM   1668  C C     . ILE B 1 55  ? 25.986 -16.764  -145.096 1.00 127.88 ? 52  ILE B C     1 
ATOM   1669  O O     . ILE B 1 55  ? 26.267 -15.699  -145.662 1.00 140.16 ? 52  ILE B O     1 
ATOM   1670  C CB    . ILE B 1 55  ? 26.992 -17.091  -142.799 1.00 120.63 ? 52  ILE B CB    1 
ATOM   1671  C CG1   . ILE B 1 55  ? 28.269 -17.537  -142.084 1.00 123.06 ? 52  ILE B CG1   1 
ATOM   1672  C CG2   . ILE B 1 55  ? 25.778 -17.658  -142.093 1.00 103.07 ? 52  ILE B CG2   1 
ATOM   1673  C CD1   . ILE B 1 55  ? 28.467 -19.039  -142.048 1.00 123.08 ? 52  ILE B CD1   1 
ATOM   1674  N N     . SER B 1 56  ? 24.775 -17.316  -145.159 1.00 115.78 ? 53  SER B N     1 
ATOM   1675  C CA    . SER B 1 56  ? 23.643 -16.648  -145.789 1.00 124.69 ? 53  SER B CA    1 
ATOM   1676  C C     . SER B 1 56  ? 22.449 -16.707  -144.845 1.00 123.56 ? 53  SER B C     1 
ATOM   1677  O O     . SER B 1 56  ? 22.586 -17.160  -143.703 1.00 114.74 ? 53  SER B O     1 
ATOM   1678  C CB    . SER B 1 56  ? 23.309 -17.288  -147.138 1.00 124.91 ? 53  SER B CB    1 
ATOM   1679  O OG    . SER B 1 56  ? 24.387 -17.148  -148.049 1.00 122.14 ? 53  SER B OG    1 
ATOM   1680  N N     . SER B 1 57  ? 21.280 -16.259  -145.294 1.00 125.45 ? 54  SER B N     1 
ATOM   1681  C CA    . SER B 1 57  ? 20.140 -16.166  -144.395 1.00 128.36 ? 54  SER B CA    1 
ATOM   1682  C C     . SER B 1 57  ? 18.848 -16.489  -145.130 1.00 128.15 ? 54  SER B C     1 
ATOM   1683  O O     . SER B 1 57  ? 18.675 -16.122  -146.295 1.00 131.04 ? 54  SER B O     1 
ATOM   1684  C CB    . SER B 1 57  ? 20.043 -14.772  -143.766 1.00 140.91 ? 54  SER B CB    1 
ATOM   1685  O OG    . SER B 1 57  ? 19.466 -13.843  -144.666 1.00 145.27 ? 54  SER B OG    1 
ATOM   1686  N N     . ARG B 1 58  ? 17.947 -17.176  -144.432 1.00 136.57 ? 55  ARG B N     1 
ATOM   1687  C CA    . ARG B 1 58  ? 16.612 -17.475  -144.925 1.00 145.80 ? 55  ARG B CA    1 
ATOM   1688  C C     . ARG B 1 58  ? 15.594 -17.033  -143.884 1.00 144.17 ? 55  ARG B C     1 
ATOM   1689  O O     . ARG B 1 58  ? 15.940 -16.645  -142.766 1.00 129.00 ? 55  ARG B O     1 
ATOM   1690  C CB    . ARG B 1 58  ? 16.429 -18.971  -145.224 1.00 153.91 ? 55  ARG B CB    1 
ATOM   1691  C CG    . ARG B 1 58  ? 16.336 -19.839  -143.975 1.00 155.76 ? 55  ARG B CG    1 
ATOM   1692  C CD    . ARG B 1 58  ? 15.326 -20.969  -144.139 1.00 158.95 ? 55  ARG B CD    1 
ATOM   1693  N NE    . ARG B 1 58  ? 15.788 -22.033  -145.025 1.00 160.88 ? 55  ARG B NE    1 
ATOM   1694  C CZ    . ARG B 1 58  ? 15.093 -23.139  -145.278 1.00 161.79 ? 55  ARG B CZ    1 
ATOM   1695  N NH1   . ARG B 1 58  ? 15.578 -24.062  -146.097 1.00 151.92 ? 55  ARG B NH1   1 
ATOM   1696  N NH2   . ARG B 1 58  ? 13.910 -23.323  -144.709 1.00 165.19 ? 55  ARG B NH2   1 
ATOM   1697  N N     . MET B 1 59  ? 14.323 -17.097  -144.264 1.00 149.88 ? 56  MET B N     1 
ATOM   1698  C CA    . MET B 1 59  ? 13.213 -16.788  -143.368 1.00 158.00 ? 56  MET B CA    1 
ATOM   1699  C C     . MET B 1 59  ? 12.422 -18.076  -143.168 1.00 156.11 ? 56  MET B C     1 
ATOM   1700  O O     . MET B 1 59  ? 11.681 -18.504  -144.057 1.00 153.48 ? 56  MET B O     1 
ATOM   1701  C CB    . MET B 1 59  ? 12.345 -15.668  -143.932 1.00 170.10 ? 56  MET B CB    1 
ATOM   1702  C CG    . MET B 1 59  ? 12.999 -14.298  -143.860 1.00 171.64 ? 56  MET B CG    1 
ATOM   1703  S SD    . MET B 1 59  ? 13.593 -13.891  -142.205 1.00 183.57 ? 56  MET B SD    1 
ATOM   1704  C CE    . MET B 1 59  ? 12.068 -13.939  -141.268 1.00 160.01 ? 56  MET B CE    1 
ATOM   1705  N N     . ALA B 1 60  ? 12.594 -18.695  -142.002 1.00 160.68 ? 57  ALA B N     1 
ATOM   1706  C CA    . ALA B 1 60  ? 11.878 -19.925  -141.695 1.00 176.48 ? 57  ALA B CA    1 
ATOM   1707  C C     . ALA B 1 60  ? 10.375 -19.674  -141.644 1.00 179.27 ? 57  ALA B C     1 
ATOM   1708  O O     . ALA B 1 60  ? 9.915  -18.583  -141.295 1.00 171.94 ? 57  ALA B O     1 
ATOM   1709  C CB    . ALA B 1 60  ? 12.360 -20.506  -140.365 1.00 172.33 ? 57  ALA B CB    1 
ATOM   1710  N N     . GLY B 1 61  ? 9.607  -20.701  -141.999 1.00 186.39 ? 58  GLY B N     1 
ATOM   1711  C CA    . GLY B 1 61  ? 8.163  -20.604  -141.943 1.00 183.77 ? 58  GLY B CA    1 
ATOM   1712  C C     . GLY B 1 61  ? 7.678  -20.582  -140.510 1.00 193.30 ? 58  GLY B C     1 
ATOM   1713  O O     . GLY B 1 61  ? 7.815  -21.571  -139.783 1.00 193.54 ? 58  GLY B O     1 
ATOM   1714  N N     . GLY B 1 62  ? 7.106  -19.453  -140.092 1.00 184.23 ? 59  GLY B N     1 
ATOM   1715  C CA    . GLY B 1 62  ? 6.730  -19.247  -138.712 1.00 166.94 ? 59  GLY B CA    1 
ATOM   1716  C C     . GLY B 1 62  ? 7.872  -18.893  -137.785 1.00 167.96 ? 59  GLY B C     1 
ATOM   1717  O O     . GLY B 1 62  ? 7.627  -18.315  -136.719 1.00 176.31 ? 59  GLY B O     1 
ATOM   1718  N N     . GLY B 1 63  ? 9.111  -19.217  -138.150 1.00 163.89 ? 60  GLY B N     1 
ATOM   1719  C CA    . GLY B 1 63  ? 10.255 -18.915  -137.313 1.00 162.18 ? 60  GLY B CA    1 
ATOM   1720  C C     . GLY B 1 63  ? 10.888 -17.570  -137.609 1.00 171.40 ? 60  GLY B C     1 
ATOM   1721  O O     . GLY B 1 63  ? 10.187 -16.594  -137.892 1.00 166.06 ? 60  GLY B O     1 
ATOM   1722  N N     . GLN B 1 64  ? 12.220 -17.508  -137.550 1.00 175.19 ? 61  GLN B N     1 
ATOM   1723  C CA    . GLN B 1 64  ? 12.941 -16.258  -137.756 1.00 168.06 ? 61  GLN B CA    1 
ATOM   1724  C C     . GLN B 1 64  ? 14.116 -16.453  -138.707 1.00 171.98 ? 61  GLN B C     1 
ATOM   1725  O O     . GLN B 1 64  ? 14.221 -17.485  -139.378 1.00 165.77 ? 61  GLN B O     1 
ATOM   1726  C CB    . GLN B 1 64  ? 13.439 -15.685  -136.424 1.00 165.58 ? 61  GLN B CB    1 
ATOM   1727  C CG    . GLN B 1 64  ? 12.534 -15.951  -135.231 1.00 183.48 ? 61  GLN B CG    1 
ATOM   1728  C CD    . GLN B 1 64  ? 12.951 -17.182  -134.448 1.00 185.96 ? 61  GLN B CD    1 
ATOM   1729  O OE1   . GLN B 1 64  ? 13.139 -18.258  -135.015 1.00 181.19 ? 61  GLN B OE1   1 
ATOM   1730  N NE2   . GLN B 1 64  ? 13.100 -17.029  -133.138 1.00 173.79 ? 61  GLN B NE2   1 
ATOM   1731  N N     . LYS B 1 65  ? 14.983 -15.446  -138.781 1.00 178.26 ? 62  LYS B N     1 
ATOM   1732  C CA    . LYS B 1 65  ? 16.170 -15.499  -139.626 1.00 177.05 ? 62  LYS B CA    1 
ATOM   1733  C C     . LYS B 1 65  ? 17.068 -16.668  -139.235 1.00 154.18 ? 62  LYS B C     1 
ATOM   1734  O O     . LYS B 1 65  ? 17.570 -16.729  -138.109 1.00 140.50 ? 62  LYS B O     1 
ATOM   1735  C CB    . LYS B 1 65  ? 16.930 -14.178  -139.517 1.00 179.24 ? 62  LYS B CB    1 
ATOM   1736  C CG    . LYS B 1 65  ? 18.188 -14.086  -140.366 1.00 172.84 ? 62  LYS B CG    1 
ATOM   1737  C CD    . LYS B 1 65  ? 18.861 -12.731  -140.179 1.00 160.66 ? 62  LYS B CD    1 
ATOM   1738  C CE    . LYS B 1 65  ? 20.186 -12.652  -140.918 1.00 158.27 ? 62  LYS B CE    1 
ATOM   1739  N NZ    . LYS B 1 65  ? 20.830 -11.316  -140.780 1.00 162.91 ? 62  LYS B NZ    1 
ATOM   1740  N N     . VAL B 1 66  ? 17.274 -17.592  -140.172 1.00 148.16 ? 63  VAL B N     1 
ATOM   1741  C CA    . VAL B 1 66  ? 18.163 -18.730  -139.980 1.00 141.68 ? 63  VAL B CA    1 
ATOM   1742  C C     . VAL B 1 66  ? 19.385 -18.538  -140.868 1.00 140.96 ? 63  VAL B C     1 
ATOM   1743  O O     . VAL B 1 66  ? 19.323 -17.866  -141.902 1.00 154.70 ? 63  VAL B O     1 
ATOM   1744  C CB    . VAL B 1 66  ? 17.454 -20.066  -140.291 1.00 145.07 ? 63  VAL B CB    1 
ATOM   1745  C CG1   . VAL B 1 66  ? 18.268 -21.241  -139.776 1.00 151.54 ? 63  VAL B CG1   1 
ATOM   1746  C CG2   . VAL B 1 66  ? 16.058 -20.080  -139.691 1.00 151.94 ? 63  VAL B CG2   1 
ATOM   1747  N N     . CYS B 1 67  ? 20.502 -19.136  -140.462 1.00 124.69 ? 64  CYS B N     1 
ATOM   1748  C CA    . CYS B 1 67  ? 21.769 -19.002  -141.167 1.00 124.75 ? 64  CYS B CA    1 
ATOM   1749  C C     . CYS B 1 67  ? 22.185 -20.341  -141.761 1.00 119.28 ? 64  CYS B C     1 
ATOM   1750  O O     . CYS B 1 67  ? 21.980 -21.393  -141.146 1.00 114.35 ? 64  CYS B O     1 
ATOM   1751  C CB    . CYS B 1 67  ? 22.861 -18.486  -140.227 1.00 119.73 ? 64  CYS B CB    1 
ATOM   1752  S SG    . CYS B 1 67  ? 22.332 -17.145  -139.139 1.00 157.40 ? 64  CYS B SG    1 
ATOM   1753  N N     . TYR B 1 68  ? 22.769 -20.298  -142.958 1.00 124.66 ? 65  TYR B N     1 
ATOM   1754  C CA    . TYR B 1 68  ? 23.187 -21.511  -143.647 1.00 113.16 ? 65  TYR B CA    1 
ATOM   1755  C C     . TYR B 1 68  ? 24.409 -21.211  -144.508 1.00 115.57 ? 65  TYR B C     1 
ATOM   1756  O O     . TYR B 1 68  ? 24.876 -20.072  -144.589 1.00 129.94 ? 65  TYR B O     1 
ATOM   1757  C CB    . TYR B 1 68  ? 22.044 -22.088  -144.487 1.00 118.28 ? 65  TYR B CB    1 
ATOM   1758  C CG    . TYR B 1 68  ? 21.611 -21.226  -145.656 1.00 111.04 ? 65  TYR B CG    1 
ATOM   1759  C CD1   . TYR B 1 68  ? 22.217 -21.350  -146.900 1.00 118.59 ? 65  TYR B CD1   1 
ATOM   1760  C CD2   . TYR B 1 68  ? 20.588 -20.297  -145.517 1.00 117.23 ? 65  TYR B CD2   1 
ATOM   1761  C CE1   . TYR B 1 68  ? 21.822 -20.570  -147.970 1.00 122.04 ? 65  TYR B CE1   1 
ATOM   1762  C CE2   . TYR B 1 68  ? 20.185 -19.512  -146.582 1.00 126.74 ? 65  TYR B CE2   1 
ATOM   1763  C CZ    . TYR B 1 68  ? 20.806 -19.653  -147.806 1.00 127.64 ? 65  TYR B CZ    1 
ATOM   1764  O OH    . TYR B 1 68  ? 20.409 -18.874  -148.869 1.00 128.90 ? 65  TYR B OH    1 
ATOM   1765  N N     . ILE B 1 69  ? 24.921 -22.256  -145.157 1.00 115.89 ? 66  ILE B N     1 
ATOM   1766  C CA    . ILE B 1 69  ? 26.029 -22.158  -146.101 1.00 111.59 ? 66  ILE B CA    1 
ATOM   1767  C C     . ILE B 1 69  ? 25.603 -22.815  -147.406 1.00 107.57 ? 66  ILE B C     1 
ATOM   1768  O O     . ILE B 1 69  ? 25.166 -23.971  -147.408 1.00 136.34 ? 66  ILE B O     1 
ATOM   1769  C CB    . ILE B 1 69  ? 27.311 -22.822  -145.561 1.00 95.91  ? 66  ILE B CB    1 
ATOM   1770  C CG1   . ILE B 1 69  ? 27.682 -22.242  -144.195 1.00 105.36 ? 66  ILE B CG1   1 
ATOM   1771  C CG2   . ILE B 1 69  ? 28.455 -22.647  -146.546 1.00 98.47  ? 66  ILE B CG2   1 
ATOM   1772  C CD1   . ILE B 1 69  ? 28.911 -22.873  -143.579 1.00 92.68  ? 66  ILE B CD1   1 
ATOM   1773  N N     . GLU B 1 70  ? 25.718 -22.077  -148.509 1.00 109.93 ? 67  GLU B N     1 
ATOM   1774  C CA    . GLU B 1 70  ? 25.330 -22.609  -149.809 1.00 131.77 ? 67  GLU B CA    1 
ATOM   1775  C C     . GLU B 1 70  ? 26.201 -23.804  -150.191 1.00 129.01 ? 67  GLU B C     1 
ATOM   1776  O O     . GLU B 1 70  ? 27.340 -23.944  -149.738 1.00 126.73 ? 67  GLU B O     1 
ATOM   1777  C CB    . GLU B 1 70  ? 25.423 -21.520  -150.880 1.00 143.61 ? 67  GLU B CB    1 
ATOM   1778  C CG    . GLU B 1 70  ? 24.465 -20.356  -150.660 1.00 143.85 ? 67  GLU B CG    1 
ATOM   1779  C CD    . GLU B 1 70  ? 24.480 -19.356  -151.802 1.00 150.09 ? 67  GLU B CD    1 
ATOM   1780  O OE1   . GLU B 1 70  ? 24.346 -19.782  -152.968 1.00 153.98 ? 67  GLU B OE1   1 
ATOM   1781  O OE2   . GLU B 1 70  ? 24.622 -18.145  -151.533 1.00 141.93 ? 67  GLU B OE2   1 
ATOM   1782  N N     . GLY B 1 71  ? 25.643 -24.676  -151.030 1.00 119.17 ? 68  GLY B N     1 
ATOM   1783  C CA    . GLY B 1 71  ? 26.299 -25.897  -151.463 1.00 124.93 ? 68  GLY B CA    1 
ATOM   1784  C C     . GLY B 1 71  ? 27.648 -25.725  -152.133 1.00 127.10 ? 68  GLY B C     1 
ATOM   1785  O O     . GLY B 1 71  ? 28.648 -26.299  -151.684 1.00 118.54 ? 68  GLY B O     1 
ATOM   1786  N N     . HIS B 1 72  ? 27.678 -24.957  -153.229 1.00 128.34 ? 69  HIS B N     1 
ATOM   1787  C CA    . HIS B 1 72  ? 28.922 -24.717  -153.956 1.00 130.43 ? 69  HIS B CA    1 
ATOM   1788  C C     . HIS B 1 72  ? 30.024 -24.190  -153.047 1.00 128.09 ? 69  HIS B C     1 
ATOM   1789  O O     . HIS B 1 72  ? 31.204 -24.496  -153.259 1.00 109.75 ? 69  HIS B O     1 
ATOM   1790  C CB    . HIS B 1 72  ? 28.669 -23.743  -155.108 1.00 135.41 ? 69  HIS B CB    1 
ATOM   1791  C CG    . HIS B 1 72  ? 27.994 -22.474  -154.689 1.00 144.01 ? 69  HIS B CG    1 
ATOM   1792  N ND1   . HIS B 1 72  ? 28.685 -21.306  -154.448 1.00 156.34 ? 69  HIS B ND1   1 
ATOM   1793  C CD2   . HIS B 1 72  ? 26.689 -22.191  -154.463 1.00 141.97 ? 69  HIS B CD2   1 
ATOM   1794  C CE1   . HIS B 1 72  ? 27.835 -20.358  -154.095 1.00 159.36 ? 69  HIS B CE1   1 
ATOM   1795  N NE2   . HIS B 1 72  ? 26.617 -20.869  -154.096 1.00 153.05 ? 69  HIS B NE2   1 
ATOM   1796  N N     . ARG B 1 73  ? 29.660 -23.401  -152.033 1.00 141.45 ? 70  ARG B N     1 
ATOM   1797  C CA    . ARG B 1 73  ? 30.642 -22.942  -151.057 1.00 147.43 ? 70  ARG B CA    1 
ATOM   1798  C C     . ARG B 1 73  ? 31.327 -24.121  -150.377 1.00 135.60 ? 70  ARG B C     1 
ATOM   1799  O O     . ARG B 1 73  ? 32.559 -24.193  -150.326 1.00 132.47 ? 70  ARG B O     1 
ATOM   1800  C CB    . ARG B 1 73  ? 29.971 -22.041  -150.019 1.00 137.70 ? 70  ARG B CB    1 
ATOM   1801  C CG    . ARG B 1 73  ? 29.318 -20.793  -150.592 1.00 134.63 ? 70  ARG B CG    1 
ATOM   1802  C CD    . ARG B 1 73  ? 30.309 -19.642  -150.693 1.00 140.04 ? 70  ARG B CD    1 
ATOM   1803  N NE    . ARG B 1 73  ? 29.733 -18.475  -151.356 1.00 145.23 ? 70  ARG B NE    1 
ATOM   1804  C CZ    . ARG B 1 73  ? 28.851 -17.652  -150.796 1.00 145.61 ? 70  ARG B CZ    1 
ATOM   1805  N NH1   . ARG B 1 73  ? 28.438 -17.861  -149.553 1.00 131.04 ? 70  ARG B NH1   1 
ATOM   1806  N NH2   . ARG B 1 73  ? 28.382 -16.616  -151.479 1.00 158.88 ? 70  ARG B NH2   1 
ATOM   1807  N N     . VAL B 1 74  ? 30.535 -25.055  -149.841 1.00 124.51 ? 71  VAL B N     1 
ATOM   1808  C CA    . VAL B 1 74  ? 31.094 -26.222  -149.163 1.00 123.76 ? 71  VAL B CA    1 
ATOM   1809  C C     . VAL B 1 74  ? 31.887 -27.085  -150.137 1.00 118.34 ? 71  VAL B C     1 
ATOM   1810  O O     . VAL B 1 74  ? 32.918 -27.667  -149.776 1.00 112.03 ? 71  VAL B O     1 
ATOM   1811  C CB    . VAL B 1 74  ? 29.975 -27.027  -148.478 1.00 118.86 ? 71  VAL B CB    1 
ATOM   1812  C CG1   . VAL B 1 74  ? 30.561 -27.979  -147.446 1.00 86.95  ? 71  VAL B CG1   1 
ATOM   1813  C CG2   . VAL B 1 74  ? 28.962 -26.091  -147.838 1.00 134.00 ? 71  VAL B CG2   1 
ATOM   1814  N N     . ILE B 1 75  ? 31.412 -27.197  -151.379 1.00 117.71 ? 72  ILE B N     1 
ATOM   1815  C CA    . ILE B 1 75  ? 32.120 -27.998  -152.377 1.00 116.40 ? 72  ILE B CA    1 
ATOM   1816  C C     . ILE B 1 75  ? 33.514 -27.431  -152.621 1.00 120.46 ? 72  ILE B C     1 
ATOM   1817  O O     . ILE B 1 75  ? 34.513 -28.163  -152.622 1.00 105.97 ? 72  ILE B O     1 
ATOM   1818  C CB    . ILE B 1 75  ? 31.303 -28.078  -153.680 1.00 121.83 ? 72  ILE B CB    1 
ATOM   1819  C CG1   . ILE B 1 75  ? 30.076 -28.972  -153.485 1.00 119.68 ? 72  ILE B CG1   1 
ATOM   1820  C CG2   . ILE B 1 75  ? 32.164 -28.604  -154.820 1.00 102.90 ? 72  ILE B CG2   1 
ATOM   1821  C CD1   . ILE B 1 75  ? 29.400 -29.382  -154.779 1.00 119.67 ? 72  ILE B CD1   1 
ATOM   1822  N N     . ASN B 1 76  ? 33.600 -26.113  -152.835 1.00 125.29 ? 73  ASN B N     1 
ATOM   1823  C CA    . ASN B 1 76  ? 34.900 -25.473  -153.024 1.00 123.56 ? 73  ASN B CA    1 
ATOM   1824  C C     . ASN B 1 76  ? 35.764 -25.592  -151.775 1.00 127.34 ? 73  ASN B C     1 
ATOM   1825  O O     . ASN B 1 76  ? 36.976 -25.821  -151.871 1.00 126.13 ? 73  ASN B O     1 
ATOM   1826  C CB    . ASN B 1 76  ? 34.716 -24.005  -153.407 1.00 128.69 ? 73  ASN B CB    1 
ATOM   1827  C CG    . ASN B 1 76  ? 34.210 -23.831  -154.825 1.00 138.75 ? 73  ASN B CG    1 
ATOM   1828  O OD1   . ASN B 1 76  ? 34.691 -24.483  -155.752 1.00 126.69 ? 73  ASN B OD1   1 
ATOM   1829  N ND2   . ASN B 1 76  ? 33.235 -22.947  -155.002 1.00 147.94 ? 73  ASN B ND2   1 
ATOM   1830  N N     . LEU B 1 77  ? 35.162 -25.423  -150.595 1.00 127.51 ? 74  LEU B N     1 
ATOM   1831  C CA    . LEU B 1 77  ? 35.912 -25.568  -149.351 1.00 123.22 ? 74  LEU B CA    1 
ATOM   1832  C C     . LEU B 1 77  ? 36.548 -26.948  -149.247 1.00 122.05 ? 74  LEU B C     1 
ATOM   1833  O O     . LEU B 1 77  ? 37.716 -27.072  -148.863 1.00 128.47 ? 74  LEU B O     1 
ATOM   1834  C CB    . LEU B 1 77  ? 35.000 -25.306  -148.152 1.00 127.36 ? 74  LEU B CB    1 
ATOM   1835  C CG    . LEU B 1 77  ? 34.600 -23.851  -147.899 1.00 121.84 ? 74  LEU B CG    1 
ATOM   1836  C CD1   . LEU B 1 77  ? 33.417 -23.775  -146.944 1.00 110.54 ? 74  LEU B CD1   1 
ATOM   1837  C CD2   . LEU B 1 77  ? 35.780 -23.054  -147.363 1.00 149.48 ? 74  LEU B CD2   1 
ATOM   1838  N N     . ALA B 1 78  ? 35.796 -27.996  -149.586 1.00 111.42 ? 75  ALA B N     1 
ATOM   1839  C CA    . ALA B 1 78  ? 36.340 -29.350  -149.532 1.00 118.22 ? 75  ALA B CA    1 
ATOM   1840  C C     . ALA B 1 78  ? 37.428 -29.548  -150.580 1.00 113.83 ? 75  ALA B C     1 
ATOM   1841  O O     . ALA B 1 78  ? 38.508 -30.077  -150.278 1.00 113.32 ? 75  ALA B O     1 
ATOM   1842  C CB    . ALA B 1 78  ? 35.219 -30.372  -149.716 1.00 117.24 ? 75  ALA B CB    1 
ATOM   1843  N N     . ASN B 1 79  ? 37.161 -29.132  -151.822 1.00 104.83 ? 76  ASN B N     1 
ATOM   1844  C CA    . ASN B 1 79  ? 38.152 -29.262  -152.884 1.00 114.51 ? 76  ASN B CA    1 
ATOM   1845  C C     . ASN B 1 79  ? 39.434 -28.498  -152.584 1.00 121.42 ? 76  ASN B C     1 
ATOM   1846  O O     . ASN B 1 79  ? 40.484 -28.831  -153.143 1.00 123.85 ? 76  ASN B O     1 
ATOM   1847  C CB    . ASN B 1 79  ? 37.564 -28.794  -154.216 1.00 115.60 ? 76  ASN B CB    1 
ATOM   1848  C CG    . ASN B 1 79  ? 36.641 -29.824  -154.840 1.00 117.05 ? 76  ASN B CG    1 
ATOM   1849  O OD1   . ASN B 1 79  ? 37.089 -30.864  -155.323 1.00 99.51  ? 76  ASN B OD1   1 
ATOM   1850  N ND2   . ASN B 1 79  ? 35.345 -29.540  -154.830 1.00 128.09 ? 76  ASN B ND2   1 
ATOM   1851  N N     . GLU B 1 80  ? 39.375 -27.473  -151.736 1.00 127.67 ? 77  GLU B N     1 
ATOM   1852  C CA    . GLU B 1 80  ? 40.591 -26.776  -151.332 1.00 135.40 ? 77  GLU B CA    1 
ATOM   1853  C C     . GLU B 1 80  ? 41.267 -27.448  -150.141 1.00 129.89 ? 77  GLU B C     1 
ATOM   1854  O O     . GLU B 1 80  ? 42.484 -27.655  -150.155 1.00 134.72 ? 77  GLU B O     1 
ATOM   1855  C CB    . GLU B 1 80  ? 40.282 -25.309  -151.016 1.00 133.15 ? 77  GLU B CB    1 
ATOM   1856  C CG    . GLU B 1 80  ? 39.826 -24.497  -152.223 1.00 145.89 ? 77  GLU B CG    1 
ATOM   1857  C CD    . GLU B 1 80  ? 40.812 -24.550  -153.378 1.00 135.69 ? 77  GLU B CD    1 
ATOM   1858  O OE1   . GLU B 1 80  ? 42.036 -24.590  -153.126 1.00 130.08 ? 77  GLU B OE1   1 
ATOM   1859  O OE2   . GLU B 1 80  ? 40.360 -24.557  -154.541 1.00 123.24 ? 77  GLU B OE2   1 
ATOM   1860  N N     . MET B 1 81  ? 40.493 -27.787  -149.107 1.00 128.60 ? 78  MET B N     1 
ATOM   1861  C CA    . MET B 1 81  ? 41.061 -28.389  -147.904 1.00 131.06 ? 78  MET B CA    1 
ATOM   1862  C C     . MET B 1 81  ? 41.758 -29.708  -148.218 1.00 141.64 ? 78  MET B C     1 
ATOM   1863  O O     . MET B 1 81  ? 42.877 -29.957  -147.755 1.00 140.52 ? 78  MET B O     1 
ATOM   1864  C CB    . MET B 1 81  ? 39.965 -28.599  -146.859 1.00 123.18 ? 78  MET B CB    1 
ATOM   1865  C CG    . MET B 1 81  ? 39.514 -27.327  -146.164 1.00 143.80 ? 78  MET B CG    1 
ATOM   1866  S SD    . MET B 1 81  ? 40.755 -26.627  -145.058 1.00 189.46 ? 78  MET B SD    1 
ATOM   1867  C CE    . MET B 1 81  ? 41.485 -28.108  -144.363 1.00 147.03 ? 78  MET B CE    1 
ATOM   1868  N N     . PHE B 1 82  ? 41.113 -30.566  -149.008 1.00 140.49 ? 79  PHE B N     1 
ATOM   1869  C CA    . PHE B 1 82  ? 41.646 -31.893  -149.290 1.00 127.71 ? 79  PHE B CA    1 
ATOM   1870  C C     . PHE B 1 82  ? 42.219 -32.044  -150.690 1.00 129.80 ? 79  PHE B C     1 
ATOM   1871  O O     . PHE B 1 82  ? 43.117 -32.864  -150.888 1.00 127.91 ? 79  PHE B O     1 
ATOM   1872  C CB    . PHE B 1 82  ? 40.558 -32.953  -149.081 1.00 113.02 ? 79  PHE B CB    1 
ATOM   1873  C CG    . PHE B 1 82  ? 39.821 -32.812  -147.780 1.00 109.70 ? 79  PHE B CG    1 
ATOM   1874  C CD1   . PHE B 1 82  ? 38.505 -32.380  -147.758 1.00 105.54 ? 79  PHE B CD1   1 
ATOM   1875  C CD2   . PHE B 1 82  ? 40.449 -33.088  -146.578 1.00 106.20 ? 79  PHE B CD2   1 
ATOM   1876  C CE1   . PHE B 1 82  ? 37.824 -32.240  -146.563 1.00 92.34  ? 79  PHE B CE1   1 
ATOM   1877  C CE2   . PHE B 1 82  ? 39.775 -32.950  -145.378 1.00 96.36  ? 79  PHE B CE2   1 
ATOM   1878  C CZ    . PHE B 1 82  ? 38.460 -32.525  -145.370 1.00 97.20  ? 79  PHE B CZ    1 
ATOM   1879  N N     . GLY B 1 83  ? 41.728 -31.285  -151.655 1.00 127.13 ? 80  GLY B N     1 
ATOM   1880  C CA    . GLY B 1 83  ? 42.123 -31.433  -153.040 1.00 120.86 ? 80  GLY B CA    1 
ATOM   1881  C C     . GLY B 1 83  ? 40.968 -31.930  -153.891 1.00 108.30 ? 80  GLY B C     1 
ATOM   1882  O O     . GLY B 1 83  ? 39.961 -32.440  -153.398 1.00 117.26 ? 80  GLY B O     1 
ATOM   1883  N N     . TYR B 1 84  ? 41.121 -31.772  -155.211 1.00 102.25 ? 81  TYR B N     1 
ATOM   1884  C CA    . TYR B 1 84  ? 40.102 -32.288  -156.121 1.00 110.57 ? 81  TYR B CA    1 
ATOM   1885  C C     . TYR B 1 84  ? 40.046 -33.809  -156.085 1.00 120.93 ? 81  TYR B C     1 
ATOM   1886  O O     . TYR B 1 84  ? 39.005 -34.398  -156.396 1.00 125.33 ? 81  TYR B O     1 
ATOM   1887  C CB    . TYR B 1 84  ? 40.365 -31.811  -157.548 1.00 107.69 ? 81  TYR B CB    1 
ATOM   1888  C CG    . TYR B 1 84  ? 41.464 -32.572  -158.252 1.00 110.82 ? 81  TYR B CG    1 
ATOM   1889  C CD1   . TYR B 1 84  ? 42.799 -32.306  -157.986 1.00 110.86 ? 81  TYR B CD1   1 
ATOM   1890  C CD2   . TYR B 1 84  ? 41.165 -33.562  -159.180 1.00 123.54 ? 81  TYR B CD2   1 
ATOM   1891  C CE1   . TYR B 1 84  ? 43.806 -33.001  -158.626 1.00 113.43 ? 81  TYR B CE1   1 
ATOM   1892  C CE2   . TYR B 1 84  ? 42.167 -34.266  -159.823 1.00 129.66 ? 81  TYR B CE2   1 
ATOM   1893  C CZ    . TYR B 1 84  ? 43.486 -33.979  -159.542 1.00 127.14 ? 81  TYR B CZ    1 
ATOM   1894  O OH    . TYR B 1 84  ? 44.490 -34.671  -160.179 1.00 137.42 ? 81  TYR B OH    1 
ATOM   1895  N N     . ASN B 1 85  ? 41.154 -34.455  -155.722 1.00 114.41 ? 82  ASN B N     1 
ATOM   1896  C CA    . ASN B 1 85  ? 41.231 -35.908  -155.631 1.00 104.27 ? 82  ASN B CA    1 
ATOM   1897  C C     . ASN B 1 85  ? 41.600 -36.370  -154.227 1.00 115.99 ? 82  ASN B C     1 
ATOM   1898  O O     . ASN B 1 85  ? 42.034 -37.512  -154.046 1.00 124.76 ? 82  ASN B O     1 
ATOM   1899  C CB    . ASN B 1 85  ? 42.236 -36.450  -156.649 1.00 114.54 ? 82  ASN B CB    1 
ATOM   1900  C CG    . ASN B 1 85  ? 43.662 -36.068  -156.315 1.00 125.04 ? 82  ASN B CG    1 
ATOM   1901  O OD1   . ASN B 1 85  ? 43.943 -34.924  -155.959 1.00 128.52 ? 82  ASN B OD1   1 
ATOM   1902  N ND2   . ASN B 1 85  ? 44.573 -37.028  -156.425 1.00 133.18 ? 82  ASN B ND2   1 
ATOM   1903  N N     . GLY B 1 86  ? 41.443 -35.503  -153.230 1.00 112.74 ? 83  GLY B N     1 
ATOM   1904  C CA    . GLY B 1 86  ? 41.746 -35.865  -151.860 1.00 107.11 ? 83  GLY B CA    1 
ATOM   1905  C C     . GLY B 1 86  ? 40.515 -36.287  -151.087 1.00 96.90  ? 83  GLY B C     1 
ATOM   1906  O O     . GLY B 1 86  ? 40.619 -36.971  -150.064 1.00 100.59 ? 83  GLY B O     1 
ATOM   1907  N N     . TRP B 1 87  ? 39.342 -35.885  -151.568 1.00 90.48  ? 84  TRP B N     1 
ATOM   1908  C CA    . TRP B 1 87  ? 38.078 -36.260  -150.956 1.00 95.90  ? 84  TRP B CA    1 
ATOM   1909  C C     . TRP B 1 87  ? 37.176 -36.883  -152.011 1.00 98.82  ? 84  TRP B C     1 
ATOM   1910  O O     . TRP B 1 87  ? 37.364 -36.690  -153.215 1.00 93.10  ? 84  TRP B O     1 
ATOM   1911  C CB    . TRP B 1 87  ? 37.375 -35.059  -150.309 1.00 83.82  ? 84  TRP B CB    1 
ATOM   1912  C CG    . TRP B 1 87  ? 36.734 -34.141  -151.297 1.00 73.82  ? 84  TRP B CG    1 
ATOM   1913  C CD1   . TRP B 1 87  ? 37.367 -33.345  -152.204 1.00 97.87  ? 84  TRP B CD1   1 
ATOM   1914  C CD2   . TRP B 1 87  ? 35.331 -33.922  -151.481 1.00 82.92  ? 84  TRP B CD2   1 
ATOM   1915  N NE1   . TRP B 1 87  ? 36.446 -32.643  -152.943 1.00 104.16 ? 84  TRP B NE1   1 
ATOM   1916  C CE2   . TRP B 1 87  ? 35.188 -32.979  -152.518 1.00 95.82  ? 84  TRP B CE2   1 
ATOM   1917  C CE3   . TRP B 1 87  ? 34.181 -34.430  -150.869 1.00 91.28  ? 84  TRP B CE3   1 
ATOM   1918  C CZ2   . TRP B 1 87  ? 33.943 -32.535  -152.958 1.00 96.78  ? 84  TRP B CZ2   1 
ATOM   1919  C CZ3   . TRP B 1 87  ? 32.945 -33.988  -151.307 1.00 95.21  ? 84  TRP B CZ3   1 
ATOM   1920  C CH2   . TRP B 1 87  ? 32.836 -33.050  -152.341 1.00 90.97  ? 84  TRP B CH2   1 
ATOM   1921  N N     . ALA B 1 88  ? 36.188 -37.639  -151.540 1.00 101.57 ? 85  ALA B N     1 
ATOM   1922  C CA    . ALA B 1 88  ? 35.239 -38.303  -152.418 1.00 82.36  ? 85  ALA B CA    1 
ATOM   1923  C C     . ALA B 1 88  ? 33.940 -38.519  -151.660 1.00 84.59  ? 85  ALA B C     1 
ATOM   1924  O O     . ALA B 1 88  ? 33.947 -38.770  -150.452 1.00 89.17  ? 85  ALA B O     1 
ATOM   1925  C CB    . ALA B 1 88  ? 35.785 -39.641  -152.929 1.00 86.93  ? 85  ALA B CB    1 
ATOM   1926  N N     . HIS B 1 89  ? 32.824 -38.421  -152.377 1.00 81.69  ? 86  HIS B N     1 
ATOM   1927  C CA    . HIS B 1 89  ? 31.513 -38.656  -151.791 1.00 87.67  ? 86  HIS B CA    1 
ATOM   1928  C C     . HIS B 1 89  ? 30.735 -39.644  -152.649 1.00 96.89  ? 86  HIS B C     1 
ATOM   1929  O O     . HIS B 1 89  ? 31.024 -39.840  -153.833 1.00 91.15  ? 86  HIS B O     1 
ATOM   1930  C CB    . HIS B 1 89  ? 30.722 -37.347  -151.617 1.00 66.87  ? 86  HIS B CB    1 
ATOM   1931  C CG    . HIS B 1 89  ? 30.045 -36.868  -152.865 1.00 83.03  ? 86  HIS B CG    1 
ATOM   1932  N ND1   . HIS B 1 89  ? 28.825 -36.227  -152.846 1.00 77.24  ? 86  HIS B ND1   1 
ATOM   1933  C CD2   . HIS B 1 89  ? 30.426 -36.911  -154.163 1.00 93.38  ? 86  HIS B CD2   1 
ATOM   1934  C CE1   . HIS B 1 89  ? 28.477 -35.911  -154.080 1.00 92.97  ? 86  HIS B CE1   1 
ATOM   1935  N NE2   . HIS B 1 89  ? 29.430 -36.316  -154.899 1.00 95.74  ? 86  HIS B NE2   1 
ATOM   1936  N N     . SER B 1 90  ? 29.745 -40.278  -152.026 1.00 93.61  ? 87  SER B N     1 
ATOM   1937  C CA    . SER B 1 90  ? 28.928 -41.279  -152.693 1.00 84.29  ? 87  SER B CA    1 
ATOM   1938  C C     . SER B 1 90  ? 27.556 -41.319  -152.039 1.00 93.00  ? 87  SER B C     1 
ATOM   1939  O O     . SER B 1 90  ? 27.404 -40.988  -150.860 1.00 99.70  ? 87  SER B O     1 
ATOM   1940  C CB    . SER B 1 90  ? 29.585 -42.663  -152.640 1.00 87.57  ? 87  SER B CB    1 
ATOM   1941  O OG    . SER B 1 90  ? 30.033 -42.960  -151.329 1.00 82.23  ? 87  SER B OG    1 
ATOM   1942  N N     . ILE B 1 91  ? 26.557 -41.728  -152.818 1.00 76.59  ? 88  ILE B N     1 
ATOM   1943  C CA    . ILE B 1 91  ? 25.185 -41.835  -152.335 1.00 67.29  ? 88  ILE B CA    1 
ATOM   1944  C C     . ILE B 1 91  ? 24.978 -43.277  -151.882 1.00 80.96  ? 88  ILE B C     1 
ATOM   1945  O O     . ILE B 1 91  ? 24.829 -44.185  -152.701 1.00 76.81  ? 88  ILE B O     1 
ATOM   1946  C CB    . ILE B 1 91  ? 24.173 -41.426  -153.405 1.00 79.74  ? 88  ILE B CB    1 
ATOM   1947  C CG1   . ILE B 1 91  ? 24.551 -40.069  -154.002 1.00 82.85  ? 88  ILE B CG1   1 
ATOM   1948  C CG2   . ILE B 1 91  ? 22.771 -41.378  -152.818 1.00 75.86  ? 88  ILE B CG2   1 
ATOM   1949  C CD1   . ILE B 1 91  ? 23.640 -39.622  -155.123 1.00 69.68  ? 88  ILE B CD1   1 
ATOM   1950  N N     . THR B 1 92  ? 24.974 -43.487  -150.563 1.00 102.26 ? 89  THR B N     1 
ATOM   1951  C CA    . THR B 1 92  ? 24.753 -44.828  -150.031 1.00 78.09  ? 89  THR B CA    1 
ATOM   1952  C C     . THR B 1 92  ? 23.336 -45.308  -150.320 1.00 71.60  ? 89  THR B C     1 
ATOM   1953  O O     . THR B 1 92  ? 23.134 -46.461  -150.719 1.00 87.16  ? 89  THR B O     1 
ATOM   1954  C CB    . THR B 1 92  ? 25.033 -44.849  -148.527 1.00 76.12  ? 89  THR B CB    1 
ATOM   1955  O OG1   . THR B 1 92  ? 26.438 -44.683  -148.300 1.00 89.82  ? 89  THR B OG1   1 
ATOM   1956  C CG2   . THR B 1 92  ? 24.583 -46.168  -147.913 1.00 84.39  ? 89  THR B CG2   1 
ATOM   1957  N N     . GLN B 1 93  ? 22.346 -44.435  -150.141 1.00 72.73  ? 90  GLN B N     1 
ATOM   1958  C CA    . GLN B 1 93  ? 20.961 -44.780  -150.426 1.00 77.36  ? 90  GLN B CA    1 
ATOM   1959  C C     . GLN B 1 93  ? 20.128 -43.510  -150.477 1.00 74.88  ? 90  GLN B C     1 
ATOM   1960  O O     . GLN B 1 93  ? 20.310 -42.610  -149.654 1.00 72.32  ? 90  GLN B O     1 
ATOM   1961  C CB    . GLN B 1 93  ? 20.390 -45.730  -149.364 1.00 78.17  ? 90  GLN B CB    1 
ATOM   1962  C CG    . GLN B 1 93  ? 18.942 -46.121  -149.606 1.00 74.82  ? 90  GLN B CG    1 
ATOM   1963  C CD    . GLN B 1 93  ? 18.428 -47.112  -148.585 1.00 111.07 ? 90  GLN B CD    1 
ATOM   1964  O OE1   . GLN B 1 93  ? 18.431 -46.840  -147.385 1.00 114.31 ? 90  GLN B OE1   1 
ATOM   1965  N NE2   . GLN B 1 93  ? 17.981 -48.271  -149.057 1.00 137.30 ? 90  GLN B NE2   1 
ATOM   1966  N N     . GLN B 1 94  ? 19.218 -43.452  -151.447 1.00 76.09  ? 91  GLN B N     1 
ATOM   1967  C CA    . GLN B 1 94  ? 18.220 -42.398  -151.540 1.00 81.38  ? 91  GLN B CA    1 
ATOM   1968  C C     . GLN B 1 94  ? 16.851 -43.047  -151.650 1.00 88.29  ? 91  GLN B C     1 
ATOM   1969  O O     . GLN B 1 94  ? 16.634 -43.899  -152.519 1.00 101.81 ? 91  GLN B O     1 
ATOM   1970  C CB    . GLN B 1 94  ? 18.470 -41.485  -152.743 1.00 77.55  ? 91  GLN B CB    1 
ATOM   1971  C CG    . GLN B 1 94  ? 17.237 -40.710  -153.180 1.00 77.36  ? 91  GLN B CG    1 
ATOM   1972  C CD    . GLN B 1 94  ? 17.554 -39.615  -154.171 1.00 76.96  ? 91  GLN B CD    1 
ATOM   1973  O OE1   . GLN B 1 94  ? 16.954 -39.539  -155.242 1.00 82.54  ? 91  GLN B OE1   1 
ATOM   1974  N NE2   . GLN B 1 94  ? 18.494 -38.752  -153.815 1.00 79.75  ? 91  GLN B NE2   1 
ATOM   1975  N N     . ASN B 1 95  ? 15.930 -42.641  -150.781 1.00 77.72  ? 92  ASN B N     1 
ATOM   1976  C CA    . ASN B 1 95  ? 14.603 -43.236  -150.721 1.00 81.75  ? 92  ASN B CA    1 
ATOM   1977  C C     . ASN B 1 95  ? 13.562 -42.132  -150.633 1.00 75.48  ? 92  ASN B C     1 
ATOM   1978  O O     . ASN B 1 95  ? 13.660 -41.248  -149.777 1.00 82.89  ? 92  ASN B O     1 
ATOM   1979  C CB    . ASN B 1 95  ? 14.476 -44.184  -149.524 1.00 90.18  ? 92  ASN B CB    1 
ATOM   1980  C CG    . ASN B 1 95  ? 13.110 -44.834  -149.438 1.00 100.98 ? 92  ASN B CG    1 
ATOM   1981  O OD1   . ASN B 1 95  ? 12.783 -45.723  -150.224 1.00 101.34 ? 92  ASN B OD1   1 
ATOM   1982  N ND2   . ASN B 1 95  ? 12.303 -44.393  -148.480 1.00 93.58  ? 92  ASN B ND2   1 
ATOM   1983  N N     . VAL B 1 96  ? 12.571 -42.186  -151.517 1.00 68.37  ? 93  VAL B N     1 
ATOM   1984  C CA    . VAL B 1 96  ? 11.472 -41.226  -151.495 1.00 74.66  ? 93  VAL B CA    1 
ATOM   1985  C C     . VAL B 1 96  ? 10.522 -41.615  -150.369 1.00 84.46  ? 93  VAL B C     1 
ATOM   1986  O O     . VAL B 1 96  ? 9.945  -42.707  -150.378 1.00 80.90  ? 93  VAL B O     1 
ATOM   1987  C CB    . VAL B 1 96  ? 10.746 -41.184  -152.846 1.00 59.97  ? 93  VAL B CB    1 
ATOM   1988  C CG1   . VAL B 1 96  ? 9.599  -40.188  -152.801 1.00 64.74  ? 93  VAL B CG1   1 
ATOM   1989  C CG2   . VAL B 1 96  ? 11.721 -40.831  -153.960 1.00 62.97  ? 93  VAL B CG2   1 
ATOM   1990  N N     . ASP B 1 97  ? 10.360 -40.719  -149.393 1.00 86.42  ? 94  ASP B N     1 
ATOM   1991  C CA    . ASP B 1 97  ? 9.532  -41.031  -148.233 1.00 78.99  ? 94  ASP B CA    1 
ATOM   1992  C C     . ASP B 1 97  ? 8.051  -41.031  -148.593 1.00 75.96  ? 94  ASP B C     1 
ATOM   1993  O O     . ASP B 1 97  ? 7.323  -41.974  -148.263 1.00 87.96  ? 94  ASP B O     1 
ATOM   1994  C CB    . ASP B 1 97  ? 9.816  -40.042  -147.102 1.00 66.01  ? 94  ASP B CB    1 
ATOM   1995  C CG    . ASP B 1 97  ? 11.088 -40.374  -146.344 1.00 75.69  ? 94  ASP B CG    1 
ATOM   1996  O OD1   . ASP B 1 97  ? 11.246 -41.539  -145.925 1.00 80.82  ? 94  ASP B OD1   1 
ATOM   1997  O OD2   . ASP B 1 97  ? 11.935 -39.474  -146.172 1.00 90.21  ? 94  ASP B OD2   1 
ATOM   1998  N N     . PHE B 1 98  ? 7.587  -39.988  -149.277 1.00 80.29  ? 95  PHE B N     1 
ATOM   1999  C CA    . PHE B 1 98  ? 6.171  -39.884  -149.597 1.00 84.37  ? 95  PHE B CA    1 
ATOM   2000  C C     . PHE B 1 98  ? 5.984  -38.955  -150.786 1.00 80.99  ? 95  PHE B C     1 
ATOM   2001  O O     . PHE B 1 98  ? 6.841  -38.121  -151.090 1.00 72.46  ? 95  PHE B O     1 
ATOM   2002  C CB    . PHE B 1 98  ? 5.361  -39.383  -148.392 1.00 90.68  ? 95  PHE B CB    1 
ATOM   2003  C CG    . PHE B 1 98  ? 5.750  -38.005  -147.927 1.00 100.11 ? 95  PHE B CG    1 
ATOM   2004  C CD1   . PHE B 1 98  ? 5.171  -36.876  -148.487 1.00 90.26  ? 95  PHE B CD1   1 
ATOM   2005  C CD2   . PHE B 1 98  ? 6.699  -37.838  -146.932 1.00 104.22 ? 95  PHE B CD2   1 
ATOM   2006  C CE1   . PHE B 1 98  ? 5.529  -35.610  -148.062 1.00 94.74  ? 95  PHE B CE1   1 
ATOM   2007  C CE2   . PHE B 1 98  ? 7.061  -36.575  -146.503 1.00 100.82 ? 95  PHE B CE2   1 
ATOM   2008  C CZ    . PHE B 1 98  ? 6.475  -35.460  -147.068 1.00 102.86 ? 95  PHE B CZ    1 
ATOM   2009  N N     . VAL B 1 99  ? 4.840  -39.114  -151.449 1.00 79.98  ? 96  VAL B N     1 
ATOM   2010  C CA    . VAL B 1 99  ? 4.388  -38.225  -152.514 1.00 80.12  ? 96  VAL B CA    1 
ATOM   2011  C C     . VAL B 1 99  ? 2.880  -38.093  -152.347 1.00 95.11  ? 96  VAL B C     1 
ATOM   2012  O O     . VAL B 1 99  ? 2.143  -39.063  -152.560 1.00 89.07  ? 96  VAL B O     1 
ATOM   2013  C CB    . VAL B 1 99  ? 4.735  -38.743  -153.918 1.00 79.44  ? 96  VAL B CB    1 
ATOM   2014  C CG1   . VAL B 1 99  ? 3.942  -37.986  -154.973 1.00 88.08  ? 96  VAL B CG1   1 
ATOM   2015  C CG2   . VAL B 1 99  ? 6.227  -38.611  -154.186 1.00 68.66  ? 96  VAL B CG2   1 
ATOM   2016  N N     . ASP B 1 100 ? 2.420  -36.908  -151.954 1.00 91.98  ? 97  ASP B N     1 
ATOM   2017  C CA    . ASP B 1 100 ? 1.009  -36.668  -151.703 1.00 95.35  ? 97  ASP B CA    1 
ATOM   2018  C C     . ASP B 1 100 ? 0.487  -35.576  -152.626 1.00 103.94 ? 97  ASP B C     1 
ATOM   2019  O O     . ASP B 1 100 ? 1.249  -34.782  -153.185 1.00 111.73 ? 97  ASP B O     1 
ATOM   2020  C CB    . ASP B 1 100 ? 0.761  -36.276  -150.239 1.00 106.41 ? 97  ASP B CB    1 
ATOM   2021  C CG    . ASP B 1 100 ? 1.378  -37.255  -149.260 1.00 131.19 ? 97  ASP B CG    1 
ATOM   2022  O OD1   . ASP B 1 100 ? 1.171  -38.476  -149.424 1.00 124.36 ? 97  ASP B OD1   1 
ATOM   2023  O OD2   . ASP B 1 100 ? 2.067  -36.802  -148.321 1.00 126.89 ? 97  ASP B OD2   1 
ATOM   2024  N N     . LEU B 1 101 ? -0.836 -35.550  -152.779 1.00 113.96 ? 98  LEU B N     1 
ATOM   2025  C CA    . LEU B 1 101 ? -1.506 -34.608  -153.667 1.00 106.27 ? 98  LEU B CA    1 
ATOM   2026  C C     . LEU B 1 101 ? -2.723 -34.044  -152.953 1.00 119.08 ? 98  LEU B C     1 
ATOM   2027  O O     . LEU B 1 101 ? -3.664 -34.785  -152.650 1.00 127.54 ? 98  LEU B O     1 
ATOM   2028  C CB    . LEU B 1 101 ? -1.917 -35.286  -154.978 1.00 85.80  ? 98  LEU B CB    1 
ATOM   2029  C CG    . LEU B 1 101 ? -2.700 -34.434  -155.977 1.00 122.04 ? 98  LEU B CG    1 
ATOM   2030  C CD1   . LEU B 1 101 ? -1.970 -33.131  -156.268 1.00 128.98 ? 98  LEU B CD1   1 
ATOM   2031  C CD2   . LEU B 1 101 ? -2.950 -35.213  -157.259 1.00 135.79 ? 98  LEU B CD2   1 
ATOM   2032  N N     . ASN B 1 102 ? -2.707 -32.740  -152.686 1.00 124.31 ? 99  ASN B N     1 
ATOM   2033  C CA    . ASN B 1 102 ? -3.819 -32.048  -152.042 1.00 127.67 ? 99  ASN B CA    1 
ATOM   2034  C C     . ASN B 1 102 ? -4.303 -30.951  -152.980 1.00 136.21 ? 99  ASN B C     1 
ATOM   2035  O O     . ASN B 1 102 ? -3.643 -29.914  -153.118 1.00 134.88 ? 99  ASN B O     1 
ATOM   2036  C CB    . ASN B 1 102 ? -3.405 -31.472  -150.688 1.00 132.57 ? 99  ASN B CB    1 
ATOM   2037  C CG    . ASN B 1 102 ? -2.913 -32.536  -149.727 1.00 132.75 ? 99  ASN B CG    1 
ATOM   2038  O OD1   . ASN B 1 102 ? -3.433 -33.652  -149.700 1.00 142.29 ? 99  ASN B OD1   1 
ATOM   2039  N ND2   . ASN B 1 102 ? -1.909 -32.194  -148.928 1.00 125.99 ? 99  ASN B ND2   1 
ATOM   2040  N N     . ASN B 1 103 ? -5.457 -31.182  -153.603 1.00 128.06 ? 100 ASN B N     1 
ATOM   2041  C CA    . ASN B 1 103 ? -6.136 -30.237  -154.495 1.00 126.76 ? 100 ASN B CA    1 
ATOM   2042  C C     . ASN B 1 103 ? -5.151 -29.514  -155.417 1.00 128.79 ? 100 ASN B C     1 
ATOM   2043  O O     . ASN B 1 103 ? -5.064 -28.286  -155.451 1.00 130.24 ? 100 ASN B O     1 
ATOM   2044  C CB    . ASN B 1 103 ? -6.997 -29.240  -153.711 1.00 113.90 ? 100 ASN B CB    1 
ATOM   2045  C CG    . ASN B 1 103 ? -6.285 -28.654  -152.507 1.00 133.04 ? 100 ASN B CG    1 
ATOM   2046  O OD1   . ASN B 1 103 ? -6.326 -29.218  -151.413 1.00 141.13 ? 100 ASN B OD1   1 
ATOM   2047  N ND2   . ASN B 1 103 ? -5.628 -27.519  -152.702 1.00 135.82 ? 100 ASN B ND2   1 
ATOM   2048  N N     . GLY B 1 104 ? -4.400 -30.314  -156.175 1.00 127.25 ? 101 GLY B N     1 
ATOM   2049  C CA    . GLY B 1 104 ? -3.527 -29.803  -157.209 1.00 123.97 ? 101 GLY B CA    1 
ATOM   2050  C C     . GLY B 1 104 ? -2.103 -29.509  -156.789 1.00 120.91 ? 101 GLY B C     1 
ATOM   2051  O O     . GLY B 1 104 ? -1.273 -29.202  -157.654 1.00 117.23 ? 101 GLY B O     1 
ATOM   2052  N N     . ALA B 1 105 ? -1.788 -29.588  -155.500 1.00 118.39 ? 102 ALA B N     1 
ATOM   2053  C CA    . ALA B 1 105 ? -0.451 -29.305  -154.998 1.00 125.12 ? 102 ALA B CA    1 
ATOM   2054  C C     . ALA B 1 105 ? 0.249  -30.609  -154.639 1.00 121.60 ? 102 ALA B C     1 
ATOM   2055  O O     . ALA B 1 105 ? -0.333 -31.466  -153.966 1.00 122.42 ? 102 ALA B O     1 
ATOM   2056  C CB    . ALA B 1 105 ? -0.506 -28.378  -153.782 1.00 130.60 ? 102 ALA B CB    1 
ATOM   2057  N N     . PHE B 1 106 ? 1.490  -30.757  -155.095 1.00 123.74 ? 103 PHE B N     1 
ATOM   2058  C CA    . PHE B 1 106 ? 2.284  -31.955  -154.849 1.00 107.90 ? 103 PHE B CA    1 
ATOM   2059  C C     . PHE B 1 106 ? 3.241  -31.697  -153.692 1.00 102.16 ? 103 PHE B C     1 
ATOM   2060  O O     . PHE B 1 106 ? 4.054  -30.768  -153.747 1.00 105.54 ? 103 PHE B O     1 
ATOM   2061  C CB    . PHE B 1 106 ? 3.057  -32.367  -156.101 1.00 107.58 ? 103 PHE B CB    1 
ATOM   2062  C CG    . PHE B 1 106 ? 2.285  -33.271  -157.018 1.00 110.22 ? 103 PHE B CG    1 
ATOM   2063  C CD1   . PHE B 1 106 ? 1.621  -34.380  -156.519 1.00 113.97 ? 103 PHE B CD1   1 
ATOM   2064  C CD2   . PHE B 1 106 ? 2.225  -33.015  -158.377 1.00 123.95 ? 103 PHE B CD2   1 
ATOM   2065  C CE1   . PHE B 1 106 ? 0.910  -35.216  -157.359 1.00 116.93 ? 103 PHE B CE1   1 
ATOM   2066  C CE2   . PHE B 1 106 ? 1.515  -33.847  -159.222 1.00 131.74 ? 103 PHE B CE2   1 
ATOM   2067  C CZ    . PHE B 1 106 ? 0.857  -34.949  -158.713 1.00 120.61 ? 103 PHE B CZ    1 
ATOM   2068  N N     . TYR B 1 107 ? 3.143  -32.521  -152.652 1.00 98.67  ? 104 TYR B N     1 
ATOM   2069  C CA    . TYR B 1 107 ? 3.995  -32.427  -151.471 1.00 99.98  ? 104 TYR B CA    1 
ATOM   2070  C C     . TYR B 1 107 ? 4.888  -33.661  -151.464 1.00 89.03  ? 104 TYR B C     1 
ATOM   2071  O O     . TYR B 1 107 ? 4.398  -34.785  -151.312 1.00 95.78  ? 104 TYR B O     1 
ATOM   2072  C CB    . TYR B 1 107 ? 3.157  -32.331  -150.196 1.00 111.54 ? 104 TYR B CB    1 
ATOM   2073  C CG    . TYR B 1 107 ? 2.088  -31.261  -150.253 1.00 115.24 ? 104 TYR B CG    1 
ATOM   2074  C CD1   . TYR B 1 107 ? 0.895  -31.486  -150.930 1.00 122.08 ? 104 TYR B CD1   1 
ATOM   2075  C CD2   . TYR B 1 107 ? 2.275  -30.023  -149.652 1.00 127.88 ? 104 TYR B CD2   1 
ATOM   2076  C CE1   . TYR B 1 107 ? -0.081 -30.521  -150.997 1.00 130.22 ? 104 TYR B CE1   1 
ATOM   2077  C CE2   . TYR B 1 107 ? 1.296  -29.046  -149.715 1.00 151.00 ? 104 TYR B CE2   1 
ATOM   2078  C CZ    . TYR B 1 107 ? 0.119  -29.305  -150.391 1.00 154.08 ? 104 TYR B CZ    1 
ATOM   2079  O OH    . TYR B 1 107 ? -0.868 -28.352  -150.470 1.00 152.11 ? 104 TYR B OH    1 
ATOM   2080  N N     . VAL B 1 108 ? 6.191  -33.454  -151.630 1.00 82.79  ? 105 VAL B N     1 
ATOM   2081  C CA    . VAL B 1 108 ? 7.147  -34.541  -151.803 1.00 82.41  ? 105 VAL B CA    1 
ATOM   2082  C C     . VAL B 1 108 ? 8.212  -34.446  -150.721 1.00 74.71  ? 105 VAL B C     1 
ATOM   2083  O O     . VAL B 1 108 ? 8.806  -33.381  -150.517 1.00 80.26  ? 105 VAL B O     1 
ATOM   2084  C CB    . VAL B 1 108 ? 7.791  -34.507  -153.202 1.00 83.28  ? 105 VAL B CB    1 
ATOM   2085  C CG1   . VAL B 1 108 ? 8.854  -35.583  -153.323 1.00 81.60  ? 105 VAL B CG1   1 
ATOM   2086  C CG2   . VAL B 1 108 ? 6.730  -34.677  -154.277 1.00 88.85  ? 105 VAL B CG2   1 
ATOM   2087  N N     . GLY B 1 109 ? 8.448  -35.559  -150.031 1.00 71.90  ? 106 GLY B N     1 
ATOM   2088  C CA    . GLY B 1 109 ? 9.561  -35.668  -149.110 1.00 81.77  ? 106 GLY B CA    1 
ATOM   2089  C C     . GLY B 1 109 ? 10.531 -36.742  -149.555 1.00 82.40  ? 106 GLY B C     1 
ATOM   2090  O O     . GLY B 1 109 ? 10.118 -37.863  -149.865 1.00 82.89  ? 106 GLY B O     1 
ATOM   2091  N N     . VAL B 1 110 ? 11.822 -36.420  -149.584 1.00 80.98  ? 107 VAL B N     1 
ATOM   2092  C CA    . VAL B 1 110 ? 12.852 -37.330  -150.073 1.00 81.62  ? 107 VAL B CA    1 
ATOM   2093  C C     . VAL B 1 110 ? 14.072 -37.199  -149.173 1.00 75.21  ? 107 VAL B C     1 
ATOM   2094  O O     . VAL B 1 110 ? 14.428 -36.094  -148.749 1.00 85.77  ? 107 VAL B O     1 
ATOM   2095  C CB    . VAL B 1 110 ? 13.220 -37.038  -151.546 1.00 87.33  ? 107 VAL B CB    1 
ATOM   2096  C CG1   . VAL B 1 110 ? 14.443 -37.839  -151.973 1.00 68.31  ? 107 VAL B CG1   1 
ATOM   2097  C CG2   . VAL B 1 110 ? 12.049 -37.346  -152.467 1.00 80.43  ? 107 VAL B CG2   1 
ATOM   2098  N N     . CYS B 1 111 ? 14.711 -38.329  -148.878 1.00 74.36  ? 108 CYS B N     1 
ATOM   2099  C CA    . CYS B 1 111 ? 15.908 -38.354  -148.054 1.00 95.04  ? 108 CYS B CA    1 
ATOM   2100  C C     . CYS B 1 111 ? 17.011 -39.104  -148.785 1.00 81.67  ? 108 CYS B C     1 
ATOM   2101  O O     . CYS B 1 111 ? 16.748 -39.964  -149.631 1.00 78.74  ? 108 CYS B O     1 
ATOM   2102  C CB    . CYS B 1 111 ? 15.642 -39.005  -146.687 1.00 96.19  ? 108 CYS B CB    1 
ATOM   2103  S SG    . CYS B 1 111 ? 15.612 -40.811  -146.699 1.00 79.52  ? 108 CYS B SG    1 
ATOM   2104  N N     . ALA B 1 112 ? 18.253 -38.763  -148.451 1.00 76.97  ? 109 ALA B N     1 
ATOM   2105  C CA    . ALA B 1 112 ? 19.419 -39.385  -149.057 1.00 75.54  ? 109 ALA B CA    1 
ATOM   2106  C C     . ALA B 1 112 ? 20.482 -39.599  -147.990 1.00 72.49  ? 109 ALA B C     1 
ATOM   2107  O O     . ALA B 1 112 ? 20.498 -38.929  -146.956 1.00 82.23  ? 109 ALA B O     1 
ATOM   2108  C CB    . ALA B 1 112 ? 19.981 -38.539  -150.207 1.00 79.90  ? 109 ALA B CB    1 
ATOM   2109  N N     . PHE B 1 113 ? 21.382 -40.540  -148.262 1.00 76.15  ? 110 PHE B N     1 
ATOM   2110  C CA    . PHE B 1 113 ? 22.468 -40.888  -147.351 1.00 81.06  ? 110 PHE B CA    1 
ATOM   2111  C C     . PHE B 1 113 ? 23.781 -40.728  -148.106 1.00 88.94  ? 110 PHE B C     1 
ATOM   2112  O O     . PHE B 1 113 ? 24.112 -41.553  -148.965 1.00 104.93 ? 110 PHE B O     1 
ATOM   2113  C CB    . PHE B 1 113 ? 22.310 -42.312  -146.817 1.00 74.13  ? 110 PHE B CB    1 
ATOM   2114  C CG    . PHE B 1 113 ? 21.117 -42.499  -145.919 1.00 75.58  ? 110 PHE B CG    1 
ATOM   2115  C CD1   . PHE B 1 113 ? 19.834 -42.534  -146.442 1.00 78.00  ? 110 PHE B CD1   1 
ATOM   2116  C CD2   . PHE B 1 113 ? 21.281 -42.638  -144.552 1.00 70.80  ? 110 PHE B CD2   1 
ATOM   2117  C CE1   . PHE B 1 113 ? 18.738 -42.704  -145.617 1.00 74.19  ? 110 PHE B CE1   1 
ATOM   2118  C CE2   . PHE B 1 113 ? 20.188 -42.810  -143.723 1.00 68.36  ? 110 PHE B CE2   1 
ATOM   2119  C CZ    . PHE B 1 113 ? 18.915 -42.842  -144.256 1.00 70.59  ? 110 PHE B CZ    1 
ATOM   2120  N N     . VAL B 1 114 ? 24.521 -39.670  -147.789 1.00 76.10  ? 111 VAL B N     1 
ATOM   2121  C CA    . VAL B 1 114 ? 25.778 -39.360  -148.460 1.00 77.23  ? 111 VAL B CA    1 
ATOM   2122  C C     . VAL B 1 114 ? 26.937 -39.764  -147.561 1.00 81.13  ? 111 VAL B C     1 
ATOM   2123  O O     . VAL B 1 114 ? 26.924 -39.506  -146.350 1.00 77.70  ? 111 VAL B O     1 
ATOM   2124  C CB    . VAL B 1 114 ? 25.858 -37.866  -148.825 1.00 87.90  ? 111 VAL B CB    1 
ATOM   2125  C CG1   . VAL B 1 114 ? 27.047 -37.607  -149.736 1.00 90.56  ? 111 VAL B CG1   1 
ATOM   2126  C CG2   . VAL B 1 114 ? 24.565 -37.419  -149.488 1.00 102.60 ? 111 VAL B CG2   1 
ATOM   2127  N N     . ARG B 1 115 ? 27.943 -40.400  -148.158 1.00 78.42  ? 112 ARG B N     1 
ATOM   2128  C CA    . ARG B 1 115 ? 29.146 -40.833  -147.458 1.00 86.32  ? 112 ARG B CA    1 
ATOM   2129  C C     . ARG B 1 115 ? 30.352 -40.159  -148.093 1.00 80.23  ? 112 ARG B C     1 
ATOM   2130  O O     . ARG B 1 115 ? 30.657 -40.406  -149.265 1.00 90.37  ? 112 ARG B O     1 
ATOM   2131  C CB    . ARG B 1 115 ? 29.298 -42.355  -147.511 1.00 96.50  ? 112 ARG B CB    1 
ATOM   2132  C CG    . ARG B 1 115 ? 30.665 -42.855  -147.068 1.00 80.96  ? 112 ARG B CG    1 
ATOM   2133  C CD    . ARG B 1 115 ? 30.850 -44.328  -147.395 1.00 82.41  ? 112 ARG B CD    1 
ATOM   2134  N NE    . ARG B 1 115 ? 32.259 -44.680  -147.558 1.00 96.54  ? 112 ARG B NE    1 
ATOM   2135  C CZ    . ARG B 1 115 ? 32.949 -45.427  -146.703 1.00 112.78 ? 112 ARG B CZ    1 
ATOM   2136  N NH1   . ARG B 1 115 ? 32.361 -45.911  -145.617 1.00 132.16 ? 112 ARG B NH1   1 
ATOM   2137  N NH2   . ARG B 1 115 ? 34.227 -45.695  -146.935 1.00 98.17  ? 112 ARG B NH2   1 
ATOM   2138  N N     . VAL B 1 116 ? 31.038 -39.320  -147.323 1.00 73.95  ? 113 VAL B N     1 
ATOM   2139  C CA    . VAL B 1 116 ? 32.250 -38.647  -147.776 1.00 81.15  ? 113 VAL B CA    1 
ATOM   2140  C C     . VAL B 1 116 ? 33.449 -39.439  -147.283 1.00 74.17  ? 113 VAL B C     1 
ATOM   2141  O O     . VAL B 1 116 ? 33.460 -39.921  -146.144 1.00 80.38  ? 113 VAL B O     1 
ATOM   2142  C CB    . VAL B 1 116 ? 32.308 -37.190  -147.277 1.00 79.19  ? 113 VAL B CB    1 
ATOM   2143  C CG1   . VAL B 1 116 ? 33.459 -36.451  -147.939 1.00 79.02  ? 113 VAL B CG1   1 
ATOM   2144  C CG2   . VAL B 1 116 ? 30.995 -36.481  -147.548 1.00 77.37  ? 113 VAL B CG2   1 
ATOM   2145  N N     . GLN B 1 117 ? 34.459 -39.580  -148.138 1.00 71.74  ? 114 GLN B N     1 
ATOM   2146  C CA    . GLN B 1 117 ? 35.632 -40.379  -147.815 1.00 92.27  ? 114 GLN B CA    1 
ATOM   2147  C C     . GLN B 1 117 ? 36.886 -39.670  -148.299 1.00 96.57  ? 114 GLN B C     1 
ATOM   2148  O O     . GLN B 1 117 ? 36.925 -39.152  -149.419 1.00 83.83  ? 114 GLN B O     1 
ATOM   2149  C CB    . GLN B 1 117 ? 35.547 -41.777  -148.444 1.00 92.38  ? 114 GLN B CB    1 
ATOM   2150  C CG    . GLN B 1 117 ? 36.763 -42.652  -148.181 1.00 87.98  ? 114 GLN B CG    1 
ATOM   2151  C CD    . GLN B 1 117 ? 36.735 -43.943  -148.976 1.00 100.78 ? 114 GLN B CD    1 
ATOM   2152  O OE1   . GLN B 1 117 ? 36.391 -43.950  -150.158 1.00 102.76 ? 114 GLN B OE1   1 
ATOM   2153  N NE2   . GLN B 1 117 ? 37.098 -45.045  -148.329 1.00 124.03 ? 114 GLN B NE2   1 
ATOM   2154  N N     . LEU B 1 118 ? 37.906 -39.650  -147.448 1.00 112.22 ? 115 LEU B N     1 
ATOM   2155  C CA    . LEU B 1 118 ? 39.198 -39.081  -147.792 1.00 103.76 ? 115 LEU B CA    1 
ATOM   2156  C C     . LEU B 1 118 ? 40.122 -40.163  -148.341 1.00 102.81 ? 115 LEU B C     1 
ATOM   2157  O O     . LEU B 1 118 ? 39.918 -41.359  -148.122 1.00 113.49 ? 115 LEU B O     1 
ATOM   2158  C CB    . LEU B 1 118 ? 39.833 -38.410  -146.574 1.00 119.23 ? 115 LEU B CB    1 
ATOM   2159  C CG    . LEU B 1 118 ? 38.930 -37.460  -145.785 1.00 105.45 ? 115 LEU B CG    1 
ATOM   2160  C CD1   . LEU B 1 118 ? 39.673 -36.875  -144.593 1.00 116.19 ? 115 LEU B CD1   1 
ATOM   2161  C CD2   . LEU B 1 118 ? 38.397 -36.357  -146.687 1.00 96.21  ? 115 LEU B CD2   1 
ATOM   2162  N N     . LYS B 1 119 ? 41.149 -39.721  -149.074 1.00 94.20  ? 116 LYS B N     1 
ATOM   2163  C CA    . LYS B 1 119 ? 42.071 -40.650  -149.720 1.00 101.27 ? 116 LYS B CA    1 
ATOM   2164  C C     . LYS B 1 119 ? 42.791 -41.560  -148.731 1.00 108.52 ? 116 LYS B C     1 
ATOM   2165  O O     . LYS B 1 119 ? 43.366 -42.571  -149.147 1.00 116.51 ? 116 LYS B O     1 
ATOM   2166  C CB    . LYS B 1 119 ? 43.095 -39.882  -150.560 1.00 112.15 ? 116 LYS B CB    1 
ATOM   2167  C CG    . LYS B 1 119 ? 43.818 -38.775  -149.818 1.00 117.75 ? 116 LYS B CG    1 
ATOM   2168  C CD    . LYS B 1 119 ? 44.728 -38.001  -150.759 1.00 123.49 ? 116 LYS B CD    1 
ATOM   2169  C CE    . LYS B 1 119 ? 45.253 -36.735  -150.106 1.00 139.20 ? 116 LYS B CE    1 
ATOM   2170  N NZ    . LYS B 1 119 ? 45.979 -35.871  -151.078 1.00 145.33 ? 116 LYS B NZ    1 
ATOM   2171  N N     . ASP B 1 120 ? 42.791 -41.224  -147.440 1.00 102.02 ? 117 ASP B N     1 
ATOM   2172  C CA    . ASP B 1 120 ? 43.412 -42.088  -146.444 1.00 115.05 ? 117 ASP B CA    1 
ATOM   2173  C C     . ASP B 1 120 ? 42.499 -43.216  -145.982 1.00 113.44 ? 117 ASP B C     1 
ATOM   2174  O O     . ASP B 1 120 ? 42.977 -44.145  -145.323 1.00 115.05 ? 117 ASP B O     1 
ATOM   2175  C CB    . ASP B 1 120 ? 43.855 -41.267  -145.230 1.00 120.53 ? 117 ASP B CB    1 
ATOM   2176  C CG    . ASP B 1 120 ? 42.695 -40.878  -144.336 1.00 128.23 ? 117 ASP B CG    1 
ATOM   2177  O OD1   . ASP B 1 120 ? 41.642 -40.468  -144.870 1.00 125.47 ? 117 ASP B OD1   1 
ATOM   2178  O OD2   . ASP B 1 120 ? 42.834 -40.988  -143.100 1.00 124.01 ? 117 ASP B OD2   1 
ATOM   2179  N N     . GLY B 1 121 ? 41.209 -43.161  -146.307 1.00 106.58 ? 118 GLY B N     1 
ATOM   2180  C CA    . GLY B 1 121 ? 40.247 -44.161  -145.894 1.00 97.47  ? 118 GLY B CA    1 
ATOM   2181  C C     . GLY B 1 121 ? 39.234 -43.672  -144.882 1.00 107.11 ? 118 GLY B C     1 
ATOM   2182  O O     . GLY B 1 121 ? 38.187 -44.312  -144.716 1.00 105.99 ? 118 GLY B O     1 
ATOM   2183  N N     . SER B 1 122 ? 39.518 -42.567  -144.193 1.00 111.16 ? 119 SER B N     1 
ATOM   2184  C CA    . SER B 1 122 ? 38.557 -41.997  -143.258 1.00 113.25 ? 119 SER B CA    1 
ATOM   2185  C C     . SER B 1 122 ? 37.272 -41.619  -143.985 1.00 104.85 ? 119 SER B C     1 
ATOM   2186  O O     . SER B 1 122 ? 37.284 -41.239  -145.159 1.00 90.93  ? 119 SER B O     1 
ATOM   2187  C CB    . SER B 1 122 ? 39.152 -40.773  -142.561 1.00 122.03 ? 119 SER B CB    1 
ATOM   2188  O OG    . SER B 1 122 ? 38.208 -40.175  -141.688 1.00 136.87 ? 119 SER B OG    1 
ATOM   2189  N N     . TYR B 1 123 ? 36.150 -41.726  -143.275 1.00 100.11 ? 120 TYR B N     1 
ATOM   2190  C CA    . TYR B 1 123 ? 34.849 -41.555  -143.903 1.00 88.81  ? 120 TYR B CA    1 
ATOM   2191  C C     . TYR B 1 123 ? 33.838 -41.035  -142.891 1.00 83.57  ? 120 TYR B C     1 
ATOM   2192  O O     . TYR B 1 123 ? 33.900 -41.359  -141.704 1.00 82.15  ? 120 TYR B O     1 
ATOM   2193  C CB    . TYR B 1 123 ? 34.360 -42.872  -144.519 1.00 99.62  ? 120 TYR B CB    1 
ATOM   2194  C CG    . TYR B 1 123 ? 34.210 -44.000  -143.521 1.00 98.68  ? 120 TYR B CG    1 
ATOM   2195  C CD1   . TYR B 1 123 ? 33.013 -44.205  -142.844 1.00 85.91  ? 120 TYR B CD1   1 
ATOM   2196  C CD2   . TYR B 1 123 ? 35.267 -44.862  -143.258 1.00 86.34  ? 120 TYR B CD2   1 
ATOM   2197  C CE1   . TYR B 1 123 ? 32.877 -45.233  -141.932 1.00 71.48  ? 120 TYR B CE1   1 
ATOM   2198  C CE2   . TYR B 1 123 ? 35.138 -45.894  -142.348 1.00 82.89  ? 120 TYR B CE2   1 
ATOM   2199  C CZ    . TYR B 1 123 ? 33.942 -46.075  -141.689 1.00 89.45  ? 120 TYR B CZ    1 
ATOM   2200  O OH    . TYR B 1 123 ? 33.810 -47.101  -140.782 1.00 107.30 ? 120 TYR B OH    1 
ATOM   2201  N N     . HIS B 1 124 ? 32.899 -40.230  -143.381 1.00 78.62  ? 121 HIS B N     1 
ATOM   2202  C CA    . HIS B 1 124 ? 31.781 -39.756  -142.581 1.00 81.27  ? 121 HIS B CA    1 
ATOM   2203  C C     . HIS B 1 124 ? 30.517 -39.803  -143.426 1.00 73.76  ? 121 HIS B C     1 
ATOM   2204  O O     . HIS B 1 124 ? 30.534 -39.436  -144.604 1.00 76.54  ? 121 HIS B O     1 
ATOM   2205  C CB    . HIS B 1 124 ? 32.023 -38.336  -142.049 1.00 103.13 ? 121 HIS B CB    1 
ATOM   2206  C CG    . HIS B 1 124 ? 33.068 -38.262  -140.977 1.00 109.09 ? 121 HIS B CG    1 
ATOM   2207  N ND1   . HIS B 1 124 ? 34.110 -37.360  -141.013 1.00 102.74 ? 121 HIS B ND1   1 
ATOM   2208  C CD2   . HIS B 1 124 ? 33.231 -38.977  -139.839 1.00 98.85  ? 121 HIS B CD2   1 
ATOM   2209  C CE1   . HIS B 1 124 ? 34.869 -37.523  -139.944 1.00 103.00 ? 121 HIS B CE1   1 
ATOM   2210  N NE2   . HIS B 1 124 ? 34.357 -38.498  -139.215 1.00 100.44 ? 121 HIS B NE2   1 
ATOM   2211  N N     . GLU B 1 125 ? 29.425 -40.259  -142.817 1.00 76.87  ? 122 GLU B N     1 
ATOM   2212  C CA    . GLU B 1 125 ? 28.159 -40.462  -143.508 1.00 82.95  ? 122 GLU B CA    1 
ATOM   2213  C C     . GLU B 1 125 ? 27.026 -39.825  -142.718 1.00 87.08  ? 122 GLU B C     1 
ATOM   2214  O O     . GLU B 1 125 ? 26.968 -39.949  -141.491 1.00 93.60  ? 122 GLU B O     1 
ATOM   2215  C CB    . GLU B 1 125 ? 27.880 -41.959  -143.710 1.00 102.15 ? 122 GLU B CB    1 
ATOM   2216  C CG    . GLU B 1 125 ? 26.512 -42.273  -144.292 1.00 93.30  ? 122 GLU B CG    1 
ATOM   2217  C CD    . GLU B 1 125 ? 26.262 -43.763  -144.421 1.00 91.83  ? 122 GLU B CD    1 
ATOM   2218  O OE1   . GLU B 1 125 ? 26.663 -44.518  -143.509 1.00 90.79  ? 122 GLU B OE1   1 
ATOM   2219  O OE2   . GLU B 1 125 ? 25.657 -44.180  -145.430 1.00 92.46  ? 122 GLU B OE2   1 
ATOM   2220  N N     . ASP B 1 126 ? 26.123 -39.150  -143.427 1.00 79.17  ? 123 ASP B N     1 
ATOM   2221  C CA    . ASP B 1 126 ? 25.013 -38.464  -142.784 1.00 87.84  ? 123 ASP B CA    1 
ATOM   2222  C C     . ASP B 1 126 ? 23.859 -38.345  -143.769 1.00 83.07  ? 123 ASP B C     1 
ATOM   2223  O O     . ASP B 1 126 ? 24.024 -38.533  -144.977 1.00 83.00  ? 123 ASP B O     1 
ATOM   2224  C CB    . ASP B 1 126 ? 25.427 -37.079  -142.271 1.00 90.89  ? 123 ASP B CB    1 
ATOM   2225  C CG    . ASP B 1 126 ? 24.671 -36.673  -141.023 1.00 90.77  ? 123 ASP B CG    1 
ATOM   2226  O OD1   . ASP B 1 126 ? 23.422 -36.674  -141.058 1.00 89.43  ? 123 ASP B OD1   1 
ATOM   2227  O OD2   . ASP B 1 126 ? 25.325 -36.353  -140.008 1.00 88.70  ? 123 ASP B OD2   1 
ATOM   2228  N N     . VAL B 1 127 ? 22.683 -38.032  -143.231 1.00 79.25  ? 124 VAL B N     1 
ATOM   2229  C CA    . VAL B 1 127 ? 21.460 -37.964  -144.018 1.00 84.62  ? 124 VAL B CA    1 
ATOM   2230  C C     . VAL B 1 127 ? 21.264 -36.545  -144.539 1.00 84.70  ? 124 VAL B C     1 
ATOM   2231  O O     . VAL B 1 127 ? 21.850 -35.581  -144.042 1.00 93.04  ? 124 VAL B O     1 
ATOM   2232  C CB    . VAL B 1 127 ? 20.243 -38.431  -143.190 1.00 73.96  ? 124 VAL B CB    1 
ATOM   2233  C CG1   . VAL B 1 127 ? 19.054 -38.760  -144.086 1.00 79.40  ? 124 VAL B CG1   1 
ATOM   2234  C CG2   . VAL B 1 127 ? 20.615 -39.633  -142.363 1.00 87.81  ? 124 VAL B CG2   1 
ATOM   2235  N N     . GLY B 1 128 ? 20.434 -36.423  -145.564 1.00 76.84  ? 125 GLY B N     1 
ATOM   2236  C CA    . GLY B 1 128 ? 19.972 -35.128  -146.027 1.00 84.01  ? 125 GLY B CA    1 
ATOM   2237  C C     . GLY B 1 128 ? 18.571 -35.260  -146.575 1.00 82.52  ? 125 GLY B C     1 
ATOM   2238  O O     . GLY B 1 128 ? 18.175 -36.323  -147.062 1.00 81.74  ? 125 GLY B O     1 
ATOM   2239  N N     . TYR B 1 129 ? 17.812 -34.172  -146.490 1.00 88.84  ? 126 TYR B N     1 
ATOM   2240  C CA    . TYR B 1 129 ? 16.406 -34.183  -146.856 1.00 84.11  ? 126 TYR B CA    1 
ATOM   2241  C C     . TYR B 1 129 ? 16.115 -33.132  -147.919 1.00 95.65  ? 126 TYR B C     1 
ATOM   2242  O O     . TYR B 1 129 ? 16.785 -32.098  -148.001 1.00 96.03  ? 126 TYR B O     1 
ATOM   2243  C CB    . TYR B 1 129 ? 15.515 -33.940  -145.636 1.00 83.09  ? 126 TYR B CB    1 
ATOM   2244  C CG    . TYR B 1 129 ? 14.232 -34.734  -145.663 1.00 85.80  ? 126 TYR B CG    1 
ATOM   2245  C CD1   . TYR B 1 129 ? 14.178 -36.021  -145.148 1.00 88.94  ? 126 TYR B CD1   1 
ATOM   2246  C CD2   . TYR B 1 129 ? 13.078 -34.202  -146.223 1.00 98.41  ? 126 TYR B CD2   1 
ATOM   2247  C CE1   . TYR B 1 129 ? 13.007 -36.750  -145.175 1.00 88.90  ? 126 TYR B CE1   1 
ATOM   2248  C CE2   . TYR B 1 129 ? 11.903 -34.925  -146.257 1.00 88.35  ? 126 TYR B CE2   1 
ATOM   2249  C CZ    . TYR B 1 129 ? 11.873 -36.197  -145.733 1.00 85.87  ? 126 TYR B CZ    1 
ATOM   2250  O OH    . TYR B 1 129 ? 10.702 -36.917  -145.767 1.00 85.42  ? 126 TYR B OH    1 
ATOM   2251  N N     . GLY B 1 130 ? 15.112 -33.417  -148.731 1.00 94.63  ? 127 GLY B N     1 
ATOM   2252  C CA    . GLY B 1 130 ? 14.634 -32.466  -149.721 1.00 94.12  ? 127 GLY B CA    1 
ATOM   2253  C C     . GLY B 1 130 ? 13.128 -32.356  -149.649 1.00 96.66  ? 127 GLY B C     1 
ATOM   2254  O O     . GLY B 1 130 ? 12.435 -33.341  -149.404 1.00 92.35  ? 127 GLY B O     1 
ATOM   2255  N N     . VAL B 1 131 ? 12.629 -31.144  -149.871 1.00 94.77  ? 128 VAL B N     1 
ATOM   2256  C CA    . VAL B 1 131 ? 11.228 -30.818  -149.624 1.00 87.89  ? 128 VAL B CA    1 
ATOM   2257  C C     . VAL B 1 131 ? 10.718 -29.955  -150.770 1.00 86.55  ? 128 VAL B C     1 
ATOM   2258  O O     . VAL B 1 131 ? 11.334 -28.940  -151.114 1.00 95.35  ? 128 VAL B O     1 
ATOM   2259  C CB    . VAL B 1 131 ? 11.035 -30.084  -148.280 1.00 96.87  ? 128 VAL B CB    1 
ATOM   2260  C CG1   . VAL B 1 131 ? 9.562  -29.833  -148.025 1.00 106.28 ? 128 VAL B CG1   1 
ATOM   2261  C CG2   . VAL B 1 131 ? 11.639 -30.877  -147.127 1.00 86.93  ? 128 VAL B CG2   1 
ATOM   2262  N N     . SER B 1 132 ? 9.600  -30.365  -151.369 1.00 77.42  ? 129 SER B N     1 
ATOM   2263  C CA    . SER B 1 132 ? 8.916  -29.582  -152.400 1.00 93.46  ? 129 SER B CA    1 
ATOM   2264  C C     . SER B 1 132 ? 7.419  -29.674  -152.123 1.00 87.63  ? 129 SER B C     1 
ATOM   2265  O O     . SER B 1 132 ? 6.791  -30.695  -152.418 1.00 98.52  ? 129 SER B O     1 
ATOM   2266  C CB    . SER B 1 132 ? 9.258  -30.084  -153.797 1.00 94.22  ? 129 SER B CB    1 
ATOM   2267  O OG    . SER B 1 132 ? 8.596  -29.314  -154.786 1.00 106.11 ? 129 SER B OG    1 
ATOM   2268  N N     . GLU B 1 133 ? 6.851  -28.607  -151.562 1.00 106.39 ? 130 GLU B N     1 
ATOM   2269  C CA    . GLU B 1 133 ? 5.448  -28.585  -151.169 1.00 125.50 ? 130 GLU B CA    1 
ATOM   2270  C C     . GLU B 1 133 ? 4.556  -27.768  -152.090 1.00 120.83 ? 130 GLU B C     1 
ATOM   2271  O O     . GLU B 1 133 ? 3.381  -28.105  -152.247 1.00 119.15 ? 130 GLU B O     1 
ATOM   2272  C CB    . GLU B 1 133 ? 5.306  -28.037  -149.742 1.00 116.70 ? 130 GLU B CB    1 
ATOM   2273  C CG    . GLU B 1 133 ? 6.267  -28.656  -148.739 1.00 118.53 ? 130 GLU B CG    1 
ATOM   2274  C CD    . GLU B 1 133 ? 5.814  -28.479  -147.301 1.00 134.28 ? 130 GLU B CD    1 
ATOM   2275  O OE1   . GLU B 1 133 ? 4.795  -29.091  -146.916 1.00 138.02 ? 130 GLU B OE1   1 
ATOM   2276  O OE2   . GLU B 1 133 ? 6.480  -27.729  -146.556 1.00 130.32 ? 130 GLU B OE2   1 
ATOM   2277  N N     . GLY B 1 134 ? 5.078  -26.710  -152.702 1.00 113.41 ? 131 GLY B N     1 
ATOM   2278  C CA    . GLY B 1 134 ? 4.249  -25.768  -153.430 1.00 125.24 ? 131 GLY B CA    1 
ATOM   2279  C C     . GLY B 1 134 ? 3.887  -26.157  -154.849 1.00 129.57 ? 131 GLY B C     1 
ATOM   2280  O O     . GLY B 1 134 ? 2.739  -25.976  -155.268 1.00 131.61 ? 131 GLY B O     1 
ATOM   2281  N N     . LEU B 1 135 ? 4.854  -26.685  -155.597 1.00 119.74 ? 132 LEU B N     1 
ATOM   2282  C CA    . LEU B 1 135 ? 4.691  -26.869  -157.032 1.00 109.60 ? 132 LEU B CA    1 
ATOM   2283  C C     . LEU B 1 135 ? 3.542  -27.827  -157.347 1.00 94.83  ? 132 LEU B C     1 
ATOM   2284  O O     . LEU B 1 135 ? 3.120  -28.638  -156.519 1.00 106.49 ? 132 LEU B O     1 
ATOM   2285  C CB    . LEU B 1 135 ? 5.987  -27.390  -157.653 1.00 115.54 ? 132 LEU B CB    1 
ATOM   2286  C CG    . LEU B 1 135 ? 7.119  -26.372  -157.817 1.00 125.46 ? 132 LEU B CG    1 
ATOM   2287  C CD1   . LEU B 1 135 ? 8.476  -27.057  -157.759 1.00 123.67 ? 132 LEU B CD1   1 
ATOM   2288  C CD2   . LEU B 1 135 ? 6.959  -25.599  -159.117 1.00 131.33 ? 132 LEU B CD2   1 
ATOM   2289  N N     . ALA B 1 136 ? 3.036  -27.713  -158.575 1.00 103.43 ? 133 ALA B N     1 
ATOM   2290  C CA    . ALA B 1 136 ? 1.952  -28.550  -159.069 1.00 107.56 ? 133 ALA B CA    1 
ATOM   2291  C C     . ALA B 1 136 ? 2.418  -29.574  -160.093 1.00 113.78 ? 133 ALA B C     1 
ATOM   2292  O O     . ALA B 1 136 ? 1.603  -30.374  -160.564 1.00 99.79  ? 133 ALA B O     1 
ATOM   2293  C CB    . ALA B 1 136 ? 0.844  -27.680  -159.675 1.00 105.57 ? 133 ALA B CB    1 
ATOM   2294  N N     . SER B 1 137 ? 3.697  -29.568  -160.455 1.00 121.66 ? 134 SER B N     1 
ATOM   2295  C CA    . SER B 1 137 ? 4.258  -30.535  -161.388 1.00 127.26 ? 134 SER B CA    1 
ATOM   2296  C C     . SER B 1 137 ? 5.027  -31.586  -160.598 1.00 129.93 ? 134 SER B C     1 
ATOM   2297  O O     . SER B 1 137 ? 5.936  -31.250  -159.831 1.00 125.89 ? 134 SER B O     1 
ATOM   2298  C CB    . SER B 1 137 ? 5.168  -29.851  -162.408 1.00 131.50 ? 134 SER B CB    1 
ATOM   2299  O OG    . SER B 1 137 ? 5.799  -30.803  -163.247 1.00 129.37 ? 134 SER B OG    1 
ATOM   2300  N N     . LYS B 1 138 ? 4.650  -32.853  -160.781 1.00 130.81 ? 135 LYS B N     1 
ATOM   2301  C CA    . LYS B 1 138 ? 5.300  -33.943  -160.059 1.00 122.81 ? 135 LYS B CA    1 
ATOM   2302  C C     . LYS B 1 138 ? 6.785  -34.024  -160.389 1.00 113.88 ? 135 LYS B C     1 
ATOM   2303  O O     . LYS B 1 138 ? 7.624  -34.183  -159.495 1.00 96.78  ? 135 LYS B O     1 
ATOM   2304  C CB    . LYS B 1 138 ? 4.601  -35.266  -160.376 1.00 111.99 ? 135 LYS B CB    1 
ATOM   2305  C CG    . LYS B 1 138 ? 4.923  -36.387  -159.404 1.00 95.76  ? 135 LYS B CG    1 
ATOM   2306  C CD    . LYS B 1 138 ? 3.705  -37.258  -159.150 1.00 110.26 ? 135 LYS B CD    1 
ATOM   2307  C CE    . LYS B 1 138 ? 3.455  -38.212  -160.304 1.00 99.95  ? 135 LYS B CE    1 
ATOM   2308  N NZ    . LYS B 1 138 ? 2.369  -39.186  -160.002 1.00 93.81  ? 135 LYS B NZ    1 
ATOM   2309  N N     . ALA B 1 139 ? 7.127  -33.940  -161.678 1.00 109.84 ? 136 ALA B N     1 
ATOM   2310  C CA    . ALA B 1 139 ? 8.525  -34.048  -162.087 1.00 109.88 ? 136 ALA B CA    1 
ATOM   2311  C C     . ALA B 1 139 ? 9.383  -32.956  -161.459 1.00 112.85 ? 136 ALA B C     1 
ATOM   2312  O O     . ALA B 1 139 ? 10.489 -33.228  -160.976 1.00 113.80 ? 136 ALA B O     1 
ATOM   2313  C CB    . ALA B 1 139 ? 8.628  -34.001  -163.610 1.00 98.50  ? 136 ALA B CB    1 
ATOM   2314  N N     . LEU B 1 140 ? 8.892  -31.714  -161.456 1.00 119.21 ? 137 LEU B N     1 
ATOM   2315  C CA    . LEU B 1 140 ? 9.652  -30.618  -160.862 1.00 120.26 ? 137 LEU B CA    1 
ATOM   2316  C C     . LEU B 1 140 ? 9.843  -30.834  -159.367 1.00 104.65 ? 137 LEU B C     1 
ATOM   2317  O O     . LEU B 1 140 ? 10.947 -30.658  -158.833 1.00 100.04 ? 137 LEU B O     1 
ATOM   2318  C CB    . LEU B 1 140 ? 8.947  -29.285  -161.123 1.00 124.30 ? 137 LEU B CB    1 
ATOM   2319  C CG    . LEU B 1 140 ? 9.246  -28.507  -162.409 1.00 122.11 ? 137 LEU B CG    1 
ATOM   2320  C CD1   . LEU B 1 140 ? 9.142  -29.388  -163.647 1.00 116.63 ? 137 LEU B CD1   1 
ATOM   2321  C CD2   . LEU B 1 140 ? 8.315  -27.308  -162.521 1.00 126.38 ? 137 LEU B CD2   1 
ATOM   2322  N N     . SER B 1 141 ? 8.769  -31.223  -158.675 1.00 101.89 ? 138 SER B N     1 
ATOM   2323  C CA    . SER B 1 141 ? 8.852  -31.455  -157.238 1.00 110.97 ? 138 SER B CA    1 
ATOM   2324  C C     . SER B 1 141 ? 9.845  -32.562  -156.917 1.00 108.98 ? 138 SER B C     1 
ATOM   2325  O O     . SER B 1 141 ? 10.637 -32.440  -155.977 1.00 107.69 ? 138 SER B O     1 
ATOM   2326  C CB    . SER B 1 141 ? 7.470  -31.795  -156.680 1.00 109.06 ? 138 SER B CB    1 
ATOM   2327  O OG    . SER B 1 141 ? 6.627  -30.656  -156.660 1.00 111.25 ? 138 SER B OG    1 
ATOM   2328  N N     . LEU B 1 142 ? 9.827  -33.645  -157.695 1.00 100.05 ? 139 LEU B N     1 
ATOM   2329  C CA    . LEU B 1 142 ? 10.745 -34.749  -157.439 1.00 98.79  ? 139 LEU B CA    1 
ATOM   2330  C C     . LEU B 1 142 ? 12.187 -34.352  -157.731 1.00 95.77  ? 139 LEU B C     1 
ATOM   2331  O O     . LEU B 1 142 ? 13.089 -34.671  -156.949 1.00 82.57  ? 139 LEU B O     1 
ATOM   2332  C CB    . LEU B 1 142 ? 10.340 -35.969  -158.264 1.00 86.97  ? 139 LEU B CB    1 
ATOM   2333  C CG    . LEU B 1 142 ? 9.076  -36.683  -157.782 1.00 87.31  ? 139 LEU B CG    1 
ATOM   2334  C CD1   . LEU B 1 142 ? 8.587  -37.678  -158.818 1.00 99.02  ? 139 LEU B CD1   1 
ATOM   2335  C CD2   . LEU B 1 142 ? 9.337  -37.376  -156.457 1.00 80.47  ? 139 LEU B CD2   1 
ATOM   2336  N N     . GLU B 1 143 ? 12.428 -33.678  -158.859 1.00 102.91 ? 140 GLU B N     1 
ATOM   2337  C CA    . GLU B 1 143 ? 13.764 -33.172  -159.159 1.00 97.48  ? 140 GLU B CA    1 
ATOM   2338  C C     . GLU B 1 143 ? 14.303 -32.337  -158.003 1.00 99.94  ? 140 GLU B C     1 
ATOM   2339  O O     . GLU B 1 143 ? 15.411 -32.582  -157.495 1.00 92.16  ? 140 GLU B O     1 
ATOM   2340  C CB    . GLU B 1 143 ? 13.716 -32.347  -160.448 1.00 89.18  ? 140 GLU B CB    1 
ATOM   2341  C CG    . GLU B 1 143 ? 15.043 -31.746  -160.880 1.00 107.14 ? 140 GLU B CG    1 
ATOM   2342  C CD    . GLU B 1 143 ? 14.955 -31.056  -162.230 1.00 125.30 ? 140 GLU B CD    1 
ATOM   2343  O OE1   . GLU B 1 143 ? 13.825 -30.767  -162.678 1.00 108.59 ? 140 GLU B OE1   1 
ATOM   2344  O OE2   . GLU B 1 143 ? 16.013 -30.799  -162.844 1.00 110.71 ? 140 GLU B OE2   1 
ATOM   2345  N N     . LYS B 1 144 ? 13.494 -31.380  -157.536 1.00 102.06 ? 141 LYS B N     1 
ATOM   2346  C CA    . LYS B 1 144 ? 13.909 -30.522  -156.433 1.00 94.96  ? 141 LYS B CA    1 
ATOM   2347  C C     . LYS B 1 144 ? 14.193 -31.342  -155.184 1.00 98.46  ? 141 LYS B C     1 
ATOM   2348  O O     . LYS B 1 144 ? 15.251 -31.196  -154.563 1.00 99.73  ? 141 LYS B O     1 
ATOM   2349  C CB    . LYS B 1 144 ? 12.835 -29.471  -156.149 1.00 88.42  ? 141 LYS B CB    1 
ATOM   2350  C CG    . LYS B 1 144 ? 13.174 -28.532  -155.001 1.00 100.04 ? 141 LYS B CG    1 
ATOM   2351  C CD    . LYS B 1 144 ? 11.997 -27.633  -154.654 1.00 113.33 ? 141 LYS B CD    1 
ATOM   2352  C CE    . LYS B 1 144 ? 12.296 -26.775  -153.434 1.00 123.56 ? 141 LYS B CE    1 
ATOM   2353  N NZ    . LYS B 1 144 ? 11.112 -25.975  -153.013 1.00 124.53 ? 141 LYS B NZ    1 
ATOM   2354  N N     . ALA B 1 145 ? 13.260 -32.218  -154.806 1.00 88.00  ? 142 ALA B N     1 
ATOM   2355  C CA    . ALA B 1 145 ? 13.397 -32.947  -153.552 1.00 85.06  ? 142 ALA B CA    1 
ATOM   2356  C C     . ALA B 1 145 ? 14.642 -33.823  -153.561 1.00 89.37  ? 142 ALA B C     1 
ATOM   2357  O O     . ALA B 1 145 ? 15.426 -33.810  -152.608 1.00 89.03  ? 142 ALA B O     1 
ATOM   2358  C CB    . ALA B 1 145 ? 12.145 -33.785  -153.294 1.00 88.87  ? 142 ALA B CB    1 
ATOM   2359  N N     . ARG B 1 146 ? 14.864 -34.562  -154.652 1.00 89.35  ? 143 ARG B N     1 
ATOM   2360  C CA    . ARG B 1 146 ? 15.982 -35.501  -154.693 1.00 91.82  ? 143 ARG B CA    1 
ATOM   2361  C C     . ARG B 1 146 ? 17.323 -34.774  -154.721 1.00 88.38  ? 143 ARG B C     1 
ATOM   2362  O O     . ARG B 1 146 ? 18.244 -35.117  -153.962 1.00 83.06  ? 143 ARG B O     1 
ATOM   2363  C CB    . ARG B 1 146 ? 15.843 -36.434  -155.898 1.00 73.65  ? 143 ARG B CB    1 
ATOM   2364  C CG    . ARG B 1 146 ? 14.497 -37.140  -155.975 1.00 88.84  ? 143 ARG B CG    1 
ATOM   2365  C CD    . ARG B 1 146 ? 14.516 -38.327  -156.924 1.00 84.72  ? 143 ARG B CD    1 
ATOM   2366  N NE    . ARG B 1 146 ? 14.770 -39.582  -156.225 1.00 85.99  ? 143 ARG B NE    1 
ATOM   2367  C CZ    . ARG B 1 146 ? 14.410 -40.776  -156.683 1.00 84.08  ? 143 ARG B CZ    1 
ATOM   2368  N NH1   . ARG B 1 146 ? 13.772 -40.879  -157.840 1.00 70.18  ? 143 ARG B NH1   1 
ATOM   2369  N NH2   . ARG B 1 146 ? 14.681 -41.868  -155.980 1.00 115.18 ? 143 ARG B NH2   1 
ATOM   2370  N N     . LYS B 1 147 ? 17.464 -33.770  -155.596 1.00 84.79  ? 144 LYS B N     1 
ATOM   2371  C CA    . LYS B 1 147 ? 18.733 -33.049  -155.647 1.00 85.33  ? 144 LYS B CA    1 
ATOM   2372  C C     . LYS B 1 147 ? 19.008 -32.308  -154.342 1.00 83.01  ? 144 LYS B C     1 
ATOM   2373  O O     . LYS B 1 147 ? 20.142 -32.321  -153.840 1.00 81.47  ? 144 LYS B O     1 
ATOM   2374  C CB    . LYS B 1 147 ? 18.751 -32.105  -156.848 1.00 84.60  ? 144 LYS B CB    1 
ATOM   2375  C CG    . LYS B 1 147 ? 18.641 -32.851  -158.171 1.00 72.01  ? 144 LYS B CG    1 
ATOM   2376  C CD    . LYS B 1 147 ? 18.541 -31.918  -159.355 1.00 69.80  ? 144 LYS B CD    1 
ATOM   2377  C CE    . LYS B 1 147 ? 18.461 -32.703  -160.654 1.00 78.13  ? 144 LYS B CE    1 
ATOM   2378  N NZ    . LYS B 1 147 ? 18.310 -31.820  -161.843 1.00 81.10  ? 144 LYS B NZ    1 
ATOM   2379  N N     . GLU B 1 148 ? 17.985 -31.664  -153.771 1.00 73.00  ? 145 GLU B N     1 
ATOM   2380  C CA    . GLU B 1 148 ? 18.145 -30.997  -152.484 1.00 77.81  ? 145 GLU B CA    1 
ATOM   2381  C C     . GLU B 1 148 ? 18.541 -31.984  -151.394 1.00 92.72  ? 145 GLU B C     1 
ATOM   2382  O O     . GLU B 1 148 ? 19.390 -31.676  -150.551 1.00 87.34  ? 145 GLU B O     1 
ATOM   2383  C CB    . GLU B 1 148 ? 16.848 -30.279  -152.110 1.00 91.99  ? 145 GLU B CB    1 
ATOM   2384  C CG    . GLU B 1 148 ? 16.901 -29.516  -150.796 1.00 122.59 ? 145 GLU B CG    1 
ATOM   2385  C CD    . GLU B 1 148 ? 15.601 -28.794  -150.490 1.00 132.30 ? 145 GLU B CD    1 
ATOM   2386  O OE1   . GLU B 1 148 ? 14.824 -28.535  -151.434 1.00 123.65 ? 145 GLU B OE1   1 
ATOM   2387  O OE2   . GLU B 1 148 ? 15.354 -28.492  -149.303 1.00 125.58 ? 145 GLU B OE2   1 
ATOM   2388  N N     . ALA B 1 149 ? 17.944 -33.179  -151.398 1.00 97.76  ? 146 ALA B N     1 
ATOM   2389  C CA    . ALA B 1 149 ? 18.272 -34.179  -150.389 1.00 87.39  ? 146 ALA B CA    1 
ATOM   2390  C C     . ALA B 1 149 ? 19.729 -34.600  -150.491 1.00 84.03  ? 146 ALA B C     1 
ATOM   2391  O O     . ALA B 1 149 ? 20.438 -34.674  -149.480 1.00 85.36  ? 146 ALA B O     1 
ATOM   2392  C CB    . ALA B 1 149 ? 17.348 -35.389  -150.531 1.00 83.49  ? 146 ALA B CB    1 
ATOM   2393  N N     . VAL B 1 150 ? 20.199 -34.876  -151.709 1.00 86.13  ? 147 VAL B N     1 
ATOM   2394  C CA    . VAL B 1 150 ? 21.586 -35.311  -151.870 1.00 90.71  ? 147 VAL B CA    1 
ATOM   2395  C C     . VAL B 1 150 ? 22.553 -34.202  -151.469 1.00 92.32  ? 147 VAL B C     1 
ATOM   2396  O O     . VAL B 1 150 ? 23.549 -34.449  -150.776 1.00 79.00  ? 147 VAL B O     1 
ATOM   2397  C CB    . VAL B 1 150 ? 21.834 -35.803  -153.306 1.00 79.81  ? 147 VAL B CB    1 
ATOM   2398  C CG1   . VAL B 1 150 ? 23.318 -35.785  -153.631 1.00 59.29  ? 147 VAL B CG1   1 
ATOM   2399  C CG2   . VAL B 1 150 ? 21.305 -37.208  -153.445 1.00 88.17  ? 147 VAL B CG2   1 
ATOM   2400  N N     . THR B 1 151 ? 22.278 -32.963  -151.889 1.00 100.22 ? 148 THR B N     1 
ATOM   2401  C CA    . THR B 1 151 ? 23.170 -31.861  -151.536 1.00 96.78  ? 148 THR B CA    1 
ATOM   2402  C C     . THR B 1 151 ? 23.191 -31.617  -150.028 1.00 91.02  ? 148 THR B C     1 
ATOM   2403  O O     . THR B 1 151 ? 24.261 -31.415  -149.436 1.00 94.73  ? 148 THR B O     1 
ATOM   2404  C CB    . THR B 1 151 ? 22.758 -30.595  -152.286 1.00 107.79 ? 148 THR B CB    1 
ATOM   2405  O OG1   . THR B 1 151 ? 22.831 -30.837  -153.696 1.00 101.00 ? 148 THR B OG1   1 
ATOM   2406  C CG2   . THR B 1 151 ? 23.681 -29.438  -151.934 1.00 102.41 ? 148 THR B CG2   1 
ATOM   2407  N N     . ASP B 1 152 ? 22.016 -31.622  -149.392 1.00 84.42  ? 149 ASP B N     1 
ATOM   2408  C CA    . ASP B 1 152 ? 21.944 -31.444  -147.946 1.00 83.81  ? 149 ASP B CA    1 
ATOM   2409  C C     . ASP B 1 152 ? 22.678 -32.562  -147.217 1.00 82.28  ? 149 ASP B C     1 
ATOM   2410  O O     . ASP B 1 152 ? 23.350 -32.316  -146.208 1.00 75.62  ? 149 ASP B O     1 
ATOM   2411  C CB    . ASP B 1 152 ? 20.481 -31.377  -147.507 1.00 83.74  ? 149 ASP B CB    1 
ATOM   2412  C CG    . ASP B 1 152 ? 20.308 -30.741  -146.143 1.00 98.23  ? 149 ASP B CG    1 
ATOM   2413  O OD1   . ASP B 1 152 ? 20.320 -29.494  -146.065 1.00 112.19 ? 149 ASP B OD1   1 
ATOM   2414  O OD2   . ASP B 1 152 ? 20.155 -31.484  -145.151 1.00 97.07  ? 149 ASP B OD2   1 
ATOM   2415  N N     . GLY B 1 153 ? 22.555 -33.798  -147.706 1.00 93.66  ? 150 GLY B N     1 
ATOM   2416  C CA    . GLY B 1 153 ? 23.295 -34.895  -147.105 1.00 86.29  ? 150 GLY B CA    1 
ATOM   2417  C C     . GLY B 1 153 ? 24.794 -34.735  -147.256 1.00 89.82  ? 150 GLY B C     1 
ATOM   2418  O O     . GLY B 1 153 ? 25.557 -35.054  -146.342 1.00 84.93  ? 150 GLY B O     1 
ATOM   2419  N N     . LEU B 1 154 ? 25.236 -34.230  -148.410 1.00 93.76  ? 151 LEU B N     1 
ATOM   2420  C CA    . LEU B 1 154 ? 26.659 -33.965  -148.597 1.00 91.53  ? 151 LEU B CA    1 
ATOM   2421  C C     . LEU B 1 154 ? 27.151 -32.919  -147.607 1.00 90.91  ? 151 LEU B C     1 
ATOM   2422  O O     . LEU B 1 154 ? 28.229 -33.067  -147.015 1.00 91.78  ? 151 LEU B O     1 
ATOM   2423  C CB    . LEU B 1 154 ? 26.923 -33.512  -150.032 1.00 72.51  ? 151 LEU B CB    1 
ATOM   2424  C CG    . LEU B 1 154 ? 28.378 -33.199  -150.383 1.00 64.50  ? 151 LEU B CG    1 
ATOM   2425  C CD1   . LEU B 1 154 ? 29.288 -34.360  -150.018 1.00 82.41  ? 151 LEU B CD1   1 
ATOM   2426  C CD2   . LEU B 1 154 ? 28.508 -32.861  -151.858 1.00 83.61  ? 151 LEU B CD2   1 
ATOM   2427  N N     . LYS B 1 155 ? 26.364 -31.861  -147.404 1.00 81.08  ? 152 LYS B N     1 
ATOM   2428  C CA    . LYS B 1 155 ? 26.725 -30.849  -146.413 1.00 83.41  ? 152 LYS B CA    1 
ATOM   2429  C C     . LYS B 1 155 ? 26.802 -31.452  -145.013 1.00 83.04  ? 152 LYS B C     1 
ATOM   2430  O O     . LYS B 1 155 ? 27.781 -31.242  -144.285 1.00 83.78  ? 152 LYS B O     1 
ATOM   2431  C CB    . LYS B 1 155 ? 25.728 -29.689  -146.447 1.00 103.64 ? 152 LYS B CB    1 
ATOM   2432  C CG    . LYS B 1 155 ? 25.753 -28.874  -147.732 1.00 90.27  ? 152 LYS B CG    1 
ATOM   2433  C CD    . LYS B 1 155 ? 24.943 -27.592  -147.585 1.00 79.52  ? 152 LYS B CD    1 
ATOM   2434  C CE    . LYS B 1 155 ? 23.501 -27.878  -147.188 1.00 91.86  ? 152 LYS B CE    1 
ATOM   2435  N NZ    . LYS B 1 155 ? 22.749 -26.626  -146.891 1.00 99.27  ? 152 LYS B NZ    1 
ATOM   2436  N N     . ARG B 1 156 ? 25.765 -32.194  -144.613 1.00 84.20  ? 153 ARG B N     1 
ATOM   2437  C CA    . ARG B 1 156 ? 25.731 -32.773  -143.273 1.00 88.40  ? 153 ARG B CA    1 
ATOM   2438  C C     . ARG B 1 156 ? 26.834 -33.802  -143.063 1.00 80.27  ? 153 ARG B C     1 
ATOM   2439  O O     . ARG B 1 156 ? 27.267 -34.022  -141.926 1.00 90.77  ? 153 ARG B O     1 
ATOM   2440  C CB    . ARG B 1 156 ? 24.364 -33.404  -143.007 1.00 80.55  ? 153 ARG B CB    1 
ATOM   2441  C CG    . ARG B 1 156 ? 23.322 -32.419  -142.514 1.00 89.30  ? 153 ARG B CG    1 
ATOM   2442  C CD    . ARG B 1 156 ? 22.043 -33.125  -142.100 1.00 77.24  ? 153 ARG B CD    1 
ATOM   2443  N NE    . ARG B 1 156 ? 22.287 -34.161  -141.102 1.00 94.12  ? 153 ARG B NE    1 
ATOM   2444  C CZ    . ARG B 1 156 ? 22.435 -33.926  -139.803 1.00 95.25  ? 153 ARG B CZ    1 
ATOM   2445  N NH1   . ARG B 1 156 ? 22.365 -32.686  -139.339 1.00 103.11 ? 153 ARG B NH1   1 
ATOM   2446  N NH2   . ARG B 1 156 ? 22.653 -34.931  -138.966 1.00 84.00  ? 153 ARG B NH2   1 
ATOM   2447  N N     . ALA B 1 157 ? 27.295 -34.448  -144.134 1.00 82.91  ? 154 ALA B N     1 
ATOM   2448  C CA    . ALA B 1 157 ? 28.363 -35.430  -143.999 1.00 79.05  ? 154 ALA B CA    1 
ATOM   2449  C C     . ALA B 1 157 ? 29.726 -34.755  -143.935 1.00 88.08  ? 154 ALA B C     1 
ATOM   2450  O O     . ALA B 1 157 ? 30.617 -35.216  -143.212 1.00 71.53  ? 154 ALA B O     1 
ATOM   2451  C CB    . ALA B 1 157 ? 28.307 -36.427  -145.156 1.00 103.96 ? 154 ALA B CB    1 
ATOM   2452  N N     . LEU B 1 158 ? 29.907 -33.664  -144.685 1.00 107.08 ? 155 LEU B N     1 
ATOM   2453  C CA    . LEU B 1 158 ? 31.145 -32.901  -144.591 1.00 98.36  ? 155 LEU B CA    1 
ATOM   2454  C C     . LEU B 1 158 ? 31.240 -32.120  -143.287 1.00 94.38  ? 155 LEU B C     1 
ATOM   2455  O O     . LEU B 1 158 ? 32.346 -31.743  -142.886 1.00 85.24  ? 155 LEU B O     1 
ATOM   2456  C CB    . LEU B 1 158 ? 31.264 -31.949  -145.783 1.00 88.39  ? 155 LEU B CB    1 
ATOM   2457  C CG    . LEU B 1 158 ? 31.643 -32.578  -147.125 1.00 79.23  ? 155 LEU B CG    1 
ATOM   2458  C CD1   . LEU B 1 158 ? 31.269 -31.658  -148.273 1.00 75.51  ? 155 LEU B CD1   1 
ATOM   2459  C CD2   . LEU B 1 158 ? 33.131 -32.893  -147.160 1.00 93.29  ? 155 LEU B CD2   1 
ATOM   2460  N N     . ARG B 1 159 ? 30.107 -31.861  -142.627 1.00 94.66  ? 156 ARG B N     1 
ATOM   2461  C CA    . ARG B 1 159 ? 30.133 -31.169  -141.341 1.00 91.94  ? 156 ARG B CA    1 
ATOM   2462  C C     . ARG B 1 159 ? 31.055 -31.853  -140.339 1.00 102.01 ? 156 ARG B C     1 
ATOM   2463  O O     . ARG B 1 159 ? 31.835 -31.188  -139.648 1.00 109.63 ? 156 ARG B O     1 
ATOM   2464  C CB    . ARG B 1 159 ? 28.723 -31.083  -140.763 1.00 108.09 ? 156 ARG B CB    1 
ATOM   2465  C CG    . ARG B 1 159 ? 27.894 -29.945  -141.302 1.00 123.72 ? 156 ARG B CG    1 
ATOM   2466  C CD    . ARG B 1 159 ? 26.638 -29.791  -140.479 1.00 127.56 ? 156 ARG B CD    1 
ATOM   2467  N NE    . ARG B 1 159 ? 25.821 -28.676  -140.936 1.00 125.70 ? 156 ARG B NE    1 
ATOM   2468  C CZ    . ARG B 1 159 ? 24.580 -28.456  -140.523 1.00 129.84 ? 156 ARG B CZ    1 
ATOM   2469  N NH1   . ARG B 1 159 ? 24.017 -29.277  -139.647 1.00 125.40 ? 156 ARG B NH1   1 
ATOM   2470  N NH2   . ARG B 1 159 ? 23.902 -27.417  -140.987 1.00 131.43 ? 156 ARG B NH2   1 
ATOM   2471  N N     . SER B 1 160 ? 30.981 -33.180  -140.244 1.00 108.86 ? 157 SER B N     1 
ATOM   2472  C CA    . SER B 1 160 ? 31.690 -33.955  -139.225 1.00 103.76 ? 157 SER B CA    1 
ATOM   2473  C C     . SER B 1 160 ? 33.222 -33.897  -139.359 1.00 109.37 ? 157 SER B C     1 
ATOM   2474  O O     . SER B 1 160 ? 33.892 -34.651  -138.638 1.00 112.73 ? 157 SER B O     1 
ATOM   2475  C CB    . SER B 1 160 ? 31.229 -35.412  -139.267 1.00 104.44 ? 157 SER B CB    1 
ATOM   2476  O OG    . SER B 1 160 ? 29.817 -35.509  -139.334 1.00 96.11  ? 157 SER B OG    1 
ATOM   2477  N N     . PHE B 1 161 ? 33.793 -33.061  -140.228 1.00 112.94 ? 158 PHE B N     1 
ATOM   2478  C CA    . PHE B 1 161 ? 35.238 -32.955  -140.373 1.00 115.43 ? 158 PHE B CA    1 
ATOM   2479  C C     . PHE B 1 161 ? 35.852 -31.825  -139.559 1.00 123.25 ? 158 PHE B C     1 
ATOM   2480  O O     . PHE B 1 161 ? 37.039 -31.904  -139.228 1.00 118.72 ? 158 PHE B O     1 
ATOM   2481  C CB    . PHE B 1 161 ? 35.604 -32.760  -141.850 1.00 120.09 ? 158 PHE B CB    1 
ATOM   2482  C CG    . PHE B 1 161 ? 35.662 -34.038  -142.636 1.00 121.79 ? 158 PHE B CG    1 
ATOM   2483  C CD1   . PHE B 1 161 ? 36.372 -35.132  -142.164 1.00 121.69 ? 158 PHE B CD1   1 
ATOM   2484  C CD2   . PHE B 1 161 ? 34.990 -34.152  -143.841 1.00 110.12 ? 158 PHE B CD2   1 
ATOM   2485  C CE1   . PHE B 1 161 ? 36.425 -36.309  -142.892 1.00 116.48 ? 158 PHE B CE1   1 
ATOM   2486  C CE2   . PHE B 1 161 ? 35.034 -35.326  -144.569 1.00 113.91 ? 158 PHE B CE2   1 
ATOM   2487  C CZ    . PHE B 1 161 ? 35.751 -36.406  -144.095 1.00 112.92 ? 158 PHE B CZ    1 
ATOM   2488  N N     . GLY B 1 162 ? 35.090 -30.792  -139.231 1.00 131.81 ? 159 GLY B N     1 
ATOM   2489  C CA    . GLY B 1 162 ? 35.627 -29.675  -138.480 1.00 137.29 ? 159 GLY B CA    1 
ATOM   2490  C C     . GLY B 1 162 ? 34.777 -28.438  -138.644 1.00 145.98 ? 159 GLY B C     1 
ATOM   2491  O O     . GLY B 1 162 ? 33.886 -28.367  -139.492 1.00 145.37 ? 159 GLY B O     1 
ATOM   2492  N N     . ASN B 1 163 ? 35.069 -27.449  -137.791 1.00 149.47 ? 160 ASN B N     1 
ATOM   2493  C CA    . ASN B 1 163 ? 34.341 -26.183  -137.829 1.00 139.28 ? 160 ASN B CA    1 
ATOM   2494  C C     . ASN B 1 163 ? 34.458 -25.510  -139.190 1.00 134.97 ? 160 ASN B C     1 
ATOM   2495  O O     . ASN B 1 163 ? 33.502 -24.887  -139.665 1.00 136.87 ? 160 ASN B O     1 
ATOM   2496  C CB    . ASN B 1 163 ? 34.853 -25.246  -136.733 1.00 138.00 ? 160 ASN B CB    1 
ATOM   2497  C CG    . ASN B 1 163 ? 34.764 -25.858  -135.350 1.00 143.83 ? 160 ASN B CG    1 
ATOM   2498  O OD1   . ASN B 1 163 ? 33.715 -26.361  -134.948 1.00 137.90 ? 160 ASN B OD1   1 
ATOM   2499  N ND2   . ASN B 1 163 ? 35.868 -25.820  -134.613 1.00 154.72 ? 160 ASN B ND2   1 
ATOM   2500  N N     . ALA B 1 164 ? 35.629 -25.616  -139.825 1.00 129.31 ? 161 ALA B N     1 
ATOM   2501  C CA    . ALA B 1 164 ? 35.853 -24.937  -141.098 1.00 132.48 ? 161 ALA B CA    1 
ATOM   2502  C C     . ALA B 1 164 ? 34.906 -25.430  -142.185 1.00 140.26 ? 161 ALA B C     1 
ATOM   2503  O O     . ALA B 1 164 ? 34.617 -24.691  -143.133 1.00 148.14 ? 161 ALA B O     1 
ATOM   2504  C CB    . ALA B 1 164 ? 37.305 -25.116  -141.540 1.00 124.40 ? 161 ALA B CB    1 
ATOM   2505  N N     . LEU B 1 165 ? 34.419 -26.666  -142.074 1.00 129.57 ? 162 LEU B N     1 
ATOM   2506  C CA    . LEU B 1 165 ? 33.551 -27.254  -143.084 1.00 125.19 ? 162 LEU B CA    1 
ATOM   2507  C C     . LEU B 1 165 ? 32.078 -27.226  -142.687 1.00 117.47 ? 162 LEU B C     1 
ATOM   2508  O O     . LEU B 1 165 ? 31.274 -27.964  -143.266 1.00 116.63 ? 162 LEU B O     1 
ATOM   2509  C CB    . LEU B 1 165 ? 33.994 -28.685  -143.394 1.00 128.59 ? 162 LEU B CB    1 
ATOM   2510  C CG    . LEU B 1 165 ? 35.218 -28.799  -144.306 1.00 116.18 ? 162 LEU B CG    1 
ATOM   2511  C CD1   . LEU B 1 165 ? 35.650 -30.248  -144.463 1.00 114.06 ? 162 LEU B CD1   1 
ATOM   2512  C CD2   . LEU B 1 165 ? 34.936 -28.172  -145.663 1.00 99.99  ? 162 LEU B CD2   1 
ATOM   2513  N N     . GLY B 1 166 ? 31.708 -26.396  -141.715 1.00 112.07 ? 163 GLY B N     1 
ATOM   2514  C CA    . GLY B 1 166 ? 30.318 -26.201  -141.363 1.00 123.68 ? 163 GLY B CA    1 
ATOM   2515  C C     . GLY B 1 166 ? 29.892 -26.700  -139.998 1.00 129.90 ? 163 GLY B C     1 
ATOM   2516  O O     . GLY B 1 166 ? 28.696 -26.653  -139.692 1.00 139.10 ? 163 GLY B O     1 
ATOM   2517  N N     . ASN B 1 167 ? 30.820 -27.179  -139.167 1.00 123.30 ? 164 ASN B N     1 
ATOM   2518  C CA    . ASN B 1 167 ? 30.438 -27.656  -137.843 1.00 119.97 ? 164 ASN B CA    1 
ATOM   2519  C C     . ASN B 1 167 ? 30.102 -26.514  -136.892 1.00 134.56 ? 164 ASN B C     1 
ATOM   2520  O O     . ASN B 1 167 ? 29.425 -26.741  -135.884 1.00 138.25 ? 164 ASN B O     1 
ATOM   2521  C CB    . ASN B 1 167 ? 31.554 -28.518  -137.251 1.00 129.71 ? 164 ASN B CB    1 
ATOM   2522  C CG    . ASN B 1 167 ? 31.138 -29.215  -135.970 1.00 131.81 ? 164 ASN B CG    1 
ATOM   2523  O OD1   . ASN B 1 167 ? 29.976 -29.586  -135.800 1.00 130.38 ? 164 ASN B OD1   1 
ATOM   2524  N ND2   . ASN B 1 167 ? 32.088 -29.397  -135.061 1.00 128.18 ? 164 ASN B ND2   1 
ATOM   2525  N N     . CYS B 1 168 ? 30.549 -25.295  -137.193 1.00 143.38 ? 165 CYS B N     1 
ATOM   2526  C CA    . CYS B 1 168 ? 30.313 -24.156  -136.315 1.00 132.08 ? 165 CYS B CA    1 
ATOM   2527  C C     . CYS B 1 168 ? 28.960 -23.497  -136.540 1.00 122.66 ? 165 CYS B C     1 
ATOM   2528  O O     . CYS B 1 168 ? 28.529 -22.709  -135.692 1.00 130.53 ? 165 CYS B O     1 
ATOM   2529  C CB    . CYS B 1 168 ? 31.423 -23.118  -136.497 1.00 137.76 ? 165 CYS B CB    1 
ATOM   2530  S SG    . CYS B 1 168 ? 31.638 -22.551  -138.198 1.00 128.83 ? 165 CYS B SG    1 
ATOM   2531  N N     . ILE B 1 169 ? 28.282 -23.797  -137.652 1.00 128.68 ? 166 ILE B N     1 
ATOM   2532  C CA    . ILE B 1 169 ? 26.992 -23.182  -137.944 1.00 127.52 ? 166 ILE B CA    1 
ATOM   2533  C C     . ILE B 1 169 ? 25.945 -23.538  -136.896 1.00 126.38 ? 166 ILE B C     1 
ATOM   2534  O O     . ILE B 1 169 ? 24.906 -22.876  -136.810 1.00 112.47 ? 166 ILE B O     1 
ATOM   2535  C CB    . ILE B 1 169 ? 26.519 -23.587  -139.358 1.00 125.41 ? 166 ILE B CB    1 
ATOM   2536  C CG1   . ILE B 1 169 ? 25.465 -22.606  -139.877 1.00 122.46 ? 166 ILE B CG1   1 
ATOM   2537  C CG2   . ILE B 1 169 ? 25.958 -25.001  -139.352 1.00 123.10 ? 166 ILE B CG2   1 
ATOM   2538  C CD1   . ILE B 1 169 ? 26.042 -21.313  -140.405 1.00 123.72 ? 166 ILE B CD1   1 
ATOM   2539  N N     . LEU B 1 170 ? 26.196 -24.565  -136.085 1.00 132.64 ? 167 LEU B N     1 
ATOM   2540  C CA    . LEU B 1 170 ? 25.277 -24.970  -135.033 1.00 137.23 ? 167 LEU B CA    1 
ATOM   2541  C C     . LEU B 1 170 ? 25.685 -24.447  -133.663 1.00 142.03 ? 167 LEU B C     1 
ATOM   2542  O O     . LEU B 1 170 ? 24.988 -24.713  -132.679 1.00 151.56 ? 167 LEU B O     1 
ATOM   2543  C CB    . LEU B 1 170 ? 25.163 -26.497  -134.993 1.00 138.08 ? 167 LEU B CB    1 
ATOM   2544  C CG    . LEU B 1 170 ? 24.490 -27.134  -136.211 1.00 139.69 ? 167 LEU B CG    1 
ATOM   2545  C CD1   . LEU B 1 170 ? 24.852 -28.608  -136.322 1.00 148.37 ? 167 LEU B CD1   1 
ATOM   2546  C CD2   . LEU B 1 170 ? 22.982 -26.949  -136.146 1.00 128.96 ? 167 LEU B CD2   1 
ATOM   2547  N N     . ASP B 1 171 ? 26.796 -23.719  -133.575 1.00 136.06 ? 168 ASP B N     1 
ATOM   2548  C CA    . ASP B 1 171 ? 27.227 -23.109  -132.322 1.00 128.97 ? 168 ASP B CA    1 
ATOM   2549  C C     . ASP B 1 171 ? 26.512 -21.771  -132.176 1.00 144.53 ? 168 ASP B C     1 
ATOM   2550  O O     . ASP B 1 171 ? 26.773 -20.833  -132.937 1.00 152.16 ? 168 ASP B O     1 
ATOM   2551  C CB    . ASP B 1 171 ? 28.743 -22.940  -132.300 1.00 131.06 ? 168 ASP B CB    1 
ATOM   2552  C CG    . ASP B 1 171 ? 29.272 -22.609  -130.918 1.00 141.24 ? 168 ASP B CG    1 
ATOM   2553  O OD1   . ASP B 1 171 ? 28.512 -22.756  -129.937 1.00 146.43 ? 168 ASP B OD1   1 
ATOM   2554  O OD2   . ASP B 1 171 ? 30.449 -22.203  -130.811 1.00 143.58 ? 168 ASP B OD2   1 
ATOM   2555  N N     . LYS B 1 172 ? 25.600 -21.686  -131.204 1.00 149.98 ? 169 LYS B N     1 
ATOM   2556  C CA    . LYS B 1 172 ? 24.782 -20.486  -131.045 1.00 150.43 ? 169 LYS B CA    1 
ATOM   2557  C C     . LYS B 1 172 ? 25.636 -19.259  -130.748 1.00 146.09 ? 169 LYS B C     1 
ATOM   2558  O O     . LYS B 1 172 ? 25.342 -18.158  -131.230 1.00 135.83 ? 169 LYS B O     1 
ATOM   2559  C CB    . LYS B 1 172 ? 23.751 -20.710  -129.940 1.00 141.85 ? 169 LYS B CB    1 
ATOM   2560  C CG    . LYS B 1 172 ? 22.856 -21.915  -130.182 1.00 135.97 ? 169 LYS B CG    1 
ATOM   2561  C CD    . LYS B 1 172 ? 22.268 -22.447  -128.887 1.00 155.48 ? 169 LYS B CD    1 
ATOM   2562  C CE    . LYS B 1 172 ? 21.549 -23.768  -129.113 1.00 155.70 ? 169 LYS B CE    1 
ATOM   2563  N NZ    . LYS B 1 172 ? 21.105 -24.387  -127.833 1.00 165.25 ? 169 LYS B NZ    1 
ATOM   2564  N N     . ASP B 1 173 ? 26.692 -19.427  -129.949 1.00 146.21 ? 170 ASP B N     1 
ATOM   2565  C CA    . ASP B 1 173 ? 27.596 -18.317  -129.663 1.00 148.78 ? 170 ASP B CA    1 
ATOM   2566  C C     . ASP B 1 173 ? 28.270 -17.809  -130.933 1.00 153.12 ? 170 ASP B C     1 
ATOM   2567  O O     . ASP B 1 173 ? 28.459 -16.597  -131.104 1.00 168.97 ? 170 ASP B O     1 
ATOM   2568  C CB    . ASP B 1 173 ? 28.640 -18.746  -128.633 1.00 156.22 ? 170 ASP B CB    1 
ATOM   2569  C CG    . ASP B 1 173 ? 28.017 -19.233  -127.341 1.00 171.75 ? 170 ASP B CG    1 
ATOM   2570  O OD1   . ASP B 1 173 ? 26.974 -18.679  -126.935 1.00 172.75 ? 170 ASP B OD1   1 
ATOM   2571  O OD2   . ASP B 1 173 ? 28.571 -20.173  -126.730 1.00 169.35 ? 170 ASP B OD2   1 
ATOM   2572  N N     . TYR B 1 174 ? 28.664 -18.724  -131.822 1.00 145.25 ? 171 TYR B N     1 
ATOM   2573  C CA    . TYR B 1 174 ? 29.239 -18.321  -133.102 1.00 147.58 ? 171 TYR B CA    1 
ATOM   2574  C C     . TYR B 1 174 ? 28.262 -17.470  -133.908 1.00 150.22 ? 171 TYR B C     1 
ATOM   2575  O O     . TYR B 1 174 ? 28.653 -16.462  -134.505 1.00 150.45 ? 171 TYR B O     1 
ATOM   2576  C CB    . TYR B 1 174 ? 29.664 -19.562  -133.887 1.00 142.55 ? 171 TYR B CB    1 
ATOM   2577  C CG    . TYR B 1 174 ? 30.061 -19.296  -135.320 1.00 127.63 ? 171 TYR B CG    1 
ATOM   2578  C CD1   . TYR B 1 174 ? 31.236 -18.624  -135.623 1.00 131.29 ? 171 TYR B CD1   1 
ATOM   2579  C CD2   . TYR B 1 174 ? 29.268 -19.736  -136.370 1.00 137.59 ? 171 TYR B CD2   1 
ATOM   2580  C CE1   . TYR B 1 174 ? 31.604 -18.386  -136.933 1.00 136.30 ? 171 TYR B CE1   1 
ATOM   2581  C CE2   . TYR B 1 174 ? 29.628 -19.505  -137.682 1.00 149.74 ? 171 TYR B CE2   1 
ATOM   2582  C CZ    . TYR B 1 174 ? 30.796 -18.828  -137.959 1.00 143.32 ? 171 TYR B CZ    1 
ATOM   2583  O OH    . TYR B 1 174 ? 31.153 -18.597  -139.267 1.00 125.24 ? 171 TYR B OH    1 
ATOM   2584  N N     . LEU B 1 175 ? 26.981 -17.849  -133.921 1.00 151.39 ? 172 LEU B N     1 
ATOM   2585  C CA    . LEU B 1 175 ? 25.979 -17.050  -134.625 1.00 160.15 ? 172 LEU B CA    1 
ATOM   2586  C C     . LEU B 1 175 ? 25.805 -15.680  -133.977 1.00 160.44 ? 172 LEU B C     1 
ATOM   2587  O O     . LEU B 1 175 ? 25.698 -14.661  -134.677 1.00 159.66 ? 172 LEU B O     1 
ATOM   2588  C CB    . LEU B 1 175 ? 24.648 -17.799  -134.667 1.00 157.66 ? 172 LEU B CB    1 
ATOM   2589  C CG    . LEU B 1 175 ? 24.591 -19.016  -135.594 1.00 146.95 ? 172 LEU B CG    1 
ATOM   2590  C CD1   . LEU B 1 175 ? 23.168 -19.539  -135.707 1.00 143.33 ? 172 LEU B CD1   1 
ATOM   2591  C CD2   . LEU B 1 175 ? 25.151 -18.676  -136.969 1.00 142.96 ? 172 LEU B CD2   1 
ATOM   2592  N N     . ARG B 1 176 ? 25.747 -15.641  -132.643 1.00 159.02 ? 173 ARG B N     1 
ATOM   2593  C CA    . ARG B 1 176 ? 25.638 -14.367  -131.939 1.00 158.66 ? 173 ARG B CA    1 
ATOM   2594  C C     . ARG B 1 176 ? 26.801 -13.447  -132.285 1.00 161.38 ? 173 ARG B C     1 
ATOM   2595  O O     . ARG B 1 176 ? 26.609 -12.246  -132.508 1.00 166.79 ? 173 ARG B O     1 
ATOM   2596  C CB    . ARG B 1 176 ? 25.575 -14.605  -130.429 1.00 158.46 ? 173 ARG B CB    1 
ATOM   2597  C CG    . ARG B 1 176 ? 24.343 -15.365  -129.961 1.00 163.55 ? 173 ARG B CG    1 
ATOM   2598  C CD    . ARG B 1 176 ? 24.165 -15.291  -128.447 1.00 146.94 ? 173 ARG B CD    1 
ATOM   2599  N NE    . ARG B 1 176 ? 25.310 -15.836  -127.719 1.00 150.79 ? 173 ARG B NE    1 
ATOM   2600  C CZ    . ARG B 1 176 ? 26.278 -15.100  -127.181 1.00 153.29 ? 173 ARG B CZ    1 
ATOM   2601  N NH1   . ARG B 1 176 ? 26.244 -13.778  -127.282 1.00 155.87 ? 173 ARG B NH1   1 
ATOM   2602  N NH2   . ARG B 1 176 ? 27.280 -15.686  -126.538 1.00 156.35 ? 173 ARG B NH2   1 
ATOM   2603  N N     . SER B 1 177 ? 28.018 -13.993  -132.336 1.00 156.76 ? 174 SER B N     1 
ATOM   2604  C CA    . SER B 1 177 ? 29.172 -13.197  -132.736 1.00 163.28 ? 174 SER B CA    1 
ATOM   2605  C C     . SER B 1 177 ? 29.139 -12.840  -134.216 1.00 160.21 ? 174 SER B C     1 
ATOM   2606  O O     . SER B 1 177 ? 29.745 -11.839  -134.614 1.00 151.84 ? 174 SER B O     1 
ATOM   2607  C CB    . SER B 1 177 ? 30.466 -13.942  -132.407 1.00 157.30 ? 174 SER B CB    1 
ATOM   2608  O OG    . SER B 1 177 ? 30.636 -14.076  -131.007 1.00 160.37 ? 174 SER B OG    1 
ATOM   2609  N N     . LEU B 1 178 ? 28.450 -13.636  -135.036 1.00 158.74 ? 175 LEU B N     1 
ATOM   2610  C CA    . LEU B 1 178 ? 28.313 -13.300  -136.449 1.00 163.31 ? 175 LEU B CA    1 
ATOM   2611  C C     . LEU B 1 178 ? 27.390 -12.106  -136.644 1.00 167.61 ? 175 LEU B C     1 
ATOM   2612  O O     . LEU B 1 178 ? 27.628 -11.265  -137.519 1.00 165.61 ? 175 LEU B O     1 
ATOM   2613  C CB    . LEU B 1 178 ? 27.786 -14.504  -137.228 1.00 171.29 ? 175 LEU B CB    1 
ATOM   2614  C CG    . LEU B 1 178 ? 28.791 -15.448  -137.884 1.00 166.14 ? 175 LEU B CG    1 
ATOM   2615  C CD1   . LEU B 1 178 ? 28.049 -16.562  -138.598 1.00 155.25 ? 175 LEU B CD1   1 
ATOM   2616  C CD2   . LEU B 1 178 ? 29.682 -14.689  -138.851 1.00 161.77 ? 175 LEU B CD2   1 
ATOM   2617  N N     . ASN B 1 179 ? 26.325 -12.020  -135.843 1.00 172.49 ? 176 ASN B N     1 
ATOM   2618  C CA    . ASN B 1 179 ? 25.443 -10.859  -135.926 1.00 176.63 ? 176 ASN B CA    1 
ATOM   2619  C C     . ASN B 1 179 ? 26.159 -9.572   -135.529 1.00 178.50 ? 176 ASN B C     1 
ATOM   2620  O O     . ASN B 1 179 ? 25.771 -8.486   -135.975 1.00 180.54 ? 176 ASN B O     1 
ATOM   2621  C CB    . ASN B 1 179 ? 24.207 -11.071  -135.051 1.00 180.68 ? 176 ASN B CB    1 
ATOM   2622  C CG    . ASN B 1 179 ? 23.359 -12.239  -135.514 1.00 188.50 ? 176 ASN B CG    1 
ATOM   2623  O OD1   . ASN B 1 179 ? 23.085 -13.164  -134.749 1.00 180.09 ? 176 ASN B OD1   1 
ATOM   2624  N ND2   . ASN B 1 179 ? 22.937 -12.201  -136.772 1.00 190.92 ? 176 ASN B ND2   1 
ATOM   2625  N N     . LYS B 1 180 ? 27.200 -9.668   -134.702 1.00 179.30 ? 177 LYS B N     1 
ATOM   2626  C CA    . LYS B 1 180 ? 27.923 -8.503   -134.211 1.00 177.47 ? 177 LYS B CA    1 
ATOM   2627  C C     . LYS B 1 180 ? 29.064 -8.075   -135.130 1.00 170.33 ? 177 LYS B C     1 
ATOM   2628  O O     . LYS B 1 180 ? 30.015 -7.435   -134.665 1.00 165.83 ? 177 LYS B O     1 
ATOM   2629  C CB    . LYS B 1 180 ? 28.457 -8.774   -132.802 1.00 170.54 ? 177 LYS B CB    1 
ATOM   2630  C CG    . LYS B 1 180 ? 27.381 -9.156   -131.798 1.00 164.98 ? 177 LYS B CG    1 
ATOM   2631  C CD    . LYS B 1 180 ? 27.986 -9.630   -130.486 1.00 162.43 ? 177 LYS B CD    1 
ATOM   2632  C CE    . LYS B 1 180 ? 26.910 -10.113  -129.526 1.00 156.32 ? 177 LYS B CE    1 
ATOM   2633  N NZ    . LYS B 1 180 ? 27.487 -10.626  -128.252 1.00 132.13 ? 177 LYS B NZ    1 
ATOM   2634  N N     . LEU B 1 181 ? 28.995 -8.410   -136.412 1.00 169.78 ? 178 LEU B N     1 
ATOM   2635  C CA    . LEU B 1 181 ? 29.997 -8.034   -137.394 1.00 167.80 ? 178 LEU B CA    1 
ATOM   2636  C C     . LEU B 1 181 ? 29.347 -7.233   -138.513 1.00 166.88 ? 178 LEU B C     1 
ATOM   2637  O O     . LEU B 1 181 ? 28.139 -7.352   -138.750 1.00 167.29 ? 178 LEU B O     1 
ATOM   2638  C CB    . LEU B 1 181 ? 30.690 -9.274   -137.978 1.00 168.54 ? 178 LEU B CB    1 
ATOM   2639  C CG    . LEU B 1 181 ? 31.816 -9.880   -137.139 1.00 159.21 ? 178 LEU B CG    1 
ATOM   2640  C CD1   . LEU B 1 181 ? 32.403 -11.097  -137.835 1.00 154.89 ? 178 LEU B CD1   1 
ATOM   2641  C CD2   . LEU B 1 181 ? 32.896 -8.846   -136.859 1.00 153.07 ? 178 LEU B CD2   1 
ATOM   2642  N N     . PRO B 1 182 ? 30.111 -6.394   -139.212 1.00 164.69 ? 179 PRO B N     1 
ATOM   2643  C CA    . PRO B 1 182 ? 29.532 -5.647   -140.340 1.00 167.70 ? 179 PRO B CA    1 
ATOM   2644  C C     . PRO B 1 182 ? 29.070 -6.593   -141.437 1.00 161.03 ? 179 PRO B C     1 
ATOM   2645  O O     . PRO B 1 182 ? 29.848 -7.392   -141.964 1.00 157.28 ? 179 PRO B O     1 
ATOM   2646  C CB    . PRO B 1 182 ? 30.690 -4.757   -140.803 1.00 167.55 ? 179 PRO B CB    1 
ATOM   2647  C CG    . PRO B 1 182 ? 31.570 -4.627   -139.599 1.00 159.78 ? 179 PRO B CG    1 
ATOM   2648  C CD    . PRO B 1 182 ? 31.485 -5.956   -138.911 1.00 147.49 ? 179 PRO B CD    1 
ATOM   2649  N N     . ARG B 1 183 ? 27.789 -6.494   -141.781 1.00 155.87 ? 180 ARG B N     1 
ATOM   2650  C CA    . ARG B 1 183 ? 27.193 -7.322   -142.826 1.00 164.37 ? 180 ARG B CA    1 
ATOM   2651  C C     . ARG B 1 183 ? 27.606 -6.759   -144.180 1.00 171.12 ? 180 ARG B C     1 
ATOM   2652  O O     . ARG B 1 183 ? 26.982 -5.830   -144.697 1.00 172.33 ? 180 ARG B O     1 
ATOM   2653  C CB    . ARG B 1 183 ? 25.678 -7.371   -142.673 1.00 166.73 ? 180 ARG B CB    1 
ATOM   2654  C CG    . ARG B 1 183 ? 25.103 -8.780   -142.656 1.00 173.59 ? 180 ARG B CG    1 
ATOM   2655  C CD    . ARG B 1 183 ? 25.148 -9.431   -144.029 1.00 179.13 ? 180 ARG B CD    1 
ATOM   2656  N NE    . ARG B 1 183 ? 24.541 -8.597   -145.062 1.00 187.47 ? 180 ARG B NE    1 
ATOM   2657  C CZ    . ARG B 1 183 ? 24.607 -8.857   -146.365 1.00 179.03 ? 180 ARG B CZ    1 
ATOM   2658  N NH1   . ARG B 1 183 ? 25.252 -9.932   -146.796 1.00 166.66 ? 180 ARG B NH1   1 
ATOM   2659  N NH2   . ARG B 1 183 ? 24.026 -8.044   -147.236 1.00 178.71 ? 180 ARG B NH2   1 
ATOM   2660  N N     . GLN B 1 184 ? 28.661 -7.321   -144.762 1.00 170.03 ? 181 GLN B N     1 
ATOM   2661  C CA    . GLN B 1 184 ? 29.214 -6.782   -145.993 1.00 172.32 ? 181 GLN B CA    1 
ATOM   2662  C C     . GLN B 1 184 ? 28.341 -7.148   -147.191 1.00 176.60 ? 181 GLN B C     1 
ATOM   2663  O O     . GLN B 1 184 ? 27.576 -8.116   -147.170 1.00 182.75 ? 181 GLN B O     1 
ATOM   2664  C CB    . GLN B 1 184 ? 30.631 -7.300   -146.228 1.00 168.54 ? 181 GLN B CB    1 
ATOM   2665  C CG    . GLN B 1 184 ? 30.742 -8.810   -146.187 1.00 172.46 ? 181 GLN B CG    1 
ATOM   2666  C CD    . GLN B 1 184 ? 32.101 -9.298   -146.631 1.00 169.94 ? 181 GLN B CD    1 
ATOM   2667  O OE1   . GLN B 1 184 ? 32.204 -10.221  -147.435 1.00 175.35 ? 181 GLN B OE1   1 
ATOM   2668  N NE2   . GLN B 1 184 ? 33.154 -8.687   -146.102 1.00 156.98 ? 181 GLN B NE2   1 
ATOM   2669  N N     . LEU B 1 185 ? 28.468 -6.350   -148.247 1.00 170.67 ? 182 LEU B N     1 
ATOM   2670  C CA    . LEU B 1 185 ? 27.738 -6.556   -149.485 1.00 171.85 ? 182 LEU B CA    1 
ATOM   2671  C C     . LEU B 1 185 ? 28.364 -7.704   -150.278 1.00 177.33 ? 182 LEU B C     1 
ATOM   2672  O O     . LEU B 1 185 ? 29.551 -8.000   -150.113 1.00 170.24 ? 182 LEU B O     1 
ATOM   2673  C CB    . LEU B 1 185 ? 27.750 -5.276   -150.318 1.00 183.60 ? 182 LEU B CB    1 
ATOM   2674  C CG    . LEU B 1 185 ? 26.469 -4.861   -151.046 1.00 183.68 ? 182 LEU B CG    1 
ATOM   2675  C CD1   . LEU B 1 185 ? 25.309 -4.745   -150.067 1.00 181.75 ? 182 LEU B CD1   1 
ATOM   2676  C CD2   . LEU B 1 185 ? 26.673 -3.554   -151.795 1.00 162.66 ? 182 LEU B CD2   1 
ATOM   2677  N N     . PRO B 1 186 ? 27.577 -8.388   -151.113 1.00 182.51 ? 183 PRO B N     1 
ATOM   2678  C CA    . PRO B 1 186 ? 28.123 -9.494   -151.911 1.00 173.96 ? 183 PRO B CA    1 
ATOM   2679  C C     . PRO B 1 186 ? 29.393 -9.108   -152.658 1.00 173.99 ? 183 PRO B C     1 
ATOM   2680  O O     . PRO B 1 186 ? 29.501 -8.019   -153.227 1.00 172.15 ? 183 PRO B O     1 
ATOM   2681  C CB    . PRO B 1 186 ? 26.981 -9.819   -152.877 1.00 166.26 ? 183 PRO B CB    1 
ATOM   2682  C CG    . PRO B 1 186 ? 25.751 -9.478   -152.112 1.00 164.15 ? 183 PRO B CG    1 
ATOM   2683  C CD    . PRO B 1 186 ? 26.105 -8.337   -151.183 1.00 176.26 ? 183 PRO B CD    1 
ATOM   2684  N N     . LEU B 1 187 ? 30.360 -10.021  -152.646 1.00 177.42 ? 184 LEU B N     1 
ATOM   2685  C CA    . LEU B 1 187 ? 31.639 -9.798   -153.305 1.00 182.08 ? 184 LEU B CA    1 
ATOM   2686  C C     . LEU B 1 187 ? 31.475 -9.734   -154.819 1.00 180.64 ? 184 LEU B C     1 
ATOM   2687  O O     . LEU B 1 187 ? 30.568 -10.340  -155.398 1.00 180.70 ? 184 LEU B O     1 
ATOM   2688  C CB    . LEU B 1 187 ? 32.632 -10.905  -152.943 1.00 184.85 ? 184 LEU B CB    1 
ATOM   2689  C CG    . LEU B 1 187 ? 32.985 -11.141  -151.469 1.00 189.25 ? 184 LEU B CG    1 
ATOM   2690  C CD1   . LEU B 1 187 ? 33.150 -9.820   -150.723 1.00 160.40 ? 184 LEU B CD1   1 
ATOM   2691  C CD2   . LEU B 1 187 ? 31.974 -12.052  -150.773 1.00 172.68 ? 184 LEU B CD2   1 
ATOM   2692  N N     . GLU B 1 188 ? 32.369 -8.986   -155.459 1.00 182.75 ? 185 GLU B N     1 
ATOM   2693  C CA    . GLU B 1 188 ? 32.383 -8.860   -156.910 1.00 174.83 ? 185 GLU B CA    1 
ATOM   2694  C C     . GLU B 1 188 ? 33.328 -9.906   -157.489 1.00 179.10 ? 185 GLU B C     1 
ATOM   2695  O O     . GLU B 1 188 ? 34.451 -10.074  -157.002 1.00 180.06 ? 185 GLU B O     1 
ATOM   2696  C CB    . GLU B 1 188 ? 32.814 -7.453   -157.326 1.00 166.19 ? 185 GLU B CB    1 
ATOM   2697  C CG    . GLU B 1 188 ? 32.752 -7.191   -158.822 1.00 164.83 ? 185 GLU B CG    1 
ATOM   2698  C CD    . GLU B 1 188 ? 33.070 -5.750   -159.174 1.00 168.56 ? 185 GLU B CD    1 
ATOM   2699  O OE1   . GLU B 1 188 ? 34.045 -5.200   -158.619 1.00 147.28 ? 185 GLU B OE1   1 
ATOM   2700  O OE2   . GLU B 1 188 ? 32.343 -5.167   -160.006 1.00 171.65 ? 185 GLU B OE2   1 
ATOM   2701  N N     . VAL B 1 189 ? 32.870 -10.606  -158.523 1.00 175.79 ? 186 VAL B N     1 
ATOM   2702  C CA    . VAL B 1 189 ? 33.617 -11.701  -159.130 1.00 169.48 ? 186 VAL B CA    1 
ATOM   2703  C C     . VAL B 1 189 ? 34.346 -11.178  -160.359 1.00 157.36 ? 186 VAL B C     1 
ATOM   2704  O O     . VAL B 1 189 ? 33.736 -10.548  -161.234 1.00 150.00 ? 186 VAL B O     1 
ATOM   2705  C CB    . VAL B 1 189 ? 32.690 -12.873  -159.496 1.00 164.15 ? 186 VAL B CB    1 
ATOM   2706  C CG1   . VAL B 1 189 ? 33.486 -14.004  -160.127 1.00 153.20 ? 186 VAL B CG1   1 
ATOM   2707  C CG2   . VAL B 1 189 ? 31.943 -13.363  -158.265 1.00 163.46 ? 186 VAL B CG2   1 
ATOM   2708  N N     . ASP B 1 190 ? 35.650 -11.436  -160.425 1.00 149.31 ? 187 ASP B N     1 
ATOM   2709  C CA    . ASP B 1 190 ? 36.484 -10.982  -161.533 1.00 163.59 ? 187 ASP B CA    1 
ATOM   2710  C C     . ASP B 1 190 ? 36.505 -12.061  -162.609 1.00 162.86 ? 187 ASP B C     1 
ATOM   2711  O O     . ASP B 1 190 ? 37.047 -13.150  -162.396 1.00 153.52 ? 187 ASP B O     1 
ATOM   2712  C CB    . ASP B 1 190 ? 37.895 -10.669  -161.042 1.00 172.20 ? 187 ASP B CB    1 
ATOM   2713  C CG    . ASP B 1 190 ? 38.811 -10.206  -162.157 1.00 189.47 ? 187 ASP B CG    1 
ATOM   2714  O OD1   . ASP B 1 190 ? 38.653 -9.056   -162.617 1.00 191.77 ? 187 ASP B OD1   1 
ATOM   2715  O OD2   . ASP B 1 190 ? 39.687 -10.993  -162.573 1.00 186.79 ? 187 ASP B OD2   1 
ATOM   2716  N N     . LEU B 1 191 ? 35.918 -11.757  -163.768 1.00 168.12 ? 188 LEU B N     1 
ATOM   2717  C CA    . LEU B 1 191 ? 35.855 -12.687  -164.888 1.00 168.59 ? 188 LEU B CA    1 
ATOM   2718  C C     . LEU B 1 191 ? 36.852 -12.342  -165.989 1.00 173.44 ? 188 LEU B C     1 
ATOM   2719  O O     . LEU B 1 191 ? 36.602 -12.627  -167.166 1.00 163.23 ? 188 LEU B O     1 
ATOM   2720  C CB    . LEU B 1 191 ? 34.434 -12.741  -165.450 1.00 165.86 ? 188 LEU B CB    1 
ATOM   2721  C CG    . LEU B 1 191 ? 33.359 -13.121  -164.432 1.00 158.02 ? 188 LEU B CG    1 
ATOM   2722  C CD1   . LEU B 1 191 ? 32.006 -13.274  -165.099 1.00 159.02 ? 188 LEU B CD1   1 
ATOM   2723  C CD2   . LEU B 1 191 ? 33.750 -14.403  -163.718 1.00 156.01 ? 188 LEU B CD2   1 
ATOM   2724  N N     . THR B 1 192 ? 37.981 -11.729  -165.631 1.00 182.97 ? 189 THR B N     1 
ATOM   2725  C CA    . THR B 1 192 ? 39.014 -11.433  -166.617 1.00 178.47 ? 189 THR B CA    1 
ATOM   2726  C C     . THR B 1 192 ? 39.820 -12.683  -166.953 1.00 169.23 ? 189 THR B C     1 
ATOM   2727  O O     . THR B 1 192 ? 39.874 -13.109  -168.112 1.00 165.77 ? 189 THR B O     1 
ATOM   2728  C CB    . THR B 1 192 ? 39.933 -10.319  -166.106 1.00 186.31 ? 189 THR B CB    1 
ATOM   2729  O OG1   . THR B 1 192 ? 40.579 -10.744  -164.899 1.00 186.09 ? 189 THR B OG1   1 
ATOM   2730  C CG2   . THR B 1 192 ? 39.135 -9.052   -165.836 1.00 178.67 ? 189 THR B CG2   1 
ATOM   2731  N N     . LYS B 1 193 ? 40.454 -13.282  -165.945 1.00 167.94 ? 190 LYS B N     1 
ATOM   2732  C CA    . LYS B 1 193 ? 41.251 -14.489  -166.118 1.00 170.41 ? 190 LYS B CA    1 
ATOM   2733  C C     . LYS B 1 193 ? 40.411 -15.762  -166.105 1.00 167.99 ? 190 LYS B C     1 
ATOM   2734  O O     . LYS B 1 193 ? 40.957 -16.849  -165.877 1.00 147.21 ? 190 LYS B O     1 
ATOM   2735  C CB    . LYS B 1 193 ? 42.328 -14.564  -165.033 1.00 164.68 ? 190 LYS B CB    1 
ATOM   2736  C CG    . LYS B 1 193 ? 43.225 -13.341  -164.967 1.00 167.29 ? 190 LYS B CG    1 
ATOM   2737  C CD    . LYS B 1 193 ? 44.243 -13.465  -163.847 1.00 167.17 ? 190 LYS B CD    1 
ATOM   2738  C CE    . LYS B 1 193 ? 45.105 -12.218  -163.745 1.00 166.42 ? 190 LYS B CE    1 
ATOM   2739  N NZ    . LYS B 1 193 ? 46.091 -12.314  -162.633 1.00 185.54 ? 190 LYS B NZ    1 
ATOM   2740  N N     . ALA B 1 194 ? 39.106 -15.651  -166.337 1.00 167.38 ? 191 ALA B N     1 
ATOM   2741  C CA    . ALA B 1 194 ? 38.233 -16.813  -166.351 1.00 155.23 ? 191 ALA B CA    1 
ATOM   2742  C C     . ALA B 1 194 ? 38.587 -17.742  -167.510 1.00 154.75 ? 191 ALA B C     1 
ATOM   2743  O O     . ALA B 1 194 ? 39.157 -17.328  -168.524 1.00 157.00 ? 191 ALA B O     1 
ATOM   2744  C CB    . ALA B 1 194 ? 36.769 -16.383  -166.450 1.00 145.03 ? 191 ALA B CB    1 
ATOM   2745  N N     . LYS B 1 195 ? 38.246 -19.018  -167.343 1.00 146.30 ? 192 LYS B N     1 
ATOM   2746  C CA    . LYS B 1 195 ? 38.499 -20.005  -168.385 1.00 146.65 ? 192 LYS B CA    1 
ATOM   2747  C C     . LYS B 1 195 ? 37.677 -19.681  -169.626 1.00 137.63 ? 192 LYS B C     1 
ATOM   2748  O O     . LYS B 1 195 ? 36.468 -19.449  -169.543 1.00 118.93 ? 192 LYS B O     1 
ATOM   2749  C CB    . LYS B 1 195 ? 38.165 -21.406  -167.874 1.00 146.20 ? 192 LYS B CB    1 
ATOM   2750  C CG    . LYS B 1 195 ? 38.461 -22.520  -168.860 1.00 147.69 ? 192 LYS B CG    1 
ATOM   2751  C CD    . LYS B 1 195 ? 38.485 -23.869  -168.165 1.00 126.51 ? 192 LYS B CD    1 
ATOM   2752  C CE    . LYS B 1 195 ? 38.920 -24.967  -169.117 1.00 135.51 ? 192 LYS B CE    1 
ATOM   2753  N NZ    . LYS B 1 195 ? 40.178 -24.611  -169.828 1.00 134.29 ? 192 LYS B NZ    1 
ATOM   2754  N N     . ARG B 1 196 ? 38.342 -19.667  -170.783 1.00 139.63 ? 193 ARG B N     1 
ATOM   2755  C CA    . ARG B 1 196 ? 37.708 -19.258  -172.027 1.00 151.43 ? 193 ARG B CA    1 
ATOM   2756  C C     . ARG B 1 196 ? 37.871 -20.252  -173.169 1.00 148.70 ? 193 ARG B C     1 
ATOM   2757  O O     . ARG B 1 196 ? 37.253 -20.053  -174.220 1.00 135.69 ? 193 ARG B O     1 
ATOM   2758  C CB    . ARG B 1 196 ? 38.250 -17.891  -172.479 1.00 150.09 ? 193 ARG B CB    1 
ATOM   2759  C CG    . ARG B 1 196 ? 37.899 -16.746  -171.537 1.00 147.11 ? 193 ARG B CG    1 
ATOM   2760  C CD    . ARG B 1 196 ? 37.923 -15.403  -172.250 1.00 129.23 ? 193 ARG B CD    1 
ATOM   2761  N NE    . ARG B 1 196 ? 36.938 -14.472  -171.703 1.00 151.72 ? 193 ARG B NE    1 
ATOM   2762  C CZ    . ARG B 1 196 ? 37.094 -13.792  -170.571 1.00 150.99 ? 193 ARG B CZ    1 
ATOM   2763  N NH1   . ARG B 1 196 ? 38.202 -13.932  -169.856 1.00 154.63 ? 193 ARG B NH1   1 
ATOM   2764  N NH2   . ARG B 1 196 ? 36.141 -12.968  -170.155 1.00 137.03 ? 193 ARG B NH2   1 
ATOM   2765  N N     . GLN B 1 197 ? 38.668 -21.306  -173.004 1.00 150.26 ? 194 GLN B N     1 
ATOM   2766  C CA    . GLN B 1 197 ? 38.830 -22.322  -174.033 1.00 151.08 ? 194 GLN B CA    1 
ATOM   2767  C C     . GLN B 1 197 ? 38.967 -23.687  -173.371 1.00 154.41 ? 194 GLN B C     1 
ATOM   2768  O O     . GLN B 1 197 ? 39.139 -23.799  -172.154 1.00 145.26 ? 194 GLN B O     1 
ATOM   2769  C CB    . GLN B 1 197 ? 40.036 -22.023  -174.937 1.00 136.52 ? 194 GLN B CB    1 
ATOM   2770  C CG    . GLN B 1 197 ? 41.371 -22.551  -174.423 1.00 136.92 ? 194 GLN B CG    1 
ATOM   2771  C CD    . GLN B 1 197 ? 41.861 -21.826  -173.181 1.00 149.05 ? 194 GLN B CD    1 
ATOM   2772  O OE1   . GLN B 1 197 ? 41.291 -20.816  -172.767 1.00 147.36 ? 194 GLN B OE1   1 
ATOM   2773  N NE2   . GLN B 1 197 ? 42.927 -22.343  -172.580 1.00 146.71 ? 194 GLN B NE2   1 
ATOM   2774  N N     . ASP B 1 198 ? 38.884 -24.735  -174.193 1.00 151.14 ? 195 ASP B N     1 
ATOM   2775  C CA    . ASP B 1 198 ? 38.896 -26.100  -173.677 1.00 139.34 ? 195 ASP B CA    1 
ATOM   2776  C C     . ASP B 1 198 ? 40.298 -26.531  -173.256 1.00 139.21 ? 195 ASP B C     1 
ATOM   2777  O O     . ASP B 1 198 ? 40.517 -26.930  -172.107 1.00 137.62 ? 195 ASP B O     1 
ATOM   2778  C CB    . ASP B 1 198 ? 38.340 -27.066  -174.729 1.00 132.82 ? 195 ASP B CB    1 
ATOM   2779  C CG    . ASP B 1 198 ? 36.883 -26.805  -175.054 1.00 135.65 ? 195 ASP B CG    1 
ATOM   2780  O OD1   . ASP B 1 198 ? 36.238 -26.022  -174.327 1.00 149.64 ? 195 ASP B OD1   1 
ATOM   2781  O OD2   . ASP B 1 198 ? 36.380 -27.387  -176.039 1.00 119.13 ? 195 ASP B OD2   1 
ATOM   2782  N N     . LEU B 1 199 ? 41.254 -26.459  -174.180 1.00 139.87 ? 196 LEU B N     1 
ATOM   2783  C CA    . LEU B 1 199 ? 42.577 -27.023  -173.947 1.00 136.85 ? 196 LEU B CA    1 
ATOM   2784  C C     . LEU B 1 199 ? 43.277 -26.346  -172.773 1.00 140.60 ? 196 LEU B C     1 
ATOM   2785  O O     . LEU B 1 199 ? 43.200 -25.128  -172.596 1.00 149.92 ? 196 LEU B O     1 
ATOM   2786  C CB    . LEU B 1 199 ? 43.430 -26.896  -175.211 1.00 119.78 ? 196 LEU B CB    1 
ATOM   2787  C CG    . LEU B 1 199 ? 44.866 -27.423  -175.137 1.00 120.10 ? 196 LEU B CG    1 
ATOM   2788  C CD1   . LEU B 1 199 ? 44.881 -28.888  -174.727 1.00 136.88 ? 196 LEU B CD1   1 
ATOM   2789  C CD2   . LEU B 1 199 ? 45.578 -27.228  -176.466 1.00 122.97 ? 196 LEU B CD2   1 
ATOM   2790  N N     . GLU B 1 200 ? 43.962 -27.157  -171.968 1.00 139.97 ? 197 GLU B N     1 
ATOM   2791  C CA    . GLU B 1 200 ? 44.776 -26.689  -170.847 1.00 145.56 ? 197 GLU B CA    1 
ATOM   2792  C C     . GLU B 1 200 ? 46.174 -27.265  -171.026 1.00 159.52 ? 197 GLU B C     1 
ATOM   2793  O O     . GLU B 1 200 ? 46.502 -28.318  -170.462 1.00 170.27 ? 197 GLU B O     1 
ATOM   2794  C CB    . GLU B 1 200 ? 44.169 -27.096  -169.504 1.00 145.69 ? 197 GLU B CB    1 
ATOM   2795  C CG    . GLU B 1 200 ? 42.923 -26.316  -169.121 1.00 155.47 ? 197 GLU B CG    1 
ATOM   2796  C CD    . GLU B 1 200 ? 43.240 -24.925  -168.605 1.00 170.97 ? 197 GLU B CD    1 
ATOM   2797  O OE1   . GLU B 1 200 ? 44.176 -24.792  -167.788 1.00 178.36 ? 197 GLU B OE1   1 
ATOM   2798  O OE2   . GLU B 1 200 ? 42.554 -23.966  -169.015 1.00 168.57 ? 197 GLU B OE2   1 
ATOM   2799  N N     . PRO B 1 201 ? 47.022 -26.606  -171.823 1.00 145.90 ? 198 PRO B N     1 
ATOM   2800  C CA    . PRO B 1 201 ? 48.374 -27.141  -172.061 1.00 141.19 ? 198 PRO B CA    1 
ATOM   2801  C C     . PRO B 1 201 ? 49.189 -27.331  -170.794 1.00 142.93 ? 198 PRO B C     1 
ATOM   2802  O O     . PRO B 1 201 ? 50.024 -28.243  -170.740 1.00 140.04 ? 198 PRO B O     1 
ATOM   2803  C CB    . PRO B 1 201 ? 49.003 -26.088  -172.986 1.00 136.62 ? 198 PRO B CB    1 
ATOM   2804  C CG    . PRO B 1 201 ? 47.834 -25.450  -173.665 1.00 137.57 ? 198 PRO B CG    1 
ATOM   2805  C CD    . PRO B 1 201 ? 46.765 -25.390  -172.613 1.00 140.09 ? 198 PRO B CD    1 
ATOM   2806  N N     . SER B 1 202 ? 48.980 -26.490  -169.777 1.00 144.06 ? 199 SER B N     1 
ATOM   2807  C CA    . SER B 1 202 ? 49.659 -26.676  -168.498 1.00 140.91 ? 199 SER B CA    1 
ATOM   2808  C C     . SER B 1 202 ? 49.408 -28.070  -167.931 1.00 151.00 ? 199 SER B C     1 
ATOM   2809  O O     . SER B 1 202 ? 50.323 -28.708  -167.399 1.00 147.99 ? 199 SER B O     1 
ATOM   2810  C CB    . SER B 1 202 ? 49.205 -25.604  -167.505 1.00 145.45 ? 199 SER B CB    1 
ATOM   2811  O OG    . SER B 1 202 ? 49.933 -25.687  -166.292 1.00 151.13 ? 199 SER B OG    1 
ATOM   2812  N N     . VAL B 1 203 ? 48.173 -28.558  -168.042 1.00 154.49 ? 200 VAL B N     1 
ATOM   2813  C CA    . VAL B 1 203 ? 47.834 -29.887  -167.543 1.00 157.04 ? 200 VAL B CA    1 
ATOM   2814  C C     . VAL B 1 203 ? 48.287 -30.965  -168.520 1.00 152.54 ? 200 VAL B C     1 
ATOM   2815  O O     . VAL B 1 203 ? 48.809 -32.011  -168.111 1.00 152.01 ? 200 VAL B O     1 
ATOM   2816  C CB    . VAL B 1 203 ? 46.322 -29.981  -167.264 1.00 162.64 ? 200 VAL B CB    1 
ATOM   2817  C CG1   . VAL B 1 203 ? 45.983 -31.340  -166.678 1.00 165.13 ? 200 VAL B CG1   1 
ATOM   2818  C CG2   . VAL B 1 203 ? 45.875 -28.860  -166.340 1.00 162.62 ? 200 VAL B CG2   1 
ATOM   2819  N N     . GLU B 1 204 ? 48.029 -30.748  -169.815 1.00 148.76 ? 201 GLU B N     1 
ATOM   2820  C CA    . GLU B 1 204 ? 48.416 -31.708  -170.846 1.00 146.22 ? 201 GLU B CA    1 
ATOM   2821  C C     . GLU B 1 204 ? 49.901 -32.047  -170.773 1.00 149.19 ? 201 GLU B C     1 
ATOM   2822  O O     . GLU B 1 204 ? 50.289 -33.208  -170.949 1.00 136.42 ? 201 GLU B O     1 
ATOM   2823  C CB    . GLU B 1 204 ? 48.059 -31.151  -172.226 1.00 136.56 ? 201 GLU B CB    1 
ATOM   2824  C CG    . GLU B 1 204 ? 48.632 -31.931  -173.398 1.00 136.65 ? 201 GLU B CG    1 
ATOM   2825  C CD    . GLU B 1 204 ? 48.015 -33.306  -173.542 1.00 139.75 ? 201 GLU B CD    1 
ATOM   2826  O OE1   . GLU B 1 204 ? 46.784 -33.385  -173.735 1.00 132.60 ? 201 GLU B OE1   1 
ATOM   2827  O OE2   . GLU B 1 204 ? 48.760 -34.306  -173.468 1.00 149.70 ? 201 GLU B OE2   1 
ATOM   2828  N N     . GLU B 1 205 ? 50.744 -31.046  -170.512 1.00 156.33 ? 202 GLU B N     1 
ATOM   2829  C CA    . GLU B 1 205 ? 52.184 -31.271  -170.413 1.00 161.51 ? 202 GLU B CA    1 
ATOM   2830  C C     . GLU B 1 205 ? 52.510 -32.269  -169.307 1.00 158.44 ? 202 GLU B C     1 
ATOM   2831  O O     . GLU B 1 205 ? 53.172 -33.290  -169.540 1.00 162.50 ? 202 GLU B O     1 
ATOM   2832  C CB    . GLU B 1 205 ? 52.892 -29.938  -170.165 1.00 163.50 ? 202 GLU B CB    1 
ATOM   2833  C CG    . GLU B 1 205 ? 54.404 -29.986  -170.256 1.00 175.63 ? 202 GLU B CG    1 
ATOM   2834  C CD    . GLU B 1 205 ? 55.028 -28.609  -170.143 1.00 194.07 ? 202 GLU B CD    1 
ATOM   2835  O OE1   . GLU B 1 205 ? 54.878 -27.976  -169.076 1.00 176.83 ? 202 GLU B OE1   1 
ATOM   2836  O OE2   . GLU B 1 205 ? 55.663 -28.159  -171.119 1.00 218.68 ? 202 GLU B OE2   1 
ATOM   2837  N N     . ALA B 1 206 ? 52.064 -31.971  -168.084 1.00 157.97 ? 203 ALA B N     1 
ATOM   2838  C CA    . ALA B 1 206 ? 52.346 -32.842  -166.949 1.00 167.89 ? 203 ALA B CA    1 
ATOM   2839  C C     . ALA B 1 206 ? 51.757 -34.231  -167.153 1.00 166.48 ? 203 ALA B C     1 
ATOM   2840  O O     . ALA B 1 206 ? 52.359 -35.233  -166.750 1.00 163.20 ? 203 ALA B O     1 
ATOM   2841  C CB    . ALA B 1 206 ? 51.809 -32.214  -165.664 1.00 162.47 ? 203 ALA B CB    1 
ATOM   2842  N N     . ARG B 1 207 ? 50.584 -34.318  -167.786 1.00 165.27 ? 204 ARG B N     1 
ATOM   2843  C CA    . ARG B 1 207 ? 49.957 -35.626  -167.956 1.00 161.60 ? 204 ARG B CA    1 
ATOM   2844  C C     . ARG B 1 207 ? 50.686 -36.458  -169.004 1.00 160.05 ? 204 ARG B C     1 
ATOM   2845  O O     . ARG B 1 207 ? 50.834 -37.675  -168.844 1.00 156.28 ? 204 ARG B O     1 
ATOM   2846  C CB    . ARG B 1 207 ? 48.483 -35.466  -168.321 1.00 152.36 ? 204 ARG B CB    1 
ATOM   2847  C CG    . ARG B 1 207 ? 47.688 -36.757  -168.215 1.00 144.74 ? 204 ARG B CG    1 
ATOM   2848  C CD    . ARG B 1 207 ? 46.290 -36.578  -168.764 1.00 140.96 ? 204 ARG B CD    1 
ATOM   2849  N NE    . ARG B 1 207 ? 45.674 -35.345  -168.287 1.00 132.37 ? 204 ARG B NE    1 
ATOM   2850  C CZ    . ARG B 1 207 ? 44.878 -34.579  -169.026 1.00 124.59 ? 204 ARG B CZ    1 
ATOM   2851  N NH1   . ARG B 1 207 ? 44.610 -34.918  -170.279 1.00 123.54 ? 204 ARG B NH1   1 
ATOM   2852  N NH2   . ARG B 1 207 ? 44.356 -33.474  -168.518 1.00 120.36 ? 204 ARG B NH2   1 
ATOM   2853  N N     . TYR B 1 208 ? 51.138 -35.824  -170.090 1.00 155.90 ? 205 TYR B N     1 
ATOM   2854  C CA    . TYR B 1 208 ? 51.950 -36.533  -171.071 1.00 155.33 ? 205 TYR B CA    1 
ATOM   2855  C C     . TYR B 1 208 ? 53.287 -36.958  -170.479 1.00 159.37 ? 205 TYR B C     1 
ATOM   2856  O O     . TYR B 1 208 ? 53.827 -38.004  -170.858 1.00 146.32 ? 205 TYR B O     1 
ATOM   2857  C CB    . TYR B 1 208 ? 52.168 -35.663  -172.308 1.00 142.69 ? 205 TYR B CB    1 
ATOM   2858  C CG    . TYR B 1 208 ? 53.110 -36.278  -173.317 1.00 148.59 ? 205 TYR B CG    1 
ATOM   2859  C CD1   . TYR B 1 208 ? 52.763 -37.433  -174.004 1.00 144.37 ? 205 TYR B CD1   1 
ATOM   2860  C CD2   . TYR B 1 208 ? 54.349 -35.708  -173.578 1.00 162.58 ? 205 TYR B CD2   1 
ATOM   2861  C CE1   . TYR B 1 208 ? 53.621 -38.003  -174.925 1.00 149.93 ? 205 TYR B CE1   1 
ATOM   2862  C CE2   . TYR B 1 208 ? 55.215 -36.271  -174.498 1.00 165.47 ? 205 TYR B CE2   1 
ATOM   2863  C CZ    . TYR B 1 208 ? 54.845 -37.418  -175.168 1.00 154.50 ? 205 TYR B CZ    1 
ATOM   2864  O OH    . TYR B 1 208 ? 55.703 -37.981  -176.085 1.00 151.45 ? 205 TYR B OH    1 
ATOM   2865  N N     . ASN B 1 209 ? 53.832 -36.168  -169.552 1.00 167.50 ? 206 ASN B N     1 
ATOM   2866  C CA    . ASN B 1 209 ? 55.053 -36.562  -168.860 1.00 171.01 ? 206 ASN B CA    1 
ATOM   2867  C C     . ASN B 1 209 ? 54.802 -37.543  -167.721 1.00 166.63 ? 206 ASN B C     1 
ATOM   2868  O O     . ASN B 1 209 ? 55.767 -38.069  -167.156 1.00 165.01 ? 206 ASN B O     1 
ATOM   2869  C CB    . ASN B 1 209 ? 55.778 -35.325  -168.321 1.00 167.91 ? 206 ASN B CB    1 
ATOM   2870  C CG    . ASN B 1 209 ? 56.344 -34.455  -169.425 1.00 169.57 ? 206 ASN B CG    1 
ATOM   2871  O OD1   . ASN B 1 209 ? 57.276 -34.849  -170.126 1.00 175.86 ? 206 ASN B OD1   1 
ATOM   2872  N ND2   . ASN B 1 209 ? 55.780 -33.263  -169.587 1.00 171.64 ? 206 ASN B ND2   1 
ATOM   2873  N N     . SER B 1 210 ? 53.541 -37.802  -167.375 1.00 160.39 ? 207 SER B N     1 
ATOM   2874  C CA    . SER B 1 210 ? 53.203 -38.700  -166.277 1.00 156.26 ? 207 SER B CA    1 
ATOM   2875  C C     . SER B 1 210 ? 53.348 -40.174  -166.638 1.00 143.36 ? 207 SER B C     1 
ATOM   2876  O O     . SER B 1 210 ? 53.171 -41.026  -165.760 1.00 156.46 ? 207 SER B O     1 
ATOM   2877  C CB    . SER B 1 210 ? 51.773 -38.429  -165.801 1.00 157.69 ? 207 SER B CB    1 
ATOM   2878  O OG    . SER B 1 210 ? 51.529 -39.025  -164.539 1.00 150.30 ? 207 SER B OG    1 
ATOM   2879  N N     . CYS B 1 211 ? 53.658 -40.497  -167.889 1.00 126.05 ? 208 CYS B N     1 
ATOM   2880  C CA    . CYS B 1 211 ? 53.816 -41.888  -168.300 1.00 129.38 ? 208 CYS B CA    1 
ATOM   2881  C C     . CYS B 1 211 ? 55.256 -42.353  -168.119 1.00 125.35 ? 208 CYS B C     1 
ATOM   2882  O O     . CYS B 1 211 ? 55.773 -43.129  -168.923 1.00 104.09 ? 208 CYS B O     1 
ATOM   2883  C CB    . CYS B 1 211 ? 53.385 -42.074  -169.756 1.00 134.43 ? 208 CYS B CB    1 
ATOM   2884  S SG    . CYS B 1 211 ? 51.637 -41.744  -170.073 1.00 154.24 ? 208 CYS B SG    1 
ATOM   2885  N N     . CYS C 1 28  ? 46.885 -49.289  -164.006 1.00 133.88 ? 25  CYS C N     1 
ATOM   2886  C CA    . CYS C 1 28  ? 45.668 -49.148  -164.796 1.00 135.18 ? 25  CYS C CA    1 
ATOM   2887  C C     . CYS C 1 28  ? 44.726 -48.129  -164.163 1.00 121.19 ? 25  CYS C C     1 
ATOM   2888  O O     . CYS C 1 28  ? 45.107 -47.412  -163.238 1.00 127.34 ? 25  CYS C O     1 
ATOM   2889  C CB    . CYS C 1 28  ? 44.964 -50.498  -164.941 1.00 140.86 ? 25  CYS C CB    1 
ATOM   2890  S SG    . CYS C 1 28  ? 44.526 -51.285  -163.372 1.00 136.67 ? 25  CYS C SG    1 
ATOM   2891  N N     . PHE C 1 29  ? 43.495 -48.067  -164.666 1.00 105.13 ? 26  PHE C N     1 
ATOM   2892  C CA    . PHE C 1 29  ? 42.510 -47.155  -164.103 1.00 84.72  ? 26  PHE C CA    1 
ATOM   2893  C C     . PHE C 1 29  ? 42.107 -47.614  -162.708 1.00 100.43 ? 26  PHE C C     1 
ATOM   2894  O O     . PHE C 1 29  ? 41.965 -48.812  -162.447 1.00 111.87 ? 26  PHE C O     1 
ATOM   2895  C CB    . PHE C 1 29  ? 41.284 -47.065  -165.009 1.00 90.13  ? 26  PHE C CB    1 
ATOM   2896  C CG    . PHE C 1 29  ? 40.455 -45.834  -164.783 1.00 96.52  ? 26  PHE C CG    1 
ATOM   2897  C CD1   . PHE C 1 29  ? 39.552 -45.770  -163.735 1.00 90.41  ? 26  PHE C CD1   1 
ATOM   2898  C CD2   . PHE C 1 29  ? 40.587 -44.736  -165.615 1.00 99.66  ? 26  PHE C CD2   1 
ATOM   2899  C CE1   . PHE C 1 29  ? 38.794 -44.636  -163.525 1.00 90.27  ? 26  PHE C CE1   1 
ATOM   2900  C CE2   . PHE C 1 29  ? 39.831 -43.600  -165.410 1.00 88.71  ? 26  PHE C CE2   1 
ATOM   2901  C CZ    . PHE C 1 29  ? 38.936 -43.550  -164.363 1.00 80.01  ? 26  PHE C CZ    1 
ATOM   2902  N N     . GLY C 1 30  ? 41.924 -46.649  -161.808 1.00 99.29  ? 27  GLY C N     1 
ATOM   2903  C CA    . GLY C 1 30  ? 41.684 -46.936  -160.412 1.00 110.69 ? 27  GLY C CA    1 
ATOM   2904  C C     . GLY C 1 30  ? 42.931 -47.226  -159.607 1.00 113.69 ? 27  GLY C C     1 
ATOM   2905  O O     . GLY C 1 30  ? 42.874 -47.205  -158.371 1.00 105.82 ? 27  GLY C O     1 
ATOM   2906  N N     . GLN C 1 31  ? 44.054 -47.500  -160.267 1.00 120.35 ? 28  GLN C N     1 
ATOM   2907  C CA    . GLN C 1 31  ? 45.327 -47.784  -159.618 1.00 125.57 ? 28  GLN C CA    1 
ATOM   2908  C C     . GLN C 1 31  ? 46.361 -46.689  -159.823 1.00 135.91 ? 28  GLN C C     1 
ATOM   2909  O O     . GLN C 1 31  ? 47.079 -46.345  -158.882 1.00 142.96 ? 28  GLN C O     1 
ATOM   2910  C CB    . GLN C 1 31  ? 45.897 -49.114  -160.130 1.00 126.87 ? 28  GLN C CB    1 
ATOM   2911  C CG    . GLN C 1 31  ? 45.020 -50.331  -159.853 1.00 129.53 ? 28  GLN C CG    1 
ATOM   2912  C CD    . GLN C 1 31  ? 45.110 -50.822  -158.418 1.00 121.96 ? 28  GLN C CD    1 
ATOM   2913  O OE1   . GLN C 1 31  ? 45.568 -50.107  -157.526 1.00 120.16 ? 28  GLN C OE1   1 
ATOM   2914  N NE2   . GLN C 1 31  ? 44.671 -52.054  -158.191 1.00 109.96 ? 28  GLN C NE2   1 
ATOM   2915  N N     . CYS C 1 32  ? 46.459 -46.143  -161.036 1.00 135.08 ? 29  CYS C N     1 
ATOM   2916  C CA    . CYS C 1 32  ? 47.464 -45.128  -161.329 1.00 134.50 ? 29  CYS C CA    1 
ATOM   2917  C C     . CYS C 1 32  ? 47.250 -43.897  -160.459 1.00 131.04 ? 29  CYS C C     1 
ATOM   2918  O O     . CYS C 1 32  ? 46.138 -43.369  -160.372 1.00 123.66 ? 29  CYS C O     1 
ATOM   2919  C CB    . CYS C 1 32  ? 47.408 -44.744  -162.808 1.00 140.69 ? 29  CYS C CB    1 
ATOM   2920  S SG    . CYS C 1 32  ? 47.973 -46.030  -163.944 1.00 148.27 ? 29  CYS C SG    1 
ATOM   2921  N N     . GLN C 1 33  ? 48.322 -43.433  -159.829 1.00 138.25 ? 30  GLN C N     1 
ATOM   2922  C CA    . GLN C 1 33  ? 48.273 -42.284  -158.939 1.00 141.26 ? 30  GLN C CA    1 
ATOM   2923  C C     . GLN C 1 33  ? 48.721 -41.019  -159.662 1.00 139.93 ? 30  GLN C C     1 
ATOM   2924  O O     . GLN C 1 33  ? 49.562 -41.058  -160.564 1.00 137.36 ? 30  GLN C O     1 
ATOM   2925  C CB    . GLN C 1 33  ? 49.143 -42.519  -157.703 1.00 139.60 ? 30  GLN C CB    1 
ATOM   2926  C CG    . GLN C 1 33  ? 48.626 -43.624  -156.797 1.00 142.81 ? 30  GLN C CG    1 
ATOM   2927  C CD    . GLN C 1 33  ? 49.529 -43.875  -155.608 1.00 176.24 ? 30  GLN C CD    1 
ATOM   2928  O OE1   . GLN C 1 33  ? 49.937 -42.943  -154.916 1.00 180.88 ? 30  GLN C OE1   1 
ATOM   2929  N NE2   . GLN C 1 33  ? 49.843 -45.142  -155.361 1.00 186.54 ? 30  GLN C NE2   1 
ATOM   2930  N N     . TYR C 1 34  ? 48.142 -39.893  -159.254 1.00 139.95 ? 31  TYR C N     1 
ATOM   2931  C CA    . TYR C 1 34  ? 48.468 -38.614  -159.869 1.00 134.04 ? 31  TYR C CA    1 
ATOM   2932  C C     . TYR C 1 34  ? 49.847 -38.143  -159.424 1.00 145.95 ? 31  TYR C C     1 
ATOM   2933  O O     . TYR C 1 34  ? 50.202 -38.230  -158.245 1.00 145.91 ? 31  TYR C O     1 
ATOM   2934  C CB    . TYR C 1 34  ? 47.419 -37.564  -159.502 1.00 131.88 ? 31  TYR C CB    1 
ATOM   2935  C CG    . TYR C 1 34  ? 46.204 -37.553  -160.399 1.00 125.65 ? 31  TYR C CG    1 
ATOM   2936  C CD1   . TYR C 1 34  ? 46.320 -37.279  -161.755 1.00 121.53 ? 31  TYR C CD1   1 
ATOM   2937  C CD2   . TYR C 1 34  ? 44.938 -37.808  -159.889 1.00 127.23 ? 31  TYR C CD2   1 
ATOM   2938  C CE1   . TYR C 1 34  ? 45.211 -37.264  -162.579 1.00 132.65 ? 31  TYR C CE1   1 
ATOM   2939  C CE2   . TYR C 1 34  ? 43.822 -37.795  -160.705 1.00 125.03 ? 31  TYR C CE2   1 
ATOM   2940  C CZ    . TYR C 1 34  ? 43.965 -37.523  -162.049 1.00 132.30 ? 31  TYR C CZ    1 
ATOM   2941  O OH    . TYR C 1 34  ? 42.858 -37.509  -162.867 1.00 134.52 ? 31  TYR C OH    1 
ATOM   2942  N N     . THR C 1 35  ? 50.627 -37.645  -160.379 1.00 141.21 ? 32  THR C N     1 
ATOM   2943  C CA    . THR C 1 35  ? 51.907 -37.036  -160.057 1.00 136.24 ? 32  THR C CA    1 
ATOM   2944  C C     . THR C 1 35  ? 51.702 -35.623  -159.516 1.00 146.22 ? 32  THR C C     1 
ATOM   2945  O O     . THR C 1 35  ? 50.626 -35.031  -159.642 1.00 139.63 ? 32  THR C O     1 
ATOM   2946  C CB    . THR C 1 35  ? 52.818 -37.003  -161.285 1.00 123.90 ? 32  THR C CB    1 
ATOM   2947  O OG1   . THR C 1 35  ? 52.157 -36.315  -162.355 1.00 144.61 ? 32  THR C OG1   1 
ATOM   2948  C CG2   . THR C 1 35  ? 53.161 -38.416  -161.733 1.00 127.66 ? 32  THR C CG2   1 
ATOM   2949  N N     . ALA C 1 36  ? 52.758 -35.088  -158.896 1.00 162.78 ? 33  ALA C N     1 
ATOM   2950  C CA    . ALA C 1 36  ? 52.679 -33.762  -158.288 1.00 153.72 ? 33  ALA C CA    1 
ATOM   2951  C C     . ALA C 1 36  ? 52.343 -32.696  -159.326 1.00 149.45 ? 33  ALA C C     1 
ATOM   2952  O O     . ALA C 1 36  ? 51.479 -31.840  -159.099 1.00 149.83 ? 33  ALA C O     1 
ATOM   2953  C CB    . ALA C 1 36  ? 53.994 -33.431  -157.581 1.00 155.15 ? 33  ALA C CB    1 
ATOM   2954  N N     . GLU C 1 37  ? 53.027 -32.731  -160.472 1.00 145.98 ? 34  GLU C N     1 
ATOM   2955  C CA    . GLU C 1 37  ? 52.801 -31.726  -161.505 1.00 152.67 ? 34  GLU C CA    1 
ATOM   2956  C C     . GLU C 1 37  ? 51.374 -31.805  -162.033 1.00 150.08 ? 34  GLU C C     1 
ATOM   2957  O O     . GLU C 1 37  ? 50.677 -30.787  -162.134 1.00 141.44 ? 34  GLU C O     1 
ATOM   2958  C CB    . GLU C 1 37  ? 53.805 -31.909  -162.645 1.00 153.33 ? 34  GLU C CB    1 
ATOM   2959  C CG    . GLU C 1 37  ? 55.213 -32.275  -162.202 1.00 145.41 ? 34  GLU C CG    1 
ATOM   2960  C CD    . GLU C 1 37  ? 55.419 -33.774  -162.104 1.00 141.29 ? 34  GLU C CD    1 
ATOM   2961  O OE1   . GLU C 1 37  ? 55.187 -34.472  -163.113 1.00 160.46 ? 34  GLU C OE1   1 
ATOM   2962  O OE2   . GLU C 1 37  ? 55.809 -34.252  -161.019 1.00 125.60 ? 34  GLU C OE2   1 
ATOM   2963  N N     . GLU C 1 38  ? 50.932 -33.014  -162.391 1.00 152.44 ? 35  GLU C N     1 
ATOM   2964  C CA    . GLU C 1 38  ? 49.565 -33.208  -162.864 1.00 146.85 ? 35  GLU C CA    1 
ATOM   2965  C C     . GLU C 1 38  ? 48.548 -32.768  -161.819 1.00 141.36 ? 35  GLU C C     1 
ATOM   2966  O O     . GLU C 1 38  ? 47.568 -32.089  -162.147 1.00 143.23 ? 35  GLU C O     1 
ATOM   2967  C CB    . GLU C 1 38  ? 49.351 -34.674  -163.242 1.00 156.56 ? 35  GLU C CB    1 
ATOM   2968  C CG    . GLU C 1 38  ? 48.084 -34.944  -164.033 1.00 161.72 ? 35  GLU C CG    1 
ATOM   2969  C CD    . GLU C 1 38  ? 47.986 -36.384  -164.498 1.00 166.92 ? 35  GLU C CD    1 
ATOM   2970  O OE1   . GLU C 1 38  ? 46.977 -36.733  -165.144 1.00 166.98 ? 35  GLU C OE1   1 
ATOM   2971  O OE2   . GLU C 1 38  ? 48.918 -37.168  -164.215 1.00 162.17 ? 35  GLU C OE2   1 
ATOM   2972  N N     . TYR C 1 39  ? 48.763 -33.150  -160.556 1.00 141.08 ? 36  TYR C N     1 
ATOM   2973  C CA    . TYR C 1 39  ? 47.861 -32.744  -159.481 1.00 141.78 ? 36  TYR C CA    1 
ATOM   2974  C C     . TYR C 1 39  ? 47.736 -31.228  -159.403 1.00 141.49 ? 36  TYR C C     1 
ATOM   2975  O O     . TYR C 1 39  ? 46.626 -30.683  -159.401 1.00 139.38 ? 36  TYR C O     1 
ATOM   2976  C CB    . TYR C 1 39  ? 48.341 -33.296  -158.137 1.00 139.62 ? 36  TYR C CB    1 
ATOM   2977  C CG    . TYR C 1 39  ? 47.816 -32.480  -156.977 1.00 149.43 ? 36  TYR C CG    1 
ATOM   2978  C CD1   . TYR C 1 39  ? 46.459 -32.452  -156.680 1.00 147.11 ? 36  TYR C CD1   1 
ATOM   2979  C CD2   . TYR C 1 39  ? 48.669 -31.701  -156.207 1.00 156.35 ? 36  TYR C CD2   1 
ATOM   2980  C CE1   . TYR C 1 39  ? 45.970 -31.691  -155.638 1.00 143.41 ? 36  TYR C CE1   1 
ATOM   2981  C CE2   . TYR C 1 39  ? 48.189 -30.937  -155.162 1.00 157.39 ? 36  TYR C CE2   1 
ATOM   2982  C CZ    . TYR C 1 39  ? 46.839 -30.936  -154.882 1.00 148.18 ? 36  TYR C CZ    1 
ATOM   2983  O OH    . TYR C 1 39  ? 46.355 -30.175  -153.845 1.00 149.29 ? 36  TYR C OH    1 
ATOM   2984  N N     . GLN C 1 40  ? 48.871 -30.532  -159.283 1.00 143.60 ? 37  GLN C N     1 
ATOM   2985  C CA    . GLN C 1 40  ? 48.831 -29.083  -159.116 1.00 147.35 ? 37  GLN C CA    1 
ATOM   2986  C C     . GLN C 1 40  ? 48.213 -28.405  -160.332 1.00 143.87 ? 37  GLN C C     1 
ATOM   2987  O O     . GLN C 1 40  ? 47.419 -27.463  -160.192 1.00 140.98 ? 37  GLN C O     1 
ATOM   2988  C CB    . GLN C 1 40  ? 50.237 -28.543  -158.852 1.00 156.73 ? 37  GLN C CB    1 
ATOM   2989  C CG    . GLN C 1 40  ? 50.257 -27.287  -157.997 1.00 159.33 ? 37  GLN C CG    1 
ATOM   2990  C CD    . GLN C 1 40  ? 51.647 -26.702  -157.850 1.00 170.26 ? 37  GLN C CD    1 
ATOM   2991  O OE1   . GLN C 1 40  ? 52.577 -27.097  -158.552 1.00 172.66 ? 37  GLN C OE1   1 
ATOM   2992  N NE2   . GLN C 1 40  ? 51.795 -25.756  -156.929 1.00 175.08 ? 37  GLN C NE2   1 
ATOM   2993  N N     . ALA C 1 41  ? 48.572 -28.863  -161.534 1.00 132.82 ? 38  ALA C N     1 
ATOM   2994  C CA    . ALA C 1 41  ? 47.999 -28.299  -162.751 1.00 131.27 ? 38  ALA C CA    1 
ATOM   2995  C C     . ALA C 1 41  ? 46.483 -28.453  -162.765 1.00 136.36 ? 38  ALA C C     1 
ATOM   2996  O O     . ALA C 1 41  ? 45.754 -27.491  -163.035 1.00 141.51 ? 38  ALA C O     1 
ATOM   2997  C CB    . ALA C 1 41  ? 48.625 -28.962  -163.977 1.00 128.87 ? 38  ALA C CB    1 
ATOM   2998  N N     . ILE C 1 42  ? 45.991 -29.663  -162.480 1.00 137.43 ? 39  ILE C N     1 
ATOM   2999  C CA    . ILE C 1 42  ? 44.551 -29.903  -162.489 1.00 141.11 ? 39  ILE C CA    1 
ATOM   3000  C C     . ILE C 1 42  ? 43.861 -29.048  -161.434 1.00 130.03 ? 39  ILE C C     1 
ATOM   3001  O O     . ILE C 1 42  ? 42.800 -28.469  -161.685 1.00 127.77 ? 39  ILE C O     1 
ATOM   3002  C CB    . ILE C 1 42  ? 44.250 -31.400  -162.289 1.00 138.36 ? 39  ILE C CB    1 
ATOM   3003  C CG1   . ILE C 1 42  ? 44.607 -32.191  -163.546 1.00 138.23 ? 39  ILE C CG1   1 
ATOM   3004  C CG2   . ILE C 1 42  ? 42.783 -31.607  -161.964 1.00 133.32 ? 39  ILE C CG2   1 
ATOM   3005  C CD1   . ILE C 1 42  ? 44.753 -33.677  -163.315 1.00 140.05 ? 39  ILE C CD1   1 
ATOM   3006  N N     . GLN C 1 43  ? 44.447 -28.961  -160.238 1.00 127.18 ? 40  GLN C N     1 
ATOM   3007  C CA    . GLN C 1 43  ? 43.855 -28.158  -159.171 1.00 127.77 ? 40  GLN C CA    1 
ATOM   3008  C C     . GLN C 1 43  ? 43.717 -26.698  -159.591 1.00 137.93 ? 40  GLN C C     1 
ATOM   3009  O O     . GLN C 1 43  ? 42.633 -26.104  -159.484 1.00 136.82 ? 40  GLN C O     1 
ATOM   3010  C CB    . GLN C 1 43  ? 44.699 -28.280  -157.900 1.00 126.58 ? 40  GLN C CB    1 
ATOM   3011  C CG    . GLN C 1 43  ? 44.273 -27.368  -156.754 1.00 132.24 ? 40  GLN C CG    1 
ATOM   3012  C CD    . GLN C 1 43  ? 43.043 -27.867  -156.015 1.00 129.53 ? 40  GLN C CD    1 
ATOM   3013  O OE1   . GLN C 1 43  ? 42.066 -28.304  -156.624 1.00 129.51 ? 40  GLN C OE1   1 
ATOM   3014  N NE2   . GLN C 1 43  ? 43.086 -27.799  -154.689 1.00 138.40 ? 40  GLN C NE2   1 
ATOM   3015  N N     . LYS C 1 44  ? 44.815 -26.097  -160.061 1.00 143.78 ? 41  LYS C N     1 
ATOM   3016  C CA    . LYS C 1 44  ? 44.774 -24.691  -160.449 1.00 138.02 ? 41  LYS C CA    1 
ATOM   3017  C C     . LYS C 1 44  ? 43.823 -24.462  -161.617 1.00 135.36 ? 41  LYS C C     1 
ATOM   3018  O O     . LYS C 1 44  ? 43.119 -23.445  -161.660 1.00 130.68 ? 41  LYS C O     1 
ATOM   3019  C CB    . LYS C 1 44  ? 46.180 -24.195  -160.786 1.00 145.78 ? 41  LYS C CB    1 
ATOM   3020  C CG    . LYS C 1 44  ? 47.158 -24.295  -159.625 1.00 156.11 ? 41  LYS C CG    1 
ATOM   3021  C CD    . LYS C 1 44  ? 48.473 -23.603  -159.940 1.00 162.10 ? 41  LYS C CD    1 
ATOM   3022  C CE    . LYS C 1 44  ? 49.483 -23.807  -158.822 1.00 167.57 ? 41  LYS C CE    1 
ATOM   3023  N NZ    . LYS C 1 44  ? 48.951 -23.368  -157.501 1.00 161.40 ? 41  LYS C NZ    1 
ATOM   3024  N N     . ALA C 1 45  ? 43.783 -25.392  -162.576 1.00 137.84 ? 42  ALA C N     1 
ATOM   3025  C CA    . ALA C 1 45  ? 42.841 -25.256  -163.682 1.00 142.41 ? 42  ALA C CA    1 
ATOM   3026  C C     . ALA C 1 45  ? 41.397 -25.408  -163.218 1.00 137.06 ? 42  ALA C C     1 
ATOM   3027  O O     . ALA C 1 45  ? 40.490 -24.826  -163.822 1.00 136.12 ? 42  ALA C O     1 
ATOM   3028  C CB    . ALA C 1 45  ? 43.162 -26.277  -164.774 1.00 137.51 ? 42  ALA C CB    1 
ATOM   3029  N N     . LEU C 1 46  ? 41.163 -26.183  -162.157 1.00 132.63 ? 43  LEU C N     1 
ATOM   3030  C CA    . LEU C 1 46  ? 39.815 -26.369  -161.639 1.00 132.78 ? 43  LEU C CA    1 
ATOM   3031  C C     . LEU C 1 46  ? 39.362 -25.208  -160.770 1.00 125.70 ? 43  LEU C C     1 
ATOM   3032  O O     . LEU C 1 46  ? 38.153 -25.024  -160.590 1.00 113.02 ? 43  LEU C O     1 
ATOM   3033  C CB    . LEU C 1 46  ? 39.729 -27.671  -160.839 1.00 147.78 ? 43  LEU C CB    1 
ATOM   3034  C CG    . LEU C 1 46  ? 39.633 -28.964  -161.649 1.00 135.47 ? 43  LEU C CG    1 
ATOM   3035  C CD1   . LEU C 1 46  ? 39.578 -30.173  -160.732 1.00 126.05 ? 43  LEU C CD1   1 
ATOM   3036  C CD2   . LEU C 1 46  ? 38.426 -28.933  -162.571 1.00 125.80 ? 43  LEU C CD2   1 
ATOM   3037  N N     . ARG C 1 47  ? 40.296 -24.428  -160.225 1.00 133.12 ? 44  ARG C N     1 
ATOM   3038  C CA    . ARG C 1 47  ? 39.892 -23.203  -159.544 1.00 127.53 ? 44  ARG C CA    1 
ATOM   3039  C C     . ARG C 1 47  ? 39.421 -22.124  -160.511 1.00 122.12 ? 44  ARG C C     1 
ATOM   3040  O O     . ARG C 1 47  ? 38.837 -21.130  -160.063 1.00 124.45 ? 44  ARG C O     1 
ATOM   3041  C CB    . ARG C 1 47  ? 41.036 -22.662  -158.685 1.00 115.93 ? 44  ARG C CB    1 
ATOM   3042  C CG    . ARG C 1 47  ? 41.220 -23.400  -157.372 1.00 111.37 ? 44  ARG C CG    1 
ATOM   3043  C CD    . ARG C 1 47  ? 42.294 -22.755  -156.513 1.00 115.77 ? 44  ARG C CD    1 
ATOM   3044  N NE    . ARG C 1 47  ? 43.640 -23.163  -156.900 1.00 121.84 ? 44  ARG C NE    1 
ATOM   3045  C CZ    . ARG C 1 47  ? 44.433 -23.917  -156.145 1.00 126.77 ? 44  ARG C CZ    1 
ATOM   3046  N NH1   . ARG C 1 47  ? 44.011 -24.348  -154.963 1.00 114.06 ? 44  ARG C NH1   1 
ATOM   3047  N NH2   . ARG C 1 47  ? 45.645 -24.244  -156.571 1.00 132.34 ? 44  ARG C NH2   1 
ATOM   3048  N N     . GLN C 1 48  ? 39.663 -22.288  -161.811 1.00 112.92 ? 45  GLN C N     1 
ATOM   3049  C CA    . GLN C 1 48  ? 39.207 -21.318  -162.797 1.00 120.01 ? 45  GLN C CA    1 
ATOM   3050  C C     . GLN C 1 48  ? 37.684 -21.268  -162.851 1.00 121.58 ? 45  GLN C C     1 
ATOM   3051  O O     . GLN C 1 48  ? 36.993 -22.233  -162.512 1.00 131.31 ? 45  GLN C O     1 
ATOM   3052  C CB    . GLN C 1 48  ? 39.759 -21.667  -164.180 1.00 126.67 ? 45  GLN C CB    1 
ATOM   3053  C CG    . GLN C 1 48  ? 41.249 -21.427  -164.343 1.00 134.13 ? 45  GLN C CG    1 
ATOM   3054  C CD    . GLN C 1 48  ? 41.706 -21.590  -165.781 1.00 142.13 ? 45  GLN C CD    1 
ATOM   3055  O OE1   . GLN C 1 48  ? 41.537 -22.652  -166.381 1.00 142.09 ? 45  GLN C OE1   1 
ATOM   3056  N NE2   . GLN C 1 48  ? 42.287 -20.536  -166.341 1.00 150.21 ? 45  GLN C NE2   1 
ATOM   3057  N N     . ARG C 1 49  ? 37.163 -20.127  -163.288 1.00 116.88 ? 46  ARG C N     1 
ATOM   3058  C CA    . ARG C 1 49  ? 35.753 -19.967  -163.606 1.00 114.48 ? 46  ARG C CA    1 
ATOM   3059  C C     . ARG C 1 49  ? 35.579 -19.892  -165.118 1.00 128.67 ? 46  ARG C C     1 
ATOM   3060  O O     . ARG C 1 49  ? 36.524 -19.610  -165.858 1.00 136.54 ? 46  ARG C O     1 
ATOM   3061  C CB    . ARG C 1 49  ? 35.177 -18.714  -162.937 1.00 125.00 ? 46  ARG C CB    1 
ATOM   3062  C CG    . ARG C 1 49  ? 34.966 -18.865  -161.438 1.00 138.47 ? 46  ARG C CG    1 
ATOM   3063  C CD    . ARG C 1 49  ? 34.424 -17.589  -160.816 1.00 151.87 ? 46  ARG C CD    1 
ATOM   3064  N NE    . ARG C 1 49  ? 33.893 -17.814  -159.474 1.00 168.10 ? 46  ARG C NE    1 
ATOM   3065  C CZ    . ARG C 1 49  ? 34.635 -17.866  -158.372 1.00 168.08 ? 46  ARG C CZ    1 
ATOM   3066  N NH1   . ARG C 1 49  ? 35.950 -17.707  -158.446 1.00 147.95 ? 46  ARG C NH1   1 
ATOM   3067  N NH2   . ARG C 1 49  ? 34.063 -18.076  -157.194 1.00 169.85 ? 46  ARG C NH2   1 
ATOM   3068  N N     . LEU C 1 50  ? 34.357 -20.146  -165.575 1.00 128.82 ? 47  LEU C N     1 
ATOM   3069  C CA    . LEU C 1 50  ? 34.083 -20.220  -167.004 1.00 139.12 ? 47  LEU C CA    1 
ATOM   3070  C C     . LEU C 1 50  ? 33.642 -18.869  -167.553 1.00 135.06 ? 47  LEU C C     1 
ATOM   3071  O O     . LEU C 1 50  ? 33.113 -18.020  -166.831 1.00 138.30 ? 47  LEU C O     1 
ATOM   3072  C CB    . LEU C 1 50  ? 33.009 -21.267  -167.310 1.00 153.59 ? 47  LEU C CB    1 
ATOM   3073  C CG    . LEU C 1 50  ? 33.341 -22.747  -167.088 1.00 150.51 ? 47  LEU C CG    1 
ATOM   3074  C CD1   . LEU C 1 50  ? 34.731 -23.087  -167.619 1.00 142.79 ? 47  LEU C CD1   1 
ATOM   3075  C CD2   . LEU C 1 50  ? 33.193 -23.145  -165.631 1.00 122.65 ? 47  LEU C CD2   1 
ATOM   3076  N N     . GLY C 1 51  ? 33.872 -18.680  -168.850 1.00 143.65 ? 48  GLY C N     1 
ATOM   3077  C CA    . GLY C 1 51  ? 33.475 -17.475  -169.537 1.00 151.07 ? 48  GLY C CA    1 
ATOM   3078  C C     . GLY C 1 51  ? 32.132 -17.622  -170.224 1.00 146.65 ? 48  GLY C C     1 
ATOM   3079  O O     . GLY C 1 51  ? 31.532 -18.701  -170.242 1.00 151.72 ? 48  GLY C O     1 
ATOM   3080  N N     . PRO C 1 52  ? 31.628 -16.525  -170.797 1.00 133.52 ? 49  PRO C N     1 
ATOM   3081  C CA    . PRO C 1 52  ? 30.339 -16.588  -171.509 1.00 132.29 ? 49  PRO C CA    1 
ATOM   3082  C C     . PRO C 1 52  ? 30.307 -17.573  -172.666 1.00 140.75 ? 49  PRO C C     1 
ATOM   3083  O O     . PRO C 1 52  ? 29.212 -17.948  -173.103 1.00 137.23 ? 49  PRO C O     1 
ATOM   3084  C CB    . PRO C 1 52  ? 30.145 -15.148  -172.002 1.00 144.84 ? 49  PRO C CB    1 
ATOM   3085  C CG    . PRO C 1 52  ? 30.913 -14.321  -171.031 1.00 156.98 ? 49  PRO C CG    1 
ATOM   3086  C CD    . PRO C 1 52  ? 32.121 -15.143  -170.671 1.00 147.71 ? 49  PRO C CD    1 
ATOM   3087  N N     . GLU C 1 53  ? 31.461 -18.006  -173.181 1.00 145.74 ? 50  GLU C N     1 
ATOM   3088  C CA    . GLU C 1 53  ? 31.474 -18.954  -174.291 1.00 152.11 ? 50  GLU C CA    1 
ATOM   3089  C C     . GLU C 1 53  ? 30.916 -20.320  -173.913 1.00 135.39 ? 50  GLU C C     1 
ATOM   3090  O O     . GLU C 1 53  ? 30.675 -21.138  -174.807 1.00 133.97 ? 50  GLU C O     1 
ATOM   3091  C CB    . GLU C 1 53  ? 32.896 -19.124  -174.838 1.00 164.21 ? 50  GLU C CB    1 
ATOM   3092  C CG    . GLU C 1 53  ? 33.614 -17.826  -175.184 1.00 177.81 ? 50  GLU C CG    1 
ATOM   3093  C CD    . GLU C 1 53  ? 34.255 -17.163  -173.979 1.00 172.01 ? 50  GLU C CD    1 
ATOM   3094  O OE1   . GLU C 1 53  ? 33.514 -16.660  -173.109 1.00 162.57 ? 50  GLU C OE1   1 
ATOM   3095  O OE2   . GLU C 1 53  ? 35.501 -17.140  -173.905 1.00 170.32 ? 50  GLU C OE2   1 
ATOM   3096  N N     . TYR C 1 54  ? 30.704 -20.583  -172.627 1.00 135.45 ? 51  TYR C N     1 
ATOM   3097  C CA    . TYR C 1 54  ? 30.162 -21.851  -172.155 1.00 128.04 ? 51  TYR C CA    1 
ATOM   3098  C C     . TYR C 1 54  ? 28.757 -21.726  -171.593 1.00 113.66 ? 51  TYR C C     1 
ATOM   3099  O O     . TYR C 1 54  ? 27.915 -22.590  -171.848 1.00 107.87 ? 51  TYR C O     1 
ATOM   3100  C CB    . TYR C 1 54  ? 31.078 -22.448  -171.083 1.00 116.49 ? 51  TYR C CB    1 
ATOM   3101  C CG    . TYR C 1 54  ? 32.403 -22.924  -171.623 1.00 120.22 ? 51  TYR C CG    1 
ATOM   3102  C CD1   . TYR C 1 54  ? 32.478 -23.607  -172.831 1.00 115.24 ? 51  TYR C CD1   1 
ATOM   3103  C CD2   . TYR C 1 54  ? 33.581 -22.686  -170.930 1.00 117.91 ? 51  TYR C CD2   1 
ATOM   3104  C CE1   . TYR C 1 54  ? 33.689 -24.041  -173.328 1.00 116.15 ? 51  TYR C CE1   1 
ATOM   3105  C CE2   . TYR C 1 54  ? 34.795 -23.116  -171.418 1.00 122.38 ? 51  TYR C CE2   1 
ATOM   3106  C CZ    . TYR C 1 54  ? 34.844 -23.793  -172.617 1.00 122.84 ? 51  TYR C CZ    1 
ATOM   3107  O OH    . TYR C 1 54  ? 36.053 -24.223  -173.106 1.00 119.57 ? 51  TYR C OH    1 
ATOM   3108  N N     . ILE C 1 55  ? 28.492 -20.670  -170.825 1.00 110.48 ? 52  ILE C N     1 
ATOM   3109  C CA    . ILE C 1 55  ? 27.185 -20.496  -170.210 1.00 103.41 ? 52  ILE C CA    1 
ATOM   3110  C C     . ILE C 1 55  ? 26.132 -20.260  -171.288 1.00 111.89 ? 52  ILE C C     1 
ATOM   3111  O O     . ILE C 1 55  ? 26.403 -19.671  -172.343 1.00 129.83 ? 52  ILE C O     1 
ATOM   3112  C CB    . ILE C 1 55  ? 27.220 -19.332  -169.203 1.00 125.26 ? 52  ILE C CB    1 
ATOM   3113  C CG1   . ILE C 1 55  ? 28.527 -19.353  -168.407 1.00 121.99 ? 52  ILE C CG1   1 
ATOM   3114  C CG2   . ILE C 1 55  ? 26.028 -19.401  -168.264 1.00 102.17 ? 52  ILE C CG2   1 
ATOM   3115  C CD1   . ILE C 1 55  ? 28.732 -20.602  -167.577 1.00 117.69 ? 52  ILE C CD1   1 
ATOM   3116  N N     . SER C 1 56  ? 24.916 -20.731  -171.020 1.00 96.53  ? 53  SER C N     1 
ATOM   3117  C CA    . SER C 1 56  ? 23.773 -20.469  -171.886 1.00 111.46 ? 53  SER C CA    1 
ATOM   3118  C C     . SER C 1 56  ? 22.600 -20.009  -171.031 1.00 111.47 ? 53  SER C C     1 
ATOM   3119  O O     . SER C 1 56  ? 22.763 -19.784  -169.827 1.00 102.35 ? 53  SER C O     1 
ATOM   3120  C CB    . SER C 1 56  ? 23.412 -21.709  -172.705 1.00 118.57 ? 53  SER C CB    1 
ATOM   3121  O OG    . SER C 1 56  ? 24.472 -22.074  -173.575 1.00 123.29 ? 53  SER C OG    1 
ATOM   3122  N N     . SER C 1 57  ? 21.420 -19.862  -171.628 1.00 110.42 ? 54  SER C N     1 
ATOM   3123  C CA    . SER C 1 57  ? 20.286 -19.303  -170.908 1.00 121.57 ? 54  SER C CA    1 
ATOM   3124  C C     . SER C 1 57  ? 18.997 -19.989  -171.329 1.00 132.23 ? 54  SER C C     1 
ATOM   3125  O O     . SER C 1 57  ? 18.809 -20.313  -172.505 1.00 130.46 ? 54  SER C O     1 
ATOM   3126  C CB    . SER C 1 57  ? 20.170 -17.793  -171.146 1.00 128.81 ? 54  SER C CB    1 
ATOM   3127  O OG    . SER C 1 57  ? 19.570 -17.516  -172.399 1.00 135.21 ? 54  SER C OG    1 
ATOM   3128  N N     . ARG C 1 58  ? 18.113 -20.206  -170.355 1.00 141.55 ? 55  ARG C N     1 
ATOM   3129  C CA    . ARG C 1 58  ? 16.792 -20.765  -170.593 1.00 150.24 ? 55  ARG C CA    1 
ATOM   3130  C C     . ARG C 1 58  ? 15.738 -19.879  -169.947 1.00 159.55 ? 55  ARG C C     1 
ATOM   3131  O O     . ARG C 1 58  ? 16.045 -18.939  -169.209 1.00 160.58 ? 55  ARG C O     1 
ATOM   3132  C CB    . ARG C 1 58  ? 16.670 -22.194  -170.047 1.00 159.99 ? 55  ARG C CB    1 
ATOM   3133  C CG    . ARG C 1 58  ? 16.577 -22.332  -168.540 1.00 165.49 ? 55  ARG C CG    1 
ATOM   3134  C CD    . ARG C 1 58  ? 16.359 -23.797  -168.181 1.00 164.86 ? 55  ARG C CD    1 
ATOM   3135  N NE    . ARG C 1 58  ? 15.054 -24.286  -168.623 1.00 169.86 ? 55  ARG C NE    1 
ATOM   3136  C CZ    . ARG C 1 58  ? 14.626 -25.534  -168.467 1.00 170.71 ? 55  ARG C CZ    1 
ATOM   3137  N NH1   . ARG C 1 58  ? 15.465 -26.481  -168.072 1.00 165.43 ? 55  ARG C NH1   1 
ATOM   3138  N NH2   . ARG C 1 58  ? 13.413 -25.873  -168.882 1.00 174.05 ? 55  ARG C NH2   1 
ATOM   3139  N N     . MET C 1 59  ? 14.481 -20.197  -170.231 1.00 161.92 ? 56  MET C N     1 
ATOM   3140  C CA    . MET C 1 59  ? 13.337 -19.514  -169.637 1.00 176.77 ? 56  MET C CA    1 
ATOM   3141  C C     . MET C 1 59  ? 12.608 -20.537  -168.773 1.00 181.86 ? 56  MET C C     1 
ATOM   3142  O O     . MET C 1 59  ? 11.901 -21.407  -169.288 1.00 182.34 ? 56  MET C O     1 
ATOM   3143  C CB    . MET C 1 59  ? 12.427 -18.922  -170.708 1.00 179.58 ? 56  MET C CB    1 
ATOM   3144  C CG    . MET C 1 59  ? 13.004 -17.695  -171.394 1.00 181.82 ? 56  MET C CG    1 
ATOM   3145  S SD    . MET C 1 59  ? 13.544 -16.429  -170.226 1.00 173.23 ? 56  MET C SD    1 
ATOM   3146  C CE    . MET C 1 59  ? 12.006 -16.050  -169.391 1.00 184.53 ? 56  MET C CE    1 
ATOM   3147  N N     . ALA C 1 60  ? 12.792 -20.431  -167.459 1.00 181.41 ? 57  ALA C N     1 
ATOM   3148  C CA    . ALA C 1 60  ? 12.128 -21.336  -166.533 1.00 186.35 ? 57  ALA C CA    1 
ATOM   3149  C C     . ALA C 1 60  ? 10.617 -21.162  -166.612 1.00 194.24 ? 57  ALA C C     1 
ATOM   3150  O O     . ALA C 1 60  ? 10.109 -20.079  -166.916 1.00 190.17 ? 57  ALA C O     1 
ATOM   3151  C CB    . ALA C 1 60  ? 12.613 -21.090  -165.103 1.00 181.15 ? 57  ALA C CB    1 
ATOM   3152  N N     . GLY C 1 61  ? 9.895  -22.245  -166.336 1.00 199.35 ? 58  GLY C N     1 
ATOM   3153  C CA    . GLY C 1 61  ? 8.449  -22.178  -166.336 1.00 204.12 ? 58  GLY C CA    1 
ATOM   3154  C C     . GLY C 1 61  ? 7.958  -21.359  -165.162 1.00 206.38 ? 58  GLY C C     1 
ATOM   3155  O O     . GLY C 1 61  ? 8.119  -21.756  -164.004 1.00 205.38 ? 58  GLY C O     1 
ATOM   3156  N N     . GLY C 1 62  ? 7.354  -20.207  -165.453 1.00 201.87 ? 59  GLY C N     1 
ATOM   3157  C CA    . GLY C 1 62  ? 6.963  -19.260  -164.435 1.00 191.34 ? 59  GLY C CA    1 
ATOM   3158  C C     . GLY C 1 62  ? 8.080  -18.397  -163.889 1.00 194.24 ? 59  GLY C C     1 
ATOM   3159  O O     . GLY C 1 62  ? 7.801  -17.319  -163.350 1.00 209.04 ? 59  GLY C O     1 
ATOM   3160  N N     . GLY C 1 63  ? 9.335  -18.827  -164.012 1.00 187.74 ? 60  GLY C N     1 
ATOM   3161  C CA    . GLY C 1 63  ? 10.457 -18.058  -163.509 1.00 185.83 ? 60  GLY C CA    1 
ATOM   3162  C C     . GLY C 1 63  ? 11.061 -17.110  -164.524 1.00 187.62 ? 60  GLY C C     1 
ATOM   3163  O O     . GLY C 1 63  ? 10.340 -16.508  -165.325 1.00 183.14 ? 60  GLY C O     1 
ATOM   3164  N N     . GLN C 1 64  ? 12.389 -16.975  -164.504 1.00 186.63 ? 61  GLN C N     1 
ATOM   3165  C CA    . GLN C 1 64  ? 13.101 -16.052  -165.383 1.00 179.09 ? 61  GLN C CA    1 
ATOM   3166  C C     . GLN C 1 64  ? 14.316 -16.711  -166.027 1.00 176.05 ? 61  GLN C C     1 
ATOM   3167  O O     . GLN C 1 64  ? 14.463 -17.937  -165.991 1.00 180.22 ? 61  GLN C O     1 
ATOM   3168  C CB    . GLN C 1 64  ? 13.531 -14.791  -164.626 1.00 178.02 ? 61  GLN C CB    1 
ATOM   3169  C CG    . GLN C 1 64  ? 12.569 -14.328  -163.551 1.00 181.73 ? 61  GLN C CG    1 
ATOM   3170  C CD    . GLN C 1 64  ? 12.936 -14.842  -162.171 1.00 185.93 ? 61  GLN C CD    1 
ATOM   3171  O OE1   . GLN C 1 64  ? 13.147 -16.038  -161.980 1.00 176.31 ? 61  GLN C OE1   1 
ATOM   3172  N NE2   . GLN C 1 64  ? 13.016 -13.936  -161.200 1.00 189.06 ? 61  GLN C NE2   1 
ATOM   3173  N N     . LYS C 1 65  ? 15.178 -15.892  -166.630 1.00 165.52 ? 62  LYS C N     1 
ATOM   3174  C CA    . LYS C 1 65  ? 16.391 -16.373  -167.283 1.00 162.93 ? 62  LYS C CA    1 
ATOM   3175  C C     . LYS C 1 65  ? 17.285 -17.129  -166.305 1.00 163.95 ? 62  LYS C C     1 
ATOM   3176  O O     . LYS C 1 65  ? 17.753 -16.563  -165.312 1.00 156.57 ? 62  LYS C O     1 
ATOM   3177  C CB    . LYS C 1 65  ? 17.141 -15.187  -167.888 1.00 162.11 ? 62  LYS C CB    1 
ATOM   3178  C CG    . LYS C 1 65  ? 18.420 -15.536  -168.621 1.00 150.24 ? 62  LYS C CG    1 
ATOM   3179  C CD    . LYS C 1 65  ? 19.065 -14.271  -169.175 1.00 138.49 ? 62  LYS C CD    1 
ATOM   3180  C CE    . LYS C 1 65  ? 20.418 -14.549  -169.813 1.00 142.68 ? 62  LYS C CE    1 
ATOM   3181  N NZ    . LYS C 1 65  ? 21.006 -13.308  -170.389 1.00 154.69 ? 62  LYS C NZ    1 
ATOM   3182  N N     . VAL C 1 66  ? 17.518 -18.409  -166.594 1.00 161.95 ? 63  VAL C N     1 
ATOM   3183  C CA    . VAL C 1 66  ? 18.412 -19.259  -165.816 1.00 152.04 ? 63  VAL C CA    1 
ATOM   3184  C C     . VAL C 1 66  ? 19.641 -19.556  -166.663 1.00 142.92 ? 63  VAL C C     1 
ATOM   3185  O O     . VAL C 1 66  ? 19.580 -19.549  -167.896 1.00 140.81 ? 63  VAL C O     1 
ATOM   3186  C CB    . VAL C 1 66  ? 17.719 -20.568  -165.373 1.00 146.87 ? 63  VAL C CB    1 
ATOM   3187  C CG1   . VAL C 1 66  ? 18.535 -21.277  -164.304 1.00 154.21 ? 63  VAL C CG1   1 
ATOM   3188  C CG2   . VAL C 1 66  ? 16.310 -20.287  -164.873 1.00 154.12 ? 63  VAL C CG2   1 
ATOM   3189  N N     . CYS C 1 67  ? 20.759 -19.831  -165.997 1.00 138.25 ? 64  CYS C N     1 
ATOM   3190  C CA    . CYS C 1 67  ? 22.031 -20.079  -166.660 1.00 137.67 ? 64  CYS C CA    1 
ATOM   3191  C C     . CYS C 1 67  ? 22.461 -21.526  -166.453 1.00 125.77 ? 64  CYS C C     1 
ATOM   3192  O O     . CYS C 1 67  ? 22.268 -22.092  -165.372 1.00 120.44 ? 64  CYS C O     1 
ATOM   3193  C CB    . CYS C 1 67  ? 23.112 -19.133  -166.133 1.00 134.71 ? 64  CYS C CB    1 
ATOM   3194  S SG    . CYS C 1 67  ? 22.567 -17.421  -165.927 1.00 159.45 ? 64  CYS C SG    1 
ATOM   3195  N N     . TYR C 1 68  ? 23.051 -22.118  -167.491 1.00 124.69 ? 65  TYR C N     1 
ATOM   3196  C CA    . TYR C 1 68  ? 23.468 -23.513  -167.444 1.00 117.41 ? 65  TYR C CA    1 
ATOM   3197  C C     . TYR C 1 68  ? 24.689 -23.719  -168.333 1.00 119.19 ? 65  TYR C C     1 
ATOM   3198  O O     . TYR C 1 68  ? 25.176 -22.794  -168.988 1.00 139.32 ? 65  TYR C O     1 
ATOM   3199  C CB    . TYR C 1 68  ? 22.329 -24.441  -167.870 1.00 122.32 ? 65  TYR C CB    1 
ATOM   3200  C CG    . TYR C 1 68  ? 21.920 -24.300  -169.321 1.00 118.77 ? 65  TYR C CG    1 
ATOM   3201  C CD1   . TYR C 1 68  ? 22.542 -25.044  -170.318 1.00 117.44 ? 65  TYR C CD1   1 
ATOM   3202  C CD2   . TYR C 1 68  ? 20.904 -23.430  -169.692 1.00 126.29 ? 65  TYR C CD2   1 
ATOM   3203  C CE1   . TYR C 1 68  ? 22.167 -24.920  -171.640 1.00 135.18 ? 65  TYR C CE1   1 
ATOM   3204  C CE2   . TYR C 1 68  ? 20.523 -23.300  -171.012 1.00 132.57 ? 65  TYR C CE2   1 
ATOM   3205  C CZ    . TYR C 1 68  ? 21.155 -24.050  -171.982 1.00 134.91 ? 65  TYR C CZ    1 
ATOM   3206  O OH    . TYR C 1 68  ? 20.781 -23.922  -173.299 1.00 139.38 ? 65  TYR C OH    1 
ATOM   3207  N N     . ILE C 1 69  ? 25.177 -24.960  -168.349 1.00 115.90 ? 66  ILE C N     1 
ATOM   3208  C CA    . ILE C 1 69  ? 26.263 -25.396  -169.219 1.00 115.84 ? 66  ILE C CA    1 
ATOM   3209  C C     . ILE C 1 69  ? 25.781 -26.621  -169.983 1.00 114.25 ? 66  ILE C C     1 
ATOM   3210  O O     . ILE C 1 69  ? 25.321 -27.594  -169.373 1.00 122.85 ? 66  ILE C O     1 
ATOM   3211  C CB    . ILE C 1 69  ? 27.546 -25.722  -168.429 1.00 96.76  ? 66  ILE C CB    1 
ATOM   3212  C CG1   . ILE C 1 69  ? 27.958 -24.534  -167.559 1.00 91.04  ? 66  ILE C CG1   1 
ATOM   3213  C CG2   . ILE C 1 69  ? 28.673 -26.098  -169.377 1.00 97.29  ? 66  ILE C CG2   1 
ATOM   3214  C CD1   . ILE C 1 69  ? 29.190 -24.792  -166.722 1.00 103.88 ? 66  ILE C CD1   1 
ATOM   3215  N N     . GLU C 1 70  ? 25.874 -26.571  -171.310 1.00 112.40 ? 67  GLU C N     1 
ATOM   3216  C CA    . GLU C 1 70  ? 25.413 -27.682  -172.135 1.00 118.48 ? 67  GLU C CA    1 
ATOM   3217  C C     . GLU C 1 70  ? 26.215 -28.948  -171.848 1.00 118.37 ? 67  GLU C C     1 
ATOM   3218  O O     . GLU C 1 70  ? 27.364 -28.898  -171.405 1.00 117.51 ? 67  GLU C O     1 
ATOM   3219  C CB    . GLU C 1 70  ? 25.506 -27.319  -173.618 1.00 126.01 ? 67  GLU C CB    1 
ATOM   3220  C CG    . GLU C 1 70  ? 24.602 -26.165  -174.026 1.00 132.20 ? 67  GLU C CG    1 
ATOM   3221  C CD    . GLU C 1 70  ? 24.606 -25.914  -175.521 1.00 140.49 ? 67  GLU C CD    1 
ATOM   3222  O OE1   . GLU C 1 70  ? 24.410 -26.880  -176.290 1.00 143.62 ? 67  GLU C OE1   1 
ATOM   3223  O OE2   . GLU C 1 70  ? 24.803 -24.750  -175.928 1.00 138.49 ? 67  GLU C OE2   1 
ATOM   3224  N N     . GLY C 1 71  ? 25.585 -30.095  -172.100 1.00 116.77 ? 68  GLY C N     1 
ATOM   3225  C CA    . GLY C 1 71  ? 26.181 -31.392  -171.835 1.00 116.14 ? 68  GLY C CA    1 
ATOM   3226  C C     . GLY C 1 71  ? 27.511 -31.635  -172.520 1.00 113.86 ? 68  GLY C C     1 
ATOM   3227  O O     . GLY C 1 71  ? 28.514 -31.910  -171.852 1.00 112.52 ? 68  GLY C O     1 
ATOM   3228  N N     . HIS C 1 72  ? 27.520 -31.556  -173.855 1.00 107.68 ? 69  HIS C N     1 
ATOM   3229  C CA    . HIS C 1 72  ? 28.754 -31.746  -174.614 1.00 109.39 ? 69  HIS C CA    1 
ATOM   3230  C C     . HIS C 1 72  ? 29.861 -30.820  -174.132 1.00 110.66 ? 69  HIS C C     1 
ATOM   3231  O O     . HIS C 1 72  ? 31.041 -31.192  -174.157 1.00 105.53 ? 69  HIS C O     1 
ATOM   3232  C CB    . HIS C 1 72  ? 28.489 -31.528  -176.105 1.00 120.45 ? 69  HIS C CB    1 
ATOM   3233  C CG    . HIS C 1 72  ? 27.830 -30.220  -176.416 1.00 125.69 ? 69  HIS C CG    1 
ATOM   3234  N ND1   . HIS C 1 72  ? 28.534 -29.113  -176.838 1.00 122.89 ? 69  HIS C ND1   1 
ATOM   3235  C CD2   . HIS C 1 72  ? 26.531 -29.842  -176.367 1.00 123.71 ? 69  HIS C CD2   1 
ATOM   3236  C CE1   . HIS C 1 72  ? 27.698 -28.109  -177.035 1.00 125.92 ? 69  HIS C CE1   1 
ATOM   3237  N NE2   . HIS C 1 72  ? 26.476 -28.526  -176.757 1.00 122.51 ? 69  HIS C NE2   1 
ATOM   3238  N N     . ARG C 1 73  ? 29.500 -29.612  -173.690 1.00 115.69 ? 70  ARG C N     1 
ATOM   3239  C CA    . ARG C 1 73  ? 30.484 -28.700  -173.119 1.00 121.82 ? 70  ARG C CA    1 
ATOM   3240  C C     . ARG C 1 73  ? 31.177 -29.329  -171.916 1.00 114.50 ? 70  ARG C C     1 
ATOM   3241  O O     . ARG C 1 73  ? 32.410 -29.355  -171.843 1.00 108.86 ? 70  ARG C O     1 
ATOM   3242  C CB    . ARG C 1 73  ? 29.810 -27.383  -172.728 1.00 123.27 ? 70  ARG C CB    1 
ATOM   3243  C CG    . ARG C 1 73  ? 29.131 -26.665  -173.885 1.00 122.24 ? 70  ARG C CG    1 
ATOM   3244  C CD    . ARG C 1 73  ? 30.093 -25.750  -174.628 1.00 120.56 ? 70  ARG C CD    1 
ATOM   3245  N NE    . ARG C 1 73  ? 29.482 -25.174  -175.824 1.00 123.88 ? 70  ARG C NE    1 
ATOM   3246  C CZ    . ARG C 1 73  ? 28.572 -24.204  -175.812 1.00 125.82 ? 70  ARG C CZ    1 
ATOM   3247  N NH1   . ARG C 1 73  ? 28.158 -23.689  -174.662 1.00 125.30 ? 70  ARG C NH1   1 
ATOM   3248  N NH2   . ARG C 1 73  ? 28.074 -23.747  -176.953 1.00 133.32 ? 70  ARG C NH2   1 
ATOM   3249  N N     . VAL C 1 74  ? 30.395 -29.834  -170.958 1.00 110.64 ? 71  VAL C N     1 
ATOM   3250  C CA    . VAL C 1 74  ? 30.968 -30.456  -169.765 1.00 107.70 ? 71  VAL C CA    1 
ATOM   3251  C C     . VAL C 1 74  ? 31.765 -31.700  -170.137 1.00 109.10 ? 71  VAL C C     1 
ATOM   3252  O O     . VAL C 1 74  ? 32.799 -31.998  -169.526 1.00 105.67 ? 71  VAL C O     1 
ATOM   3253  C CB    . VAL C 1 74  ? 29.862 -30.783  -168.745 1.00 100.48 ? 71  VAL C CB    1 
ATOM   3254  C CG1   . VAL C 1 74  ? 30.469 -31.039  -167.374 1.00 91.63  ? 71  VAL C CG1   1 
ATOM   3255  C CG2   . VAL C 1 74  ? 28.845 -29.658  -168.680 1.00 121.89 ? 71  VAL C CG2   1 
ATOM   3256  N N     . ILE C 1 75  ? 31.285 -32.457  -171.125 1.00 115.95 ? 72  ILE C N     1 
ATOM   3257  C CA    . ILE C 1 75  ? 31.995 -33.661  -171.554 1.00 111.82 ? 72  ILE C CA    1 
ATOM   3258  C C     . ILE C 1 75  ? 33.384 -33.300  -172.070 1.00 120.58 ? 72  ILE C C     1 
ATOM   3259  O O     . ILE C 1 75  ? 34.389 -33.919  -171.695 1.00 115.78 ? 72  ILE C O     1 
ATOM   3260  C CB    . ILE C 1 75  ? 31.173 -34.419  -172.612 1.00 102.75 ? 72  ILE C CB    1 
ATOM   3261  C CG1   . ILE C 1 75  ? 29.955 -35.080  -171.963 1.00 84.81  ? 72  ILE C CG1   1 
ATOM   3262  C CG2   . ILE C 1 75  ? 32.034 -35.457  -173.317 1.00 86.90  ? 72  ILE C CG2   1 
ATOM   3263  C CD1   . ILE C 1 75  ? 29.274 -36.111  -172.837 1.00 84.79  ? 72  ILE C CD1   1 
ATOM   3264  N N     . ASN C 1 76  ? 33.456 -32.290  -172.943 1.00 116.28 ? 73  ASN C N     1 
ATOM   3265  C CA    . ASN C 1 76  ? 34.747 -31.834  -173.451 1.00 111.50 ? 73  ASN C CA    1 
ATOM   3266  C C     . ASN C 1 76  ? 35.616 -31.273  -172.332 1.00 114.17 ? 73  ASN C C     1 
ATOM   3267  O O     . ASN C 1 76  ? 36.831 -31.507  -172.303 1.00 113.21 ? 73  ASN C O     1 
ATOM   3268  C CB    . ASN C 1 76  ? 34.541 -30.785  -174.543 1.00 119.62 ? 73  ASN C CB    1 
ATOM   3269  C CG    . ASN C 1 76  ? 34.010 -31.383  -175.830 1.00 118.17 ? 73  ASN C CG    1 
ATOM   3270  O OD1   . ASN C 1 76  ? 34.482 -32.424  -176.285 1.00 115.85 ? 73  ASN C OD1   1 
ATOM   3271  N ND2   . ASN C 1 76  ? 33.024 -30.722  -176.426 1.00 115.80 ? 73  ASN C ND2   1 
ATOM   3272  N N     . LEU C 1 77  ? 35.013 -30.517  -171.410 1.00 112.86 ? 74  LEU C N     1 
ATOM   3273  C CA    . LEU C 1 77  ? 35.763 -29.982  -170.277 1.00 117.37 ? 74  LEU C CA    1 
ATOM   3274  C C     . LEU C 1 77  ? 36.416 -31.097  -169.472 1.00 116.86 ? 74  LEU C C     1 
ATOM   3275  O O     . LEU C 1 77  ? 37.585 -30.990  -169.085 1.00 119.78 ? 74  LEU C O     1 
ATOM   3276  C CB    . LEU C 1 77  ? 34.844 -29.145  -169.386 1.00 121.61 ? 74  LEU C CB    1 
ATOM   3277  C CG    . LEU C 1 77  ? 34.411 -27.773  -169.909 1.00 114.06 ? 74  LEU C CG    1 
ATOM   3278  C CD1   . LEU C 1 77  ? 33.224 -27.243  -169.117 1.00 100.76 ? 74  LEU C CD1   1 
ATOM   3279  C CD2   . LEU C 1 77  ? 35.571 -26.790  -169.862 1.00 130.61 ? 74  LEU C CD2   1 
ATOM   3280  N N     . ALA C 1 78  ? 35.677 -32.177  -169.212 1.00 109.30 ? 75  ALA C N     1 
ATOM   3281  C CA    . ALA C 1 78  ? 36.237 -33.299  -168.465 1.00 111.09 ? 75  ALA C CA    1 
ATOM   3282  C C     . ALA C 1 78  ? 37.328 -34.002  -169.265 1.00 107.13 ? 75  ALA C C     1 
ATOM   3283  O O     . ALA C 1 78  ? 38.414 -34.285  -168.740 1.00 109.37 ? 75  ALA C O     1 
ATOM   3284  C CB    . ALA C 1 78  ? 35.129 -34.279  -168.084 1.00 112.41 ? 75  ALA C CB    1 
ATOM   3285  N N     . ASN C 1 79  ? 37.054 -34.293  -170.541 1.00 102.11 ? 76  ASN C N     1 
ATOM   3286  C CA    . ASN C 1 79  ? 38.041 -34.950  -171.391 1.00 111.76 ? 76  ASN C CA    1 
ATOM   3287  C C     . ASN C 1 79  ? 39.318 -34.135  -171.539 1.00 119.66 ? 76  ASN C C     1 
ATOM   3288  O O     . ASN C 1 79  ? 40.370 -34.704  -171.849 1.00 119.79 ? 76  ASN C O     1 
ATOM   3289  C CB    . ASN C 1 79  ? 37.446 -35.235  -172.771 1.00 109.37 ? 76  ASN C CB    1 
ATOM   3290  C CG    . ASN C 1 79  ? 36.522 -36.436  -172.770 1.00 116.57 ? 76  ASN C CG    1 
ATOM   3291  O OD1   . ASN C 1 79  ? 36.968 -37.577  -172.647 1.00 114.26 ? 76  ASN C OD1   1 
ATOM   3292  N ND2   . ASN C 1 79  ? 35.225 -36.186  -172.907 1.00 117.81 ? 76  ASN C ND2   1 
ATOM   3293  N N     . GLU C 1 80  ? 39.250 -32.820  -171.346 1.00 121.23 ? 77  GLU C N     1 
ATOM   3294  C CA    . GLU C 1 80  ? 40.457 -32.001  -171.366 1.00 122.10 ? 77  GLU C CA    1 
ATOM   3295  C C     . GLU C 1 80  ? 41.138 -31.955  -170.002 1.00 122.78 ? 77  GLU C C     1 
ATOM   3296  O O     . GLU C 1 80  ? 42.358 -32.128  -169.911 1.00 122.43 ? 77  GLU C O     1 
ATOM   3297  C CB    . GLU C 1 80  ? 40.128 -30.584  -171.848 1.00 122.55 ? 77  GLU C CB    1 
ATOM   3298  C CG    . GLU C 1 80  ? 39.666 -30.504  -173.299 1.00 133.05 ? 77  GLU C CG    1 
ATOM   3299  C CD    . GLU C 1 80  ? 40.658 -31.118  -174.272 1.00 137.07 ? 77  GLU C CD    1 
ATOM   3300  O OE1   . GLU C 1 80  ? 41.880 -31.009  -174.033 1.00 134.75 ? 77  GLU C OE1   1 
ATOM   3301  O OE2   . GLU C 1 80  ? 40.216 -31.710  -175.278 1.00 135.79 ? 77  GLU C OE2   1 
ATOM   3302  N N     . MET C 1 81  ? 40.367 -31.720  -168.937 1.00 122.95 ? 78  MET C N     1 
ATOM   3303  C CA    . MET C 1 81  ? 40.941 -31.602  -167.599 1.00 121.19 ? 78  MET C CA    1 
ATOM   3304  C C     . MET C 1 81  ? 41.653 -32.882  -167.180 1.00 127.19 ? 78  MET C C     1 
ATOM   3305  O O     . MET C 1 81  ? 42.777 -32.840  -166.666 1.00 127.69 ? 78  MET C O     1 
ATOM   3306  C CB    . MET C 1 81  ? 39.850 -31.241  -166.590 1.00 117.23 ? 78  MET C CB    1 
ATOM   3307  C CG    . MET C 1 81  ? 39.380 -29.800  -166.664 1.00 143.77 ? 78  MET C CG    1 
ATOM   3308  S SD    . MET C 1 81  ? 40.623 -28.613  -166.118 1.00 193.25 ? 78  MET C SD    1 
ATOM   3309  C CE    . MET C 1 81  ? 41.396 -29.506  -164.771 1.00 141.00 ? 78  MET C CE    1 
ATOM   3310  N N     . PHE C 1 82  ? 41.015 -34.034  -167.389 1.00 126.05 ? 79  PHE C N     1 
ATOM   3311  C CA    . PHE C 1 82  ? 41.576 -35.302  -166.940 1.00 110.77 ? 79  PHE C CA    1 
ATOM   3312  C C     . PHE C 1 82  ? 42.139 -36.162  -168.058 1.00 109.37 ? 79  PHE C C     1 
ATOM   3313  O O     . PHE C 1 82  ? 43.072 -36.931  -167.814 1.00 114.13 ? 79  PHE C O     1 
ATOM   3314  C CB    . PHE C 1 82  ? 40.518 -36.114  -166.182 1.00 98.29  ? 79  PHE C CB    1 
ATOM   3315  C CG    . PHE C 1 82  ? 39.808 -35.332  -165.119 1.00 98.32  ? 79  PHE C CG    1 
ATOM   3316  C CD1   . PHE C 1 82  ? 38.471 -35.000  -165.258 1.00 99.11  ? 79  PHE C CD1   1 
ATOM   3317  C CD2   . PHE C 1 82  ? 40.484 -34.917  -163.984 1.00 91.29  ? 79  PHE C CD2   1 
ATOM   3318  C CE1   . PHE C 1 82  ? 37.821 -34.276  -164.280 1.00 95.85  ? 79  PHE C CE1   1 
ATOM   3319  C CE2   . PHE C 1 82  ? 39.840 -34.194  -163.003 1.00 94.91  ? 79  PHE C CE2   1 
ATOM   3320  C CZ    . PHE C 1 82  ? 38.506 -33.872  -163.150 1.00 100.78 ? 79  PHE C CZ    1 
ATOM   3321  N N     . GLY C 1 83  ? 41.610 -36.051  -169.265 1.00 106.26 ? 80  GLY C N     1 
ATOM   3322  C CA    . GLY C 1 83  ? 42.011 -36.905  -170.360 1.00 103.43 ? 80  GLY C CA    1 
ATOM   3323  C C     . GLY C 1 83  ? 40.881 -37.821  -170.801 1.00 102.49 ? 80  GLY C C     1 
ATOM   3324  O O     . GLY C 1 83  ? 39.879 -38.011  -170.106 1.00 106.73 ? 80  GLY C O     1 
ATOM   3325  N N     . TYR C 1 84  ? 41.052 -38.394  -171.994 1.00 107.25 ? 81  TYR C N     1 
ATOM   3326  C CA    . TYR C 1 84  ? 40.074 -39.359  -172.483 1.00 110.45 ? 81  TYR C CA    1 
ATOM   3327  C C     . TYR C 1 84  ? 40.059 -40.618  -171.627 1.00 108.87 ? 81  TYR C C     1 
ATOM   3328  O O     . TYR C 1 84  ? 39.036 -41.310  -171.562 1.00 112.18 ? 81  TYR C O     1 
ATOM   3329  C CB    . TYR C 1 84  ? 40.367 -39.719  -173.939 1.00 104.71 ? 81  TYR C CB    1 
ATOM   3330  C CG    . TYR C 1 84  ? 41.530 -40.670  -174.109 1.00 101.31 ? 81  TYR C CG    1 
ATOM   3331  C CD1   . TYR C 1 84  ? 42.840 -40.216  -174.048 1.00 106.83 ? 81  TYR C CD1   1 
ATOM   3332  C CD2   . TYR C 1 84  ? 41.317 -42.028  -174.310 1.00 114.64 ? 81  TYR C CD2   1 
ATOM   3333  C CE1   . TYR C 1 84  ? 43.906 -41.084  -174.196 1.00 106.05 ? 81  TYR C CE1   1 
ATOM   3334  C CE2   . TYR C 1 84  ? 42.376 -42.904  -174.452 1.00 119.32 ? 81  TYR C CE2   1 
ATOM   3335  C CZ    . TYR C 1 84  ? 43.668 -42.427  -174.398 1.00 108.16 ? 81  TYR C CZ    1 
ATOM   3336  O OH    . TYR C 1 84  ? 44.725 -43.296  -174.544 1.00 109.21 ? 81  TYR C OH    1 
ATOM   3337  N N     . ASN C 1 85  ? 41.176 -40.928  -170.968 1.00 100.53 ? 82  ASN C N     1 
ATOM   3338  C CA    . ASN C 1 85  ? 41.285 -42.101  -170.109 1.00 94.14  ? 82  ASN C CA    1 
ATOM   3339  C C     . ASN C 1 85  ? 41.641 -41.731  -168.673 1.00 96.44  ? 82  ASN C C     1 
ATOM   3340  O O     . ASN C 1 85  ? 42.087 -42.591  -167.907 1.00 96.68  ? 82  ASN C O     1 
ATOM   3341  C CB    . ASN C 1 85  ? 42.316 -43.078  -170.679 1.00 92.99  ? 82  ASN C CB    1 
ATOM   3342  C CG    . ASN C 1 85  ? 43.732 -42.539  -170.608 1.00 94.15  ? 82  ASN C CG    1 
ATOM   3343  O OD1   . ASN C 1 85  ? 43.982 -41.376  -170.927 1.00 95.22  ? 82  ASN C OD1   1 
ATOM   3344  N ND2   . ASN C 1 85  ? 44.666 -43.382  -170.185 1.00 107.06 ? 82  ASN C ND2   1 
ATOM   3345  N N     . GLY C 1 86  ? 41.454 -40.470  -168.292 1.00 90.83  ? 83  GLY C N     1 
ATOM   3346  C CA    . GLY C 1 86  ? 41.744 -40.042  -166.938 1.00 102.10 ? 83  GLY C CA    1 
ATOM   3347  C C     . GLY C 1 86  ? 40.521 -39.998  -166.045 1.00 98.64  ? 83  GLY C C     1 
ATOM   3348  O O     . GLY C 1 86  ? 40.637 -40.023  -164.816 1.00 99.36  ? 83  GLY C O     1 
ATOM   3349  N N     . TRP C 1 87  ? 39.341 -39.930  -166.654 1.00 86.12  ? 84  TRP C N     1 
ATOM   3350  C CA    . TRP C 1 87  ? 38.084 -39.924  -165.923 1.00 87.13  ? 84  TRP C CA    1 
ATOM   3351  C C     . TRP C 1 87  ? 37.180 -41.020  -166.468 1.00 94.84  ? 84  TRP C C     1 
ATOM   3352  O O     . TRP C 1 87  ? 37.359 -41.504  -167.589 1.00 90.50  ? 84  TRP C O     1 
ATOM   3353  C CB    . TRP C 1 87  ? 37.378 -38.566  -166.017 1.00 82.25  ? 84  TRP C CB    1 
ATOM   3354  C CG    . TRP C 1 87  ? 36.725 -38.335  -167.339 1.00 78.13  ? 84  TRP C CG    1 
ATOM   3355  C CD1   . TRP C 1 87  ? 37.346 -38.168  -168.540 1.00 96.40  ? 84  TRP C CD1   1 
ATOM   3356  C CD2   . TRP C 1 87  ? 35.320 -38.240  -167.596 1.00 63.81  ? 84  TRP C CD2   1 
ATOM   3357  N NE1   . TRP C 1 87  ? 36.416 -37.980  -169.532 1.00 98.78  ? 84  TRP C NE1   1 
ATOM   3358  C CE2   . TRP C 1 87  ? 35.163 -38.019  -168.978 1.00 87.16  ? 84  TRP C CE2   1 
ATOM   3359  C CE3   . TRP C 1 87  ? 34.179 -38.321  -166.793 1.00 74.74  ? 84  TRP C CE3   1 
ATOM   3360  C CZ2   . TRP C 1 87  ? 33.912 -37.877  -169.574 1.00 93.14  ? 84  TRP C CZ2   1 
ATOM   3361  C CZ3   . TRP C 1 87  ? 32.938 -38.181  -167.386 1.00 79.74  ? 84  TRP C CZ3   1 
ATOM   3362  C CH2   . TRP C 1 87  ? 32.815 -37.962  -168.763 1.00 80.02  ? 84  TRP C CH2   1 
ATOM   3363  N N     . ALA C 1 88  ? 36.200 -41.406  -165.656 1.00 88.20  ? 85  ALA C N     1 
ATOM   3364  C CA    . ALA C 1 88  ? 35.247 -42.437  -166.032 1.00 70.81  ? 85  ALA C CA    1 
ATOM   3365  C C     . ALA C 1 88  ? 33.955 -42.213  -165.263 1.00 73.35  ? 85  ALA C C     1 
ATOM   3366  O O     . ALA C 1 88  ? 33.975 -41.769  -164.113 1.00 77.00  ? 85  ALA C O     1 
ATOM   3367  C CB    . ALA C 1 88  ? 35.796 -43.840  -165.753 1.00 80.76  ? 85  ALA C CB    1 
ATOM   3368  N N     . HIS C 1 89  ? 32.831 -42.516  -165.910 1.00 77.55  ? 86  HIS C N     1 
ATOM   3369  C CA    . HIS C 1 89  ? 31.525 -42.405  -165.277 1.00 87.13  ? 86  HIS C CA    1 
ATOM   3370  C C     . HIS C 1 89  ? 30.742 -43.697  -165.472 1.00 96.75  ? 86  HIS C C     1 
ATOM   3371  O O     . HIS C 1 89  ? 31.023 -44.493  -166.373 1.00 76.89  ? 86  HIS C O     1 
ATOM   3372  C CB    . HIS C 1 89  ? 30.727 -41.202  -165.814 1.00 68.58  ? 86  HIS C CB    1 
ATOM   3373  C CG    . HIS C 1 89  ? 30.034 -41.456  -167.118 1.00 72.68  ? 86  HIS C CG    1 
ATOM   3374  N ND1   . HIS C 1 89  ? 28.812 -40.899  -167.427 1.00 73.48  ? 86  HIS C ND1   1 
ATOM   3375  C CD2   . HIS C 1 89  ? 30.402 -42.179  -168.202 1.00 82.72  ? 86  HIS C CD2   1 
ATOM   3376  C CE1   . HIS C 1 89  ? 28.448 -41.284  -168.637 1.00 82.09  ? 86  HIS C CE1   1 
ATOM   3377  N NE2   . HIS C 1 89  ? 29.395 -42.061  -169.130 1.00 87.15  ? 86  HIS C NE2   1 
ATOM   3378  N N     . SER C 1 90  ? 29.756 -43.900  -164.601 1.00 89.08  ? 87  SER C N     1 
ATOM   3379  C CA    . SER C 1 90  ? 28.936 -45.101  -164.633 1.00 81.72  ? 87  SER C CA    1 
ATOM   3380  C C     . SER C 1 90  ? 27.564 -44.790  -164.056 1.00 77.49  ? 87  SER C C     1 
ATOM   3381  O O     . SER C 1 90  ? 27.411 -43.890  -163.225 1.00 74.89  ? 87  SER C O     1 
ATOM   3382  C CB    . SER C 1 90  ? 29.591 -46.248  -163.853 1.00 82.73  ? 87  SER C CB    1 
ATOM   3383  O OG    . SER C 1 90  ? 30.044 -45.808  -162.585 1.00 51.69  ? 87  SER C OG    1 
ATOM   3384  N N     . ILE C 1 91  ? 26.566 -45.547  -164.507 1.00 71.46  ? 88  ILE C N     1 
ATOM   3385  C CA    . ILE C 1 91  ? 25.192 -45.396  -164.041 1.00 59.72  ? 88  ILE C CA    1 
ATOM   3386  C C     . ILE C 1 91  ? 24.991 -46.398  -162.909 1.00 81.90  ? 88  ILE C C     1 
ATOM   3387  O O     . ILE C 1 91  ? 24.851 -47.600  -163.144 1.00 106.26 ? 88  ILE C O     1 
ATOM   3388  C CB    . ILE C 1 91  ? 24.182 -45.609  -165.168 1.00 67.02  ? 88  ILE C CB    1 
ATOM   3389  C CG1   . ILE C 1 91  ? 24.551 -44.761  -166.387 1.00 70.68  ? 88  ILE C CG1   1 
ATOM   3390  C CG2   . ILE C 1 91  ? 22.776 -45.280  -164.688 1.00 72.51  ? 88  ILE C CG2   1 
ATOM   3391  C CD1   . ILE C 1 91  ? 23.636 -44.977  -167.573 1.00 63.32  ? 88  ILE C CD1   1 
ATOM   3392  N N     . THR C 1 92  ? 24.982 -45.901  -161.670 1.00 79.53  ? 89  THR C N     1 
ATOM   3393  C CA    . THR C 1 92  ? 24.770 -46.784  -160.527 1.00 75.59  ? 89  THR C CA    1 
ATOM   3394  C C     . THR C 1 92  ? 23.360 -47.360  -160.529 1.00 78.19  ? 89  THR C C     1 
ATOM   3395  O O     . THR C 1 92  ? 23.173 -48.561  -160.298 1.00 102.97 ? 89  THR C O     1 
ATOM   3396  C CB    . THR C 1 92  ? 25.045 -46.033  -159.224 1.00 78.18  ? 89  THR C CB    1 
ATOM   3397  O OG1   . THR C 1 92  ? 26.448 -45.763  -159.116 1.00 92.59  ? 89  THR C OG1   1 
ATOM   3398  C CG2   . THR C 1 92  ? 24.602 -46.857  -158.024 1.00 73.43  ? 89  THR C CG2   1 
ATOM   3399  N N     . GLN C 1 93  ? 22.358 -46.526  -160.801 1.00 65.32  ? 90  GLN C N     1 
ATOM   3400  C CA    . GLN C 1 93  ? 20.977 -46.979  -160.875 1.00 72.82  ? 90  GLN C CA    1 
ATOM   3401  C C     . GLN C 1 93  ? 20.137 -45.891  -161.524 1.00 72.46  ? 90  GLN C C     1 
ATOM   3402  O O     . GLN C 1 93  ? 20.331 -44.705  -161.247 1.00 75.05  ? 90  GLN C O     1 
ATOM   3403  C CB    . GLN C 1 93  ? 20.420 -47.323  -159.486 1.00 72.11  ? 90  GLN C CB    1 
ATOM   3404  C CG    . GLN C 1 93  ? 18.983 -47.821  -159.504 1.00 85.53  ? 90  GLN C CG    1 
ATOM   3405  C CD    . GLN C 1 93  ? 18.492 -48.247  -158.136 1.00 119.68 ? 90  GLN C CD    1 
ATOM   3406  O OE1   . GLN C 1 93  ? 18.482 -47.457  -157.192 1.00 137.54 ? 90  GLN C OE1   1 
ATOM   3407  N NE2   . GLN C 1 93  ? 18.083 -49.507  -158.020 1.00 124.14 ? 90  GLN C NE2   1 
ATOM   3408  N N     . GLN C 1 94  ? 19.211 -46.304  -162.386 1.00 73.41  ? 91  GLN C N     1 
ATOM   3409  C CA    . GLN C 1 94  ? 18.228 -45.411  -162.984 1.00 71.58  ? 91  GLN C CA    1 
ATOM   3410  C C     . GLN C 1 94  ? 16.840 -45.979  -162.731 1.00 84.66  ? 91  GLN C C     1 
ATOM   3411  O O     . GLN C 1 94  ? 16.588 -47.155  -163.012 1.00 90.58  ? 91  GLN C O     1 
ATOM   3412  C CB    . GLN C 1 94  ? 18.460 -45.240  -164.487 1.00 73.98  ? 91  GLN C CB    1 
ATOM   3413  C CG    . GLN C 1 94  ? 17.231 -44.749  -165.237 1.00 79.38  ? 91  GLN C CG    1 
ATOM   3414  C CD    . GLN C 1 94  ? 17.540 -44.318  -166.654 1.00 82.82  ? 91  GLN C CD    1 
ATOM   3415  O OE1   . GLN C 1 94  ? 16.904 -44.771  -167.605 1.00 81.74  ? 91  GLN C OE1   1 
ATOM   3416  N NE2   . GLN C 1 94  ? 18.518 -43.436  -166.804 1.00 85.49  ? 91  GLN C NE2   1 
ATOM   3417  N N     . ASN C 1 95  ? 15.946 -45.145  -162.205 1.00 78.80  ? 92  ASN C N     1 
ATOM   3418  C CA    . ASN C 1 95  ? 14.606 -45.573  -161.832 1.00 91.33  ? 92  ASN C CA    1 
ATOM   3419  C C     . ASN C 1 95  ? 13.587 -44.574  -162.356 1.00 83.19  ? 92  ASN C C     1 
ATOM   3420  O O     . ASN C 1 95  ? 13.712 -43.369  -162.113 1.00 83.93  ? 92  ASN C O     1 
ATOM   3421  C CB    . ASN C 1 95  ? 14.476 -45.713  -160.311 1.00 106.36 ? 92  ASN C CB    1 
ATOM   3422  C CG    . ASN C 1 95  ? 13.091 -46.155  -159.883 1.00 120.08 ? 92  ASN C CG    1 
ATOM   3423  O OD1   . ASN C 1 95  ? 12.715 -47.314  -160.059 1.00 125.85 ? 92  ASN C OD1   1 
ATOM   3424  N ND2   . ASN C 1 95  ? 12.323 -45.231  -159.316 1.00 99.95  ? 92  ASN C ND2   1 
ATOM   3425  N N     . VAL C 1 96  ? 12.587 -45.077  -163.073 1.00 82.75  ? 93  VAL C N     1 
ATOM   3426  C CA    . VAL C 1 96  ? 11.498 -44.244  -163.573 1.00 70.46  ? 93  VAL C CA    1 
ATOM   3427  C C     . VAL C 1 96  ? 10.542 -43.963  -162.420 1.00 82.39  ? 93  VAL C C     1 
ATOM   3428  O O     . VAL C 1 96  ? 9.963  -44.888  -161.840 1.00 88.84  ? 93  VAL C O     1 
ATOM   3429  C CB    . VAL C 1 96  ? 10.772 -44.921  -164.743 1.00 51.81  ? 93  VAL C CB    1 
ATOM   3430  C CG1   . VAL C 1 96  ? 9.636  -44.043  -165.239 1.00 60.43  ? 93  VAL C CG1   1 
ATOM   3431  C CG2   . VAL C 1 96  ? 11.749 -45.224  -165.869 1.00 69.51  ? 93  VAL C CG2   1 
ATOM   3432  N N     . ASP C 1 97  ? 10.377 -42.683  -162.085 1.00 89.21  ? 94  ASP C N     1 
ATOM   3433  C CA    . ASP C 1 97  ? 9.546  -42.318  -160.942 1.00 72.52  ? 94  ASP C CA    1 
ATOM   3434  C C     . ASP C 1 97  ? 8.066  -42.525  -161.241 1.00 68.13  ? 94  ASP C C     1 
ATOM   3435  O O     . ASP C 1 97  ? 7.341  -43.127  -160.440 1.00 94.53  ? 94  ASP C O     1 
ATOM   3436  C CB    . ASP C 1 97  ? 9.819  -40.869  -160.537 1.00 71.95  ? 94  ASP C CB    1 
ATOM   3437  C CG    . ASP C 1 97  ? 11.087 -40.724  -159.719 1.00 89.41  ? 94  ASP C CG    1 
ATOM   3438  O OD1   . ASP C 1 97  ? 11.245 -41.469  -158.728 1.00 72.83  ? 94  ASP C OD1   1 
ATOM   3439  O OD2   . ASP C 1 97  ? 11.928 -39.871  -160.070 1.00 102.93 ? 94  ASP C OD2   1 
ATOM   3440  N N     . PHE C 1 98  ? 7.597  -42.039  -162.387 1.00 70.54  ? 95  PHE C N     1 
ATOM   3441  C CA    . PHE C 1 98  ? 6.178  -42.128  -162.698 1.00 75.60  ? 95  PHE C CA    1 
ATOM   3442  C C     . PHE C 1 98  ? 5.975  -42.028  -164.202 1.00 77.38  ? 95  PHE C C     1 
ATOM   3443  O O     . PHE C 1 98  ? 6.824  -41.510  -164.932 1.00 77.00  ? 95  PHE C O     1 
ATOM   3444  C CB    . PHE C 1 98  ? 5.383  -41.030  -161.981 1.00 97.14  ? 95  PHE C CB    1 
ATOM   3445  C CG    . PHE C 1 98  ? 5.777  -39.633  -162.383 1.00 108.89 ? 95  PHE C CG    1 
ATOM   3446  C CD1   . PHE C 1 98  ? 5.188  -39.016  -163.476 1.00 95.75  ? 95  PHE C CD1   1 
ATOM   3447  C CD2   . PHE C 1 98  ? 6.745  -38.942  -161.674 1.00 98.74  ? 95  PHE C CD2   1 
ATOM   3448  C CE1   . PHE C 1 98  ? 5.552  -37.736  -163.849 1.00 92.70  ? 95  PHE C CE1   1 
ATOM   3449  C CE2   . PHE C 1 98  ? 7.112  -37.662  -162.042 1.00 96.96  ? 95  PHE C CE2   1 
ATOM   3450  C CZ    . PHE C 1 98  ? 6.515  -37.058  -163.130 1.00 100.91 ? 95  PHE C CZ    1 
ATOM   3451  N N     . VAL C 1 99  ? 4.823  -42.528  -164.647 1.00 84.96  ? 96  VAL C N     1 
ATOM   3452  C CA    . VAL C 1 99  ? 4.354  -42.386  -166.022 1.00 93.91  ? 96  VAL C CA    1 
ATOM   3453  C C     . VAL C 1 99  ? 2.848  -42.172  -165.940 1.00 100.64 ? 96  VAL C C     1 
ATOM   3454  O O     . VAL C 1 99  ? 2.108  -43.094  -165.578 1.00 90.64  ? 96  VAL C O     1 
ATOM   3455  C CB    . VAL C 1 99  ? 4.682  -43.605  -166.898 1.00 82.61  ? 96  VAL C CB    1 
ATOM   3456  C CG1   . VAL C 1 99  ? 3.872  -43.565  -168.186 1.00 84.30  ? 96  VAL C CG1   1 
ATOM   3457  C CG2   . VAL C 1 99  ? 6.169  -43.653  -167.216 1.00 76.37  ? 96  VAL C CG2   1 
ATOM   3458  N N     . ASP C 1 100 ? 2.396  -40.963  -166.261 1.00 112.18 ? 97  ASP C N     1 
ATOM   3459  C CA    . ASP C 1 100 ? 0.989  -40.608  -166.178 1.00 110.83 ? 97  ASP C CA    1 
ATOM   3460  C C     . ASP C 1 100 ? 0.472  -40.178  -167.544 1.00 120.62 ? 97  ASP C C     1 
ATOM   3461  O O     . ASP C 1 100 ? 1.239  -39.821  -168.442 1.00 120.93 ? 97  ASP C O     1 
ATOM   3462  C CB    . ASP C 1 100 ? 0.757  -39.487  -165.156 1.00 104.64 ? 97  ASP C CB    1 
ATOM   3463  C CG    . ASP C 1 100 ? 1.370  -39.794  -163.804 1.00 123.67 ? 97  ASP C CG    1 
ATOM   3464  O OD1   . ASP C 1 100 ? 1.147  -40.909  -163.286 1.00 141.52 ? 97  ASP C OD1   1 
ATOM   3465  O OD2   . ASP C 1 100 ? 2.073  -38.918  -163.257 1.00 118.32 ? 97  ASP C OD2   1 
ATOM   3466  N N     . LEU C 1 101 ? -0.851 -40.217  -167.686 1.00 124.84 ? 98  LEU C N     1 
ATOM   3467  C CA    . LEU C 1 101 ? -1.517 -39.885  -168.940 1.00 112.81 ? 98  LEU C CA    1 
ATOM   3468  C C     . LEU C 1 101 ? -2.717 -39.005  -168.630 1.00 117.69 ? 98  LEU C C     1 
ATOM   3469  O O     . LEU C 1 101 ? -3.661 -39.452  -167.972 1.00 117.98 ? 98  LEU C O     1 
ATOM   3470  C CB    . LEU C 1 101 ? -1.953 -41.149  -169.687 1.00 95.17  ? 98  LEU C CB    1 
ATOM   3471  C CG    . LEU C 1 101 ? -2.730 -40.944  -170.989 1.00 118.91 ? 98  LEU C CG    1 
ATOM   3472  C CD1   . LEU C 1 101 ? -1.980 -40.008  -171.926 1.00 125.03 ? 98  LEU C CD1   1 
ATOM   3473  C CD2   . LEU C 1 101 ? -3.004 -42.279  -171.664 1.00 126.81 ? 98  LEU C CD2   1 
ATOM   3474  N N     . ASN C 1 102 ? -2.681 -37.761  -169.101 1.00 138.05 ? 99  ASN C N     1 
ATOM   3475  C CA    . ASN C 1 102 ? -3.771 -36.809  -168.911 1.00 140.68 ? 99  ASN C CA    1 
ATOM   3476  C C     . ASN C 1 102 ? -4.273 -36.376  -170.282 1.00 148.25 ? 99  ASN C C     1 
ATOM   3477  O O     . ASN C 1 102 ? -3.615 -35.581  -170.963 1.00 157.05 ? 99  ASN C O     1 
ATOM   3478  C CB    . ASN C 1 102 ? -3.315 -35.607  -168.085 1.00 135.55 ? 99  ASN C CB    1 
ATOM   3479  C CG    . ASN C 1 102 ? -2.802 -36.002  -166.714 1.00 134.71 ? 99  ASN C CG    1 
ATOM   3480  O OD1   . ASN C 1 102 ? -3.327 -36.918  -166.083 1.00 135.28 ? 99  ASN C OD1   1 
ATOM   3481  N ND2   . ASN C 1 102 ? -1.772 -35.307  -166.245 1.00 131.78 ? 99  ASN C ND2   1 
ATOM   3482  N N     . ASN C 1 103 ? -5.441 -36.890  -170.665 1.00 147.37 ? 100 ASN C N     1 
ATOM   3483  C CA    . ASN C 1 103 ? -6.140 -36.562  -171.912 1.00 156.62 ? 100 ASN C CA    1 
ATOM   3484  C C     . ASN C 1 103 ? -5.175 -36.448  -173.094 1.00 158.67 ? 100 ASN C C     1 
ATOM   3485  O O     . ASN C 1 103 ? -5.102 -35.432  -173.785 1.00 158.22 ? 100 ASN C O     1 
ATOM   3486  C CB    . ASN C 1 103 ? -6.986 -35.292  -171.767 1.00 160.30 ? 100 ASN C CB    1 
ATOM   3487  C CG    . ASN C 1 103 ? -6.244 -34.154  -171.093 1.00 165.20 ? 100 ASN C CG    1 
ATOM   3488  O OD1   . ASN C 1 103 ? -6.244 -34.037  -169.867 1.00 162.71 ? 100 ASN C OD1   1 
ATOM   3489  N ND2   . ASN C 1 103 ? -5.607 -33.306  -171.893 1.00 155.48 ? 100 ASN C ND2   1 
ATOM   3490  N N     . GLY C 1 104 ? -4.427 -37.529  -173.316 1.00 147.22 ? 101 GLY C N     1 
ATOM   3491  C CA    . GLY C 1 104 ? -3.566 -37.644  -174.472 1.00 145.42 ? 101 GLY C CA    1 
ATOM   3492  C C     . GLY C 1 104 ? -2.144 -37.163  -174.283 1.00 139.53 ? 101 GLY C C     1 
ATOM   3493  O O     . GLY C 1 104 ? -1.318 -37.360  -175.184 1.00 134.34 ? 101 GLY C O     1 
ATOM   3494  N N     . ALA C 1 105 ? -1.827 -36.541  -173.151 1.00 129.68 ? 102 ALA C N     1 
ATOM   3495  C CA    . ALA C 1 105 ? -0.491 -36.027  -172.882 1.00 130.36 ? 102 ALA C CA    1 
ATOM   3496  C C     . ALA C 1 105 ? 0.216  -36.939  -171.891 1.00 125.20 ? 102 ALA C C     1 
ATOM   3497  O O     . ALA C 1 105 ? -0.354 -37.298  -170.855 1.00 128.57 ? 102 ALA C O     1 
ATOM   3498  C CB    . ALA C 1 105 ? -0.551 -34.597  -172.340 1.00 135.21 ? 102 ALA C CB    1 
ATOM   3499  N N     . PHE C 1 106 ? 1.454  -37.309  -172.209 1.00 130.40 ? 103 PHE C N     1 
ATOM   3500  C CA    . PHE C 1 106 ? 2.249  -38.201  -171.375 1.00 110.58 ? 103 PHE C CA    1 
ATOM   3501  C C     . PHE C 1 106 ? 3.222  -37.379  -170.540 1.00 110.63 ? 103 PHE C C     1 
ATOM   3502  O O     . PHE C 1 106 ? 4.038  -36.628  -171.087 1.00 116.34 ? 103 PHE C O     1 
ATOM   3503  C CB    . PHE C 1 106 ? 3.004  -39.216  -172.233 1.00 108.25 ? 103 PHE C CB    1 
ATOM   3504  C CG    . PHE C 1 106 ? 2.210  -40.451  -172.547 1.00 105.36 ? 103 PHE C CG    1 
ATOM   3505  C CD1   . PHE C 1 106 ? 1.543  -41.135  -171.546 1.00 108.65 ? 103 PHE C CD1   1 
ATOM   3506  C CD2   . PHE C 1 106 ? 2.126  -40.924  -173.846 1.00 109.46 ? 103 PHE C CD2   1 
ATOM   3507  C CE1   . PHE C 1 106 ? 0.811  -42.272  -171.832 1.00 104.61 ? 103 PHE C CE1   1 
ATOM   3508  C CE2   . PHE C 1 106 ? 1.395  -42.059  -174.139 1.00 113.30 ? 103 PHE C CE2   1 
ATOM   3509  C CZ    . PHE C 1 106 ? 0.736  -42.734  -173.131 1.00 101.13 ? 103 PHE C CZ    1 
ATOM   3510  N N     . TYR C 1 107 ? 3.136  -37.524  -169.220 1.00 99.50  ? 104 TYR C N     1 
ATOM   3511  C CA    . TYR C 1 107 ? 4.016  -36.839  -168.278 1.00 100.49 ? 104 TYR C CA    1 
ATOM   3512  C C     . TYR C 1 107 ? 4.904  -37.891  -167.626 1.00 94.38  ? 104 TYR C C     1 
ATOM   3513  O O     . TYR C 1 107 ? 4.413  -38.760  -166.898 1.00 103.18 ? 104 TYR C O     1 
ATOM   3514  C CB    . TYR C 1 107 ? 3.219  -36.063  -167.231 1.00 113.37 ? 104 TYR C CB    1 
ATOM   3515  C CG    . TYR C 1 107 ? 2.218  -35.079  -167.801 1.00 124.85 ? 104 TYR C CG    1 
ATOM   3516  C CD1   . TYR C 1 107 ? 0.994  -35.508  -168.299 1.00 127.99 ? 104 TYR C CD1   1 
ATOM   3517  C CD2   . TYR C 1 107 ? 2.501  -33.720  -167.840 1.00 134.00 ? 104 TYR C CD2   1 
ATOM   3518  C CE1   . TYR C 1 107 ? 0.080  -34.610  -168.819 1.00 140.48 ? 104 TYR C CE1   1 
ATOM   3519  C CE2   . TYR C 1 107 ? 1.594  -32.815  -168.358 1.00 137.21 ? 104 TYR C CE2   1 
ATOM   3520  C CZ    . TYR C 1 107 ? 0.386  -33.265  -168.846 1.00 146.41 ? 104 TYR C CZ    1 
ATOM   3521  O OH    . TYR C 1 107 ? -0.520 -32.367  -169.363 1.00 147.44 ? 104 TYR C OH    1 
ATOM   3522  N N     . VAL C 1 108 ? 6.206  -37.815  -167.890 1.00 87.17  ? 105 VAL C N     1 
ATOM   3523  C CA    . VAL C 1 108 ? 7.161  -38.828  -167.457 1.00 84.45  ? 105 VAL C CA    1 
ATOM   3524  C C     . VAL C 1 108 ? 8.242  -38.163  -166.616 1.00 89.65  ? 105 VAL C C     1 
ATOM   3525  O O     . VAL C 1 108 ? 8.837  -37.163  -167.035 1.00 96.13  ? 105 VAL C O     1 
ATOM   3526  C CB    . VAL C 1 108 ? 7.785  -39.566  -168.655 1.00 80.39  ? 105 VAL C CB    1 
ATOM   3527  C CG1   . VAL C 1 108 ? 8.855  -40.530  -168.178 1.00 91.59  ? 105 VAL C CG1   1 
ATOM   3528  C CG2   . VAL C 1 108 ? 6.711  -40.300  -169.440 1.00 97.96  ? 105 VAL C CG2   1 
ATOM   3529  N N     . GLY C 1 109 ? 8.493  -38.721  -165.434 1.00 83.40  ? 106 GLY C N     1 
ATOM   3530  C CA    . GLY C 1 109 ? 9.617  -38.312  -164.616 1.00 80.20  ? 106 GLY C CA    1 
ATOM   3531  C C     . GLY C 1 109 ? 10.594 -39.451  -164.415 1.00 80.89  ? 106 GLY C C     1 
ATOM   3532  O O     . GLY C 1 109 ? 10.187 -40.566  -164.075 1.00 95.61  ? 106 GLY C O     1 
ATOM   3533  N N     . VAL C 1 110 ? 11.883 -39.190  -164.619 1.00 73.40  ? 107 VAL C N     1 
ATOM   3534  C CA    . VAL C 1 110 ? 12.917 -40.217  -164.539 1.00 76.19  ? 107 VAL C CA    1 
ATOM   3535  C C     . VAL C 1 110 ? 14.138 -39.616  -163.858 1.00 83.75  ? 107 VAL C C     1 
ATOM   3536  O O     . VAL C 1 110 ? 14.494 -38.459  -164.104 1.00 89.67  ? 107 VAL C O     1 
ATOM   3537  C CB    . VAL C 1 110 ? 13.279 -40.771  -165.936 1.00 77.29  ? 107 VAL C CB    1 
ATOM   3538  C CG1   . VAL C 1 110 ? 14.502 -41.675  -165.864 1.00 60.53  ? 107 VAL C CG1   1 
ATOM   3539  C CG2   . VAL C 1 110 ? 12.106 -41.533  -166.535 1.00 86.44  ? 107 VAL C CG2   1 
ATOM   3540  N N     . CYS C 1 111 ? 14.778 -40.406  -162.998 1.00 79.29  ? 108 CYS C N     1 
ATOM   3541  C CA    . CYS C 1 111 ? 15.975 -39.986  -162.288 1.00 78.75  ? 108 CYS C CA    1 
ATOM   3542  C C     . CYS C 1 111 ? 17.076 -41.016  -162.495 1.00 73.00  ? 108 CYS C C     1 
ATOM   3543  O O     . CYS C 1 111 ? 16.810 -42.195  -162.745 1.00 82.34  ? 108 CYS C O     1 
ATOM   3544  C CB    . CYS C 1 111 ? 15.709 -39.801  -160.788 1.00 86.34  ? 108 CYS C CB    1 
ATOM   3545  S SG    . CYS C 1 111 ? 15.675 -41.336  -159.837 1.00 93.00  ? 108 CYS C SG    1 
ATOM   3546  N N     . ALA C 1 112 ? 18.320 -40.555  -162.388 1.00 62.90  ? 109 ALA C N     1 
ATOM   3547  C CA    . ALA C 1 112 ? 19.481 -41.413  -162.558 1.00 70.80  ? 109 ALA C CA    1 
ATOM   3548  C C     . ALA C 1 112 ? 20.542 -41.032  -161.535 1.00 69.73  ? 109 ALA C C     1 
ATOM   3549  O O     . ALA C 1 112 ? 20.557 -39.917  -161.010 1.00 72.85  ? 109 ALA C O     1 
ATOM   3550  C CB    . ALA C 1 112 ? 20.054 -41.319  -163.979 1.00 69.50  ? 109 ALA C CB    1 
ATOM   3551  N N     . PHE C 1 113 ? 21.434 -41.980  -161.256 1.00 71.11  ? 110 PHE C N     1 
ATOM   3552  C CA    . PHE C 1 113 ? 22.523 -41.796  -160.302 1.00 69.24  ? 110 PHE C CA    1 
ATOM   3553  C C     . PHE C 1 113 ? 23.832 -42.096  -161.021 1.00 76.22  ? 110 PHE C C     1 
ATOM   3554  O O     . PHE C 1 113 ? 24.148 -43.261  -161.283 1.00 96.50  ? 110 PHE C O     1 
ATOM   3555  C CB    . PHE C 1 113 ? 22.350 -42.702  -159.081 1.00 72.53  ? 110 PHE C CB    1 
ATOM   3556  C CG    . PHE C 1 113 ? 21.164 -42.352  -158.222 1.00 73.12  ? 110 PHE C CG    1 
ATOM   3557  C CD1   . PHE C 1 113 ? 19.874 -42.636  -158.641 1.00 68.53  ? 110 PHE C CD1   1 
ATOM   3558  C CD2   . PHE C 1 113 ? 21.342 -41.749  -156.988 1.00 69.77  ? 110 PHE C CD2   1 
ATOM   3559  C CE1   . PHE C 1 113 ? 18.785 -42.317  -157.851 1.00 58.44  ? 110 PHE C CE1   1 
ATOM   3560  C CE2   . PHE C 1 113 ? 20.257 -41.430  -156.193 1.00 68.55  ? 110 PHE C CE2   1 
ATOM   3561  C CZ    . PHE C 1 113 ? 18.977 -41.713  -156.626 1.00 65.24  ? 110 PHE C CZ    1 
ATOM   3562  N N     . VAL C 1 114 ? 24.590 -41.050  -161.337 1.00 67.43  ? 111 VAL C N     1 
ATOM   3563  C CA    . VAL C 1 114 ? 25.845 -41.178  -162.070 1.00 70.79  ? 111 VAL C CA    1 
ATOM   3564  C C     . VAL C 1 114 ? 27.009 -41.032  -161.103 1.00 69.03  ? 111 VAL C C     1 
ATOM   3565  O O     . VAL C 1 114 ? 27.006 -40.155  -160.229 1.00 64.92  ? 111 VAL C O     1 
ATOM   3566  C CB    . VAL C 1 114 ? 25.934 -40.139  -163.204 1.00 75.58  ? 111 VAL C CB    1 
ATOM   3567  C CG1   . VAL C 1 114 ? 27.116 -40.442  -164.110 1.00 80.53  ? 111 VAL C CG1   1 
ATOM   3568  C CG2   . VAL C 1 114 ? 24.639 -40.118  -164.000 1.00 78.91  ? 111 VAL C CG2   1 
ATOM   3569  N N     . ARG C 1 115 ? 28.009 -41.897  -161.257 1.00 71.99  ? 112 ARG C N     1 
ATOM   3570  C CA    . ARG C 1 115 ? 29.219 -41.876  -160.444 1.00 79.08  ? 112 ARG C CA    1 
ATOM   3571  C C     . ARG C 1 115 ? 30.419 -41.667  -161.354 1.00 82.23  ? 112 ARG C C     1 
ATOM   3572  O O     . ARG C 1 115 ? 30.712 -42.515  -162.203 1.00 86.85  ? 112 ARG C O     1 
ATOM   3573  C CB    . ARG C 1 115 ? 29.380 -43.175  -159.650 1.00 85.41  ? 112 ARG C CB    1 
ATOM   3574  C CG    . ARG C 1 115 ? 30.760 -43.335  -159.030 1.00 83.64  ? 112 ARG C CG    1 
ATOM   3575  C CD    . ARG C 1 115 ? 30.982 -44.738  -158.491 1.00 96.82  ? 112 ARG C CD    1 
ATOM   3576  N NE    . ARG C 1 115 ? 32.400 -45.089  -158.476 1.00 99.23  ? 112 ARG C NE    1 
ATOM   3577  C CZ    . ARG C 1 115 ? 33.130 -45.217  -157.373 1.00 100.07 ? 112 ARG C CZ    1 
ATOM   3578  N NH1   . ARG C 1 115 ? 32.578 -45.024  -156.183 1.00 109.33 ? 112 ARG C NH1   1 
ATOM   3579  N NH2   . ARG C 1 115 ? 34.413 -45.540  -157.460 1.00 79.39  ? 112 ARG C NH2   1 
ATOM   3580  N N     . VAL C 1 116 ? 31.111 -40.546  -161.174 1.00 79.61  ? 113 VAL C N     1 
ATOM   3581  C CA    . VAL C 1 116 ? 32.319 -40.239  -161.931 1.00 73.17  ? 113 VAL C CA    1 
ATOM   3582  C C     . VAL C 1 116 ? 33.523 -40.627  -161.088 1.00 76.88  ? 113 VAL C C     1 
ATOM   3583  O O     . VAL C 1 116 ? 33.545 -40.392  -159.875 1.00 79.11  ? 113 VAL C O     1 
ATOM   3584  C CB    . VAL C 1 116 ? 32.375 -38.750  -162.321 1.00 83.12  ? 113 VAL C CB    1 
ATOM   3585  C CG1   . VAL C 1 116 ? 33.520 -38.502  -163.287 1.00 86.38  ? 113 VAL C CG1   1 
ATOM   3586  C CG2   . VAL C 1 116 ? 31.056 -38.315  -162.932 1.00 83.72  ? 113 VAL C CG2   1 
ATOM   3587  N N     . GLN C 1 117 ? 34.528 -41.219  -161.729 1.00 73.87  ? 114 GLN C N     1 
ATOM   3588  C CA    . GLN C 1 117 ? 35.701 -41.715  -161.026 1.00 73.25  ? 114 GLN C CA    1 
ATOM   3589  C C     . GLN C 1 117 ? 36.955 -41.389  -161.821 1.00 75.65  ? 114 GLN C C     1 
ATOM   3590  O O     . GLN C 1 117 ? 36.987 -41.560  -163.042 1.00 72.19  ? 114 GLN C O     1 
ATOM   3591  C CB    . GLN C 1 117 ? 35.618 -43.229  -160.794 1.00 82.17  ? 114 GLN C CB    1 
ATOM   3592  C CG    . GLN C 1 117 ? 36.839 -43.812  -160.097 1.00 92.69  ? 114 GLN C CG    1 
ATOM   3593  C CD    . GLN C 1 117 ? 36.823 -45.328  -160.062 1.00 99.66  ? 114 GLN C CD    1 
ATOM   3594  O OE1   . GLN C 1 117 ? 36.619 -45.982  -161.085 1.00 100.74 ? 114 GLN C OE1   1 
ATOM   3595  N NE2   . GLN C 1 117 ? 37.036 -45.894  -158.880 1.00 123.00 ? 114 GLN C NE2   1 
ATOM   3596  N N     . LEU C 1 118 ? 37.979 -40.911  -161.121 1.00 85.92  ? 115 LEU C N     1 
ATOM   3597  C CA    . LEU C 1 118 ? 39.271 -40.631  -161.725 1.00 95.69  ? 115 LEU C CA    1 
ATOM   3598  C C     . LEU C 1 118 ? 40.192 -41.839  -161.590 1.00 89.99  ? 115 LEU C C     1 
ATOM   3599  O O     . LEU C 1 118 ? 39.993 -42.712  -160.742 1.00 100.79 ? 115 LEU C O     1 
ATOM   3600  C CB    . LEU C 1 118 ? 39.913 -39.403  -161.079 1.00 102.32 ? 115 LEU C CB    1 
ATOM   3601  C CG    . LEU C 1 118 ? 39.030 -38.163  -160.935 1.00 93.60  ? 115 LEU C CG    1 
ATOM   3602  C CD1   . LEU C 1 118 ? 39.796 -37.034  -160.262 1.00 95.41  ? 115 LEU C CD1   1 
ATOM   3603  C CD2   . LEU C 1 118 ? 38.499 -37.723  -162.292 1.00 94.30  ? 115 LEU C CD2   1 
ATOM   3604  N N     . LYS C 1 119 ? 41.212 -41.880  -162.452 1.00 86.24  ? 116 LYS C N     1 
ATOM   3605  C CA    . LYS C 1 119 ? 42.133 -43.013  -162.479 1.00 94.01  ? 116 LYS C CA    1 
ATOM   3606  C C     . LYS C 1 119 ? 42.862 -43.216  -161.155 1.00 102.99 ? 116 LYS C C     1 
ATOM   3607  O O     . LYS C 1 119 ? 43.422 -44.294  -160.931 1.00 112.45 ? 116 LYS C O     1 
ATOM   3608  C CB    . LYS C 1 119 ? 43.150 -42.843  -163.610 1.00 100.59 ? 116 LYS C CB    1 
ATOM   3609  C CG    . LYS C 1 119 ? 43.878 -41.511  -163.611 1.00 104.41 ? 116 LYS C CG    1 
ATOM   3610  C CD    . LYS C 1 119 ? 44.782 -41.391  -164.826 1.00 100.30 ? 116 LYS C CD    1 
ATOM   3611  C CE    . LYS C 1 119 ? 45.312 -39.978  -164.990 1.00 122.14 ? 116 LYS C CE    1 
ATOM   3612  N NZ    . LYS C 1 119 ? 46.032 -39.806  -166.283 1.00 146.49 ? 116 LYS C NZ    1 
ATOM   3613  N N     . ASP C 1 120 ? 42.877 -42.213  -160.278 1.00 96.66  ? 117 ASP C N     1 
ATOM   3614  C CA    . ASP C 1 120 ? 43.509 -42.372  -158.975 1.00 110.79 ? 117 ASP C CA    1 
ATOM   3615  C C     . ASP C 1 120 ? 42.602 -43.049  -157.957 1.00 108.03 ? 117 ASP C C     1 
ATOM   3616  O O     . ASP C 1 120 ? 43.083 -43.444  -156.890 1.00 107.84 ? 117 ASP C O     1 
ATOM   3617  C CB    . ASP C 1 120 ? 43.957 -41.013  -158.430 1.00 117.75 ? 117 ASP C CB    1 
ATOM   3618  C CG    . ASP C 1 120 ? 42.803 -40.193  -157.892 1.00 120.13 ? 117 ASP C CG    1 
ATOM   3619  O OD1   . ASP C 1 120 ? 41.743 -40.150  -158.551 1.00 115.46 ? 117 ASP C OD1   1 
ATOM   3620  O OD2   . ASP C 1 120 ? 42.954 -39.597  -156.805 1.00 117.31 ? 117 ASP C OD2   1 
ATOM   3621  N N     . GLY C 1 121 ? 41.312 -43.190  -158.257 1.00 98.33  ? 118 GLY C N     1 
ATOM   3622  C CA    . GLY C 1 121 ? 40.353 -43.787  -157.355 1.00 95.61  ? 118 GLY C CA    1 
ATOM   3623  C C     . GLY C 1 121 ? 39.340 -42.814  -156.793 1.00 96.94  ? 118 GLY C C     1 
ATOM   3624  O O     . GLY C 1 121 ? 38.294 -43.251  -156.293 1.00 93.46  ? 118 GLY C O     1 
ATOM   3625  N N     . SER C 1 122 ? 39.621 -41.513  -156.851 1.00 97.27  ? 119 SER C N     1 
ATOM   3626  C CA    . SER C 1 122 ? 38.662 -40.518  -156.394 1.00 96.41  ? 119 SER C CA    1 
ATOM   3627  C C     . SER C 1 122 ? 37.367 -40.630  -157.189 1.00 94.18  ? 119 SER C C     1 
ATOM   3628  O O     . SER C 1 122 ? 37.366 -40.976  -158.373 1.00 97.08  ? 119 SER C O     1 
ATOM   3629  C CB    . SER C 1 122 ? 39.246 -39.111  -156.531 1.00 104.70 ? 119 SER C CB    1 
ATOM   3630  O OG    . SER C 1 122 ? 38.303 -38.126  -156.144 1.00 109.58 ? 119 SER C OG    1 
ATOM   3631  N N     . TYR C 1 123 ? 36.252 -40.329  -156.527 1.00 82.46  ? 120 TYR C N     1 
ATOM   3632  C CA    . TYR C 1 123 ? 34.946 -40.562  -157.122 1.00 78.50  ? 120 TYR C CA    1 
ATOM   3633  C C     . TYR C 1 123 ? 33.936 -39.570  -156.567 1.00 75.36  ? 120 TYR C C     1 
ATOM   3634  O O     . TYR C 1 123 ? 34.016 -39.158  -155.408 1.00 82.90  ? 120 TYR C O     1 
ATOM   3635  C CB    . TYR C 1 123 ? 34.475 -42.000  -156.871 1.00 90.50  ? 120 TYR C CB    1 
ATOM   3636  C CG    . TYR C 1 123 ? 34.342 -42.354  -155.405 1.00 90.07  ? 120 TYR C CG    1 
ATOM   3637  C CD1   . TYR C 1 123 ? 33.149 -42.148  -154.723 1.00 88.19  ? 120 TYR C CD1   1 
ATOM   3638  C CD2   . TYR C 1 123 ? 35.412 -42.895  -154.704 1.00 85.43  ? 120 TYR C CD2   1 
ATOM   3639  C CE1   . TYR C 1 123 ? 33.027 -42.467  -153.385 1.00 76.01  ? 120 TYR C CE1   1 
ATOM   3640  C CE2   . TYR C 1 123 ? 35.298 -43.219  -153.366 1.00 81.72  ? 120 TYR C CE2   1 
ATOM   3641  C CZ    . TYR C 1 123 ? 34.103 -43.003  -152.712 1.00 78.08  ? 120 TYR C CZ    1 
ATOM   3642  O OH    . TYR C 1 123 ? 33.983 -43.323  -151.380 1.00 80.54  ? 120 TYR C OH    1 
ATOM   3643  N N     . HIS C 1 124 ? 32.979 -39.195  -157.411 1.00 64.44  ? 121 HIS C N     1 
ATOM   3644  C CA    . HIS C 1 124 ? 31.862 -38.359  -157.001 1.00 82.24  ? 121 HIS C CA    1 
ATOM   3645  C C     . HIS C 1 124 ? 30.591 -38.884  -157.650 1.00 71.35  ? 121 HIS C C     1 
ATOM   3646  O O     . HIS C 1 124 ? 30.593 -39.250  -158.829 1.00 80.38  ? 121 HIS C O     1 
ATOM   3647  C CB    . HIS C 1 124 ? 32.084 -36.887  -157.378 1.00 111.96 ? 121 HIS C CB    1 
ATOM   3648  C CG    . HIS C 1 124 ? 33.147 -36.210  -156.569 1.00 105.46 ? 121 HIS C CG    1 
ATOM   3649  N ND1   . HIS C 1 124 ? 34.169 -35.485  -157.141 1.00 91.81  ? 121 HIS C ND1   1 
ATOM   3650  C CD2   . HIS C 1 124 ? 33.346 -36.148  -155.231 1.00 91.18  ? 121 HIS C CD2   1 
ATOM   3651  C CE1   . HIS C 1 124 ? 34.953 -35.006  -156.191 1.00 99.49  ? 121 HIS C CE1   1 
ATOM   3652  N NE2   . HIS C 1 124 ? 34.475 -35.394  -155.023 1.00 95.37  ? 121 HIS C NE2   1 
ATOM   3653  N N     . GLU C 1 125 ? 29.512 -38.926  -156.873 1.00 68.53  ? 122 GLU C N     1 
ATOM   3654  C CA    . GLU C 1 125 ? 28.242 -39.472  -157.325 1.00 82.14  ? 122 GLU C CA    1 
ATOM   3655  C C     . GLU C 1 125 ? 27.123 -38.498  -156.991 1.00 79.35  ? 122 GLU C C     1 
ATOM   3656  O O     . GLU C 1 125 ? 27.089 -37.932  -155.895 1.00 91.20  ? 122 GLU C O     1 
ATOM   3657  C CB    . GLU C 1 125 ? 27.967 -40.839  -156.681 1.00 104.01 ? 122 GLU C CB    1 
ATOM   3658  C CG    . GLU C 1 125 ? 26.600 -41.423  -156.995 1.00 93.39  ? 122 GLU C CG    1 
ATOM   3659  C CD    . GLU C 1 125 ? 26.362 -42.749  -156.299 1.00 99.09  ? 122 GLU C CD    1 
ATOM   3660  O OE1   . GLU C 1 125 ? 26.768 -42.887  -155.125 1.00 102.55 ? 122 GLU C OE1   1 
ATOM   3661  O OE2   . GLU C 1 125 ? 25.770 -43.654  -156.925 1.00 91.31  ? 122 GLU C OE2   1 
ATOM   3662  N N     . ASP C 1 126 ? 26.211 -38.303  -157.940 1.00 71.67  ? 123 ASP C N     1 
ATOM   3663  C CA    . ASP C 1 126 ? 25.118 -37.360  -157.753 1.00 75.38  ? 123 ASP C CA    1 
ATOM   3664  C C     . ASP C 1 126 ? 23.950 -37.769  -158.638 1.00 80.25  ? 123 ASP C C     1 
ATOM   3665  O O     . ASP C 1 126 ? 24.095 -38.584  -159.552 1.00 88.06  ? 123 ASP C O     1 
ATOM   3666  C CB    . ASP C 1 126 ? 25.554 -35.925  -158.061 1.00 84.02  ? 123 ASP C CB    1 
ATOM   3667  C CG    . ASP C 1 126 ? 24.823 -34.904  -157.218 1.00 100.65 ? 123 ASP C CG    1 
ATOM   3668  O OD1   . ASP C 1 126 ? 23.573 -34.904  -157.236 1.00 105.17 ? 123 ASP C OD1   1 
ATOM   3669  O OD2   . ASP C 1 126 ? 25.494 -34.100  -156.538 1.00 119.91 ? 123 ASP C OD2   1 
ATOM   3670  N N     . VAL C 1 127 ? 22.787 -37.189  -158.349 1.00 67.52  ? 124 VAL C N     1 
ATOM   3671  C CA    . VAL C 1 127 ? 21.556 -37.535  -159.044 1.00 76.58  ? 124 VAL C CA    1 
ATOM   3672  C C     . VAL C 1 127 ? 21.374 -36.626  -160.254 1.00 80.84  ? 124 VAL C C     1 
ATOM   3673  O O     . VAL C 1 127 ? 21.972 -35.553  -160.358 1.00 90.87  ? 124 VAL C O     1 
ATOM   3674  C CB    . VAL C 1 127 ? 20.340 -37.450  -158.095 1.00 74.51  ? 124 VAL C CB    1 
ATOM   3675  C CG1   . VAL C 1 127 ? 19.138 -38.194  -158.667 1.00 92.15  ? 124 VAL C CG1   1 
ATOM   3676  C CG2   . VAL C 1 127 ? 20.701 -38.008  -156.747 1.00 80.96  ? 124 VAL C CG2   1 
ATOM   3677  N N     . GLY C 1 128 ? 20.541 -37.073  -161.182 1.00 69.31  ? 125 GLY C N     1 
ATOM   3678  C CA    . GLY C 1 128 ? 20.089 -36.234  -162.278 1.00 68.75  ? 125 GLY C CA    1 
ATOM   3679  C C     . GLY C 1 128 ? 18.688 -36.636  -162.668 1.00 75.90  ? 125 GLY C C     1 
ATOM   3680  O O     . GLY C 1 128 ? 18.284 -37.790  -162.490 1.00 84.31  ? 125 GLY C O     1 
ATOM   3681  N N     . TYR C 1 129 ? 17.935 -35.677  -163.198 1.00 78.58  ? 126 TYR C N     1 
ATOM   3682  C CA    . TYR C 1 129 ? 16.530 -35.885  -163.501 1.00 66.88  ? 126 TYR C CA    1 
ATOM   3683  C C     . TYR C 1 129 ? 16.244 -35.602  -164.968 1.00 72.50  ? 126 TYR C C     1 
ATOM   3684  O O     . TYR C 1 129 ? 16.912 -34.783  -165.607 1.00 90.58  ? 126 TYR C O     1 
ATOM   3685  C CB    . TYR C 1 129 ? 15.633 -35.002  -162.628 1.00 82.95  ? 126 TYR C CB    1 
ATOM   3686  C CG    . TYR C 1 129 ? 14.352 -35.685  -162.221 1.00 82.96  ? 126 TYR C CG    1 
ATOM   3687  C CD1   . TYR C 1 129 ? 14.297 -36.468  -161.077 1.00 85.69  ? 126 TYR C CD1   1 
ATOM   3688  C CD2   . TYR C 1 129 ? 13.205 -35.567  -162.992 1.00 85.89  ? 126 TYR C CD2   1 
ATOM   3689  C CE1   . TYR C 1 129 ? 13.130 -37.100  -160.703 1.00 86.93  ? 126 TYR C CE1   1 
ATOM   3690  C CE2   . TYR C 1 129 ? 12.033 -36.197  -162.628 1.00 87.26  ? 126 TYR C CE2   1 
ATOM   3691  C CZ    . TYR C 1 129 ? 12.001 -36.963  -161.482 1.00 87.61  ? 126 TYR C CZ    1 
ATOM   3692  O OH    . TYR C 1 129 ? 10.836 -37.594  -161.115 1.00 87.73  ? 126 TYR C OH    1 
ATOM   3693  N N     . GLY C 1 130 ? 15.242 -36.291  -165.487 1.00 82.23  ? 127 GLY C N     1 
ATOM   3694  C CA    . GLY C 1 130 ? 14.770 -36.054  -166.841 1.00 104.92 ? 127 GLY C CA    1 
ATOM   3695  C C     . GLY C 1 130 ? 13.265 -35.916  -166.847 1.00 105.67 ? 127 GLY C C     1 
ATOM   3696  O O     . GLY C 1 130 ? 12.564 -36.596  -166.098 1.00 102.93 ? 127 GLY C O     1 
ATOM   3697  N N     . VAL C 1 131 ? 12.772 -35.028  -167.705 1.00 102.04 ? 128 VAL C N     1 
ATOM   3698  C CA    . VAL C 1 131 ? 11.375 -34.611  -167.686 1.00 92.14  ? 128 VAL C CA    1 
ATOM   3699  C C     . VAL C 1 131 ? 10.875 -34.513  -169.121 1.00 95.25  ? 128 VAL C C     1 
ATOM   3700  O O     . VAL C 1 131 ? 11.507 -33.862  -169.961 1.00 104.02 ? 128 VAL C O     1 
ATOM   3701  C CB    . VAL C 1 131 ? 11.185 -33.261  -166.963 1.00 94.94  ? 128 VAL C CB    1 
ATOM   3702  C CG1   . VAL C 1 131 ? 9.716  -32.899  -166.899 1.00 102.03 ? 128 VAL C CG1   1 
ATOM   3703  C CG2   . VAL C 1 131 ? 11.777 -33.301  -165.557 1.00 87.17  ? 128 VAL C CG2   1 
ATOM   3704  N N     . SER C 1 132 ? 9.752  -35.171  -169.405 1.00 80.14  ? 129 SER C N     1 
ATOM   3705  C CA    . SER C 1 132 ? 9.078  -35.061  -170.701 1.00 103.92 ? 129 SER C CA    1 
ATOM   3706  C C     . SER C 1 132 ? 7.580  -34.964  -170.431 1.00 111.47 ? 129 SER C C     1 
ATOM   3707  O O     . SER C 1 132 ? 6.931  -35.973  -170.137 1.00 111.23 ? 129 SER C O     1 
ATOM   3708  C CB    . SER C 1 132 ? 9.406  -36.242  -171.604 1.00 106.76 ? 129 SER C CB    1 
ATOM   3709  O OG    . SER C 1 132 ? 8.752  -36.114  -172.853 1.00 110.19 ? 129 SER C OG    1 
ATOM   3710  N N     . GLU C 1 133 ? 7.036  -33.752  -170.538 1.00 128.09 ? 130 GLU C N     1 
ATOM   3711  C CA    . GLU C 1 133 ? 5.634  -33.489  -170.243 1.00 126.26 ? 130 GLU C CA    1 
ATOM   3712  C C     . GLU C 1 133 ? 4.773  -33.267  -171.476 1.00 133.42 ? 130 GLU C C     1 
ATOM   3713  O O     . GLU C 1 133 ? 3.583  -33.589  -171.447 1.00 127.36 ? 130 GLU C O     1 
ATOM   3714  C CB    . GLU C 1 133 ? 5.504  -32.263  -169.328 1.00 121.54 ? 130 GLU C CB    1 
ATOM   3715  C CG    . GLU C 1 133 ? 6.436  -32.279  -168.126 1.00 126.12 ? 130 GLU C CG    1 
ATOM   3716  C CD    . GLU C 1 133 ? 5.975  -31.356  -167.012 1.00 145.48 ? 130 GLU C CD    1 
ATOM   3717  O OE1   . GLU C 1 133 ? 4.933  -31.648  -166.386 1.00 141.28 ? 130 GLU C OE1   1 
ATOM   3718  O OE2   . GLU C 1 133 ? 6.656  -30.339  -166.761 1.00 139.12 ? 130 GLU C OE2   1 
ATOM   3719  N N     . GLY C 1 134 ? 5.338  -32.729  -172.553 1.00 112.90 ? 131 GLY C N     1 
ATOM   3720  C CA    . GLY C 1 134 ? 4.548  -32.295  -173.689 1.00 103.60 ? 131 GLY C CA    1 
ATOM   3721  C C     . GLY C 1 134 ? 4.145  -33.381  -174.666 1.00 117.23 ? 131 GLY C C     1 
ATOM   3722  O O     . GLY C 1 134 ? 3.004  -33.397  -175.137 1.00 127.71 ? 131 GLY C O     1 
ATOM   3723  N N     . LEU C 1 135 ? 5.069  -34.285  -174.983 1.00 118.60 ? 132 LEU C N     1 
ATOM   3724  C CA    . LEU C 1 135 ? 4.861  -35.231  -176.072 1.00 114.24 ? 132 LEU C CA    1 
ATOM   3725  C C     . LEU C 1 135 ? 3.660  -36.134  -175.798 1.00 101.85 ? 132 LEU C C     1 
ATOM   3726  O O     . LEU C 1 135 ? 3.225  -36.316  -174.657 1.00 102.75 ? 132 LEU C O     1 
ATOM   3727  C CB    . LEU C 1 135 ? 6.114  -36.080  -176.288 1.00 110.63 ? 132 LEU C CB    1 
ATOM   3728  C CG    . LEU C 1 135 ? 7.293  -35.397  -176.985 1.00 114.61 ? 132 LEU C CG    1 
ATOM   3729  C CD1   . LEU C 1 135 ? 8.612  -36.013  -176.543 1.00 116.32 ? 132 LEU C CD1   1 
ATOM   3730  C CD2   . LEU C 1 135 ? 7.141  -35.480  -178.495 1.00 117.19 ? 132 LEU C CD2   1 
ATOM   3731  N N     . ALA C 1 136 ? 3.123  -36.704  -176.876 1.00 111.19 ? 133 ALA C N     1 
ATOM   3732  C CA    . ALA C 1 136 ? 1.982  -37.606  -176.806 1.00 118.72 ? 133 ALA C CA    1 
ATOM   3733  C C     . ALA C 1 136 ? 2.363  -39.057  -177.054 1.00 122.91 ? 133 ALA C C     1 
ATOM   3734  O O     . ALA C 1 136 ? 1.496  -39.934  -176.973 1.00 101.85 ? 133 ALA C O     1 
ATOM   3735  C CB    . ALA C 1 136 ? 0.904  -37.176  -177.808 1.00 112.63 ? 133 ALA C CB    1 
ATOM   3736  N N     . SER C 1 137 ? 3.628  -39.333  -177.356 1.00 135.35 ? 134 SER C N     1 
ATOM   3737  C CA    . SER C 1 137 ? 4.116  -40.690  -177.558 1.00 130.85 ? 134 SER C CA    1 
ATOM   3738  C C     . SER C 1 137 ? 4.883  -41.123  -176.314 1.00 105.02 ? 134 SER C C     1 
ATOM   3739  O O     . SER C 1 137 ? 5.825  -40.442  -175.894 1.00 100.72 ? 134 SER C O     1 
ATOM   3740  C CB    . SER C 1 137 ? 5.001  -40.773  -178.802 1.00 124.69 ? 134 SER C CB    1 
ATOM   3741  O OG    . SER C 1 137 ? 5.564  -42.065  -178.946 1.00 119.91 ? 134 SER C OG    1 
ATOM   3742  N N     . LYS C 1 138 ? 4.469  -42.246  -175.724 1.00 98.34  ? 135 LYS C N     1 
ATOM   3743  C CA    . LYS C 1 138 ? 5.123  -42.747  -174.518 1.00 109.95 ? 135 LYS C CA    1 
ATOM   3744  C C     . LYS C 1 138 ? 6.595  -43.046  -174.773 1.00 104.97 ? 135 LYS C C     1 
ATOM   3745  O O     . LYS C 1 138 ? 7.465  -42.686  -173.969 1.00 96.72  ? 135 LYS C O     1 
ATOM   3746  C CB    . LYS C 1 138 ? 4.400  -43.996  -174.014 1.00 118.88 ? 135 LYS C CB    1 
ATOM   3747  C CG    . LYS C 1 138 ? 4.737  -44.379  -172.581 1.00 106.11 ? 135 LYS C CG    1 
ATOM   3748  C CD    . LYS C 1 138 ? 3.521  -44.937  -171.859 1.00 110.90 ? 135 LYS C CD    1 
ATOM   3749  C CE    . LYS C 1 138 ? 3.248  -46.375  -172.269 1.00 106.05 ? 135 LYS C CE    1 
ATOM   3750  N NZ    . LYS C 1 138 ? 2.168  -46.998  -171.455 1.00 98.95  ? 135 LYS C NZ    1 
ATOM   3751  N N     . ALA C 1 139 ? 6.889  -43.723  -175.887 1.00 99.34  ? 136 ALA C N     1 
ATOM   3752  C CA    . ALA C 1 139 ? 8.269  -44.074  -176.205 1.00 99.38  ? 136 ALA C CA    1 
ATOM   3753  C C     . ALA C 1 139 ? 9.143  -42.834  -176.333 1.00 94.27  ? 136 ALA C C     1 
ATOM   3754  O O     . ALA C 1 139 ? 10.270 -42.808  -175.827 1.00 95.34  ? 136 ALA C O     1 
ATOM   3755  C CB    . ALA C 1 139 ? 8.316  -44.899  -177.490 1.00 103.29 ? 136 ALA C CB    1 
ATOM   3756  N N     . LEU C 1 140 ? 8.642  -41.796  -177.009 1.00 102.00 ? 137 LEU C N     1 
ATOM   3757  C CA    . LEU C 1 140 ? 9.410  -40.563  -177.159 1.00 107.40 ? 137 LEU C CA    1 
ATOM   3758  C C     . LEU C 1 140 ? 9.658  -39.899  -175.809 1.00 102.80 ? 137 LEU C C     1 
ATOM   3759  O O     . LEU C 1 140 ? 10.774 -39.440  -175.525 1.00 97.72  ? 137 LEU C O     1 
ATOM   3760  C CB    . LEU C 1 140 ? 8.682  -39.599  -178.097 1.00 112.62 ? 137 LEU C CB    1 
ATOM   3761  C CG    . LEU C 1 140 ? 8.933  -39.678  -179.606 1.00 102.65 ? 137 LEU C CG    1 
ATOM   3762  C CD1   . LEU C 1 140 ? 8.803  -41.099  -180.137 1.00 93.03  ? 137 LEU C CD1   1 
ATOM   3763  C CD2   . LEU C 1 140 ? 7.984  -38.740  -180.342 1.00 104.46 ? 137 LEU C CD2   1 
ATOM   3764  N N     . SER C 1 141 ? 8.623  -39.831  -174.969 1.00 92.16  ? 138 SER C N     1 
ATOM   3765  C CA    . SER C 1 141 ? 8.775  -39.217  -173.656 1.00 90.04  ? 138 SER C CA    1 
ATOM   3766  C C     . SER C 1 141 ? 9.808  -39.957  -172.818 1.00 96.56  ? 138 SER C C     1 
ATOM   3767  O O     . SER C 1 141 ? 10.653 -39.331  -172.170 1.00 88.80  ? 138 SER C O     1 
ATOM   3768  C CB    . SER C 1 141 ? 7.427  -39.178  -172.937 1.00 102.53 ? 138 SER C CB    1 
ATOM   3769  O OG    . SER C 1 141 ? 6.563  -38.220  -173.522 1.00 109.98 ? 138 SER C OG    1 
ATOM   3770  N N     . LEU C 1 142 ? 9.773  -41.293  -172.839 1.00 96.29  ? 139 LEU C N     1 
ATOM   3771  C CA    . LEU C 1 142 ? 10.736 -42.068  -172.061 1.00 94.36  ? 139 LEU C CA    1 
ATOM   3772  C C     . LEU C 1 142 ? 12.146 -41.916  -172.619 1.00 97.32  ? 139 LEU C C     1 
ATOM   3773  O O     . LEU C 1 142 ? 13.109 -41.759  -171.857 1.00 90.74  ? 139 LEU C O     1 
ATOM   3774  C CB    . LEU C 1 142 ? 10.320 -43.539  -172.031 1.00 90.01  ? 139 LEU C CB    1 
ATOM   3775  C CG    . LEU C 1 142 ? 9.106  -43.876  -171.163 1.00 94.13  ? 139 LEU C CG    1 
ATOM   3776  C CD1   . LEU C 1 142 ? 8.602  -45.277  -171.456 1.00 96.53  ? 139 LEU C CD1   1 
ATOM   3777  C CD2   . LEU C 1 142 ? 9.463  -43.740  -169.695 1.00 78.57  ? 139 LEU C CD2   1 
ATOM   3778  N N     . GLU C 1 143 ? 12.287 -41.985  -173.946 1.00 98.90  ? 140 GLU C N     1 
ATOM   3779  C CA    . GLU C 1 143 ? 13.574 -41.753  -174.591 1.00 97.08  ? 140 GLU C CA    1 
ATOM   3780  C C     . GLU C 1 143 ? 14.183 -40.433  -174.137 1.00 104.36 ? 140 GLU C C     1 
ATOM   3781  O O     . GLU C 1 143 ? 15.362 -40.371  -173.769 1.00 106.28 ? 140 GLU C O     1 
ATOM   3782  C CB    . GLU C 1 143 ? 13.396 -41.771  -176.110 1.00 104.13 ? 140 GLU C CB    1 
ATOM   3783  C CG    . GLU C 1 143 ? 14.670 -41.528  -176.900 1.00 114.83 ? 140 GLU C CG    1 
ATOM   3784  C CD    . GLU C 1 143 ? 14.464 -41.690  -178.394 1.00 137.55 ? 140 GLU C CD    1 
ATOM   3785  O OE1   . GLU C 1 143 ? 13.297 -41.677  -178.840 1.00 126.45 ? 140 GLU C OE1   1 
ATOM   3786  O OE2   . GLU C 1 143 ? 15.469 -41.826  -179.123 1.00 120.10 ? 140 GLU C OE2   1 
ATOM   3787  N N     . LYS C 1 144 ? 13.389 -39.361  -174.167 1.00 103.51 ? 141 LYS C N     1 
ATOM   3788  C CA    . LYS C 1 144 ? 13.881 -38.063  -173.713 1.00 100.65 ? 141 LYS C CA    1 
ATOM   3789  C C     . LYS C 1 144 ? 14.246 -38.094  -172.231 1.00 99.94  ? 141 LYS C C     1 
ATOM   3790  O O     . LYS C 1 144 ? 15.341 -37.668  -171.840 1.00 95.28  ? 141 LYS C O     1 
ATOM   3791  C CB    . LYS C 1 144 ? 12.835 -36.981  -173.985 1.00 102.53 ? 141 LYS C CB    1 
ATOM   3792  C CG    . LYS C 1 144 ? 13.254 -35.588  -173.535 1.00 105.24 ? 141 LYS C CG    1 
ATOM   3793  C CD    . LYS C 1 144 ? 12.110 -34.596  -173.663 1.00 106.21 ? 141 LYS C CD    1 
ATOM   3794  C CE    . LYS C 1 144 ? 12.493 -33.237  -173.103 1.00 127.10 ? 141 LYS C CE    1 
ATOM   3795  N NZ    . LYS C 1 144 ? 11.346 -32.287  -173.113 1.00 140.93 ? 141 LYS C NZ    1 
ATOM   3796  N N     . ALA C 1 145 ? 13.331 -38.596  -171.394 1.00 94.14  ? 142 ALA C N     1 
ATOM   3797  C CA    . ALA C 1 145 ? 13.486 -38.500  -169.946 1.00 90.60  ? 142 ALA C CA    1 
ATOM   3798  C C     . ALA C 1 145 ? 14.719 -39.245  -169.452 1.00 93.53  ? 142 ALA C C     1 
ATOM   3799  O O     . ALA C 1 145 ? 15.486 -38.717  -168.639 1.00 93.53  ? 142 ALA C O     1 
ATOM   3800  C CB    . ALA C 1 145 ? 12.227 -39.025  -169.256 1.00 85.34  ? 142 ALA C CB    1 
ATOM   3801  N N     . ARG C 1 146 ? 14.935 -40.472  -169.933 1.00 83.33  ? 143 ARG C N     1 
ATOM   3802  C CA    . ARG C 1 146 ? 16.029 -41.285  -169.401 1.00 83.33  ? 143 ARG C CA    1 
ATOM   3803  C C     . ARG C 1 146 ? 17.388 -40.695  -169.767 1.00 91.35  ? 143 ARG C C     1 
ATOM   3804  O O     . ARG C 1 146 ? 18.284 -40.582  -168.916 1.00 90.76  ? 143 ARG C O     1 
ATOM   3805  C CB    . ARG C 1 146 ? 15.903 -42.723  -169.904 1.00 74.06  ? 143 ARG C CB    1 
ATOM   3806  C CG    . ARG C 1 146 ? 14.529 -43.331  -169.667 1.00 89.46  ? 143 ARG C CG    1 
ATOM   3807  C CD    . ARG C 1 146 ? 14.532 -44.845  -169.800 1.00 78.46  ? 143 ARG C CD    1 
ATOM   3808  N NE    . ARG C 1 146 ? 14.685 -45.507  -168.509 1.00 73.19  ? 143 ARG C NE    1 
ATOM   3809  C CZ    . ARG C 1 146 ? 14.284 -46.748  -168.257 1.00 84.04  ? 143 ARG C CZ    1 
ATOM   3810  N NH1   . ARG C 1 146 ? 13.699 -47.463  -169.209 1.00 82.07  ? 143 ARG C NH1   1 
ATOM   3811  N NH2   . ARG C 1 146 ? 14.463 -47.273  -167.053 1.00 92.15  ? 143 ARG C NH2   1 
ATOM   3812  N N     . LYS C 1 147 ? 17.561 -40.324  -171.038 1.00 89.40  ? 144 LYS C N     1 
ATOM   3813  C CA    . LYS C 1 147 ? 18.817 -39.722  -171.469 1.00 87.50  ? 144 LYS C CA    1 
ATOM   3814  C C     . LYS C 1 147 ? 19.061 -38.393  -170.766 1.00 83.81  ? 144 LYS C C     1 
ATOM   3815  O O     . LYS C 1 147 ? 20.191 -38.104  -170.346 1.00 74.17  ? 144 LYS C O     1 
ATOM   3816  C CB    . LYS C 1 147 ? 18.817 -39.545  -172.987 1.00 79.99  ? 144 LYS C CB    1 
ATOM   3817  C CG    . LYS C 1 147 ? 18.671 -40.851  -173.748 1.00 76.58  ? 144 LYS C CG    1 
ATOM   3818  C CD    . LYS C 1 147 ? 18.544 -40.617  -175.240 1.00 77.44  ? 144 LYS C CD    1 
ATOM   3819  C CE    . LYS C 1 147 ? 18.403 -41.933  -175.985 1.00 77.63  ? 144 LYS C CE    1 
ATOM   3820  N NZ    . LYS C 1 147 ? 18.228 -41.729  -177.448 1.00 124.34 ? 144 LYS C NZ    1 
ATOM   3821  N N     . GLU C 1 148 ? 18.017 -37.566  -170.630 1.00 77.30  ? 145 GLU C N     1 
ATOM   3822  C CA    . GLU C 1 148 ? 18.171 -36.312  -169.902 1.00 87.53  ? 145 GLU C CA    1 
ATOM   3823  C C     . GLU C 1 148 ? 18.577 -36.561  -168.456 1.00 78.82  ? 145 GLU C C     1 
ATOM   3824  O O     . GLU C 1 148 ? 19.426 -35.847  -167.913 1.00 77.42  ? 145 GLU C O     1 
ATOM   3825  C CB    . GLU C 1 148 ? 16.874 -35.505  -169.962 1.00 99.09  ? 145 GLU C CB    1 
ATOM   3826  C CG    . GLU C 1 148 ? 16.957 -34.155  -169.262 1.00 108.89 ? 145 GLU C CG    1 
ATOM   3827  C CD    . GLU C 1 148 ? 15.674 -33.356  -169.376 1.00 118.49 ? 145 GLU C CD    1 
ATOM   3828  O OE1   . GLU C 1 148 ? 14.881 -33.627  -170.303 1.00 118.77 ? 145 GLU C OE1   1 
ATOM   3829  O OE2   . GLU C 1 148 ? 15.460 -32.454  -168.538 1.00 123.56 ? 145 GLU C OE2   1 
ATOM   3830  N N     . ALA C 1 149 ? 17.991 -37.578  -167.821 1.00 82.13  ? 146 ALA C N     1 
ATOM   3831  C CA    . ALA C 1 149 ? 18.331 -37.884  -166.436 1.00 90.39  ? 146 ALA C CA    1 
ATOM   3832  C C     . ALA C 1 149 ? 19.795 -38.279  -166.308 1.00 82.66  ? 146 ALA C C     1 
ATOM   3833  O O     . ALA C 1 149 ? 20.507 -37.791  -165.423 1.00 77.42  ? 146 ALA C O     1 
ATOM   3834  C CB    . ALA C 1 149 ? 17.424 -38.995  -165.906 1.00 77.98  ? 146 ALA C CB    1 
ATOM   3835  N N     . VAL C 1 150 ? 20.266 -39.157  -167.195 1.00 81.84  ? 147 VAL C N     1 
ATOM   3836  C CA    . VAL C 1 150 ? 21.656 -39.602  -167.110 1.00 86.73  ? 147 VAL C CA    1 
ATOM   3837  C C     . VAL C 1 150 ? 22.614 -38.443  -167.364 1.00 83.43  ? 147 VAL C C     1 
ATOM   3838  O O     . VAL C 1 150 ? 23.612 -38.277  -166.649 1.00 72.01  ? 147 VAL C O     1 
ATOM   3839  C CB    . VAL C 1 150 ? 21.904 -40.778  -168.072 1.00 75.90  ? 147 VAL C CB    1 
ATOM   3840  C CG1   . VAL C 1 150 ? 23.387 -40.931  -168.362 1.00 60.73  ? 147 VAL C CG1   1 
ATOM   3841  C CG2   . VAL C 1 150 ? 21.373 -42.049  -167.455 1.00 82.33  ? 147 VAL C CG2   1 
ATOM   3842  N N     . THR C 1 151 ? 22.330 -37.620  -168.377 1.00 91.75  ? 148 THR C N     1 
ATOM   3843  C CA    . THR C 1 151 ? 23.211 -36.492  -168.672 1.00 90.45  ? 148 THR C CA    1 
ATOM   3844  C C     . THR C 1 151 ? 23.227 -35.481  -167.528 1.00 83.21  ? 148 THR C C     1 
ATOM   3845  O O     . THR C 1 151 ? 24.293 -34.973  -167.152 1.00 78.55  ? 148 THR C O     1 
ATOM   3846  C CB    . THR C 1 151 ? 22.790 -35.825  -169.980 1.00 90.50  ? 148 THR C CB    1 
ATOM   3847  O OG1   . THR C 1 151 ? 22.876 -36.779  -171.045 1.00 86.90  ? 148 THR C OG1   1 
ATOM   3848  C CG2   . THR C 1 151 ? 23.701 -34.647  -170.297 1.00 94.23  ? 148 THR C CG2   1 
ATOM   3849  N N     . ASP C 1 152 ? 22.054 -35.160  -166.976 1.00 82.49  ? 149 ASP C N     1 
ATOM   3850  C CA    . ASP C 1 152 ? 21.983 -34.240  -165.847 1.00 84.98  ? 149 ASP C CA    1 
ATOM   3851  C C     . ASP C 1 152 ? 22.736 -34.788  -164.641 1.00 92.13  ? 149 ASP C C     1 
ATOM   3852  O O     . ASP C 1 152 ? 23.406 -34.035  -163.925 1.00 83.34  ? 149 ASP C O     1 
ATOM   3853  C CB    . ASP C 1 152 ? 20.520 -33.964  -165.497 1.00 83.24  ? 149 ASP C CB    1 
ATOM   3854  C CG    . ASP C 1 152 ? 20.342 -32.699  -164.680 1.00 104.08 ? 149 ASP C CG    1 
ATOM   3855  O OD1   . ASP C 1 152 ? 20.338 -31.603  -165.280 1.00 124.67 ? 149 ASP C OD1   1 
ATOM   3856  O OD2   . ASP C 1 152 ? 20.201 -32.798  -163.443 1.00 88.84  ? 149 ASP C OD2   1 
ATOM   3857  N N     . GLY C 1 153 ? 22.629 -36.097  -164.395 1.00 95.52  ? 150 GLY C N     1 
ATOM   3858  C CA    . GLY C 1 153 ? 23.387 -36.697  -163.308 1.00 83.25  ? 150 GLY C CA    1 
ATOM   3859  C C     . GLY C 1 153 ? 24.882 -36.629  -163.538 1.00 87.57  ? 150 GLY C C     1 
ATOM   3860  O O     . GLY C 1 153 ? 25.653 -36.396  -162.605 1.00 72.56  ? 150 GLY C O     1 
ATOM   3861  N N     . LEU C 1 154 ? 25.312 -36.820  -164.787 1.00 87.69  ? 151 LEU C N     1 
ATOM   3862  C CA    . LEU C 1 154 ? 26.728 -36.682  -165.108 1.00 80.58  ? 151 LEU C CA    1 
ATOM   3863  C C     . LEU C 1 154 ? 27.209 -35.261  -164.851 1.00 91.22  ? 151 LEU C C     1 
ATOM   3864  O O     . LEU C 1 154 ? 28.297 -35.053  -164.298 1.00 94.47  ? 151 LEU C O     1 
ATOM   3865  C CB    . LEU C 1 154 ? 26.977 -37.079  -166.563 1.00 67.63  ? 151 LEU C CB    1 
ATOM   3866  C CG    . LEU C 1 154 ? 28.422 -37.003  -167.058 1.00 69.08  ? 151 LEU C CG    1 
ATOM   3867  C CD1   . LEU C 1 154 ? 29.350 -37.778  -166.140 1.00 72.71  ? 151 LEU C CD1   1 
ATOM   3868  C CD2   . LEU C 1 154 ? 28.524 -37.520  -168.484 1.00 66.57  ? 151 LEU C CD2   1 
ATOM   3869  N N     . LYS C 1 155 ? 26.403 -34.269  -165.236 1.00 83.69  ? 152 LYS C N     1 
ATOM   3870  C CA    . LYS C 1 155 ? 26.752 -32.879  -164.955 1.00 87.94  ? 152 LYS C CA    1 
ATOM   3871  C C     . LYS C 1 155 ? 26.857 -32.628  -163.455 1.00 89.38  ? 152 LYS C C     1 
ATOM   3872  O O     . LYS C 1 155 ? 27.845 -32.059  -162.975 1.00 90.43  ? 152 LYS C O     1 
ATOM   3873  C CB    . LYS C 1 155 ? 25.725 -31.936  -165.584 1.00 89.30  ? 152 LYS C CB    1 
ATOM   3874  C CG    . LYS C 1 155 ? 25.707 -31.941  -167.102 1.00 96.80  ? 152 LYS C CG    1 
ATOM   3875  C CD    . LYS C 1 155 ? 24.847 -30.807  -167.642 1.00 92.35  ? 152 LYS C CD    1 
ATOM   3876  C CE    . LYS C 1 155 ? 23.422 -30.887  -167.110 1.00 90.50  ? 152 LYS C CE    1 
ATOM   3877  N NZ    . LYS C 1 155 ? 22.611 -29.702  -167.506 1.00 92.29  ? 152 LYS C NZ    1 
ATOM   3878  N N     . ARG C 1 156 ? 25.834 -33.037  -162.698 1.00 75.27  ? 153 ARG C N     1 
ATOM   3879  C CA    . ARG C 1 156 ? 25.829 -32.791  -161.259 1.00 80.84  ? 153 ARG C CA    1 
ATOM   3880  C C     . ARG C 1 156 ? 26.949 -33.540  -160.549 1.00 85.17  ? 153 ARG C C     1 
ATOM   3881  O O     . ARG C 1 156 ? 27.410 -33.103  -159.488 1.00 100.09 ? 153 ARG C O     1 
ATOM   3882  C CB    . ARG C 1 156 ? 24.470 -33.170  -160.667 1.00 77.97  ? 153 ARG C CB    1 
ATOM   3883  C CG    . ARG C 1 156 ? 23.423 -32.067  -160.777 1.00 99.18  ? 153 ARG C CG    1 
ATOM   3884  C CD    . ARG C 1 156 ? 22.141 -32.427  -160.038 1.00 78.24  ? 153 ARG C CD    1 
ATOM   3885  N NE    . ARG C 1 156 ? 22.381 -32.746  -158.634 1.00 68.88  ? 153 ARG C NE    1 
ATOM   3886  C CZ    . ARG C 1 156 ? 22.501 -31.840  -157.669 1.00 77.40  ? 153 ARG C CZ    1 
ATOM   3887  N NH1   . ARG C 1 156 ? 22.403 -30.548  -157.952 1.00 107.05 ? 153 ARG C NH1   1 
ATOM   3888  N NH2   . ARG C 1 156 ? 22.718 -32.225  -156.419 1.00 83.99  ? 153 ARG C NH2   1 
ATOM   3889  N N     . ALA C 1 157 ? 27.400 -34.664  -161.108 1.00 88.89  ? 154 ALA C N     1 
ATOM   3890  C CA    . ALA C 1 157 ? 28.483 -35.414  -160.484 1.00 95.59  ? 154 ALA C CA    1 
ATOM   3891  C C     . ALA C 1 157 ? 29.842 -34.817  -160.826 1.00 95.66  ? 154 ALA C C     1 
ATOM   3892  O O     . ALA C 1 157 ? 30.747 -34.805  -159.983 1.00 87.21  ? 154 ALA C O     1 
ATOM   3893  C CB    . ALA C 1 157 ? 28.418 -36.880  -160.912 1.00 87.27  ? 154 ALA C CB    1 
ATOM   3894  N N     . LEU C 1 158 ? 30.004 -34.317  -162.054 1.00 93.53  ? 155 LEU C N     1 
ATOM   3895  C CA    . LEU C 1 158 ? 31.239 -33.637  -162.420 1.00 86.53  ? 155 LEU C CA    1 
ATOM   3896  C C     . LEU C 1 158 ? 31.353 -32.265  -161.770 1.00 99.25  ? 155 LEU C C     1 
ATOM   3897  O O     . LEU C 1 158 ? 32.463 -31.735  -161.664 1.00 101.81 ? 155 LEU C O     1 
ATOM   3898  C CB    . LEU C 1 158 ? 31.335 -33.508  -163.942 1.00 81.38  ? 155 LEU C CB    1 
ATOM   3899  C CG    . LEU C 1 158 ? 31.691 -34.779  -164.716 1.00 75.02  ? 155 LEU C CG    1 
ATOM   3900  C CD1   . LEU C 1 158 ? 31.296 -34.645  -166.178 1.00 79.41  ? 155 LEU C CD1   1 
ATOM   3901  C CD2   . LEU C 1 158 ? 33.177 -35.084  -164.592 1.00 77.27  ? 155 LEU C CD2   1 
ATOM   3902  N N     . ARG C 1 159 ? 30.230 -31.678  -161.346 1.00 92.52  ? 156 ARG C N     1 
ATOM   3903  C CA    . ARG C 1 159 ? 30.278 -30.391  -160.657 1.00 82.40  ? 156 ARG C CA    1 
ATOM   3904  C C     . ARG C 1 159 ? 31.221 -30.425  -159.462 1.00 85.19  ? 156 ARG C C     1 
ATOM   3905  O O     . ARG C 1 159 ? 32.024 -29.506  -159.268 1.00 104.60 ? 156 ARG C O     1 
ATOM   3906  C CB    . ARG C 1 159 ? 28.876 -29.983  -160.207 1.00 93.18  ? 156 ARG C CB    1 
ATOM   3907  C CG    . ARG C 1 159 ? 28.039 -29.329  -161.287 1.00 112.62 ? 156 ARG C CG    1 
ATOM   3908  C CD    . ARG C 1 159 ? 26.777 -28.734  -160.698 1.00 129.73 ? 156 ARG C CD    1 
ATOM   3909  N NE    . ARG C 1 159 ? 25.963 -28.066  -161.707 1.00 136.57 ? 156 ARG C NE    1 
ATOM   3910  C CZ    . ARG C 1 159 ? 24.719 -27.653  -161.498 1.00 144.34 ? 156 ARG C CZ    1 
ATOM   3911  N NH1   . ARG C 1 159 ? 24.148 -27.841  -160.316 1.00 136.05 ? 156 ARG C NH1   1 
ATOM   3912  N NH2   . ARG C 1 159 ? 24.048 -27.052  -162.470 1.00 151.45 ? 156 ARG C NH2   1 
ATOM   3913  N N     . SER C 1 160 ? 31.148 -31.485  -158.655 1.00 97.91  ? 157 SER C N     1 
ATOM   3914  C CA    . SER C 1 160 ? 31.879 -31.590  -157.391 1.00 101.39 ? 157 SER C CA    1 
ATOM   3915  C C     . SER C 1 160 ? 33.409 -31.631  -157.561 1.00 101.38 ? 157 SER C C     1 
ATOM   3916  O O     . SER C 1 160 ? 34.092 -31.879  -156.556 1.00 105.42 ? 157 SER C O     1 
ATOM   3917  C CB    . SER C 1 160 ? 31.419 -32.832  -156.627 1.00 114.44 ? 157 SER C CB    1 
ATOM   3918  O OG    . SER C 1 160 ? 30.006 -32.937  -156.608 1.00 112.20 ? 157 SER C OG    1 
ATOM   3919  N N     . PHE C 1 161 ? 33.968 -31.414  -158.754 1.00 95.27  ? 158 PHE C N     1 
ATOM   3920  C CA    . PHE C 1 161 ? 35.413 -31.410  -158.936 1.00 109.94 ? 158 PHE C CA    1 
ATOM   3921  C C     . PHE C 1 161 ? 36.019 -30.016  -158.878 1.00 119.38 ? 158 PHE C C     1 
ATOM   3922  O O     . PHE C 1 161 ? 37.206 -29.888  -158.558 1.00 125.48 ? 158 PHE C O     1 
ATOM   3923  C CB    . PHE C 1 161 ? 35.780 -32.057  -160.275 1.00 102.83 ? 158 PHE C CB    1 
ATOM   3924  C CG    . PHE C 1 161 ? 35.847 -33.555  -160.227 1.00 106.79 ? 158 PHE C CG    1 
ATOM   3925  C CD1   . PHE C 1 161 ? 36.558 -34.203  -159.229 1.00 108.80 ? 158 PHE C CD1   1 
ATOM   3926  C CD2   . PHE C 1 161 ? 35.182 -34.317  -161.172 1.00 103.19 ? 158 PHE C CD2   1 
ATOM   3927  C CE1   . PHE C 1 161 ? 36.618 -35.586  -159.188 1.00 116.16 ? 158 PHE C CE1   1 
ATOM   3928  C CE2   . PHE C 1 161 ? 35.234 -35.697  -161.133 1.00 102.93 ? 158 PHE C CE2   1 
ATOM   3929  C CZ    . PHE C 1 161 ? 35.952 -36.333  -160.141 1.00 110.42 ? 158 PHE C CZ    1 
ATOM   3930  N N     . GLY C 1 162 ? 35.246 -28.983  -159.172 1.00 117.44 ? 159 GLY C N     1 
ATOM   3931  C CA    . GLY C 1 162 ? 35.765 -27.630  -159.167 1.00 121.41 ? 159 GLY C CA    1 
ATOM   3932  C C     . GLY C 1 162 ? 34.890 -26.707  -159.978 1.00 116.59 ? 159 GLY C C     1 
ATOM   3933  O O     . GLY C 1 162 ? 34.002 -27.133  -160.718 1.00 98.82  ? 159 GLY C O     1 
ATOM   3934  N N     . ASN C 1 163 ? 35.159 -25.408  -159.815 1.00 131.25 ? 160 ASN C N     1 
ATOM   3935  C CA    . ASN C 1 163 ? 34.400 -24.389  -160.534 1.00 133.25 ? 160 ASN C CA    1 
ATOM   3936  C C     . ASN C 1 163 ? 34.502 -24.580  -162.041 1.00 125.55 ? 160 ASN C C     1 
ATOM   3937  O O     . ASN C 1 163 ? 33.529 -24.352  -162.769 1.00 121.42 ? 160 ASN C O     1 
ATOM   3938  C CB    . ASN C 1 163 ? 34.887 -22.994  -160.141 1.00 130.15 ? 160 ASN C CB    1 
ATOM   3939  C CG    . ASN C 1 163 ? 34.822 -22.753  -158.646 1.00 133.55 ? 160 ASN C CG    1 
ATOM   3940  O OD1   . ASN C 1 163 ? 33.792 -22.981  -158.013 1.00 130.25 ? 160 ASN C OD1   1 
ATOM   3941  N ND2   . ASN C 1 163 ? 35.927 -22.287  -158.073 1.00 139.39 ? 160 ASN C ND2   1 
ATOM   3942  N N     . ALA C 1 164 ? 35.676 -24.994  -162.527 1.00 120.81 ? 161 ALA C N     1 
ATOM   3943  C CA    . ALA C 1 164 ? 35.884 -25.130  -163.965 1.00 122.24 ? 161 ALA C CA    1 
ATOM   3944  C C     . ALA C 1 164 ? 34.952 -26.163  -164.584 1.00 119.09 ? 161 ALA C C     1 
ATOM   3945  O O     . ALA C 1 164 ? 34.645 -26.081  -165.779 1.00 124.83 ? 161 ALA C O     1 
ATOM   3946  C CB    . ALA C 1 164 ? 37.340 -25.495  -164.252 1.00 118.65 ? 161 ALA C CB    1 
ATOM   3947  N N     . LEU C 1 165 ? 34.495 -27.140  -163.801 1.00 105.68 ? 162 LEU C N     1 
ATOM   3948  C CA    . LEU C 1 165 ? 33.643 -28.207  -164.307 1.00 100.70 ? 162 LEU C CA    1 
ATOM   3949  C C     . LEU C 1 165 ? 32.170 -27.993  -163.972 1.00 105.19 ? 162 LEU C C     1 
ATOM   3950  O O     . LEU C 1 165 ? 31.380 -28.942  -164.044 1.00 88.28  ? 162 LEU C O     1 
ATOM   3951  C CB    . LEU C 1 165 ? 34.119 -29.559  -163.776 1.00 99.60  ? 162 LEU C CB    1 
ATOM   3952  C CG    . LEU C 1 165 ? 35.349 -30.132  -164.482 1.00 99.15  ? 162 LEU C CG    1 
ATOM   3953  C CD1   . LEU C 1 165 ? 35.810 -31.409  -163.808 1.00 112.97 ? 162 LEU C CD1   1 
ATOM   3954  C CD2   . LEU C 1 165 ? 35.052 -30.381  -165.951 1.00 107.02 ? 162 LEU C CD2   1 
ATOM   3955  N N     . GLY C 1 166 ? 31.783 -26.770  -163.609 1.00 105.30 ? 163 GLY C N     1 
ATOM   3956  C CA    . GLY C 1 166 ? 30.388 -26.432  -163.403 1.00 107.06 ? 163 GLY C CA    1 
ATOM   3957  C C     . GLY C 1 166 ? 29.993 -26.117  -161.977 1.00 113.43 ? 163 GLY C C     1 
ATOM   3958  O O     . GLY C 1 166 ? 28.801 -25.915  -161.719 1.00 114.13 ? 163 GLY C O     1 
ATOM   3959  N N     . ASN C 1 167 ? 30.940 -26.071  -161.037 1.00 96.02  ? 164 ASN C N     1 
ATOM   3960  C CA    . ASN C 1 167 ? 30.588 -25.756  -159.657 1.00 95.63  ? 164 ASN C CA    1 
ATOM   3961  C C     . ASN C 1 167 ? 30.273 -24.279  -159.457 1.00 127.45 ? 164 ASN C C     1 
ATOM   3962  O O     . ASN C 1 167 ? 29.616 -23.926  -158.473 1.00 129.70 ? 164 ASN C O     1 
ATOM   3963  C CB    . ASN C 1 167 ? 31.719 -26.174  -158.718 1.00 111.63 ? 164 ASN C CB    1 
ATOM   3964  C CG    . ASN C 1 167 ? 31.337 -26.060  -157.257 1.00 123.26 ? 164 ASN C CG    1 
ATOM   3965  O OD1   . ASN C 1 167 ? 30.181 -26.269  -156.887 1.00 123.42 ? 164 ASN C OD1   1 
ATOM   3966  N ND2   . ASN C 1 167 ? 32.307 -25.721  -156.418 1.00 123.48 ? 164 ASN C ND2   1 
ATOM   3967  N N     . CYS C 1 168 ? 30.717 -23.411  -160.366 1.00 139.58 ? 165 CYS C N     1 
ATOM   3968  C CA    . CYS C 1 168 ? 30.505 -21.977  -160.218 1.00 112.98 ? 165 CYS C CA    1 
ATOM   3969  C C     . CYS C 1 168 ? 29.152 -21.512  -160.740 1.00 118.74 ? 165 CYS C C     1 
ATOM   3970  O O     . CYS C 1 168 ? 28.742 -20.389  -160.427 1.00 133.84 ? 165 CYS C O     1 
ATOM   3971  C CB    . CYS C 1 168 ? 31.618 -21.206  -160.932 1.00 125.32 ? 165 CYS C CB    1 
ATOM   3972  S SG    . CYS C 1 168 ? 31.807 -21.623  -162.679 1.00 158.01 ? 165 CYS C SG    1 
ATOM   3973  N N     . ILE C 1 169 ? 28.450 -22.342  -161.517 1.00 116.00 ? 166 ILE C N     1 
ATOM   3974  C CA    . ILE C 1 169 ? 27.164 -21.954  -162.085 1.00 118.27 ? 166 ILE C CA    1 
ATOM   3975  C C     . ILE C 1 169 ? 26.122 -21.667  -161.010 1.00 121.57 ? 166 ILE C C     1 
ATOM   3976  O O     . ILE C 1 169 ? 25.092 -21.049  -161.299 1.00 106.13 ? 166 ILE C O     1 
ATOM   3977  C CB    . ILE C 1 169 ? 26.666 -23.050  -163.054 1.00 125.54 ? 166 ILE C CB    1 
ATOM   3978  C CG1   . ILE C 1 169 ? 25.613 -22.489  -164.013 1.00 113.47 ? 166 ILE C CG1   1 
ATOM   3979  C CG2   . ILE C 1 169 ? 26.101 -24.234  -162.283 1.00 132.48 ? 166 ILE C CG2   1 
ATOM   3980  C CD1   . ILE C 1 169 ? 26.191 -21.694  -165.159 1.00 115.87 ? 166 ILE C CD1   1 
ATOM   3981  N N     . LEU C 1 170 ? 26.365 -22.091  -159.772 1.00 130.00 ? 167 LEU C N     1 
ATOM   3982  C CA    . LEU C 1 170 ? 25.439 -21.858  -158.673 1.00 131.17 ? 167 LEU C CA    1 
ATOM   3983  C C     . LEU C 1 170 ? 25.837 -20.679  -157.795 1.00 141.86 ? 167 LEU C C     1 
ATOM   3984  O O     . LEU C 1 170 ? 25.130 -20.381  -156.827 1.00 147.05 ? 167 LEU C O     1 
ATOM   3985  C CB    . LEU C 1 170 ? 25.310 -23.121  -157.816 1.00 133.62 ? 167 LEU C CB    1 
ATOM   3986  C CG    . LEU C 1 170 ? 24.638 -24.304  -158.515 1.00 136.05 ? 167 LEU C CG    1 
ATOM   3987  C CD1   . LEU C 1 170 ? 24.960 -25.616  -157.810 1.00 139.86 ? 167 LEU C CD1   1 
ATOM   3988  C CD2   . LEU C 1 170 ? 23.137 -24.082  -158.601 1.00 128.88 ? 167 LEU C CD2   1 
ATOM   3989  N N     . ASP C 1 171 ? 26.942 -20.006  -158.103 1.00 145.57 ? 168 ASP C N     1 
ATOM   3990  C CA    . ASP C 1 171 ? 27.362 -18.827  -157.354 1.00 148.03 ? 168 ASP C CA    1 
ATOM   3991  C C     . ASP C 1 171 ? 26.628 -17.614  -157.912 1.00 153.69 ? 168 ASP C C     1 
ATOM   3992  O O     . ASP C 1 171 ? 26.872 -17.202  -159.051 1.00 155.29 ? 168 ASP C O     1 
ATOM   3993  C CB    . ASP C 1 171 ? 28.875 -18.648  -157.435 1.00 150.91 ? 168 ASP C CB    1 
ATOM   3994  C CG    . ASP C 1 171 ? 29.396 -17.629  -156.439 1.00 151.73 ? 168 ASP C CG    1 
ATOM   3995  O OD1   . ASP C 1 171 ? 28.636 -17.249  -155.523 1.00 147.96 ? 168 ASP C OD1   1 
ATOM   3996  O OD2   . ASP C 1 171 ? 30.564 -17.207  -156.573 1.00 152.11 ? 168 ASP C OD2   1 
ATOM   3997  N N     . LYS C 1 172 ? 25.718 -17.048  -157.114 1.00 151.27 ? 169 LYS C N     1 
ATOM   3998  C CA    . LYS C 1 172 ? 24.896 -15.937  -157.585 1.00 152.11 ? 169 LYS C CA    1 
ATOM   3999  C C     . LYS C 1 172 ? 25.749 -14.729  -157.954 1.00 152.96 ? 169 LYS C C     1 
ATOM   4000  O O     . LYS C 1 172 ? 25.450 -14.022  -158.925 1.00 143.14 ? 169 LYS C O     1 
ATOM   4001  C CB    . LYS C 1 172 ? 23.862 -15.570  -156.522 1.00 147.50 ? 169 LYS C CB    1 
ATOM   4002  C CG    . LYS C 1 172 ? 22.962 -16.732  -156.128 1.00 152.52 ? 169 LYS C CG    1 
ATOM   4003  C CD    . LYS C 1 172 ? 22.360 -16.538  -154.746 1.00 161.32 ? 169 LYS C CD    1 
ATOM   4004  C CE    . LYS C 1 172 ? 21.633 -17.793  -154.284 1.00 152.74 ? 169 LYS C CE    1 
ATOM   4005  N NZ    . LYS C 1 172 ? 21.171 -17.685  -152.872 1.00 137.19 ? 169 LYS C NZ    1 
ATOM   4006  N N     . ASP C 1 173 ? 26.807 -14.467  -157.183 1.00 156.15 ? 170 ASP C N     1 
ATOM   4007  C CA    . ASP C 1 173 ? 27.718 -13.375  -157.516 1.00 157.65 ? 170 ASP C CA    1 
ATOM   4008  C C     . ASP C 1 173 ? 28.391 -13.615  -158.862 1.00 149.21 ? 170 ASP C C     1 
ATOM   4009  O O     . ASP C 1 173 ? 28.577 -12.680  -159.653 1.00 149.55 ? 170 ASP C O     1 
ATOM   4010  C CB    . ASP C 1 173 ? 28.763 -13.213  -156.413 1.00 156.78 ? 170 ASP C CB    1 
ATOM   4011  C CG    . ASP C 1 173 ? 28.140 -12.969  -155.054 1.00 163.01 ? 170 ASP C CG    1 
ATOM   4012  O OD1   . ASP C 1 173 ? 27.093 -12.291  -154.991 1.00 164.54 ? 170 ASP C OD1   1 
ATOM   4013  O OD2   . ASP C 1 173 ? 28.697 -13.459  -154.047 1.00 164.57 ? 170 ASP C OD2   1 
ATOM   4014  N N     . TYR C 1 174 ? 28.783 -14.863  -159.128 1.00 142.71 ? 171 TYR C N     1 
ATOM   4015  C CA    . TYR C 1 174 ? 29.343 -15.211  -160.429 1.00 148.31 ? 171 TYR C CA    1 
ATOM   4016  C C     . TYR C 1 174 ? 28.349 -14.927  -161.549 1.00 145.93 ? 171 TYR C C     1 
ATOM   4017  O O     . TYR C 1 174 ? 28.728 -14.426  -162.611 1.00 138.08 ? 171 TYR C O     1 
ATOM   4018  C CB    . TYR C 1 174 ? 29.772 -16.679  -160.431 1.00 150.39 ? 171 TYR C CB    1 
ATOM   4019  C CG    . TYR C 1 174 ? 30.182 -17.216  -161.782 1.00 148.90 ? 171 TYR C CG    1 
ATOM   4020  C CD1   . TYR C 1 174 ? 31.363 -16.808  -162.385 1.00 144.42 ? 171 TYR C CD1   1 
ATOM   4021  C CD2   . TYR C 1 174 ? 29.398 -18.150  -162.445 1.00 137.25 ? 171 TYR C CD2   1 
ATOM   4022  C CE1   . TYR C 1 174 ? 31.745 -17.304  -163.617 1.00 135.51 ? 171 TYR C CE1   1 
ATOM   4023  C CE2   . TYR C 1 174 ? 29.772 -18.653  -163.674 1.00 141.03 ? 171 TYR C CE2   1 
ATOM   4024  C CZ    . TYR C 1 174 ? 30.945 -18.225  -164.258 1.00 139.16 ? 171 TYR C CZ    1 
ATOM   4025  O OH    . TYR C 1 174 ? 31.319 -18.725  -165.484 1.00 139.19 ? 171 TYR C OH    1 
ATOM   4026  N N     . LEU C 1 175 ? 27.067 -15.232  -161.326 1.00 143.30 ? 172 LEU C N     1 
ATOM   4027  C CA    . LEU C 1 175 ? 26.050 -14.935  -162.331 1.00 141.06 ? 172 LEU C CA    1 
ATOM   4028  C C     . LEU C 1 175 ? 25.906 -13.432  -162.547 1.00 150.74 ? 172 LEU C C     1 
ATOM   4029  O O     . LEU C 1 175 ? 25.795 -12.966  -163.690 1.00 152.94 ? 172 LEU C O     1 
ATOM   4030  C CB    . LEU C 1 175 ? 24.710 -15.545  -161.918 1.00 140.43 ? 172 LEU C CB    1 
ATOM   4031  C CG    . LEU C 1 175 ? 24.597 -17.068  -161.997 1.00 128.25 ? 172 LEU C CG    1 
ATOM   4032  C CD1   . LEU C 1 175 ? 23.161 -17.510  -161.766 1.00 110.24 ? 172 LEU C CD1   1 
ATOM   4033  C CD2   . LEU C 1 175 ? 25.113 -17.582  -163.334 1.00 141.23 ? 172 LEU C CD2   1 
ATOM   4034  N N     . ARG C 1 176 ? 25.883 -12.661  -161.455 1.00 159.35 ? 173 ARG C N     1 
ATOM   4035  C CA    . ARG C 1 176 ? 25.807 -11.208  -161.575 1.00 160.19 ? 173 ARG C CA    1 
ATOM   4036  C C     . ARG C 1 176 ? 26.976 -10.663  -162.383 1.00 156.02 ? 173 ARG C C     1 
ATOM   4037  O O     . ARG C 1 176 ? 26.797 -9.784   -163.234 1.00 154.10 ? 173 ARG C O     1 
ATOM   4038  C CB    . ARG C 1 176 ? 25.775 -10.562  -160.189 1.00 154.43 ? 173 ARG C CB    1 
ATOM   4039  C CG    . ARG C 1 176 ? 24.553 -10.906  -159.355 1.00 154.09 ? 173 ARG C CG    1 
ATOM   4040  C CD    . ARG C 1 176 ? 24.407 -9.972   -158.156 1.00 149.34 ? 173 ARG C CD    1 
ATOM   4041  N NE    . ARG C 1 176 ? 25.573 -9.993   -157.275 1.00 147.01 ? 173 ARG C NE    1 
ATOM   4042  C CZ    . ARG C 1 176 ? 26.539 -9.079   -157.285 1.00 146.18 ? 173 ARG C CZ    1 
ATOM   4043  N NH1   . ARG C 1 176 ? 26.481 -8.059   -158.131 1.00 157.01 ? 173 ARG C NH1   1 
ATOM   4044  N NH2   . ARG C 1 176 ? 27.562 -9.182   -156.448 1.00 139.70 ? 173 ARG C NH2   1 
ATOM   4045  N N     . SER C 1 177 ? 28.183 -11.175  -162.132 1.00 158.01 ? 174 SER C N     1 
ATOM   4046  C CA    . SER C 1 177 ? 29.340 -10.757  -162.915 1.00 153.73 ? 174 SER C CA    1 
ATOM   4047  C C     . SER C 1 177 ? 29.279 -11.269  -164.349 1.00 152.91 ? 174 SER C C     1 
ATOM   4048  O O     . SER C 1 177 ? 29.893 -10.667  -165.236 1.00 156.38 ? 174 SER C O     1 
ATOM   4049  C CB    . SER C 1 177 ? 30.630 -11.229  -162.244 1.00 154.19 ? 174 SER C CB    1 
ATOM   4050  O OG    . SER C 1 177 ? 30.826 -10.574  -161.003 1.00 157.25 ? 174 SER C OG    1 
ATOM   4051  N N     . LEU C 1 178 ? 28.558 -12.365  -164.591 1.00 157.16 ? 175 LEU C N     1 
ATOM   4052  C CA    . LEU C 1 178 ? 28.387 -12.854  -165.955 1.00 167.25 ? 175 LEU C CA    1 
ATOM   4053  C C     . LEU C 1 178 ? 27.471 -11.937  -166.753 1.00 158.36 ? 175 LEU C C     1 
ATOM   4054  O O     . LEU C 1 178 ? 27.692 -11.717  -167.950 1.00 150.37 ? 175 LEU C O     1 
ATOM   4055  C CB    . LEU C 1 178 ? 27.826 -14.274  -165.940 1.00 172.22 ? 175 LEU C CB    1 
ATOM   4056  C CG    . LEU C 1 178 ? 28.808 -15.442  -165.980 1.00 167.04 ? 175 LEU C CG    1 
ATOM   4057  C CD1   . LEU C 1 178 ? 28.040 -16.750  -165.963 1.00 154.56 ? 175 LEU C CD1   1 
ATOM   4058  C CD2   . LEU C 1 178 ? 29.698 -15.352  -167.207 1.00 153.60 ? 175 LEU C CD2   1 
ATOM   4059  N N     . ASN C 1 179 ? 26.432 -11.402  -166.107 1.00 154.72 ? 176 ASN C N     1 
ATOM   4060  C CA    . ASN C 1 179 ? 25.569 -10.438  -166.781 1.00 153.31 ? 176 ASN C CA    1 
ATOM   4061  C C     . ASN C 1 179 ? 26.329 -9.169   -167.150 1.00 165.19 ? 176 ASN C C     1 
ATOM   4062  O O     . ASN C 1 179 ? 25.942 -8.464   -168.089 1.00 168.02 ? 176 ASN C O     1 
ATOM   4063  C CB    . ASN C 1 179 ? 24.360 -10.103  -165.906 1.00 154.52 ? 176 ASN C CB    1 
ATOM   4064  C CG    . ASN C 1 179 ? 23.477 -11.307  -165.649 1.00 168.04 ? 176 ASN C CG    1 
ATOM   4065  O OD1   . ASN C 1 179 ? 23.112 -12.031  -166.575 1.00 168.40 ? 176 ASN C OD1   1 
ATOM   4066  N ND2   . ASN C 1 179 ? 23.123 -11.525  -164.387 1.00 163.67 ? 176 ASN C ND2   1 
ATOM   4067  N N     . LYS C 1 180 ? 27.411 -8.864   -166.428 1.00 165.99 ? 177 LYS C N     1 
ATOM   4068  C CA    . LYS C 1 180 ? 28.198 -7.657   -166.649 1.00 162.14 ? 177 LYS C CA    1 
ATOM   4069  C C     . LYS C 1 180 ? 29.287 -7.844   -167.700 1.00 168.45 ? 177 LYS C C     1 
ATOM   4070  O O     . LYS C 1 180 ? 30.297 -7.129   -167.672 1.00 181.95 ? 177 LYS C O     1 
ATOM   4071  C CB    . LYS C 1 180 ? 28.816 -7.188   -165.331 1.00 149.33 ? 177 LYS C CB    1 
ATOM   4072  C CG    . LYS C 1 180 ? 27.809 -6.929   -164.224 1.00 149.93 ? 177 LYS C CG    1 
ATOM   4073  C CD    . LYS C 1 180 ? 28.511 -6.695   -162.895 1.00 146.39 ? 177 LYS C CD    1 
ATOM   4074  C CE    . LYS C 1 180 ? 27.513 -6.548   -161.756 1.00 151.35 ? 177 LYS C CE    1 
ATOM   4075  N NZ    . LYS C 1 180 ? 28.202 -6.368   -160.447 1.00 146.49 ? 177 LYS C NZ    1 
ATOM   4076  N N     . LEU C 1 181 ? 29.116 -8.786   -168.619 1.00 164.21 ? 178 LEU C N     1 
ATOM   4077  C CA    . LEU C 1 181 ? 30.074 -9.042   -169.681 1.00 170.57 ? 178 LEU C CA    1 
ATOM   4078  C C     . LEU C 1 181 ? 29.410 -8.871   -171.041 1.00 171.65 ? 178 LEU C C     1 
ATOM   4079  O O     . LEU C 1 181 ? 28.186 -9.002   -171.166 1.00 164.29 ? 178 LEU C O     1 
ATOM   4080  C CB    . LEU C 1 181 ? 30.657 -10.458  -169.561 1.00 165.11 ? 178 LEU C CB    1 
ATOM   4081  C CG    . LEU C 1 181 ? 31.792 -10.625  -168.548 1.00 157.14 ? 178 LEU C CG    1 
ATOM   4082  C CD1   . LEU C 1 181 ? 32.282 -12.062  -168.520 1.00 156.50 ? 178 LEU C CD1   1 
ATOM   4083  C CD2   . LEU C 1 181 ? 32.937 -9.671   -168.857 1.00 154.98 ? 178 LEU C CD2   1 
ATOM   4084  N N     . PRO C 1 182 ? 30.185 -8.565   -172.081 1.00 172.28 ? 179 PRO C N     1 
ATOM   4085  C CA    . PRO C 1 182 ? 29.599 -8.434   -173.421 1.00 178.54 ? 179 PRO C CA    1 
ATOM   4086  C C     . PRO C 1 182 ? 29.004 -9.752   -173.896 1.00 174.48 ? 179 PRO C C     1 
ATOM   4087  O O     . PRO C 1 182 ? 29.677 -10.785  -173.925 1.00 169.36 ? 179 PRO C O     1 
ATOM   4088  C CB    . PRO C 1 182 ? 30.790 -8.006   -174.287 1.00 181.65 ? 179 PRO C CB    1 
ATOM   4089  C CG    . PRO C 1 182 ? 31.746 -7.376   -173.326 1.00 163.87 ? 179 PRO C CG    1 
ATOM   4090  C CD    . PRO C 1 182 ? 31.604 -8.169   -172.062 1.00 159.52 ? 179 PRO C CD    1 
ATOM   4091  N N     . ARG C 1 183 ? 27.728 -9.707   -174.273 1.00 177.14 ? 180 ARG C N     1 
ATOM   4092  C CA    . ARG C 1 183 ? 27.025 -10.889  -174.769 1.00 180.40 ? 180 ARG C CA    1 
ATOM   4093  C C     . ARG C 1 183 ? 27.494 -11.146  -176.195 1.00 181.21 ? 180 ARG C C     1 
ATOM   4094  O O     . ARG C 1 183 ? 26.969 -10.588  -177.160 1.00 174.89 ? 180 ARG C O     1 
ATOM   4095  C CB    . ARG C 1 183 ? 25.516 -10.692  -174.699 1.00 175.89 ? 180 ARG C CB    1 
ATOM   4096  C CG    . ARG C 1 183 ? 24.771 -11.837  -174.033 1.00 176.58 ? 180 ARG C CG    1 
ATOM   4097  C CD    . ARG C 1 183 ? 24.735 -13.067  -174.925 1.00 184.59 ? 180 ARG C CD    1 
ATOM   4098  N NE    . ARG C 1 183 ? 24.239 -12.760  -176.264 1.00 204.33 ? 180 ARG C NE    1 
ATOM   4099  C CZ    . ARG C 1 183 ? 24.273 -13.610  -177.285 1.00 203.17 ? 180 ARG C CZ    1 
ATOM   4100  N NH1   . ARG C 1 183 ? 24.780 -14.825  -177.123 1.00 194.50 ? 180 ARG C NH1   1 
ATOM   4101  N NH2   . ARG C 1 183 ? 23.800 -13.246  -178.470 1.00 199.46 ? 180 ARG C NH2   1 
ATOM   4102  N N     . GLN C 1 184 ? 28.501 -12.003  -176.328 1.00 180.83 ? 181 GLN C N     1 
ATOM   4103  C CA    . GLN C 1 184 ? 29.109 -12.260  -177.622 1.00 174.57 ? 181 GLN C CA    1 
ATOM   4104  C C     . GLN C 1 184 ? 28.235 -13.188  -178.459 1.00 176.16 ? 181 GLN C C     1 
ATOM   4105  O O     . GLN C 1 184 ? 27.430 -13.968  -177.942 1.00 183.09 ? 181 GLN C O     1 
ATOM   4106  C CB    . GLN C 1 184 ? 30.505 -12.857  -177.447 1.00 172.26 ? 181 GLN C CB    1 
ATOM   4107  C CG    . GLN C 1 184 ? 30.560 -14.044  -176.501 1.00 176.88 ? 181 GLN C CG    1 
ATOM   4108  C CD    . GLN C 1 184 ? 31.921 -14.706  -176.480 1.00 171.28 ? 181 GLN C CD    1 
ATOM   4109  O OE1   . GLN C 1 184 ? 32.394 -15.214  -177.497 1.00 179.11 ? 181 GLN C OE1   1 
ATOM   4110  N NE2   . GLN C 1 184 ? 32.566 -14.694  -175.319 1.00 153.72 ? 181 GLN C NE2   1 
ATOM   4111  N N     . LEU C 1 185 ? 28.407 -13.094  -179.774 1.00 173.02 ? 182 LEU C N     1 
ATOM   4112  C CA    . LEU C 1 185 ? 27.672 -13.920  -180.714 1.00 191.81 ? 182 LEU C CA    1 
ATOM   4113  C C     . LEU C 1 185 ? 28.266 -15.329  -180.740 1.00 200.16 ? 182 LEU C C     1 
ATOM   4114  O O     . LEU C 1 185 ? 29.443 -15.513  -180.414 1.00 202.05 ? 182 LEU C O     1 
ATOM   4115  C CB    . LEU C 1 185 ? 27.721 -13.299  -182.109 1.00 194.76 ? 182 LEU C CB    1 
ATOM   4116  C CG    . LEU C 1 185 ? 26.442 -13.312  -182.952 1.00 191.99 ? 182 LEU C CG    1 
ATOM   4117  C CD1   . LEU C 1 185 ? 25.295 -12.654  -182.195 1.00 180.59 ? 182 LEU C CD1   1 
ATOM   4118  C CD2   . LEU C 1 185 ? 26.666 -12.624  -184.290 1.00 171.52 ? 182 LEU C CD2   1 
ATOM   4119  N N     . PRO C 1 186 ? 27.464 -16.340  -181.083 1.00 195.85 ? 183 PRO C N     1 
ATOM   4120  C CA    . PRO C 1 186 ? 27.982 -17.714  -181.132 1.00 186.72 ? 183 PRO C CA    1 
ATOM   4121  C C     . PRO C 1 186 ? 29.272 -17.824  -181.934 1.00 186.01 ? 183 PRO C C     1 
ATOM   4122  O O     . PRO C 1 186 ? 29.420 -17.225  -183.002 1.00 186.53 ? 183 PRO C O     1 
ATOM   4123  C CB    . PRO C 1 186 ? 26.841 -18.490  -181.796 1.00 178.61 ? 183 PRO C CB    1 
ATOM   4124  C CG    . PRO C 1 186 ? 25.614 -17.759  -181.377 1.00 183.51 ? 183 PRO C CG    1 
ATOM   4125  C CD    . PRO C 1 186 ? 25.996 -16.305  -181.212 1.00 185.46 ? 183 PRO C CD    1 
ATOM   4126  N N     . LEU C 1 187 ? 30.212 -18.601  -181.400 1.00 186.90 ? 184 LEU C N     1 
ATOM   4127  C CA    . LEU C 1 187 ? 31.502 -18.795  -182.045 1.00 187.49 ? 184 LEU C CA    1 
ATOM   4128  C C     . LEU C 1 187 ? 31.349 -19.563  -183.353 1.00 180.07 ? 184 LEU C C     1 
ATOM   4129  O O     . LEU C 1 187 ? 30.436 -20.375  -183.524 1.00 175.10 ? 184 LEU C O     1 
ATOM   4130  C CB    . LEU C 1 187 ? 32.463 -19.541  -181.116 1.00 178.56 ? 184 LEU C CB    1 
ATOM   4131  C CG    . LEU C 1 187 ? 32.800 -18.936  -179.748 1.00 181.84 ? 184 LEU C CG    1 
ATOM   4132  C CD1   . LEU C 1 187 ? 33.001 -17.426  -179.848 1.00 173.56 ? 184 LEU C CD1   1 
ATOM   4133  C CD2   . LEU C 1 187 ? 31.758 -19.287  -178.687 1.00 175.33 ? 184 LEU C CD2   1 
ATOM   4134  N N     . GLU C 1 188 ? 32.261 -19.293  -184.284 1.00 176.44 ? 185 GLU C N     1 
ATOM   4135  C CA    . GLU C 1 188 ? 32.280 -19.967  -185.574 1.00 168.76 ? 185 GLU C CA    1 
ATOM   4136  C C     . GLU C 1 188 ? 33.213 -21.170  -185.504 1.00 173.04 ? 185 GLU C C     1 
ATOM   4137  O O     . GLU C 1 188 ? 34.336 -21.065  -185.000 1.00 176.14 ? 185 GLU C O     1 
ATOM   4138  C CB    . GLU C 1 188 ? 32.725 -19.007  -186.677 1.00 166.60 ? 185 GLU C CB    1 
ATOM   4139  C CG    . GLU C 1 188 ? 32.669 -19.593  -188.077 1.00 166.36 ? 185 GLU C CG    1 
ATOM   4140  C CD    . GLU C 1 188 ? 33.001 -18.572  -189.148 1.00 169.87 ? 185 GLU C CD    1 
ATOM   4141  O OE1   . GLU C 1 188 ? 33.981 -17.818  -188.969 1.00 172.69 ? 185 GLU C OE1   1 
ATOM   4142  O OE2   . GLU C 1 188 ? 32.281 -18.522  -190.166 1.00 166.80 ? 185 GLU C OE2   1 
ATOM   4143  N N     . VAL C 1 189 ? 32.744 -22.309  -186.007 1.00 168.27 ? 186 VAL C N     1 
ATOM   4144  C CA    . VAL C 1 189 ? 33.486 -23.563  -185.953 1.00 159.36 ? 186 VAL C CA    1 
ATOM   4145  C C     . VAL C 1 189 ? 34.188 -23.773  -187.287 1.00 159.10 ? 186 VAL C C     1 
ATOM   4146  O O     . VAL C 1 189 ? 33.557 -23.709  -188.349 1.00 158.76 ? 186 VAL C O     1 
ATOM   4147  C CB    . VAL C 1 189 ? 32.557 -24.745  -185.625 1.00 157.62 ? 186 VAL C CB    1 
ATOM   4148  C CG1   . VAL C 1 189 ? 33.346 -26.044  -185.574 1.00 160.22 ? 186 VAL C CG1   1 
ATOM   4149  C CG2   . VAL C 1 189 ? 31.832 -24.504  -184.309 1.00 145.73 ? 186 VAL C CG2   1 
ATOM   4150  N N     . ASP C 1 190 ? 35.495 -24.024  -187.232 1.00 157.76 ? 187 ASP C N     1 
ATOM   4151  C CA    . ASP C 1 190 ? 36.309 -24.227  -188.427 1.00 170.01 ? 187 ASP C CA    1 
ATOM   4152  C C     . ASP C 1 190 ? 36.332 -25.715  -188.758 1.00 169.72 ? 187 ASP C C     1 
ATOM   4153  O O     . ASP C 1 190 ? 36.864 -26.522  -187.987 1.00 171.29 ? 187 ASP C O     1 
ATOM   4154  C CB    . ASP C 1 190 ? 37.720 -23.685  -188.210 1.00 173.79 ? 187 ASP C CB    1 
ATOM   4155  C CG    . ASP C 1 190 ? 38.604 -23.857  -189.428 1.00 181.61 ? 187 ASP C CG    1 
ATOM   4156  O OD1   . ASP C 1 190 ? 38.406 -23.118  -190.415 1.00 193.69 ? 187 ASP C OD1   1 
ATOM   4157  O OD2   . ASP C 1 190 ? 39.498 -24.730  -189.399 1.00 173.09 ? 187 ASP C OD2   1 
ATOM   4158  N N     . LEU C 1 191 ? 35.755 -26.079  -189.905 1.00 159.29 ? 188 LEU C N     1 
ATOM   4159  C CA    . LEU C 1 191 ? 35.671 -27.467  -190.347 1.00 158.79 ? 188 LEU C CA    1 
ATOM   4160  C C     . LEU C 1 191 ? 36.692 -27.805  -191.429 1.00 157.52 ? 188 LEU C C     1 
ATOM   4161  O O     . LEU C 1 191 ? 36.429 -28.660  -192.282 1.00 151.48 ? 188 LEU C O     1 
ATOM   4162  C CB    . LEU C 1 191 ? 34.259 -27.778  -190.840 1.00 152.98 ? 188 LEU C CB    1 
ATOM   4163  C CG    . LEU C 1 191 ? 33.134 -27.511  -189.842 1.00 145.90 ? 188 LEU C CG    1 
ATOM   4164  C CD1   . LEU C 1 191 ? 31.808 -27.986  -190.403 1.00 142.24 ? 188 LEU C CD1   1 
ATOM   4165  C CD2   . LEU C 1 191 ? 33.432 -28.186  -188.516 1.00 149.71 ? 188 LEU C CD2   1 
ATOM   4166  N N     . THR C 1 192 ? 37.853 -27.150  -191.417 1.00 162.91 ? 189 THR C N     1 
ATOM   4167  C CA    . THR C 1 192 ? 38.889 -27.461  -192.397 1.00 164.55 ? 189 THR C CA    1 
ATOM   4168  C C     . THR C 1 192 ? 39.625 -28.750  -192.042 1.00 157.32 ? 189 THR C C     1 
ATOM   4169  O O     . THR C 1 192 ? 39.636 -29.707  -192.824 1.00 159.42 ? 189 THR C O     1 
ATOM   4170  C CB    . THR C 1 192 ? 39.875 -26.294  -192.510 1.00 172.91 ? 189 THR C CB    1 
ATOM   4171  O OG1   . THR C 1 192 ? 40.510 -26.077  -191.244 1.00 179.72 ? 189 THR C OG1   1 
ATOM   4172  C CG2   . THR C 1 192 ? 39.152 -25.026  -192.937 1.00 170.69 ? 189 THR C CG2   1 
ATOM   4173  N N     . LYS C 1 193 ? 40.248 -28.790  -190.864 1.00 161.30 ? 190 LYS C N     1 
ATOM   4174  C CA    . LYS C 1 193 ? 41.002 -29.950  -190.402 1.00 175.03 ? 190 LYS C CA    1 
ATOM   4175  C C     . LYS C 1 193 ? 40.129 -31.026  -189.758 1.00 180.82 ? 190 LYS C C     1 
ATOM   4176  O O     . LYS C 1 193 ? 40.651 -31.843  -188.989 1.00 166.55 ? 190 LYS C O     1 
ATOM   4177  C CB    . LYS C 1 193 ? 42.094 -29.511  -189.423 1.00 169.99 ? 190 LYS C CB    1 
ATOM   4178  C CG    . LYS C 1 193 ? 43.049 -28.471  -189.982 1.00 162.61 ? 190 LYS C CG    1 
ATOM   4179  C CD    . LYS C 1 193 ? 44.089 -28.069  -188.950 1.00 161.97 ? 190 LYS C CD    1 
ATOM   4180  C CE    . LYS C 1 193 ? 45.021 -26.997  -189.491 1.00 172.03 ? 190 LYS C CE    1 
ATOM   4181  N NZ    . LYS C 1 193 ? 46.031 -26.581  -188.479 1.00 170.65 ? 190 LYS C NZ    1 
ATOM   4182  N N     . ALA C 1 194 ? 38.827 -31.043  -190.036 1.00 175.63 ? 191 ALA C N     1 
ATOM   4183  C CA    . ALA C 1 194 ? 37.952 -32.051  -189.452 1.00 158.54 ? 191 ALA C CA    1 
ATOM   4184  C C     . ALA C 1 194 ? 38.328 -33.445  -189.944 1.00 164.02 ? 191 ALA C C     1 
ATOM   4185  O O     . ALA C 1 194 ? 38.909 -33.616  -191.020 1.00 163.65 ? 191 ALA C O     1 
ATOM   4186  C CB    . ALA C 1 194 ? 36.492 -31.750  -189.792 1.00 147.53 ? 191 ALA C CB    1 
ATOM   4187  N N     . LYS C 1 195 ? 37.991 -34.450  -189.136 1.00 145.05 ? 192 LYS C N     1 
ATOM   4188  C CA    . LYS C 1 195 ? 38.275 -35.834  -189.493 1.00 135.94 ? 192 LYS C CA    1 
ATOM   4189  C C     . LYS C 1 195 ? 37.483 -36.240  -190.730 1.00 127.72 ? 192 LYS C C     1 
ATOM   4190  O O     . LYS C 1 195 ? 36.271 -36.017  -190.808 1.00 109.28 ? 192 LYS C O     1 
ATOM   4191  C CB    . LYS C 1 195 ? 37.945 -36.759  -188.322 1.00 139.41 ? 192 LYS C CB    1 
ATOM   4192  C CG    . LYS C 1 195 ? 38.279 -38.220  -188.567 1.00 141.28 ? 192 LYS C CG    1 
ATOM   4193  C CD    . LYS C 1 195 ? 38.310 -39.001  -187.264 1.00 117.35 ? 192 LYS C CD    1 
ATOM   4194  C CE    . LYS C 1 195 ? 38.783 -40.427  -187.487 1.00 133.44 ? 192 LYS C CE    1 
ATOM   4195  N NZ    . LYS C 1 195 ? 40.054 -40.478  -188.262 1.00 139.37 ? 192 LYS C NZ    1 
ATOM   4196  N N     . ARG C 1 196 ? 38.175 -36.839  -191.700 1.00 125.04 ? 193 ARG C N     1 
ATOM   4197  C CA    . ARG C 1 196 ? 37.569 -37.169  -192.982 1.00 135.52 ? 193 ARG C CA    1 
ATOM   4198  C C     . ARG C 1 196 ? 37.758 -38.616  -193.415 1.00 141.69 ? 193 ARG C C     1 
ATOM   4199  O O     . ARG C 1 196 ? 37.161 -39.015  -194.421 1.00 139.20 ? 193 ARG C O     1 
ATOM   4200  C CB    . ARG C 1 196 ? 38.118 -36.247  -194.082 1.00 134.90 ? 193 ARG C CB    1 
ATOM   4201  C CG    . ARG C 1 196 ? 37.751 -34.782  -193.891 1.00 138.23 ? 193 ARG C CG    1 
ATOM   4202  C CD    . ARG C 1 196 ? 37.783 -34.013  -195.201 1.00 137.10 ? 193 ARG C CD    1 
ATOM   4203  N NE    . ARG C 1 196 ? 36.789 -32.942  -195.230 1.00 148.35 ? 193 ARG C NE    1 
ATOM   4204  C CZ    . ARG C 1 196 ? 36.930 -31.771  -194.616 1.00 147.24 ? 193 ARG C CZ    1 
ATOM   4205  N NH1   . ARG C 1 196 ? 38.029 -31.510  -193.922 1.00 155.02 ? 193 ARG C NH1   1 
ATOM   4206  N NH2   . ARG C 1 196 ? 35.972 -30.858  -194.699 1.00 121.65 ? 193 ARG C NH2   1 
ATOM   4207  N N     . GLN C 1 197 ? 38.554 -39.412  -192.702 1.00 147.26 ? 194 GLN C N     1 
ATOM   4208  C CA    . GLN C 1 197 ? 38.734 -40.817  -193.036 1.00 146.69 ? 194 GLN C CA    1 
ATOM   4209  C C     . GLN C 1 197 ? 38.860 -41.626  -191.752 1.00 141.08 ? 194 GLN C C     1 
ATOM   4210  O O     . GLN C 1 197 ? 39.015 -41.080  -190.656 1.00 130.34 ? 194 GLN C O     1 
ATOM   4211  C CB    . GLN C 1 197 ? 39.959 -41.030  -193.939 1.00 139.03 ? 194 GLN C CB    1 
ATOM   4212  C CG    . GLN C 1 197 ? 41.280 -41.217  -193.199 1.00 141.69 ? 194 GLN C CG    1 
ATOM   4213  C CD    . GLN C 1 197 ? 41.757 -39.959  -192.495 1.00 137.34 ? 194 GLN C CD    1 
ATOM   4214  O OE1   . GLN C 1 197 ? 41.194 -38.879  -192.671 1.00 143.09 ? 194 GLN C OE1   1 
ATOM   4215  N NE2   . GLN C 1 197 ? 42.806 -40.096  -191.692 1.00 128.00 ? 194 GLN C NE2   1 
ATOM   4216  N N     . ASP C 1 198 ? 38.792 -42.950  -191.901 1.00 142.21 ? 195 ASP C N     1 
ATOM   4217  C CA    . ASP C 1 198 ? 38.798 -43.843  -190.747 1.00 130.75 ? 195 ASP C CA    1 
ATOM   4218  C C     . ASP C 1 198 ? 40.194 -43.972  -190.146 1.00 126.35 ? 195 ASP C C     1 
ATOM   4219  O O     . ASP C 1 198 ? 40.392 -43.728  -188.951 1.00 127.69 ? 195 ASP C O     1 
ATOM   4220  C CB    . ASP C 1 198 ? 38.259 -45.220  -191.147 1.00 133.87 ? 195 ASP C CB    1 
ATOM   4221  C CG    . ASP C 1 198 ? 36.809 -45.174  -191.587 1.00 128.80 ? 195 ASP C CG    1 
ATOM   4222  O OD1   . ASP C 1 198 ? 36.158 -44.126  -191.390 1.00 120.89 ? 195 ASP C OD1   1 
ATOM   4223  O OD2   . ASP C 1 198 ? 36.319 -46.188  -192.128 1.00 117.87 ? 195 ASP C OD2   1 
ATOM   4224  N N     . LEU C 1 199 ? 41.168 -44.365  -190.964 1.00 128.03 ? 196 LEU C N     1 
ATOM   4225  C CA    . LEU C 1 199 ? 42.495 -44.700  -190.464 1.00 128.16 ? 196 LEU C CA    1 
ATOM   4226  C C     . LEU C 1 199 ? 43.154 -43.502  -189.788 1.00 128.23 ? 196 LEU C C     1 
ATOM   4227  O O     . LEU C 1 199 ? 43.036 -42.362  -190.245 1.00 124.61 ? 196 LEU C O     1 
ATOM   4228  C CB    . LEU C 1 199 ? 43.374 -45.207  -191.610 1.00 115.76 ? 196 LEU C CB    1 
ATOM   4229  C CG    . LEU C 1 199 ? 44.818 -45.587  -191.275 1.00 114.71 ? 196 LEU C CG    1 
ATOM   4230  C CD1   . LEU C 1 199 ? 44.857 -46.645  -190.183 1.00 134.30 ? 196 LEU C CD1   1 
ATOM   4231  C CD2   . LEU C 1 199 ? 45.551 -46.066  -192.518 1.00 115.01 ? 196 LEU C CD2   1 
ATOM   4232  N N     . GLU C 1 200 ? 43.848 -43.775  -188.684 1.00 135.29 ? 197 GLU C N     1 
ATOM   4233  C CA    . GLU C 1 200 ? 44.619 -42.775  -187.946 1.00 128.95 ? 197 GLU C CA    1 
ATOM   4234  C C     . GLU C 1 200 ? 46.045 -43.294  -187.825 1.00 142.64 ? 197 GLU C C     1 
ATOM   4235  O O     . GLU C 1 200 ? 46.412 -43.902  -186.810 1.00 149.45 ? 197 GLU C O     1 
ATOM   4236  C CB    . GLU C 1 200 ? 44.010 -42.504  -186.570 1.00 131.13 ? 197 GLU C CB    1 
ATOM   4237  C CG    . GLU C 1 200 ? 42.720 -41.706  -186.604 1.00 136.40 ? 197 GLU C CG    1 
ATOM   4238  C CD    . GLU C 1 200 ? 42.959 -40.229  -186.831 1.00 143.13 ? 197 GLU C CD    1 
ATOM   4239  O OE1   . GLU C 1 200 ? 43.873 -39.669  -186.188 1.00 144.45 ? 197 GLU C OE1   1 
ATOM   4240  O OE2   . GLU C 1 200 ? 42.235 -39.627  -187.651 1.00 143.97 ? 197 GLU C OE2   1 
ATOM   4241  N N     . PRO C 1 201 ? 46.874 -43.088  -188.854 1.00 136.56 ? 198 PRO C N     1 
ATOM   4242  C CA    . PRO C 1 201 ? 48.252 -43.603  -188.796 1.00 134.85 ? 198 PRO C CA    1 
ATOM   4243  C C     . PRO C 1 201 ? 49.055 -43.067  -187.625 1.00 132.47 ? 198 PRO C C     1 
ATOM   4244  O O     . PRO C 1 201 ? 49.900 -43.791  -187.086 1.00 129.42 ? 198 PRO C O     1 
ATOM   4245  C CB    . PRO C 1 201 ? 48.844 -43.155  -190.140 1.00 136.91 ? 198 PRO C CB    1 
ATOM   4246  C CG    . PRO C 1 201 ? 47.657 -43.011  -191.038 1.00 135.07 ? 198 PRO C CG    1 
ATOM   4247  C CD    . PRO C 1 201 ? 46.575 -42.464  -190.153 1.00 133.49 ? 198 PRO C CD    1 
ATOM   4248  N N     . SER C 1 202 ? 48.816 -41.817  -187.217 1.00 133.80 ? 199 SER C N     1 
ATOM   4249  C CA    . SER C 1 202 ? 49.479 -41.279  -186.031 1.00 132.52 ? 199 SER C CA    1 
ATOM   4250  C C     . SER C 1 202 ? 49.214 -42.147  -184.807 1.00 138.55 ? 199 SER C C     1 
ATOM   4251  O O     . SER C 1 202 ? 50.120 -42.396  -184.003 1.00 140.86 ? 199 SER C O     1 
ATOM   4252  C CB    . SER C 1 202 ? 49.020 -39.842  -185.781 1.00 140.57 ? 199 SER C CB    1 
ATOM   4253  O OG    . SER C 1 202 ? 49.736 -39.257  -184.707 1.00 127.39 ? 199 SER C OG    1 
ATOM   4254  N N     . VAL C 1 203 ? 47.978 -42.619  -184.653 1.00 137.79 ? 200 VAL C N     1 
ATOM   4255  C CA    . VAL C 1 203 ? 47.621 -43.464  -183.518 1.00 132.22 ? 200 VAL C CA    1 
ATOM   4256  C C     . VAL C 1 203 ? 48.081 -44.898  -183.743 1.00 122.22 ? 200 VAL C C     1 
ATOM   4257  O O     . VAL C 1 203 ? 48.590 -45.551  -182.822 1.00 123.35 ? 200 VAL C O     1 
ATOM   4258  C CB    . VAL C 1 203 ? 46.105 -43.393  -183.260 1.00 133.79 ? 200 VAL C CB    1 
ATOM   4259  C CG1   . VAL C 1 203 ? 45.740 -44.227  -182.046 1.00 153.09 ? 200 VAL C CG1   1 
ATOM   4260  C CG2   . VAL C 1 203 ? 45.663 -41.950  -183.082 1.00 132.30 ? 200 VAL C CG2   1 
ATOM   4261  N N     . GLU C 1 204 ? 47.843 -45.425  -184.948 1.00 121.74 ? 201 GLU C N     1 
ATOM   4262  C CA    . GLU C 1 204 ? 48.252 -46.788  -185.276 1.00 132.59 ? 201 GLU C CA    1 
ATOM   4263  C C     . GLU C 1 204 ? 49.739 -47.004  -185.015 1.00 136.71 ? 201 GLU C C     1 
ATOM   4264  O O     . GLU C 1 204 ? 50.142 -48.058  -184.511 1.00 116.70 ? 201 GLU C O     1 
ATOM   4265  C CB    . GLU C 1 204 ? 47.908 -47.096  -186.734 1.00 135.42 ? 201 GLU C CB    1 
ATOM   4266  C CG    . GLU C 1 204 ? 48.490 -48.398  -187.260 1.00 151.11 ? 201 GLU C CG    1 
ATOM   4267  C CD    . GLU C 1 204 ? 47.871 -49.617  -186.610 1.00 145.45 ? 201 GLU C CD    1 
ATOM   4268  O OE1   . GLU C 1 204 ? 46.641 -49.796  -186.734 1.00 144.20 ? 201 GLU C OE1   1 
ATOM   4269  O OE2   . GLU C 1 204 ? 48.614 -50.399  -185.979 1.00 141.40 ? 201 GLU C OE2   1 
ATOM   4270  N N     . GLU C 1 205 ? 50.566 -46.010  -185.346 1.00 150.73 ? 202 GLU C N     1 
ATOM   4271  C CA    . GLU C 1 205 ? 52.007 -46.108  -185.127 1.00 150.80 ? 202 GLU C CA    1 
ATOM   4272  C C     . GLU C 1 205 ? 52.328 -46.318  -183.652 1.00 148.38 ? 202 GLU C C     1 
ATOM   4273  O O     . GLU C 1 205 ? 53.014 -47.279  -183.276 1.00 151.60 ? 202 GLU C O     1 
ATOM   4274  C CB    . GLU C 1 205 ? 52.688 -44.840  -185.648 1.00 157.33 ? 202 GLU C CB    1 
ATOM   4275  C CG    . GLU C 1 205 ? 54.203 -44.884  -185.673 1.00 164.87 ? 202 GLU C CG    1 
ATOM   4276  C CD    . GLU C 1 205 ? 54.800 -43.648  -186.317 1.00 180.81 ? 202 GLU C CD    1 
ATOM   4277  O OE1   . GLU C 1 205 ? 54.606 -42.542  -185.768 1.00 173.22 ? 202 GLU C OE1   1 
ATOM   4278  O OE2   . GLU C 1 205 ? 55.457 -43.780  -187.370 1.00 198.57 ? 202 GLU C OE2   1 
ATOM   4279  N N     . ALA C 1 206 ? 51.852 -45.404  -182.803 1.00 143.57 ? 203 ALA C N     1 
ATOM   4280  C CA    . ALA C 1 206 ? 52.129 -45.490  -181.375 1.00 150.15 ? 203 ALA C CA    1 
ATOM   4281  C C     . ALA C 1 206 ? 51.571 -46.773  -180.773 1.00 147.82 ? 203 ALA C C     1 
ATOM   4282  O O     . ALA C 1 206 ? 52.190 -47.372  -179.886 1.00 130.88 ? 203 ALA C O     1 
ATOM   4283  C CB    . ALA C 1 206 ? 51.555 -44.267  -180.664 1.00 143.45 ? 203 ALA C CB    1 
ATOM   4284  N N     . ARG C 1 207 ? 50.408 -47.224  -181.251 1.00 155.85 ? 204 ARG C N     1 
ATOM   4285  C CA    . ARG C 1 207 ? 49.806 -48.421  -180.671 1.00 140.72 ? 204 ARG C CA    1 
ATOM   4286  C C     . ARG C 1 207 ? 50.565 -49.675  -181.086 1.00 138.06 ? 204 ARG C C     1 
ATOM   4287  O O     . ARG C 1 207 ? 50.734 -50.599  -180.282 1.00 132.91 ? 204 ARG C O     1 
ATOM   4288  C CB    . ARG C 1 207 ? 48.337 -48.522  -181.075 1.00 135.82 ? 204 ARG C CB    1 
ATOM   4289  C CG    . ARG C 1 207 ? 47.545 -49.538  -180.270 1.00 128.01 ? 204 ARG C CG    1 
ATOM   4290  C CD    . ARG C 1 207 ? 46.169 -49.737  -180.866 1.00 126.86 ? 204 ARG C CD    1 
ATOM   4291  N NE    . ARG C 1 207 ? 45.540 -48.469  -181.221 1.00 128.52 ? 204 ARG C NE    1 
ATOM   4292  C CZ    . ARG C 1 207 ? 44.775 -48.295  -182.294 1.00 121.42 ? 204 ARG C CZ    1 
ATOM   4293  N NH1   . ARG C 1 207 ? 44.552 -49.307  -183.120 1.00 115.91 ? 204 ARG C NH1   1 
ATOM   4294  N NH2   . ARG C 1 207 ? 44.239 -47.109  -182.548 1.00 105.49 ? 204 ARG C NH2   1 
ATOM   4295  N N     . TYR C 1 208 ? 51.022 -49.728  -182.340 1.00 140.38 ? 205 TYR C N     1 
ATOM   4296  C CA    . TYR C 1 208 ? 51.858 -50.837  -182.782 1.00 138.96 ? 205 TYR C CA    1 
ATOM   4297  C C     . TYR C 1 208 ? 53.192 -50.847  -182.051 1.00 142.42 ? 205 TYR C C     1 
ATOM   4298  O O     . TYR C 1 208 ? 53.757 -51.918  -181.804 1.00 129.37 ? 205 TYR C O     1 
ATOM   4299  C CB    . TYR C 1 208 ? 52.073 -50.753  -184.293 1.00 135.74 ? 205 TYR C CB    1 
ATOM   4300  C CG    . TYR C 1 208 ? 53.024 -51.790  -184.843 1.00 142.77 ? 205 TYR C CG    1 
ATOM   4301  C CD1   . TYR C 1 208 ? 52.692 -53.138  -184.836 1.00 138.16 ? 205 TYR C CD1   1 
ATOM   4302  C CD2   . TYR C 1 208 ? 54.255 -51.422  -185.370 1.00 153.02 ? 205 TYR C CD2   1 
ATOM   4303  C CE1   . TYR C 1 208 ? 53.558 -54.090  -185.340 1.00 136.44 ? 205 TYR C CE1   1 
ATOM   4304  C CE2   . TYR C 1 208 ? 55.129 -52.366  -185.874 1.00 144.05 ? 205 TYR C CE2   1 
ATOM   4305  C CZ    . TYR C 1 208 ? 54.775 -53.699  -185.857 1.00 131.28 ? 205 TYR C CZ    1 
ATOM   4306  O OH    . TYR C 1 208 ? 55.642 -54.643  -186.358 1.00 103.93 ? 205 TYR C OH    1 
ATOM   4307  N N     . ASN C 1 209 ? 53.711 -49.669  -181.699 1.00 152.33 ? 206 ASN C N     1 
ATOM   4308  C CA    . ASN C 1 209 ? 54.928 -49.598  -180.900 1.00 158.52 ? 206 ASN C CA    1 
ATOM   4309  C C     . ASN C 1 209 ? 54.675 -49.799  -179.411 1.00 159.72 ? 206 ASN C C     1 
ATOM   4310  O O     . ASN C 1 209 ? 55.640 -49.921  -178.648 1.00 159.50 ? 206 ASN C O     1 
ATOM   4311  C CB    . ASN C 1 209 ? 55.628 -48.255  -181.123 1.00 164.06 ? 206 ASN C CB    1 
ATOM   4312  C CG    . ASN C 1 209 ? 56.193 -48.119  -182.523 1.00 166.82 ? 206 ASN C CG    1 
ATOM   4313  O OD1   . ASN C 1 209 ? 57.139 -48.815  -182.893 1.00 165.61 ? 206 ASN C OD1   1 
ATOM   4314  N ND2   . ASN C 1 209 ? 55.616 -47.219  -183.310 1.00 162.30 ? 206 ASN C ND2   1 
ATOM   4315  N N     . SER C 1 210 ? 53.415 -49.839  -178.982 1.00 157.47 ? 207 SER C N     1 
ATOM   4316  C CA    . SER C 1 210 ? 53.080 -50.002  -177.572 1.00 156.99 ? 207 SER C CA    1 
ATOM   4317  C C     . SER C 1 210 ? 53.225 -51.437  -177.082 1.00 143.08 ? 207 SER C C     1 
ATOM   4318  O O     . SER C 1 210 ? 53.055 -51.682  -175.882 1.00 153.06 ? 207 SER C O     1 
ATOM   4319  C CB    . SER C 1 210 ? 51.652 -49.515  -177.315 1.00 155.48 ? 207 SER C CB    1 
ATOM   4320  O OG    . SER C 1 210 ? 51.412 -49.335  -175.929 1.00 151.27 ? 207 SER C OG    1 
ATOM   4321  N N     . CYS C 1 211 ? 53.529 -52.384  -177.963 1.00 123.80 ? 208 CYS C N     1 
ATOM   4322  C CA    . CYS C 1 211 ? 53.683 -53.779  -177.564 1.00 135.74 ? 208 CYS C CA    1 
ATOM   4323  C C     . CYS C 1 211 ? 55.123 -54.082  -177.164 1.00 135.74 ? 208 CYS C C     1 
ATOM   4324  O O     . CYS C 1 211 ? 55.618 -55.188  -177.382 1.00 113.46 ? 208 CYS C O     1 
ATOM   4325  C CB    . CYS C 1 211 ? 53.246 -54.714  -178.694 1.00 132.11 ? 208 CYS C CB    1 
ATOM   4326  S SG    . CYS C 1 211 ? 51.497 -54.594  -179.136 1.00 134.77 ? 208 CYS C SG    1 
ATOM   4327  N N     . CYS D 1 28  ? 46.943 -57.747  -170.097 1.00 136.79 ? 25  CYS D N     1 
ATOM   4328  C CA    . CYS D 1 28  ? 45.705 -58.082  -170.789 1.00 131.05 ? 25  CYS D CA    1 
ATOM   4329  C C     . CYS D 1 28  ? 44.744 -56.901  -170.780 1.00 131.55 ? 25  CYS D C     1 
ATOM   4330  O O     . CYS D 1 28  ? 45.122 -55.786  -170.419 1.00 150.41 ? 25  CYS D O     1 
ATOM   4331  C CB    . CYS D 1 28  ? 45.042 -59.301  -170.146 1.00 126.85 ? 25  CYS D CB    1 
ATOM   4332  S SG    . CYS D 1 28  ? 44.666 -59.094  -168.390 1.00 145.10 ? 25  CYS D SG    1 
ATOM   4333  N N     . PHE D 1 29  ? 43.500 -57.150  -171.179 1.00 110.66 ? 26  PHE D N     1 
ATOM   4334  C CA    . PHE D 1 29  ? 42.493 -56.099  -171.168 1.00 87.57  ? 26  PHE D CA    1 
ATOM   4335  C C     . PHE D 1 29  ? 42.151 -55.719  -169.733 1.00 90.68  ? 26  PHE D C     1 
ATOM   4336  O O     . PHE D 1 29  ? 42.056 -56.577  -168.850 1.00 103.58 ? 26  PHE D O     1 
ATOM   4337  C CB    . PHE D 1 29  ? 41.239 -56.558  -171.910 1.00 71.86  ? 26  PHE D CB    1 
ATOM   4338  C CG    . PHE D 1 29  ? 40.356 -55.432  -172.363 1.00 79.48  ? 26  PHE D CG    1 
ATOM   4339  C CD1   . PHE D 1 29  ? 39.481 -54.818  -171.482 1.00 85.63  ? 26  PHE D CD1   1 
ATOM   4340  C CD2   . PHE D 1 29  ? 40.405 -54.984  -173.672 1.00 89.37  ? 26  PHE D CD2   1 
ATOM   4341  C CE1   . PHE D 1 29  ? 38.672 -53.780  -171.899 1.00 91.31  ? 26  PHE D CE1   1 
ATOM   4342  C CE2   . PHE D 1 29  ? 39.598 -53.946  -174.094 1.00 88.30  ? 26  PHE D CE2   1 
ATOM   4343  C CZ    . PHE D 1 29  ? 38.731 -53.343  -173.207 1.00 78.56  ? 26  PHE D CZ    1 
ATOM   4344  N N     . GLY D 1 30  ? 41.966 -54.420  -169.501 1.00 92.27  ? 27  GLY D N     1 
ATOM   4345  C CA    . GLY D 1 30  ? 41.761 -53.895  -168.170 1.00 102.67 ? 27  GLY D CA    1 
ATOM   4346  C C     . GLY D 1 30  ? 43.020 -53.683  -167.358 1.00 110.34 ? 27  GLY D C     1 
ATOM   4347  O O     . GLY D 1 30  ? 42.970 -52.986  -166.337 1.00 108.94 ? 27  GLY D O     1 
ATOM   4348  N N     . GLN D 1 31  ? 44.148 -54.257  -167.774 1.00 114.56 ? 28  GLN D N     1 
ATOM   4349  C CA    . GLN D 1 31  ? 45.416 -54.128  -167.065 1.00 129.59 ? 28  GLN D CA    1 
ATOM   4350  C C     . GLN D 1 31  ? 46.447 -53.291  -167.803 1.00 129.17 ? 28  GLN D C     1 
ATOM   4351  O O     . GLN D 1 31  ? 47.142 -52.489  -167.175 1.00 136.20 ? 28  GLN D O     1 
ATOM   4352  C CB    . GLN D 1 31  ? 46.010 -55.515  -166.786 1.00 133.18 ? 28  GLN D CB    1 
ATOM   4353  C CG    . GLN D 1 31  ? 45.157 -56.403  -165.889 1.00 143.21 ? 28  GLN D CG    1 
ATOM   4354  C CD    . GLN D 1 31  ? 45.266 -56.041  -164.416 1.00 141.39 ? 28  GLN D CD    1 
ATOM   4355  O OE1   . GLN D 1 31  ? 45.716 -54.952  -164.057 1.00 114.80 ? 28  GLN D OE1   1 
ATOM   4356  N NE2   . GLN D 1 31  ? 44.852 -56.961  -163.554 1.00 151.41 ? 28  GLN D NE2   1 
ATOM   4357  N N     . CYS D 1 32  ? 46.570 -53.463  -169.118 1.00 125.82 ? 29  CYS D N     1 
ATOM   4358  C CA    . CYS D 1 32  ? 47.585 -52.745  -169.878 1.00 131.29 ? 29  CYS D CA    1 
ATOM   4359  C C     . CYS D 1 32  ? 47.368 -51.241  -169.780 1.00 123.02 ? 29  CYS D C     1 
ATOM   4360  O O     . CYS D 1 32  ? 46.253 -50.748  -169.962 1.00 116.82 ? 29  CYS D O     1 
ATOM   4361  C CB    . CYS D 1 32  ? 47.562 -53.184  -171.343 1.00 137.08 ? 29  CYS D CB    1 
ATOM   4362  S SG    . CYS D 1 32  ? 48.156 -54.865  -171.638 1.00 138.44 ? 29  CYS D SG    1 
ATOM   4363  N N     . GLN D 1 33  ? 48.443 -50.516  -169.492 1.00 126.95 ? 30  GLN D N     1 
ATOM   4364  C CA    . GLN D 1 33  ? 48.399 -49.070  -169.359 1.00 130.52 ? 30  GLN D CA    1 
ATOM   4365  C C     . GLN D 1 33  ? 48.822 -48.421  -170.669 1.00 136.31 ? 30  GLN D C     1 
ATOM   4366  O O     . GLN D 1 33  ? 49.649 -48.957  -171.410 1.00 139.80 ? 30  GLN D O     1 
ATOM   4367  C CB    . GLN D 1 33  ? 49.310 -48.592  -168.227 1.00 136.46 ? 30  GLN D CB    1 
ATOM   4368  C CG    . GLN D 1 33  ? 48.865 -49.016  -166.840 1.00 143.65 ? 30  GLN D CG    1 
ATOM   4369  C CD    . GLN D 1 33  ? 49.829 -48.560  -165.763 1.00 160.74 ? 30  GLN D CD    1 
ATOM   4370  O OE1   . GLN D 1 33  ? 50.234 -47.398  -165.729 1.00 152.27 ? 30  GLN D OE1   1 
ATOM   4371  N NE2   . GLN D 1 33  ? 50.201 -49.475  -164.875 1.00 175.34 ? 30  GLN D NE2   1 
ATOM   4372  N N     . TYR D 1 34  ? 48.243 -47.258  -170.949 1.00 130.90 ? 31  TYR D N     1 
ATOM   4373  C CA    . TYR D 1 34  ? 48.559 -46.559  -172.185 1.00 128.39 ? 31  TYR D CA    1 
ATOM   4374  C C     . TYR D 1 34  ? 49.950 -45.949  -172.089 1.00 143.10 ? 31  TYR D C     1 
ATOM   4375  O O     . TYR D 1 34  ? 50.307 -45.344  -171.073 1.00 146.98 ? 31  TYR D O     1 
ATOM   4376  C CB    . TYR D 1 34  ? 47.517 -45.476  -172.464 1.00 118.88 ? 31  TYR D CB    1 
ATOM   4377  C CG    . TYR D 1 34  ? 46.282 -45.983  -173.174 1.00 115.98 ? 31  TYR D CG    1 
ATOM   4378  C CD1   . TYR D 1 34  ? 46.369 -46.549  -174.438 1.00 114.17 ? 31  TYR D CD1   1 
ATOM   4379  C CD2   . TYR D 1 34  ? 45.030 -45.896  -172.580 1.00 112.76 ? 31  TYR D CD2   1 
ATOM   4380  C CE1   . TYR D 1 34  ? 45.244 -47.015  -175.092 1.00 120.26 ? 31  TYR D CE1   1 
ATOM   4381  C CE2   . TYR D 1 34  ? 43.898 -46.360  -173.226 1.00 107.74 ? 31  TYR D CE2   1 
ATOM   4382  C CZ    . TYR D 1 34  ? 44.011 -46.918  -174.482 1.00 115.57 ? 31  TYR D CZ    1 
ATOM   4383  O OH    . TYR D 1 34  ? 42.889 -47.381  -175.130 1.00 113.36 ? 31  TYR D OH    1 
ATOM   4384  N N     . THR D 1 35  ? 50.735 -46.108  -173.150 1.00 138.37 ? 32  THR D N     1 
ATOM   4385  C CA    . THR D 1 35  ? 52.035 -45.466  -173.223 1.00 137.53 ? 32  THR D CA    1 
ATOM   4386  C C     . THR D 1 35  ? 51.871 -43.992  -173.578 1.00 137.66 ? 32  THR D C     1 
ATOM   4387  O O     . THR D 1 35  ? 50.805 -43.542  -174.006 1.00 136.87 ? 32  THR D O     1 
ATOM   4388  C CB    . THR D 1 35  ? 52.928 -46.169  -174.245 1.00 138.60 ? 32  THR D CB    1 
ATOM   4389  O OG1   . THR D 1 35  ? 52.274 -46.192  -175.521 1.00 139.88 ? 32  THR D OG1   1 
ATOM   4390  C CG2   . THR D 1 35  ? 53.219 -47.595  -173.803 1.00 143.12 ? 32  THR D CG2   1 
ATOM   4391  N N     . ALA D 1 36  ? 52.950 -43.231  -173.384 1.00 141.59 ? 33  ALA D N     1 
ATOM   4392  C CA    . ALA D 1 36  ? 52.902 -41.796  -173.646 1.00 147.06 ? 33  ALA D CA    1 
ATOM   4393  C C     . ALA D 1 36  ? 52.531 -41.522  -175.098 1.00 143.45 ? 33  ALA D C     1 
ATOM   4394  O O     . ALA D 1 36  ? 51.685 -40.667  -175.386 1.00 137.96 ? 33  ALA D O     1 
ATOM   4395  C CB    . ALA D 1 36  ? 54.245 -41.155  -173.298 1.00 156.59 ? 33  ALA D CB    1 
ATOM   4396  N N     . GLU D 1 37  ? 53.160 -42.243  -176.028 1.00 144.74 ? 34  GLU D N     1 
ATOM   4397  C CA    . GLU D 1 37  ? 52.892 -42.027  -177.446 1.00 146.05 ? 34  GLU D CA    1 
ATOM   4398  C C     . GLU D 1 37  ? 51.444 -42.368  -177.786 1.00 141.60 ? 34  GLU D C     1 
ATOM   4399  O O     . GLU D 1 37  ? 50.738 -41.574  -178.420 1.00 140.36 ? 34  GLU D O     1 
ATOM   4400  C CB    . GLU D 1 37  ? 53.852 -42.867  -178.291 1.00 154.91 ? 34  GLU D CB    1 
ATOM   4401  C CG    . GLU D 1 37  ? 55.273 -42.944  -177.753 1.00 162.89 ? 34  GLU D CG    1 
ATOM   4402  C CD    . GLU D 1 37  ? 55.471 -44.111  -176.803 1.00 167.95 ? 34  GLU D CD    1 
ATOM   4403  O OE1   . GLU D 1 37  ? 55.198 -45.262  -177.207 1.00 171.28 ? 34  GLU D OE1   1 
ATOM   4404  O OE2   . GLU D 1 37  ? 55.894 -43.878  -175.651 1.00 164.30 ? 34  GLU D OE2   1 
ATOM   4405  N N     . GLU D 1 38  ? 50.992 -43.559  -177.379 1.00 138.81 ? 35  GLU D N     1 
ATOM   4406  C CA    . GLU D 1 38  ? 49.612 -43.972  -177.622 1.00 135.65 ? 35  GLU D CA    1 
ATOM   4407  C C     . GLU D 1 38  ? 48.623 -43.011  -176.972 1.00 128.88 ? 35  GLU D C     1 
ATOM   4408  O O     . GLU D 1 38  ? 47.629 -42.609  -177.592 1.00 120.58 ? 35  GLU D O     1 
ATOM   4409  C CB    . GLU D 1 38  ? 49.401 -45.396  -177.105 1.00 144.21 ? 35  GLU D CB    1 
ATOM   4410  C CG    . GLU D 1 38  ? 48.117 -46.055  -177.580 1.00 148.71 ? 35  GLU D CG    1 
ATOM   4411  C CD    . GLU D 1 38  ? 48.014 -47.504  -177.144 1.00 138.00 ? 35  GLU D CD    1 
ATOM   4412  O OE1   . GLU D 1 38  ? 47.003 -48.156  -177.476 1.00 136.05 ? 35  GLU D OE1   1 
ATOM   4413  O OE2   . GLU D 1 38  ? 48.943 -47.988  -176.463 1.00 126.83 ? 35  GLU D OE2   1 
ATOM   4414  N N     . TYR D 1 39  ? 48.881 -42.639  -175.715 1.00 131.37 ? 36  TYR D N     1 
ATOM   4415  C CA    . TYR D 1 39  ? 48.016 -41.690  -175.022 1.00 130.12 ? 36  TYR D CA    1 
ATOM   4416  C C     . TYR D 1 39  ? 47.891 -40.389  -175.800 1.00 132.89 ? 36  TYR D C     1 
ATOM   4417  O O     . TYR D 1 39  ? 46.780 -39.925  -176.075 1.00 130.50 ? 36  TYR D O     1 
ATOM   4418  C CB    . TYR D 1 39  ? 48.542 -41.407  -173.614 1.00 116.54 ? 36  TYR D CB    1 
ATOM   4419  C CG    . TYR D 1 39  ? 48.089 -40.058  -173.099 1.00 118.68 ? 36  TYR D CG    1 
ATOM   4420  C CD1   . TYR D 1 39  ? 46.749 -39.805  -172.835 1.00 115.05 ? 36  TYR D CD1   1 
ATOM   4421  C CD2   . TYR D 1 39  ? 48.998 -39.024  -172.921 1.00 137.46 ? 36  TYR D CD2   1 
ATOM   4422  C CE1   . TYR D 1 39  ? 46.332 -38.567  -172.389 1.00 119.20 ? 36  TYR D CE1   1 
ATOM   4423  C CE2   . TYR D 1 39  ? 48.590 -37.784  -172.474 1.00 146.90 ? 36  TYR D CE2   1 
ATOM   4424  C CZ    . TYR D 1 39  ? 47.257 -37.561  -172.209 1.00 130.21 ? 36  TYR D CZ    1 
ATOM   4425  O OH    . TYR D 1 39  ? 46.853 -36.325  -171.767 1.00 120.26 ? 36  TYR D OH    1 
ATOM   4426  N N     . GLN D 1 40  ? 49.025 -39.765  -176.129 1.00 131.27 ? 37  GLN D N     1 
ATOM   4427  C CA    . GLN D 1 40  ? 48.987 -38.469  -176.797 1.00 132.32 ? 37  GLN D CA    1 
ATOM   4428  C C     . GLN D 1 40  ? 48.318 -38.569  -178.161 1.00 124.36 ? 37  GLN D C     1 
ATOM   4429  O O     . GLN D 1 40  ? 47.525 -37.695  -178.536 1.00 126.12 ? 37  GLN D O     1 
ATOM   4430  C CB    . GLN D 1 40  ? 50.401 -37.903  -176.931 1.00 147.38 ? 37  GLN D CB    1 
ATOM   4431  C CG    . GLN D 1 40  ? 50.453 -36.384  -176.916 1.00 156.66 ? 37  GLN D CG    1 
ATOM   4432  C CD    . GLN D 1 40  ? 51.845 -35.841  -177.169 1.00 159.03 ? 37  GLN D CD    1 
ATOM   4433  O OE1   . GLN D 1 40  ? 52.747 -36.575  -177.571 1.00 157.10 ? 37  GLN D OE1   1 
ATOM   4434  N NE2   . GLN D 1 40  ? 52.027 -34.547  -176.930 1.00 160.97 ? 37  GLN D NE2   1 
ATOM   4435  N N     . ALA D 1 41  ? 48.627 -39.624  -178.921 1.00 123.25 ? 38  ALA D N     1 
ATOM   4436  C CA    . ALA D 1 41  ? 48.007 -39.800  -180.229 1.00 123.12 ? 38  ALA D CA    1 
ATOM   4437  C C     . ALA D 1 41  ? 46.491 -39.897  -180.115 1.00 124.67 ? 38  ALA D C     1 
ATOM   4438  O O     . ALA D 1 41  ? 45.759 -39.186  -180.816 1.00 125.25 ? 38  ALA D O     1 
ATOM   4439  C CB    . ALA D 1 41  ? 48.579 -41.041  -180.915 1.00 106.80 ? 38  ALA D CB    1 
ATOM   4440  N N     . ILE D 1 42  ? 45.999 -40.768  -179.227 1.00 124.07 ? 39  ILE D N     1 
ATOM   4441  C CA    . ILE D 1 42  ? 44.555 -40.934  -179.077 1.00 122.97 ? 39  ILE D CA    1 
ATOM   4442  C C     . ILE D 1 42  ? 43.917 -39.638  -178.591 1.00 123.73 ? 39  ILE D C     1 
ATOM   4443  O O     . ILE D 1 42  ? 42.851 -39.232  -179.075 1.00 123.50 ? 39  ILE D O     1 
ATOM   4444  C CB    . ILE D 1 42  ? 44.241 -42.109  -178.132 1.00 126.77 ? 39  ILE D CB    1 
ATOM   4445  C CG1   . ILE D 1 42  ? 44.554 -43.439  -178.812 1.00 128.57 ? 39  ILE D CG1   1 
ATOM   4446  C CG2   . ILE D 1 42  ? 42.777 -42.089  -177.739 1.00 120.89 ? 39  ILE D CG2   1 
ATOM   4447  C CD1   . ILE D 1 42  ? 44.689 -44.601  -177.855 1.00 132.90 ? 39  ILE D CD1   1 
ATOM   4448  N N     . GLN D 1 43  ? 44.557 -38.972  -177.627 1.00 125.18 ? 40  GLN D N     1 
ATOM   4449  C CA    . GLN D 1 43  ? 44.025 -37.726  -177.087 1.00 120.50 ? 40  GLN D CA    1 
ATOM   4450  C C     . GLN D 1 43  ? 43.856 -36.681  -178.182 1.00 123.58 ? 40  GLN D C     1 
ATOM   4451  O O     . GLN D 1 43  ? 42.778 -36.095  -178.334 1.00 122.90 ? 40  GLN D O     1 
ATOM   4452  C CB    . GLN D 1 43  ? 44.947 -37.210  -175.980 1.00 111.16 ? 40  GLN D CB    1 
ATOM   4453  C CG    . GLN D 1 43  ? 44.585 -35.843  -175.413 1.00 112.74 ? 40  GLN D CG    1 
ATOM   4454  C CD    . GLN D 1 43  ? 43.419 -35.893  -174.442 1.00 116.20 ? 40  GLN D CD    1 
ATOM   4455  O OE1   . GLN D 1 43  ? 42.412 -36.558  -174.687 1.00 112.90 ? 40  GLN D OE1   1 
ATOM   4456  N NE2   . GLN D 1 43  ? 43.555 -35.188  -173.324 1.00 137.38 ? 40  GLN D NE2   1 
ATOM   4457  N N     . LYS D 1 44  ? 44.920 -36.426  -178.947 1.00 128.55 ? 41  LYS D N     1 
ATOM   4458  C CA    . LYS D 1 44  ? 44.845 -35.421  -180.004 1.00 127.33 ? 41  LYS D CA    1 
ATOM   4459  C C     . LYS D 1 44  ? 43.851 -35.820  -181.089 1.00 128.56 ? 41  LYS D C     1 
ATOM   4460  O O     . LYS D 1 44  ? 43.128 -34.968  -181.619 1.00 119.55 ? 41  LYS D O     1 
ATOM   4461  C CB    . LYS D 1 44  ? 46.230 -35.185  -180.607 1.00 126.93 ? 41  LYS D CB    1 
ATOM   4462  C CG    . LYS D 1 44  ? 47.268 -34.682  -179.617 1.00 117.75 ? 41  LYS D CG    1 
ATOM   4463  C CD    . LYS D 1 44  ? 48.548 -34.281  -180.332 1.00 137.04 ? 41  LYS D CD    1 
ATOM   4464  C CE    . LYS D 1 44  ? 49.636 -33.886  -179.350 1.00 132.59 ? 41  LYS D CE    1 
ATOM   4465  N NZ    . LYS D 1 44  ? 49.187 -32.810  -178.424 1.00 137.51 ? 41  LYS D NZ    1 
ATOM   4466  N N     . ALA D 1 45  ? 43.795 -37.111  -181.431 1.00 126.03 ? 42  ALA D N     1 
ATOM   4467  C CA    . ALA D 1 45  ? 42.851 -37.566  -182.448 1.00 129.56 ? 42  ALA D CA    1 
ATOM   4468  C C     . ALA D 1 45  ? 41.401 -37.443  -181.995 1.00 122.49 ? 42  ALA D C     1 
ATOM   4469  O O     . ALA D 1 45  ? 40.507 -37.281  -182.834 1.00 123.10 ? 42  ALA D O     1 
ATOM   4470  C CB    . ALA D 1 45  ? 43.166 -39.008  -182.844 1.00 133.11 ? 42  ALA D CB    1 
ATOM   4471  N N     . LEU D 1 46  ? 41.140 -37.518  -180.690 1.00 119.37 ? 43  LEU D N     1 
ATOM   4472  C CA    . LEU D 1 46  ? 39.763 -37.433  -180.214 1.00 128.49 ? 43  LEU D CA    1 
ATOM   4473  C C     . LEU D 1 46  ? 39.222 -36.009  -180.181 1.00 128.37 ? 43  LEU D C     1 
ATOM   4474  O O     . LEU D 1 46  ? 37.999 -35.830  -180.170 1.00 123.85 ? 43  LEU D O     1 
ATOM   4475  C CB    . LEU D 1 46  ? 39.643 -38.059  -178.823 1.00 127.87 ? 43  LEU D CB    1 
ATOM   4476  C CG    . LEU D 1 46  ? 39.599 -39.588  -178.799 1.00 127.32 ? 43  LEU D CG    1 
ATOM   4477  C CD1   . LEU D 1 46  ? 39.500 -40.109  -177.379 1.00 120.20 ? 43  LEU D CD1   1 
ATOM   4478  C CD2   . LEU D 1 46  ? 38.435 -40.093  -179.634 1.00 122.86 ? 43  LEU D CD2   1 
ATOM   4479  N N     . ARG D 1 47  ? 40.090 -34.996  -180.169 1.00 129.34 ? 44  ARG D N     1 
ATOM   4480  C CA    . ARG D 1 47  ? 39.618 -33.622  -180.285 1.00 125.31 ? 44  ARG D CA    1 
ATOM   4481  C C     . ARG D 1 47  ? 39.121 -33.279  -181.684 1.00 117.93 ? 44  ARG D C     1 
ATOM   4482  O O     . ARG D 1 47  ? 38.498 -32.225  -181.856 1.00 121.57 ? 44  ARG D O     1 
ATOM   4483  C CB    . ARG D 1 47  ? 40.722 -32.644  -179.881 1.00 135.52 ? 44  ARG D CB    1 
ATOM   4484  C CG    . ARG D 1 47  ? 40.927 -32.527  -178.381 1.00 141.47 ? 44  ARG D CG    1 
ATOM   4485  C CD    . ARG D 1 47  ? 41.971 -31.476  -178.044 1.00 136.77 ? 44  ARG D CD    1 
ATOM   4486  N NE    . ARG D 1 47  ? 43.330 -31.987  -178.186 1.00 136.48 ? 44  ARG D NE    1 
ATOM   4487  C CZ    . ARG D 1 47  ? 44.162 -32.184  -177.169 1.00 137.55 ? 44  ARG D CZ    1 
ATOM   4488  N NH1   . ARG D 1 47  ? 43.772 -31.915  -175.930 1.00 116.35 ? 44  ARG D NH1   1 
ATOM   4489  N NH2   . ARG D 1 47  ? 45.383 -32.653  -177.388 1.00 150.22 ? 44  ARG D NH2   1 
ATOM   4490  N N     . GLN D 1 48  ? 39.379 -34.128  -182.677 1.00 118.91 ? 45  GLN D N     1 
ATOM   4491  C CA    . GLN D 1 48  ? 38.914 -33.864  -184.031 1.00 125.10 ? 45  GLN D CA    1 
ATOM   4492  C C     . GLN D 1 48  ? 37.390 -33.848  -184.094 1.00 122.06 ? 45  GLN D C     1 
ATOM   4493  O O     . GLN D 1 48  ? 36.701 -34.454  -183.270 1.00 132.09 ? 45  GLN D O     1 
ATOM   4494  C CB    . GLN D 1 48  ? 39.456 -34.917  -184.998 1.00 125.47 ? 45  GLN D CB    1 
ATOM   4495  C CG    . GLN D 1 48  ? 40.942 -34.805  -185.284 1.00 124.22 ? 45  GLN D CG    1 
ATOM   4496  C CD    . GLN D 1 48  ? 41.385 -35.729  -186.403 1.00 131.03 ? 45  GLN D CD    1 
ATOM   4497  O OE1   . GLN D 1 48  ? 41.218 -36.946  -186.322 1.00 133.94 ? 45  GLN D OE1   1 
ATOM   4498  N NE2   . GLN D 1 48  ? 41.952 -35.153  -187.457 1.00 135.23 ? 45  GLN D NE2   1 
ATOM   4499  N N     . ARG D 1 49  ? 36.869 -33.138  -185.089 1.00 110.87 ? 46  ARG D N     1 
ATOM   4500  C CA    . ARG D 1 49  ? 35.458 -33.162  -185.436 1.00 109.73 ? 46  ARG D CA    1 
ATOM   4501  C C     . ARG D 1 49  ? 35.268 -33.943  -186.730 1.00 114.97 ? 46  ARG D C     1 
ATOM   4502  O O     . ARG D 1 49  ? 36.210 -34.142  -187.502 1.00 113.97 ? 46  ARG D O     1 
ATOM   4503  C CB    . ARG D 1 49  ? 34.906 -31.740  -185.578 1.00 128.28 ? 46  ARG D CB    1 
ATOM   4504  C CG    . ARG D 1 49  ? 34.715 -31.018  -184.250 1.00 130.47 ? 46  ARG D CG    1 
ATOM   4505  C CD    . ARG D 1 49  ? 34.206 -29.599  -184.452 1.00 135.89 ? 46  ARG D CD    1 
ATOM   4506  N NE    . ARG D 1 49  ? 33.683 -29.014  -183.220 1.00 143.15 ? 46  ARG D NE    1 
ATOM   4507  C CZ    . ARG D 1 49  ? 34.435 -28.449  -182.280 1.00 149.72 ? 46  ARG D CZ    1 
ATOM   4508  N NH1   . ARG D 1 49  ? 35.751 -28.388  -182.427 1.00 142.41 ? 46  ARG D NH1   1 
ATOM   4509  N NH2   . ARG D 1 49  ? 33.870 -27.942  -181.192 1.00 149.09 ? 46  ARG D NH2   1 
ATOM   4510  N N     . LEU D 1 50  ? 34.038 -34.388  -186.964 1.00 121.40 ? 47  LEU D N     1 
ATOM   4511  C CA    . LEU D 1 50  ? 33.750 -35.241  -188.108 1.00 130.52 ? 47  LEU D CA    1 
ATOM   4512  C C     . LEU D 1 50  ? 33.320 -34.412  -189.313 1.00 122.21 ? 47  LEU D C     1 
ATOM   4513  O O     . LEU D 1 50  ? 32.795 -33.304  -189.179 1.00 121.98 ? 47  LEU D O     1 
ATOM   4514  C CB    . LEU D 1 50  ? 32.661 -36.264  -187.773 1.00 134.14 ? 47  LEU D CB    1 
ATOM   4515  C CG    . LEU D 1 50  ? 32.979 -37.359  -186.747 1.00 119.60 ? 47  LEU D CG    1 
ATOM   4516  C CD1   . LEU D 1 50  ? 34.366 -37.952  -186.975 1.00 121.56 ? 47  LEU D CD1   1 
ATOM   4517  C CD2   . LEU D 1 50  ? 32.821 -36.862  -185.319 1.00 112.69 ? 47  LEU D CD2   1 
ATOM   4518  N N     . GLY D 1 51  ? 33.553 -34.968  -190.500 1.00 127.26 ? 48  GLY D N     1 
ATOM   4519  C CA    . GLY D 1 51  ? 33.170 -34.328  -191.736 1.00 138.10 ? 48  GLY D CA    1 
ATOM   4520  C C     . GLY D 1 51  ? 31.829 -34.813  -192.252 1.00 145.74 ? 48  GLY D C     1 
ATOM   4521  O O     . GLY D 1 51  ? 31.216 -35.727  -191.692 1.00 152.32 ? 48  GLY D O     1 
ATOM   4522  N N     . PRO D 1 52  ? 31.343 -34.194  -193.332 1.00 139.20 ? 49  PRO D N     1 
ATOM   4523  C CA    . PRO D 1 52  ? 30.063 -34.629  -193.919 1.00 130.80 ? 49  PRO D CA    1 
ATOM   4524  C C     . PRO D 1 52  ? 30.043 -36.082  -194.365 1.00 147.70 ? 49  PRO D C     1 
ATOM   4525  O O     . PRO D 1 52  ? 28.953 -36.639  -194.548 1.00 151.67 ? 49  PRO D O     1 
ATOM   4526  C CB    . PRO D 1 52  ? 29.887 -33.679  -195.111 1.00 136.15 ? 49  PRO D CB    1 
ATOM   4527  C CG    . PRO D 1 52  ? 30.648 -32.458  -194.721 1.00 146.00 ? 49  PRO D CG    1 
ATOM   4528  C CD    . PRO D 1 52  ? 31.844 -32.958  -193.957 1.00 140.77 ? 49  PRO D CD    1 
ATOM   4529  N N     . GLU D 1 53  ? 31.204 -36.717  -194.551 1.00 151.78 ? 50  GLU D N     1 
ATOM   4530  C CA    . GLU D 1 53  ? 31.237 -38.118  -194.957 1.00 147.09 ? 50  GLU D CA    1 
ATOM   4531  C C     . GLU D 1 53  ? 30.686 -39.051  -193.888 1.00 128.96 ? 50  GLU D C     1 
ATOM   4532  O O     . GLU D 1 53  ? 30.468 -40.233  -194.174 1.00 139.32 ? 50  GLU D O     1 
ATOM   4533  C CB    . GLU D 1 53  ? 32.665 -38.546  -195.309 1.00 159.02 ? 50  GLU D CB    1 
ATOM   4534  C CG    . GLU D 1 53  ? 33.391 -37.637  -196.292 1.00 172.98 ? 50  GLU D CG    1 
ATOM   4535  C CD    . GLU D 1 53  ? 34.019 -36.429  -195.624 1.00 159.26 ? 50  GLU D CD    1 
ATOM   4536  O OE1   . GLU D 1 53  ? 33.270 -35.540  -195.170 1.00 137.97 ? 50  GLU D OE1   1 
ATOM   4537  O OE2   . GLU D 1 53  ? 35.264 -36.368  -195.556 1.00 164.37 ? 50  GLU D OE2   1 
ATOM   4538  N N     . TYR D 1 54  ? 30.456 -38.552  -192.677 1.00 126.72 ? 51  TYR D N     1 
ATOM   4539  C CA    . TYR D 1 54  ? 29.932 -39.340  -191.568 1.00 135.35 ? 51  TYR D CA    1 
ATOM   4540  C C     . TYR D 1 54  ? 28.511 -38.965  -191.188 1.00 121.17 ? 51  TYR D C     1 
ATOM   4541  O O     . TYR D 1 54  ? 27.697 -39.849  -190.909 1.00 116.82 ? 51  TYR D O     1 
ATOM   4542  C CB    . TYR D 1 54  ? 30.836 -39.179  -190.341 1.00 127.01 ? 51  TYR D CB    1 
ATOM   4543  C CG    . TYR D 1 54  ? 32.201 -39.807  -190.500 1.00 129.82 ? 51  TYR D CG    1 
ATOM   4544  C CD1   . TYR D 1 54  ? 32.349 -41.051  -191.098 1.00 132.41 ? 51  TYR D CD1   1 
ATOM   4545  C CD2   . TYR D 1 54  ? 33.342 -39.151  -190.059 1.00 114.24 ? 51  TYR D CD2   1 
ATOM   4546  C CE1   . TYR D 1 54  ? 33.595 -41.627  -191.246 1.00 128.92 ? 51  TYR D CE1   1 
ATOM   4547  C CE2   . TYR D 1 54  ? 34.591 -39.718  -190.202 1.00 122.38 ? 51  TYR D CE2   1 
ATOM   4548  C CZ    . TYR D 1 54  ? 34.712 -40.956  -190.797 1.00 128.78 ? 51  TYR D CZ    1 
ATOM   4549  O OH    . TYR D 1 54  ? 35.955 -41.528  -190.943 1.00 117.78 ? 51  TYR D OH    1 
ATOM   4550  N N     . ILE D 1 55  ? 28.199 -37.669  -191.168 1.00 104.90 ? 52  ILE D N     1 
ATOM   4551  C CA    . ILE D 1 55  ? 26.878 -37.215  -190.759 1.00 99.80  ? 52  ILE D CA    1 
ATOM   4552  C C     . ILE D 1 55  ? 25.824 -37.675  -191.763 1.00 99.97  ? 52  ILE D C     1 
ATOM   4553  O O     . ILE D 1 55  ? 26.082 -37.796  -192.968 1.00 108.02 ? 52  ILE D O     1 
ATOM   4554  C CB    . ILE D 1 55  ? 26.866 -35.683  -190.607 1.00 111.45 ? 52  ILE D CB    1 
ATOM   4555  C CG1   . ILE D 1 55  ? 28.154 -35.201  -189.938 1.00 119.27 ? 52  ILE D CG1   1 
ATOM   4556  C CG2   . ILE D 1 55  ? 25.665 -35.237  -189.796 1.00 92.75  ? 52  ILE D CG2   1 
ATOM   4557  C CD1   . ILE D 1 55  ? 28.360 -35.738  -188.537 1.00 124.69 ? 52  ILE D CD1   1 
ATOM   4558  N N     . SER D 1 56  ? 24.620 -37.934  -191.254 1.00 101.28 ? 53  SER D N     1 
ATOM   4559  C CA    . SER D 1 56  ? 23.460 -38.247  -192.078 1.00 102.20 ? 53  SER D CA    1 
ATOM   4560  C C     . SER D 1 56  ? 22.291 -37.391  -191.608 1.00 107.93 ? 53  SER D C     1 
ATOM   4561  O O     . SER D 1 56  ? 22.473 -36.512  -190.760 1.00 112.81 ? 53  SER D O     1 
ATOM   4562  C CB    . SER D 1 56  ? 23.125 -39.738  -192.010 1.00 123.77 ? 53  SER D CB    1 
ATOM   4563  O OG    . SER D 1 56  ? 24.183 -40.528  -192.530 1.00 126.73 ? 53  SER D OG    1 
ATOM   4564  N N     . SER D 1 57  ? 21.094 -37.626  -192.140 1.00 114.33 ? 54  SER D N     1 
ATOM   4565  C CA    . SER D 1 57  ? 19.961 -36.763  -191.839 1.00 135.70 ? 54  SER D CA    1 
ATOM   4566  C C     . SER D 1 57  ? 18.674 -37.569  -191.762 1.00 141.75 ? 54  SER D C     1 
ATOM   4567  O O     . SER D 1 57  ? 18.473 -38.512  -192.534 1.00 137.19 ? 54  SER D O     1 
ATOM   4568  C CB    . SER D 1 57  ? 19.809 -35.660  -192.891 1.00 140.35 ? 54  SER D CB    1 
ATOM   4569  O OG    . SER D 1 57  ? 19.180 -36.153  -194.060 1.00 158.59 ? 54  SER D OG    1 
ATOM   4570  N N     . ARG D 1 58  ? 17.804 -37.183  -190.829 1.00 150.77 ? 55  ARG D N     1 
ATOM   4571  C CA    . ARG D 1 58  ? 16.483 -37.773  -190.676 1.00 158.26 ? 55  ARG D CA    1 
ATOM   4572  C C     . ARG D 1 58  ? 15.438 -36.665  -190.671 1.00 161.19 ? 55  ARG D C     1 
ATOM   4573  O O     . ARG D 1 58  ? 15.761 -35.475  -190.626 1.00 165.29 ? 55  ARG D O     1 
ATOM   4574  C CB    . ARG D 1 58  ? 16.377 -38.605  -189.388 1.00 164.78 ? 55  ARG D CB    1 
ATOM   4575  C CG    . ARG D 1 58  ? 16.299 -37.795  -188.106 1.00 165.19 ? 55  ARG D CG    1 
ATOM   4576  C CD    . ARG D 1 58  ? 16.100 -38.710  -186.907 1.00 159.86 ? 55  ARG D CD    1 
ATOM   4577  N NE    . ARG D 1 58  ? 14.796 -39.370  -186.908 1.00 161.22 ? 55  ARG D NE    1 
ATOM   4578  C CZ    . ARG D 1 58  ? 14.391 -40.229  -185.978 1.00 165.02 ? 55  ARG D CZ    1 
ATOM   4579  N NH1   . ARG D 1 58  ? 15.251 -40.690  -185.081 1.00 161.53 ? 55  ARG D NH1   1 
ATOM   4580  N NH2   . ARG D 1 58  ? 13.179 -40.761  -186.051 1.00 176.96 ? 55  ARG D NH2   1 
ATOM   4581  N N     . MET D 1 59  ? 14.170 -37.066  -190.715 1.00 160.48 ? 56  MET D N     1 
ATOM   4582  C CA    . MET D 1 59  ? 13.045 -36.134  -190.658 1.00 174.17 ? 56  MET D CA    1 
ATOM   4583  C C     . MET D 1 59  ? 12.272 -36.398  -189.370 1.00 178.22 ? 56  MET D C     1 
ATOM   4584  O O     . MET D 1 59  ? 11.522 -37.375  -189.278 1.00 180.31 ? 56  MET D O     1 
ATOM   4585  C CB    . MET D 1 59  ? 12.151 -36.276  -191.888 1.00 172.48 ? 56  MET D CB    1 
ATOM   4586  C CG    . MET D 1 59  ? 12.760 -35.709  -193.160 1.00 178.88 ? 56  MET D CG    1 
ATOM   4587  S SD    . MET D 1 59  ? 13.323 -34.005  -192.968 1.00 173.07 ? 56  MET D SD    1 
ATOM   4588  C CE    . MET D 1 59  ? 11.787 -33.183  -192.552 1.00 173.45 ? 56  MET D CE    1 
ATOM   4589  N N     . ALA D 1 60  ? 12.459 -35.531  -188.377 1.00 177.64 ? 57  ALA D N     1 
ATOM   4590  C CA    . ALA D 1 60  ? 11.747 -35.671  -187.115 1.00 179.77 ? 57  ALA D CA    1 
ATOM   4591  C C     . ALA D 1 60  ? 10.247 -35.481  -187.316 1.00 186.28 ? 57  ALA D C     1 
ATOM   4592  O O     . ALA D 1 60  ? 9.803  -34.728  -188.186 1.00 182.22 ? 57  ALA D O     1 
ATOM   4593  C CB    . ALA D 1 60  ? 12.270 -34.662  -186.092 1.00 173.99 ? 57  ALA D CB    1 
ATOM   4594  N N     . GLY D 1 61  ? 9.463  -36.177  -186.495 1.00 194.38 ? 58  GLY D N     1 
ATOM   4595  C CA    . GLY D 1 61  ? 8.021  -36.039  -186.535 1.00 195.93 ? 58  GLY D CA    1 
ATOM   4596  C C     . GLY D 1 61  ? 7.565  -34.715  -185.959 1.00 194.64 ? 58  GLY D C     1 
ATOM   4597  O O     . GLY D 1 61  ? 7.719  -34.468  -184.759 1.00 193.96 ? 58  GLY D O     1 
ATOM   4598  N N     . GLY D 1 62  ? 7.000  -33.851  -186.804 1.00 198.06 ? 59  GLY D N     1 
ATOM   4599  C CA    . GLY D 1 62  ? 6.632  -32.510  -186.404 1.00 191.68 ? 59  GLY D CA    1 
ATOM   4600  C C     . GLY D 1 62  ? 7.778  -31.527  -186.314 1.00 188.12 ? 59  GLY D C     1 
ATOM   4601  O O     . GLY D 1 62  ? 7.542  -30.315  -186.396 1.00 174.45 ? 59  GLY D O     1 
ATOM   4602  N N     . GLY D 1 63  ? 9.010  -32.003  -186.148 1.00 191.74 ? 60  GLY D N     1 
ATOM   4603  C CA    . GLY D 1 63  ? 10.166 -31.132  -186.063 1.00 191.26 ? 60  GLY D CA    1 
ATOM   4604  C C     . GLY D 1 63  ? 10.793 -30.886  -187.418 1.00 196.67 ? 60  GLY D C     1 
ATOM   4605  O O     . GLY D 1 63  ? 10.081 -30.736  -188.416 1.00 192.78 ? 60  GLY D O     1 
ATOM   4606  N N     . GLN D 1 64  ? 12.125 -30.845  -187.474 1.00 194.51 ? 61  GLN D N     1 
ATOM   4607  C CA    . GLN D 1 64  ? 12.816 -30.571  -188.729 1.00 176.58 ? 61  GLN D CA    1 
ATOM   4608  C C     . GLN D 1 64  ? 13.956 -31.553  -188.972 1.00 174.01 ? 61  GLN D C     1 
ATOM   4609  O O     . GLN D 1 64  ? 14.079 -32.565  -188.273 1.00 179.83 ? 61  GLN D O     1 
ATOM   4610  C CB    . GLN D 1 64  ? 13.355 -29.136  -188.755 1.00 170.32 ? 61  GLN D CB    1 
ATOM   4611  C CG    . GLN D 1 64  ? 12.488 -28.107  -188.045 1.00 183.10 ? 61  GLN D CG    1 
ATOM   4612  C CD    . GLN D 1 64  ? 12.936 -27.848  -186.619 1.00 193.37 ? 61  GLN D CD    1 
ATOM   4613  O OE1   . GLN D 1 64  ? 13.115 -28.778  -185.833 1.00 191.41 ? 61  GLN D OE1   1 
ATOM   4614  N NE2   . GLN D 1 64  ? 13.116 -26.577  -186.278 1.00 182.30 ? 61  GLN D NE2   1 
ATOM   4615  N N     . LYS D 1 65  ? 14.777 -31.260  -189.977 1.00 171.47 ? 62  LYS D N     1 
ATOM   4616  C CA    . LYS D 1 65  ? 15.918 -32.097  -190.328 1.00 164.66 ? 62  LYS D CA    1 
ATOM   4617  C C     . LYS D 1 65  ? 16.896 -32.215  -189.163 1.00 159.28 ? 62  LYS D C     1 
ATOM   4618  O O     . LYS D 1 65  ? 17.455 -31.213  -188.705 1.00 136.44 ? 62  LYS D O     1 
ATOM   4619  C CB    . LYS D 1 65  ? 16.608 -31.510  -191.558 1.00 171.36 ? 62  LYS D CB    1 
ATOM   4620  C CG    . LYS D 1 65  ? 17.801 -32.290  -192.076 1.00 169.47 ? 62  LYS D CG    1 
ATOM   4621  C CD    . LYS D 1 65  ? 18.374 -31.599  -193.307 1.00 169.92 ? 62  LYS D CD    1 
ATOM   4622  C CE    . LYS D 1 65  ? 19.642 -32.271  -193.803 1.00 169.48 ? 62  LYS D CE    1 
ATOM   4623  N NZ    . LYS D 1 65  ? 20.162 -31.619  -195.036 1.00 162.24 ? 62  LYS D NZ    1 
ATOM   4624  N N     . VAL D 1 66  ? 17.103 -33.443  -188.687 1.00 171.63 ? 63  VAL D N     1 
ATOM   4625  C CA    . VAL D 1 66  ? 18.063 -33.732  -187.628 1.00 146.73 ? 63  VAL D CA    1 
ATOM   4626  C C     . VAL D 1 66  ? 19.227 -34.507  -188.231 1.00 137.95 ? 63  VAL D C     1 
ATOM   4627  O O     . VAL D 1 66  ? 19.076 -35.215  -189.232 1.00 136.48 ? 63  VAL D O     1 
ATOM   4628  C CB    . VAL D 1 66  ? 17.417 -34.521  -186.467 1.00 129.22 ? 63  VAL D CB    1 
ATOM   4629  C CG1   . VAL D 1 66  ? 18.326 -34.528  -185.244 1.00 129.35 ? 63  VAL D CG1   1 
ATOM   4630  C CG2   . VAL D 1 66  ? 16.057 -33.942  -186.119 1.00 144.19 ? 63  VAL D CG2   1 
ATOM   4631  N N     . CYS D 1 67  ? 20.395 -34.379  -187.605 1.00 132.56 ? 64  CYS D N     1 
ATOM   4632  C CA    . CYS D 1 67  ? 21.627 -34.995  -188.076 1.00 131.39 ? 64  CYS D CA    1 
ATOM   4633  C C     . CYS D 1 67  ? 22.097 -36.055  -187.088 1.00 128.20 ? 64  CYS D C     1 
ATOM   4634  O O     . CYS D 1 67  ? 21.948 -35.892  -185.872 1.00 138.80 ? 64  CYS D O     1 
ATOM   4635  C CB    . CYS D 1 67  ? 22.721 -33.942  -188.274 1.00 124.58 ? 64  CYS D CB    1 
ATOM   4636  S SG    . CYS D 1 67  ? 22.160 -32.437  -189.103 1.00 163.34 ? 64  CYS D SG    1 
ATOM   4637  N N     . TYR D 1 68  ? 22.666 -37.140  -187.612 1.00 113.26 ? 65  TYR D N     1 
ATOM   4638  C CA    . TYR D 1 68  ? 23.108 -38.248  -186.777 1.00 96.09  ? 65  TYR D CA    1 
ATOM   4639  C C     . TYR D 1 68  ? 24.336 -38.900  -187.401 1.00 99.22  ? 65  TYR D C     1 
ATOM   4640  O O     . TYR D 1 68  ? 24.800 -38.507  -188.474 1.00 121.42 ? 65  TYR D O     1 
ATOM   4641  C CB    . TYR D 1 68  ? 21.986 -39.273  -186.586 1.00 120.67 ? 65  TYR D CB    1 
ATOM   4642  C CG    . TYR D 1 68  ? 21.584 -40.012  -187.846 1.00 124.18 ? 65  TYR D CG    1 
ATOM   4643  C CD1   . TYR D 1 68  ? 22.205 -41.203  -188.206 1.00 128.03 ? 65  TYR D CD1   1 
ATOM   4644  C CD2   . TYR D 1 68  ? 20.584 -39.520  -188.676 1.00 125.16 ? 65  TYR D CD2   1 
ATOM   4645  C CE1   . TYR D 1 68  ? 21.841 -41.883  -189.353 1.00 140.41 ? 65  TYR D CE1   1 
ATOM   4646  C CE2   . TYR D 1 68  ? 20.212 -40.195  -189.826 1.00 129.65 ? 65  TYR D CE2   1 
ATOM   4647  C CZ    . TYR D 1 68  ? 20.843 -41.376  -190.158 1.00 137.19 ? 65  TYR D CZ    1 
ATOM   4648  O OH    . TYR D 1 68  ? 20.480 -42.050  -191.302 1.00 135.59 ? 65  TYR D OH    1 
ATOM   4649  N N     . ILE D 1 69  ? 24.857 -39.911  -186.708 1.00 98.03  ? 66  ILE D N     1 
ATOM   4650  C CA    . ILE D 1 69  ? 25.969 -40.729  -187.182 1.00 95.66  ? 66  ILE D CA    1 
ATOM   4651  C C     . ILE D 1 69  ? 25.528 -42.184  -187.117 1.00 103.61 ? 66  ILE D C     1 
ATOM   4652  O O     . ILE D 1 69  ? 25.094 -42.657  -186.059 1.00 110.78 ? 66  ILE D O     1 
ATOM   4653  C CB    . ILE D 1 69  ? 27.247 -40.512  -186.354 1.00 71.60  ? 66  ILE D CB    1 
ATOM   4654  C CG1   . ILE D 1 69  ? 27.615 -39.028  -186.317 1.00 85.27  ? 66  ILE D CG1   1 
ATOM   4655  C CG2   . ILE D 1 69  ? 28.394 -41.331  -186.922 1.00 76.05  ? 66  ILE D CG2   1 
ATOM   4656  C CD1   . ILE D 1 69  ? 28.841 -38.724  -185.484 1.00 92.55  ? 66  ILE D CD1   1 
ATOM   4657  N N     . GLU D 1 70  ? 25.628 -42.888  -188.243 1.00 115.60 ? 67  GLU D N     1 
ATOM   4658  C CA    . GLU D 1 70  ? 25.212 -44.283  -188.300 1.00 123.69 ? 67  GLU D CA    1 
ATOM   4659  C C     . GLU D 1 70  ? 26.060 -45.148  -187.371 1.00 112.39 ? 67  GLU D C     1 
ATOM   4660  O O     . GLU D 1 70  ? 27.200 -44.814  -187.038 1.00 109.60 ? 67  GLU D O     1 
ATOM   4661  C CB    . GLU D 1 70  ? 25.297 -44.807  -189.735 1.00 127.62 ? 67  GLU D CB    1 
ATOM   4662  C CG    . GLU D 1 70  ? 24.352 -44.106  -190.701 1.00 130.34 ? 67  GLU D CG    1 
ATOM   4663  C CD    . GLU D 1 70  ? 24.354 -44.731  -192.083 1.00 139.97 ? 67  GLU D CD    1 
ATOM   4664  O OE1   . GLU D 1 70  ? 24.197 -45.966  -192.180 1.00 131.84 ? 67  GLU D OE1   1 
ATOM   4665  O OE2   . GLU D 1 70  ? 24.507 -43.985  -193.073 1.00 152.63 ? 67  GLU D OE2   1 
ATOM   4666  N N     . GLY D 1 71  ? 25.479 -46.267  -186.943 1.00 89.93  ? 68  GLY D N     1 
ATOM   4667  C CA    . GLY D 1 71  ? 26.119 -47.186  -186.020 1.00 97.07  ? 68  GLY D CA    1 
ATOM   4668  C C     . GLY D 1 71  ? 27.466 -47.708  -186.478 1.00 105.10 ? 68  GLY D C     1 
ATOM   4669  O O     . GLY D 1 71  ? 28.468 -47.555  -185.769 1.00 103.55 ? 68  GLY D O     1 
ATOM   4670  N N     . HIS D 1 72  ? 27.492 -48.347  -187.653 1.00 98.11  ? 69  HIS D N     1 
ATOM   4671  C CA    . HIS D 1 72  ? 28.739 -48.881  -188.195 1.00 111.32 ? 69  HIS D CA    1 
ATOM   4672  C C     . HIS D 1 72  ? 29.828 -47.819  -188.269 1.00 118.81 ? 69  HIS D C     1 
ATOM   4673  O O     . HIS D 1 72  ? 31.011 -48.129  -188.085 1.00 115.96 ? 69  HIS D O     1 
ATOM   4674  C CB    . HIS D 1 72  ? 28.496 -49.476  -189.583 1.00 108.84 ? 69  HIS D CB    1 
ATOM   4675  C CG    . HIS D 1 72  ? 27.847 -48.527  -190.542 1.00 119.48 ? 69  HIS D CG    1 
ATOM   4676  N ND1   . HIS D 1 72  ? 28.562 -47.804  -191.472 1.00 126.61 ? 69  HIS D ND1   1 
ATOM   4677  C CD2   . HIS D 1 72  ? 26.548 -48.185  -190.717 1.00 121.98 ? 69  HIS D CD2   1 
ATOM   4678  C CE1   . HIS D 1 72  ? 27.733 -47.055  -192.177 1.00 132.85 ? 69  HIS D CE1   1 
ATOM   4679  N NE2   . HIS D 1 72  ? 26.505 -47.268  -191.740 1.00 127.86 ? 69  HIS D NE2   1 
ATOM   4680  N N     . ARG D 1 73  ? 29.449 -46.567  -188.533 1.00 121.71 ? 70  ARG D N     1 
ATOM   4681  C CA    . ARG D 1 73  ? 30.418 -45.475  -188.531 1.00 123.28 ? 70  ARG D CA    1 
ATOM   4682  C C     . ARG D 1 73  ? 31.110 -45.355  -187.179 1.00 113.13 ? 70  ARG D C     1 
ATOM   4683  O O     . ARG D 1 73  ? 32.342 -45.327  -187.101 1.00 107.40 ? 70  ARG D O     1 
ATOM   4684  C CB    . ARG D 1 73  ? 29.727 -44.163  -188.903 1.00 126.67 ? 70  ARG D CB    1 
ATOM   4685  C CG    . ARG D 1 73  ? 29.079 -44.165  -190.278 1.00 128.54 ? 70  ARG D CG    1 
ATOM   4686  C CD    . ARG D 1 73  ? 30.071 -43.750  -191.355 1.00 142.91 ? 70  ARG D CD    1 
ATOM   4687  N NE    . ARG D 1 73  ? 29.515 -43.878  -192.700 1.00 147.10 ? 70  ARG D NE    1 
ATOM   4688  C CZ    . ARG D 1 73  ? 28.614 -43.052  -193.223 1.00 144.70 ? 70  ARG D CZ    1 
ATOM   4689  N NH1   . ARG D 1 73  ? 28.158 -42.026  -192.517 1.00 134.77 ? 70  ARG D NH1   1 
ATOM   4690  N NH2   . ARG D 1 73  ? 28.169 -43.251  -194.456 1.00 153.09 ? 70  ARG D NH2   1 
ATOM   4691  N N     . VAL D 1 74  ? 30.327 -45.272  -186.099 1.00 102.53 ? 71  VAL D N     1 
ATOM   4692  C CA    . VAL D 1 74  ? 30.904 -45.146  -184.762 1.00 95.98  ? 71  VAL D CA    1 
ATOM   4693  C C     . VAL D 1 74  ? 31.709 -46.388  -184.402 1.00 96.96  ? 71  VAL D C     1 
ATOM   4694  O O     . VAL D 1 74  ? 32.755 -46.301  -183.745 1.00 99.87  ? 71  VAL D O     1 
ATOM   4695  C CB    . VAL D 1 74  ? 29.797 -44.871  -183.727 1.00 91.41  ? 71  VAL D CB    1 
ATOM   4696  C CG1   . VAL D 1 74  ? 30.400 -44.332  -182.438 1.00 80.59  ? 71  VAL D CG1   1 
ATOM   4697  C CG2   . VAL D 1 74  ? 28.769 -43.904  -184.290 1.00 106.58 ? 71  VAL D CG2   1 
ATOM   4698  N N     . ILE D 1 75  ? 31.228 -47.564  -184.811 1.00 99.73  ? 72  ILE D N     1 
ATOM   4699  C CA    . ILE D 1 75  ? 31.940 -48.806  -184.515 1.00 102.39 ? 72  ILE D CA    1 
ATOM   4700  C C     . ILE D 1 75  ? 33.323 -48.791  -185.159 1.00 112.57 ? 72  ILE D C     1 
ATOM   4701  O O     . ILE D 1 75  ? 34.333 -49.110  -184.517 1.00 106.39 ? 72  ILE D O     1 
ATOM   4702  C CB    . ILE D 1 75  ? 31.111 -50.020  -184.972 1.00 103.39 ? 72  ILE D CB    1 
ATOM   4703  C CG1   . ILE D 1 75  ? 29.904 -50.212  -184.050 1.00 90.98  ? 72  ILE D CG1   1 
ATOM   4704  C CG2   . ILE D 1 75  ? 31.968 -51.278  -184.999 1.00 100.92 ? 72  ILE D CG2   1 
ATOM   4705  C CD1   . ILE D 1 75  ? 29.217 -51.554  -184.200 1.00 95.13  ? 72  ILE D CD1   1 
ATOM   4706  N N     . ASN D 1 76  ? 33.385 -48.424  -186.443 1.00 114.38 ? 73  ASN D N     1 
ATOM   4707  C CA    . ASN D 1 76  ? 34.667 -48.322  -187.133 1.00 109.60 ? 73  ASN D CA    1 
ATOM   4708  C C     . ASN D 1 76  ? 35.545 -47.241  -186.515 1.00 113.96 ? 73  ASN D C     1 
ATOM   4709  O O     . ASN D 1 76  ? 36.761 -47.419  -186.389 1.00 116.00 ? 73  ASN D O     1 
ATOM   4710  C CB    . ASN D 1 76  ? 34.445 -48.047  -188.619 1.00 104.16 ? 73  ASN D CB    1 
ATOM   4711  C CG    . ASN D 1 76  ? 33.908 -49.255  -189.357 1.00 115.13 ? 73  ASN D CG    1 
ATOM   4712  O OD1   . ASN D 1 76  ? 34.387 -50.374  -189.170 1.00 107.81 ? 73  ASN D OD1   1 
ATOM   4713  N ND2   . ASN D 1 76  ? 32.907 -49.036  -190.202 1.00 130.16 ? 73  ASN D ND2   1 
ATOM   4714  N N     . LEU D 1 77  ? 34.950 -46.104  -186.146 1.00 107.05 ? 74  LEU D N     1 
ATOM   4715  C CA    . LEU D 1 77  ? 35.713 -45.044  -185.494 1.00 103.25 ? 74  LEU D CA    1 
ATOM   4716  C C     . LEU D 1 77  ? 36.378 -45.549  -184.220 1.00 102.68 ? 74  LEU D C     1 
ATOM   4717  O O     . LEU D 1 77  ? 37.549 -45.251  -183.963 1.00 100.31 ? 74  LEU D O     1 
ATOM   4718  C CB    . LEU D 1 77  ? 34.806 -43.851  -185.191 1.00 99.28  ? 74  LEU D CB    1 
ATOM   4719  C CG    . LEU D 1 77  ? 34.383 -42.985  -186.378 1.00 78.88  ? 74  LEU D CG    1 
ATOM   4720  C CD1   . LEU D 1 77  ? 33.208 -42.097  -186.004 1.00 80.59  ? 74  LEU D CD1   1 
ATOM   4721  C CD2   . LEU D 1 77  ? 35.553 -42.146  -186.867 1.00 97.12  ? 74  LEU D CD2   1 
ATOM   4722  N N     . ALA D 1 78  ? 35.645 -46.316  -183.412 1.00 100.36 ? 75  ALA D N     1 
ATOM   4723  C CA    . ALA D 1 78  ? 36.222 -46.861  -182.186 1.00 106.79 ? 75  ALA D CA    1 
ATOM   4724  C C     . ALA D 1 78  ? 37.310 -47.881  -182.499 1.00 101.55 ? 75  ALA D C     1 
ATOM   4725  O O     . ALA D 1 78  ? 38.405 -47.836  -181.921 1.00 103.79 ? 75  ALA D O     1 
ATOM   4726  C CB    . ALA D 1 78  ? 35.126 -47.487  -181.324 1.00 103.83 ? 75  ALA D CB    1 
ATOM   4727  N N     . ASN D 1 79  ? 37.025 -48.810  -183.417 1.00 96.76  ? 76  ASN D N     1 
ATOM   4728  C CA    . ASN D 1 79  ? 38.009 -49.816  -183.803 1.00 110.77 ? 76  ASN D CA    1 
ATOM   4729  C C     . ASN D 1 79  ? 39.274 -49.202  -184.390 1.00 124.31 ? 76  ASN D C     1 
ATOM   4730  O O     . ASN D 1 79  ? 40.325 -49.850  -184.379 1.00 123.26 ? 76  ASN D O     1 
ATOM   4731  C CB    . ASN D 1 79  ? 37.395 -50.796  -184.805 1.00 108.48 ? 76  ASN D CB    1 
ATOM   4732  C CG    . ASN D 1 79  ? 36.487 -51.813  -184.143 1.00 115.44 ? 76  ASN D CG    1 
ATOM   4733  O OD1   . ASN D 1 79  ? 36.950 -52.712  -183.441 1.00 117.99 ? 76  ASN D OD1   1 
ATOM   4734  N ND2   . ASN D 1 79  ? 35.185 -51.676  -184.364 1.00 118.32 ? 76  ASN D ND2   1 
ATOM   4735  N N     . GLU D 1 80  ? 39.194 -47.985  -184.924 1.00 124.19 ? 77  GLU D N     1 
ATOM   4736  C CA    . GLU D 1 80  ? 40.388 -47.302  -185.407 1.00 118.33 ? 77  GLU D CA    1 
ATOM   4737  C C     . GLU D 1 80  ? 41.097 -46.541  -184.292 1.00 119.50 ? 77  GLU D C     1 
ATOM   4738  O O     . GLU D 1 80  ? 42.319 -46.643  -184.149 1.00 125.55 ? 77  GLU D O     1 
ATOM   4739  C CB    . GLU D 1 80  ? 40.030 -46.345  -186.549 1.00 121.29 ? 77  GLU D CB    1 
ATOM   4740  C CG    . GLU D 1 80  ? 39.498 -47.027  -187.801 1.00 134.50 ? 77  GLU D CG    1 
ATOM   4741  C CD    . GLU D 1 80  ? 40.433 -48.089  -188.341 1.00 144.04 ? 77  GLU D CD    1 
ATOM   4742  O OE1   . GLU D 1 80  ? 41.667 -47.910  -188.252 1.00 139.24 ? 77  GLU D OE1   1 
ATOM   4743  O OE2   . GLU D 1 80  ? 39.929 -49.111  -188.850 1.00 142.40 ? 77  GLU D OE2   1 
ATOM   4744  N N     . MET D 1 81  ? 40.342 -45.773  -183.503 1.00 111.54 ? 78  MET D N     1 
ATOM   4745  C CA    . MET D 1 81  ? 40.937 -44.962  -182.447 1.00 110.02 ? 78  MET D CA    1 
ATOM   4746  C C     . MET D 1 81  ? 41.659 -45.825  -181.421 1.00 116.37 ? 78  MET D C     1 
ATOM   4747  O O     . MET D 1 81  ? 42.797 -45.531  -181.035 1.00 118.99 ? 78  MET D O     1 
ATOM   4748  C CB    . MET D 1 81  ? 39.858 -44.118  -181.769 1.00 113.19 ? 78  MET D CB    1 
ATOM   4749  C CG    . MET D 1 81  ? 39.376 -42.939  -182.594 1.00 123.11 ? 78  MET D CG    1 
ATOM   4750  S SD    . MET D 1 81  ? 40.625 -41.652  -182.773 1.00 151.52 ? 78  MET D SD    1 
ATOM   4751  C CE    . MET D 1 81  ? 41.405 -41.697  -181.161 1.00 116.84 ? 78  MET D CE    1 
ATOM   4752  N N     . PHE D 1 82  ? 41.017 -46.903  -180.971 1.00 114.85 ? 79  PHE D N     1 
ATOM   4753  C CA    . PHE D 1 82  ? 41.576 -47.740  -179.919 1.00 106.70 ? 79  PHE D CA    1 
ATOM   4754  C C     . PHE D 1 82  ? 42.112 -49.072  -180.411 1.00 105.67 ? 79  PHE D C     1 
ATOM   4755  O O     . PHE D 1 82  ? 43.032 -49.616  -179.798 1.00 109.64 ? 79  PHE D O     1 
ATOM   4756  C CB    . PHE D 1 82  ? 40.522 -48.010  -178.838 1.00 98.04  ? 79  PHE D CB    1 
ATOM   4757  C CG    . PHE D 1 82  ? 39.795 -46.780  -178.386 1.00 95.98  ? 79  PHE D CG    1 
ATOM   4758  C CD1   . PHE D 1 82  ? 38.450 -46.610  -178.670 1.00 95.57  ? 79  PHE D CD1   1 
ATOM   4759  C CD2   . PHE D 1 82  ? 40.460 -45.786  -177.691 1.00 92.59  ? 79  PHE D CD2   1 
ATOM   4760  C CE1   . PHE D 1 82  ? 37.780 -45.475  -178.258 1.00 99.50  ? 79  PHE D CE1   1 
ATOM   4761  C CE2   . PHE D 1 82  ? 39.797 -44.649  -177.276 1.00 101.74 ? 79  PHE D CE2   1 
ATOM   4762  C CZ    . PHE D 1 82  ? 38.455 -44.492  -177.560 1.00 104.30 ? 79  PHE D CZ    1 
ATOM   4763  N N     . GLY D 1 83  ? 41.562 -49.609  -181.488 1.00 90.24  ? 80  GLY D N     1 
ATOM   4764  C CA    . GLY D 1 83  ? 41.916 -50.929  -181.963 1.00 95.13  ? 80  GLY D CA    1 
ATOM   4765  C C     . GLY D 1 83  ? 40.757 -51.900  -181.825 1.00 101.29 ? 80  GLY D C     1 
ATOM   4766  O O     . GLY D 1 83  ? 39.767 -51.650  -181.137 1.00 107.15 ? 80  GLY D O     1 
ATOM   4767  N N     . TYR D 1 84  ? 40.897 -53.034  -182.513 1.00 104.34 ? 81  TYR D N     1 
ATOM   4768  C CA    . TYR D 1 84  ? 39.896 -54.085  -182.382 1.00 102.25 ? 81  TYR D CA    1 
ATOM   4769  C C     . TYR D 1 84  ? 39.864 -54.655  -180.973 1.00 101.31 ? 81  TYR D C     1 
ATOM   4770  O O     . TYR D 1 84  ? 38.834 -55.193  -180.554 1.00 112.14 ? 81  TYR D O     1 
ATOM   4771  C CB    . TYR D 1 84  ? 40.160 -55.211  -183.382 1.00 100.60 ? 81  TYR D CB    1 
ATOM   4772  C CG    . TYR D 1 84  ? 41.291 -56.132  -182.979 1.00 99.48  ? 81  TYR D CG    1 
ATOM   4773  C CD1   . TYR D 1 84  ? 42.615 -55.760  -183.166 1.00 104.77 ? 81  TYR D CD1   1 
ATOM   4774  C CD2   . TYR D 1 84  ? 41.033 -57.367  -182.397 1.00 108.28 ? 81  TYR D CD2   1 
ATOM   4775  C CE1   . TYR D 1 84  ? 43.651 -56.598  -182.796 1.00 104.54 ? 81  TYR D CE1   1 
ATOM   4776  C CE2   . TYR D 1 84  ? 42.063 -58.208  -182.018 1.00 112.24 ? 81  TYR D CE2   1 
ATOM   4777  C CZ    . TYR D 1 84  ? 43.370 -57.819  -182.222 1.00 106.36 ? 81  TYR D CZ    1 
ATOM   4778  O OH    . TYR D 1 84  ? 44.400 -58.654  -181.852 1.00 104.75 ? 81  TYR D OH    1 
ATOM   4779  N N     . ASN D 1 85  ? 40.972 -54.551  -180.238 1.00 96.26  ? 82  ASN D N     1 
ATOM   4780  C CA    . ASN D 1 85  ? 41.068 -55.045  -178.870 1.00 97.49  ? 82  ASN D CA    1 
ATOM   4781  C C     . ASN D 1 85  ? 41.395 -53.930  -177.884 1.00 91.02  ? 82  ASN D C     1 
ATOM   4782  O O     . ASN D 1 85  ? 41.842 -54.206  -176.766 1.00 100.73 ? 82  ASN D O     1 
ATOM   4783  C CB    . ASN D 1 85  ? 42.116 -56.155  -178.782 1.00 97.55  ? 82  ASN D CB    1 
ATOM   4784  C CG    . ASN D 1 85  ? 43.526 -55.640  -178.996 1.00 99.18  ? 82  ASN D CG    1 
ATOM   4785  O OD1   . ASN D 1 85  ? 43.777 -54.843  -179.901 1.00 99.71  ? 82  ASN D OD1   1 
ATOM   4786  N ND2   . ASN D 1 85  ? 44.455 -56.090  -178.161 1.00 101.02 ? 82  ASN D ND2   1 
ATOM   4787  N N     . GLY D 1 86  ? 41.190 -52.675  -178.276 1.00 83.30  ? 83  GLY D N     1 
ATOM   4788  C CA    . GLY D 1 86  ? 41.453 -51.559  -177.390 1.00 95.50  ? 83  GLY D CA    1 
ATOM   4789  C C     . GLY D 1 86  ? 40.211 -51.056  -176.685 1.00 90.71  ? 83  GLY D C     1 
ATOM   4790  O O     . GLY D 1 86  ? 40.301 -50.396  -175.646 1.00 88.57  ? 83  GLY D O     1 
ATOM   4791  N N     . TRP D 1 87  ? 39.043 -51.364  -177.243 1.00 81.89  ? 84  TRP D N     1 
ATOM   4792  C CA    . TRP D 1 87  ? 37.771 -50.991  -176.646 1.00 80.26  ? 84  TRP D CA    1 
ATOM   4793  C C     . TRP D 1 87  ? 36.890 -52.224  -176.504 1.00 90.97  ? 84  TRP D C     1 
ATOM   4794  O O     . TRP D 1 87  ? 37.074 -53.231  -177.193 1.00 89.87  ? 84  TRP D O     1 
ATOM   4795  C CB    . TRP D 1 87  ? 37.050 -49.921  -177.480 1.00 80.01  ? 84  TRP D CB    1 
ATOM   4796  C CG    . TRP D 1 87  ? 36.472 -50.449  -178.755 1.00 83.15  ? 84  TRP D CG    1 
ATOM   4797  C CD1   . TRP D 1 87  ? 37.162 -50.899  -179.840 1.00 95.81  ? 84  TRP D CD1   1 
ATOM   4798  C CD2   . TRP D 1 87  ? 35.083 -50.585  -179.079 1.00 73.20  ? 84  TRP D CD2   1 
ATOM   4799  N NE1   . TRP D 1 87  ? 36.292 -51.305  -180.822 1.00 94.69  ? 84  TRP D NE1   1 
ATOM   4800  C CE2   . TRP D 1 87  ? 35.008 -51.123  -180.379 1.00 84.33  ? 84  TRP D CE2   1 
ATOM   4801  C CE3   . TRP D 1 87  ? 33.895 -50.302  -178.397 1.00 76.78  ? 84  TRP D CE3   1 
ATOM   4802  C CZ2   . TRP D 1 87  ? 33.794 -51.385  -181.010 1.00 90.65  ? 84  TRP D CZ2   1 
ATOM   4803  C CZ3   . TRP D 1 87  ? 32.691 -50.564  -179.025 1.00 82.80  ? 84  TRP D CZ3   1 
ATOM   4804  C CH2   . TRP D 1 87  ? 32.650 -51.099  -180.319 1.00 86.94  ? 84  TRP D CH2   1 
ATOM   4805  N N     . ALA D 1 88  ? 35.919 -52.126  -175.599 1.00 86.91  ? 85  ALA D N     1 
ATOM   4806  C CA    . ALA D 1 88  ? 34.983 -53.210  -175.343 1.00 74.80  ? 85  ALA D CA    1 
ATOM   4807  C C     . ALA D 1 88  ? 33.701 -52.620  -174.777 1.00 73.84  ? 85  ALA D C     1 
ATOM   4808  O O     . ALA D 1 88  ? 33.747 -51.643  -174.027 1.00 67.15  ? 85  ALA D O     1 
ATOM   4809  C CB    . ALA D 1 88  ? 35.574 -54.237  -174.370 1.00 71.01  ? 85  ALA D CB    1 
ATOM   4810  N N     . HIS D 1 89  ? 32.565 -53.215  -175.135 1.00 67.20  ? 86  HIS D N     1 
ATOM   4811  C CA    . HIS D 1 89  ? 31.277 -52.778  -174.620 1.00 68.78  ? 86  HIS D CA    1 
ATOM   4812  C C     . HIS D 1 89  ? 30.503 -53.977  -174.092 1.00 82.38  ? 86  HIS D C     1 
ATOM   4813  O O     . HIS D 1 89  ? 30.765 -55.126  -174.458 1.00 68.48  ? 86  HIS D O     1 
ATOM   4814  C CB    . HIS D 1 89  ? 30.444 -52.050  -175.684 1.00 61.39  ? 86  HIS D CB    1 
ATOM   4815  C CG    . HIS D 1 89  ? 29.678 -52.965  -176.588 1.00 70.75  ? 86  HIS D CG    1 
ATOM   4816  N ND1   . HIS D 1 89  ? 30.274 -53.984  -177.298 1.00 87.72  ? 86  HIS D ND1   1 
ATOM   4817  C CD2   . HIS D 1 89  ? 28.361 -53.010  -176.898 1.00 63.85  ? 86  HIS D CD2   1 
ATOM   4818  C CE1   . HIS D 1 89  ? 29.357 -54.619  -178.006 1.00 94.32  ? 86  HIS D CE1   1 
ATOM   4819  N NE2   . HIS D 1 89  ? 28.187 -54.048  -177.781 1.00 77.79  ? 86  HIS D NE2   1 
ATOM   4820  N N     . SER D 1 90  ? 29.536 -53.690  -173.224 1.00 84.49  ? 87  SER D N     1 
ATOM   4821  C CA    . SER D 1 90  ? 28.722 -54.722  -172.602 1.00 67.46  ? 87  SER D CA    1 
ATOM   4822  C C     . SER D 1 90  ? 27.359 -54.141  -172.259 1.00 62.22  ? 87  SER D C     1 
ATOM   4823  O O     . SER D 1 90  ? 27.218 -52.934  -172.041 1.00 60.06  ? 87  SER D O     1 
ATOM   4824  C CB    . SER D 1 90  ? 29.396 -55.288  -171.346 1.00 63.29  ? 87  SER D CB    1 
ATOM   4825  O OG    . SER D 1 90  ? 29.873 -54.247  -170.510 1.00 60.98  ? 87  SER D OG    1 
ATOM   4826  N N     . ILE D 1 91  ? 26.356 -55.014  -172.222 1.00 62.03  ? 88  ILE D N     1 
ATOM   4827  C CA    . ILE D 1 91  ? 24.988 -54.625  -171.895 1.00 58.66  ? 88  ILE D CA    1 
ATOM   4828  C C     . ILE D 1 91  ? 24.801 -54.861  -170.400 1.00 65.92  ? 88  ILE D C     1 
ATOM   4829  O O     . ILE D 1 91  ? 24.651 -55.999  -169.951 1.00 80.42  ? 88  ILE D O     1 
ATOM   4830  C CB    . ILE D 1 91  ? 23.965 -55.400  -172.725 1.00 68.84  ? 88  ILE D CB    1 
ATOM   4831  C CG1   . ILE D 1 91  ? 24.330 -55.340  -174.209 1.00 62.41  ? 88  ILE D CG1   1 
ATOM   4832  C CG2   . ILE D 1 91  ? 22.564 -54.847  -172.496 1.00 65.86  ? 88  ILE D CG2   1 
ATOM   4833  C CD1   . ILE D 1 91  ? 23.412 -56.151  -175.090 1.00 79.44  ? 88  ILE D CD1   1 
ATOM   4834  N N     . THR D 1 92  ? 24.816 -53.777  -169.622 1.00 68.02  ? 89  THR D N     1 
ATOM   4835  C CA    . THR D 1 92  ? 24.617 -53.905  -168.182 1.00 66.69  ? 89  THR D CA    1 
ATOM   4836  C C     . THR D 1 92  ? 23.198 -54.357  -167.859 1.00 62.86  ? 89  THR D C     1 
ATOM   4837  O O     . THR D 1 92  ? 23.000 -55.241  -167.018 1.00 89.10  ? 89  THR D O     1 
ATOM   4838  C CB    . THR D 1 92  ? 24.932 -52.579  -167.488 1.00 67.11  ? 89  THR D CB    1 
ATOM   4839  O OG1   . THR D 1 92  ? 26.341 -52.327  -167.558 1.00 66.61  ? 89  THR D OG1   1 
ATOM   4840  C CG2   . THR D 1 92  ? 24.508 -52.622  -166.026 1.00 65.50  ? 89  THR D CG2   1 
ATOM   4841  N N     . GLN D 1 93  ? 22.203 -53.777  -168.527 1.00 47.98  ? 90  GLN D N     1 
ATOM   4842  C CA    . GLN D 1 93  ? 20.815 -54.162  -168.320 1.00 58.48  ? 90  GLN D CA    1 
ATOM   4843  C C     . GLN D 1 93  ? 19.968 -53.593  -169.446 1.00 66.06  ? 90  GLN D C     1 
ATOM   4844  O O     . GLN D 1 93  ? 20.178 -52.454  -169.870 1.00 71.64  ? 90  GLN D O     1 
ATOM   4845  C CB    . GLN D 1 93  ? 20.288 -53.665  -166.966 1.00 62.87  ? 90  GLN D CB    1 
ATOM   4846  C CG    . GLN D 1 93  ? 18.841 -54.042  -166.692 1.00 71.12  ? 90  GLN D CG    1 
ATOM   4847  C CD    . GLN D 1 93  ? 18.372 -53.614  -165.317 1.00 102.92 ? 90  GLN D CD    1 
ATOM   4848  O OE1   . GLN D 1 93  ? 18.401 -52.431  -164.979 1.00 107.41 ? 90  GLN D OE1   1 
ATOM   4849  N NE2   . GLN D 1 93  ? 17.938 -54.578  -164.512 1.00 114.74 ? 90  GLN D NE2   1 
ATOM   4850  N N     . GLN D 1 94  ? 19.021 -54.397  -169.926 1.00 71.01  ? 91  GLN D N     1 
ATOM   4851  C CA    . GLN D 1 94  ? 18.020 -53.962  -170.890 1.00 75.45  ? 91  GLN D CA    1 
ATOM   4852  C C     . GLN D 1 94  ? 16.644 -54.311  -170.346 1.00 76.53  ? 91  GLN D C     1 
ATOM   4853  O O     . GLN D 1 94  ? 16.401 -55.458  -169.957 1.00 104.88 ? 91  GLN D O     1 
ATOM   4854  C CB    . GLN D 1 94  ? 18.232 -54.618  -172.257 1.00 80.34  ? 91  GLN D CB    1 
ATOM   4855  C CG    . GLN D 1 94  ? 16.992 -54.610  -173.136 1.00 90.50  ? 91  GLN D CG    1 
ATOM   4856  C CD    . GLN D 1 94  ? 17.285 -54.999  -174.567 1.00 90.00  ? 91  GLN D CD    1 
ATOM   4857  O OE1   . GLN D 1 94  ? 16.650 -55.896  -175.119 1.00 86.58  ? 91  GLN D OE1   1 
ATOM   4858  N NE2   . GLN D 1 94  ? 18.243 -54.318  -175.181 1.00 87.49  ? 91  GLN D NE2   1 
ATOM   4859  N N     . ASN D 1 95  ? 15.746 -53.327  -170.322 1.00 57.28  ? 92  ASN D N     1 
ATOM   4860  C CA    . ASN D 1 95  ? 14.418 -53.502  -169.752 1.00 76.12  ? 92  ASN D CA    1 
ATOM   4861  C C     . ASN D 1 95  ? 13.379 -52.935  -170.707 1.00 75.13  ? 92  ASN D C     1 
ATOM   4862  O O     . ASN D 1 95  ? 13.488 -51.781  -171.134 1.00 85.19  ? 92  ASN D O     1 
ATOM   4863  C CB    . ASN D 1 95  ? 14.310 -52.821  -168.383 1.00 98.26  ? 92  ASN D CB    1 
ATOM   4864  C CG    . ASN D 1 95  ? 12.941 -52.990  -167.753 1.00 119.80 ? 92  ASN D CG    1 
ATOM   4865  O OD1   . ASN D 1 95  ? 12.590 -54.073  -167.284 1.00 106.01 ? 92  ASN D OD1   1 
ATOM   4866  N ND2   . ASN D 1 95  ? 12.159 -51.917  -167.739 1.00 113.46 ? 92  ASN D ND2   1 
ATOM   4867  N N     . VAL D 1 96  ? 12.377 -53.745  -171.032 1.00 73.02  ? 93  VAL D N     1 
ATOM   4868  C CA    . VAL D 1 96  ? 11.278 -53.313  -171.888 1.00 78.62  ? 93  VAL D CA    1 
ATOM   4869  C C     . VAL D 1 96  ? 10.332 -52.450  -171.063 1.00 84.76  ? 93  VAL D C     1 
ATOM   4870  O O     . VAL D 1 96  ? 9.764  -52.910  -170.067 1.00 99.51  ? 93  VAL D O     1 
ATOM   4871  C CB    . VAL D 1 96  ? 10.541 -54.516  -172.495 1.00 73.82  ? 93  VAL D CB    1 
ATOM   4872  C CG1   . VAL D 1 96  ? 9.396  -54.045  -173.377 1.00 96.62  ? 93  VAL D CG1   1 
ATOM   4873  C CG2   . VAL D 1 96  ? 11.507 -55.386  -173.286 1.00 75.99  ? 93  VAL D CG2   1 
ATOM   4874  N N     . ASP D 1 97  ? 10.163 -51.192  -171.477 1.00 71.97  ? 94  ASP D N     1 
ATOM   4875  C CA    . ASP D 1 97  ? 9.337  -50.266  -170.710 1.00 71.21  ? 94  ASP D CA    1 
ATOM   4876  C C     . ASP D 1 97  ? 7.857  -50.606  -170.838 1.00 74.85  ? 94  ASP D C     1 
ATOM   4877  O O     . ASP D 1 97  ? 7.139  -50.680  -169.834 1.00 93.36  ? 94  ASP D O     1 
ATOM   4878  C CB    . ASP D 1 97  ? 9.603  -48.829  -171.159 1.00 74.42  ? 94  ASP D CB    1 
ATOM   4879  C CG    . ASP D 1 97  ? 10.877 -48.259  -170.565 1.00 78.28  ? 94  ASP D CG    1 
ATOM   4880  O OD1   . ASP D 1 97  ? 11.053 -48.348  -169.332 1.00 78.80  ? 94  ASP D OD1   1 
ATOM   4881  O OD2   . ASP D 1 97  ? 11.702 -47.720  -171.330 1.00 88.55  ? 94  ASP D OD2   1 
ATOM   4882  N N     . PHE D 1 98  ? 7.381  -50.818  -172.063 1.00 78.73  ? 95  PHE D N     1 
ATOM   4883  C CA    . PHE D 1 98  ? 5.964  -51.077  -172.274 1.00 90.15  ? 95  PHE D CA    1 
ATOM   4884  C C     . PHE D 1 98  ? 5.770  -51.795  -173.600 1.00 87.44  ? 95  PHE D C     1 
ATOM   4885  O O     . PHE D 1 98  ? 6.618  -51.729  -174.494 1.00 84.14  ? 95  PHE D O     1 
ATOM   4886  C CB    . PHE D 1 98  ? 5.149  -49.777  -172.245 1.00 102.13 ? 95  PHE D CB    1 
ATOM   4887  C CG    . PHE D 1 98  ? 5.526  -48.798  -173.326 1.00 101.47 ? 95  PHE D CG    1 
ATOM   4888  C CD1   . PHE D 1 98  ? 4.935  -48.860  -174.579 1.00 103.59 ? 95  PHE D CD1   1 
ATOM   4889  C CD2   . PHE D 1 98  ? 6.480  -47.821  -173.090 1.00 102.45 ? 95  PHE D CD2   1 
ATOM   4890  C CE1   . PHE D 1 98  ? 5.284  -47.963  -175.572 1.00 107.21 ? 95  PHE D CE1   1 
ATOM   4891  C CE2   . PHE D 1 98  ? 6.832  -46.922  -174.080 1.00 101.25 ? 95  PHE D CE2   1 
ATOM   4892  C CZ    . PHE D 1 98  ? 6.234  -46.993  -175.322 1.00 108.78 ? 95  PHE D CZ    1 
ATOM   4893  N N     . VAL D 1 99  ? 4.631  -52.477  -173.711 1.00 90.11  ? 96  VAL D N     1 
ATOM   4894  C CA    . VAL D 1 99  ? 4.177  -53.093  -174.955 1.00 97.22  ? 96  VAL D CA    1 
ATOM   4895  C C     . VAL D 1 99  ? 2.666  -52.904  -175.005 1.00 107.38 ? 96  VAL D C     1 
ATOM   4896  O O     . VAL D 1 99  ? 1.935  -53.521  -174.222 1.00 93.11  ? 96  VAL D O     1 
ATOM   4897  C CB    . VAL D 1 99  ? 4.543  -54.582  -175.055 1.00 75.98  ? 96  VAL D CB    1 
ATOM   4898  C CG1   . VAL D 1 99  ? 3.753  -55.249  -176.171 1.00 81.25  ? 96  VAL D CG1   1 
ATOM   4899  C CG2   . VAL D 1 99  ? 6.035  -54.754  -175.297 1.00 67.90  ? 96  VAL D CG2   1 
ATOM   4900  N N     . ASP D 1 100 ? 2.199  -52.047  -175.908 1.00 123.56 ? 97  ASP D N     1 
ATOM   4901  C CA    . ASP D 1 100 ? 0.786  -51.733  -176.040 1.00 123.16 ? 97  ASP D CA    1 
ATOM   4902  C C     . ASP D 1 100 ? 0.301  -52.068  -177.445 1.00 122.31 ? 97  ASP D C     1 
ATOM   4903  O O     . ASP D 1 100 ? 1.090  -52.209  -178.384 1.00 121.11 ? 97  ASP D O     1 
ATOM   4904  C CB    . ASP D 1 100 ? 0.511  -50.256  -175.721 1.00 135.85 ? 97  ASP D CB    1 
ATOM   4905  C CG    . ASP D 1 100 ? 1.078  -49.834  -174.378 1.00 136.43 ? 97  ASP D CG    1 
ATOM   4906  O OD1   . ASP D 1 100 ? 0.840  -50.547  -173.379 1.00 127.41 ? 97  ASP D OD1   1 
ATOM   4907  O OD2   . ASP D 1 100 ? 1.758  -48.788  -174.318 1.00 126.73 ? 97  ASP D OD2   1 
ATOM   4908  N N     . LEU D 1 101 ? -1.018 -52.195  -177.575 1.00 127.07 ? 98  LEU D N     1 
ATOM   4909  C CA    . LEU D 1 101 ? -1.653 -52.570  -178.834 1.00 129.58 ? 98  LEU D CA    1 
ATOM   4910  C C     . LEU D 1 101 ? -2.856 -51.669  -179.062 1.00 135.21 ? 98  LEU D C     1 
ATOM   4911  O O     . LEU D 1 101 ? -3.812 -51.700  -178.282 1.00 120.20 ? 98  LEU D O     1 
ATOM   4912  C CB    . LEU D 1 101 ? -2.077 -54.042  -178.825 1.00 110.57 ? 98  LEU D CB    1 
ATOM   4913  C CG    . LEU D 1 101 ? -2.834 -54.552  -180.054 1.00 115.32 ? 98  LEU D CG    1 
ATOM   4914  C CD1   . LEU D 1 101 ? -2.076 -54.234  -181.332 1.00 125.60 ? 98  LEU D CD1   1 
ATOM   4915  C CD2   . LEU D 1 101 ? -3.095 -56.047  -179.941 1.00 110.73 ? 98  LEU D CD2   1 
ATOM   4916  N N     . ASN D 1 102 ? -2.805 -50.866  -180.123 1.00 144.79 ? 99  ASN D N     1 
ATOM   4917  C CA    . ASN D 1 102 ? -3.892 -49.964  -180.490 1.00 140.27 ? 99  ASN D CA    1 
ATOM   4918  C C     . ASN D 1 102 ? -4.373 -50.326  -181.890 1.00 143.50 ? 99  ASN D C     1 
ATOM   4919  O O     . ASN D 1 102 ? -3.696 -50.021  -182.879 1.00 146.56 ? 99  ASN D O     1 
ATOM   4920  C CB    . ASN D 1 102 ? -3.443 -48.505  -180.425 1.00 139.19 ? 99  ASN D CB    1 
ATOM   4921  C CG    . ASN D 1 102 ? -2.959 -48.105  -179.045 1.00 135.15 ? 99  ASN D CG    1 
ATOM   4922  O OD1   . ASN D 1 102 ? -3.504 -48.543  -178.032 1.00 127.55 ? 99  ASN D OD1   1 
ATOM   4923  N ND2   . ASN D 1 102 ? -1.932 -47.264  -178.998 1.00 134.17 ? 99  ASN D ND2   1 
ATOM   4924  N N     . ASN D 1 103 ? -5.541 -50.962  -181.960 1.00 143.78 ? 100 ASN D N     1 
ATOM   4925  C CA    . ASN D 1 103 ? -6.229 -51.336  -183.200 1.00 145.73 ? 100 ASN D CA    1 
ATOM   4926  C C     . ASN D 1 103 ? -5.260 -51.864  -184.259 1.00 148.43 ? 100 ASN D C     1 
ATOM   4927  O O     . ASN D 1 103 ? -5.168 -51.357  -185.377 1.00 144.74 ? 100 ASN D O     1 
ATOM   4928  C CB    . ASN D 1 103 ? -7.065 -50.176  -183.753 1.00 141.56 ? 100 ASN D CB    1 
ATOM   4929  C CG    . ASN D 1 103 ? -6.316 -48.857  -183.770 1.00 158.39 ? 100 ASN D CG    1 
ATOM   4930  O OD1   . ASN D 1 103 ? -6.324 -48.113  -182.789 1.00 160.67 ? 100 ASN D OD1   1 
ATOM   4931  N ND2   . ASN D 1 103 ? -5.664 -48.561  -184.889 1.00 162.15 ? 100 ASN D ND2   1 
ATOM   4932  N N     . GLY D 1 104 ? -4.524 -52.908  -183.877 1.00 149.17 ? 101 GLY D N     1 
ATOM   4933  C CA    . GLY D 1 104 ? -3.667 -53.621  -184.800 1.00 149.09 ? 101 GLY D CA    1 
ATOM   4934  C C     . GLY D 1 104 ? -2.241 -53.123  -184.889 1.00 141.26 ? 101 GLY D C     1 
ATOM   4935  O O     . GLY D 1 104 ? -1.418 -53.774  -185.546 1.00 141.92 ? 101 GLY D O     1 
ATOM   4936  N N     . ALA D 1 105 ? -1.919 -51.999  -184.259 1.00 136.72 ? 102 ALA D N     1 
ATOM   4937  C CA    . ALA D 1 105 ? -0.577 -51.436  -184.291 1.00 140.68 ? 102 ALA D CA    1 
ATOM   4938  C C     . ALA D 1 105 ? 0.103  -51.686  -182.952 1.00 133.88 ? 102 ALA D C     1 
ATOM   4939  O O     . ALA D 1 105 ? -0.484 -51.431  -181.896 1.00 124.67 ? 102 ALA D O     1 
ATOM   4940  C CB    . ALA D 1 105 ? -0.615 -49.938  -184.602 1.00 147.46 ? 102 ALA D CB    1 
ATOM   4941  N N     . PHE D 1 106 ? 1.337  -52.180  -183.001 1.00 133.40 ? 103 PHE D N     1 
ATOM   4942  C CA    . PHE D 1 106 ? 2.104  -52.502  -181.805 1.00 115.09 ? 103 PHE D CA    1 
ATOM   4943  C C     . PHE D 1 106 ? 3.071  -51.363  -181.503 1.00 116.96 ? 103 PHE D C     1 
ATOM   4944  O O     . PHE D 1 106 ? 3.907  -51.012  -182.343 1.00 123.68 ? 103 PHE D O     1 
ATOM   4945  C CB    . PHE D 1 106 ? 2.862  -53.817  -181.984 1.00 115.81 ? 103 PHE D CB    1 
ATOM   4946  C CG    . PHE D 1 106 ? 2.059  -55.033  -181.618 1.00 117.90 ? 103 PHE D CG    1 
ATOM   4947  C CD1   . PHE D 1 106 ? 1.368  -55.088  -180.419 1.00 115.43 ? 103 PHE D CD1   1 
ATOM   4948  C CD2   . PHE D 1 106 ? 1.990  -56.118  -182.477 1.00 108.01 ? 103 PHE D CD2   1 
ATOM   4949  C CE1   . PHE D 1 106 ? 0.629  -56.206  -180.079 1.00 99.52  ? 103 PHE D CE1   1 
ATOM   4950  C CE2   . PHE D 1 106 ? 1.250  -57.237  -182.144 1.00 101.19 ? 103 PHE D CE2   1 
ATOM   4951  C CZ    . PHE D 1 106 ? 0.569  -57.281  -180.943 1.00 102.87 ? 103 PHE D CZ    1 
ATOM   4952  N N     . TYR D 1 107 ? 2.954  -50.792  -180.306 1.00 117.43 ? 104 TYR D N     1 
ATOM   4953  C CA    . TYR D 1 107 ? 3.819  -49.710  -179.847 1.00 117.46 ? 104 TYR D CA    1 
ATOM   4954  C C     . TYR D 1 107 ? 4.683  -50.255  -178.715 1.00 109.24 ? 104 TYR D C     1 
ATOM   4955  O O     . TYR D 1 107 ? 4.170  -50.589  -177.641 1.00 99.30  ? 104 TYR D O     1 
ATOM   4956  C CB    . TYR D 1 107 ? 2.999  -48.504  -179.391 1.00 122.01 ? 104 TYR D CB    1 
ATOM   4957  C CG    . TYR D 1 107 ? 2.011  -47.996  -180.422 1.00 125.44 ? 104 TYR D CG    1 
ATOM   4958  C CD1   . TYR D 1 107 ? 0.800  -48.644  -180.636 1.00 127.24 ? 104 TYR D CD1   1 
ATOM   4959  C CD2   . TYR D 1 107 ? 2.291  -46.869  -181.182 1.00 136.13 ? 104 TYR D CD2   1 
ATOM   4960  C CE1   . TYR D 1 107 ? -0.101 -48.183  -181.577 1.00 131.02 ? 104 TYR D CE1   1 
ATOM   4961  C CE2   . TYR D 1 107 ? 1.396  -46.401  -182.126 1.00 141.47 ? 104 TYR D CE2   1 
ATOM   4962  C CZ    . TYR D 1 107 ? 0.202  -47.062  -182.319 1.00 138.72 ? 104 TYR D CZ    1 
ATOM   4963  O OH    . TYR D 1 107 ? -0.694 -46.600  -183.256 1.00 139.38 ? 104 TYR D OH    1 
ATOM   4964  N N     . VAL D 1 108 ? 5.989  -50.343  -178.955 1.00 98.81  ? 105 VAL D N     1 
ATOM   4965  C CA    . VAL D 1 108 ? 6.927  -50.972  -178.033 1.00 92.74  ? 105 VAL D CA    1 
ATOM   4966  C C     . VAL D 1 108 ? 8.016  -49.970  -177.677 1.00 99.46  ? 105 VAL D C     1 
ATOM   4967  O O     . VAL D 1 108 ? 8.618  -49.356  -178.565 1.00 111.10 ? 105 VAL D O     1 
ATOM   4968  C CB    . VAL D 1 108 ? 7.541  -52.249  -178.635 1.00 93.80  ? 105 VAL D CB    1 
ATOM   4969  C CG1   . VAL D 1 108 ? 8.591  -52.819  -177.699 1.00 110.21 ? 105 VAL D CG1   1 
ATOM   4970  C CG2   . VAL D 1 108 ? 6.457  -53.277  -178.914 1.00 99.77  ? 105 VAL D CG2   1 
ATOM   4971  N N     . GLY D 1 109 ? 8.270  -49.811  -176.379 1.00 96.59  ? 106 GLY D N     1 
ATOM   4972  C CA    . GLY D 1 109 ? 9.400  -49.030  -175.917 1.00 88.51  ? 106 GLY D CA    1 
ATOM   4973  C C     . GLY D 1 109 ? 10.393 -49.882  -175.154 1.00 92.08  ? 106 GLY D C     1 
ATOM   4974  O O     . GLY D 1 109 ? 10.006 -50.643  -174.262 1.00 96.30  ? 106 GLY D O     1 
ATOM   4975  N N     . VAL D 1 110 ? 11.675 -49.762  -175.491 1.00 82.97  ? 107 VAL D N     1 
ATOM   4976  C CA    . VAL D 1 110 ? 12.729 -50.584  -174.904 1.00 76.53  ? 107 VAL D CA    1 
ATOM   4977  C C     . VAL D 1 110 ? 13.952 -49.707  -174.676 1.00 69.30  ? 107 VAL D C     1 
ATOM   4978  O O     . VAL D 1 110 ? 14.279 -48.850  -175.503 1.00 86.40  ? 107 VAL D O     1 
ATOM   4979  C CB    . VAL D 1 110 ? 13.077 -51.792  -175.805 1.00 90.51  ? 107 VAL D CB    1 
ATOM   4980  C CG1   . VAL D 1 110 ? 14.318 -52.514  -175.296 1.00 78.75  ? 107 VAL D CG1   1 
ATOM   4981  C CG2   . VAL D 1 110 ? 11.906 -52.761  -175.886 1.00 91.70  ? 107 VAL D CG2   1 
ATOM   4982  N N     . CYS D 1 111 ? 14.627 -49.920  -173.547 1.00 66.62  ? 108 CYS D N     1 
ATOM   4983  C CA    . CYS D 1 111 ? 15.832 -49.183  -173.200 1.00 78.97  ? 108 CYS D CA    1 
ATOM   4984  C C     . CYS D 1 111 ? 16.946 -50.163  -172.862 1.00 70.23  ? 108 CYS D C     1 
ATOM   4985  O O     . CYS D 1 111 ? 16.694 -51.300  -172.454 1.00 91.85  ? 108 CYS D O     1 
ATOM   4986  C CB    . CYS D 1 111 ? 15.599 -48.237  -172.014 1.00 99.37  ? 108 CYS D CB    1 
ATOM   4987  S SG    . CYS D 1 111 ? 15.626 -49.047  -170.397 1.00 67.69  ? 108 CYS D SG    1 
ATOM   4988  N N     . ALA D 1 112 ? 18.184 -49.711  -173.046 1.00 67.13  ? 109 ALA D N     1 
ATOM   4989  C CA    . ALA D 1 112 ? 19.354 -50.522  -172.753 1.00 66.35  ? 109 ALA D CA    1 
ATOM   4990  C C     . ALA D 1 112 ? 20.428 -49.647  -172.124 1.00 64.45  ? 109 ALA D C     1 
ATOM   4991  O O     . ALA D 1 112 ? 20.452 -48.428  -172.306 1.00 69.47  ? 109 ALA D O     1 
ATOM   4992  C CB    . ALA D 1 112 ? 19.899 -51.209  -174.012 1.00 74.68  ? 109 ALA D CB    1 
ATOM   4993  N N     . PHE D 1 113 ? 21.330 -50.290  -171.386 1.00 73.42  ? 110 PHE D N     1 
ATOM   4994  C CA    . PHE D 1 113 ? 22.429 -49.614  -170.702 1.00 73.29  ? 110 PHE D CA    1 
ATOM   4995  C C     . PHE D 1 113 ? 23.734 -50.252  -171.157 1.00 72.82  ? 110 PHE D C     1 
ATOM   4996  O O     . PHE D 1 113 ? 24.060 -51.371  -170.746 1.00 94.75  ? 110 PHE D O     1 
ATOM   4997  C CB    . PHE D 1 113 ? 22.277 -49.705  -169.182 1.00 67.56  ? 110 PHE D CB    1 
ATOM   4998  C CG    . PHE D 1 113 ? 21.097 -48.948  -168.640 1.00 67.80  ? 110 PHE D CG    1 
ATOM   4999  C CD1   . PHE D 1 113 ? 19.807 -49.426  -168.811 1.00 59.49  ? 110 PHE D CD1   1 
ATOM   5000  C CD2   . PHE D 1 113 ? 21.277 -47.753  -167.965 1.00 66.97  ? 110 PHE D CD2   1 
ATOM   5001  C CE1   . PHE D 1 113 ? 18.722 -48.731  -168.315 1.00 54.67  ? 110 PHE D CE1   1 
ATOM   5002  C CE2   . PHE D 1 113 ? 20.196 -47.054  -167.465 1.00 64.55  ? 110 PHE D CE2   1 
ATOM   5003  C CZ    . PHE D 1 113 ? 18.917 -47.543  -167.641 1.00 65.86  ? 110 PHE D CZ    1 
ATOM   5004  N N     . VAL D 1 114 ? 24.478 -49.543  -171.999 1.00 54.07  ? 111 VAL D N     1 
ATOM   5005  C CA    . VAL D 1 114 ? 25.729 -50.043  -172.555 1.00 66.63  ? 111 VAL D CA    1 
ATOM   5006  C C     . VAL D 1 114 ? 26.891 -49.390  -171.822 1.00 66.65  ? 111 VAL D C     1 
ATOM   5007  O O     . VAL D 1 114 ? 26.878 -48.180  -171.561 1.00 65.66  ? 111 VAL D O     1 
ATOM   5008  C CB    . VAL D 1 114 ? 25.811 -49.780  -174.070 1.00 77.90  ? 111 VAL D CB    1 
ATOM   5009  C CG1   . VAL D 1 114 ? 26.993 -50.523  -174.675 1.00 69.91  ? 111 VAL D CG1   1 
ATOM   5010  C CG2   . VAL D 1 114 ? 24.514 -50.192  -174.747 1.00 77.95  ? 111 VAL D CG2   1 
ATOM   5011  N N     . ARG D 1 115 ? 27.895 -50.194  -171.483 1.00 60.50  ? 112 ARG D N     1 
ATOM   5012  C CA    . ARG D 1 115 ? 29.100 -49.727  -170.810 1.00 73.80  ? 112 ARG D CA    1 
ATOM   5013  C C     . ARG D 1 115 ? 30.305 -50.045  -171.683 1.00 81.28  ? 112 ARG D C     1 
ATOM   5014  O O     . ARG D 1 115 ? 30.610 -51.219  -171.918 1.00 91.15  ? 112 ARG D O     1 
ATOM   5015  C CB    . ARG D 1 115 ? 29.246 -50.380  -169.433 1.00 85.65  ? 112 ARG D CB    1 
ATOM   5016  C CG    . ARG D 1 115 ? 30.607 -50.180  -168.789 1.00 82.76  ? 112 ARG D CG    1 
ATOM   5017  C CD    . ARG D 1 115 ? 30.771 -51.065  -167.567 1.00 94.50  ? 112 ARG D CD    1 
ATOM   5018  N NE    . ARG D 1 115 ? 32.173 -51.364  -167.290 1.00 101.08 ? 112 ARG D NE    1 
ATOM   5019  C CZ    . ARG D 1 115 ? 32.850 -50.880  -166.254 1.00 98.42  ? 112 ARG D CZ    1 
ATOM   5020  N NH1   . ARG D 1 115 ? 32.253 -50.071  -165.389 1.00 83.13  ? 112 ARG D NH1   1 
ATOM   5021  N NH2   . ARG D 1 115 ? 34.123 -51.208  -166.082 1.00 91.96  ? 112 ARG D NH2   1 
ATOM   5022  N N     . VAL D 1 116 ? 30.988 -49.005  -172.155 1.00 76.91  ? 113 VAL D N     1 
ATOM   5023  C CA    . VAL D 1 116 ? 32.196 -49.157  -172.960 1.00 72.84  ? 113 VAL D CA    1 
ATOM   5024  C C     . VAL D 1 116 ? 33.407 -49.000  -172.055 1.00 74.53  ? 113 VAL D C     1 
ATOM   5025  O O     . VAL D 1 116 ? 33.432 -48.129  -171.177 1.00 64.47  ? 113 VAL D O     1 
ATOM   5026  C CB    . VAL D 1 116 ? 32.234 -48.141  -174.117 1.00 81.28  ? 113 VAL D CB    1 
ATOM   5027  C CG1   . VAL D 1 116 ? 33.384 -48.456  -175.059 1.00 88.75  ? 113 VAL D CG1   1 
ATOM   5028  C CG2   . VAL D 1 116 ? 30.920 -48.153  -174.870 1.00 79.25  ? 113 VAL D CG2   1 
ATOM   5029  N N     . GLN D 1 117 ? 34.416 -49.842  -172.268 1.00 73.83  ? 114 GLN D N     1 
ATOM   5030  C CA    . GLN D 1 117 ? 35.602 -49.857  -171.427 1.00 83.99  ? 114 GLN D CA    1 
ATOM   5031  C C     . GLN D 1 117 ? 36.840 -50.041  -172.292 1.00 92.94  ? 114 GLN D C     1 
ATOM   5032  O O     . GLN D 1 117 ? 36.850 -50.869  -173.207 1.00 92.59  ? 114 GLN D O     1 
ATOM   5033  C CB    . GLN D 1 117 ? 35.523 -50.970  -170.373 1.00 88.83  ? 114 GLN D CB    1 
ATOM   5034  C CG    . GLN D 1 117 ? 36.745 -51.070  -169.474 1.00 85.26  ? 114 GLN D CG    1 
ATOM   5035  C CD    . GLN D 1 117 ? 36.709 -52.292  -168.578 1.00 100.44 ? 114 GLN D CD    1 
ATOM   5036  O OE1   . GLN D 1 117 ? 36.477 -53.409  -169.041 1.00 118.48 ? 114 GLN D OE1   1 
ATOM   5037  N NE2   . GLN D 1 117 ? 36.932 -52.085  -167.285 1.00 112.13 ? 114 GLN D NE2   1 
ATOM   5038  N N     . LEU D 1 118 ? 37.875 -49.260  -172.002 1.00 90.52  ? 115 LEU D N     1 
ATOM   5039  C CA    . LEU D 1 118 ? 39.150 -49.370  -172.691 1.00 88.53  ? 115 LEU D CA    1 
ATOM   5040  C C     . LEU D 1 118 ? 40.088 -50.309  -171.939 1.00 81.82  ? 115 LEU D C     1 
ATOM   5041  O O     . LEU D 1 118 ? 39.918 -50.574  -170.747 1.00 89.45  ? 115 LEU D O     1 
ATOM   5042  C CB    . LEU D 1 118 ? 39.798 -47.995  -172.850 1.00 100.04 ? 115 LEU D CB    1 
ATOM   5043  C CG    . LEU D 1 118 ? 38.909 -46.879  -173.398 1.00 94.67  ? 115 LEU D CG    1 
ATOM   5044  C CD1   . LEU D 1 118 ? 39.683 -45.572  -173.482 1.00 96.22  ? 115 LEU D CD1   1 
ATOM   5045  C CD2   . LEU D 1 118 ? 38.341 -47.263  -174.755 1.00 90.39  ? 115 LEU D CD2   1 
ATOM   5046  N N     . LYS D 1 119 ? 41.092 -50.814  -172.664 1.00 76.61  ? 116 LYS D N     1 
ATOM   5047  C CA    . LYS D 1 119 ? 42.030 -51.779  -172.095 1.00 84.63  ? 116 LYS D CA    1 
ATOM   5048  C C     . LYS D 1 119 ? 42.785 -51.234  -170.888 1.00 92.28  ? 116 LYS D C     1 
ATOM   5049  O O     . LYS D 1 119 ? 43.385 -52.017  -170.145 1.00 100.12 ? 116 LYS D O     1 
ATOM   5050  C CB    . LYS D 1 119 ? 43.027 -52.240  -173.160 1.00 86.58  ? 116 LYS D CB    1 
ATOM   5051  C CG    . LYS D 1 119 ? 43.740 -51.116  -173.888 1.00 98.62  ? 116 LYS D CG    1 
ATOM   5052  C CD    . LYS D 1 119 ? 44.629 -51.666  -174.992 1.00 108.88 ? 116 LYS D CD    1 
ATOM   5053  C CE    . LYS D 1 119 ? 45.145 -50.560  -175.895 1.00 126.54 ? 116 LYS D CE    1 
ATOM   5054  N NZ    . LYS D 1 119 ? 45.850 -51.107  -177.087 1.00 142.31 ? 116 LYS D NZ    1 
ATOM   5055  N N     . ASP D 1 120 ? 42.791 -49.917  -170.683 1.00 92.46  ? 117 ASP D N     1 
ATOM   5056  C CA    . ASP D 1 120 ? 43.447 -49.350  -169.512 1.00 103.53 ? 117 ASP D CA    1 
ATOM   5057  C C     . ASP D 1 120 ? 42.572 -49.387  -168.266 1.00 100.59 ? 117 ASP D C     1 
ATOM   5058  O O     . ASP D 1 120 ? 43.082 -49.155  -167.165 1.00 102.23 ? 117 ASP D O     1 
ATOM   5059  C CB    . ASP D 1 120 ? 43.882 -47.909  -169.792 1.00 101.44 ? 117 ASP D CB    1 
ATOM   5060  C CG    . ASP D 1 120 ? 42.722 -46.934  -169.758 1.00 106.79 ? 117 ASP D CG    1 
ATOM   5061  O OD1   . ASP D 1 120 ? 41.654 -47.259  -170.320 1.00 101.85 ? 117 ASP D OD1   1 
ATOM   5062  O OD2   . ASP D 1 120 ? 42.876 -45.847  -169.163 1.00 105.52 ? 117 ASP D OD2   1 
ATOM   5063  N N     . GLY D 1 121 ? 41.279 -49.672  -168.409 1.00 91.77  ? 118 GLY D N     1 
ATOM   5064  C CA    . GLY D 1 121 ? 40.350 -49.704  -167.300 1.00 92.61  ? 118 GLY D CA    1 
ATOM   5065  C C     . GLY D 1 121 ? 39.326 -48.589  -167.312 1.00 92.81  ? 118 GLY D C     1 
ATOM   5066  O O     . GLY D 1 121 ? 38.299 -48.703  -166.629 1.00 86.71  ? 118 GLY D O     1 
ATOM   5067  N N     . SER D 1 122 ? 39.579 -47.513  -168.056 1.00 92.57  ? 119 SER D N     1 
ATOM   5068  C CA    . SER D 1 122 ? 38.606 -46.437  -168.177 1.00 90.71  ? 119 SER D CA    1 
ATOM   5069  C C     . SER D 1 122 ? 37.306 -46.965  -168.770 1.00 92.88  ? 119 SER D C     1 
ATOM   5070  O O     . SER D 1 122 ? 37.299 -47.892  -169.583 1.00 93.75  ? 119 SER D O     1 
ATOM   5071  C CB    . SER D 1 122 ? 39.163 -45.309  -169.046 1.00 100.05 ? 119 SER D CB    1 
ATOM   5072  O OG    . SER D 1 122 ? 38.203 -44.280  -169.221 1.00 119.14 ? 119 SER D OG    1 
ATOM   5073  N N     . TYR D 1 123 ? 36.193 -46.361  -168.359 1.00 84.19  ? 120 TYR D N     1 
ATOM   5074  C CA    . TYR D 1 123 ? 34.884 -46.882  -168.722 1.00 76.24  ? 120 TYR D CA    1 
ATOM   5075  C C     . TYR D 1 123 ? 33.872 -45.748  -168.790 1.00 79.81  ? 120 TYR D C     1 
ATOM   5076  O O     . TYR D 1 123 ? 33.950 -44.778  -168.033 1.00 82.57  ? 120 TYR D O     1 
ATOM   5077  C CB    . TYR D 1 123 ? 34.422 -47.947  -167.719 1.00 94.99  ? 120 TYR D CB    1 
ATOM   5078  C CG    . TYR D 1 123 ? 34.298 -47.434  -166.299 1.00 86.27  ? 120 TYR D CG    1 
ATOM   5079  C CD1   . TYR D 1 123 ? 33.107 -46.888  -165.836 1.00 80.94  ? 120 TYR D CD1   1 
ATOM   5080  C CD2   . TYR D 1 123 ? 35.374 -47.492  -165.424 1.00 70.45  ? 120 TYR D CD2   1 
ATOM   5081  C CE1   . TYR D 1 123 ? 32.993 -46.416  -164.544 1.00 65.96  ? 120 TYR D CE1   1 
ATOM   5082  C CE2   . TYR D 1 123 ? 35.268 -47.023  -164.128 1.00 73.93  ? 120 TYR D CE2   1 
ATOM   5083  C CZ    . TYR D 1 123 ? 34.075 -46.486  -163.694 1.00 73.71  ? 120 TYR D CZ    1 
ATOM   5084  O OH    . TYR D 1 123 ? 33.961 -46.017  -162.406 1.00 81.16  ? 120 TYR D OH    1 
ATOM   5085  N N     . HIS D 1 124 ? 32.917 -45.885  -169.706 1.00 80.17  ? 121 HIS D N     1 
ATOM   5086  C CA    . HIS D 1 124 ? 31.800 -44.958  -169.812 1.00 90.02  ? 121 HIS D CA    1 
ATOM   5087  C C     . HIS D 1 124 ? 30.529 -45.742  -170.100 1.00 77.09  ? 121 HIS D C     1 
ATOM   5088  O O     . HIS D 1 124 ? 30.533 -46.665  -170.919 1.00 69.57  ? 121 HIS D O     1 
ATOM   5089  C CB    . HIS D 1 124 ? 32.041 -43.909  -170.905 1.00 96.01  ? 121 HIS D CB    1 
ATOM   5090  C CG    . HIS D 1 124 ? 33.111 -42.918  -170.565 1.00 88.99  ? 121 HIS D CG    1 
ATOM   5091  N ND1   . HIS D 1 124 ? 34.145 -42.615  -171.424 1.00 89.30  ? 121 HIS D ND1   1 
ATOM   5092  C CD2   . HIS D 1 124 ? 33.310 -42.164  -169.457 1.00 82.50  ? 121 HIS D CD2   1 
ATOM   5093  C CE1   . HIS D 1 124 ? 34.933 -41.716  -170.862 1.00 106.05 ? 121 HIS D CE1   1 
ATOM   5094  N NE2   . HIS D 1 124 ? 34.448 -41.425  -169.668 1.00 99.36  ? 121 HIS D NE2   1 
ATOM   5095  N N     . GLU D 1 125 ? 29.445 -45.370  -169.421 1.00 67.93  ? 122 GLU D N     1 
ATOM   5096  C CA    . GLU D 1 125 ? 28.173 -46.070  -169.531 1.00 72.76  ? 122 GLU D CA    1 
ATOM   5097  C C     . GLU D 1 125 ? 27.051 -45.066  -169.749 1.00 76.48  ? 122 GLU D C     1 
ATOM   5098  O O     . GLU D 1 125 ? 27.013 -44.015  -169.103 1.00 92.89  ? 122 GLU D O     1 
ATOM   5099  C CB    . GLU D 1 125 ? 27.896 -46.911  -168.278 1.00 92.80  ? 122 GLU D CB    1 
ATOM   5100  C CG    . GLU D 1 125 ? 26.527 -47.567  -168.259 1.00 92.97  ? 122 GLU D CG    1 
ATOM   5101  C CD    . GLU D 1 125 ? 26.273 -48.354  -166.989 1.00 90.47  ? 122 GLU D CD    1 
ATOM   5102  O OE1   . GLU D 1 125 ? 26.672 -47.882  -165.902 1.00 86.39  ? 122 GLU D OE1   1 
ATOM   5103  O OE2   . GLU D 1 125 ? 25.669 -49.444  -167.078 1.00 86.46  ? 122 GLU D OE2   1 
ATOM   5104  N N     . ASP D 1 126 ? 26.137 -45.394  -170.662 1.00 62.64  ? 123 ASP D N     1 
ATOM   5105  C CA    . ASP D 1 126 ? 25.036 -44.501  -170.992 1.00 69.94  ? 123 ASP D CA    1 
ATOM   5106  C C     . ASP D 1 126 ? 23.872 -45.321  -171.533 1.00 72.28  ? 123 ASP D C     1 
ATOM   5107  O O     . ASP D 1 126 ? 24.020 -46.494  -171.885 1.00 75.70  ? 123 ASP D O     1 
ATOM   5108  C CB    . ASP D 1 126 ? 25.467 -43.427  -171.996 1.00 80.56  ? 123 ASP D CB    1 
ATOM   5109  C CG    . ASP D 1 126 ? 24.722 -42.123  -171.801 1.00 86.37  ? 123 ASP D CG    1 
ATOM   5110  O OD1   . ASP D 1 126 ? 23.473 -42.143  -171.824 1.00 87.21  ? 123 ASP D OD1   1 
ATOM   5111  O OD2   . ASP D 1 126 ? 25.385 -41.079  -171.620 1.00 97.47  ? 123 ASP D OD2   1 
ATOM   5112  N N     . VAL D 1 127 ? 22.705 -44.683  -171.593 1.00 65.86  ? 124 VAL D N     1 
ATOM   5113  C CA    . VAL D 1 127 ? 21.472 -45.350  -171.989 1.00 66.44  ? 124 VAL D CA    1 
ATOM   5114  C C     . VAL D 1 127 ? 21.283 -45.243  -173.497 1.00 70.72  ? 124 VAL D C     1 
ATOM   5115  O O     . VAL D 1 127 ? 21.876 -44.397  -174.170 1.00 86.36  ? 124 VAL D O     1 
ATOM   5116  C CB    . VAL D 1 127 ? 20.260 -44.762  -171.234 1.00 67.33  ? 124 VAL D CB    1 
ATOM   5117  C CG1   . VAL D 1 127 ? 19.054 -45.693  -171.309 1.00 69.77  ? 124 VAL D CG1   1 
ATOM   5118  C CG2   . VAL D 1 127 ? 20.626 -44.498  -169.796 1.00 98.31  ? 124 VAL D CG2   1 
ATOM   5119  N N     . GLY D 1 128 ? 20.449 -46.125  -174.030 1.00 75.02  ? 125 GLY D N     1 
ATOM   5120  C CA    . GLY D 1 128 ? 19.982 -46.015  -175.400 1.00 79.60  ? 125 GLY D CA    1 
ATOM   5121  C C     . GLY D 1 128 ? 18.581 -46.571  -175.494 1.00 81.06  ? 125 GLY D C     1 
ATOM   5122  O O     . GLY D 1 128 ? 18.194 -47.454  -174.723 1.00 86.44  ? 125 GLY D O     1 
ATOM   5123  N N     . TYR D 1 129 ? 17.811 -46.047  -176.443 1.00 90.80  ? 126 TYR D N     1 
ATOM   5124  C CA    . TYR D 1 129 ? 16.404 -46.392  -176.564 1.00 85.81  ? 126 TYR D CA    1 
ATOM   5125  C C     . TYR D 1 129 ? 16.092 -46.925  -177.955 1.00 91.77  ? 126 TYR D C     1 
ATOM   5126  O O     . TYR D 1 129 ? 16.737 -46.559  -178.943 1.00 90.94  ? 126 TYR D O     1 
ATOM   5127  C CB    . TYR D 1 129 ? 15.510 -45.185  -176.264 1.00 85.87  ? 126 TYR D CB    1 
ATOM   5128  C CG    . TYR D 1 129 ? 14.250 -45.548  -175.518 1.00 84.44  ? 126 TYR D CG    1 
ATOM   5129  C CD1   . TYR D 1 129 ? 14.237 -45.606  -174.132 1.00 93.87  ? 126 TYR D CD1   1 
ATOM   5130  C CD2   . TYR D 1 129 ? 13.079 -45.849  -176.199 1.00 88.32  ? 126 TYR D CD2   1 
ATOM   5131  C CE1   . TYR D 1 129 ? 13.090 -45.941  -173.443 1.00 92.00  ? 126 TYR D CE1   1 
ATOM   5132  C CE2   . TYR D 1 129 ? 11.925 -46.188  -175.519 1.00 100.53 ? 126 TYR D CE2   1 
ATOM   5133  C CZ    . TYR D 1 129 ? 11.937 -46.232  -174.140 1.00 96.94  ? 126 TYR D CZ    1 
ATOM   5134  O OH    . TYR D 1 129 ? 10.791 -46.569  -173.456 1.00 86.30  ? 126 TYR D OH    1 
ATOM   5135  N N     . GLY D 1 130 ? 15.095 -47.791  -178.014 1.00 99.43  ? 127 GLY D N     1 
ATOM   5136  C CA    . GLY D 1 130 ? 14.596 -48.302  -179.281 1.00 106.07 ? 127 GLY D CA    1 
ATOM   5137  C C     . GLY D 1 130 ? 13.088 -48.208  -179.321 1.00 110.45 ? 127 GLY D C     1 
ATOM   5138  O O     . GLY D 1 130 ? 12.414 -48.413  -178.312 1.00 108.10 ? 127 GLY D O     1 
ATOM   5139  N N     . VAL D 1 131 ? 12.562 -47.903  -180.504 1.00 100.05 ? 128 VAL D N     1 
ATOM   5140  C CA    . VAL D 1 131 ? 11.155 -47.555  -180.671 1.00 95.13  ? 128 VAL D CA    1 
ATOM   5141  C C     . VAL D 1 131 ? 10.629 -48.229  -181.931 1.00 92.41  ? 128 VAL D C     1 
ATOM   5142  O O     . VAL D 1 131 ? 11.228 -48.104  -183.004 1.00 118.91 ? 128 VAL D O     1 
ATOM   5143  C CB    . VAL D 1 131 ? 10.943 -46.029  -180.760 1.00 97.86  ? 128 VAL D CB    1 
ATOM   5144  C CG1   . VAL D 1 131 ? 9.467  -45.707  -180.861 1.00 97.60  ? 128 VAL D CG1   1 
ATOM   5145  C CG2   . VAL D 1 131 ? 11.551 -45.319  -179.555 1.00 116.26 ? 128 VAL D CG2   1 
ATOM   5146  N N     . SER D 1 132 ? 9.518  -48.954  -181.798 1.00 83.56  ? 129 SER D N     1 
ATOM   5147  C CA    . SER D 1 132 ? 8.820  -49.545  -182.940 1.00 107.81 ? 129 SER D CA    1 
ATOM   5148  C C     . SER D 1 132 ? 7.324  -49.349  -182.715 1.00 114.50 ? 129 SER D C     1 
ATOM   5149  O O     . SER D 1 132 ? 6.712  -50.069  -181.920 1.00 113.47 ? 129 SER D O     1 
ATOM   5150  C CB    . SER D 1 132 ? 9.172  -51.018  -183.106 1.00 112.40 ? 129 SER D CB    1 
ATOM   5151  O OG    . SER D 1 132 ? 8.495  -51.576  -184.218 1.00 113.89 ? 129 SER D OG    1 
ATOM   5152  N N     . GLU D 1 133 ? 6.741  -48.375  -183.415 1.00 135.35 ? 130 GLU D N     1 
ATOM   5153  C CA    . GLU D 1 133 ? 5.335  -48.026  -183.253 1.00 130.45 ? 130 GLU D CA    1 
ATOM   5154  C C     . GLU D 1 133 ? 4.446  -48.474  -184.404 1.00 136.73 ? 130 GLU D C     1 
ATOM   5155  O O     . GLU D 1 133 ? 3.270  -48.763  -184.178 1.00 133.18 ? 130 GLU D O     1 
ATOM   5156  C CB    . GLU D 1 133 ? 5.181  -46.509  -183.076 1.00 133.22 ? 130 GLU D CB    1 
ATOM   5157  C CG    . GLU D 1 133 ? 6.124  -45.905  -182.050 1.00 137.55 ? 130 GLU D CG    1 
ATOM   5158  C CD    . GLU D 1 133 ? 5.648  -44.560  -181.532 1.00 148.08 ? 130 GLU D CD    1 
ATOM   5159  O OE1   . GLU D 1 133 ? 4.623  -44.524  -180.818 1.00 140.42 ? 130 GLU D OE1   1 
ATOM   5160  O OE2   . GLU D 1 133 ? 6.299  -43.538  -181.838 1.00 145.08 ? 130 GLU D OE2   1 
ATOM   5161  N N     . GLY D 1 134 ? 4.973  -48.538  -185.624 1.00 131.96 ? 131 GLY D N     1 
ATOM   5162  C CA    . GLY D 1 134 ? 4.147  -48.751  -186.797 1.00 131.31 ? 131 GLY D CA    1 
ATOM   5163  C C     . GLY D 1 134 ? 3.765  -50.188  -187.089 1.00 126.58 ? 131 GLY D C     1 
ATOM   5164  O O     . GLY D 1 134 ? 2.615  -50.465  -187.445 1.00 137.81 ? 131 GLY D O     1 
ATOM   5165  N N     . LEU D 1 135 ? 4.717  -51.109  -186.948 1.00 114.36 ? 132 LEU D N     1 
ATOM   5166  C CA    . LEU D 1 135 ? 4.527  -52.475  -187.413 1.00 115.30 ? 132 LEU D CA    1 
ATOM   5167  C C     . LEU D 1 135 ? 3.366  -53.152  -186.686 1.00 113.21 ? 132 LEU D C     1 
ATOM   5168  O O     . LEU D 1 135 ? 2.946  -52.741  -185.600 1.00 118.38 ? 132 LEU D O     1 
ATOM   5169  C CB    . LEU D 1 135 ? 5.809  -53.286  -187.225 1.00 118.08 ? 132 LEU D CB    1 
ATOM   5170  C CG    . LEU D 1 135 ? 6.931  -52.995  -188.224 1.00 117.67 ? 132 LEU D CG    1 
ATOM   5171  C CD1   . LEU D 1 135 ? 8.293  -53.265  -187.604 1.00 107.66 ? 132 LEU D CD1   1 
ATOM   5172  C CD2   . LEU D 1 135 ? 6.742  -53.813  -189.492 1.00 124.09 ? 132 LEU D CD2   1 
ATOM   5173  N N     . ALA D 1 136 ? 2.845  -54.208  -187.310 1.00 107.71 ? 133 ALA D N     1 
ATOM   5174  C CA    . ALA D 1 136 ? 1.736  -54.977  -186.765 1.00 119.31 ? 133 ALA D CA    1 
ATOM   5175  C C     . ALA D 1 136 ? 2.164  -56.333  -186.225 1.00 123.74 ? 133 ALA D C     1 
ATOM   5176  O O     . ALA D 1 136 ? 1.320  -57.073  -185.708 1.00 116.29 ? 133 ALA D O     1 
ATOM   5177  C CB    . ALA D 1 136 ? 0.648  -55.164  -187.829 1.00 129.03 ? 133 ALA D CB    1 
ATOM   5178  N N     . SER D 1 137 ? 3.441  -56.685  -186.340 1.00 128.81 ? 134 SER D N     1 
ATOM   5179  C CA    . SER D 1 137 ? 3.965  -57.934  -185.803 1.00 116.78 ? 134 SER D CA    1 
ATOM   5180  C C     . SER D 1 137 ? 4.720  -57.638  -184.513 1.00 116.44 ? 134 SER D C     1 
ATOM   5181  O O     . SER D 1 137 ? 5.647  -56.819  -184.505 1.00 106.02 ? 134 SER D O     1 
ATOM   5182  C CB    . SER D 1 137 ? 4.873  -58.626  -186.819 1.00 117.02 ? 134 SER D CB    1 
ATOM   5183  O OG    . SER D 1 137 ? 5.467  -59.787  -186.266 1.00 117.27 ? 134 SER D OG    1 
ATOM   5184  N N     . LYS D 1 138 ? 4.313  -58.296  -183.425 1.00 125.78 ? 135 LYS D N     1 
ATOM   5185  C CA    . LYS D 1 138 ? 4.957  -58.086  -182.130 1.00 119.81 ? 135 LYS D CA    1 
ATOM   5186  C C     . LYS D 1 138 ? 6.433  -58.463  -182.179 1.00 113.06 ? 135 LYS D C     1 
ATOM   5187  O O     . LYS D 1 138 ? 7.293  -57.730  -181.673 1.00 101.20 ? 135 LYS D O     1 
ATOM   5188  C CB    . LYS D 1 138 ? 4.234  -58.894  -181.052 1.00 118.62 ? 135 LYS D CB    1 
ATOM   5189  C CG    . LYS D 1 138 ? 4.561  -58.467  -179.632 1.00 102.99 ? 135 LYS D CG    1 
ATOM   5190  C CD    . LYS D 1 138 ? 3.344  -58.578  -178.730 1.00 96.90  ? 135 LYS D CD    1 
ATOM   5191  C CE    . LYS D 1 138 ? 3.091  -60.021  -178.328 1.00 87.53  ? 135 LYS D CE    1 
ATOM   5192  N NZ    . LYS D 1 138 ? 2.008  -60.137  -177.313 1.00 107.48 ? 135 LYS D NZ    1 
ATOM   5193  N N     . ALA D 1 139 ? 6.740  -59.621  -182.771 1.00 108.38 ? 136 ALA D N     1 
ATOM   5194  C CA    . ALA D 1 139 ? 8.123  -60.076  -182.846 1.00 102.09 ? 136 ALA D CA    1 
ATOM   5195  C C     . ALA D 1 139 ? 8.995  -59.075  -183.591 1.00 103.32 ? 136 ALA D C     1 
ATOM   5196  O O     . ALA D 1 139 ? 10.117 -58.783  -183.163 1.00 103.98 ? 136 ALA D O     1 
ATOM   5197  C CB    . ALA D 1 139 ? 8.188  -61.448  -183.515 1.00 101.41 ? 136 ALA D CB    1 
ATOM   5198  N N     . LEU D 1 140 ? 8.498  -58.540  -184.709 1.00 109.15 ? 137 LEU D N     1 
ATOM   5199  C CA    . LEU D 1 140 ? 9.263  -57.549  -185.461 1.00 106.77 ? 137 LEU D CA    1 
ATOM   5200  C C     . LEU D 1 140 ? 9.490  -56.289  -184.636 1.00 104.36 ? 137 LEU D C     1 
ATOM   5201  O O     . LEU D 1 140 ? 10.596 -55.732  -184.627 1.00 101.40 ? 137 LEU D O     1 
ATOM   5202  C CB    . LEU D 1 140 ? 8.549  -57.207  -186.771 1.00 103.39 ? 137 LEU D CB    1 
ATOM   5203  C CG    . LEU D 1 140 ? 8.846  -58.040  -188.023 1.00 96.36  ? 137 LEU D CG    1 
ATOM   5204  C CD1   . LEU D 1 140 ? 8.750  -59.535  -187.757 1.00 108.15 ? 137 LEU D CD1   1 
ATOM   5205  C CD2   . LEU D 1 140 ? 7.912  -57.636  -189.155 1.00 106.73 ? 137 LEU D CD2   1 
ATOM   5206  N N     . SER D 1 141 ? 8.448  -55.818  -183.945 1.00 103.37 ? 138 SER D N     1 
ATOM   5207  C CA    . SER D 1 141 ? 8.584  -54.616  -183.130 1.00 103.86 ? 138 SER D CA    1 
ATOM   5208  C C     . SER D 1 141 ? 9.625  -54.805  -182.033 1.00 102.77 ? 138 SER D C     1 
ATOM   5209  O O     . SER D 1 141 ? 10.461 -53.924  -181.806 1.00 91.07  ? 138 SER D O     1 
ATOM   5210  C CB    . SER D 1 141 ? 7.231  -54.237  -182.528 1.00 105.91 ? 138 SER D CB    1 
ATOM   5211  O OG    . SER D 1 141 ? 6.355  -53.728  -183.518 1.00 99.05  ? 138 SER D OG    1 
ATOM   5212  N N     . LEU D 1 142 ? 9.607  -55.958  -181.359 1.00 100.53 ? 139 LEU D N     1 
ATOM   5213  C CA    . LEU D 1 142 ? 10.580 -56.201  -180.297 1.00 95.07  ? 139 LEU D CA    1 
ATOM   5214  C C     . LEU D 1 142 ? 11.988 -56.360  -180.860 1.00 93.62  ? 139 LEU D C     1 
ATOM   5215  O O     . LEU D 1 142 ? 12.952 -55.818  -180.302 1.00 92.67  ? 139 LEU D O     1 
ATOM   5216  C CB    . LEU D 1 142 ? 10.177 -57.434  -179.489 1.00 84.10  ? 139 LEU D CB    1 
ATOM   5217  C CG    . LEU D 1 142 ? 8.974  -57.254  -178.562 1.00 89.94  ? 139 LEU D CG    1 
ATOM   5218  C CD1   . LEU D 1 142 ? 8.476  -58.595  -178.054 1.00 107.31 ? 139 LEU D CD1   1 
ATOM   5219  C CD2   . LEU D 1 142 ? 9.336  -56.347  -177.400 1.00 82.90  ? 139 LEU D CD2   1 
ATOM   5220  N N     . GLU D 1 143 ? 12.125 -57.121  -181.950 1.00 94.58  ? 140 GLU D N     1 
ATOM   5221  C CA    . GLU D 1 143 ? 13.410 -57.263  -182.626 1.00 90.23  ? 140 GLU D CA    1 
ATOM   5222  C C     . GLU D 1 143 ? 14.015 -55.903  -182.945 1.00 97.28  ? 140 GLU D C     1 
ATOM   5223  O O     . GLU D 1 143 ? 15.194 -55.652  -182.669 1.00 95.02  ? 140 GLU D O     1 
ATOM   5224  C CB    . GLU D 1 143 ? 13.226 -58.086  -183.902 1.00 96.04  ? 140 GLU D CB    1 
ATOM   5225  C CG    . GLU D 1 143 ? 14.491 -58.300  -184.711 1.00 102.49 ? 140 GLU D CG    1 
ATOM   5226  C CD    . GLU D 1 143 ? 14.269 -59.232  -185.887 1.00 121.84 ? 140 GLU D CD    1 
ATOM   5227  O OE1   . GLU D 1 143 ? 13.096 -59.459  -186.253 1.00 101.23 ? 140 GLU D OE1   1 
ATOM   5228  O OE2   . GLU D 1 143 ? 15.266 -59.737  -186.444 1.00 120.25 ? 140 GLU D OE2   1 
ATOM   5229  N N     . LYS D 1 144 ? 13.217 -55.011  -183.536 1.00 103.87 ? 141 LYS D N     1 
ATOM   5230  C CA    . LYS D 1 144 ? 13.703 -53.669  -183.841 1.00 105.63 ? 141 LYS D CA    1 
ATOM   5231  C C     . LYS D 1 144 ? 14.066 -52.908  -182.571 1.00 103.73 ? 141 LYS D C     1 
ATOM   5232  O O     . LYS D 1 144 ? 15.155 -52.329  -182.471 1.00 103.90 ? 141 LYS D O     1 
ATOM   5233  C CB    . LYS D 1 144 ? 12.656 -52.894  -184.643 1.00 101.63 ? 141 LYS D CB    1 
ATOM   5234  C CG    . LYS D 1 144 ? 13.086 -51.475  -184.991 1.00 92.85  ? 141 LYS D CG    1 
ATOM   5235  C CD    . LYS D 1 144 ? 11.952 -50.682  -185.622 1.00 111.80 ? 141 LYS D CD    1 
ATOM   5236  C CE    . LYS D 1 144 ? 12.359 -49.235  -185.856 1.00 132.37 ? 141 LYS D CE    1 
ATOM   5237  N NZ    . LYS D 1 144 ? 11.228 -48.410  -186.364 1.00 137.09 ? 141 LYS D NZ    1 
ATOM   5238  N N     . ALA D 1 145 ? 13.155 -52.891  -181.592 1.00 91.11  ? 142 ALA D N     1 
ATOM   5239  C CA    . ALA D 1 145 ? 13.322 -52.038  -180.420 1.00 94.43  ? 142 ALA D CA    1 
ATOM   5240  C C     . ALA D 1 145 ? 14.567 -52.404  -179.622 1.00 96.82  ? 142 ALA D C     1 
ATOM   5241  O O     . ALA D 1 145 ? 15.346 -51.525  -179.238 1.00 99.55  ? 142 ALA D O     1 
ATOM   5242  C CB    . ALA D 1 145 ? 12.076 -52.118  -179.538 1.00 93.31  ? 142 ALA D CB    1 
ATOM   5243  N N     . ARG D 1 146 ? 14.785 -53.698  -179.374 1.00 92.41  ? 143 ARG D N     1 
ATOM   5244  C CA    . ARG D 1 146 ? 15.892 -54.099  -178.506 1.00 94.17  ? 143 ARG D CA    1 
ATOM   5245  C C     . ARG D 1 146 ? 17.242 -53.806  -179.155 1.00 92.00  ? 143 ARG D C     1 
ATOM   5246  O O     . ARG D 1 146 ? 18.144 -53.236  -178.519 1.00 92.41  ? 143 ARG D O     1 
ATOM   5247  C CB    . ARG D 1 146 ? 15.766 -55.581  -178.155 1.00 77.46  ? 143 ARG D CB    1 
ATOM   5248  C CG    . ARG D 1 146 ? 14.397 -55.950  -177.609 1.00 83.22  ? 143 ARG D CG    1 
ATOM   5249  C CD    . ARG D 1 146 ? 14.395 -57.291  -176.902 1.00 81.07  ? 143 ARG D CD    1 
ATOM   5250  N NE    . ARG D 1 146 ? 14.575 -57.145  -175.462 1.00 76.80  ? 143 ARG D NE    1 
ATOM   5251  C CZ    . ARG D 1 146 ? 14.173 -58.041  -174.568 1.00 76.16  ? 143 ARG D CZ    1 
ATOM   5252  N NH1   . ARG D 1 146 ? 13.560 -59.147  -174.969 1.00 67.04  ? 143 ARG D NH1   1 
ATOM   5253  N NH2   . ARG D 1 146 ? 14.378 -57.831  -173.275 1.00 90.77  ? 143 ARG D NH2   1 
ATOM   5254  N N     . LYS D 1 147 ? 17.399 -54.193  -180.422 1.00 78.16  ? 144 LYS D N     1 
ATOM   5255  C CA    . LYS D 1 147 ? 18.650 -53.934  -181.126 1.00 77.84  ? 144 LYS D CA    1 
ATOM   5256  C C     . LYS D 1 147 ? 18.901 -52.440  -181.278 1.00 78.01  ? 144 LYS D C     1 
ATOM   5257  O O     . LYS D 1 147 ? 20.033 -51.973  -181.095 1.00 85.41  ? 144 LYS D O     1 
ATOM   5258  C CB    . LYS D 1 147 ? 18.636 -54.629  -182.486 1.00 84.11  ? 144 LYS D CB    1 
ATOM   5259  C CG    . LYS D 1 147 ? 18.489 -56.136  -182.388 1.00 70.56  ? 144 LYS D CG    1 
ATOM   5260  C CD    . LYS D 1 147 ? 18.344 -56.780  -183.751 1.00 71.04  ? 144 LYS D CD    1 
ATOM   5261  C CE    . LYS D 1 147 ? 18.205 -58.285  -183.615 1.00 87.33  ? 144 LYS D CE    1 
ATOM   5262  N NZ    . LYS D 1 147 ? 18.010 -58.955  -184.926 1.00 120.49 ? 144 LYS D NZ    1 
ATOM   5263  N N     . GLU D 1 148 ? 17.860 -51.671  -181.615 1.00 82.84  ? 145 GLU D N     1 
ATOM   5264  C CA    . GLU D 1 148 ? 18.012 -50.224  -181.710 1.00 87.76  ? 145 GLU D CA    1 
ATOM   5265  C C     . GLU D 1 148 ? 18.429 -49.623  -180.375 1.00 87.81  ? 145 GLU D C     1 
ATOM   5266  O O     . GLU D 1 148 ? 19.288 -48.737  -180.329 1.00 76.61  ? 145 GLU D O     1 
ATOM   5267  C CB    . GLU D 1 148 ? 16.708 -49.597  -182.201 1.00 99.54  ? 145 GLU D CB    1 
ATOM   5268  C CG    . GLU D 1 148 ? 16.761 -48.088  -182.384 1.00 136.72 ? 145 GLU D CG    1 
ATOM   5269  C CD    . GLU D 1 148 ? 15.459 -47.521  -182.919 1.00 139.36 ? 145 GLU D CD    1 
ATOM   5270  O OE1   . GLU D 1 148 ? 14.678 -48.286  -183.525 1.00 138.45 ? 145 GLU D OE1   1 
ATOM   5271  O OE2   . GLU D 1 148 ? 15.213 -46.311  -182.728 1.00 130.20 ? 145 GLU D OE2   1 
ATOM   5272  N N     . ALA D 1 149 ? 17.846 -50.108  -179.275 1.00 92.58  ? 146 ALA D N     1 
ATOM   5273  C CA    . ALA D 1 149 ? 18.196 -49.590  -177.956 1.00 85.92  ? 146 ALA D CA    1 
ATOM   5274  C C     . ALA D 1 149 ? 19.657 -49.862  -177.631 1.00 80.26  ? 146 ALA D C     1 
ATOM   5275  O O     . ALA D 1 149 ? 20.377 -48.973  -177.163 1.00 72.70  ? 146 ALA D O     1 
ATOM   5276  C CB    . ALA D 1 149 ? 17.283 -50.203  -176.894 1.00 81.44  ? 146 ALA D CB    1 
ATOM   5277  N N     . VAL D 1 150 ? 20.115 -51.091  -177.877 1.00 75.30  ? 147 VAL D N     1 
ATOM   5278  C CA    . VAL D 1 150 ? 21.502 -51.427  -177.562 1.00 72.59  ? 147 VAL D CA    1 
ATOM   5279  C C     . VAL D 1 150 ? 22.467 -50.624  -178.429 1.00 80.35  ? 147 VAL D C     1 
ATOM   5280  O O     . VAL D 1 150 ? 23.477 -50.104  -177.935 1.00 70.92  ? 147 VAL D O     1 
ATOM   5281  C CB    . VAL D 1 150 ? 21.727 -52.943  -177.695 1.00 60.03  ? 147 VAL D CB    1 
ATOM   5282  C CG1   . VAL D 1 150 ? 23.207 -53.257  -177.842 1.00 58.73  ? 147 VAL D CG1   1 
ATOM   5283  C CG2   . VAL D 1 150 ? 21.173 -53.636  -176.475 1.00 72.86  ? 147 VAL D CG2   1 
ATOM   5284  N N     . THR D 1 151 ? 22.178 -50.504  -179.728 1.00 92.03  ? 148 THR D N     1 
ATOM   5285  C CA    . THR D 1 151 ? 23.060 -49.744  -180.611 1.00 86.98  ? 148 THR D CA    1 
ATOM   5286  C C     . THR D 1 151 ? 23.097 -48.267  -180.226 1.00 89.71  ? 148 THR D C     1 
ATOM   5287  O O     . THR D 1 151 ? 24.170 -47.647  -180.208 1.00 91.81  ? 148 THR D O     1 
ATOM   5288  C CB    . THR D 1 151 ? 22.619 -49.917  -182.065 1.00 89.90  ? 148 THR D CB    1 
ATOM   5289  O OG1   . THR D 1 151 ? 22.673 -51.305  -182.416 1.00 86.54  ? 148 THR D OG1   1 
ATOM   5290  C CG2   . THR D 1 151 ? 23.535 -49.137  -182.996 1.00 93.83  ? 148 THR D CG2   1 
ATOM   5291  N N     . ASP D 1 152 ? 21.932 -47.681  -179.934 1.00 87.30  ? 149 ASP D N     1 
ATOM   5292  C CA    . ASP D 1 152 ? 21.878 -46.290  -179.499 1.00 91.14  ? 149 ASP D CA    1 
ATOM   5293  C C     . ASP D 1 152 ? 22.642 -46.090  -178.196 1.00 87.36  ? 149 ASP D C     1 
ATOM   5294  O O     . ASP D 1 152 ? 23.316 -45.070  -178.015 1.00 68.34  ? 149 ASP D O     1 
ATOM   5295  C CB    . ASP D 1 152 ? 20.421 -45.853  -179.346 1.00 95.12  ? 149 ASP D CB    1 
ATOM   5296  C CG    . ASP D 1 152 ? 20.258 -44.347  -179.348 1.00 117.73 ? 149 ASP D CG    1 
ATOM   5297  O OD1   . ASP D 1 152 ? 20.251 -43.753  -180.448 1.00 140.61 ? 149 ASP D OD1   1 
ATOM   5298  O OD2   . ASP D 1 152 ? 20.133 -43.757  -178.254 1.00 99.37  ? 149 ASP D OD2   1 
ATOM   5299  N N     . GLY D 1 153 ? 22.536 -47.047  -177.270 1.00 89.87  ? 150 GLY D N     1 
ATOM   5300  C CA    . GLY D 1 153 ? 23.304 -46.955  -176.039 1.00 81.62  ? 150 GLY D CA    1 
ATOM   5301  C C     . GLY D 1 153 ? 24.797 -47.031  -176.281 1.00 80.60  ? 150 GLY D C     1 
ATOM   5302  O O     . GLY D 1 153 ? 25.576 -46.324  -175.639 1.00 75.59  ? 150 GLY D O     1 
ATOM   5303  N N     . LEU D 1 154 ? 25.215 -47.881  -177.221 1.00 73.52  ? 151 LEU D N     1 
ATOM   5304  C CA    . LEU D 1 154 ? 26.629 -47.947  -177.577 1.00 72.89  ? 151 LEU D CA    1 
ATOM   5305  C C     . LEU D 1 154 ? 27.107 -46.620  -178.153 1.00 85.18  ? 151 LEU D C     1 
ATOM   5306  O O     . LEU D 1 154 ? 28.199 -46.144  -177.819 1.00 86.72  ? 151 LEU D O     1 
ATOM   5307  C CB    . LEU D 1 154 ? 26.868 -49.084  -178.571 1.00 60.40  ? 151 LEU D CB    1 
ATOM   5308  C CG    . LEU D 1 154 ? 28.308 -49.291  -179.043 1.00 55.81  ? 151 LEU D CG    1 
ATOM   5309  C CD1   . LEU D 1 154 ? 29.252 -49.415  -177.862 1.00 60.18  ? 151 LEU D CD1   1 
ATOM   5310  C CD2   . LEU D 1 154 ? 28.407 -50.520  -179.933 1.00 54.50  ? 151 LEU D CD2   1 
ATOM   5311  N N     . LYS D 1 155 ? 26.292 -46.005  -179.012 1.00 71.96  ? 152 LYS D N     1 
ATOM   5312  C CA    . LYS D 1 155 ? 26.636 -44.692  -179.552 1.00 69.24  ? 152 LYS D CA    1 
ATOM   5313  C C     . LYS D 1 155 ? 26.760 -43.654  -178.441 1.00 77.70  ? 152 LYS D C     1 
ATOM   5314  O O     . LYS D 1 155 ? 27.754 -42.921  -178.365 1.00 87.86  ? 152 LYS D O     1 
ATOM   5315  C CB    . LYS D 1 155 ? 25.590 -44.252  -180.577 1.00 89.10  ? 152 LYS D CB    1 
ATOM   5316  C CG    . LYS D 1 155 ? 25.535 -45.099  -181.837 1.00 92.77  ? 152 LYS D CG    1 
ATOM   5317  C CD    . LYS D 1 155 ? 24.647 -44.449  -182.889 1.00 89.29  ? 152 LYS D CD    1 
ATOM   5318  C CE    . LYS D 1 155 ? 23.238 -44.215  -182.358 1.00 96.31  ? 152 LYS D CE    1 
ATOM   5319  N NZ    . LYS D 1 155 ? 22.399 -43.440  -183.316 1.00 110.67 ? 152 LYS D NZ    1 
ATOM   5320  N N     . ARG D 1 156 ? 25.748 -43.573  -177.573 1.00 67.15  ? 153 ARG D N     1 
ATOM   5321  C CA    . ARG D 1 156 ? 25.754 -42.578  -176.504 1.00 64.31  ? 153 ARG D CA    1 
ATOM   5322  C C     . ARG D 1 156 ? 26.881 -42.816  -175.508 1.00 67.80  ? 153 ARG D C     1 
ATOM   5323  O O     . ARG D 1 156 ? 27.347 -41.870  -174.862 1.00 81.34  ? 153 ARG D O     1 
ATOM   5324  C CB    . ARG D 1 156 ? 24.402 -42.569  -175.790 1.00 62.67  ? 153 ARG D CB    1 
ATOM   5325  C CG    . ARG D 1 156 ? 23.354 -41.701  -176.470 1.00 88.54  ? 153 ARG D CG    1 
ATOM   5326  C CD    . ARG D 1 156 ? 22.078 -41.611  -175.646 1.00 78.02  ? 153 ARG D CD    1 
ATOM   5327  N NE    . ARG D 1 156 ? 22.326 -41.138  -174.288 1.00 78.24  ? 153 ARG D NE    1 
ATOM   5328  C CZ    . ARG D 1 156 ? 22.456 -39.859  -173.951 1.00 78.21  ? 153 ARG D CZ    1 
ATOM   5329  N NH1   . ARG D 1 156 ? 22.360 -38.913  -174.875 1.00 109.09 ? 153 ARG D NH1   1 
ATOM   5330  N NH2   . ARG D 1 156 ? 22.681 -39.525  -172.688 1.00 74.05  ? 153 ARG D NH2   1 
ATOM   5331  N N     . ALA D 1 157 ? 27.330 -44.063  -175.362 1.00 74.08  ? 154 ALA D N     1 
ATOM   5332  C CA    . ALA D 1 157 ? 28.419 -44.353  -174.438 1.00 83.11  ? 154 ALA D CA    1 
ATOM   5333  C C     . ALA D 1 157 ? 29.774 -44.044  -175.061 1.00 83.74  ? 154 ALA D C     1 
ATOM   5334  O O     . ALA D 1 157 ? 30.688 -43.585  -174.367 1.00 73.03  ? 154 ALA D O     1 
ATOM   5335  C CB    . ALA D 1 157 ? 28.352 -45.813  -173.991 1.00 85.89  ? 154 ALA D CB    1 
ATOM   5336  N N     . LEU D 1 158 ? 29.923 -44.291  -176.366 1.00 89.50  ? 155 LEU D N     1 
ATOM   5337  C CA    . LEU D 1 158 ? 31.151 -43.909  -177.051 1.00 90.26  ? 155 LEU D CA    1 
ATOM   5338  C C     . LEU D 1 158 ? 31.254 -42.401  -177.235 1.00 97.96  ? 155 LEU D C     1 
ATOM   5339  O O     . LEU D 1 158 ? 32.359 -41.890  -177.446 1.00 95.77  ? 155 LEU D O     1 
ATOM   5340  C CB    . LEU D 1 158 ? 31.239 -44.613  -178.407 1.00 82.39  ? 155 LEU D CB    1 
ATOM   5341  C CG    . LEU D 1 158 ? 31.596 -46.101  -178.383 1.00 74.49  ? 155 LEU D CG    1 
ATOM   5342  C CD1   . LEU D 1 158 ? 31.195 -46.767  -179.687 1.00 78.24  ? 155 LEU D CD1   1 
ATOM   5343  C CD2   . LEU D 1 158 ? 33.083 -46.292  -178.119 1.00 77.93  ? 155 LEU D CD2   1 
ATOM   5344  N N     . ARG D 1 159 ? 30.125 -41.687  -177.175 1.00 94.25  ? 156 ARG D N     1 
ATOM   5345  C CA    . ARG D 1 159 ? 30.152 -40.229  -177.268 1.00 84.16  ? 156 ARG D CA    1 
ATOM   5346  C C     . ARG D 1 159 ? 31.094 -39.611  -176.241 1.00 85.81  ? 156 ARG D C     1 
ATOM   5347  O O     . ARG D 1 159 ? 31.876 -38.710  -176.566 1.00 91.28  ? 156 ARG D O     1 
ATOM   5348  C CB    . ARG D 1 159 ? 28.743 -39.665  -177.079 1.00 98.71  ? 156 ARG D CB    1 
ATOM   5349  C CG    . ARG D 1 159 ? 27.871 -39.677  -178.319 1.00 108.77 ? 156 ARG D CG    1 
ATOM   5350  C CD    . ARG D 1 159 ? 26.610 -38.865  -178.079 1.00 126.10 ? 156 ARG D CD    1 
ATOM   5351  N NE    . ARG D 1 159 ? 25.744 -38.813  -179.252 1.00 149.35 ? 156 ARG D NE    1 
ATOM   5352  C CZ    . ARG D 1 159 ? 24.500 -38.348  -179.237 1.00 145.88 ? 156 ARG D CZ    1 
ATOM   5353  N NH1   . ARG D 1 159 ? 23.974 -37.894  -178.107 1.00 120.32 ? 156 ARG D NH1   1 
ATOM   5354  N NH2   . ARG D 1 159 ? 23.780 -38.337  -180.350 1.00 157.74 ? 156 ARG D NH2   1 
ATOM   5355  N N     . SER D 1 160 ? 31.038 -40.086  -174.996 1.00 90.69  ? 157 SER D N     1 
ATOM   5356  C CA    . SER D 1 160 ? 31.755 -39.496  -173.863 1.00 92.55  ? 157 SER D CA    1 
ATOM   5357  C C     . SER D 1 160 ? 33.280 -39.590  -173.975 1.00 93.03  ? 157 SER D C     1 
ATOM   5358  O O     . SER D 1 160 ? 33.953 -39.246  -172.994 1.00 101.78 ? 157 SER D O     1 
ATOM   5359  C CB    . SER D 1 160 ? 31.295 -40.156  -172.562 1.00 101.02 ? 157 SER D CB    1 
ATOM   5360  O OG    . SER D 1 160 ? 29.883 -40.251  -172.507 1.00 111.46 ? 157 SER D OG    1 
ATOM   5361  N N     . PHE D 1 161 ? 33.860 -40.033  -175.090 1.00 81.92  ? 158 PHE D N     1 
ATOM   5362  C CA    . PHE D 1 161 ? 35.308 -40.090  -175.231 1.00 100.84 ? 158 PHE D CA    1 
ATOM   5363  C C     . PHE D 1 161 ? 35.892 -38.874  -175.936 1.00 116.27 ? 158 PHE D C     1 
ATOM   5364  O O     . PHE D 1 161 ? 37.075 -38.574  -175.740 1.00 131.74 ? 158 PHE D O     1 
ATOM   5365  C CB    . PHE D 1 161 ? 35.720 -41.357  -175.989 1.00 110.20 ? 158 PHE D CB    1 
ATOM   5366  C CG    . PHE D 1 161 ? 35.811 -42.580  -175.121 1.00 121.19 ? 158 PHE D CG    1 
ATOM   5367  C CD1   . PHE D 1 161 ? 36.511 -42.547  -173.925 1.00 117.37 ? 158 PHE D CD1   1 
ATOM   5368  C CD2   . PHE D 1 161 ? 35.192 -43.760  -175.497 1.00 120.17 ? 158 PHE D CD2   1 
ATOM   5369  C CE1   . PHE D 1 161 ? 36.598 -43.672  -173.125 1.00 110.93 ? 158 PHE D CE1   1 
ATOM   5370  C CE2   . PHE D 1 161 ? 35.273 -44.887  -174.701 1.00 112.42 ? 158 PHE D CE2   1 
ATOM   5371  C CZ    . PHE D 1 161 ? 35.975 -44.842  -173.513 1.00 110.23 ? 158 PHE D CZ    1 
ATOM   5372  N N     . GLY D 1 162 ? 35.105 -38.176  -176.740 1.00 115.38 ? 159 GLY D N     1 
ATOM   5373  C CA    . GLY D 1 162 ? 35.600 -37.027  -177.470 1.00 119.27 ? 159 GLY D CA    1 
ATOM   5374  C C     . GLY D 1 162 ? 34.706 -36.706  -178.644 1.00 115.00 ? 159 GLY D C     1 
ATOM   5375  O O     . GLY D 1 162 ? 33.824 -37.478  -179.020 1.00 112.76 ? 159 GLY D O     1 
ATOM   5376  N N     . ASN D 1 163 ? 34.951 -35.526  -179.219 1.00 111.66 ? 160 ASN D N     1 
ATOM   5377  C CA    . ASN D 1 163 ? 34.168 -35.079  -180.368 1.00 113.34 ? 160 ASN D CA    1 
ATOM   5378  C C     . ASN D 1 163 ? 34.258 -36.068  -181.523 1.00 111.53 ? 160 ASN D C     1 
ATOM   5379  O O     . ASN D 1 163 ? 33.275 -36.285  -182.240 1.00 110.17 ? 160 ASN D O     1 
ATOM   5380  C CB    . ASN D 1 163 ? 34.634 -33.694  -180.818 1.00 119.96 ? 160 ASN D CB    1 
ATOM   5381  C CG    . ASN D 1 163 ? 34.578 -32.668  -179.705 1.00 109.75 ? 160 ASN D CG    1 
ATOM   5382  O OD1   . ASN D 1 163 ? 33.558 -32.520  -179.032 1.00 106.91 ? 160 ASN D OD1   1 
ATOM   5383  N ND2   . ASN D 1 163 ? 35.677 -31.951  -179.506 1.00 114.76 ? 160 ASN D ND2   1 
ATOM   5384  N N     . ALA D 1 164 ? 35.432 -36.677  -181.717 1.00 111.82 ? 161 ALA D N     1 
ATOM   5385  C CA    . ALA D 1 164 ? 35.633 -37.577  -182.848 1.00 112.53 ? 161 ALA D CA    1 
ATOM   5386  C C     . ALA D 1 164 ? 34.700 -38.780  -182.801 1.00 120.87 ? 161 ALA D C     1 
ATOM   5387  O O     . ALA D 1 164 ? 34.390 -39.364  -183.846 1.00 121.13 ? 161 ALA D O     1 
ATOM   5388  C CB    . ALA D 1 164 ? 37.090 -38.040  -182.896 1.00 100.76 ? 161 ALA D CB    1 
ATOM   5389  N N     . LEU D 1 165 ? 34.244 -39.170  -181.610 1.00 115.42 ? 162 LEU D N     1 
ATOM   5390  C CA    . LEU D 1 165 ? 33.389 -40.338  -181.450 1.00 106.32 ? 162 LEU D CA    1 
ATOM   5391  C C     . LEU D 1 165 ? 31.917 -39.973  -181.284 1.00 108.78 ? 162 LEU D C     1 
ATOM   5392  O O     . LEU D 1 165 ? 31.130 -40.804  -180.818 1.00 107.91 ? 162 LEU D O     1 
ATOM   5393  C CB    . LEU D 1 165 ? 33.865 -41.183  -180.268 1.00 111.35 ? 162 LEU D CB    1 
ATOM   5394  C CG    . LEU D 1 165 ? 35.090 -42.057  -180.547 1.00 110.04 ? 162 LEU D CG    1 
ATOM   5395  C CD1   . LEU D 1 165 ? 35.552 -42.765  -179.286 1.00 118.46 ? 162 LEU D CD1   1 
ATOM   5396  C CD2   . LEU D 1 165 ? 34.784 -43.063  -181.643 1.00 95.82  ? 162 LEU D CD2   1 
ATOM   5397  N N     . GLY D 1 166 ? 31.529 -38.754  -181.651 1.00 104.07 ? 163 GLY D N     1 
ATOM   5398  C CA    . GLY D 1 166 ? 30.135 -38.363  -181.659 1.00 102.01 ? 163 GLY D CA    1 
ATOM   5399  C C     . GLY D 1 166 ? 29.724 -37.315  -180.646 1.00 107.39 ? 163 GLY D C     1 
ATOM   5400  O O     . GLY D 1 166 ? 28.527 -37.022  -180.542 1.00 111.02 ? 163 GLY D O     1 
ATOM   5401  N N     . ASN D 1 167 ? 30.666 -36.743  -179.892 1.00 98.96  ? 164 ASN D N     1 
ATOM   5402  C CA    . ASN D 1 167 ? 30.313 -35.724  -178.908 1.00 94.57  ? 164 ASN D CA    1 
ATOM   5403  C C     . ASN D 1 167 ? 29.963 -34.388  -179.552 1.00 116.91 ? 164 ASN D C     1 
ATOM   5404  O O     . ASN D 1 167 ? 29.311 -33.556  -178.911 1.00 116.29 ? 164 ASN D O     1 
ATOM   5405  C CB    . ASN D 1 167 ? 31.458 -35.537  -177.912 1.00 92.24  ? 164 ASN D CB    1 
ATOM   5406  C CG    . ASN D 1 167 ? 31.080 -34.643  -176.747 1.00 106.25 ? 164 ASN D CG    1 
ATOM   5407  O OD1   . ASN D 1 167 ? 29.932 -34.631  -176.304 1.00 105.43 ? 164 ASN D OD1   1 
ATOM   5408  N ND2   . ASN D 1 167 ? 32.049 -33.886  -176.247 1.00 111.33 ? 164 ASN D ND2   1 
ATOM   5409  N N     . CYS D 1 168 ? 30.369 -34.167  -180.802 1.00 124.34 ? 165 CYS D N     1 
ATOM   5410  C CA    . CYS D 1 168 ? 30.134 -32.895  -181.473 1.00 106.02 ? 165 CYS D CA    1 
ATOM   5411  C C     . CYS D 1 168 ? 28.757 -32.800  -182.116 1.00 103.88 ? 165 CYS D C     1 
ATOM   5412  O O     . CYS D 1 168 ? 28.341 -31.694  -182.478 1.00 117.91 ? 165 CYS D O     1 
ATOM   5413  C CB    . CYS D 1 168 ? 31.209 -32.660  -182.535 1.00 114.02 ? 165 CYS D CB    1 
ATOM   5414  S SG    . CYS D 1 168 ? 31.344 -33.990  -183.749 1.00 115.67 ? 165 CYS D SG    1 
ATOM   5415  N N     . ILE D 1 169 ? 28.042 -33.919  -182.265 1.00 105.38 ? 166 ILE D N     1 
ATOM   5416  C CA    . ILE D 1 169 ? 26.732 -33.900  -182.908 1.00 112.47 ? 166 ILE D CA    1 
ATOM   5417  C C     . ILE D 1 169 ? 25.732 -33.043  -182.141 1.00 108.77 ? 166 ILE D C     1 
ATOM   5418  O O     . ILE D 1 169 ? 24.693 -32.663  -182.692 1.00 93.67  ? 166 ILE D O     1 
ATOM   5419  C CB    . ILE D 1 169 ? 26.209 -35.343  -183.081 1.00 113.34 ? 166 ILE D CB    1 
ATOM   5420  C CG1   . ILE D 1 169 ? 25.116 -35.399  -184.152 1.00 104.59 ? 166 ILE D CG1   1 
ATOM   5421  C CG2   . ILE D 1 169 ? 25.692 -35.892  -181.758 1.00 104.20 ? 166 ILE D CG2   1 
ATOM   5422  C CD1   . ILE D 1 169 ? 25.645 -35.391  -185.568 1.00 107.16 ? 166 ILE D CD1   1 
ATOM   5423  N N     . LEU D 1 170 ? 26.024 -32.711  -180.885 1.00 113.73 ? 167 LEU D N     1 
ATOM   5424  C CA    . LEU D 1 170 ? 25.149 -31.874  -180.078 1.00 118.32 ? 167 LEU D CA    1 
ATOM   5425  C C     . LEU D 1 170 ? 25.602 -30.422  -180.019 1.00 128.03 ? 167 LEU D C     1 
ATOM   5426  O O     . LEU D 1 170 ? 24.940 -29.608  -179.367 1.00 144.61 ? 167 LEU D O     1 
ATOM   5427  C CB    . LEU D 1 170 ? 25.037 -32.440  -178.658 1.00 115.06 ? 167 LEU D CB    1 
ATOM   5428  C CG    . LEU D 1 170 ? 24.307 -33.779  -178.530 1.00 109.01 ? 167 LEU D CG    1 
ATOM   5429  C CD1   . LEU D 1 170 ? 24.666 -34.471  -177.224 1.00 120.66 ? 167 LEU D CD1   1 
ATOM   5430  C CD2   . LEU D 1 170 ? 22.804 -33.575  -178.637 1.00 94.59  ? 167 LEU D CD2   1 
ATOM   5431  N N     . ASP D 1 171 ? 26.707 -30.076  -180.677 1.00 121.41 ? 168 ASP D N     1 
ATOM   5432  C CA    . ASP D 1 171 ? 27.171 -28.693  -180.721 1.00 126.33 ? 168 ASP D CA    1 
ATOM   5433  C C     . ASP D 1 171 ? 26.433 -27.977  -181.845 1.00 139.21 ? 168 ASP D C     1 
ATOM   5434  O O     . ASP D 1 171 ? 26.662 -28.258  -183.026 1.00 145.95 ? 168 ASP D O     1 
ATOM   5435  C CB    . ASP D 1 171 ? 28.682 -28.640  -180.920 1.00 122.62 ? 168 ASP D CB    1 
ATOM   5436  C CG    . ASP D 1 171 ? 29.256 -27.259  -180.668 1.00 130.73 ? 168 ASP D CG    1 
ATOM   5437  O OD1   . ASP D 1 171 ? 28.537 -26.409  -180.101 1.00 131.29 ? 168 ASP D OD1   1 
ATOM   5438  O OD2   . ASP D 1 171 ? 30.426 -27.023  -181.035 1.00 133.18 ? 168 ASP D OD2   1 
ATOM   5439  N N     . LYS D 1 172 ? 25.538 -27.056  -181.476 1.00 142.81 ? 169 LYS D N     1 
ATOM   5440  C CA    . LYS D 1 172 ? 24.702 -26.383  -182.465 1.00 136.28 ? 169 LYS D CA    1 
ATOM   5441  C C     . LYS D 1 172 ? 25.532 -25.554  -183.440 1.00 134.93 ? 169 LYS D C     1 
ATOM   5442  O O     . LYS D 1 172 ? 25.225 -25.501  -184.637 1.00 135.71 ? 169 LYS D O     1 
ATOM   5443  C CB    . LYS D 1 172 ? 23.660 -25.520  -181.754 1.00 123.41 ? 169 LYS D CB    1 
ATOM   5444  C CG    . LYS D 1 172 ? 22.782 -26.323  -180.804 1.00 131.97 ? 169 LYS D CG    1 
ATOM   5445  C CD    . LYS D 1 172 ? 22.170 -25.459  -179.717 1.00 152.28 ? 169 LYS D CD    1 
ATOM   5446  C CE    . LYS D 1 172 ? 21.473 -26.319  -178.673 1.00 149.02 ? 169 LYS D CE    1 
ATOM   5447  N NZ    . LYS D 1 172 ? 20.998 -25.517  -177.512 1.00 164.54 ? 169 LYS D NZ    1 
ATOM   5448  N N     . ASP D 1 173 ? 26.581 -24.889  -182.946 1.00 123.44 ? 170 ASP D N     1 
ATOM   5449  C CA    . ASP D 1 173 ? 27.461 -24.134  -183.834 1.00 141.69 ? 170 ASP D CA    1 
ATOM   5450  C C     . ASP D 1 173 ? 28.150 -25.053  -184.836 1.00 139.23 ? 170 ASP D C     1 
ATOM   5451  O O     . ASP D 1 173 ? 28.305 -24.701  -186.014 1.00 147.63 ? 170 ASP D O     1 
ATOM   5452  C CB    . ASP D 1 173 ? 28.493 -23.359  -183.015 1.00 147.70 ? 170 ASP D CB    1 
ATOM   5453  C CG    . ASP D 1 173 ? 27.854 -22.409  -182.020 1.00 152.85 ? 170 ASP D CG    1 
ATOM   5454  O OD1   . ASP D 1 173 ? 26.793 -21.832  -182.340 1.00 147.81 ? 170 ASP D OD1   1 
ATOM   5455  O OD2   . ASP D 1 173 ? 28.414 -22.238  -180.916 1.00 151.36 ? 170 ASP D OD2   1 
ATOM   5456  N N     . TYR D 1 174 ? 28.587 -26.228  -184.379 1.00 129.38 ? 171 TYR D N     1 
ATOM   5457  C CA    . TYR D 1 174 ? 29.174 -27.214  -185.281 1.00 130.20 ? 171 TYR D CA    1 
ATOM   5458  C C     . TYR D 1 174 ? 28.187 -27.631  -186.366 1.00 131.62 ? 171 TYR D C     1 
ATOM   5459  O O     . TYR D 1 174 ? 28.561 -27.771  -187.535 1.00 134.81 ? 171 TYR D O     1 
ATOM   5460  C CB    . TYR D 1 174 ? 29.652 -28.424  -184.479 1.00 133.50 ? 171 TYR D CB    1 
ATOM   5461  C CG    . TYR D 1 174 ? 30.050 -29.617  -185.315 1.00 130.10 ? 171 TYR D CG    1 
ATOM   5462  C CD1   . TYR D 1 174 ? 31.195 -29.591  -186.096 1.00 129.35 ? 171 TYR D CD1   1 
ATOM   5463  C CD2   . TYR D 1 174 ? 29.291 -30.778  -185.303 1.00 127.22 ? 171 TYR D CD2   1 
ATOM   5464  C CE1   . TYR D 1 174 ? 31.566 -30.683  -186.855 1.00 121.89 ? 171 TYR D CE1   1 
ATOM   5465  C CE2   . TYR D 1 174 ? 29.654 -31.876  -186.056 1.00 132.18 ? 171 TYR D CE2   1 
ATOM   5466  C CZ    . TYR D 1 174 ? 30.792 -31.823  -186.832 1.00 132.50 ? 171 TYR D CZ    1 
ATOM   5467  O OH    . TYR D 1 174 ? 31.156 -32.915  -187.585 1.00 133.75 ? 171 TYR D OH    1 
ATOM   5468  N N     . LEU D 1 175 ? 26.916 -27.822  -186.002 1.00 122.12 ? 172 LEU D N     1 
ATOM   5469  C CA    . LEU D 1 175 ? 25.905 -28.170  -186.997 1.00 134.51 ? 172 LEU D CA    1 
ATOM   5470  C C     . LEU D 1 175 ? 25.700 -27.037  -187.998 1.00 150.43 ? 172 LEU D C     1 
ATOM   5471  O O     . LEU D 1 175 ? 25.595 -27.275  -189.210 1.00 154.66 ? 172 LEU D O     1 
ATOM   5472  C CB    . LEU D 1 175 ? 24.589 -28.520  -186.303 1.00 125.29 ? 172 LEU D CB    1 
ATOM   5473  C CG    . LEU D 1 175 ? 24.568 -29.834  -185.519 1.00 116.97 ? 172 LEU D CG    1 
ATOM   5474  C CD1   . LEU D 1 175 ? 23.156 -30.166  -185.061 1.00 100.54 ? 172 LEU D CD1   1 
ATOM   5475  C CD2   . LEU D 1 175 ? 25.151 -30.972  -186.347 1.00 121.85 ? 172 LEU D CD2   1 
ATOM   5476  N N     . ARG D 1 176 ? 25.622 -25.799  -187.503 1.00 146.38 ? 173 ARG D N     1 
ATOM   5477  C CA    . ARG D 1 176 ? 25.484 -24.649  -188.391 1.00 150.31 ? 173 ARG D CA    1 
ATOM   5478  C C     . ARG D 1 176 ? 26.640 -24.577  -189.380 1.00 146.10 ? 173 ARG D C     1 
ATOM   5479  O O     . ARG D 1 176 ? 26.435 -24.313  -190.570 1.00 145.55 ? 173 ARG D O     1 
ATOM   5480  C CB    . ARG D 1 176 ? 25.401 -23.361  -187.573 1.00 146.45 ? 173 ARG D CB    1 
ATOM   5481  C CG    . ARG D 1 176 ? 24.174 -23.256  -186.683 1.00 142.49 ? 173 ARG D CG    1 
ATOM   5482  C CD    . ARG D 1 176 ? 23.987 -21.841  -186.144 1.00 158.71 ? 173 ARG D CD    1 
ATOM   5483  N NE    . ARG D 1 176 ? 25.133 -21.383  -185.359 1.00 163.79 ? 173 ARG D NE    1 
ATOM   5484  C CZ    . ARG D 1 176 ? 26.094 -20.590  -185.824 1.00 162.95 ? 173 ARG D CZ    1 
ATOM   5485  N NH1   . ARG D 1 176 ? 26.052 -20.157  -187.077 1.00 152.70 ? 173 ARG D NH1   1 
ATOM   5486  N NH2   . ARG D 1 176 ? 27.096 -20.229  -185.035 1.00 165.14 ? 173 ARG D NH2   1 
ATOM   5487  N N     . SER D 1 177 ? 27.866 -24.814  -188.906 1.00 144.29 ? 174 SER D N     1 
ATOM   5488  C CA    . SER D 1 177 ? 29.013 -24.833  -189.805 1.00 140.19 ? 174 SER D CA    1 
ATOM   5489  C C     . SER D 1 177 ? 28.997 -26.040  -190.734 1.00 141.08 ? 174 SER D C     1 
ATOM   5490  O O     . SER D 1 177 ? 29.589 -25.982  -191.817 1.00 142.20 ? 174 SER D O     1 
ATOM   5491  C CB    . SER D 1 177 ? 30.314 -24.809  -189.002 1.00 140.03 ? 174 SER D CB    1 
ATOM   5492  O OG    . SER D 1 177 ? 30.465 -23.581  -188.313 1.00 134.60 ? 174 SER D OG    1 
ATOM   5493  N N     . LEU D 1 178 ? 28.337 -27.129  -190.334 1.00 144.79 ? 175 LEU D N     1 
ATOM   5494  C CA    . LEU D 1 178 ? 28.211 -28.284  -191.217 1.00 153.02 ? 175 LEU D CA    1 
ATOM   5495  C C     . LEU D 1 178 ? 27.262 -27.992  -192.370 1.00 154.03 ? 175 LEU D C     1 
ATOM   5496  O O     . LEU D 1 178 ? 27.479 -28.458  -193.496 1.00 140.24 ? 175 LEU D O     1 
ATOM   5497  C CB    . LEU D 1 178 ? 27.729 -29.502  -190.431 1.00 149.50 ? 175 LEU D CB    1 
ATOM   5498  C CG    . LEU D 1 178 ? 28.788 -30.451  -189.874 1.00 146.64 ? 175 LEU D CG    1 
ATOM   5499  C CD1   . LEU D 1 178 ? 28.115 -31.598  -189.142 1.00 154.43 ? 175 LEU D CD1   1 
ATOM   5500  C CD2   . LEU D 1 178 ? 29.680 -30.969  -190.988 1.00 142.76 ? 175 LEU D CD2   1 
ATOM   5501  N N     . ASN D 1 179 ? 26.197 -27.231  -192.107 1.00 153.17 ? 176 ASN D N     1 
ATOM   5502  C CA    . ASN D 1 179 ? 25.288 -26.836  -193.178 1.00 149.99 ? 176 ASN D CA    1 
ATOM   5503  C C     . ASN D 1 179 ? 25.973 -25.971  -194.230 1.00 155.51 ? 176 ASN D C     1 
ATOM   5504  O O     . ASN D 1 179 ? 25.513 -25.928  -195.377 1.00 152.79 ? 176 ASN D O     1 
ATOM   5505  C CB    . ASN D 1 179 ? 24.080 -26.092  -192.604 1.00 145.63 ? 176 ASN D CB    1 
ATOM   5506  C CG    . ASN D 1 179 ? 23.250 -26.958  -191.679 1.00 151.35 ? 176 ASN D CG    1 
ATOM   5507  O OD1   . ASN D 1 179 ? 22.898 -28.087  -192.018 1.00 156.86 ? 176 ASN D OD1   1 
ATOM   5508  N ND2   . ASN D 1 179 ? 22.927 -26.428  -190.505 1.00 154.43 ? 176 ASN D ND2   1 
ATOM   5509  N N     . LYS D 1 180 ? 27.058 -25.284  -193.867 1.00 159.40 ? 177 LYS D N     1 
ATOM   5510  C CA    . LYS D 1 180 ? 27.765 -24.369  -194.756 1.00 153.90 ? 177 LYS D CA    1 
ATOM   5511  C C     . LYS D 1 180 ? 28.824 -25.062  -195.608 1.00 156.87 ? 177 LYS D C     1 
ATOM   5512  O O     . LYS D 1 180 ? 29.801 -24.418  -196.015 1.00 157.29 ? 177 LYS D O     1 
ATOM   5513  C CB    . LYS D 1 180 ? 28.402 -23.245  -193.937 1.00 146.54 ? 177 LYS D CB    1 
ATOM   5514  C CG    . LYS D 1 180 ? 27.419 -22.472  -193.074 1.00 142.31 ? 177 LYS D CG    1 
ATOM   5515  C CD    . LYS D 1 180 ? 28.143 -21.538  -192.118 1.00 143.03 ? 177 LYS D CD    1 
ATOM   5516  C CE    . LYS D 1 180 ? 27.169 -20.849  -191.174 1.00 140.87 ? 177 LYS D CE    1 
ATOM   5517  N NZ    . LYS D 1 180 ? 27.870 -19.969  -190.198 1.00 115.50 ? 177 LYS D NZ    1 
ATOM   5518  N N     . LEU D 1 181 ? 28.665 -26.349  -195.890 1.00 163.29 ? 178 LEU D N     1 
ATOM   5519  C CA    . LEU D 1 181 ? 29.615 -27.105  -196.687 1.00 169.02 ? 178 LEU D CA    1 
ATOM   5520  C C     . LEU D 1 181 ? 28.950 -27.681  -197.932 1.00 169.03 ? 178 LEU D C     1 
ATOM   5521  O O     . LEU D 1 181 ? 27.728 -27.869  -197.966 1.00 166.50 ? 178 LEU D O     1 
ATOM   5522  C CB    . LEU D 1 181 ? 30.234 -28.241  -195.858 1.00 164.66 ? 178 LEU D CB    1 
ATOM   5523  C CG    . LEU D 1 181 ? 31.387 -27.838  -194.935 1.00 155.11 ? 178 LEU D CG    1 
ATOM   5524  C CD1   . LEU D 1 181 ? 31.910 -29.040  -194.164 1.00 159.48 ? 178 LEU D CD1   1 
ATOM   5525  C CD2   . LEU D 1 181 ? 32.505 -27.179  -195.727 1.00 152.41 ? 178 LEU D CD2   1 
ATOM   5526  N N     . PRO D 1 182 ? 29.726 -27.958  -198.981 1.00 168.06 ? 179 PRO D N     1 
ATOM   5527  C CA    . PRO D 1 182 ? 29.152 -28.560  -200.192 1.00 169.74 ? 179 PRO D CA    1 
ATOM   5528  C C     . PRO D 1 182 ? 28.554 -29.931  -199.909 1.00 176.00 ? 179 PRO D C     1 
ATOM   5529  O O     . PRO D 1 182 ? 29.206 -30.808  -199.337 1.00 175.89 ? 179 PRO D O     1 
ATOM   5530  C CB    . PRO D 1 182 ? 30.351 -28.650  -201.144 1.00 158.35 ? 179 PRO D CB    1 
ATOM   5531  C CG    . PRO D 1 182 ? 31.290 -27.597  -200.662 1.00 155.89 ? 179 PRO D CG    1 
ATOM   5532  C CD    . PRO D 1 182 ? 31.141 -27.593  -199.170 1.00 159.46 ? 179 PRO D CD    1 
ATOM   5533  N N     . ARG D 1 183 ? 27.301 -30.108  -200.320 1.00 177.74 ? 180 ARG D N     1 
ATOM   5534  C CA    . ARG D 1 183 ? 26.578 -31.362  -200.120 1.00 182.73 ? 180 ARG D CA    1 
ATOM   5535  C C     . ARG D 1 183 ? 27.124 -32.408  -201.083 1.00 183.59 ? 180 ARG D C     1 
ATOM   5536  O O     . ARG D 1 183 ? 26.720 -32.480  -202.245 1.00 175.78 ? 180 ARG D O     1 
ATOM   5537  C CB    . ARG D 1 183 ? 25.082 -31.151  -200.327 1.00 181.83 ? 180 ARG D CB    1 
ATOM   5538  C CG    . ARG D 1 183 ? 24.216 -31.705  -199.209 1.00 181.99 ? 180 ARG D CG    1 
ATOM   5539  C CD    . ARG D 1 183 ? 24.174 -33.224  -199.248 1.00 185.93 ? 180 ARG D CD    1 
ATOM   5540  N NE    . ARG D 1 183 ? 23.806 -33.728  -200.568 1.00 193.13 ? 180 ARG D NE    1 
ATOM   5541  C CZ    . ARG D 1 183 ? 23.869 -35.007  -200.923 1.00 195.90 ? 180 ARG D CZ    1 
ATOM   5542  N NH1   . ARG D 1 183 ? 24.286 -35.918  -200.054 1.00 195.77 ? 180 ARG D NH1   1 
ATOM   5543  N NH2   . ARG D 1 183 ? 23.515 -35.377  -202.146 1.00 189.30 ? 180 ARG D NH2   1 
ATOM   5544  N N     . GLN D 1 184 ? 28.052 -33.225  -200.594 1.00 186.21 ? 181 GLN D N     1 
ATOM   5545  C CA    . GLN D 1 184 ? 28.744 -34.196  -201.428 1.00 178.13 ? 181 GLN D CA    1 
ATOM   5546  C C     . GLN D 1 184 ? 27.855 -35.397  -201.729 1.00 175.33 ? 181 GLN D C     1 
ATOM   5547  O O     . GLN D 1 184 ? 26.927 -35.718  -200.981 1.00 180.84 ? 181 GLN D O     1 
ATOM   5548  C CB    . GLN D 1 184 ? 30.022 -34.669  -200.735 1.00 185.58 ? 181 GLN D CB    1 
ATOM   5549  C CG    . GLN D 1 184 ? 29.792 -35.130  -199.301 1.00 184.21 ? 181 GLN D CG    1 
ATOM   5550  C CD    . GLN D 1 184 ? 31.017 -35.769  -198.681 1.00 176.63 ? 181 GLN D CD    1 
ATOM   5551  O OE1   . GLN D 1 184 ? 31.476 -35.351  -197.618 1.00 167.61 ? 181 GLN D OE1   1 
ATOM   5552  N NE2   . GLN D 1 184 ? 31.549 -36.793  -199.338 1.00 177.27 ? 181 GLN D NE2   1 
ATOM   5553  N N     . LEU D 1 185 ? 28.153 -36.062  -202.843 1.00 172.58 ? 182 LEU D N     1 
ATOM   5554  C CA    . LEU D 1 185 ? 27.433 -37.256  -203.251 1.00 182.73 ? 182 LEU D CA    1 
ATOM   5555  C C     . LEU D 1 185 ? 27.918 -38.456  -202.436 1.00 181.26 ? 182 LEU D C     1 
ATOM   5556  O O     . LEU D 1 185 ? 29.053 -38.460  -201.951 1.00 178.91 ? 182 LEU D O     1 
ATOM   5557  C CB    . LEU D 1 185 ? 27.642 -37.513  -204.741 1.00 182.49 ? 182 LEU D CB    1 
ATOM   5558  C CG    . LEU D 1 185 ? 26.441 -37.973  -205.571 1.00 181.47 ? 182 LEU D CG    1 
ATOM   5559  C CD1   . LEU D 1 185 ? 25.286 -36.990  -205.433 1.00 179.20 ? 182 LEU D CD1   1 
ATOM   5560  C CD2   . LEU D 1 185 ? 26.828 -38.146  -207.032 1.00 159.95 ? 182 LEU D CD2   1 
ATOM   5561  N N     . PRO D 1 186 ? 27.066 -39.466  -202.241 1.00 175.74 ? 183 PRO D N     1 
ATOM   5562  C CA    . PRO D 1 186 ? 27.487 -40.653  -201.485 1.00 173.87 ? 183 PRO D CA    1 
ATOM   5563  C C     . PRO D 1 186 ? 28.800 -41.226  -202.002 1.00 171.98 ? 183 PRO D C     1 
ATOM   5564  O O     . PRO D 1 186 ? 29.022 -41.333  -203.210 1.00 172.61 ? 183 PRO D O     1 
ATOM   5565  C CB    . PRO D 1 186 ? 26.327 -41.629  -201.697 1.00 169.50 ? 183 PRO D CB    1 
ATOM   5566  C CG    . PRO D 1 186 ? 25.137 -40.750  -201.858 1.00 173.69 ? 183 PRO D CG    1 
ATOM   5567  C CD    . PRO D 1 186 ? 25.614 -39.465  -202.498 1.00 168.42 ? 183 PRO D CD    1 
ATOM   5568  N N     . LEU D 1 187 ? 29.676 -41.594  -201.070 1.00 173.25 ? 184 LEU D N     1 
ATOM   5569  C CA    . LEU D 1 187 ? 30.968 -42.154  -201.436 1.00 175.91 ? 184 LEU D CA    1 
ATOM   5570  C C     . LEU D 1 187 ? 30.803 -43.527  -202.076 1.00 175.31 ? 184 LEU D C     1 
ATOM   5571  O O     . LEU D 1 187 ? 29.880 -44.282  -201.757 1.00 168.16 ? 184 LEU D O     1 
ATOM   5572  C CB    . LEU D 1 187 ? 31.878 -42.261  -200.210 1.00 181.05 ? 184 LEU D CB    1 
ATOM   5573  C CG    . LEU D 1 187 ? 32.222 -40.992  -199.420 1.00 189.77 ? 184 LEU D CG    1 
ATOM   5574  C CD1   . LEU D 1 187 ? 32.499 -39.822  -200.360 1.00 191.00 ? 184 LEU D CD1   1 
ATOM   5575  C CD2   . LEU D 1 187 ? 31.148 -40.638  -198.394 1.00 167.70 ? 184 LEU D CD2   1 
ATOM   5576  N N     . GLU D 1 188 ? 31.715 -43.846  -202.989 1.00 173.20 ? 185 GLU D N     1 
ATOM   5577  C CA    . GLU D 1 188 ? 31.740 -45.138  -203.661 1.00 155.94 ? 185 GLU D CA    1 
ATOM   5578  C C     . GLU D 1 188 ? 32.708 -46.066  -202.940 1.00 155.54 ? 185 GLU D C     1 
ATOM   5579  O O     . GLU D 1 188 ? 33.829 -45.665  -202.610 1.00 166.84 ? 185 GLU D O     1 
ATOM   5580  C CB    . GLU D 1 188 ? 32.138 -44.989  -205.130 1.00 150.49 ? 185 GLU D CB    1 
ATOM   5581  C CG    . GLU D 1 188 ? 32.073 -46.290  -205.915 1.00 158.10 ? 185 GLU D CG    1 
ATOM   5582  C CD    . GLU D 1 188 ? 32.348 -46.098  -207.392 1.00 144.48 ? 185 GLU D CD    1 
ATOM   5583  O OE1   . GLU D 1 188 ? 33.304 -45.370  -207.731 1.00 136.97 ? 185 GLU D OE1   1 
ATOM   5584  O OE2   . GLU D 1 188 ? 31.604 -46.675  -208.213 1.00 135.08 ? 185 GLU D OE2   1 
ATOM   5585  N N     . VAL D 1 189 ? 32.274 -47.299  -202.699 1.00 139.21 ? 186 VAL D N     1 
ATOM   5586  C CA    . VAL D 1 189 ? 33.066 -48.287  -201.976 1.00 139.22 ? 186 VAL D CA    1 
ATOM   5587  C C     . VAL D 1 189 ? 33.758 -49.182  -202.994 1.00 134.36 ? 186 VAL D C     1 
ATOM   5588  O O     . VAL D 1 189 ? 33.110 -49.730  -203.895 1.00 134.04 ? 186 VAL D O     1 
ATOM   5589  C CB    . VAL D 1 189 ? 32.192 -49.111  -201.016 1.00 139.92 ? 186 VAL D CB    1 
ATOM   5590  C CG1   . VAL D 1 189 ? 33.034 -50.143  -200.289 1.00 132.56 ? 186 VAL D CG1   1 
ATOM   5591  C CG2   . VAL D 1 189 ? 31.495 -48.199  -200.020 1.00 131.91 ? 186 VAL D CG2   1 
ATOM   5592  N N     . ASP D 1 190 ? 35.073 -49.331  -202.854 1.00 123.96 ? 187 ASP D N     1 
ATOM   5593  C CA    . ASP D 1 190 ? 35.872 -50.128  -203.779 1.00 131.86 ? 187 ASP D CA    1 
ATOM   5594  C C     . ASP D 1 190 ? 35.927 -51.563  -203.266 1.00 135.55 ? 187 ASP D C     1 
ATOM   5595  O O     . ASP D 1 190 ? 36.498 -51.830  -202.203 1.00 139.30 ? 187 ASP D O     1 
ATOM   5596  C CB    . ASP D 1 190 ? 37.272 -49.540  -203.925 1.00 129.66 ? 187 ASP D CB    1 
ATOM   5597  C CG    . ASP D 1 190 ? 38.136 -50.327  -204.888 1.00 150.16 ? 187 ASP D CG    1 
ATOM   5598  O OD1   . ASP D 1 190 ? 37.900 -50.230  -206.111 1.00 146.66 ? 187 ASP D OD1   1 
ATOM   5599  O OD2   . ASP D 1 190 ? 39.047 -51.044  -204.424 1.00 158.99 ? 187 ASP D OD2   1 
ATOM   5600  N N     . LEU D 1 191 ? 35.333 -52.486  -204.024 1.00 139.84 ? 188 LEU D N     1 
ATOM   5601  C CA    . LEU D 1 191 ? 35.274 -53.896  -203.660 1.00 136.69 ? 188 LEU D CA    1 
ATOM   5602  C C     . LEU D 1 191 ? 36.277 -54.744  -204.437 1.00 135.82 ? 188 LEU D C     1 
ATOM   5603  O O     . LEU D 1 191 ? 36.020 -55.925  -204.696 1.00 126.66 ? 188 LEU D O     1 
ATOM   5604  C CB    . LEU D 1 191 ? 33.858 -54.430  -203.864 1.00 132.84 ? 188 LEU D CB    1 
ATOM   5605  C CG    . LEU D 1 191 ? 32.771 -53.659  -203.116 1.00 127.93 ? 188 LEU D CG    1 
ATOM   5606  C CD1   . LEU D 1 191 ? 31.423 -54.336  -203.276 1.00 124.22 ? 188 LEU D CD1   1 
ATOM   5607  C CD2   . LEU D 1 191 ? 33.138 -53.523  -201.649 1.00 125.06 ? 188 LEU D CD2   1 
ATOM   5608  N N     . THR D 1 192 ? 37.415 -54.165  -204.821 1.00 138.17 ? 189 THR D N     1 
ATOM   5609  C CA    . THR D 1 192 ? 38.438 -54.939  -205.516 1.00 140.74 ? 189 THR D CA    1 
ATOM   5610  C C     . THR D 1 192 ? 39.224 -55.811  -204.544 1.00 143.26 ? 189 THR D C     1 
ATOM   5611  O O     . THR D 1 192 ? 39.239 -57.041  -204.666 1.00 140.43 ? 189 THR D O     1 
ATOM   5612  C CB    . THR D 1 192 ? 39.379 -54.003  -206.279 1.00 137.70 ? 189 THR D CB    1 
ATOM   5613  O OG1   . THR D 1 192 ? 40.036 -53.127  -205.355 1.00 138.97 ? 189 THR D OG1   1 
ATOM   5614  C CG2   . THR D 1 192 ? 38.600 -53.175  -207.288 1.00 128.93 ? 189 THR D CG2   1 
ATOM   5615  N N     . LYS D 1 193 ? 39.886 -55.188  -203.568 1.00 142.67 ? 190 LYS D N     1 
ATOM   5616  C CA    . LYS D 1 193 ? 40.669 -55.905  -202.570 1.00 155.41 ? 190 LYS D CA    1 
ATOM   5617  C C     . LYS D 1 193 ? 39.828 -56.418  -201.403 1.00 155.79 ? 190 LYS D C     1 
ATOM   5618  O O     . LYS D 1 193 ? 40.384 -56.698  -200.333 1.00 133.27 ? 190 LYS D O     1 
ATOM   5619  C CB    . LYS D 1 193 ? 41.802 -55.016  -202.050 1.00 147.63 ? 190 LYS D CB    1 
ATOM   5620  C CG    . LYS D 1 193 ? 42.719 -54.490  -203.140 1.00 138.86 ? 190 LYS D CG    1 
ATOM   5621  C CD    . LYS D 1 193 ? 43.806 -53.598  -202.566 1.00 151.33 ? 190 LYS D CD    1 
ATOM   5622  C CE    . LYS D 1 193 ? 44.697 -53.040  -203.664 1.00 168.03 ? 190 LYS D CE    1 
ATOM   5623  N NZ    . LYS D 1 193 ? 45.755 -52.145  -203.118 1.00 167.89 ? 190 LYS D NZ    1 
ATOM   5624  N N     . ALA D 1 194 ? 38.515 -56.537  -201.579 1.00 149.17 ? 191 ALA D N     1 
ATOM   5625  C CA    . ALA D 1 194 ? 37.655 -57.033  -200.517 1.00 122.91 ? 191 ALA D CA    1 
ATOM   5626  C C     . ALA D 1 194 ? 37.988 -58.487  -200.195 1.00 126.16 ? 191 ALA D C     1 
ATOM   5627  O O     . ALA D 1 194 ? 38.522 -59.231  -201.022 1.00 128.19 ? 191 ALA D O     1 
ATOM   5628  C CB    . ALA D 1 194 ? 36.184 -56.902  -200.912 1.00 114.51 ? 191 ALA D CB    1 
ATOM   5629  N N     . LYS D 1 195 ? 37.669 -58.887  -198.965 1.00 130.58 ? 192 LYS D N     1 
ATOM   5630  C CA    . LYS D 1 195 ? 37.915 -60.257  -198.535 1.00 117.25 ? 192 LYS D CA    1 
ATOM   5631  C C     . LYS D 1 195 ? 37.067 -61.225  -199.349 1.00 110.91 ? 192 LYS D C     1 
ATOM   5632  O O     . LYS D 1 195 ? 35.857 -61.033  -199.504 1.00 108.20 ? 192 LYS D O     1 
ATOM   5633  C CB    . LYS D 1 195 ? 37.615 -60.404  -197.044 1.00 119.45 ? 192 LYS D CB    1 
ATOM   5634  C CG    . LYS D 1 195 ? 37.916 -61.782  -196.487 1.00 119.43 ? 192 LYS D CG    1 
ATOM   5635  C CD    . LYS D 1 195 ? 37.993 -61.753  -194.972 1.00 101.13 ? 192 LYS D CD    1 
ATOM   5636  C CE    . LYS D 1 195 ? 38.440 -63.096  -194.426 1.00 114.88 ? 192 LYS D CE    1 
ATOM   5637  N NZ    . LYS D 1 195 ? 39.669 -63.587  -195.106 1.00 109.63 ? 192 LYS D NZ    1 
ATOM   5638  N N     . ARG D 1 196 ? 37.709 -62.272  -199.870 1.00 108.75 ? 193 ARG D N     1 
ATOM   5639  C CA    . ARG D 1 196 ? 37.047 -63.203  -200.770 1.00 116.58 ? 193 ARG D CA    1 
ATOM   5640  C C     . ARG D 1 196 ? 37.185 -64.665  -200.369 1.00 123.70 ? 193 ARG D C     1 
ATOM   5641  O O     . ARG D 1 196 ? 36.532 -65.514  -200.986 1.00 129.89 ? 193 ARG D O     1 
ATOM   5642  C CB    . ARG D 1 196 ? 37.587 -63.029  -202.199 1.00 117.99 ? 193 ARG D CB    1 
ATOM   5643  C CG    . ARG D 1 196 ? 37.292 -61.662  -202.802 1.00 131.26 ? 193 ARG D CG    1 
ATOM   5644  C CD    . ARG D 1 196 ? 37.304 -61.694  -204.322 1.00 129.89 ? 193 ARG D CD    1 
ATOM   5645  N NE    . ARG D 1 196 ? 36.366 -60.731  -204.893 1.00 132.27 ? 193 ARG D NE    1 
ATOM   5646  C CZ    . ARG D 1 196 ? 36.596 -59.424  -204.984 1.00 126.40 ? 193 ARG D CZ    1 
ATOM   5647  N NH1   . ARG D 1 196 ? 37.739 -58.916  -204.543 1.00 115.32 ? 193 ARG D NH1   1 
ATOM   5648  N NH2   . ARG D 1 196 ? 35.683 -58.624  -205.518 1.00 121.16 ? 193 ARG D NH2   1 
ATOM   5649  N N     . GLN D 1 197 ? 37.998 -64.987  -199.366 1.00 126.08 ? 194 GLN D N     1 
ATOM   5650  C CA    . GLN D 1 197 ? 38.143 -66.354  -198.889 1.00 131.18 ? 194 GLN D CA    1 
ATOM   5651  C C     . GLN D 1 197 ? 38.329 -66.336  -197.379 1.00 130.73 ? 194 GLN D C     1 
ATOM   5652  O O     . GLN D 1 197 ? 38.545 -65.286  -196.768 1.00 133.23 ? 194 GLN D O     1 
ATOM   5653  C CB    . GLN D 1 197 ? 39.313 -67.072  -199.578 1.00 132.82 ? 194 GLN D CB    1 
ATOM   5654  C CG    . GLN D 1 197 ? 40.667 -66.866  -198.911 1.00 143.58 ? 194 GLN D CG    1 
ATOM   5655  C CD    . GLN D 1 197 ? 41.185 -65.444  -199.043 1.00 132.40 ? 194 GLN D CD    1 
ATOM   5656  O OE1   . GLN D 1 197 ? 40.620 -64.627  -199.771 1.00 130.96 ? 194 GLN D OE1   1 
ATOM   5657  N NE2   . GLN D 1 197 ? 42.264 -65.142  -198.331 1.00 130.85 ? 194 GLN D NE2   1 
ATOM   5658  N N     . ASP D 1 198 ? 38.244 -67.522  -196.774 1.00 120.14 ? 195 ASP D N     1 
ATOM   5659  C CA    . ASP D 1 198 ? 38.301 -67.630  -195.320 1.00 112.88 ? 195 ASP D CA    1 
ATOM   5660  C C     . ASP D 1 198 ? 39.721 -67.442  -194.796 1.00 110.46 ? 195 ASP D C     1 
ATOM   5661  O O     . ASP D 1 198 ? 39.970 -66.582  -193.944 1.00 113.54 ? 195 ASP D O     1 
ATOM   5662  C CB    . ASP D 1 198 ? 37.742 -68.984  -194.870 1.00 119.03 ? 195 ASP D CB    1 
ATOM   5663  C CG    . ASP D 1 198 ? 36.270 -69.147  -195.197 1.00 118.43 ? 195 ASP D CG    1 
ATOM   5664  O OD1   . ASP D 1 198 ? 35.628 -68.147  -195.582 1.00 107.53 ? 195 ASP D OD1   1 
ATOM   5665  O OD2   . ASP D 1 198 ? 35.753 -70.277  -195.063 1.00 120.26 ? 195 ASP D OD2   1 
ATOM   5666  N N     . LEU D 1 199 ? 40.661 -68.243  -195.294 1.00 108.18 ? 196 LEU D N     1 
ATOM   5667  C CA    . LEU D 1 199 ? 42.002 -68.281  -194.723 1.00 108.90 ? 196 LEU D CA    1 
ATOM   5668  C C     . LEU D 1 199 ? 42.691 -66.924  -194.823 1.00 98.44  ? 196 LEU D C     1 
ATOM   5669  O O     . LEU D 1 199 ? 42.579 -66.220  -195.830 1.00 104.93 ? 196 LEU D O     1 
ATOM   5670  C CB    . LEU D 1 199 ? 42.838 -69.351  -195.429 1.00 102.97 ? 196 LEU D CB    1 
ATOM   5671  C CG    . LEU D 1 199 ? 44.291 -69.526  -194.981 1.00 111.21 ? 196 LEU D CG    1 
ATOM   5672  C CD1   . LEU D 1 199 ? 44.361 -69.819  -193.490 1.00 121.82 ? 196 LEU D CD1   1 
ATOM   5673  C CD2   . LEU D 1 199 ? 44.968 -70.630  -195.778 1.00 98.81  ? 196 LEU D CD2   1 
ATOM   5674  N N     . GLU D 1 200 ? 43.403 -66.560  -193.756 1.00 111.03 ? 197 GLU D N     1 
ATOM   5675  C CA    . GLU D 1 200 ? 44.200 -65.334  -193.693 1.00 122.90 ? 197 GLU D CA    1 
ATOM   5676  C C     . GLU D 1 200 ? 45.623 -65.706  -193.300 1.00 142.02 ? 197 GLU D C     1 
ATOM   5677  O O     . GLU D 1 200 ? 45.986 -65.651  -192.117 1.00 157.60 ? 197 GLU D O     1 
ATOM   5678  C CB    . GLU D 1 200 ? 43.604 -64.330  -192.706 1.00 116.01 ? 197 GLU D CB    1 
ATOM   5679  C CG    . GLU D 1 200 ? 42.344 -63.645  -193.194 1.00 116.24 ? 197 GLU D CG    1 
ATOM   5680  C CD    . GLU D 1 200 ? 42.634 -62.547  -194.196 1.00 129.19 ? 197 GLU D CD    1 
ATOM   5681  O OE1   . GLU D 1 200 ? 43.569 -61.754  -193.957 1.00 134.57 ? 197 GLU D OE1   1 
ATOM   5682  O OE2   . GLU D 1 200 ? 41.927 -62.475  -195.223 1.00 133.41 ? 197 GLU D OE2   1 
ATOM   5683  N N     . PRO D 1 201 ? 46.453 -66.107  -194.268 1.00 125.78 ? 198 PRO D N     1 
ATOM   5684  C CA    . PRO D 1 201 ? 47.833 -66.495  -193.931 1.00 123.53 ? 198 PRO D CA    1 
ATOM   5685  C C     . PRO D 1 201 ? 48.630 -65.391  -193.258 1.00 128.86 ? 198 PRO D C     1 
ATOM   5686  O O     . PRO D 1 201 ? 49.494 -65.688  -192.423 1.00 128.74 ? 198 PRO D O     1 
ATOM   5687  C CB    . PRO D 1 201 ? 48.429 -66.868  -195.296 1.00 134.85 ? 198 PRO D CB    1 
ATOM   5688  C CG    . PRO D 1 201 ? 47.245 -67.259  -196.122 1.00 140.05 ? 198 PRO D CG    1 
ATOM   5689  C CD    . PRO D 1 201 ? 46.155 -66.319  -195.694 1.00 126.48 ? 198 PRO D CD    1 
ATOM   5690  N N     . SER D 1 202 ? 48.369 -64.126  -193.601 1.00 122.02 ? 199 SER D N     1 
ATOM   5691  C CA    . SER D 1 202 ? 49.040 -63.013  -192.933 1.00 119.18 ? 199 SER D CA    1 
ATOM   5692  C C     . SER D 1 202 ? 48.834 -63.056  -191.422 1.00 135.87 ? 199 SER D C     1 
ATOM   5693  O O     . SER D 1 202 ? 49.773 -62.820  -190.653 1.00 134.20 ? 199 SER D O     1 
ATOM   5694  C CB    . SER D 1 202 ? 48.542 -61.685  -193.503 1.00 117.96 ? 199 SER D CB    1 
ATOM   5695  O OG    . SER D 1 202 ? 49.261 -60.594  -192.956 1.00 136.73 ? 199 SER D OG    1 
ATOM   5696  N N     . VAL D 1 203 ? 47.615 -63.360  -190.980 1.00 142.39 ? 200 VAL D N     1 
ATOM   5697  C CA    . VAL D 1 203 ? 47.325 -63.432  -189.551 1.00 138.49 ? 200 VAL D CA    1 
ATOM   5698  C C     . VAL D 1 203 ? 47.805 -64.755  -188.968 1.00 134.85 ? 200 VAL D C     1 
ATOM   5699  O O     . VAL D 1 203 ? 48.362 -64.795  -187.863 1.00 137.59 ? 200 VAL D O     1 
ATOM   5700  C CB    . VAL D 1 203 ? 45.820 -63.216  -189.301 1.00 135.99 ? 200 VAL D CB    1 
ATOM   5701  C CG1   . VAL D 1 203 ? 45.531 -63.221  -187.809 1.00 133.79 ? 200 VAL D CG1   1 
ATOM   5702  C CG2   . VAL D 1 203 ? 45.356 -61.918  -189.941 1.00 134.45 ? 200 VAL D CG2   1 
ATOM   5703  N N     . GLU D 1 204 ? 47.534 -65.855  -189.680 1.00 123.05 ? 201 GLU D N     1 
ATOM   5704  C CA    . GLU D 1 204 ? 47.958 -67.180  -189.237 1.00 134.13 ? 201 GLU D CA    1 
ATOM   5705  C C     . GLU D 1 204 ? 49.452 -67.216  -188.942 1.00 140.92 ? 201 GLU D C     1 
ATOM   5706  O O     . GLU D 1 204 ? 49.887 -67.856  -187.980 1.00 136.90 ? 201 GLU D O     1 
ATOM   5707  C CB    . GLU D 1 204 ? 47.593 -68.220  -190.298 1.00 141.03 ? 201 GLU D CB    1 
ATOM   5708  C CG    . GLU D 1 204 ? 48.205 -69.595  -190.079 1.00 150.96 ? 201 GLU D CG    1 
ATOM   5709  C CD    . GLU D 1 204 ? 47.644 -70.297  -188.862 1.00 154.18 ? 201 GLU D CD    1 
ATOM   5710  O OE1   . GLU D 1 204 ? 46.419 -70.533  -188.825 1.00 159.48 ? 201 GLU D OE1   1 
ATOM   5711  O OE2   . GLU D 1 204 ? 48.429 -70.617  -187.944 1.00 156.44 ? 201 GLU D OE2   1 
ATOM   5712  N N     . GLU D 1 205 ? 50.251 -66.531  -189.762 1.00 149.05 ? 202 GLU D N     1 
ATOM   5713  C CA    . GLU D 1 205 ? 51.696 -66.488  -189.565 1.00 146.94 ? 202 GLU D CA    1 
ATOM   5714  C C     . GLU D 1 205 ? 52.050 -65.908  -188.200 1.00 143.44 ? 202 GLU D C     1 
ATOM   5715  O O     . GLU D 1 205 ? 52.748 -66.541  -187.395 1.00 133.21 ? 202 GLU D O     1 
ATOM   5716  C CB    . GLU D 1 205 ? 52.326 -65.652  -190.678 1.00 144.55 ? 202 GLU D CB    1 
ATOM   5717  C CG    . GLU D 1 205 ? 53.831 -65.691  -190.755 1.00 149.79 ? 202 GLU D CG    1 
ATOM   5718  C CD    . GLU D 1 205 ? 54.341 -64.929  -191.957 1.00 168.68 ? 202 GLU D CD    1 
ATOM   5719  O OE1   . GLU D 1 205 ? 54.148 -63.696  -192.005 1.00 179.31 ? 202 GLU D OE1   1 
ATOM   5720  O OE2   . GLU D 1 205 ? 54.906 -65.564  -192.867 1.00 177.03 ? 202 GLU D OE2   1 
ATOM   5721  N N     . ALA D 1 206 ? 51.583 -64.686  -187.935 1.00 150.11 ? 203 ALA D N     1 
ATOM   5722  C CA    . ALA D 1 206 ? 51.890 -64.024  -186.673 1.00 161.30 ? 203 ALA D CA    1 
ATOM   5723  C C     . ALA D 1 206 ? 51.350 -64.809  -185.486 1.00 144.38 ? 203 ALA D C     1 
ATOM   5724  O O     . ALA D 1 206 ? 51.987 -64.865  -184.428 1.00 140.18 ? 203 ALA D O     1 
ATOM   5725  C CB    . ALA D 1 206 ? 51.327 -62.603  -186.679 1.00 165.84 ? 203 ALA D CB    1 
ATOM   5726  N N     . ARG D 1 207 ? 50.180 -65.434  -185.640 1.00 145.24 ? 204 ARG D N     1 
ATOM   5727  C CA    . ARG D 1 207 ? 49.598 -66.151  -184.509 1.00 150.04 ? 204 ARG D CA    1 
ATOM   5728  C C     . ARG D 1 207 ? 50.355 -67.443  -184.225 1.00 144.93 ? 204 ARG D C     1 
ATOM   5729  O O     . ARG D 1 207 ? 50.549 -67.811  -183.060 1.00 145.02 ? 204 ARG D O     1 
ATOM   5730  C CB    . ARG D 1 207 ? 48.119 -66.433  -184.765 1.00 146.80 ? 204 ARG D CB    1 
ATOM   5731  C CG    . ARG D 1 207 ? 47.359 -66.883  -183.527 1.00 139.33 ? 204 ARG D CG    1 
ATOM   5732  C CD    . ARG D 1 207 ? 45.959 -67.326  -183.890 1.00 135.11 ? 204 ARG D CD    1 
ATOM   5733  N NE    . ARG D 1 207 ? 45.317 -66.387  -184.805 1.00 130.16 ? 204 ARG D NE    1 
ATOM   5734  C CZ    . ARG D 1 207 ? 44.503 -66.751  -185.790 1.00 124.73 ? 204 ARG D CZ    1 
ATOM   5735  N NH1   . ARG D 1 207 ? 44.235 -68.033  -185.991 1.00 124.86 ? 204 ARG D NH1   1 
ATOM   5736  N NH2   . ARG D 1 207 ? 43.962 -65.834  -186.579 1.00 115.74 ? 204 ARG D NH2   1 
ATOM   5737  N N     . TYR D 1 208 ? 50.784 -68.148  -185.275 1.00 135.69 ? 205 TYR D N     1 
ATOM   5738  C CA    . TYR D 1 208 ? 51.618 -69.328  -185.090 1.00 118.17 ? 205 TYR D CA    1 
ATOM   5739  C C     . TYR D 1 208 ? 52.968 -68.964  -184.491 1.00 127.97 ? 205 TYR D C     1 
ATOM   5740  O O     . TYR D 1 208 ? 53.543 -69.751  -183.731 1.00 130.73 ? 205 TYR D O     1 
ATOM   5741  C CB    . TYR D 1 208 ? 51.799 -70.052  -186.425 1.00 122.16 ? 205 TYR D CB    1 
ATOM   5742  C CG    . TYR D 1 208 ? 52.763 -71.214  -186.373 1.00 130.29 ? 205 TYR D CG    1 
ATOM   5743  C CD1   . TYR D 1 208 ? 52.467 -72.354  -185.638 1.00 124.73 ? 205 TYR D CD1   1 
ATOM   5744  C CD2   . TYR D 1 208 ? 53.967 -71.174  -187.064 1.00 139.65 ? 205 TYR D CD2   1 
ATOM   5745  C CE1   . TYR D 1 208 ? 53.346 -73.420  -185.588 1.00 122.43 ? 205 TYR D CE1   1 
ATOM   5746  C CE2   . TYR D 1 208 ? 54.852 -72.235  -187.021 1.00 153.02 ? 205 TYR D CE2   1 
ATOM   5747  C CZ    . TYR D 1 208 ? 54.536 -73.355  -186.282 1.00 143.25 ? 205 TYR D CZ    1 
ATOM   5748  O OH    . TYR D 1 208 ? 55.414 -74.414  -186.236 1.00 147.20 ? 205 TYR D OH    1 
ATOM   5749  N N     . ASN D 1 209 ? 53.489 -67.781  -184.819 1.00 138.03 ? 206 ASN D N     1 
ATOM   5750  C CA    . ASN D 1 209 ? 54.722 -67.317  -184.197 1.00 140.87 ? 206 ASN D CA    1 
ATOM   5751  C C     . ASN D 1 209 ? 54.500 -66.709  -182.817 1.00 145.47 ? 206 ASN D C     1 
ATOM   5752  O O     . ASN D 1 209 ? 55.481 -66.427  -182.119 1.00 146.67 ? 206 ASN D O     1 
ATOM   5753  C CB    . ASN D 1 209 ? 55.418 -66.296  -185.102 1.00 139.48 ? 206 ASN D CB    1 
ATOM   5754  C CG    . ASN D 1 209 ? 55.953 -66.918  -186.378 1.00 129.96 ? 206 ASN D CG    1 
ATOM   5755  O OD1   . ASN D 1 209 ? 56.890 -67.715  -186.349 1.00 135.07 ? 206 ASN D OD1   1 
ATOM   5756  N ND2   . ASN D 1 209 ? 55.356 -66.556  -187.507 1.00 120.08 ? 206 ASN D ND2   1 
ATOM   5757  N N     . SER D 1 210 ? 53.249 -66.507  -182.406 1.00 147.48 ? 207 SER D N     1 
ATOM   5758  C CA    . SER D 1 210 ? 52.939 -65.897  -181.119 1.00 144.80 ? 207 SER D CA    1 
ATOM   5759  C C     . SER D 1 210 ? 53.095 -66.851  -179.941 1.00 131.94 ? 207 SER D C     1 
ATOM   5760  O O     . SER D 1 210 ? 52.952 -66.416  -178.794 1.00 134.68 ? 207 SER D O     1 
ATOM   5761  C CB    . SER D 1 210 ? 51.513 -65.338  -181.135 1.00 147.04 ? 207 SER D CB    1 
ATOM   5762  O OG    . SER D 1 210 ? 51.298 -64.450  -180.051 1.00 154.04 ? 207 SER D OG    1 
ATOM   5763  N N     . CYS D 1 211 ? 53.381 -68.126  -180.185 1.00 138.33 ? 208 CYS D N     1 
ATOM   5764  C CA    . CYS D 1 211 ? 53.539 -69.089  -179.100 1.00 153.08 ? 208 CYS D CA    1 
ATOM   5765  C C     . CYS D 1 211 ? 54.985 -69.148  -178.619 1.00 156.60 ? 208 CYS D C     1 
ATOM   5766  O O     . CYS D 1 211 ? 55.285 -69.768  -177.599 1.00 144.66 ? 208 CYS D O     1 
ATOM   5767  C CB    . CYS D 1 211 ? 53.076 -70.479  -179.542 1.00 146.44 ? 208 CYS D CB    1 
ATOM   5768  S SG    . CYS D 1 211 ? 51.318 -70.596  -179.947 1.00 128.88 ? 208 CYS D SG    1 
ATOM   5769  N N     . CYS E 1 28  ? 46.640 -68.416  -170.274 1.00 119.90 ? 25  CYS E N     1 
ATOM   5770  C CA    . CYS E 1 28  ? 45.416 -69.060  -170.734 1.00 112.09 ? 25  CYS E CA    1 
ATOM   5771  C C     . CYS E 1 28  ? 44.502 -68.052  -171.421 1.00 116.42 ? 25  CYS E C     1 
ATOM   5772  O O     . CYS E 1 28  ? 44.912 -66.927  -171.708 1.00 128.34 ? 25  CYS E O     1 
ATOM   5773  C CB    . CYS E 1 28  ? 44.685 -69.725  -169.566 1.00 116.13 ? 25  CYS E CB    1 
ATOM   5774  S SG    . CYS E 1 28  ? 44.250 -68.603  -168.215 1.00 116.64 ? 25  CYS E SG    1 
ATOM   5775  N N     . PHE E 1 29  ? 43.264 -68.460  -171.685 1.00 103.59 ? 26  PHE E N     1 
ATOM   5776  C CA    . PHE E 1 29  ? 42.298 -67.562  -172.301 1.00 82.29  ? 26  PHE E CA    1 
ATOM   5777  C C     . PHE E 1 29  ? 41.923 -66.452  -171.328 1.00 90.91  ? 26  PHE E C     1 
ATOM   5778  O O     . PHE E 1 29  ? 41.775 -66.683  -170.124 1.00 105.64 ? 26  PHE E O     1 
ATOM   5779  C CB    . PHE E 1 29  ? 41.052 -68.336  -172.730 1.00 74.87  ? 26  PHE E CB    1 
ATOM   5780  C CG    . PHE E 1 29  ? 40.221 -67.628  -173.762 1.00 82.95  ? 26  PHE E CG    1 
ATOM   5781  C CD1   . PHE E 1 29  ? 39.341 -66.622  -173.396 1.00 77.88  ? 26  PHE E CD1   1 
ATOM   5782  C CD2   . PHE E 1 29  ? 40.318 -67.971  -175.099 1.00 91.34  ? 26  PHE E CD2   1 
ATOM   5783  C CE1   . PHE E 1 29  ? 38.577 -65.971  -174.346 1.00 83.84  ? 26  PHE E CE1   1 
ATOM   5784  C CE2   . PHE E 1 29  ? 39.557 -67.324  -176.054 1.00 92.58  ? 26  PHE E CE2   1 
ATOM   5785  C CZ    . PHE E 1 29  ? 38.686 -66.322  -175.677 1.00 78.75  ? 26  PHE E CZ    1 
ATOM   5786  N N     . GLY E 1 30  ? 41.773 -65.238  -171.856 1.00 90.90  ? 27  GLY E N     1 
ATOM   5787  C CA    . GLY E 1 30  ? 41.551 -64.072  -171.030 1.00 101.84 ? 27  GLY E CA    1 
ATOM   5788  C C     . GLY E 1 30  ? 42.800 -63.467  -170.428 1.00 106.67 ? 27  GLY E C     1 
ATOM   5789  O O     . GLY E 1 30  ? 42.741 -62.335  -169.930 1.00 105.91 ? 27  GLY E O     1 
ATOM   5790  N N     . GLN E 1 31  ? 43.925 -64.179  -170.451 1.00 110.90 ? 28  GLN E N     1 
ATOM   5791  C CA    . GLN E 1 31  ? 45.185 -63.706  -169.887 1.00 118.25 ? 28  GLN E CA    1 
ATOM   5792  C C     . GLN E 1 31  ? 46.236 -63.380  -170.936 1.00 120.27 ? 28  GLN E C     1 
ATOM   5793  O O     . GLN E 1 31  ? 46.940 -62.377  -170.801 1.00 129.33 ? 28  GLN E O     1 
ATOM   5794  C CB    . GLN E 1 31  ? 45.753 -64.753  -168.921 1.00 115.30 ? 28  GLN E CB    1 
ATOM   5795  C CG    . GLN E 1 31  ? 44.858 -65.074  -167.729 1.00 124.24 ? 28  GLN E CG    1 
ATOM   5796  C CD    . GLN E 1 31  ? 44.905 -64.017  -166.638 1.00 125.35 ? 28  GLN E CD    1 
ATOM   5797  O OE1   . GLN E 1 31  ? 45.347 -62.889  -166.860 1.00 115.59 ? 28  GLN E OE1   1 
ATOM   5798  N NE2   . GLN E 1 31  ? 44.448 -64.383  -165.446 1.00 129.08 ? 28  GLN E NE2   1 
ATOM   5799  N N     . CYS E 1 32  ? 46.366 -64.209  -171.970 1.00 114.89 ? 29  CYS E N     1 
ATOM   5800  C CA    . CYS E 1 32  ? 47.395 -64.007  -172.983 1.00 117.88 ? 29  CYS E CA    1 
ATOM   5801  C C     . CYS E 1 32  ? 47.206 -62.671  -173.692 1.00 114.65 ? 29  CYS E C     1 
ATOM   5802  O O     . CYS E 1 32  ? 46.095 -62.320  -174.097 1.00 115.77 ? 29  CYS E O     1 
ATOM   5803  C CB    . CYS E 1 32  ? 47.366 -65.151  -173.996 1.00 125.27 ? 29  CYS E CB    1 
ATOM   5804  S SG    . CYS E 1 32  ? 47.925 -66.741  -173.342 1.00 147.79 ? 29  CYS E SG    1 
ATOM   5805  N N     . GLN E 1 33  ? 48.297 -61.925  -173.835 1.00 120.07 ? 30  GLN E N     1 
ATOM   5806  C CA    . GLN E 1 33  ? 48.277 -60.620  -174.476 1.00 118.76 ? 30  GLN E CA    1 
ATOM   5807  C C     . GLN E 1 33  ? 48.681 -60.743  -175.939 1.00 120.36 ? 30  GLN E C     1 
ATOM   5808  O O     . GLN E 1 33  ? 49.494 -61.593  -176.310 1.00 121.28 ? 30  GLN E O     1 
ATOM   5809  C CB    . GLN E 1 33  ? 49.216 -59.645  -173.762 1.00 124.66 ? 30  GLN E CB    1 
ATOM   5810  C CG    . GLN E 1 33  ? 48.791 -59.288  -172.351 1.00 134.70 ? 30  GLN E CG    1 
ATOM   5811  C CD    . GLN E 1 33  ? 49.773 -58.357  -171.666 1.00 156.88 ? 30  GLN E CD    1 
ATOM   5812  O OE1   . GLN E 1 33  ? 50.185 -57.345  -172.234 1.00 159.00 ? 30  GLN E OE1   1 
ATOM   5813  N NE2   . GLN E 1 33  ? 50.151 -58.693  -170.438 1.00 161.88 ? 30  GLN E NE2   1 
ATOM   5814  N N     . TYR E 1 34  ? 48.102 -59.879  -176.769 1.00 118.17 ? 31  TYR E N     1 
ATOM   5815  C CA    . TYR E 1 34  ? 48.391 -59.906  -178.196 1.00 112.55 ? 31  TYR E CA    1 
ATOM   5816  C C     . TYR E 1 34  ? 49.772 -59.328  -178.479 1.00 121.59 ? 31  TYR E C     1 
ATOM   5817  O O     . TYR E 1 34  ? 50.158 -58.293  -177.928 1.00 124.47 ? 31  TYR E O     1 
ATOM   5818  C CB    . TYR E 1 34  ? 47.331 -59.121  -178.969 1.00 109.02 ? 31  TYR E CB    1 
ATOM   5819  C CG    . TYR E 1 34  ? 46.105 -59.926  -179.332 1.00 105.19 ? 31  TYR E CG    1 
ATOM   5820  C CD1   . TYR E 1 34  ? 46.201 -61.043  -180.150 1.00 99.29  ? 31  TYR E CD1   1 
ATOM   5821  C CD2   . TYR E 1 34  ? 44.849 -59.564  -178.864 1.00 105.86 ? 31  TYR E CD2   1 
ATOM   5822  C CE1   . TYR E 1 34  ? 45.082 -61.780  -180.488 1.00 110.31 ? 31  TYR E CE1   1 
ATOM   5823  C CE2   . TYR E 1 34  ? 43.724 -60.295  -179.196 1.00 101.87 ? 31  TYR E CE2   1 
ATOM   5824  C CZ    . TYR E 1 34  ? 43.846 -61.402  -180.009 1.00 106.45 ? 31  TYR E CZ    1 
ATOM   5825  O OH    . TYR E 1 34  ? 42.729 -62.133  -180.342 1.00 102.38 ? 31  TYR E OH    1 
ATOM   5826  N N     . THR E 1 35  ? 50.518 -60.008  -179.346 1.00 119.35 ? 32  THR E N     1 
ATOM   5827  C CA    . THR E 1 35  ? 51.793 -59.496  -179.819 1.00 118.57 ? 32  THR E CA    1 
ATOM   5828  C C     . THR E 1 35  ? 51.568 -58.435  -180.896 1.00 123.89 ? 32  THR E C     1 
ATOM   5829  O O     . THR E 1 35  ? 50.473 -58.291  -181.446 1.00 123.44 ? 32  THR E O     1 
ATOM   5830  C CB    . THR E 1 35  ? 52.665 -60.629  -180.359 1.00 113.48 ? 32  THR E CB    1 
ATOM   5831  O OG1   . THR E 1 35  ? 51.958 -61.330  -181.390 1.00 108.01 ? 32  THR E OG1   1 
ATOM   5832  C CG2   . THR E 1 35  ? 53.026 -61.598  -179.245 1.00 124.10 ? 32  THR E CG2   1 
ATOM   5833  N N     . ALA E 1 36  ? 52.629 -57.678  -181.187 1.00 126.70 ? 33  ALA E N     1 
ATOM   5834  C CA    . ALA E 1 36  ? 52.528 -56.593  -182.159 1.00 128.08 ? 33  ALA E CA    1 
ATOM   5835  C C     . ALA E 1 36  ? 52.120 -57.113  -183.533 1.00 128.82 ? 33  ALA E C     1 
ATOM   5836  O O     . ALA E 1 36  ? 51.224 -56.557  -184.181 1.00 127.63 ? 33  ALA E O     1 
ATOM   5837  C CB    . ALA E 1 36  ? 53.857 -55.841  -182.238 1.00 139.27 ? 33  ALA E CB    1 
ATOM   5838  N N     . GLU E 1 37  ? 52.771 -58.184  -183.994 1.00 132.85 ? 34  GLU E N     1 
ATOM   5839  C CA    . GLU E 1 37  ? 52.472 -58.724  -185.317 1.00 146.72 ? 34  GLU E CA    1 
ATOM   5840  C C     . GLU E 1 37  ? 51.040 -59.239  -185.392 1.00 137.26 ? 34  GLU E C     1 
ATOM   5841  O O     . GLU E 1 37  ? 50.309 -58.936  -186.342 1.00 137.07 ? 34  GLU E O     1 
ATOM   5842  C CB    . GLU E 1 37  ? 53.460 -59.836  -185.671 1.00 153.25 ? 34  GLU E CB    1 
ATOM   5843  C CG    . GLU E 1 37  ? 54.911 -59.517  -185.364 1.00 167.28 ? 34  GLU E CG    1 
ATOM   5844  C CD    . GLU E 1 37  ? 55.835 -60.671  -185.698 1.00 199.35 ? 34  GLU E CD    1 
ATOM   5845  O OE1   . GLU E 1 37  ? 55.329 -61.791  -185.922 1.00 184.41 ? 34  GLU E OE1   1 
ATOM   5846  O OE2   . GLU E 1 37  ? 57.065 -60.458  -185.744 1.00 221.70 ? 34  GLU E OE2   1 
ATOM   5847  N N     . GLU E 1 38  ? 50.635 -60.050  -184.410 1.00 132.24 ? 35  GLU E N     1 
ATOM   5848  C CA    . GLU E 1 38  ? 49.266 -60.555  -184.378 1.00 126.52 ? 35  GLU E CA    1 
ATOM   5849  C C     . GLU E 1 38  ? 48.257 -59.414  -184.330 1.00 116.41 ? 35  GLU E C     1 
ATOM   5850  O O     . GLU E 1 38  ? 47.253 -59.433  -185.053 1.00 102.31 ? 35  GLU E O     1 
ATOM   5851  C CB    . GLU E 1 38  ? 49.080 -61.493  -183.184 1.00 133.19 ? 35  GLU E CB    1 
ATOM   5852  C CG    . GLU E 1 38  ? 47.805 -62.319  -183.238 1.00 139.35 ? 35  GLU E CG    1 
ATOM   5853  C CD    . GLU E 1 38  ? 47.715 -63.335  -182.116 1.00 138.21 ? 35  GLU E CD    1 
ATOM   5854  O OE1   . GLU E 1 38  ? 46.709 -64.074  -182.061 1.00 132.42 ? 35  GLU E OE1   1 
ATOM   5855  O OE2   . GLU E 1 38  ? 48.646 -63.392  -181.286 1.00 139.49 ? 35  GLU E OE2   1 
ATOM   5856  N N     . TYR E 1 39  ? 48.509 -58.410  -183.483 1.00 117.55 ? 36  TYR E N     1 
ATOM   5857  C CA    . TYR E 1 39  ? 47.625 -57.251  -183.404 1.00 113.50 ? 36  TYR E CA    1 
ATOM   5858  C C     . TYR E 1 39  ? 47.468 -56.580  -184.762 1.00 119.35 ? 36  TYR E C     1 
ATOM   5859  O O     . TYR E 1 39  ? 46.346 -56.346  -185.225 1.00 121.54 ? 36  TYR E O     1 
ATOM   5860  C CB    . TYR E 1 39  ? 48.152 -56.236  -182.387 1.00 107.43 ? 36  TYR E CB    1 
ATOM   5861  C CG    . TYR E 1 39  ? 47.666 -54.834  -182.694 1.00 111.05 ? 36  TYR E CG    1 
ATOM   5862  C CD1   . TYR E 1 39  ? 46.320 -54.503  -182.588 1.00 113.71 ? 36  TYR E CD1   1 
ATOM   5863  C CD2   . TYR E 1 39  ? 48.546 -53.858  -183.144 1.00 126.49 ? 36  TYR E CD2   1 
ATOM   5864  C CE1   . TYR E 1 39  ? 45.871 -53.232  -182.896 1.00 118.73 ? 36  TYR E CE1   1 
ATOM   5865  C CE2   . TYR E 1 39  ? 48.106 -52.586  -183.453 1.00 138.69 ? 36  TYR E CE2   1 
ATOM   5866  C CZ    . TYR E 1 39  ? 46.769 -52.279  -183.326 1.00 125.72 ? 36  TYR E CZ    1 
ATOM   5867  O OH    . TYR E 1 39  ? 46.331 -51.013  -183.636 1.00 118.41 ? 36  TYR E OH    1 
ATOM   5868  N N     . GLN E 1 40  ? 48.588 -56.213  -185.389 1.00 119.93 ? 37  GLN E N     1 
ATOM   5869  C CA    . GLN E 1 40  ? 48.520 -55.479  -186.648 1.00 129.96 ? 37  GLN E CA    1 
ATOM   5870  C C     . GLN E 1 40  ? 47.850 -56.307  -187.736 1.00 116.27 ? 37  GLN E C     1 
ATOM   5871  O O     . GLN E 1 40  ? 47.025 -55.791  -188.503 1.00 114.94 ? 37  GLN E O     1 
ATOM   5872  C CB    . GLN E 1 40  ? 49.921 -55.049  -187.080 1.00 142.71 ? 37  GLN E CB    1 
ATOM   5873  C CG    . GLN E 1 40  ? 49.948 -53.768  -187.894 1.00 144.13 ? 37  GLN E CG    1 
ATOM   5874  C CD    . GLN E 1 40  ? 51.334 -53.431  -188.401 1.00 147.60 ? 37  GLN E CD    1 
ATOM   5875  O OE1   . GLN E 1 40  ? 52.250 -54.249  -188.329 1.00 145.43 ? 37  GLN E OE1   1 
ATOM   5876  N NE2   . GLN E 1 40  ? 51.496 -52.218  -188.918 1.00 155.35 ? 37  GLN E NE2   1 
ATOM   5877  N N     . ALA E 1 41  ? 48.193 -57.596  -187.819 1.00 113.30 ? 38  ALA E N     1 
ATOM   5878  C CA    . ALA E 1 41  ? 47.574 -58.469  -188.809 1.00 112.33 ? 38  ALA E CA    1 
ATOM   5879  C C     . ALA E 1 41  ? 46.065 -58.532  -188.618 1.00 113.12 ? 38  ALA E C     1 
ATOM   5880  O O     . ALA E 1 41  ? 45.301 -58.360  -189.575 1.00 108.02 ? 38  ALA E O     1 
ATOM   5881  C CB    . ALA E 1 41  ? 48.189 -59.867  -188.732 1.00 117.49 ? 38  ALA E CB    1 
ATOM   5882  N N     . ILE E 1 42  ? 45.615 -58.777  -187.383 1.00 116.34 ? 39  ILE E N     1 
ATOM   5883  C CA    . ILE E 1 42  ? 44.182 -58.878  -187.123 1.00 112.00 ? 39  ILE E CA    1 
ATOM   5884  C C     . ILE E 1 42  ? 43.487 -57.558  -187.429 1.00 104.82 ? 39  ILE E C     1 
ATOM   5885  O O     . ILE E 1 42  ? 42.410 -57.537  -188.032 1.00 105.23 ? 39  ILE E O     1 
ATOM   5886  C CB    . ILE E 1 42  ? 43.924 -59.330  -185.674 1.00 115.77 ? 39  ILE E CB    1 
ATOM   5887  C CG1   . ILE E 1 42  ? 44.276 -60.806  -185.500 1.00 113.79 ? 39  ILE E CG1   1 
ATOM   5888  C CG2   . ILE E 1 42  ? 42.467 -59.112  -185.305 1.00 112.48 ? 39  ILE E CG2   1 
ATOM   5889  C CD1   . ILE E 1 42  ? 44.455 -61.225  -184.059 1.00 120.53 ? 39  ILE E CD1   1 
ATOM   5890  N N     . GLN E 1 43  ? 44.088 -56.439  -187.019 1.00 104.74 ? 40  GLN E N     1 
ATOM   5891  C CA    . GLN E 1 43  ? 43.489 -55.129  -187.264 1.00 102.28 ? 40  GLN E CA    1 
ATOM   5892  C C     . GLN E 1 43  ? 43.299 -54.877  -188.756 1.00 99.32  ? 40  GLN E C     1 
ATOM   5893  O O     . GLN E 1 43  ? 42.195 -54.541  -189.210 1.00 87.16  ? 40  GLN E O     1 
ATOM   5894  C CB    . GLN E 1 43  ? 44.360 -54.038  -186.637 1.00 88.54  ? 40  GLN E CB    1 
ATOM   5895  C CG    . GLN E 1 43  ? 43.929 -52.608  -186.943 1.00 88.76  ? 40  GLN E CG    1 
ATOM   5896  C CD    . GLN E 1 43  ? 42.738 -52.152  -186.120 1.00 102.11 ? 40  GLN E CD    1 
ATOM   5897  O OE1   . GLN E 1 43  ? 41.764 -52.885  -185.946 1.00 103.72 ? 40  GLN E OE1   1 
ATOM   5898  N NE2   . GLN E 1 43  ? 42.812 -50.930  -185.606 1.00 124.19 ? 40  GLN E NE2   1 
ATOM   5899  N N     . LYS E 1 44  ? 44.373 -55.025  -189.536 1.00 111.19 ? 41  LYS E N     1 
ATOM   5900  C CA    . LYS E 1 44  ? 44.283 -54.765  -190.970 1.00 110.10 ? 41  LYS E CA    1 
ATOM   5901  C C     . LYS E 1 44  ? 43.334 -55.741  -191.656 1.00 119.95 ? 41  LYS E C     1 
ATOM   5902  O O     . LYS E 1 44  ? 42.607 -55.359  -192.581 1.00 116.85 ? 41  LYS E O     1 
ATOM   5903  C CB    . LYS E 1 44  ? 45.672 -54.807  -191.603 1.00 112.70 ? 41  LYS E CB    1 
ATOM   5904  C CG    . LYS E 1 44  ? 46.618 -53.759  -191.037 1.00 120.51 ? 41  LYS E CG    1 
ATOM   5905  C CD    . LYS E 1 44  ? 47.909 -53.674  -191.829 1.00 145.80 ? 41  LYS E CD    1 
ATOM   5906  C CE    . LYS E 1 44  ? 48.880 -52.697  -191.185 1.00 146.46 ? 41  LYS E CE    1 
ATOM   5907  N NZ    . LYS E 1 44  ? 48.270 -51.350  -190.998 1.00 145.78 ? 41  LYS E NZ    1 
ATOM   5908  N N     . ALA E 1 45  ? 43.329 -57.008  -191.228 1.00 115.42 ? 42  ALA E N     1 
ATOM   5909  C CA    . ALA E 1 45  ? 42.390 -57.965  -191.800 1.00 106.17 ? 42  ALA E CA    1 
ATOM   5910  C C     . ALA E 1 45  ? 40.950 -57.634  -191.429 1.00 105.94 ? 42  ALA E C     1 
ATOM   5911  O O     . ALA E 1 45  ? 40.029 -57.954  -192.188 1.00 106.04 ? 42  ALA E O     1 
ATOM   5912  C CB    . ALA E 1 45  ? 42.749 -59.382  -191.354 1.00 107.37 ? 42  ALA E CB    1 
ATOM   5913  N N     . LEU E 1 46  ? 40.733 -57.006  -190.272 1.00 104.12 ? 43  LEU E N     1 
ATOM   5914  C CA    . LEU E 1 46  ? 39.389 -56.625  -189.861 1.00 108.91 ? 43  LEU E CA    1 
ATOM   5915  C C     . LEU E 1 46  ? 38.921 -55.348  -190.538 1.00 108.21 ? 43  LEU E C     1 
ATOM   5916  O O     . LEU E 1 46  ? 37.711 -55.110  -190.612 1.00 109.63 ? 43  LEU E O     1 
ATOM   5917  C CB    . LEU E 1 46  ? 39.320 -56.456  -188.342 1.00 116.67 ? 43  LEU E CB    1 
ATOM   5918  C CG    . LEU E 1 46  ? 39.232 -57.745  -187.523 1.00 112.09 ? 43  LEU E CG    1 
ATOM   5919  C CD1   . LEU E 1 46  ? 39.190 -57.445  -186.037 1.00 103.07 ? 43  LEU E CD1   1 
ATOM   5920  C CD2   . LEU E 1 46  ? 38.018 -58.557  -187.940 1.00 111.55 ? 43  LEU E CD2   1 
ATOM   5921  N N     . ARG E 1 47  ? 39.847 -54.521  -191.027 1.00 113.16 ? 44  ARG E N     1 
ATOM   5922  C CA    . ARG E 1 47  ? 39.426 -53.395  -191.851 1.00 106.08 ? 44  ARG E CA    1 
ATOM   5923  C C     . ARG E 1 47  ? 38.942 -53.829  -193.230 1.00 105.21 ? 44  ARG E C     1 
ATOM   5924  O O     . ARG E 1 47  ? 38.339 -53.014  -193.937 1.00 110.23 ? 44  ARG E O     1 
ATOM   5925  C CB    . ARG E 1 47  ? 40.562 -52.381  -192.004 1.00 99.02  ? 44  ARG E CB    1 
ATOM   5926  C CG    . ARG E 1 47  ? 40.764 -51.486  -190.796 1.00 83.44  ? 44  ARG E CG    1 
ATOM   5927  C CD    . ARG E 1 47  ? 41.819 -50.423  -191.067 1.00 93.78  ? 44  ARG E CD    1 
ATOM   5928  N NE    . ARG E 1 47  ? 43.180 -50.917  -190.888 1.00 104.41 ? 44  ARG E NE    1 
ATOM   5929  C CZ    . ARG E 1 47  ? 43.993 -50.512  -189.917 1.00 116.91 ? 44  ARG E CZ    1 
ATOM   5930  N NH1   . ARG E 1 47  ? 43.578 -49.610  -189.038 1.00 118.04 ? 44  ARG E NH1   1 
ATOM   5931  N NH2   . ARG E 1 47  ? 45.219 -51.006  -189.822 1.00 126.41 ? 44  ARG E NH2   1 
ATOM   5932  N N     . GLN E 1 48  ? 39.190 -55.077  -193.625 1.00 95.74  ? 45  GLN E N     1 
ATOM   5933  C CA    . GLN E 1 48  ? 38.727 -55.574  -194.915 1.00 88.90  ? 45  GLN E CA    1 
ATOM   5934  C C     . GLN E 1 48  ? 37.204 -55.608  -194.970 1.00 100.44 ? 45  GLN E C     1 
ATOM   5935  O O     . GLN E 1 48  ? 36.522 -55.701  -193.947 1.00 110.03 ? 45  GLN E O     1 
ATOM   5936  C CB    . GLN E 1 48  ? 39.282 -56.973  -195.179 1.00 84.86  ? 45  GLN E CB    1 
ATOM   5937  C CG    . GLN E 1 48  ? 40.769 -57.015  -195.480 1.00 104.15 ? 45  GLN E CG    1 
ATOM   5938  C CD    . GLN E 1 48  ? 41.228 -58.389  -195.936 1.00 121.42 ? 45  GLN E CD    1 
ATOM   5939  O OE1   . GLN E 1 48  ? 41.072 -59.378  -195.218 1.00 116.83 ? 45  GLN E OE1   1 
ATOM   5940  N NE2   . GLN E 1 48  ? 41.797 -58.457  -197.134 1.00 131.91 ? 45  GLN E NE2   1 
ATOM   5941  N N     . ARG E 1 49  ? 36.673 -55.537  -196.187 1.00 99.27  ? 46  ARG E N     1 
ATOM   5942  C CA    . ARG E 1 49  ? 35.259 -55.752  -196.452 1.00 99.55  ? 46  ARG E CA    1 
ATOM   5943  C C     . ARG E 1 49  ? 35.063 -57.098  -197.138 1.00 90.38  ? 46  ARG E C     1 
ATOM   5944  O O     . ARG E 1 49  ? 35.998 -57.675  -197.699 1.00 103.68 ? 46  ARG E O     1 
ATOM   5945  C CB    . ARG E 1 49  ? 34.686 -54.625  -197.317 1.00 100.48 ? 46  ARG E CB    1 
ATOM   5946  C CG    . ARG E 1 49  ? 34.506 -53.309  -196.575 1.00 99.73  ? 46  ARG E CG    1 
ATOM   5947  C CD    . ARG E 1 49  ? 33.965 -52.226  -197.491 1.00 109.51 ? 46  ARG E CD    1 
ATOM   5948  N NE    . ARG E 1 49  ? 33.472 -51.068  -196.751 1.00 126.06 ? 46  ARG E NE    1 
ATOM   5949  C CZ    . ARG E 1 49  ? 34.244 -50.086  -196.294 1.00 125.53 ? 46  ARG E CZ    1 
ATOM   5950  N NH1   . ARG E 1 49  ? 35.553 -50.116  -196.503 1.00 115.81 ? 46  ARG E NH1   1 
ATOM   5951  N NH2   . ARG E 1 49  ? 33.707 -49.071  -195.631 1.00 129.22 ? 46  ARG E NH2   1 
ATOM   5952  N N     . LEU E 1 50  ? 33.833 -57.601  -197.087 1.00 89.34  ? 47  LEU E N     1 
ATOM   5953  C CA    . LEU E 1 50  ? 33.532 -58.922  -197.620 1.00 117.18 ? 47  LEU E CA    1 
ATOM   5954  C C     . LEU E 1 50  ? 33.073 -58.831  -199.070 1.00 110.67 ? 47  LEU E C     1 
ATOM   5955  O O     . LEU E 1 50  ? 32.549 -57.807  -199.516 1.00 109.60 ? 47  LEU E O     1 
ATOM   5956  C CB    . LEU E 1 50  ? 32.458 -59.625  -196.786 1.00 136.73 ? 47  LEU E CB    1 
ATOM   5957  C CG    . LEU E 1 50  ? 32.786 -60.046  -195.349 1.00 112.82 ? 47  LEU E CG    1 
ATOM   5958  C CD1   . LEU E 1 50  ? 34.170 -60.681  -195.253 1.00 111.82 ? 47  LEU E CD1   1 
ATOM   5959  C CD2   . LEU E 1 50  ? 32.645 -58.887  -194.382 1.00 107.30 ? 47  LEU E CD2   1 
ATOM   5960  N N     . GLY E 1 51  ? 33.280 -59.921  -199.805 1.00 111.19 ? 48  GLY E N     1 
ATOM   5961  C CA    . GLY E 1 51  ? 32.859 -60.007  -201.182 1.00 121.25 ? 48  GLY E CA    1 
ATOM   5962  C C     . GLY E 1 51  ? 31.509 -60.681  -201.329 1.00 133.45 ? 48  GLY E C     1 
ATOM   5963  O O     . GLY E 1 51  ? 30.923 -61.168  -200.356 1.00 143.64 ? 48  GLY E O     1 
ATOM   5964  N N     . PRO E 1 52  ? 30.981 -60.707  -202.556 1.00 128.92 ? 49  PRO E N     1 
ATOM   5965  C CA    . PRO E 1 52  ? 29.690 -61.378  -202.792 1.00 122.22 ? 49  PRO E CA    1 
ATOM   5966  C C     . PRO E 1 52  ? 29.678 -62.855  -202.427 1.00 129.22 ? 49  PRO E C     1 
ATOM   5967  O O     . PRO E 1 52  ? 28.590 -63.422  -202.266 1.00 129.60 ? 49  PRO E O     1 
ATOM   5968  C CB    . PRO E 1 52  ? 29.463 -61.176  -204.295 1.00 130.98 ? 49  PRO E CB    1 
ATOM   5969  C CG    . PRO E 1 52  ? 30.213 -59.929  -204.614 1.00 138.95 ? 49  PRO E CG    1 
ATOM   5970  C CD    . PRO E 1 52  ? 31.440 -59.965  -203.743 1.00 134.80 ? 49  PRO E CD    1 
ATOM   5971  N N     . GLU E 1 53  ? 30.841 -63.497  -202.292 1.00 133.36 ? 50  GLU E N     1 
ATOM   5972  C CA    . GLU E 1 53  ? 30.886 -64.911  -201.931 1.00 138.74 ? 50  GLU E CA    1 
ATOM   5973  C C     . GLU E 1 53  ? 30.361 -65.180  -200.527 1.00 124.66 ? 50  GLU E C     1 
ATOM   5974  O O     . GLU E 1 53  ? 30.153 -66.346  -200.175 1.00 125.21 ? 50  GLU E O     1 
ATOM   5975  C CB    . GLU E 1 53  ? 32.315 -65.450  -202.054 1.00 148.69 ? 50  GLU E CB    1 
ATOM   5976  C CG    . GLU E 1 53  ? 32.982 -65.188  -203.398 1.00 156.48 ? 50  GLU E CG    1 
ATOM   5977  C CD    . GLU E 1 53  ? 33.578 -63.799  -203.507 1.00 143.42 ? 50  GLU E CD    1 
ATOM   5978  O OE1   . GLU E 1 53  ? 32.805 -62.821  -203.565 1.00 131.95 ? 50  GLU E OE1   1 
ATOM   5979  O OE2   . GLU E 1 53  ? 34.820 -63.687  -203.544 1.00 143.09 ? 50  GLU E OE2   1 
ATOM   5980  N N     . TYR E 1 54  ? 30.145 -64.140  -199.727 1.00 117.09 ? 51  TYR E N     1 
ATOM   5981  C CA    . TYR E 1 54  ? 29.614 -64.262  -198.375 1.00 113.27 ? 51  TYR E CA    1 
ATOM   5982  C C     . TYR E 1 54  ? 28.204 -63.720  -198.243 1.00 110.53 ? 51  TYR E C     1 
ATOM   5983  O O     . TYR E 1 54  ? 27.371 -64.331  -197.569 1.00 115.41 ? 51  TYR E O     1 
ATOM   5984  C CB    . TYR E 1 54  ? 30.521 -63.530  -197.380 1.00 110.32 ? 51  TYR E CB    1 
ATOM   5985  C CG    . TYR E 1 54  ? 31.851 -64.201  -197.142 1.00 119.64 ? 51  TYR E CG    1 
ATOM   5986  C CD1   . TYR E 1 54  ? 31.941 -65.579  -197.007 1.00 125.33 ? 51  TYR E CD1   1 
ATOM   5987  C CD2   . TYR E 1 54  ? 33.017 -63.454  -197.043 1.00 106.13 ? 51  TYR E CD2   1 
ATOM   5988  C CE1   . TYR E 1 54  ? 33.154 -66.196  -196.783 1.00 133.02 ? 51  TYR E CE1   1 
ATOM   5989  C CE2   . TYR E 1 54  ? 34.235 -64.061  -196.819 1.00 110.72 ? 51  TYR E CE2   1 
ATOM   5990  C CZ    . TYR E 1 54  ? 34.298 -65.432  -196.690 1.00 127.49 ? 51  TYR E CZ    1 
ATOM   5991  O OH    . TYR E 1 54  ? 35.508 -66.044  -196.467 1.00 126.03 ? 51  TYR E OH    1 
ATOM   5992  N N     . ILE E 1 55  ? 27.923 -62.580  -198.875 1.00 91.02  ? 52  ILE E N     1 
ATOM   5993  C CA    . ILE E 1 55  ? 26.619 -61.948  -198.753 1.00 90.53  ? 52  ILE E CA    1 
ATOM   5994  C C     . ILE E 1 55  ? 25.547 -62.821  -199.395 1.00 104.40 ? 52  ILE E C     1 
ATOM   5995  O O     . ILE E 1 55  ? 25.793 -63.537  -200.376 1.00 114.65 ? 52  ILE E O     1 
ATOM   5996  C CB    . ILE E 1 55  ? 26.651 -60.548  -199.392 1.00 105.88 ? 52  ILE E CB    1 
ATOM   5997  C CG1   . ILE E 1 55  ? 27.974 -59.847  -199.073 1.00 104.06 ? 52  ILE E CG1   1 
ATOM   5998  C CG2   . ILE E 1 55  ? 25.483 -59.714  -198.901 1.00 105.25 ? 52  ILE E CG2   1 
ATOM   5999  C CD1   . ILE E 1 55  ? 28.220 -59.624  -197.597 1.00 100.49 ? 52  ILE E CD1   1 
ATOM   6000  N N     . SER E 1 56  ? 24.342 -62.764  -198.831 1.00 107.32 ? 53  SER E N     1 
ATOM   6001  C CA    . SER E 1 56  ? 23.180 -63.431  -199.404 1.00 122.54 ? 53  SER E CA    1 
ATOM   6002  C C     . SER E 1 56  ? 22.008 -62.459  -199.444 1.00 123.25 ? 53  SER E C     1 
ATOM   6003  O O     . SER E 1 56  ? 22.171 -61.274  -199.134 1.00 104.03 ? 53  SER E O     1 
ATOM   6004  C CB    . SER E 1 56  ? 22.824 -64.686  -198.604 1.00 122.11 ? 53  SER E CB    1 
ATOM   6005  O OG    . SER E 1 56  ? 23.874 -65.638  -198.652 1.00 130.14 ? 53  SER E OG    1 
ATOM   6006  N N     . SER E 1 57  ? 20.826 -62.941  -199.823 1.00 129.19 ? 54  SER E N     1 
ATOM   6007  C CA    . SER E 1 57  ? 19.670 -62.075  -199.997 1.00 137.21 ? 54  SER E CA    1 
ATOM   6008  C C     . SER E 1 57  ? 18.409 -62.806  -199.566 1.00 134.51 ? 54  SER E C     1 
ATOM   6009  O O     . SER E 1 57  ? 18.258 -64.005  -199.817 1.00 132.07 ? 54  SER E O     1 
ATOM   6010  C CB    . SER E 1 57  ? 19.531 -61.610  -201.451 1.00 147.88 ? 54  SER E CB    1 
ATOM   6011  O OG    . SER E 1 57  ? 18.946 -62.618  -202.256 1.00 156.52 ? 54  SER E OG    1 
ATOM   6012  N N     . ARG E 1 58  ? 17.505 -62.071  -198.921 1.00 141.92 ? 55  ARG E N     1 
ATOM   6013  C CA    . ARG E 1 58  ? 16.205 -62.574  -198.504 1.00 156.37 ? 55  ARG E CA    1 
ATOM   6014  C C     . ARG E 1 58  ? 15.120 -61.628  -199.000 1.00 156.33 ? 55  ARG E C     1 
ATOM   6015  O O     . ARG E 1 58  ? 15.397 -60.562  -199.556 1.00 148.02 ? 55  ARG E O     1 
ATOM   6016  C CB    . ARG E 1 58  ? 16.110 -62.717  -196.979 1.00 158.81 ? 55  ARG E CB    1 
ATOM   6017  C CG    . ARG E 1 58  ? 15.978 -61.395  -196.242 1.00 164.77 ? 55  ARG E CG    1 
ATOM   6018  C CD    . ARG E 1 58  ? 15.753 -61.622  -194.760 1.00 144.94 ? 55  ARG E CD    1 
ATOM   6019  N NE    . ARG E 1 58  ? 14.459 -62.235  -194.478 1.00 154.61 ? 55  ARG E NE    1 
ATOM   6020  C CZ    . ARG E 1 58  ? 14.030 -62.551  -193.260 1.00 164.95 ? 55  ARG E CZ    1 
ATOM   6021  N NH1   . ARG E 1 58  ? 14.861 -62.499  -192.229 1.00 167.41 ? 55  ARG E NH1   1 
ATOM   6022  N NH2   . ARG E 1 58  ? 12.827 -63.084  -193.101 1.00 170.17 ? 55  ARG E NH2   1 
ATOM   6023  N N     . MET E 1 59  ? 13.870 -62.030  -198.791 1.00 159.06 ? 56  MET E N     1 
ATOM   6024  C CA    . MET E 1 59  ? 12.708 -61.217  -199.140 1.00 161.75 ? 56  MET E CA    1 
ATOM   6025  C C     . MET E 1 59  ? 12.004 -60.799  -197.854 1.00 158.89 ? 56  MET E C     1 
ATOM   6026  O O     . MET E 1 59  ? 11.292 -61.595  -197.236 1.00 154.18 ? 56  MET E O     1 
ATOM   6027  C CB    . MET E 1 59  ? 11.764 -61.980  -200.066 1.00 176.53 ? 56  MET E CB    1 
ATOM   6028  C CG    . MET E 1 59  ? 12.247 -62.065  -201.498 1.00 178.33 ? 56  MET E CG    1 
ATOM   6029  S SD    . MET E 1 59  ? 12.612 -60.417  -202.121 1.00 183.40 ? 56  MET E SD    1 
ATOM   6030  C CE    . MET E 1 59  ? 11.004 -59.643  -201.938 1.00 148.85 ? 56  MET E CE    1 
ATOM   6031  N N     . ALA E 1 60  ? 12.212 -59.545  -197.455 1.00 162.56 ? 57  ALA E N     1 
ATOM   6032  C CA    . ALA E 1 60  ? 11.553 -59.013  -196.272 1.00 174.95 ? 57  ALA E CA    1 
ATOM   6033  C C     . ALA E 1 60  ? 10.047 -58.943  -196.492 1.00 182.01 ? 57  ALA E C     1 
ATOM   6034  O O     . ALA E 1 60  ? 9.569  -58.744  -197.612 1.00 181.79 ? 57  ALA E O     1 
ATOM   6035  C CB    . ALA E 1 60  ? 12.100 -57.626  -195.933 1.00 162.88 ? 57  ALA E CB    1 
ATOM   6036  N N     . GLY E 1 61  ? 9.295  -59.107  -195.407 1.00 188.28 ? 58  GLY E N     1 
ATOM   6037  C CA    . GLY E 1 61  ? 7.854  -58.998  -195.491 1.00 187.31 ? 58  GLY E CA    1 
ATOM   6038  C C     . GLY E 1 61  ? 7.424  -57.562  -195.700 1.00 184.68 ? 58  GLY E C     1 
ATOM   6039  O O     . GLY E 1 61  ? 7.603  -56.720  -194.815 1.00 191.03 ? 58  GLY E O     1 
ATOM   6040  N N     . GLY E 1 62  ? 6.855  -57.267  -196.870 1.00 180.13 ? 59  GLY E N     1 
ATOM   6041  C CA    . GLY E 1 62  ? 6.509  -55.911  -197.235 1.00 163.60 ? 59  GLY E CA    1 
ATOM   6042  C C     . GLY E 1 62  ? 7.662  -55.046  -197.694 1.00 166.78 ? 59  GLY E C     1 
ATOM   6043  O O     . GLY E 1 62  ? 7.428  -54.045  -198.383 1.00 166.41 ? 59  GLY E O     1 
ATOM   6044  N N     . GLY E 1 63  ? 8.899  -55.390  -197.340 1.00 172.99 ? 60  GLY E N     1 
ATOM   6045  C CA    . GLY E 1 63  ? 10.048 -54.596  -197.731 1.00 173.80 ? 60  GLY E CA    1 
ATOM   6046  C C     . GLY E 1 63  ? 10.663 -55.017  -199.050 1.00 164.50 ? 60  GLY E C     1 
ATOM   6047  O O     . GLY E 1 63  ? 9.944  -55.376  -199.988 1.00 150.13 ? 60  GLY E O     1 
ATOM   6048  N N     . GLN E 1 64  ? 11.994 -54.981  -199.137 1.00 162.54 ? 61  GLN E N     1 
ATOM   6049  C CA    . GLN E 1 64  ? 12.683 -55.304  -200.382 1.00 160.41 ? 61  GLN E CA    1 
ATOM   6050  C C     . GLN E 1 64  ? 13.847 -56.256  -200.146 1.00 157.93 ? 61  GLN E C     1 
ATOM   6051  O O     . GLN E 1 64  ? 13.983 -56.831  -199.061 1.00 160.64 ? 61  GLN E O     1 
ATOM   6052  C CB    . GLN E 1 64  ? 13.200 -54.033  -201.066 1.00 170.08 ? 61  GLN E CB    1 
ATOM   6053  C CG    . GLN E 1 64  ? 12.347 -52.796  -200.852 1.00 173.80 ? 61  GLN E CG    1 
ATOM   6054  C CD    . GLN E 1 64  ? 12.853 -51.939  -199.706 1.00 178.91 ? 61  GLN E CD    1 
ATOM   6055  O OE1   . GLN E 1 64  ? 13.075 -52.431  -198.599 1.00 163.99 ? 61  GLN E OE1   1 
ATOM   6056  N NE2   . GLN E 1 64  ? 13.039 -50.650  -199.967 1.00 179.12 ? 61  GLN E NE2   1 
ATOM   6057  N N     . LYS E 1 65  ? 14.676 -56.440  -201.172 1.00 156.74 ? 62  LYS E N     1 
ATOM   6058  C CA    . LYS E 1 65  ? 15.854 -57.291  -201.070 1.00 161.97 ? 62  LYS E CA    1 
ATOM   6059  C C     . LYS E 1 65  ? 16.795 -56.780  -199.985 1.00 156.36 ? 62  LYS E C     1 
ATOM   6060  O O     . LYS E 1 65  ? 17.295 -55.653  -200.064 1.00 136.58 ? 62  LYS E O     1 
ATOM   6061  C CB    . LYS E 1 65  ? 16.568 -57.342  -202.420 1.00 159.69 ? 62  LYS E CB    1 
ATOM   6062  C CG    . LYS E 1 65  ? 17.808 -58.220  -202.452 1.00 156.17 ? 62  LYS E CG    1 
ATOM   6063  C CD    . LYS E 1 65  ? 18.440 -58.204  -203.836 1.00 163.38 ? 62  LYS E CD    1 
ATOM   6064  C CE    . LYS E 1 65  ? 19.749 -58.975  -203.867 1.00 168.40 ? 62  LYS E CE    1 
ATOM   6065  N NZ    . LYS E 1 65  ? 20.340 -58.996  -205.234 1.00 188.42 ? 62  LYS E NZ    1 
ATOM   6066  N N     . VAL E 1 66  ? 17.031 -57.607  -198.970 1.00 154.79 ? 63  VAL E N     1 
ATOM   6067  C CA    . VAL E 1 66  ? 17.965 -57.287  -197.897 1.00 139.48 ? 63  VAL E CA    1 
ATOM   6068  C C     . VAL E 1 66  ? 19.181 -58.193  -198.031 1.00 131.21 ? 63  VAL E C     1 
ATOM   6069  O O     . VAL E 1 66  ? 19.094 -59.308  -198.556 1.00 129.71 ? 63  VAL E O     1 
ATOM   6070  C CB    . VAL E 1 66  ? 17.314 -57.444  -196.505 1.00 128.06 ? 63  VAL E CB    1 
ATOM   6071  C CG1   . VAL E 1 66  ? 18.182 -56.806  -195.431 1.00 135.34 ? 63  VAL E CG1   1 
ATOM   6072  C CG2   . VAL E 1 66  ? 15.921 -56.838  -196.495 1.00 144.69 ? 63  VAL E CG2   1 
ATOM   6073  N N     . CYS E 1 67  ? 20.320 -57.709  -197.545 1.00 129.37 ? 64  CYS E N     1 
ATOM   6074  C CA    . CYS E 1 67  ? 21.581 -58.430  -197.627 1.00 123.75 ? 64  CYS E CA    1 
ATOM   6075  C C     . CYS E 1 67  ? 22.044 -58.814  -196.229 1.00 111.95 ? 64  CYS E C     1 
ATOM   6076  O O     . CYS E 1 67  ? 21.895 -58.037  -195.280 1.00 104.25 ? 64  CYS E O     1 
ATOM   6077  C CB    . CYS E 1 67  ? 22.651 -57.583  -198.320 1.00 134.17 ? 64  CYS E CB    1 
ATOM   6078  S SG    . CYS E 1 67  ? 22.074 -56.702  -199.791 1.00 141.46 ? 64  CYS E SG    1 
ATOM   6079  N N     . TYR E 1 68  ? 22.609 -60.013  -196.106 1.00 114.99 ? 65  TYR E N     1 
ATOM   6080  C CA    . TYR E 1 68  ? 23.061 -60.520  -194.819 1.00 112.50 ? 65  TYR E CA    1 
ATOM   6081  C C     . TYR E 1 68  ? 24.249 -61.450  -195.034 1.00 110.27 ? 65  TYR E C     1 
ATOM   6082  O O     . TYR E 1 68  ? 24.675 -61.700  -196.165 1.00 129.21 ? 65  TYR E O     1 
ATOM   6083  C CB    . TYR E 1 68  ? 21.925 -61.232  -194.078 1.00 113.02 ? 65  TYR E CB    1 
ATOM   6084  C CG    . TYR E 1 68  ? 21.437 -62.501  -194.747 1.00 110.22 ? 65  TYR E CG    1 
ATOM   6085  C CD1   . TYR E 1 68  ? 22.024 -63.729  -194.466 1.00 116.92 ? 65  TYR E CD1   1 
ATOM   6086  C CD2   . TYR E 1 68  ? 20.383 -62.472  -195.651 1.00 118.66 ? 65  TYR E CD2   1 
ATOM   6087  C CE1   . TYR E 1 68  ? 21.582 -64.888  -195.072 1.00 127.84 ? 65  TYR E CE1   1 
ATOM   6088  C CE2   . TYR E 1 68  ? 19.932 -63.629  -196.261 1.00 126.54 ? 65  TYR E CE2   1 
ATOM   6089  C CZ    . TYR E 1 68  ? 20.535 -64.834  -195.967 1.00 127.42 ? 65  TYR E CZ    1 
ATOM   6090  O OH    . TYR E 1 68  ? 20.093 -65.989  -196.571 1.00 105.21 ? 65  TYR E OH    1 
ATOM   6091  N N     . ILE E 1 69  ? 24.779 -61.965  -193.926 1.00 102.29 ? 66  ILE E N     1 
ATOM   6092  C CA    . ILE E 1 69  ? 25.847 -62.958  -193.932 1.00 93.96  ? 66  ILE E CA    1 
ATOM   6093  C C     . ILE E 1 69  ? 25.382 -64.141  -193.096 1.00 99.23  ? 66  ILE E C     1 
ATOM   6094  O O     . ILE E 1 69  ? 24.986 -63.969  -191.937 1.00 111.94 ? 66  ILE E O     1 
ATOM   6095  C CB    . ILE E 1 69  ? 27.170 -62.393  -193.381 1.00 76.36  ? 66  ILE E CB    1 
ATOM   6096  C CG1   . ILE E 1 69  ? 27.569 -61.127  -194.141 1.00 95.75  ? 66  ILE E CG1   1 
ATOM   6097  C CG2   . ILE E 1 69  ? 28.272 -63.434  -193.481 1.00 78.57  ? 66  ILE E CG2   1 
ATOM   6098  C CD1   . ILE E 1 69  ? 28.842 -60.489  -193.630 1.00 105.79 ? 66  ILE E CD1   1 
ATOM   6099  N N     . GLU E 1 70  ? 25.420 -65.335  -193.683 1.00 99.76  ? 67  GLU E N     1 
ATOM   6100  C CA    . GLU E 1 70  ? 24.966 -66.530  -192.983 1.00 108.29 ? 67  GLU E CA    1 
ATOM   6101  C C     . GLU E 1 70  ? 25.820 -66.795  -191.746 1.00 104.38 ? 67  GLU E C     1 
ATOM   6102  O O     . GLU E 1 70  ? 26.979 -66.384  -191.661 1.00 97.56  ? 67  GLU E O     1 
ATOM   6103  C CB    . GLU E 1 70  ? 24.997 -67.738  -193.920 1.00 111.31 ? 67  GLU E CB    1 
ATOM   6104  C CG    . GLU E 1 70  ? 24.048 -67.617  -195.104 1.00 102.31 ? 67  GLU E CG    1 
ATOM   6105  C CD    . GLU E 1 70  ? 23.993 -68.876  -195.945 1.00 114.41 ? 67  GLU E CD    1 
ATOM   6106  O OE1   . GLU E 1 70  ? 23.794 -69.968  -195.372 1.00 113.31 ? 67  GLU E OE1   1 
ATOM   6107  O OE2   . GLU E 1 70  ? 24.148 -68.774  -197.181 1.00 130.73 ? 67  GLU E OE2   1 
ATOM   6108  N N     . GLY E 1 71  ? 25.223 -67.485  -190.775 1.00 97.60  ? 68  GLY E N     1 
ATOM   6109  C CA    . GLY E 1 71  ? 25.865 -67.774  -189.506 1.00 91.34  ? 68  GLY E CA    1 
ATOM   6110  C C     . GLY E 1 71  ? 27.192 -68.498  -189.604 1.00 98.39  ? 68  GLY E C     1 
ATOM   6111  O O     . GLY E 1 71  ? 28.207 -68.005  -189.101 1.00 90.27  ? 68  GLY E O     1 
ATOM   6112  N N     . HIS E 1 72  ? 27.187 -69.682  -190.227 1.00 103.95 ? 69  HIS E N     1 
ATOM   6113  C CA    . HIS E 1 72  ? 28.415 -70.455  -190.392 1.00 105.60 ? 69  HIS E CA    1 
ATOM   6114  C C     . HIS E 1 72  ? 29.516 -69.644  -191.063 1.00 113.30 ? 69  HIS E C     1 
ATOM   6115  O O     . HIS E 1 72  ? 30.700 -69.830  -190.757 1.00 106.68 ? 69  HIS E O     1 
ATOM   6116  C CB    . HIS E 1 72  ? 28.131 -71.723  -191.198 1.00 106.01 ? 69  HIS E CB    1 
ATOM   6117  C CG    . HIS E 1 72  ? 27.461 -71.465  -192.512 1.00 115.16 ? 69  HIS E CG    1 
ATOM   6118  N ND1   . HIS E 1 72  ? 28.154 -71.404  -193.702 1.00 116.52 ? 69  HIS E ND1   1 
ATOM   6119  C CD2   . HIS E 1 72  ? 26.161 -71.252  -192.824 1.00 117.74 ? 69  HIS E CD2   1 
ATOM   6120  C CE1   . HIS E 1 72  ? 27.310 -71.165  -194.690 1.00 128.61 ? 69  HIS E CE1   1 
ATOM   6121  N NE2   . HIS E 1 72  ? 26.094 -71.068  -194.184 1.00 122.25 ? 69  HIS E NE2   1 
ATOM   6122  N N     . ARG E 1 73  ? 29.147 -68.745  -191.979 1.00 112.05 ? 70  ARG E N     1 
ATOM   6123  C CA    . ARG E 1 73  ? 30.131 -67.863  -192.599 1.00 106.17 ? 70  ARG E CA    1 
ATOM   6124  C C     . ARG E 1 73  ? 30.852 -67.026  -191.549 1.00 101.72 ? 70  ARG E C     1 
ATOM   6125  O O     . ARG E 1 73  ? 32.087 -66.989  -191.509 1.00 99.44  ? 70  ARG E O     1 
ATOM   6126  C CB    . ARG E 1 73  ? 29.448 -66.968  -193.634 1.00 105.78 ? 70  ARG E CB    1 
ATOM   6127  C CG    . ARG E 1 73  ? 28.745 -67.735  -194.743 1.00 110.68 ? 70  ARG E CG    1 
ATOM   6128  C CD    . ARG E 1 73  ? 29.690 -68.061  -195.890 1.00 126.02 ? 70  ARG E CD    1 
ATOM   6129  N NE    . ARG E 1 73  ? 29.064 -68.923  -196.890 1.00 120.78 ? 70  ARG E NE    1 
ATOM   6130  C CZ    . ARG E 1 73  ? 28.150 -68.520  -197.766 1.00 112.73 ? 70  ARG E CZ    1 
ATOM   6131  N NH1   . ARG E 1 73  ? 27.746 -67.256  -197.780 1.00 119.68 ? 70  ARG E NH1   1 
ATOM   6132  N NH2   . ARG E 1 73  ? 27.639 -69.383  -198.634 1.00 95.34  ? 70  ARG E NH2   1 
ATOM   6133  N N     . VAL E 1 74  ? 30.090 -66.341  -190.691 1.00 97.63  ? 71  VAL E N     1 
ATOM   6134  C CA    . VAL E 1 74  ? 30.689 -65.512  -189.647 1.00 99.96  ? 71  VAL E CA    1 
ATOM   6135  C C     . VAL E 1 74  ? 31.483 -66.371  -188.670 1.00 94.64  ? 71  VAL E C     1 
ATOM   6136  O O     . VAL E 1 74  ? 32.525 -65.948  -188.153 1.00 77.93  ? 71  VAL E O     1 
ATOM   6137  C CB    . VAL E 1 74  ? 29.604 -64.692  -188.925 1.00 88.04  ? 71  VAL E CB    1 
ATOM   6138  C CG1   . VAL E 1 74  ? 30.236 -63.549  -188.147 1.00 82.19  ? 71  VAL E CG1   1 
ATOM   6139  C CG2   . VAL E 1 74  ? 28.583 -64.167  -189.919 1.00 87.57  ? 71  VAL E CG2   1 
ATOM   6140  N N     . ILE E 1 75  ? 30.991 -67.577  -188.382 1.00 89.19  ? 72  ILE E N     1 
ATOM   6141  C CA    . ILE E 1 75  ? 31.694 -68.474  -187.468 1.00 95.53  ? 72  ILE E CA    1 
ATOM   6142  C C     . ILE E 1 75  ? 33.075 -68.816  -188.019 1.00 102.23 ? 72  ILE E C     1 
ATOM   6143  O O     . ILE E 1 75  ? 34.083 -68.756  -187.304 1.00 99.40  ? 72  ILE E O     1 
ATOM   6144  C CB    . ILE E 1 75  ? 30.854 -69.737  -187.206 1.00 99.92  ? 72  ILE E CB    1 
ATOM   6145  C CG1   . ILE E 1 75  ? 29.653 -69.399  -186.320 1.00 94.35  ? 72  ILE E CG1   1 
ATOM   6146  C CG2   . ILE E 1 75  ? 31.704 -70.829  -186.569 1.00 91.85  ? 72  ILE E CG2   1 
ATOM   6147  C CD1   . ILE E 1 75  ? 28.959 -70.611  -185.733 1.00 105.56 ? 72  ILE E CD1   1 
ATOM   6148  N N     . ASN E 1 76  ? 33.135 -69.191  -189.300 1.00 98.50  ? 73  ASN E N     1 
ATOM   6149  C CA    . ASN E 1 76  ? 34.419 -69.481  -189.932 1.00 99.60  ? 73  ASN E CA    1 
ATOM   6150  C C     . ASN E 1 76  ? 35.303 -68.240  -189.982 1.00 104.47 ? 73  ASN E C     1 
ATOM   6151  O O     . ASN E 1 76  ? 36.518 -68.324  -189.761 1.00 113.26 ? 73  ASN E O     1 
ATOM   6152  C CB    . ASN E 1 76  ? 34.198 -70.037  -191.337 1.00 99.75  ? 73  ASN E CB    1 
ATOM   6153  C CG    . ASN E 1 76  ? 33.650 -71.449  -191.323 1.00 99.79  ? 73  ASN E CG    1 
ATOM   6154  O OD1   . ASN E 1 76  ? 34.119 -72.301  -190.569 1.00 98.75  ? 73  ASN E OD1   1 
ATOM   6155  N ND2   . ASN E 1 76  ? 32.648 -71.704  -192.158 1.00 96.12  ? 73  ASN E ND2   1 
ATOM   6156  N N     . LEU E 1 77  ? 34.710 -67.082  -190.284 1.00 92.45  ? 74  LEU E N     1 
ATOM   6157  C CA    . LEU E 1 77  ? 35.473 -65.838  -190.302 1.00 91.22  ? 74  LEU E CA    1 
ATOM   6158  C C     . LEU E 1 77  ? 36.136 -65.582  -188.955 1.00 99.72  ? 74  LEU E C     1 
ATOM   6159  O O     . LEU E 1 77  ? 37.311 -65.206  -188.896 1.00 106.85 ? 74  LEU E O     1 
ATOM   6160  C CB    . LEU E 1 77  ? 34.562 -64.669  -190.679 1.00 94.42  ? 74  LEU E CB    1 
ATOM   6161  C CG    . LEU E 1 77  ? 34.110 -64.568  -192.136 1.00 87.37  ? 74  LEU E CG    1 
ATOM   6162  C CD1   . LEU E 1 77  ? 32.935 -63.611  -192.266 1.00 81.02  ? 74  LEU E CD1   1 
ATOM   6163  C CD2   . LEU E 1 77  ? 35.261 -64.130  -193.026 1.00 123.96 ? 74  LEU E CD2   1 
ATOM   6164  N N     . ALA E 1 78  ? 35.398 -65.786  -187.863 1.00 90.40  ? 75  ALA E N     1 
ATOM   6165  C CA    . ALA E 1 78  ? 35.959 -65.584  -186.531 1.00 97.20  ? 75  ALA E CA    1 
ATOM   6166  C C     . ALA E 1 78  ? 37.036 -66.618  -186.224 1.00 99.42  ? 75  ALA E C     1 
ATOM   6167  O O     . ALA E 1 78  ? 38.119 -66.275  -185.732 1.00 106.50 ? 75  ALA E O     1 
ATOM   6168  C CB    . ALA E 1 78  ? 34.849 -65.631  -185.482 1.00 88.53  ? 75  ALA E CB    1 
ATOM   6169  N N     . ASN E 1 79  ? 36.750 -67.894  -186.502 1.00 95.99  ? 76  ASN E N     1 
ATOM   6170  C CA    . ASN E 1 79  ? 37.725 -68.952  -186.259 1.00 100.89 ? 76  ASN E CA    1 
ATOM   6171  C C     . ASN E 1 79  ? 39.009 -68.748  -187.050 1.00 106.92 ? 76  ASN E C     1 
ATOM   6172  O O     . ASN E 1 79  ? 40.055 -69.276  -186.659 1.00 106.32 ? 76  ASN E O     1 
ATOM   6173  C CB    . ASN E 1 79  ? 37.120 -70.314  -186.596 1.00 100.99 ? 76  ASN E CB    1 
ATOM   6174  C CG    . ASN E 1 79  ? 36.176 -70.810  -185.522 1.00 112.47 ? 76  ASN E CG    1 
ATOM   6175  O OD1   . ASN E 1 79  ? 36.602 -71.189  -184.431 1.00 111.70 ? 76  ASN E OD1   1 
ATOM   6176  N ND2   . ASN E 1 79  ? 34.884 -70.809  -185.824 1.00 112.49 ? 76  ASN E ND2   1 
ATOM   6177  N N     . GLU E 1 80  ? 38.953 -68.016  -188.160 1.00 105.77 ? 77  GLU E N     1 
ATOM   6178  C CA    . GLU E 1 80  ? 40.169 -67.690  -188.894 1.00 111.17 ? 77  GLU E CA    1 
ATOM   6179  C C     . GLU E 1 80  ? 40.847 -66.435  -188.351 1.00 107.26 ? 77  GLU E C     1 
ATOM   6180  O O     . GLU E 1 80  ? 42.065 -66.425  -188.148 1.00 114.54 ? 77  GLU E O     1 
ATOM   6181  C CB    . GLU E 1 80  ? 39.863 -67.534  -190.386 1.00 110.17 ? 77  GLU E CB    1 
ATOM   6182  C CG    . GLU E 1 80  ? 39.431 -68.828  -191.070 1.00 113.86 ? 77  GLU E CG    1 
ATOM   6183  C CD    . GLU E 1 80  ? 40.443 -69.950  -190.903 1.00 116.71 ? 77  GLU E CD    1 
ATOM   6184  O OE1   . GLU E 1 80  ? 41.660 -69.663  -190.886 1.00 106.87 ? 77  GLU E OE1   1 
ATOM   6185  O OE2   . GLU E 1 80  ? 40.023 -71.120  -190.787 1.00 121.88 ? 77  GLU E OE2   1 
ATOM   6186  N N     . MET E 1 81  ? 40.072 -65.372  -188.117 1.00 108.63 ? 78  MET E N     1 
ATOM   6187  C CA    . MET E 1 81  ? 40.642 -64.110  -187.652 1.00 114.92 ? 78  MET E CA    1 
ATOM   6188  C C     . MET E 1 81  ? 41.347 -64.273  -186.311 1.00 114.16 ? 78  MET E C     1 
ATOM   6189  O O     . MET E 1 81  ? 42.466 -63.783  -186.121 1.00 109.24 ? 78  MET E O     1 
ATOM   6190  C CB    . MET E 1 81  ? 39.548 -63.046  -187.554 1.00 112.91 ? 78  MET E CB    1 
ATOM   6191  C CG    . MET E 1 81  ? 39.080 -62.509  -188.896 1.00 120.23 ? 78  MET E CG    1 
ATOM   6192  S SD    . MET E 1 81  ? 40.329 -61.527  -189.749 1.00 158.60 ? 78  MET E SD    1 
ATOM   6193  C CE    . MET E 1 81  ? 41.115 -60.684  -188.377 1.00 114.45 ? 78  MET E CE    1 
ATOM   6194  N N     . PHE E 1 82  ? 40.706 -64.958  -185.363 1.00 118.21 ? 79  PHE E N     1 
ATOM   6195  C CA    . PHE E 1 82  ? 41.250 -65.097  -184.019 1.00 103.98 ? 79  PHE E CA    1 
ATOM   6196  C C     . PHE E 1 82  ? 41.812 -66.477  -183.721 1.00 94.41  ? 79  PHE E C     1 
ATOM   6197  O O     . PHE E 1 82  ? 42.725 -66.592  -182.901 1.00 95.07  ? 79  PHE E O     1 
ATOM   6198  C CB    . PHE E 1 82  ? 40.176 -64.774  -182.973 1.00 88.29  ? 79  PHE E CB    1 
ATOM   6199  C CG    . PHE E 1 82  ? 39.412 -63.516  -183.259 1.00 83.31  ? 79  PHE E CG    1 
ATOM   6200  C CD1   . PHE E 1 82  ? 38.049 -63.557  -183.499 1.00 71.79  ? 79  PHE E CD1   1 
ATOM   6201  C CD2   . PHE E 1 82  ? 40.058 -62.293  -183.290 1.00 81.48  ? 79  PHE E CD2   1 
ATOM   6202  C CE1   . PHE E 1 82  ? 37.343 -62.398  -183.762 1.00 85.54  ? 79  PHE E CE1   1 
ATOM   6203  C CE2   . PHE E 1 82  ? 39.359 -61.130  -183.552 1.00 81.80  ? 79  PHE E CE2   1 
ATOM   6204  C CZ    . PHE E 1 82  ? 37.999 -61.183  -183.788 1.00 91.98  ? 79  PHE E CZ    1 
ATOM   6205  N N     . GLY E 1 83  ? 41.299 -67.513  -184.362 1.00 84.54  ? 80  GLY E N     1 
ATOM   6206  C CA    . GLY E 1 83  ? 41.672 -68.877  -184.058 1.00 97.53  ? 80  GLY E CA    1 
ATOM   6207  C C     . GLY E 1 83  ? 40.503 -69.646  -183.466 1.00 100.65 ? 80  GLY E C     1 
ATOM   6208  O O     . GLY E 1 83  ? 39.498 -69.080  -183.032 1.00 104.05 ? 80  GLY E O     1 
ATOM   6209  N N     . TYR E 1 84  ? 40.639 -70.976  -183.459 1.00 95.29  ? 81  TYR E N     1 
ATOM   6210  C CA    . TYR E 1 84  ? 39.604 -71.799  -182.841 1.00 94.35  ? 81  TYR E CA    1 
ATOM   6211  C C     . TYR E 1 84  ? 39.536 -71.567  -181.337 1.00 100.19 ? 81  TYR E C     1 
ATOM   6212  O O     . TYR E 1 84  ? 38.484 -71.780  -180.724 1.00 99.08  ? 81  TYR E O     1 
ATOM   6213  C CB    . TYR E 1 84  ? 39.852 -73.277  -183.133 1.00 88.74  ? 81  TYR E CB    1 
ATOM   6214  C CG    . TYR E 1 84  ? 40.940 -73.896  -182.285 1.00 81.63  ? 81  TYR E CG    1 
ATOM   6215  C CD1   . TYR E 1 84  ? 42.280 -73.686  -182.577 1.00 94.19  ? 81  TYR E CD1   1 
ATOM   6216  C CD2   . TYR E 1 84  ? 40.626 -74.696  -181.194 1.00 91.26  ? 81  TYR E CD2   1 
ATOM   6217  C CE1   . TYR E 1 84  ? 43.277 -74.250  -181.804 1.00 87.12  ? 81  TYR E CE1   1 
ATOM   6218  C CE2   . TYR E 1 84  ? 41.617 -75.262  -180.414 1.00 99.73  ? 81  TYR E CE2   1 
ATOM   6219  C CZ    . TYR E 1 84  ? 42.940 -75.037  -180.725 1.00 87.51  ? 81  TYR E CZ    1 
ATOM   6220  O OH    . TYR E 1 84  ? 43.931 -75.601  -179.954 1.00 99.51  ? 81  TYR E OH    1 
ATOM   6221  N N     . ASN E 1 85  ? 40.644 -71.139  -180.731 1.00 85.72  ? 82  ASN E N     1 
ATOM   6222  C CA    . ASN E 1 85  ? 40.708 -70.857  -179.302 1.00 83.97  ? 82  ASN E CA    1 
ATOM   6223  C C     . ASN E 1 85  ? 41.104 -69.411  -179.028 1.00 94.46  ? 82  ASN E C     1 
ATOM   6224  O O     . ASN E 1 85  ? 41.541 -69.090  -177.919 1.00 110.37 ? 82  ASN E O     1 
ATOM   6225  C CB    . ASN E 1 85  ? 41.678 -71.817  -178.611 1.00 96.30  ? 82  ASN E CB    1 
ATOM   6226  C CG    . ASN E 1 85  ? 43.119 -71.570  -179.003 1.00 96.80  ? 82  ASN E CG    1 
ATOM   6227  O OD1   . ASN E 1 85  ? 43.430 -71.373  -180.177 1.00 94.24  ? 82  ASN E OD1   1 
ATOM   6228  N ND2   . ASN E 1 85  ? 44.009 -71.579  -178.017 1.00 108.52 ? 82  ASN E ND2   1 
ATOM   6229  N N     . GLY E 1 86  ? 40.966 -68.533  -180.019 1.00 87.91  ? 83  GLY E N     1 
ATOM   6230  C CA    . GLY E 1 86  ? 41.300 -67.134  -179.844 1.00 91.58  ? 83  GLY E CA    1 
ATOM   6231  C C     . GLY E 1 86  ? 40.088 -66.292  -179.511 1.00 75.82  ? 83  GLY E C     1 
ATOM   6232  O O     . GLY E 1 86  ? 40.215 -65.185  -178.979 1.00 70.01  ? 83  GLY E O     1 
ATOM   6233  N N     . TRP E 1 87  ? 38.904 -66.812  -179.819 1.00 67.89  ? 84  TRP E N     1 
ATOM   6234  C CA    . TRP E 1 87  ? 37.650 -66.145  -179.510 1.00 69.08  ? 84  TRP E CA    1 
ATOM   6235  C C     . TRP E 1 87  ? 36.761 -67.093  -178.718 1.00 77.21  ? 84  TRP E C     1 
ATOM   6236  O O     . TRP E 1 87  ? 36.933 -68.314  -178.749 1.00 80.23  ? 84  TRP E O     1 
ATOM   6237  C CB    . TRP E 1 87  ? 36.924 -65.682  -180.781 1.00 76.48  ? 84  TRP E CB    1 
ATOM   6238  C CG    . TRP E 1 87  ? 36.294 -66.802  -181.549 1.00 71.48  ? 84  TRP E CG    1 
ATOM   6239  C CD1   . TRP E 1 87  ? 36.941 -67.795  -182.223 1.00 83.03  ? 84  TRP E CD1   1 
ATOM   6240  C CD2   . TRP E 1 87  ? 34.893 -67.046  -181.725 1.00 65.03  ? 84  TRP E CD2   1 
ATOM   6241  N NE1   . TRP E 1 87  ? 36.032 -68.642  -182.807 1.00 83.11  ? 84  TRP E NE1   1 
ATOM   6242  C CE2   . TRP E 1 87  ? 34.767 -68.205  -182.516 1.00 75.02  ? 84  TRP E CE2   1 
ATOM   6243  C CE3   . TRP E 1 87  ? 33.734 -66.397  -181.290 1.00 68.79  ? 84  TRP E CE3   1 
ATOM   6244  C CZ2   . TRP E 1 87  ? 33.530 -68.729  -182.882 1.00 79.69  ? 84  TRP E CZ2   1 
ATOM   6245  C CZ3   . TRP E 1 87  ? 32.505 -66.919  -181.655 1.00 73.65  ? 84  TRP E CZ3   1 
ATOM   6246  C CH2   . TRP E 1 87  ? 32.413 -68.073  -182.442 1.00 75.45  ? 84  TRP E CH2   1 
ATOM   6247  N N     . ALA E 1 88  ? 35.798 -66.510  -178.008 1.00 86.48  ? 85  ALA E N     1 
ATOM   6248  C CA    . ALA E 1 88  ? 34.865 -67.276  -177.198 1.00 73.00  ? 85  ALA E CA    1 
ATOM   6249  C C     . ALA E 1 88  ? 33.578 -66.481  -177.050 1.00 68.45  ? 85  ALA E C     1 
ATOM   6250  O O     . ALA E 1 88  ? 33.613 -65.252  -176.956 1.00 60.34  ? 85  ALA E O     1 
ATOM   6251  C CB    . ALA E 1 88  ? 35.454 -67.594  -175.819 1.00 65.80  ? 85  ALA E CB    1 
ATOM   6252  N N     . HIS E 1 89  ? 32.449 -67.185  -177.027 1.00 64.11  ? 86  HIS E N     1 
ATOM   6253  C CA    . HIS E 1 89  ? 31.153 -66.552  -176.838 1.00 70.03  ? 86  HIS E CA    1 
ATOM   6254  C C     . HIS E 1 89  ? 30.383 -67.268  -175.737 1.00 80.72  ? 86  HIS E C     1 
ATOM   6255  O O     . HIS E 1 89  ? 30.660 -68.423  -175.402 1.00 65.65  ? 86  HIS E O     1 
ATOM   6256  C CB    . HIS E 1 89  ? 30.335 -66.520  -178.143 1.00 54.67  ? 86  HIS E CB    1 
ATOM   6257  C CG    . HIS E 1 89  ? 29.622 -67.800  -178.456 1.00 62.19  ? 86  HIS E CG    1 
ATOM   6258  N ND1   . HIS E 1 89  ? 28.389 -67.831  -179.071 1.00 66.68  ? 86  HIS E ND1   1 
ATOM   6259  C CD2   . HIS E 1 89  ? 29.980 -69.093  -178.270 1.00 65.95  ? 86  HIS E CD2   1 
ATOM   6260  C CE1   . HIS E 1 89  ? 28.009 -69.085  -179.232 1.00 69.23  ? 86  HIS E CE1   1 
ATOM   6261  N NE2   . HIS E 1 89  ? 28.956 -69.872  -178.755 1.00 77.06  ? 86  HIS E NE2   1 
ATOM   6262  N N     . SER E 1 90  ? 29.412 -66.556  -175.170 1.00 86.27  ? 87  SER E N     1 
ATOM   6263  C CA    . SER E 1 90  ? 28.603 -67.085  -174.083 1.00 67.33  ? 87  SER E CA    1 
ATOM   6264  C C     . SER E 1 90  ? 27.239 -66.415  -174.107 1.00 60.52  ? 87  SER E C     1 
ATOM   6265  O O     . SER E 1 90  ? 27.097 -65.277  -174.562 1.00 68.96  ? 87  SER E O     1 
ATOM   6266  C CB    . SER E 1 90  ? 29.276 -66.866  -172.723 1.00 74.15  ? 87  SER E CB    1 
ATOM   6267  O OG    . SER E 1 90  ? 29.738 -65.532  -172.595 1.00 67.08  ? 87  SER E OG    1 
ATOM   6268  N N     . ILE E 1 91  ? 26.238 -67.132  -173.604 1.00 55.57  ? 88  ILE E N     1 
ATOM   6269  C CA    . ILE E 1 91  ? 24.871 -66.628  -173.535 1.00 56.69  ? 88  ILE E CA    1 
ATOM   6270  C C     . ILE E 1 91  ? 24.683 -66.027  -172.147 1.00 68.28  ? 88  ILE E C     1 
ATOM   6271  O O     . ILE E 1 91  ? 24.540 -66.747  -171.158 1.00 82.93  ? 88  ILE E O     1 
ATOM   6272  C CB    . ILE E 1 91  ? 23.845 -67.725  -173.819 1.00 68.85  ? 88  ILE E CB    1 
ATOM   6273  C CG1   . ILE E 1 91  ? 24.203 -68.472  -175.104 1.00 58.93  ? 88  ILE E CG1   1 
ATOM   6274  C CG2   . ILE E 1 91  ? 22.447 -67.128  -173.920 1.00 59.02  ? 88  ILE E CG2   1 
ATOM   6275  C CD1   . ILE E 1 91  ? 23.276 -69.624  -175.407 1.00 63.34  ? 88  ILE E CD1   1 
ATOM   6276  N N     . THR E 1 92  ? 24.690 -64.694  -172.070 1.00 68.16  ? 89  THR E N     1 
ATOM   6277  C CA    . THR E 1 92  ? 24.479 -64.037  -170.785 1.00 64.12  ? 89  THR E CA    1 
ATOM   6278  C C     . THR E 1 92  ? 23.063 -64.277  -170.276 1.00 55.30  ? 89  THR E C     1 
ATOM   6279  O O     . THR E 1 92  ? 22.864 -64.570  -169.091 1.00 99.99  ? 89  THR E O     1 
ATOM   6280  C CB    . THR E 1 92  ? 24.766 -62.540  -170.902 1.00 70.88  ? 89  THR E CB    1 
ATOM   6281  O OG1   . THR E 1 92  ? 26.171 -62.336  -171.096 1.00 72.51  ? 89  THR E OG1   1 
ATOM   6282  C CG2   . THR E 1 92  ? 24.328 -61.808  -169.641 1.00 58.83  ? 89  THR E CG2   1 
ATOM   6283  N N     . GLN E 1 93  ? 22.072 -64.175  -171.159 1.00 50.35  ? 90  GLN E N     1 
ATOM   6284  C CA    . GLN E 1 93  ? 20.688 -64.432  -170.792 1.00 66.07  ? 90  GLN E CA    1 
ATOM   6285  C C     . GLN E 1 93  ? 19.856 -64.579  -172.055 1.00 76.67  ? 90  GLN E C     1 
ATOM   6286  O O     . GLN E 1 93  ? 20.052 -63.838  -173.022 1.00 76.43  ? 90  GLN E O     1 
ATOM   6287  C CB    . GLN E 1 93  ? 20.116 -63.306  -169.918 1.00 58.46  ? 90  GLN E CB    1 
ATOM   6288  C CG    . GLN E 1 93  ? 18.667 -63.525  -169.505 1.00 62.75  ? 90  GLN E CG    1 
ATOM   6289  C CD    . GLN E 1 93  ? 18.149 -62.444  -168.579 1.00 98.29  ? 90  GLN E CD    1 
ATOM   6290  O OE1   . GLN E 1 93  ? 18.143 -61.264  -168.926 1.00 116.75 ? 90  GLN E OE1   1 
ATOM   6291  N NE2   . GLN E 1 93  ? 17.707 -62.844  -167.391 1.00 112.76 ? 90  GLN E NE2   1 
ATOM   6292  N N     . GLN E 1 94  ? 18.938 -65.543  -172.039 1.00 75.59  ? 91  GLN E N     1 
ATOM   6293  C CA    . GLN E 1 94  ? 17.943 -65.709  -173.088 1.00 75.80  ? 91  GLN E CA    1 
ATOM   6294  C C     . GLN E 1 94  ? 16.570 -65.750  -172.438 1.00 78.58  ? 91  GLN E C     1 
ATOM   6295  O O     . GLN E 1 94  ? 16.342 -66.538  -171.514 1.00 87.96  ? 91  GLN E O     1 
ATOM   6296  C CB    . GLN E 1 94  ? 18.186 -66.982  -173.903 1.00 90.00  ? 91  GLN E CB    1 
ATOM   6297  C CG    . GLN E 1 94  ? 16.956 -67.467  -174.650 1.00 97.78  ? 91  GLN E CG    1 
ATOM   6298  C CD    . GLN E 1 94  ? 17.275 -68.539  -175.666 1.00 88.55  ? 91  GLN E CD    1 
ATOM   6299  O OE1   . GLN E 1 94  ? 16.673 -69.612  -175.663 1.00 100.10 ? 91  GLN E OE1   1 
ATOM   6300  N NE2   . GLN E 1 94  ? 18.217 -68.249  -176.555 1.00 63.51  ? 91  GLN E NE2   1 
ATOM   6301  N N     . ASN E 1 95  ? 15.658 -64.912  -172.924 1.00 76.89  ? 92  ASN E N     1 
ATOM   6302  C CA    . ASN E 1 95  ? 14.332 -64.777  -172.338 1.00 85.94  ? 92  ASN E CA    1 
ATOM   6303  C C     . ASN E 1 95  ? 13.283 -64.794  -173.438 1.00 76.40  ? 92  ASN E C     1 
ATOM   6304  O O     . ASN E 1 95  ? 13.382 -64.036  -174.408 1.00 82.58  ? 92  ASN E O     1 
ATOM   6305  C CB    . ASN E 1 95  ? 14.218 -63.487  -171.519 1.00 84.63  ? 92  ASN E CB    1 
ATOM   6306  C CG    . ASN E 1 95  ? 12.854 -63.321  -170.882 1.00 95.20  ? 92  ASN E CG    1 
ATOM   6307  O OD1   . ASN E 1 95  ? 12.520 -64.009  -169.917 1.00 82.41  ? 92  ASN E OD1   1 
ATOM   6308  N ND2   . ASN E 1 95  ? 12.055 -62.409  -171.422 1.00 86.63  ? 92  ASN E ND2   1 
ATOM   6309  N N     . VAL E 1 96  ? 12.281 -65.654  -173.280 1.00 75.42  ? 93  VAL E N     1 
ATOM   6310  C CA    . VAL E 1 96  ? 11.175 -65.735  -174.228 1.00 71.11  ? 93  VAL E CA    1 
ATOM   6311  C C     . VAL E 1 96  ? 10.235 -64.562  -173.979 1.00 79.01  ? 93  VAL E C     1 
ATOM   6312  O O     . VAL E 1 96  ? 9.672  -64.425  -172.888 1.00 90.96  ? 93  VAL E O     1 
ATOM   6313  C CB    . VAL E 1 96  ? 10.433 -67.073  -174.100 1.00 73.29  ? 93  VAL E CB    1 
ATOM   6314  C CG1   . VAL E 1 96  ? 9.279  -67.134  -175.087 1.00 67.91  ? 93  VAL E CG1   1 
ATOM   6315  C CG2   . VAL E 1 96  ? 11.392 -68.236  -174.314 1.00 91.34  ? 93  VAL E CG2   1 
ATOM   6316  N N     . ASP E 1 97  ? 10.064 -63.713  -174.994 1.00 85.41  ? 94  ASP E N     1 
ATOM   6317  C CA    . ASP E 1 97  ? 9.236  -62.522  -174.832 1.00 74.71  ? 94  ASP E CA    1 
ATOM   6318  C C     . ASP E 1 97  ? 7.757  -62.884  -174.759 1.00 78.45  ? 94  ASP E C     1 
ATOM   6319  O O     . ASP E 1 97  ? 7.037  -62.416  -173.869 1.00 98.50  ? 94  ASP E O     1 
ATOM   6320  C CB    . ASP E 1 97  ? 9.497  -61.540  -175.974 1.00 72.75  ? 94  ASP E CB    1 
ATOM   6321  C CG    . ASP E 1 97  ? 10.772 -60.742  -175.776 1.00 86.15  ? 94  ASP E CG    1 
ATOM   6322  O OD1   . ASP E 1 97  ? 10.950 -60.165  -174.683 1.00 85.71  ? 94  ASP E OD1   1 
ATOM   6323  O OD2   . ASP E 1 97  ? 11.595 -60.689  -176.713 1.00 94.84  ? 94  ASP E OD2   1 
ATOM   6324  N N     . PHE E 1 98  ? 7.284  -63.713  -175.686 1.00 77.61  ? 95  PHE E N     1 
ATOM   6325  C CA    . PHE E 1 98  ? 5.871  -64.065  -175.727 1.00 72.39  ? 95  PHE E CA    1 
ATOM   6326  C C     . PHE E 1 98  ? 5.698  -65.372  -176.485 1.00 73.08  ? 95  PHE E C     1 
ATOM   6327  O O     . PHE E 1 98  ? 6.550  -65.768  -177.284 1.00 85.07  ? 95  PHE E O     1 
ATOM   6328  C CB    . PHE E 1 98  ? 5.038  -62.951  -176.375 1.00 86.86  ? 95  PHE E CB    1 
ATOM   6329  C CG    . PHE E 1 98  ? 5.410  -62.664  -177.806 1.00 100.35 ? 95  PHE E CG    1 
ATOM   6330  C CD1   . PHE E 1 98  ? 4.836  -63.378  -178.848 1.00 97.51  ? 95  PHE E CD1   1 
ATOM   6331  C CD2   . PHE E 1 98  ? 6.340  -61.683  -178.109 1.00 112.84 ? 95  PHE E CD2   1 
ATOM   6332  C CE1   . PHE E 1 98  ? 5.180  -63.116  -180.162 1.00 102.94 ? 95  PHE E CE1   1 
ATOM   6333  C CE2   . PHE E 1 98  ? 6.688  -61.416  -179.421 1.00 109.81 ? 95  PHE E CE2   1 
ATOM   6334  C CZ    . PHE E 1 98  ? 6.107  -62.133  -180.449 1.00 109.04 ? 95  PHE E CZ    1 
ATOM   6335  N N     . VAL E 1 99  ? 4.572  -66.034  -176.220 1.00 69.70  ? 96  VAL E N     1 
ATOM   6336  C CA    . VAL E 1 99  ? 4.138  -67.216  -176.959 1.00 72.99  ? 96  VAL E CA    1 
ATOM   6337  C C     . VAL E 1 99  ? 2.623  -67.107  -177.089 1.00 88.73  ? 96  VAL E C     1 
ATOM   6338  O O     . VAL E 1 99  ? 1.902  -67.235  -176.093 1.00 88.24  ? 96  VAL E O     1 
ATOM   6339  C CB    . VAL E 1 99  ? 4.530  -68.535  -176.273 1.00 63.00  ? 96  VAL E CB    1 
ATOM   6340  C CG1   . VAL E 1 99  ? 3.759  -69.699  -176.881 1.00 66.23  ? 96  VAL E CG1   1 
ATOM   6341  C CG2   . VAL E 1 99  ? 6.028  -68.778  -176.388 1.00 65.11  ? 96  VAL E CG2   1 
ATOM   6342  N N     . ASP E 1 100 ? 2.142  -66.858  -178.303 1.00 103.37 ? 97  ASP E N     1 
ATOM   6343  C CA    . ASP E 1 100 ? 0.723  -66.676  -178.564 1.00 103.76 ? 97  ASP E CA    1 
ATOM   6344  C C     . ASP E 1 100 ? 0.232  -67.702  -179.577 1.00 107.02 ? 97  ASP E C     1 
ATOM   6345  O O     . ASP E 1 100 ? 1.015  -68.310  -180.313 1.00 110.99 ? 97  ASP E O     1 
ATOM   6346  C CB    . ASP E 1 100 ? 0.431  -65.255  -179.063 1.00 110.36 ? 97  ASP E CB    1 
ATOM   6347  C CG    . ASP E 1 100 ? 1.003  -64.188  -178.149 1.00 129.51 ? 97  ASP E CG    1 
ATOM   6348  O OD1   . ASP E 1 100 ? 0.783  -64.274  -176.922 1.00 124.06 ? 97  ASP E OD1   1 
ATOM   6349  O OD2   . ASP E 1 100 ? 1.672  -63.262  -178.656 1.00 124.61 ? 97  ASP E OD2   1 
ATOM   6350  N N     . LEU E 1 101 ? -1.088 -67.885  -179.605 1.00 106.26 ? 98  LEU E N     1 
ATOM   6351  C CA    . LEU E 1 101 ? -1.728 -68.867  -180.474 1.00 117.68 ? 98  LEU E CA    1 
ATOM   6352  C C     . LEU E 1 101 ? -2.938 -68.222  -181.130 1.00 133.58 ? 98  LEU E C     1 
ATOM   6353  O O     . LEU E 1 101 ? -3.894 -67.851  -180.442 1.00 138.36 ? 98  LEU E O     1 
ATOM   6354  C CB    . LEU E 1 101 ? -2.144 -70.113  -179.686 1.00 102.89 ? 98  LEU E CB    1 
ATOM   6355  C CG    . LEU E 1 101 ? -2.898 -71.201  -180.456 1.00 125.38 ? 98  LEU E CG    1 
ATOM   6356  C CD1   . LEU E 1 101 ? -2.139 -71.605  -181.710 1.00 128.97 ? 98  LEU E CD1   1 
ATOM   6357  C CD2   . LEU E 1 101 ? -3.154 -72.410  -179.568 1.00 126.03 ? 98  LEU E CD2   1 
ATOM   6358  N N     . ASN E 1 102 ? -2.894 -68.087  -182.454 1.00 137.42 ? 99  ASN E N     1 
ATOM   6359  C CA    . ASN E 1 102 ? -3.985 -67.513  -183.236 1.00 137.19 ? 99  ASN E CA    1 
ATOM   6360  C C     . ASN E 1 102 ? -4.456 -68.551  -184.247 1.00 143.46 ? 99  ASN E C     1 
ATOM   6361  O O     . ASN E 1 102 ? -3.765 -68.812  -185.238 1.00 150.27 ? 99  ASN E O     1 
ATOM   6362  C CB    . ASN E 1 102 ? -3.550 -66.223  -183.932 1.00 140.04 ? 99  ASN E CB    1 
ATOM   6363  C CG    . ASN E 1 102 ? -3.084 -65.161  -182.954 1.00 135.33 ? 99  ASN E CG    1 
ATOM   6364  O OD1   . ASN E 1 102 ? -3.635 -65.023  -181.862 1.00 135.90 ? 99  ASN E OD1   1 
ATOM   6365  N ND2   . ASN E 1 102 ? -2.068 -64.400  -183.346 1.00 120.06 ? 99  ASN E ND2   1 
ATOM   6366  N N     . ASN E 1 103 ? -5.631 -69.124  -183.990 1.00 143.77 ? 100 ASN E N     1 
ATOM   6367  C CA    . ASN E 1 103 ? -6.307 -70.096  -184.857 1.00 139.57 ? 100 ASN E CA    1 
ATOM   6368  C C     . ASN E 1 103 ? -5.331 -71.115  -185.443 1.00 143.01 ? 100 ASN E C     1 
ATOM   6369  O O     . ASN E 1 103 ? -5.211 -71.287  -186.657 1.00 141.13 ? 100 ASN E O     1 
ATOM   6370  C CB    . ASN E 1 103 ? -7.107 -69.405  -185.967 1.00 137.71 ? 100 ASN E CB    1 
ATOM   6371  C CG    . ASN E 1 103 ? -6.324 -68.317  -186.677 1.00 163.29 ? 100 ASN E CG    1 
ATOM   6372  O OD1   . ASN E 1 103 ? -6.323 -67.160  -186.255 1.00 171.03 ? 100 ASN E OD1   1 
ATOM   6373  N ND2   . ASN E 1 103 ? -5.648 -68.685  -187.760 1.00 154.11 ? 100 ASN E ND2   1 
ATOM   6374  N N     . GLY E 1 104 ? -4.621 -71.795  -184.543 1.00 139.70 ? 101 GLY E N     1 
ATOM   6375  C CA    . GLY E 1 104 ? -3.763 -72.899  -184.913 1.00 139.78 ? 101 GLY E CA    1 
ATOM   6376  C C     . GLY E 1 104 ? -2.330 -72.535  -185.231 1.00 124.99 ? 101 GLY E C     1 
ATOM   6377  O O     . GLY E 1 104 ? -1.502 -73.440  -185.396 1.00 115.58 ? 101 GLY E O     1 
ATOM   6378  N N     . ALA E 1 105 ? -2.006 -71.249  -185.315 1.00 132.10 ? 102 ALA E N     1 
ATOM   6379  C CA    . ALA E 1 105 ? -0.659 -70.796  -185.630 1.00 139.19 ? 102 ALA E CA    1 
ATOM   6380  C C     . ALA E 1 105 ? 0.007  -70.274  -184.366 1.00 130.63 ? 102 ALA E C     1 
ATOM   6381  O O     . ALA E 1 105 ? -0.585 -69.477  -183.630 1.00 124.14 ? 102 ALA E O     1 
ATOM   6382  C CB    . ALA E 1 105 ? -0.682 -69.709  -186.708 1.00 141.89 ? 102 ALA E CB    1 
ATOM   6383  N N     . PHE E 1 106 ? 1.236  -70.719  -184.122 1.00 138.52 ? 103 PHE E N     1 
ATOM   6384  C CA    . PHE E 1 106 ? 1.992  -70.331  -182.939 1.00 120.62 ? 103 PHE E CA    1 
ATOM   6385  C C     . PHE E 1 106 ? 2.958  -69.215  -183.311 1.00 116.97 ? 103 PHE E C     1 
ATOM   6386  O O     . PHE E 1 106 ? 3.798  -69.385  -184.201 1.00 118.96 ? 103 PHE E O     1 
ATOM   6387  C CB    . PHE E 1 106 ? 2.745  -71.527  -182.357 1.00 109.76 ? 103 PHE E CB    1 
ATOM   6388  C CG    . PHE E 1 106 ? 1.940  -72.331  -181.380 1.00 97.73  ? 103 PHE E CG    1 
ATOM   6389  C CD1   . PHE E 1 106 ? 1.257  -71.710  -180.349 1.00 99.19  ? 103 PHE E CD1   1 
ATOM   6390  C CD2   . PHE E 1 106 ? 1.855  -73.708  -181.499 1.00 115.10 ? 103 PHE E CD2   1 
ATOM   6391  C CE1   . PHE E 1 106 ? 0.514  -72.447  -179.447 1.00 106.35 ? 103 PHE E CE1   1 
ATOM   6392  C CE2   . PHE E 1 106 ? 1.111  -74.451  -180.602 1.00 125.68 ? 103 PHE E CE2   1 
ATOM   6393  C CZ    . PHE E 1 106 ? 0.439  -73.819  -179.575 1.00 116.98 ? 103 PHE E CZ    1 
ATOM   6394  N N     . TYR E 1 107 ? 2.837  -68.080  -182.629 1.00 112.25 ? 104 TYR E N     1 
ATOM   6395  C CA    . TYR E 1 107 ? 3.693  -66.920  -182.848 1.00 119.65 ? 104 TYR E CA    1 
ATOM   6396  C C     . TYR E 1 107 ? 4.570  -66.757  -181.614 1.00 109.69 ? 104 TYR E C     1 
ATOM   6397  O O     . TYR E 1 107 ? 4.069  -66.466  -180.523 1.00 99.16  ? 104 TYR E O     1 
ATOM   6398  C CB    . TYR E 1 107 ? 2.866  -65.662  -183.112 1.00 121.71 ? 104 TYR E CB    1 
ATOM   6399  C CG    . TYR E 1 107 ? 1.855  -65.801  -184.232 1.00 126.00 ? 104 TYR E CG    1 
ATOM   6400  C CD1   . TYR E 1 107 ? 0.649  -66.461  -184.030 1.00 131.53 ? 104 TYR E CD1   1 
ATOM   6401  C CD2   . TYR E 1 107 ? 2.108  -65.273  -185.491 1.00 133.32 ? 104 TYR E CD2   1 
ATOM   6402  C CE1   . TYR E 1 107 ? -0.275 -66.590  -185.047 1.00 138.30 ? 104 TYR E CE1   1 
ATOM   6403  C CE2   . TYR E 1 107 ? 1.188  -65.397  -186.517 1.00 142.88 ? 104 TYR E CE2   1 
ATOM   6404  C CZ    . TYR E 1 107 ? -0.002 -66.057  -186.288 1.00 146.73 ? 104 TYR E CZ    1 
ATOM   6405  O OH    . TYR E 1 107 ? -0.924 -66.186  -187.302 1.00 144.66 ? 104 TYR E OH    1 
ATOM   6406  N N     . VAL E 1 108 ? 5.875  -66.949  -181.788 1.00 109.83 ? 105 VAL E N     1 
ATOM   6407  C CA    . VAL E 1 108 ? 6.826  -66.972  -180.685 1.00 99.27  ? 105 VAL E CA    1 
ATOM   6408  C C     . VAL E 1 108 ? 7.891  -65.914  -180.931 1.00 98.02  ? 105 VAL E C     1 
ATOM   6409  O O     . VAL E 1 108 ? 8.486  -65.863  -182.014 1.00 105.26 ? 105 VAL E O     1 
ATOM   6410  C CB    . VAL E 1 108 ? 7.471  -68.360  -180.524 1.00 87.61  ? 105 VAL E CB    1 
ATOM   6411  C CG1   . VAL E 1 108 ? 8.534  -68.323  -179.444 1.00 97.56  ? 105 VAL E CG1   1 
ATOM   6412  C CG2   . VAL E 1 108 ? 6.412  -69.401  -180.200 1.00 98.41  ? 105 VAL E CG2   1 
ATOM   6413  N N     . GLY E 1 109 ? 8.130  -65.076  -179.925 1.00 81.69  ? 106 GLY E N     1 
ATOM   6414  C CA    . GLY E 1 109 ? 9.245  -64.152  -179.957 1.00 87.16  ? 106 GLY E CA    1 
ATOM   6415  C C     . GLY E 1 109 ? 10.225 -64.452  -178.844 1.00 87.68  ? 106 GLY E C     1 
ATOM   6416  O O     . GLY E 1 109 ? 9.827  -64.601  -177.685 1.00 95.58  ? 106 GLY E O     1 
ATOM   6417  N N     . VAL E 1 110 ? 11.510 -64.536  -179.180 1.00 85.33  ? 107 VAL E N     1 
ATOM   6418  C CA    . VAL E 1 110 ? 12.554 -64.904  -178.231 1.00 80.45  ? 107 VAL E CA    1 
ATOM   6419  C C     . VAL E 1 110 ? 13.778 -64.046  -178.513 1.00 74.53  ? 107 VAL E C     1 
ATOM   6420  O O     . VAL E 1 110 ? 14.120 -63.797  -179.674 1.00 94.80  ? 107 VAL E O     1 
ATOM   6421  C CB    . VAL E 1 110 ? 12.905 -66.407  -178.323 1.00 90.20  ? 107 VAL E CB    1 
ATOM   6422  C CG1   . VAL E 1 110 ? 14.143 -66.731  -177.498 1.00 85.12  ? 107 VAL E CG1   1 
ATOM   6423  C CG2   . VAL E 1 110 ? 11.735 -67.265  -177.867 1.00 88.36  ? 107 VAL E CG2   1 
ATOM   6424  N N     . CYS E 1 111 ? 14.439 -63.595  -177.450 1.00 62.38  ? 108 CYS E N     1 
ATOM   6425  C CA    . CYS E 1 111 ? 15.645 -62.794  -177.568 1.00 85.84  ? 108 CYS E CA    1 
ATOM   6426  C C     . CYS E 1 111 ? 16.749 -63.417  -176.729 1.00 78.46  ? 108 CYS E C     1 
ATOM   6427  O O     . CYS E 1 111 ? 16.487 -64.110  -175.741 1.00 76.87  ? 108 CYS E O     1 
ATOM   6428  C CB    . CYS E 1 111 ? 15.412 -61.344  -177.126 1.00 81.98  ? 108 CYS E CB    1 
ATOM   6429  S SG    . CYS E 1 111 ? 15.422 -61.103  -175.340 1.00 75.54  ? 108 CYS E SG    1 
ATOM   6430  N N     . ALA E 1 112 ? 17.989 -63.160  -177.132 1.00 79.38  ? 109 ALA E N     1 
ATOM   6431  C CA    . ALA E 1 112 ? 19.153 -63.678  -176.432 1.00 75.14  ? 109 ALA E CA    1 
ATOM   6432  C C     . ALA E 1 112 ? 20.228 -62.603  -176.397 1.00 75.61  ? 109 ALA E C     1 
ATOM   6433  O O     . ALA E 1 112 ? 20.250 -61.689  -177.224 1.00 103.26 ? 109 ALA E O     1 
ATOM   6434  C CB    . ALA E 1 112 ? 19.694 -64.952  -177.096 1.00 88.90  ? 109 ALA E CB    1 
ATOM   6435  N N     . PHE E 1 113 ? 21.127 -62.726  -175.424 1.00 75.43  ? 110 PHE E N     1 
ATOM   6436  C CA    . PHE E 1 113 ? 22.226 -61.783  -175.237 1.00 76.77  ? 110 PHE E CA    1 
ATOM   6437  C C     . PHE E 1 113 ? 23.528 -62.571  -175.256 1.00 73.22  ? 110 PHE E C     1 
ATOM   6438  O O     . PHE E 1 113 ? 23.857 -63.260  -174.285 1.00 84.28  ? 110 PHE E O     1 
ATOM   6439  C CB    . PHE E 1 113 ? 22.071 -61.003  -173.931 1.00 71.57  ? 110 PHE E CB    1 
ATOM   6440  C CG    . PHE E 1 113 ? 20.896 -60.063  -173.917 1.00 83.18  ? 110 PHE E CG    1 
ATOM   6441  C CD1   . PHE E 1 113 ? 19.601 -60.545  -173.812 1.00 83.34  ? 110 PHE E CD1   1 
ATOM   6442  C CD2   . PHE E 1 113 ? 21.089 -58.694  -174.003 1.00 80.52  ? 110 PHE E CD2   1 
ATOM   6443  C CE1   . PHE E 1 113 ? 18.521 -59.681  -173.799 1.00 75.63  ? 110 PHE E CE1   1 
ATOM   6444  C CE2   . PHE E 1 113 ? 20.013 -57.826  -173.987 1.00 75.68  ? 110 PHE E CE2   1 
ATOM   6445  C CZ    . PHE E 1 113 ? 18.727 -58.321  -173.887 1.00 70.72  ? 110 PHE E CZ    1 
ATOM   6446  N N     . VAL E 1 114 ? 24.266 -62.464  -176.355 1.00 62.89  ? 111 VAL E N     1 
ATOM   6447  C CA    . VAL E 1 114 ? 25.513 -63.194  -176.543 1.00 63.32  ? 111 VAL E CA    1 
ATOM   6448  C C     . VAL E 1 114 ? 26.678 -62.245  -176.313 1.00 67.80  ? 111 VAL E C     1 
ATOM   6449  O O     . VAL E 1 114 ? 26.665 -61.097  -176.776 1.00 64.63  ? 111 VAL E O     1 
ATOM   6450  C CB    . VAL E 1 114 ? 25.581 -63.827  -177.945 1.00 58.94  ? 111 VAL E CB    1 
ATOM   6451  C CG1   . VAL E 1 114 ? 26.754 -64.792  -178.036 1.00 56.53  ? 111 VAL E CG1   1 
ATOM   6452  C CG2   . VAL E 1 114 ? 24.273 -64.528  -178.271 1.00 63.27  ? 111 VAL E CG2   1 
ATOM   6453  N N     . ARG E 1 115 ? 27.688 -62.724  -175.591 1.00 64.05  ? 112 ARG E N     1 
ATOM   6454  C CA    . ARG E 1 115 ? 28.894 -61.959  -175.303 1.00 72.29  ? 112 ARG E CA    1 
ATOM   6455  C C     . ARG E 1 115 ? 30.090 -62.702  -175.877 1.00 67.59  ? 112 ARG E C     1 
ATOM   6456  O O     . ARG E 1 115 ? 30.403 -63.812  -175.435 1.00 67.37  ? 112 ARG E O     1 
ATOM   6457  C CB    . ARG E 1 115 ? 29.065 -61.750  -173.797 1.00 82.32  ? 112 ARG E CB    1 
ATOM   6458  C CG    . ARG E 1 115 ? 30.428 -61.211  -173.398 1.00 67.27  ? 112 ARG E CG    1 
ATOM   6459  C CD    . ARG E 1 115 ? 30.627 -61.284  -171.897 1.00 64.34  ? 112 ARG E CD    1 
ATOM   6460  N NE    . ARG E 1 115 ? 32.041 -61.356  -171.540 1.00 76.87  ? 112 ARG E NE    1 
ATOM   6461  C CZ    . ARG E 1 115 ? 32.714 -60.374  -170.950 1.00 82.92  ? 112 ARG E CZ    1 
ATOM   6462  N NH1   . ARG E 1 115 ? 32.101 -59.239  -170.644 1.00 87.68  ? 112 ARG E NH1   1 
ATOM   6463  N NH2   . ARG E 1 115 ? 33.999 -60.529  -170.662 1.00 75.06  ? 112 ARG E NH2   1 
ATOM   6464  N N     . VAL E 1 116 ? 30.758 -62.088  -176.851 1.00 66.73  ? 113 VAL E N     1 
ATOM   6465  C CA    . VAL E 1 116 ? 31.955 -62.652  -177.464 1.00 67.55  ? 113 VAL E CA    1 
ATOM   6466  C C     . VAL E 1 116 ? 33.175 -62.032  -176.804 1.00 57.54  ? 113 VAL E C     1 
ATOM   6467  O O     . VAL E 1 116 ? 33.203 -60.824  -176.535 1.00 51.52  ? 113 VAL E O     1 
ATOM   6468  C CB    . VAL E 1 116 ? 31.974 -62.417  -178.987 1.00 70.12  ? 113 VAL E CB    1 
ATOM   6469  C CG1   . VAL E 1 116 ? 33.114 -63.192  -179.629 1.00 70.87  ? 113 VAL E CG1   1 
ATOM   6470  C CG2   . VAL E 1 116 ? 30.651 -62.823  -179.600 1.00 69.12  ? 113 VAL E CG2   1 
ATOM   6471  N N     . GLN E 1 117 ? 34.188 -62.855  -176.543 1.00 49.84  ? 114 GLN E N     1 
ATOM   6472  C CA    . GLN E 1 117 ? 35.383 -62.411  -175.843 1.00 58.22  ? 114 GLN E CA    1 
ATOM   6473  C C     . GLN E 1 117 ? 36.613 -63.023  -176.495 1.00 71.03  ? 114 GLN E C     1 
ATOM   6474  O O     . GLN E 1 117 ? 36.627 -64.214  -176.818 1.00 73.62  ? 114 GLN E O     1 
ATOM   6475  C CB    . GLN E 1 117 ? 35.332 -62.792  -174.358 1.00 75.44  ? 114 GLN E CB    1 
ATOM   6476  C CG    . GLN E 1 117 ? 36.567 -62.393  -173.568 1.00 76.99  ? 114 GLN E CG    1 
ATOM   6477  C CD    . GLN E 1 117 ? 36.563 -62.955  -172.161 1.00 79.49  ? 114 GLN E CD    1 
ATOM   6478  O OE1   . GLN E 1 117 ? 36.238 -64.123  -171.948 1.00 90.96  ? 114 GLN E OE1   1 
ATOM   6479  N NE2   . GLN E 1 117 ? 36.924 -62.124  -171.190 1.00 103.03 ? 114 GLN E NE2   1 
ATOM   6480  N N     . LEU E 1 118 ? 37.638 -62.200  -176.688 1.00 84.22  ? 115 LEU E N     1 
ATOM   6481  C CA    . LEU E 1 118 ? 38.905 -62.656  -177.237 1.00 83.45  ? 115 LEU E CA    1 
ATOM   6482  C C     . LEU E 1 118 ? 39.866 -63.045  -176.119 1.00 71.53  ? 115 LEU E C     1 
ATOM   6483  O O     . LEU E 1 118 ? 39.717 -62.637  -174.965 1.00 71.17  ? 115 LEU E O     1 
ATOM   6484  C CB    . LEU E 1 118 ? 39.536 -61.578  -178.119 1.00 85.36  ? 115 LEU E CB    1 
ATOM   6485  C CG    . LEU E 1 118 ? 38.632 -60.938  -179.171 1.00 78.77  ? 115 LEU E CG    1 
ATOM   6486  C CD1   . LEU E 1 118 ? 39.390 -59.880  -179.957 1.00 91.50  ? 115 LEU E CD1   1 
ATOM   6487  C CD2   . LEU E 1 118 ? 38.062 -62.000  -180.099 1.00 66.59  ? 115 LEU E CD2   1 
ATOM   6488  N N     . LYS E 1 119 ? 40.865 -63.852  -176.486 1.00 70.77  ? 116 LYS E N     1 
ATOM   6489  C CA    . LYS E 1 119 ? 41.825 -64.373  -175.518 1.00 68.64  ? 116 LYS E CA    1 
ATOM   6490  C C     . LYS E 1 119 ? 42.591 -63.278  -174.786 1.00 86.86  ? 116 LYS E C     1 
ATOM   6491  O O     . LYS E 1 119 ? 43.197 -63.556  -173.745 1.00 102.03 ? 116 LYS E O     1 
ATOM   6492  C CB    . LYS E 1 119 ? 42.808 -65.313  -176.219 1.00 76.26  ? 116 LYS E CB    1 
ATOM   6493  C CG    . LYS E 1 119 ? 43.463 -64.718  -177.453 1.00 82.16  ? 116 LYS E CG    1 
ATOM   6494  C CD    . LYS E 1 119 ? 44.329 -65.744  -178.167 1.00 101.38 ? 116 LYS E CD    1 
ATOM   6495  C CE    . LYS E 1 119 ? 44.763 -65.242  -179.535 1.00 113.30 ? 116 LYS E CE    1 
ATOM   6496  N NZ    . LYS E 1 119 ? 45.438 -66.304  -180.331 1.00 116.39 ? 116 LYS E NZ    1 
ATOM   6497  N N     . ASP E 1 120 ? 42.594 -62.048  -175.301 1.00 87.19  ? 117 ASP E N     1 
ATOM   6498  C CA    . ASP E 1 120 ? 43.262 -60.954  -174.608 1.00 100.21 ? 117 ASP E CA    1 
ATOM   6499  C C     . ASP E 1 120 ? 42.400 -60.315  -173.527 1.00 88.87  ? 117 ASP E C     1 
ATOM   6500  O O     . ASP E 1 120 ? 42.926 -59.548  -172.714 1.00 92.92  ? 117 ASP E O     1 
ATOM   6501  C CB    . ASP E 1 120 ? 43.699 -59.881  -175.608 1.00 101.23 ? 117 ASP E CB    1 
ATOM   6502  C CG    . ASP E 1 120 ? 42.544 -59.028  -176.089 1.00 109.12 ? 117 ASP E CG    1 
ATOM   6503  O OD1   . ASP E 1 120 ? 41.472 -59.593  -176.395 1.00 104.14 ? 117 ASP E OD1   1 
ATOM   6504  O OD2   . ASP E 1 120 ? 42.706 -57.792  -176.154 1.00 96.17  ? 117 ASP E OD2   1 
ATOM   6505  N N     . GLY E 1 121 ? 41.103 -60.615  -173.489 1.00 74.42  ? 118 GLY E N     1 
ATOM   6506  C CA    . GLY E 1 121 ? 40.187 -60.033  -172.532 1.00 81.60  ? 118 GLY E CA    1 
ATOM   6507  C C     . GLY E 1 121 ? 39.162 -59.096  -173.137 1.00 92.86  ? 118 GLY E C     1 
ATOM   6508  O O     . GLY E 1 121 ? 38.151 -58.803  -172.484 1.00 87.66  ? 118 GLY E O     1 
ATOM   6509  N N     . SER E 1 122 ? 39.399 -58.604  -174.353 1.00 92.00  ? 119 SER E N     1 
ATOM   6510  C CA    . SER E 1 122 ? 38.418 -57.767  -175.030 1.00 87.17  ? 119 SER E CA    1 
ATOM   6511  C C     . SER E 1 122 ? 37.113 -58.533  -175.223 1.00 84.19  ? 119 SER E C     1 
ATOM   6512  O O     . SER E 1 122 ? 37.105 -59.753  -175.409 1.00 73.81  ? 119 SER E O     1 
ATOM   6513  C CB    . SER E 1 122 ? 38.960 -57.298  -176.381 1.00 89.82  ? 119 SER E CB    1 
ATOM   6514  O OG    . SER E 1 122 ? 37.995 -56.530  -177.079 1.00 112.86 ? 119 SER E OG    1 
ATOM   6515  N N     . TYR E 1 123 ? 35.999 -57.805  -175.185 1.00 80.79  ? 120 TYR E N     1 
ATOM   6516  C CA    . TYR E 1 123 ? 34.692 -58.445  -175.184 1.00 68.87  ? 120 TYR E CA    1 
ATOM   6517  C C     . TYR E 1 123 ? 33.659 -57.535  -175.833 1.00 70.67  ? 120 TYR E C     1 
ATOM   6518  O O     . TYR E 1 123 ? 33.736 -56.308  -175.733 1.00 69.97  ? 120 TYR E O     1 
ATOM   6519  C CB    . TYR E 1 123 ? 34.252 -58.805  -173.759 1.00 94.89  ? 120 TYR E CB    1 
ATOM   6520  C CG    . TYR E 1 123 ? 34.110 -57.613  -172.836 1.00 79.36  ? 120 TYR E CG    1 
ATOM   6521  C CD1   . TYR E 1 123 ? 32.904 -56.930  -172.730 1.00 72.34  ? 120 TYR E CD1   1 
ATOM   6522  C CD2   . TYR E 1 123 ? 35.179 -57.173  -172.067 1.00 75.92  ? 120 TYR E CD2   1 
ATOM   6523  C CE1   . TYR E 1 123 ? 32.768 -55.843  -171.891 1.00 55.61  ? 120 TYR E CE1   1 
ATOM   6524  C CE2   . TYR E 1 123 ? 35.051 -56.085  -171.222 1.00 86.97  ? 120 TYR E CE2   1 
ATOM   6525  C CZ    . TYR E 1 123 ? 33.842 -55.424  -171.138 1.00 74.01  ? 120 TYR E CZ    1 
ATOM   6526  O OH    . TYR E 1 123 ? 33.705 -54.340  -170.301 1.00 72.19  ? 120 TYR E OH    1 
ATOM   6527  N N     . HIS E 1 124 ? 32.685 -58.154  -176.494 1.00 63.23  ? 121 HIS E N     1 
ATOM   6528  C CA    . HIS E 1 124 ? 31.547 -57.441  -177.054 1.00 75.73  ? 121 HIS E CA    1 
ATOM   6529  C C     . HIS E 1 124 ? 30.285 -58.251  -176.804 1.00 68.42  ? 121 HIS E C     1 
ATOM   6530  O O     . HIS E 1 124 ? 30.283 -59.475  -176.966 1.00 73.91  ? 121 HIS E O     1 
ATOM   6531  C CB    . HIS E 1 124 ? 31.718 -57.185  -178.558 1.00 99.45  ? 121 HIS E CB    1 
ATOM   6532  C CG    . HIS E 1 124 ? 32.775 -56.176  -178.886 1.00 86.75  ? 121 HIS E CG    1 
ATOM   6533  N ND1   . HIS E 1 124 ? 32.844 -54.943  -178.274 1.00 85.46  ? 121 HIS E ND1   1 
ATOM   6534  C CD2   . HIS E 1 124 ? 33.799 -56.215  -179.771 1.00 72.16  ? 121 HIS E CD2   1 
ATOM   6535  C CE1   . HIS E 1 124 ? 33.870 -54.268  -178.763 1.00 83.50  ? 121 HIS E CE1   1 
ATOM   6536  N NE2   . HIS E 1 124 ? 34.466 -55.018  -179.672 1.00 75.86  ? 121 HIS E NE2   1 
ATOM   6537  N N     . GLU E 1 125 ? 29.217 -57.563  -176.409 1.00 61.01  ? 122 GLU E N     1 
ATOM   6538  C CA    . GLU E 1 125 ? 27.951 -58.197  -176.071 1.00 62.51  ? 122 GLU E CA    1 
ATOM   6539  C C     . GLU E 1 125 ? 26.826 -57.471  -176.792 1.00 83.49  ? 122 GLU E C     1 
ATOM   6540  O O     . GLU E 1 125 ? 26.796 -56.237  -176.827 1.00 97.17  ? 122 GLU E O     1 
ATOM   6541  C CB    . GLU E 1 125 ? 27.719 -58.185  -174.552 1.00 74.74  ? 122 GLU E CB    1 
ATOM   6542  C CG    . GLU E 1 125 ? 26.362 -58.708  -174.108 1.00 88.31  ? 122 GLU E CG    1 
ATOM   6543  C CD    . GLU E 1 125 ? 26.175 -58.634  -172.601 1.00 83.76  ? 122 GLU E CD    1 
ATOM   6544  O OE1   . GLU E 1 125 ? 26.608 -57.631  -171.993 1.00 73.43  ? 122 GLU E OE1   1 
ATOM   6545  O OE2   . GLU E 1 125 ? 25.591 -59.575  -172.025 1.00 77.80  ? 122 GLU E OE2   1 
ATOM   6546  N N     . ASP E 1 126 ? 25.902 -58.237  -177.366 1.00 77.51  ? 123 ASP E N     1 
ATOM   6547  C CA    . ASP E 1 126 ? 24.812 -57.656  -178.139 1.00 85.86  ? 123 ASP E CA    1 
ATOM   6548  C C     . ASP E 1 126 ? 23.636 -58.622  -178.146 1.00 80.71  ? 123 ASP E C     1 
ATOM   6549  O O     . ASP E 1 126 ? 23.764 -59.792  -177.778 1.00 83.17  ? 123 ASP E O     1 
ATOM   6550  C CB    . ASP E 1 126 ? 25.251 -57.318  -179.566 1.00 98.07  ? 123 ASP E CB    1 
ATOM   6551  C CG    . ASP E 1 126 ? 24.528 -56.109  -180.121 1.00 96.02  ? 123 ASP E CG    1 
ATOM   6552  O OD1   . ASP E 1 126 ? 23.278 -56.116  -180.127 1.00 90.40  ? 123 ASP E OD1   1 
ATOM   6553  O OD2   . ASP E 1 126 ? 25.207 -55.154  -180.553 1.00 114.95 ? 123 ASP E OD2   1 
ATOM   6554  N N     . VAL E 1 127 ? 22.483 -58.111  -178.574 1.00 77.84  ? 124 VAL E N     1 
ATOM   6555  C CA    . VAL E 1 127 ? 21.243 -58.872  -178.555 1.00 81.37  ? 124 VAL E CA    1 
ATOM   6556  C C     . VAL E 1 127 ? 21.081 -59.628  -179.868 1.00 78.97  ? 124 VAL E C     1 
ATOM   6557  O O     . VAL E 1 127 ? 21.703 -59.312  -180.884 1.00 88.60  ? 124 VAL E O     1 
ATOM   6558  C CB    . VAL E 1 127 ? 20.032 -57.949  -178.297 1.00 73.50  ? 124 VAL E CB    1 
ATOM   6559  C CG1   . VAL E 1 127 ? 18.813 -58.748  -177.843 1.00 84.92  ? 124 VAL E CG1   1 
ATOM   6560  C CG2   . VAL E 1 127 ? 20.386 -56.899  -177.282 1.00 93.04  ? 124 VAL E CG2   1 
ATOM   6561  N N     . GLY E 1 128 ? 20.238 -60.650  -179.835 1.00 64.77  ? 125 GLY E N     1 
ATOM   6562  C CA    . GLY E 1 128 ? 19.790 -61.319  -181.043 1.00 65.86  ? 125 GLY E CA    1 
ATOM   6563  C C     . GLY E 1 128 ? 18.384 -61.827  -180.830 1.00 78.57  ? 125 GLY E C     1 
ATOM   6564  O O     . GLY E 1 128 ? 17.985 -62.140  -179.704 1.00 86.01  ? 125 GLY E O     1 
ATOM   6565  N N     . TYR E 1 129 ? 17.626 -61.910  -181.918 1.00 83.95  ? 126 TYR E N     1 
ATOM   6566  C CA    . TYR E 1 129 ? 16.217 -62.259  -181.844 1.00 73.81  ? 126 TYR E CA    1 
ATOM   6567  C C     . TYR E 1 129 ? 15.908 -63.468  -182.717 1.00 85.73  ? 126 TYR E C     1 
ATOM   6568  O O     . TYR E 1 129 ? 16.571 -63.716  -183.729 1.00 105.51 ? 126 TYR E O     1 
ATOM   6569  C CB    . TYR E 1 129 ? 15.329 -61.083  -182.264 1.00 82.90  ? 126 TYR E CB    1 
ATOM   6570  C CG    . TYR E 1 129 ? 14.058 -60.986  -181.459 1.00 83.90  ? 126 TYR E CG    1 
ATOM   6571  C CD1   . TYR E 1 129 ? 14.022 -60.281  -180.264 1.00 93.07  ? 126 TYR E CD1   1 
ATOM   6572  C CD2   . TYR E 1 129 ? 12.897 -61.617  -181.884 1.00 89.57  ? 126 TYR E CD2   1 
ATOM   6573  C CE1   . TYR E 1 129 ? 12.862 -60.194  -179.522 1.00 91.23  ? 126 TYR E CE1   1 
ATOM   6574  C CE2   . TYR E 1 129 ? 11.732 -61.537  -181.148 1.00 95.53  ? 126 TYR E CE2   1 
ATOM   6575  C CZ    . TYR E 1 129 ? 11.720 -60.825  -179.968 1.00 89.80  ? 126 TYR E CZ    1 
ATOM   6576  O OH    . TYR E 1 129 ? 10.561 -60.745  -179.233 1.00 76.20  ? 126 TYR E OH    1 
ATOM   6577  N N     . GLY E 1 130 ? 14.898 -64.215  -182.304 1.00 80.94  ? 127 GLY E N     1 
ATOM   6578  C CA    . GLY E 1 130 ? 14.401 -65.333  -183.091 1.00 100.94 ? 127 GLY E CA    1 
ATOM   6579  C C     . GLY E 1 130 ? 12.896 -65.262  -183.199 1.00 106.37 ? 127 GLY E C     1 
ATOM   6580  O O     . GLY E 1 130 ? 12.211 -64.872  -182.253 1.00 99.58  ? 127 GLY E O     1 
ATOM   6581  N N     . VAL E 1 131 ? 12.383 -65.651  -184.363 1.00 102.00 ? 128 VAL E N     1 
ATOM   6582  C CA    . VAL E 1 131 ? 10.984 -65.438  -184.717 1.00 97.70  ? 128 VAL E CA    1 
ATOM   6583  C C     . VAL E 1 131 ? 10.459 -66.687  -185.412 1.00 100.46 ? 128 VAL E C     1 
ATOM   6584  O O     . VAL E 1 131 ? 11.074 -67.179  -186.363 1.00 113.26 ? 128 VAL E O     1 
ATOM   6585  C CB    . VAL E 1 131 ? 10.798 -64.206  -185.627 1.00 100.10 ? 128 VAL E CB    1 
ATOM   6586  C CG1   . VAL E 1 131 ? 9.327  -63.976  -185.907 1.00 108.42 ? 128 VAL E CG1   1 
ATOM   6587  C CG2   . VAL E 1 131 ? 11.411 -62.959  -184.999 1.00 87.03  ? 128 VAL E CG2   1 
ATOM   6588  N N     . SER E 1 132 ? 9.329  -67.204  -184.930 1.00 86.07  ? 129 SER E N     1 
ATOM   6589  C CA    . SER E 1 132 ? 8.634  -68.322  -185.570 1.00 107.13 ? 129 SER E CA    1 
ATOM   6590  C C     . SER E 1 132 ? 7.141  -68.011  -185.545 1.00 109.76 ? 129 SER E C     1 
ATOM   6591  O O     . SER E 1 132 ? 6.494  -68.135  -184.501 1.00 99.79  ? 129 SER E O     1 
ATOM   6592  C CB    . SER E 1 132 ? 8.939  -69.642  -184.874 1.00 117.07 ? 129 SER E CB    1 
ATOM   6593  O OG    . SER E 1 132 ? 8.265  -70.712  -185.513 1.00 114.65 ? 129 SER E OG    1 
ATOM   6594  N N     . GLU E 1 133 ? 6.601  -67.608  -186.695 1.00 118.10 ? 130 GLU E N     1 
ATOM   6595  C CA    . GLU E 1 133 ? 5.205  -67.201  -186.804 1.00 117.42 ? 130 GLU E CA    1 
ATOM   6596  C C     . GLU E 1 133 ? 4.321  -68.232  -187.491 1.00 118.11 ? 130 GLU E C     1 
ATOM   6597  O O     . GLU E 1 133 ? 3.132  -68.324  -187.168 1.00 122.41 ? 130 GLU E O     1 
ATOM   6598  C CB    . GLU E 1 133 ? 5.102  -65.877  -187.570 1.00 110.10 ? 130 GLU E CB    1 
ATOM   6599  C CG    . GLU E 1 133 ? 6.079  -64.811  -187.103 1.00 121.20 ? 130 GLU E CG    1 
ATOM   6600  C CD    . GLU E 1 133 ? 5.665  -63.411  -187.514 1.00 135.40 ? 130 GLU E CD    1 
ATOM   6601  O OE1   . GLU E 1 133 ? 4.649  -62.909  -186.988 1.00 148.49 ? 130 GLU E OE1   1 
ATOM   6602  O OE2   . GLU E 1 133 ? 6.357  -62.812  -188.364 1.00 139.46 ? 130 GLU E OE2   1 
ATOM   6603  N N     . GLY E 1 134 ? 4.866  -69.005  -188.425 1.00 110.61 ? 131 GLY E N     1 
ATOM   6604  C CA    . GLY E 1 134 ? 4.063  -69.867  -189.271 1.00 119.40 ? 131 GLY E CA    1 
ATOM   6605  C C     . GLY E 1 134 ? 3.667  -71.205  -188.680 1.00 126.01 ? 131 GLY E C     1 
ATOM   6606  O O     . GLY E 1 134 ? 2.525  -71.644  -188.845 1.00 133.15 ? 131 GLY E O     1 
ATOM   6607  N N     . LEU E 1 135 ? 4.601  -71.862  -187.995 1.00 120.84 ? 132 LEU E N     1 
ATOM   6608  C CA    . LEU E 1 135 ? 4.416  -73.249  -187.593 1.00 121.94 ? 132 LEU E CA    1 
ATOM   6609  C C     . LEU E 1 135 ? 3.215  -73.411  -186.664 1.00 111.20 ? 132 LEU E C     1 
ATOM   6610  O O     . LEU E 1 135 ? 2.753  -72.465  -186.019 1.00 109.81 ? 132 LEU E O     1 
ATOM   6611  C CB    . LEU E 1 135 ? 5.673  -73.775  -186.900 1.00 131.41 ? 132 LEU E CB    1 
ATOM   6612  C CG    . LEU E 1 135 ? 6.876  -74.095  -187.787 1.00 138.68 ? 132 LEU E CG    1 
ATOM   6613  C CD1   . LEU E 1 135 ? 8.172  -73.921  -187.011 1.00 133.47 ? 132 LEU E CD1   1 
ATOM   6614  C CD2   . LEU E 1 135 ? 6.765  -75.505  -188.344 1.00 148.09 ? 132 LEU E CD2   1 
ATOM   6615  N N     . ALA E 1 136 ? 2.706  -74.641  -186.611 1.00 111.04 ? 133 ALA E N     1 
ATOM   6616  C CA    . ALA E 1 136 ? 1.583  -74.998  -185.758 1.00 114.41 ? 133 ALA E CA    1 
ATOM   6617  C C     . ALA E 1 136 ? 2.002  -75.848  -184.568 1.00 117.09 ? 133 ALA E C     1 
ATOM   6618  O O     . ALA E 1 136 ? 1.156  -76.178  -183.730 1.00 104.92 ? 133 ALA E O     1 
ATOM   6619  C CB    . ALA E 1 136 ? 0.511  -75.733  -186.570 1.00 114.16 ? 133 ALA E CB    1 
ATOM   6620  N N     . SER E 1 137 ? 3.277  -76.216  -184.476 1.00 124.52 ? 134 SER E N     1 
ATOM   6621  C CA    . SER E 1 137 ? 3.805  -76.980  -183.354 1.00 121.44 ? 134 SER E CA    1 
ATOM   6622  C C     . SER E 1 137 ? 4.574  -76.034  -182.440 1.00 117.03 ? 134 SER E C     1 
ATOM   6623  O O     . SER E 1 137 ? 5.497  -75.346  -182.888 1.00 114.47 ? 134 SER E O     1 
ATOM   6624  C CB    . SER E 1 137 ? 4.703  -78.117  -183.840 1.00 126.63 ? 134 SER E CB    1 
ATOM   6625  O OG    . SER E 1 137 ? 5.300  -78.797  -182.750 1.00 119.88 ? 134 SER E OG    1 
ATOM   6626  N N     . LYS E 1 138 ? 4.183  -75.998  -181.164 1.00 124.27 ? 135 LYS E N     1 
ATOM   6627  C CA    . LYS E 1 138 ? 4.832  -75.108  -180.204 1.00 118.64 ? 135 LYS E CA    1 
ATOM   6628  C C     . LYS E 1 138 ? 6.315  -75.428  -180.059 1.00 111.85 ? 135 LYS E C     1 
ATOM   6629  O O     . LYS E 1 138 ? 7.158  -74.523  -180.046 1.00 105.78 ? 135 LYS E O     1 
ATOM   6630  C CB    . LYS E 1 138 ? 4.126  -75.199  -178.850 1.00 114.93 ? 135 LYS E CB    1 
ATOM   6631  C CG    . LYS E 1 138 ? 4.452  -74.057  -177.903 1.00 113.36 ? 135 LYS E CG    1 
ATOM   6632  C CD    . LYS E 1 138 ? 3.240  -73.657  -177.079 1.00 119.35 ? 135 LYS E CD    1 
ATOM   6633  C CE    . LYS E 1 138 ? 2.996  -74.636  -175.942 1.00 114.95 ? 135 LYS E CE    1 
ATOM   6634  N NZ    . LYS E 1 138 ? 1.918  -74.171  -175.024 1.00 104.49 ? 135 LYS E NZ    1 
ATOM   6635  N N     . ALA E 1 139 ? 6.648  -76.715  -179.928 1.00 109.64 ? 136 ALA E N     1 
ATOM   6636  C CA    . ALA E 1 139 ? 8.042  -77.111  -179.747 1.00 105.49 ? 136 ALA E CA    1 
ATOM   6637  C C     . ALA E 1 139 ? 8.909  -76.670  -180.920 1.00 104.97 ? 136 ALA E C     1 
ATOM   6638  O O     . ALA E 1 139 ? 10.023 -76.170  -180.722 1.00 97.68  ? 136 ALA E O     1 
ATOM   6639  C CB    . ALA E 1 139 ? 8.134  -78.623  -179.550 1.00 92.40  ? 136 ALA E CB    1 
ATOM   6640  N N     . LEU E 1 140 ? 8.419  -76.851  -182.149 1.00 107.66 ? 137 LEU E N     1 
ATOM   6641  C CA    . LEU E 1 140 ? 9.184  -76.432  -183.320 1.00 106.73 ? 137 LEU E CA    1 
ATOM   6642  C C     . LEU E 1 140 ? 9.389  -74.922  -183.330 1.00 103.85 ? 137 LEU E C     1 
ATOM   6643  O O     . LEU E 1 140 ? 10.494 -74.435  -183.609 1.00 101.19 ? 137 LEU E O     1 
ATOM   6644  C CB    . LEU E 1 140 ? 8.480  -76.881  -184.602 1.00 115.88 ? 137 LEU E CB    1 
ATOM   6645  C CG    . LEU E 1 140 ? 8.780  -78.268  -185.180 1.00 129.27 ? 137 LEU E CG    1 
ATOM   6646  C CD1   . LEU E 1 140 ? 8.676  -79.366  -184.129 1.00 110.34 ? 137 LEU E CD1   1 
ATOM   6647  C CD2   . LEU E 1 140 ? 7.859  -78.559  -186.358 1.00 132.21 ? 137 LEU E CD2   1 
ATOM   6648  N N     . SER E 1 141 ? 8.328  -74.167  -183.033 1.00 105.17 ? 138 SER E N     1 
ATOM   6649  C CA    . SER E 1 141 ? 8.432  -72.713  -183.011 1.00 106.02 ? 138 SER E CA    1 
ATOM   6650  C C     . SER E 1 141 ? 9.440  -72.247  -181.970 1.00 107.36 ? 138 SER E C     1 
ATOM   6651  O O     . SER E 1 141 ? 10.249 -71.352  -182.237 1.00 101.98 ? 138 SER E O     1 
ATOM   6652  C CB    . SER E 1 141 ? 7.059  -72.094  -182.746 1.00 105.79 ? 138 SER E CB    1 
ATOM   6653  O OG    . SER E 1 141 ? 6.211  -72.229  -183.873 1.00 107.48 ? 138 SER E OG    1 
ATOM   6654  N N     . LEU E 1 142 ? 9.418  -72.854  -180.781 1.00 102.95 ? 139 LEU E N     1 
ATOM   6655  C CA    . LEU E 1 142 ? 10.354 -72.455  -179.735 1.00 93.60  ? 139 LEU E CA    1 
ATOM   6656  C C     . LEU E 1 142 ? 11.785 -72.831  -180.100 1.00 96.15  ? 139 LEU E C     1 
ATOM   6657  O O     . LEU E 1 142 ? 12.707 -72.031  -179.909 1.00 92.32  ? 139 LEU E O     1 
ATOM   6658  C CB    . LEU E 1 142 ? 9.950  -73.085  -178.403 1.00 84.27  ? 139 LEU E CB    1 
ATOM   6659  C CG    . LEU E 1 142 ? 8.710  -72.483  -177.741 1.00 85.19  ? 139 LEU E CG    1 
ATOM   6660  C CD1   . LEU E 1 142 ? 8.222  -73.363  -176.608 1.00 106.21 ? 139 LEU E CD1   1 
ATOM   6661  C CD2   . LEU E 1 142 ? 9.017  -71.090  -177.229 1.00 72.40  ? 139 LEU E CD2   1 
ATOM   6662  N N     . GLU E 1 143 ? 11.992 -74.049  -180.606 1.00 93.66  ? 140 GLU E N     1 
ATOM   6663  C CA    . GLU E 1 143 ? 13.311 -74.454  -181.081 1.00 89.72  ? 140 GLU E CA    1 
ATOM   6664  C C     . GLU E 1 143 ? 13.869 -73.443  -182.076 1.00 98.44  ? 140 GLU E C     1 
ATOM   6665  O O     . GLU E 1 143 ? 14.990 -72.932  -181.913 1.00 98.53  ? 140 GLU E O     1 
ATOM   6666  C CB    . GLU E 1 143 ? 13.205 -75.841  -181.721 1.00 88.27  ? 140 GLU E CB    1 
ATOM   6667  C CG    . GLU E 1 143 ? 14.495 -76.397  -182.286 1.00 100.94 ? 140 GLU E CG    1 
ATOM   6668  C CD    . GLU E 1 143 ? 14.339 -77.821  -182.788 1.00 125.22 ? 140 GLU E CD    1 
ATOM   6669  O OE1   . GLU E 1 143 ? 13.185 -78.258  -182.987 1.00 110.80 ? 140 GLU E OE1   1 
ATOM   6670  O OE2   . GLU E 1 143 ? 15.367 -78.503  -182.986 1.00 125.92 ? 140 GLU E OE2   1 
ATOM   6671  N N     . LYS E 1 144 ? 13.060 -73.097  -183.083 1.00 96.94  ? 141 LYS E N     1 
ATOM   6672  C CA    . LYS E 1 144 ? 13.492 -72.139  -184.094 1.00 90.41  ? 141 LYS E CA    1 
ATOM   6673  C C     . LYS E 1 144 ? 13.813 -70.793  -183.464 1.00 89.64  ? 141 LYS E C     1 
ATOM   6674  O O     . LYS E 1 144 ? 14.881 -70.222  -183.710 1.00 99.80  ? 141 LYS E O     1 
ATOM   6675  C CB    . LYS E 1 144 ? 12.413 -71.987  -185.168 1.00 103.33 ? 141 LYS E CB    1 
ATOM   6676  C CG    . LYS E 1 144 ? 12.768 -71.002  -186.274 1.00 107.81 ? 141 LYS E CG    1 
ATOM   6677  C CD    . LYS E 1 144 ? 11.585 -70.774  -187.203 1.00 105.95 ? 141 LYS E CD    1 
ATOM   6678  C CE    . LYS E 1 144 ? 11.892 -69.710  -188.244 1.00 116.06 ? 141 LYS E CE    1 
ATOM   6679  N NZ    . LYS E 1 144 ? 10.701 -69.400  -189.082 1.00 120.33 ? 141 LYS E NZ    1 
ATOM   6680  N N     . ALA E 1 145 ? 12.901 -70.273  -182.641 1.00 87.99  ? 142 ALA E N     1 
ATOM   6681  C CA    . ALA E 1 145 ? 13.076 -68.932  -182.099 1.00 102.99 ? 142 ALA E CA    1 
ATOM   6682  C C     . ALA E 1 145 ? 14.338 -68.847  -181.251 1.00 95.48  ? 142 ALA E C     1 
ATOM   6683  O O     . ALA E 1 145 ? 15.140 -67.923  -181.408 1.00 98.54  ? 142 ALA E O     1 
ATOM   6684  C CB    . ALA E 1 145 ? 11.846 -68.532  -181.285 1.00 97.68  ? 142 ALA E CB    1 
ATOM   6685  N N     . ARG E 1 146 ? 14.553 -69.829  -180.374 1.00 93.76  ? 143 ARG E N     1 
ATOM   6686  C CA    . ARG E 1 146 ? 15.688 -69.764  -179.458 1.00 96.77  ? 143 ARG E CA    1 
ATOM   6687  C C     . ARG E 1 146 ? 17.013 -69.914  -180.200 1.00 94.32  ? 143 ARG E C     1 
ATOM   6688  O O     . ARG E 1 146 ? 17.952 -69.132  -179.981 1.00 101.91 ? 143 ARG E O     1 
ATOM   6689  C CB    . ARG E 1 146 ? 15.546 -70.831  -178.371 1.00 89.82  ? 143 ARG E CB    1 
ATOM   6690  C CG    . ARG E 1 146 ? 14.208 -70.786  -177.646 1.00 94.17  ? 143 ARG E CG    1 
ATOM   6691  C CD    . ARG E 1 146 ? 14.219 -71.567  -176.344 1.00 80.63  ? 143 ARG E CD    1 
ATOM   6692  N NE    . ARG E 1 146 ? 14.493 -70.711  -175.194 1.00 96.56  ? 143 ARG E NE    1 
ATOM   6693  C CZ    . ARG E 1 146 ? 14.131 -70.999  -173.949 1.00 100.32 ? 143 ARG E CZ    1 
ATOM   6694  N NH1   . ARG E 1 146 ? 13.471 -72.120  -173.693 1.00 103.40 ? 143 ARG E NH1   1 
ATOM   6695  N NH2   . ARG E 1 146 ? 14.421 -70.165  -172.960 1.00 107.32 ? 143 ARG E NH2   1 
ATOM   6696  N N     . LYS E 1 147 ? 17.116 -70.915  -181.083 1.00 88.92  ? 144 LYS E N     1 
ATOM   6697  C CA    . LYS E 1 147 ? 18.367 -71.090  -181.815 1.00 91.80  ? 144 LYS E CA    1 
ATOM   6698  C C     . LYS E 1 147 ? 18.660 -69.897  -182.719 1.00 92.12  ? 144 LYS E C     1 
ATOM   6699  O O     . LYS E 1 147 ? 19.804 -69.423  -182.785 1.00 94.65  ? 144 LYS E O     1 
ATOM   6700  C CB    . LYS E 1 147 ? 18.329 -72.399  -182.602 1.00 92.97  ? 144 LYS E CB    1 
ATOM   6701  C CG    . LYS E 1 147 ? 18.183 -73.610  -181.698 1.00 76.03  ? 144 LYS E CG    1 
ATOM   6702  C CD    . LYS E 1 147 ? 18.010 -74.899  -182.469 1.00 77.55  ? 144 LYS E CD    1 
ATOM   6703  C CE    . LYS E 1 147 ? 17.894 -76.065  -181.505 1.00 91.13  ? 144 LYS E CE    1 
ATOM   6704  N NZ    . LYS E 1 147 ? 17.665 -77.361  -182.196 1.00 104.47 ? 144 LYS E NZ    1 
ATOM   6705  N N     . GLU E 1 148 ? 17.638 -69.390  -183.418 1.00 86.18  ? 145 GLU E N     1 
ATOM   6706  C CA    . GLU E 1 148 ? 17.820 -68.207  -184.250 1.00 93.11  ? 145 GLU E CA    1 
ATOM   6707  C C     . GLU E 1 148 ? 18.246 -67.004  -183.419 1.00 82.91  ? 145 GLU E C     1 
ATOM   6708  O O     . GLU E 1 148 ? 19.097 -66.218  -183.849 1.00 87.17  ? 145 GLU E O     1 
ATOM   6709  C CB    . GLU E 1 148 ? 16.531 -67.909  -185.015 1.00 109.43 ? 145 GLU E CB    1 
ATOM   6710  C CG    . GLU E 1 148 ? 16.619 -66.720  -185.960 1.00 132.13 ? 145 GLU E CG    1 
ATOM   6711  C CD    . GLU E 1 148 ? 15.334 -66.497  -186.734 1.00 135.10 ? 145 GLU E CD    1 
ATOM   6712  O OE1   . GLU E 1 148 ? 14.541 -67.454  -186.864 1.00 127.38 ? 145 GLU E OE1   1 
ATOM   6713  O OE2   . GLU E 1 148 ? 15.116 -65.364  -187.213 1.00 139.73 ? 145 GLU E OE2   1 
ATOM   6714  N N     . ALA E 1 149 ? 17.670 -66.842  -182.225 1.00 89.63  ? 146 ALA E N     1 
ATOM   6715  C CA    . ALA E 1 149 ? 18.035 -65.718  -181.371 1.00 90.05  ? 146 ALA E CA    1 
ATOM   6716  C C     . ALA E 1 149 ? 19.501 -65.792  -180.970 1.00 83.22  ? 146 ALA E C     1 
ATOM   6717  O O     . ALA E 1 149 ? 20.224 -64.792  -181.031 1.00 79.48  ? 146 ALA E O     1 
ATOM   6718  C CB    . ALA E 1 149 ? 17.138 -65.683  -180.134 1.00 84.57  ? 146 ALA E CB    1 
ATOM   6719  N N     . VAL E 1 150 ? 19.958 -66.976  -180.558 1.00 86.76  ? 147 VAL E N     1 
ATOM   6720  C CA    . VAL E 1 150 ? 21.353 -67.106  -180.139 1.00 77.37  ? 147 VAL E CA    1 
ATOM   6721  C C     . VAL E 1 150 ? 22.295 -66.854  -181.311 1.00 88.19  ? 147 VAL E C     1 
ATOM   6722  O O     . VAL E 1 150 ? 23.308 -66.154  -181.172 1.00 77.72  ? 147 VAL E O     1 
ATOM   6723  C CB    . VAL E 1 150 ? 21.595 -68.481  -179.492 1.00 68.34  ? 147 VAL E CB    1 
ATOM   6724  C CG1   . VAL E 1 150 ? 23.076 -68.822  -179.497 1.00 57.78  ? 147 VAL E CG1   1 
ATOM   6725  C CG2   . VAL E 1 150 ? 21.082 -68.457  -178.075 1.00 77.62  ? 147 VAL E CG2   1 
ATOM   6726  N N     . THR E 1 151 ? 21.977 -67.409  -182.484 1.00 104.40 ? 148 THR E N     1 
ATOM   6727  C CA    . THR E 1 151 ? 22.839 -67.202  -183.646 1.00 91.67  ? 148 THR E CA    1 
ATOM   6728  C C     . THR E 1 151 ? 22.879 -65.732  -184.056 1.00 88.33  ? 148 THR E C     1 
ATOM   6729  O O     . THR E 1 151 ? 23.951 -65.190  -184.365 1.00 85.51  ? 148 THR E O     1 
ATOM   6730  C CB    . THR E 1 151 ? 22.368 -68.074  -184.808 1.00 76.00  ? 148 THR E CB    1 
ATOM   6731  O OG1   . THR E 1 151 ? 22.422 -69.450  -184.419 1.00 92.25  ? 148 THR E OG1   1 
ATOM   6732  C CG2   . THR E 1 151 ? 23.259 -67.869  -186.024 1.00 87.25  ? 148 THR E CG2   1 
ATOM   6733  N N     . ASP E 1 152 ? 21.717 -65.075  -184.080 1.00 81.35  ? 149 ASP E N     1 
ATOM   6734  C CA    . ASP E 1 152 ? 21.661 -63.657  -184.413 1.00 76.20  ? 149 ASP E CA    1 
ATOM   6735  C C     . ASP E 1 152 ? 22.446 -62.822  -183.411 1.00 78.43  ? 149 ASP E C     1 
ATOM   6736  O O     . ASP E 1 152 ? 23.128 -61.865  -183.793 1.00 80.51  ? 149 ASP E O     1 
ATOM   6737  C CB    . ASP E 1 152 ? 20.204 -63.197  -184.473 1.00 85.52  ? 149 ASP E CB    1 
ATOM   6738  C CG    . ASP E 1 152 ? 20.033 -61.896  -185.228 1.00 116.98 ? 149 ASP E CG    1 
ATOM   6739  O OD1   . ASP E 1 152 ? 20.001 -61.934  -186.476 1.00 130.79 ? 149 ASP E OD1   1 
ATOM   6740  O OD2   . ASP E 1 152 ? 19.930 -60.837  -184.575 1.00 99.02  ? 149 ASP E OD2   1 
ATOM   6741  N N     . GLY E 1 153 ? 22.358 -63.162  -182.124 1.00 83.27  ? 150 GLY E N     1 
ATOM   6742  C CA    . GLY E 1 153 ? 23.139 -62.445  -181.131 1.00 83.25  ? 150 GLY E CA    1 
ATOM   6743  C C     . GLY E 1 153 ? 24.630 -62.635  -181.316 1.00 79.64  ? 150 GLY E C     1 
ATOM   6744  O O     . GLY E 1 153 ? 25.409 -61.691  -181.163 1.00 75.15  ? 150 GLY E O     1 
ATOM   6745  N N     . LEU E 1 154 ? 25.046 -63.852  -181.675 1.00 75.90  ? 151 LEU E N     1 
ATOM   6746  C CA    . LEU E 1 154 ? 26.459 -64.097  -181.944 1.00 70.58  ? 151 LEU E CA    1 
ATOM   6747  C C     . LEU E 1 154 ? 26.944 -63.271  -183.130 1.00 84.01  ? 151 LEU E C     1 
ATOM   6748  O O     . LEU E 1 154 ? 28.027 -62.673  -183.083 1.00 86.34  ? 151 LEU E O     1 
ATOM   6749  C CB    . LEU E 1 154 ? 26.690 -65.587  -182.197 1.00 58.72  ? 151 LEU E CB    1 
ATOM   6750  C CG    . LEU E 1 154 ? 28.123 -66.028  -182.501 1.00 65.13  ? 151 LEU E CG    1 
ATOM   6751  C CD1   . LEU E 1 154 ? 29.086 -65.533  -181.437 1.00 66.04  ? 151 LEU E CD1   1 
ATOM   6752  C CD2   . LEU E 1 154 ? 28.199 -67.541  -182.633 1.00 70.32  ? 151 LEU E CD2   1 
ATOM   6753  N N     . LYS E 1 155 ? 26.144 -63.215  -184.197 1.00 75.17  ? 152 LYS E N     1 
ATOM   6754  C CA    . LYS E 1 155 ? 26.501 -62.389  -185.349 1.00 73.97  ? 152 LYS E CA    1 
ATOM   6755  C C     . LYS E 1 155 ? 26.589 -60.912  -184.970 1.00 80.98  ? 152 LYS E C     1 
ATOM   6756  O O     . LYS E 1 155 ? 27.565 -60.228  -185.307 1.00 81.59  ? 152 LYS E O     1 
ATOM   6757  C CB    . LYS E 1 155 ? 25.499 -62.606  -186.483 1.00 82.14  ? 152 LYS E CB    1 
ATOM   6758  C CG    . LYS E 1 155 ? 25.537 -64.006  -187.077 1.00 61.59  ? 152 LYS E CG    1 
ATOM   6759  C CD    . LYS E 1 155 ? 24.718 -64.093  -188.356 1.00 68.54  ? 152 LYS E CD    1 
ATOM   6760  C CE    . LYS E 1 155 ? 23.272 -63.686  -188.127 1.00 86.86  ? 152 LYS E CE    1 
ATOM   6761  N NZ    . LYS E 1 155 ? 22.511 -63.623  -189.405 1.00 95.27  ? 152 LYS E NZ    1 
ATOM   6762  N N     . ARG E 1 156 ? 25.563 -60.397  -184.286 1.00 72.11  ? 153 ARG E N     1 
ATOM   6763  C CA    . ARG E 1 156 ? 25.544 -58.984  -183.919 1.00 70.87  ? 153 ARG E CA    1 
ATOM   6764  C C     . ARG E 1 156 ? 26.669 -58.632  -182.955 1.00 67.26  ? 153 ARG E C     1 
ATOM   6765  O O     . ARG E 1 156 ? 27.118 -57.481  -182.922 1.00 82.42  ? 153 ARG E O     1 
ATOM   6766  C CB    . ARG E 1 156 ? 24.193 -58.616  -183.307 1.00 68.95  ? 153 ARG E CB    1 
ATOM   6767  C CG    . ARG E 1 156 ? 23.121 -58.278  -184.327 1.00 91.70  ? 153 ARG E CG    1 
ATOM   6768  C CD    . ARG E 1 156 ? 21.866 -57.755  -183.650 1.00 86.72  ? 153 ARG E CD    1 
ATOM   6769  N NE    . ARG E 1 156 ? 22.147 -56.604  -182.796 1.00 83.04  ? 153 ARG E NE    1 
ATOM   6770  C CZ    . ARG E 1 156 ? 22.262 -55.356  -183.237 1.00 91.50  ? 153 ARG E CZ    1 
ATOM   6771  N NH1   . ARG E 1 156 ? 22.120 -55.089  -184.529 1.00 113.47 ? 153 ARG E NH1   1 
ATOM   6772  N NH2   . ARG E 1 156 ? 22.520 -54.372  -182.386 1.00 84.73  ? 153 ARG E NH2   1 
ATOM   6773  N N     . ALA E 1 157 ? 27.133 -59.598  -182.162 1.00 78.90  ? 154 ALA E N     1 
ATOM   6774  C CA    . ALA E 1 157 ? 28.224 -59.323  -181.237 1.00 90.43  ? 154 ALA E CA    1 
ATOM   6775  C C     . ALA E 1 157 ? 29.571 -59.378  -181.944 1.00 84.94  ? 154 ALA E C     1 
ATOM   6776  O O     . ALA E 1 157 ? 30.476 -58.601  -181.619 1.00 80.49  ? 154 ALA E O     1 
ATOM   6777  C CB    . ALA E 1 157 ? 28.183 -60.309  -180.071 1.00 92.41  ? 154 ALA E CB    1 
ATOM   6778  N N     . LEU E 1 158 ? 29.721 -60.283  -182.915 1.00 84.38  ? 155 LEU E N     1 
ATOM   6779  C CA    . LEU E 1 158 ? 30.945 -60.317  -183.704 1.00 78.86  ? 155 LEU E CA    1 
ATOM   6780  C C     . LEU E 1 158 ? 31.046 -59.136  -184.660 1.00 90.47  ? 155 LEU E C     1 
ATOM   6781  O O     . LEU E 1 158 ? 32.152 -58.814  -185.108 1.00 91.19  ? 155 LEU E O     1 
ATOM   6782  C CB    . LEU E 1 158 ? 31.031 -61.628  -184.486 1.00 68.80  ? 155 LEU E CB    1 
ATOM   6783  C CG    . LEU E 1 158 ? 31.397 -62.873  -183.679 1.00 60.42  ? 155 LEU E CG    1 
ATOM   6784  C CD1   . LEU E 1 158 ? 30.998 -64.129  -184.432 1.00 68.14  ? 155 LEU E CD1   1 
ATOM   6785  C CD2   . LEU E 1 158 ? 32.886 -62.883  -183.366 1.00 69.06  ? 155 LEU E CD2   1 
ATOM   6786  N N     . ARG E 1 159 ? 29.919 -58.496  -184.986 1.00 95.48  ? 156 ARG E N     1 
ATOM   6787  C CA    . ARG E 1 159 ? 29.946 -57.317  -185.851 1.00 79.34  ? 156 ARG E CA    1 
ATOM   6788  C C     . ARG E 1 159 ? 30.903 -56.250  -185.330 1.00 72.51  ? 156 ARG E C     1 
ATOM   6789  O O     . ARG E 1 159 ? 31.689 -55.678  -186.093 1.00 87.82  ? 156 ARG E O     1 
ATOM   6790  C CB    . ARG E 1 159 ? 28.539 -56.735  -185.988 1.00 80.46  ? 156 ARG E CB    1 
ATOM   6791  C CG    . ARG E 1 159 ? 27.668 -57.409  -187.031 1.00 97.02  ? 156 ARG E CG    1 
ATOM   6792  C CD    . ARG E 1 159 ? 26.404 -56.599  -187.267 1.00 107.35 ? 156 ARG E CD    1 
ATOM   6793  N NE    . ARG E 1 159 ? 25.554 -57.184  -188.299 1.00 128.42 ? 156 ARG E NE    1 
ATOM   6794  C CZ    . ARG E 1 159 ? 24.308 -56.797  -188.547 1.00 130.39 ? 156 ARG E CZ    1 
ATOM   6795  N NH1   . ARG E 1 159 ? 23.761 -55.820  -187.835 1.00 123.55 ? 156 ARG E NH1   1 
ATOM   6796  N NH2   . ARG E 1 159 ? 23.608 -57.384  -189.508 1.00 131.75 ? 156 ARG E NH2   1 
ATOM   6797  N N     . SER E 1 160 ? 30.854 -55.973  -184.028 1.00 85.06  ? 157 SER E N     1 
ATOM   6798  C CA    . SER E 1 160 ? 31.591 -54.865  -183.411 1.00 92.17  ? 157 SER E CA    1 
ATOM   6799  C C     . SER E 1 160 ? 33.117 -55.025  -183.461 1.00 91.28  ? 157 SER E C     1 
ATOM   6800  O O     . SER E 1 160 ? 33.804 -54.200  -182.843 1.00 86.25  ? 157 SER E O     1 
ATOM   6801  C CB    . SER E 1 160 ? 31.139 -54.691  -181.960 1.00 101.33 ? 157 SER E CB    1 
ATOM   6802  O OG    . SER E 1 160 ? 29.726 -54.724  -181.860 1.00 110.98 ? 157 SER E OG    1 
ATOM   6803  N N     . PHE E 1 161 ? 33.687 -56.012  -184.151 1.00 85.58  ? 158 PHE E N     1 
ATOM   6804  C CA    . PHE E 1 161 ? 35.134 -56.158  -184.229 1.00 91.46  ? 158 PHE E CA    1 
ATOM   6805  C C     . PHE E 1 161 ? 35.738 -55.516  -185.469 1.00 115.65 ? 158 PHE E C     1 
ATOM   6806  O O     . PHE E 1 161 ? 36.922 -55.160  -185.448 1.00 114.69 ? 158 PHE E O     1 
ATOM   6807  C CB    . PHE E 1 161 ? 35.520 -57.641  -184.196 1.00 90.96  ? 158 PHE E CB    1 
ATOM   6808  C CG    . PHE E 1 161 ? 35.582 -58.222  -182.813 1.00 103.17 ? 158 PHE E CG    1 
ATOM   6809  C CD1   . PHE E 1 161 ? 36.274 -57.572  -181.804 1.00 111.60 ? 158 PHE E CD1   1 
ATOM   6810  C CD2   . PHE E 1 161 ? 34.940 -59.414  -182.519 1.00 99.81  ? 158 PHE E CD2   1 
ATOM   6811  C CE1   . PHE E 1 161 ? 36.334 -58.106  -180.530 1.00 103.61 ? 158 PHE E CE1   1 
ATOM   6812  C CE2   . PHE E 1 161 ? 34.994 -59.951  -181.246 1.00 92.01  ? 158 PHE E CE2   1 
ATOM   6813  C CZ    . PHE E 1 161 ? 35.690 -59.295  -180.250 1.00 85.65  ? 158 PHE E CZ    1 
ATOM   6814  N N     . GLY E 1 162 ? 34.964 -55.353  -186.529 1.00 118.60 ? 159 GLY E N     1 
ATOM   6815  C CA    . GLY E 1 162 ? 35.472 -54.782  -187.760 1.00 113.04 ? 159 GLY E CA    1 
ATOM   6816  C C     . GLY E 1 162 ? 34.583 -55.142  -188.924 1.00 115.35 ? 159 GLY E C     1 
ATOM   6817  O O     . GLY E 1 162 ? 33.701 -55.997  -188.828 1.00 111.89 ? 159 GLY E O     1 
ATOM   6818  N N     . ASN E 1 163 ? 34.833 -54.459  -190.045 1.00 120.91 ? 160 ASN E N     1 
ATOM   6819  C CA    . ASN E 1 163 ? 34.050 -54.698  -191.255 1.00 116.26 ? 160 ASN E CA    1 
ATOM   6820  C C     . ASN E 1 163 ? 34.131 -56.154  -191.695 1.00 113.11 ? 160 ASN E C     1 
ATOM   6821  O O     . ASN E 1 163 ? 33.145 -56.715  -192.185 1.00 112.97 ? 160 ASN E O     1 
ATOM   6822  C CB    . ASN E 1 163 ? 34.520 -53.775  -192.379 1.00 104.80 ? 160 ASN E CB    1 
ATOM   6823  C CG    . ASN E 1 163 ? 34.467 -52.312  -191.993 1.00 110.98 ? 160 ASN E CG    1 
ATOM   6824  O OD1   . ASN E 1 163 ? 33.449 -51.822  -191.507 1.00 108.07 ? 160 ASN E OD1   1 
ATOM   6825  N ND2   . ASN E 1 163 ? 35.569 -51.603  -192.211 1.00 117.98 ? 160 ASN E ND2   1 
ATOM   6826  N N     . ALA E 1 164 ? 35.299 -56.782  -191.526 1.00 109.90 ? 161 ALA E N     1 
ATOM   6827  C CA    . ALA E 1 164 ? 35.490 -58.151  -191.997 1.00 107.74 ? 161 ALA E CA    1 
ATOM   6828  C C     . ALA E 1 164 ? 34.550 -59.136  -191.311 1.00 114.74 ? 161 ALA E C     1 
ATOM   6829  O O     . ALA E 1 164 ? 34.241 -60.190  -191.878 1.00 126.66 ? 161 ALA E O     1 
ATOM   6830  C CB    . ALA E 1 164 ? 36.941 -58.581  -191.789 1.00 90.22  ? 161 ALA E CB    1 
ATOM   6831  N N     . LEU E 1 165 ? 34.095 -58.825  -190.098 1.00 98.17  ? 162 LEU E N     1 
ATOM   6832  C CA    . LEU E 1 165 ? 33.233 -59.725  -189.343 1.00 93.53  ? 162 LEU E CA    1 
ATOM   6833  C C     . LEU E 1 165 ? 31.763 -59.323  -189.410 1.00 96.55  ? 162 LEU E C     1 
ATOM   6834  O O     . LEU E 1 165 ? 30.966 -59.774  -188.580 1.00 93.52  ? 162 LEU E O     1 
ATOM   6835  C CB    . LEU E 1 165 ? 33.697 -59.809  -187.889 1.00 104.35 ? 162 LEU E CB    1 
ATOM   6836  C CG    . LEU E 1 165 ? 34.915 -60.702  -187.646 1.00 84.12  ? 162 LEU E CG    1 
ATOM   6837  C CD1   . LEU E 1 165 ? 35.363 -60.630  -186.198 1.00 91.30  ? 162 LEU E CD1   1 
ATOM   6838  C CD2   . LEU E 1 165 ? 34.606 -62.136  -188.037 1.00 73.05  ? 162 LEU E CD2   1 
ATOM   6839  N N     . GLY E 1 166 ? 31.388 -58.488  -190.378 1.00 85.57  ? 163 GLY E N     1 
ATOM   6840  C CA    . GLY E 1 166 ? 29.998 -58.153  -190.611 1.00 92.41  ? 163 GLY E CA    1 
ATOM   6841  C C     . GLY E 1 166 ? 29.613 -56.720  -190.317 1.00 104.93 ? 163 GLY E C     1 
ATOM   6842  O O     . GLY E 1 166 ? 28.423 -56.394  -190.400 1.00 110.39 ? 163 GLY E O     1 
ATOM   6843  N N     . ASN E 1 167 ? 30.565 -55.852  -189.970 1.00 95.74  ? 164 ASN E N     1 
ATOM   6844  C CA    . ASN E 1 167 ? 30.222 -54.462  -189.692 1.00 95.23  ? 164 ASN E CA    1 
ATOM   6845  C C     . ASN E 1 167 ? 29.909 -53.678  -190.960 1.00 118.89 ? 164 ASN E C     1 
ATOM   6846  O O     . ASN E 1 167 ? 29.257 -52.631  -190.883 1.00 117.90 ? 164 ASN E O     1 
ATOM   6847  C CB    . ASN E 1 167 ? 31.357 -53.784  -188.924 1.00 99.09  ? 164 ASN E CB    1 
ATOM   6848  C CG    . ASN E 1 167 ? 30.979 -52.405  -188.420 1.00 116.06 ? 164 ASN E CG    1 
ATOM   6849  O OD1   . ASN E 1 167 ? 29.824 -52.151  -188.080 1.00 114.88 ? 164 ASN E OD1   1 
ATOM   6850  N ND2   . ASN E 1 167 ? 31.955 -51.507  -188.368 1.00 126.41 ? 164 ASN E ND2   1 
ATOM   6851  N N     . CYS E 1 168 ? 30.348 -54.162  -192.123 1.00 129.07 ? 165 CYS E N     1 
ATOM   6852  C CA    . CYS E 1 168 ? 30.132 -53.443  -193.371 1.00 106.07 ? 165 CYS E CA    1 
ATOM   6853  C C     . CYS E 1 168 ? 28.771 -53.729  -193.993 1.00 107.02 ? 165 CYS E C     1 
ATOM   6854  O O     . CYS E 1 168 ? 28.344 -52.981  -194.879 1.00 114.33 ? 165 CYS E O     1 
ATOM   6855  C CB    . CYS E 1 168 ? 31.234 -53.791  -194.373 1.00 113.48 ? 165 CYS E CB    1 
ATOM   6856  S SG    . CYS E 1 168 ? 31.395 -55.561  -194.702 1.00 115.82 ? 165 CYS E SG    1 
ATOM   6857  N N     . ILE E 1 169 ? 28.079 -54.780  -193.543 1.00 107.39 ? 166 ILE E N     1 
ATOM   6858  C CA    . ILE E 1 169 ? 26.784 -55.141  -194.110 1.00 110.69 ? 166 ILE E CA    1 
ATOM   6859  C C     . ILE E 1 169 ? 25.748 -54.041  -193.916 1.00 109.59 ? 166 ILE E C     1 
ATOM   6860  O O     . ILE E 1 169 ? 24.706 -54.049  -194.580 1.00 102.32 ? 166 ILE E O     1 
ATOM   6861  C CB    . ILE E 1 169 ? 26.291 -56.471  -193.500 1.00 108.81 ? 166 ILE E CB    1 
ATOM   6862  C CG1   . ILE E 1 169 ? 25.226 -57.116  -194.389 1.00 104.20 ? 166 ILE E CG1   1 
ATOM   6863  C CG2   . ILE E 1 169 ? 25.730 -56.247  -192.104 1.00 110.70 ? 166 ILE E CG2   1 
ATOM   6864  C CD1   . ILE E 1 169 ? 25.788 -57.839  -195.587 1.00 114.21 ? 166 ILE E CD1   1 
ATOM   6865  N N     . LEU E 1 170 ? 26.008 -53.087  -193.025 1.00 108.77 ? 167 LEU E N     1 
ATOM   6866  C CA    . LEU E 1 170 ? 25.092 -51.985  -192.773 1.00 110.82 ? 167 LEU E CA    1 
ATOM   6867  C C     . LEU E 1 170 ? 25.488 -50.703  -193.492 1.00 123.61 ? 167 LEU E C     1 
ATOM   6868  O O     . LEU E 1 170 ? 24.793 -49.692  -193.355 1.00 126.51 ? 167 LEU E O     1 
ATOM   6869  C CB    . LEU E 1 170 ? 24.987 -51.723  -191.269 1.00 126.70 ? 167 LEU E CB    1 
ATOM   6870  C CG    . LEU E 1 170 ? 24.330 -52.861  -190.486 1.00 126.14 ? 167 LEU E CG    1 
ATOM   6871  C CD1   . LEU E 1 170 ? 24.656 -52.769  -189.001 1.00 124.31 ? 167 LEU E CD1   1 
ATOM   6872  C CD2   . LEU E 1 170 ? 22.830 -52.865  -190.725 1.00 110.11 ? 167 LEU E CD2   1 
ATOM   6873  N N     . ASP E 1 171 ? 26.584 -50.717  -194.247 1.00 122.25 ? 168 ASP E N     1 
ATOM   6874  C CA    . ASP E 1 171 ? 27.000 -49.552  -195.021 1.00 115.34 ? 168 ASP E CA    1 
ATOM   6875  C C     . ASP E 1 171 ? 26.245 -49.562  -196.345 1.00 124.80 ? 168 ASP E C     1 
ATOM   6876  O O     . ASP E 1 171 ? 26.467 -50.437  -197.188 1.00 127.25 ? 168 ASP E O     1 
ATOM   6877  C CB    . ASP E 1 171 ? 28.511 -49.565  -195.240 1.00 111.09 ? 168 ASP E CB    1 
ATOM   6878  C CG    . ASP E 1 171 ? 29.035 -48.243  -195.767 1.00 127.46 ? 168 ASP E CG    1 
ATOM   6879  O OD1   . ASP E 1 171 ? 28.285 -47.244  -195.728 1.00 127.72 ? 168 ASP E OD1   1 
ATOM   6880  O OD2   . ASP E 1 171 ? 30.199 -48.201  -196.221 1.00 130.55 ? 168 ASP E OD2   1 
ATOM   6881  N N     . LYS E 1 172 ? 25.338 -48.597  -196.520 1.00 136.54 ? 169 LYS E N     1 
ATOM   6882  C CA    . LYS E 1 172 ? 24.497 -48.570  -197.714 1.00 135.74 ? 169 LYS E CA    1 
ATOM   6883  C C     . LYS E 1 172 ? 25.332 -48.417  -198.980 1.00 130.74 ? 169 LYS E C     1 
ATOM   6884  O O     . LYS E 1 172 ? 25.014 -49.014  -200.015 1.00 122.16 ? 169 LYS E O     1 
ATOM   6885  C CB    . LYS E 1 172 ? 23.469 -47.445  -197.600 1.00 132.08 ? 169 LYS E CB    1 
ATOM   6886  C CG    . LYS E 1 172 ? 22.583 -47.558  -196.370 1.00 133.60 ? 169 LYS E CG    1 
ATOM   6887  C CD    . LYS E 1 172 ? 21.990 -46.217  -195.977 1.00 157.58 ? 169 LYS E CD    1 
ATOM   6888  C CE    . LYS E 1 172 ? 21.275 -46.306  -194.637 1.00 156.45 ? 169 LYS E CE    1 
ATOM   6889  N NZ    . LYS E 1 172 ? 20.820 -44.973  -194.155 1.00 168.15 ? 169 LYS E NZ    1 
ATOM   6890  N N     . ASP E 1 173 ? 26.395 -47.611  -198.921 1.00 128.42 ? 170 ASP E N     1 
ATOM   6891  C CA    . ASP E 1 173 ? 27.288 -47.480  -200.069 1.00 132.77 ? 170 ASP E CA    1 
ATOM   6892  C C     . ASP E 1 173 ? 27.948 -48.812  -200.405 1.00 121.89 ? 170 ASP E C     1 
ATOM   6893  O O     . ASP E 1 173 ? 28.109 -49.157  -201.582 1.00 140.92 ? 170 ASP E O     1 
ATOM   6894  C CB    . ASP E 1 173 ? 28.345 -46.411  -199.792 1.00 134.71 ? 170 ASP E CB    1 
ATOM   6895  C CG    . ASP E 1 173 ? 27.738 -45.059  -199.476 1.00 144.29 ? 170 ASP E CG    1 
ATOM   6896  O OD1   . ASP E 1 173 ? 26.691 -44.721  -200.066 1.00 145.44 ? 170 ASP E OD1   1 
ATOM   6897  O OD2   . ASP E 1 173 ? 28.309 -44.332  -198.635 1.00 156.94 ? 170 ASP E OD2   1 
ATOM   6898  N N     . TYR E 1 174 ? 28.351 -49.564  -199.379 1.00 94.18  ? 171 TYR E N     1 
ATOM   6899  C CA    . TYR E 1 174 ? 28.905 -50.896  -199.596 1.00 107.82 ? 171 TYR E CA    1 
ATOM   6900  C C     . TYR E 1 174 ? 27.904 -51.803  -200.305 1.00 115.35 ? 171 TYR E C     1 
ATOM   6901  O O     . TYR E 1 174 ? 28.270 -52.545  -201.223 1.00 124.24 ? 171 TYR E O     1 
ATOM   6902  C CB    . TYR E 1 174 ? 29.331 -51.495  -198.255 1.00 126.99 ? 171 TYR E CB    1 
ATOM   6903  C CG    . TYR E 1 174 ? 29.716 -52.956  -198.295 1.00 109.24 ? 171 TYR E CG    1 
ATOM   6904  C CD1   . TYR E 1 174 ? 30.899 -53.369  -198.891 1.00 102.62 ? 171 TYR E CD1   1 
ATOM   6905  C CD2   . TYR E 1 174 ? 28.896 -53.921  -197.729 1.00 98.38  ? 171 TYR E CD2   1 
ATOM   6906  C CE1   . TYR E 1 174 ? 31.253 -54.705  -198.921 1.00 100.23 ? 171 TYR E CE1   1 
ATOM   6907  C CE2   . TYR E 1 174 ? 29.241 -55.256  -197.753 1.00 113.67 ? 171 TYR E CE2   1 
ATOM   6908  C CZ    . TYR E 1 174 ? 30.418 -55.644  -198.353 1.00 113.36 ? 171 TYR E CZ    1 
ATOM   6909  O OH    . TYR E 1 174 ? 30.758 -56.976  -198.378 1.00 114.37 ? 171 TYR E OH    1 
ATOM   6910  N N     . LEU E 1 175 ? 26.631 -51.742  -199.908 1.00 110.41 ? 172 LEU E N     1 
ATOM   6911  C CA    . LEU E 1 175 ? 25.608 -52.549  -200.570 1.00 107.43 ? 172 LEU E CA    1 
ATOM   6912  C C     . LEU E 1 175 ? 25.412 -52.121  -202.020 1.00 121.93 ? 172 LEU E C     1 
ATOM   6913  O O     . LEU E 1 175 ? 25.285 -52.969  -202.914 1.00 132.01 ? 172 LEU E O     1 
ATOM   6914  C CB    . LEU E 1 175 ? 24.291 -52.461  -199.800 1.00 119.07 ? 172 LEU E CB    1 
ATOM   6915  C CG    . LEU E 1 175 ? 24.260 -53.184  -198.451 1.00 118.01 ? 172 LEU E CG    1 
ATOM   6916  C CD1   . LEU E 1 175 ? 22.848 -53.211  -197.885 1.00 106.34 ? 172 LEU E CD1   1 
ATOM   6917  C CD2   . LEU E 1 175 ? 24.823 -54.595  -198.573 1.00 114.28 ? 172 LEU E CD2   1 
ATOM   6918  N N     . ARG E 1 176 ? 25.355 -50.809  -202.267 1.00 122.36 ? 173 ARG E N     1 
ATOM   6919  C CA    . ARG E 1 176 ? 25.229 -50.314  -203.634 1.00 125.38 ? 173 ARG E CA    1 
ATOM   6920  C C     . ARG E 1 176 ? 26.385 -50.790  -204.503 1.00 122.13 ? 173 ARG E C     1 
ATOM   6921  O O     . ARG E 1 176 ? 26.182 -51.190  -205.655 1.00 121.20 ? 173 ARG E O     1 
ATOM   6922  C CB    . ARG E 1 176 ? 25.148 -48.788  -203.634 1.00 130.23 ? 173 ARG E CB    1 
ATOM   6923  C CG    . ARG E 1 176 ? 23.911 -48.229  -202.948 1.00 138.93 ? 173 ARG E CG    1 
ATOM   6924  C CD    . ARG E 1 176 ? 23.708 -46.751  -203.259 1.00 131.47 ? 173 ARG E CD    1 
ATOM   6925  N NE    . ARG E 1 176 ? 24.844 -45.931  -202.845 1.00 126.33 ? 173 ARG E NE    1 
ATOM   6926  C CZ    . ARG E 1 176 ? 25.801 -45.506  -203.665 1.00 140.87 ? 173 ARG E CZ    1 
ATOM   6927  N NH1   . ARG E 1 176 ? 25.762 -45.820  -204.953 1.00 135.70 ? 173 ARG E NH1   1 
ATOM   6928  N NH2   . ARG E 1 176 ? 26.796 -44.764  -203.197 1.00 156.19 ? 173 ARG E NH2   1 
ATOM   6929  N N     . SER E 1 177 ? 27.608 -50.755  -203.968 1.00 121.00 ? 174 SER E N     1 
ATOM   6930  C CA    . SER E 1 177 ? 28.753 -51.268  -204.710 1.00 112.98 ? 174 SER E CA    1 
ATOM   6931  C C     . SER E 1 177 ? 28.708 -52.783  -204.852 1.00 111.51 ? 174 SER E C     1 
ATOM   6932  O O     . SER E 1 177 ? 29.304 -53.325  -205.790 1.00 117.35 ? 174 SER E O     1 
ATOM   6933  C CB    . SER E 1 177 ? 30.056 -50.846  -204.030 1.00 115.60 ? 174 SER E CB    1 
ATOM   6934  O OG    . SER E 1 177 ? 30.232 -49.441  -204.095 1.00 130.08 ? 174 SER E OG    1 
ATOM   6935  N N     . LEU E 1 178 ? 28.021 -53.474  -203.941 1.00 123.06 ? 175 LEU E N     1 
ATOM   6936  C CA    . LEU E 1 178 ? 27.853 -54.917  -204.078 1.00 126.14 ? 175 LEU E CA    1 
ATOM   6937  C C     . LEU E 1 178 ? 26.902 -55.248  -205.218 1.00 132.26 ? 175 LEU E C     1 
ATOM   6938  O O     . LEU E 1 178 ? 27.102 -56.235  -205.937 1.00 140.71 ? 175 LEU E O     1 
ATOM   6939  C CB    . LEU E 1 178 ? 27.337 -55.511  -202.768 1.00 126.46 ? 175 LEU E CB    1 
ATOM   6940  C CG    . LEU E 1 178 ? 28.356 -56.041  -201.762 1.00 131.04 ? 175 LEU E CG    1 
ATOM   6941  C CD1   . LEU E 1 178 ? 27.632 -56.574  -200.541 1.00 134.83 ? 175 LEU E CD1   1 
ATOM   6942  C CD2   . LEU E 1 178 ? 29.214 -57.123  -202.393 1.00 129.05 ? 175 LEU E CD2   1 
ATOM   6943  N N     . ASN E 1 179 ? 25.856 -54.436  -205.395 1.00 126.68 ? 176 ASN E N     1 
ATOM   6944  C CA    . ASN E 1 179 ? 24.950 -54.636  -206.521 1.00 122.02 ? 176 ASN E CA    1 
ATOM   6945  C C     . ASN E 1 179 ? 25.658 -54.436  -207.856 1.00 131.56 ? 176 ASN E C     1 
ATOM   6946  O O     . ASN E 1 179 ? 25.233 -54.996  -208.873 1.00 140.96 ? 176 ASN E O     1 
ATOM   6947  C CB    . ASN E 1 179 ? 23.752 -53.692  -206.411 1.00 120.98 ? 176 ASN E CB    1 
ATOM   6948  C CG    . ASN E 1 179 ? 22.914 -53.956  -205.177 1.00 142.09 ? 176 ASN E CG    1 
ATOM   6949  O OD1   . ASN E 1 179 ? 22.689 -53.062  -204.361 1.00 137.35 ? 176 ASN E OD1   1 
ATOM   6950  N ND2   . ASN E 1 179 ? 22.446 -55.191  -205.033 1.00 158.14 ? 176 ASN E ND2   1 
ATOM   6951  N N     . LYS E 1 180 ? 26.738 -53.651  -207.874 1.00 132.91 ? 177 LYS E N     1 
ATOM   6952  C CA    . LYS E 1 180 ? 27.472 -53.343  -209.096 1.00 136.70 ? 177 LYS E CA    1 
ATOM   6953  C C     . LYS E 1 180 ? 28.550 -54.374  -209.414 1.00 128.95 ? 177 LYS E C     1 
ATOM   6954  O O     . LYS E 1 180 ? 29.540 -54.044  -210.082 1.00 124.63 ? 177 LYS E O     1 
ATOM   6955  C CB    . LYS E 1 180 ? 28.083 -51.944  -209.006 1.00 129.32 ? 177 LYS E CB    1 
ATOM   6956  C CG    . LYS E 1 180 ? 27.069 -50.839  -208.762 1.00 124.84 ? 177 LYS E CG    1 
ATOM   6957  C CD    . LYS E 1 180 ? 27.753 -49.513  -208.474 1.00 128.40 ? 177 LYS E CD    1 
ATOM   6958  C CE    . LYS E 1 180 ? 26.739 -48.434  -208.130 1.00 144.35 ? 177 LYS E CE    1 
ATOM   6959  N NZ    . LYS E 1 180 ? 27.394 -47.138  -207.802 1.00 142.55 ? 177 LYS E NZ    1 
ATOM   6960  N N     . LEU E 1 181 ? 28.390 -55.607  -208.953 1.00 123.68 ? 178 LEU E N     1 
ATOM   6961  C CA    . LEU E 1 181 ? 29.337 -56.681  -209.196 1.00 136.34 ? 178 LEU E CA    1 
ATOM   6962  C C     . LEU E 1 181 ? 28.659 -57.837  -209.921 1.00 144.62 ? 178 LEU E C     1 
ATOM   6963  O O     . LEU E 1 181 ? 27.434 -57.996  -209.848 1.00 143.17 ? 178 LEU E O     1 
ATOM   6964  C CB    . LEU E 1 181 ? 29.947 -57.177  -207.876 1.00 138.54 ? 178 LEU E CB    1 
ATOM   6965  C CG    . LEU E 1 181 ? 31.098 -56.325  -207.334 1.00 138.80 ? 178 LEU E CG    1 
ATOM   6966  C CD1   . LEU E 1 181 ? 31.627 -56.891  -206.027 1.00 137.06 ? 178 LEU E CD1   1 
ATOM   6967  C CD2   . LEU E 1 181 ? 32.213 -56.210  -208.363 1.00 120.36 ? 178 LEU E CD2   1 
ATOM   6968  N N     . PRO E 1 182 ? 29.425 -58.656  -210.642 1.00 147.95 ? 179 PRO E N     1 
ATOM   6969  C CA    . PRO E 1 182 ? 28.834 -59.812  -211.330 1.00 155.79 ? 179 PRO E CA    1 
ATOM   6970  C C     . PRO E 1 182 ? 28.209 -60.794  -210.349 1.00 169.23 ? 179 PRO E C     1 
ATOM   6971  O O     . PRO E 1 182 ? 28.844 -61.227  -209.385 1.00 172.38 ? 179 PRO E O     1 
ATOM   6972  C CB    . PRO E 1 182 ? 30.026 -60.431  -212.069 1.00 152.17 ? 179 PRO E CB    1 
ATOM   6973  C CG    . PRO E 1 182 ? 30.992 -59.305  -212.232 1.00 144.66 ? 179 PRO E CG    1 
ATOM   6974  C CD    . PRO E 1 182 ? 30.847 -58.484  -210.985 1.00 140.51 ? 179 PRO E CD    1 
ATOM   6975  N N     . ARG E 1 183 ? 26.951 -61.143  -210.606 1.00 173.21 ? 180 ARG E N     1 
ATOM   6976  C CA    . ARG E 1 183 ? 26.212 -62.082  -209.764 1.00 172.47 ? 180 ARG E CA    1 
ATOM   6977  C C     . ARG E 1 183 ? 26.750 -63.484  -210.021 1.00 178.17 ? 180 ARG E C     1 
ATOM   6978  O O     . ARG E 1 183 ? 26.327 -64.169  -210.955 1.00 179.02 ? 180 ARG E O     1 
ATOM   6979  C CB    . ARG E 1 183 ? 24.719 -61.994  -210.060 1.00 170.41 ? 180 ARG E CB    1 
ATOM   6980  C CG    . ARG E 1 183 ? 23.906 -61.303  -208.978 1.00 172.72 ? 180 ARG E CG    1 
ATOM   6981  C CD    . ARG E 1 183 ? 23.571 -62.257  -207.846 1.00 187.15 ? 180 ARG E CD    1 
ATOM   6982  N NE    . ARG E 1 183 ? 22.893 -63.456  -208.332 1.00 196.89 ? 180 ARG E NE    1 
ATOM   6983  C CZ    . ARG E 1 183 ? 22.683 -64.546  -207.601 1.00 185.16 ? 180 ARG E CZ    1 
ATOM   6984  N NH1   . ARG E 1 183 ? 23.099 -64.593  -206.342 1.00 164.53 ? 180 ARG E NH1   1 
ATOM   6985  N NH2   . ARG E 1 183 ? 22.057 -65.589  -208.127 1.00 186.69 ? 180 ARG E NH2   1 
ATOM   6986  N N     . GLN E 1 184 ? 27.688 -63.914  -209.182 1.00 180.53 ? 181 GLN E N     1 
ATOM   6987  C CA    . GLN E 1 184 ? 28.391 -65.172  -209.382 1.00 180.36 ? 181 GLN E CA    1 
ATOM   6988  C C     . GLN E 1 184 ? 27.533 -66.369  -208.990 1.00 177.09 ? 181 GLN E C     1 
ATOM   6989  O O     . GLN E 1 184 ? 26.619 -66.269  -208.166 1.00 177.78 ? 181 GLN E O     1 
ATOM   6990  C CB    . GLN E 1 184 ? 29.685 -65.182  -208.568 1.00 181.28 ? 181 GLN E CB    1 
ATOM   6991  C CG    . GLN E 1 184 ? 29.480 -64.803  -207.109 1.00 175.60 ? 181 GLN E CG    1 
ATOM   6992  C CD    . GLN E 1 184 ? 30.728 -64.987  -206.273 1.00 162.41 ? 181 GLN E CD    1 
ATOM   6993  O OE1   . GLN E 1 184 ? 31.487 -64.042  -206.054 1.00 158.89 ? 181 GLN E OE1   1 
ATOM   6994  N NE2   . GLN E 1 184 ? 30.947 -66.206  -205.796 1.00 150.45 ? 181 GLN E NE2   1 
ATOM   6995  N N     . LEU E 1 185 ? 27.845 -67.517  -209.599 1.00 174.02 ? 182 LEU E N     1 
ATOM   6996  C CA    . LEU E 1 185 ? 27.178 -68.780  -209.333 1.00 188.31 ? 182 LEU E CA    1 
ATOM   6997  C C     . LEU E 1 185 ? 27.716 -69.403  -208.043 1.00 190.86 ? 182 LEU E C     1 
ATOM   6998  O O     . LEU E 1 185 ? 28.858 -69.143  -207.654 1.00 187.72 ? 182 LEU E O     1 
ATOM   6999  C CB    . LEU E 1 185 ? 27.385 -69.739  -210.503 1.00 184.86 ? 182 LEU E CB    1 
ATOM   7000  C CG    . LEU E 1 185 ? 26.200 -70.597  -210.953 1.00 175.99 ? 182 LEU E CG    1 
ATOM   7001  C CD1   . LEU E 1 185 ? 25.001 -69.720  -211.283 1.00 173.03 ? 182 LEU E CD1   1 
ATOM   7002  C CD2   . LEU E 1 185 ? 26.581 -71.456  -212.148 1.00 169.17 ? 182 LEU E CD2   1 
ATOM   7003  N N     . PRO E 1 186 ? 26.901 -70.201  -207.349 1.00 187.19 ? 183 PRO E N     1 
ATOM   7004  C CA    . PRO E 1 186 ? 27.372 -70.858  -206.121 1.00 178.53 ? 183 PRO E CA    1 
ATOM   7005  C C     . PRO E 1 186 ? 28.682 -71.610  -206.327 1.00 182.90 ? 183 PRO E C     1 
ATOM   7006  O O     . PRO E 1 186 ? 28.878 -72.293  -207.335 1.00 183.25 ? 183 PRO E O     1 
ATOM   7007  C CB    . PRO E 1 186 ? 26.226 -71.814  -205.779 1.00 175.04 ? 183 PRO E CB    1 
ATOM   7008  C CG    . PRO E 1 186 ? 25.012 -71.131  -206.309 1.00 172.99 ? 183 PRO E CG    1 
ATOM   7009  C CD    . PRO E 1 186 ? 25.442 -70.332  -207.518 1.00 180.78 ? 183 PRO E CD    1 
ATOM   7010  N N     . LEU E 1 187 ? 29.583 -71.473  -205.357 1.00 182.63 ? 184 LEU E N     1 
ATOM   7011  C CA    . LEU E 1 187 ? 30.873 -72.147  -205.417 1.00 180.56 ? 184 LEU E CA    1 
ATOM   7012  C C     . LEU E 1 187 ? 30.710 -73.657  -205.272 1.00 177.57 ? 184 LEU E C     1 
ATOM   7013  O O     . LEU E 1 187 ? 29.787 -74.146  -204.614 1.00 181.77 ? 184 LEU E O     1 
ATOM   7014  C CB    . LEU E 1 187 ? 31.807 -71.626  -204.321 1.00 176.17 ? 184 LEU E CB    1 
ATOM   7015  C CG    . LEU E 1 187 ? 32.151 -70.132  -204.266 1.00 186.10 ? 184 LEU E CG    1 
ATOM   7016  C CD1   . LEU E 1 187 ? 32.388 -69.569  -205.665 1.00 187.99 ? 184 LEU E CD1   1 
ATOM   7017  C CD2   . LEU E 1 187 ? 31.094 -69.325  -203.513 1.00 171.49 ? 184 LEU E CD2   1 
ATOM   7018  N N     . GLU E 1 188 ? 31.621 -74.397  -205.898 1.00 168.61 ? 185 GLU E N     1 
ATOM   7019  C CA    . GLU E 1 188 ? 31.638 -75.851  -205.801 1.00 168.04 ? 185 GLU E CA    1 
ATOM   7020  C C     . GLU E 1 188 ? 32.599 -76.277  -204.697 1.00 175.03 ? 185 GLU E C     1 
ATOM   7021  O O     . GLU E 1 188 ? 33.724 -75.774  -204.616 1.00 180.29 ? 185 GLU E O     1 
ATOM   7022  C CB    . GLU E 1 188 ? 32.040 -76.483  -207.134 1.00 175.03 ? 185 GLU E CB    1 
ATOM   7023  C CG    . GLU E 1 188 ? 31.968 -78.002  -207.140 1.00 174.18 ? 185 GLU E CG    1 
ATOM   7024  C CD    . GLU E 1 188 ? 32.246 -78.597  -208.506 1.00 168.96 ? 185 GLU E CD    1 
ATOM   7025  O OE1   . GLU E 1 188 ? 33.207 -78.151  -209.167 1.00 168.00 ? 185 GLU E OE1   1 
ATOM   7026  O OE2   . GLU E 1 188 ? 31.499 -79.511  -208.919 1.00 144.81 ? 185 GLU E OE2   1 
ATOM   7027  N N     . VAL E 1 189 ? 32.153 -77.202  -203.850 1.00 169.74 ? 186 VAL E N     1 
ATOM   7028  C CA    . VAL E 1 189 ? 32.926 -77.664  -202.703 1.00 160.86 ? 186 VAL E CA    1 
ATOM   7029  C C     . VAL E 1 189 ? 33.623 -78.967  -203.072 1.00 153.33 ? 186 VAL E C     1 
ATOM   7030  O O     . VAL E 1 189 ? 32.982 -79.910  -203.554 1.00 152.01 ? 186 VAL E O     1 
ATOM   7031  C CB    . VAL E 1 189 ? 32.033 -77.849  -201.464 1.00 153.83 ? 186 VAL E CB    1 
ATOM   7032  C CG1   . VAL E 1 189 ? 32.856 -78.338  -200.285 1.00 155.17 ? 186 VAL E CG1   1 
ATOM   7033  C CG2   . VAL E 1 189 ? 31.332 -76.547  -201.118 1.00 148.14 ? 186 VAL E CG2   1 
ATOM   7034  N N     . ASP E 1 190 ? 34.934 -79.019  -202.846 1.00 140.16 ? 187 ASP E N     1 
ATOM   7035  C CA    . ASP E 1 190 ? 35.740 -80.192  -203.166 1.00 158.35 ? 187 ASP E CA    1 
ATOM   7036  C C     . ASP E 1 190 ? 35.786 -81.107  -201.946 1.00 156.71 ? 187 ASP E C     1 
ATOM   7037  O O     . ASP E 1 190 ? 36.354 -80.745  -200.910 1.00 155.52 ? 187 ASP E O     1 
ATOM   7038  C CB    . ASP E 1 190 ? 37.145 -79.774  -203.592 1.00 167.08 ? 187 ASP E CB    1 
ATOM   7039  C CG    . ASP E 1 190 ? 38.028 -80.958  -203.932 1.00 183.04 ? 187 ASP E CG    1 
ATOM   7040  O OD1   . ASP E 1 190 ? 37.819 -81.567  -205.003 1.00 179.60 ? 187 ASP E OD1   1 
ATOM   7041  O OD2   . ASP E 1 190 ? 38.929 -81.280  -203.130 1.00 185.19 ? 187 ASP E OD2   1 
ATOM   7042  N N     . LEU E 1 191 ? 35.190 -82.294  -202.070 1.00 146.35 ? 188 LEU E N     1 
ATOM   7043  C CA    . LEU E 1 191 ? 35.136 -83.271  -200.989 1.00 144.43 ? 188 LEU E CA    1 
ATOM   7044  C C     . LEU E 1 191 ? 36.125 -84.417  -201.180 1.00 142.33 ? 188 LEU E C     1 
ATOM   7045  O O     . LEU E 1 191 ? 35.866 -85.540  -200.735 1.00 130.23 ? 188 LEU E O     1 
ATOM   7046  C CB    . LEU E 1 191 ? 33.715 -83.814  -200.839 1.00 144.96 ? 188 LEU E CB    1 
ATOM   7047  C CG    . LEU E 1 191 ? 32.647 -82.748  -200.599 1.00 140.40 ? 188 LEU E CG    1 
ATOM   7048  C CD1   . LEU E 1 191 ? 31.297 -83.386  -200.335 1.00 141.41 ? 188 LEU E CD1   1 
ATOM   7049  C CD2   . LEU E 1 191 ? 33.055 -81.859  -199.438 1.00 135.66 ? 188 LEU E CD2   1 
ATOM   7050  N N     . THR E 1 192 ? 37.255 -84.158  -201.838 1.00 148.61 ? 189 THR E N     1 
ATOM   7051  C CA    . THR E 1 192 ? 38.270 -85.194  -202.002 1.00 152.23 ? 189 THR E CA    1 
ATOM   7052  C C     . THR E 1 192 ? 39.070 -85.387  -200.718 1.00 148.43 ? 189 THR E C     1 
ATOM   7053  O O     . THR E 1 192 ? 39.098 -86.483  -200.148 1.00 140.90 ? 189 THR E O     1 
ATOM   7054  C CB    . THR E 1 192 ? 39.199 -84.846  -203.169 1.00 148.57 ? 189 THR E CB    1 
ATOM   7055  O OG1   . THR E 1 192 ? 39.869 -83.609  -202.897 1.00 150.14 ? 189 THR E OG1   1 
ATOM   7056  C CG2   . THR E 1 192 ? 38.408 -84.720  -204.462 1.00 131.09 ? 189 THR E CG2   1 
ATOM   7057  N N     . LYS E 1 193 ? 39.727 -84.326  -200.249 1.00 152.12 ? 190 LYS E N     1 
ATOM   7058  C CA    . LYS E 1 193 ? 40.529 -84.364  -199.033 1.00 155.08 ? 190 LYS E CA    1 
ATOM   7059  C C     . LYS E 1 193 ? 39.699 -84.180  -197.766 1.00 153.23 ? 190 LYS E C     1 
ATOM   7060  O O     . LYS E 1 193 ? 40.254 -83.812  -196.723 1.00 131.44 ? 190 LYS E O     1 
ATOM   7061  C CB    . LYS E 1 193 ? 41.628 -83.301  -199.099 1.00 147.09 ? 190 LYS E CB    1 
ATOM   7062  C CG    . LYS E 1 193 ? 42.521 -83.417  -200.323 1.00 148.47 ? 190 LYS E CG    1 
ATOM   7063  C CD    . LYS E 1 193 ? 43.570 -82.319  -200.354 1.00 152.55 ? 190 LYS E CD    1 
ATOM   7064  C CE    . LYS E 1 193 ? 44.425 -82.415  -201.608 1.00 156.30 ? 190 LYS E CE    1 
ATOM   7065  N NZ    . LYS E 1 193 ? 45.445 -81.332  -201.671 1.00 139.52 ? 190 LYS E NZ    1 
ATOM   7066  N N     . ALA E 1 194 ? 38.391 -84.417  -197.836 1.00 157.29 ? 191 ALA E N     1 
ATOM   7067  C CA    . ALA E 1 194 ? 37.530 -84.275  -196.672 1.00 145.10 ? 191 ALA E CA    1 
ATOM   7068  C C     . ALA E 1 194 ? 37.899 -85.297  -195.600 1.00 148.79 ? 191 ALA E C     1 
ATOM   7069  O O     . ALA E 1 194 ? 38.470 -86.355  -195.878 1.00 152.80 ? 191 ALA E O     1 
ATOM   7070  C CB    . ALA E 1 194 ? 36.063 -84.434  -197.070 1.00 138.08 ? 191 ALA E CB    1 
ATOM   7071  N N     . LYS E 1 195 ? 37.568 -84.961  -194.355 1.00 137.88 ? 192 LYS E N     1 
ATOM   7072  C CA    . LYS E 1 195 ? 37.846 -85.854  -193.238 1.00 141.61 ? 192 LYS E CA    1 
ATOM   7073  C C     . LYS E 1 195 ? 37.043 -87.141  -193.377 1.00 146.37 ? 192 LYS E C     1 
ATOM   7074  O O     . LYS E 1 195 ? 35.831 -87.112  -193.606 1.00 134.25 ? 192 LYS E O     1 
ATOM   7075  C CB    . LYS E 1 195 ? 37.515 -85.161  -191.916 1.00 144.03 ? 192 LYS E CB    1 
ATOM   7076  C CG    . LYS E 1 195 ? 37.849 -85.979  -190.679 1.00 149.10 ? 192 LYS E CG    1 
ATOM   7077  C CD    . LYS E 1 195 ? 37.874 -85.103  -189.437 1.00 112.67 ? 192 LYS E CD    1 
ATOM   7078  C CE    . LYS E 1 195 ? 38.351 -85.878  -188.222 1.00 111.29 ? 192 LYS E CE    1 
ATOM   7079  N NZ    . LYS E 1 195 ? 39.628 -86.597  -188.487 1.00 127.96 ? 192 LYS E NZ    1 
ATOM   7080  N N     . ARG E 1 196 ? 37.728 -88.278  -193.235 1.00 145.39 ? 193 ARG E N     1 
ATOM   7081  C CA    . ARG E 1 196 ? 37.115 -89.578  -193.456 1.00 142.84 ? 193 ARG E CA    1 
ATOM   7082  C C     . ARG E 1 196 ? 37.306 -90.561  -192.310 1.00 145.99 ? 193 ARG E C     1 
ATOM   7083  O O     . ARG E 1 196 ? 36.714 -91.645  -192.354 1.00 148.37 ? 193 ARG E O     1 
ATOM   7084  C CB    . ARG E 1 196 ? 37.651 -90.210  -194.751 1.00 141.47 ? 193 ARG E CB    1 
ATOM   7085  C CG    . ARG E 1 196 ? 37.269 -89.437  -196.005 1.00 148.02 ? 193 ARG E CG    1 
ATOM   7086  C CD    . ARG E 1 196 ? 37.282 -90.318  -197.244 1.00 149.85 ? 193 ARG E CD    1 
ATOM   7087  N NE    . ARG E 1 196 ? 36.268 -89.909  -198.212 1.00 134.96 ? 193 ARG E NE    1 
ATOM   7088  C CZ    . ARG E 1 196 ? 36.387 -88.867  -199.029 1.00 147.99 ? 193 ARG E CZ    1 
ATOM   7089  N NH1   . ARG E 1 196 ? 37.483 -88.120  -199.002 1.00 149.32 ? 193 ARG E NH1   1 
ATOM   7090  N NH2   . ARG E 1 196 ? 35.410 -88.572  -199.876 1.00 154.86 ? 193 ARG E NH2   1 
ATOM   7091  N N     . GLN E 1 197 ? 38.104 -90.229  -191.297 1.00 150.38 ? 194 GLN E N     1 
ATOM   7092  C CA    . GLN E 1 197 ? 38.284 -91.093  -190.141 1.00 152.17 ? 194 GLN E CA    1 
ATOM   7093  C C     . GLN E 1 197 ? 38.408 -90.231  -188.892 1.00 144.72 ? 194 GLN E C     1 
ATOM   7094  O O     . GLN E 1 197 ? 38.578 -89.011  -188.964 1.00 136.02 ? 194 GLN E O     1 
ATOM   7095  C CB    . GLN E 1 197 ? 39.510 -92.004  -190.302 1.00 145.05 ? 194 GLN E CB    1 
ATOM   7096  C CG    . GLN E 1 197 ? 40.828 -91.386  -189.847 1.00 148.95 ? 194 GLN E CG    1 
ATOM   7097  C CD    . GLN E 1 197 ? 41.295 -90.248  -190.738 1.00 142.96 ? 194 GLN E CD    1 
ATOM   7098  O OE1   . GLN E 1 197 ? 40.725 -89.997  -191.800 1.00 152.36 ? 194 GLN E OE1   1 
ATOM   7099  N NE2   . GLN E 1 197 ? 42.338 -89.550  -190.303 1.00 134.55 ? 194 GLN E NE2   1 
ATOM   7100  N N     . ASP E 1 198 ? 38.322 -90.886  -187.733 1.00 144.96 ? 195 ASP E N     1 
ATOM   7101  C CA    . ASP E 1 198 ? 38.327 -90.172  -186.459 1.00 143.60 ? 195 ASP E CA    1 
ATOM   7102  C C     . ASP E 1 198 ? 39.728 -89.699  -186.086 1.00 136.95 ? 195 ASP E C     1 
ATOM   7103  O O     . ASP E 1 198 ? 39.952 -88.507  -185.848 1.00 133.89 ? 195 ASP E O     1 
ATOM   7104  C CB    . ASP E 1 198 ? 37.751 -91.063  -185.355 1.00 158.55 ? 195 ASP E CB    1 
ATOM   7105  C CG    . ASP E 1 198 ? 36.294 -91.413  -185.587 1.00 146.35 ? 195 ASP E CG    1 
ATOM   7106  O OD1   . ASP E 1 198 ? 35.668 -90.807  -186.483 1.00 140.54 ? 195 ASP E OD1   1 
ATOM   7107  O OD2   . ASP E 1 198 ? 35.773 -92.293  -184.870 1.00 133.60 ? 195 ASP E OD2   1 
ATOM   7108  N N     . LEU E 1 199 ? 40.680 -90.629  -186.024 1.00 135.40 ? 196 LEU E N     1 
ATOM   7109  C CA    . LEU E 1 199 ? 42.007 -90.327  -185.504 1.00 134.73 ? 196 LEU E CA    1 
ATOM   7110  C C     . LEU E 1 199 ? 42.702 -89.261  -186.343 1.00 135.97 ? 196 LEU E C     1 
ATOM   7111  O O     . LEU E 1 199 ? 42.596 -89.240  -187.572 1.00 134.19 ? 196 LEU E O     1 
ATOM   7112  C CB    . LEU E 1 199 ? 42.857 -91.599  -185.458 1.00 129.91 ? 196 LEU E CB    1 
ATOM   7113  C CG    . LEU E 1 199 ? 44.297 -91.455  -184.956 1.00 137.25 ? 196 LEU E CG    1 
ATOM   7114  C CD1   . LEU E 1 199 ? 44.327 -90.839  -183.564 1.00 118.20 ? 196 LEU E CD1   1 
ATOM   7115  C CD2   . LEU E 1 199 ? 45.008 -92.800  -184.965 1.00 128.93 ? 196 LEU E CD2   1 
ATOM   7116  N N     . GLU E 1 200 ? 43.422 -88.369  -185.659 1.00 134.53 ? 197 GLU E N     1 
ATOM   7117  C CA    . GLU E 1 200 ? 44.223 -87.318  -186.282 1.00 139.01 ? 197 GLU E CA    1 
ATOM   7118  C C     . GLU E 1 200 ? 45.652 -87.473  -185.773 1.00 143.95 ? 197 GLU E C     1 
ATOM   7119  O O     . GLU E 1 200 ? 46.050 -86.814  -184.800 1.00 147.51 ? 197 GLU E O     1 
ATOM   7120  C CB    . GLU E 1 200 ? 43.672 -85.929  -185.965 1.00 134.77 ? 197 GLU E CB    1 
ATOM   7121  C CG    . GLU E 1 200 ? 42.389 -85.579  -186.697 1.00 123.27 ? 197 GLU E CG    1 
ATOM   7122  C CD    . GLU E 1 200 ? 42.632 -85.192  -188.141 1.00 144.96 ? 197 GLU E CD    1 
ATOM   7123  O OE1   . GLU E 1 200 ? 43.579 -84.419  -188.398 1.00 149.66 ? 197 GLU E OE1   1 
ATOM   7124  O OE2   . GLU E 1 200 ? 41.877 -85.659  -189.019 1.00 153.98 ? 197 GLU E OE2   1 
ATOM   7125  N N     . PRO E 1 201 ? 46.445 -88.353  -186.393 1.00 138.43 ? 198 PRO E N     1 
ATOM   7126  C CA    . PRO E 1 201 ? 47.823 -88.556  -185.916 1.00 141.17 ? 198 PRO E CA    1 
ATOM   7127  C C     . PRO E 1 201 ? 48.656 -87.289  -185.923 1.00 140.81 ? 198 PRO E C     1 
ATOM   7128  O O     . PRO E 1 201 ? 49.522 -87.128  -185.054 1.00 134.25 ? 198 PRO E O     1 
ATOM   7129  C CB    . PRO E 1 201 ? 48.376 -89.602  -186.895 1.00 147.92 ? 198 PRO E CB    1 
ATOM   7130  C CG    . PRO E 1 201 ? 47.163 -90.325  -187.387 1.00 151.10 ? 198 PRO E CG    1 
ATOM   7131  C CD    . PRO E 1 201 ? 46.106 -89.264  -187.499 1.00 134.34 ? 198 PRO E CD    1 
ATOM   7132  N N     . SER E 1 202 ? 48.423 -86.387  -186.879 1.00 136.73 ? 199 SER E N     1 
ATOM   7133  C CA    . SER E 1 202 ? 49.108 -85.098  -186.867 1.00 128.08 ? 199 SER E CA    1 
ATOM   7134  C C     . SER E 1 202 ? 48.864 -84.355  -185.558 1.00 129.81 ? 199 SER E C     1 
ATOM   7135  O O     . SER E 1 202 ? 49.786 -83.757  -184.992 1.00 129.55 ? 199 SER E O     1 
ATOM   7136  C CB    . SER E 1 202 ? 48.654 -84.252  -188.057 1.00 124.39 ? 199 SER E CB    1 
ATOM   7137  O OG    . SER E 1 202 ? 49.393 -83.045  -188.135 1.00 129.43 ? 199 SER E OG    1 
ATOM   7138  N N     . VAL E 1 203 ? 47.628 -84.391  -185.060 1.00 136.05 ? 200 VAL E N     1 
ATOM   7139  C CA    . VAL E 1 203 ? 47.289 -83.720  -183.809 1.00 131.63 ? 200 VAL E CA    1 
ATOM   7140  C C     . VAL E 1 203 ? 47.729 -84.552  -182.612 1.00 134.16 ? 200 VAL E C     1 
ATOM   7141  O O     . VAL E 1 203 ? 48.251 -84.016  -181.625 1.00 129.55 ? 200 VAL E O     1 
ATOM   7142  C CB    . VAL E 1 203 ? 45.778 -83.421  -183.760 1.00 124.32 ? 200 VAL E CB    1 
ATOM   7143  C CG1   . VAL E 1 203 ? 45.436 -82.645  -182.498 1.00 122.09 ? 200 VAL E CG1   1 
ATOM   7144  C CG2   . VAL E 1 203 ? 45.336 -82.671  -185.007 1.00 136.50 ? 200 VAL E CG2   1 
ATOM   7145  N N     . GLU E 1 204 ? 47.457 -85.861  -182.658 1.00 137.62 ? 201 GLU E N     1 
ATOM   7146  C CA    . GLU E 1 204 ? 47.840 -86.762  -181.574 1.00 136.94 ? 201 GLU E CA    1 
ATOM   7147  C C     . GLU E 1 204 ? 49.330 -86.662  -181.264 1.00 137.19 ? 201 GLU E C     1 
ATOM   7148  O O     . GLU E 1 204 ? 49.732 -86.681  -180.096 1.00 118.86 ? 201 GLU E O     1 
ATOM   7149  C CB    . GLU E 1 204 ? 47.459 -88.197  -181.941 1.00 146.60 ? 201 GLU E CB    1 
ATOM   7150  C CG    . GLU E 1 204 ? 48.008 -89.264  -181.008 1.00 158.76 ? 201 GLU E CG    1 
ATOM   7151  C CD    . GLU E 1 204 ? 47.382 -89.211  -179.631 1.00 157.94 ? 201 GLU E CD    1 
ATOM   7152  O OE1   . GLU E 1 204 ? 46.147 -89.369  -179.535 1.00 150.85 ? 201 GLU E OE1   1 
ATOM   7153  O OE2   . GLU E 1 204 ? 48.124 -89.019  -178.645 1.00 161.94 ? 201 GLU E OE2   1 
ATOM   7154  N N     . GLU E 1 205 ? 50.160 -86.549  -182.303 1.00 148.51 ? 202 GLU E N     1 
ATOM   7155  C CA    . GLU E 1 205 ? 51.604 -86.433  -182.124 1.00 144.74 ? 202 GLU E CA    1 
ATOM   7156  C C     . GLU E 1 205 ? 51.958 -85.201  -181.299 1.00 137.10 ? 202 GLU E C     1 
ATOM   7157  O O     . GLU E 1 205 ? 52.646 -85.293  -180.272 1.00 138.82 ? 202 GLU E O     1 
ATOM   7158  C CB    . GLU E 1 205 ? 52.278 -86.377  -183.497 1.00 142.38 ? 202 GLU E CB    1 
ATOM   7159  C CG    . GLU E 1 205 ? 53.789 -86.471  -183.484 1.00 141.41 ? 202 GLU E CG    1 
ATOM   7160  C CD    . GLU E 1 205 ? 54.363 -86.544  -184.884 1.00 156.12 ? 202 GLU E CD    1 
ATOM   7161  O OE1   . GLU E 1 205 ? 54.194 -85.568  -185.646 1.00 150.42 ? 202 GLU E OE1   1 
ATOM   7162  O OE2   . GLU E 1 205 ? 54.976 -87.577  -185.226 1.00 172.79 ? 202 GLU E OE2   1 
ATOM   7163  N N     . ALA E 1 206 ? 51.509 -84.030  -181.755 1.00 133.05 ? 203 ALA E N     1 
ATOM   7164  C CA    . ALA E 1 206 ? 51.818 -82.786  -181.060 1.00 137.21 ? 203 ALA E CA    1 
ATOM   7165  C C     . ALA E 1 206 ? 51.267 -82.791  -179.641 1.00 135.09 ? 203 ALA E C     1 
ATOM   7166  O O     . ALA E 1 206 ? 51.900 -82.259  -178.721 1.00 133.40 ? 203 ALA E O     1 
ATOM   7167  C CB    . ALA E 1 206 ? 51.264 -81.599  -181.847 1.00 137.26 ? 203 ALA E CB    1 
ATOM   7168  N N     . ARG E 1 207 ? 50.093 -83.393  -179.435 1.00 137.32 ? 204 ARG E N     1 
ATOM   7169  C CA    . ARG E 1 207 ? 49.505 -83.377  -178.099 1.00 136.63 ? 204 ARG E CA    1 
ATOM   7170  C C     . ARG E 1 207 ? 50.247 -84.318  -177.157 1.00 136.99 ? 204 ARG E C     1 
ATOM   7171  O O     . ARG E 1 207 ? 50.429 -84.004  -175.974 1.00 141.87 ? 204 ARG E O     1 
ATOM   7172  C CB    . ARG E 1 207 ? 48.022 -83.730  -178.165 1.00 132.17 ? 204 ARG E CB    1 
ATOM   7173  C CG    . ARG E 1 207 ? 47.264 -83.412  -176.886 1.00 123.89 ? 204 ARG E CG    1 
ATOM   7174  C CD    . ARG E 1 207 ? 45.854 -83.948  -176.949 1.00 119.57 ? 204 ARG E CD    1 
ATOM   7175  N NE    . ARG E 1 207 ? 45.223 -83.655  -178.233 1.00 122.37 ? 204 ARG E NE    1 
ATOM   7176  C CZ    . ARG E 1 207 ? 44.395 -84.484  -178.860 1.00 112.77 ? 204 ARG E CZ    1 
ATOM   7177  N NH1   . ARG E 1 207 ? 44.103 -85.661  -178.325 1.00 117.83 ? 204 ARG E NH1   1 
ATOM   7178  N NH2   . ARG E 1 207 ? 43.866 -84.141  -180.024 1.00 105.42 ? 204 ARG E NH2   1 
ATOM   7179  N N     . TYR E 1 208 ? 50.676 -85.481  -177.657 1.00 130.53 ? 205 TYR E N     1 
ATOM   7180  C CA    . TYR E 1 208 ? 51.500 -86.373  -176.850 1.00 125.72 ? 205 TYR E CA    1 
ATOM   7181  C C     . TYR E 1 208 ? 52.844 -85.741  -176.524 1.00 134.72 ? 205 TYR E C     1 
ATOM   7182  O O     . TYR E 1 208 ? 53.400 -85.986  -175.447 1.00 135.94 ? 205 TYR E O     1 
ATOM   7183  C CB    . TYR E 1 208 ? 51.700 -87.705  -177.574 1.00 127.46 ? 205 TYR E CB    1 
ATOM   7184  C CG    . TYR E 1 208 ? 52.696 -88.618  -176.898 1.00 135.43 ? 205 TYR E CG    1 
ATOM   7185  C CD1   . TYR E 1 208 ? 52.435 -89.159  -175.646 1.00 140.41 ? 205 TYR E CD1   1 
ATOM   7186  C CD2   . TYR E 1 208 ? 53.901 -88.936  -177.510 1.00 141.83 ? 205 TYR E CD2   1 
ATOM   7187  C CE1   . TYR E 1 208 ? 53.347 -89.991  -175.023 1.00 147.50 ? 205 TYR E CE1   1 
ATOM   7188  C CE2   . TYR E 1 208 ? 54.818 -89.769  -176.897 1.00 151.96 ? 205 TYR E CE2   1 
ATOM   7189  C CZ    . TYR E 1 208 ? 54.536 -90.294  -175.654 1.00 153.68 ? 205 TYR E CZ    1 
ATOM   7190  O OH    . TYR E 1 208 ? 55.447 -91.123  -175.040 1.00 158.18 ? 205 TYR E OH    1 
ATOM   7191  N N     . ASN E 1 209 ? 53.382 -84.929  -177.434 1.00 137.10 ? 206 ASN E N     1 
ATOM   7192  C CA    . ASN E 1 209 ? 54.611 -84.202  -177.141 1.00 135.37 ? 206 ASN E CA    1 
ATOM   7193  C C     . ASN E 1 209 ? 54.374 -82.938  -176.323 1.00 136.33 ? 206 ASN E C     1 
ATOM   7194  O O     . ASN E 1 209 ? 55.347 -82.322  -175.874 1.00 136.19 ? 206 ASN E O     1 
ATOM   7195  C CB    . ASN E 1 209 ? 55.334 -83.842  -178.442 1.00 139.01 ? 206 ASN E CB    1 
ATOM   7196  C CG    . ASN E 1 209 ? 55.884 -85.060  -179.158 1.00 137.64 ? 206 ASN E CG    1 
ATOM   7197  O OD1   . ASN E 1 209 ? 55.508 -85.348  -180.294 1.00 139.35 ? 206 ASN E OD1   1 
ATOM   7198  N ND2   . ASN E 1 209 ? 56.782 -85.781  -178.496 1.00 146.26 ? 206 ASN E ND2   1 
ATOM   7199  N N     . SER E 1 210 ? 53.117 -82.544  -176.113 1.00 137.56 ? 207 SER E N     1 
ATOM   7200  C CA    . SER E 1 210 ? 52.802 -81.322  -175.382 1.00 137.45 ? 207 SER E CA    1 
ATOM   7201  C C     . SER E 1 210 ? 52.940 -81.462  -173.871 1.00 134.66 ? 207 SER E C     1 
ATOM   7202  O O     . SER E 1 210 ? 52.793 -80.461  -173.162 1.00 130.26 ? 207 SER E O     1 
ATOM   7203  C CB    . SER E 1 210 ? 51.379 -80.867  -175.719 1.00 134.77 ? 207 SER E CB    1 
ATOM   7204  O OG    . SER E 1 210 ? 51.157 -79.530  -175.310 1.00 137.45 ? 207 SER E OG    1 
ATOM   7205  N N     . CYS E 1 211 ? 53.210 -82.658  -173.361 1.00 135.90 ? 208 CYS E N     1 
ATOM   7206  C CA    . CYS E 1 211 ? 53.355 -82.847  -171.922 1.00 139.53 ? 208 CYS E CA    1 
ATOM   7207  C C     . CYS E 1 211 ? 54.803 -82.657  -171.481 1.00 139.03 ? 208 CYS E C     1 
ATOM   7208  O O     . CYS E 1 211 ? 55.284 -83.348  -170.582 1.00 134.27 ? 208 CYS E O     1 
ATOM   7209  C CB    . CYS E 1 211 ? 52.855 -84.231  -171.509 1.00 137.96 ? 208 CYS E CB    1 
ATOM   7210  S SG    . CYS E 1 211 ? 51.091 -84.501  -171.795 1.00 154.30 ? 208 CYS E SG    1 
ATOM   7211  N N     . CYS F 1 28  ? 46.557 -77.255  -164.744 1.00 104.56 ? 25  CYS F N     1 
ATOM   7212  C CA    . CYS F 1 28  ? 45.345 -78.065  -164.785 1.00 114.53 ? 25  CYS F CA    1 
ATOM   7213  C C     . CYS F 1 28  ? 44.409 -77.592  -165.893 1.00 105.44 ? 25  CYS F C     1 
ATOM   7214  O O     . CYS F 1 28  ? 44.794 -76.780  -166.735 1.00 114.53 ? 25  CYS F O     1 
ATOM   7215  C CB    . CYS F 1 28  ? 44.627 -78.022  -163.435 1.00 115.98 ? 25  CYS F CB    1 
ATOM   7216  S SG    . CYS F 1 28  ? 44.179 -76.359  -162.886 1.00 126.43 ? 25  CYS F SG    1 
ATOM   7217  N N     . PHE F 1 29  ? 43.180 -78.104  -165.889 1.00 87.59  ? 26  PHE F N     1 
ATOM   7218  C CA    . PHE F 1 29  ? 42.197 -77.690  -166.880 1.00 76.58  ? 26  PHE F CA    1 
ATOM   7219  C C     . PHE F 1 29  ? 41.790 -76.242  -166.640 1.00 102.43 ? 26  PHE F C     1 
ATOM   7220  O O     . PHE F 1 29  ? 41.638 -75.802  -165.497 1.00 108.13 ? 26  PHE F O     1 
ATOM   7221  C CB    . PHE F 1 29  ? 40.972 -78.602  -166.829 1.00 72.25  ? 26  PHE F CB    1 
ATOM   7222  C CG    . PHE F 1 29  ? 40.137 -78.568  -168.077 1.00 74.40  ? 26  PHE F CG    1 
ATOM   7223  C CD1   . PHE F 1 29  ? 39.228 -77.547  -168.294 1.00 77.85  ? 26  PHE F CD1   1 
ATOM   7224  C CD2   . PHE F 1 29  ? 40.267 -79.557  -169.037 1.00 81.64  ? 26  PHE F CD2   1 
ATOM   7225  C CE1   . PHE F 1 29  ? 38.462 -77.515  -169.443 1.00 80.87  ? 26  PHE F CE1   1 
ATOM   7226  C CE2   . PHE F 1 29  ? 39.504 -79.531  -170.188 1.00 77.89  ? 26  PHE F CE2   1 
ATOM   7227  C CZ    . PHE F 1 29  ? 38.602 -78.507  -170.392 1.00 78.14  ? 26  PHE F CZ    1 
ATOM   7228  N N     . GLY F 1 30  ? 41.611 -75.499  -167.732 1.00 99.49  ? 27  GLY F N     1 
ATOM   7229  C CA    . GLY F 1 30  ? 41.372 -74.075  -167.654 1.00 93.40  ? 27  GLY F CA    1 
ATOM   7230  C C     . GLY F 1 30  ? 42.620 -73.237  -167.487 1.00 91.35  ? 27  GLY F C     1 
ATOM   7231  O O     . GLY F 1 30  ? 42.555 -72.014  -167.673 1.00 89.48  ? 27  GLY F O     1 
ATOM   7232  N N     . GLN F 1 31  ? 43.748 -73.849  -167.133 1.00 97.21  ? 28  GLN F N     1 
ATOM   7233  C CA    . GLN F 1 31  ? 45.020 -73.164  -166.945 1.00 99.14  ? 28  GLN F CA    1 
ATOM   7234  C C     . GLN F 1 31  ? 46.046 -73.500  -168.014 1.00 107.42 ? 28  GLN F C     1 
ATOM   7235  O O     . GLN F 1 31  ? 46.759 -72.608  -168.478 1.00 109.97 ? 28  GLN F O     1 
ATOM   7236  C CB    . GLN F 1 31  ? 45.605 -73.504  -165.568 1.00 96.09  ? 28  GLN F CB    1 
ATOM   7237  C CG    . GLN F 1 31  ? 44.737 -73.090  -164.384 1.00 103.51 ? 28  GLN F CG    1 
ATOM   7238  C CD    . GLN F 1 31  ? 44.821 -71.606  -164.068 1.00 121.44 ? 28  GLN F CD    1 
ATOM   7239  O OE1   . GLN F 1 31  ? 45.264 -70.802  -164.889 1.00 118.45 ? 28  GLN F OE1   1 
ATOM   7240  N NE2   . GLN F 1 31  ? 44.393 -71.237  -162.866 1.00 136.95 ? 28  GLN F NE2   1 
ATOM   7241  N N     . CYS F 1 32  ? 46.140 -74.771  -168.407 1.00 114.61 ? 29  CYS F N     1 
ATOM   7242  C CA    . CYS F 1 32  ? 47.142 -75.199  -169.376 1.00 122.22 ? 29  CYS F CA    1 
ATOM   7243  C C     . CYS F 1 32  ? 46.948 -74.488  -170.710 1.00 120.13 ? 29  CYS F C     1 
ATOM   7244  O O     . CYS F 1 32  ? 45.832 -74.411  -171.231 1.00 110.84 ? 29  CYS F O     1 
ATOM   7245  C CB    . CYS F 1 32  ? 47.066 -76.714  -169.572 1.00 119.39 ? 29  CYS F CB    1 
ATOM   7246  S SG    . CYS F 1 32  ? 47.619 -77.684  -168.151 1.00 136.97 ? 29  CYS F SG    1 
ATOM   7247  N N     . GLN F 1 33  ? 48.041 -73.966  -171.257 1.00 126.11 ? 30  GLN F N     1 
ATOM   7248  C CA    . GLN F 1 33  ? 48.024 -73.241  -172.518 1.00 122.48 ? 30  GLN F CA    1 
ATOM   7249  C C     . GLN F 1 33  ? 48.439 -74.151  -173.669 1.00 118.51 ? 30  GLN F C     1 
ATOM   7250  O O     . GLN F 1 33  ? 49.247 -75.069  -173.503 1.00 109.28 ? 30  GLN F O     1 
ATOM   7251  C CB    . GLN F 1 33  ? 48.947 -72.022  -172.454 1.00 121.43 ? 30  GLN F CB    1 
ATOM   7252  C CG    . GLN F 1 33  ? 48.477 -70.954  -171.480 1.00 138.13 ? 30  GLN F CG    1 
ATOM   7253  C CD    . GLN F 1 33  ? 49.428 -69.777  -171.394 1.00 165.54 ? 30  GLN F CD    1 
ATOM   7254  O OE1   . GLN F 1 33  ? 49.852 -69.230  -172.412 1.00 172.39 ? 30  GLN F OE1   1 
ATOM   7255  N NE2   . GLN F 1 33  ? 49.765 -69.377  -170.173 1.00 179.41 ? 30  GLN F NE2   1 
ATOM   7256  N N     . TYR F 1 34  ? 47.872 -73.884  -174.843 1.00 132.34 ? 31  TYR F N     1 
ATOM   7257  C CA    . TYR F 1 34  ? 48.163 -74.687  -176.024 1.00 115.10 ? 31  TYR F CA    1 
ATOM   7258  C C     . TYR F 1 34  ? 49.552 -74.377  -176.567 1.00 120.47 ? 31  TYR F C     1 
ATOM   7259  O O     . TYR F 1 34  ? 49.959 -73.215  -176.656 1.00 109.84 ? 31  TYR F O     1 
ATOM   7260  C CB    . TYR F 1 34  ? 47.121 -74.431  -177.112 1.00 106.48 ? 31  TYR F CB    1 
ATOM   7261  C CG    . TYR F 1 34  ? 45.885 -75.290  -177.009 1.00 104.98 ? 31  TYR F CG    1 
ATOM   7262  C CD1   . TYR F 1 34  ? 45.967 -76.672  -177.110 1.00 112.70 ? 31  TYR F CD1   1 
ATOM   7263  C CD2   . TYR F 1 34  ? 44.633 -74.719  -176.822 1.00 103.65 ? 31  TYR F CD2   1 
ATOM   7264  C CE1   . TYR F 1 34  ? 44.838 -77.462  -177.022 1.00 115.67 ? 31  TYR F CE1   1 
ATOM   7265  C CE2   . TYR F 1 34  ? 43.498 -75.501  -176.732 1.00 101.40 ? 31  TYR F CE2   1 
ATOM   7266  C CZ    . TYR F 1 34  ? 43.607 -76.872  -176.833 1.00 107.81 ? 31  TYR F CZ    1 
ATOM   7267  O OH    . TYR F 1 34  ? 42.479 -77.656  -176.744 1.00 111.47 ? 31  TYR F OH    1 
ATOM   7268  N N     . THR F 1 35  ? 50.282 -75.428  -176.931 1.00 119.16 ? 32  THR F N     1 
ATOM   7269  C CA    . THR F 1 35  ? 51.558 -75.259  -177.605 1.00 110.39 ? 32  THR F CA    1 
ATOM   7270  C C     . THR F 1 35  ? 51.338 -74.940  -179.083 1.00 116.02 ? 32  THR F C     1 
ATOM   7271  O O     . THR F 1 35  ? 50.248 -75.122  -179.631 1.00 111.95 ? 32  THR F O     1 
ATOM   7272  C CB    . THR F 1 35  ? 52.422 -76.513  -177.463 1.00 102.19 ? 32  THR F CB    1 
ATOM   7273  O OG1   . THR F 1 35  ? 51.707 -77.648  -177.965 1.00 107.21 ? 32  THR F OG1   1 
ATOM   7274  C CG2   . THR F 1 35  ? 52.784 -76.747  -176.004 1.00 121.85 ? 32  THR F CG2   1 
ATOM   7275  N N     . ALA F 1 36  ? 52.402 -74.450  -179.725 1.00 122.34 ? 33  ALA F N     1 
ATOM   7276  C CA    . ALA F 1 36  ? 52.317 -74.054  -181.129 1.00 113.39 ? 33  ALA F CA    1 
ATOM   7277  C C     . ALA F 1 36  ? 51.941 -75.233  -182.020 1.00 123.93 ? 33  ALA F C     1 
ATOM   7278  O O     . ALA F 1 36  ? 51.067 -75.119  -182.890 1.00 130.18 ? 33  ALA F O     1 
ATOM   7279  C CB    . ALA F 1 36  ? 53.644 -73.441  -181.579 1.00 112.68 ? 33  ALA F CB    1 
ATOM   7280  N N     . GLU F 1 37  ? 52.600 -76.377  -181.821 1.00 122.81 ? 34  GLU F N     1 
ATOM   7281  C CA    . GLU F 1 37  ? 52.351 -77.543  -182.665 1.00 119.49 ? 34  GLU F CA    1 
ATOM   7282  C C     . GLU F 1 37  ? 50.915 -78.029  -182.514 1.00 112.20 ? 34  GLU F C     1 
ATOM   7283  O O     . GLU F 1 37  ? 50.218 -78.267  -183.509 1.00 97.39  ? 34  GLU F O     1 
ATOM   7284  C CB    . GLU F 1 37  ? 53.333 -78.662  -182.314 1.00 127.61 ? 34  GLU F CB    1 
ATOM   7285  C CG    . GLU F 1 37  ? 54.749 -78.195  -182.014 1.00 127.43 ? 34  GLU F CG    1 
ATOM   7286  C CD    . GLU F 1 37  ? 54.956 -77.881  -180.544 1.00 139.49 ? 34  GLU F CD    1 
ATOM   7287  O OE1   . GLU F 1 37  ? 54.707 -78.773  -179.704 1.00 146.16 ? 34  GLU F OE1   1 
ATOM   7288  O OE2   . GLU F 1 37  ? 55.363 -76.743  -180.228 1.00 131.11 ? 34  GLU F OE2   1 
ATOM   7289  N N     . GLU F 1 38  ? 50.465 -78.199  -181.268 1.00 117.98 ? 35  GLU F N     1 
ATOM   7290  C CA    . GLU F 1 38  ? 49.089 -78.614  -181.014 1.00 113.47 ? 35  GLU F CA    1 
ATOM   7291  C C     . GLU F 1 38  ? 48.095 -77.627  -181.611 1.00 101.92 ? 35  GLU F C     1 
ATOM   7292  O O     . GLU F 1 38  ? 47.108 -78.032  -182.238 1.00 92.24  ? 35  GLU F O     1 
ATOM   7293  C CB    . GLU F 1 38  ? 48.863 -78.764  -179.508 1.00 118.49 ? 35  GLU F CB    1 
ATOM   7294  C CG    . GLU F 1 38  ? 47.581 -79.488  -179.132 1.00 119.40 ? 35  GLU F CG    1 
ATOM   7295  C CD    . GLU F 1 38  ? 47.461 -79.726  -177.638 1.00 127.78 ? 35  GLU F CD    1 
ATOM   7296  O OE1   . GLU F 1 38  ? 46.446 -80.314  -177.210 1.00 127.48 ? 35  GLU F OE1   1 
ATOM   7297  O OE2   . GLU F 1 38  ? 48.379 -79.323  -176.893 1.00 128.66 ? 35  GLU F OE2   1 
ATOM   7298  N N     . TYR F 1 39  ? 48.339 -76.327  -181.423 1.00 112.36 ? 36  TYR F N     1 
ATOM   7299  C CA    . TYR F 1 39  ? 47.462 -75.305  -181.988 1.00 108.63 ? 36  TYR F CA    1 
ATOM   7300  C C     . TYR F 1 39  ? 47.337 -75.455  -183.499 1.00 111.34 ? 36  TYR F C     1 
ATOM   7301  O O     . TYR F 1 39  ? 46.227 -75.507  -184.039 1.00 103.72 ? 36  TYR F O     1 
ATOM   7302  C CB    . TYR F 1 39  ? 47.973 -73.905  -181.642 1.00 96.60  ? 36  TYR F CB    1 
ATOM   7303  C CG    . TYR F 1 39  ? 47.458 -72.864  -182.610 1.00 100.37 ? 36  TYR F CG    1 
ATOM   7304  C CD1   . TYR F 1 39  ? 46.107 -72.550  -182.667 1.00 107.26 ? 36  TYR F CD1   1 
ATOM   7305  C CD2   . TYR F 1 39  ? 48.316 -72.230  -183.499 1.00 120.30 ? 36  TYR F CD2   1 
ATOM   7306  C CE1   . TYR F 1 39  ? 45.628 -71.617  -183.564 1.00 113.85 ? 36  TYR F CE1   1 
ATOM   7307  C CE2   . TYR F 1 39  ? 47.845 -71.295  -184.400 1.00 135.12 ? 36  TYR F CE2   1 
ATOM   7308  C CZ    . TYR F 1 39  ? 46.501 -70.993  -184.427 1.00 126.99 ? 36  TYR F CZ    1 
ATOM   7309  O OH    . TYR F 1 39  ? 46.029 -70.064  -185.324 1.00 131.09 ? 36  TYR F OH    1 
ATOM   7310  N N     . GLN F 1 40  ? 48.472 -75.473  -184.205 1.00 121.67 ? 37  GLN F N     1 
ATOM   7311  C CA    . GLN F 1 40  ? 48.429 -75.529  -185.663 1.00 110.93 ? 37  GLN F CA    1 
ATOM   7312  C C     . GLN F 1 40  ? 47.779 -76.818  -186.150 1.00 107.15 ? 37  GLN F C     1 
ATOM   7313  O O     . GLN F 1 40  ? 46.987 -76.803  -187.103 1.00 99.41  ? 37  GLN F O     1 
ATOM   7314  C CB    . GLN F 1 40  ? 49.835 -75.386  -186.244 1.00 115.22 ? 37  GLN F CB    1 
ATOM   7315  C CG    . GLN F 1 40  ? 49.855 -74.746  -187.624 1.00 134.91 ? 37  GLN F CG    1 
ATOM   7316  C CD    . GLN F 1 40  ? 51.236 -74.729  -188.244 1.00 139.06 ? 37  GLN F CD    1 
ATOM   7317  O OE1   . GLN F 1 40  ? 52.159 -75.379  -187.752 1.00 140.84 ? 37  GLN F OE1   1 
ATOM   7318  N NE2   . GLN F 1 40  ? 51.387 -73.982  -189.332 1.00 126.15 ? 37  GLN F NE2   1 
ATOM   7319  N N     . ALA F 1 41  ? 48.111 -77.947  -185.517 1.00 107.99 ? 38  ALA F N     1 
ATOM   7320  C CA    . ALA F 1 41  ? 47.504 -79.218  -185.895 1.00 96.16  ? 38  ALA F CA    1 
ATOM   7321  C C     . ALA F 1 41  ? 45.989 -79.170  -185.740 1.00 102.62 ? 38  ALA F C     1 
ATOM   7322  O O     . ALA F 1 41  ? 45.247 -79.558  -186.653 1.00 92.89  ? 38  ALA F O     1 
ATOM   7323  C CB    . ALA F 1 41  ? 48.101 -80.349  -185.058 1.00 106.13 ? 38  ALA F CB    1 
ATOM   7324  N N     . ILE F 1 42  ? 45.510 -78.699  -184.584 1.00 115.61 ? 39  ILE F N     1 
ATOM   7325  C CA    . ILE F 1 42  ? 44.072 -78.628  -184.343 1.00 120.65 ? 39  ILE F CA    1 
ATOM   7326  C C     . ILE F 1 42  ? 43.409 -77.686  -185.338 1.00 111.90 ? 39  ILE F C     1 
ATOM   7327  O O     . ILE F 1 42  ? 42.330 -77.977  -185.862 1.00 114.60 ? 39  ILE F O     1 
ATOM   7328  C CB    . ILE F 1 42  ? 43.789 -78.209  -182.887 1.00 110.89 ? 39  ILE F CB    1 
ATOM   7329  C CG1   . ILE F 1 42  ? 44.106 -79.357  -181.930 1.00 98.52  ? 39  ILE F CG1   1 
ATOM   7330  C CG2   . ILE F 1 42  ? 42.338 -77.794  -182.723 1.00 108.68 ? 39  ILE F CG2   1 
ATOM   7331  C CD1   . ILE F 1 42  ? 44.271 -78.924  -180.492 1.00 105.31 ? 39  ILE F CD1   1 
ATOM   7332  N N     . GLN F 1 43  ? 44.037 -76.539  -185.607 1.00 104.30 ? 40  GLN F N     1 
ATOM   7333  C CA    . GLN F 1 43  ? 43.478 -75.579  -186.556 1.00 105.47 ? 40  GLN F CA    1 
ATOM   7334  C C     . GLN F 1 43  ? 43.303 -76.207  -187.935 1.00 105.86 ? 40  GLN F C     1 
ATOM   7335  O O     . GLN F 1 43  ? 42.213 -76.157  -188.526 1.00 104.01 ? 40  GLN F O     1 
ATOM   7336  C CB    . GLN F 1 43  ? 44.383 -74.347  -186.632 1.00 107.70 ? 40  GLN F CB    1 
ATOM   7337  C CG    . GLN F 1 43  ? 43.995 -73.311  -187.681 1.00 110.22 ? 40  GLN F CG    1 
ATOM   7338  C CD    . GLN F 1 43  ? 42.837 -72.428  -187.247 1.00 110.21 ? 40  GLN F CD    1 
ATOM   7339  O OE1   . GLN F 1 43  ? 41.844 -72.905  -186.699 1.00 126.92 ? 40  GLN F OE1   1 
ATOM   7340  N NE2   . GLN F 1 43  ? 42.966 -71.129  -187.490 1.00 114.36 ? 40  GLN F NE2   1 
ATOM   7341  N N     . LYS F 1 44  ? 44.375 -76.803  -188.467 1.00 108.57 ? 41  LYS F N     1 
ATOM   7342  C CA    . LYS F 1 44  ? 44.305 -77.398  -189.798 1.00 109.09 ? 41  LYS F CA    1 
ATOM   7343  C C     . LYS F 1 44  ? 43.307 -78.548  -189.840 1.00 114.73 ? 41  LYS F C     1 
ATOM   7344  O O     . LYS F 1 44  ? 42.585 -78.714  -190.831 1.00 111.77 ? 41  LYS F O     1 
ATOM   7345  C CB    . LYS F 1 44  ? 45.690 -77.870  -190.241 1.00 101.80 ? 41  LYS F CB    1 
ATOM   7346  C CG    . LYS F 1 44  ? 46.729 -76.764  -190.319 1.00 114.63 ? 41  LYS F CG    1 
ATOM   7347  C CD    . LYS F 1 44  ? 48.017 -77.260  -190.955 1.00 127.33 ? 41  LYS F CD    1 
ATOM   7348  C CE    . LYS F 1 44  ? 49.097 -76.190  -190.924 1.00 119.83 ? 41  LYS F CE    1 
ATOM   7349  N NZ    . LYS F 1 44  ? 48.646 -74.920  -191.558 1.00 126.87 ? 41  LYS F NZ    1 
ATOM   7350  N N     . ALA F 1 45  ? 43.247 -79.354  -188.776 1.00 108.27 ? 42  ALA F N     1 
ATOM   7351  C CA    . ALA F 1 45  ? 42.268 -80.434  -188.738 1.00 102.62 ? 42  ALA F CA    1 
ATOM   7352  C C     . ALA F 1 45  ? 40.841 -79.905  -188.644 1.00 99.83  ? 42  ALA F C     1 
ATOM   7353  O O     . ALA F 1 45  ? 39.909 -80.553  -189.132 1.00 109.67 ? 42  ALA F O     1 
ATOM   7354  C CB    . ALA F 1 45  ? 42.569 -81.372  -187.570 1.00 100.33 ? 42  ALA F CB    1 
ATOM   7355  N N     . LEU F 1 46  ? 40.649 -78.737  -188.028 1.00 96.48  ? 43  LEU F N     1 
ATOM   7356  C CA    . LEU F 1 46  ? 39.317 -78.162  -187.903 1.00 101.62 ? 43  LEU F CA    1 
ATOM   7357  C C     . LEU F 1 46  ? 38.863 -77.457  -189.168 1.00 104.45 ? 43  LEU F C     1 
ATOM   7358  O O     . LEU F 1 46  ? 37.655 -77.286  -189.364 1.00 99.54  ? 43  LEU F O     1 
ATOM   7359  C CB    . LEU F 1 46  ? 39.268 -77.177  -186.732 1.00 108.28 ? 43  LEU F CB    1 
ATOM   7360  C CG    . LEU F 1 46  ? 39.171 -77.776  -185.329 1.00 115.70 ? 43  LEU F CG    1 
ATOM   7361  C CD1   . LEU F 1 46  ? 39.147 -76.678  -184.280 1.00 99.86  ? 43  LEU F CD1   1 
ATOM   7362  C CD2   . LEU F 1 46  ? 37.943 -78.662  -185.212 1.00 114.23 ? 43  LEU F CD2   1 
ATOM   7363  N N     . ARG F 1 47  ? 39.793 -77.042  -190.030 1.00 113.92 ? 44  ARG F N     1 
ATOM   7364  C CA    . ARG F 1 47  ? 39.363 -76.527  -191.325 1.00 112.07 ? 44  ARG F CA    1 
ATOM   7365  C C     . ARG F 1 47  ? 38.856 -77.622  -192.256 1.00 112.91 ? 44  ARG F C     1 
ATOM   7366  O O     . ARG F 1 47  ? 38.241 -77.300  -193.279 1.00 120.54 ? 44  ARG F O     1 
ATOM   7367  C CB    . ARG F 1 47  ? 40.497 -75.762  -192.007 1.00 101.91 ? 44  ARG F CB    1 
ATOM   7368  C CG    . ARG F 1 47  ? 40.725 -74.366  -191.456 1.00 99.70  ? 44  ARG F CG    1 
ATOM   7369  C CD    . ARG F 1 47  ? 41.781 -73.629  -192.262 1.00 105.67 ? 44  ARG F CD    1 
ATOM   7370  N NE    . ARG F 1 47  ? 43.137 -74.009  -191.881 1.00 112.77 ? 44  ARG F NE    1 
ATOM   7371  C CZ    . ARG F 1 47  ? 43.993 -73.196  -191.271 1.00 118.87 ? 44  ARG F CZ    1 
ATOM   7372  N NH1   . ARG F 1 47  ? 43.630 -71.957  -190.969 1.00 118.11 ? 44  ARG F NH1   1 
ATOM   7373  N NH2   . ARG F 1 47  ? 45.210 -73.622  -190.960 1.00 122.40 ? 44  ARG F NH2   1 
ATOM   7374  N N     . GLN F 1 48  ? 39.094 -78.893  -191.934 1.00 93.64  ? 45  GLN F N     1 
ATOM   7375  C CA    . GLN F 1 48  ? 38.613 -79.990  -192.761 1.00 104.51 ? 45  GLN F CA    1 
ATOM   7376  C C     . GLN F 1 48  ? 37.087 -80.043  -192.778 1.00 108.68 ? 45  GLN F C     1 
ATOM   7377  O O     . GLN F 1 48  ? 36.407 -79.572  -191.863 1.00 116.98 ? 45  GLN F O     1 
ATOM   7378  C CB    . GLN F 1 48  ? 39.168 -81.325  -192.262 1.00 116.20 ? 45  GLN F CB    1 
ATOM   7379  C CG    . GLN F 1 48  ? 40.650 -81.528  -192.533 1.00 138.69 ? 45  GLN F CG    1 
ATOM   7380  C CD    . GLN F 1 48  ? 41.107 -82.943  -192.226 1.00 129.08 ? 45  GLN F CD    1 
ATOM   7381  O OE1   . GLN F 1 48  ? 40.974 -83.421  -191.098 1.00 119.36 ? 45  GLN F OE1   1 
ATOM   7382  N NE2   . GLN F 1 48  ? 41.647 -83.620  -193.231 1.00 133.92 ? 45  GLN F NE2   1 
ATOM   7383  N N     . ARG F 1 49  ? 36.553 -80.629  -193.846 1.00 113.15 ? 46  ARG F N     1 
ATOM   7384  C CA    . ARG F 1 49  ? 35.141 -80.963  -193.953 1.00 111.53 ? 46  ARG F CA    1 
ATOM   7385  C C     . ARG F 1 49  ? 34.961 -82.471  -193.822 1.00 114.39 ? 46  ARG F C     1 
ATOM   7386  O O     . ARG F 1 49  ? 35.901 -83.249  -194.003 1.00 117.63 ? 46  ARG F O     1 
ATOM   7387  C CB    . ARG F 1 49  ? 34.557 -80.469  -195.280 1.00 123.53 ? 46  ARG F CB    1 
ATOM   7388  C CG    . ARG F 1 49  ? 34.351 -78.962  -195.336 1.00 121.95 ? 46  ARG F CG    1 
ATOM   7389  C CD    . ARG F 1 49  ? 33.801 -78.521  -196.683 1.00 129.07 ? 46  ARG F CD    1 
ATOM   7390  N NE    . ARG F 1 49  ? 33.281 -77.156  -196.643 1.00 133.38 ? 46  ARG F NE    1 
ATOM   7391  C CZ    . ARG F 1 49  ? 34.031 -76.065  -196.752 1.00 129.82 ? 46  ARG F CZ    1 
ATOM   7392  N NH1   . ARG F 1 49  ? 35.343 -76.172  -196.911 1.00 121.44 ? 46  ARG F NH1   1 
ATOM   7393  N NH2   . ARG F 1 49  ? 33.469 -74.864  -196.704 1.00 125.90 ? 46  ARG F NH2   1 
ATOM   7394  N N     . LEU F 1 50  ? 33.736 -82.880  -193.503 1.00 109.56 ? 47  LEU F N     1 
ATOM   7395  C CA    . LEU F 1 50  ? 33.442 -84.281  -193.235 1.00 126.22 ? 47  LEU F CA    1 
ATOM   7396  C C     . LEU F 1 50  ? 32.975 -85.000  -194.496 1.00 123.25 ? 47  LEU F C     1 
ATOM   7397  O O     . LEU F 1 50  ? 32.447 -84.390  -195.428 1.00 125.56 ? 47  LEU F O     1 
ATOM   7398  C CB    . LEU F 1 50  ? 32.378 -84.421  -192.144 1.00 131.32 ? 47  LEU F CB    1 
ATOM   7399  C CG    . LEU F 1 50  ? 32.737 -83.992  -190.716 1.00 104.67 ? 47  LEU F CG    1 
ATOM   7400  C CD1   . LEU F 1 50  ? 34.127 -84.485  -190.326 1.00 111.09 ? 47  LEU F CD1   1 
ATOM   7401  C CD2   . LEU F 1 50  ? 32.610 -82.489  -190.526 1.00 106.35 ? 47  LEU F CD2   1 
ATOM   7402  N N     . GLY F 1 51  ? 33.180 -86.316  -194.511 1.00 119.99 ? 48  GLY F N     1 
ATOM   7403  C CA    . GLY F 1 51  ? 32.754 -87.147  -195.611 1.00 139.73 ? 48  GLY F CA    1 
ATOM   7404  C C     . GLY F 1 51  ? 31.401 -87.784  -195.361 1.00 145.82 ? 48  GLY F C     1 
ATOM   7405  O O     . GLY F 1 51  ? 30.814 -87.647  -194.283 1.00 141.86 ? 48  GLY F O     1 
ATOM   7406  N N     . PRO F 1 52  ? 30.872 -88.485  -196.369 1.00 156.53 ? 49  PRO F N     1 
ATOM   7407  C CA    . PRO F 1 52  ? 29.574 -89.162  -196.198 1.00 151.29 ? 49  PRO F CA    1 
ATOM   7408  C C     . PRO F 1 52  ? 29.539 -90.181  -195.070 1.00 148.54 ? 49  PRO F C     1 
ATOM   7409  O O     . PRO F 1 52  ? 28.443 -90.552  -194.632 1.00 144.79 ? 49  PRO F O     1 
ATOM   7410  C CB    . PRO F 1 52  ? 29.353 -89.835  -197.559 1.00 158.47 ? 49  PRO F CB    1 
ATOM   7411  C CG    . PRO F 1 52  ? 30.122 -88.994  -198.514 1.00 156.72 ? 49  PRO F CG    1 
ATOM   7412  C CD    . PRO F 1 52  ? 31.346 -88.548  -197.762 1.00 157.05 ? 49  PRO F CD    1 
ATOM   7413  N N     . GLU F 1 53  ? 30.693 -90.647  -194.585 1.00 152.37 ? 50  GLU F N     1 
ATOM   7414  C CA    . GLU F 1 53  ? 30.720 -91.628  -193.505 1.00 160.09 ? 50  GLU F CA    1 
ATOM   7415  C C     . GLU F 1 53  ? 30.178 -91.086  -192.188 1.00 135.93 ? 50  GLU F C     1 
ATOM   7416  O O     . GLU F 1 53  ? 29.971 -91.872  -191.257 1.00 128.01 ? 50  GLU F O     1 
ATOM   7417  C CB    . GLU F 1 53  ? 32.145 -92.148  -193.283 1.00 169.41 ? 50  GLU F CB    1 
ATOM   7418  C CG    . GLU F 1 53  ? 32.858 -92.653  -194.531 1.00 183.04 ? 50  GLU F CG    1 
ATOM   7419  C CD    . GLU F 1 53  ? 33.495 -91.542  -195.344 1.00 161.29 ? 50  GLU F CD    1 
ATOM   7420  O OE1   . GLU F 1 53  ? 32.751 -90.745  -195.951 1.00 151.70 ? 50  GLU F OE1   1 
ATOM   7421  O OE2   . GLU F 1 53  ? 34.741 -91.468  -195.378 1.00 157.78 ? 50  GLU F OE2   1 
ATOM   7422  N N     . TYR F 1 54  ? 29.946 -89.781  -192.084 1.00 131.02 ? 51  TYR F N     1 
ATOM   7423  C CA    . TYR F 1 54  ? 29.441 -89.163  -190.863 1.00 127.34 ? 51  TYR F CA    1 
ATOM   7424  C C     . TYR F 1 54  ? 28.015 -88.652  -190.981 1.00 124.00 ? 51  TYR F C     1 
ATOM   7425  O O     . TYR F 1 54  ? 27.227 -88.818  -190.048 1.00 125.81 ? 51  TYR F O     1 
ATOM   7426  C CB    . TYR F 1 54  ? 30.353 -88.003  -190.450 1.00 103.38 ? 51  TYR F CB    1 
ATOM   7427  C CG    . TYR F 1 54  ? 31.715 -88.441  -189.964 1.00 112.38 ? 51  TYR F CG    1 
ATOM   7428  C CD1   . TYR F 1 54  ? 31.855 -89.542  -189.129 1.00 129.52 ? 51  TYR F CD1   1 
ATOM   7429  C CD2   . TYR F 1 54  ? 32.861 -87.759  -190.347 1.00 105.84 ? 51  TYR F CD2   1 
ATOM   7430  C CE1   . TYR F 1 54  ? 33.099 -89.946  -188.684 1.00 128.03 ? 51  TYR F CE1   1 
ATOM   7431  C CE2   . TYR F 1 54  ? 34.108 -88.154  -189.909 1.00 117.40 ? 51  TYR F CE2   1 
ATOM   7432  C CZ    . TYR F 1 54  ? 34.221 -89.248  -189.078 1.00 124.69 ? 51  TYR F CZ    1 
ATOM   7433  O OH    . TYR F 1 54  ? 35.461 -89.647  -188.637 1.00 127.61 ? 51  TYR F OH    1 
ATOM   7434  N N     . ILE F 1 55  ? 27.667 -88.028  -192.107 1.00 117.72 ? 52  ILE F N     1 
ATOM   7435  C CA    . ILE F 1 55  ? 26.341 -87.446  -192.268 1.00 120.64 ? 52  ILE F CA    1 
ATOM   7436  C C     . ILE F 1 55  ? 25.276 -88.539  -192.289 1.00 127.00 ? 52  ILE F C     1 
ATOM   7437  O O     . ILE F 1 55  ? 25.508 -89.665  -192.752 1.00 130.20 ? 52  ILE F O     1 
ATOM   7438  C CB    . ILE F 1 55  ? 26.288 -86.596  -193.551 1.00 128.83 ? 52  ILE F CB    1 
ATOM   7439  C CG1   . ILE F 1 55  ? 27.581 -85.794  -193.713 1.00 127.34 ? 52  ILE F CG1   1 
ATOM   7440  C CG2   . ILE F 1 55  ? 25.092 -85.661  -193.525 1.00 119.91 ? 52  ILE F CG2   1 
ATOM   7441  C CD1   . ILE F 1 55  ? 27.843 -84.810  -192.591 1.00 116.77 ? 52  ILE F CD1   1 
ATOM   7442  N N     . SER F 1 56  ? 24.091 -88.200  -191.780 1.00 126.19 ? 53  SER F N     1 
ATOM   7443  C CA    . SER F 1 56  ? 22.929 -89.078  -191.848 1.00 133.76 ? 53  SER F CA    1 
ATOM   7444  C C     . SER F 1 56  ? 21.733 -88.281  -192.355 1.00 124.77 ? 53  SER F C     1 
ATOM   7445  O O     . SER F 1 56  ? 21.881 -87.111  -192.725 1.00 109.99 ? 53  SER F O     1 
ATOM   7446  C CB    . SER F 1 56  ? 22.636 -89.701  -190.481 1.00 129.86 ? 53  SER F CB    1 
ATOM   7447  O OG    . SER F 1 56  ? 23.707 -90.523  -190.050 1.00 121.49 ? 53  SER F OG    1 
ATOM   7448  N N     . SER F 1 57  ? 20.548 -88.888  -192.376 1.00 128.95 ? 54  SER F N     1 
ATOM   7449  C CA    . SER F 1 57  ? 19.394 -88.239  -192.982 1.00 126.55 ? 54  SER F CA    1 
ATOM   7450  C C     . SER F 1 57  ? 18.118 -88.588  -192.231 1.00 131.24 ? 54  SER F C     1 
ATOM   7451  O O     . SER F 1 57  ? 17.955 -89.715  -191.755 1.00 136.13 ? 54  SER F O     1 
ATOM   7452  C CB    . SER F 1 57  ? 19.251 -88.633  -194.455 1.00 139.03 ? 54  SER F CB    1 
ATOM   7453  O OG    . SER F 1 57  ? 18.657 -89.913  -194.585 1.00 150.66 ? 54  SER F OG    1 
ATOM   7454  N N     . ARG F 1 58  ? 17.221 -87.608  -192.133 1.00 143.79 ? 55  ARG F N     1 
ATOM   7455  C CA    . ARG F 1 58  ? 15.898 -87.780  -191.553 1.00 157.48 ? 55  ARG F CA    1 
ATOM   7456  C C     . ARG F 1 58  ? 14.860 -87.274  -192.545 1.00 159.12 ? 55  ARG F C     1 
ATOM   7457  O O     . ARG F 1 58  ? 15.189 -86.702  -193.588 1.00 147.86 ? 55  ARG F O     1 
ATOM   7458  C CB    . ARG F 1 58  ? 15.738 -87.026  -190.226 1.00 159.03 ? 55  ARG F CB    1 
ATOM   7459  C CG    . ARG F 1 58  ? 15.596 -85.520  -190.389 1.00 159.09 ? 55  ARG F CG    1 
ATOM   7460  C CD    . ARG F 1 58  ? 15.296 -84.849  -189.062 1.00 148.18 ? 55  ARG F CD    1 
ATOM   7461  N NE    . ARG F 1 58  ? 13.976 -85.196  -188.541 1.00 157.88 ? 55  ARG F NE    1 
ATOM   7462  C CZ    . ARG F 1 58  ? 13.487 -84.751  -187.389 1.00 172.46 ? 55  ARG F CZ    1 
ATOM   7463  N NH1   . ARG F 1 58  ? 14.274 -84.105  -186.539 1.00 175.86 ? 55  ARG F NH1   1 
ATOM   7464  N NH2   . ARG F 1 58  ? 12.267 -85.102  -187.008 1.00 183.77 ? 55  ARG F NH2   1 
ATOM   7465  N N     . MET F 1 59  ? 13.592 -87.486  -192.209 1.00 163.15 ? 56  MET F N     1 
ATOM   7466  C CA    . MET F 1 59  ? 12.471 -87.002  -193.011 1.00 169.84 ? 56  MET F CA    1 
ATOM   7467  C C     . MET F 1 59  ? 11.744 -85.945  -192.185 1.00 175.09 ? 56  MET F C     1 
ATOM   7468  O O     . MET F 1 59  ? 11.013 -86.273  -191.247 1.00 176.60 ? 56  MET F O     1 
ATOM   7469  C CB    . MET F 1 59  ? 11.544 -88.147  -193.408 1.00 172.76 ? 56  MET F CB    1 
ATOM   7470  C CG    . MET F 1 59  ? 12.125 -89.073  -194.466 1.00 174.50 ? 56  MET F CG    1 
ATOM   7471  S SD    . MET F 1 59  ? 12.719 -88.191  -195.924 1.00 199.93 ? 56  MET F SD    1 
ATOM   7472  C CE    . MET F 1 59  ? 11.211 -87.415  -196.497 1.00 183.03 ? 56  MET F CE    1 
ATOM   7473  N N     . ALA F 1 60  ? 11.956 -84.678  -192.536 1.00 177.01 ? 57  ALA F N     1 
ATOM   7474  C CA    . ALA F 1 60  ? 11.313 -83.582  -191.824 1.00 187.83 ? 57  ALA F CA    1 
ATOM   7475  C C     . ALA F 1 60  ? 9.799  -83.635  -191.988 1.00 193.55 ? 57  ALA F C     1 
ATOM   7476  O O     . ALA F 1 60  ? 9.275  -84.075  -193.015 1.00 181.93 ? 57  ALA F O     1 
ATOM   7477  C CB    . ALA F 1 60  ? 11.844 -82.238  -192.325 1.00 171.95 ? 57  ALA F CB    1 
ATOM   7478  N N     . GLY F 1 61  ? 9.093  -83.172  -190.958 1.00 197.53 ? 58  GLY F N     1 
ATOM   7479  C CA    . GLY F 1 61  ? 7.646  -83.108  -191.003 1.00 199.81 ? 58  GLY F CA    1 
ATOM   7480  C C     . GLY F 1 61  ? 7.163  -82.010  -191.927 1.00 199.45 ? 58  GLY F C     1 
ATOM   7481  O O     . GLY F 1 61  ? 7.372  -80.824  -191.655 1.00 206.21 ? 58  GLY F O     1 
ATOM   7482  N N     . GLY F 1 62  ? 6.515  -82.393  -193.028 1.00 195.84 ? 59  GLY F N     1 
ATOM   7483  C CA    . GLY F 1 62  ? 6.111  -81.455  -194.051 1.00 195.11 ? 59  GLY F CA    1 
ATOM   7484  C C     . GLY F 1 62  ? 7.217  -80.994  -194.974 1.00 200.99 ? 59  GLY F C     1 
ATOM   7485  O O     . GLY F 1 62  ? 6.927  -80.553  -196.092 1.00 200.86 ? 59  GLY F O     1 
ATOM   7486  N N     . GLY F 1 63  ? 8.475  -81.079  -194.546 1.00 199.35 ? 60  GLY F N     1 
ATOM   7487  C CA    . GLY F 1 63  ? 9.596  -80.669  -195.366 1.00 194.06 ? 60  GLY F CA    1 
ATOM   7488  C C     . GLY F 1 63  ? 10.160 -81.806  -196.192 1.00 198.76 ? 60  GLY F C     1 
ATOM   7489  O O     . GLY F 1 63  ? 9.409  -82.638  -196.710 1.00 200.74 ? 60  GLY F O     1 
ATOM   7490  N N     . GLN F 1 64  ? 11.486 -81.854  -196.320 1.00 198.97 ? 61  GLN F N     1 
ATOM   7491  C CA    . GLN F 1 64  ? 12.142 -82.876  -197.127 1.00 188.85 ? 61  GLN F CA    1 
ATOM   7492  C C     . GLN F 1 64  ? 13.314 -83.502  -196.382 1.00 182.08 ? 61  GLN F C     1 
ATOM   7493  O O     . GLN F 1 64  ? 13.467 -83.307  -195.172 1.00 187.99 ? 61  GLN F O     1 
ATOM   7494  C CB    . GLN F 1 64  ? 12.623 -82.294  -198.462 1.00 175.17 ? 61  GLN F CB    1 
ATOM   7495  C CG    . GLN F 1 64  ? 11.728 -81.218  -199.052 1.00 179.72 ? 61  GLN F CG    1 
ATOM   7496  C CD    . GLN F 1 64  ? 12.184 -79.817  -198.694 1.00 181.33 ? 61  GLN F CD    1 
ATOM   7497  O OE1   . GLN F 1 64  ? 12.409 -79.505  -197.525 1.00 184.29 ? 61  GLN F OE1   1 
ATOM   7498  N NE2   . GLN F 1 64  ? 12.321 -78.963  -199.701 1.00 170.80 ? 61  GLN F NE2   1 
ATOM   7499  N N     . LYS F 1 65  ? 14.127 -84.273  -197.100 1.00 173.64 ? 62  LYS F N     1 
ATOM   7500  C CA    . LYS F 1 65  ? 15.298 -84.922  -196.523 1.00 170.57 ? 62  LYS F CA    1 
ATOM   7501  C C     . LYS F 1 65  ? 16.261 -83.894  -195.938 1.00 162.60 ? 62  LYS F C     1 
ATOM   7502  O O     . LYS F 1 65  ? 16.776 -83.032  -196.658 1.00 144.31 ? 62  LYS F O     1 
ATOM   7503  C CB    . LYS F 1 65  ? 15.988 -85.763  -197.596 1.00 170.56 ? 62  LYS F CB    1 
ATOM   7504  C CG    . LYS F 1 65  ? 17.212 -86.534  -197.135 1.00 161.47 ? 62  LYS F CG    1 
ATOM   7505  C CD    . LYS F 1 65  ? 17.787 -87.339  -198.294 1.00 154.12 ? 62  LYS F CD    1 
ATOM   7506  C CE    . LYS F 1 65  ? 19.081 -88.038  -197.917 1.00 158.89 ? 62  LYS F CE    1 
ATOM   7507  N NZ    . LYS F 1 65  ? 19.610 -88.865  -199.036 1.00 164.94 ? 62  LYS F NZ    1 
ATOM   7508  N N     . VAL F 1 66  ? 16.496 -83.985  -194.630 1.00 164.89 ? 63  VAL F N     1 
ATOM   7509  C CA    . VAL F 1 66  ? 17.442 -83.126  -193.927 1.00 144.88 ? 63  VAL F CA    1 
ATOM   7510  C C     . VAL F 1 66  ? 18.637 -83.971  -193.507 1.00 134.71 ? 63  VAL F C     1 
ATOM   7511  O O     . VAL F 1 66  ? 18.527 -85.188  -193.325 1.00 133.85 ? 63  VAL F O     1 
ATOM   7512  C CB    . VAL F 1 66  ? 16.793 -82.437  -192.706 1.00 140.62 ? 63  VAL F CB    1 
ATOM   7513  C CG1   . VAL F 1 66  ? 17.671 -81.302  -192.188 1.00 135.10 ? 63  VAL F CG1   1 
ATOM   7514  C CG2   . VAL F 1 66  ? 15.410 -81.916  -193.061 1.00 143.45 ? 63  VAL F CG2   1 
ATOM   7515  N N     . CYS F 1 67  ? 19.784 -83.317  -193.347 1.00 125.96 ? 64  CYS F N     1 
ATOM   7516  C CA    . CYS F 1 67  ? 21.035 -83.979  -193.008 1.00 125.54 ? 64  CYS F CA    1 
ATOM   7517  C C     . CYS F 1 67  ? 21.475 -83.573  -191.609 1.00 122.93 ? 64  CYS F C     1 
ATOM   7518  O O     . CYS F 1 67  ? 21.290 -82.422  -191.199 1.00 122.23 ? 64  CYS F O     1 
ATOM   7519  C CB    . CYS F 1 67  ? 22.130 -83.631  -194.019 1.00 125.63 ? 64  CYS F CB    1 
ATOM   7520  S SG    . CYS F 1 67  ? 21.591 -83.652  -195.744 1.00 154.27 ? 64  CYS F SG    1 
ATOM   7521  N N     . TYR F 1 68  ? 22.059 -84.521  -190.877 1.00 123.92 ? 65  TYR F N     1 
ATOM   7522  C CA    . TYR F 1 68  ? 22.476 -84.274  -189.505 1.00 121.10 ? 65  TYR F CA    1 
ATOM   7523  C C     . TYR F 1 68  ? 23.714 -85.101  -189.183 1.00 120.64 ? 65  TYR F C     1 
ATOM   7524  O O     . TYR F 1 68  ? 24.196 -85.888  -190.003 1.00 135.51 ? 65  TYR F O     1 
ATOM   7525  C CB    . TYR F 1 68  ? 21.339 -84.588  -188.530 1.00 121.08 ? 65  TYR F CB    1 
ATOM   7526  C CG    . TYR F 1 68  ? 20.931 -86.046  -188.485 1.00 122.92 ? 65  TYR F CG    1 
ATOM   7527  C CD1   . TYR F 1 68  ? 21.552 -86.939  -187.621 1.00 125.42 ? 65  TYR F CD1   1 
ATOM   7528  C CD2   . TYR F 1 68  ? 19.914 -86.526  -189.300 1.00 135.79 ? 65  TYR F CD2   1 
ATOM   7529  C CE1   . TYR F 1 68  ? 21.179 -88.269  -187.578 1.00 133.95 ? 65  TYR F CE1   1 
ATOM   7530  C CE2   . TYR F 1 68  ? 19.533 -87.855  -189.261 1.00 137.80 ? 65  TYR F CE2   1 
ATOM   7531  C CZ    . TYR F 1 68  ? 20.167 -88.720  -188.397 1.00 132.39 ? 65  TYR F CZ    1 
ATOM   7532  O OH    . TYR F 1 68  ? 19.794 -90.044  -188.355 1.00 123.61 ? 65  TYR F OH    1 
ATOM   7533  N N     . ILE F 1 69  ? 24.226 -84.910  -187.968 1.00 115.60 ? 66  ILE F N     1 
ATOM   7534  C CA    . ILE F 1 69  ? 25.345 -85.675  -187.430 1.00 114.57 ? 66  ILE F CA    1 
ATOM   7535  C C     . ILE F 1 69  ? 24.924 -86.225  -186.074 1.00 115.99 ? 66  ILE F C     1 
ATOM   7536  O O     . ILE F 1 69  ? 24.504 -85.461  -185.196 1.00 125.56 ? 66  ILE F O     1 
ATOM   7537  C CB    . ILE F 1 69  ? 26.618 -84.823  -187.294 1.00 107.11 ? 66  ILE F CB    1 
ATOM   7538  C CG1   . ILE F 1 69  ? 26.967 -84.163  -188.629 1.00 101.55 ? 66  ILE F CG1   1 
ATOM   7539  C CG2   . ILE F 1 69  ? 27.778 -85.676  -186.805 1.00 96.98  ? 66  ILE F CG2   1 
ATOM   7540  C CD1   . ILE F 1 69  ? 28.187 -83.271  -188.566 1.00 108.16 ? 66  ILE F CD1   1 
ATOM   7541  N N     . GLU F 1 70  ? 25.027 -87.541  -185.905 1.00 116.83 ? 67  GLU F N     1 
ATOM   7542  C CA    . GLU F 1 70  ? 24.649 -88.164  -184.643 1.00 125.96 ? 67  GLU F CA    1 
ATOM   7543  C C     . GLU F 1 70  ? 25.554 -87.688  -183.508 1.00 119.66 ? 67  GLU F C     1 
ATOM   7544  O O     . GLU F 1 70  ? 26.699 -87.283  -183.722 1.00 111.59 ? 67  GLU F O     1 
ATOM   7545  C CB    . GLU F 1 70  ? 24.699 -89.687  -184.766 1.00 130.22 ? 67  GLU F CB    1 
ATOM   7546  C CG    . GLU F 1 70  ? 23.701 -90.248  -185.771 1.00 128.32 ? 67  GLU F CG    1 
ATOM   7547  C CD    . GLU F 1 70  ? 23.667 -91.763  -185.789 1.00 133.79 ? 67  GLU F CD    1 
ATOM   7548  O OE1   . GLU F 1 70  ? 23.539 -92.370  -184.705 1.00 140.78 ? 67  GLU F OE1   1 
ATOM   7549  O OE2   . GLU F 1 70  ? 23.762 -92.347  -186.889 1.00 140.91 ? 67  GLU F OE2   1 
ATOM   7550  N N     . GLY F 1 71  ? 25.018 -87.734  -182.289 1.00 112.93 ? 68  GLY F N     1 
ATOM   7551  C CA    . GLY F 1 71  ? 25.714 -87.275  -181.100 1.00 111.16 ? 68  GLY F CA    1 
ATOM   7552  C C     . GLY F 1 71  ? 27.055 -87.929  -180.826 1.00 110.41 ? 68  GLY F C     1 
ATOM   7553  O O     . GLY F 1 71  ? 28.076 -87.240  -180.716 1.00 105.55 ? 68  GLY F O     1 
ATOM   7554  N N     . HIS F 1 72  ? 27.054 -89.260  -180.690 1.00 109.65 ? 69  HIS F N     1 
ATOM   7555  C CA    . HIS F 1 72  ? 28.287 -89.999  -180.427 1.00 108.36 ? 69  HIS F CA    1 
ATOM   7556  C C     . HIS F 1 72  ? 29.371 -89.688  -181.450 1.00 109.92 ? 69  HIS F C     1 
ATOM   7557  O O     . HIS F 1 72  ? 30.562 -89.682  -181.112 1.00 107.22 ? 69  HIS F O     1 
ATOM   7558  C CB    . HIS F 1 72  ? 27.995 -91.500  -180.397 1.00 110.65 ? 69  HIS F CB    1 
ATOM   7559  C CG    . HIS F 1 72  ? 27.261 -91.998  -181.603 1.00 108.95 ? 69  HIS F CG    1 
ATOM   7560  N ND1   . HIS F 1 72  ? 27.897 -92.600  -182.668 1.00 110.64 ? 69  HIS F ND1   1 
ATOM   7561  C CD2   . HIS F 1 72  ? 25.943 -91.982  -181.913 1.00 101.49 ? 69  HIS F CD2   1 
ATOM   7562  C CE1   . HIS F 1 72  ? 27.003 -92.933  -183.581 1.00 126.37 ? 69  HIS F CE1   1 
ATOM   7563  N NE2   . HIS F 1 72  ? 25.809 -92.570  -183.148 1.00 119.06 ? 69  HIS F NE2   1 
ATOM   7564  N N     . ARG F 1 73  ? 28.983 -89.428  -182.701 1.00 117.81 ? 70  ARG F N     1 
ATOM   7565  C CA    . ARG F 1 73  ? 29.952 -89.021  -183.713 1.00 127.86 ? 70  ARG F CA    1 
ATOM   7566  C C     . ARG F 1 73  ? 30.685 -87.756  -183.285 1.00 108.62 ? 70  ARG F C     1 
ATOM   7567  O O     . ARG F 1 73  ? 31.921 -87.709  -183.289 1.00 102.03 ? 70  ARG F O     1 
ATOM   7568  C CB    . ARG F 1 73  ? 29.250 -88.806  -185.056 1.00 127.23 ? 70  ARG F CB    1 
ATOM   7569  C CG    . ARG F 1 73  ? 28.539 -90.035  -185.601 1.00 121.51 ? 70  ARG F CG    1 
ATOM   7570  C CD    . ARG F 1 73  ? 29.474 -90.903  -186.432 1.00 121.80 ? 70  ARG F CD    1 
ATOM   7571  N NE    . ARG F 1 73  ? 28.840 -92.151  -186.849 1.00 135.97 ? 70  ARG F NE    1 
ATOM   7572  C CZ    . ARG F 1 73  ? 27.919 -92.245  -187.804 1.00 139.31 ? 70  ARG F CZ    1 
ATOM   7573  N NH1   . ARG F 1 73  ? 27.516 -91.161  -188.455 1.00 130.37 ? 70  ARG F NH1   1 
ATOM   7574  N NH2   . ARG F 1 73  ? 27.400 -93.426  -188.112 1.00 144.25 ? 70  ARG F NH2   1 
ATOM   7575  N N     . VAL F 1 74  ? 29.933 -86.718  -182.913 1.00 107.63 ? 71  VAL F N     1 
ATOM   7576  C CA    . VAL F 1 74  ? 30.538 -85.458  -182.486 1.00 103.21 ? 71  VAL F CA    1 
ATOM   7577  C C     . VAL F 1 74  ? 31.353 -85.657  -181.214 1.00 95.04  ? 71  VAL F C     1 
ATOM   7578  O O     . VAL F 1 74  ? 32.402 -85.027  -181.026 1.00 87.36  ? 71  VAL F O     1 
ATOM   7579  C CB    . VAL F 1 74  ? 29.453 -84.382  -182.298 1.00 97.65  ? 71  VAL F CB    1 
ATOM   7580  C CG1   . VAL F 1 74  ? 30.079 -82.998  -182.274 1.00 101.31 ? 71  VAL F CG1   1 
ATOM   7581  C CG2   . VAL F 1 74  ? 28.407 -84.484  -183.396 1.00 115.75 ? 71  VAL F CG2   1 
ATOM   7582  N N     . ILE F 1 75  ? 30.876 -86.517  -180.312 1.00 95.64  ? 72  ILE F N     1 
ATOM   7583  C CA    . ILE F 1 75  ? 31.602 -86.773  -179.070 1.00 98.53  ? 72  ILE F CA    1 
ATOM   7584  C C     . ILE F 1 75  ? 32.979 -87.356  -179.372 1.00 105.38 ? 72  ILE F C     1 
ATOM   7585  O O     . ILE F 1 75  ? 33.999 -86.906  -178.832 1.00 102.01 ? 72  ILE F O     1 
ATOM   7586  C CB    . ILE F 1 75  ? 30.783 -87.697  -178.150 1.00 95.59  ? 72  ILE F CB    1 
ATOM   7587  C CG1   . ILE F 1 75  ? 29.586 -86.943  -177.570 1.00 86.41  ? 72  ILE F CG1   1 
ATOM   7588  C CG2   . ILE F 1 75  ? 31.654 -88.248  -177.030 1.00 85.47  ? 72  ILE F CG2   1 
ATOM   7589  C CD1   . ILE F 1 75  ? 28.917 -87.650  -176.410 1.00 98.11  ? 72  ILE F CD1   1 
ATOM   7590  N N     . ASN F 1 76  ? 33.025 -88.373  -180.238 1.00 108.61 ? 73  ASN F N     1 
ATOM   7591  C CA    . ASN F 1 76  ? 34.305 -88.958  -180.630 1.00 109.47 ? 73  ASN F CA    1 
ATOM   7592  C C     . ASN F 1 76  ? 35.174 -87.948  -181.369 1.00 104.44 ? 73  ASN F C     1 
ATOM   7593  O O     . ASN F 1 76  ? 36.392 -87.894  -181.158 1.00 109.22 ? 73  ASN F O     1 
ATOM   7594  C CB    . ASN F 1 76  ? 34.075 -90.200  -181.489 1.00 110.93 ? 73  ASN F CB    1 
ATOM   7595  C CG    . ASN F 1 76  ? 33.557 -91.374  -180.685 1.00 105.39 ? 73  ASN F CG    1 
ATOM   7596  O OD1   . ASN F 1 76  ? 34.053 -91.661  -179.596 1.00 99.00  ? 73  ASN F OD1   1 
ATOM   7597  N ND2   . ASN F 1 76  ? 32.553 -92.060  -181.218 1.00 110.90 ? 73  ASN F ND2   1 
ATOM   7598  N N     . LEU F 1 77  ? 34.566 -87.147  -182.249 1.00 97.66  ? 74  LEU F N     1 
ATOM   7599  C CA    . LEU F 1 77  ? 35.320 -86.120  -182.961 1.00 101.03 ? 74  LEU F CA    1 
ATOM   7600  C C     . LEU F 1 77  ? 36.002 -85.164  -181.992 1.00 104.87 ? 74  LEU F C     1 
ATOM   7601  O O     . LEU F 1 77  ? 37.176 -84.824  -182.168 1.00 108.68 ? 74  LEU F O     1 
ATOM   7602  C CB    . LEU F 1 77  ? 34.398 -85.352  -183.909 1.00 96.98  ? 74  LEU F CB    1 
ATOM   7603  C CG    . LEU F 1 77  ? 33.935 -86.072  -185.176 1.00 81.11  ? 74  LEU F CG    1 
ATOM   7604  C CD1   . LEU F 1 77  ? 32.748 -85.352  -185.799 1.00 72.75  ? 74  LEU F CD1   1 
ATOM   7605  C CD2   . LEU F 1 77  ? 35.077 -86.192  -186.173 1.00 101.68 ? 74  LEU F CD2   1 
ATOM   7606  N N     . ALA F 1 78  ? 35.282 -84.727  -180.958 1.00 94.66  ? 75  ALA F N     1 
ATOM   7607  C CA    . ALA F 1 78  ? 35.866 -83.821  -179.973 1.00 90.38  ? 75  ALA F CA    1 
ATOM   7608  C C     . ALA F 1 78  ? 36.955 -84.515  -179.164 1.00 94.27  ? 75  ALA F C     1 
ATOM   7609  O O     . ALA F 1 78  ? 38.050 -83.967  -178.977 1.00 88.76  ? 75  ALA F O     1 
ATOM   7610  C CB    . ALA F 1 78  ? 34.775 -83.273  -179.054 1.00 88.50  ? 75  ALA F CB    1 
ATOM   7611  N N     . ASN F 1 79  ? 36.670 -85.725  -178.672 1.00 95.93  ? 76  ASN F N     1 
ATOM   7612  C CA    . ASN F 1 79  ? 37.657 -86.470  -177.897 1.00 103.08 ? 76  ASN F CA    1 
ATOM   7613  C C     . ASN F 1 79  ? 38.923 -86.760  -178.690 1.00 110.86 ? 76  ASN F C     1 
ATOM   7614  O O     . ASN F 1 79  ? 39.977 -86.992  -178.089 1.00 119.19 ? 76  ASN F O     1 
ATOM   7615  C CB    . ASN F 1 79  ? 37.050 -87.777  -177.386 1.00 94.18  ? 76  ASN F CB    1 
ATOM   7616  C CG    . ASN F 1 79  ? 36.139 -87.566  -176.192 1.00 106.52 ? 76  ASN F CG    1 
ATOM   7617  O OD1   . ASN F 1 79  ? 36.600 -87.264  -175.090 1.00 97.35  ? 76  ASN F OD1   1 
ATOM   7618  N ND2   . ASN F 1 79  ? 34.839 -87.724  -176.405 1.00 113.35 ? 76  ASN F ND2   1 
ATOM   7619  N N     . GLU F 1 80  ? 38.844 -86.778  -180.019 1.00 103.95 ? 77  GLU F N     1 
ATOM   7620  C CA    . GLU F 1 80  ? 40.048 -86.937  -180.827 1.00 107.79 ? 77  GLU F CA    1 
ATOM   7621  C C     . GLU F 1 80  ? 40.736 -85.603  -181.102 1.00 107.60 ? 77  GLU F C     1 
ATOM   7622  O O     . GLU F 1 80  ? 41.958 -85.493  -180.958 1.00 113.20 ? 77  GLU F O     1 
ATOM   7623  C CB    . GLU F 1 80  ? 39.716 -87.650  -182.141 1.00 118.73 ? 77  GLU F CB    1 
ATOM   7624  C CG    . GLU F 1 80  ? 39.259 -89.092  -181.961 1.00 125.52 ? 77  GLU F CG    1 
ATOM   7625  C CD    . GLU F 1 80  ? 40.260 -89.933  -181.188 1.00 125.59 ? 77  GLU F CD    1 
ATOM   7626  O OE1   . GLU F 1 80  ? 41.481 -89.716  -181.346 1.00 121.33 ? 77  GLU F OE1   1 
ATOM   7627  O OE2   . GLU F 1 80  ? 39.825 -90.812  -180.416 1.00 129.51 ? 77  GLU F OE2   1 
ATOM   7628  N N     . MET F 1 81  ? 39.967 -84.587  -181.504 1.00 102.70 ? 78  MET F N     1 
ATOM   7629  C CA    . MET F 1 81  ? 40.545 -83.290  -181.844 1.00 106.51 ? 78  MET F CA    1 
ATOM   7630  C C     . MET F 1 81  ? 41.271 -82.673  -180.654 1.00 111.13 ? 78  MET F C     1 
ATOM   7631  O O     . MET F 1 81  ? 42.399 -82.184  -180.786 1.00 110.69 ? 78  MET F O     1 
ATOM   7632  C CB    . MET F 1 81  ? 39.450 -82.349  -182.345 1.00 105.87 ? 78  MET F CB    1 
ATOM   7633  C CG    . MET F 1 81  ? 38.960 -82.651  -183.748 1.00 107.70 ? 78  MET F CG    1 
ATOM   7634  S SD    . MET F 1 81  ? 40.183 -82.294  -185.022 1.00 125.62 ? 78  MET F SD    1 
ATOM   7635  C CE    . MET F 1 81  ? 40.946 -80.813  -184.363 1.00 111.44 ? 78  MET F CE    1 
ATOM   7636  N N     . PHE F 1 82  ? 40.641 -82.692  -179.480 1.00 109.33 ? 79  PHE F N     1 
ATOM   7637  C CA    . PHE F 1 82  ? 41.197 -82.043  -178.301 1.00 103.73 ? 79  PHE F CA    1 
ATOM   7638  C C     . PHE F 1 82  ? 41.763 -83.010  -177.274 1.00 108.14 ? 79  PHE F C     1 
ATOM   7639  O O     . PHE F 1 82  ? 42.681 -82.640  -176.539 1.00 118.14 ? 79  PHE F O     1 
ATOM   7640  C CB    . PHE F 1 82  ? 40.130 -81.174  -177.625 1.00 98.78  ? 79  PHE F CB    1 
ATOM   7641  C CG    . PHE F 1 82  ? 39.395 -80.276  -178.576 1.00 101.55 ? 79  PHE F CG    1 
ATOM   7642  C CD1   . PHE F 1 82  ? 38.074 -80.528  -178.904 1.00 99.53  ? 79  PHE F CD1   1 
ATOM   7643  C CD2   . PHE F 1 82  ? 40.030 -79.194  -179.159 1.00 92.88  ? 79  PHE F CD2   1 
ATOM   7644  C CE1   . PHE F 1 82  ? 37.394 -79.709  -179.785 1.00 79.33  ? 79  PHE F CE1   1 
ATOM   7645  C CE2   . PHE F 1 82  ? 39.356 -78.369  -180.041 1.00 91.82  ? 79  PHE F CE2   1 
ATOM   7646  C CZ    . PHE F 1 82  ? 38.036 -78.627  -180.355 1.00 91.04  ? 79  PHE F CZ    1 
ATOM   7647  N N     . GLY F 1 83  ? 41.247 -84.225  -177.209 1.00 104.99 ? 80  GLY F N     1 
ATOM   7648  C CA    . GLY F 1 83  ? 41.622 -85.184  -176.191 1.00 105.08 ? 80  GLY F CA    1 
ATOM   7649  C C     . GLY F 1 83  ? 40.458 -85.479  -175.261 1.00 103.72 ? 80  GLY F C     1 
ATOM   7650  O O     . GLY F 1 83  ? 39.465 -84.753  -175.201 1.00 118.62 ? 80  GLY F O     1 
ATOM   7651  N N     . TYR F 1 84  ? 40.587 -86.583  -174.518 1.00 100.92 ? 81  TYR F N     1 
ATOM   7652  C CA    . TYR F 1 84  ? 39.557 -86.917  -173.539 1.00 99.22  ? 81  TYR F CA    1 
ATOM   7653  C C     . TYR F 1 84  ? 39.506 -85.896  -172.412 1.00 95.50  ? 81  TYR F C     1 
ATOM   7654  O O     . TYR F 1 84  ? 38.457 -85.719  -171.783 1.00 103.70 ? 81  TYR F O     1 
ATOM   7655  C CB    . TYR F 1 84  ? 39.798 -88.314  -172.968 1.00 94.89  ? 81  TYR F CB    1 
ATOM   7656  C CG    . TYR F 1 84  ? 40.906 -88.369  -171.942 1.00 79.75  ? 81  TYR F CG    1 
ATOM   7657  C CD1   . TYR F 1 84  ? 42.238 -88.374  -172.329 1.00 93.58  ? 81  TYR F CD1   1 
ATOM   7658  C CD2   . TYR F 1 84  ? 40.619 -88.405  -170.583 1.00 99.84  ? 81  TYR F CD2   1 
ATOM   7659  C CE1   . TYR F 1 84  ? 43.254 -88.419  -171.394 1.00 88.85  ? 81  TYR F CE1   1 
ATOM   7660  C CE2   . TYR F 1 84  ? 41.630 -88.447  -169.640 1.00 112.37 ? 81  TYR F CE2   1 
ATOM   7661  C CZ    . TYR F 1 84  ? 42.946 -88.455  -170.052 1.00 98.64  ? 81  TYR F CZ    1 
ATOM   7662  O OH    . TYR F 1 84  ? 43.958 -88.501  -169.120 1.00 97.69  ? 81  TYR F OH    1 
ATOM   7663  N N     . ASN F 1 85  ? 40.623 -85.217  -172.147 1.00 90.83  ? 82  ASN F N     1 
ATOM   7664  C CA    . ASN F 1 85  ? 40.707 -84.211  -171.096 1.00 96.83  ? 82  ASN F CA    1 
ATOM   7665  C C     . ASN F 1 85  ? 41.099 -82.843  -171.643 1.00 97.90  ? 82  ASN F C     1 
ATOM   7666  O O     . ASN F 1 85  ? 41.541 -81.977  -170.882 1.00 93.28  ? 82  ASN F O     1 
ATOM   7667  C CB    . ASN F 1 85  ? 41.696 -84.655  -170.017 1.00 94.04  ? 82  ASN F CB    1 
ATOM   7668  C CG    . ASN F 1 85  ? 43.127 -84.668  -170.510 1.00 93.32  ? 82  ASN F CG    1 
ATOM   7669  O OD1   . ASN F 1 85  ? 43.411 -85.139  -171.612 1.00 89.14  ? 82  ASN F OD1   1 
ATOM   7670  N ND2   . ASN F 1 85  ? 44.038 -84.145  -169.699 1.00 97.88  ? 82  ASN F ND2   1 
ATOM   7671  N N     . GLY F 1 86  ? 40.948 -82.631  -172.948 1.00 93.79  ? 83  GLY F N     1 
ATOM   7672  C CA    . GLY F 1 86  ? 41.276 -81.352  -173.544 1.00 107.86 ? 83  GLY F CA    1 
ATOM   7673  C C     . GLY F 1 86  ? 40.061 -80.464  -173.704 1.00 93.75  ? 83  GLY F C     1 
ATOM   7674  O O     . GLY F 1 86  ? 40.183 -79.242  -173.836 1.00 83.69  ? 83  GLY F O     1 
ATOM   7675  N N     . TRP F 1 87  ? 38.878 -81.072  -173.690 1.00 83.32  ? 84  TRP F N     1 
ATOM   7676  C CA    . TRP F 1 87  ? 37.622 -80.346  -173.781 1.00 84.32  ? 84  TRP F CA    1 
ATOM   7677  C C     . TRP F 1 87  ? 36.727 -80.736  -172.615 1.00 85.07  ? 84  TRP F C     1 
ATOM   7678  O O     . TRP F 1 87  ? 36.898 -81.789  -171.995 1.00 85.92  ? 84  TRP F O     1 
ATOM   7679  C CB    . TRP F 1 87  ? 36.906 -80.619  -175.111 1.00 79.21  ? 84  TRP F CB    1 
ATOM   7680  C CG    . TRP F 1 87  ? 36.284 -81.976  -175.181 1.00 67.73  ? 84  TRP F CG    1 
ATOM   7681  C CD1   . TRP F 1 87  ? 36.936 -83.171  -175.225 1.00 84.90  ? 84  TRP F CD1   1 
ATOM   7682  C CD2   . TRP F 1 87  ? 34.885 -82.280  -175.214 1.00 66.52  ? 84  TRP F CD2   1 
ATOM   7683  N NE1   . TRP F 1 87  ? 36.032 -84.203  -175.283 1.00 90.05  ? 84  TRP F NE1   1 
ATOM   7684  C CE2   . TRP F 1 87  ? 34.765 -83.683  -175.278 1.00 76.90  ? 84  TRP F CE2   1 
ATOM   7685  C CE3   . TRP F 1 87  ? 33.722 -81.504  -175.196 1.00 73.67  ? 84  TRP F CE3   1 
ATOM   7686  C CZ2   . TRP F 1 87  ? 33.530 -84.325  -175.324 1.00 81.20  ? 84  TRP F CZ2   1 
ATOM   7687  C CZ3   . TRP F 1 87  ? 32.497 -82.144  -175.242 1.00 76.89  ? 84  TRP F CZ3   1 
ATOM   7688  C CH2   . TRP F 1 87  ? 32.410 -83.541  -175.305 1.00 73.79  ? 84  TRP F CH2   1 
ATOM   7689  N N     . ALA F 1 88  ? 35.760 -79.868  -172.325 1.00 78.98  ? 85  ALA F N     1 
ATOM   7690  C CA    . ALA F 1 88  ? 34.816 -80.095  -171.241 1.00 70.78  ? 85  ALA F CA    1 
ATOM   7691  C C     . ALA F 1 88  ? 33.532 -79.341  -171.546 1.00 79.64  ? 85  ALA F C     1 
ATOM   7692  O O     . ALA F 1 88  ? 33.571 -78.249  -172.117 1.00 88.99  ? 85  ALA F O     1 
ATOM   7693  C CB    . ALA F 1 88  ? 35.390 -79.637  -169.896 1.00 74.60  ? 85  ALA F CB    1 
ATOM   7694  N N     . HIS F 1 89  ? 32.399 -79.926  -171.163 1.00 74.52  ? 86  HIS F N     1 
ATOM   7695  C CA    . HIS F 1 89  ? 31.108 -79.283  -171.345 1.00 72.87  ? 86  HIS F CA    1 
ATOM   7696  C C     . HIS F 1 89  ? 30.335 -79.312  -170.034 1.00 78.76  ? 86  HIS F C     1 
ATOM   7697  O O     . HIS F 1 89  ? 30.604 -80.124  -169.144 1.00 65.40  ? 86  HIS F O     1 
ATOM   7698  C CB    . HIS F 1 89  ? 30.283 -79.944  -172.460 1.00 58.07  ? 86  HIS F CB    1 
ATOM   7699  C CG    . HIS F 1 89  ? 29.523 -81.157  -172.019 1.00 63.05  ? 86  HIS F CG    1 
ATOM   7700  N ND1   . HIS F 1 89  ? 30.124 -82.228  -171.395 1.00 69.52  ? 86  HIS F ND1   1 
ATOM   7701  C CD2   . HIS F 1 89  ? 28.209 -81.467  -172.116 1.00 57.09  ? 86  HIS F CD2   1 
ATOM   7702  C CE1   . HIS F 1 89  ? 29.212 -83.146  -171.126 1.00 73.32  ? 86  HIS F CE1   1 
ATOM   7703  N NE2   . HIS F 1 89  ? 28.042 -82.709  -171.553 1.00 74.27  ? 86  HIS F NE2   1 
ATOM   7704  N N     . SER F 1 90  ? 29.367 -78.404  -169.928 1.00 78.88  ? 87  SER F N     1 
ATOM   7705  C CA    . SER F 1 90  ? 28.555 -78.279  -168.728 1.00 79.50  ? 87  SER F CA    1 
ATOM   7706  C C     . SER F 1 90  ? 27.193 -77.720  -169.107 1.00 75.31  ? 87  SER F C     1 
ATOM   7707  O O     . SER F 1 90  ? 27.054 -77.003  -170.102 1.00 73.13  ? 87  SER F O     1 
ATOM   7708  C CB    . SER F 1 90  ? 29.226 -77.381  -167.682 1.00 78.89  ? 87  SER F CB    1 
ATOM   7709  O OG    . SER F 1 90  ? 29.699 -76.182  -168.271 1.00 81.71  ? 87  SER F OG    1 
ATOM   7710  N N     . ILE F 1 91  ? 26.189 -78.056  -168.300 1.00 68.19  ? 88  ILE F N     1 
ATOM   7711  C CA    . ILE F 1 91  ? 24.822 -77.593  -168.513 1.00 55.25  ? 88  ILE F CA    1 
ATOM   7712  C C     . ILE F 1 91  ? 24.631 -76.339  -167.667 1.00 59.12  ? 88  ILE F C     1 
ATOM   7713  O O     . ILE F 1 91  ? 24.492 -76.414  -166.445 1.00 70.22  ? 88  ILE F O     1 
ATOM   7714  C CB    . ILE F 1 91  ? 23.797 -78.673  -168.168 1.00 57.06  ? 88  ILE F CB    1 
ATOM   7715  C CG1   . ILE F 1 91  ? 24.157 -79.987  -168.861 1.00 60.36  ? 88  ILE F CG1   1 
ATOM   7716  C CG2   . ILE F 1 91  ? 22.398 -78.225  -168.567 1.00 55.95  ? 88  ILE F CG2   1 
ATOM   7717  C CD1   . ILE F 1 91  ? 23.232 -81.129  -168.513 1.00 71.94  ? 88  ILE F CD1   1 
ATOM   7718  N N     . THR F 1 92  ? 24.631 -75.176  -168.323 1.00 71.38  ? 89  THR F N     1 
ATOM   7719  C CA    . THR F 1 92  ? 24.422 -73.924  -167.604 1.00 72.42  ? 89  THR F CA    1 
ATOM   7720  C C     . THR F 1 92  ? 23.009 -73.844  -167.040 1.00 66.67  ? 89  THR F C     1 
ATOM   7721  O O     . THR F 1 92  ? 22.817 -73.435  -165.888 1.00 88.74  ? 89  THR F O     1 
ATOM   7722  C CB    . THR F 1 92  ? 24.701 -72.734  -168.523 1.00 70.17  ? 89  THR F CB    1 
ATOM   7723  O OG1   . THR F 1 92  ? 26.105 -72.665  -168.804 1.00 83.35  ? 89  THR F OG1   1 
ATOM   7724  C CG2   . THR F 1 92  ? 24.263 -71.432  -167.866 1.00 63.06  ? 89  THR F CG2   1 
ATOM   7725  N N     . GLN F 1 93  ? 22.013 -74.241  -167.828 1.00 47.82  ? 90  GLN F N     1 
ATOM   7726  C CA    . GLN F 1 93  ? 20.631 -74.245  -167.370 1.00 55.34  ? 90  GLN F CA    1 
ATOM   7727  C C     . GLN F 1 93  ? 19.792 -75.069  -168.333 1.00 63.51  ? 90  GLN F C     1 
ATOM   7728  O O     . GLN F 1 93  ? 19.980 -74.992  -169.549 1.00 73.03  ? 90  GLN F O     1 
ATOM   7729  C CB    . GLN F 1 93  ? 20.069 -72.820  -167.268 1.00 56.22  ? 90  GLN F CB    1 
ATOM   7730  C CG    . GLN F 1 93  ? 18.627 -72.758  -166.787 1.00 66.48  ? 90  GLN F CG    1 
ATOM   7731  C CD    . GLN F 1 93  ? 18.127 -71.339  -166.611 1.00 98.45  ? 90  GLN F CD    1 
ATOM   7732  O OE1   . GLN F 1 93  ? 18.121 -70.550  -167.556 1.00 117.24 ? 90  GLN F OE1   1 
ATOM   7733  N NE2   . GLN F 1 93  ? 17.707 -71.006  -165.396 1.00 103.01 ? 90  GLN F NE2   1 
ATOM   7734  N N     . GLN F 1 94  ? 18.876 -75.859  -167.776 1.00 68.88  ? 91  GLN F N     1 
ATOM   7735  C CA    . GLN F 1 94  ? 17.883 -76.594  -168.547 1.00 63.58  ? 91  GLN F CA    1 
ATOM   7736  C C     . GLN F 1 94  ? 16.506 -76.276  -167.987 1.00 70.88  ? 91  GLN F C     1 
ATOM   7737  O O     . GLN F 1 94  ? 16.281 -76.403  -166.779 1.00 87.63  ? 91  GLN F O     1 
ATOM   7738  C CB    . GLN F 1 94  ? 18.143 -78.102  -168.498 1.00 75.94  ? 91  GLN F CB    1 
ATOM   7739  C CG    . GLN F 1 94  ? 16.927 -78.942  -168.842 1.00 86.67  ? 91  GLN F CG    1 
ATOM   7740  C CD    . GLN F 1 94  ? 17.271 -80.398  -169.063 1.00 85.34  ? 91  GLN F CD    1 
ATOM   7741  O OE1   . GLN F 1 94  ? 16.673 -81.288  -168.460 1.00 94.00  ? 91  GLN F OE1   1 
ATOM   7742  N NE2   . GLN F 1 94  ? 18.236 -80.650  -169.936 1.00 74.70  ? 91  GLN F NE2   1 
ATOM   7743  N N     . ASN F 1 95  ? 15.588 -75.871  -168.862 1.00 74.17  ? 92  ASN F N     1 
ATOM   7744  C CA    . ASN F 1 95  ? 14.254 -75.449  -168.457 1.00 89.41  ? 92  ASN F CA    1 
ATOM   7745  C C     . ASN F 1 95  ? 13.214 -76.087  -169.365 1.00 93.11  ? 92  ASN F C     1 
ATOM   7746  O O     . ASN F 1 95  ? 13.321 -76.001  -170.593 1.00 104.83 ? 92  ASN F O     1 
ATOM   7747  C CB    . ASN F 1 95  ? 14.125 -73.921  -168.498 1.00 112.47 ? 92  ASN F CB    1 
ATOM   7748  C CG    . ASN F 1 95  ? 12.751 -73.440  -168.077 1.00 131.93 ? 92  ASN F CG    1 
ATOM   7749  O OD1   . ASN F 1 95  ? 12.403 -73.476  -166.897 1.00 139.08 ? 92  ASN F OD1   1 
ATOM   7750  N ND2   . ASN F 1 95  ? 11.961 -72.984  -169.043 1.00 104.51 ? 92  ASN F ND2   1 
ATOM   7751  N N     . VAL F 1 96  ? 12.217 -76.727  -168.761 1.00 78.53  ? 93  VAL F N     1 
ATOM   7752  C CA    . VAL F 1 96  ? 11.113 -77.319  -169.511 1.00 76.52  ? 93  VAL F CA    1 
ATOM   7753  C C     . VAL F 1 96  ? 10.163 -76.204  -169.929 1.00 92.03  ? 93  VAL F C     1 
ATOM   7754  O O     . VAL F 1 96  ? 9.595  -75.508  -169.081 1.00 111.55 ? 93  VAL F O     1 
ATOM   7755  C CB    . VAL F 1 96  ? 10.385 -78.384  -168.679 1.00 83.71  ? 93  VAL F CB    1 
ATOM   7756  C CG1   . VAL F 1 96  ? 9.233  -78.978  -169.475 1.00 82.27  ? 93  VAL F CG1   1 
ATOM   7757  C CG2   . VAL F 1 96  ? 11.356 -79.471  -168.241 1.00 92.09  ? 93  VAL F CG2   1 
ATOM   7758  N N     . ASP F 1 97  ? 9.988  -76.033  -171.240 1.00 95.54  ? 94  ASP F N     1 
ATOM   7759  C CA    . ASP F 1 97  ? 9.169  -74.933  -171.742 1.00 85.80  ? 94  ASP F CA    1 
ATOM   7760  C C     . ASP F 1 97  ? 7.685  -75.180  -171.498 1.00 89.83  ? 94  ASP F C     1 
ATOM   7761  O O     . ASP F 1 97  ? 6.978  -74.303  -170.987 1.00 104.72 ? 94  ASP F O     1 
ATOM   7762  C CB    . ASP F 1 97  ? 9.444  -74.713  -173.229 1.00 85.70  ? 94  ASP F CB    1 
ATOM   7763  C CG    . ASP F 1 97  ? 10.724 -73.939  -173.474 1.00 109.18 ? 94  ASP F CG    1 
ATOM   7764  O OD1   . ASP F 1 97  ? 10.900 -72.868  -172.855 1.00 115.96 ? 94  ASP F OD1   1 
ATOM   7765  O OD2   . ASP F 1 97  ? 11.555 -74.402  -174.281 1.00 112.40 ? 94  ASP F OD2   1 
ATOM   7766  N N     . PHE F 1 98  ? 7.192  -76.365  -171.849 1.00 96.16  ? 95  PHE F N     1 
ATOM   7767  C CA    . PHE F 1 98  ? 5.767  -76.638  -171.723 1.00 94.48  ? 95  PHE F CA    1 
ATOM   7768  C C     . PHE F 1 98  ? 5.539  -78.139  -171.652 1.00 97.29  ? 95  PHE F C     1 
ATOM   7769  O O     . PHE F 1 98  ? 6.378  -78.936  -172.080 1.00 97.45  ? 95  PHE F O     1 
ATOM   7770  C CB    . PHE F 1 98  ? 4.978  -76.030  -172.891 1.00 104.45 ? 95  PHE F CB    1 
ATOM   7771  C CG    . PHE F 1 98  ? 5.349  -76.595  -174.237 1.00 110.03 ? 95  PHE F CG    1 
ATOM   7772  C CD1   . PHE F 1 98  ? 4.726  -77.734  -174.726 1.00 112.01 ? 95  PHE F CD1   1 
ATOM   7773  C CD2   . PHE F 1 98  ? 6.328  -75.993  -175.009 1.00 109.07 ? 95  PHE F CD2   1 
ATOM   7774  C CE1   . PHE F 1 98  ? 5.068  -78.256  -175.960 1.00 105.34 ? 95  PHE F CE1   1 
ATOM   7775  C CE2   . PHE F 1 98  ? 6.675  -76.511  -176.244 1.00 118.11 ? 95  PHE F CE2   1 
ATOM   7776  C CZ    . PHE F 1 98  ? 6.044  -77.644  -176.720 1.00 111.53 ? 95  PHE F CZ    1 
ATOM   7777  N N     . VAL F 1 99  ? 4.381  -78.509  -171.107 1.00 98.31  ? 96  VAL F N     1 
ATOM   7778  C CA    . VAL F 1 99  ? 3.905  -79.890  -171.083 1.00 87.44  ? 96  VAL F CA    1 
ATOM   7779  C C     . VAL F 1 99  ? 2.399  -79.841  -171.310 1.00 103.72 ? 96  VAL F C     1 
ATOM   7780  O O     . VAL F 1 99  ? 1.655  -79.361  -170.447 1.00 106.95 ? 96  VAL F O     1 
ATOM   7781  C CB    . VAL F 1 99  ? 4.230  -80.611  -169.765 1.00 87.87  ? 96  VAL F CB    1 
ATOM   7782  C CG1   . VAL F 1 99  ? 3.416  -81.891  -169.647 1.00 103.02 ? 96  VAL F CG1   1 
ATOM   7783  C CG2   . VAL F 1 99  ? 5.716  -80.921  -169.673 1.00 83.53  ? 96  VAL F CG2   1 
ATOM   7784  N N     . ASP F 1 100 ? 1.950  -80.319  -172.467 1.00 110.57 ? 97  ASP F N     1 
ATOM   7785  C CA    . ASP F 1 100 ? 0.540  -80.303  -172.825 1.00 112.52 ? 97  ASP F CA    1 
ATOM   7786  C C     . ASP F 1 100 ? 0.047  -81.723  -173.072 1.00 120.98 ? 97  ASP F C     1 
ATOM   7787  O O     . ASP F 1 100 ? 0.831  -82.645  -173.314 1.00 121.00 ? 97  ASP F O     1 
ATOM   7788  C CB    . ASP F 1 100 ? 0.288  -79.435  -174.066 1.00 119.48 ? 97  ASP F CB    1 
ATOM   7789  C CG    . ASP F 1 100 ? 0.875  -78.041  -173.934 1.00 140.80 ? 97  ASP F CG    1 
ATOM   7790  O OD1   . ASP F 1 100 ? 0.640  -77.391  -172.894 1.00 139.53 ? 97  ASP F OD1   1 
ATOM   7791  O OD2   . ASP F 1 100 ? 1.564  -77.593  -174.875 1.00 134.75 ? 97  ASP F OD2   1 
ATOM   7792  N N     . LEU F 1 101 ? -1.273 -81.886  -173.004 1.00 123.05 ? 98  LEU F N     1 
ATOM   7793  C CA    . LEU F 1 101 ? -1.914 -83.187  -173.164 1.00 122.50 ? 98  LEU F CA    1 
ATOM   7794  C C     . LEU F 1 101 ? -3.135 -83.027  -174.056 1.00 135.52 ? 98  LEU F C     1 
ATOM   7795  O O     . LEU F 1 101 ? -4.086 -82.332  -173.686 1.00 141.99 ? 98  LEU F O     1 
ATOM   7796  C CB    . LEU F 1 101 ? -2.312 -83.778  -171.807 1.00 111.11 ? 98  LEU F CB    1 
ATOM   7797  C CG    . LEU F 1 101 ? -3.065 -85.110  -171.829 1.00 119.44 ? 98  LEU F CG    1 
ATOM   7798  C CD1   . LEU F 1 101 ? -2.317 -86.144  -172.654 1.00 128.19 ? 98  LEU F CD1   1 
ATOM   7799  C CD2   . LEU F 1 101 ? -3.298 -85.614  -170.413 1.00 114.28 ? 98  LEU F CD2   1 
ATOM   7800  N N     . ASN F 1 102 ? -3.108 -83.664  -175.225 1.00 143.32 ? 99  ASN F N     1 
ATOM   7801  C CA    . ASN F 1 102 ? -4.219 -83.629  -176.172 1.00 139.12 ? 99  ASN F CA    1 
ATOM   7802  C C     . ASN F 1 102 ? -4.699 -85.054  -176.414 1.00 154.91 ? 99  ASN F C     1 
ATOM   7803  O O     . ASN F 1 102 ? -4.038 -85.822  -177.123 1.00 165.16 ? 99  ASN F O     1 
ATOM   7804  C CB    . ASN F 1 102 ? -3.802 -82.959  -177.482 1.00 149.06 ? 99  ASN F CB    1 
ATOM   7805  C CG    . ASN F 1 102 ? -3.327 -81.533  -177.283 1.00 145.26 ? 99  ASN F CG    1 
ATOM   7806  O OD1   . ASN F 1 102 ? -3.860 -80.799  -176.451 1.00 137.19 ? 99  ASN F OD1   1 
ATOM   7807  N ND2   . ASN F 1 102 ? -2.321 -81.132  -178.053 1.00 146.71 ? 99  ASN F ND2   1 
ATOM   7808  N N     . ASN F 1 103 ? -5.853 -85.388  -175.836 1.00 159.30 ? 100 ASN F N     1 
ATOM   7809  C CA    . ASN F 1 103 ? -6.537 -86.678  -175.992 1.00 159.90 ? 100 ASN F CA    1 
ATOM   7810  C C     . ASN F 1 103 ? -5.555 -87.850  -175.973 1.00 155.33 ? 100 ASN F C     1 
ATOM   7811  O O     . ASN F 1 103 ? -5.487 -88.664  -176.893 1.00 148.69 ? 100 ASN F O     1 
ATOM   7812  C CB    . ASN F 1 103 ? -7.402 -86.710  -177.256 1.00 155.12 ? 100 ASN F CB    1 
ATOM   7813  C CG    . ASN F 1 103 ? -6.683 -86.185  -178.484 1.00 167.15 ? 100 ASN F CG    1 
ATOM   7814  O OD1   . ASN F 1 103 ? -6.700 -84.985  -178.762 1.00 163.63 ? 100 ASN F OD1   1 
ATOM   7815  N ND2   . ASN F 1 103 ? -6.045 -87.083  -179.225 1.00 169.60 ? 100 ASN F ND2   1 
ATOM   7816  N N     . GLY F 1 104 ? -4.786 -87.922  -174.886 1.00 151.25 ? 101 GLY F N     1 
ATOM   7817  C CA    . GLY F 1 104 ? -3.900 -89.039  -174.649 1.00 146.66 ? 101 GLY F CA    1 
ATOM   7818  C C     . GLY F 1 104 ? -2.493 -88.877  -175.180 1.00 146.06 ? 101 GLY F C     1 
ATOM   7819  O O     . GLY F 1 104 ? -1.640 -89.727  -174.892 1.00 135.94 ? 101 GLY F O     1 
ATOM   7820  N N     . ALA F 1 105 ? -2.216 -87.821  -175.940 1.00 150.86 ? 102 ALA F N     1 
ATOM   7821  C CA    . ALA F 1 105 ? -0.896 -87.590  -176.508 1.00 142.92 ? 102 ALA F CA    1 
ATOM   7822  C C     . ALA F 1 105 ? -0.192 -86.487  -175.731 1.00 129.87 ? 102 ALA F C     1 
ATOM   7823  O O     . ALA F 1 105 ? -0.772 -85.424  -175.487 1.00 126.53 ? 102 ALA F O     1 
ATOM   7824  C CB    . ALA F 1 105 ? -0.996 -87.216  -177.988 1.00 142.10 ? 102 ALA F CB    1 
ATOM   7825  N N     . PHE F 1 106 ? 1.056  -86.742  -175.348 1.00 127.53 ? 103 PHE F N     1 
ATOM   7826  C CA    . PHE F 1 106 ? 1.852  -85.802  -174.569 1.00 122.62 ? 103 PHE F CA    1 
ATOM   7827  C C     . PHE F 1 106 ? 2.805  -85.050  -175.491 1.00 123.96 ? 103 PHE F C     1 
ATOM   7828  O O     . PHE F 1 106 ? 3.622  -85.667  -176.183 1.00 131.91 ? 103 PHE F O     1 
ATOM   7829  C CB    . PHE F 1 106 ? 2.629  -86.529  -173.472 1.00 122.76 ? 103 PHE F CB    1 
ATOM   7830  C CG    . PHE F 1 106 ? 1.856  -86.704  -172.196 1.00 122.35 ? 103 PHE F CG    1 
ATOM   7831  C CD1   . PHE F 1 106 ? 1.193  -85.634  -171.620 1.00 117.79 ? 103 PHE F CD1   1 
ATOM   7832  C CD2   . PHE F 1 106 ? 1.787  -87.941  -171.576 1.00 122.00 ? 103 PHE F CD2   1 
ATOM   7833  C CE1   . PHE F 1 106 ? 0.482  -85.791  -170.445 1.00 102.92 ? 103 PHE F CE1   1 
ATOM   7834  C CE2   . PHE F 1 106 ? 1.076  -88.106  -170.402 1.00 107.92 ? 103 PHE F CE2   1 
ATOM   7835  C CZ    . PHE F 1 106 ? 0.423  -87.029  -169.836 1.00 100.68 ? 103 PHE F CZ    1 
ATOM   7836  N N     . TYR F 1 107 ? 2.701  -83.723  -175.492 1.00 117.14 ? 104 TYR F N     1 
ATOM   7837  C CA    . TYR F 1 107 ? 3.566  -82.850  -176.280 1.00 119.60 ? 104 TYR F CA    1 
ATOM   7838  C C     . TYR F 1 107 ? 4.451  -82.080  -175.307 1.00 113.49 ? 104 TYR F C     1 
ATOM   7839  O O     . TYR F 1 107 ? 3.956  -81.257  -174.529 1.00 112.32 ? 104 TYR F O     1 
ATOM   7840  C CB    . TYR F 1 107 ? 2.753  -81.898  -177.156 1.00 118.08 ? 104 TYR F CB    1 
ATOM   7841  C CG    . TYR F 1 107 ? 1.761  -82.573  -178.079 1.00 116.69 ? 104 TYR F CG    1 
ATOM   7842  C CD1   . TYR F 1 107 ? 0.547  -83.054  -177.603 1.00 127.74 ? 104 TYR F CD1   1 
ATOM   7843  C CD2   . TYR F 1 107 ? 2.037  -82.722  -179.432 1.00 138.92 ? 104 TYR F CD2   1 
ATOM   7844  C CE1   . TYR F 1 107 ? -0.359 -83.668  -178.447 1.00 140.06 ? 104 TYR F CE1   1 
ATOM   7845  C CE2   . TYR F 1 107 ? 1.137  -83.334  -180.284 1.00 158.66 ? 104 TYR F CE2   1 
ATOM   7846  C CZ    . TYR F 1 107 ? -0.059 -83.805  -179.786 1.00 158.31 ? 104 TYR F CZ    1 
ATOM   7847  O OH    . TYR F 1 107 ? -0.959 -84.415  -180.630 1.00 169.65 ? 104 TYR F OH    1 
ATOM   7848  N N     . VAL F 1 108 ? 5.754  -82.346  -175.349 1.00 107.34 ? 105 VAL F N     1 
ATOM   7849  C CA    . VAL F 1 108 ? 6.706  -81.796  -174.393 1.00 101.66 ? 105 VAL F CA    1 
ATOM   7850  C C     . VAL F 1 108 ? 7.786  -81.038  -175.151 1.00 113.22 ? 105 VAL F C     1 
ATOM   7851  O O     . VAL F 1 108 ? 8.385  -81.574  -176.091 1.00 122.57 ? 105 VAL F O     1 
ATOM   7852  C CB    . VAL F 1 108 ? 7.331  -82.899  -173.519 1.00 95.28  ? 105 VAL F CB    1 
ATOM   7853  C CG1   . VAL F 1 108 ? 8.397  -82.312  -172.612 1.00 103.80 ? 105 VAL F CG1   1 
ATOM   7854  C CG2   . VAL F 1 108 ? 6.257  -83.594  -172.699 1.00 111.02 ? 105 VAL F CG2   1 
ATOM   7855  N N     . GLY F 1 109 ? 8.034  -79.797  -174.737 1.00 96.85  ? 106 GLY F N     1 
ATOM   7856  C CA    . GLY F 1 109 ? 9.156  -79.033  -175.245 1.00 91.65  ? 106 GLY F CA    1 
ATOM   7857  C C     . GLY F 1 109 ? 10.141 -78.696  -174.146 1.00 91.76  ? 106 GLY F C     1 
ATOM   7858  O O     . GLY F 1 109 ? 9.745  -78.211  -173.082 1.00 105.99 ? 106 GLY F O     1 
ATOM   7859  N N     . VAL F 1 110 ? 11.427 -78.939  -174.389 1.00 88.40  ? 107 VAL F N     1 
ATOM   7860  C CA    . VAL F 1 110 ? 12.472 -78.743  -173.390 1.00 93.38  ? 107 VAL F CA    1 
ATOM   7861  C C     . VAL F 1 110 ? 13.693 -78.152  -174.081 1.00 93.95  ? 107 VAL F C     1 
ATOM   7862  O O     . VAL F 1 110 ? 14.034 -78.540  -175.203 1.00 100.43 ? 107 VAL F O     1 
ATOM   7863  C CB    . VAL F 1 110 ? 12.831 -80.065  -172.673 1.00 100.24 ? 107 VAL F CB    1 
ATOM   7864  C CG1   . VAL F 1 110 ? 14.068 -79.893  -171.800 1.00 81.10  ? 107 VAL F CG1   1 
ATOM   7865  C CG2   . VAL F 1 110 ? 11.665 -80.556  -171.831 1.00 100.22 ? 107 VAL F CG2   1 
ATOM   7866  N N     . CYS F 1 111 ? 14.352 -77.212  -173.406 1.00 88.96  ? 108 CYS F N     1 
ATOM   7867  C CA    . CYS F 1 111 ? 15.552 -76.572  -173.921 1.00 100.40 ? 108 CYS F CA    1 
ATOM   7868  C C     . CYS F 1 111 ? 16.663 -76.673  -172.888 1.00 95.72  ? 108 CYS F C     1 
ATOM   7869  O O     . CYS F 1 111 ? 16.410 -76.778  -171.685 1.00 101.02 ? 108 CYS F O     1 
ATOM   7870  C CB    . CYS F 1 111 ? 15.303 -75.099  -174.268 1.00 100.75 ? 108 CYS F CB    1 
ATOM   7871  S SG    . CYS F 1 111 ? 15.319 -73.994  -172.839 1.00 99.63  ? 108 CYS F SG    1 
ATOM   7872  N N     . ALA F 1 112 ? 17.902 -76.638  -173.373 1.00 92.40  ? 109 ALA F N     1 
ATOM   7873  C CA    . ALA F 1 112 ? 19.072 -76.716  -172.513 1.00 80.87  ? 109 ALA F CA    1 
ATOM   7874  C C     . ALA F 1 112 ? 20.136 -75.760  -173.028 1.00 79.63  ? 109 ALA F C     1 
ATOM   7875  O O     . ALA F 1 112 ? 20.152 -75.388  -174.203 1.00 89.32  ? 109 ALA F O     1 
ATOM   7876  C CB    . ALA F 1 112 ? 19.630 -78.144  -172.440 1.00 84.36  ? 109 ALA F CB    1 
ATOM   7877  N N     . PHE F 1 113 ? 21.037 -75.371  -172.129 1.00 78.05  ? 110 PHE F N     1 
ATOM   7878  C CA    . PHE F 1 113 ? 22.128 -74.453  -172.440 1.00 73.00  ? 110 PHE F CA    1 
ATOM   7879  C C     . PHE F 1 113 ? 23.436 -75.140  -172.072 1.00 68.47  ? 110 PHE F C     1 
ATOM   7880  O O     . PHE F 1 113 ? 23.767 -75.262  -170.888 1.00 91.88  ? 110 PHE F O     1 
ATOM   7881  C CB    . PHE F 1 113 ? 21.973 -73.130  -171.688 1.00 70.25  ? 110 PHE F CB    1 
ATOM   7882  C CG    . PHE F 1 113 ? 20.793 -72.309  -172.134 1.00 69.82  ? 110 PHE F CG    1 
ATOM   7883  C CD1   . PHE F 1 113 ? 19.501 -72.679  -171.797 1.00 72.96  ? 110 PHE F CD1   1 
ATOM   7884  C CD2   . PHE F 1 113 ? 20.979 -71.159  -172.882 1.00 68.90  ? 110 PHE F CD2   1 
ATOM   7885  C CE1   . PHE F 1 113 ? 18.417 -71.924  -172.204 1.00 65.14  ? 110 PHE F CE1   1 
ATOM   7886  C CE2   . PHE F 1 113 ? 19.898 -70.398  -173.288 1.00 72.27  ? 110 PHE F CE2   1 
ATOM   7887  C CZ    . PHE F 1 113 ? 18.616 -70.782  -172.950 1.00 55.50  ? 110 PHE F CZ    1 
ATOM   7888  N N     . VAL F 1 114 ? 24.174 -75.584  -173.083 1.00 61.87  ? 111 VAL F N     1 
ATOM   7889  C CA    . VAL F 1 114 ? 25.425 -76.307  -172.891 1.00 64.59  ? 111 VAL F CA    1 
ATOM   7890  C C     . VAL F 1 114 ? 26.586 -75.364  -173.161 1.00 70.69  ? 111 VAL F C     1 
ATOM   7891  O O     . VAL F 1 114 ? 26.572 -74.600  -174.135 1.00 74.21  ? 111 VAL F O     1 
ATOM   7892  C CB    . VAL F 1 114 ? 25.496 -77.546  -173.804 1.00 69.59  ? 111 VAL F CB    1 
ATOM   7893  C CG1   . VAL F 1 114 ? 26.673 -78.428  -173.416 1.00 76.29  ? 111 VAL F CG1   1 
ATOM   7894  C CG2   . VAL F 1 114 ? 24.190 -78.321  -173.743 1.00 69.20  ? 111 VAL F CG2   1 
ATOM   7895  N N     . ARG F 1 115 ? 27.597 -75.417  -172.297 1.00 66.84  ? 112 ARG F N     1 
ATOM   7896  C CA    . ARG F 1 115 ? 28.806 -74.610  -172.428 1.00 68.06  ? 112 ARG F CA    1 
ATOM   7897  C C     . ARG F 1 115 ? 29.993 -75.555  -172.553 1.00 64.54  ? 112 ARG F C     1 
ATOM   7898  O O     . ARG F 1 115 ? 30.314 -76.281  -171.606 1.00 60.07  ? 112 ARG F O     1 
ATOM   7899  C CB    . ARG F 1 115 ? 28.971 -73.676  -171.229 1.00 76.36  ? 112 ARG F CB    1 
ATOM   7900  C CG    . ARG F 1 115 ? 30.336 -73.014  -171.130 1.00 63.55  ? 112 ARG F CG    1 
ATOM   7901  C CD    . ARG F 1 115 ? 30.509 -72.326  -169.784 1.00 73.30  ? 112 ARG F CD    1 
ATOM   7902  N NE    . ARG F 1 115 ? 31.914 -72.217  -169.400 1.00 82.16  ? 112 ARG F NE    1 
ATOM   7903  C CZ    . ARG F 1 115 ? 32.595 -71.077  -169.357 1.00 81.35  ? 112 ARG F CZ    1 
ATOM   7904  N NH1   . ARG F 1 115 ? 32.001 -69.934  -169.671 1.00 79.51  ? 112 ARG F NH1   1 
ATOM   7905  N NH2   . ARG F 1 115 ? 33.871 -71.080  -168.995 1.00 68.15  ? 112 ARG F NH2   1 
ATOM   7906  N N     . VAL F 1 116 ? 30.649 -75.537  -173.711 1.00 65.77  ? 113 VAL F N     1 
ATOM   7907  C CA    . VAL F 1 116 ? 31.835 -76.349  -173.961 1.00 65.83  ? 113 VAL F CA    1 
ATOM   7908  C C     . VAL F 1 116 ? 33.064 -75.485  -173.737 1.00 67.31  ? 113 VAL F C     1 
ATOM   7909  O O     . VAL F 1 116 ? 33.096 -74.318  -174.142 1.00 71.38  ? 113 VAL F O     1 
ATOM   7910  C CB    . VAL F 1 116 ? 31.825 -76.936  -175.385 1.00 66.78  ? 113 VAL F CB    1 
ATOM   7911  C CG1   . VAL F 1 116 ? 32.940 -77.957  -175.546 1.00 70.55  ? 113 VAL F CG1   1 
ATOM   7912  C CG2   . VAL F 1 116 ? 30.475 -77.558  -175.693 1.00 70.26  ? 113 VAL F CG2   1 
ATOM   7913  N N     . GLN F 1 117 ? 34.083 -76.057  -173.098 1.00 65.17  ? 114 GLN F N     1 
ATOM   7914  C CA    . GLN F 1 117 ? 35.279 -75.309  -172.744 1.00 67.00  ? 114 GLN F CA    1 
ATOM   7915  C C     . GLN F 1 117 ? 36.514 -76.162  -172.989 1.00 75.27  ? 114 GLN F C     1 
ATOM   7916  O O     . GLN F 1 117 ? 36.539 -77.347  -172.644 1.00 83.81  ? 114 GLN F O     1 
ATOM   7917  C CB    . GLN F 1 117 ? 35.238 -74.855  -171.279 1.00 79.39  ? 114 GLN F CB    1 
ATOM   7918  C CG    . GLN F 1 117 ? 36.474 -74.097  -170.823 1.00 77.04  ? 114 GLN F CG    1 
ATOM   7919  C CD    . GLN F 1 117 ? 36.480 -73.837  -169.328 1.00 88.51  ? 114 GLN F CD    1 
ATOM   7920  O OE1   . GLN F 1 117 ? 36.427 -72.690  -168.886 1.00 115.49 ? 114 GLN F OE1   1 
ATOM   7921  N NE2   . GLN F 1 117 ? 36.548 -74.905  -168.543 1.00 90.49  ? 114 GLN F NE2   1 
ATOM   7922  N N     . LEU F 1 118 ? 37.531 -75.553  -173.588 1.00 77.00  ? 115 LEU F N     1 
ATOM   7923  C CA    . LEU F 1 118 ? 38.806 -76.213  -173.816 1.00 80.59  ? 115 LEU F CA    1 
ATOM   7924  C C     . LEU F 1 118 ? 39.757 -75.939  -172.656 1.00 74.06  ? 115 LEU F C     1 
ATOM   7925  O O     . LEU F 1 118 ? 39.590 -74.983  -171.896 1.00 79.78  ? 115 LEU F O     1 
ATOM   7926  C CB    . LEU F 1 118 ? 39.427 -75.746  -175.132 1.00 94.64  ? 115 LEU F CB    1 
ATOM   7927  C CG    . LEU F 1 118 ? 38.511 -75.749  -176.356 1.00 85.46  ? 115 LEU F CG    1 
ATOM   7928  C CD1   . LEU F 1 118 ? 39.255 -75.244  -177.582 1.00 85.41  ? 115 LEU F CD1   1 
ATOM   7929  C CD2   . LEU F 1 118 ? 37.951 -77.142  -176.602 1.00 77.12  ? 115 LEU F CD2   1 
ATOM   7930  N N     . LYS F 1 119 ? 40.767 -76.806  -172.527 1.00 62.64  ? 116 LYS F N     1 
ATOM   7931  C CA    . LYS F 1 119 ? 41.707 -76.709  -171.413 1.00 87.86  ? 116 LYS F CA    1 
ATOM   7932  C C     . LYS F 1 119 ? 42.452 -75.379  -171.375 1.00 87.43  ? 116 LYS F C     1 
ATOM   7933  O O     . LYS F 1 119 ? 43.020 -75.032  -170.334 1.00 82.21  ? 116 LYS F O     1 
ATOM   7934  C CB    . LYS F 1 119 ? 42.708 -77.865  -171.468 1.00 93.64  ? 116 LYS F CB    1 
ATOM   7935  C CG    . LYS F 1 119 ? 43.409 -78.027  -172.806 1.00 98.72  ? 116 LYS F CG    1 
ATOM   7936  C CD    . LYS F 1 119 ? 44.299 -79.259  -172.807 1.00 119.74 ? 116 LYS F CD    1 
ATOM   7937  C CE    . LYS F 1 119 ? 44.796 -79.585  -174.205 1.00 123.88 ? 116 LYS F CE    1 
ATOM   7938  N NZ    . LYS F 1 119 ? 45.501 -80.896  -174.255 1.00 138.03 ? 116 LYS F NZ    1 
ATOM   7939  N N     . ASP F 1 120 ? 42.465 -74.629  -172.476 1.00 84.06  ? 117 ASP F N     1 
ATOM   7940  C CA    . ASP F 1 120 ? 43.113 -73.324  -172.484 1.00 95.18  ? 117 ASP F CA    1 
ATOM   7941  C C     . ASP F 1 120 ? 42.225 -72.218  -171.930 1.00 81.52  ? 117 ASP F C     1 
ATOM   7942  O O     . ASP F 1 120 ? 42.724 -71.118  -171.673 1.00 89.08  ? 117 ASP F O     1 
ATOM   7943  C CB    . ASP F 1 120 ? 43.561 -72.961  -173.903 1.00 116.28 ? 117 ASP F CB    1 
ATOM   7944  C CG    . ASP F 1 120 ? 42.410 -72.525  -174.787 1.00 111.60 ? 117 ASP F CG    1 
ATOM   7945  O OD1   . ASP F 1 120 ? 41.344 -73.174  -174.745 1.00 107.93 ? 117 ASP F OD1   1 
ATOM   7946  O OD2   . ASP F 1 120 ? 42.573 -71.529  -175.523 1.00 110.47 ? 117 ASP F OD2   1 
ATOM   7947  N N     . GLY F 1 121 ? 40.933 -72.479  -171.740 1.00 69.30  ? 118 GLY F N     1 
ATOM   7948  C CA    . GLY F 1 121 ? 39.994 -71.494  -171.250 1.00 69.18  ? 118 GLY F CA    1 
ATOM   7949  C C     . GLY F 1 121 ? 38.972 -71.045  -172.271 1.00 83.48  ? 118 GLY F C     1 
ATOM   7950  O O     . GLY F 1 121 ? 37.941 -70.476  -171.886 1.00 70.82  ? 118 GLY F O     1 
ATOM   7951  N N     . SER F 1 122 ? 39.229 -71.274  -173.559 1.00 89.00  ? 119 SER F N     1 
ATOM   7952  C CA    . SER F 1 122 ? 38.258 -70.935  -174.590 1.00 84.08  ? 119 SER F CA    1 
ATOM   7953  C C     . SER F 1 122 ? 36.956 -71.692  -174.359 1.00 80.52  ? 119 SER F C     1 
ATOM   7954  O O     . SER F 1 122 ? 36.947 -72.824  -173.869 1.00 82.01  ? 119 SER F O     1 
ATOM   7955  C CB    . SER F 1 122 ? 38.818 -71.258  -175.976 1.00 93.29  ? 119 SER F CB    1 
ATOM   7956  O OG    . SER F 1 122 ? 37.863 -70.988  -176.989 1.00 111.26 ? 119 SER F OG    1 
ATOM   7957  N N     . TYR F 1 123 ? 35.844 -71.056  -174.721 1.00 68.36  ? 120 TYR F N     1 
ATOM   7958  C CA    . TYR F 1 123 ? 34.535 -71.600  -174.396 1.00 64.28  ? 120 TYR F CA    1 
ATOM   7959  C C     . TYR F 1 123 ? 33.509 -71.158  -175.429 1.00 72.39  ? 120 TYR F C     1 
ATOM   7960  O O     . TYR F 1 123 ? 33.594 -70.060  -175.983 1.00 71.50  ? 120 TYR F O     1 
ATOM   7961  C CB    . TYR F 1 123 ? 34.095 -71.172  -172.990 1.00 72.09  ? 120 TYR F CB    1 
ATOM   7962  C CG    . TYR F 1 123 ? 33.982 -69.673  -172.812 1.00 78.58  ? 120 TYR F CG    1 
ATOM   7963  C CD1   . TYR F 1 123 ? 32.790 -69.010  -173.077 1.00 77.06  ? 120 TYR F CD1   1 
ATOM   7964  C CD2   . TYR F 1 123 ? 35.066 -68.922  -172.374 1.00 69.29  ? 120 TYR F CD2   1 
ATOM   7965  C CE1   . TYR F 1 123 ? 32.682 -67.642  -172.917 1.00 67.06  ? 120 TYR F CE1   1 
ATOM   7966  C CE2   . TYR F 1 123 ? 34.966 -67.553  -172.209 1.00 70.74  ? 120 TYR F CE2   1 
ATOM   7967  C CZ    . TYR F 1 123 ? 33.772 -66.919  -172.482 1.00 76.32  ? 120 TYR F CZ    1 
ATOM   7968  O OH    . TYR F 1 123 ? 33.665 -65.557  -172.321 1.00 89.43  ? 120 TYR F OH    1 
ATOM   7969  N N     . HIS F 1 124 ? 32.535 -72.030  -175.678 1.00 72.32  ? 121 HIS F N     1 
ATOM   7970  C CA    . HIS F 1 124 ? 31.399 -71.712  -176.530 1.00 79.92  ? 121 HIS F CA    1 
ATOM   7971  C C     . HIS F 1 124 ? 30.136 -72.279  -175.901 1.00 68.59  ? 121 HIS F C     1 
ATOM   7972  O O     . HIS F 1 124 ? 30.133 -73.410  -175.408 1.00 75.73  ? 121 HIS F O     1 
ATOM   7973  C CB    . HIS F 1 124 ? 31.578 -72.267  -177.949 1.00 91.28  ? 121 HIS F CB    1 
ATOM   7974  C CG    . HIS F 1 124 ? 32.626 -71.556  -178.749 1.00 86.60  ? 121 HIS F CG    1 
ATOM   7975  N ND1   . HIS F 1 124 ? 33.622 -72.221  -179.429 1.00 99.10  ? 121 HIS F ND1   1 
ATOM   7976  C CD2   . HIS F 1 124 ? 32.832 -70.237  -178.976 1.00 74.51  ? 121 HIS F CD2   1 
ATOM   7977  C CE1   . HIS F 1 124 ? 34.397 -71.343  -180.041 1.00 93.54  ? 121 HIS F CE1   1 
ATOM   7978  N NE2   . HIS F 1 124 ? 33.939 -70.132  -179.782 1.00 92.65  ? 121 HIS F NE2   1 
ATOM   7979  N N     . GLU F 1 125 ? 29.067 -71.487  -175.921 1.00 64.76  ? 122 GLU F N     1 
ATOM   7980  C CA    . GLU F 1 125 ? 27.808 -71.854  -175.290 1.00 75.11  ? 122 GLU F CA    1 
ATOM   7981  C C     . GLU F 1 125 ? 26.661 -71.620  -176.262 1.00 83.21  ? 122 GLU F C     1 
ATOM   7982  O O     . GLU F 1 125 ? 26.612 -70.589  -176.939 1.00 95.20  ? 122 GLU F O     1 
ATOM   7983  C CB    . GLU F 1 125 ? 27.590 -71.049  -174.000 1.00 81.52  ? 122 GLU F CB    1 
ATOM   7984  C CG    . GLU F 1 125 ? 26.241 -71.263  -173.336 1.00 84.22  ? 122 GLU F CG    1 
ATOM   7985  C CD    . GLU F 1 125 ? 26.065 -70.409  -172.094 1.00 85.40  ? 122 GLU F CD    1 
ATOM   7986  O OE1   . GLU F 1 125 ? 26.496 -69.236  -172.109 1.00 92.25  ? 122 GLU F OE1   1 
ATOM   7987  O OE2   . GLU F 1 125 ? 25.491 -70.909  -171.104 1.00 79.40  ? 122 GLU F OE2   1 
ATOM   7988  N N     . ASP F 1 126 ? 25.741 -72.580  -176.328 1.00 75.49  ? 123 ASP F N     1 
ATOM   7989  C CA    . ASP F 1 126 ? 24.619 -72.488  -177.252 1.00 80.21  ? 123 ASP F CA    1 
ATOM   7990  C C     . ASP F 1 126 ? 23.468 -73.331  -176.719 1.00 84.12  ? 123 ASP F C     1 
ATOM   7991  O O     . ASP F 1 126 ? 23.638 -74.155  -175.817 1.00 82.82  ? 123 ASP F O     1 
ATOM   7992  C CB    . ASP F 1 126 ? 25.018 -72.928  -178.663 1.00 82.20  ? 123 ASP F CB    1 
ATOM   7993  C CG    . ASP F 1 126 ? 24.250 -72.187  -179.738 1.00 97.58  ? 123 ASP F CG    1 
ATOM   7994  O OD1   . ASP F 1 126 ? 23.001 -72.216  -179.701 1.00 96.02  ? 123 ASP F OD1   1 
ATOM   7995  O OD2   . ASP F 1 126 ? 24.893 -71.573  -180.615 1.00 108.20 ? 123 ASP F OD2   1 
ATOM   7996  N N     . VAL F 1 127 ? 22.287 -73.107  -177.294 1.00 80.93  ? 124 VAL F N     1 
ATOM   7997  C CA    . VAL F 1 127 ? 21.068 -73.767  -176.849 1.00 83.92  ? 124 VAL F CA    1 
ATOM   7998  C C     . VAL F 1 127 ? 20.874 -75.067  -177.623 1.00 89.21  ? 124 VAL F C     1 
ATOM   7999  O O     . VAL F 1 127 ? 21.448 -75.279  -178.694 1.00 105.73 ? 124 VAL F O     1 
ATOM   8000  C CB    . VAL F 1 127 ? 19.845 -72.837  -177.006 1.00 72.06  ? 124 VAL F CB    1 
ATOM   8001  C CG1   . VAL F 1 127 ? 18.660 -73.337  -176.188 1.00 83.33  ? 124 VAL F CG1   1 
ATOM   8002  C CG2   . VAL F 1 127 ? 20.206 -71.441  -176.581 1.00 84.31  ? 124 VAL F CG2   1 
ATOM   8003  N N     . GLY F 1 128 ? 20.058 -75.947  -177.062 1.00 68.37  ? 125 GLY F N     1 
ATOM   8004  C CA    . GLY F 1 128 ? 19.594 -77.127  -177.769 1.00 80.50  ? 125 GLY F CA    1 
ATOM   8005  C C     . GLY F 1 128 ? 18.205 -77.474  -177.292 1.00 85.31  ? 125 GLY F C     1 
ATOM   8006  O O     . GLY F 1 128 ? 17.829 -77.174  -176.154 1.00 82.86  ? 125 GLY F O     1 
ATOM   8007  N N     . TYR F 1 129 ? 17.432 -78.108  -178.168 1.00 87.86  ? 126 TYR F N     1 
ATOM   8008  C CA    . TYR F 1 129 ? 16.031 -78.376  -177.890 1.00 88.01  ? 126 TYR F CA    1 
ATOM   8009  C C     . TYR F 1 129 ? 15.728 -79.865  -177.988 1.00 98.38  ? 126 TYR F C     1 
ATOM   8010  O O     . TYR F 1 129 ? 16.372 -80.604  -178.740 1.00 102.95 ? 126 TYR F O     1 
ATOM   8011  C CB    . TYR F 1 129 ? 15.120 -77.605  -178.849 1.00 82.38  ? 126 TYR F CB    1 
ATOM   8012  C CG    . TYR F 1 129 ? 13.876 -77.079  -178.183 1.00 86.27  ? 126 TYR F CG    1 
ATOM   8013  C CD1   . TYR F 1 129 ? 13.874 -75.840  -177.559 1.00 97.33  ? 126 TYR F CD1   1 
ATOM   8014  C CD2   . TYR F 1 129 ? 12.710 -77.830  -178.155 1.00 96.50  ? 126 TYR F CD2   1 
ATOM   8015  C CE1   . TYR F 1 129 ? 12.742 -75.355  -176.943 1.00 110.29 ? 126 TYR F CE1   1 
ATOM   8016  C CE2   . TYR F 1 129 ? 11.571 -77.355  -177.538 1.00 101.42 ? 126 TYR F CE2   1 
ATOM   8017  C CZ    . TYR F 1 129 ? 11.593 -76.116  -176.933 1.00 104.88 ? 126 TYR F CZ    1 
ATOM   8018  O OH    . TYR F 1 129 ? 10.460 -75.638  -176.316 1.00 94.03  ? 126 TYR F OH    1 
ATOM   8019  N N     . GLY F 1 130 ? 14.742 -80.288  -177.215 1.00 99.35  ? 127 GLY F N     1 
ATOM   8020  C CA    . GLY F 1 130 ? 14.252 -81.656  -177.276 1.00 103.03 ? 127 GLY F CA    1 
ATOM   8021  C C     . GLY F 1 130 ? 12.744 -81.660  -177.370 1.00 107.04 ? 127 GLY F C     1 
ATOM   8022  O O     . GLY F 1 130 ? 12.070 -80.828  -176.764 1.00 111.34 ? 127 GLY F O     1 
ATOM   8023  N N     . VAL F 1 131 ? 12.218 -82.613  -178.134 1.00 104.57 ? 128 VAL F N     1 
ATOM   8024  C CA    . VAL F 1 131 ? 10.810 -82.626  -178.517 1.00 104.74 ? 128 VAL F CA    1 
ATOM   8025  C C     . VAL F 1 131 ? 10.288 -84.052  -178.421 1.00 119.01 ? 128 VAL F C     1 
ATOM   8026  O O     . VAL F 1 131 ? 10.891 -84.979  -178.974 1.00 124.66 ? 128 VAL F O     1 
ATOM   8027  C CB    . VAL F 1 131 ? 10.595 -82.075  -179.942 1.00 115.34 ? 128 VAL F CB    1 
ATOM   8028  C CG1   . VAL F 1 131 ? 9.119  -82.038  -180.274 1.00 122.10 ? 128 VAL F CG1   1 
ATOM   8029  C CG2   . VAL F 1 131 ? 11.198 -80.683  -180.089 1.00 107.90 ? 128 VAL F CG2   1 
ATOM   8030  N N     . SER F 1 132 ? 9.173  -84.230  -177.712 1.00 115.08 ? 129 SER F N     1 
ATOM   8031  C CA    . SER F 1 132 ? 8.479  -85.518  -177.636 1.00 121.32 ? 129 SER F CA    1 
ATOM   8032  C C     . SER F 1 132 ? 6.983  -85.241  -177.753 1.00 122.82 ? 129 SER F C     1 
ATOM   8033  O O     . SER F 1 132 ? 6.353  -84.798  -176.789 1.00 113.20 ? 129 SER F O     1 
ATOM   8034  C CB    . SER F 1 132 ? 8.810  -86.252  -176.344 1.00 118.11 ? 129 SER F CB    1 
ATOM   8035  O OG    . SER F 1 132 ? 8.137  -87.497  -176.286 1.00 118.75 ? 129 SER F OG    1 
ATOM   8036  N N     . GLU F 1 133 ? 6.423  -85.506  -178.934 1.00 135.13 ? 130 GLU F N     1 
ATOM   8037  C CA    . GLU F 1 133 ? 5.021  -85.226  -179.221 1.00 139.48 ? 130 GLU F CA    1 
ATOM   8038  C C     . GLU F 1 133 ? 4.139  -86.465  -179.263 1.00 144.16 ? 130 GLU F C     1 
ATOM   8039  O O     . GLU F 1 133 ? 2.955  -86.373  -178.933 1.00 141.23 ? 130 GLU F O     1 
ATOM   8040  C CB    . GLU F 1 133 ? 4.890  -84.487  -180.560 1.00 133.37 ? 130 GLU F CB    1 
ATOM   8041  C CG    . GLU F 1 133 ? 5.838  -83.311  -180.716 1.00 135.13 ? 130 GLU F CG    1 
ATOM   8042  C CD    . GLU F 1 133 ? 5.385  -82.326  -181.778 1.00 148.26 ? 130 GLU F CD    1 
ATOM   8043  O OE1   . GLU F 1 133 ? 4.357  -81.650  -181.567 1.00 159.00 ? 130 GLU F OE1   1 
ATOM   8044  O OE2   . GLU F 1 133 ? 6.061  -82.226  -182.825 1.00 140.44 ? 130 GLU F OE2   1 
ATOM   8045  N N     . GLY F 1 134 ? 4.681  -87.613  -179.657 1.00 143.92 ? 131 GLY F N     1 
ATOM   8046  C CA    . GLY F 1 134 ? 3.871  -88.787  -179.921 1.00 147.46 ? 131 GLY F CA    1 
ATOM   8047  C C     . GLY F 1 134 ? 3.476  -89.606  -178.709 1.00 131.70 ? 131 GLY F C     1 
ATOM   8048  O O     . GLY F 1 134 ? 2.331  -90.059  -178.611 1.00 137.05 ? 131 GLY F O     1 
ATOM   8049  N N     . LEU F 1 135 ? 4.412  -89.809  -177.785 1.00 115.46 ? 132 LEU F N     1 
ATOM   8050  C CA    . LEU F 1 135 ? 4.219  -90.764  -176.702 1.00 126.67 ? 132 LEU F CA    1 
ATOM   8051  C C     . LEU F 1 135 ? 3.034  -90.376  -175.819 1.00 127.45 ? 132 LEU F C     1 
ATOM   8052  O O     . LEU F 1 135 ? 2.597  -89.222  -175.780 1.00 124.85 ? 132 LEU F O     1 
ATOM   8053  C CB    . LEU F 1 135 ? 5.487  -90.870  -175.854 1.00 125.88 ? 132 LEU F CB    1 
ATOM   8054  C CG    . LEU F 1 135 ? 6.651  -91.653  -176.463 1.00 127.42 ? 132 LEU F CG    1 
ATOM   8055  C CD1   . LEU F 1 135 ? 7.980  -91.139  -175.933 1.00 112.06 ? 132 LEU F CD1   1 
ATOM   8056  C CD2   . LEU F 1 135 ? 6.498  -93.140  -176.185 1.00 144.34 ? 132 LEU F CD2   1 
ATOM   8057  N N     . ALA F 1 136 ? 2.515  -91.372  -175.102 1.00 126.85 ? 133 ALA F N     1 
ATOM   8058  C CA    . ALA F 1 136 ? 1.394  -91.195  -174.191 1.00 124.60 ? 133 ALA F CA    1 
ATOM   8059  C C     . ALA F 1 136 ? 1.805  -91.253  -172.727 1.00 121.23 ? 133 ALA F C     1 
ATOM   8060  O O     . ALA F 1 136 ? 0.955  -91.070  -171.850 1.00 106.95 ? 133 ALA F O     1 
ATOM   8061  C CB    . ALA F 1 136 ? 0.317  -92.251  -174.466 1.00 120.96 ? 133 ALA F CB    1 
ATOM   8062  N N     . SER F 1 137 ? 3.078  -91.508  -172.441 1.00 125.18 ? 134 SER F N     1 
ATOM   8063  C CA    . SER F 1 137 ? 3.594  -91.538  -171.079 1.00 121.72 ? 134 SER F CA    1 
ATOM   8064  C C     . SER F 1 137 ? 4.359  -90.247  -170.811 1.00 110.49 ? 134 SER F C     1 
ATOM   8065  O O     . SER F 1 137 ? 5.283  -89.903  -171.556 1.00 96.69  ? 134 SER F O     1 
ATOM   8066  C CB    . SER F 1 137 ? 4.492  -92.756  -170.862 1.00 124.83 ? 134 SER F CB    1 
ATOM   8067  O OG    . SER F 1 137 ? 5.081  -92.735  -169.574 1.00 108.89 ? 134 SER F OG    1 
ATOM   8068  N N     . LYS F 1 138 ? 3.961  -89.532  -169.756 1.00 107.46 ? 135 LYS F N     1 
ATOM   8069  C CA    . LYS F 1 138 ? 4.614  -88.272  -169.410 1.00 111.11 ? 135 LYS F CA    1 
ATOM   8070  C C     . LYS F 1 138 ? 6.093  -88.482  -169.106 1.00 107.51 ? 135 LYS F C     1 
ATOM   8071  O O     . LYS F 1 138 ? 6.954  -87.732  -169.588 1.00 106.08 ? 135 LYS F O     1 
ATOM   8072  C CB    . LYS F 1 138 ? 3.907  -87.634  -168.214 1.00 112.17 ? 135 LYS F CB    1 
ATOM   8073  C CG    . LYS F 1 138 ? 4.228  -86.165  -167.997 1.00 109.93 ? 135 LYS F CG    1 
ATOM   8074  C CD    . LYS F 1 138 ? 3.011  -85.407  -167.492 1.00 112.51 ? 135 LYS F CD    1 
ATOM   8075  C CE    . LYS F 1 138 ? 2.779  -85.667  -166.010 1.00 102.44 ? 135 LYS F CE    1 
ATOM   8076  N NZ    . LYS F 1 138 ? 1.696  -84.812  -165.448 1.00 85.25  ? 135 LYS F NZ    1 
ATOM   8077  N N     . ALA F 1 139 ? 6.403  -89.497  -168.295 1.00 109.10 ? 136 ALA F N     1 
ATOM   8078  C CA    . ALA F 1 139 ? 7.790  -89.763  -167.930 1.00 114.28 ? 136 ALA F CA    1 
ATOM   8079  C C     . ALA F 1 139 ? 8.642  -90.055  -169.157 1.00 107.29 ? 136 ALA F C     1 
ATOM   8080  O O     . ALA F 1 139 ? 9.766  -89.555  -169.270 1.00 107.17 ? 136 ALA F O     1 
ATOM   8081  C CB    . ALA F 1 139 ? 7.856  -90.926  -166.940 1.00 108.25 ? 136 ALA F CB    1 
ATOM   8082  N N     . LEU F 1 140 ? 8.124  -90.864  -170.085 1.00 106.78 ? 137 LEU F N     1 
ATOM   8083  C CA    . LEU F 1 140 ? 8.871  -91.174  -171.301 1.00 111.72 ? 137 LEU F CA    1 
ATOM   8084  C C     . LEU F 1 140 ? 9.101  -89.924  -172.142 1.00 109.84 ? 137 LEU F C     1 
ATOM   8085  O O     . LEU F 1 140 ? 10.204 -89.708  -172.663 1.00 107.06 ? 137 LEU F O     1 
ATOM   8086  C CB    . LEU F 1 140 ? 8.136  -92.239  -172.117 1.00 117.98 ? 137 LEU F CB    1 
ATOM   8087  C CG    . LEU F 1 140 ? 8.418  -93.720  -171.836 1.00 120.24 ? 137 LEU F CG    1 
ATOM   8088  C CD1   . LEU F 1 140 ? 8.327  -94.053  -170.352 1.00 108.72 ? 137 LEU F CD1   1 
ATOM   8089  C CD2   . LEU F 1 140 ? 7.470  -94.598  -172.643 1.00 125.06 ? 137 LEU F CD2   1 
ATOM   8090  N N     . SER F 1 141 ? 8.065  -89.095  -172.295 1.00 105.83 ? 138 SER F N     1 
ATOM   8091  C CA    . SER F 1 141 ? 8.204  -87.875  -173.081 1.00 103.23 ? 138 SER F CA    1 
ATOM   8092  C C     . SER F 1 141 ? 9.257  -86.951  -172.483 1.00 107.33 ? 138 SER F C     1 
ATOM   8093  O O     . SER F 1 141 ? 10.086 -86.392  -173.210 1.00 103.52 ? 138 SER F O     1 
ATOM   8094  C CB    . SER F 1 141 ? 6.857  -87.160  -173.185 1.00 102.28 ? 138 SER F CB    1 
ATOM   8095  O OG    . SER F 1 141 ? 5.970  -87.860  -174.040 1.00 109.11 ? 138 SER F OG    1 
ATOM   8096  N N     . LEU F 1 142 ? 9.256  -86.796  -171.156 1.00 112.71 ? 139 LEU F N     1 
ATOM   8097  C CA    . LEU F 1 142 ? 10.244 -85.931  -170.516 1.00 104.59 ? 139 LEU F CA    1 
ATOM   8098  C C     . LEU F 1 142 ? 11.647 -86.519  -170.625 1.00 101.18 ? 139 LEU F C     1 
ATOM   8099  O O     . LEU F 1 142 ? 12.613 -85.793  -170.896 1.00 98.68  ? 139 LEU F O     1 
ATOM   8100  C CB    . LEU F 1 142 ? 9.866  -85.696  -169.054 1.00 95.92  ? 139 LEU F CB    1 
ATOM   8101  C CG    . LEU F 1 142 ? 8.667  -84.778  -168.808 1.00 93.85  ? 139 LEU F CG    1 
ATOM   8102  C CD1   . LEU F 1 142 ? 8.206  -84.868  -167.363 1.00 92.67  ? 139 LEU F CD1   1 
ATOM   8103  C CD2   . LEU F 1 142 ? 9.019  -83.345  -169.166 1.00 91.74  ? 139 LEU F CD2   1 
ATOM   8104  N N     . GLU F 1 143 ? 11.778 -87.827  -170.386 1.00 101.91 ? 140 GLU F N     1 
ATOM   8105  C CA    . GLU F 1 143 ? 13.054 -88.513  -170.562 1.00 92.21  ? 140 GLU F CA    1 
ATOM   8106  C C     . GLU F 1 143 ? 13.634 -88.240  -171.943 1.00 102.19 ? 140 GLU F C     1 
ATOM   8107  O O     . GLU F 1 143 ? 14.813 -87.895  -172.081 1.00 108.06 ? 140 GLU F O     1 
ATOM   8108  C CB    . GLU F 1 143 ? 12.860 -90.015  -170.343 1.00 104.65 ? 140 GLU F CB    1 
ATOM   8109  C CG    . GLU F 1 143 ? 14.114 -90.855  -170.509 1.00 113.52 ? 140 GLU F CG    1 
ATOM   8110  C CD    . GLU F 1 143 ? 13.881 -92.312  -170.152 1.00 131.62 ? 140 GLU F CD    1 
ATOM   8111  O OE1   . GLU F 1 143 ? 12.704 -92.726  -170.081 1.00 112.01 ? 140 GLU F OE1   1 
ATOM   8112  O OE2   . GLU F 1 143 ? 14.872 -93.043  -169.945 1.00 125.18 ? 140 GLU F OE2   1 
ATOM   8113  N N     . LYS F 1 144 ? 12.813 -88.398  -172.983 1.00 106.77 ? 141 LYS F N     1 
ATOM   8114  C CA    . LYS F 1 144 ? 13.276 -88.120  -174.339 1.00 111.28 ? 141 LYS F CA    1 
ATOM   8115  C C     . LYS F 1 144 ? 13.657 -86.654  -174.505 1.00 100.72 ? 141 LYS F C     1 
ATOM   8116  O O     . LYS F 1 144 ? 14.749 -86.336  -174.994 1.00 99.33  ? 141 LYS F O     1 
ATOM   8117  C CB    . LYS F 1 144 ? 12.198 -88.509  -175.354 1.00 114.55 ? 141 LYS F CB    1 
ATOM   8118  C CG    . LYS F 1 144 ? 12.586 -88.240  -176.802 1.00 118.24 ? 141 LYS F CG    1 
ATOM   8119  C CD    . LYS F 1 144 ? 11.416 -88.470  -177.747 1.00 129.56 ? 141 LYS F CD    1 
ATOM   8120  C CE    . LYS F 1 144 ? 11.774 -88.089  -179.176 1.00 142.51 ? 141 LYS F CE    1 
ATOM   8121  N NZ    . LYS F 1 144 ? 10.607 -88.195  -180.095 1.00 144.98 ? 141 LYS F NZ    1 
ATOM   8122  N N     . ALA F 1 145 ? 12.764 -85.747  -174.097 1.00 96.74  ? 142 ALA F N     1 
ATOM   8123  C CA    . ALA F 1 145 ? 12.938 -84.327  -174.384 1.00 100.18 ? 142 ALA F CA    1 
ATOM   8124  C C     . ALA F 1 145 ? 14.197 -83.761  -173.738 1.00 96.42  ? 142 ALA F C     1 
ATOM   8125  O O     . ALA F 1 145 ? 14.963 -83.043  -174.386 1.00 95.50  ? 142 ALA F O     1 
ATOM   8126  C CB    . ALA F 1 145 ? 11.703 -83.550  -173.928 1.00 101.14 ? 142 ALA F CB    1 
ATOM   8127  N N     . ARG F 1 146 ? 14.435 -84.078  -172.462 1.00 97.03  ? 143 ARG F N     1 
ATOM   8128  C CA    . ARG F 1 146 ? 15.558 -83.461  -171.754 1.00 89.60  ? 143 ARG F CA    1 
ATOM   8129  C C     . ARG F 1 146 ? 16.897 -83.933  -172.314 1.00 94.71  ? 143 ARG F C     1 
ATOM   8130  O O     . ARG F 1 146 ? 17.801 -83.123  -172.571 1.00 97.86  ? 143 ARG F O     1 
ATOM   8131  C CB    . ARG F 1 146 ? 15.459 -83.755  -170.257 1.00 70.66  ? 143 ARG F CB    1 
ATOM   8132  C CG    . ARG F 1 146 ? 14.107 -83.403  -169.658 1.00 93.74  ? 143 ARG F CG    1 
ATOM   8133  C CD    . ARG F 1 146 ? 14.151 -83.312  -168.141 1.00 84.92  ? 143 ARG F CD    1 
ATOM   8134  N NE    . ARG F 1 146 ? 14.351 -81.939  -167.686 1.00 86.43  ? 143 ARG F NE    1 
ATOM   8135  C CZ    . ARG F 1 146 ? 13.995 -81.491  -166.487 1.00 76.57  ? 143 ARG F CZ    1 
ATOM   8136  N NH1   . ARG F 1 146 ? 13.412 -82.306  -165.619 1.00 87.96  ? 143 ARG F NH1   1 
ATOM   8137  N NH2   . ARG F 1 146 ? 14.216 -80.225  -166.158 1.00 69.65  ? 143 ARG F NH2   1 
ATOM   8138  N N     . LYS F 1 147 ? 17.046 -85.247  -172.500 1.00 84.16  ? 144 LYS F N     1 
ATOM   8139  C CA    . LYS F 1 147 ? 18.286 -85.778  -173.055 1.00 84.28  ? 144 LYS F CA    1 
ATOM   8140  C C     . LYS F 1 147 ? 18.512 -85.281  -174.477 1.00 88.13  ? 144 LYS F C     1 
ATOM   8141  O O     . LYS F 1 147 ? 19.639 -84.920  -174.844 1.00 89.88  ? 144 LYS F O     1 
ATOM   8142  C CB    . LYS F 1 147 ? 18.267 -87.305  -173.004 1.00 89.66  ? 144 LYS F CB    1 
ATOM   8143  C CG    . LYS F 1 147 ? 18.141 -87.865  -171.597 1.00 84.04  ? 144 LYS F CG    1 
ATOM   8144  C CD    . LYS F 1 147 ? 17.995 -89.375  -171.605 1.00 82.55  ? 144 LYS F CD    1 
ATOM   8145  C CE    . LYS F 1 147 ? 17.877 -89.915  -170.191 1.00 81.18  ? 144 LYS F CE    1 
ATOM   8146  N NZ    . LYS F 1 147 ? 17.685 -91.390  -170.170 1.00 118.83 ? 144 LYS F NZ    1 
ATOM   8147  N N     . GLU F 1 148 ? 17.453 -85.256  -175.295 1.00 85.80  ? 145 GLU F N     1 
ATOM   8148  C CA    . GLU F 1 148 ? 17.579 -84.724  -176.647 1.00 91.26  ? 145 GLU F CA    1 
ATOM   8149  C C     . GLU F 1 148 ? 18.002 -83.262  -176.628 1.00 86.96  ? 145 GLU F C     1 
ATOM   8150  O O     . GLU F 1 148 ? 18.830 -82.838  -177.442 1.00 88.85  ? 145 GLU F O     1 
ATOM   8151  C CB    . GLU F 1 148 ? 16.258 -84.900  -177.396 1.00 108.32 ? 145 GLU F CB    1 
ATOM   8152  C CG    . GLU F 1 148 ? 16.281 -84.429  -178.840 1.00 126.14 ? 145 GLU F CG    1 
ATOM   8153  C CD    . GLU F 1 148 ? 14.963 -84.676  -179.550 1.00 132.79 ? 145 GLU F CD    1 
ATOM   8154  O OE1   . GLU F 1 148 ? 14.193 -85.549  -179.093 1.00 123.84 ? 145 GLU F OE1   1 
ATOM   8155  O OE2   . GLU F 1 148 ? 14.696 -83.997  -180.564 1.00 149.75 ? 145 GLU F OE2   1 
ATOM   8156  N N     . ALA F 1 149 ? 17.452 -82.476  -175.698 1.00 90.29  ? 146 ALA F N     1 
ATOM   8157  C CA    . ALA F 1 149 ? 17.816 -81.067  -175.598 1.00 93.64  ? 146 ALA F CA    1 
ATOM   8158  C C     . ALA F 1 149 ? 19.289 -80.907  -175.252 1.00 80.04  ? 146 ALA F C     1 
ATOM   8159  O O     . ALA F 1 149 ? 19.994 -80.090  -175.854 1.00 82.26  ? 146 ALA F O     1 
ATOM   8160  C CB    . ALA F 1 149 ? 16.937 -80.368  -174.561 1.00 87.98  ? 146 ALA F CB    1 
ATOM   8161  N N     . VAL F 1 150 ? 19.772 -81.678  -174.277 1.00 74.11  ? 147 VAL F N     1 
ATOM   8162  C CA    . VAL F 1 150 ? 21.175 -81.557  -173.882 1.00 76.64  ? 147 VAL F CA    1 
ATOM   8163  C C     . VAL F 1 150 ? 22.094 -81.966  -175.027 1.00 80.50  ? 147 VAL F C     1 
ATOM   8164  O O     . VAL F 1 150 ? 23.097 -81.297  -175.307 1.00 76.63  ? 147 VAL F O     1 
ATOM   8165  C CB    . VAL F 1 150 ? 21.452 -82.371  -172.606 1.00 77.82  ? 147 VAL F CB    1 
ATOM   8166  C CG1   . VAL F 1 150 ? 22.940 -82.653  -172.460 1.00 57.14  ? 147 VAL F CG1   1 
ATOM   8167  C CG2   . VAL F 1 150 ? 20.958 -81.607  -171.402 1.00 71.01  ? 147 VAL F CG2   1 
ATOM   8168  N N     . THR F 1 151 ? 21.768 -83.067  -175.711 1.00 92.59  ? 148 THR F N     1 
ATOM   8169  C CA    . THR F 1 151 ? 22.604 -83.511  -176.823 1.00 86.49  ? 148 THR F CA    1 
ATOM   8170  C C     . THR F 1 151 ? 22.608 -82.491  -177.957 1.00 87.04  ? 148 THR F C     1 
ATOM   8171  O O     . THR F 1 151 ? 23.665 -82.190  -178.530 1.00 93.75  ? 148 THR F O     1 
ATOM   8172  C CB    . THR F 1 151 ? 22.130 -84.874  -177.325 1.00 88.05  ? 148 THR F CB    1 
ATOM   8173  O OG1   . THR F 1 151 ? 22.220 -85.831  -176.263 1.00 99.07  ? 148 THR F OG1   1 
ATOM   8174  C CG2   . THR F 1 151 ? 22.990 -85.343  -178.490 1.00 82.17  ? 148 THR F CG2   1 
ATOM   8175  N N     . ASP F 1 152 ? 21.434 -81.958  -178.303 1.00 85.90  ? 149 ASP F N     1 
ATOM   8176  C CA    . ASP F 1 152 ? 21.351 -80.941  -179.344 1.00 87.91  ? 149 ASP F CA    1 
ATOM   8177  C C     . ASP F 1 152 ? 22.138 -79.694  -178.963 1.00 81.09  ? 149 ASP F C     1 
ATOM   8178  O O     . ASP F 1 152 ? 22.795 -79.083  -179.813 1.00 85.93  ? 149 ASP F O     1 
ATOM   8179  C CB    . ASP F 1 152 ? 19.887 -80.597  -179.616 1.00 94.34  ? 149 ASP F CB    1 
ATOM   8180  C CG    . ASP F 1 152 ? 19.686 -79.920  -180.955 1.00 108.40 ? 149 ASP F CG    1 
ATOM   8181  O OD1   . ASP F 1 152 ? 19.635 -80.632  -181.980 1.00 110.09 ? 149 ASP F OD1   1 
ATOM   8182  O OD2   . ASP F 1 152 ? 19.582 -78.677  -180.985 1.00 105.37 ? 149 ASP F OD2   1 
ATOM   8183  N N     . GLY F 1 153 ? 22.078 -79.295  -177.690 1.00 81.61  ? 150 GLY F N     1 
ATOM   8184  C CA    . GLY F 1 153 ? 22.861 -78.153  -177.249 1.00 81.23  ? 150 GLY F CA    1 
ATOM   8185  C C     . GLY F 1 153 ? 24.353 -78.402  -177.332 1.00 89.19  ? 150 GLY F C     1 
ATOM   8186  O O     . GLY F 1 153 ? 25.118 -77.516  -177.717 1.00 87.97  ? 150 GLY F O     1 
ATOM   8187  N N     . LEU F 1 154 ? 24.784 -79.619  -176.990 1.00 79.60  ? 151 LEU F N     1 
ATOM   8188  C CA    . LEU F 1 154 ? 26.197 -79.960  -177.118 1.00 64.45  ? 151 LEU F CA    1 
ATOM   8189  C C     . LEU F 1 154 ? 26.641 -79.901  -178.574 1.00 82.12  ? 151 LEU F C     1 
ATOM   8190  O O     . LEU F 1 154 ? 27.721 -79.382  -178.885 1.00 90.91  ? 151 LEU F O     1 
ATOM   8191  C CB    . LEU F 1 154 ? 26.458 -81.347  -176.530 1.00 52.92  ? 151 LEU F CB    1 
ATOM   8192  C CG    . LEU F 1 154 ? 27.905 -81.843  -176.567 1.00 67.99  ? 151 LEU F CG    1 
ATOM   8193  C CD1   . LEU F 1 154 ? 28.838 -80.821  -175.939 1.00 77.40  ? 151 LEU F CD1   1 
ATOM   8194  C CD2   . LEU F 1 154 ? 28.037 -83.189  -175.869 1.00 51.49  ? 151 LEU F CD2   1 
ATOM   8195  N N     . LYS F 1 155 ? 25.809 -80.416  -179.482 1.00 75.72  ? 152 LYS F N     1 
ATOM   8196  C CA    . LYS F 1 155 ? 26.120 -80.335  -180.907 1.00 75.06  ? 152 LYS F CA    1 
ATOM   8197  C C     . LYS F 1 155 ? 26.221 -78.884  -181.370 1.00 83.54  ? 152 LYS F C     1 
ATOM   8198  O O     . LYS F 1 155 ? 27.195 -78.493  -182.027 1.00 90.31  ? 152 LYS F O     1 
ATOM   8199  C CB    . LYS F 1 155 ? 25.064 -81.087  -181.718 1.00 82.27  ? 152 LYS F CB    1 
ATOM   8200  C CG    . LYS F 1 155 ? 25.042 -82.589  -181.485 1.00 66.10  ? 152 LYS F CG    1 
ATOM   8201  C CD    . LYS F 1 155 ? 24.133 -83.283  -182.486 1.00 67.11  ? 152 LYS F CD    1 
ATOM   8202  C CE    . LYS F 1 155 ? 22.716 -82.731  -182.415 1.00 76.26  ? 152 LYS F CE    1 
ATOM   8203  N NZ    . LYS F 1 155 ? 21.840 -83.281  -183.486 1.00 88.79  ? 152 LYS F NZ    1 
ATOM   8204  N N     . ARG F 1 156 ? 25.211 -78.071  -181.045 1.00 81.23  ? 153 ARG F N     1 
ATOM   8205  C CA    . ARG F 1 156 ? 25.200 -76.679  -181.487 1.00 87.70  ? 153 ARG F CA    1 
ATOM   8206  C C     . ARG F 1 156 ? 26.338 -75.875  -180.873 1.00 83.95  ? 153 ARG F C     1 
ATOM   8207  O O     . ARG F 1 156 ? 26.792 -74.892  -181.470 1.00 96.96  ? 153 ARG F O     1 
ATOM   8208  C CB    . ARG F 1 156 ? 23.855 -76.032  -181.153 1.00 80.32  ? 153 ARG F CB    1 
ATOM   8209  C CG    . ARG F 1 156 ? 22.775 -76.280  -182.195 1.00 97.72  ? 153 ARG F CG    1 
ATOM   8210  C CD    . ARG F 1 156 ? 21.517 -75.487  -181.884 1.00 90.23  ? 153 ARG F CD    1 
ATOM   8211  N NE    . ARG F 1 156 ? 21.781 -74.057  -181.752 1.00 90.50  ? 153 ARG F NE    1 
ATOM   8212  C CZ    . ARG F 1 156 ? 21.878 -73.216  -182.777 1.00 97.28  ? 153 ARG F CZ    1 
ATOM   8213  N NH1   . ARG F 1 156 ? 21.730 -73.657  -184.019 1.00 116.90 ? 153 ARG F NH1   1 
ATOM   8214  N NH2   . ARG F 1 156 ? 22.121 -71.930  -182.560 1.00 88.33  ? 153 ARG F NH2   1 
ATOM   8215  N N     . ALA F 1 157 ? 26.813 -76.270  -179.692 1.00 74.64  ? 154 ALA F N     1 
ATOM   8216  C CA    . ALA F 1 157 ? 27.913 -75.547  -179.066 1.00 85.95  ? 154 ALA F CA    1 
ATOM   8217  C C     . ALA F 1 157 ? 29.255 -75.972  -179.644 1.00 80.32  ? 154 ALA F C     1 
ATOM   8218  O O     . ALA F 1 157 ? 30.159 -75.142  -179.795 1.00 79.35  ? 154 ALA F O     1 
ATOM   8219  C CB    . ALA F 1 157 ? 27.888 -75.761  -177.552 1.00 98.34  ? 154 ALA F CB    1 
ATOM   8220  N N     . LEU F 1 158 ? 29.405 -77.258  -179.975 1.00 80.38  ? 155 LEU F N     1 
ATOM   8221  C CA    . LEU F 1 158 ? 30.622 -77.711  -180.637 1.00 84.65  ? 155 LEU F CA    1 
ATOM   8222  C C     . LEU F 1 158 ? 30.695 -77.247  -182.085 1.00 95.67  ? 155 LEU F C     1 
ATOM   8223  O O     . LEU F 1 158 ? 31.788 -77.235  -182.661 1.00 96.43  ? 155 LEU F O     1 
ATOM   8224  C CB    . LEU F 1 158 ? 30.727 -79.235  -180.568 1.00 65.95  ? 155 LEU F CB    1 
ATOM   8225  C CG    . LEU F 1 158 ? 31.135 -79.802  -179.207 1.00 69.34  ? 155 LEU F CG    1 
ATOM   8226  C CD1   . LEU F 1 158 ? 30.770 -81.274  -179.097 1.00 54.36  ? 155 LEU F CD1   1 
ATOM   8227  C CD2   . LEU F 1 158 ? 32.625 -79.595  -178.972 1.00 64.48  ? 155 LEU F CD2   1 
ATOM   8228  N N     . ARG F 1 159 ? 29.557 -76.886  -182.688 1.00 92.75  ? 156 ARG F N     1 
ATOM   8229  C CA    . ARG F 1 159 ? 29.565 -76.369  -184.055 1.00 87.21  ? 156 ARG F CA    1 
ATOM   8230  C C     . ARG F 1 159 ? 30.528 -75.196  -184.206 1.00 81.24  ? 156 ARG F C     1 
ATOM   8231  O O     . ARG F 1 159 ? 31.299 -75.129  -185.169 1.00 99.85  ? 156 ARG F O     1 
ATOM   8232  C CB    . ARG F 1 159 ? 28.153 -75.949  -184.467 1.00 100.29 ? 156 ARG F CB    1 
ATOM   8233  C CG    . ARG F 1 159 ? 27.266 -77.084  -184.951 1.00 122.62 ? 156 ARG F CG    1 
ATOM   8234  C CD    . ARG F 1 159 ? 25.990 -76.541  -185.576 1.00 122.22 ? 156 ARG F CD    1 
ATOM   8235  N NE    . ARG F 1 159 ? 25.126 -77.602  -186.086 1.00 143.85 ? 156 ARG F NE    1 
ATOM   8236  C CZ    . ARG F 1 159 ? 23.873 -77.414  -186.488 1.00 150.15 ? 156 ARG F CZ    1 
ATOM   8237  N NH1   . ARG F 1 159 ? 23.334 -76.203  -186.441 1.00 146.98 ? 156 ARG F NH1   1 
ATOM   8238  N NH2   . ARG F 1 159 ? 23.157 -78.436  -186.937 1.00 135.77 ? 156 ARG F NH2   1 
ATOM   8239  N N     . SER F 1 160 ? 30.498 -74.260  -183.257 1.00 87.38  ? 157 SER F N     1 
ATOM   8240  C CA    . SER F 1 160 ? 31.253 -73.006  -183.334 1.00 101.20 ? 157 SER F CA    1 
ATOM   8241  C C     . SER F 1 160 ? 32.780 -73.193  -183.282 1.00 96.77  ? 157 SER F C     1 
ATOM   8242  O O     . SER F 1 160 ? 33.481 -72.176  -183.197 1.00 100.36 ? 157 SER F O     1 
ATOM   8243  C CB    . SER F 1 160 ? 30.809 -72.067  -182.211 1.00 112.57 ? 157 SER F CB    1 
ATOM   8244  O OG    . SER F 1 160 ? 29.395 -72.018  -182.116 1.00 110.49 ? 157 SER F OG    1 
ATOM   8245  N N     . PHE F 1 161 ? 33.334 -74.405  -183.326 1.00 82.12  ? 158 PHE F N     1 
ATOM   8246  C CA    . PHE F 1 161 ? 34.780 -74.586  -183.310 1.00 91.37  ? 158 PHE F CA    1 
ATOM   8247  C C     . PHE F 1 161 ? 35.393 -74.739  -184.696 1.00 113.01 ? 158 PHE F C     1 
ATOM   8248  O O     . PHE F 1 161 ? 36.582 -74.445  -184.862 1.00 128.72 ? 158 PHE F O     1 
ATOM   8249  C CB    . PHE F 1 161 ? 35.154 -75.808  -182.462 1.00 91.98  ? 158 PHE F CB    1 
ATOM   8250  C CG    . PHE F 1 161 ? 35.262 -75.518  -180.992 1.00 96.75  ? 158 PHE F CG    1 
ATOM   8251  C CD1   . PHE F 1 161 ? 35.999 -74.436  -180.538 1.00 102.36 ? 158 PHE F CD1   1 
ATOM   8252  C CD2   . PHE F 1 161 ? 34.624 -76.325  -180.063 1.00 93.71  ? 158 PHE F CD2   1 
ATOM   8253  C CE1   . PHE F 1 161 ? 36.105 -74.169  -179.185 1.00 98.30  ? 158 PHE F CE1   1 
ATOM   8254  C CE2   . PHE F 1 161 ? 34.722 -76.060  -178.709 1.00 82.20  ? 158 PHE F CE2   1 
ATOM   8255  C CZ    . PHE F 1 161 ? 35.463 -74.981  -178.270 1.00 87.35  ? 158 PHE F CZ    1 
ATOM   8256  N N     . GLY F 1 162 ? 34.627 -75.181  -185.681 1.00 113.06 ? 159 GLY F N     1 
ATOM   8257  C CA    . GLY F 1 162 ? 35.158 -75.371  -187.015 1.00 101.95 ? 159 GLY F CA    1 
ATOM   8258  C C     . GLY F 1 162 ? 34.289 -76.308  -187.819 1.00 104.98 ? 159 GLY F C     1 
ATOM   8259  O O     . GLY F 1 162 ? 33.404 -76.986  -187.294 1.00 98.95  ? 159 GLY F O     1 
ATOM   8260  N N     . ASN F 1 163 ? 34.561 -76.331  -189.127 1.00 115.42 ? 160 ASN F N     1 
ATOM   8261  C CA    . ASN F 1 163 ? 33.801 -77.185  -190.036 1.00 115.77 ? 160 ASN F CA    1 
ATOM   8262  C C     . ASN F 1 163 ? 33.896 -78.652  -189.638 1.00 107.43 ? 160 ASN F C     1 
ATOM   8263  O O     . ASN F 1 163 ? 32.917 -79.398  -189.755 1.00 103.68 ? 160 ASN F O     1 
ATOM   8264  C CB    . ASN F 1 163 ? 34.290 -76.993  -191.472 1.00 110.78 ? 160 ASN F CB    1 
ATOM   8265  C CG    . ASN F 1 163 ? 34.232 -75.547  -191.919 1.00 110.39 ? 160 ASN F CG    1 
ATOM   8266  O OD1   . ASN F 1 163 ? 33.206 -74.882  -191.778 1.00 117.56 ? 160 ASN F OD1   1 
ATOM   8267  N ND2   . ASN F 1 163 ? 35.338 -75.052  -192.463 1.00 119.62 ? 160 ASN F ND2   1 
ATOM   8268  N N     . ALA F 1 164 ? 35.069 -79.083  -189.166 1.00 98.26  ? 161 ALA F N     1 
ATOM   8269  C CA    . ALA F 1 164 ? 35.270 -80.489  -188.833 1.00 97.70  ? 161 ALA F CA    1 
ATOM   8270  C C     . ALA F 1 164 ? 34.343 -80.953  -187.717 1.00 99.46  ? 161 ALA F C     1 
ATOM   8271  O O     . ALA F 1 164 ? 34.035 -82.146  -187.625 1.00 103.86 ? 161 ALA F O     1 
ATOM   8272  C CB    . ALA F 1 164 ? 36.727 -80.735  -188.445 1.00 103.14 ? 161 ALA F CB    1 
ATOM   8273  N N     . LEU F 1 165 ? 33.894 -80.037  -186.859 1.00 100.95 ? 162 LEU F N     1 
ATOM   8274  C CA    . LEU F 1 165 ? 33.055 -80.384  -185.721 1.00 97.36  ? 162 LEU F CA    1 
ATOM   8275  C C     . LEU F 1 165 ? 31.577 -80.093  -185.965 1.00 94.69  ? 162 LEU F C     1 
ATOM   8276  O O     . LEU F 1 165 ? 30.800 -80.022  -185.007 1.00 94.52  ? 162 LEU F O     1 
ATOM   8277  C CB    . LEU F 1 165 ? 33.542 -79.656  -184.467 1.00 99.38  ? 162 LEU F CB    1 
ATOM   8278  C CG    . LEU F 1 165 ? 34.785 -80.264  -183.814 1.00 82.30  ? 162 LEU F CG    1 
ATOM   8279  C CD1   . LEU F 1 165 ? 35.262 -79.412  -182.652 1.00 78.72  ? 162 LEU F CD1   1 
ATOM   8280  C CD2   . LEU F 1 165 ? 34.507 -81.687  -183.358 1.00 96.25  ? 162 LEU F CD2   1 
ATOM   8281  N N     . GLY F 1 166 ? 31.173 -79.925  -187.223 1.00 90.68  ? 163 GLY F N     1 
ATOM   8282  C CA    . GLY F 1 166 ? 29.771 -79.780  -187.565 1.00 106.89 ? 163 GLY F CA    1 
ATOM   8283  C C     . GLY F 1 166 ? 29.362 -78.423  -188.094 1.00 113.98 ? 163 GLY F C     1 
ATOM   8284  O O     . GLY F 1 166 ? 28.163 -78.203  -188.308 1.00 119.94 ? 163 GLY F O     1 
ATOM   8285  N N     . ASN F 1 167 ? 30.301 -77.500  -188.308 1.00 105.49 ? 164 ASN F N     1 
ATOM   8286  C CA    . ASN F 1 167 ? 29.937 -76.188  -188.832 1.00 97.14  ? 164 ASN F CA    1 
ATOM   8287  C C     . ASN F 1 167 ? 29.585 -76.236  -190.314 1.00 118.38 ? 164 ASN F C     1 
ATOM   8288  O O     . ASN F 1 167 ? 28.926 -75.318  -190.813 1.00 112.70 ? 164 ASN F O     1 
ATOM   8289  C CB    . ASN F 1 167 ? 31.073 -75.192  -188.597 1.00 100.89 ? 164 ASN F CB    1 
ATOM   8290  C CG    . ASN F 1 167 ? 30.678 -73.766  -188.926 1.00 114.60 ? 164 ASN F CG    1 
ATOM   8291  O OD1   . ASN F 1 167 ? 29.524 -73.374  -188.749 1.00 112.87 ? 164 ASN F OD1   1 
ATOM   8292  N ND2   . ASN F 1 167 ? 31.635 -72.982  -189.407 1.00 115.97 ? 164 ASN F ND2   1 
ATOM   8293  N N     . CYS F 1 168 ? 30.001 -77.284  -191.025 1.00 130.10 ? 165 CYS F N     1 
ATOM   8294  C CA    . CYS F 1 168 ? 29.753 -77.385  -192.457 1.00 121.40 ? 165 CYS F CA    1 
ATOM   8295  C C     . CYS F 1 168 ? 28.381 -77.956  -192.789 1.00 117.51 ? 165 CYS F C     1 
ATOM   8296  O O     . CYS F 1 168 ? 27.947 -77.841  -193.940 1.00 124.01 ? 165 CYS F O     1 
ATOM   8297  C CB    . CYS F 1 168 ? 30.835 -78.240  -193.118 1.00 127.69 ? 165 CYS F CB    1 
ATOM   8298  S SG    . CYS F 1 168 ? 31.014 -79.889  -192.405 1.00 154.16 ? 165 CYS F SG    1 
ATOM   8299  N N     . ILE F 1 169 ? 27.689 -78.562  -191.819 1.00 115.61 ? 166 ILE F N     1 
ATOM   8300  C CA    . ILE F 1 169 ? 26.380 -79.151  -192.078 1.00 116.50 ? 166 ILE F CA    1 
ATOM   8301  C C     . ILE F 1 169 ? 25.366 -78.103  -192.519 1.00 115.72 ? 166 ILE F C     1 
ATOM   8302  O O     . ILE F 1 169 ? 24.315 -78.451  -193.069 1.00 111.02 ? 166 ILE F O     1 
ATOM   8303  C CB    . ILE F 1 169 ? 25.885 -79.912  -190.828 1.00 114.00 ? 166 ILE F CB    1 
ATOM   8304  C CG1   . ILE F 1 169 ? 24.793 -80.917  -191.202 1.00 110.90 ? 166 ILE F CG1   1 
ATOM   8305  C CG2   . ILE F 1 169 ? 25.372 -78.940  -189.774 1.00 97.70  ? 166 ILE F CG2   1 
ATOM   8306  C CD1   . ILE F 1 169 ? 25.320 -82.197  -191.806 1.00 126.66 ? 166 ILE F CD1   1 
ATOM   8307  N N     . LEU F 1 170 ? 25.657 -76.822  -192.300 1.00 112.03 ? 167 LEU F N     1 
ATOM   8308  C CA    . LEU F 1 170 ? 24.778 -75.736  -192.709 1.00 115.31 ? 167 LEU F CA    1 
ATOM   8309  C C     . LEU F 1 170 ? 25.225 -75.069  -194.003 1.00 126.02 ? 167 LEU F C     1 
ATOM   8310  O O     . LEU F 1 170 ? 24.566 -74.129  -194.459 1.00 122.10 ? 167 LEU F O     1 
ATOM   8311  C CB    . LEU F 1 170 ? 24.677 -74.692  -191.591 1.00 116.69 ? 167 LEU F CB    1 
ATOM   8312  C CG    . LEU F 1 170 ? 23.968 -75.155  -190.316 1.00 101.73 ? 167 LEU F CG    1 
ATOM   8313  C CD1   . LEU F 1 170 ? 24.338 -74.268  -189.136 1.00 121.90 ? 167 LEU F CD1   1 
ATOM   8314  C CD2   . LEU F 1 170 ? 22.461 -75.181  -190.521 1.00 89.61  ? 167 LEU F CD2   1 
ATOM   8315  N N     . ASP F 1 171 ? 26.324 -75.525  -194.600 1.00 131.07 ? 168 ASP F N     1 
ATOM   8316  C CA    . ASP F 1 171 ? 26.795 -74.987  -195.872 1.00 134.14 ? 168 ASP F CA    1 
ATOM   8317  C C     . ASP F 1 171 ? 26.051 -75.692  -197.000 1.00 144.10 ? 168 ASP F C     1 
ATOM   8318  O O     . ASP F 1 171 ? 26.253 -76.889  -197.235 1.00 142.06 ? 168 ASP F O     1 
ATOM   8319  C CB    . ASP F 1 171 ? 28.305 -75.168  -196.002 1.00 140.63 ? 168 ASP F CB    1 
ATOM   8320  C CG    . ASP F 1 171 ? 28.893 -74.364  -197.146 1.00 138.94 ? 168 ASP F CG    1 
ATOM   8321  O OD1   . ASP F 1 171 ? 28.189 -73.480  -197.678 1.00 138.53 ? 168 ASP F OD1   1 
ATOM   8322  O OD2   . ASP F 1 171 ? 30.060 -74.617  -197.514 1.00 141.46 ? 168 ASP F OD2   1 
ATOM   8323  N N     . LYS F 1 172 ? 25.181 -74.951  -197.693 1.00 145.03 ? 169 LYS F N     1 
ATOM   8324  C CA    . LYS F 1 172 ? 24.339 -75.551  -198.725 1.00 143.47 ? 169 LYS F CA    1 
ATOM   8325  C C     . LYS F 1 172 ? 25.169 -76.128  -199.867 1.00 142.38 ? 169 LYS F C     1 
ATOM   8326  O O     . LYS F 1 172 ? 24.845 -77.196  -200.400 1.00 138.10 ? 169 LYS F O     1 
ATOM   8327  C CB    . LYS F 1 172 ? 23.348 -74.512  -199.247 1.00 129.78 ? 169 LYS F CB    1 
ATOM   8328  C CG    . LYS F 1 172 ? 22.476 -73.904  -198.158 1.00 130.64 ? 169 LYS F CG    1 
ATOM   8329  C CD    . LYS F 1 172 ? 21.942 -72.540  -198.561 1.00 122.79 ? 169 LYS F CD    1 
ATOM   8330  C CE    . LYS F 1 172 ? 21.249 -71.854  -197.393 1.00 123.07 ? 169 LYS F CE    1 
ATOM   8331  N NZ    . LYS F 1 172 ? 20.858 -70.455  -197.718 1.00 133.43 ? 169 LYS F NZ    1 
ATOM   8332  N N     . ASP F 1 173 ? 26.239 -75.432  -200.262 1.00 138.62 ? 170 ASP F N     1 
ATOM   8333  C CA    . ASP F 1 173 ? 27.121 -75.953  -201.303 1.00 150.52 ? 170 ASP F CA    1 
ATOM   8334  C C     . ASP F 1 173 ? 27.786 -77.253  -200.864 1.00 148.96 ? 170 ASP F C     1 
ATOM   8335  O O     . ASP F 1 173 ? 27.955 -78.178  -201.670 1.00 148.21 ? 170 ASP F O     1 
ATOM   8336  C CB    . ASP F 1 173 ? 28.170 -74.905  -201.674 1.00 143.54 ? 170 ASP F CB    1 
ATOM   8337  C CG    . ASP F 1 173 ? 27.551 -73.610  -202.161 1.00 158.12 ? 170 ASP F CG    1 
ATOM   8338  O OD1   . ASP F 1 173 ? 26.501 -73.668  -202.834 1.00 158.04 ? 170 ASP F OD1   1 
ATOM   8339  O OD2   . ASP F 1 173 ? 28.117 -72.534  -201.872 1.00 170.19 ? 170 ASP F OD2   1 
ATOM   8340  N N     . TYR F 1 174 ? 28.196 -77.328  -199.596 1.00 145.60 ? 171 TYR F N     1 
ATOM   8341  C CA    . TYR F 1 174 ? 28.754 -78.566  -199.062 1.00 145.52 ? 171 TYR F CA    1 
ATOM   8342  C C     . TYR F 1 174 ? 27.750 -79.710  -199.162 1.00 142.94 ? 171 TYR F C     1 
ATOM   8343  O O     . TYR F 1 174 ? 28.113 -80.835  -199.521 1.00 140.94 ? 171 TYR F O     1 
ATOM   8344  C CB    . TYR F 1 174 ? 29.196 -78.345  -197.615 1.00 138.98 ? 171 TYR F CB    1 
ATOM   8345  C CG    . TYR F 1 174 ? 29.595 -79.599  -196.875 1.00 133.22 ? 171 TYR F CG    1 
ATOM   8346  C CD1   . TYR F 1 174 ? 30.769 -80.269  -197.186 1.00 127.27 ? 171 TYR F CD1   1 
ATOM   8347  C CD2   . TYR F 1 174 ? 28.803 -80.103  -195.853 1.00 134.51 ? 171 TYR F CD2   1 
ATOM   8348  C CE1   . TYR F 1 174 ? 31.139 -81.412  -196.505 1.00 128.36 ? 171 TYR F CE1   1 
ATOM   8349  C CE2   . TYR F 1 174 ? 29.165 -81.242  -195.166 1.00 136.92 ? 171 TYR F CE2   1 
ATOM   8350  C CZ    . TYR F 1 174 ? 30.332 -81.895  -195.497 1.00 133.19 ? 171 TYR F CZ    1 
ATOM   8351  O OH    . TYR F 1 174 ? 30.690 -83.032  -194.812 1.00 132.55 ? 171 TYR F OH    1 
ATOM   8352  N N     . LEU F 1 175 ? 26.476 -79.437  -198.866 1.00 143.08 ? 172 LEU F N     1 
ATOM   8353  C CA    . LEU F 1 175 ? 25.447 -80.465  -198.998 1.00 143.18 ? 172 LEU F CA    1 
ATOM   8354  C C     . LEU F 1 175 ? 25.264 -80.883  -200.453 1.00 145.51 ? 172 LEU F C     1 
ATOM   8355  O O     . LEU F 1 175 ? 25.122 -82.077  -200.753 1.00 150.76 ? 172 LEU F O     1 
ATOM   8356  C CB    . LEU F 1 175 ? 24.128 -79.965  -198.411 1.00 141.72 ? 172 LEU F CB    1 
ATOM   8357  C CG    . LEU F 1 175 ? 24.073 -79.854  -196.887 1.00 132.65 ? 172 LEU F CG    1 
ATOM   8358  C CD1   . LEU F 1 175 ? 22.657 -79.554  -196.421 1.00 136.34 ? 172 LEU F CD1   1 
ATOM   8359  C CD2   . LEU F 1 175 ? 24.599 -81.124  -196.231 1.00 139.98 ? 172 LEU F CD2   1 
ATOM   8360  N N     . ARG F 1 176 ? 25.233 -79.909  -201.368 1.00 138.87 ? 173 ARG F N     1 
ATOM   8361  C CA    . ARG F 1 176 ? 25.119 -80.230  -202.788 1.00 155.39 ? 173 ARG F CA    1 
ATOM   8362  C C     . ARG F 1 176 ? 26.264 -81.125  -203.244 1.00 151.75 ? 173 ARG F C     1 
ATOM   8363  O O     . ARG F 1 176 ? 26.051 -82.090  -203.988 1.00 149.39 ? 173 ARG F O     1 
ATOM   8364  C CB    . ARG F 1 176 ? 25.088 -78.949  -203.621 1.00 166.91 ? 173 ARG F CB    1 
ATOM   8365  C CG    . ARG F 1 176 ? 23.887 -78.054  -203.375 1.00 183.25 ? 173 ARG F CG    1 
ATOM   8366  C CD    . ARG F 1 176 ? 23.743 -76.995  -204.465 1.00 169.66 ? 173 ARG F CD    1 
ATOM   8367  N NE    . ARG F 1 176 ? 24.924 -76.141  -204.583 1.00 164.07 ? 173 ARG F NE    1 
ATOM   8368  C CZ    . ARG F 1 176 ? 25.874 -76.297  -205.501 1.00 170.77 ? 173 ARG F CZ    1 
ATOM   8369  N NH1   . ARG F 1 176 ? 25.785 -77.276  -206.392 1.00 175.52 ? 173 ARG F NH1   1 
ATOM   8370  N NH2   . ARG F 1 176 ? 26.912 -75.472  -205.530 1.00 168.38 ? 173 ARG F NH2   1 
ATOM   8371  N N     . SER F 1 177 ? 27.488 -80.823  -202.804 1.00 150.92 ? 174 SER F N     1 
ATOM   8372  C CA    . SER F 1 177 ? 28.624 -81.672  -203.141 1.00 145.20 ? 174 SER F CA    1 
ATOM   8373  C C     . SER F 1 177 ? 28.560 -83.021  -202.438 1.00 147.83 ? 174 SER F C     1 
ATOM   8374  O O     . SER F 1 177 ? 29.142 -83.992  -202.931 1.00 152.81 ? 174 SER F O     1 
ATOM   8375  C CB    . SER F 1 177 ? 29.934 -80.962  -202.795 1.00 143.81 ? 174 SER F CB    1 
ATOM   8376  O OG    . SER F 1 177 ? 30.128 -79.823  -203.614 1.00 146.63 ? 174 SER F OG    1 
ATOM   8377  N N     . LEU F 1 178 ? 27.871 -83.099  -201.298 1.00 151.61 ? 175 LEU F N     1 
ATOM   8378  C CA    . LEU F 1 178 ? 27.692 -84.383  -200.630 1.00 151.28 ? 175 LEU F CA    1 
ATOM   8379  C C     . LEU F 1 178 ? 26.727 -85.270  -201.403 1.00 153.30 ? 175 LEU F C     1 
ATOM   8380  O O     . LEU F 1 178 ? 26.909 -86.492  -201.464 1.00 150.33 ? 175 LEU F O     1 
ATOM   8381  C CB    . LEU F 1 178 ? 27.189 -84.169  -199.203 1.00 148.07 ? 175 LEU F CB    1 
ATOM   8382  C CG    . LEU F 1 178 ? 28.233 -84.088  -198.092 1.00 141.53 ? 175 LEU F CG    1 
ATOM   8383  C CD1   . LEU F 1 178 ? 27.545 -83.874  -196.757 1.00 137.71 ? 175 LEU F CD1   1 
ATOM   8384  C CD2   . LEU F 1 178 ? 29.086 -85.345  -198.064 1.00 136.65 ? 175 LEU F CD2   1 
ATOM   8385  N N     . ASN F 1 179 ? 25.688 -84.673  -201.994 1.00 155.33 ? 176 ASN F N     1 
ATOM   8386  C CA    . ASN F 1 179 ? 24.774 -85.446  -202.829 1.00 154.38 ? 176 ASN F CA    1 
ATOM   8387  C C     . ASN F 1 179 ? 25.481 -86.015  -204.054 1.00 156.56 ? 176 ASN F C     1 
ATOM   8388  O O     . ASN F 1 179 ? 25.051 -87.038  -204.599 1.00 146.99 ? 176 ASN F O     1 
ATOM   8389  C CB    . ASN F 1 179 ? 23.585 -84.583  -203.255 1.00 149.60 ? 176 ASN F CB    1 
ATOM   8390  C CG    . ASN F 1 179 ? 22.753 -84.116  -202.077 1.00 159.35 ? 176 ASN F CG    1 
ATOM   8391  O OD1   . ASN F 1 179 ? 22.380 -84.909  -201.213 1.00 173.00 ? 176 ASN F OD1   1 
ATOM   8392  N ND2   . ASN F 1 179 ? 22.451 -82.823  -202.041 1.00 151.16 ? 176 ASN F ND2   1 
ATOM   8393  N N     . LYS F 1 180 ? 26.564 -85.372  -204.497 1.00 165.68 ? 177 LYS F N     1 
ATOM   8394  C CA    . LYS F 1 180 ? 27.310 -85.794  -205.677 1.00 159.32 ? 177 LYS F CA    1 
ATOM   8395  C C     . LYS F 1 180 ? 28.391 -86.817  -205.351 1.00 162.21 ? 177 LYS F C     1 
ATOM   8396  O O     . LYS F 1 180 ? 29.383 -86.921  -206.086 1.00 160.30 ? 177 LYS F O     1 
ATOM   8397  C CB    . LYS F 1 180 ? 27.925 -84.578  -206.371 1.00 142.78 ? 177 LYS F CB    1 
ATOM   8398  C CG    . LYS F 1 180 ? 26.918 -83.514  -206.776 1.00 134.53 ? 177 LYS F CG    1 
ATOM   8399  C CD    . LYS F 1 180 ? 27.619 -82.252  -207.254 1.00 149.26 ? 177 LYS F CD    1 
ATOM   8400  C CE    . LYS F 1 180 ? 26.623 -81.143  -207.561 1.00 149.99 ? 177 LYS F CE    1 
ATOM   8401  N NZ    . LYS F 1 180 ? 27.309 -79.891  -207.986 1.00 145.53 ? 177 LYS F NZ    1 
ATOM   8402  N N     . LEU F 1 181 ? 28.233 -87.569  -204.270 1.00 166.27 ? 178 LEU F N     1 
ATOM   8403  C CA    . LEU F 1 181 ? 29.179 -88.586  -203.850 1.00 173.04 ? 178 LEU F CA    1 
ATOM   8404  C C     . LEU F 1 181 ? 28.495 -89.946  -203.791 1.00 173.94 ? 178 LEU F C     1 
ATOM   8405  O O     . LEU F 1 181 ? 27.269 -90.029  -203.644 1.00 172.53 ? 178 LEU F O     1 
ATOM   8406  C CB    . LEU F 1 181 ? 29.782 -88.238  -202.481 1.00 172.04 ? 178 LEU F CB    1 
ATOM   8407  C CG    . LEU F 1 181 ? 30.930 -87.226  -202.529 1.00 157.81 ? 178 LEU F CG    1 
ATOM   8408  C CD1   . LEU F 1 181 ? 31.467 -86.937  -201.139 1.00 155.50 ? 178 LEU F CD1   1 
ATOM   8409  C CD2   . LEU F 1 181 ? 32.044 -87.717  -203.442 1.00 145.27 ? 178 LEU F CD2   1 
ATOM   8410  N N     . PRO F 1 182 ? 29.255 -91.035  -203.914 1.00 174.19 ? 179 PRO F N     1 
ATOM   8411  C CA    . PRO F 1 182 ? 28.650 -92.372  -203.846 1.00 182.88 ? 179 PRO F CA    1 
ATOM   8412  C C     . PRO F 1 182 ? 28.004 -92.638  -202.494 1.00 182.74 ? 179 PRO F C     1 
ATOM   8413  O O     . PRO F 1 182 ? 28.636 -92.502  -201.444 1.00 177.32 ? 179 PRO F O     1 
ATOM   8414  C CB    . PRO F 1 182 ? 29.837 -93.309  -204.097 1.00 181.58 ? 179 PRO F CB    1 
ATOM   8415  C CG    . PRO F 1 182 ? 30.822 -92.475  -204.845 1.00 172.44 ? 179 PRO F CG    1 
ATOM   8416  C CD    . PRO F 1 182 ? 30.683 -91.098  -204.271 1.00 161.60 ? 179 PRO F CD    1 
ATOM   8417  N N     . ARG F 1 183 ? 26.729 -93.022  -202.531 1.00 183.27 ? 180 ARG F N     1 
ATOM   8418  C CA    . ARG F 1 183 ? 25.967 -93.349  -201.326 1.00 190.06 ? 180 ARG F CA    1 
ATOM   8419  C C     . ARG F 1 183 ? 26.427 -94.721  -200.847 1.00 188.53 ? 180 ARG F C     1 
ATOM   8420  O O     . ARG F 1 183 ? 25.911 -95.760  -201.263 1.00 188.48 ? 180 ARG F O     1 
ATOM   8421  C CB    . ARG F 1 183 ? 24.472 -93.311  -201.623 1.00 189.47 ? 180 ARG F CB    1 
ATOM   8422  C CG    . ARG F 1 183 ? 23.634 -92.565  -200.601 1.00 185.98 ? 180 ARG F CG    1 
ATOM   8423  C CD    . ARG F 1 183 ? 23.393 -93.420  -199.370 1.00 187.92 ? 180 ARG F CD    1 
ATOM   8424  N NE    . ARG F 1 183 ? 22.826 -94.715  -199.740 1.00 191.24 ? 180 ARG F NE    1 
ATOM   8425  C CZ    . ARG F 1 183 ? 22.664 -95.733  -198.902 1.00 197.56 ? 180 ARG F CZ    1 
ATOM   8426  N NH1   . ARG F 1 183 ? 23.025 -95.616  -197.632 1.00 201.27 ? 180 ARG F NH1   1 
ATOM   8427  N NH2   . ARG F 1 183 ? 22.138 -96.871  -199.336 1.00 185.83 ? 180 ARG F NH2   1 
ATOM   8428  N N     . GLN F 1 184 ? 27.415 -94.718  -199.957 1.00 186.90 ? 181 GLN F N     1 
ATOM   8429  C CA    . GLN F 1 184 ? 28.048 -95.942  -199.495 1.00 192.71 ? 181 GLN F CA    1 
ATOM   8430  C C     . GLN F 1 184 ? 27.199 -96.650  -198.441 1.00 194.66 ? 181 GLN F C     1 
ATOM   8431  O O     . GLN F 1 184 ? 26.381 -96.042  -197.745 1.00 196.99 ? 181 GLN F O     1 
ATOM   8432  C CB    . GLN F 1 184 ? 29.441 -95.644  -198.942 1.00 190.95 ? 181 GLN F CB    1 
ATOM   8433  C CG    . GLN F 1 184 ? 29.483 -94.516  -197.928 1.00 195.45 ? 181 GLN F CG    1 
ATOM   8434  C CD    . GLN F 1 184 ? 30.848 -94.363  -197.290 1.00 185.39 ? 181 GLN F CD    1 
ATOM   8435  O OE1   . GLN F 1 184 ? 31.456 -93.295  -197.351 1.00 165.53 ? 181 GLN F OE1   1 
ATOM   8436  N NE2   . GLN F 1 184 ? 31.338 -95.433  -196.676 1.00 195.11 ? 181 GLN F NE2   1 
ATOM   8437  N N     . LEU F 1 185 ? 27.411 -97.964  -198.334 1.00 186.76 ? 182 LEU F N     1 
ATOM   8438  C CA    . LEU F 1 185 ? 26.735 -98.818  -197.372 1.00 192.51 ? 182 LEU F CA    1 
ATOM   8439  C C     . LEU F 1 185 ? 27.364 -98.654  -195.987 1.00 192.94 ? 182 LEU F C     1 
ATOM   8440  O O     . LEU F 1 185 ? 28.536 -98.284  -195.874 1.00 186.18 ? 182 LEU F O     1 
ATOM   8441  C CB    . LEU F 1 185 ? 26.818 -100.276 -197.819 1.00 192.48 ? 182 LEU F CB    1 
ATOM   8442  C CG    . LEU F 1 185 ? 25.571 -101.152 -197.663 1.00 186.68 ? 182 LEU F CG    1 
ATOM   8443  C CD1   . LEU F 1 185 ? 24.381 -100.519 -198.371 1.00 171.98 ? 182 LEU F CD1   1 
ATOM   8444  C CD2   . LEU F 1 185 ? 25.826 -102.555 -198.192 1.00 179.70 ? 182 LEU F CD2   1 
ATOM   8445  N N     . PRO F 1 186 ? 26.595 -98.891  -194.921 1.00 197.66 ? 183 PRO F N     1 
ATOM   8446  C CA    . PRO F 1 186 ? 27.142 -98.765  -193.562 1.00 192.63 ? 183 PRO F CA    1 
ATOM   8447  C C     . PRO F 1 186 ? 28.444 -99.534  -193.369 1.00 187.69 ? 183 PRO F C     1 
ATOM   8448  O O     . PRO F 1 186 ? 28.597 -100.668 -193.828 1.00 184.99 ? 183 PRO F O     1 
ATOM   8449  C CB    . PRO F 1 186 ? 26.023 -99.334  -192.685 1.00 183.53 ? 183 PRO F CB    1 
ATOM   8450  C CG    . PRO F 1 186 ? 24.778 -99.023  -193.437 1.00 190.17 ? 183 PRO F CG    1 
ATOM   8451  C CD    . PRO F 1 186 ? 25.128 -99.042  -194.908 1.00 196.66 ? 183 PRO F CD    1 
ATOM   8452  N N     . LEU F 1 187 ? 29.387 -98.896  -192.679 1.00 192.33 ? 184 LEU F N     1 
ATOM   8453  C CA    . LEU F 1 187 ? 30.681 -99.502  -192.397 1.00 188.58 ? 184 LEU F CA    1 
ATOM   8454  C C     . LEU F 1 187 ? 30.538 -100.677 -191.433 1.00 183.94 ? 184 LEU F C     1 
ATOM   8455  O O     . LEU F 1 187 ? 29.632 -100.719 -190.597 1.00 180.57 ? 184 LEU F O     1 
ATOM   8456  C CB    . LEU F 1 187 ? 31.647 -98.468  -191.812 1.00 182.85 ? 184 LEU F CB    1 
ATOM   8457  C CG    . LEU F 1 187 ? 31.976 -97.209  -192.624 1.00 184.14 ? 184 LEU F CG    1 
ATOM   8458  C CD1   . LEU F 1 187 ? 32.163 -97.540  -194.102 1.00 183.08 ? 184 LEU F CD1   1 
ATOM   8459  C CD2   . LEU F 1 187 ? 30.936 -96.106  -192.429 1.00 172.07 ? 184 LEU F CD2   1 
ATOM   8460  N N     . GLU F 1 188 ? 31.451 -101.637 -191.560 1.00 185.21 ? 185 GLU F N     1 
ATOM   8461  C CA    . GLU F 1 188 ? 31.476 -102.809 -190.693 1.00 185.01 ? 185 GLU F CA    1 
ATOM   8462  C C     . GLU F 1 188 ? 32.419 -102.571 -189.519 1.00 179.78 ? 185 GLU F C     1 
ATOM   8463  O O     . GLU F 1 188 ? 33.544 -102.096 -189.704 1.00 184.73 ? 185 GLU F O     1 
ATOM   8464  C CB    . GLU F 1 188 ? 31.911 -104.048 -191.476 1.00 182.41 ? 185 GLU F CB    1 
ATOM   8465  C CG    . GLU F 1 188 ? 31.865 -105.337 -190.673 1.00 174.04 ? 185 GLU F CG    1 
ATOM   8466  C CD    . GLU F 1 188 ? 32.193 -106.556 -191.511 1.00 180.64 ? 185 GLU F CD    1 
ATOM   8467  O OE1   . GLU F 1 188 ? 33.166 -106.497 -192.293 1.00 187.71 ? 185 GLU F OE1   1 
ATOM   8468  O OE2   . GLU F 1 188 ? 31.478 -107.573 -191.389 1.00 168.31 ? 185 GLU F OE2   1 
ATOM   8469  N N     . VAL F 1 189 ? 31.956 -102.901 -188.315 1.00 168.13 ? 186 VAL F N     1 
ATOM   8470  C CA    . VAL F 1 189 ? 32.716 -102.687 -187.088 1.00 169.01 ? 186 VAL F CA    1 
ATOM   8471  C C     . VAL F 1 189 ? 33.381 -103.998 -186.688 1.00 166.84 ? 186 VAL F C     1 
ATOM   8472  O O     . VAL F 1 189 ? 32.716 -105.036 -186.585 1.00 164.35 ? 186 VAL F O     1 
ATOM   8473  C CB    . VAL F 1 189 ? 31.813 -102.161 -185.958 1.00 168.98 ? 186 VAL F CB    1 
ATOM   8474  C CG1   . VAL F 1 189 ? 32.620 -101.948 -184.688 1.00 166.53 ? 186 VAL F CG1   1 
ATOM   8475  C CG2   . VAL F 1 189 ? 31.124 -100.872 -186.382 1.00 150.57 ? 186 VAL F CG2   1 
ATOM   8476  N N     . ASP F 1 190 ? 34.693 -103.951 -186.464 1.00 161.07 ? 187 ASP F N     1 
ATOM   8477  C CA    . ASP F 1 190 ? 35.465 -105.129 -186.086 1.00 163.59 ? 187 ASP F CA    1 
ATOM   8478  C C     . ASP F 1 190 ? 35.522 -105.226 -184.565 1.00 164.52 ? 187 ASP F C     1 
ATOM   8479  O O     . ASP F 1 190 ? 36.106 -104.359 -183.905 1.00 168.15 ? 187 ASP F O     1 
ATOM   8480  C CB    . ASP F 1 190 ? 36.873 -105.065 -186.676 1.00 161.40 ? 187 ASP F CB    1 
ATOM   8481  C CG    . ASP F 1 190 ? 37.710 -106.276 -186.318 1.00 167.78 ? 187 ASP F CG    1 
ATOM   8482  O OD1   . ASP F 1 190 ? 37.457 -107.361 -186.881 1.00 172.08 ? 187 ASP F OD1   1 
ATOM   8483  O OD2   . ASP F 1 190 ? 38.622 -106.142 -185.475 1.00 164.83 ? 187 ASP F OD2   1 
ATOM   8484  N N     . LEU F 1 191 ? 34.919 -106.279 -184.013 1.00 156.47 ? 188 LEU F N     1 
ATOM   8485  C CA    . LEU F 1 191 ? 34.859 -106.491 -182.571 1.00 152.01 ? 188 LEU F CA    1 
ATOM   8486  C C     . LEU F 1 191 ? 35.856 -107.538 -182.084 1.00 151.03 ? 188 LEU F C     1 
ATOM   8487  O O     . LEU F 1 191 ? 35.597 -108.224 -181.089 1.00 153.95 ? 188 LEU F O     1 
ATOM   8488  C CB    . LEU F 1 191 ? 33.441 -106.885 -182.159 1.00 152.79 ? 188 LEU F CB    1 
ATOM   8489  C CG    . LEU F 1 191 ? 32.335 -105.910 -182.561 1.00 147.34 ? 188 LEU F CG    1 
ATOM   8490  C CD1   . LEU F 1 191 ? 31.001 -106.355 -181.994 1.00 137.50 ? 188 LEU F CD1   1 
ATOM   8491  C CD2   . LEU F 1 191 ? 32.676 -104.506 -182.095 1.00 156.30 ? 188 LEU F CD2   1 
ATOM   8492  N N     . THR F 1 192 ? 36.995 -107.679 -182.763 1.00 150.95 ? 189 THR F N     1 
ATOM   8493  C CA    . THR F 1 192 ? 38.007 -108.631 -182.315 1.00 157.09 ? 189 THR F CA    1 
ATOM   8494  C C     . THR F 1 192 ? 38.808 -108.083 -181.137 1.00 148.78 ? 189 THR F C     1 
ATOM   8495  O O     . THR F 1 192 ? 38.813 -108.671 -180.049 1.00 135.27 ? 189 THR F O     1 
ATOM   8496  C CB    . THR F 1 192 ? 38.939 -108.994 -183.474 1.00 159.86 ? 189 THR F CB    1 
ATOM   8497  O OG1   . THR F 1 192 ? 39.611 -107.817 -183.939 1.00 162.51 ? 189 THR F OG1   1 
ATOM   8498  C CG2   . THR F 1 192 ? 38.149 -109.610 -184.619 1.00 151.95 ? 189 THR F CG2   1 
ATOM   8499  N N     . LYS F 1 193 ? 39.492 -106.956 -181.337 1.00 152.19 ? 190 LYS F N     1 
ATOM   8500  C CA    . LYS F 1 193 ? 40.310 -106.332 -180.303 1.00 152.75 ? 190 LYS F CA    1 
ATOM   8501  C C     . LYS F 1 193 ? 39.512 -105.439 -179.354 1.00 156.01 ? 190 LYS F C     1 
ATOM   8502  O O     . LYS F 1 193 ? 40.106 -104.574 -178.698 1.00 146.97 ? 190 LYS F O     1 
ATOM   8503  C CB    . LYS F 1 193 ? 41.446 -105.532 -180.945 1.00 156.87 ? 190 LYS F CB    1 
ATOM   8504  C CG    . LYS F 1 193 ? 42.327 -106.351 -181.874 1.00 161.85 ? 190 LYS F CG    1 
ATOM   8505  C CD    . LYS F 1 193 ? 43.421 -105.501 -182.498 1.00 156.28 ? 190 LYS F CD    1 
ATOM   8506  C CE    . LYS F 1 193 ? 44.270 -106.318 -183.459 1.00 168.86 ? 190 LYS F CE    1 
ATOM   8507  N NZ    . LYS F 1 193 ? 45.335 -105.496 -184.097 1.00 163.16 ? 190 LYS F NZ    1 
ATOM   8508  N N     . ALA F 1 194 ? 38.196 -105.619 -179.271 1.00 159.18 ? 191 ALA F N     1 
ATOM   8509  C CA    . ALA F 1 194 ? 37.377 -104.808 -178.383 1.00 145.57 ? 191 ALA F CA    1 
ATOM   8510  C C     . ALA F 1 194 ? 37.744 -105.061 -176.922 1.00 142.10 ? 191 ALA F C     1 
ATOM   8511  O O     . ALA F 1 194 ? 38.282 -106.111 -176.559 1.00 146.17 ? 191 ALA F O     1 
ATOM   8512  C CB    . ALA F 1 194 ? 35.893 -105.099 -178.609 1.00 136.53 ? 191 ALA F CB    1 
ATOM   8513  N N     . LYS F 1 195 ? 37.453 -104.070 -176.080 1.00 139.65 ? 192 LYS F N     1 
ATOM   8514  C CA    . LYS F 1 195 ? 37.724 -104.189 -174.652 1.00 139.62 ? 192 LYS F CA    1 
ATOM   8515  C C     . LYS F 1 195 ? 36.883 -105.304 -174.046 1.00 134.23 ? 192 LYS F C     1 
ATOM   8516  O O     . LYS F 1 195 ? 35.669 -105.372 -174.261 1.00 116.53 ? 192 LYS F O     1 
ATOM   8517  C CB    . LYS F 1 195 ? 37.436 -102.863 -173.948 1.00 140.80 ? 192 LYS F CB    1 
ATOM   8518  C CG    . LYS F 1 195 ? 37.735 -102.868 -172.460 1.00 137.14 ? 192 LYS F CG    1 
ATOM   8519  C CD    . LYS F 1 195 ? 37.814 -101.454 -171.913 1.00 118.52 ? 192 LYS F CD    1 
ATOM   8520  C CE    . LYS F 1 195 ? 38.238 -101.456 -170.456 1.00 115.82 ? 192 LYS F CE    1 
ATOM   8521  N NZ    . LYS F 1 195 ? 39.455 -102.282 -170.235 1.00 124.34 ? 192 LYS F NZ    1 
ATOM   8522  N N     . ARG F 1 196 ? 37.535 -106.182 -173.281 1.00 139.88 ? 193 ARG F N     1 
ATOM   8523  C CA    . ARG F 1 196 ? 36.882 -107.369 -172.751 1.00 142.51 ? 193 ARG F CA    1 
ATOM   8524  C C     . ARG F 1 196 ? 37.033 -107.560 -171.248 1.00 152.59 ? 193 ARG F C     1 
ATOM   8525  O O     . ARG F 1 196 ? 36.398 -108.469 -170.701 1.00 157.62 ? 193 ARG F O     1 
ATOM   8526  C CB    . ARG F 1 196 ? 37.407 -108.625 -173.465 1.00 133.73 ? 193 ARG F CB    1 
ATOM   8527  C CG    . ARG F 1 196 ? 37.071 -108.669 -174.948 1.00 141.02 ? 193 ARG F CG    1 
ATOM   8528  C CD    . ARG F 1 196 ? 37.069 -110.087 -175.493 1.00 134.05 ? 193 ARG F CD    1 
ATOM   8529  N NE    . ARG F 1 196 ? 36.093 -110.254 -176.566 1.00 133.71 ? 193 ARG F NE    1 
ATOM   8530  C CZ    . ARG F 1 196 ? 36.275 -109.843 -177.818 1.00 132.53 ? 193 ARG F CZ    1 
ATOM   8531  N NH1   . ARG F 1 196 ? 37.404 -109.239 -178.164 1.00 131.52 ? 193 ARG F NH1   1 
ATOM   8532  N NH2   . ARG F 1 196 ? 35.328 -110.038 -178.726 1.00 130.95 ? 193 ARG F NH2   1 
ATOM   8533  N N     . GLN F 1 197 ? 37.838 -106.749 -170.564 1.00 155.36 ? 194 GLN F N     1 
ATOM   8534  C CA    . GLN F 1 197 ? 37.985 -106.856 -169.119 1.00 157.48 ? 194 GLN F CA    1 
ATOM   8535  C C     . GLN F 1 197 ? 38.132 -105.463 -168.521 1.00 147.64 ? 194 GLN F C     1 
ATOM   8536  O O     . GLN F 1 197 ? 38.320 -104.472 -169.231 1.00 145.23 ? 194 GLN F O     1 
ATOM   8537  C CB    . GLN F 1 197 ? 39.180 -107.743 -168.738 1.00 150.19 ? 194 GLN F CB    1 
ATOM   8538  C CG    . GLN F 1 197 ? 40.517 -107.015 -168.643 1.00 156.30 ? 194 GLN F CG    1 
ATOM   8539  C CD    . GLN F 1 197 ? 41.036 -106.537 -169.988 1.00 152.71 ? 194 GLN F CD    1 
ATOM   8540  O OE1   . GLN F 1 197 ? 40.486 -106.872 -171.038 1.00 156.47 ? 194 GLN F OE1   1 
ATOM   8541  N NE2   . GLN F 1 197 ? 42.102 -105.746 -169.959 1.00 143.52 ? 194 GLN F NE2   1 
ATOM   8542  N N     . ASP F 1 198 ? 38.041 -105.400 -167.191 1.00 143.85 ? 195 ASP F N     1 
ATOM   8543  C CA    . ASP F 1 198 ? 38.059 -104.116 -166.497 1.00 135.71 ? 195 ASP F CA    1 
ATOM   8544  C C     . ASP F 1 198 ? 39.464 -103.529 -166.457 1.00 134.88 ? 195 ASP F C     1 
ATOM   8545  O O     . ASP F 1 198 ? 39.688 -102.389 -166.883 1.00 137.99 ? 195 ASP F O     1 
ATOM   8546  C CB    . ASP F 1 198 ? 37.506 -104.279 -165.079 1.00 141.02 ? 195 ASP F CB    1 
ATOM   8547  C CG    . ASP F 1 198 ? 36.051 -104.699 -165.063 1.00 140.68 ? 195 ASP F CG    1 
ATOM   8548  O OD1   . ASP F 1 198 ? 35.408 -104.666 -166.134 1.00 145.67 ? 195 ASP F OD1   1 
ATOM   8549  O OD2   . ASP F 1 198 ? 35.548 -105.059 -163.977 1.00 108.79 ? 195 ASP F OD2   1 
ATOM   8550  N N     . LEU F 1 199 ? 40.421 -104.292 -165.932 1.00 135.74 ? 196 LEU F N     1 
ATOM   8551  C CA    . LEU F 1 199 ? 41.758 -103.771 -165.682 1.00 135.85 ? 196 LEU F CA    1 
ATOM   8552  C C     . LEU F 1 199 ? 42.424 -103.316 -166.976 1.00 132.43 ? 196 LEU F C     1 
ATOM   8553  O O     . LEU F 1 199 ? 42.293 -103.954 -168.024 1.00 124.45 ? 196 LEU F O     1 
ATOM   8554  C CB    . LEU F 1 199 ? 42.616 -104.836 -164.996 1.00 141.65 ? 196 LEU F CB    1 
ATOM   8555  C CG    . LEU F 1 199 ? 44.068 -104.467 -164.680 1.00 134.77 ? 196 LEU F CG    1 
ATOM   8556  C CD1   . LEU F 1 199 ? 44.133 -103.217 -163.815 1.00 136.73 ? 196 LEU F CD1   1 
ATOM   8557  C CD2   . LEU F 1 199 ? 44.787 -105.628 -164.010 1.00 132.47 ? 196 LEU F CD2   1 
ATOM   8558  N N     . GLU F 1 200 ? 43.142 -102.194 -166.892 1.00 130.59 ? 197 GLU F N     1 
ATOM   8559  C CA    . GLU F 1 200 ? 43.921 -101.641 -167.997 1.00 137.44 ? 197 GLU F CA    1 
ATOM   8560  C C     . GLU F 1 200 ? 45.355 -101.473 -167.510 1.00 144.97 ? 197 GLU F C     1 
ATOM   8561  O O     . GLU F 1 200 ? 45.744 -100.384 -167.061 1.00 146.67 ? 197 GLU F O     1 
ATOM   8562  C CB    . GLU F 1 200 ? 43.344 -100.313 -168.485 1.00 132.41 ? 197 GLU F CB    1 
ATOM   8563  C CG    . GLU F 1 200 ? 42.058 -100.446 -169.277 1.00 122.52 ? 197 GLU F CG    1 
ATOM   8564  C CD    . GLU F 1 200 ? 42.301 -100.915 -170.696 1.00 133.83 ? 197 GLU F CD    1 
ATOM   8565  O OE1   . GLU F 1 200 ? 43.235 -100.396 -171.344 1.00 135.24 ? 197 GLU F OE1   1 
ATOM   8566  O OE2   . GLU F 1 200 ? 41.560 -101.804 -171.164 1.00 138.34 ? 197 GLU F OE2   1 
ATOM   8567  N N     . PRO F 1 201 ? 46.164 -102.535 -167.565 1.00 142.47 ? 198 PRO F N     1 
ATOM   8568  C CA    . PRO F 1 201 ? 47.550 -102.427 -167.078 1.00 143.26 ? 198 PRO F CA    1 
ATOM   8569  C C     . PRO F 1 201 ? 48.360 -101.359 -167.788 1.00 144.77 ? 198 PRO F C     1 
ATOM   8570  O O     . PRO F 1 201 ? 49.236 -100.745 -167.165 1.00 141.16 ? 198 PRO F O     1 
ATOM   8571  C CB    . PRO F 1 201 ? 48.116 -103.831 -167.336 1.00 139.96 ? 198 PRO F CB    1 
ATOM   8572  C CG    . PRO F 1 201 ? 46.913 -104.721 -167.334 1.00 142.47 ? 198 PRO F CG    1 
ATOM   8573  C CD    . PRO F 1 201 ? 45.836 -103.907 -167.989 1.00 142.75 ? 198 PRO F CD    1 
ATOM   8574  N N     . SER F 1 202 ? 48.095 -101.121 -169.076 1.00 141.87 ? 199 SER F N     1 
ATOM   8575  C CA    . SER F 1 202 ? 48.766 -100.038 -169.790 1.00 127.95 ? 199 SER F CA    1 
ATOM   8576  C C     . SER F 1 202 ? 48.567 -98.703  -169.081 1.00 141.67 ? 199 SER F C     1 
ATOM   8577  O O     . SER F 1 202 ? 49.501 -97.900  -168.976 1.00 149.01 ? 199 SER F O     1 
ATOM   8578  C CB    . SER F 1 202 ? 48.254 -99.964  -171.229 1.00 108.51 ? 199 SER F CB    1 
ATOM   8579  O OG    . SER F 1 202 ? 48.970 -98.999  -171.980 1.00 108.38 ? 199 SER F OG    1 
ATOM   8580  N N     . VAL F 1 203 ? 47.355 -98.451  -168.587 1.00 143.45 ? 200 VAL F N     1 
ATOM   8581  C CA    . VAL F 1 203 ? 47.067 -97.209  -167.880 1.00 140.69 ? 200 VAL F CA    1 
ATOM   8582  C C     . VAL F 1 203 ? 47.569 -97.272  -166.443 1.00 138.51 ? 200 VAL F C     1 
ATOM   8583  O O     . VAL F 1 203 ? 48.139 -96.300  -165.929 1.00 136.62 ? 200 VAL F O     1 
ATOM   8584  C CB    . VAL F 1 203 ? 45.558 -96.904  -167.933 1.00 132.22 ? 200 VAL F CB    1 
ATOM   8585  C CG1   . VAL F 1 203 ? 45.269 -95.580  -167.250 1.00 133.39 ? 200 VAL F CG1   1 
ATOM   8586  C CG2   . VAL F 1 203 ? 45.062 -96.900  -169.369 1.00 131.18 ? 200 VAL F CG2   1 
ATOM   8587  N N     . GLU F 1 204 ? 47.304 -98.392  -165.761 1.00 137.47 ? 201 GLU F N     1 
ATOM   8588  C CA    . GLU F 1 204 ? 47.726 -98.563  -164.373 1.00 139.47 ? 201 GLU F CA    1 
ATOM   8589  C C     . GLU F 1 204 ? 49.224 -98.333  -164.200 1.00 143.99 ? 201 GLU F C     1 
ATOM   8590  O O     . GLU F 1 204 ? 49.655 -97.722  -163.217 1.00 137.63 ? 201 GLU F O     1 
ATOM   8591  C CB    . GLU F 1 204 ? 47.336 -99.958  -163.883 1.00 141.63 ? 201 GLU F CB    1 
ATOM   8592  C CG    . GLU F 1 204 ? 47.933 -100.346 -162.540 1.00 154.40 ? 201 GLU F CG    1 
ATOM   8593  C CD    . GLU F 1 204 ? 47.377 -99.523  -161.397 1.00 149.56 ? 201 GLU F CD    1 
ATOM   8594  O OE1   . GLU F 1 204 ? 46.150 -99.569  -161.175 1.00 147.93 ? 201 GLU F OE1   1 
ATOM   8595  O OE2   . GLU F 1 204 ? 48.168 -98.833  -160.719 1.00 145.56 ? 201 GLU F OE2   1 
ATOM   8596  N N     . GLU F 1 205 ? 50.030 -98.816  -165.148 1.00 146.53 ? 202 GLU F N     1 
ATOM   8597  C CA    . GLU F 1 205 ? 51.478 -98.636  -165.075 1.00 152.98 ? 202 GLU F CA    1 
ATOM   8598  C C     . GLU F 1 205 ? 51.846 -97.157  -165.051 1.00 156.99 ? 202 GLU F C     1 
ATOM   8599  O O     . GLU F 1 205 ? 52.545 -96.684  -164.144 1.00 157.30 ? 202 GLU F O     1 
ATOM   8600  C CB    . GLU F 1 205 ? 52.140 -99.340  -166.262 1.00 163.99 ? 202 GLU F CB    1 
ATOM   8601  C CG    . GLU F 1 205 ? 53.653 -99.421  -166.200 1.00 167.13 ? 202 GLU F CG    1 
ATOM   8602  C CD    . GLU F 1 205 ? 54.227 -100.250 -167.332 1.00 174.62 ? 202 GLU F CD    1 
ATOM   8603  O OE1   . GLU F 1 205 ? 54.062 -99.849  -168.504 1.00 183.15 ? 202 GLU F OE1   1 
ATOM   8604  O OE2   . GLU F 1 205 ? 54.838 -101.303 -167.052 1.00 183.38 ? 202 GLU F OE2   1 
ATOM   8605  N N     . ALA F 1 206 ? 51.392 -96.415  -166.064 1.00 154.50 ? 203 ALA F N     1 
ATOM   8606  C CA    . ALA F 1 206 ? 51.709 -94.995  -166.155 1.00 149.05 ? 203 ALA F CA    1 
ATOM   8607  C C     . ALA F 1 206 ? 51.176 -94.228  -164.952 1.00 150.86 ? 203 ALA F C     1 
ATOM   8608  O O     . ALA F 1 206 ? 51.817 -93.284  -164.476 1.00 153.93 ? 203 ALA F O     1 
ATOM   8609  C CB    . ALA F 1 206 ? 51.143 -94.420  -167.452 1.00 143.93 ? 203 ALA F CB    1 
ATOM   8610  N N     . ARG F 1 207 ? 50.008 -94.622  -164.438 1.00 149.73 ? 204 ARG F N     1 
ATOM   8611  C CA    . ARG F 1 207 ? 49.432 -93.885  -163.317 1.00 149.26 ? 204 ARG F CA    1 
ATOM   8612  C C     . ARG F 1 207 ? 50.199 -94.158  -162.028 1.00 150.56 ? 204 ARG F C     1 
ATOM   8613  O O     . ARG F 1 207 ? 50.389 -93.251  -161.209 1.00 151.05 ? 204 ARG F O     1 
ATOM   8614  C CB    . ARG F 1 207 ? 47.954 -94.232  -163.156 1.00 142.60 ? 204 ARG F CB    1 
ATOM   8615  C CG    . ARG F 1 207 ? 47.200 -93.280  -162.241 1.00 136.95 ? 204 ARG F CG    1 
ATOM   8616  C CD    . ARG F 1 207 ? 45.801 -93.784  -161.966 1.00 132.49 ? 204 ARG F CD    1 
ATOM   8617  N NE    . ARG F 1 207 ? 45.135 -94.247  -163.180 1.00 140.01 ? 204 ARG F NE    1 
ATOM   8618  C CZ    . ARG F 1 207 ? 44.319 -95.294  -163.225 1.00 120.22 ? 204 ARG F CZ    1 
ATOM   8619  N NH1   . ARG F 1 207 ? 44.075 -95.992  -162.125 1.00 117.76 ? 204 ARG F NH1   1 
ATOM   8620  N NH2   . ARG F 1 207 ? 43.751 -95.649  -164.369 1.00 108.35 ? 204 ARG F NH2   1 
ATOM   8621  N N     . TYR F 1 208 ? 50.638 -95.403  -161.826 1.00 144.32 ? 205 TYR F N     1 
ATOM   8622  C CA    . TYR F 1 208 ? 51.489 -95.708  -160.683 1.00 144.11 ? 205 TYR F CA    1 
ATOM   8623  C C     . TYR F 1 208 ? 52.827 -94.991  -160.786 1.00 151.26 ? 205 TYR F C     1 
ATOM   8624  O O     . TYR F 1 208 ? 53.408 -94.608  -159.764 1.00 153.30 ? 205 TYR F O     1 
ATOM   8625  C CB    . TYR F 1 208 ? 51.702 -97.218  -160.570 1.00 139.73 ? 205 TYR F CB    1 
ATOM   8626  C CG    . TYR F 1 208 ? 52.695 -97.613  -159.501 1.00 135.90 ? 205 TYR F CG    1 
ATOM   8627  C CD1   . TYR F 1 208 ? 52.417 -97.407  -158.156 1.00 125.36 ? 205 TYR F CD1   1 
ATOM   8628  C CD2   . TYR F 1 208 ? 53.915 -98.185  -159.837 1.00 144.43 ? 205 TYR F CD2   1 
ATOM   8629  C CE1   . TYR F 1 208 ? 53.324 -97.764  -157.176 1.00 138.76 ? 205 TYR F CE1   1 
ATOM   8630  C CE2   . TYR F 1 208 ? 54.829 -98.545  -158.864 1.00 144.74 ? 205 TYR F CE2   1 
ATOM   8631  C CZ    . TYR F 1 208 ? 54.528 -98.332  -157.535 1.00 140.95 ? 205 TYR F CZ    1 
ATOM   8632  O OH    . TYR F 1 208 ? 55.435 -98.689  -156.564 1.00 127.31 ? 205 TYR F OH    1 
ATOM   8633  N N     . ASN F 1 209 ? 53.327 -94.796  -162.007 1.00 154.05 ? 206 ASN F N     1 
ATOM   8634  C CA    . ASN F 1 209 ? 54.546 -94.018  -162.196 1.00 155.02 ? 206 ASN F CA    1 
ATOM   8635  C C     . ASN F 1 209 ? 54.301 -92.514  -162.173 1.00 162.78 ? 206 ASN F C     1 
ATOM   8636  O O     . ASN F 1 209 ? 55.270 -91.747  -162.174 1.00 164.71 ? 206 ASN F O     1 
ATOM   8637  C CB    . ASN F 1 209 ? 55.224 -94.405  -163.513 1.00 151.81 ? 206 ASN F CB    1 
ATOM   8638  C CG    . ASN F 1 209 ? 55.791 -95.809  -163.485 1.00 155.92 ? 206 ASN F CG    1 
ATOM   8639  O OD1   . ASN F 1 209 ? 55.395 -96.667  -164.274 1.00 158.82 ? 206 ASN F OD1   1 
ATOM   8640  N ND2   . ASN F 1 209 ? 56.725 -96.052  -162.573 1.00 155.08 ? 206 ASN F ND2   1 
ATOM   8641  N N     . SER F 1 210 ? 53.043 -92.078  -162.149 1.00 164.30 ? 207 SER F N     1 
ATOM   8642  C CA    . SER F 1 210 ? 52.712 -90.658  -162.160 1.00 163.24 ? 207 SER F CA    1 
ATOM   8643  C C     . SER F 1 210 ? 52.910 -89.981  -160.809 1.00 171.22 ? 207 SER F C     1 
ATOM   8644  O O     . SER F 1 210 ? 52.747 -88.759  -160.721 1.00 182.75 ? 207 SER F O     1 
ATOM   8645  C CB    . SER F 1 210 ? 51.265 -90.463  -162.622 1.00 152.53 ? 207 SER F CB    1 
ATOM   8646  O OG    . SER F 1 210 ? 51.014 -89.114  -162.973 1.00 157.73 ? 207 SER F OG    1 
ATOM   8647  N N     . CYS F 1 211 ? 53.252 -90.728  -159.764 1.00 160.98 ? 208 CYS F N     1 
ATOM   8648  C CA    . CYS F 1 211 ? 53.462 -90.139  -158.445 1.00 161.12 ? 208 CYS F CA    1 
ATOM   8649  C C     . CYS F 1 211 ? 54.915 -89.713  -158.257 1.00 153.48 ? 208 CYS F C     1 
ATOM   8650  O O     . CYS F 1 211 ? 55.385 -89.560  -157.130 1.00 139.89 ? 208 CYS F O     1 
ATOM   8651  C CB    . CYS F 1 211 ? 53.057 -91.121  -157.344 1.00 155.54 ? 208 CYS F CB    1 
ATOM   8652  S SG    . CYS F 1 211 ? 51.302 -91.549  -157.331 1.00 163.39 ? 208 CYS F SG    1 
ATOM   8653  N N     . CYS G 1 28  ? 46.460 -81.929  -155.568 1.00 122.43 ? 25  CYS G N     1 
ATOM   8654  C CA    . CYS G 1 28  ? 45.215 -82.560  -155.147 1.00 116.85 ? 25  CYS G CA    1 
ATOM   8655  C C     . CYS G 1 28  ? 44.279 -82.760  -156.334 1.00 109.80 ? 25  CYS G C     1 
ATOM   8656  O O     . CYS G 1 28  ? 44.679 -82.589  -157.485 1.00 137.62 ? 25  CYS G O     1 
ATOM   8657  C CB    . CYS G 1 28  ? 44.524 -81.717  -154.074 1.00 131.03 ? 25  CYS G CB    1 
ATOM   8658  S SG    . CYS G 1 28  ? 44.150 -80.023  -154.590 1.00 122.17 ? 25  CYS G SG    1 
ATOM   8659  N N     . PHE G 1 29  ? 43.032 -83.126  -156.047 1.00 94.84  ? 26  PHE G N     1 
ATOM   8660  C CA    . PHE G 1 29  ? 42.047 -83.301  -157.104 1.00 74.44  ? 26  PHE G CA    1 
ATOM   8661  C C     . PHE G 1 29  ? 41.690 -81.954  -157.719 1.00 95.90  ? 26  PHE G C     1 
ATOM   8662  O O     . PHE G 1 29  ? 41.567 -80.945  -157.020 1.00 120.76 ? 26  PHE G O     1 
ATOM   8663  C CB    . PHE G 1 29  ? 40.794 -83.984  -156.556 1.00 68.68  ? 26  PHE G CB    1 
ATOM   8664  C CG    . PHE G 1 29  ? 39.946 -84.629  -157.613 1.00 73.32  ? 26  PHE G CG    1 
ATOM   8665  C CD1   . PHE G 1 29  ? 39.070 -83.877  -158.377 1.00 85.80  ? 26  PHE G CD1   1 
ATOM   8666  C CD2   . PHE G 1 29  ? 40.035 -85.990  -157.850 1.00 78.78  ? 26  PHE G CD2   1 
ATOM   8667  C CE1   . PHE G 1 29  ? 38.294 -84.472  -159.353 1.00 87.01  ? 26  PHE G CE1   1 
ATOM   8668  C CE2   . PHE G 1 29  ? 39.262 -86.591  -158.825 1.00 78.26  ? 26  PHE G CE2   1 
ATOM   8669  C CZ    . PHE G 1 29  ? 38.392 -85.830  -159.577 1.00 77.31  ? 26  PHE G CZ    1 
ATOM   8670  N N     . GLY G 1 30  ? 41.523 -81.943  -159.042 1.00 97.55  ? 27  GLY G N     1 
ATOM   8671  C CA    . GLY G 1 30  ? 41.311 -80.718  -159.779 1.00 104.30 ? 27  GLY G CA    1 
ATOM   8672  C C     . GLY G 1 30  ? 42.567 -79.939  -160.101 1.00 103.92 ? 27  GLY G C     1 
ATOM   8673  O O     . GLY G 1 30  ? 42.519 -79.039  -160.948 1.00 96.69  ? 27  GLY G O     1 
ATOM   8674  N N     . GLN G 1 31  ? 43.688 -80.251  -159.454 1.00 105.51 ? 28  GLN G N     1 
ATOM   8675  C CA    . GLN G 1 31  ? 44.959 -79.570  -159.675 1.00 106.47 ? 28  GLN G CA    1 
ATOM   8676  C C     . GLN G 1 31  ? 45.998 -80.436  -160.367 1.00 111.90 ? 28  GLN G C     1 
ATOM   8677  O O     . GLN G 1 31  ? 46.716 -79.944  -161.240 1.00 118.65 ? 28  GLN G O     1 
ATOM   8678  C CB    . GLN G 1 31  ? 45.529 -79.071  -158.341 1.00 95.58  ? 28  GLN G CB    1 
ATOM   8679  C CG    . GLN G 1 31  ? 44.652 -78.053  -157.619 1.00 106.13 ? 28  GLN G CG    1 
ATOM   8680  C CD    . GLN G 1 31  ? 44.746 -76.654  -158.208 1.00 109.80 ? 28  GLN G CD    1 
ATOM   8681  O OE1   . GLN G 1 31  ? 45.208 -76.465  -159.334 1.00 107.15 ? 28  GLN G OE1   1 
ATOM   8682  N NE2   . GLN G 1 31  ? 44.304 -75.664  -157.442 1.00 111.86 ? 28  GLN G NE2   1 
ATOM   8683  N N     . CYS G 1 32  ? 46.105 -81.711  -159.991 1.00 113.12 ? 29  CYS G N     1 
ATOM   8684  C CA    . CYS G 1 32  ? 47.120 -82.587  -160.564 1.00 115.97 ? 29  CYS G CA    1 
ATOM   8685  C C     . CYS G 1 32  ? 46.928 -82.720  -162.069 1.00 114.18 ? 29  CYS G C     1 
ATOM   8686  O O     . CYS G 1 32  ? 45.817 -82.961  -162.547 1.00 111.34 ? 29  CYS G O     1 
ATOM   8687  C CB    . CYS G 1 32  ? 47.063 -83.963  -159.899 1.00 118.42 ? 29  CYS G CB    1 
ATOM   8688  S SG    . CYS G 1 32  ? 47.614 -83.984  -158.176 1.00 164.50 ? 29  CYS G SG    1 
ATOM   8689  N N     . GLN G 1 33  ? 48.017 -82.565  -162.814 1.00 114.31 ? 30  GLN G N     1 
ATOM   8690  C CA    . GLN G 1 33  ? 47.994 -82.626  -164.267 1.00 105.32 ? 30  GLN G CA    1 
ATOM   8691  C C     . GLN G 1 33  ? 48.397 -84.011  -164.758 1.00 104.65 ? 30  GLN G C     1 
ATOM   8692  O O     . GLN G 1 33  ? 49.200 -84.707  -164.131 1.00 116.43 ? 30  GLN G O     1 
ATOM   8693  C CB    . GLN G 1 33  ? 48.922 -81.566  -164.865 1.00 113.53 ? 30  GLN G CB    1 
ATOM   8694  C CG    . GLN G 1 33  ? 48.465 -80.137  -164.608 1.00 125.32 ? 30  GLN G CG    1 
ATOM   8695  C CD    . GLN G 1 33  ? 49.427 -79.105  -165.161 1.00 147.87 ? 30  GLN G CD    1 
ATOM   8696  O OE1   . GLN G 1 33  ? 49.851 -79.190  -166.314 1.00 164.22 ? 30  GLN G OE1   1 
ATOM   8697  N NE2   . GLN G 1 33  ? 49.775 -78.120  -164.340 1.00 139.43 ? 30  GLN G NE2   1 
ATOM   8698  N N     . TYR G 1 34  ? 47.824 -84.405  -165.893 1.00 105.46 ? 31  TYR G N     1 
ATOM   8699  C CA    . TYR G 1 34  ? 48.101 -85.715  -166.465 1.00 111.07 ? 31  TYR G CA    1 
ATOM   8700  C C     . TYR G 1 34  ? 49.491 -85.753  -167.087 1.00 122.02 ? 31  TYR G C     1 
ATOM   8701  O O     . TYR G 1 34  ? 49.904 -84.825  -167.788 1.00 127.30 ? 31  TYR G O     1 
ATOM   8702  C CB    . TYR G 1 34  ? 47.054 -86.060  -167.525 1.00 109.78 ? 31  TYR G CB    1 
ATOM   8703  C CG    . TYR G 1 34  ? 45.799 -86.702  -166.981 1.00 110.57 ? 31  TYR G CG    1 
ATOM   8704  C CD1   . TYR G 1 34  ? 45.848 -87.928  -166.332 1.00 117.51 ? 31  TYR G CD1   1 
ATOM   8705  C CD2   . TYR G 1 34  ? 44.566 -86.079  -167.114 1.00 105.54 ? 31  TYR G CD2   1 
ATOM   8706  C CE1   . TYR G 1 34  ? 44.701 -88.518  -165.835 1.00 123.31 ? 31  TYR G CE1   1 
ATOM   8707  C CE2   . TYR G 1 34  ? 43.414 -86.661  -166.618 1.00 100.51 ? 31  TYR G CE2   1 
ATOM   8708  C CZ    . TYR G 1 34  ? 43.488 -87.880  -165.980 1.00 113.16 ? 31  TYR G CZ    1 
ATOM   8709  O OH    . TYR G 1 34  ? 42.343 -88.462  -165.486 1.00 116.48 ? 31  TYR G OH    1 
ATOM   8710  N N     . THR G 1 35  ? 50.215 -86.838  -166.826 1.00 122.40 ? 32  THR G N     1 
ATOM   8711  C CA    . THR G 1 35  ? 51.497 -87.063  -167.472 1.00 124.80 ? 32  THR G CA    1 
ATOM   8712  C C     . THR G 1 35  ? 51.291 -87.584  -168.893 1.00 122.66 ? 32  THR G C     1 
ATOM   8713  O O     . THR G 1 35  ? 50.199 -88.016  -169.273 1.00 117.81 ? 32  THR G O     1 
ATOM   8714  C CB    . THR G 1 35  ? 52.346 -88.048  -166.668 1.00 126.00 ? 32  THR G CB    1 
ATOM   8715  O OG1   . THR G 1 35  ? 51.624 -89.272  -166.489 1.00 133.75 ? 32  THR G OG1   1 
ATOM   8716  C CG2   . THR G 1 35  ? 52.688 -87.464  -165.305 1.00 124.37 ? 32  THR G CG2   1 
ATOM   8717  N N     . ALA G 1 36  ? 52.366 -87.529  -169.686 1.00 125.34 ? 33  ALA G N     1 
ATOM   8718  C CA    . ALA G 1 36  ? 52.289 -87.954  -171.082 1.00 130.25 ? 33  ALA G CA    1 
ATOM   8719  C C     . ALA G 1 36  ? 51.890 -89.420  -171.193 1.00 129.98 ? 33  ALA G C     1 
ATOM   8720  O O     . ALA G 1 36  ? 51.007 -89.781  -171.982 1.00 128.23 ? 33  ALA G O     1 
ATOM   8721  C CB    . ALA G 1 36  ? 53.628 -87.708  -171.778 1.00 140.78 ? 33  ALA G CB    1 
ATOM   8722  N N     . GLU G 1 37  ? 52.537 -90.283  -170.405 1.00 138.97 ? 34  GLU G N     1 
ATOM   8723  C CA    . GLU G 1 37  ? 52.254 -91.712  -170.472 1.00 131.69 ? 34  GLU G CA    1 
ATOM   8724  C C     . GLU G 1 37  ? 50.816 -91.999  -170.058 1.00 128.09 ? 34  GLU G C     1 
ATOM   8725  O O     . GLU G 1 37  ? 50.091 -92.730  -170.746 1.00 121.65 ? 34  GLU G O     1 
ATOM   8726  C CB    . GLU G 1 37  ? 53.232 -92.485  -169.585 1.00 129.57 ? 34  GLU G CB    1 
ATOM   8727  C CG    . GLU G 1 37  ? 54.662 -91.968  -169.606 1.00 144.40 ? 34  GLU G CG    1 
ATOM   8728  C CD    . GLU G 1 37  ? 54.913 -90.918  -168.540 1.00 161.41 ? 34  GLU G CD    1 
ATOM   8729  O OE1   . GLU G 1 37  ? 54.674 -91.211  -167.349 1.00 155.21 ? 34  GLU G OE1   1 
ATOM   8730  O OE2   . GLU G 1 37  ? 55.344 -89.801  -168.892 1.00 161.41 ? 34  GLU G OE2   1 
ATOM   8731  N N     . GLU G 1 38  ? 50.396 -91.441  -168.919 1.00 128.60 ? 35  GLU G N     1 
ATOM   8732  C CA    . GLU G 1 38  ? 49.025 -91.616  -168.451 1.00 122.43 ? 35  GLU G CA    1 
ATOM   8733  C C     . GLU G 1 38  ? 48.022 -91.104  -169.478 1.00 122.61 ? 35  GLU G C     1 
ATOM   8734  O O     . GLU G 1 38  ? 47.020 -91.769  -169.768 1.00 119.29 ? 35  GLU G O     1 
ATOM   8735  C CB    . GLU G 1 38  ? 48.841 -90.902  -167.111 1.00 128.19 ? 35  GLU G CB    1 
ATOM   8736  C CG    . GLU G 1 38  ? 47.566 -91.269  -166.373 1.00 135.28 ? 35  GLU G CG    1 
ATOM   8737  C CD    . GLU G 1 38  ? 47.488 -90.637  -164.997 1.00 147.24 ? 35  GLU G CD    1 
ATOM   8738  O OE1   . GLU G 1 38  ? 46.483 -90.868  -164.292 1.00 147.42 ? 35  GLU G OE1   1 
ATOM   8739  O OE2   . GLU G 1 38  ? 48.429 -89.906  -164.621 1.00 143.90 ? 35  GLU G OE2   1 
ATOM   8740  N N     . TYR G 1 39  ? 48.278 -89.917  -170.037 1.00 128.64 ? 36  TYR G N     1 
ATOM   8741  C CA    . TYR G 1 39  ? 47.393 -89.364  -171.059 1.00 120.89 ? 36  TYR G CA    1 
ATOM   8742  C C     . TYR G 1 39  ? 47.243 -90.317  -172.238 1.00 116.89 ? 36  TYR G C     1 
ATOM   8743  O O     . TYR G 1 39  ? 46.124 -90.643  -172.649 1.00 108.54 ? 36  TYR G O     1 
ATOM   8744  C CB    . TYR G 1 39  ? 47.906 -88.010  -171.554 1.00 95.84  ? 36  TYR G CB    1 
ATOM   8745  C CG    . TYR G 1 39  ? 47.378 -87.706  -172.939 1.00 96.50  ? 36  TYR G CG    1 
ATOM   8746  C CD1   . TYR G 1 39  ? 46.023 -87.483  -173.153 1.00 100.86 ? 36  TYR G CD1   1 
ATOM   8747  C CD2   . TYR G 1 39  ? 48.223 -87.701  -174.041 1.00 121.47 ? 36  TYR G CD2   1 
ATOM   8748  C CE1   . TYR G 1 39  ? 45.531 -87.236  -174.418 1.00 105.36 ? 36  TYR G CE1   1 
ATOM   8749  C CE2   . TYR G 1 39  ? 47.739 -87.453  -175.310 1.00 124.98 ? 36  TYR G CE2   1 
ATOM   8750  C CZ    . TYR G 1 39  ? 46.393 -87.221  -175.491 1.00 117.55 ? 36  TYR G CZ    1 
ATOM   8751  O OH    . TYR G 1 39  ? 45.907 -86.978  -176.754 1.00 131.64 ? 36  TYR G OH    1 
ATOM   8752  N N     . GLN G 1 40  ? 48.367 -90.727  -172.833 1.00 117.57 ? 37  GLN G N     1 
ATOM   8753  C CA    . GLN G 1 40  ? 48.299 -91.563  -174.028 1.00 119.35 ? 37  GLN G CA    1 
ATOM   8754  C C     . GLN G 1 40  ? 47.625 -92.895  -173.730 1.00 124.37 ? 37  GLN G C     1 
ATOM   8755  O O     . GLN G 1 40  ? 46.804 -93.377  -174.524 1.00 123.17 ? 37  GLN G O     1 
ATOM   8756  C CB    . GLN G 1 40  ? 49.699 -91.785  -174.600 1.00 137.15 ? 37  GLN G CB    1 
ATOM   8757  C CG    . GLN G 1 40  ? 49.718 -91.976  -176.107 1.00 151.58 ? 37  GLN G CG    1 
ATOM   8758  C CD    . GLN G 1 40  ? 51.092 -92.328  -176.636 1.00 156.41 ? 37  GLN G CD    1 
ATOM   8759  O OE1   . GLN G 1 40  ? 52.000 -92.651  -175.871 1.00 162.90 ? 37  GLN G OE1   1 
ATOM   8760  N NE2   . GLN G 1 40  ? 51.255 -92.258  -177.952 1.00 150.95 ? 37  GLN G NE2   1 
ATOM   8761  N N     . ALA G 1 41  ? 47.961 -93.506  -172.590 1.00 130.91 ? 38  ALA G N     1 
ATOM   8762  C CA    . ALA G 1 41  ? 47.335 -94.766  -172.207 1.00 117.10 ? 38  ALA G CA    1 
ATOM   8763  C C     . ALA G 1 41  ? 45.825 -94.612  -172.080 1.00 116.30 ? 38  ALA G C     1 
ATOM   8764  O O     . ALA G 1 41  ? 45.062 -95.417  -172.628 1.00 99.57  ? 38  ALA G O     1 
ATOM   8765  C CB    . ALA G 1 41  ? 47.943 -95.273  -170.899 1.00 107.55 ? 38  ALA G CB    1 
ATOM   8766  N N     . ILE G 1 42  ? 45.375 -93.581  -171.357 1.00 116.72 ? 39  ILE G N     1 
ATOM   8767  C CA    . ILE G 1 42  ? 43.943 -93.376  -171.165 1.00 100.02 ? 39  ILE G CA    1 
ATOM   8768  C C     . ILE G 1 42  ? 43.255 -93.122  -172.499 1.00 108.09 ? 39  ILE G C     1 
ATOM   8769  O O     . ILE G 1 42  ? 42.173 -93.656  -172.764 1.00 106.48 ? 39  ILE G O     1 
ATOM   8770  C CB    . ILE G 1 42  ? 43.688 -92.225  -170.174 1.00 104.73 ? 39  ILE G CB    1 
ATOM   8771  C CG1   . ILE G 1 42  ? 44.039 -92.656  -168.751 1.00 119.38 ? 39  ILE G CG1   1 
ATOM   8772  C CG2   . ILE G 1 42  ? 42.234 -91.796  -170.226 1.00 100.38 ? 39  ILE G CG2   1 
ATOM   8773  C CD1   . ILE G 1 42  ? 44.233 -91.504  -167.794 1.00 128.23 ? 39  ILE G CD1   1 
ATOM   8774  N N     . GLN G 1 43  ? 43.865 -92.301  -173.356 1.00 115.25 ? 40  GLN G N     1 
ATOM   8775  C CA    . GLN G 1 43  ? 43.276 -91.998  -174.658 1.00 112.96 ? 40  GLN G CA    1 
ATOM   8776  C C     . GLN G 1 43  ? 43.084 -93.266  -175.484 1.00 115.24 ? 40  GLN G C     1 
ATOM   8777  O O     . GLN G 1 43  ? 41.982 -93.543  -175.983 1.00 110.87 ? 40  GLN G O     1 
ATOM   8778  C CB    . GLN G 1 43  ? 44.160 -90.994  -175.400 1.00 106.21 ? 40  GLN G CB    1 
ATOM   8779  C CG    . GLN G 1 43  ? 43.726 -90.673  -176.825 1.00 123.42 ? 40  GLN G CG    1 
ATOM   8780  C CD    . GLN G 1 43  ? 42.565 -89.696  -176.886 1.00 122.98 ? 40  GLN G CD    1 
ATOM   8781  O OE1   . GLN G 1 43  ? 41.595 -89.810  -176.137 1.00 119.04 ? 40  GLN G OE1   1 
ATOM   8782  N NE2   . GLN G 1 43  ? 42.662 -88.724  -177.786 1.00 125.85 ? 40  GLN G NE2   1 
ATOM   8783  N N     . LYS G 1 44  ? 44.155 -94.051  -175.642 1.00 120.77 ? 41  LYS G N     1 
ATOM   8784  C CA    . LYS G 1 44  ? 44.065 -95.264  -176.448 1.00 115.39 ? 41  LYS G CA    1 
ATOM   8785  C C     . LYS G 1 44  ? 43.087 -96.263  -175.842 1.00 120.93 ? 41  LYS G C     1 
ATOM   8786  O O     . LYS G 1 44  ? 42.349 -96.936  -176.572 1.00 115.44 ? 41  LYS G O     1 
ATOM   8787  C CB    . LYS G 1 44  ? 45.450 -95.890  -176.615 1.00 122.32 ? 41  LYS G CB    1 
ATOM   8788  C CG    . LYS G 1 44  ? 46.456 -94.983  -177.308 1.00 123.60 ? 41  LYS G CG    1 
ATOM   8789  C CD    . LYS G 1 44  ? 47.742 -95.725  -177.632 1.00 143.66 ? 41  LYS G CD    1 
ATOM   8790  C CE    . LYS G 1 44  ? 48.786 -94.790  -178.218 1.00 154.68 ? 41  LYS G CE    1 
ATOM   8791  N NZ    . LYS G 1 44  ? 48.274 -94.063  -179.414 1.00 169.68 ? 41  LYS G NZ    1 
ATOM   8792  N N     . ALA G 1 45  ? 43.062 -96.375  -174.510 1.00 117.62 ? 42  ALA G N     1 
ATOM   8793  C CA    . ALA G 1 45  ? 42.103 -97.268  -173.870 1.00 111.63 ? 42  ALA G CA    1 
ATOM   8794  C C     . ALA G 1 45  ? 40.671 -96.776  -174.041 1.00 114.33 ? 42  ALA G C     1 
ATOM   8795  O O     . ALA G 1 45  ? 39.738 -97.587  -174.066 1.00 118.50 ? 42  ALA G O     1 
ATOM   8796  C CB    . ALA G 1 45  ? 42.442 -97.424  -172.389 1.00 104.20 ? 42  ALA G CB    1 
ATOM   8797  N N     . LEU G 1 46  ? 40.474 -95.462  -174.156 1.00 112.23 ? 43  LEU G N     1 
ATOM   8798  C CA    . LEU G 1 46  ? 39.138 -94.916  -174.342 1.00 116.56 ? 43  LEU G CA    1 
ATOM   8799  C C     . LEU G 1 46  ? 38.665 -95.028  -175.780 1.00 121.51 ? 43  LEU G C     1 
ATOM   8800  O O     . LEU G 1 46  ? 37.454 -94.990  -176.023 1.00 116.53 ? 43  LEU G O     1 
ATOM   8801  C CB    . LEU G 1 46  ? 39.095 -93.451  -173.899 1.00 115.27 ? 43  LEU G CB    1 
ATOM   8802  C CG    . LEU G 1 46  ? 39.023 -93.204  -172.392 1.00 116.78 ? 43  LEU G CG    1 
ATOM   8803  C CD1   . LEU G 1 46  ? 39.006 -91.718  -172.085 1.00 103.33 ? 43  LEU G CD1   1 
ATOM   8804  C CD2   . LEU G 1 46  ? 37.806 -93.891  -171.799 1.00 117.44 ? 43  LEU G CD2   1 
ATOM   8805  N N     . ARG G 1 47  ? 39.585 -95.167  -176.736 1.00 124.54 ? 44  ARG G N     1 
ATOM   8806  C CA    . ARG G 1 47  ? 39.144 -95.470  -178.093 1.00 120.63 ? 44  ARG G CA    1 
ATOM   8807  C C     . ARG G 1 47  ? 38.623 -96.895  -178.237 1.00 123.04 ? 44  ARG G C     1 
ATOM   8808  O O     . ARG G 1 47  ? 38.015 -97.210  -179.265 1.00 128.79 ? 44  ARG G O     1 
ATOM   8809  C CB    . ARG G 1 47  ? 40.274 -95.238  -179.099 1.00 120.68 ? 44  ARG G CB    1 
ATOM   8810  C CG    . ARG G 1 47  ? 40.509 -93.779  -179.441 1.00 121.75 ? 44  ARG G CG    1 
ATOM   8811  C CD    . ARG G 1 47  ? 41.557 -93.626  -180.531 1.00 114.37 ? 44  ARG G CD    1 
ATOM   8812  N NE    . ARG G 1 47  ? 42.917 -93.715  -180.011 1.00 127.36 ? 44  ARG G NE    1 
ATOM   8813  C CZ    . ARG G 1 47  ? 43.767 -92.694  -179.974 1.00 130.40 ? 44  ARG G CZ    1 
ATOM   8814  N NH1   . ARG G 1 47  ? 43.394 -91.503  -180.422 1.00 129.10 ? 44  ARG G NH1   1 
ATOM   8815  N NH2   . ARG G 1 47  ? 44.988 -92.860  -179.485 1.00 135.63 ? 44  ARG G NH2   1 
ATOM   8816  N N     . GLN G 1 48  ? 38.847 -97.755  -177.243 1.00 121.81 ? 45  GLN G N     1 
ATOM   8817  C CA    . GLN G 1 48  ? 38.359 -99.128  -177.299 1.00 132.22 ? 45  GLN G CA    1 
ATOM   8818  C C     . GLN G 1 48  ? 36.835 -99.175  -177.312 1.00 125.93 ? 45  GLN G C     1 
ATOM   8819  O O     . GLN G 1 48  ? 36.155 -98.262  -176.835 1.00 136.51 ? 45  GLN G O     1 
ATOM   8820  C CB    . GLN G 1 48  ? 38.881 -99.927  -176.105 1.00 131.12 ? 45  GLN G CB    1 
ATOM   8821  C CG    . GLN G 1 48  ? 40.364 -100.246 -176.153 1.00 137.02 ? 45  GLN G CG    1 
ATOM   8822  C CD    . GLN G 1 48  ? 40.781 -101.210 -175.058 1.00 141.05 ? 45  GLN G CD    1 
ATOM   8823  O OE1   . GLN G 1 48  ? 40.602 -100.934 -173.871 1.00 137.27 ? 45  GLN G OE1   1 
ATOM   8824  N NE2   . GLN G 1 48  ? 41.340 -102.348 -175.451 1.00 150.86 ? 45  GLN G NE2   1 
ATOM   8825  N N     . ARG G 1 49  ? 36.302 -100.259 -177.865 1.00 122.58 ? 46  ARG G N     1 
ATOM   8826  C CA    . ARG G 1 49  ? 34.888 -100.588 -177.779 1.00 127.50 ? 46  ARG G CA    1 
ATOM   8827  C C     . ARG G 1 49  ? 34.698 -101.756 -176.819 1.00 133.31 ? 46  ARG G C     1 
ATOM   8828  O O     . ARG G 1 49  ? 35.633 -102.508 -176.532 1.00 139.13 ? 46  ARG G O     1 
ATOM   8829  C CB    . ARG G 1 49  ? 34.316 -100.938 -179.157 1.00 130.84 ? 46  ARG G CB    1 
ATOM   8830  C CG    . ARG G 1 49  ? 34.123 -99.742  -180.076 1.00 133.60 ? 46  ARG G CG    1 
ATOM   8831  C CD    . ARG G 1 49  ? 33.581 -100.171 -181.432 1.00 140.59 ? 46  ARG G CD    1 
ATOM   8832  N NE    . ARG G 1 49  ? 33.067 -99.045  -182.208 1.00 150.14 ? 46  ARG G NE    1 
ATOM   8833  C CZ    . ARG G 1 49  ? 33.823 -98.229  -182.936 1.00 142.72 ? 46  ARG G CZ    1 
ATOM   8834  N NH1   . ARG G 1 49  ? 35.136 -98.412  -182.994 1.00 124.19 ? 46  ARG G NH1   1 
ATOM   8835  N NH2   . ARG G 1 49  ? 33.267 -97.231  -183.609 1.00 134.28 ? 46  ARG G NH2   1 
ATOM   8836  N N     . LEU G 1 50  ? 33.473 -101.910 -176.326 1.00 130.36 ? 47  LEU G N     1 
ATOM   8837  C CA    . LEU G 1 50  ? 33.184 -102.926 -175.325 1.00 135.55 ? 47  LEU G CA    1 
ATOM   8838  C C     . LEU G 1 50  ? 32.725 -104.222 -175.982 1.00 136.14 ? 47  LEU G C     1 
ATOM   8839  O O     . LEU G 1 50  ? 32.197 -104.227 -177.097 1.00 137.40 ? 47  LEU G O     1 
ATOM   8840  C CB    . LEU G 1 50  ? 32.117 -102.446 -174.337 1.00 138.29 ? 47  LEU G CB    1 
ATOM   8841  C CG    . LEU G 1 50  ? 32.464 -101.301 -173.379 1.00 127.87 ? 47  LEU G CG    1 
ATOM   8842  C CD1   . LEU G 1 50  ? 33.853 -101.489 -172.776 1.00 126.77 ? 47  LEU G CD1   1 
ATOM   8843  C CD2   . LEU G 1 50  ? 32.336 -99.946  -174.050 1.00 118.52 ? 47  LEU G CD2   1 
ATOM   8844  N N     . GLY G 1 51  ? 32.941 -105.328 -175.275 1.00 122.32 ? 48  GLY G N     1 
ATOM   8845  C CA    . GLY G 1 51  ? 32.523 -106.627 -175.740 1.00 134.71 ? 48  GLY G CA    1 
ATOM   8846  C C     . GLY G 1 51  ? 31.177 -107.035 -175.177 1.00 144.90 ? 48  GLY G C     1 
ATOM   8847  O O     . GLY G 1 51  ? 30.590 -106.338 -174.342 1.00 158.06 ? 48  GLY G O     1 
ATOM   8848  N N     . PRO G 1 52  ? 30.653 -108.174 -175.638 1.00 149.85 ? 49  PRO G N     1 
ATOM   8849  C CA    . PRO G 1 52  ? 29.366 -108.662 -175.114 1.00 144.62 ? 49  PRO G CA    1 
ATOM   8850  C C     . PRO G 1 52  ? 29.355 -108.904 -173.612 1.00 140.78 ? 49  PRO G C     1 
ATOM   8851  O O     . PRO G 1 52  ? 28.268 -108.992 -173.027 1.00 135.58 ? 49  PRO G O     1 
ATOM   8852  C CB    . PRO G 1 52  ? 29.147 -109.967 -175.890 1.00 152.35 ? 49  PRO G CB    1 
ATOM   8853  C CG    . PRO G 1 52  ? 29.898 -109.765 -177.165 1.00 153.30 ? 49  PRO G CG    1 
ATOM   8854  C CD    . PRO G 1 52  ? 31.120 -108.972 -176.786 1.00 154.73 ? 49  PRO G CD    1 
ATOM   8855  N N     . GLU G 1 53  ? 30.519 -109.018 -172.967 1.00 142.16 ? 50  GLU G N     1 
ATOM   8856  C CA    . GLU G 1 53  ? 30.569 -109.243 -171.526 1.00 147.92 ? 50  GLU G CA    1 
ATOM   8857  C C     . GLU G 1 53  ? 30.031 -108.068 -170.722 1.00 138.43 ? 50  GLU G C     1 
ATOM   8858  O O     . GLU G 1 53  ? 29.832 -108.210 -169.510 1.00 151.48 ? 50  GLU G O     1 
ATOM   8859  C CB    . GLU G 1 53  ? 32.003 -109.540 -171.075 1.00 159.01 ? 50  GLU G CB    1 
ATOM   8860  C CG    . GLU G 1 53  ? 32.717 -110.634 -171.856 1.00 179.72 ? 50  GLU G CG    1 
ATOM   8861  C CD    . GLU G 1 53  ? 33.328 -110.132 -173.151 1.00 169.41 ? 50  GLU G CD    1 
ATOM   8862  O OE1   . GLU G 1 53  ? 32.566 -109.800 -174.082 1.00 147.82 ? 50  GLU G OE1   1 
ATOM   8863  O OE2   . GLU G 1 53  ? 34.572 -110.074 -173.239 1.00 174.15 ? 50  GLU G OE2   1 
ATOM   8864  N N     . TYR G 1 54  ? 29.794 -106.922 -171.355 1.00 124.14 ? 51  TYR G N     1 
ATOM   8865  C CA    . TYR G 1 54  ? 29.281 -105.735 -170.683 1.00 124.55 ? 51  TYR G CA    1 
ATOM   8866  C C     . TYR G 1 54  ? 27.857 -105.385 -171.075 1.00 120.33 ? 51  TYR G C     1 
ATOM   8867  O O     . TYR G 1 54  ? 27.057 -105.017 -170.212 1.00 124.53 ? 51  TYR G O     1 
ATOM   8868  C CB    . TYR G 1 54  ? 30.188 -104.536 -170.975 1.00 115.09 ? 51  TYR G CB    1 
ATOM   8869  C CG    . TYR G 1 54  ? 31.542 -104.627 -170.313 1.00 115.89 ? 51  TYR G CG    1 
ATOM   8870  C CD1   . TYR G 1 54  ? 31.665 -105.086 -169.009 1.00 126.05 ? 51  TYR G CD1   1 
ATOM   8871  C CD2   . TYR G 1 54  ? 32.695 -104.258 -170.990 1.00 106.82 ? 51  TYR G CD2   1 
ATOM   8872  C CE1   . TYR G 1 54  ? 32.896 -105.171 -168.397 1.00 132.48 ? 51  TYR G CE1   1 
ATOM   8873  C CE2   . TYR G 1 54  ? 33.932 -104.340 -170.386 1.00 123.10 ? 51  TYR G CE2   1 
ATOM   8874  C CZ    . TYR G 1 54  ? 34.026 -104.798 -169.089 1.00 130.83 ? 51  TYR G CZ    1 
ATOM   8875  O OH    . TYR G 1 54  ? 35.253 -104.883 -168.477 1.00 126.98 ? 51  TYR G OH    1 
ATOM   8876  N N     . ILE G 1 55  ? 27.524 -105.493 -172.361 1.00 100.75 ? 52  ILE G N     1 
ATOM   8877  C CA    . ILE G 1 55  ? 26.199 -105.115 -172.831 1.00 115.48 ? 52  ILE G CA    1 
ATOM   8878  C C     . ILE G 1 55  ? 25.144 -106.049 -172.249 1.00 121.23 ? 52  ILE G C     1 
ATOM   8879  O O     . ILE G 1 55  ? 25.394 -107.236 -171.994 1.00 142.03 ? 52  ILE G O     1 
ATOM   8880  C CB    . ILE G 1 55  ? 26.161 -105.124 -174.370 1.00 127.24 ? 52  ILE G CB    1 
ATOM   8881  C CG1   . ILE G 1 55  ? 27.454 -104.538 -174.941 1.00 118.65 ? 52  ILE G CG1   1 
ATOM   8882  C CG2   . ILE G 1 55  ? 24.970 -104.337 -174.878 1.00 112.19 ? 52  ILE G CG2   1 
ATOM   8883  C CD1   . ILE G 1 55  ? 27.704 -103.095 -174.554 1.00 110.43 ? 52  ILE G CD1   1 
ATOM   8884  N N     . SER G 1 56  ? 23.947 -105.505 -172.033 1.00 110.04 ? 53  SER G N     1 
ATOM   8885  C CA    . SER G 1 56  ? 22.796 -106.293 -171.610 1.00 124.29 ? 53  SER G CA    1 
ATOM   8886  C C     . SER G 1 56  ? 21.611 -105.947 -172.502 1.00 139.34 ? 53  SER G C     1 
ATOM   8887  O O     . SER G 1 56  ? 21.765 -105.198 -173.472 1.00 153.55 ? 53  SER G O     1 
ATOM   8888  C CB    . SER G 1 56  ? 22.471 -106.039 -170.137 1.00 133.66 ? 53  SER G CB    1 
ATOM   8889  O OG    . SER G 1 56  ? 23.540 -106.449 -169.300 1.00 143.04 ? 53  SER G OG    1 
ATOM   8890  N N     . SER G 1 57  ? 20.429 -106.475 -172.194 1.00 144.83 ? 54  SER G N     1 
ATOM   8891  C CA    . SER G 1 57  ? 19.289 -106.297 -173.081 1.00 147.39 ? 54  SER G CA    1 
ATOM   8892  C C     . SER G 1 57  ? 18.006 -106.157 -172.278 1.00 146.06 ? 54  SER G C     1 
ATOM   8893  O O     . SER G 1 57  ? 17.828 -106.820 -171.252 1.00 143.55 ? 54  SER G O     1 
ATOM   8894  C CB    . SER G 1 57  ? 19.163 -107.467 -174.062 1.00 150.39 ? 54  SER G CB    1 
ATOM   8895  O OG    . SER G 1 57  ? 18.561 -108.590 -173.442 1.00 175.90 ? 54  SER G OG    1 
ATOM   8896  N N     . ARG G 1 58  ? 17.119 -105.288 -172.759 1.00 150.60 ? 55  ARG G N     1 
ATOM   8897  C CA    . ARG G 1 58  ? 15.796 -105.091 -172.190 1.00 158.77 ? 55  ARG G CA    1 
ATOM   8898  C C     . ARG G 1 58  ? 14.761 -105.217 -173.300 1.00 163.30 ? 55  ARG G C     1 
ATOM   8899  O O     . ARG G 1 58  ? 15.095 -105.320 -174.484 1.00 157.99 ? 55  ARG G O     1 
ATOM   8900  C CB    . ARG G 1 58  ? 15.675 -103.728 -171.493 1.00 162.42 ? 55  ARG G CB    1 
ATOM   8901  C CG    . ARG G 1 58  ? 15.585 -102.531 -172.421 1.00 164.53 ? 55  ARG G CG    1 
ATOM   8902  C CD    . ARG G 1 58  ? 15.371 -101.260 -171.614 1.00 153.74 ? 55  ARG G CD    1 
ATOM   8903  N NE    . ARG G 1 58  ? 14.068 -101.228 -170.955 1.00 168.58 ? 55  ARG G NE    1 
ATOM   8904  C CZ    . ARG G 1 58  ? 13.647 -100.239 -170.173 1.00 166.39 ? 55  ARG G CZ    1 
ATOM   8905  N NH1   . ARG G 1 58  ? 14.492 -99.294  -169.786 1.00 156.68 ? 55  ARG G NH1   1 
ATOM   8906  N NH2   . ARG G 1 58  ? 12.436 -100.290 -169.636 1.00 173.71 ? 55  ARG G NH2   1 
ATOM   8907  N N     . MET G 1 59  ? 13.490 -105.207 -172.911 1.00 168.74 ? 56  MET G N     1 
ATOM   8908  C CA    . MET G 1 59  ? 12.376 -105.272 -173.855 1.00 171.91 ? 56  MET G CA    1 
ATOM   8909  C C     . MET G 1 59  ? 11.621 -103.948 -173.794 1.00 172.23 ? 56  MET G C     1 
ATOM   8910  O O     . MET G 1 59  ? 10.868 -103.694 -172.850 1.00 164.89 ? 56  MET G O     1 
ATOM   8911  C CB    . MET G 1 59  ? 11.461 -106.453 -173.541 1.00 177.36 ? 56  MET G CB    1 
ATOM   8912  C CG    . MET G 1 59  ? 12.049 -107.806 -173.906 1.00 181.11 ? 56  MET G CG    1 
ATOM   8913  S SD    . MET G 1 59  ? 12.623 -107.884 -175.615 1.00 200.91 ? 56  MET G SD    1 
ATOM   8914  C CE    . MET G 1 59  ? 11.101 -107.569 -176.504 1.00 182.80 ? 56  MET G CE    1 
ATOM   8915  N N     . ALA G 1 60  ? 11.831 -103.105 -174.804 1.00 181.76 ? 57  ALA G N     1 
ATOM   8916  C CA    . ALA G 1 60  ? 11.144 -101.823 -174.872 1.00 185.96 ? 57  ALA G CA    1 
ATOM   8917  C C     . ALA G 1 60  ? 9.641  -102.022 -175.033 1.00 184.01 ? 57  ALA G C     1 
ATOM   8918  O O     . ALA G 1 60  ? 9.180  -102.994 -175.638 1.00 180.98 ? 57  ALA G O     1 
ATOM   8919  C CB    . ALA G 1 60  ? 11.688 -100.987 -176.031 1.00 175.44 ? 57  ALA G CB    1 
ATOM   8920  N N     . GLY G 1 61  ? 8.874  -101.083 -174.485 1.00 188.43 ? 58  GLY G N     1 
ATOM   8921  C CA    . GLY G 1 61  ? 7.431  -101.120 -174.615 1.00 197.96 ? 58  GLY G CA    1 
ATOM   8922  C C     . GLY G 1 61  ? 6.980  -100.779 -176.020 1.00 193.16 ? 58  GLY G C     1 
ATOM   8923  O O     . GLY G 1 61  ? 7.156  -99.645  -176.476 1.00 188.65 ? 58  GLY G O     1 
ATOM   8924  N N     . GLY G 1 62  ? 6.396  -101.754 -176.718 1.00 190.72 ? 59  GLY G N     1 
ATOM   8925  C CA    . GLY G 1 62  ? 6.026  -101.593 -178.107 1.00 178.98 ? 59  GLY G CA    1 
ATOM   8926  C C     . GLY G 1 62  ? 7.164  -101.703 -179.097 1.00 175.80 ? 59  GLY G C     1 
ATOM   8927  O O     . GLY G 1 62  ? 6.916  -101.993 -180.273 1.00 165.42 ? 59  GLY G O     1 
ATOM   8928  N N     . GLY G 1 63  ? 8.404  -101.482 -178.665 1.00 181.82 ? 60  GLY G N     1 
ATOM   8929  C CA    . GLY G 1 63  ? 9.550  -101.569 -179.548 1.00 180.60 ? 60  GLY G CA    1 
ATOM   8930  C C     . GLY G 1 63  ? 10.158 -102.956 -179.577 1.00 188.05 ? 60  GLY G C     1 
ATOM   8931  O O     . GLY G 1 63  ? 9.435  -103.956 -179.553 1.00 192.02 ? 60  GLY G O     1 
ATOM   8932  N N     . GLN G 1 64  ? 11.489 -103.031 -179.625 1.00 189.56 ? 61  GLN G N     1 
ATOM   8933  C CA    . GLN G 1 64  ? 12.175 -104.316 -179.703 1.00 180.59 ? 61  GLN G CA    1 
ATOM   8934  C C     . GLN G 1 64  ? 13.324 -104.393 -178.705 1.00 179.98 ? 61  GLN G C     1 
ATOM   8935  O O     . GLN G 1 64  ? 13.444 -103.546 -177.815 1.00 186.65 ? 61  GLN G O     1 
ATOM   8936  C CB    . GLN G 1 64  ? 12.699 -104.572 -181.121 1.00 175.42 ? 61  GLN G CB    1 
ATOM   8937  C CG    . GLN G 1 64  ? 11.822 -104.032 -182.239 1.00 183.79 ? 61  GLN G CG    1 
ATOM   8938  C CD    . GLN G 1 64  ? 12.268 -102.665 -182.724 1.00 182.85 ? 61  GLN G CD    1 
ATOM   8939  O OE1   . GLN G 1 64  ? 12.456 -101.743 -181.930 1.00 182.68 ? 61  GLN G OE1   1 
ATOM   8940  N NE2   . GLN G 1 64  ? 12.436 -102.526 -184.034 1.00 170.19 ? 61  GLN G NE2   1 
ATOM   8941  N N     . LYS G 1 65  ? 14.155 -105.425 -178.841 1.00 179.54 ? 62  LYS G N     1 
ATOM   8942  C CA    . LYS G 1 65  ? 15.307 -105.616 -177.967 1.00 176.79 ? 62  LYS G CA    1 
ATOM   8943  C C     . LYS G 1 65  ? 16.260 -104.428 -178.046 1.00 160.64 ? 62  LYS G C     1 
ATOM   8944  O O     . LYS G 1 65  ? 16.809 -104.131 -179.111 1.00 143.72 ? 62  LYS G O     1 
ATOM   8945  C CB    . LYS G 1 65  ? 16.021 -106.911 -178.354 1.00 185.16 ? 62  LYS G CB    1 
ATOM   8946  C CG    . LYS G 1 65  ? 17.230 -107.269 -177.508 1.00 177.63 ? 62  LYS G CG    1 
ATOM   8947  C CD    . LYS G 1 65  ? 17.831 -108.583 -177.993 1.00 175.76 ? 62  LYS G CD    1 
ATOM   8948  C CE    . LYS G 1 65  ? 19.111 -108.932 -177.257 1.00 161.08 ? 62  LYS G CE    1 
ATOM   8949  N NZ    . LYS G 1 65  ? 19.661 -110.242 -177.700 1.00 155.76 ? 62  LYS G NZ    1 
ATOM   8950  N N     . VAL G 1 66  ? 16.452 -103.750 -176.915 1.00 160.93 ? 63  VAL G N     1 
ATOM   8951  C CA    . VAL G 1 66  ? 17.384 -102.634 -176.810 1.00 150.65 ? 63  VAL G CA    1 
ATOM   8952  C C     . VAL G 1 66  ? 18.557 -103.062 -175.938 1.00 146.10 ? 63  VAL G C     1 
ATOM   8953  O O     . VAL G 1 66  ? 18.430 -103.945 -175.083 1.00 146.96 ? 63  VAL G O     1 
ATOM   8954  C CB    . VAL G 1 66  ? 16.706 -101.367 -176.242 1.00 139.38 ? 63  VAL G CB    1 
ATOM   8955  C CG1   . VAL G 1 66  ? 17.581 -100.144 -176.467 1.00 135.15 ? 63  VAL G CG1   1 
ATOM   8956  C CG2   . VAL G 1 66  ? 15.337 -101.164 -176.872 1.00 154.03 ? 63  VAL G CG2   1 
ATOM   8957  N N     . CYS G 1 67  ? 19.704 -102.424 -176.155 1.00 144.00 ? 64  CYS G N     1 
ATOM   8958  C CA    . CYS G 1 67  ? 20.942 -102.751 -175.464 1.00 139.55 ? 64  CYS G CA    1 
ATOM   8959  C C     . CYS G 1 67  ? 21.367 -101.602 -174.559 1.00 134.00 ? 64  CYS G C     1 
ATOM   8960  O O     . CYS G 1 67  ? 21.179 -100.429 -174.898 1.00 146.28 ? 64  CYS G O     1 
ATOM   8961  C CB    . CYS G 1 67  ? 22.057 -103.063 -176.466 1.00 144.65 ? 64  CYS G CB    1 
ATOM   8962  S SG    . CYS G 1 67  ? 21.545 -104.107 -177.851 1.00 178.08 ? 64  CYS G SG    1 
ATOM   8963  N N     . TYR G 1 68  ? 21.941 -101.946 -173.407 1.00 119.75 ? 65  TYR G N     1 
ATOM   8964  C CA    . TYR G 1 68  ? 22.371 -100.956 -172.429 1.00 117.32 ? 65  TYR G CA    1 
ATOM   8965  C C     . TYR G 1 68  ? 23.607 -101.480 -171.707 1.00 121.38 ? 65  TYR G C     1 
ATOM   8966  O O     . TYR G 1 68  ? 24.075 -102.593 -171.960 1.00 134.20 ? 65  TYR G O     1 
ATOM   8967  C CB    . TYR G 1 68  ? 21.246 -100.627 -171.439 1.00 130.09 ? 65  TYR G CB    1 
ATOM   8968  C CG    . TYR G 1 68  ? 20.852 -101.776 -170.532 1.00 141.90 ? 65  TYR G CG    1 
ATOM   8969  C CD1   . TYR G 1 68  ? 21.498 -101.983 -169.317 1.00 132.10 ? 65  TYR G CD1   1 
ATOM   8970  C CD2   . TYR G 1 68  ? 19.832 -102.649 -170.887 1.00 146.47 ? 65  TYR G CD2   1 
ATOM   8971  C CE1   . TYR G 1 68  ? 21.141 -103.028 -168.487 1.00 134.39 ? 65  TYR G CE1   1 
ATOM   8972  C CE2   . TYR G 1 68  ? 19.468 -103.697 -170.060 1.00 142.17 ? 65  TYR G CE2   1 
ATOM   8973  C CZ    . TYR G 1 68  ? 20.125 -103.881 -168.861 1.00 135.44 ? 65  TYR G CZ    1 
ATOM   8974  O OH    . TYR G 1 68  ? 19.768 -104.922 -168.036 1.00 131.50 ? 65  TYR G OH    1 
ATOM   8975  N N     . ILE G 1 69  ? 24.134 -100.661 -170.798 1.00 112.60 ? 66  ILE G N     1 
ATOM   8976  C CA    . ILE G 1 69  ? 25.263 -101.027 -169.951 1.00 90.11  ? 66  ILE G CA    1 
ATOM   8977  C C     . ILE G 1 69  ? 24.866 -100.795 -168.500 1.00 99.18  ? 66  ILE G C     1 
ATOM   8978  O O     . ILE G 1 69  ? 24.429 -99.696  -168.140 1.00 107.26 ? 66  ILE G O     1 
ATOM   8979  C CB    . ILE G 1 69  ? 26.532 -100.224 -170.296 1.00 77.56  ? 66  ILE G CB    1 
ATOM   8980  C CG1   . ILE G 1 69  ? 26.866 -100.367 -171.782 1.00 94.15  ? 66  ILE G CG1   1 
ATOM   8981  C CG2   . ILE G 1 69  ? 27.701 -100.692 -169.447 1.00 79.75  ? 66  ILE G CG2   1 
ATOM   8982  C CD1   . ILE G 1 69  ? 28.082 -99.576  -172.213 1.00 110.82 ? 66  ILE G CD1   1 
ATOM   8983  N N     . GLU G 1 70  ? 25.011 -101.830 -167.674 1.00 105.66 ? 67  GLU G N     1 
ATOM   8984  C CA    . GLU G 1 70  ? 24.641 -101.731 -166.269 1.00 114.78 ? 67  GLU G CA    1 
ATOM   8985  C C     . GLU G 1 70  ? 25.492 -100.687 -165.551 1.00 108.11 ? 67  GLU G C     1 
ATOM   8986  O O     . GLU G 1 70  ? 26.619 -100.385 -165.953 1.00 105.52 ? 67  GLU G O     1 
ATOM   8987  C CB    . GLU G 1 70  ? 24.792 -103.092 -165.586 1.00 119.04 ? 67  GLU G CB    1 
ATOM   8988  C CG    . GLU G 1 70  ? 23.871 -104.167 -166.142 1.00 125.67 ? 67  GLU G CG    1 
ATOM   8989  C CD    . GLU G 1 70  ? 23.956 -105.468 -165.369 1.00 131.76 ? 67  GLU G CD    1 
ATOM   8990  O OE1   . GLU G 1 70  ? 23.842 -105.433 -164.125 1.00 137.94 ? 67  GLU G OE1   1 
ATOM   8991  O OE2   . GLU G 1 70  ? 24.133 -106.528 -166.006 1.00 129.59 ? 67  GLU G OE2   1 
ATOM   8992  N N     . GLY G 1 71  ? 24.931 -100.128 -164.480 1.00 101.52 ? 68  GLY G N     1 
ATOM   8993  C CA    . GLY G 1 71  ? 25.582 -99.090  -163.702 1.00 102.24 ? 68  GLY G CA    1 
ATOM   8994  C C     . GLY G 1 71  ? 26.939 -99.475  -163.149 1.00 100.42 ? 68  GLY G C     1 
ATOM   8995  O O     . GLY G 1 71  ? 27.939 -98.799  -163.415 1.00 100.14 ? 68  GLY G O     1 
ATOM   8996  N N     . HIS G 1 72  ? 26.973 -100.551 -162.355 1.00 94.23  ? 69  HIS G N     1 
ATOM   8997  C CA    . HIS G 1 72  ? 28.228 -101.025 -161.778 1.00 103.69 ? 69  HIS G CA    1 
ATOM   8998  C C     . HIS G 1 72  ? 29.289 -101.260 -162.843 1.00 112.02 ? 69  HIS G C     1 
ATOM   8999  O O     . HIS G 1 72  ? 30.482 -101.062 -162.585 1.00 111.35 ? 69  HIS G O     1 
ATOM   9000  C CB    . HIS G 1 72  ? 27.988 -102.310 -160.983 1.00 106.87 ? 69  HIS G CB    1 
ATOM   9001  C CG    . HIS G 1 72  ? 27.308 -103.389 -161.768 1.00 121.94 ? 69  HIS G CG    1 
ATOM   9002  N ND1   . HIS G 1 72  ? 27.998 -104.421 -162.367 1.00 122.54 ? 69  HIS G ND1   1 
ATOM   9003  C CD2   . HIS G 1 72  ? 26.001 -103.596 -162.052 1.00 125.66 ? 69  HIS G CD2   1 
ATOM   9004  C CE1   . HIS G 1 72  ? 27.145 -105.217 -162.986 1.00 127.67 ? 69  HIS G CE1   1 
ATOM   9005  N NE2   . HIS G 1 72  ? 25.926 -104.739 -162.811 1.00 129.39 ? 69  HIS G NE2   1 
ATOM   9006  N N     . ARG G 1 73  ? 28.877 -101.682 -164.041 1.00 116.26 ? 70  ARG G N     1 
ATOM   9007  C CA    . ARG G 1 73  ? 29.823 -101.851 -165.139 1.00 127.21 ? 70  ARG G CA    1 
ATOM   9008  C C     . ARG G 1 73  ? 30.546 -100.545 -165.445 1.00 107.79 ? 70  ARG G C     1 
ATOM   9009  O O     . ARG G 1 73  ? 31.780 -100.498 -165.476 1.00 110.06 ? 70  ARG G O     1 
ATOM   9010  C CB    . ARG G 1 73  ? 29.092 -102.362 -166.382 1.00 124.20 ? 70  ARG G CB    1 
ATOM   9011  C CG    . ARG G 1 73  ? 28.374 -103.689 -166.190 1.00 127.70 ? 70  ARG G CG    1 
ATOM   9012  C CD    . ARG G 1 73  ? 29.290 -104.871 -166.466 1.00 129.83 ? 70  ARG G CD    1 
ATOM   9013  N NE    . ARG G 1 73  ? 28.650 -106.147 -166.158 1.00 140.54 ? 70  ARG G NE    1 
ATOM   9014  C CZ    . ARG G 1 73  ? 27.704 -106.713 -166.902 1.00 138.02 ? 70  ARG G CZ    1 
ATOM   9015  N NH1   . ARG G 1 73  ? 27.279 -106.120 -168.009 1.00 109.86 ? 70  ARG G NH1   1 
ATOM   9016  N NH2   . ARG G 1 73  ? 27.183 -107.877 -166.539 1.00 157.38 ? 70  ARG G NH2   1 
ATOM   9017  N N     . VAL G 1 74  ? 29.786 -99.470  -165.670 1.00 103.34 ? 71  VAL G N     1 
ATOM   9018  C CA    . VAL G 1 74  ? 30.386 -98.174  -165.974 1.00 104.15 ? 71  VAL G CA    1 
ATOM   9019  C C     . VAL G 1 74  ? 31.201 -97.668  -164.790 1.00 93.67  ? 71  VAL G C     1 
ATOM   9020  O O     . VAL G 1 74  ? 32.252 -97.038  -164.965 1.00 80.84  ? 71  VAL G O     1 
ATOM   9021  C CB    . VAL G 1 74  ? 29.298 -97.164  -166.384 1.00 109.45 ? 71  VAL G CB    1 
ATOM   9022  C CG1   . VAL G 1 74  ? 29.922 -95.974  -167.096 1.00 97.30  ? 71  VAL G CG1   1 
ATOM   9023  C CG2   . VAL G 1 74  ? 28.256 -97.833  -167.265 1.00 115.09 ? 71  VAL G CG2   1 
ATOM   9024  N N     . ILE G 1 75  ? 30.722 -97.918  -163.570 1.00 99.67  ? 72  ILE G N     1 
ATOM   9025  C CA    . ILE G 1 75  ? 31.442 -97.471  -162.379 1.00 98.51  ? 72  ILE G CA    1 
ATOM   9026  C C     . ILE G 1 75  ? 32.823 -98.116  -162.319 1.00 102.82 ? 72  ILE G C     1 
ATOM   9027  O O     . ILE G 1 75  ? 33.837 -97.440  -162.099 1.00 102.17 ? 72  ILE G O     1 
ATOM   9028  C CB    . ILE G 1 75  ? 30.619 -97.769  -161.112 1.00 91.10  ? 72  ILE G CB    1 
ATOM   9029  C CG1   . ILE G 1 75  ? 29.416 -96.828  -161.026 1.00 87.51  ? 72  ILE G CG1   1 
ATOM   9030  C CG2   . ILE G 1 75  ? 31.484 -97.647  -159.867 1.00 84.57  ? 72  ILE G CG2   1 
ATOM   9031  C CD1   . ILE G 1 75  ? 28.741 -96.812  -159.670 1.00 101.40 ? 72  ILE G CD1   1 
ATOM   9032  N N     . ASN G 1 76  ? 32.880 -99.438  -162.509 1.00 100.17 ? 73  ASN G N     1 
ATOM   9033  C CA    . ASN G 1 76  ? 34.163 -100.135 -162.527 1.00 96.92  ? 73  ASN G CA    1 
ATOM   9034  C C     . ASN G 1 76  ? 35.028 -99.677  -163.693 1.00 92.64  ? 73  ASN G C     1 
ATOM   9035  O O     . ASN G 1 76  ? 36.247 -99.528  -163.548 1.00 84.45  ? 73  ASN G O     1 
ATOM   9036  C CB    . ASN G 1 76  ? 33.944 -101.646 -162.583 1.00 108.42 ? 73  ASN G CB    1 
ATOM   9037  C CG    . ASN G 1 76  ? 33.442 -102.209 -161.268 1.00 114.92 ? 73  ASN G CG    1 
ATOM   9038  O OD1   . ASN G 1 76  ? 33.945 -101.863 -160.198 1.00 95.24  ? 73  ASN G OD1   1 
ATOM   9039  N ND2   . ASN G 1 76  ? 32.447 -103.086 -161.341 1.00 116.23 ? 73  ASN G ND2   1 
ATOM   9040  N N     . LEU G 1 77  ? 34.420 -99.470  -164.865 1.00 96.86  ? 74  LEU G N     1 
ATOM   9041  C CA    . LEU G 1 77  ? 35.176 -98.981  -166.014 1.00 92.08  ? 74  LEU G CA    1 
ATOM   9042  C C     . LEU G 1 77  ? 35.856 -97.655  -165.700 1.00 94.64  ? 74  LEU G C     1 
ATOM   9043  O O     . LEU G 1 77  ? 37.027 -97.454  -166.037 1.00 96.60  ? 74  LEU G O     1 
ATOM   9044  C CB    . LEU G 1 77  ? 34.258 -98.839  -167.227 1.00 91.08  ? 74  LEU G CB    1 
ATOM   9045  C CG    . LEU G 1 77  ? 33.806 -100.129 -167.912 1.00 84.98  ? 74  LEU G CG    1 
ATOM   9046  C CD1   . LEU G 1 77  ? 32.623 -99.860  -168.831 1.00 92.61  ? 74  LEU G CD1   1 
ATOM   9047  C CD2   . LEU G 1 77  ? 34.955 -100.759 -168.683 1.00 104.37 ? 74  LEU G CD2   1 
ATOM   9048  N N     . ALA G 1 78  ? 35.135 -96.739  -165.052 1.00 86.56  ? 75  ALA G N     1 
ATOM   9049  C CA    . ALA G 1 78  ? 35.720 -95.453  -164.686 1.00 87.50  ? 75  ALA G CA    1 
ATOM   9050  C C     . ALA G 1 78  ? 36.808 -95.626  -163.633 1.00 90.76  ? 75  ALA G C     1 
ATOM   9051  O O     . ALA G 1 78  ? 37.902 -95.060  -163.755 1.00 99.74  ? 75  ALA G O     1 
ATOM   9052  C CB    . ALA G 1 78  ? 34.632 -94.503  -164.188 1.00 87.92  ? 75  ALA G CB    1 
ATOM   9053  N N     . ASN G 1 79  ? 36.522 -96.407  -162.586 1.00 85.16  ? 76  ASN G N     1 
ATOM   9054  C CA    . ASN G 1 79  ? 37.507 -96.646  -161.537 1.00 93.50  ? 76  ASN G CA    1 
ATOM   9055  C C     . ASN G 1 79  ? 38.774 -97.304  -162.068 1.00 101.02 ? 76  ASN G C     1 
ATOM   9056  O O     . ASN G 1 79  ? 39.832 -97.181  -161.442 1.00 111.21 ? 76  ASN G O     1 
ATOM   9057  C CB    . ASN G 1 79  ? 36.900 -97.512  -160.433 1.00 98.71  ? 76  ASN G CB    1 
ATOM   9058  C CG    . ASN G 1 79  ? 35.976 -96.729  -159.523 1.00 94.39  ? 76  ASN G CG    1 
ATOM   9059  O OD1   . ASN G 1 79  ? 36.424 -95.903  -158.727 1.00 102.55 ? 76  ASN G OD1   1 
ATOM   9060  N ND2   . ASN G 1 79  ? 34.679 -96.985  -159.636 1.00 91.22  ? 76  ASN G ND2   1 
ATOM   9061  N N     . GLU G 1 80  ? 38.692 -98.008  -163.194 1.00 97.08  ? 77  GLU G N     1 
ATOM   9062  C CA    . GLU G 1 80  ? 39.887 -98.576  -163.805 1.00 104.24 ? 77  GLU G CA    1 
ATOM   9063  C C     . GLU G 1 80  ? 40.586 -97.578  -164.723 1.00 110.54 ? 77  GLU G C     1 
ATOM   9064  O O     . GLU G 1 80  ? 41.809 -97.419  -164.650 1.00 124.29 ? 77  GLU G O     1 
ATOM   9065  C CB    . GLU G 1 80  ? 39.534 -99.851  -164.578 1.00 115.84 ? 77  GLU G CB    1 
ATOM   9066  C CG    . GLU G 1 80  ? 39.035 -100.998 -163.706 1.00 129.53 ? 77  GLU G CG    1 
ATOM   9067  C CD    . GLU G 1 80  ? 40.003 -101.366 -162.597 1.00 143.17 ? 77  GLU G CD    1 
ATOM   9068  O OE1   . GLU G 1 80  ? 41.231 -101.285 -162.819 1.00 155.77 ? 77  GLU G OE1   1 
ATOM   9069  O OE2   . GLU G 1 80  ? 39.536 -101.736 -161.500 1.00 132.29 ? 77  GLU G OE2   1 
ATOM   9070  N N     . MET G 1 81  ? 39.825 -96.908  -165.590 1.00 105.39 ? 78  MET G N     1 
ATOM   9071  C CA    . MET G 1 81  ? 40.413 -95.972  -166.543 1.00 100.22 ? 78  MET G CA    1 
ATOM   9072  C C     . MET G 1 81  ? 41.134 -94.833  -165.834 1.00 102.36 ? 78  MET G C     1 
ATOM   9073  O O     . MET G 1 81  ? 42.268 -94.486  -166.185 1.00 94.47  ? 78  MET G O     1 
ATOM   9074  C CB    . MET G 1 81  ? 39.326 -95.422  -167.468 1.00 103.38 ? 78  MET G CB    1 
ATOM   9075  C CG    . MET G 1 81  ? 38.831 -96.411  -168.507 1.00 111.72 ? 78  MET G CG    1 
ATOM   9076  S SD    . MET G 1 81  ? 40.055 -96.799  -169.771 1.00 141.56 ? 78  MET G SD    1 
ATOM   9077  C CE    . MET G 1 81  ? 40.847 -95.207  -169.986 1.00 114.26 ? 78  MET G CE    1 
ATOM   9078  N N     . PHE G 1 82  ? 40.496 -94.243  -164.823 1.00 109.08 ? 79  PHE G N     1 
ATOM   9079  C CA    . PHE G 1 82  ? 41.039 -93.076  -164.142 1.00 106.39 ? 79  PHE G CA    1 
ATOM   9080  C C     . PHE G 1 82  ? 41.593 -93.371  -162.759 1.00 108.09 ? 79  PHE G C     1 
ATOM   9081  O O     . PHE G 1 82  ? 42.498 -92.665  -162.309 1.00 114.38 ? 79  PHE G O     1 
ATOM   9082  C CB    . PHE G 1 82  ? 39.964 -91.991  -164.018 1.00 92.38  ? 79  PHE G CB    1 
ATOM   9083  C CG    . PHE G 1 82  ? 39.201 -91.752  -165.287 1.00 91.76  ? 79  PHE G CG    1 
ATOM   9084  C CD1   . PHE G 1 82  ? 37.849 -92.044  -165.363 1.00 87.92  ? 79  PHE G CD1   1 
ATOM   9085  C CD2   . PHE G 1 82  ? 39.839 -91.255  -166.409 1.00 92.02  ? 79  PHE G CD2   1 
ATOM   9086  C CE1   . PHE G 1 82  ? 37.145 -91.831  -166.532 1.00 85.82  ? 79  PHE G CE1   1 
ATOM   9087  C CE2   . PHE G 1 82  ? 39.141 -91.039  -167.581 1.00 92.53  ? 79  PHE G CE2   1 
ATOM   9088  C CZ    . PHE G 1 82  ? 37.792 -91.328  -167.644 1.00 95.98  ? 79  PHE G CZ    1 
ATOM   9089  N N     . GLY G 1 83  ? 41.079 -94.381  -162.079 1.00 93.73  ? 80  GLY G N     1 
ATOM   9090  C CA    . GLY G 1 83  ? 41.452 -94.653  -160.708 1.00 93.50  ? 80  GLY G CA    1 
ATOM   9091  C C     . GLY G 1 83  ? 40.282 -94.433  -159.765 1.00 97.54  ? 80  GLY G C     1 
ATOM   9092  O O     . GLY G 1 83  ? 39.269 -93.821  -160.108 1.00 106.90 ? 80  GLY G O     1 
ATOM   9093  N N     . TYR G 1 84  ? 40.426 -94.957  -158.543 1.00 87.03  ? 81  TYR G N     1 
ATOM   9094  C CA    . TYR G 1 84  ? 39.392 -94.735  -157.537 1.00 77.33  ? 81  TYR G CA    1 
ATOM   9095  C C     . TYR G 1 84  ? 39.295 -93.265  -157.157 1.00 93.34  ? 81  TYR G C     1 
ATOM   9096  O O     . TYR G 1 84  ? 38.233 -92.804  -156.724 1.00 107.53 ? 81  TYR G O     1 
ATOM   9097  C CB    . TYR G 1 84  ? 39.671 -95.575  -156.293 1.00 82.72  ? 81  TYR G CB    1 
ATOM   9098  C CG    . TYR G 1 84  ? 40.769 -95.014  -155.416 1.00 69.92  ? 81  TYR G CG    1 
ATOM   9099  C CD1   . TYR G 1 84  ? 42.105 -95.186  -155.748 1.00 79.57  ? 81  TYR G CD1   1 
ATOM   9100  C CD2   . TYR G 1 84  ? 40.467 -94.305  -154.260 1.00 83.29  ? 81  TYR G CD2   1 
ATOM   9101  C CE1   . TYR G 1 84  ? 43.111 -94.672  -154.951 1.00 81.54  ? 81  TYR G CE1   1 
ATOM   9102  C CE2   . TYR G 1 84  ? 41.467 -93.784  -153.460 1.00 93.71  ? 81  TYR G CE2   1 
ATOM   9103  C CZ    . TYR G 1 84  ? 42.787 -93.972  -153.809 1.00 87.60  ? 81  TYR G CZ    1 
ATOM   9104  O OH    . TYR G 1 84  ? 43.787 -93.460  -153.013 1.00 88.12  ? 81  TYR G OH    1 
ATOM   9105  N N     . ASN G 1 85  ? 40.390 -92.519  -157.311 1.00 90.31  ? 82  ASN G N     1 
ATOM   9106  C CA    . ASN G 1 85  ? 40.429 -91.093  -157.013 1.00 83.81  ? 82  ASN G CA    1 
ATOM   9107  C C     . ASN G 1 85  ? 40.812 -90.277  -158.242 1.00 90.35  ? 82  ASN G C     1 
ATOM   9108  O O     . ASN G 1 85  ? 41.228 -89.121  -158.112 1.00 104.40 ? 82  ASN G O     1 
ATOM   9109  C CB    . ASN G 1 85  ? 41.394 -90.811  -155.860 1.00 78.52  ? 82  ASN G CB    1 
ATOM   9110  C CG    . ASN G 1 85  ? 42.839 -91.052  -156.239 1.00 84.87  ? 82  ASN G CG    1 
ATOM   9111  O OD1   . ASN G 1 85  ? 43.168 -92.053  -156.874 1.00 75.98  ? 82  ASN G OD1   1 
ATOM   9112  N ND2   . ASN G 1 85  ? 43.713 -90.132  -155.849 1.00 92.28  ? 82  ASN G ND2   1 
ATOM   9113  N N     . GLY G 1 86  ? 40.679 -90.858  -159.431 1.00 82.92  ? 83  GLY G N     1 
ATOM   9114  C CA    . GLY G 1 86  ? 41.000 -90.161  -160.660 1.00 101.44 ? 83  GLY G CA    1 
ATOM   9115  C C     . GLY G 1 86  ? 39.772 -89.542  -161.288 1.00 90.17  ? 83  GLY G C     1 
ATOM   9116  O O     . GLY G 1 86  ? 39.875 -88.629  -162.112 1.00 94.87  ? 83  GLY G O     1 
ATOM   9117  N N     . TRP G 1 87  ? 38.599 -90.037  -160.902 1.00 77.06  ? 84  TRP G N     1 
ATOM   9118  C CA    . TRP G 1 87  ? 37.332 -89.500  -161.366 1.00 75.87  ? 84  TRP G CA    1 
ATOM   9119  C C     . TRP G 1 87  ? 36.474 -89.153  -160.159 1.00 78.63  ? 84  TRP G C     1 
ATOM   9120  O O     . TRP G 1 87  ? 36.677 -89.667  -159.056 1.00 80.67  ? 84  TRP G O     1 
ATOM   9121  C CB    . TRP G 1 87  ? 36.589 -90.493  -162.272 1.00 79.40  ? 84  TRP G CB    1 
ATOM   9122  C CG    . TRP G 1 87  ? 35.958 -91.624  -161.520 1.00 83.93  ? 84  TRP G CG    1 
ATOM   9123  C CD1   . TRP G 1 87  ? 36.603 -92.625  -160.856 1.00 92.08  ? 84  TRP G CD1   1 
ATOM   9124  C CD2   . TRP G 1 87  ? 34.557 -91.870  -161.353 1.00 76.21  ? 84  TRP G CD2   1 
ATOM   9125  N NE1   . TRP G 1 87  ? 35.692 -93.479  -160.285 1.00 91.68  ? 84  TRP G NE1   1 
ATOM   9126  C CE2   . TRP G 1 87  ? 34.428 -93.039  -160.576 1.00 86.16  ? 84  TRP G CE2   1 
ATOM   9127  C CE3   . TRP G 1 87  ? 33.398 -91.218  -161.786 1.00 78.64  ? 84  TRP G CE3   1 
ATOM   9128  C CZ2   . TRP G 1 87  ? 33.189 -93.568  -160.223 1.00 96.40  ? 84  TRP G CZ2   1 
ATOM   9129  C CZ3   . TRP G 1 87  ? 32.169 -91.745  -161.433 1.00 87.19  ? 84  TRP G CZ3   1 
ATOM   9130  C CH2   . TRP G 1 87  ? 32.074 -92.908  -160.660 1.00 90.45  ? 84  TRP G CH2   1 
ATOM   9131  N N     . ALA G 1 88  ? 35.507 -88.267  -160.382 1.00 80.10  ? 85  ALA G N     1 
ATOM   9132  C CA    . ALA G 1 88  ? 34.599 -87.837  -159.330 1.00 73.09  ? 85  ALA G CA    1 
ATOM   9133  C C     . ALA G 1 88  ? 33.305 -87.366  -159.972 1.00 73.85  ? 85  ALA G C     1 
ATOM   9134  O O     . ALA G 1 88  ? 33.327 -86.781  -161.058 1.00 69.63  ? 85  ALA G O     1 
ATOM   9135  C CB    . ALA G 1 88  ? 35.214 -86.716  -158.485 1.00 72.87  ? 85  ALA G CB    1 
ATOM   9136  N N     . HIS G 1 89  ? 32.185 -87.620  -159.301 1.00 71.43  ? 86  HIS G N     1 
ATOM   9137  C CA    . HIS G 1 89  ? 30.886 -87.174  -159.781 1.00 72.28  ? 86  HIS G CA    1 
ATOM   9138  C C     . HIS G 1 89  ? 30.151 -86.454  -158.659 1.00 71.63  ? 86  HIS G C     1 
ATOM   9139  O O     . HIS G 1 89  ? 30.455 -86.625  -157.475 1.00 63.29  ? 86  HIS G O     1 
ATOM   9140  C CB    . HIS G 1 89  ? 30.033 -88.337  -160.314 1.00 68.17  ? 86  HIS G CB    1 
ATOM   9141  C CG    . HIS G 1 89  ? 29.289 -89.086  -159.253 1.00 72.59  ? 86  HIS G CG    1 
ATOM   9142  N ND1   . HIS G 1 89  ? 29.908 -89.630  -158.148 1.00 83.05  ? 86  HIS G ND1   1 
ATOM   9143  C CD2   . HIS G 1 89  ? 27.974 -89.386  -159.132 1.00 63.53  ? 86  HIS G CD2   1 
ATOM   9144  C CE1   . HIS G 1 89  ? 29.006 -90.229  -157.390 1.00 87.74  ? 86  HIS G CE1   1 
ATOM   9145  N NE2   . HIS G 1 89  ? 27.825 -90.096  -157.965 1.00 84.80  ? 86  HIS G NE2   1 
ATOM   9146  N N     . SER G 1 90  ? 29.180 -85.633  -159.052 1.00 71.50  ? 87  SER G N     1 
ATOM   9147  C CA    . SER G 1 90  ? 28.405 -84.849  -158.103 1.00 78.27  ? 87  SER G CA    1 
ATOM   9148  C C     . SER G 1 90  ? 27.027 -84.584  -158.689 1.00 72.49  ? 87  SER G C     1 
ATOM   9149  O O     . SER G 1 90  ? 26.851 -84.550  -159.910 1.00 66.44  ? 87  SER G O     1 
ATOM   9150  C CB    . SER G 1 90  ? 29.102 -83.527  -157.761 1.00 91.12  ? 87  SER G CB    1 
ATOM   9151  O OG    . SER G 1 90  ? 29.545 -82.865  -158.934 1.00 80.85  ? 87  SER G OG    1 
ATOM   9152  N N     . ILE G 1 91  ? 26.050 -84.399  -157.804 1.00 60.62  ? 88  ILE G N     1 
ATOM   9153  C CA    . ILE G 1 91  ? 24.676 -84.119  -158.205 1.00 59.65  ? 88  ILE G CA    1 
ATOM   9154  C C     . ILE G 1 91  ? 24.506 -82.604  -158.204 1.00 74.53  ? 88  ILE G C     1 
ATOM   9155  O O     . ILE G 1 91  ? 24.389 -81.979  -157.149 1.00 85.35  ? 88  ILE G O     1 
ATOM   9156  C CB    . ILE G 1 91  ? 23.664 -84.802  -157.284 1.00 68.83  ? 88  ILE G CB    1 
ATOM   9157  C CG1   . ILE G 1 91  ? 24.007 -86.284  -157.125 1.00 71.43  ? 88  ILE G CG1   1 
ATOM   9158  C CG2   . ILE G 1 91  ? 22.253 -84.631  -157.827 1.00 72.98  ? 88  ILE G CG2   1 
ATOM   9159  C CD1   . ILE G 1 91  ? 23.096 -87.017  -156.171 1.00 69.25  ? 88  ILE G CD1   1 
ATOM   9160  N N     . THR G 1 92  ? 24.498 -82.009  -159.399 1.00 88.04  ? 89  THR G N     1 
ATOM   9161  C CA    . THR G 1 92  ? 24.311 -80.566  -159.498 1.00 71.50  ? 89  THR G CA    1 
ATOM   9162  C C     . THR G 1 92  ? 22.909 -80.164  -159.057 1.00 83.22  ? 89  THR G C     1 
ATOM   9163  O O     . THR G 1 92  ? 22.742 -79.189  -158.313 1.00 110.97 ? 89  THR G O     1 
ATOM   9164  C CB    . THR G 1 92  ? 24.583 -80.097  -160.928 1.00 67.92  ? 89  THR G CB    1 
ATOM   9165  O OG1   . THR G 1 92  ? 25.981 -80.225  -161.213 1.00 81.30  ? 89  THR G OG1   1 
ATOM   9166  C CG2   . THR G 1 92  ? 24.173 -78.642  -161.102 1.00 77.40  ? 89  THR G CG2   1 
ATOM   9167  N N     . GLN G 1 93  ? 21.895 -80.912  -159.486 1.00 70.40  ? 90  GLN G N     1 
ATOM   9168  C CA    . GLN G 1 93  ? 20.520 -80.643  -159.089 1.00 76.23  ? 90  GLN G CA    1 
ATOM   9169  C C     . GLN G 1 93  ? 19.661 -81.847  -159.439 1.00 74.50  ? 90  GLN G C     1 
ATOM   9170  O O     . GLN G 1 93  ? 19.823 -82.437  -160.510 1.00 70.87  ? 90  GLN G O     1 
ATOM   9171  C CB    . GLN G 1 93  ? 19.974 -79.385  -159.781 1.00 76.50  ? 90  GLN G CB    1 
ATOM   9172  C CG    . GLN G 1 93  ? 18.542 -79.041  -159.402 1.00 82.72  ? 90  GLN G CG    1 
ATOM   9173  C CD    . GLN G 1 93  ? 18.066 -77.747  -160.032 1.00 112.67 ? 90  GLN G CD    1 
ATOM   9174  O OE1   . GLN G 1 93  ? 18.056 -77.605  -161.254 1.00 130.91 ? 90  GLN G OE1   1 
ATOM   9175  N NE2   . GLN G 1 93  ? 17.670 -76.793  -159.196 1.00 116.25 ? 90  GLN G NE2   1 
ATOM   9176  N N     . GLN G 1 94  ? 18.753 -82.200  -158.532 1.00 79.24  ? 91  GLN G N     1 
ATOM   9177  C CA    . GLN G 1 94  ? 17.750 -83.228  -158.772 1.00 65.48  ? 91  GLN G CA    1 
ATOM   9178  C C     . GLN G 1 94  ? 16.377 -82.651  -158.467 1.00 70.45  ? 91  GLN G C     1 
ATOM   9179  O O     . GLN G 1 94  ? 16.158 -82.106  -157.381 1.00 84.13  ? 91  GLN G O     1 
ATOM   9180  C CB    . GLN G 1 94  ? 18.004 -84.471  -157.915 1.00 74.25  ? 91  GLN G CB    1 
ATOM   9181  C CG    . GLN G 1 94  ? 16.777 -85.351  -157.745 1.00 99.10  ? 91  GLN G CG    1 
ATOM   9182  C CD    . GLN G 1 94  ? 17.104 -86.703  -157.148 1.00 81.64  ? 91  GLN G CD    1 
ATOM   9183  O OE1   . GLN G 1 94  ? 16.506 -87.117  -156.155 1.00 87.65  ? 91  GLN G OE1   1 
ATOM   9184  N NE2   . GLN G 1 94  ? 18.052 -87.403  -157.756 1.00 56.56  ? 91  GLN G NE2   1 
ATOM   9185  N N     . ASN G 1 95  ? 15.456 -82.779  -159.420 1.00 75.44  ? 92  ASN G N     1 
ATOM   9186  C CA    . ASN G 1 95  ? 14.124 -82.203  -159.301 1.00 91.35  ? 92  ASN G CA    1 
ATOM   9187  C C     . ASN G 1 95  ? 13.085 -83.232  -159.718 1.00 85.15  ? 92  ASN G C     1 
ATOM   9188  O O     . ASN G 1 95  ? 13.184 -83.814  -160.803 1.00 82.12  ? 92  ASN G O     1 
ATOM   9189  C CB    . ASN G 1 95  ? 13.994 -80.938  -160.159 1.00 106.84 ? 92  ASN G CB    1 
ATOM   9190  C CG    . ASN G 1 95  ? 12.622 -80.302  -160.055 1.00 113.99 ? 92  ASN G CG    1 
ATOM   9191  O OD1   . ASN G 1 95  ? 12.283 -79.694  -159.040 1.00 119.95 ? 92  ASN G OD1   1 
ATOM   9192  N ND2   . ASN G 1 95  ? 11.825 -80.438  -161.109 1.00 107.81 ? 92  ASN G ND2   1 
ATOM   9193  N N     . VAL G 1 96  ? 12.094 -83.448  -158.859 1.00 85.12  ? 93  VAL G N     1 
ATOM   9194  C CA    . VAL G 1 96  ? 10.991 -84.355  -159.161 1.00 68.08  ? 93  VAL G CA    1 
ATOM   9195  C C     . VAL G 1 96  ? 10.035 -83.648  -160.114 1.00 76.88  ? 93  VAL G C     1 
ATOM   9196  O O     . VAL G 1 96  ? 9.470  -82.601  -159.780 1.00 108.06 ? 93  VAL G O     1 
ATOM   9197  C CB    . VAL G 1 96  ? 10.270 -84.799  -157.881 1.00 71.10  ? 93  VAL G CB    1 
ATOM   9198  C CG1   . VAL G 1 96  ? 9.118  -85.729  -158.219 1.00 76.91  ? 93  VAL G CG1   1 
ATOM   9199  C CG2   . VAL G 1 96  ? 11.245 -85.475  -156.928 1.00 77.52  ? 93  VAL G CG2   1 
ATOM   9200  N N     . ASP G 1 97  ? 9.852  -84.220  -161.305 1.00 82.79  ? 94  ASP G N     1 
ATOM   9201  C CA    . ASP G 1 97  ? 9.023  -83.573  -162.317 1.00 82.68  ? 94  ASP G CA    1 
ATOM   9202  C C     . ASP G 1 97  ? 7.543  -83.646  -161.959 1.00 84.98  ? 94  ASP G C     1 
ATOM   9203  O O     . ASP G 1 97  ? 6.833  -82.635  -162.011 1.00 102.15 ? 94  ASP G O     1 
ATOM   9204  C CB    . ASP G 1 97  ? 9.280  -84.201  -163.686 1.00 79.19  ? 94  ASP G CB    1 
ATOM   9205  C CG    . ASP G 1 97  ? 10.553 -83.690  -164.331 1.00 76.90  ? 94  ASP G CG    1 
ATOM   9206  O OD1   . ASP G 1 97  ? 10.734 -82.456  -164.396 1.00 94.10  ? 94  ASP G OD1   1 
ATOM   9207  O OD2   . ASP G 1 97  ? 11.373 -84.519  -164.774 1.00 87.62  ? 94  ASP G OD2   1 
ATOM   9208  N N     . PHE G 1 98  ? 7.058  -84.830  -161.592 1.00 84.28  ? 95  PHE G N     1 
ATOM   9209  C CA    . PHE G 1 98  ? 5.638  -84.992  -161.313 1.00 91.08  ? 95  PHE G CA    1 
ATOM   9210  C C     . PHE G 1 98  ? 5.426  -86.207  -160.423 1.00 88.67  ? 95  PHE G C     1 
ATOM   9211  O O     . PHE G 1 98  ? 6.263  -87.111  -160.360 1.00 78.35  ? 95  PHE G O     1 
ATOM   9212  C CB    . PHE G 1 98  ? 4.827  -85.131  -162.609 1.00 96.08  ? 95  PHE G CB    1 
ATOM   9213  C CG    . PHE G 1 98  ? 5.196  -86.337  -163.432 1.00 107.64 ? 95  PHE G CG    1 
ATOM   9214  C CD1   . PHE G 1 98  ? 4.596  -87.566  -163.202 1.00 114.16 ? 95  PHE G CD1   1 
ATOM   9215  C CD2   . PHE G 1 98  ? 6.149  -86.242  -164.432 1.00 105.02 ? 95  PHE G CD2   1 
ATOM   9216  C CE1   . PHE G 1 98  ? 4.937  -88.674  -163.955 1.00 109.92 ? 95  PHE G CE1   1 
ATOM   9217  C CE2   . PHE G 1 98  ? 6.494  -87.347  -165.189 1.00 111.10 ? 95  PHE G CE2   1 
ATOM   9218  C CZ    . PHE G 1 98  ? 5.887  -88.564  -164.950 1.00 115.33 ? 95  PHE G CZ    1 
ATOM   9219  N N     . VAL G 1 99  ? 4.279  -86.213  -159.744 1.00 90.12  ? 96  VAL G N     1 
ATOM   9220  C CA    . VAL G 1 99  ? 3.809  -87.350  -158.957 1.00 89.55  ? 96  VAL G CA    1 
ATOM   9221  C C     . VAL G 1 99  ? 2.301  -87.421  -159.163 1.00 99.40  ? 96  VAL G C     1 
ATOM   9222  O O     . VAL G 1 99  ? 1.567  -86.545  -158.692 1.00 82.12  ? 96  VAL G O     1 
ATOM   9223  C CB    . VAL G 1 99  ? 4.147  -87.225  -157.463 1.00 93.72  ? 96  VAL G CB    1 
ATOM   9224  C CG1   . VAL G 1 99  ? 3.339  -88.226  -156.649 1.00 106.26 ? 96  VAL G CG1   1 
ATOM   9225  C CG2   . VAL G 1 99  ? 5.635  -87.435  -157.227 1.00 83.78  ? 96  VAL G CG2   1 
ATOM   9226  N N     . ASP G 1 100 ? 1.840  -88.447  -159.873 1.00 114.00 ? 97  ASP G N     1 
ATOM   9227  C CA    . ASP G 1 100 ? 0.429  -88.613  -160.178 1.00 123.63 ? 97  ASP G CA    1 
ATOM   9228  C C     . ASP G 1 100 ? -0.078 -89.936  -159.620 1.00 120.29 ? 97  ASP G C     1 
ATOM   9229  O O     . ASP G 1 100 ? 0.696  -90.855  -159.333 1.00 119.67 ? 97  ASP G O     1 
ATOM   9230  C CB    . ASP G 1 100 ? 0.174  -88.551  -161.692 1.00 123.55 ? 97  ASP G CB    1 
ATOM   9231  C CG    . ASP G 1 100 ? 0.777  -87.316  -162.337 1.00 135.99 ? 97  ASP G CG    1 
ATOM   9232  O OD1   . ASP G 1 100 ? 0.563  -86.202  -161.813 1.00 122.17 ? 97  ASP G OD1   1 
ATOM   9233  O OD2   . ASP G 1 100 ? 1.460  -87.459  -163.373 1.00 126.34 ? 97  ASP G OD2   1 
ATOM   9234  N N     . LEU G 1 101 ? -1.399 -90.021  -159.471 1.00 120.91 ? 98  LEU G N     1 
ATOM   9235  C CA    . LEU G 1 101 ? -2.050 -91.197  -158.904 1.00 121.88 ? 98  LEU G CA    1 
ATOM   9236  C C     . LEU G 1 101 ? -3.276 -91.527  -159.739 1.00 133.30 ? 98  LEU G C     1 
ATOM   9237  O O     . LEU G 1 101 ? -4.224 -90.738  -159.787 1.00 134.59 ? 98  LEU G O     1 
ATOM   9238  C CB    . LEU G 1 101 ? -2.442 -90.958  -157.442 1.00 101.34 ? 98  LEU G CB    1 
ATOM   9239  C CG    . LEU G 1 101 ? -3.210 -92.079  -156.739 1.00 120.55 ? 98  LEU G CG    1 
ATOM   9240  C CD1   . LEU G 1 101 ? -2.483 -93.407  -156.877 1.00 137.68 ? 98  LEU G CD1   1 
ATOM   9241  C CD2   . LEU G 1 101 ? -3.430 -91.734  -155.274 1.00 106.73 ? 98  LEU G CD2   1 
ATOM   9242  N N     . ASN G 1 102 ? -3.259 -92.685  -160.395 1.00 137.30 ? 99  ASN G N     1 
ATOM   9243  C CA    . ASN G 1 102 ? -4.381 -93.151  -161.206 1.00 136.78 ? 99  ASN G CA    1 
ATOM   9244  C C     . ASN G 1 102 ? -4.848 -94.495  -160.657 1.00 143.67 ? 99  ASN G C     1 
ATOM   9245  O O     . ASN G 1 102 ? -4.192 -95.519  -160.873 1.00 145.98 ? 99  ASN G O     1 
ATOM   9246  C CB    . ASN G 1 102 ? -3.988 -93.258  -162.678 1.00 137.04 ? 99  ASN G CB    1 
ATOM   9247  C CG    . ASN G 1 102 ? -3.523 -91.935  -163.253 1.00 145.77 ? 99  ASN G CG    1 
ATOM   9248  O OD1   . ASN G 1 102 ? -4.053 -90.878  -162.914 1.00 153.35 ? 99  ASN G OD1   1 
ATOM   9249  N ND2   . ASN G 1 102 ? -2.529 -91.988  -164.134 1.00 147.30 ? 99  ASN G ND2   1 
ATOM   9250  N N     . ASN G 1 103 ? -5.985 -94.475  -159.963 1.00 142.04 ? 100 ASN G N     1 
ATOM   9251  C CA    . ASN G 1 103 ? -6.661 -95.657  -159.417 1.00 148.19 ? 100 ASN G CA    1 
ATOM   9252  C C     . ASN G 1 103 ? -5.670 -96.665  -158.833 1.00 143.00 ? 100 ASN G C     1 
ATOM   9253  O O     . ASN G 1 103 ? -5.612 -97.831  -159.223 1.00 127.22 ? 100 ASN G O     1 
ATOM   9254  C CB    . ASN G 1 103 ? -7.569 -96.318  -160.460 1.00 148.94 ? 100 ASN G CB    1 
ATOM   9255  C CG    . ASN G 1 103 ? -6.905 -96.475  -161.812 1.00 156.12 ? 100 ASN G CG    1 
ATOM   9256  O OD1   . ASN G 1 103 ? -6.955 -95.574  -162.649 1.00 143.39 ? 100 ASN G OD1   1 
ATOM   9257  N ND2   . ASN G 1 103 ? -6.277 -97.625  -162.033 1.00 160.09 ? 100 ASN G ND2   1 
ATOM   9258  N N     . GLY G 1 104 ? -4.875 -96.182  -157.877 1.00 144.38 ? 101 GLY G N     1 
ATOM   9259  C CA    . GLY G 1 104 ? -3.981 -97.030  -157.119 1.00 151.16 ? 101 GLY G CA    1 
ATOM   9260  C C     . GLY G 1 104 ? -2.580 -97.172  -157.673 1.00 146.57 ? 101 GLY G C     1 
ATOM   9261  O O     . GLY G 1 104 ? -1.727 -97.766  -157.001 1.00 143.66 ? 101 GLY G O     1 
ATOM   9262  N N     . ALA G 1 105 ? -2.309 -96.657  -158.868 1.00 136.78 ? 102 ALA G N     1 
ATOM   9263  C CA    . ALA G 1 105 ? -0.991 -96.749  -159.481 1.00 138.26 ? 102 ALA G CA    1 
ATOM   9264  C C     . ALA G 1 105 ? -0.300 -95.395  -159.401 1.00 129.55 ? 102 ALA G C     1 
ATOM   9265  O O     . ALA G 1 105 ? -0.894 -94.369  -159.748 1.00 114.96 ? 102 ALA G O     1 
ATOM   9266  C CB    . ALA G 1 105 ? -1.091 -97.212  -160.935 1.00 147.15 ? 102 ALA G CB    1 
ATOM   9267  N N     . PHE G 1 106 ? 0.949  -95.397  -158.942 1.00 137.67 ? 103 PHE G N     1 
ATOM   9268  C CA    . PHE G 1 106 ? 1.738  -94.180  -158.793 1.00 118.75 ? 103 PHE G CA    1 
ATOM   9269  C C     . PHE G 1 106 ? 2.688  -94.045  -159.977 1.00 119.26 ? 103 PHE G C     1 
ATOM   9270  O O     . PHE G 1 106 ? 3.509  -94.935  -160.224 1.00 119.66 ? 103 PHE G O     1 
ATOM   9271  C CB    . PHE G 1 106 ? 2.516  -94.191  -157.478 1.00 102.36 ? 103 PHE G CB    1 
ATOM   9272  C CG    . PHE G 1 106 ? 1.752  -93.622  -156.318 1.00 107.15 ? 103 PHE G CG    1 
ATOM   9273  C CD1   . PHE G 1 106 ? 1.097  -92.407  -156.432 1.00 110.97 ? 103 PHE G CD1   1 
ATOM   9274  C CD2   . PHE G 1 106 ? 1.686  -94.301  -155.113 1.00 112.07 ? 103 PHE G CD2   1 
ATOM   9275  C CE1   . PHE G 1 106 ? 0.393  -91.878  -155.366 1.00 95.78  ? 103 PHE G CE1   1 
ATOM   9276  C CE2   . PHE G 1 106 ? 0.982  -93.779  -154.044 1.00 104.56 ? 103 PHE G CE2   1 
ATOM   9277  C CZ    . PHE G 1 106 ? 0.335  -92.566  -154.171 1.00 86.74  ? 103 PHE G CZ    1 
ATOM   9278  N N     . TYR G 1 107 ? 2.579  -92.931  -160.697 1.00 105.60 ? 104 TYR G N     1 
ATOM   9279  C CA    . TYR G 1 107 ? 3.430  -92.633  -161.845 1.00 106.11 ? 104 TYR G CA    1 
ATOM   9280  C C     . TYR G 1 107 ? 4.328  -91.464  -161.459 1.00 108.46 ? 104 TYR G C     1 
ATOM   9281  O O     . TYR G 1 107 ? 3.842  -90.348  -161.245 1.00 110.43 ? 104 TYR G O     1 
ATOM   9282  C CB    . TYR G 1 107 ? 2.595  -92.309  -163.083 1.00 115.74 ? 104 TYR G CB    1 
ATOM   9283  C CG    . TYR G 1 107 ? 1.556  -93.355  -163.430 1.00 116.16 ? 104 TYR G CG    1 
ATOM   9284  C CD1   . TYR G 1 107 ? 0.354  -93.429  -162.737 1.00 125.45 ? 104 TYR G CD1   1 
ATOM   9285  C CD2   . TYR G 1 107 ? 1.778  -94.268  -164.452 1.00 124.27 ? 104 TYR G CD2   1 
ATOM   9286  C CE1   . TYR G 1 107 ? -0.595 -94.382  -163.050 1.00 132.27 ? 104 TYR G CE1   1 
ATOM   9287  C CE2   . TYR G 1 107 ? 0.833  -95.226  -164.773 1.00 138.43 ? 104 TYR G CE2   1 
ATOM   9288  C CZ    . TYR G 1 107 ? -0.351 -95.277  -164.069 1.00 139.47 ? 104 TYR G CZ    1 
ATOM   9289  O OH    . TYR G 1 107 ? -1.296 -96.227  -164.383 1.00 148.47 ? 104 TYR G OH    1 
ATOM   9290  N N     . VAL G 1 108 ? 5.631  -91.718  -161.369 1.00 105.13 ? 105 VAL G N     1 
ATOM   9291  C CA    . VAL G 1 108 ? 6.596  -90.745  -160.870 1.00 103.66 ? 105 VAL G CA    1 
ATOM   9292  C C     . VAL G 1 108 ? 7.665  -90.515  -161.929 1.00 110.85 ? 105 VAL G C     1 
ATOM   9293  O O     . VAL G 1 108 ? 8.251  -91.474  -162.446 1.00 114.61 ? 105 VAL G O     1 
ATOM   9294  C CB    . VAL G 1 108 ? 7.234  -91.210  -159.548 1.00 93.54  ? 105 VAL G CB    1 
ATOM   9295  C CG1   . VAL G 1 108 ? 8.309  -90.233  -159.110 1.00 96.89  ? 105 VAL G CG1   1 
ATOM   9296  C CG2   . VAL G 1 108 ? 6.172  -91.354  -158.470 1.00 98.03  ? 105 VAL G CG2   1 
ATOM   9297  N N     . GLY G 1 109 ? 7.918  -89.246  -162.244 1.00 101.66 ? 106 GLY G N     1 
ATOM   9298  C CA    . GLY G 1 109 ? 9.035  -88.873  -163.090 1.00 89.77  ? 106 GLY G CA    1 
ATOM   9299  C C     . GLY G 1 109 ? 10.029 -88.004  -162.349 1.00 86.66  ? 106 GLY G C     1 
ATOM   9300  O O     . GLY G 1 109 ? 9.639  -87.026  -161.704 1.00 95.96  ? 106 GLY G O     1 
ATOM   9301  N N     . VAL G 1 110 ? 11.314 -88.341  -162.435 1.00 88.71  ? 107 VAL G N     1 
ATOM   9302  C CA    . VAL G 1 110 ? 12.368 -87.646  -161.702 1.00 86.92  ? 107 VAL G CA    1 
ATOM   9303  C C     . VAL G 1 110 ? 13.584 -87.521  -162.610 1.00 80.11  ? 107 VAL G C     1 
ATOM   9304  O O     . VAL G 1 110 ? 13.912 -88.448  -163.358 1.00 93.08  ? 107 VAL G O     1 
ATOM   9305  C CB    . VAL G 1 110 ? 12.730 -88.382  -160.391 1.00 96.98  ? 107 VAL G CB    1 
ATOM   9306  C CG1   . VAL G 1 110 ? 13.971 -87.776  -159.749 1.00 90.57  ? 107 VAL G CG1   1 
ATOM   9307  C CG2   . VAL G 1 110 ? 11.567 -88.343  -159.412 1.00 90.74  ? 107 VAL G CG2   1 
ATOM   9308  N N     . CYS G 1 111 ? 14.254 -86.371  -162.543 1.00 75.38  ? 108 CYS G N     1 
ATOM   9309  C CA    . CYS G 1 111 ? 15.449 -86.109  -163.329 1.00 88.62  ? 108 CYS G CA    1 
ATOM   9310  C C     . CYS G 1 111 ? 16.575 -85.655  -162.414 1.00 80.61  ? 108 CYS G C     1 
ATOM   9311  O O     . CYS G 1 111 ? 16.339 -85.096  -161.339 1.00 88.38  ? 108 CYS G O     1 
ATOM   9312  C CB    . CYS G 1 111 ? 15.194 -85.041  -164.400 1.00 94.10  ? 108 CYS G CB    1 
ATOM   9313  S SG    . CYS G 1 111 ? 15.217 -83.344  -163.768 1.00 85.77  ? 108 CYS G SG    1 
ATOM   9314  N N     . ALA G 1 112 ? 17.808 -85.898  -162.854 1.00 81.56  ? 109 ALA G N     1 
ATOM   9315  C CA    . ALA G 1 112 ? 18.991 -85.518  -162.098 1.00 78.96  ? 109 ALA G CA    1 
ATOM   9316  C C     . ALA G 1 112 ? 20.056 -85.003  -163.054 1.00 79.23  ? 109 ALA G C     1 
ATOM   9317  O O     . ALA G 1 112 ? 20.061 -85.323  -164.244 1.00 88.57  ? 109 ALA G O     1 
ATOM   9318  C CB    . ALA G 1 112 ? 19.538 -86.692  -161.275 1.00 78.23  ? 109 ALA G CB    1 
ATOM   9319  N N     . PHE G 1 113 ? 20.971 -84.202  -162.512 1.00 81.52  ? 110 PHE G N     1 
ATOM   9320  C CA    . PHE G 1 113 ? 22.066 -83.610  -163.275 1.00 76.25  ? 110 PHE G CA    1 
ATOM   9321  C C     . PHE G 1 113 ? 23.378 -83.993  -162.604 1.00 73.14  ? 110 PHE G C     1 
ATOM   9322  O O     . PHE G 1 113 ? 23.716 -83.461  -161.541 1.00 87.51  ? 110 PHE G O     1 
ATOM   9323  C CB    . PHE G 1 113 ? 21.920 -82.091  -163.369 1.00 73.62  ? 110 PHE G CB    1 
ATOM   9324  C CG    . PHE G 1 113 ? 20.747 -81.641  -164.195 1.00 80.88  ? 110 PHE G CG    1 
ATOM   9325  C CD1   . PHE G 1 113 ? 19.453 -81.754  -163.713 1.00 80.82  ? 110 PHE G CD1   1 
ATOM   9326  C CD2   . PHE G 1 113 ? 20.939 -81.103  -165.457 1.00 75.80  ? 110 PHE G CD2   1 
ATOM   9327  C CE1   . PHE G 1 113 ? 18.374 -81.341  -164.472 1.00 81.84  ? 110 PHE G CE1   1 
ATOM   9328  C CE2   . PHE G 1 113 ? 19.865 -80.686  -166.220 1.00 72.09  ? 110 PHE G CE2   1 
ATOM   9329  C CZ    . PHE G 1 113 ? 18.581 -80.807  -165.727 1.00 75.30  ? 110 PHE G CZ    1 
ATOM   9330  N N     . VAL G 1 114 ? 24.111 -84.913  -163.222 1.00 69.72  ? 111 VAL G N     1 
ATOM   9331  C CA    . VAL G 1 114 ? 25.371 -85.412  -162.685 1.00 76.54  ? 111 VAL G CA    1 
ATOM   9332  C C     . VAL G 1 114 ? 26.522 -84.768  -163.441 1.00 77.34  ? 111 VAL G C     1 
ATOM   9333  O O     . VAL G 1 114 ? 26.491 -84.654  -164.673 1.00 65.23  ? 111 VAL G O     1 
ATOM   9334  C CB    . VAL G 1 114 ? 25.442 -86.949  -162.772 1.00 81.07  ? 111 VAL G CB    1 
ATOM   9335  C CG1   . VAL G 1 114 ? 26.636 -87.473  -161.988 1.00 68.15  ? 111 VAL G CG1   1 
ATOM   9336  C CG2   . VAL G 1 114 ? 24.149 -87.565  -162.265 1.00 84.39  ? 111 VAL G CG2   1 
ATOM   9337  N N     . ARG G 1 115 ? 27.542 -84.342  -162.700 1.00 81.09  ? 112 ARG G N     1 
ATOM   9338  C CA    . ARG G 1 115 ? 28.746 -83.743  -163.263 1.00 78.34  ? 112 ARG G CA    1 
ATOM   9339  C C     . ARG G 1 115 ? 29.941 -84.594  -162.863 1.00 76.35  ? 112 ARG G C     1 
ATOM   9340  O O     . ARG G 1 115 ? 30.267 -84.689  -161.676 1.00 84.91  ? 112 ARG G O     1 
ATOM   9341  C CB    . ARG G 1 115 ? 28.925 -82.303  -162.775 1.00 89.49  ? 112 ARG G CB    1 
ATOM   9342  C CG    . ARG G 1 115 ? 30.296 -81.716  -163.070 1.00 82.31  ? 112 ARG G CG    1 
ATOM   9343  C CD    . ARG G 1 115 ? 30.503 -80.403  -162.334 1.00 89.94  ? 112 ARG G CD    1 
ATOM   9344  N NE    . ARG G 1 115 ? 31.917 -80.135  -162.087 1.00 91.27  ? 112 ARG G NE    1 
ATOM   9345  C CZ    . ARG G 1 115 ? 32.620 -79.185  -162.695 1.00 87.50  ? 112 ARG G CZ    1 
ATOM   9346  N NH1   . ARG G 1 115 ? 32.041 -78.401  -163.594 1.00 97.35  ? 112 ARG G NH1   1 
ATOM   9347  N NH2   . ARG G 1 115 ? 33.902 -79.019  -162.401 1.00 75.41  ? 112 ARG G NH2   1 
ATOM   9348  N N     . VAL G 1 116 ? 30.595 -85.201  -163.850 1.00 58.78  ? 113 VAL G N     1 
ATOM   9349  C CA    . VAL G 1 116 ? 31.785 -86.012  -163.623 1.00 66.80  ? 113 VAL G CA    1 
ATOM   9350  C C     . VAL G 1 116 ? 33.011 -85.158  -163.896 1.00 61.06  ? 113 VAL G C     1 
ATOM   9351  O O     . VAL G 1 116 ? 33.033 -84.374  -164.852 1.00 60.01  ? 113 VAL G O     1 
ATOM   9352  C CB    . VAL G 1 116 ? 31.782 -87.277  -164.504 1.00 70.03  ? 113 VAL G CB    1 
ATOM   9353  C CG1   . VAL G 1 116 ? 32.914 -88.206  -164.098 1.00 74.97  ? 113 VAL G CG1   1 
ATOM   9354  C CG2   . VAL G 1 116 ? 30.450 -87.992  -164.393 1.00 65.30  ? 113 VAL G CG2   1 
ATOM   9355  N N     . GLN G 1 117 ? 34.033 -85.300  -163.053 1.00 53.71  ? 114 GLN G N     1 
ATOM   9356  C CA    . GLN G 1 117 ? 35.236 -84.488  -163.153 1.00 60.66  ? 114 GLN G CA    1 
ATOM   9357  C C     . GLN G 1 117 ? 36.464 -85.349  -162.903 1.00 64.17  ? 114 GLN G C     1 
ATOM   9358  O O     . GLN G 1 117 ? 36.477 -86.173  -161.984 1.00 71.43  ? 114 GLN G O     1 
ATOM   9359  C CB    . GLN G 1 117 ? 35.210 -83.321  -162.156 1.00 73.85  ? 114 GLN G CB    1 
ATOM   9360  C CG    . GLN G 1 117 ? 36.463 -82.455  -162.185 1.00 80.38  ? 114 GLN G CG    1 
ATOM   9361  C CD    . GLN G 1 117 ? 36.498 -81.437  -161.062 1.00 89.75  ? 114 GLN G CD    1 
ATOM   9362  O OE1   . GLN G 1 117 ? 36.336 -81.781  -159.891 1.00 103.34 ? 114 GLN G OE1   1 
ATOM   9363  N NE2   . GLN G 1 117 ? 36.709 -80.174  -161.415 1.00 93.06  ? 114 GLN G NE2   1 
ATOM   9364  N N     . LEU G 1 118 ? 37.486 -85.158  -163.730 1.00 70.59  ? 115 LEU G N     1 
ATOM   9365  C CA    . LEU G 1 118 ? 38.759 -85.842  -163.571 1.00 75.30  ? 115 LEU G CA    1 
ATOM   9366  C C     . LEU G 1 118 ? 39.716 -84.997  -162.735 1.00 78.23  ? 115 LEU G C     1 
ATOM   9367  O O     . LEU G 1 118 ? 39.547 -83.784  -162.587 1.00 87.90  ? 115 LEU G O     1 
ATOM   9368  C CB    . LEU G 1 118 ? 39.382 -86.153  -164.932 1.00 83.64  ? 115 LEU G CB    1 
ATOM   9369  C CG    . LEU G 1 118 ? 38.473 -86.817  -165.965 1.00 75.13  ? 115 LEU G CG    1 
ATOM   9370  C CD1   . LEU G 1 118 ? 39.222 -87.046  -167.268 1.00 81.84  ? 115 LEU G CD1   1 
ATOM   9371  C CD2   . LEU G 1 118 ? 37.920 -88.126  -165.424 1.00 79.01  ? 115 LEU G CD2   1 
ATOM   9372  N N     . LYS G 1 119 ? 40.731 -85.665  -162.178 1.00 74.03  ? 116 LYS G N     1 
ATOM   9373  C CA    . LYS G 1 119 ? 41.683 -85.001  -161.292 1.00 83.43  ? 116 LYS G CA    1 
ATOM   9374  C C     . LYS G 1 119 ? 42.421 -83.849  -161.966 1.00 84.26  ? 116 LYS G C     1 
ATOM   9375  O O     . LYS G 1 119 ? 43.007 -83.015  -161.268 1.00 80.73  ? 116 LYS G O     1 
ATOM   9376  C CB    . LYS G 1 119 ? 42.697 -86.013  -160.757 1.00 87.69  ? 116 LYS G CB    1 
ATOM   9377  C CG    . LYS G 1 119 ? 43.381 -86.831  -161.837 1.00 93.99  ? 116 LYS G CG    1 
ATOM   9378  C CD    . LYS G 1 119 ? 44.292 -87.888  -161.237 1.00 100.18 ? 116 LYS G CD    1 
ATOM   9379  C CE    . LYS G 1 119 ? 44.768 -88.866  -162.299 1.00 112.15 ? 116 LYS G CE    1 
ATOM   9380  N NZ    . LYS G 1 119 ? 45.498 -90.022  -161.710 1.00 131.26 ? 116 LYS G NZ    1 
ATOM   9381  N N     . ASP G 1 120 ? 42.419 -83.786  -163.298 1.00 91.53  ? 117 ASP G N     1 
ATOM   9382  C CA    . ASP G 1 120 ? 43.060 -82.681  -163.998 1.00 97.39  ? 117 ASP G CA    1 
ATOM   9383  C C     . ASP G 1 120 ? 42.171 -81.451  -164.108 1.00 91.13  ? 117 ASP G C     1 
ATOM   9384  O O     . ASP G 1 120 ? 42.668 -80.379  -164.473 1.00 99.53  ? 117 ASP G O     1 
ATOM   9385  C CB    . ASP G 1 120 ? 43.492 -83.118  -165.400 1.00 102.42 ? 117 ASP G CB    1 
ATOM   9386  C CG    . ASP G 1 120 ? 42.328 -83.206  -166.366 1.00 104.26 ? 117 ASP G CG    1 
ATOM   9387  O OD1   . ASP G 1 120 ? 41.266 -83.733  -165.975 1.00 100.36 ? 117 ASP G OD1   1 
ATOM   9388  O OD2   . ASP G 1 120 ? 42.475 -82.742  -167.516 1.00 97.81  ? 117 ASP G OD2   1 
ATOM   9389  N N     . GLY G 1 121 ? 40.880 -81.574  -163.809 1.00 77.56  ? 118 GLY G N     1 
ATOM   9390  C CA    . GLY G 1 121 ? 39.939 -80.482  -163.922 1.00 82.74  ? 118 GLY G CA    1 
ATOM   9391  C C     . GLY G 1 121 ? 38.925 -80.653  -165.032 1.00 80.98  ? 118 GLY G C     1 
ATOM   9392  O O     . GLY G 1 121 ? 37.895 -79.965  -165.023 1.00 81.43  ? 118 GLY G O     1 
ATOM   9393  N N     . SER G 1 122 ? 39.194 -81.534  -165.995 1.00 79.93  ? 119 SER G N     1 
ATOM   9394  C CA    . SER G 1 122 ? 38.230 -81.806  -167.052 1.00 84.53  ? 119 SER G CA    1 
ATOM   9395  C C     . SER G 1 122 ? 36.929 -82.327  -166.456 1.00 80.53  ? 119 SER G C     1 
ATOM   9396  O O     . SER G 1 122 ? 36.921 -83.020  -165.435 1.00 86.62  ? 119 SER G O     1 
ATOM   9397  C CB    . SER G 1 122 ? 38.800 -82.822  -168.044 1.00 78.13  ? 119 SER G CB    1 
ATOM   9398  O OG    . SER G 1 122 ? 37.851 -83.145  -169.045 1.00 83.08  ? 119 SER G OG    1 
ATOM   9399  N N     . TYR G 1 123 ? 35.816 -81.990  -167.104 1.00 71.74  ? 120 TYR G N     1 
ATOM   9400  C CA    . TYR G 1 123 ? 34.510 -82.288  -166.539 1.00 64.02  ? 120 TYR G CA    1 
ATOM   9401  C C     . TYR G 1 123 ? 33.482 -82.466  -167.646 1.00 64.63  ? 120 TYR G C     1 
ATOM   9402  O O     . TYR G 1 123 ? 33.553 -81.822  -168.695 1.00 68.47  ? 120 TYR G O     1 
ATOM   9403  C CB    . TYR G 1 123 ? 34.064 -81.187  -165.567 1.00 76.55  ? 120 TYR G CB    1 
ATOM   9404  C CG    . TYR G 1 123 ? 33.939 -79.817  -166.198 1.00 73.33  ? 120 TYR G CG    1 
ATOM   9405  C CD1   . TYR G 1 123 ? 32.744 -79.399  -166.769 1.00 72.87  ? 120 TYR G CD1   1 
ATOM   9406  C CD2   . TYR G 1 123 ? 35.016 -78.940  -166.217 1.00 66.42  ? 120 TYR G CD2   1 
ATOM   9407  C CE1   . TYR G 1 123 ? 32.626 -78.150  -167.345 1.00 78.65  ? 120 TYR G CE1   1 
ATOM   9408  C CE2   . TYR G 1 123 ? 34.906 -77.688  -166.790 1.00 82.94  ? 120 TYR G CE2   1 
ATOM   9409  C CZ    . TYR G 1 123 ? 33.709 -77.298  -167.353 1.00 90.73  ? 120 TYR G CZ    1 
ATOM   9410  O OH    . TYR G 1 123 ? 33.594 -76.052  -167.926 1.00 97.97  ? 120 TYR G OH    1 
ATOM   9411  N N     . HIS G 1 124 ? 32.514 -83.344  -167.391 1.00 62.95  ? 121 HIS G N     1 
ATOM   9412  C CA    . HIS G 1 124 ? 31.379 -83.540  -168.279 1.00 70.31  ? 121 HIS G CA    1 
ATOM   9413  C C     . HIS G 1 124 ? 30.119 -83.677  -167.438 1.00 71.05  ? 121 HIS G C     1 
ATOM   9414  O O     . HIS G 1 124 ? 30.122 -84.358  -166.409 1.00 84.21  ? 121 HIS G O     1 
ATOM   9415  C CB    . HIS G 1 124 ? 31.556 -84.778  -169.168 1.00 81.88  ? 121 HIS G CB    1 
ATOM   9416  C CG    . HIS G 1 124 ? 32.610 -84.622  -170.220 1.00 87.20  ? 121 HIS G CG    1 
ATOM   9417  N ND1   . HIS G 1 124 ? 32.672 -83.529  -171.057 1.00 86.69  ? 121 HIS G ND1   1 
ATOM   9418  C CD2   . HIS G 1 124 ? 33.637 -85.428  -170.579 1.00 81.74  ? 121 HIS G CD2   1 
ATOM   9419  C CE1   . HIS G 1 124 ? 33.695 -83.664  -171.882 1.00 86.94  ? 121 HIS G CE1   1 
ATOM   9420  N NE2   . HIS G 1 124 ? 34.298 -84.808  -171.612 1.00 85.85  ? 121 HIS G NE2   1 
ATOM   9421  N N     . GLU G 1 125 ? 29.046 -83.026  -167.880 1.00 61.93  ? 122 GLU G N     1 
ATOM   9422  C CA    . GLU G 1 125 ? 27.791 -82.992  -167.144 1.00 76.85  ? 122 GLU G CA    1 
ATOM   9423  C C     . GLU G 1 125 ? 26.641 -83.334  -168.078 1.00 79.40  ? 122 GLU G C     1 
ATOM   9424  O O     . GLU G 1 125 ? 26.582 -82.840  -169.208 1.00 86.45  ? 122 GLU G O     1 
ATOM   9425  C CB    . GLU G 1 125 ? 27.569 -81.612  -166.506 1.00 78.66  ? 122 GLU G CB    1 
ATOM   9426  C CG    . GLU G 1 125 ? 26.223 -81.437  -165.825 1.00 90.78  ? 122 GLU G CG    1 
ATOM   9427  C CD    . GLU G 1 125 ? 26.037 -80.043  -165.253 1.00 86.38  ? 122 GLU G CD    1 
ATOM   9428  O OE1   . GLU G 1 125 ? 26.452 -79.066  -165.912 1.00 87.37  ? 122 GLU G OE1   1 
ATOM   9429  O OE2   . GLU G 1 125 ? 25.474 -79.926  -164.145 1.00 75.51  ? 122 GLU G OE2   1 
ATOM   9430  N N     . ASP G 1 126 ? 25.725 -84.174  -167.600 1.00 73.97  ? 123 ASP G N     1 
ATOM   9431  C CA    . ASP G 1 126 ? 24.605 -84.615  -168.420 1.00 78.68  ? 123 ASP G CA    1 
ATOM   9432  C C     . ASP G 1 126 ? 23.451 -85.019  -167.514 1.00 74.17  ? 123 ASP G C     1 
ATOM   9433  O O     . ASP G 1 126 ? 23.620 -85.208  -166.306 1.00 84.53  ? 123 ASP G O     1 
ATOM   9434  C CB    . ASP G 1 126 ? 25.005 -85.774  -169.339 1.00 85.06  ? 123 ASP G CB    1 
ATOM   9435  C CG    . ASP G 1 126 ? 24.242 -85.765  -170.648 1.00 96.74  ? 123 ASP G CG    1 
ATOM   9436  O OD1   . ASP G 1 126 ? 22.993 -85.765  -170.608 1.00 94.77  ? 123 ASP G OD1   1 
ATOM   9437  O OD2   . ASP G 1 126 ? 24.890 -85.755  -171.716 1.00 105.08 ? 123 ASP G OD2   1 
ATOM   9438  N N     . VAL G 1 127 ? 22.272 -85.148  -168.121 1.00 66.34  ? 124 VAL G N     1 
ATOM   9439  C CA    . VAL G 1 127 ? 21.048 -85.442  -167.389 1.00 67.48  ? 124 VAL G CA    1 
ATOM   9440  C C     . VAL G 1 127 ? 20.841 -86.951  -167.314 1.00 76.10  ? 124 VAL G C     1 
ATOM   9441  O O     . VAL G 1 127 ? 21.410 -87.727  -168.085 1.00 84.89  ? 124 VAL G O     1 
ATOM   9442  C CB    . VAL G 1 127 ? 19.836 -84.743  -168.041 1.00 59.58  ? 124 VAL G CB    1 
ATOM   9443  C CG1   . VAL G 1 127 ? 18.649 -84.688  -167.087 1.00 79.73  ? 124 VAL G CG1   1 
ATOM   9444  C CG2   . VAL G 1 127 ? 20.216 -83.350  -168.476 1.00 89.47  ? 124 VAL G CG2   1 
ATOM   9445  N N     . GLY G 1 128 ? 20.019 -87.365  -166.360 1.00 74.41  ? 125 GLY G N     1 
ATOM   9446  C CA    . GLY G 1 128 ? 19.542 -88.735  -166.295 1.00 74.67  ? 125 GLY G CA    1 
ATOM   9447  C C     . GLY G 1 128 ? 18.154 -88.753  -165.701 1.00 82.68  ? 125 GLY G C     1 
ATOM   9448  O O     . GLY G 1 128 ? 17.789 -87.877  -164.910 1.00 83.39  ? 125 GLY G O     1 
ATOM   9449  N N     . TYR G 1 129 ? 17.371 -89.758  -166.084 1.00 96.03  ? 126 TYR G N     1 
ATOM   9450  C CA    . TYR G 1 129 ? 15.971 -89.829  -165.697 1.00 89.10  ? 126 TYR G CA    1 
ATOM   9451  C C     . TYR G 1 129 ? 15.663 -91.135  -164.978 1.00 92.69  ? 126 TYR G C     1 
ATOM   9452  O O     . TYR G 1 129 ? 16.301 -92.166  -165.215 1.00 88.38  ? 126 TYR G O     1 
ATOM   9453  C CB    . TYR G 1 129 ? 15.055 -89.685  -166.914 1.00 83.12  ? 126 TYR G CB    1 
ATOM   9454  C CG    . TYR G 1 129 ? 13.805 -88.896  -166.618 1.00 82.03  ? 126 TYR G CG    1 
ATOM   9455  C CD1   . TYR G 1 129 ? 13.793 -87.514  -166.732 1.00 90.67  ? 126 TYR G CD1   1 
ATOM   9456  C CD2   . TYR G 1 129 ? 12.643 -89.532  -166.202 1.00 95.59  ? 126 TYR G CD2   1 
ATOM   9457  C CE1   . TYR G 1 129 ? 12.654 -86.787  -166.457 1.00 96.76  ? 126 TYR G CE1   1 
ATOM   9458  C CE2   . TYR G 1 129 ? 11.500 -88.813  -165.923 1.00 97.39  ? 126 TYR G CE2   1 
ATOM   9459  C CZ    . TYR G 1 129 ? 11.511 -87.441  -166.051 1.00 87.70  ? 126 TYR G CZ    1 
ATOM   9460  O OH    . TYR G 1 129 ? 10.373 -86.722  -165.773 1.00 94.66  ? 126 TYR G OH    1 
ATOM   9461  N N     . GLY G 1 130 ? 14.680 -91.071  -164.095 1.00 98.02  ? 127 GLY G N     1 
ATOM   9462  C CA    . GLY G 1 130 ? 14.184 -92.254  -163.410 1.00 100.90 ? 127 GLY G CA    1 
ATOM   9463  C C     . GLY G 1 130 ? 12.674 -92.295  -163.472 1.00 100.55 ? 127 GLY G C     1 
ATOM   9464  O O     . GLY G 1 130 ? 12.011 -91.262  -163.394 1.00 82.01  ? 127 GLY G O     1 
ATOM   9465  N N     . VAL G 1 131 ? 12.136 -93.504  -163.600 1.00 106.59 ? 128 VAL G N     1 
ATOM   9466  C CA    . VAL G 1 131 ? 10.722 -93.705  -163.901 1.00 105.72 ? 128 VAL G CA    1 
ATOM   9467  C C     . VAL G 1 131 ? 10.194 -94.847  -163.043 1.00 101.72 ? 128 VAL G C     1 
ATOM   9468  O O     . VAL G 1 131 ? 10.783 -95.933  -163.012 1.00 106.40 ? 128 VAL G O     1 
ATOM   9469  C CB    . VAL G 1 131 ? 10.489 -94.014  -165.395 1.00 102.71 ? 128 VAL G CB    1 
ATOM   9470  C CG1   . VAL G 1 131 ? 9.007  -94.144  -165.680 1.00 104.00 ? 128 VAL G CG1   1 
ATOM   9471  C CG2   . VAL G 1 131 ? 11.096 -92.932  -166.280 1.00 102.30 ? 128 VAL G CG2   1 
ATOM   9472  N N     . SER G 1 132 ? 9.089  -94.598  -162.338 1.00 94.68  ? 129 SER G N     1 
ATOM   9473  C CA    . SER G 1 132 ? 8.392  -95.630  -161.569 1.00 105.03 ? 129 SER G CA    1 
ATOM   9474  C C     . SER G 1 132 ? 6.895  -95.438  -161.792 1.00 104.86 ? 129 SER G C     1 
ATOM   9475  O O     . SER G 1 132 ? 6.286  -94.539  -161.203 1.00 92.70  ? 129 SER G O     1 
ATOM   9476  C CB    . SER G 1 132 ? 8.751  -95.555  -160.090 1.00 103.31 ? 129 SER G CB    1 
ATOM   9477  O OG    . SER G 1 132 ? 8.078  -96.562  -159.354 1.00 105.69 ? 129 SER G OG    1 
ATOM   9478  N N     . GLU G 1 133 ? 6.307  -96.282  -162.640 1.00 114.46 ? 130 GLU G N     1 
ATOM   9479  C CA    . GLU G 1 133 ? 4.899  -96.178  -163.003 1.00 122.56 ? 130 GLU G CA    1 
ATOM   9480  C C     . GLU G 1 133 ? 4.014  -97.244  -162.375 1.00 131.64 ? 130 GLU G C     1 
ATOM   9481  O O     . GLU G 1 133 ? 2.838  -96.976  -162.118 1.00 127.73 ? 130 GLU G O     1 
ATOM   9482  C CB    . GLU G 1 133 ? 4.735  -96.244  -164.527 1.00 116.26 ? 130 GLU G CB    1 
ATOM   9483  C CG    . GLU G 1 133 ? 5.677  -95.332  -165.293 1.00 133.06 ? 130 GLU G CG    1 
ATOM   9484  C CD    . GLU G 1 133 ? 5.195  -95.037  -166.701 1.00 157.78 ? 130 GLU G CD    1 
ATOM   9485  O OE1   . GLU G 1 133 ? 4.172  -94.336  -166.847 1.00 162.93 ? 130 GLU G OE1   1 
ATOM   9486  O OE2   . GLU G 1 133 ? 5.841  -95.506  -167.663 1.00 153.80 ? 130 GLU G OE2   1 
ATOM   9487  N N     . GLY G 1 134 ? 4.541  -98.440  -162.124 1.00 129.94 ? 131 GLY G N     1 
ATOM   9488  C CA    . GLY G 1 134 ? 3.714  -99.562  -161.723 1.00 125.69 ? 131 GLY G CA    1 
ATOM   9489  C C     . GLY G 1 134 ? 3.347  -99.629  -160.255 1.00 129.11 ? 131 GLY G C     1 
ATOM   9490  O O     . GLY G 1 134 ? 2.197  -99.930  -159.917 1.00 141.29 ? 131 GLY G O     1 
ATOM   9491  N N     . LEU G 1 135 ? 4.308  -99.355  -159.375 1.00 123.67 ? 132 LEU G N     1 
ATOM   9492  C CA    . LEU G 1 135 ? 4.131  -99.609  -157.952 1.00 127.81 ? 132 LEU G CA    1 
ATOM   9493  C C     . LEU G 1 135 ? 2.982  -98.781  -157.378 1.00 122.52 ? 132 LEU G C     1 
ATOM   9494  O O     . LEU G 1 135 ? 2.563  -97.764  -157.939 1.00 120.11 ? 132 LEU G O     1 
ATOM   9495  C CB    . LEU G 1 135 ? 5.423  -99.314  -157.190 1.00 117.54 ? 132 LEU G CB    1 
ATOM   9496  C CG    . LEU G 1 135 ? 6.534  -100.357 -157.335 1.00 119.27 ? 132 LEU G CG    1 
ATOM   9497  C CD1   . LEU G 1 135 ? 7.906  -99.720  -157.173 1.00 102.68 ? 132 LEU G CD1   1 
ATOM   9498  C CD2   . LEU G 1 135 ? 6.341  -101.488 -156.336 1.00 117.10 ? 132 LEU G CD2   1 
ATOM   9499  N N     . ALA G 1 136 ? 2.470  -99.240  -156.236 1.00 121.79 ? 133 ALA G N     1 
ATOM   9500  C CA    . ALA G 1 136 ? 1.372  -98.584  -155.542 1.00 119.27 ? 133 ALA G CA    1 
ATOM   9501  C C     . ALA G 1 136 ? 1.814  -97.856  -154.282 1.00 117.90 ? 133 ALA G C     1 
ATOM   9502  O O     . ALA G 1 136 ? 0.980  -97.225  -153.623 1.00 113.65 ? 133 ALA G O     1 
ATOM   9503  C CB    . ALA G 1 136 ? 0.283  -99.604  -155.191 1.00 129.04 ? 133 ALA G CB    1 
ATOM   9504  N N     . SER G 1 137 ? 3.093  -97.930  -153.923 1.00 122.91 ? 134 SER G N     1 
ATOM   9505  C CA    . SER G 1 137 ? 3.627  -97.221  -152.768 1.00 116.33 ? 134 SER G CA    1 
ATOM   9506  C C     . SER G 1 137 ? 4.392  -95.995  -153.253 1.00 108.76 ? 134 SER G C     1 
ATOM   9507  O O     . SER G 1 137 ? 5.322  -96.118  -154.059 1.00 107.08 ? 134 SER G O     1 
ATOM   9508  C CB    . SER G 1 137 ? 4.533  -98.131  -151.939 1.00 110.31 ? 134 SER G CB    1 
ATOM   9509  O OG    . SER G 1 137 ? 5.140  -97.415  -150.877 1.00 101.86 ? 134 SER G OG    1 
ATOM   9510  N N     . LYS G 1 138 ? 3.993  -94.817  -152.767 1.00 105.31 ? 135 LYS G N     1 
ATOM   9511  C CA    . LYS G 1 138 ? 4.650  -93.577  -153.171 1.00 99.00  ? 135 LYS G CA    1 
ATOM   9512  C C     . LYS G 1 138 ? 6.123  -93.580  -152.781 1.00 96.56  ? 135 LYS G C     1 
ATOM   9513  O O     . LYS G 1 138 ? 6.990  -93.202  -153.579 1.00 88.32  ? 135 LYS G O     1 
ATOM   9514  C CB    . LYS G 1 138 ? 3.933  -92.377  -152.552 1.00 95.96  ? 135 LYS G CB    1 
ATOM   9515  C CG    . LYS G 1 138 ? 4.286  -91.050  -153.202 1.00 83.64  ? 135 LYS G CG    1 
ATOM   9516  C CD    . LYS G 1 138 ? 3.085  -90.124  -153.269 1.00 92.41  ? 135 LYS G CD    1 
ATOM   9517  C CE    . LYS G 1 138 ? 2.809  -89.476  -151.923 1.00 98.66  ? 135 LYS G CE    1 
ATOM   9518  N NZ    . LYS G 1 138 ? 1.743  -88.441  -152.018 1.00 114.74 ? 135 LYS G NZ    1 
ATOM   9519  N N     . ALA G 1 139 ? 6.421  -93.984  -151.543 1.00 106.32 ? 136 ALA G N     1 
ATOM   9520  C CA    . ALA G 1 139 ? 7.804  -94.004  -151.079 1.00 95.09  ? 136 ALA G CA    1 
ATOM   9521  C C     . ALA G 1 139 ? 8.663  -94.917  -151.944 1.00 101.59 ? 136 ALA G C     1 
ATOM   9522  O O     . ALA G 1 139 ? 9.789  -94.558  -152.305 1.00 103.77 ? 136 ALA G O     1 
ATOM   9523  C CB    . ALA G 1 139 ? 7.862  -94.440  -149.616 1.00 105.65 ? 136 ALA G CB    1 
ATOM   9524  N N     . LEU G 1 140 ? 8.149  -96.101  -152.283 1.00 109.84 ? 137 LEU G N     1 
ATOM   9525  C CA    . LEU G 1 140 ? 8.896  -97.019  -153.138 1.00 109.31 ? 137 LEU G CA    1 
ATOM   9526  C C     . LEU G 1 140 ? 9.123  -96.420  -154.520 1.00 100.21 ? 137 LEU G C     1 
ATOM   9527  O O     . LEU G 1 140 ? 10.226 -96.512  -155.076 1.00 97.70  ? 137 LEU G O     1 
ATOM   9528  C CB    . LEU G 1 140 ? 8.161  -98.356  -153.253 1.00 107.42 ? 137 LEU G CB    1 
ATOM   9529  C CG    . LEU G 1 140 ? 8.434  -99.454  -152.220 1.00 103.87 ? 137 LEU G CG    1 
ATOM   9530  C CD1   . LEU G 1 140 ? 8.337  -98.936  -150.792 1.00 98.93  ? 137 LEU G CD1   1 
ATOM   9531  C CD2   . LEU G 1 140 ? 7.482  -100.624 -152.434 1.00 106.21 ? 137 LEU G CD2   1 
ATOM   9532  N N     . SER G 1 141 ? 8.083  -95.808  -155.092 1.00 93.22  ? 138 SER G N     1 
ATOM   9533  C CA    . SER G 1 141 ? 8.214  -95.206  -156.413 1.00 95.46  ? 138 SER G CA    1 
ATOM   9534  C C     . SER G 1 141 ? 9.266  -94.106  -156.415 1.00 100.95 ? 138 SER G C     1 
ATOM   9535  O O     . SER G 1 141 ? 10.087 -94.027  -157.335 1.00 105.71 ? 138 SER G O     1 
ATOM   9536  C CB    . SER G 1 141 ? 6.863  -94.661  -156.876 1.00 104.72 ? 138 SER G CB    1 
ATOM   9537  O OG    . SER G 1 141 ? 5.973  -95.713  -157.205 1.00 105.85 ? 138 SER G OG    1 
ATOM   9538  N N     . LEU G 1 142 ? 9.271  -93.258  -155.384 1.00 92.16  ? 139 LEU G N     1 
ATOM   9539  C CA    . LEU G 1 142 ? 10.256 -92.181  -155.322 1.00 91.12  ? 139 LEU G CA    1 
ATOM   9540  C C     . LEU G 1 142 ? 11.661 -92.727  -155.094 1.00 94.69  ? 139 LEU G C     1 
ATOM   9541  O O     . LEU G 1 142 ? 12.621 -92.264  -155.723 1.00 99.74  ? 139 LEU G O     1 
ATOM   9542  C CB    . LEU G 1 142 ? 9.876  -91.183  -154.228 1.00 83.60  ? 139 LEU G CB    1 
ATOM   9543  C CG    . LEU G 1 142 ? 8.673  -90.294  -154.549 1.00 73.41  ? 139 LEU G CG    1 
ATOM   9544  C CD1   . LEU G 1 142 ? 8.189  -89.561  -153.310 1.00 70.05  ? 139 LEU G CD1   1 
ATOM   9545  C CD2   . LEU G 1 142 ? 9.024  -89.309  -155.650 1.00 73.18  ? 139 LEU G CD2   1 
ATOM   9546  N N     . GLU G 1 143 ? 11.802 -93.691  -154.179 1.00 93.45  ? 140 GLU G N     1 
ATOM   9547  C CA    . GLU G 1 143 ? 13.086 -94.351  -153.964 1.00 90.49  ? 140 GLU G CA    1 
ATOM   9548  C C     . GLU G 1 143 ? 13.655 -94.873  -155.276 1.00 93.06  ? 140 GLU G C     1 
ATOM   9549  O O     . GLU G 1 143 ? 14.832 -94.660  -155.589 1.00 92.47  ? 140 GLU G O     1 
ATOM   9550  C CB    . GLU G 1 143 ? 12.918 -95.490  -152.957 1.00 106.37 ? 140 GLU G CB    1 
ATOM   9551  C CG    . GLU G 1 143 ? 14.192 -96.268  -152.667 1.00 130.91 ? 140 GLU G CG    1 
ATOM   9552  C CD    . GLU G 1 143 ? 14.008 -97.293  -151.564 1.00 144.35 ? 140 GLU G CD    1 
ATOM   9553  O OE1   . GLU G 1 143 ? 12.847 -97.618  -151.238 1.00 122.81 ? 140 GLU G OE1   1 
ATOM   9554  O OE2   . GLU G 1 143 ? 15.025 -97.777  -151.023 1.00 130.71 ? 140 GLU G OE2   1 
ATOM   9555  N N     . LYS G 1 144 ? 12.827 -95.571  -156.055 1.00 98.26  ? 141 LYS G N     1 
ATOM   9556  C CA    . LYS G 1 144 ? 13.272 -96.073  -157.351 1.00 92.59  ? 141 LYS G CA    1 
ATOM   9557  C C     . LYS G 1 144 ? 13.642 -94.931  -158.292 1.00 87.97  ? 141 LYS G C     1 
ATOM   9558  O O     . LYS G 1 144 ? 14.728 -94.927  -158.885 1.00 91.24  ? 141 LYS G O     1 
ATOM   9559  C CB    . LYS G 1 144 ? 12.180 -96.947  -157.970 1.00 82.29  ? 141 LYS G CB    1 
ATOM   9560  C CG    . LYS G 1 144 ? 12.520 -97.514  -159.339 1.00 80.33  ? 141 LYS G CG    1 
ATOM   9561  C CD    . LYS G 1 144 ? 11.313 -98.209  -159.950 1.00 102.44 ? 141 LYS G CD    1 
ATOM   9562  C CE    . LYS G 1 144 ? 11.592 -98.676  -161.368 1.00 114.75 ? 141 LYS G CE    1 
ATOM   9563  N NZ    . LYS G 1 144 ? 10.374 -99.250  -162.006 1.00 97.74  ? 141 LYS G NZ    1 
ATOM   9564  N N     . ALA G 1 145 ? 12.746 -93.949  -158.432 1.00 79.89  ? 142 ALA G N     1 
ATOM   9565  C CA    . ALA G 1 145 ? 12.904 -92.911  -159.446 1.00 94.00  ? 142 ALA G CA    1 
ATOM   9566  C C     . ALA G 1 145 ? 14.158 -92.075  -159.221 1.00 87.82  ? 142 ALA G C     1 
ATOM   9567  O O     . ALA G 1 145 ? 14.916 -91.816  -160.162 1.00 92.07  ? 142 ALA G O     1 
ATOM   9568  C CB    . ALA G 1 145 ? 11.662 -92.020  -159.471 1.00 94.52  ? 142 ALA G CB    1 
ATOM   9569  N N     . ARG G 1 146 ? 14.402 -91.646  -157.980 1.00 81.99  ? 143 ARG G N     1 
ATOM   9570  C CA    . ARG G 1 146 ? 15.517 -90.734  -157.728 1.00 85.15  ? 143 ARG G CA    1 
ATOM   9571  C C     . ARG G 1 146 ? 16.858 -91.425  -157.957 1.00 86.12  ? 143 ARG G C     1 
ATOM   9572  O O     . ARG G 1 146 ? 17.750 -90.881  -158.627 1.00 89.55  ? 143 ARG G O     1 
ATOM   9573  C CB    . ARG G 1 146 ? 15.426 -90.182  -156.304 1.00 79.68  ? 143 ARG G CB    1 
ATOM   9574  C CG    . ARG G 1 146 ? 14.065 -89.592  -155.972 1.00 97.10  ? 143 ARG G CG    1 
ATOM   9575  C CD    . ARG G 1 146 ? 14.092 -88.715  -154.733 1.00 79.58  ? 143 ARG G CD    1 
ATOM   9576  N NE    . ARG G 1 146 ? 14.249 -87.304  -155.067 1.00 86.43  ? 143 ARG G NE    1 
ATOM   9577  C CZ    . ARG G 1 146 ? 13.863 -86.306  -154.279 1.00 80.00  ? 143 ARG G CZ    1 
ATOM   9578  N NH1   . ARG G 1 146 ? 13.290 -86.569  -153.112 1.00 73.00  ? 143 ARG G NH1   1 
ATOM   9579  N NH2   . ARG G 1 146 ? 14.042 -85.048  -154.659 1.00 86.22  ? 143 ARG G NH2   1 
ATOM   9580  N N     . LYS G 1 147 ? 17.016 -92.628  -157.402 1.00 81.55  ? 144 LYS G N     1 
ATOM   9581  C CA    . LYS G 1 147 ? 18.253 -93.375  -157.587 1.00 78.52  ? 144 LYS G CA    1 
ATOM   9582  C C     . LYS G 1 147 ? 18.470 -93.726  -159.054 1.00 67.07  ? 144 LYS G C     1 
ATOM   9583  O O     . LYS G 1 147 ? 19.595 -93.624  -159.563 1.00 70.13  ? 144 LYS G O     1 
ATOM   9584  C CB    . LYS G 1 147 ? 18.236 -94.631  -156.717 1.00 81.31  ? 144 LYS G CB    1 
ATOM   9585  C CG    . LYS G 1 147 ? 18.105 -94.334  -155.232 1.00 78.34  ? 144 LYS G CG    1 
ATOM   9586  C CD    . LYS G 1 147 ? 17.949 -95.603  -154.415 1.00 78.70  ? 144 LYS G CD    1 
ATOM   9587  C CE    . LYS G 1 147 ? 17.823 -95.282  -152.935 1.00 78.71  ? 144 LYS G CE    1 
ATOM   9588  N NZ    . LYS G 1 147 ? 17.618 -96.505  -152.114 1.00 110.26 ? 144 LYS G NZ    1 
ATOM   9589  N N     . GLU G 1 148 ? 17.407 -94.143  -159.751 1.00 65.14  ? 145 GLU G N     1 
ATOM   9590  C CA    . GLU G 1 148 ? 17.523 -94.431  -161.176 1.00 82.40  ? 145 GLU G CA    1 
ATOM   9591  C C     . GLU G 1 148 ? 17.945 -93.194  -161.959 1.00 81.64  ? 145 GLU G C     1 
ATOM   9592  O O     . GLU G 1 148 ? 18.778 -93.283  -162.868 1.00 74.34  ? 145 GLU G O     1 
ATOM   9593  C CB    . GLU G 1 148 ? 16.195 -94.976  -161.701 1.00 85.61  ? 145 GLU G CB    1 
ATOM   9594  C CG    . GLU G 1 148 ? 16.204 -95.360  -163.170 1.00 109.94 ? 145 GLU G CG    1 
ATOM   9595  C CD    . GLU G 1 148 ? 14.876 -95.938  -163.623 1.00 134.97 ? 145 GLU G CD    1 
ATOM   9596  O OE1   . GLU G 1 148 ? 14.109 -96.417  -162.761 1.00 137.23 ? 145 GLU G OE1   1 
ATOM   9597  O OE2   . GLU G 1 148 ? 14.598 -95.911  -164.840 1.00 136.02 ? 145 GLU G OE2   1 
ATOM   9598  N N     . ALA G 1 149 ? 17.391 -92.030  -161.612 1.00 88.15  ? 146 ALA G N     1 
ATOM   9599  C CA    . ALA G 1 149 ? 17.751 -90.797  -162.304 1.00 77.13  ? 146 ALA G CA    1 
ATOM   9600  C C     . ALA G 1 149 ? 19.224 -90.469  -162.105 1.00 70.59  ? 146 ALA G C     1 
ATOM   9601  O O     . ALA G 1 149 ? 19.929 -90.121  -163.058 1.00 69.79  ? 146 ALA G O     1 
ATOM   9602  C CB    . ALA G 1 149 ? 16.869 -89.646  -161.821 1.00 76.43  ? 146 ALA G CB    1 
ATOM   9603  N N     . VAL G 1 150 ? 19.706 -90.572  -160.864 1.00 72.04  ? 147 VAL G N     1 
ATOM   9604  C CA    . VAL G 1 150 ? 21.107 -90.247  -160.596 1.00 67.62  ? 147 VAL G CA    1 
ATOM   9605  C C     . VAL G 1 150 ? 22.036 -91.221  -161.314 1.00 67.01  ? 147 VAL G C     1 
ATOM   9606  O O     . VAL G 1 150 ? 23.046 -90.816  -161.904 1.00 61.42  ? 147 VAL G O     1 
ATOM   9607  C CB    . VAL G 1 150 ? 21.370 -90.207  -159.080 1.00 63.09  ? 147 VAL G CB    1 
ATOM   9608  C CG1   . VAL G 1 150 ? 22.855 -90.349  -158.787 1.00 56.69  ? 147 VAL G CG1   1 
ATOM   9609  C CG2   . VAL G 1 150 ? 20.860 -88.901  -158.517 1.00 59.94  ? 147 VAL G CG2   1 
ATOM   9610  N N     . THR G 1 151 ? 21.716 -92.518  -161.276 1.00 74.22  ? 148 THR G N     1 
ATOM   9611  C CA    . THR G 1 151 ? 22.561 -93.501  -161.950 1.00 75.11  ? 148 THR G CA    1 
ATOM   9612  C C     . THR G 1 151 ? 22.572 -93.286  -163.462 1.00 88.04  ? 148 THR G C     1 
ATOM   9613  O O     . THR G 1 151 ? 23.631 -93.355  -164.102 1.00 95.48  ? 148 THR G O     1 
ATOM   9614  C CB    . THR G 1 151 ? 22.096 -94.915  -161.604 1.00 78.93  ? 148 THR G CB    1 
ATOM   9615  O OG1   . THR G 1 151 ? 22.181 -95.111  -160.187 1.00 84.09  ? 148 THR G OG1   1 
ATOM   9616  C CG2   . THR G 1 151 ? 22.966 -95.952  -162.302 1.00 71.59  ? 148 THR G CG2   1 
ATOM   9617  N N     . ASP G 1 152 ? 21.399 -93.039  -164.053 1.00 83.96  ? 149 ASP G N     1 
ATOM   9618  C CA    . ASP G 1 152 ? 21.323 -92.769  -165.484 1.00 73.84  ? 149 ASP G CA    1 
ATOM   9619  C C     . ASP G 1 152 ? 22.110 -91.516  -165.851 1.00 67.32  ? 149 ASP G C     1 
ATOM   9620  O O     . ASP G 1 152 ? 22.777 -91.477  -166.891 1.00 73.13  ? 149 ASP G O     1 
ATOM   9621  C CB    . ASP G 1 152 ? 19.861 -92.633  -165.908 1.00 84.91  ? 149 ASP G CB    1 
ATOM   9622  C CG    . ASP G 1 152 ? 19.666 -92.801  -167.400 1.00 112.85 ? 149 ASP G CG    1 
ATOM   9623  O OD1   . ASP G 1 152 ? 19.623 -93.960  -167.865 1.00 145.23 ? 149 ASP G OD1   1 
ATOM   9624  O OD2   . ASP G 1 152 ? 19.554 -91.779  -168.109 1.00 101.68 ? 149 ASP G OD2   1 
ATOM   9625  N N     . GLY G 1 153 ? 22.038 -90.480  -165.012 1.00 77.38  ? 150 GLY G N     1 
ATOM   9626  C CA    . GLY G 1 153 ? 22.824 -89.284  -165.265 1.00 70.34  ? 150 GLY G CA    1 
ATOM   9627  C C     . GLY G 1 153 ? 24.314 -89.542  -165.184 1.00 75.99  ? 150 GLY G C     1 
ATOM   9628  O O     . GLY G 1 153 ? 25.090 -89.003  -165.975 1.00 79.03  ? 150 GLY G O     1 
ATOM   9629  N N     . LEU G 1 154 ? 24.733 -90.381  -164.234 1.00 80.32  ? 151 LEU G N     1 
ATOM   9630  C CA    . LEU G 1 154 ? 26.143 -90.743  -164.145 1.00 78.14  ? 151 LEU G CA    1 
ATOM   9631  C C     . LEU G 1 154 ? 26.598 -91.481  -165.398 1.00 80.03  ? 151 LEU G C     1 
ATOM   9632  O O     . LEU G 1 154 ? 27.683 -91.211  -165.928 1.00 77.51  ? 151 LEU G O     1 
ATOM   9633  C CB    . LEU G 1 154 ? 26.391 -91.594  -162.900 1.00 61.34  ? 151 LEU G CB    1 
ATOM   9634  C CG    . LEU G 1 154 ? 27.837 -92.035  -162.666 1.00 58.08  ? 151 LEU G CG    1 
ATOM   9635  C CD1   . LEU G 1 154 ? 28.774 -90.840  -162.692 1.00 79.14  ? 151 LEU G CD1   1 
ATOM   9636  C CD2   . LEU G 1 154 ? 27.965 -92.786  -161.350 1.00 62.93  ? 151 LEU G CD2   1 
ATOM   9637  N N     . LYS G 1 155 ? 25.773 -92.406  -165.893 1.00 65.39  ? 152 LYS G N     1 
ATOM   9638  C CA    . LYS G 1 155 ? 26.106 -93.106  -167.133 1.00 74.02  ? 152 LYS G CA    1 
ATOM   9639  C C     . LYS G 1 155 ? 26.214 -92.134  -168.304 1.00 79.35  ? 152 LYS G C     1 
ATOM   9640  O O     . LYS G 1 155 ? 27.197 -92.155  -169.057 1.00 82.86  ? 152 LYS G O     1 
ATOM   9641  C CB    . LYS G 1 155 ? 25.067 -94.188  -167.429 1.00 86.74  ? 152 LYS G CB    1 
ATOM   9642  C CG    . LYS G 1 155 ? 25.044 -95.336  -166.434 1.00 88.30  ? 152 LYS G CG    1 
ATOM   9643  C CD    . LYS G 1 155 ? 24.180 -96.480  -166.946 1.00 65.89  ? 152 LYS G CD    1 
ATOM   9644  C CE    . LYS G 1 155 ? 22.761 -96.020  -167.241 1.00 64.56  ? 152 LYS G CE    1 
ATOM   9645  N NZ    . LYS G 1 155 ? 21.956 -97.093  -167.889 1.00 88.71  ? 152 LYS G NZ    1 
ATOM   9646  N N     . ARG G 1 156 ? 25.200 -91.282  -168.482 1.00 79.42  ? 153 ARG G N     1 
ATOM   9647  C CA    . ARG G 1 156 ? 25.197 -90.350  -169.605 1.00 65.86  ? 153 ARG G CA    1 
ATOM   9648  C C     . ARG G 1 156 ? 26.329 -89.336  -169.509 1.00 67.37  ? 153 ARG G C     1 
ATOM   9649  O O     . ARG G 1 156 ? 26.787 -88.820  -170.536 1.00 90.11  ? 153 ARG G O     1 
ATOM   9650  C CB    . ARG G 1 156 ? 23.848 -89.637  -169.690 1.00 52.02  ? 153 ARG G CB    1 
ATOM   9651  C CG    . ARG G 1 156 ? 22.789 -90.418  -170.450 1.00 75.83  ? 153 ARG G CG    1 
ATOM   9652  C CD    . ARG G 1 156 ? 21.523 -89.599  -170.635 1.00 75.24  ? 153 ARG G CD    1 
ATOM   9653  N NE    . ARG G 1 156 ? 21.782 -88.319  -171.287 1.00 74.50  ? 153 ARG G NE    1 
ATOM   9654  C CZ    . ARG G 1 156 ? 21.901 -88.157  -172.600 1.00 87.29  ? 153 ARG G CZ    1 
ATOM   9655  N NH1   . ARG G 1 156 ? 21.781 -89.198  -173.413 1.00 106.97 ? 153 ARG G NH1   1 
ATOM   9656  N NH2   . ARG G 1 156 ? 22.137 -86.953  -173.102 1.00 78.25  ? 153 ARG G NH2   1 
ATOM   9657  N N     . ALA G 1 157 ? 26.790 -89.030  -168.296 1.00 64.85  ? 154 ALA G N     1 
ATOM   9658  C CA    . ALA G 1 157 ? 27.883 -88.079  -168.142 1.00 75.32  ? 154 ALA G CA    1 
ATOM   9659  C C     . ALA G 1 157 ? 29.234 -88.742  -168.374 1.00 73.62  ? 154 ALA G C     1 
ATOM   9660  O O     . ALA G 1 157 ? 30.146 -88.119  -168.928 1.00 74.27  ? 154 ALA G O     1 
ATOM   9661  C CB    . ALA G 1 157 ? 27.827 -87.436  -166.757 1.00 96.60  ? 154 ALA G CB    1 
ATOM   9662  N N     . LEU G 1 158 ? 29.383 -90.003  -167.957 1.00 80.26  ? 155 LEU G N     1 
ATOM   9663  C CA    . LEU G 1 158 ? 30.610 -90.733  -168.247 1.00 82.48  ? 155 LEU G CA    1 
ATOM   9664  C C     . LEU G 1 158 ? 30.715 -91.109  -169.718 1.00 82.61  ? 155 LEU G C     1 
ATOM   9665  O O     . LEU G 1 158 ? 31.822 -91.374  -170.197 1.00 77.19  ? 155 LEU G O     1 
ATOM   9666  C CB    . LEU G 1 158 ? 30.695 -91.991  -167.381 1.00 53.80  ? 155 LEU G CB    1 
ATOM   9667  C CG    . LEU G 1 158 ? 31.060 -91.771  -165.913 1.00 62.83  ? 155 LEU G CG    1 
ATOM   9668  C CD1   . LEU G 1 158 ? 30.661 -92.973  -165.077 1.00 74.01  ? 155 LEU G CD1   1 
ATOM   9669  C CD2   . LEU G 1 158 ? 32.549 -91.492  -165.779 1.00 68.68  ? 155 LEU G CD2   1 
ATOM   9670  N N     . ARG G 1 159 ? 29.588 -91.144  -170.435 1.00 82.72  ? 156 ARG G N     1 
ATOM   9671  C CA    . ARG G 1 159 ? 29.621 -91.430  -171.867 1.00 76.68  ? 156 ARG G CA    1 
ATOM   9672  C C     . ARG G 1 159 ? 30.570 -90.496  -172.610 1.00 88.04  ? 156 ARG G C     1 
ATOM   9673  O O     . ARG G 1 159 ? 31.352 -90.940  -173.459 1.00 99.10  ? 156 ARG G O     1 
ATOM   9674  C CB    . ARG G 1 159 ? 28.215 -91.321  -172.458 1.00 83.88  ? 156 ARG G CB    1 
ATOM   9675  C CG    . ARG G 1 159 ? 27.357 -92.555  -172.273 1.00 104.35 ? 156 ARG G CG    1 
ATOM   9676  C CD    . ARG G 1 159 ? 26.092 -92.459  -173.106 1.00 124.84 ? 156 ARG G CD    1 
ATOM   9677  N NE    . ARG G 1 159 ? 25.261 -93.651  -172.978 1.00 151.59 ? 156 ARG G NE    1 
ATOM   9678  C CZ    . ARG G 1 159 ? 24.015 -93.744  -173.428 1.00 140.97 ? 156 ARG G CZ    1 
ATOM   9679  N NH1   . ARG G 1 159 ? 23.449 -92.712  -174.041 1.00 139.55 ? 156 ARG G NH1   1 
ATOM   9680  N NH2   . ARG G 1 159 ? 23.335 -94.869  -173.266 1.00 132.98 ? 156 ARG G NH2   1 
ATOM   9681  N N     . SER G 1 160 ? 30.518 -89.199  -172.301 1.00 92.26  ? 157 SER G N     1 
ATOM   9682  C CA    . SER G 1 160 ? 31.252 -88.163  -173.034 1.00 94.74  ? 157 SER G CA    1 
ATOM   9683  C C     . SER G 1 160 ? 32.779 -88.273  -172.904 1.00 96.78  ? 157 SER G C     1 
ATOM   9684  O O     . SER G 1 160 ? 33.472 -87.365  -173.384 1.00 94.09  ? 157 SER G O     1 
ATOM   9685  C CB    . SER G 1 160 ? 30.793 -86.781  -172.565 1.00 100.37 ? 157 SER G CB    1 
ATOM   9686  O OG    . SER G 1 160 ? 29.380 -86.713  -172.493 1.00 97.03  ? 157 SER G OG    1 
ATOM   9687  N N     . PHE G 1 161 ? 33.336 -89.320  -172.295 1.00 94.85  ? 158 PHE G N     1 
ATOM   9688  C CA    . PHE G 1 161 ? 34.780 -89.474  -172.195 1.00 95.69  ? 158 PHE G CA    1 
ATOM   9689  C C     . PHE G 1 161 ? 35.368 -90.359  -173.285 1.00 97.76  ? 158 PHE G C     1 
ATOM   9690  O O     . PHE G 1 161 ? 36.556 -90.223  -173.596 1.00 102.34 ? 158 PHE G O     1 
ATOM   9691  C CB    . PHE G 1 161 ? 35.163 -90.045  -170.825 1.00 86.52  ? 158 PHE G CB    1 
ATOM   9692  C CG    . PHE G 1 161 ? 35.256 -89.010  -169.742 1.00 88.42  ? 158 PHE G CG    1 
ATOM   9693  C CD1   . PHE G 1 161 ? 35.973 -87.842  -169.942 1.00 98.80  ? 158 PHE G CD1   1 
ATOM   9694  C CD2   . PHE G 1 161 ? 34.620 -89.200  -168.527 1.00 89.99  ? 158 PHE G CD2   1 
ATOM   9695  C CE1   . PHE G 1 161 ? 36.063 -86.887  -168.946 1.00 93.35  ? 158 PHE G CE1   1 
ATOM   9696  C CE2   . PHE G 1 161 ? 34.703 -88.247  -167.529 1.00 86.88  ? 158 PHE G CE2   1 
ATOM   9697  C CZ    . PHE G 1 161 ? 35.424 -87.089  -167.740 1.00 86.19  ? 158 PHE G CZ    1 
ATOM   9698  N N     . GLY G 1 162 ? 34.577 -91.247  -173.865 1.00 95.08  ? 159 GLY G N     1 
ATOM   9699  C CA    . GLY G 1 162 ? 35.073 -92.145  -174.888 1.00 99.46  ? 159 GLY G CA    1 
ATOM   9700  C C     . GLY G 1 162 ? 34.170 -93.344  -175.040 1.00 102.80 ? 159 GLY G C     1 
ATOM   9701  O O     . GLY G 1 162 ? 33.279 -93.594  -174.228 1.00 102.27 ? 159 GLY G O     1 
ATOM   9702  N N     . ASN G 1 163 ? 34.416 -94.089  -176.122 1.00 103.54 ? 160 ASN G N     1 
ATOM   9703  C CA    . ASN G 1 163 ? 33.629 -95.287  -176.399 1.00 109.67 ? 160 ASN G CA    1 
ATOM   9704  C C     . ASN G 1 163 ? 33.712 -96.288  -175.255 1.00 106.06 ? 160 ASN G C     1 
ATOM   9705  O O     . ASN G 1 163 ? 32.728 -96.968  -174.945 1.00 105.30 ? 160 ASN G O     1 
ATOM   9706  C CB    . ASN G 1 163 ? 34.089 -95.932  -177.707 1.00 115.46 ? 160 ASN G CB    1 
ATOM   9707  C CG    . ASN G 1 163 ? 34.032 -94.977  -178.882 1.00 114.44 ? 160 ASN G CG    1 
ATOM   9708  O OD1   . ASN G 1 163 ? 33.014 -94.328  -179.121 1.00 115.28 ? 160 ASN G OD1   1 
ATOM   9709  N ND2   . ASN G 1 163 ? 35.128 -94.891  -179.628 1.00 119.08 ? 160 ASN G ND2   1 
ATOM   9710  N N     . ALA G 1 164 ? 34.881 -96.390  -174.615 1.00 96.52  ? 161 ALA G N     1 
ATOM   9711  C CA    . ALA G 1 164 ? 35.082 -97.386  -173.566 1.00 85.67  ? 161 ALA G CA    1 
ATOM   9712  C C     . ALA G 1 164 ? 34.134 -97.189  -172.389 1.00 99.66  ? 161 ALA G C     1 
ATOM   9713  O O     . ALA G 1 164 ? 33.837 -98.148  -171.669 1.00 110.11 ? 161 ALA G O     1 
ATOM   9714  C CB    . ALA G 1 164 ? 36.532 -97.355  -173.085 1.00 95.62  ? 161 ALA G CB    1 
ATOM   9715  N N     . LEU G 1 165 ? 33.654 -95.964  -172.170 1.00 96.93  ? 162 LEU G N     1 
ATOM   9716  C CA    . LEU G 1 165 ? 32.783 -95.662  -171.043 1.00 80.56  ? 162 LEU G CA    1 
ATOM   9717  C C     . LEU G 1 165 ? 31.312 -95.584  -171.439 1.00 83.72  ? 162 LEU G C     1 
ATOM   9718  O O     . LEU G 1 165 ? 30.503 -95.031  -170.685 1.00 81.05  ? 162 LEU G O     1 
ATOM   9719  C CB    . LEU G 1 165 ? 33.221 -94.360  -170.371 1.00 89.97  ? 162 LEU G CB    1 
ATOM   9720  C CG    . LEU G 1 165 ? 34.438 -94.458  -169.450 1.00 78.71  ? 162 LEU G CG    1 
ATOM   9721  C CD1   . LEU G 1 165 ? 34.840 -93.087  -168.942 1.00 83.85  ? 162 LEU G CD1   1 
ATOM   9722  C CD2   . LEU G 1 165 ? 34.146 -95.388  -168.288 1.00 84.82  ? 162 LEU G CD2   1 
ATOM   9723  N N     . GLY G 1 166 ? 30.948 -96.123  -172.599 1.00 98.55  ? 163 GLY G N     1 
ATOM   9724  C CA    . GLY G 1 166 ? 29.561 -96.215  -173.000 1.00 104.94 ? 163 GLY G CA    1 
ATOM   9725  C C     . GLY G 1 166 ? 29.148 -95.361  -174.181 1.00 112.07 ? 163 GLY G C     1 
ATOM   9726  O O     . GLY G 1 166 ? 27.955 -95.321  -174.501 1.00 119.33 ? 163 GLY G O     1 
ATOM   9727  N N     . ASN G 1 167 ? 30.085 -94.676  -174.840 1.00 103.60 ? 164 ASN G N     1 
ATOM   9728  C CA    . ASN G 1 167 ? 29.722 -93.838  -175.978 1.00 111.88 ? 164 ASN G CA    1 
ATOM   9729  C C     . ASN G 1 167 ? 29.381 -94.652  -177.220 1.00 117.70 ? 164 ASN G C     1 
ATOM   9730  O O     . ASN G 1 167 ? 28.721 -94.130  -178.125 1.00 116.88 ? 164 ASN G O     1 
ATOM   9731  C CB    . ASN G 1 167 ? 30.857 -92.861  -176.293 1.00 107.60 ? 164 ASN G CB    1 
ATOM   9732  C CG    . ASN G 1 167 ? 30.463 -91.823  -177.325 1.00 108.97 ? 164 ASN G CG    1 
ATOM   9733  O OD1   . ASN G 1 167 ? 29.309 -91.399  -177.385 1.00 107.72 ? 164 ASN G OD1   1 
ATOM   9734  N ND2   . ASN G 1 167 ? 31.422 -91.410  -178.146 1.00 106.93 ? 164 ASN G ND2   1 
ATOM   9735  N N     . CYS G 1 168 ? 29.803 -95.914  -177.283 1.00 119.97 ? 165 CYS G N     1 
ATOM   9736  C CA    . CYS G 1 168 ? 29.566 -96.742  -178.459 1.00 125.67 ? 165 CYS G CA    1 
ATOM   9737  C C     . CYS G 1 168 ? 28.197 -97.409  -178.458 1.00 127.47 ? 165 CYS G C     1 
ATOM   9738  O O     . CYS G 1 168 ? 27.775 -97.915  -179.503 1.00 128.73 ? 165 CYS G O     1 
ATOM   9739  C CB    . CYS G 1 168 ? 30.655 -97.811  -178.575 1.00 130.27 ? 165 CYS G CB    1 
ATOM   9740  S SG    . CYS G 1 168 ? 30.827 -98.856  -177.113 1.00 139.80 ? 165 CYS G SG    1 
ATOM   9741  N N     . ILE G 1 169 ? 27.497 -97.423  -177.319 1.00 141.14 ? 166 ILE G N     1 
ATOM   9742  C CA    . ILE G 1 169 ? 26.194 -98.073  -177.232 1.00 134.38 ? 166 ILE G CA    1 
ATOM   9743  C C     . ILE G 1 169 ? 25.166 -97.426  -178.153 1.00 124.59 ? 166 ILE G C     1 
ATOM   9744  O O     . ILE G 1 169 ? 24.121 -98.025  -178.427 1.00 112.49 ? 166 ILE G O     1 
ATOM   9745  C CB    . ILE G 1 169 ? 25.706 -98.073  -175.766 1.00 130.26 ? 166 ILE G CB    1 
ATOM   9746  C CG1   . ILE G 1 169 ? 24.632 -99.142  -175.550 1.00 132.83 ? 166 ILE G CG1   1 
ATOM   9747  C CG2   . ILE G 1 169 ? 25.172 -96.701  -175.380 1.00 115.15 ? 166 ILE G CG2   1 
ATOM   9748  C CD1   . ILE G 1 169 ? 25.187 -100.538 -175.399 1.00 129.90 ? 166 ILE G CD1   1 
ATOM   9749  N N     . LEU G 1 170 ? 25.440 -96.222  -178.653 1.00 118.58 ? 167 LEU G N     1 
ATOM   9750  C CA    . LEU G 1 170 ? 24.528 -95.524  -179.549 1.00 119.12 ? 167 LEU G CA    1 
ATOM   9751  C C     . LEU G 1 170 ? 24.909 -95.663  -181.017 1.00 127.26 ? 167 LEU G C     1 
ATOM   9752  O O     . LEU G 1 170 ? 24.211 -95.120  -181.878 1.00 134.59 ? 167 LEU G O     1 
ATOM   9753  C CB    . LEU G 1 170 ? 24.455 -94.040  -179.175 1.00 136.57 ? 167 LEU G CB    1 
ATOM   9754  C CG    . LEU G 1 170 ? 23.809 -93.707  -177.828 1.00 123.67 ? 167 LEU G CG    1 
ATOM   9755  C CD1   . LEU G 1 170 ? 24.222 -92.321  -177.354 1.00 117.48 ? 167 LEU G CD1   1 
ATOM   9756  C CD2   . LEU G 1 170 ? 22.295 -93.815  -177.919 1.00 119.71 ? 167 LEU G CD2   1 
ATOM   9757  N N     . ASP G 1 171 ? 25.993 -96.373  -181.323 1.00 121.92 ? 168 ASP G N     1 
ATOM   9758  C CA    . ASP G 1 171 ? 26.399 -96.607  -182.705 1.00 128.64 ? 168 ASP G CA    1 
ATOM   9759  C C     . ASP G 1 171 ? 25.635 -97.813  -183.241 1.00 142.67 ? 168 ASP G C     1 
ATOM   9760  O O     . ASP G 1 171 ? 25.858 -98.945  -182.797 1.00 150.57 ? 168 ASP G O     1 
ATOM   9761  C CB    . ASP G 1 171 ? 27.907 -96.820  -182.790 1.00 130.83 ? 168 ASP G CB    1 
ATOM   9762  C CG    . ASP G 1 171 ? 28.425 -96.763  -184.215 1.00 145.03 ? 168 ASP G CG    1 
ATOM   9763  O OD1   . ASP G 1 171 ? 27.673 -96.313  -185.106 1.00 143.26 ? 168 ASP G OD1   1 
ATOM   9764  O OD2   . ASP G 1 171 ? 29.585 -97.166  -184.446 1.00 149.05 ? 168 ASP G OD2   1 
ATOM   9765  N N     . LYS G 1 172 ? 24.726 -97.570  -184.190 1.00 143.43 ? 169 LYS G N     1 
ATOM   9766  C CA    . LYS G 1 172 ? 23.878 -98.642  -184.705 1.00 141.98 ? 169 LYS G CA    1 
ATOM   9767  C C     . LYS G 1 172 ? 24.701 -99.733  -185.380 1.00 142.48 ? 169 LYS G C     1 
ATOM   9768  O O     . LYS G 1 172 ? 24.391 -100.925 -185.251 1.00 143.73 ? 169 LYS G O     1 
ATOM   9769  C CB    . LYS G 1 172 ? 22.848 -98.064  -185.676 1.00 136.43 ? 169 LYS G CB    1 
ATOM   9770  C CG    . LYS G 1 172 ? 21.980 -96.972  -185.069 1.00 130.18 ? 169 LYS G CG    1 
ATOM   9771  C CD    . LYS G 1 172 ? 21.401 -96.062  -186.140 1.00 143.06 ? 169 LYS G CD    1 
ATOM   9772  C CE    . LYS G 1 172 ? 20.708 -94.856  -185.523 1.00 143.83 ? 169 LYS G CE    1 
ATOM   9773  N NZ    . LYS G 1 172 ? 20.275 -93.876  -186.558 1.00 149.73 ? 169 LYS G NZ    1 
ATOM   9774  N N     . ASP G 1 173 ? 25.749 -99.346  -186.111 1.00 132.43 ? 170 ASP G N     1 
ATOM   9775  C CA    . ASP G 1 173 ? 26.628 -100.332 -186.734 1.00 149.83 ? 170 ASP G CA    1 
ATOM   9776  C C     . ASP G 1 173 ? 27.315 -101.199 -185.686 1.00 151.64 ? 170 ASP G C     1 
ATOM   9777  O O     . ASP G 1 173 ? 27.476 -102.411 -185.877 1.00 161.75 ? 170 ASP G O     1 
ATOM   9778  C CB    . ASP G 1 173 ? 27.663 -99.630  -187.613 1.00 149.03 ? 170 ASP G CB    1 
ATOM   9779  C CG    . ASP G 1 173 ? 27.027 -98.772  -188.689 1.00 160.87 ? 170 ASP G CG    1 
ATOM   9780  O OD1   . ASP G 1 173 ? 25.967 -99.166  -189.218 1.00 165.58 ? 170 ASP G OD1   1 
ATOM   9781  O OD2   . ASP G 1 173 ? 27.589 -97.702  -189.006 1.00 163.98 ? 170 ASP G OD2   1 
ATOM   9782  N N     . TYR G 1 174 ? 27.747 -100.586 -184.582 1.00 141.42 ? 171 TYR G N     1 
ATOM   9783  C CA    . TYR G 1 174 ? 28.337 -101.347 -183.486 1.00 138.54 ? 171 TYR G CA    1 
ATOM   9784  C C     . TYR G 1 174 ? 27.355 -102.374 -182.931 1.00 130.86 ? 171 TYR G C     1 
ATOM   9785  O O     . TYR G 1 174 ? 27.733 -103.516 -182.651 1.00 140.23 ? 171 TYR G O     1 
ATOM   9786  C CB    . TYR G 1 174 ? 28.808 -100.386 -182.393 1.00 137.77 ? 171 TYR G CB    1 
ATOM   9787  C CG    . TYR G 1 174 ? 29.255 -101.050 -181.113 1.00 127.26 ? 171 TYR G CG    1 
ATOM   9788  C CD1   . TYR G 1 174 ? 30.436 -101.776 -181.060 1.00 128.84 ? 171 TYR G CD1   1 
ATOM   9789  C CD2   . TYR G 1 174 ? 28.505 -100.933 -179.951 1.00 131.61 ? 171 TYR G CD2   1 
ATOM   9790  C CE1   . TYR G 1 174 ? 30.852 -102.378 -179.888 1.00 129.90 ? 171 TYR G CE1   1 
ATOM   9791  C CE2   . TYR G 1 174 ? 28.913 -101.529 -178.775 1.00 144.28 ? 171 TYR G CE2   1 
ATOM   9792  C CZ    . TYR G 1 174 ? 30.086 -102.252 -178.750 1.00 135.79 ? 171 TYR G CZ    1 
ATOM   9793  O OH    . TYR G 1 174 ? 30.493 -102.847 -177.579 1.00 132.07 ? 171 TYR G OH    1 
ATOM   9794  N N     . LEU G 1 175 ? 26.084 -101.993 -182.785 1.00 125.92 ? 172 LEU G N     1 
ATOM   9795  C CA    . LEU G 1 175 ? 25.079 -102.941 -182.309 1.00 144.82 ? 172 LEU G CA    1 
ATOM   9796  C C     . LEU G 1 175 ? 24.867 -104.076 -183.306 1.00 147.04 ? 172 LEU G C     1 
ATOM   9797  O O     . LEU G 1 175 ? 24.766 -105.249 -182.916 1.00 149.48 ? 172 LEU G O     1 
ATOM   9798  C CB    . LEU G 1 175 ? 23.761 -102.215 -182.035 1.00 152.24 ? 172 LEU G CB    1 
ATOM   9799  C CG    . LEU G 1 175 ? 23.729 -101.297 -180.811 1.00 142.60 ? 172 LEU G CG    1 
ATOM   9800  C CD1   . LEU G 1 175 ? 22.313 -100.810 -180.541 1.00 146.39 ? 172 LEU G CD1   1 
ATOM   9801  C CD2   . LEU G 1 175 ? 24.301 -101.999 -179.586 1.00 130.57 ? 172 LEU G CD2   1 
ATOM   9802  N N     . ARG G 1 176 ? 24.772 -103.742 -184.597 1.00 149.42 ? 173 ARG G N     1 
ATOM   9803  C CA    . ARG G 1 176 ? 24.623 -104.773 -185.621 1.00 155.91 ? 173 ARG G CA    1 
ATOM   9804  C C     . ARG G 1 176 ? 25.785 -105.758 -185.585 1.00 156.60 ? 173 ARG G C     1 
ATOM   9805  O O     . ARG G 1 176 ? 25.584 -106.972 -185.704 1.00 156.42 ? 173 ARG G O     1 
ATOM   9806  C CB    . ARG G 1 176 ? 24.503 -104.129 -187.003 1.00 148.35 ? 173 ARG G CB    1 
ATOM   9807  C CG    . ARG G 1 176 ? 23.257 -103.274 -187.181 1.00 159.90 ? 173 ARG G CG    1 
ATOM   9808  C CD    . ARG G 1 176 ? 22.992 -102.935 -188.645 1.00 168.65 ? 173 ARG G CD    1 
ATOM   9809  N NE    . ARG G 1 176 ? 24.100 -102.215 -189.269 1.00 170.81 ? 173 ARG G NE    1 
ATOM   9810  C CZ    . ARG G 1 176 ? 25.020 -102.780 -190.045 1.00 174.38 ? 173 ARG G CZ    1 
ATOM   9811  N NH1   . ARG G 1 176 ? 24.968 -104.081 -190.301 1.00 174.79 ? 173 ARG G NH1   1 
ATOM   9812  N NH2   . ARG G 1 176 ? 25.992 -102.045 -190.567 1.00 172.85 ? 173 ARG G NH2   1 
ATOM   9813  N N     . SER G 1 177 ? 27.010 -105.254 -185.420 1.00 150.81 ? 174 SER G N     1 
ATOM   9814  C CA    . SER G 1 177 ? 28.162 -106.141 -185.297 1.00 138.51 ? 174 SER G CA    1 
ATOM   9815  C C     . SER G 1 177 ? 28.156 -106.909 -183.982 1.00 149.30 ? 174 SER G C     1 
ATOM   9816  O O     . SER G 1 177 ? 28.755 -107.987 -183.903 1.00 165.82 ? 174 SER G O     1 
ATOM   9817  C CB    . SER G 1 177 ? 29.459 -105.341 -185.428 1.00 137.27 ? 174 SER G CB    1 
ATOM   9818  O OG    . SER G 1 177 ? 29.598 -104.806 -186.733 1.00 153.83 ? 174 SER G OG    1 
ATOM   9819  N N     . LEU G 1 178 ? 27.498 -106.375 -182.951 1.00 150.16 ? 175 LEU G N     1 
ATOM   9820  C CA    . LEU G 1 178 ? 27.379 -107.100 -181.690 1.00 150.98 ? 175 LEU G CA    1 
ATOM   9821  C C     . LEU G 1 178 ? 26.431 -108.284 -181.823 1.00 158.84 ? 175 LEU G C     1 
ATOM   9822  O O     . LEU G 1 178 ? 26.657 -109.338 -181.216 1.00 155.54 ? 175 LEU G O     1 
ATOM   9823  C CB    . LEU G 1 178 ? 26.896 -106.160 -180.585 1.00 138.98 ? 175 LEU G CB    1 
ATOM   9824  C CG    . LEU G 1 178 ? 27.940 -105.466 -179.714 1.00 132.65 ? 175 LEU G CG    1 
ATOM   9825  C CD1   . LEU G 1 178 ? 27.249 -104.587 -178.687 1.00 138.87 ? 175 LEU G CD1   1 
ATOM   9826  C CD2   . LEU G 1 178 ? 28.832 -106.488 -179.032 1.00 136.96 ? 175 LEU G CD2   1 
ATOM   9827  N N     . ASN G 1 179 ? 25.361 -108.126 -182.606 1.00 160.04 ? 176 ASN G N     1 
ATOM   9828  C CA    . ASN G 1 179 ? 24.446 -109.243 -182.830 1.00 156.38 ? 176 ASN G CA    1 
ATOM   9829  C C     . ASN G 1 179 ? 25.124 -110.405 -183.548 1.00 159.60 ? 176 ASN G C     1 
ATOM   9830  O O     . ASN G 1 179 ? 24.692 -111.555 -183.406 1.00 154.95 ? 176 ASN G O     1 
ATOM   9831  C CB    . ASN G 1 179 ? 23.225 -108.776 -183.624 1.00 145.88 ? 176 ASN G CB    1 
ATOM   9832  C CG    . ASN G 1 179 ? 22.407 -107.741 -182.879 1.00 145.80 ? 176 ASN G CG    1 
ATOM   9833  O OD1   . ASN G 1 179 ? 22.075 -107.922 -181.708 1.00 144.86 ? 176 ASN G OD1   1 
ATOM   9834  N ND2   . ASN G 1 179 ? 22.072 -106.651 -183.558 1.00 144.25 ? 176 ASN G ND2   1 
ATOM   9835  N N     . LYS G 1 180 ? 26.181 -110.134 -184.317 1.00 162.11 ? 177 LYS G N     1 
ATOM   9836  C CA    . LYS G 1 180 ? 26.871 -111.156 -185.097 1.00 163.67 ? 177 LYS G CA    1 
ATOM   9837  C C     . LYS G 1 180 ? 27.975 -111.862 -184.314 1.00 163.24 ? 177 LYS G C     1 
ATOM   9838  O O     . LYS G 1 180 ? 28.931 -112.367 -184.919 1.00 165.60 ? 177 LYS G O     1 
ATOM   9839  C CB    . LYS G 1 180 ? 27.434 -110.544 -186.381 1.00 157.43 ? 177 LYS G CB    1 
ATOM   9840  C CG    . LYS G 1 180 ? 26.383 -109.887 -187.262 1.00 151.34 ? 177 LYS G CG    1 
ATOM   9841  C CD    . LYS G 1 180 ? 27.017 -109.122 -188.411 1.00 155.07 ? 177 LYS G CD    1 
ATOM   9842  C CE    . LYS G 1 180 ? 25.966 -108.387 -189.229 1.00 154.95 ? 177 LYS G CE    1 
ATOM   9843  N NZ    . LYS G 1 180 ? 26.572 -107.597 -190.336 1.00 124.51 ? 177 LYS G NZ    1 
ATOM   9844  N N     . LEU G 1 181 ? 27.873 -111.913 -182.992 1.00 158.51 ? 178 LEU G N     1 
ATOM   9845  C CA    . LEU G 1 181 ? 28.846 -112.575 -182.141 1.00 164.86 ? 178 LEU G CA    1 
ATOM   9846  C C     . LEU G 1 181 ? 28.172 -113.678 -181.336 1.00 172.09 ? 178 LEU G C     1 
ATOM   9847  O O     . LEU G 1 181 ? 26.956 -113.641 -181.111 1.00 170.30 ? 178 LEU G O     1 
ATOM   9848  C CB    . LEU G 1 181 ? 29.515 -111.572 -181.188 1.00 161.23 ? 178 LEU G CB    1 
ATOM   9849  C CG    . LEU G 1 181 ? 30.664 -110.745 -181.770 1.00 152.52 ? 178 LEU G CG    1 
ATOM   9850  C CD1   . LEU G 1 181 ? 31.226 -109.800 -180.721 1.00 149.52 ? 178 LEU G CD1   1 
ATOM   9851  C CD2   . LEU G 1 181 ? 31.755 -111.650 -182.322 1.00 160.44 ? 178 LEU G CD2   1 
ATOM   9852  N N     . PRO G 1 182 ? 28.927 -114.686 -180.898 1.00 172.47 ? 179 PRO G N     1 
ATOM   9853  C CA    . PRO G 1 182 ? 28.331 -115.748 -180.077 1.00 162.68 ? 179 PRO G CA    1 
ATOM   9854  C C     . PRO G 1 182 ? 27.791 -115.194 -178.766 1.00 164.62 ? 179 PRO G C     1 
ATOM   9855  O O     . PRO G 1 182 ? 28.505 -114.532 -178.008 1.00 162.52 ? 179 PRO G O     1 
ATOM   9856  C CB    . PRO G 1 182 ? 29.499 -116.715 -179.846 1.00 146.93 ? 179 PRO G CB    1 
ATOM   9857  C CG    . PRO G 1 182 ? 30.424 -116.463 -180.989 1.00 155.34 ? 179 PRO G CG    1 
ATOM   9858  C CD    . PRO G 1 182 ? 30.325 -114.990 -181.255 1.00 163.32 ? 179 PRO G CD    1 
ATOM   9859  N N     . ARG G 1 183 ? 26.516 -115.472 -178.505 1.00 164.68 ? 180 ARG G N     1 
ATOM   9860  C CA    . ARG G 1 183 ? 25.848 -115.009 -177.291 1.00 174.89 ? 180 ARG G CA    1 
ATOM   9861  C C     . ARG G 1 183 ? 26.331 -115.861 -176.125 1.00 172.11 ? 180 ARG G C     1 
ATOM   9862  O O     . ARG G 1 183 ? 25.805 -116.947 -175.868 1.00 158.77 ? 180 ARG G O     1 
ATOM   9863  C CB    . ARG G 1 183 ? 24.334 -115.081 -177.451 1.00 183.45 ? 180 ARG G CB    1 
ATOM   9864  C CG    . ARG G 1 183 ? 23.611 -113.790 -177.099 1.00 186.09 ? 180 ARG G CG    1 
ATOM   9865  C CD    . ARG G 1 183 ? 23.599 -113.546 -175.600 1.00 184.30 ? 180 ARG G CD    1 
ATOM   9866  N NE    . ARG G 1 183 ? 23.094 -114.699 -174.861 1.00 192.33 ? 180 ARG G NE    1 
ATOM   9867  C CZ    . ARG G 1 183 ? 23.140 -114.815 -173.538 1.00 189.10 ? 180 ARG G CZ    1 
ATOM   9868  N NH1   . ARG G 1 183 ? 23.669 -113.846 -172.804 1.00 183.95 ? 180 ARG G NH1   1 
ATOM   9869  N NH2   . ARG G 1 183 ? 22.656 -115.900 -172.948 1.00 186.26 ? 180 ARG G NH2   1 
ATOM   9870  N N     . GLN G 1 184 ? 27.340 -115.367 -175.414 1.00 177.37 ? 181 GLN G N     1 
ATOM   9871  C CA    . GLN G 1 184 ? 27.979 -116.123 -174.350 1.00 173.51 ? 181 GLN G CA    1 
ATOM   9872  C C     . GLN G 1 184 ? 27.119 -116.136 -173.089 1.00 170.88 ? 181 GLN G C     1 
ATOM   9873  O O     . GLN G 1 184 ? 26.278 -115.262 -172.862 1.00 179.73 ? 181 GLN G O     1 
ATOM   9874  C CB    . GLN G 1 184 ? 29.359 -115.542 -174.040 1.00 181.17 ? 181 GLN G CB    1 
ATOM   9875  C CG    . GLN G 1 184 ? 29.355 -114.042 -173.807 1.00 185.16 ? 181 GLN G CG    1 
ATOM   9876  C CD    . GLN G 1 184 ? 30.697 -113.523 -173.334 1.00 177.81 ? 181 GLN G CD    1 
ATOM   9877  O OE1   . GLN G 1 184 ? 31.250 -112.588 -173.912 1.00 175.24 ? 181 GLN G OE1   1 
ATOM   9878  N NE2   . GLN G 1 184 ? 31.226 -114.126 -172.276 1.00 180.10 ? 181 GLN G NE2   1 
ATOM   9879  N N     . LEU G 1 185 ? 27.346 -117.157 -172.263 1.00 160.08 ? 182 LEU G N     1 
ATOM   9880  C CA    . LEU G 1 185 ? 26.652 -117.350 -171.002 1.00 176.92 ? 182 LEU G CA    1 
ATOM   9881  C C     . LEU G 1 185 ? 27.213 -116.402 -169.940 1.00 180.91 ? 182 LEU G C     1 
ATOM   9882  O O     . LEU G 1 185 ? 28.363 -115.966 -170.040 1.00 182.79 ? 182 LEU G O     1 
ATOM   9883  C CB    . LEU G 1 185 ? 26.799 -118.800 -170.542 1.00 181.76 ? 182 LEU G CB    1 
ATOM   9884  C CG    . LEU G 1 185 ? 25.584 -119.507 -169.935 1.00 180.19 ? 182 LEU G CG    1 
ATOM   9885  C CD1   . LEU G 1 185 ? 24.400 -119.457 -170.892 1.00 178.77 ? 182 LEU G CD1   1 
ATOM   9886  C CD2   . LEU G 1 185 ? 25.920 -120.945 -169.570 1.00 147.17 ? 182 LEU G CD2   1 
ATOM   9887  N N     . PRO G 1 186 ? 26.408 -116.042 -168.937 1.00 175.96 ? 183 PRO G N     1 
ATOM   9888  C CA    . PRO G 1 186 ? 26.891 -115.147 -167.876 1.00 166.86 ? 183 PRO G CA    1 
ATOM   9889  C C     . PRO G 1 186 ? 28.223 -115.598 -167.290 1.00 163.25 ? 183 PRO G C     1 
ATOM   9890  O O     . PRO G 1 186 ? 28.457 -116.787 -167.062 1.00 162.38 ? 183 PRO G O     1 
ATOM   9891  C CB    . PRO G 1 186 ? 25.771 -115.207 -166.835 1.00 163.95 ? 183 PRO G CB    1 
ATOM   9892  C CG    . PRO G 1 186 ? 24.541 -115.444 -167.640 1.00 173.03 ? 183 PRO G CG    1 
ATOM   9893  C CD    . PRO G 1 186 ? 24.950 -116.251 -168.852 1.00 173.53 ? 183 PRO G CD    1 
ATOM   9894  N N     . LEU G 1 187 ? 29.100 -114.626 -167.049 1.00 163.99 ? 184 LEU G N     1 
ATOM   9895  C CA    . LEU G 1 187 ? 30.421 -114.906 -166.506 1.00 162.08 ? 184 LEU G CA    1 
ATOM   9896  C C     . LEU G 1 187 ? 30.326 -115.442 -165.082 1.00 157.79 ? 184 LEU G C     1 
ATOM   9897  O O     . LEU G 1 187 ? 29.405 -115.116 -164.328 1.00 159.73 ? 184 LEU G O     1 
ATOM   9898  C CB    . LEU G 1 187 ? 31.288 -113.644 -166.520 1.00 168.09 ? 184 LEU G CB    1 
ATOM   9899  C CG    . LEU G 1 187 ? 31.553 -112.925 -167.849 1.00 184.21 ? 184 LEU G CG    1 
ATOM   9900  C CD1   . LEU G 1 187 ? 31.813 -113.922 -168.973 1.00 190.25 ? 184 LEU G CD1   1 
ATOM   9901  C CD2   . LEU G 1 187 ? 30.429 -111.954 -168.213 1.00 166.13 ? 184 LEU G CD2   1 
ATOM   9902  N N     . GLU G 1 188 ? 31.298 -116.275 -164.720 1.00 150.98 ? 185 GLU G N     1 
ATOM   9903  C CA    . GLU G 1 188 ? 31.375 -116.846 -163.382 1.00 160.40 ? 185 GLU G CA    1 
ATOM   9904  C C     . GLU G 1 188 ? 32.285 -115.991 -162.509 1.00 152.91 ? 185 GLU G C     1 
ATOM   9905  O O     . GLU G 1 188 ? 33.392 -115.629 -162.923 1.00 157.55 ? 185 GLU G O     1 
ATOM   9906  C CB    . GLU G 1 188 ? 31.893 -118.284 -163.444 1.00 165.09 ? 185 GLU G CB    1 
ATOM   9907  C CG    . GLU G 1 188 ? 31.909 -119.004 -162.108 1.00 161.33 ? 185 GLU G CG    1 
ATOM   9908  C CD    . GLU G 1 188 ? 32.318 -120.458 -162.239 1.00 164.33 ? 185 GLU G CD    1 
ATOM   9909  O OE1   . GLU G 1 188 ? 33.297 -120.737 -162.963 1.00 174.09 ? 185 GLU G OE1   1 
ATOM   9910  O OE2   . GLU G 1 188 ? 31.659 -121.320 -161.622 1.00 160.36 ? 185 GLU G OE2   1 
ATOM   9911  N N     . VAL G 1 189 ? 31.818 -115.671 -161.306 1.00 127.14 ? 186 VAL G N     1 
ATOM   9912  C CA    . VAL G 1 189 ? 32.549 -114.820 -160.374 1.00 131.56 ? 186 VAL G CA    1 
ATOM   9913  C C     . VAL G 1 189 ? 33.255 -115.705 -159.357 1.00 138.02 ? 186 VAL G C     1 
ATOM   9914  O O     . VAL G 1 189 ? 32.627 -116.562 -158.723 1.00 140.94 ? 186 VAL G O     1 
ATOM   9915  C CB    . VAL G 1 189 ? 31.611 -113.819 -159.678 1.00 140.93 ? 186 VAL G CB    1 
ATOM   9916  C CG1   . VAL G 1 189 ? 32.392 -112.954 -158.704 1.00 150.35 ? 186 VAL G CG1   1 
ATOM   9917  C CG2   . VAL G 1 189 ? 30.907 -112.954 -160.706 1.00 118.09 ? 186 VAL G CG2   1 
ATOM   9918  N N     . ASP G 1 190 ? 34.560 -115.497 -159.198 1.00 134.65 ? 187 ASP G N     1 
ATOM   9919  C CA    . ASP G 1 190 ? 35.370 -116.280 -158.270 1.00 144.59 ? 187 ASP G CA    1 
ATOM   9920  C C     . ASP G 1 190 ? 35.397 -115.569 -156.920 1.00 144.94 ? 187 ASP G C     1 
ATOM   9921  O O     . ASP G 1 190 ? 35.947 -114.469 -156.801 1.00 141.29 ? 187 ASP G O     1 
ATOM   9922  C CB    . ASP G 1 190 ? 36.780 -116.471 -158.820 1.00 144.20 ? 187 ASP G CB    1 
ATOM   9923  C CG    . ASP G 1 190 ? 37.661 -117.283 -157.894 1.00 164.47 ? 187 ASP G CG    1 
ATOM   9924  O OD1   . ASP G 1 190 ? 37.461 -118.513 -157.812 1.00 162.49 ? 187 ASP G OD1   1 
ATOM   9925  O OD2   . ASP G 1 190 ? 38.551 -116.692 -157.246 1.00 171.83 ? 187 ASP G OD2   1 
ATOM   9926  N N     . LEU G 1 191 ? 34.804 -116.197 -155.903 1.00 145.40 ? 188 LEU G N     1 
ATOM   9927  C CA    . LEU G 1 191 ? 34.743 -115.636 -154.559 1.00 144.64 ? 188 LEU G CA    1 
ATOM   9928  C C     . LEU G 1 191 ? 35.744 -116.283 -153.608 1.00 141.73 ? 188 LEU G C     1 
ATOM   9929  O O     . LEU G 1 191 ? 35.495 -116.354 -152.400 1.00 142.75 ? 188 LEU G O     1 
ATOM   9930  C CB    . LEU G 1 191 ? 33.327 -115.757 -153.997 1.00 146.69 ? 188 LEU G CB    1 
ATOM   9931  C CG    . LEU G 1 191 ? 32.233 -115.111 -154.843 1.00 141.98 ? 188 LEU G CG    1 
ATOM   9932  C CD1   . LEU G 1 191 ? 30.901 -115.179 -154.123 1.00 142.17 ? 188 LEU G CD1   1 
ATOM   9933  C CD2   . LEU G 1 191 ? 32.600 -113.674 -155.164 1.00 134.12 ? 188 LEU G CD2   1 
ATOM   9934  N N     . THR G 1 192 ? 36.875 -116.758 -154.129 1.00 143.95 ? 189 THR G N     1 
ATOM   9935  C CA    . THR G 1 192 ? 37.907 -117.331 -153.271 1.00 144.19 ? 189 THR G CA    1 
ATOM   9936  C C     . THR G 1 192 ? 38.706 -116.237 -152.573 1.00 141.59 ? 189 THR G C     1 
ATOM   9937  O O     . THR G 1 192 ? 38.758 -116.178 -151.340 1.00 138.30 ? 189 THR G O     1 
ATOM   9938  C CB    . THR G 1 192 ? 38.832 -118.236 -154.088 1.00 137.21 ? 189 THR G CB    1 
ATOM   9939  O OG1   . THR G 1 192 ? 39.478 -117.466 -155.110 1.00 129.92 ? 189 THR G OG1   1 
ATOM   9940  C CG2   . THR G 1 192 ? 38.040 -119.363 -154.731 1.00 142.07 ? 189 THR G CG2   1 
ATOM   9941  N N     . LYS G 1 193 ? 39.337 -115.359 -153.352 1.00 139.76 ? 190 LYS G N     1 
ATOM   9942  C CA    . LYS G 1 193 ? 40.139 -114.265 -152.822 1.00 142.82 ? 190 LYS G CA    1 
ATOM   9943  C C     . LYS G 1 193 ? 39.305 -113.049 -152.431 1.00 150.95 ? 190 LYS G C     1 
ATOM   9944  O O     . LYS G 1 193 ? 39.855 -111.946 -152.323 1.00 145.69 ? 190 LYS G O     1 
ATOM   9945  C CB    . LYS G 1 193 ? 41.205 -113.861 -153.844 1.00 148.19 ? 190 LYS G CB    1 
ATOM   9946  C CG    . LYS G 1 193 ? 42.095 -115.008 -154.293 1.00 153.26 ? 190 LYS G CG    1 
ATOM   9947  C CD    . LYS G 1 193 ? 43.105 -114.553 -155.335 1.00 147.50 ? 190 LYS G CD    1 
ATOM   9948  C CE    . LYS G 1 193 ? 43.958 -115.714 -155.820 1.00 142.76 ? 190 LYS G CE    1 
ATOM   9949  N NZ    . LYS G 1 193 ? 44.936 -115.291 -156.861 1.00 119.20 ? 190 LYS G NZ    1 
ATOM   9950  N N     . ALA G 1 194 ? 38.002 -113.220 -152.222 1.00 146.59 ? 191 ALA G N     1 
ATOM   9951  C CA    . ALA G 1 194 ? 37.145 -112.108 -151.840 1.00 131.64 ? 191 ALA G CA    1 
ATOM   9952  C C     . ALA G 1 194 ? 37.526 -111.573 -150.463 1.00 128.06 ? 191 ALA G C     1 
ATOM   9953  O O     . ALA G 1 194 ? 38.096 -112.283 -149.629 1.00 131.09 ? 191 ALA G O     1 
ATOM   9954  C CB    . ALA G 1 194 ? 35.678 -112.537 -151.847 1.00 115.21 ? 191 ALA G CB    1 
ATOM   9955  N N     . LYS G 1 195 ? 37.209 -110.301 -150.234 1.00 128.29 ? 192 LYS G N     1 
ATOM   9956  C CA    . LYS G 1 195 ? 37.492 -109.675 -148.949 1.00 123.64 ? 192 LYS G CA    1 
ATOM   9957  C C     . LYS G 1 195 ? 36.672 -110.335 -147.848 1.00 114.84 ? 192 LYS G C     1 
ATOM   9958  O O     . LYS G 1 195 ? 35.457 -110.510 -147.981 1.00 109.64 ? 192 LYS G O     1 
ATOM   9959  C CB    . LYS G 1 195 ? 37.190 -108.178 -149.016 1.00 112.98 ? 192 LYS G CB    1 
ATOM   9960  C CG    . LYS G 1 195 ? 37.519 -107.418 -147.746 1.00 116.09 ? 192 LYS G CG    1 
ATOM   9961  C CD    . LYS G 1 195 ? 37.579 -105.922 -148.003 1.00 75.21  ? 192 LYS G CD    1 
ATOM   9962  C CE    . LYS G 1 195 ? 38.047 -105.177 -146.767 1.00 97.75  ? 192 LYS G CE    1 
ATOM   9963  N NZ    . LYS G 1 195 ? 39.295 -105.764 -146.208 1.00 103.03 ? 192 LYS G NZ    1 
ATOM   9964  N N     . ARG G 1 196 ? 37.344 -110.703 -146.756 1.00 111.02 ? 193 ARG G N     1 
ATOM   9965  C CA    . ARG G 1 196 ? 36.706 -111.446 -145.679 1.00 118.81 ? 193 ARG G CA    1 
ATOM   9966  C C     . ARG G 1 196 ? 36.900 -110.843 -144.295 1.00 120.73 ? 193 ARG G C     1 
ATOM   9967  O O     . ARG G 1 196 ? 36.283 -111.335 -143.344 1.00 129.95 ? 193 ARG G O     1 
ATOM   9968  C CB    . ARG G 1 196 ? 37.208 -112.899 -145.663 1.00 125.01 ? 193 ARG G CB    1 
ATOM   9969  C CG    . ARG G 1 196 ? 36.797 -113.698 -146.891 1.00 128.46 ? 193 ARG G CG    1 
ATOM   9970  C CD    . ARG G 1 196 ? 36.777 -115.191 -146.606 1.00 126.01 ? 193 ARG G CD    1 
ATOM   9971  N NE    . ARG G 1 196 ? 35.736 -115.879 -147.366 1.00 122.61 ? 193 ARG G NE    1 
ATOM   9972  C CZ    . ARG G 1 196 ? 35.832 -116.196 -148.654 1.00 130.11 ? 193 ARG G CZ    1 
ATOM   9973  N NH1   . ARG G 1 196 ? 36.928 -115.890 -149.336 1.00 136.23 ? 193 ARG G NH1   1 
ATOM   9974  N NH2   . ARG G 1 196 ? 34.832 -116.822 -149.260 1.00 120.14 ? 193 ARG G NH2   1 
ATOM   9975  N N     . GLN G 1 197 ? 37.722 -109.807 -144.146 1.00 122.32 ? 194 GLN G N     1 
ATOM   9976  C CA    . GLN G 1 197 ? 37.908 -109.149 -142.862 1.00 130.19 ? 194 GLN G CA    1 
ATOM   9977  C C     . GLN G 1 197 ? 38.075 -107.652 -143.089 1.00 129.10 ? 194 GLN G C     1 
ATOM   9978  O O     . GLN G 1 197 ? 38.248 -107.187 -144.218 1.00 127.52 ? 194 GLN G O     1 
ATOM   9979  C CB    . GLN G 1 197 ? 39.108 -109.726 -142.097 1.00 129.88 ? 194 GLN G CB    1 
ATOM   9980  C CG    . GLN G 1 197 ? 40.446 -109.084 -142.437 1.00 139.44 ? 194 GLN G CG    1 
ATOM   9981  C CD    . GLN G 1 197 ? 40.921 -109.405 -143.842 1.00 144.85 ? 194 GLN G CD    1 
ATOM   9982  O OE1   . GLN G 1 197 ? 40.341 -110.243 -144.534 1.00 142.82 ? 194 GLN G OE1   1 
ATOM   9983  N NE2   . GLN G 1 197 ? 41.980 -108.731 -144.274 1.00 142.10 ? 194 GLN G NE2   1 
ATOM   9984  N N     . ASP G 1 198 ? 38.016 -106.895 -141.992 1.00 128.32 ? 195 ASP G N     1 
ATOM   9985  C CA    . ASP G 1 198 ? 38.051 -105.438 -142.081 1.00 126.09 ? 195 ASP G CA    1 
ATOM   9986  C C     . ASP G 1 198 ? 39.456 -104.924 -142.379 1.00 125.62 ? 195 ASP G C     1 
ATOM   9987  O O     . ASP G 1 198 ? 39.667 -104.193 -143.353 1.00 126.34 ? 195 ASP G O     1 
ATOM   9988  C CB    . ASP G 1 198 ? 37.520 -104.818 -140.785 1.00 126.19 ? 195 ASP G CB    1 
ATOM   9989  C CG    . ASP G 1 198 ? 36.060 -105.142 -140.537 1.00 130.52 ? 195 ASP G CG    1 
ATOM   9990  O OD1   . ASP G 1 198 ? 35.400 -105.669 -141.458 1.00 132.93 ? 195 ASP G OD1   1 
ATOM   9991  O OD2   . ASP G 1 198 ? 35.570 -104.864 -139.422 1.00 125.12 ? 195 ASP G OD2   1 
ATOM   9992  N N     . LEU G 1 199 ? 40.424 -105.293 -141.542 1.00 121.50 ? 196 LEU G N     1 
ATOM   9993  C CA    . LEU G 1 199 ? 41.757 -104.710 -141.625 1.00 126.65 ? 196 LEU G CA    1 
ATOM   9994  C C     . LEU G 1 199 ? 42.409 -105.001 -142.971 1.00 127.10 ? 196 LEU G C     1 
ATOM   9995  O O     . LEU G 1 199 ? 42.290 -106.101 -143.518 1.00 123.30 ? 196 LEU G O     1 
ATOM   9996  C CB    . LEU G 1 199 ? 42.633 -105.244 -140.490 1.00 119.94 ? 196 LEU G CB    1 
ATOM   9997  C CG    . LEU G 1 199 ? 44.081 -104.750 -140.436 1.00 123.04 ? 196 LEU G CG    1 
ATOM   9998  C CD1   . LEU G 1 199 ? 44.131 -103.231 -140.366 1.00 124.62 ? 196 LEU G CD1   1 
ATOM   9999  C CD2   . LEU G 1 199 ? 44.814 -105.370 -139.257 1.00 119.34 ? 196 LEU G CD2   1 
ATOM   10000 N N     . GLU G 1 200 ? 43.104 -103.996 -143.503 1.00 128.26 ? 197 GLU G N     1 
ATOM   10001 C CA    . GLU G 1 200 ? 43.867 -104.109 -144.746 1.00 131.48 ? 197 GLU G CA    1 
ATOM   10002 C C     . GLU G 1 200 ? 45.298 -103.683 -144.451 1.00 142.52 ? 197 GLU G C     1 
ATOM   10003 O O     . GLU G 1 200 ? 45.671 -102.523 -144.671 1.00 141.32 ? 197 GLU G O     1 
ATOM   10004 C CB    . GLU G 1 200 ? 43.253 -103.258 -145.859 1.00 124.00 ? 197 GLU G CB    1 
ATOM   10005 C CG    . GLU G 1 200 ? 41.959 -103.809 -146.428 1.00 121.39 ? 197 GLU G CG    1 
ATOM   10006 C CD    . GLU G 1 200 ? 42.187 -104.962 -147.385 1.00 115.37 ? 197 GLU G CD    1 
ATOM   10007 O OE1   . GLU G 1 200 ? 43.098 -104.859 -148.234 1.00 111.50 ? 197 GLU G OE1   1 
ATOM   10008 O OE2   . GLU G 1 200 ? 41.456 -105.969 -147.290 1.00 111.41 ? 197 GLU G OE2   1 
ATOM   10009 N N     . PRO G 1 201 ? 46.125 -104.597 -143.934 1.00 140.92 ? 198 PRO G N     1 
ATOM   10010 C CA    . PRO G 1 201 ? 47.511 -104.225 -143.604 1.00 138.83 ? 198 PRO G CA    1 
ATOM   10011 C C     . PRO G 1 201 ? 48.303 -103.705 -144.789 1.00 137.77 ? 198 PRO G C     1 
ATOM   10012 O O     . PRO G 1 201 ? 49.168 -102.840 -144.608 1.00 142.70 ? 198 PRO G O     1 
ATOM   10013 C CB    . PRO G 1 201 ? 48.099 -105.536 -143.062 1.00 148.25 ? 198 PRO G CB    1 
ATOM   10014 C CG    . PRO G 1 201 ? 46.912 -106.295 -142.560 1.00 155.24 ? 198 PRO G CG    1 
ATOM   10015 C CD    . PRO G 1 201 ? 45.818 -105.982 -143.539 1.00 147.81 ? 198 PRO G CD    1 
ATOM   10016 N N     . SER G 1 202 ? 48.034 -104.208 -145.998 1.00 128.06 ? 199 SER G N     1 
ATOM   10017 C CA    . SER G 1 202 ? 48.696 -103.681 -147.188 1.00 116.13 ? 199 SER G CA    1 
ATOM   10018 C C     . SER G 1 202 ? 48.479 -102.178 -147.325 1.00 130.15 ? 199 SER G C     1 
ATOM   10019 O O     . SER G 1 202 ? 49.409 -101.437 -147.664 1.00 125.84 ? 199 SER G O     1 
ATOM   10020 C CB    . SER G 1 202 ? 48.193 -104.413 -148.432 1.00 108.55 ? 199 SER G CB    1 
ATOM   10021 O OG    . SER G 1 202 ? 48.902 -104.004 -149.589 1.00 121.08 ? 199 SER G OG    1 
ATOM   10022 N N     . VAL G 1 203 ? 47.260 -101.712 -147.060 1.00 141.70 ? 200 VAL G N     1 
ATOM   10023 C CA    . VAL G 1 203 ? 46.953 -100.288 -147.152 1.00 140.95 ? 200 VAL G CA    1 
ATOM   10024 C C     . VAL G 1 203 ? 47.431 -99.546  -145.910 1.00 138.61 ? 200 VAL G C     1 
ATOM   10025 O O     . VAL G 1 203 ? 47.973 -98.438  -146.005 1.00 137.55 ? 200 VAL G O     1 
ATOM   10026 C CB    . VAL G 1 203 ? 45.444 -100.082 -147.382 1.00 130.67 ? 200 VAL G CB    1 
ATOM   10027 C CG1   . VAL G 1 203 ? 45.136 -98.604  -147.537 1.00 122.40 ? 200 VAL G CG1   1 
ATOM   10028 C CG2   . VAL G 1 203 ? 44.977 -100.866 -148.597 1.00 131.65 ? 200 VAL G CG2   1 
ATOM   10029 N N     . GLU G 1 204 ? 47.169 -100.119 -144.730 1.00 130.19 ? 201 GLU G N     1 
ATOM   10030 C CA    . GLU G 1 204 ? 47.579 -99.499  -143.472 1.00 137.16 ? 201 GLU G CA    1 
ATOM   10031 C C     . GLU G 1 204 ? 49.073 -99.193  -143.454 1.00 144.97 ? 201 GLU G C     1 
ATOM   10032 O O     . GLU G 1 204 ? 49.492 -98.138  -142.966 1.00 143.53 ? 201 GLU G O     1 
ATOM   10033 C CB    . GLU G 1 204 ? 47.201 -100.410 -142.303 1.00 143.49 ? 201 GLU G CB    1 
ATOM   10034 C CG    . GLU G 1 204 ? 47.777 -99.994  -140.961 1.00 146.88 ? 201 GLU G CG    1 
ATOM   10035 C CD    . GLU G 1 204 ? 47.180 -98.701  -140.448 1.00 145.28 ? 201 GLU G CD    1 
ATOM   10036 O OE1   . GLU G 1 204 ? 45.949 -98.656  -140.247 1.00 142.31 ? 201 GLU G OE1   1 
ATOM   10037 O OE2   . GLU G 1 204 ? 47.942 -97.733  -140.244 1.00 150.05 ? 201 GLU G OE2   1 
ATOM   10038 N N     . GLU G 1 205 ? 49.889 -100.104 -143.987 1.00 146.84 ? 202 GLU G N     1 
ATOM   10039 C CA    . GLU G 1 205 ? 51.335 -99.904  -144.031 1.00 153.55 ? 202 GLU G CA    1 
ATOM   10040 C C     . GLU G 1 205 ? 51.697 -98.655  -144.826 1.00 147.85 ? 202 GLU G C     1 
ATOM   10041 O O     . GLU G 1 205 ? 52.400 -97.761  -144.334 1.00 144.85 ? 202 GLU G O     1 
ATOM   10042 C CB    . GLU G 1 205 ? 51.999 -101.137 -144.643 1.00 161.57 ? 202 GLU G CB    1 
ATOM   10043 C CG    . GLU G 1 205 ? 53.508 -101.160 -144.554 1.00 170.14 ? 202 GLU G CG    1 
ATOM   10044 C CD    . GLU G 1 205 ? 54.081 -102.463 -145.063 1.00 174.06 ? 202 GLU G CD    1 
ATOM   10045 O OE1   . GLU G 1 205 ? 53.919 -102.752 -146.268 1.00 166.91 ? 202 GLU G OE1   1 
ATOM   10046 O OE2   . GLU G 1 205 ? 54.675 -103.206 -144.258 1.00 188.48 ? 202 GLU G OE2   1 
ATOM   10047 N N     . ALA G 1 206 ? 51.243 -98.599  -146.081 1.00 147.85 ? 203 ALA G N     1 
ATOM   10048 C CA    . ALA G 1 206 ? 51.555 -97.466  -146.942 1.00 152.95 ? 203 ALA G CA    1 
ATOM   10049 C C     . ALA G 1 206 ? 51.016 -96.165  -146.364 1.00 148.87 ? 203 ALA G C     1 
ATOM   10050 O O     . ALA G 1 206 ? 51.647 -95.110  -146.498 1.00 143.37 ? 203 ALA G O     1 
ATOM   10051 C CB    . ALA G 1 206 ? 50.995 -97.707  -148.342 1.00 144.72 ? 203 ALA G CB    1 
ATOM   10052 N N     . ARG G 1 207 ? 49.851 -96.214  -145.713 1.00 144.71 ? 204 ARG G N     1 
ATOM   10053 C CA    . ARG G 1 207 ? 49.275 -94.985  -145.176 1.00 142.41 ? 204 ARG G CA    1 
ATOM   10054 C C     . ARG G 1 207 ? 50.040 -94.506  -143.948 1.00 145.14 ? 204 ARG G C     1 
ATOM   10055 O O     . ARG G 1 207 ? 50.237 -93.299  -143.765 1.00 148.12 ? 204 ARG G O     1 
ATOM   10056 C CB    . ARG G 1 207 ? 47.800 -95.191  -144.843 1.00 135.20 ? 204 ARG G CB    1 
ATOM   10057 C CG    . ARG G 1 207 ? 47.046 -93.898  -144.578 1.00 127.62 ? 204 ARG G CG    1 
ATOM   10058 C CD    . ARG G 1 207 ? 45.659 -94.190  -144.055 1.00 122.23 ? 204 ARG G CD    1 
ATOM   10059 N NE    . ARG G 1 207 ? 45.003 -95.247  -144.818 1.00 116.44 ? 204 ARG G NE    1 
ATOM   10060 C CZ    . ARG G 1 207 ? 44.215 -96.170  -144.279 1.00 114.43 ? 204 ARG G CZ    1 
ATOM   10061 N NH1   . ARG G 1 207 ? 43.993 -96.170  -142.972 1.00 117.30 ? 204 ARG G NH1   1 
ATOM   10062 N NH2   . ARG G 1 207 ? 43.657 -97.099  -145.040 1.00 111.15 ? 204 ARG G NH2   1 
ATOM   10063 N N     . TYR G 1 208 ? 50.474 -95.436  -143.092 1.00 142.22 ? 205 TYR G N     1 
ATOM   10064 C CA    . TYR G 1 208 ? 51.307 -95.060  -141.956 1.00 144.68 ? 205 TYR G CA    1 
ATOM   10065 C C     . TYR G 1 208 ? 52.650 -94.513  -142.412 1.00 151.92 ? 205 TYR G C     1 
ATOM   10066 O O     . TYR G 1 208 ? 53.210 -93.621  -141.764 1.00 155.02 ? 205 TYR G O     1 
ATOM   10067 C CB    . TYR G 1 208 ? 51.509 -96.259  -141.030 1.00 132.60 ? 205 TYR G CB    1 
ATOM   10068 C CG    . TYR G 1 208 ? 52.488 -95.996  -139.908 1.00 136.74 ? 205 TYR G CG    1 
ATOM   10069 C CD1   . TYR G 1 208 ? 52.195 -95.080  -138.906 1.00 135.48 ? 205 TYR G CD1   1 
ATOM   10070 C CD2   . TYR G 1 208 ? 53.705 -96.662  -139.851 1.00 142.52 ? 205 TYR G CD2   1 
ATOM   10071 C CE1   . TYR G 1 208 ? 53.087 -94.833  -137.880 1.00 138.95 ? 205 TYR G CE1   1 
ATOM   10072 C CE2   . TYR G 1 208 ? 54.604 -96.423  -138.828 1.00 152.20 ? 205 TYR G CE2   1 
ATOM   10073 C CZ    . TYR G 1 208 ? 54.289 -95.508  -137.845 1.00 149.46 ? 205 TYR G CZ    1 
ATOM   10074 O OH    . TYR G 1 208 ? 55.181 -95.266  -136.825 1.00 155.90 ? 205 TYR G OH    1 
ATOM   10075 N N     . ASN G 1 209 ? 53.182 -95.025  -143.523 1.00 155.96 ? 206 ASN G N     1 
ATOM   10076 C CA    . ASN G 1 209 ? 54.407 -94.458  -144.072 1.00 156.89 ? 206 ASN G CA    1 
ATOM   10077 C C     . ASN G 1 209 ? 54.158 -93.200  -144.895 1.00 163.66 ? 206 ASN G C     1 
ATOM   10078 O O     . ASN G 1 209 ? 55.123 -92.523  -145.268 1.00 172.45 ? 206 ASN G O     1 
ATOM   10079 C CB    . ASN G 1 209 ? 55.136 -95.497  -144.927 1.00 152.58 ? 206 ASN G CB    1 
ATOM   10080 C CG    . ASN G 1 209 ? 55.702 -96.636  -144.101 1.00 149.46 ? 206 ASN G CG    1 
ATOM   10081 O OD1   . ASN G 1 209 ? 56.631 -96.446  -143.316 1.00 160.81 ? 206 ASN G OD1   1 
ATOM   10082 N ND2   . ASN G 1 209 ? 55.141 -97.826  -144.272 1.00 143.41 ? 206 ASN G ND2   1 
ATOM   10083 N N     . SER G 1 210 ? 52.897 -92.871  -145.181 1.00 161.04 ? 207 SER G N     1 
ATOM   10084 C CA    . SER G 1 210 ? 52.562 -91.698  -145.977 1.00 165.67 ? 207 SER G CA    1 
ATOM   10085 C C     . SER G 1 210 ? 52.632 -90.397  -145.188 1.00 165.44 ? 207 SER G C     1 
ATOM   10086 O O     . SER G 1 210 ? 52.457 -89.326  -145.779 1.00 172.05 ? 207 SER G O     1 
ATOM   10087 C CB    . SER G 1 210 ? 51.162 -91.856  -146.576 1.00 158.40 ? 207 SER G CB    1 
ATOM   10088 O OG    . SER G 1 210 ? 50.941 -90.920  -147.616 1.00 160.44 ? 207 SER G OG    1 
ATOM   10089 N N     . CYS G 1 211 ? 52.877 -90.459  -143.883 1.00 152.29 ? 208 CYS G N     1 
ATOM   10090 C CA    . CYS G 1 211 ? 52.951 -89.257  -143.063 1.00 157.29 ? 208 CYS G CA    1 
ATOM   10091 C C     . CYS G 1 211 ? 54.372 -88.704  -143.017 1.00 151.93 ? 208 CYS G C     1 
ATOM   10092 O O     . CYS G 1 211 ? 54.749 -88.013  -142.071 1.00 143.73 ? 208 CYS G O     1 
ATOM   10093 C CB    . CYS G 1 211 ? 52.453 -89.546  -141.646 1.00 160.37 ? 208 CYS G CB    1 
ATOM   10094 S SG    . CYS G 1 211 ? 50.712 -90.027  -141.551 1.00 169.69 ? 208 CYS G SG    1 
ATOM   10095 N N     . CYS H 1 28  ? 46.564 -80.611  -145.125 1.00 133.95 ? 25  CYS H N     1 
ATOM   10096 C CA    . CYS H 1 28  ? 45.367 -80.989  -144.382 1.00 124.27 ? 25  CYS H CA    1 
ATOM   10097 C C     . CYS H 1 28  ? 44.424 -81.807  -145.257 1.00 115.42 ? 25  CYS H C     1 
ATOM   10098 O O     . CYS H 1 28  ? 44.796 -82.239  -146.348 1.00 127.83 ? 25  CYS H O     1 
ATOM   10099 C CB    . CYS H 1 28  ? 44.648 -79.747  -143.851 1.00 134.72 ? 25  CYS H CB    1 
ATOM   10100 S SG    . CYS H 1 28  ? 44.162 -78.562  -145.129 1.00 132.63 ? 25  CYS H SG    1 
ATOM   10101 N N     . PHE H 1 29  ? 43.203 -82.017  -144.773 1.00 99.15  ? 26  PHE H N     1 
ATOM   10102 C CA    . PHE H 1 29  ? 42.211 -82.751  -145.545 1.00 91.57  ? 26  PHE H CA    1 
ATOM   10103 C C     . PHE H 1 29  ? 41.790 -81.934  -146.761 1.00 107.88 ? 26  PHE H C     1 
ATOM   10104 O O     . PHE H 1 29  ? 41.640 -80.711  -146.687 1.00 128.29 ? 26  PHE H O     1 
ATOM   10105 C CB    . PHE H 1 29  ? 40.997 -83.078  -144.675 1.00 85.45  ? 26  PHE H CB    1 
ATOM   10106 C CG    . PHE H 1 29  ? 40.151 -84.201  -145.206 1.00 90.36  ? 26  PHE H CG    1 
ATOM   10107 C CD1   . PHE H 1 29  ? 39.229 -83.979  -146.215 1.00 93.35  ? 26  PHE H CD1   1 
ATOM   10108 C CD2   . PHE H 1 29  ? 40.281 -85.481  -144.694 1.00 92.02  ? 26  PHE H CD2   1 
ATOM   10109 C CE1   . PHE H 1 29  ? 38.451 -85.013  -146.704 1.00 88.71  ? 26  PHE H CE1   1 
ATOM   10110 C CE2   . PHE H 1 29  ? 39.506 -86.518  -145.178 1.00 96.37  ? 26  PHE H CE2   1 
ATOM   10111 C CZ    . PHE H 1 29  ? 38.591 -86.283  -146.185 1.00 92.21  ? 26  PHE H CZ    1 
ATOM   10112 N N     . GLY H 1 30  ? 41.603 -82.620  -147.888 1.00 104.93 ? 27  GLY H N     1 
ATOM   10113 C CA    . GLY H 1 30  ? 41.344 -81.962  -149.149 1.00 107.90 ? 27  GLY H CA    1 
ATOM   10114 C C     . GLY H 1 30  ? 42.576 -81.452  -149.862 1.00 119.44 ? 27  GLY H C     1 
ATOM   10115 O O     . GLY H 1 30  ? 42.493 -81.126  -151.053 1.00 120.81 ? 27  GLY H O     1 
ATOM   10116 N N     . GLN H 1 31  ? 43.715 -81.372  -149.177 1.00 128.96 ? 28  GLN H N     1 
ATOM   10117 C CA    . GLN H 1 31  ? 44.968 -80.890  -149.747 1.00 124.73 ? 28  GLN H CA    1 
ATOM   10118 C C     . GLN H 1 31  ? 46.010 -81.983  -149.922 1.00 130.96 ? 28  GLN H C     1 
ATOM   10119 O O     . GLN H 1 31  ? 46.699 -82.012  -150.944 1.00 139.17 ? 28  GLN H O     1 
ATOM   10120 C CB    . GLN H 1 31  ? 45.555 -79.780  -148.865 1.00 117.43 ? 28  GLN H CB    1 
ATOM   10121 C CG    . GLN H 1 31  ? 44.668 -78.548  -148.711 1.00 131.82 ? 28  GLN H CG    1 
ATOM   10122 C CD    . GLN H 1 31  ? 44.702 -77.627  -149.918 1.00 139.95 ? 28  GLN H CD    1 
ATOM   10123 O OE1   . GLN H 1 31  ? 45.124 -78.017  -151.008 1.00 129.73 ? 28  GLN H OE1   1 
ATOM   10124 N NE2   . GLN H 1 31  ? 44.255 -76.391  -149.726 1.00 140.30 ? 28  GLN H NE2   1 
ATOM   10125 N N     . CYS H 1 32  ? 46.146 -82.876  -148.942 1.00 131.24 ? 29  CYS H N     1 
ATOM   10126 C CA    . CYS H 1 32  ? 47.167 -83.916  -148.989 1.00 130.05 ? 29  CYS H CA    1 
ATOM   10127 C C     . CYS H 1 32  ? 46.966 -84.827  -150.194 1.00 128.50 ? 29  CYS H C     1 
ATOM   10128 O O     . CYS H 1 32  ? 45.853 -85.287  -150.461 1.00 126.03 ? 29  CYS H O     1 
ATOM   10129 C CB    . CYS H 1 32  ? 47.138 -84.736  -147.700 1.00 130.19 ? 29  CYS H CB    1 
ATOM   10130 S SG    . CYS H 1 32  ? 47.706 -83.847  -146.234 1.00 151.36 ? 29  CYS H SG    1 
ATOM   10131 N N     . GLN H 1 33  ? 48.050 -85.085  -150.919 1.00 125.19 ? 30  GLN H N     1 
ATOM   10132 C CA    . GLN H 1 33  ? 48.019 -85.926  -152.106 1.00 123.99 ? 30  GLN H CA    1 
ATOM   10133 C C     . GLN H 1 33  ? 48.444 -87.348  -151.758 1.00 126.81 ? 30  GLN H C     1 
ATOM   10134 O O     . GLN H 1 33  ? 49.267 -87.572  -150.866 1.00 131.29 ? 30  GLN H O     1 
ATOM   10135 C CB    . GLN H 1 33  ? 48.929 -85.358  -153.198 1.00 123.29 ? 30  GLN H CB    1 
ATOM   10136 C CG    . GLN H 1 33  ? 48.460 -84.024  -153.759 1.00 145.95 ? 30  GLN H CG    1 
ATOM   10137 C CD    . GLN H 1 33  ? 49.408 -83.461  -154.800 1.00 180.43 ? 30  GLN H CD    1 
ATOM   10138 O OE1   . GLN H 1 33  ? 49.821 -84.162  -155.724 1.00 178.54 ? 30  GLN H OE1   1 
ATOM   10139 N NE2   . GLN H 1 33  ? 49.757 -82.187  -154.656 1.00 182.44 ? 30  GLN H NE2   1 
ATOM   10140 N N     . TYR H 1 34  ? 47.867 -88.311  -152.473 1.00 120.38 ? 31  TYR H N     1 
ATOM   10141 C CA    . TYR H 1 34  ? 48.162 -89.715  -152.223 1.00 125.94 ? 31  TYR H CA    1 
ATOM   10142 C C     . TYR H 1 34  ? 49.541 -90.092  -152.751 1.00 133.21 ? 31  TYR H C     1 
ATOM   10143 O O     . TYR H 1 34  ? 49.928 -89.709  -153.858 1.00 134.75 ? 31  TYR H O     1 
ATOM   10144 C CB    . TYR H 1 34  ? 47.099 -90.604  -152.869 1.00 123.13 ? 31  TYR H CB    1 
ATOM   10145 C CG    . TYR H 1 34  ? 45.884 -90.843  -152.003 1.00 114.01 ? 31  TYR H CG    1 
ATOM   10146 C CD1   . TYR H 1 34  ? 45.998 -91.486  -150.779 1.00 105.66 ? 31  TYR H CD1   1 
ATOM   10147 C CD2   . TYR H 1 34  ? 44.624 -90.427  -152.410 1.00 108.45 ? 31  TYR H CD2   1 
ATOM   10148 C CE1   . TYR H 1 34  ? 44.891 -91.708  -149.983 1.00 118.07 ? 31  TYR H CE1   1 
ATOM   10149 C CE2   . TYR H 1 34  ? 43.511 -90.644  -151.621 1.00 106.82 ? 31  TYR H CE2   1 
ATOM   10150 C CZ    . TYR H 1 34  ? 43.650 -91.285  -150.408 1.00 117.12 ? 31  TYR H CZ    1 
ATOM   10151 O OH    . TYR H 1 34  ? 42.545 -91.504  -149.618 1.00 128.62 ? 31  TYR H OH    1 
ATOM   10152 N N     . THR H 1 35  ? 50.281 -90.850  -151.946 1.00 129.00 ? 32  THR H N     1 
ATOM   10153 C CA    . THR H 1 35  ? 51.553 -91.407  -152.376 1.00 129.17 ? 32  THR H CA    1 
ATOM   10154 C C     . THR H 1 35  ? 51.322 -92.629  -153.265 1.00 121.69 ? 32  THR H C     1 
ATOM   10155 O O     . THR H 1 35  ? 50.222 -93.184  -153.332 1.00 111.87 ? 32  THR H O     1 
ATOM   10156 C CB    . THR H 1 35  ? 52.417 -91.772  -151.170 1.00 122.33 ? 32  THR H CB    1 
ATOM   10157 O OG1   . THR H 1 35  ? 51.701 -92.678  -150.322 1.00 130.12 ? 32  THR H OG1   1 
ATOM   10158 C CG2   . THR H 1 35  ? 52.779 -90.523  -150.381 1.00 126.26 ? 32  THR H CG2   1 
ATOM   10159 N N     . ALA H 1 36  ? 52.382 -93.040  -153.966 1.00 127.96 ? 33  ALA H N     1 
ATOM   10160 C CA    . ALA H 1 36  ? 52.274 -94.159  -154.899 1.00 136.88 ? 33  ALA H CA    1 
ATOM   10161 C C     . ALA H 1 36  ? 51.856 -95.442  -154.189 1.00 126.23 ? 33  ALA H C     1 
ATOM   10162 O O     . ALA H 1 36  ? 50.951 -96.153  -154.645 1.00 120.88 ? 33  ALA H O     1 
ATOM   10163 C CB    . ALA H 1 36  ? 53.602 -94.356  -155.631 1.00 141.33 ? 33  ALA H CB    1 
ATOM   10164 N N     . GLU H 1 37  ? 52.506 -95.753  -153.064 1.00 123.98 ? 34  GLU H N     1 
ATOM   10165 C CA    . GLU H 1 37  ? 52.201 -96.989  -152.350 1.00 136.30 ? 34  GLU H CA    1 
ATOM   10166 C C     . GLU H 1 37  ? 50.767 -96.988  -151.837 1.00 129.24 ? 34  GLU H C     1 
ATOM   10167 O O     . GLU H 1 37  ? 50.031 -97.966  -152.017 1.00 126.97 ? 34  GLU H O     1 
ATOM   10168 C CB    . GLU H 1 37  ? 53.182 -97.192  -151.194 1.00 151.60 ? 34  GLU H CB    1 
ATOM   10169 C CG    . GLU H 1 37  ? 54.636 -96.923  -151.534 1.00 163.96 ? 34  GLU H CG    1 
ATOM   10170 C CD    . GLU H 1 37  ? 55.548 -97.099  -150.335 1.00 182.11 ? 34  GLU H CD    1 
ATOM   10171 O OE1   . GLU H 1 37  ? 55.030 -97.182  -149.202 1.00 164.28 ? 34  GLU H OE1   1 
ATOM   10172 O OE2   . GLU H 1 37  ? 56.781 -97.158  -150.526 1.00 194.87 ? 34  GLU H OE2   1 
ATOM   10173 N N     . GLU H 1 38  ? 50.364 -95.904  -151.168 1.00 130.11 ? 35  GLU H N     1 
ATOM   10174 C CA    . GLU H 1 38  ? 48.994 -95.801  -150.676 1.00 120.11 ? 35  GLU H CA    1 
ATOM   10175 C C     . GLU H 1 38  ? 47.987 -95.906  -151.814 1.00 115.02 ? 35  GLU H C     1 
ATOM   10176 O O     . GLU H 1 38  ? 46.981 -96.618  -151.697 1.00 108.41 ? 35  GLU H O     1 
ATOM   10177 C CB    . GLU H 1 38  ? 48.808 -94.491  -149.910 1.00 124.75 ? 35  GLU H CB    1 
ATOM   10178 C CG    . GLU H 1 38  ? 47.527 -94.431  -149.096 1.00 122.27 ? 35  GLU H CG    1 
ATOM   10179 C CD    . GLU H 1 38  ? 47.431 -93.181  -148.243 1.00 136.09 ? 35  GLU H CD    1 
ATOM   10180 O OE1   . GLU H 1 38  ? 46.412 -93.019  -147.539 1.00 131.13 ? 35  GLU H OE1   1 
ATOM   10181 O OE2   . GLU H 1 38  ? 48.371 -92.360  -148.280 1.00 144.47 ? 35  GLU H OE2   1 
ATOM   10182 N N     . TYR H 1 39  ? 48.238 -95.201  -152.922 1.00 118.11 ? 36  TYR H N     1 
ATOM   10183 C CA    . TYR H 1 39  ? 47.344 -95.278  -154.075 1.00 113.35 ? 36  TYR H CA    1 
ATOM   10184 C C     . TYR H 1 39  ? 47.186 -96.713  -154.562 1.00 108.53 ? 36  TYR H C     1 
ATOM   10185 O O     . TYR H 1 39  ? 46.063 -97.201  -154.730 1.00 106.69 ? 36  TYR H O     1 
ATOM   10186 C CB    . TYR H 1 39  ? 47.852 -94.398  -155.219 1.00 108.62 ? 36  TYR H CB    1 
ATOM   10187 C CG    . TYR H 1 39  ? 47.314 -94.867  -156.554 1.00 99.20  ? 36  TYR H CG    1 
ATOM   10188 C CD1   . TYR H 1 39  ? 45.958 -94.783  -156.847 1.00 93.33  ? 36  TYR H CD1   1 
ATOM   10189 C CD2   . TYR H 1 39  ? 48.153 -95.444  -157.499 1.00 112.37 ? 36  TYR H CD2   1 
ATOM   10190 C CE1   . TYR H 1 39  ? 45.459 -95.236  -158.050 1.00 100.25 ? 36  TYR H CE1   1 
ATOM   10191 C CE2   . TYR H 1 39  ? 47.662 -95.898  -158.707 1.00 122.11 ? 36  TYR H CE2   1 
ATOM   10192 C CZ    . TYR H 1 39  ? 46.315 -95.790  -158.977 1.00 111.86 ? 36  TYR H CZ    1 
ATOM   10193 O OH    . TYR H 1 39  ? 45.822 -96.245  -160.177 1.00 115.78 ? 36  TYR H OH    1 
ATOM   10194 N N     . GLN H 1 40  ? 48.305 -97.385  -154.848 1.00 103.65 ? 37  GLN H N     1 
ATOM   10195 C CA    . GLN H 1 40  ? 48.233 -98.731  -155.406 1.00 110.79 ? 37  GLN H CA    1 
ATOM   10196 C C     . GLN H 1 40  ? 47.556 -99.693  -154.438 1.00 115.80 ? 37  GLN H C     1 
ATOM   10197 O O     . GLN H 1 40  ? 46.726 -100.519 -154.846 1.00 109.14 ? 37  GLN H O     1 
ATOM   10198 C CB    . GLN H 1 40  ? 49.634 -99.225  -155.764 1.00 129.11 ? 37  GLN H CB    1 
ATOM   10199 C CG    . GLN H 1 40  ? 49.670 -100.208 -156.920 1.00 146.53 ? 37  GLN H CG    1 
ATOM   10200 C CD    . GLN H 1 40  ? 51.057 -100.767 -157.166 1.00 149.52 ? 37  GLN H CD    1 
ATOM   10201 O OE1   . GLN H 1 40  ? 51.963 -100.590 -156.351 1.00 144.59 ? 37  GLN H OE1   1 
ATOM   10202 N NE2   . GLN H 1 40  ? 51.233 -101.443 -158.296 1.00 137.22 ? 37  GLN H NE2   1 
ATOM   10203 N N     . ALA H 1 41  ? 47.897 -99.598  -153.150 1.00 122.00 ? 38  ALA H N     1 
ATOM   10204 C CA    . ALA H 1 41  ? 47.273 -100.451 -152.146 1.00 105.97 ? 38  ALA H CA    1 
ATOM   10205 C C     . ALA H 1 41  ? 45.765 -100.244 -152.112 1.00 106.14 ? 38  ALA H C     1 
ATOM   10206 O O     . ALA H 1 41  ? 44.995 -101.211 -152.139 1.00 105.72 ? 38  ALA H O     1 
ATOM   10207 C CB    . ALA H 1 41  ? 47.888 -100.180 -150.773 1.00 100.12 ? 38  ALA H CB    1 
ATOM   10208 N N     . ILE H 1 42  ? 45.323 -98.983  -152.053 1.00 103.77 ? 39  ILE H N     1 
ATOM   10209 C CA    . ILE H 1 42  ? 43.892 -98.701  -151.985 1.00 102.77 ? 39  ILE H CA    1 
ATOM   10210 C C     . ILE H 1 42  ? 43.188 -99.200  -153.239 1.00 104.03 ? 39  ILE H C     1 
ATOM   10211 O O     . ILE H 1 42  ? 42.111 -99.800  -153.162 1.00 104.76 ? 39  ILE H O     1 
ATOM   10212 C CB    . ILE H 1 42  ? 43.646 -97.196  -151.765 1.00 100.71 ? 39  ILE H CB    1 
ATOM   10213 C CG1   . ILE H 1 42  ? 44.007 -96.791  -150.339 1.00 97.36  ? 39  ILE H CG1   1 
ATOM   10214 C CG2   . ILE H 1 42  ? 42.191 -96.856  -152.027 1.00 99.31  ? 39  ILE H CG2   1 
ATOM   10215 C CD1   . ILE H 1 42  ? 44.199 -95.304  -150.160 1.00 105.84 ? 39  ILE H CD1   1 
ATOM   10216 N N     . GLN H 1 43  ? 43.780 -98.962  -154.411 1.00 103.27 ? 40  GLN H N     1 
ATOM   10217 C CA    . GLN H 1 43  ? 43.167 -99.400  -155.663 1.00 95.22  ? 40  GLN H CA    1 
ATOM   10218 C C     . GLN H 1 43  ? 42.978 -100.913 -155.690 1.00 104.42 ? 40  GLN H C     1 
ATOM   10219 O O     . GLN H 1 43  ? 41.869 -101.415 -155.933 1.00 106.92 ? 40  GLN H O     1 
ATOM   10220 C CB    . GLN H 1 43  ? 44.022 -98.939  -156.845 1.00 102.99 ? 40  GLN H CB    1 
ATOM   10221 C CG    . GLN H 1 43  ? 43.572 -99.448  -158.210 1.00 111.39 ? 40  GLN H CG    1 
ATOM   10222 C CD    . GLN H 1 43  ? 42.378 -98.692  -158.766 1.00 113.56 ? 40  GLN H CD    1 
ATOM   10223 O OE1   . GLN H 1 43  ? 41.413 -98.411  -158.055 1.00 104.78 ? 40  GLN H OE1   1 
ATOM   10224 N NE2   . GLN H 1 43  ? 42.441 -98.357  -160.050 1.00 123.64 ? 40  GLN H NE2   1 
ATOM   10225 N N     . LYS H 1 44  ? 44.059 -101.661 -155.444 1.00 108.44 ? 41  LYS H N     1 
ATOM   10226 C CA    . LYS H 1 44  ? 43.967 -103.116 -155.498 1.00 104.02 ? 41  LYS H CA    1 
ATOM   10227 C C     . LYS H 1 44  ? 43.025 -103.656 -154.428 1.00 118.72 ? 41  LYS H C     1 
ATOM   10228 O O     . LYS H 1 44  ? 42.284 -104.614 -154.674 1.00 121.89 ? 41  LYS H O     1 
ATOM   10229 C CB    . LYS H 1 44  ? 45.358 -103.738 -155.375 1.00 95.37  ? 41  LYS H CB    1 
ATOM   10230 C CG    . LYS H 1 44  ? 46.303 -103.320 -156.493 1.00 115.88 ? 41  LYS H CG    1 
ATOM   10231 C CD    . LYS H 1 44  ? 47.598 -104.114 -156.471 1.00 123.62 ? 41  LYS H CD    1 
ATOM   10232 C CE    . LYS H 1 44  ? 48.570 -103.604 -157.524 1.00 121.27 ? 41  LYS H CE    1 
ATOM   10233 N NZ    . LYS H 1 44  ? 47.969 -103.596 -158.889 1.00 122.44 ? 41  LYS H NZ    1 
ATOM   10234 N N     . ALA H 1 45  ? 43.034 -103.056 -153.233 1.00 111.18 ? 42  ALA H N     1 
ATOM   10235 C CA    . ALA H 1 45  ? 42.105 -103.485 -152.194 1.00 99.41  ? 42  ALA H CA    1 
ATOM   10236 C C     . ALA H 1 45  ? 40.661 -103.154 -152.553 1.00 102.82 ? 42  ALA H C     1 
ATOM   10237 O O     . ALA H 1 45  ? 39.742 -103.860 -152.123 1.00 116.23 ? 42  ALA H O     1 
ATOM   10238 C CB    . ALA H 1 45  ? 42.484 -102.849 -150.857 1.00 108.93 ? 42  ALA H CB    1 
ATOM   10239 N N     . LEU H 1 46  ? 40.439 -102.093 -153.331 1.00 103.99 ? 43  LEU H N     1 
ATOM   10240 C CA    . LEU H 1 46  ? 39.089 -101.723 -153.733 1.00 107.86 ? 43  LEU H CA    1 
ATOM   10241 C C     . LEU H 1 46  ? 38.575 -102.569 -154.884 1.00 104.33 ? 43  LEU H C     1 
ATOM   10242 O O     . LEU H 1 46  ? 37.357 -102.657 -155.074 1.00 100.42 ? 43  LEU H O     1 
ATOM   10243 C CB    . LEU H 1 46  ? 39.029 -100.245 -154.126 1.00 102.81 ? 43  LEU H CB    1 
ATOM   10244 C CG    . LEU H 1 46  ? 38.979 -99.226  -152.988 1.00 93.84  ? 43  LEU H CG    1 
ATOM   10245 C CD1   . LEU H 1 46  ? 38.937 -97.812  -153.535 1.00 94.21  ? 43  LEU H CD1   1 
ATOM   10246 C CD2   . LEU H 1 46  ? 37.785 -99.491  -152.090 1.00 105.52 ? 43  LEU H CD2   1 
ATOM   10247 N N     . ARG H 1 47  ? 39.468 -103.191 -155.656 1.00 109.99 ? 44  ARG H N     1 
ATOM   10248 C CA    . ARG H 1 47  ? 38.988 -104.153 -156.642 1.00 117.14 ? 44  ARG H CA    1 
ATOM   10249 C C     . ARG H 1 47  ? 38.477 -105.444 -156.008 1.00 115.82 ? 44  ARG H C     1 
ATOM   10250 O O     . ARG H 1 47  ? 37.847 -106.245 -156.707 1.00 121.99 ? 44  ARG H O     1 
ATOM   10251 C CB    . ARG H 1 47  ? 40.081 -104.474 -157.662 1.00 123.02 ? 44  ARG H CB    1 
ATOM   10252 C CG    . ARG H 1 47  ? 40.265 -103.404 -158.724 1.00 117.33 ? 44  ARG H CG    1 
ATOM   10253 C CD    . ARG H 1 47  ? 41.279 -103.833 -159.772 1.00 123.13 ? 44  ARG H CD    1 
ATOM   10254 N NE    . ARG H 1 47  ? 42.655 -103.615 -159.340 1.00 129.23 ? 44  ARG H NE    1 
ATOM   10255 C CZ    . ARG H 1 47  ? 43.468 -102.715 -159.884 1.00 132.75 ? 44  ARG H CZ    1 
ATOM   10256 N NH1   . ARG H 1 47  ? 43.038 -101.947 -160.876 1.00 139.81 ? 44  ARG H NH1   1 
ATOM   10257 N NH2   . ARG H 1 47  ? 44.708 -102.579 -159.435 1.00 129.70 ? 44  ARG H NH2   1 
ATOM   10258 N N     . GLN H 1 48  ? 38.730 -105.663 -154.718 1.00 107.15 ? 45  GLN H N     1 
ATOM   10259 C CA    . GLN H 1 48  ? 38.249 -106.857 -154.035 1.00 104.32 ? 45  GLN H CA    1 
ATOM   10260 C C     . GLN H 1 48  ? 36.723 -106.892 -153.991 1.00 108.75 ? 45  GLN H C     1 
ATOM   10261 O O     . GLN H 1 48  ? 36.045 -105.865 -154.064 1.00 120.54 ? 45  GLN H O     1 
ATOM   10262 C CB    . GLN H 1 48  ? 38.796 -106.918 -152.608 1.00 94.18  ? 45  GLN H CB    1 
ATOM   10263 C CG    . GLN H 1 48  ? 40.278 -107.233 -152.508 1.00 111.38 ? 45  GLN H CG    1 
ATOM   10264 C CD    . GLN H 1 48  ? 40.716 -107.490 -151.077 1.00 116.07 ? 45  GLN H CD    1 
ATOM   10265 O OE1   . GLN H 1 48  ? 40.561 -106.633 -150.205 1.00 118.46 ? 45  GLN H OE1   1 
ATOM   10266 N NE2   . GLN H 1 48  ? 41.262 -108.673 -150.828 1.00 118.32 ? 45  GLN H NE2   1 
ATOM   10267 N N     . ARG H 1 49  ? 36.185 -108.103 -153.872 1.00 110.96 ? 46  ARG H N     1 
ATOM   10268 C CA    . ARG H 1 49  ? 34.773 -108.326 -153.605 1.00 112.71 ? 46  ARG H CA    1 
ATOM   10269 C C     . ARG H 1 49  ? 34.593 -108.792 -152.166 1.00 116.46 ? 46  ARG H C     1 
ATOM   10270 O O     . ARG H 1 49  ? 35.534 -109.262 -151.522 1.00 126.84 ? 46  ARG H O     1 
ATOM   10271 C CB    . ARG H 1 49  ? 34.183 -109.352 -154.578 1.00 113.21 ? 46  ARG H CB    1 
ATOM   10272 C CG    . ARG H 1 49  ? 33.973 -108.812 -155.985 1.00 115.51 ? 46  ARG H CG    1 
ATOM   10273 C CD    . ARG H 1 49  ? 33.415 -109.876 -156.916 1.00 130.35 ? 46  ARG H CD    1 
ATOM   10274 N NE    . ARG H 1 49  ? 32.890 -109.304 -158.154 1.00 135.98 ? 46  ARG H NE    1 
ATOM   10275 C CZ    . ARG H 1 49  ? 33.636 -108.977 -159.204 1.00 145.68 ? 46  ARG H CZ    1 
ATOM   10276 N NH1   . ARG H 1 49  ? 34.948 -109.165 -159.176 1.00 144.35 ? 46  ARG H NH1   1 
ATOM   10277 N NH2   . ARG H 1 49  ? 33.068 -108.463 -160.288 1.00 143.37 ? 46  ARG H NH2   1 
ATOM   10278 N N     . LEU H 1 50  ? 33.369 -108.662 -151.662 1.00 110.92 ? 47  LEU H N     1 
ATOM   10279 C CA    . LEU H 1 50  ? 33.091 -108.964 -150.265 1.00 118.11 ? 47  LEU H CA    1 
ATOM   10280 C C     . LEU H 1 50  ? 32.655 -110.414 -150.095 1.00 113.91 ? 47  LEU H C     1 
ATOM   10281 O O     . LEU H 1 50  ? 32.125 -111.040 -151.016 1.00 119.59 ? 47  LEU H O     1 
ATOM   10282 C CB    . LEU H 1 50  ? 32.011 -108.037 -149.701 1.00 123.18 ? 47  LEU H CB    1 
ATOM   10283 C CG    . LEU H 1 50  ? 32.323 -106.544 -149.554 1.00 99.95  ? 47  LEU H CG    1 
ATOM   10284 C CD1   . LEU H 1 50  ? 33.719 -106.321 -148.981 1.00 99.93  ? 47  LEU H CD1   1 
ATOM   10285 C CD2   . LEU H 1 50  ? 32.138 -105.800 -150.864 1.00 104.04 ? 47  LEU H CD2   1 
ATOM   10286 N N     . GLY H 1 51  ? 32.891 -110.944 -148.896 1.00 101.88 ? 48  GLY H N     1 
ATOM   10287 C CA    . GLY H 1 51  ? 32.498 -112.291 -148.560 1.00 129.27 ? 48  GLY H CA    1 
ATOM   10288 C C     . GLY H 1 51  ? 31.161 -112.342 -147.847 1.00 133.13 ? 48  GLY H C     1 
ATOM   10289 O O     . GLY H 1 51  ? 30.563 -111.309 -147.526 1.00 127.08 ? 48  GLY H O     1 
ATOM   10290 N N     . PRO H 1 52  ? 30.660 -113.555 -147.595 1.00 125.77 ? 49  PRO H N     1 
ATOM   10291 C CA    . PRO H 1 52  ? 29.381 -113.690 -146.876 1.00 113.54 ? 49  PRO H CA    1 
ATOM   10292 C C     . PRO H 1 52  ? 29.376 -113.063 -145.491 1.00 120.55 ? 49  PRO H C     1 
ATOM   10293 O O     . PRO H 1 52  ? 28.291 -112.805 -144.955 1.00 123.28 ? 49  PRO H O     1 
ATOM   10294 C CB    . PRO H 1 52  ? 29.186 -115.210 -146.798 1.00 125.90 ? 49  PRO H CB    1 
ATOM   10295 C CG    . PRO H 1 52  ? 29.936 -115.736 -147.976 1.00 131.10 ? 49  PRO H CG    1 
ATOM   10296 C CD    . PRO H 1 52  ? 31.142 -114.848 -148.111 1.00 123.51 ? 49  PRO H CD    1 
ATOM   10297 N N     . GLU H 1 53  ? 30.544 -112.806 -144.894 1.00 124.61 ? 50  GLU H N     1 
ATOM   10298 C CA    . GLU H 1 53  ? 30.596 -112.186 -143.574 1.00 128.60 ? 50  GLU H CA    1 
ATOM   10299 C C     . GLU H 1 53  ? 30.083 -110.753 -143.574 1.00 123.20 ? 50  GLU H C     1 
ATOM   10300 O O     . GLU H 1 53  ? 29.892 -110.182 -142.495 1.00 125.86 ? 50  GLU H O     1 
ATOM   10301 C CB    . GLU H 1 53  ? 32.023 -112.219 -143.018 1.00 127.28 ? 50  GLU H CB    1 
ATOM   10302 C CG    . GLU H 1 53  ? 32.680 -113.593 -143.027 1.00 163.50 ? 50  GLU H CG    1 
ATOM   10303 C CD    . GLU H 1 53  ? 33.287 -113.952 -144.369 1.00 138.09 ? 50  GLU H CD    1 
ATOM   10304 O OE1   . GLU H 1 53  ? 32.523 -114.178 -145.330 1.00 114.21 ? 50  GLU H OE1   1 
ATOM   10305 O OE2   . GLU H 1 53  ? 34.529 -114.020 -144.460 1.00 134.69 ? 50  GLU H OE2   1 
ATOM   10306 N N     . TYR H 1 54  ? 29.862 -110.162 -144.745 1.00 121.80 ? 51  TYR H N     1 
ATOM   10307 C CA    . TYR H 1 54  ? 29.357 -108.802 -144.871 1.00 111.82 ? 51  TYR H CA    1 
ATOM   10308 C C     . TYR H 1 54  ? 27.938 -108.738 -145.406 1.00 110.54 ? 51  TYR H C     1 
ATOM   10309 O O     . TYR H 1 54  ? 27.128 -107.955 -144.905 1.00 114.02 ? 51  TYR H O     1 
ATOM   10310 C CB    . TYR H 1 54  ? 30.268 -107.986 -145.793 1.00 96.30  ? 51  TYR H CB    1 
ATOM   10311 C CG    . TYR H 1 54  ? 31.618 -107.666 -145.202 1.00 88.54  ? 51  TYR H CG    1 
ATOM   10312 C CD1   . TYR H 1 54  ? 31.741 -107.275 -143.876 1.00 99.43  ? 51  TYR H CD1   1 
ATOM   10313 C CD2   . TYR H 1 54  ? 32.770 -107.753 -145.970 1.00 84.01  ? 51  TYR H CD2   1 
ATOM   10314 C CE1   . TYR H 1 54  ? 32.973 -106.978 -143.333 1.00 113.19 ? 51  TYR H CE1   1 
ATOM   10315 C CE2   . TYR H 1 54  ? 34.006 -107.459 -145.437 1.00 91.25  ? 51  TYR H CE2   1 
ATOM   10316 C CZ    . TYR H 1 54  ? 34.101 -107.072 -144.118 1.00 104.06 ? 51  TYR H CZ    1 
ATOM   10317 O OH    . TYR H 1 54  ? 35.329 -106.776 -143.579 1.00 92.69  ? 51  TYR H OH    1 
ATOM   10318 N N     . ILE H 1 55  ? 27.623 -109.548 -146.416 1.00 91.31  ? 52  ILE H N     1 
ATOM   10319 C CA    . ILE H 1 55  ? 26.303 -109.518 -147.028 1.00 101.86 ? 52  ILE H CA    1 
ATOM   10320 C C     . ILE H 1 55  ? 25.250 -110.007 -146.038 1.00 119.22 ? 52  ILE H C     1 
ATOM   10321 O O     . ILE H 1 55  ? 25.510 -110.866 -145.183 1.00 135.76 ? 52  ILE H O     1 
ATOM   10322 C CB    . ILE H 1 55  ? 26.298 -110.367 -148.312 1.00 109.37 ? 52  ILE H CB    1 
ATOM   10323 C CG1   . ILE H 1 55  ? 27.595 -110.151 -149.095 1.00 110.36 ? 52  ILE H CG1   1 
ATOM   10324 C CG2   . ILE H 1 55  ? 25.098 -110.025 -149.177 1.00 92.65  ? 52  ILE H CG2   1 
ATOM   10325 C CD1   . ILE H 1 55  ? 27.808 -108.724 -149.554 1.00 106.10 ? 52  ILE H CD1   1 
ATOM   10326 N N     . SER H 1 56  ? 24.045 -109.451 -146.156 1.00 94.20  ? 53  SER H N     1 
ATOM   10327 C CA    . SER H 1 56  ? 22.894 -109.908 -145.388 1.00 109.65 ? 53  SER H CA    1 
ATOM   10328 C C     . SER H 1 56  ? 21.717 -110.092 -146.336 1.00 107.64 ? 53  SER H C     1 
ATOM   10329 O O     . SER H 1 56  ? 21.876 -109.956 -147.553 1.00 101.49 ? 53  SER H O     1 
ATOM   10330 C CB    . SER H 1 56  ? 22.554 -108.921 -144.269 1.00 117.17 ? 53  SER H CB    1 
ATOM   10331 O OG    . SER H 1 56  ? 23.615 -108.818 -143.334 1.00 121.35 ? 53  SER H OG    1 
ATOM   10332 N N     . SER H 1 57  ? 20.534 -110.392 -145.803 1.00 112.98 ? 54  SER H N     1 
ATOM   10333 C CA    . SER H 1 57  ? 19.390 -110.700 -146.648 1.00 117.82 ? 54  SER H CA    1 
ATOM   10334 C C     . SER H 1 57  ? 18.113 -110.164 -146.021 1.00 127.59 ? 54  SER H C     1 
ATOM   10335 O O     . SER H 1 57  ? 17.937 -110.219 -144.801 1.00 137.73 ? 54  SER H O     1 
ATOM   10336 C CB    . SER H 1 57  ? 19.257 -112.210 -146.878 1.00 126.01 ? 54  SER H CB    1 
ATOM   10337 O OG    . SER H 1 57  ? 18.660 -112.847 -145.763 1.00 134.32 ? 54  SER H OG    1 
ATOM   10338 N N     . ARG H 1 58  ? 17.227 -109.650 -146.872 1.00 131.58 ? 55  ARG H N     1 
ATOM   10339 C CA    . ARG H 1 58  ? 15.911 -109.170 -146.477 1.00 142.99 ? 55  ARG H CA    1 
ATOM   10340 C C     . ARG H 1 58  ? 14.856 -109.813 -147.368 1.00 147.16 ? 55  ARG H C     1 
ATOM   10341 O O     . ARG H 1 58  ? 15.167 -110.521 -148.329 1.00 142.44 ? 55  ARG H O     1 
ATOM   10342 C CB    . ARG H 1 58  ? 15.811 -107.641 -146.561 1.00 150.82 ? 55  ARG H CB    1 
ATOM   10343 C CG    . ARG H 1 58  ? 15.737 -107.095 -147.976 1.00 172.36 ? 55  ARG H CG    1 
ATOM   10344 C CD    . ARG H 1 58  ? 15.493 -105.598 -147.962 1.00 149.97 ? 55  ARG H CD    1 
ATOM   10345 N NE    . ARG H 1 58  ? 14.162 -105.261 -147.463 1.00 153.74 ? 55  ARG H NE    1 
ATOM   10346 C CZ    . ARG H 1 58  ? 13.701 -104.022 -147.331 1.00 152.75 ? 55  ARG H CZ    1 
ATOM   10347 N NH1   . ARG H 1 58  ? 14.522 -102.990 -147.466 1.00 146.94 ? 55  ARG H NH1   1 
ATOM   10348 N NH2   . ARG H 1 58  ? 12.467 -103.822 -146.890 1.00 152.44 ? 55  ARG H NH2   1 
ATOM   10349 N N     . MET H 1 59  ? 13.594 -109.554 -147.038 1.00 152.71 ? 56  MET H N     1 
ATOM   10350 C CA    . MET H 1 59  ? 12.451 -110.038 -147.810 1.00 159.83 ? 56  MET H CA    1 
ATOM   10351 C C     . MET H 1 59  ? 11.748 -108.843 -148.444 1.00 153.87 ? 56  MET H C     1 
ATOM   10352 O O     . MET H 1 59  ? 11.037 -108.097 -147.765 1.00 162.00 ? 56  MET H O     1 
ATOM   10353 C CB    . MET H 1 59  ? 11.496 -110.839 -146.930 1.00 168.30 ? 56  MET H CB    1 
ATOM   10354 C CG    . MET H 1 59  ? 11.989 -112.232 -146.601 1.00 168.85 ? 56  MET H CG    1 
ATOM   10355 S SD    . MET H 1 59  ? 12.412 -113.111 -148.114 1.00 178.80 ? 56  MET H SD    1 
ATOM   10356 C CE    . MET H 1 59  ? 10.828 -113.087 -148.955 1.00 156.06 ? 56  MET H CE    1 
ATOM   10357 N N     . ALA H 1 60  ? 11.957 -108.664 -149.747 1.00 137.63 ? 57  ALA H N     1 
ATOM   10358 C CA    . ALA H 1 60  ? 11.303 -107.582 -150.470 1.00 162.24 ? 57  ALA H CA    1 
ATOM   10359 C C     . ALA H 1 60  ? 9.793  -107.783 -150.477 1.00 171.31 ? 57  ALA H C     1 
ATOM   10360 O O     . ALA H 1 60  ? 9.293  -108.911 -150.458 1.00 166.28 ? 57  ALA H O     1 
ATOM   10361 C CB    . ALA H 1 60  ? 11.828 -107.503 -151.905 1.00 160.54 ? 57  ALA H CB    1 
ATOM   10362 N N     . GLY H 1 61  ? 9.062  -106.671 -150.502 1.00 185.76 ? 58  GLY H N     1 
ATOM   10363 C CA    . GLY H 1 61  ? 7.615  -106.731 -150.561 1.00 185.10 ? 58  GLY H CA    1 
ATOM   10364 C C     . GLY H 1 61  ? 7.124  -107.196 -151.915 1.00 178.34 ? 58  GLY H C     1 
ATOM   10365 O O     . GLY H 1 61  ? 7.296  -106.498 -152.919 1.00 181.46 ? 58  GLY H O     1 
ATOM   10366 N N     . GLY H 1 62  ? 6.507  -108.378 -151.954 1.00 173.24 ? 59  GLY H N     1 
ATOM   10367 C CA    . GLY H 1 62  ? 6.104  -108.993 -153.198 1.00 175.65 ? 59  GLY H CA    1 
ATOM   10368 C C     . GLY H 1 62  ? 7.217  -109.655 -153.979 1.00 184.02 ? 59  GLY H C     1 
ATOM   10369 O O     . GLY H 1 62  ? 6.937  -110.529 -154.808 1.00 193.28 ? 59  GLY H O     1 
ATOM   10370 N N     . GLY H 1 63  ? 8.471  -109.272 -153.745 1.00 175.79 ? 60  GLY H N     1 
ATOM   10371 C CA    . GLY H 1 63  ? 9.593  -109.847 -154.458 1.00 168.28 ? 60  GLY H CA    1 
ATOM   10372 C C     . GLY H 1 63  ? 10.188 -111.059 -153.772 1.00 175.02 ? 60  GLY H C     1 
ATOM   10373 O O     . GLY H 1 63  ? 9.458  -111.889 -153.220 1.00 174.37 ? 60  GLY H O     1 
ATOM   10374 N N     . GLN H 1 64  ? 11.517 -111.171 -153.797 1.00 175.42 ? 61  GLN H N     1 
ATOM   10375 C CA    . GLN H 1 64  ? 12.200 -112.323 -153.223 1.00 172.72 ? 61  GLN H CA    1 
ATOM   10376 C C     . GLN H 1 64  ? 13.367 -111.892 -152.344 1.00 167.12 ? 61  GLN H C     1 
ATOM   10377 O O     . GLN H 1 64  ? 13.495 -110.712 -152.002 1.00 172.13 ? 61  GLN H O     1 
ATOM   10378 C CB    . GLN H 1 64  ? 12.703 -113.266 -154.323 1.00 171.42 ? 61  GLN H CB    1 
ATOM   10379 C CG    . GLN H 1 64  ? 11.822 -113.337 -155.558 1.00 169.33 ? 61  GLN H CG    1 
ATOM   10380 C CD    . GLN H 1 64  ? 12.286 -112.398 -156.654 1.00 166.16 ? 61  GLN H CD    1 
ATOM   10381 O OE1   . GLN H 1 64  ? 12.497 -111.208 -156.419 1.00 157.56 ? 61  GLN H OE1   1 
ATOM   10382 N NE2   . GLN H 1 64  ? 12.449 -112.928 -157.860 1.00 174.06 ? 61  GLN H NE2   1 
ATOM   10383 N N     . LYS H 1 65  ? 14.203 -112.853 -151.960 1.00 171.81 ? 62  LYS H N     1 
ATOM   10384 C CA    . LYS H 1 65  ? 15.373 -112.582 -151.134 1.00 165.55 ? 62  LYS H CA    1 
ATOM   10385 C C     . LYS H 1 65  ? 16.309 -111.591 -151.818 1.00 152.09 ? 62  LYS H C     1 
ATOM   10386 O O     . LYS H 1 65  ? 16.835 -111.865 -152.901 1.00 145.91 ? 62  LYS H O     1 
ATOM   10387 C CB    . LYS H 1 65  ? 16.098 -113.895 -150.842 1.00 163.69 ? 62  LYS H CB    1 
ATOM   10388 C CG    . LYS H 1 65  ? 17.334 -113.777 -149.968 1.00 157.94 ? 62  LYS H CG    1 
ATOM   10389 C CD    . LYS H 1 65  ? 17.958 -115.150 -149.751 1.00 169.02 ? 62  LYS H CD    1 
ATOM   10390 C CE    . LYS H 1 65  ? 19.265 -115.065 -148.982 1.00 171.58 ? 62  LYS H CE    1 
ATOM   10391 N NZ    . LYS H 1 65  ? 19.846 -116.412 -148.727 1.00 183.36 ? 62  LYS H NZ    1 
ATOM   10392 N N     . VAL H 1 66  ? 16.518 -110.440 -151.181 1.00 150.57 ? 63  VAL H N     1 
ATOM   10393 C CA    . VAL H 1 66  ? 17.444 -109.424 -151.667 1.00 138.96 ? 63  VAL H CA    1 
ATOM   10394 C C     . VAL H 1 66  ? 18.639 -109.377 -150.725 1.00 130.51 ? 63  VAL H C     1 
ATOM   10395 O O     . VAL H 1 66  ? 18.533 -109.703 -149.538 1.00 127.90 ? 63  VAL H O     1 
ATOM   10396 C CB    . VAL H 1 66  ? 16.770 -108.039 -151.778 1.00 130.76 ? 63  VAL H CB    1 
ATOM   10397 C CG1   . VAL H 1 66  ? 17.628 -107.078 -152.592 1.00 139.32 ? 63  VAL H CG1   1 
ATOM   10398 C CG2   . VAL H 1 66  ? 15.390 -108.168 -152.396 1.00 148.56 ? 63  VAL H CG2   1 
ATOM   10399 N N     . CYS H 1 67  ? 19.783 -108.958 -151.260 1.00 125.65 ? 64  CYS H N     1 
ATOM   10400 C CA    . CYS H 1 67  ? 21.033 -108.906 -150.516 1.00 115.96 ? 64  CYS H CA    1 
ATOM   10401 C C     . CYS H 1 67  ? 21.476 -107.460 -150.344 1.00 100.10 ? 64  CYS H C     1 
ATOM   10402 O O     . CYS H 1 67  ? 21.293 -106.633 -151.243 1.00 104.96 ? 64  CYS H O     1 
ATOM   10403 C CB    . CYS H 1 67  ? 22.129 -109.707 -151.224 1.00 119.53 ? 64  CYS H CB    1 
ATOM   10404 S SG    . CYS H 1 67  ? 21.592 -111.310 -151.867 1.00 135.63 ? 64  CYS H SG    1 
ATOM   10405 N N     . TYR H 1 68  ? 22.055 -107.158 -149.184 1.00 95.12  ? 65  TYR H N     1 
ATOM   10406 C CA    . TYR H 1 68  ? 22.490 -105.805 -148.872 1.00 89.25  ? 65  TYR H CA    1 
ATOM   10407 C C     . TYR H 1 68  ? 23.716 -105.870 -147.970 1.00 92.85  ? 65  TYR H C     1 
ATOM   10408 O O     . TYR H 1 68  ? 24.176 -106.949 -147.585 1.00 111.71 ? 65  TYR H O     1 
ATOM   10409 C CB    . TYR H 1 68  ? 21.361 -105.003 -148.217 1.00 96.75  ? 65  TYR H CB    1 
ATOM   10410 C CG    . TYR H 1 68  ? 20.950 -105.501 -146.845 1.00 108.66 ? 65  TYR H CG    1 
ATOM   10411 C CD1   . TYR H 1 68  ? 21.575 -105.031 -145.695 1.00 104.91 ? 65  TYR H CD1   1 
ATOM   10412 C CD2   . TYR H 1 68  ? 19.935 -106.439 -146.699 1.00 124.02 ? 65  TYR H CD2   1 
ATOM   10413 C CE1   . TYR H 1 68  ? 21.203 -105.482 -144.442 1.00 107.65 ? 65  TYR H CE1   1 
ATOM   10414 C CE2   . TYR H 1 68  ? 19.555 -106.895 -145.449 1.00 119.50 ? 65  TYR H CE2   1 
ATOM   10415 C CZ    . TYR H 1 68  ? 20.193 -106.412 -144.325 1.00 105.98 ? 65  TYR H CZ    1 
ATOM   10416 O OH    . TYR H 1 68  ? 19.821 -106.863 -143.080 1.00 96.80  ? 65  TYR H OH    1 
ATOM   10417 N N     . ILE H 1 69  ? 24.244 -104.694 -147.635 1.00 95.72  ? 66  ILE H N     1 
ATOM   10418 C CA    . ILE H 1 69  ? 25.351 -104.546 -146.697 1.00 87.72  ? 66  ILE H CA    1 
ATOM   10419 C C     . ILE H 1 69  ? 24.925 -103.555 -145.623 1.00 79.63  ? 66  ILE H C     1 
ATOM   10420 O O     . ILE H 1 69  ? 24.508 -102.435 -145.938 1.00 84.67  ? 66  ILE H O     1 
ATOM   10421 C CB    . ILE H 1 69  ? 26.641 -104.069 -147.392 1.00 75.15  ? 66  ILE H CB    1 
ATOM   10422 C CG1   . ILE H 1 69  ? 27.005 -105.003 -148.547 1.00 83.94  ? 66  ILE H CG1   1 
ATOM   10423 C CG2   . ILE H 1 69  ? 27.784 -103.993 -146.395 1.00 73.84  ? 66  ILE H CG2   1 
ATOM   10424 C CD1   . ILE H 1 69  ? 28.245 -104.577 -149.303 1.00 94.24  ? 66  ILE H CD1   1 
ATOM   10425 N N     . GLU H 1 70  ? 25.022 -103.970 -144.361 1.00 97.20  ? 67  GLU H N     1 
ATOM   10426 C CA    . GLU H 1 70  ? 24.618 -103.111 -143.256 1.00 110.41 ? 67  GLU H CA    1 
ATOM   10427 C C     . GLU H 1 70  ? 25.480 -101.852 -143.201 1.00 100.18 ? 67  GLU H C     1 
ATOM   10428 O O     . GLU H 1 70  ? 26.621 -101.829 -143.667 1.00 98.29  ? 67  GLU H O     1 
ATOM   10429 C CB    . GLU H 1 70  ? 24.706 -103.873 -141.932 1.00 110.50 ? 67  GLU H CB    1 
ATOM   10430 C CG    . GLU H 1 70  ? 23.758 -105.063 -141.847 1.00 109.47 ? 67  GLU H CG    1 
ATOM   10431 C CD    . GLU H 1 70  ? 23.764 -105.727 -140.482 1.00 118.17 ? 67  GLU H CD    1 
ATOM   10432 O OE1   . GLU H 1 70  ? 23.612 -105.013 -139.468 1.00 110.44 ? 67  GLU H OE1   1 
ATOM   10433 O OE2   . GLU H 1 70  ? 23.919 -106.965 -140.425 1.00 139.42 ? 67  GLU H OE2   1 
ATOM   10434 N N     . GLY H 1 71  ? 24.911 -100.792 -142.628 1.00 74.30  ? 68  GLY H N     1 
ATOM   10435 C CA    . GLY H 1 71  ? 25.567 -99.501  -142.537 1.00 83.94  ? 68  GLY H CA    1 
ATOM   10436 C C     . GLY H 1 71  ? 26.918 -99.525  -141.852 1.00 89.60  ? 68  GLY H C     1 
ATOM   10437 O O     . GLY H 1 71  ? 27.923 -99.102  -142.435 1.00 99.09  ? 68  GLY H O     1 
ATOM   10438 N N     . HIS H 1 72  ? 26.945 -99.996  -140.601 1.00 97.14  ? 69  HIS H N     1 
ATOM   10439 C CA    . HIS H 1 72  ? 28.195 -100.082 -139.853 1.00 103.02 ? 69  HIS H CA    1 
ATOM   10440 C C     . HIS H 1 72  ? 29.262 -100.860 -140.614 1.00 101.83 ? 69  HIS H C     1 
ATOM   10441 O O     . HIS H 1 72  ? 30.454 -100.551 -140.501 1.00 98.22  ? 69  HIS H O     1 
ATOM   10442 C CB    . HIS H 1 72  ? 27.943 -100.721 -138.485 1.00 101.29 ? 69  HIS H CB    1 
ATOM   10443 C CG    . HIS H 1 72  ? 27.237 -102.040 -138.553 1.00 108.28 ? 69  HIS H CG    1 
ATOM   10444 N ND1   . HIS H 1 72  ? 27.904 -103.245 -138.489 1.00 112.22 ? 69  HIS H ND1   1 
ATOM   10445 C CD2   . HIS H 1 72  ? 25.924 -102.344 -138.680 1.00 98.30  ? 69  HIS H CD2   1 
ATOM   10446 C CE1   . HIS H 1 72  ? 27.031 -104.234 -138.574 1.00 114.01 ? 69  HIS H CE1   1 
ATOM   10447 N NE2   . HIS H 1 72  ? 25.823 -103.714 -138.690 1.00 109.93 ? 69  HIS H NE2   1 
ATOM   10448 N N     . ARG H 1 73  ? 28.854 -101.867 -141.390 1.00 96.06  ? 70  ARG H N     1 
ATOM   10449 C CA    . ARG H 1 73  ? 29.804 -102.600 -142.221 1.00 101.47 ? 70  ARG H CA    1 
ATOM   10450 C C     . ARG H 1 73  ? 30.519 -101.665 -143.190 1.00 99.57  ? 70  ARG H C     1 
ATOM   10451 O O     . ARG H 1 73  ? 31.752 -101.651 -143.261 1.00 103.79 ? 70  ARG H O     1 
ATOM   10452 C CB    . ARG H 1 73  ? 29.085 -103.715 -142.981 1.00 104.53 ? 70  ARG H CB    1 
ATOM   10453 C CG    . ARG H 1 73  ? 28.402 -104.744 -142.093 1.00 115.25 ? 70  ARG H CG    1 
ATOM   10454 C CD    . ARG H 1 73  ? 29.356 -105.864 -141.705 1.00 127.58 ? 70  ARG H CD    1 
ATOM   10455 N NE    . ARG H 1 73  ? 28.762 -106.795 -140.749 1.00 134.05 ? 70  ARG H NE    1 
ATOM   10456 C CZ    . ARG H 1 73  ? 27.840 -107.703 -141.058 1.00 129.25 ? 70  ARG H CZ    1 
ATOM   10457 N NH1   . ARG H 1 73  ? 27.399 -107.812 -142.305 1.00 116.60 ? 70  ARG H NH1   1 
ATOM   10458 N NH2   . ARG H 1 73  ? 27.359 -108.506 -140.118 1.00 120.95 ? 70  ARG H NH2   1 
ATOM   10459 N N     . VAL H 1 74  ? 29.752 -100.879 -143.952 1.00 106.10 ? 71  VAL H N     1 
ATOM   10460 C CA    . VAL H 1 74  ? 30.345 -99.949  -144.911 1.00 94.94  ? 71  VAL H CA    1 
ATOM   10461 C C     . VAL H 1 74  ? 31.173 -98.891  -144.192 1.00 85.76  ? 71  VAL